data_1IJ0
# 
_entry.id   1IJ0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IJ0         
RCSB  RCSB013316   
WWPDB D_1000013316 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IJ0 
_pdbx_database_status.recvd_initial_deposition_date   2001-04-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Akey, D.L.'         1 
'Malashkevich, V.N.' 2 
'Kim, P.S.'          3 
# 
_citation.id                        primary 
_citation.title                     'Buried polar residues in coiled-coil interfaces.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            40 
_citation.page_first                6352 
_citation.page_last                 6360 
_citation.year                      2001 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11371197 
_citation.pdbx_database_id_DOI      10.1021/bi002829w 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Akey, D.L.'         1 
primary 'Malashkevich, V.N.' 2 
primary 'Kim, P.S.'          3 
# 
_cell.entry_id           1IJ0 
_cell.length_a           35.466 
_cell.length_b           28.616 
_cell.length_c           44.496 
_cell.angle_alpha        90.00 
_cell.angle_beta         109.60 
_cell.angle_gamma        90.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IJ0 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'GENERAL CONTROL PROTEIN GCN4' 3990.650 3   ? 'L12S, N16V' 'Coiled coil region' ? 
2 non-polymer syn 'ZINC ION'                     65.409   3   ? ?            ?                    ? 
3 water       nat water                          18.015   130 ? ?            ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        GCN4-pVLS 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       '(ACE)RMKQLEDKVEESLSKVYHLENEVARLKKLVGER' 
_entity_poly.pdbx_seq_one_letter_code_can   XRMKQLEDKVEESLSKVYHLENEVARLKKLVGER 
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ACE n 
1 2  ARG n 
1 3  MET n 
1 4  LYS n 
1 5  GLN n 
1 6  LEU n 
1 7  GLU n 
1 8  ASP n 
1 9  LYS n 
1 10 VAL n 
1 11 GLU n 
1 12 GLU n 
1 13 SER n 
1 14 LEU n 
1 15 SER n 
1 16 LYS n 
1 17 VAL n 
1 18 TYR n 
1 19 HIS n 
1 20 LEU n 
1 21 GLU n 
1 22 ASN n 
1 23 GLU n 
1 24 VAL n 
1 25 ALA n 
1 26 ARG n 
1 27 LEU n 
1 28 LYS n 
1 29 LYS n 
1 30 LEU n 
1 31 VAL n 
1 32 GLY n 
1 33 GLU n 
1 34 ARG n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
;THIS PROTEIN WAS CHEMICALLY SYNTHESIZED USING Solid phase FMOC peptide synthesis. It is naturally found in Saccharomyces cerevisiae (yeast).
;
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GCN4_YEAST 
_struct_ref.pdbx_db_accession          P03069 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   RMKQLEDKVEELLSKNYHLENEVARLKKLVGER 
_struct_ref.pdbx_align_begin           249 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1IJ0 A 2 ? 34 ? P03069 249 ? 281 ? 1 33 
2 1 1IJ0 B 2 ? 34 ? P03069 249 ? 281 ? 1 33 
3 1 1IJ0 C 2 ? 34 ? P03069 249 ? 281 ? 1 33 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1IJ0 SER A 13 ? UNP P03069 LEU 260 ENGINEERED 12 1 
1 1IJ0 VAL A 17 ? UNP P03069 ASN 264 ENGINEERED 16 2 
2 1IJ0 SER B 13 ? UNP P03069 LEU 260 ENGINEERED 12 3 
2 1IJ0 VAL B 17 ? UNP P03069 ASN 264 ENGINEERED 16 4 
3 1IJ0 SER C 13 ? UNP P03069 LEU 260 ENGINEERED 12 5 
3 1IJ0 VAL C 17 ? UNP P03069 ASN 264 ENGINEERED 16 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'  ? 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1IJ0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   30.77 
_exptl_crystal.density_Matthews      1.78 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.temp            297 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;0.1 M Na Cacodylate, 
16% PEG 8000, 
0.1 M Zn Acetate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 297K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV++' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1IJ0 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20.00 
_reflns.d_resolution_high            1.86 
_reflns.number_obs                   6740 
_reflns.number_all                   6904 
_reflns.percent_possible_obs         97.6 
_reflns.pdbx_Rmerge_I_obs            0.0650000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.4 
_reflns.B_iso_Wilson_estimate        24.5 
_reflns.pdbx_redundancy              3.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.86 
_reflns_shell.d_res_low              1.94 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   93.2 
_reflns_shell.Rmerge_I_obs           0.0360000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        2.6 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1IJ0 
_refine.ls_number_reflns_obs                     6847 
_refine.ls_number_reflns_all                     7255 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               539511.42 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.86 
_refine.ls_percent_reflns_obs                    94.4 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2110000 
_refine.ls_R_factor_R_free                       0.2580000 
_refine.ls_R_factor_R_free_error                 0.010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.9 
_refine.ls_number_reflns_R_free                  670 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               25.9 
_refine.aniso_B[1][1]                            -1.44 
_refine.aniso_B[2][2]                            -2.05 
_refine.aniso_B[3][3]                            3.49 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            1.51 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.364 
_refine.solvent_model_param_bsol                 57.42 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1IJ0 
_refine_analyze.Luzzati_coordinate_error_obs    0.23 
_refine_analyze.Luzzati_sigma_a_obs             0.33 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.28 
_refine_analyze.Luzzati_sigma_a_free            0.32 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        777 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             130 
_refine_hist.number_atoms_total               910 
_refine_hist.d_res_high                       1.86 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.013 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.9   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 16.0  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.15  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.86 
_refine_ls_shell.number_reflns_R_work             557 
_refine_ls_shell.R_factor_R_work                  0.4030000 
_refine_ls_shell.percent_reflns_obs               79.0 
_refine_ls_shell.R_factor_R_free                  0.3860000 
_refine_ls_shell.R_factor_R_free_error            0.047 
_refine_ls_shell.percent_reflns_R_free            10.7 
_refine_ls_shell.number_reflns_R_free             67 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1IJ0 
_struct.title                     'Coiled Coil Trimer GCN4-pVLS Ser at Buried D Position' 
_struct.pdbx_descriptor           'GENERAL CONTROL PROTEIN GCN4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IJ0 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'COILED COIL TRIMER, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;The biological assembly is a  
homotypic coiled coil trimer
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 2 ? GLY A 32 ? ARG A 1 GLY A 31 1 ? 31 
HELX_P HELX_P2 2 ARG B 2 ? GLY B 32 ? ARG B 1 GLY B 31 1 ? 31 
HELX_P HELX_P3 3 ARG C 2 ? GLY C 32 ? ARG C 1 GLY C 31 1 ? 31 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A ACE 1 C  ? ? ? 1_555 A ARG 2  N   ? ? A ACE 0   A ARG 1   1_555 ? ? ? ? ? ? ? 1.320 ? 
covale2  covale ? ? B ACE 1 C  ? ? ? 1_555 B ARG 2  N   ? ? B ACE 0   B ARG 1   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale3  covale ? ? C ACE 1 C  ? ? ? 1_555 C ARG 2  N   ? ? C ACE 0   C ARG 1   1_555 ? ? ? ? ? ? ? 1.332 ? 
metalc1  metalc ? ? D ZN  . ZN ? ? ? 1_555 A HIS 19 NE2 ? ? A ZN  201 A HIS 18  1_555 ? ? ? ? ? ? ? 2.237 ? 
metalc2  metalc ? ? D ZN  . ZN ? ? ? 1_555 A GLU 23 OE1 ? ? A ZN  201 A GLU 22  1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc3  metalc ? ? D ZN  . ZN ? ? ? 1_555 H HOH .  O   ? ? A ZN  201 B HOH 230 1_555 ? ? ? ? ? ? ? 2.615 ? 
metalc4  metalc ? ? E ZN  . ZN ? ? ? 1_555 B HIS 19 NE2 ? ? B ZN  202 B HIS 18  1_555 ? ? ? ? ? ? ? 2.117 ? 
metalc5  metalc ? ? E ZN  . ZN ? ? ? 1_555 B GLU 23 OE1 ? ? B ZN  202 B GLU 22  1_555 ? ? ? ? ? ? ? 2.202 ? 
metalc6  metalc ? ? F ZN  . ZN ? ? ? 1_555 I HOH .  O   ? ? C ZN  203 C HOH 225 1_555 ? ? ? ? ? ? ? 2.621 ? 
metalc7  metalc ? ? F ZN  . ZN ? ? ? 1_555 I HOH .  O   ? ? C ZN  203 C HOH 221 1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc8  metalc ? ? F ZN  . ZN ? ? ? 1_555 C GLU 23 OE2 ? ? C ZN  203 C GLU 22  1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc9  metalc ? ? F ZN  . ZN ? ? ? 1_555 C HIS 19 NE2 ? ? C ZN  203 C HIS 18  1_555 ? ? ? ? ? ? ? 2.218 ? 
metalc10 metalc ? ? F ZN  . ZN ? ? ? 1_555 I HOH .  O   ? ? C ZN  203 C HOH 226 1_555 ? ? ? ? ? ? ? 2.684 ? 
metalc11 metalc ? ? D ZN  . ZN ? ? ? 1_555 C GLU 11 OE1 ? ? A ZN  201 C GLU 10  1_545 ? ? ? ? ? ? ? 2.338 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 201' 
AC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE ZN B 202' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE ZN C 203' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 HIS A 19 ? HIS A 18  . ? 1_555 ? 
2  AC1 4 GLU A 23 ? GLU A 22  . ? 1_555 ? 
3  AC1 4 HOH H .  ? HOH B 230 . ? 1_555 ? 
4  AC1 4 GLU C 11 ? GLU C 10  . ? 1_545 ? 
5  AC2 2 HIS B 19 ? HIS B 18  . ? 1_555 ? 
6  AC2 2 GLU B 23 ? GLU B 22  . ? 1_555 ? 
7  AC3 6 LYS A 28 ? LYS A 27  . ? 1_555 ? 
8  AC3 6 HIS C 19 ? HIS C 18  . ? 1_555 ? 
9  AC3 6 GLU C 23 ? GLU C 22  . ? 1_555 ? 
10 AC3 6 HOH I .  ? HOH C 221 . ? 1_555 ? 
11 AC3 6 HOH I .  ? HOH C 225 . ? 1_555 ? 
12 AC3 6 HOH I .  ? HOH C 226 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1IJ0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IJ0 
_atom_sites.fract_transf_matrix[1][1]   0.028196 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.010039 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.034945 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.023856 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1   C  C   . ACE A 1 1  ? -21.538 7.592   8.764  1.00 26.42 ? 0   ACE A C   1 
HETATM 2   O  O   . ACE A 1 1  ? -20.842 6.669   9.144  1.00 25.41 ? 0   ACE A O   1 
HETATM 3   C  CH3 . ACE A 1 1  ? -23.034 7.514   8.841  1.00 26.84 ? 0   ACE A CH3 1 
ATOM   4   N  N   . ARG A 1 2  ? -21.009 8.733   8.363  1.00 26.84 ? 1   ARG A N   1 
ATOM   5   C  CA  . ARG A 1 2  ? -19.574 8.919   8.185  1.00 27.04 ? 1   ARG A CA  1 
ATOM   6   C  C   . ARG A 1 2  ? -18.686 8.976   9.385  1.00 24.45 ? 1   ARG A C   1 
ATOM   7   O  O   . ARG A 1 2  ? -17.550 8.525   9.337  1.00 22.19 ? 1   ARG A O   1 
ATOM   8   C  CB  . ARG A 1 2  ? -19.354 10.181  7.421  1.00 30.33 ? 1   ARG A CB  1 
ATOM   9   C  CG  . ARG A 1 2  ? -19.676 10.052  5.999  1.00 34.59 ? 1   ARG A CG  1 
ATOM   10  C  CD  . ARG A 1 2  ? -18.436 10.578  5.362  1.00 39.27 ? 1   ARG A CD  1 
ATOM   11  N  NE  . ARG A 1 2  ? -18.525 10.611  3.917  1.00 43.03 ? 1   ARG A NE  1 
ATOM   12  C  CZ  . ARG A 1 2  ? -18.548 11.733  3.224  1.00 40.60 ? 1   ARG A CZ  1 
ATOM   13  N  NH1 . ARG A 1 2  ? -18.497 12.885  3.876  1.00 37.85 ? 1   ARG A NH1 1 
ATOM   14  N  NH2 . ARG A 1 2  ? -18.682 11.698  1.907  1.00 43.55 ? 1   ARG A NH2 1 
ATOM   15  N  N   . MET A 1 3  ? -19.186 9.586   10.446 1.00 23.27 ? 2   MET A N   1 
ATOM   16  C  CA  . MET A 1 3  ? -18.374 9.668   11.641 1.00 26.07 ? 2   MET A CA  1 
ATOM   17  C  C   . MET A 1 3  ? -18.127 8.298   12.258 1.00 26.44 ? 2   MET A C   1 
ATOM   18  O  O   . MET A 1 3  ? -17.044 8.036   12.780 1.00 27.93 ? 2   MET A O   1 
ATOM   19  C  CB  . MET A 1 3  ? -19.004 10.622  12.671 1.00 27.79 ? 2   MET A CB  1 
ATOM   20  C  CG  . MET A 1 3  ? -18.945 12.107  12.250 1.00 34.43 ? 2   MET A CG  1 
ATOM   21  S  SD  . MET A 1 3  ? -17.222 12.805  12.127 1.00 40.85 ? 2   MET A SD  1 
ATOM   22  C  CE  . MET A 1 3  ? -16.629 12.511  13.759 1.00 35.94 ? 2   MET A CE  1 
ATOM   23  N  N   . LYS A 1 4  ? -19.140 7.437   12.203 1.00 27.97 ? 3   LYS A N   1 
ATOM   24  C  CA  . LYS A 1 4  ? -19.070 6.063   12.732 1.00 27.62 ? 3   LYS A CA  1 
ATOM   25  C  C   . LYS A 1 4  ? -18.095 5.285   11.876 1.00 25.60 ? 3   LYS A C   1 
ATOM   26  O  O   . LYS A 1 4  ? -17.264 4.535   12.364 1.00 24.11 ? 3   LYS A O   1 
ATOM   27  C  CB  . LYS A 1 4  ? -20.442 5.397   12.618 1.00 29.71 ? 3   LYS A CB  1 
ATOM   28  C  CG  . LYS A 1 4  ? -20.643 4.090   13.388 1.00 30.79 ? 3   LYS A CG  1 
ATOM   29  C  CD  . LYS A 1 4  ? -21.106 4.345   14.849 1.00 33.77 ? 3   LYS A CD  1 
ATOM   30  C  CE  . LYS A 1 4  ? -19.989 4.280   15.895 1.00 35.47 ? 3   LYS A CE  1 
ATOM   31  N  NZ  . LYS A 1 4  ? -18.913 5.329   15.814 1.00 37.53 ? 3   LYS A NZ  1 
ATOM   32  N  N   . GLN A 1 5  ? -18.242 5.481   10.577 1.00 25.86 ? 4   GLN A N   1 
ATOM   33  C  CA  . GLN A 1 5  ? -17.432 4.859   9.553  1.00 25.54 ? 4   GLN A CA  1 
ATOM   34  C  C   . GLN A 1 5  ? -15.971 5.234   9.838  1.00 22.67 ? 4   GLN A C   1 
ATOM   35  O  O   . GLN A 1 5  ? -15.100 4.363   9.852  1.00 20.20 ? 4   GLN A O   1 
ATOM   36  C  CB  . GLN A 1 5  ? -17.915 5.410   8.202  1.00 28.96 ? 4   GLN A CB  1 
ATOM   37  C  CG  . GLN A 1 5  ? -17.692 4.607   6.941  1.00 35.12 ? 4   GLN A CG  1 
ATOM   38  C  CD  . GLN A 1 5  ? -18.251 5.340   5.701  1.00 36.99 ? 4   GLN A CD  1 
ATOM   39  O  OE1 . GLN A 1 5  ? -19.464 5.564   5.566  1.00 37.28 ? 4   GLN A OE1 1 
ATOM   40  N  NE2 . GLN A 1 5  ? -17.353 5.734   4.808  1.00 36.66 ? 4   GLN A NE2 1 
ATOM   41  N  N   . LEU A 1 6  ? -15.704 6.516   10.101 1.00 22.24 ? 5   LEU A N   1 
ATOM   42  C  CA  . LEU A 1 6  ? -14.337 6.953   10.371 1.00 21.03 ? 5   LEU A CA  1 
ATOM   43  C  C   . LEU A 1 6  ? -13.848 6.413   11.708 1.00 20.24 ? 5   LEU A C   1 
ATOM   44  O  O   . LEU A 1 6  ? -12.757 5.879   11.790 1.00 18.68 ? 5   LEU A O   1 
ATOM   45  C  CB  . LEU A 1 6  ? -14.243 8.475   10.344 1.00 24.14 ? 5   LEU A CB  1 
ATOM   46  C  CG  . LEU A 1 6  ? -14.640 9.077   8.997  1.00 29.91 ? 5   LEU A CG  1 
ATOM   47  C  CD1 . LEU A 1 6  ? -14.486 10.595  9.027  1.00 30.79 ? 5   LEU A CD1 1 
ATOM   48  C  CD2 . LEU A 1 6  ? -13.721 8.466   7.903  1.00 29.82 ? 5   LEU A CD2 1 
ATOM   49  N  N   . GLU A 1 7  ? -14.647 6.525   12.760 1.00 21.31 ? 6   GLU A N   1 
ATOM   50  C  CA  . GLU A 1 7  ? -14.199 6.000   14.062 1.00 25.66 ? 6   GLU A CA  1 
ATOM   51  C  C   . GLU A 1 7  ? -13.889 4.493   13.952 1.00 25.40 ? 6   GLU A C   1 
ATOM   52  O  O   . GLU A 1 7  ? -12.827 4.026   14.404 1.00 25.99 ? 6   GLU A O   1 
ATOM   53  C  CB  . GLU A 1 7  ? -15.246 6.271   15.155 1.00 30.89 ? 6   GLU A CB  1 
ATOM   54  C  CG  . GLU A 1 7  ? -14.901 5.700   16.547 1.00 38.47 ? 6   GLU A CG  1 
ATOM   55  C  CD  . GLU A 1 7  ? -13.595 6.239   17.146 1.00 43.82 ? 6   GLU A CD  1 
ATOM   56  O  OE1 . GLU A 1 7  ? -13.166 5.741   18.213 1.00 47.94 ? 6   GLU A OE1 1 
ATOM   57  O  OE2 . GLU A 1 7  ? -12.987 7.175   16.581 1.00 48.08 ? 6   GLU A OE2 1 
ATOM   58  N  N   . ASP A 1 8  ? -14.784 3.729   13.329 1.00 22.62 ? 7   ASP A N   1 
ATOM   59  C  CA  . ASP A 1 8  ? -14.543 2.286   13.142 1.00 22.04 ? 7   ASP A CA  1 
ATOM   60  C  C   . ASP A 1 8  ? -13.263 1.961   12.363 1.00 19.66 ? 7   ASP A C   1 
ATOM   61  O  O   . ASP A 1 8  ? -12.521 1.045   12.728 1.00 16.62 ? 7   ASP A O   1 
ATOM   62  C  CB  . ASP A 1 8  ? -15.695 1.606   12.392 1.00 22.51 ? 7   ASP A CB  1 
ATOM   63  C  CG  . ASP A 1 8  ? -16.957 1.468   13.210 1.00 21.75 ? 7   ASP A CG  1 
ATOM   64  O  OD1 . ASP A 1 8  ? -17.029 1.890   14.367 1.00 25.99 ? 7   ASP A OD1 1 
ATOM   65  O  OD2 . ASP A 1 8  ? -17.913 0.912   12.656 1.00 25.47 ? 7   ASP A OD2 1 
ATOM   66  N  N   . LYS A 1 9  ? -12.997 2.686   11.285 1.00 16.35 ? 8   LYS A N   1 
ATOM   67  C  CA  . LYS A 1 9  ? -11.806 2.370   10.519 1.00 17.67 ? 8   LYS A CA  1 
ATOM   68  C  C   . LYS A 1 9  ? -10.522 2.721   11.221 1.00 17.91 ? 8   LYS A C   1 
ATOM   69  O  O   . LYS A 1 9  ? -9.538  2.000   11.131 1.00 13.80 ? 8   LYS A O   1 
ATOM   70  C  CB  . LYS A 1 9  ? -11.867 3.015   9.154  1.00 21.79 ? 8   LYS A CB  1 
ATOM   71  C  CG  . LYS A 1 9  ? -12.679 2.154   8.192  1.00 27.23 ? 8   LYS A CG  1 
ATOM   72  C  CD  . LYS A 1 9  ? -13.007 2.951   6.949  1.00 31.14 ? 8   LYS A CD  1 
ATOM   73  C  CE  . LYS A 1 9  ? -13.645 2.092   5.892  1.00 30.65 ? 8   LYS A CE  1 
ATOM   74  N  NZ  . LYS A 1 9  ? -12.556 1.207   5.405  1.00 33.94 ? 8   LYS A NZ  1 
ATOM   75  N  N   . VAL A 1 10 ? -10.539 3.808   11.968 1.00 18.95 ? 9   VAL A N   1 
ATOM   76  C  CA  . VAL A 1 10 ? -9.330  4.185   12.663 1.00 20.08 ? 9   VAL A CA  1 
ATOM   77  C  C   . VAL A 1 10 ? -9.117  3.224   13.845 1.00 22.22 ? 9   VAL A C   1 
ATOM   78  O  O   . VAL A 1 10 ? -7.975  2.862   14.127 1.00 22.79 ? 9   VAL A O   1 
ATOM   79  C  CB  . VAL A 1 10 ? -9.381  5.687   13.074 1.00 18.58 ? 9   VAL A CB  1 
ATOM   80  C  CG1 . VAL A 1 10 ? -10.200 5.875   14.337 1.00 17.83 ? 9   VAL A CG1 1 
ATOM   81  C  CG2 . VAL A 1 10 ? -7.952  6.232   13.203 1.00 15.56 ? 9   VAL A CG2 1 
ATOM   82  N  N   . GLU A 1 11 ? -10.196 2.778   14.504 1.00 21.93 ? 10  GLU A N   1 
ATOM   83  C  CA  . GLU A 1 11 ? -10.082 1.802   15.607 1.00 22.75 ? 10  GLU A CA  1 
ATOM   84  C  C   . GLU A 1 11 ? -9.425  0.533   15.035 1.00 20.72 ? 10  GLU A C   1 
ATOM   85  O  O   . GLU A 1 11 ? -8.504  -0.020  15.602 1.00 23.69 ? 10  GLU A O   1 
ATOM   86  C  CB  . GLU A 1 11 ? -11.453 1.346   16.118 1.00 26.13 ? 10  GLU A CB  1 
ATOM   87  C  CG  . GLU A 1 11 ? -11.865 0.051   15.360 1.00 34.79 ? 10  GLU A CG  1 
ATOM   88  C  CD  . GLU A 1 11 ? -13.311 -0.385  15.374 1.00 36.52 ? 10  GLU A CD  1 
ATOM   89  O  OE1 . GLU A 1 11 ? -13.604 -1.250  14.513 1.00 38.62 ? 10  GLU A OE1 1 
ATOM   90  O  OE2 . GLU A 1 11 ? -14.130 0.089   16.206 1.00 39.70 ? 10  GLU A OE2 1 
ATOM   91  N  N   . GLU A 1 12 ? -9.956  0.058   13.918 1.00 18.20 ? 11  GLU A N   1 
ATOM   92  C  CA  . GLU A 1 12 ? -9.462  -1.149  13.265 1.00 17.70 ? 11  GLU A CA  1 
ATOM   93  C  C   . GLU A 1 12 ? -7.974  -0.971  12.989 1.00 18.07 ? 11  GLU A C   1 
ATOM   94  O  O   . GLU A 1 12 ? -7.152  -1.876  13.252 1.00 18.73 ? 11  GLU A O   1 
ATOM   95  C  CB  . GLU A 1 12 ? -10.204 -1.352  11.943 1.00 17.21 ? 11  GLU A CB  1 
ATOM   96  C  CG  . GLU A 1 12 ? -9.813  -2.603  11.170 1.00 19.48 ? 11  GLU A CG  1 
ATOM   97  C  CD  . GLU A 1 12 ? -10.387 -2.592  9.770  1.00 26.35 ? 11  GLU A CD  1 
ATOM   98  O  OE1 . GLU A 1 12 ? -11.352 -1.802  9.541  1.00 27.14 ? 11  GLU A OE1 1 
ATOM   99  O  OE2 . GLU A 1 12 ? -9.884  -3.381  8.917  1.00 30.09 ? 11  GLU A OE2 1 
ATOM   100 N  N   . SER A 1 13 ? -7.632  0.212   12.482 1.00 17.06 ? 12  SER A N   1 
ATOM   101 C  CA  . SER A 1 13 ? -6.243  0.529   12.155 1.00 17.91 ? 12  SER A CA  1 
ATOM   102 C  C   . SER A 1 13 ? -5.340  0.455   13.371 1.00 14.56 ? 12  SER A C   1 
ATOM   103 O  O   . SER A 1 13 ? -4.280  -0.180  13.337 1.00 13.08 ? 12  SER A O   1 
ATOM   104 C  CB  . SER A 1 13 ? -6.114  1.906   11.518 1.00 21.03 ? 12  SER A CB  1 
ATOM   105 O  OG  . SER A 1 13 ? -4.757  2.094   11.147 1.00 27.29 ? 12  SER A OG  1 
ATOM   106 N  N   . LEU A 1 14 ? -5.739  1.090   14.460 1.00 14.45 ? 13  LEU A N   1 
ATOM   107 C  CA  . LEU A 1 14 ? -4.889  1.015   15.665 1.00 15.83 ? 13  LEU A CA  1 
ATOM   108 C  C   . LEU A 1 14 ? -4.809  -0.403  16.226 1.00 13.92 ? 13  LEU A C   1 
ATOM   109 O  O   . LEU A 1 14 ? -3.766  -0.850  16.708 1.00 14.85 ? 13  LEU A O   1 
ATOM   110 C  CB  . LEU A 1 14 ? -5.406  1.971   16.739 1.00 16.92 ? 13  LEU A CB  1 
ATOM   111 C  CG  . LEU A 1 14 ? -5.387  3.427   16.307 1.00 20.96 ? 13  LEU A CG  1 
ATOM   112 C  CD1 . LEU A 1 14 ? -6.238  4.217   17.291 1.00 20.53 ? 13  LEU A CD1 1 
ATOM   113 C  CD2 . LEU A 1 14 ? -3.937  3.975   16.224 1.00 21.88 ? 13  LEU A CD2 1 
ATOM   114 N  N   . SER A 1 15 ? -5.915  -1.124  16.184 1.00 13.67 ? 14  SER A N   1 
ATOM   115 C  CA  . SER A 1 15 ? -5.884  -2.495  16.666 1.00 15.30 ? 14  SER A CA  1 
ATOM   116 C  C   . SER A 1 15 ? -4.912  -3.363  15.855 1.00 14.07 ? 14  SER A C   1 
ATOM   117 O  O   . SER A 1 15 ? -4.135  -4.127  16.435 1.00 15.89 ? 14  SER A O   1 
ATOM   118 C  CB  . SER A 1 15 ? -7.277  -3.118  16.660 1.00 19.34 ? 14  SER A CB  1 
ATOM   119 O  OG  . SER A 1 15 ? -8.082  -2.500  17.656 1.00 24.72 ? 14  SER A OG  1 
ATOM   120 N  N   . LYS A 1 16 ? -4.921  -3.237  14.533 1.00 16.07 ? 15  LYS A N   1 
ATOM   121 C  CA  . LYS A 1 16 ? -4.010  -4.033  13.696 1.00 15.99 ? 15  LYS A CA  1 
ATOM   122 C  C   . LYS A 1 16 ? -2.555  -3.576  13.798 1.00 16.13 ? 15  LYS A C   1 
ATOM   123 O  O   . LYS A 1 16 ? -1.626  -4.367  13.663 1.00 16.46 ? 15  LYS A O   1 
ATOM   124 C  CB  . LYS A 1 16 ? -4.471  -3.982  12.245 1.00 18.32 ? 15  LYS A CB  1 
ATOM   125 C  CG  . LYS A 1 16 ? -5.812  -4.676  12.042 1.00 24.40 ? 15  LYS A CG  1 
ATOM   126 C  CD  . LYS A 1 16 ? -6.245  -4.735  10.564 1.00 28.73 ? 15  LYS A CD  1 
ATOM   127 C  CE  . LYS A 1 16 ? -7.514  -5.612  10.384 1.00 31.18 ? 15  LYS A CE  1 
ATOM   128 N  NZ  . LYS A 1 16 ? -8.020  -5.403  8.990  1.00 34.17 ? 15  LYS A NZ  1 
ATOM   129 N  N   . VAL A 1 17 ? -2.368  -2.283  14.014 1.00 16.07 ? 16  VAL A N   1 
ATOM   130 C  CA  . VAL A 1 17 ? -1.053  -1.661  14.178 1.00 17.44 ? 16  VAL A CA  1 
ATOM   131 C  C   . VAL A 1 17 ? -0.453  -2.190  15.478 1.00 18.12 ? 16  VAL A C   1 
ATOM   132 O  O   . VAL A 1 17 ? 0.736   -2.547  15.527 1.00 15.33 ? 16  VAL A O   1 
ATOM   133 C  CB  . VAL A 1 17 ? -1.217  -0.091  14.225 1.00 16.54 ? 16  VAL A CB  1 
ATOM   134 C  CG1 . VAL A 1 17 ? -0.129  0.569   14.989 1.00 17.86 ? 16  VAL A CG1 1 
ATOM   135 C  CG2 . VAL A 1 17 ? -1.243  0.427   12.840 1.00 21.95 ? 16  VAL A CG2 1 
ATOM   136 N  N   . TYR A 1 18 ? -1.285  -2.260  16.523 1.00 16.29 ? 17  TYR A N   1 
ATOM   137 C  CA  . TYR A 1 18 ? -0.840  -2.768  17.829 1.00 18.09 ? 17  TYR A CA  1 
ATOM   138 C  C   . TYR A 1 18 ? -0.393  -4.195  17.665 1.00 17.60 ? 17  TYR A C   1 
ATOM   139 O  O   . TYR A 1 18 ? 0.643   -4.610  18.174 1.00 17.56 ? 17  TYR A O   1 
ATOM   140 C  CB  . TYR A 1 18 ? -1.981  -2.770  18.846 1.00 21.61 ? 17  TYR A CB  1 
ATOM   141 C  CG  . TYR A 1 18 ? -1.642  -3.464  20.159 1.00 22.51 ? 17  TYR A CG  1 
ATOM   142 C  CD1 . TYR A 1 18 ? -1.067  -2.760  21.190 1.00 27.48 ? 17  TYR A CD1 1 
ATOM   143 C  CD2 . TYR A 1 18 ? -1.916  -4.816  20.365 1.00 25.14 ? 17  TYR A CD2 1 
ATOM   144 C  CE1 . TYR A 1 18 ? -0.769  -3.356  22.404 1.00 25.97 ? 17  TYR A CE1 1 
ATOM   145 C  CE2 . TYR A 1 18 ? -1.619  -5.442  21.599 1.00 28.07 ? 17  TYR A CE2 1 
ATOM   146 C  CZ  . TYR A 1 18 ? -1.036  -4.682  22.614 1.00 29.69 ? 17  TYR A CZ  1 
ATOM   147 O  OH  . TYR A 1 18 ? -0.653  -5.220  23.837 1.00 32.44 ? 17  TYR A OH  1 
ATOM   148 N  N   . HIS A 1 19 ? -1.211  -4.968  16.969 1.00 16.42 ? 18  HIS A N   1 
ATOM   149 C  CA  . HIS A 1 19 ? -0.873  -6.345  16.744 1.00 15.72 ? 18  HIS A CA  1 
ATOM   150 C  C   . HIS A 1 19 ? 0.386   -6.544  15.898 1.00 16.44 ? 18  HIS A C   1 
ATOM   151 O  O   . HIS A 1 19 ? 1.185   -7.451  16.162 1.00 17.42 ? 18  HIS A O   1 
ATOM   152 C  CB  . HIS A 1 19 ? -2.060  -7.077  16.108 1.00 17.12 ? 18  HIS A CB  1 
ATOM   153 C  CG  . HIS A 1 19 ? -1.762  -8.502  15.832 1.00 20.37 ? 18  HIS A CG  1 
ATOM   154 N  ND1 . HIS A 1 19 ? -1.602  -9.425  16.838 1.00 19.36 ? 18  HIS A ND1 1 
ATOM   155 C  CD2 . HIS A 1 19 ? -1.438  -9.134  14.680 1.00 22.44 ? 18  HIS A CD2 1 
ATOM   156 C  CE1 . HIS A 1 19 ? -1.192  -10.568 16.323 1.00 24.48 ? 18  HIS A CE1 1 
ATOM   157 N  NE2 . HIS A 1 19 ? -1.085  -10.412 15.018 1.00 20.07 ? 18  HIS A NE2 1 
ATOM   158 N  N   . LEU A 1 20 ? 0.598   -5.716  14.879 1.00 17.67 ? 19  LEU A N   1 
ATOM   159 C  CA  . LEU A 1 20 ? 1.796   -5.904  14.054 1.00 18.23 ? 19  LEU A CA  1 
ATOM   160 C  C   . LEU A 1 20 ? 3.074   -5.486  14.777 1.00 19.77 ? 19  LEU A C   1 
ATOM   161 O  O   . LEU A 1 20 ? 4.165   -6.018  14.493 1.00 19.97 ? 19  LEU A O   1 
ATOM   162 C  CB  . LEU A 1 20 ? 1.679   -5.139  12.744 1.00 21.60 ? 19  LEU A CB  1 
ATOM   163 C  CG  . LEU A 1 20 ? 0.549   -5.626  11.848 1.00 23.42 ? 19  LEU A CG  1 
ATOM   164 C  CD1 . LEU A 1 20 ? 0.569   -4.796  10.587 1.00 23.97 ? 19  LEU A CD1 1 
ATOM   165 C  CD2 . LEU A 1 20 ? 0.709   -7.117  11.522 1.00 25.07 ? 19  LEU A CD2 1 
ATOM   166 N  N   . GLU A 1 21 ? 2.946   -4.536  15.703 1.00 19.27 ? 20  GLU A N   1 
ATOM   167 C  CA  . GLU A 1 21 ? 4.082   -4.076  16.502 1.00 19.21 ? 20  GLU A CA  1 
ATOM   168 C  C   . GLU A 1 21 ? 4.568   -5.220  17.367 1.00 17.94 ? 20  GLU A C   1 
ATOM   169 O  O   . GLU A 1 21 ? 5.773   -5.379  17.609 1.00 17.64 ? 20  GLU A O   1 
ATOM   170 C  CB  . GLU A 1 21 ? 3.677   -2.923  17.413 1.00 20.55 ? 20  GLU A CB  1 
ATOM   171 C  CG  . GLU A 1 21 ? 3.222   -1.713  16.653 1.00 23.79 ? 20  GLU A CG  1 
ATOM   172 C  CD  . GLU A 1 21 ? 2.958   -0.537  17.544 1.00 23.18 ? 20  GLU A CD  1 
ATOM   173 O  OE1 . GLU A 1 21 ? 2.300   -0.696  18.579 1.00 20.35 ? 20  GLU A OE1 1 
ATOM   174 O  OE2 . GLU A 1 21 ? 3.414   0.572   17.189 1.00 28.67 ? 20  GLU A OE2 1 
ATOM   175 N  N   . ASN A 1 22 ? 3.615   -6.016  17.840 1.00 16.50 ? 21  ASN A N   1 
ATOM   176 C  CA  . ASN A 1 22 ? 3.957   -7.165  18.659 1.00 18.39 ? 21  ASN A CA  1 
ATOM   177 C  C   . ASN A 1 22 ? 4.668   -8.218  17.827 1.00 18.17 ? 21  ASN A C   1 
ATOM   178 O  O   . ASN A 1 22 ? 5.625   -8.829  18.298 1.00 17.16 ? 21  ASN A O   1 
ATOM   179 C  CB  . ASN A 1 22 ? 2.706   -7.723  19.330 1.00 19.90 ? 21  ASN A CB  1 
ATOM   180 C  CG  . ASN A 1 22 ? 2.208   -6.814  20.445 1.00 20.28 ? 21  ASN A CG  1 
ATOM   181 O  OD1 . ASN A 1 22 ? 1.186   -7.085  21.085 1.00 28.29 ? 21  ASN A OD1 1 
ATOM   182 N  ND2 . ASN A 1 22 ? 2.930   -5.740  20.683 1.00 19.28 ? 21  ASN A ND2 1 
ATOM   183 N  N   . GLU A 1 23 ? 4.221   -8.397  16.578 1.00 17.31 ? 22  GLU A N   1 
ATOM   184 C  CA  . GLU A 1 23 ? 4.843   -9.365  15.682 1.00 17.93 ? 22  GLU A CA  1 
ATOM   185 C  C   . GLU A 1 23 ? 6.240   -8.922  15.268 1.00 16.99 ? 22  GLU A C   1 
ATOM   186 O  O   . GLU A 1 23 ? 7.162   -9.753  15.174 1.00 18.76 ? 22  GLU A O   1 
ATOM   187 C  CB  . GLU A 1 23 ? 3.992   -9.595  14.416 1.00 15.17 ? 22  GLU A CB  1 
ATOM   188 C  CG  . GLU A 1 23 ? 2.684   -10.364 14.589 1.00 18.70 ? 22  GLU A CG  1 
ATOM   189 C  CD  . GLU A 1 23 ? 2.876   -11.851 14.854 1.00 22.63 ? 22  GLU A CD  1 
ATOM   190 O  OE1 . GLU A 1 23 ? 1.888   -12.579 14.795 1.00 25.87 ? 22  GLU A OE1 1 
ATOM   191 O  OE2 . GLU A 1 23 ? 3.997   -12.329 15.120 1.00 20.26 ? 22  GLU A OE2 1 
ATOM   192 N  N   . VAL A 1 24 ? 6.383   -7.626  14.984 1.00 15.30 ? 23  VAL A N   1 
ATOM   193 C  CA  . VAL A 1 24 ? 7.669   -7.066  14.592 1.00 17.65 ? 23  VAL A CA  1 
ATOM   194 C  C   . VAL A 1 24 ? 8.646   -7.111  15.754 1.00 17.84 ? 23  VAL A C   1 
ATOM   195 O  O   . VAL A 1 24 ? 9.841   -7.342  15.567 1.00 17.26 ? 23  VAL A O   1 
ATOM   196 C  CB  . VAL A 1 24 ? 7.518   -5.621  14.083 1.00 14.32 ? 23  VAL A CB  1 
ATOM   197 C  CG1 . VAL A 1 24 ? 8.876   -4.964  13.887 1.00 17.09 ? 23  VAL A CG1 1 
ATOM   198 C  CG2 . VAL A 1 24 ? 6.775   -5.658  12.750 1.00 18.06 ? 23  VAL A CG2 1 
ATOM   199 N  N   . ALA A 1 25 ? 8.144   -6.924  16.964 1.00 18.02 ? 24  ALA A N   1 
ATOM   200 C  CA  . ALA A 1 25 ? 9.043   -6.961  18.082 1.00 19.15 ? 24  ALA A CA  1 
ATOM   201 C  C   . ALA A 1 25 ? 9.587   -8.384  18.211 1.00 18.06 ? 24  ALA A C   1 
ATOM   202 O  O   . ALA A 1 25 ? 10.773  -8.551  18.485 1.00 17.95 ? 24  ALA A O   1 
ATOM   203 C  CB  . ALA A 1 25 ? 8.340   -6.519  19.332 1.00 16.35 ? 24  ALA A CB  1 
ATOM   204 N  N   . ARG A 1 26 ? 8.763   -9.401  17.967 1.00 17.26 ? 25  ARG A N   1 
ATOM   205 C  CA  . ARG A 1 26 ? 9.262   -10.764 18.087 1.00 20.23 ? 25  ARG A CA  1 
ATOM   206 C  C   . ARG A 1 26 ? 10.276  -11.114 17.011 1.00 19.96 ? 25  ARG A C   1 
ATOM   207 O  O   . ARG A 1 26 ? 11.303  -11.707 17.307 1.00 18.74 ? 25  ARG A O   1 
ATOM   208 C  CB  . ARG A 1 26 ? 8.128   -11.791 18.029 1.00 23.08 ? 25  ARG A CB  1 
ATOM   209 C  CG  . ARG A 1 26 ? 7.004   -11.604 19.041 1.00 26.96 ? 25  ARG A CG  1 
ATOM   210 C  CD  . ARG A 1 26 ? 6.513   -12.979 19.444 1.00 31.00 ? 25  ARG A CD  1 
ATOM   211 N  NE  . ARG A 1 26 ? 5.119   -13.085 19.859 1.00 35.82 ? 25  ARG A NE  1 
ATOM   212 C  CZ  . ARG A 1 26 ? 4.595   -14.218 20.315 1.00 36.93 ? 25  ARG A CZ  1 
ATOM   213 N  NH1 . ARG A 1 26 ? 5.368   -15.302 20.402 1.00 36.90 ? 25  ARG A NH1 1 
ATOM   214 N  NH2 . ARG A 1 26 ? 3.310   -14.282 20.642 1.00 38.04 ? 25  ARG A NH2 1 
ATOM   215 N  N   . LEU A 1 27 ? 9.964   -10.773 15.758 1.00 18.48 ? 26  LEU A N   1 
ATOM   216 C  CA  . LEU A 1 27 ? 10.874  -11.023 14.647 1.00 20.03 ? 26  LEU A CA  1 
ATOM   217 C  C   . LEU A 1 27 ? 12.208  -10.338 14.925 1.00 21.33 ? 26  LEU A C   1 
ATOM   218 O  O   . LEU A 1 27 ? 13.285  -10.887 14.663 1.00 20.87 ? 26  LEU A O   1 
ATOM   219 C  CB  . LEU A 1 27 ? 10.278  -10.487 13.326 1.00 21.43 ? 26  LEU A CB  1 
ATOM   220 C  CG  . LEU A 1 27 ? 9.052   -11.246 12.813 1.00 24.95 ? 26  LEU A CG  1 
ATOM   221 C  CD1 . LEU A 1 27 ? 8.357   -10.489 11.658 1.00 24.10 ? 26  LEU A CD1 1 
ATOM   222 C  CD2 . LEU A 1 27 ? 9.471   -12.625 12.361 1.00 24.12 ? 26  LEU A CD2 1 
ATOM   223 N  N   . LYS A 1 28 ? 12.155  -9.143  15.498 1.00 22.66 ? 27  LYS A N   1 
ATOM   224 C  CA  . LYS A 1 28 ? 13.393  -8.432  15.754 1.00 23.01 ? 27  LYS A CA  1 
ATOM   225 C  C   . LYS A 1 28 ? 14.259  -9.187  16.741 1.00 24.14 ? 27  LYS A C   1 
ATOM   226 O  O   . LYS A 1 28 ? 15.472  -9.300  16.569 1.00 24.44 ? 27  LYS A O   1 
ATOM   227 C  CB  . LYS A 1 28 ? 13.108  -7.012  16.231 1.00 22.14 ? 27  LYS A CB  1 
ATOM   228 C  CG  . LYS A 1 28 ? 12.618  -6.083  15.123 1.00 17.36 ? 27  LYS A CG  1 
ATOM   229 C  CD  . LYS A 1 28 ? 12.275  -4.712  15.669 1.00 22.90 ? 27  LYS A CD  1 
ATOM   230 C  CE  . LYS A 1 28 ? 13.468  -3.963  16.161 1.00 24.93 ? 27  LYS A CE  1 
ATOM   231 N  NZ  . LYS A 1 28 ? 13.005  -2.654  16.702 1.00 24.40 ? 27  LYS A NZ  1 
ATOM   232 N  N   . LYS A 1 29 ? 13.642  -9.719  17.777 1.00 25.99 ? 28  LYS A N   1 
ATOM   233 C  CA  . LYS A 1 29 ? 14.394  -10.498 18.740 1.00 28.18 ? 28  LYS A CA  1 
ATOM   234 C  C   . LYS A 1 29 ? 14.989  -11.757 18.096 1.00 30.25 ? 28  LYS A C   1 
ATOM   235 O  O   . LYS A 1 29 ? 16.170  -12.065 18.272 1.00 31.43 ? 28  LYS A O   1 
ATOM   236 C  CB  . LYS A 1 29 ? 13.474  -10.870 19.889 1.00 30.76 ? 28  LYS A CB  1 
ATOM   237 C  CG  . LYS A 1 29 ? 14.017  -11.941 20.813 1.00 35.16 ? 28  LYS A CG  1 
ATOM   238 C  CD  . LYS A 1 29 ? 13.511  -11.749 22.235 1.00 37.18 ? 28  LYS A CD  1 
ATOM   239 C  CE  . LYS A 1 29 ? 12.017  -11.510 22.319 1.00 38.03 ? 28  LYS A CE  1 
ATOM   240 N  NZ  . LYS A 1 29 ? 11.677  -11.328 23.751 1.00 41.06 ? 28  LYS A NZ  1 
ATOM   241 N  N   . LEU A 1 30 ? 14.172  -12.480 17.342 1.00 29.97 ? 29  LEU A N   1 
ATOM   242 C  CA  . LEU A 1 30 ? 14.625  -13.701 16.701 1.00 30.68 ? 29  LEU A CA  1 
ATOM   243 C  C   . LEU A 1 30 ? 15.764  -13.485 15.742 1.00 32.86 ? 29  LEU A C   1 
ATOM   244 O  O   . LEU A 1 30 ? 16.598  -14.362 15.567 1.00 34.33 ? 29  LEU A O   1 
ATOM   245 C  CB  . LEU A 1 30 ? 13.484  -14.354 15.919 1.00 31.05 ? 29  LEU A CB  1 
ATOM   246 C  CG  . LEU A 1 30 ? 12.303  -14.921 16.692 1.00 27.45 ? 29  LEU A CG  1 
ATOM   247 C  CD1 . LEU A 1 30 ? 11.155  -15.194 15.741 1.00 28.23 ? 29  LEU A CD1 1 
ATOM   248 C  CD2 . LEU A 1 30 ? 12.722  -16.177 17.419 1.00 30.21 ? 29  LEU A CD2 1 
ATOM   249 N  N   . VAL A 1 31 ? 15.801  -12.303 15.138 1.00 35.42 ? 30  VAL A N   1 
ATOM   250 C  CA  . VAL A 1 31 ? 16.776  -11.972 14.110 1.00 36.83 ? 30  VAL A CA  1 
ATOM   251 C  C   . VAL A 1 31 ? 18.165  -11.511 14.528 1.00 38.29 ? 30  VAL A C   1 
ATOM   252 O  O   . VAL A 1 31 ? 19.067  -12.323 14.743 1.00 39.42 ? 30  VAL A O   1 
ATOM   253 C  CB  . VAL A 1 31 ? 16.150  -10.944 13.137 1.00 36.54 ? 30  VAL A CB  1 
ATOM   254 C  CG1 . VAL A 1 31 ? 17.190  -10.359 12.248 1.00 36.62 ? 30  VAL A CG1 1 
ATOM   255 C  CG2 . VAL A 1 31 ? 15.075  -11.634 12.286 1.00 36.56 ? 30  VAL A CG2 1 
ATOM   256 N  N   . GLY A 1 32 ? 18.341  -10.202 14.590 1.00 39.83 ? 31  GLY A N   1 
ATOM   257 C  CA  . GLY A 1 32 ? 19.607  -9.635  14.990 1.00 40.58 ? 31  GLY A CA  1 
ATOM   258 C  C   . GLY A 1 32 ? 19.268  -8.689  16.111 1.00 40.86 ? 31  GLY A C   1 
ATOM   259 O  O   . GLY A 1 32 ? 19.814  -8.833  17.223 1.00 40.82 ? 31  GLY A O   1 
HETATM 260 C  C   . ACE B 1 1  ? -12.489 18.480  4.490  1.00 32.82 ? 0   ACE B C   1 
HETATM 261 O  O   . ACE B 1 1  ? -12.043 17.370  4.206  1.00 31.34 ? 0   ACE B O   1 
HETATM 262 C  CH3 . ACE B 1 1  ? -13.118 19.339  3.421  1.00 33.72 ? 0   ACE B CH3 1 
ATOM   263 N  N   . ARG B 1 2  ? -12.478 18.975  5.726  1.00 31.01 ? 1   ARG B N   1 
ATOM   264 C  CA  . ARG B 1 2  ? -11.853 18.290  6.862  1.00 29.64 ? 1   ARG B CA  1 
ATOM   265 C  C   . ARG B 1 2  ? -12.202 16.833  7.117  1.00 26.69 ? 1   ARG B C   1 
ATOM   266 O  O   . ARG B 1 2  ? -11.305 16.034  7.362  1.00 23.05 ? 1   ARG B O   1 
ATOM   267 C  CB  . ARG B 1 2  ? -12.101 19.086  8.147  1.00 33.15 ? 1   ARG B CB  1 
ATOM   268 C  CG  . ARG B 1 2  ? -11.026 18.924  9.240  1.00 34.22 ? 1   ARG B CG  1 
ATOM   269 C  CD  . ARG B 1 2  ? -11.396 19.754  10.482 1.00 37.27 ? 1   ARG B CD  1 
ATOM   270 N  NE  . ARG B 1 2  ? -10.506 19.617  11.635 1.00 38.16 ? 1   ARG B NE  1 
ATOM   271 C  CZ  . ARG B 1 2  ? -10.827 20.042  12.857 1.00 40.14 ? 1   ARG B CZ  1 
ATOM   272 N  NH1 . ARG B 1 2  ? -12.015 20.618  13.066 1.00 41.99 ? 1   ARG B NH1 1 
ATOM   273 N  NH2 . ARG B 1 2  ? -9.976  19.891  13.865 1.00 38.36 ? 1   ARG B NH2 1 
ATOM   274 N  N   . MET B 1 3  ? -13.484 16.482  7.103  1.00 24.62 ? 2   MET B N   1 
ATOM   275 C  CA  . MET B 1 3  ? -13.844 15.091  7.339  1.00 25.35 ? 2   MET B CA  1 
ATOM   276 C  C   . MET B 1 3  ? -13.345 14.234  6.179  1.00 23.70 ? 2   MET B C   1 
ATOM   277 O  O   . MET B 1 3  ? -12.830 13.141  6.380  1.00 23.81 ? 2   MET B O   1 
ATOM   278 C  CB  . MET B 1 3  ? -15.350 14.924  7.504  1.00 25.60 ? 2   MET B CB  1 
ATOM   279 C  CG  . MET B 1 3  ? -15.650 13.702  8.335  1.00 30.05 ? 2   MET B CG  1 
ATOM   280 S  SD  . MET B 1 3  ? -17.359 13.465  8.846  1.00 38.18 ? 2   MET B SD  1 
ATOM   281 C  CE  . MET B 1 3  ? -18.153 13.132  7.326  1.00 33.91 ? 2   MET B CE  1 
ATOM   282 N  N   . LYS B 1 4  ? -13.466 14.763  4.969  1.00 22.67 ? 3   LYS B N   1 
ATOM   283 C  CA  . LYS B 1 4  ? -13.007 14.041  3.805  1.00 24.20 ? 3   LYS B CA  1 
ATOM   284 C  C   . LYS B 1 4  ? -11.517 13.824  3.792  1.00 24.04 ? 3   LYS B C   1 
ATOM   285 O  O   . LYS B 1 4  ? -11.068 12.757  3.385  1.00 22.90 ? 3   LYS B O   1 
ATOM   286 C  CB  . LYS B 1 4  ? -13.449 14.743  2.530  1.00 27.85 ? 3   LYS B CB  1 
ATOM   287 C  CG  . LYS B 1 4  ? -14.631 14.053  1.896  1.00 32.52 ? 3   LYS B CG  1 
ATOM   288 C  CD  . LYS B 1 4  ? -14.293 12.592  1.639  1.00 34.96 ? 3   LYS B CD  1 
ATOM   289 C  CE  . LYS B 1 4  ? -15.240 11.943  0.631  1.00 38.88 ? 3   LYS B CE  1 
ATOM   290 N  NZ  . LYS B 1 4  ? -15.906 10.708  1.156  1.00 37.50 ? 3   LYS B NZ  1 
ATOM   291 N  N   . GLN B 1 5  ? -10.735 14.800  4.237  1.00 22.58 ? 4   GLN B N   1 
ATOM   292 C  CA  . GLN B 1 5  ? -9.310  14.558  4.219  1.00 24.31 ? 4   GLN B CA  1 
ATOM   293 C  C   . GLN B 1 5  ? -8.956  13.560  5.332  1.00 22.06 ? 4   GLN B C   1 
ATOM   294 O  O   . GLN B 1 5  ? -7.979  12.835  5.203  1.00 21.61 ? 4   GLN B O   1 
ATOM   295 C  CB  . GLN B 1 5  ? -8.518  15.861  4.293  1.00 27.39 ? 4   GLN B CB  1 
ATOM   296 C  CG  . GLN B 1 5  ? -7.297  15.816  3.329  1.00 33.31 ? 4   GLN B CG  1 
ATOM   297 C  CD  . GLN B 1 5  ? -7.648  15.621  1.793  1.00 37.29 ? 4   GLN B CD  1 
ATOM   298 O  OE1 . GLN B 1 5  ? -6.811  15.122  1.015  1.00 36.09 ? 4   GLN B OE1 1 
ATOM   299 N  NE2 . GLN B 1 5  ? -8.855  16.055  1.367  1.00 36.38 ? 4   GLN B NE2 1 
ATOM   300 N  N   . LEU B 1 6  ? -9.766  13.482  6.394  1.00 19.22 ? 5   LEU B N   1 
ATOM   301 C  CA  . LEU B 1 6  ? -9.522  12.484  7.466  1.00 17.83 ? 5   LEU B CA  1 
ATOM   302 C  C   . LEU B 1 6  ? -9.763  11.063  6.922  1.00 16.43 ? 5   LEU B C   1 
ATOM   303 O  O   . LEU B 1 6  ? -8.956  10.143  7.149  1.00 18.98 ? 5   LEU B O   1 
ATOM   304 C  CB  . LEU B 1 6  ? -10.446 12.746  8.657  1.00 19.18 ? 5   LEU B CB  1 
ATOM   305 C  CG  . LEU B 1 6  ? -10.319 12.034  10.012 1.00 23.83 ? 5   LEU B CG  1 
ATOM   306 C  CD1 . LEU B 1 6  ? -9.010  12.373  10.709 1.00 24.34 ? 5   LEU B CD1 1 
ATOM   307 C  CD2 . LEU B 1 6  ? -11.475 12.483  10.864 1.00 23.18 ? 5   LEU B CD2 1 
ATOM   308 N  N   . GLU B 1 7  ? -10.886 10.878  6.223  1.00 15.89 ? 6   GLU B N   1 
ATOM   309 C  CA  . GLU B 1 7  ? -11.229 9.584   5.631  1.00 18.39 ? 6   GLU B CA  1 
ATOM   310 C  C   . GLU B 1 7  ? -10.110 9.126   4.745  1.00 16.56 ? 6   GLU B C   1 
ATOM   311 O  O   . GLU B 1 7  ? -9.740  7.971   4.725  1.00 16.90 ? 6   GLU B O   1 
ATOM   312 C  CB  . GLU B 1 7  ? -12.460 9.663   4.730  1.00 24.59 ? 6   GLU B CB  1 
ATOM   313 C  CG  . GLU B 1 7  ? -13.791 9.794   5.352  1.00 30.63 ? 6   GLU B CG  1 
ATOM   314 C  CD  . GLU B 1 7  ? -14.870 9.698   4.283  1.00 35.71 ? 6   GLU B CD  1 
ATOM   315 O  OE1 . GLU B 1 7  ? -15.586 10.706  4.127  1.00 38.37 ? 6   GLU B OE1 1 
ATOM   316 O  OE2 . GLU B 1 7  ? -14.967 8.640   3.596  1.00 37.54 ? 6   GLU B OE2 1 
ATOM   317 N  N   . ASP B 1 8  ? -9.589  10.070  3.989  1.00 16.58 ? 7   ASP B N   1 
ATOM   318 C  CA  . ASP B 1 8  ? -8.495  9.797   3.084  1.00 17.83 ? 7   ASP B CA  1 
ATOM   319 C  C   . ASP B 1 8  ? -7.293  9.221   3.854  1.00 18.53 ? 7   ASP B C   1 
ATOM   320 O  O   . ASP B 1 8  ? -6.738  8.172   3.479  1.00 18.27 ? 7   ASP B O   1 
ATOM   321 C  CB  . ASP B 1 8  ? -8.103  11.089  2.355  1.00 15.88 ? 7   ASP B CB  1 
ATOM   322 C  CG  . ASP B 1 8  ? -7.215  10.833  1.150  1.00 20.78 ? 7   ASP B CG  1 
ATOM   323 O  OD1 . ASP B 1 8  ? -7.611  11.252  0.028  1.00 20.46 ? 7   ASP B OD1 1 
ATOM   324 O  OD2 . ASP B 1 8  ? -6.131  10.219  1.297  1.00 19.05 ? 7   ASP B OD2 1 
ATOM   325 N  N   . LYS B 1 9  ? -6.900  9.883   4.941  1.00 16.99 ? 8   LYS B N   1 
ATOM   326 C  CA  . LYS B 1 9  ? -5.770  9.415   5.745  1.00 15.90 ? 8   LYS B CA  1 
ATOM   327 C  C   . LYS B 1 9  ? -6.060  8.090   6.427  1.00 15.92 ? 8   LYS B C   1 
ATOM   328 O  O   . LYS B 1 9  ? -5.170  7.240   6.541  1.00 13.36 ? 8   LYS B O   1 
ATOM   329 C  CB  . LYS B 1 9  ? -5.365  10.443  6.812  1.00 18.11 ? 8   LYS B CB  1 
ATOM   330 C  CG  . LYS B 1 9  ? -5.093  11.858  6.287  1.00 19.68 ? 8   LYS B CG  1 
ATOM   331 C  CD  . LYS B 1 9  ? -4.509  12.753  7.365  1.00 26.83 ? 8   LYS B CD  1 
ATOM   332 C  CE  . LYS B 1 9  ? -5.293  14.035  7.544  1.00 27.70 ? 8   LYS B CE  1 
ATOM   333 N  NZ  . LYS B 1 9  ? -4.900  14.765  8.794  1.00 30.15 ? 8   LYS B NZ  1 
ATOM   334 N  N   . VAL B 1 10 ? -7.302  7.933   6.886  1.00 12.90 ? 9   VAL B N   1 
ATOM   335 C  CA  . VAL B 1 10 ? -7.781  6.714   7.539  1.00 16.00 ? 9   VAL B CA  1 
ATOM   336 C  C   . VAL B 1 10 ? -7.711  5.537   6.559  1.00 16.80 ? 9   VAL B C   1 
ATOM   337 O  O   . VAL B 1 10 ? -7.144  4.509   6.863  1.00 18.51 ? 9   VAL B O   1 
ATOM   338 C  CB  . VAL B 1 10 ? -9.239  6.892   8.026  1.00 18.43 ? 9   VAL B CB  1 
ATOM   339 C  CG1 . VAL B 1 10 ? -9.805  5.571   8.530  1.00 22.87 ? 9   VAL B CG1 1 
ATOM   340 C  CG2 . VAL B 1 10 ? -9.272  7.921   9.169  1.00 21.71 ? 9   VAL B CG2 1 
ATOM   341 N  N   . GLU B 1 11 ? -8.262  5.701   5.364  1.00 16.76 ? 10  GLU B N   1 
ATOM   342 C  CA  . GLU B 1 11 ? -8.250  4.634   4.365  1.00 18.64 ? 10  GLU B CA  1 
ATOM   343 C  C   . GLU B 1 11 ? -6.815  4.341   3.923  1.00 18.50 ? 10  GLU B C   1 
ATOM   344 O  O   . GLU B 1 11 ? -6.443  3.189   3.681  1.00 19.45 ? 10  GLU B O   1 
ATOM   345 C  CB  . GLU B 1 11 ? -9.121  5.038   3.163  1.00 21.79 ? 10  GLU B CB  1 
ATOM   346 C  CG  . GLU B 1 11 ? -10.597 5.262   3.457  1.00 23.50 ? 10  GLU B CG  1 
ATOM   347 C  CD  . GLU B 1 11 ? -11.338 5.818   2.222  1.00 29.77 ? 10  GLU B CD  1 
ATOM   348 O  OE1 . GLU B 1 11 ? -12.548 6.139   2.313  1.00 33.28 ? 10  GLU B OE1 1 
ATOM   349 O  OE2 . GLU B 1 11 ? -10.712 5.935   1.139  1.00 28.34 ? 10  GLU B OE2 1 
ATOM   350 N  N   . GLU B 1 12 ? -5.995  5.379   3.813  1.00 17.41 ? 11  GLU B N   1 
ATOM   351 C  CA  . GLU B 1 12 ? -4.613  5.172   3.439  1.00 17.40 ? 11  GLU B CA  1 
ATOM   352 C  C   . GLU B 1 12 ? -3.835  4.376   4.505  1.00 18.27 ? 11  GLU B C   1 
ATOM   353 O  O   . GLU B 1 12 ? -3.000  3.520   4.181  1.00 15.50 ? 11  GLU B O   1 
ATOM   354 C  CB  . GLU B 1 12 ? -3.912  6.503   3.218  1.00 22.54 ? 11  GLU B CB  1 
ATOM   355 C  CG  . GLU B 1 12 ? -2.426  6.283   2.977  1.00 28.30 ? 11  GLU B CG  1 
ATOM   356 C  CD  . GLU B 1 12 ? -1.783  7.423   2.264  1.00 31.19 ? 11  GLU B CD  1 
ATOM   357 O  OE1 . GLU B 1 12 ? -1.821  8.548   2.815  1.00 33.98 ? 11  GLU B OE1 1 
ATOM   358 O  OE2 . GLU B 1 12 ? -1.250  7.184   1.150  1.00 33.76 ? 11  GLU B OE2 1 
ATOM   359 N  N   . SER B 1 13 ? -4.083  4.702   5.771  1.00 19.87 ? 12  SER B N   1 
ATOM   360 C  CA  . SER B 1 13 ? -3.422  4.031   6.883  1.00 20.53 ? 12  SER B CA  1 
ATOM   361 C  C   . SER B 1 13 ? -3.848  2.554   6.907  1.00 19.66 ? 12  SER B C   1 
ATOM   362 O  O   . SER B 1 13 ? -2.999  1.659   7.046  1.00 18.64 ? 12  SER B O   1 
ATOM   363 C  CB  . SER B 1 13 ? -3.787  4.760   8.185  1.00 22.28 ? 12  SER B CB  1 
ATOM   364 O  OG  . SER B 1 13 ? -3.596  3.954   9.327  1.00 25.23 ? 12  SER B OG  1 
ATOM   365 N  N   . LEU B 1 14 ? -5.140  2.302   6.697  1.00 17.79 ? 13  LEU B N   1 
ATOM   366 C  CA  . LEU B 1 14 ? -5.657  0.951   6.695  1.00 19.68 ? 13  LEU B CA  1 
ATOM   367 C  C   . LEU B 1 14 ? -5.081  0.131   5.551  1.00 18.76 ? 13  LEU B C   1 
ATOM   368 O  O   . LEU B 1 14 ? -4.812  -1.044  5.738  1.00 21.95 ? 13  LEU B O   1 
ATOM   369 C  CB  . LEU B 1 14 ? -7.185  0.932   6.603  1.00 21.19 ? 13  LEU B CB  1 
ATOM   370 C  CG  . LEU B 1 14 ? -8.010  0.667   7.856  1.00 24.75 ? 13  LEU B CG  1 
ATOM   371 C  CD1 . LEU B 1 14 ? -9.387  0.259   7.370  1.00 26.53 ? 13  LEU B CD1 1 
ATOM   372 C  CD2 . LEU B 1 14 ? -7.428  -0.475  8.694  1.00 25.10 ? 13  LEU B CD2 1 
ATOM   373 N  N   . SER B 1 15 ? -4.886  0.736   4.373  1.00 14.90 ? 14  SER B N   1 
ATOM   374 C  CA  . SER B 1 15 ? -4.325  0.020   3.218  1.00 15.38 ? 14  SER B CA  1 
ATOM   375 C  C   . SER B 1 15 ? -2.901  -0.390  3.460  1.00 15.59 ? 14  SER B C   1 
ATOM   376 O  O   . SER B 1 15 ? -2.466  -1.498  3.077  1.00 14.94 ? 14  SER B O   1 
ATOM   377 C  CB  . SER B 1 15 ? -4.315  0.908   1.968  1.00 19.73 ? 14  SER B CB  1 
ATOM   378 O  OG  . SER B 1 15 ? -3.664  0.251   0.877  1.00 17.33 ? 14  SER B OG  1 
ATOM   379 N  N   . LYS B 1 16 ? -2.153  0.523   4.073  1.00 14.55 ? 15  LYS B N   1 
ATOM   380 C  CA  . LYS B 1 16 ? -0.758  0.257   4.362  1.00 17.43 ? 15  LYS B CA  1 
ATOM   381 C  C   . LYS B 1 16 ? -0.671  -0.790  5.451  1.00 15.58 ? 15  LYS B C   1 
ATOM   382 O  O   . LYS B 1 16 ? 0.270   -1.583  5.460  1.00 15.69 ? 15  LYS B O   1 
ATOM   383 C  CB  . LYS B 1 16 ? -0.016  1.540   4.776  1.00 16.64 ? 15  LYS B CB  1 
ATOM   384 C  CG  . LYS B 1 16 ? 0.375   2.447   3.611  1.00 18.09 ? 15  LYS B CG  1 
ATOM   385 C  CD  . LYS B 1 16 ? 1.055   3.699   4.145  1.00 22.14 ? 15  LYS B CD  1 
ATOM   386 C  CE  . LYS B 1 16 ? 1.649   4.654   3.081  1.00 23.97 ? 15  LYS B CE  1 
ATOM   387 N  NZ  . LYS B 1 16 ? 0.673   5.474   2.300  1.00 27.35 ? 15  LYS B NZ  1 
ATOM   388 N  N   . VAL B 1 17 ? -1.638  -0.802  6.360  1.00 14.91 ? 16  VAL B N   1 
ATOM   389 C  CA  . VAL B 1 17 ? -1.621  -1.804  7.426  1.00 17.33 ? 16  VAL B CA  1 
ATOM   390 C  C   . VAL B 1 17 ? -1.839  -3.187  6.821  1.00 16.69 ? 16  VAL B C   1 
ATOM   391 O  O   . VAL B 1 17 ? -1.193  -4.169  7.216  1.00 14.18 ? 16  VAL B O   1 
ATOM   392 C  CB  . VAL B 1 17 ? -2.724  -1.509  8.493  1.00 23.69 ? 16  VAL B CB  1 
ATOM   393 C  CG1 . VAL B 1 17 ? -3.047  -2.763  9.272  1.00 20.70 ? 16  VAL B CG1 1 
ATOM   394 C  CG2 . VAL B 1 17 ? -2.245  -0.389  9.425  1.00 21.49 ? 16  VAL B CG2 1 
ATOM   395 N  N   . TYR B 1 18 ? -2.761  -3.289  5.865  1.00 16.28 ? 17  TYR B N   1 
ATOM   396 C  CA  . TYR B 1 18 ? -3.011  -4.587  5.212  1.00 16.88 ? 17  TYR B CA  1 
ATOM   397 C  C   . TYR B 1 18 ? -1.782  -5.091  4.463  1.00 16.56 ? 17  TYR B C   1 
ATOM   398 O  O   . TYR B 1 18 ? -1.519  -6.290  4.370  1.00 16.30 ? 17  TYR B O   1 
ATOM   399 C  CB  . TYR B 1 18 ? -4.150  -4.512  4.184  1.00 18.28 ? 17  TYR B CB  1 
ATOM   400 C  CG  . TYR B 1 18 ? -5.461  -4.050  4.741  1.00 25.77 ? 17  TYR B CG  1 
ATOM   401 C  CD1 . TYR B 1 18 ? -5.864  -4.413  6.026  1.00 25.10 ? 17  TYR B CD1 1 
ATOM   402 C  CD2 . TYR B 1 18 ? -6.319  -3.232  3.979  1.00 25.96 ? 17  TYR B CD2 1 
ATOM   403 C  CE1 . TYR B 1 18 ? -7.074  -3.965  6.536  1.00 27.77 ? 17  TYR B CE1 1 
ATOM   404 C  CE2 . TYR B 1 18 ? -7.541  -2.787  4.501  1.00 27.59 ? 17  TYR B CE2 1 
ATOM   405 C  CZ  . TYR B 1 18 ? -7.907  -3.149  5.773  1.00 30.26 ? 17  TYR B CZ  1 
ATOM   406 O  OH  . TYR B 1 18 ? -9.092  -2.641  6.290  1.00 31.02 ? 17  TYR B OH  1 
ATOM   407 N  N   . HIS B 1 19 ? -1.073  -4.176  3.834  1.00 13.63 ? 18  HIS B N   1 
ATOM   408 C  CA  . HIS B 1 19 ? 0.137   -4.551  3.153  1.00 13.88 ? 18  HIS B CA  1 
ATOM   409 C  C   . HIS B 1 19 ? 1.209   -5.092  4.156  1.00 13.74 ? 18  HIS B C   1 
ATOM   410 O  O   . HIS B 1 19 ? 1.950   -6.051  3.882  1.00 17.05 ? 18  HIS B O   1 
ATOM   411 C  CB  . HIS B 1 19 ? 0.689   -3.310  2.497  1.00 13.53 ? 18  HIS B CB  1 
ATOM   412 C  CG  . HIS B 1 19 ? 1.934   -3.569  1.734  1.00 17.94 ? 18  HIS B CG  1 
ATOM   413 N  ND1 . HIS B 1 19 ? 1.930   -4.252  0.540  1.00 22.25 ? 18  HIS B ND1 1 
ATOM   414 C  CD2 . HIS B 1 19 ? 3.226   -3.307  2.020  1.00 17.74 ? 18  HIS B CD2 1 
ATOM   415 C  CE1 . HIS B 1 19 ? 3.169   -4.405  0.117  1.00 20.54 ? 18  HIS B CE1 1 
ATOM   416 N  NE2 . HIS B 1 19 ? 3.971   -3.841  0.996  1.00 19.23 ? 18  HIS B NE2 1 
ATOM   417 N  N   . LEU B 1 20 ? 1.329   -4.414  5.298  1.00 13.95 ? 19  LEU B N   1 
ATOM   418 C  CA  . LEU B 1 20 ? 2.296   -4.788  6.331  1.00 12.64 ? 19  LEU B CA  1 
ATOM   419 C  C   . LEU B 1 20 ? 1.960   -6.144  6.894  1.00 13.54 ? 19  LEU B C   1 
ATOM   420 O  O   . LEU B 1 20 ? 2.843   -6.925  7.243  1.00 17.58 ? 19  LEU B O   1 
ATOM   421 C  CB  . LEU B 1 20 ? 2.282   -3.745  7.460  1.00 12.88 ? 19  LEU B CB  1 
ATOM   422 C  CG  . LEU B 1 20 ? 2.845   -2.383  7.074  1.00 14.49 ? 19  LEU B CG  1 
ATOM   423 C  CD1 . LEU B 1 20 ? 2.739   -1.412  8.296  1.00 14.43 ? 19  LEU B CD1 1 
ATOM   424 C  CD2 . LEU B 1 20 ? 4.295   -2.536  6.691  1.00 17.50 ? 19  LEU B CD2 1 
ATOM   425 N  N   . GLU B 1 21 ? 0.677   -6.422  6.998  1.00 12.45 ? 20  GLU B N   1 
ATOM   426 C  CA  . GLU B 1 21 ? 0.276   -7.725  7.478  1.00 15.14 ? 20  GLU B CA  1 
ATOM   427 C  C   . GLU B 1 21 ? 0.868   -8.776  6.533  1.00 15.18 ? 20  GLU B C   1 
ATOM   428 O  O   . GLU B 1 21 ? 1.469   -9.764  6.953  1.00 15.94 ? 20  GLU B O   1 
ATOM   429 C  CB  . GLU B 1 21 ? -1.246  -7.826  7.489  1.00 18.22 ? 20  GLU B CB  1 
ATOM   430 C  CG  . GLU B 1 21 ? -1.930  -6.836  8.434  1.00 25.31 ? 20  GLU B CG  1 
ATOM   431 C  CD  . GLU B 1 21 ? -3.414  -7.127  8.555  1.00 29.53 ? 20  GLU B CD  1 
ATOM   432 O  OE1 . GLU B 1 21 ? -4.053  -7.371  7.486  1.00 26.45 ? 20  GLU B OE1 1 
ATOM   433 O  OE2 . GLU B 1 21 ? -3.921  -7.122  9.703  1.00 31.11 ? 20  GLU B OE2 1 
ATOM   434 N  N   . ASN B 1 22 ? 0.696   -8.543  5.241  1.00 15.82 ? 21  ASN B N   1 
ATOM   435 C  CA  . ASN B 1 22 ? 1.229   -9.431  4.235  1.00 16.66 ? 21  ASN B CA  1 
ATOM   436 C  C   . ASN B 1 22 ? 2.752   -9.564  4.349  1.00 15.61 ? 21  ASN B C   1 
ATOM   437 O  O   . ASN B 1 22 ? 3.284   -10.692 4.210  1.00 12.62 ? 21  ASN B O   1 
ATOM   438 C  CB  . ASN B 1 22 ? 0.875   -8.911  2.830  1.00 22.57 ? 21  ASN B CB  1 
ATOM   439 C  CG  . ASN B 1 22 ? -0.629  -8.822  2.576  1.00 27.94 ? 21  ASN B CG  1 
ATOM   440 O  OD1 . ASN B 1 22 ? -1.452  -9.062  3.455  1.00 28.98 ? 21  ASN B OD1 1 
ATOM   441 N  ND2 . ASN B 1 22 ? -0.989  -8.457  1.338  1.00 31.26 ? 21  ASN B ND2 1 
ATOM   442 N  N   . GLU B 1 23 ? 3.455   -8.436  4.557  1.00 13.89 ? 22  GLU B N   1 
ATOM   443 C  CA  . GLU B 1 23 ? 4.919   -8.435  4.679  1.00 15.52 ? 22  GLU B CA  1 
ATOM   444 C  C   . GLU B 1 23 ? 5.336   -9.221  5.923  1.00 16.85 ? 22  GLU B C   1 
ATOM   445 O  O   . GLU B 1 23 ? 6.298   -9.999  5.870  1.00 15.52 ? 22  GLU B O   1 
ATOM   446 C  CB  . GLU B 1 23 ? 5.527   -7.007  4.803  1.00 14.53 ? 22  GLU B CB  1 
ATOM   447 C  CG  . GLU B 1 23 ? 5.672   -6.128  3.533  1.00 18.06 ? 22  GLU B CG  1 
ATOM   448 C  CD  . GLU B 1 23 ? 6.612   -6.683  2.452  1.00 20.70 ? 22  GLU B CD  1 
ATOM   449 O  OE1 . GLU B 1 23 ? 6.814   -5.996  1.443  1.00 20.55 ? 22  GLU B OE1 1 
ATOM   450 O  OE2 . GLU B 1 23 ? 7.145   -7.805  2.546  1.00 19.11 ? 22  GLU B OE2 1 
ATOM   451 N  N   . VAL B 1 24 ? 4.615   -9.010  7.030  1.00 16.10 ? 23  VAL B N   1 
ATOM   452 C  CA  . VAL B 1 24 ? 4.903   -9.686  8.301  1.00 15.60 ? 23  VAL B CA  1 
ATOM   453 C  C   . VAL B 1 24 ? 4.604   -11.182 8.239  1.00 13.02 ? 23  VAL B C   1 
ATOM   454 O  O   . VAL B 1 24 ? 5.389   -11.968 8.755  1.00 13.75 ? 23  VAL B O   1 
ATOM   455 C  CB  . VAL B 1 24 ? 4.157   -8.992  9.504  1.00 17.59 ? 23  VAL B CB  1 
ATOM   456 C  CG1 . VAL B 1 24 ? 4.480   -9.675  10.820 1.00 15.19 ? 23  VAL B CG1 1 
ATOM   457 C  CG2 . VAL B 1 24 ? 4.603   -7.541  9.590  1.00 20.31 ? 23  VAL B CG2 1 
ATOM   458 N  N   . ALA B 1 25 ? 3.507   -11.598 7.599  1.00 14.27 ? 24  ALA B N   1 
ATOM   459 C  CA  . ALA B 1 25 ? 3.215   -13.037 7.473  1.00 13.56 ? 24  ALA B CA  1 
ATOM   460 C  C   . ALA B 1 25 ? 4.380   -13.670 6.693  1.00 15.52 ? 24  ALA B C   1 
ATOM   461 O  O   . ALA B 1 25 ? 4.863   -14.757 7.031  1.00 13.78 ? 24  ALA B O   1 
ATOM   462 C  CB  . ALA B 1 25 ? 1.882   -13.270 6.725  1.00 12.27 ? 24  ALA B CB  1 
ATOM   463 N  N   . ARG B 1 26 ? 4.825   -12.996 5.636  1.00 15.89 ? 25  ARG B N   1 
ATOM   464 C  CA  . ARG B 1 26 ? 5.958   -13.522 4.862  1.00 17.70 ? 25  ARG B CA  1 
ATOM   465 C  C   . ARG B 1 26 ? 7.256   -13.604 5.673  1.00 18.01 ? 25  ARG B C   1 
ATOM   466 O  O   . ARG B 1 26 ? 7.987   -14.597 5.584  1.00 17.32 ? 25  ARG B O   1 
ATOM   467 C  CB  . ARG B 1 26 ? 6.195   -12.698 3.591  1.00 17.03 ? 25  ARG B CB  1 
ATOM   468 C  CG  . ARG B 1 26 ? 5.248   -13.035 2.436  1.00 18.75 ? 25  ARG B CG  1 
ATOM   469 C  CD  . ARG B 1 26 ? 5.830   -12.409 1.165  1.00 22.97 ? 25  ARG B CD  1 
ATOM   470 N  NE  . ARG B 1 26 ? 5.285   -11.095 0.927  1.00 23.25 ? 25  ARG B NE  1 
ATOM   471 C  CZ  . ARG B 1 26 ? 5.927   -10.098 0.333  1.00 20.09 ? 25  ARG B CZ  1 
ATOM   472 N  NH1 . ARG B 1 26 ? 7.180   -10.231 -0.080 1.00 23.88 ? 25  ARG B NH1 1 
ATOM   473 N  NH2 . ARG B 1 26 ? 5.306   -8.947  0.213  1.00 23.26 ? 25  ARG B NH2 1 
ATOM   474 N  N   . LEU B 1 27 ? 7.557   -12.563 6.450  1.00 14.11 ? 26  LEU B N   1 
ATOM   475 C  CA  . LEU B 1 27 ? 8.740   -12.600 7.304  1.00 13.40 ? 26  LEU B CA  1 
ATOM   476 C  C   . LEU B 1 27 ? 8.688   -13.663 8.378  1.00 15.39 ? 26  LEU B C   1 
ATOM   477 O  O   . LEU B 1 27 ? 9.680   -14.332 8.633  1.00 14.93 ? 26  LEU B O   1 
ATOM   478 C  CB  . LEU B 1 27 ? 8.976   -11.251 7.986  1.00 16.21 ? 26  LEU B CB  1 
ATOM   479 C  CG  . LEU B 1 27 ? 9.622   -10.342 6.962  1.00 14.39 ? 26  LEU B CG  1 
ATOM   480 C  CD1 . LEU B 1 27 ? 9.495   -8.900  7.410  1.00 18.96 ? 26  LEU B CD1 1 
ATOM   481 C  CD2 . LEU B 1 27 ? 11.077  -10.745 6.798  1.00 15.80 ? 26  LEU B CD2 1 
ATOM   482 N  N   . LYS B 1 28 ? 7.552   -13.791 9.041  1.00 15.04 ? 27  LYS B N   1 
ATOM   483 C  CA  . LYS B 1 28 ? 7.428   -14.818 10.064 1.00 15.80 ? 27  LYS B CA  1 
ATOM   484 C  C   . LYS B 1 28 ? 7.687   -16.161 9.460  1.00 17.30 ? 27  LYS B C   1 
ATOM   485 O  O   . LYS B 1 28 ? 8.296   -17.009 10.100 1.00 17.43 ? 27  LYS B O   1 
ATOM   486 C  CB  . LYS B 1 28 ? 6.032   -14.862 10.655 1.00 17.90 ? 27  LYS B CB  1 
ATOM   487 C  CG  . LYS B 1 28 ? 5.579   -13.584 11.275 1.00 17.63 ? 27  LYS B CG  1 
ATOM   488 C  CD  . LYS B 1 28 ? 4.144   -13.780 11.822 1.00 17.59 ? 27  LYS B CD  1 
ATOM   489 C  CE  . LYS B 1 28 ? 4.164   -14.810 12.937 1.00 19.44 ? 27  LYS B CE  1 
ATOM   490 N  NZ  . LYS B 1 28 ? 2.830   -14.991 13.524 1.00 23.35 ? 27  LYS B NZ  1 
ATOM   491 N  N   . LYS B 1 29 ? 7.239   -16.380 8.227  1.00 15.71 ? 28  LYS B N   1 
ATOM   492 C  CA  . LYS B 1 29 ? 7.459   -17.691 7.628  1.00 18.27 ? 28  LYS B CA  1 
ATOM   493 C  C   . LYS B 1 29 ? 8.921   -17.856 7.248  1.00 18.89 ? 28  LYS B C   1 
ATOM   494 O  O   . LYS B 1 29 ? 9.543   -18.902 7.489  1.00 20.83 ? 28  LYS B O   1 
ATOM   495 C  CB  . LYS B 1 29 ? 6.595   -17.887 6.389  1.00 18.77 ? 28  LYS B CB  1 
ATOM   496 C  CG  . LYS B 1 29 ? 6.703   -19.283 5.827  1.00 19.25 ? 28  LYS B CG  1 
ATOM   497 C  CD  . LYS B 1 29 ? 5.810   -19.512 4.654  1.00 19.15 ? 28  LYS B CD  1 
ATOM   498 C  CE  . LYS B 1 29 ? 6.150   -20.853 4.048  1.00 22.27 ? 28  LYS B CE  1 
ATOM   499 N  NZ  . LYS B 1 29 ? 5.361   -21.171 2.821  1.00 24.55 ? 28  LYS B NZ  1 
ATOM   500 N  N   . LEU B 1 30 ? 9.480   -16.809 6.663  1.00 19.42 ? 29  LEU B N   1 
ATOM   501 C  CA  . LEU B 1 30 ? 10.866  -16.851 6.230  1.00 21.36 ? 29  LEU B CA  1 
ATOM   502 C  C   . LEU B 1 30 ? 11.879  -17.044 7.371  1.00 23.10 ? 29  LEU B C   1 
ATOM   503 O  O   . LEU B 1 30 ? 12.848  -17.812 7.250  1.00 20.66 ? 29  LEU B O   1 
ATOM   504 C  CB  . LEU B 1 30 ? 11.195  -15.575 5.450  1.00 22.90 ? 29  LEU B CB  1 
ATOM   505 C  CG  . LEU B 1 30 ? 12.634  -15.414 4.974  1.00 22.13 ? 29  LEU B CG  1 
ATOM   506 C  CD1 . LEU B 1 30 ? 12.918  -16.427 3.888  1.00 23.53 ? 29  LEU B CD1 1 
ATOM   507 C  CD2 . LEU B 1 30 ? 12.825  -14.008 4.464  1.00 25.77 ? 29  LEU B CD2 1 
ATOM   508 N  N   . VAL B 1 31 ? 11.646  -16.344 8.474  1.00 22.44 ? 30  VAL B N   1 
ATOM   509 C  CA  . VAL B 1 31 ? 12.525  -16.413 9.631  1.00 24.50 ? 30  VAL B CA  1 
ATOM   510 C  C   . VAL B 1 31 ? 12.229  -17.667 10.416 1.00 25.38 ? 30  VAL B C   1 
ATOM   511 O  O   . VAL B 1 31 ? 13.146  -18.373 10.870 1.00 25.23 ? 30  VAL B O   1 
ATOM   512 C  CB  . VAL B 1 31 ? 12.312  -15.183 10.543 1.00 27.75 ? 30  VAL B CB  1 
ATOM   513 C  CG1 . VAL B 1 31 ? 12.995  -15.390 11.886 1.00 29.27 ? 30  VAL B CG1 1 
ATOM   514 C  CG2 . VAL B 1 31 ? 12.893  -13.930 9.870  1.00 27.42 ? 30  VAL B CG2 1 
ATOM   515 N  N   . GLY B 1 32 ? 10.940  -17.956 10.523 1.00 23.26 ? 31  GLY B N   1 
ATOM   516 C  CA  . GLY B 1 32 ? 10.475  -19.102 11.276 1.00 27.02 ? 31  GLY B CA  1 
ATOM   517 C  C   . GLY B 1 32 ? 10.554  -18.866 12.783 1.00 30.44 ? 31  GLY B C   1 
ATOM   518 O  O   . GLY B 1 32 ? 10.925  -19.786 13.524 1.00 34.60 ? 31  GLY B O   1 
HETATM 519 C  C   . ACE C 1 1  ? -13.454 16.942  19.318 1.00 29.38 ? 0   ACE C C   1 
HETATM 520 O  O   . ACE C 1 1  ? -12.338 16.398  19.321 1.00 30.20 ? 0   ACE C O   1 
HETATM 521 C  CH3 . ACE C 1 1  ? -13.605 18.359  19.780 1.00 28.64 ? 0   ACE C CH3 1 
ATOM   522 N  N   . ARG C 1 2  ? -14.550 16.311  18.900 1.00 27.70 ? 1   ARG C N   1 
ATOM   523 C  CA  . ARG C 1 2  ? -14.465 14.933  18.446 1.00 28.33 ? 1   ARG C CA  1 
ATOM   524 C  C   . ARG C 1 2  ? -13.646 14.794  17.151 1.00 26.81 ? 1   ARG C C   1 
ATOM   525 O  O   . ARG C 1 2  ? -12.901 13.821  16.976 1.00 27.72 ? 1   ARG C O   1 
ATOM   526 C  CB  . ARG C 1 2  ? -15.885 14.332  18.321 1.00 30.42 ? 1   ARG C CB  1 
ATOM   527 C  CG  . ARG C 1 2  ? -16.584 14.276  19.693 1.00 31.37 ? 1   ARG C CG  1 
ATOM   528 C  CD  . ARG C 1 2  ? -17.799 13.361  19.747 1.00 35.63 ? 1   ARG C CD  1 
ATOM   529 N  NE  . ARG C 1 2  ? -17.442 12.059  19.179 1.00 38.75 ? 1   ARG C NE  1 
ATOM   530 C  CZ  . ARG C 1 2  ? -18.093 10.919  19.396 1.00 40.02 ? 1   ARG C CZ  1 
ATOM   531 N  NH1 . ARG C 1 2  ? -19.139 10.885  20.215 1.00 42.69 ? 1   ARG C NH1 1 
ATOM   532 N  NH2 . ARG C 1 2  ? -17.673 9.803   18.812 1.00 39.47 ? 1   ARG C NH2 1 
ATOM   533 N  N   . MET C 1 3  ? -13.761 15.776  16.259 1.00 25.67 ? 2   MET C N   1 
ATOM   534 C  CA  . MET C 1 3  ? -13.010 15.756  14.998 1.00 23.79 ? 2   MET C CA  1 
ATOM   535 C  C   . MET C 1 3  ? -11.511 15.771  15.327 1.00 22.93 ? 2   MET C C   1 
ATOM   536 O  O   . MET C 1 3  ? -10.708 15.048  14.730 1.00 21.58 ? 2   MET C O   1 
ATOM   537 C  CB  . MET C 1 3  ? -13.339 16.996  14.159 1.00 28.02 ? 2   MET C CB  1 
ATOM   538 C  CG  . MET C 1 3  ? -12.734 16.951  12.754 1.00 34.15 ? 2   MET C CG  1 
ATOM   539 S  SD  . MET C 1 3  ? -13.625 15.878  11.648 1.00 38.85 ? 2   MET C SD  1 
ATOM   540 C  CE  . MET C 1 3  ? -13.603 14.212  12.275 1.00 36.31 ? 2   MET C CE  1 
ATOM   541 N  N   . LYS C 1 4  ? -11.135 16.601  16.294 1.00 22.46 ? 3   LYS C N   1 
ATOM   542 C  CA  . LYS C 1 4  ? -9.736  16.698  16.664 1.00 21.76 ? 3   LYS C CA  1 
ATOM   543 C  C   . LYS C 1 4  ? -9.236  15.411  17.304 1.00 20.47 ? 3   LYS C C   1 
ATOM   544 O  O   . LYS C 1 4  ? -8.082  15.053  17.124 1.00 19.83 ? 3   LYS C O   1 
ATOM   545 C  CB  . LYS C 1 4  ? -9.498  17.885  17.592 1.00 23.39 ? 3   LYS C CB  1 
ATOM   546 C  CG  . LYS C 1 4  ? -8.060  17.987  18.119 1.00 28.56 ? 3   LYS C CG  1 
ATOM   547 C  CD  . LYS C 1 4  ? -7.039  18.498  17.095 1.00 32.47 ? 3   LYS C CD  1 
ATOM   548 C  CE  . LYS C 1 4  ? -5.684  18.673  17.764 1.00 33.01 ? 3   LYS C CE  1 
ATOM   549 N  NZ  . LYS C 1 4  ? -5.824  19.567  18.969 1.00 38.29 ? 3   LYS C NZ  1 
ATOM   550 N  N   . GLN C 1 5  ? -10.083 14.712  18.058 1.00 19.58 ? 4   GLN C N   1 
ATOM   551 C  CA  . GLN C 1 5  ? -9.602  13.446  18.628 1.00 19.75 ? 4   GLN C CA  1 
ATOM   552 C  C   . GLN C 1 5  ? -9.412  12.458  17.485 1.00 19.89 ? 4   GLN C C   1 
ATOM   553 O  O   . GLN C 1 5  ? -8.445  11.700  17.464 1.00 18.75 ? 4   GLN C O   1 
ATOM   554 C  CB  . GLN C 1 5  ? -10.568 12.868  19.665 1.00 20.89 ? 4   GLN C CB  1 
ATOM   555 C  CG  . GLN C 1 5  ? -10.656 13.713  20.937 1.00 20.99 ? 4   GLN C CG  1 
ATOM   556 C  CD  . GLN C 1 5  ? -9.313  13.803  21.628 1.00 21.87 ? 4   GLN C CD  1 
ATOM   557 O  OE1 . GLN C 1 5  ? -8.849  14.887  21.959 1.00 27.30 ? 4   GLN C OE1 1 
ATOM   558 N  NE2 . GLN C 1 5  ? -8.674  12.666  21.829 1.00 17.99 ? 4   GLN C NE2 1 
ATOM   559 N  N   . LEU C 1 6  ? -10.320 12.463  16.520 1.00 18.95 ? 5   LEU C N   1 
ATOM   560 C  CA  . LEU C 1 6  ? -10.155 11.546  15.416 1.00 20.51 ? 5   LEU C CA  1 
ATOM   561 C  C   . LEU C 1 6  ? -8.900  11.856  14.607 1.00 19.65 ? 5   LEU C C   1 
ATOM   562 O  O   . LEU C 1 6  ? -8.264  10.959  14.063 1.00 19.30 ? 5   LEU C O   1 
ATOM   563 C  CB  . LEU C 1 6  ? -11.364 11.567  14.477 1.00 24.15 ? 5   LEU C CB  1 
ATOM   564 C  CG  . LEU C 1 6  ? -12.541 10.667  14.846 1.00 22.98 ? 5   LEU C CG  1 
ATOM   565 C  CD1 . LEU C 1 6  ? -13.587 10.687  13.725 1.00 25.61 ? 5   LEU C CD1 1 
ATOM   566 C  CD2 . LEU C 1 6  ? -12.000 9.260   15.030 1.00 23.82 ? 5   LEU C CD2 1 
ATOM   567 N  N   . GLU C 1 7  ? -8.557  13.129  14.510 1.00 20.61 ? 6   GLU C N   1 
ATOM   568 C  CA  . GLU C 1 7  ? -7.353  13.520  13.767 1.00 20.79 ? 6   GLU C CA  1 
ATOM   569 C  C   . GLU C 1 7  ? -6.107  13.110  14.515 1.00 18.78 ? 6   GLU C C   1 
ATOM   570 O  O   . GLU C 1 7  ? -5.109  12.744  13.897 1.00 19.68 ? 6   GLU C O   1 
ATOM   571 C  CB  . GLU C 1 7  ? -7.339  15.019  13.539 1.00 19.52 ? 6   GLU C CB  1 
ATOM   572 C  CG  . GLU C 1 7  ? -8.492  15.440  12.686 1.00 26.53 ? 6   GLU C CG  1 
ATOM   573 C  CD  . GLU C 1 7  ? -8.557  16.926  12.481 1.00 28.14 ? 6   GLU C CD  1 
ATOM   574 O  OE1 . GLU C 1 7  ? -7.960  17.688  13.287 1.00 29.32 ? 6   GLU C OE1 1 
ATOM   575 O  OE2 . GLU C 1 7  ? -9.228  17.328  11.505 1.00 34.30 ? 6   GLU C OE2 1 
ATOM   576 N  N   . ASP C 1 8  ? -6.155  13.181  15.847 1.00 20.82 ? 7   ASP C N   1 
ATOM   577 C  CA  . ASP C 1 8  ? -5.001  12.752  16.641 1.00 22.22 ? 7   ASP C CA  1 
ATOM   578 C  C   . ASP C 1 8  ? -4.792  11.275  16.424 1.00 21.38 ? 7   ASP C C   1 
ATOM   579 O  O   . ASP C 1 8  ? -3.659  10.829  16.224 1.00 19.81 ? 7   ASP C O   1 
ATOM   580 C  CB  . ASP C 1 8  ? -5.192  12.928  18.144 1.00 22.83 ? 7   ASP C CB  1 
ATOM   581 C  CG  . ASP C 1 8  ? -5.156  14.358  18.581 1.00 26.13 ? 7   ASP C CG  1 
ATOM   582 O  OD1 . ASP C 1 8  ? -4.645  15.229  17.823 1.00 22.57 ? 7   ASP C OD1 1 
ATOM   583 O  OD2 . ASP C 1 8  ? -5.628  14.601  19.713 1.00 26.33 ? 7   ASP C OD2 1 
ATOM   584 N  N   . LYS C 1 9  ? -5.888  10.518  16.511 1.00 19.34 ? 8   LYS C N   1 
ATOM   585 C  CA  . LYS C 1 9  ? -5.851  9.063   16.327 1.00 20.34 ? 8   LYS C CA  1 
ATOM   586 C  C   . LYS C 1 9  ? -5.329  8.665   14.951 1.00 21.18 ? 8   LYS C C   1 
ATOM   587 O  O   . LYS C 1 9  ? -4.514  7.729   14.820 1.00 17.39 ? 8   LYS C O   1 
ATOM   588 C  CB  . LYS C 1 9  ? -7.246  8.453   16.514 1.00 21.22 ? 8   LYS C CB  1 
ATOM   589 C  CG  . LYS C 1 9  ? -7.718  8.413   17.974 1.00 24.20 ? 8   LYS C CG  1 
ATOM   590 C  CD  . LYS C 1 9  ? -9.129  7.807   18.076 1.00 27.33 ? 8   LYS C CD  1 
ATOM   591 C  CE  . LYS C 1 9  ? -9.566  7.643   19.527 1.00 29.33 ? 8   LYS C CE  1 
ATOM   592 N  NZ  . LYS C 1 9  ? -9.753  6.177   19.900 1.00 32.99 ? 8   LYS C NZ  1 
ATOM   593 N  N   . VAL C 1 10 ? -5.831  9.356   13.914 1.00 21.50 ? 9   VAL C N   1 
ATOM   594 C  CA  . VAL C 1 10 ? -5.347  9.039   12.577 1.00 20.46 ? 9   VAL C CA  1 
ATOM   595 C  C   . VAL C 1 10 ? -3.868  9.308   12.453 1.00 18.84 ? 9   VAL C C   1 
ATOM   596 O  O   . VAL C 1 10 ? -3.142  8.493   11.882 1.00 14.66 ? 9   VAL C O   1 
ATOM   597 C  CB  . VAL C 1 10 ? -6.067  9.669   11.337 1.00 22.75 ? 9   VAL C CB  1 
ATOM   598 C  CG1 . VAL C 1 10 ? -5.208  10.659  10.566 1.00 25.96 ? 9   VAL C CG1 1 
ATOM   599 C  CG2 . VAL C 1 10 ? -6.413  8.483   10.447 1.00 27.74 ? 9   VAL C CG2 1 
ATOM   600 N  N   . GLU C 1 11 ? -3.404  10.446  12.960 1.00 17.06 ? 10  GLU C N   1 
ATOM   601 C  CA  . GLU C 1 11 ? -1.979  10.763  12.908 1.00 17.66 ? 10  GLU C CA  1 
ATOM   602 C  C   . GLU C 1 11 ? -1.129  9.747   13.664 1.00 19.02 ? 10  GLU C C   1 
ATOM   603 O  O   . GLU C 1 11 ? -0.051  9.374   13.209 1.00 18.48 ? 10  GLU C O   1 
ATOM   604 C  CB  . GLU C 1 11 ? -1.735  12.166  13.460 1.00 16.37 ? 10  GLU C CB  1 
ATOM   605 C  CG  . GLU C 1 11 ? -2.461  13.210  12.643 1.00 19.52 ? 10  GLU C CG  1 
ATOM   606 C  CD  . GLU C 1 11 ? -2.020  14.598  12.985 1.00 23.48 ? 10  GLU C CD  1 
ATOM   607 O  OE1 . GLU C 1 11 ? -1.373  14.753  14.043 1.00 23.24 ? 10  GLU C OE1 1 
ATOM   608 O  OE2 . GLU C 1 11 ? -2.331  15.530  12.212 1.00 28.28 ? 10  GLU C OE2 1 
ATOM   609 N  N   . GLU C 1 12 ? -1.586  9.340   14.845 1.00 20.61 ? 11  GLU C N   1 
ATOM   610 C  CA  . GLU C 1 12 ? -0.872  8.325   15.596 1.00 20.01 ? 11  GLU C CA  1 
ATOM   611 C  C   . GLU C 1 12 ? -0.917  7.033   14.759 1.00 18.94 ? 11  GLU C C   1 
ATOM   612 O  O   . GLU C 1 12 ? 0.051   6.285   14.678 1.00 16.51 ? 11  GLU C O   1 
ATOM   613 C  CB  . GLU C 1 12 ? -1.571  8.107   16.942 1.00 25.99 ? 11  GLU C CB  1 
ATOM   614 C  CG  . GLU C 1 12 ? -1.012  6.959   17.759 1.00 30.99 ? 11  GLU C CG  1 
ATOM   615 C  CD  . GLU C 1 12 ? -1.834  6.719   19.020 1.00 34.62 ? 11  GLU C CD  1 
ATOM   616 O  OE1 . GLU C 1 12 ? -3.043  6.399   18.916 1.00 34.12 ? 11  GLU C OE1 1 
ATOM   617 O  OE2 . GLU C 1 12 ? -1.260  6.871   20.118 1.00 38.04 ? 11  GLU C OE2 1 
ATOM   618 N  N   . SER C 1 13 ? -2.051  6.750   14.130 1.00 18.80 ? 12  SER C N   1 
ATOM   619 C  CA  . SER C 1 13 ? -2.121  5.553   13.330 1.00 20.02 ? 12  SER C CA  1 
ATOM   620 C  C   . SER C 1 13 ? -1.079  5.566   12.198 1.00 20.32 ? 12  SER C C   1 
ATOM   621 O  O   . SER C 1 13 ? -0.387  4.555   11.975 1.00 20.87 ? 12  SER C O   1 
ATOM   622 C  CB  . SER C 1 13 ? -3.521  5.394   12.763 1.00 22.02 ? 12  SER C CB  1 
ATOM   623 O  OG  . SER C 1 13 ? -3.630  4.116   12.206 1.00 23.73 ? 12  SER C OG  1 
ATOM   624 N  N   . LEU C 1 14 ? -0.946  6.714   11.518 1.00 19.78 ? 13  LEU C N   1 
ATOM   625 C  CA  . LEU C 1 14 ? 0.006   6.857   10.409 1.00 18.82 ? 13  LEU C CA  1 
ATOM   626 C  C   . LEU C 1 14 ? 1.465   6.832   10.882 1.00 17.74 ? 13  LEU C C   1 
ATOM   627 O  O   . LEU C 1 14 ? 2.319   6.230   10.243 1.00 17.58 ? 13  LEU C O   1 
ATOM   628 C  CB  . LEU C 1 14 ? -0.274  8.145   9.616  1.00 17.28 ? 13  LEU C CB  1 
ATOM   629 C  CG  . LEU C 1 14 ? -1.519  8.180   8.710  1.00 19.07 ? 13  LEU C CG  1 
ATOM   630 C  CD1 . LEU C 1 14 ? -1.801  9.599   8.237  1.00 16.25 ? 13  LEU C CD1 1 
ATOM   631 C  CD2 . LEU C 1 14 ? -1.298  7.257   7.510  1.00 16.08 ? 13  LEU C CD2 1 
ATOM   632 N  N   . SER C 1 15 ? 1.736   7.469   12.011 1.00 17.04 ? 14  SER C N   1 
ATOM   633 C  CA  . SER C 1 15 ? 3.071   7.497   12.589 1.00 17.16 ? 14  SER C CA  1 
ATOM   634 C  C   . SER C 1 15 ? 3.552   6.051   12.843 1.00 17.60 ? 14  SER C C   1 
ATOM   635 O  O   . SER C 1 15 ? 4.690   5.676   12.533 1.00 13.55 ? 14  SER C O   1 
ATOM   636 C  CB  . SER C 1 15 ? 3.015   8.253   13.928 1.00 22.31 ? 14  SER C CB  1 
ATOM   637 O  OG  . SER C 1 15 ? 4.195   9.006   14.167 1.00 28.77 ? 14  SER C OG  1 
ATOM   638 N  N   . LYS C 1 16 ? 2.670   5.247   13.424 1.00 17.95 ? 15  LYS C N   1 
ATOM   639 C  CA  . LYS C 1 16 ? 3.028   3.874   13.740 1.00 19.86 ? 15  LYS C CA  1 
ATOM   640 C  C   . LYS C 1 16 ? 3.240   3.097   12.478 1.00 19.06 ? 15  LYS C C   1 
ATOM   641 O  O   . LYS C 1 16 ? 4.233   2.406   12.347 1.00 21.80 ? 15  LYS C O   1 
ATOM   642 C  CB  . LYS C 1 16 ? 1.963   3.238   14.610 1.00 17.77 ? 15  LYS C CB  1 
ATOM   643 C  CG  . LYS C 1 16 ? 1.846   4.005   15.959 1.00 18.19 ? 15  LYS C CG  1 
ATOM   644 C  CD  . LYS C 1 16 ? 1.043   3.245   16.990 1.00 20.58 ? 15  LYS C CD  1 
ATOM   645 C  CE  . LYS C 1 16 ? 1.172   3.914   18.378 1.00 24.58 ? 15  LYS C CE  1 
ATOM   646 N  NZ  . LYS C 1 16 ? 0.683   3.059   19.507 1.00 25.86 ? 15  LYS C NZ  1 
ATOM   647 N  N   . VAL C 1 17 ? 2.314   3.233   11.544 1.00 19.21 ? 16  VAL C N   1 
ATOM   648 C  CA  . VAL C 1 17 ? 2.415   2.563   10.251 1.00 21.84 ? 16  VAL C CA  1 
ATOM   649 C  C   . VAL C 1 17 ? 3.768   2.834   9.578  1.00 20.87 ? 16  VAL C C   1 
ATOM   650 O  O   . VAL C 1 17 ? 4.464   1.897   9.165  1.00 21.63 ? 16  VAL C O   1 
ATOM   651 C  CB  . VAL C 1 17 ? 1.249   3.027   9.323  1.00 21.99 ? 16  VAL C CB  1 
ATOM   652 C  CG1 . VAL C 1 17 ? 1.432   2.536   7.906  1.00 20.32 ? 16  VAL C CG1 1 
ATOM   653 C  CG2 . VAL C 1 17 ? -0.066  2.542   9.888  1.00 22.12 ? 16  VAL C CG2 1 
ATOM   654 N  N   . TYR C 1 18 ? 4.132   4.112   9.448  1.00 22.29 ? 17  TYR C N   1 
ATOM   655 C  CA  . TYR C 1 18 ? 5.399   4.512   8.820  1.00 19.89 ? 17  TYR C CA  1 
ATOM   656 C  C   . TYR C 1 18 ? 6.552   3.857   9.531  1.00 18.84 ? 17  TYR C C   1 
ATOM   657 O  O   . TYR C 1 18 ? 7.471   3.329   8.907  1.00 18.97 ? 17  TYR C O   1 
ATOM   658 C  CB  . TYR C 1 18 ? 5.586   6.029   8.912  1.00 20.59 ? 17  TYR C CB  1 
ATOM   659 C  CG  . TYR C 1 18 ? 4.571   6.784   8.102  1.00 17.63 ? 17  TYR C CG  1 
ATOM   660 C  CD1 . TYR C 1 18 ? 4.280   8.101   8.389  1.00 19.61 ? 17  TYR C CD1 1 
ATOM   661 C  CD2 . TYR C 1 18 ? 3.895   6.168   7.049  1.00 19.53 ? 17  TYR C CD2 1 
ATOM   662 C  CE1 . TYR C 1 18 ? 3.333   8.805   7.663  1.00 18.52 ? 17  TYR C CE1 1 
ATOM   663 C  CE2 . TYR C 1 18 ? 2.938   6.860   6.304  1.00 20.95 ? 17  TYR C CE2 1 
ATOM   664 C  CZ  . TYR C 1 18 ? 2.661   8.189   6.630  1.00 22.00 ? 17  TYR C CZ  1 
ATOM   665 O  OH  . TYR C 1 18 ? 1.690   8.893   5.948  1.00 20.19 ? 17  TYR C OH  1 
ATOM   666 N  N   . HIS C 1 19 ? 6.493   3.926   10.856 1.00 16.33 ? 18  HIS C N   1 
ATOM   667 C  CA  . HIS C 1 19 ? 7.512   3.328   11.671 1.00 17.10 ? 18  HIS C CA  1 
ATOM   668 C  C   . HIS C 1 19 ? 7.606   1.812   11.445 1.00 17.72 ? 18  HIS C C   1 
ATOM   669 O  O   . HIS C 1 19 ? 8.709   1.271   11.370 1.00 16.28 ? 18  HIS C O   1 
ATOM   670 C  CB  . HIS C 1 19 ? 7.244   3.613   13.130 1.00 18.94 ? 18  HIS C CB  1 
ATOM   671 C  CG  . HIS C 1 19 ? 8.270   3.018   14.023 1.00 19.41 ? 18  HIS C CG  1 
ATOM   672 N  ND1 . HIS C 1 19 ? 9.584   3.422   14.002 1.00 21.39 ? 18  HIS C ND1 1 
ATOM   673 C  CD2 . HIS C 1 19 ? 8.195   2.004   14.916 1.00 21.71 ? 18  HIS C CD2 1 
ATOM   674 C  CE1 . HIS C 1 19 ? 10.279  2.684   14.847 1.00 24.16 ? 18  HIS C CE1 1 
ATOM   675 N  NE2 . HIS C 1 19 ? 9.459   1.818   15.411 1.00 21.63 ? 18  HIS C NE2 1 
ATOM   676 N  N   . LEU C 1 20 ? 6.469   1.128   11.321 1.00 16.33 ? 19  LEU C N   1 
ATOM   677 C  CA  . LEU C 1 20 ? 6.511   -0.318  11.058 1.00 14.69 ? 19  LEU C CA  1 
ATOM   678 C  C   . LEU C 1 20 ? 7.052   -0.590  9.647  1.00 15.93 ? 19  LEU C C   1 
ATOM   679 O  O   . LEU C 1 20 ? 7.762   -1.575  9.422  1.00 12.91 ? 19  LEU C O   1 
ATOM   680 C  CB  . LEU C 1 20 ? 5.122   -0.926  11.236 1.00 18.04 ? 19  LEU C CB  1 
ATOM   681 C  CG  . LEU C 1 20 ? 4.677   -0.954  12.697 1.00 20.62 ? 19  LEU C CG  1 
ATOM   682 C  CD1 . LEU C 1 20 ? 3.206   -1.412  12.758 1.00 19.15 ? 19  LEU C CD1 1 
ATOM   683 C  CD2 . LEU C 1 20 ? 5.563   -1.902  13.514 1.00 21.33 ? 19  LEU C CD2 1 
ATOM   684 N  N   . GLU C 1 21 ? 6.721   0.272   8.686  1.00 14.23 ? 20  GLU C N   1 
ATOM   685 C  CA  . GLU C 1 21 ? 7.280   0.094   7.356  1.00 17.70 ? 20  GLU C CA  1 
ATOM   686 C  C   . GLU C 1 21 ? 8.810   0.158   7.447  1.00 18.11 ? 20  GLU C C   1 
ATOM   687 O  O   . GLU C 1 21 ? 9.493   -0.673  6.872  1.00 22.21 ? 20  GLU C O   1 
ATOM   688 C  CB  . GLU C 1 21 ? 6.760   1.170   6.383  1.00 15.13 ? 20  GLU C CB  1 
ATOM   689 C  CG  . GLU C 1 21 ? 5.298   1.040   6.030  1.00 16.84 ? 20  GLU C CG  1 
ATOM   690 C  CD  . GLU C 1 21 ? 4.844   2.178   5.137  1.00 19.35 ? 20  GLU C CD  1 
ATOM   691 O  OE1 . GLU C 1 21 ? 3.762   2.081   4.543  1.00 23.83 ? 20  GLU C OE1 1 
ATOM   692 O  OE2 . GLU C 1 21 ? 5.581   3.170   5.041  1.00 21.85 ? 20  GLU C OE2 1 
ATOM   693 N  N   . ASN C 1 22 ? 9.366   1.121   8.171  1.00 21.58 ? 21  ASN C N   1 
ATOM   694 C  CA  . ASN C 1 22 ? 10.829  1.186   8.287  1.00 21.86 ? 21  ASN C CA  1 
ATOM   695 C  C   . ASN C 1 22 ? 11.405  -0.084  8.999  1.00 20.61 ? 21  ASN C C   1 
ATOM   696 O  O   . ASN C 1 22 ? 12.464  -0.606  8.608  1.00 18.28 ? 21  ASN C O   1 
ATOM   697 C  CB  . ASN C 1 22 ? 11.285  2.461   9.052  1.00 25.55 ? 21  ASN C CB  1 
ATOM   698 C  CG  . ASN C 1 22 ? 10.754  3.775   8.440  1.00 28.10 ? 21  ASN C CG  1 
ATOM   699 O  OD1 . ASN C 1 22 ? 10.605  3.903   7.218  1.00 29.22 ? 21  ASN C OD1 1 
ATOM   700 N  ND2 . ASN C 1 22 ? 10.504  4.768   9.299  1.00 28.74 ? 21  ASN C ND2 1 
ATOM   701 N  N   . GLU C 1 23 ? 10.728  -0.571  10.049 1.00 17.56 ? 22  GLU C N   1 
ATOM   702 C  CA  . GLU C 1 23 ? 11.196  -1.765  10.762 1.00 18.98 ? 22  GLU C CA  1 
ATOM   703 C  C   . GLU C 1 23 ? 11.168  -2.988  9.847  1.00 18.03 ? 22  GLU C C   1 
ATOM   704 O  O   . GLU C 1 23 ? 12.095  -3.774  9.834  1.00 20.71 ? 22  GLU C O   1 
ATOM   705 C  CB  . GLU C 1 23 ? 10.346  -2.041  12.024 1.00 16.44 ? 22  GLU C CB  1 
ATOM   706 C  CG  . GLU C 1 23 ? 10.590  -1.093  13.231 1.00 23.10 ? 22  GLU C CG  1 
ATOM   707 C  CD  . GLU C 1 23 ? 11.992  -1.209  13.867 1.00 23.51 ? 22  GLU C CD  1 
ATOM   708 O  OE1 . GLU C 1 23 ? 12.926  -1.728  13.237 1.00 28.93 ? 22  GLU C OE1 1 
ATOM   709 O  OE2 . GLU C 1 23 ? 12.186  -0.751  15.010 1.00 25.92 ? 22  GLU C OE2 1 
ATOM   710 N  N   . VAL C 1 24 ? 10.107  -3.134  9.060  1.00 18.71 ? 23  VAL C N   1 
ATOM   711 C  CA  . VAL C 1 24 ? 9.979   -4.269  8.149  1.00 14.53 ? 23  VAL C CA  1 
ATOM   712 C  C   . VAL C 1 24 ? 11.030  -4.148  7.080  1.00 16.25 ? 23  VAL C C   1 
ATOM   713 O  O   . VAL C 1 24 ? 11.668  -5.135  6.691  1.00 14.05 ? 23  VAL C O   1 
ATOM   714 C  CB  . VAL C 1 24 ? 8.555   -4.325  7.506  1.00 13.50 ? 23  VAL C CB  1 
ATOM   715 C  CG1 . VAL C 1 24 ? 8.503   -5.371  6.391  1.00 13.65 ? 23  VAL C CG1 1 
ATOM   716 C  CG2 . VAL C 1 24 ? 7.526   -4.683  8.573  1.00 13.78 ? 23  VAL C CG2 1 
ATOM   717 N  N   . ALA C 1 25 ? 11.210  -2.932  6.581  1.00 16.68 ? 24  ALA C N   1 
ATOM   718 C  CA  . ALA C 1 25 ? 12.218  -2.724  5.573  1.00 19.29 ? 24  ALA C CA  1 
ATOM   719 C  C   . ALA C 1 25 ? 13.597  -3.098  6.128  1.00 20.33 ? 24  ALA C C   1 
ATOM   720 O  O   . ALA C 1 25 ? 14.396  -3.664  5.404  1.00 20.73 ? 24  ALA C O   1 
ATOM   721 C  CB  . ALA C 1 25 ? 12.215  -1.263  5.102  1.00 19.19 ? 24  ALA C CB  1 
ATOM   722 N  N   . ARG C 1 26 ? 13.903  -2.784  7.393  1.00 21.22 ? 25  ARG C N   1 
ATOM   723 C  CA  . ARG C 1 26 ? 15.234  -3.154  7.853  1.00 21.79 ? 25  ARG C CA  1 
ATOM   724 C  C   . ARG C 1 26 ? 15.348  -4.658  8.005  1.00 20.56 ? 25  ARG C C   1 
ATOM   725 O  O   . ARG C 1 26 ? 16.401  -5.250  7.694  1.00 20.41 ? 25  ARG C O   1 
ATOM   726 C  CB  . ARG C 1 26 ? 15.658  -2.512  9.199  1.00 25.35 ? 25  ARG C CB  1 
ATOM   727 C  CG  . ARG C 1 26 ? 17.199  -2.556  9.257  1.00 27.71 ? 25  ARG C CG  1 
ATOM   728 C  CD  . ARG C 1 26 ? 17.929  -2.224  10.554 1.00 33.02 ? 25  ARG C CD  1 
ATOM   729 N  NE  . ARG C 1 26 ? 19.365  -2.050  10.252 1.00 33.49 ? 25  ARG C NE  1 
ATOM   730 C  CZ  . ARG C 1 26 ? 20.370  -2.009  11.137 1.00 38.12 ? 25  ARG C CZ  1 
ATOM   731 N  NH1 . ARG C 1 26 ? 20.145  -2.124  12.444 1.00 38.03 ? 25  ARG C NH1 1 
ATOM   732 N  NH2 . ARG C 1 26 ? 21.620  -1.817  10.706 1.00 36.66 ? 25  ARG C NH2 1 
ATOM   733 N  N   . LEU C 1 27 ? 14.288  -5.278  8.510  1.00 19.40 ? 26  LEU C N   1 
ATOM   734 C  CA  . LEU C 1 27 ? 14.312  -6.725  8.683  1.00 20.85 ? 26  LEU C CA  1 
ATOM   735 C  C   . LEU C 1 27 ? 14.559  -7.443  7.370  1.00 21.56 ? 26  LEU C C   1 
ATOM   736 O  O   . LEU C 1 27 ? 15.340  -8.395  7.324  1.00 21.06 ? 26  LEU C O   1 
ATOM   737 C  CB  . LEU C 1 27 ? 13.004  -7.226  9.279  1.00 19.76 ? 26  LEU C CB  1 
ATOM   738 C  CG  . LEU C 1 27 ? 12.775  -6.891  10.759 1.00 21.67 ? 26  LEU C CG  1 
ATOM   739 C  CD1 . LEU C 1 27 ? 11.304  -7.220  11.089 1.00 18.03 ? 26  LEU C CD1 1 
ATOM   740 C  CD2 . LEU C 1 27 ? 13.733  -7.705  11.659 1.00 19.02 ? 26  LEU C CD2 1 
ATOM   741 N  N   . LYS C 1 28 ? 13.895  -6.980  6.313  1.00 21.31 ? 27  LYS C N   1 
ATOM   742 C  CA  . LYS C 1 28 ? 14.026  -7.582  4.992  1.00 23.45 ? 27  LYS C CA  1 
ATOM   743 C  C   . LYS C 1 28 ? 15.417  -7.450  4.427  1.00 25.95 ? 27  LYS C C   1 
ATOM   744 O  O   . LYS C 1 28 ? 15.897  -8.353  3.721  1.00 26.30 ? 27  LYS C O   1 
ATOM   745 C  CB  . LYS C 1 28 ? 13.018  -6.976  4.010  1.00 24.49 ? 27  LYS C CB  1 
ATOM   746 C  CG  . LYS C 1 28 ? 11.566  -7.242  4.401  1.00 24.97 ? 27  LYS C CG  1 
ATOM   747 C  CD  . LYS C 1 28 ? 10.572  -6.773  3.331  1.00 25.54 ? 27  LYS C CD  1 
ATOM   748 C  CE  . LYS C 1 28 ? 10.635  -7.597  2.041  1.00 23.39 ? 27  LYS C CE  1 
ATOM   749 N  NZ  . LYS C 1 28 ? 9.620   -7.055  1.076  1.00 24.65 ? 27  LYS C NZ  1 
ATOM   750 N  N   . LYS C 1 29 ? 16.087  -6.348  4.740  1.00 28.97 ? 28  LYS C N   1 
ATOM   751 C  CA  . LYS C 1 29 ? 17.438  -6.179  4.237  1.00 32.65 ? 28  LYS C CA  1 
ATOM   752 C  C   . LYS C 1 29 ? 18.357  -7.110  5.022  1.00 34.66 ? 28  LYS C C   1 
ATOM   753 O  O   . LYS C 1 29 ? 19.201  -7.777  4.443  1.00 35.12 ? 28  LYS C O   1 
ATOM   754 C  CB  . LYS C 1 29 ? 17.937  -4.748  4.403  1.00 34.23 ? 28  LYS C CB  1 
ATOM   755 C  CG  . LYS C 1 29 ? 19.228  -4.491  3.632  1.00 35.13 ? 28  LYS C CG  1 
ATOM   756 C  CD  . LYS C 1 29 ? 20.309  -3.918  4.515  1.00 39.66 ? 28  LYS C CD  1 
ATOM   757 C  CE  . LYS C 1 29 ? 19.847  -2.659  5.242  1.00 40.16 ? 28  LYS C CE  1 
ATOM   758 N  NZ  . LYS C 1 29 ? 20.906  -2.163  6.150  1.00 41.97 ? 28  LYS C NZ  1 
ATOM   759 N  N   . LEU C 1 30 ? 18.192  -7.187  6.337  1.00 34.89 ? 29  LEU C N   1 
ATOM   760 C  CA  . LEU C 1 30 ? 19.091  -8.061  7.065  1.00 36.68 ? 29  LEU C CA  1 
ATOM   761 C  C   . LEU C 1 30 ? 18.717  -9.554  6.917  1.00 35.88 ? 29  LEU C C   1 
ATOM   762 O  O   . LEU C 1 30 ? 19.590  -10.434 6.952  1.00 36.09 ? 29  LEU C O   1 
ATOM   763 C  CB  . LEU C 1 30 ? 19.185  -7.640  8.545  1.00 39.26 ? 29  LEU C CB  1 
ATOM   764 C  CG  . LEU C 1 30 ? 17.916  -7.767  9.382  1.00 42.65 ? 29  LEU C CG  1 
ATOM   765 C  CD1 . LEU C 1 30 ? 17.596  -9.209  9.767  1.00 43.29 ? 29  LEU C CD1 1 
ATOM   766 C  CD2 . LEU C 1 30 ? 18.026  -7.005  10.716 1.00 41.44 ? 29  LEU C CD2 1 
ATOM   767 N  N   . VAL C 1 31 ? 17.433  -9.861  6.740  1.00 36.36 ? 30  VAL C N   1 
ATOM   768 C  CA  . VAL C 1 31 ? 17.011  -11.277 6.566  1.00 36.92 ? 30  VAL C CA  1 
ATOM   769 C  C   . VAL C 1 31 ? 17.618  -11.800 5.249  1.00 38.81 ? 30  VAL C C   1 
ATOM   770 O  O   . VAL C 1 31 ? 18.481  -12.687 5.243  1.00 40.24 ? 30  VAL C O   1 
ATOM   771 C  CB  . VAL C 1 31 ? 15.499  -11.416 6.646  1.00 36.57 ? 30  VAL C CB  1 
ATOM   772 C  CG1 . VAL C 1 31 ? 15.021  -12.840 6.351  1.00 35.62 ? 30  VAL C CG1 1 
ATOM   773 C  CG2 . VAL C 1 31 ? 14.952  -11.084 8.041  1.00 33.44 ? 30  VAL C CG2 1 
ATOM   774 N  N   . GLY C 1 32 ? 17.182  -11.303 4.076  1.00 39.59 ? 31  GLY C N   1 
ATOM   775 C  CA  . GLY C 1 32 ? 17.971  -11.655 2.875  1.00 41.62 ? 31  GLY C CA  1 
ATOM   776 C  C   . GLY C 1 32 ? 17.321  -12.050 1.552  1.00 43.52 ? 31  GLY C C   1 
ATOM   777 O  O   . GLY C 1 32 ? 16.097  -12.267 1.477  1.00 44.61 ? 31  GLY C O   1 
HETATM 778 ZN ZN  . ZN  D 2 .  ? -0.134  -11.917 13.663 1.00 35.16 ? 201 ZN  A ZN  1 
HETATM 779 ZN ZN  . ZN  E 2 .  ? 6.073   -3.933  1.233  1.00 25.22 ? 202 ZN  B ZN  1 
HETATM 780 ZN ZN  . ZN  F 2 .  ? 10.545  0.057   16.210 1.00 31.34 ? 203 ZN  C ZN  1 
HETATM 781 O  O   . HOH G 3 .  ? -5.305  -7.018  15.554 1.00 53.72 ? 202 HOH A O   1 
HETATM 782 O  O   . HOH G 3 .  ? 22.740  -9.807  16.865 1.00 33.33 ? 203 HOH A O   1 
HETATM 783 O  O   . HOH G 3 .  ? 8.763   -10.133 21.851 1.00 35.15 ? 204 HOH A O   1 
HETATM 784 O  O   . HOH G 3 .  ? -8.470  0.239   18.321 1.00 24.29 ? 205 HOH A O   1 
HETATM 785 O  O   . HOH G 3 .  ? 5.087   1.343   15.367 1.00 25.40 ? 206 HOH A O   1 
HETATM 786 O  O   . HOH G 3 .  ? -2.071  0.936   18.519 1.00 24.16 ? 207 HOH A O   1 
HETATM 787 O  O   . HOH G 3 .  ? 12.046  -6.968  20.229 1.00 32.99 ? 208 HOH A O   1 
HETATM 788 O  O   . HOH G 3 .  ? 3.181   -14.554 16.861 1.00 40.66 ? 209 HOH A O   1 
HETATM 789 O  O   . HOH G 3 .  ? 6.452   -9.088  20.916 1.00 35.63 ? 210 HOH A O   1 
HETATM 790 O  O   . HOH G 3 .  ? 18.884  -8.993  19.743 1.00 48.98 ? 211 HOH A O   1 
HETATM 791 O  O   . HOH G 3 .  ? -17.173 3.092   16.340 1.00 42.52 ? 212 HOH A O   1 
HETATM 792 O  O   . HOH G 3 .  ? -10.718 -2.616  17.661 1.00 44.39 ? 213 HOH A O   1 
HETATM 793 O  O   . HOH G 3 .  ? -18.793 1.378   9.331  1.00 38.62 ? 214 HOH A O   1 
HETATM 794 O  O   . HOH G 3 .  ? -19.456 4.639   2.347  1.00 47.35 ? 215 HOH A O   1 
HETATM 795 O  O   . HOH G 3 .  ? -12.808 -3.623  12.025 1.00 46.10 ? 216 HOH A O   1 
HETATM 796 O  O   . HOH G 3 .  ? -7.445  -6.376  15.118 1.00 36.99 ? 217 HOH A O   1 
HETATM 797 O  O   . HOH G 3 .  ? -5.105  -5.992  18.424 1.00 35.65 ? 218 HOH A O   1 
HETATM 798 O  O   . HOH G 3 .  ? 2.358   -2.935  20.220 1.00 25.63 ? 219 HOH A O   1 
HETATM 799 O  O   . HOH G 3 .  ? 6.495   -12.463 14.872 1.00 19.45 ? 220 HOH A O   1 
HETATM 800 O  O   . HOH G 3 .  ? 7.523   -15.884 17.754 1.00 50.11 ? 221 HOH A O   1 
HETATM 801 O  O   . HOH G 3 .  ? 4.499   -17.810 22.320 1.00 40.29 ? 222 HOH A O   1 
HETATM 802 O  O   . HOH G 3 .  ? 5.888   3.242   16.614 1.00 49.96 ? 223 HOH A O   1 
HETATM 803 O  O   . HOH G 3 .  ? -17.685 2.865   18.575 1.00 46.97 ? 224 HOH A O   1 
HETATM 804 O  O   . HOH G 3 .  ? -10.577 1.346   3.795  1.00 30.75 ? 225 HOH A O   1 
HETATM 805 O  O   . HOH G 3 .  ? -9.966  -6.169  7.640  1.00 50.90 ? 226 HOH A O   1 
HETATM 806 O  O   . HOH G 3 .  ? -22.075 8.308   2.425  1.00 63.44 ? 227 HOH A O   1 
HETATM 807 O  O   . HOH G 3 .  ? -21.969 4.207   2.559  1.00 51.45 ? 228 HOH A O   1 
HETATM 808 O  O   . HOH G 3 .  ? -15.624 -0.235  20.882 1.00 58.68 ? 229 HOH A O   1 
HETATM 809 O  O   . HOH G 3 .  ? -13.831 0.863   22.943 1.00 43.28 ? 230 HOH A O   1 
HETATM 810 O  O   . HOH G 3 .  ? -15.703 2.043   20.939 1.00 62.98 ? 231 HOH A O   1 
HETATM 811 O  O   . HOH G 3 .  ? -13.447 -2.329  24.493 1.00 43.76 ? 232 HOH A O   1 
HETATM 812 O  O   . HOH G 3 .  ? -13.432 0.131   25.005 1.00 56.19 ? 233 HOH A O   1 
HETATM 813 O  O   . HOH G 3 .  ? -8.796  -5.009  19.086 1.00 57.21 ? 234 HOH A O   1 
HETATM 814 O  O   . HOH G 3 .  ? 5.251   -10.724 23.494 1.00 65.14 ? 235 HOH A O   1 
HETATM 815 O  O   . HOH H 3 .  ? 6.938   -7.096  -0.912 1.00 16.13 ? 203 HOH B O   1 
HETATM 816 O  O   . HOH H 3 .  ? 1.608   -17.148 11.822 1.00 22.43 ? 204 HOH B O   1 
HETATM 817 O  O   . HOH H 3 .  ? 8.135   -9.733  3.799  1.00 20.40 ? 205 HOH B O   1 
HETATM 818 O  O   . HOH H 3 .  ? 3.090   -16.403 8.456  1.00 20.95 ? 206 HOH B O   1 
HETATM 819 O  O   . HOH H 3 .  ? 5.523   -16.600 2.338  1.00 31.51 ? 207 HOH B O   1 
HETATM 820 O  O   . HOH H 3 .  ? -3.531  -7.324  12.199 1.00 38.67 ? 208 HOH B O   1 
HETATM 821 O  O   . HOH H 3 .  ? -15.471 3.955   2.166  1.00 35.65 ? 209 HOH B O   1 
HETATM 822 O  O   . HOH H 3 .  ? 13.568  -20.477 12.404 1.00 27.79 ? 210 HOH B O   1 
HETATM 823 O  O   . HOH H 3 .  ? -3.587  -8.220  5.350  1.00 38.13 ? 211 HOH B O   1 
HETATM 824 O  O   . HOH H 3 .  ? 7.955   -16.127 3.171  1.00 22.11 ? 212 HOH B O   1 
HETATM 825 O  O   . HOH H 3 .  ? 1.053   -15.137 9.937  1.00 20.89 ? 213 HOH B O   1 
HETATM 826 O  O   . HOH H 3 .  ? 9.841   -13.558 1.730  1.00 32.95 ? 214 HOH B O   1 
HETATM 827 O  O   . HOH H 3 .  ? 2.279   -0.498  4.084  1.00 25.79 ? 215 HOH B O   1 
HETATM 828 O  O   . HOH H 3 .  ? 12.406  -20.065 5.708  1.00 37.33 ? 216 HOH B O   1 
HETATM 829 O  O   . HOH H 3 .  ? 2.648   -9.728  0.395  1.00 40.82 ? 217 HOH B O   1 
HETATM 830 O  O   . HOH H 3 .  ? 12.195  -15.521 0.364  1.00 37.49 ? 218 HOH B O   1 
HETATM 831 O  O   . HOH H 3 .  ? -1.725  -10.188 11.007 1.00 38.64 ? 219 HOH B O   1 
HETATM 832 O  O   . HOH H 3 .  ? -5.640  -7.875  2.730  1.00 36.73 ? 220 HOH B O   1 
HETATM 833 O  O   . HOH H 3 .  ? 8.995   -21.778 6.980  1.00 36.85 ? 221 HOH B O   1 
HETATM 834 O  O   . HOH H 3 .  ? -11.833 11.247  1.232  1.00 22.29 ? 222 HOH B O   1 
HETATM 835 O  O   . HOH H 3 .  ? 2.230   0.042   1.470  1.00 40.03 ? 223 HOH B O   1 
HETATM 836 O  O   . HOH H 3 .  ? -6.491  -1.475  0.931  1.00 46.85 ? 224 HOH B O   1 
HETATM 837 O  O   . HOH H 3 .  ? 0.091   -5.120  -0.458 1.00 27.37 ? 225 HOH B O   1 
HETATM 838 O  O   . HOH H 3 .  ? 10.201  -11.551 2.988  1.00 38.68 ? 226 HOH B O   1 
HETATM 839 O  O   . HOH H 3 .  ? -13.494 5.476   5.231  1.00 33.82 ? 227 HOH B O   1 
HETATM 840 O  O   . HOH H 3 .  ? -0.891  10.166  4.337  1.00 51.54 ? 228 HOH B O   1 
HETATM 841 O  O   . HOH H 3 .  ? -8.644  1.024   2.359  1.00 34.41 ? 229 HOH B O   1 
HETATM 842 O  O   . HOH H 3 .  ? 0.783   -12.318 11.247 1.00 38.18 ? 230 HOH B O   1 
HETATM 843 O  O   . HOH H 3 .  ? -14.741 5.877   3.168  1.00 22.54 ? 231 HOH B O   1 
HETATM 844 O  O   . HOH H 3 .  ? -1.372  13.067  8.666  1.00 33.64 ? 232 HOH B O   1 
HETATM 845 O  O   . HOH H 3 .  ? 0.266   0.352   0.487  1.00 38.78 ? 233 HOH B O   1 
HETATM 846 O  O   . HOH H 3 .  ? -0.310  -3.520  -2.198 1.00 52.93 ? 234 HOH B O   1 
HETATM 847 O  O   . HOH H 3 .  ? -7.693  11.484  -3.151 1.00 45.87 ? 235 HOH B O   1 
HETATM 848 O  O   . HOH H 3 .  ? 3.120   -15.876 3.917  1.00 33.48 ? 236 HOH B O   1 
HETATM 849 O  O   . HOH H 3 .  ? 2.109   -16.801 14.938 1.00 37.15 ? 237 HOH B O   1 
HETATM 850 O  O   . HOH H 3 .  ? 8.627   -16.143 12.976 1.00 35.00 ? 238 HOH B O   1 
HETATM 851 O  O   . HOH H 3 .  ? 2.404   -20.173 2.804  1.00 45.04 ? 239 HOH B O   1 
HETATM 852 O  O   . HOH H 3 .  ? 7.049   -19.738 0.552  1.00 33.57 ? 240 HOH B O   1 
HETATM 853 O  O   . HOH H 3 .  ? 9.714   -20.322 15.546 1.00 41.75 ? 241 HOH B O   1 
HETATM 854 O  O   . HOH H 3 .  ? -14.597 4.736   -0.421 1.00 55.05 ? 242 HOH B O   1 
HETATM 855 O  O   . HOH H 3 .  ? -11.078 21.577  5.311  1.00 44.24 ? 243 HOH B O   1 
HETATM 856 O  O   . HOH H 3 .  ? -13.224 22.017  6.790  1.00 46.81 ? 244 HOH B O   1 
HETATM 857 O  O   . HOH H 3 .  ? -5.137  13.735  11.201 1.00 43.81 ? 245 HOH B O   1 
HETATM 858 O  O   . HOH H 3 .  ? -1.543  1.661   0.086  1.00 29.92 ? 246 HOH B O   1 
HETATM 859 O  O   . HOH H 3 .  ? 7.666   -14.989 15.025 1.00 44.19 ? 247 HOH B O   1 
HETATM 860 O  O   . HOH H 3 .  ? 1.517   -17.078 17.398 1.00 38.98 ? 248 HOH B O   1 
HETATM 861 O  O   . HOH H 3 .  ? 7.485   -20.281 16.352 1.00 50.66 ? 249 HOH B O   1 
HETATM 862 O  O   . HOH H 3 .  ? 7.599   -22.722 15.787 1.00 38.96 ? 250 HOH B O   1 
HETATM 863 O  O   . HOH H 3 .  ? -17.454 7.949   2.152  1.00 57.61 ? 251 HOH B O   1 
HETATM 864 O  O   . HOH H 3 .  ? -4.988  17.147  0.117  1.00 45.52 ? 252 HOH B O   1 
HETATM 865 O  O   . HOH H 3 .  ? -3.380  16.225  1.745  1.00 55.76 ? 253 HOH B O   1 
HETATM 866 O  O   . HOH H 3 .  ? -4.405  16.438  4.016  1.00 59.10 ? 254 HOH B O   1 
HETATM 867 O  O   . HOH H 3 .  ? -3.069  14.460  5.701  1.00 55.61 ? 255 HOH B O   1 
HETATM 868 O  O   . HOH H 3 .  ? -1.569  16.274  5.626  1.00 58.54 ? 256 HOH B O   1 
HETATM 869 O  O   . HOH H 3 .  ? -11.715 2.656   0.962  1.00 44.17 ? 257 HOH B O   1 
HETATM 870 O  O   . HOH H 3 .  ? -11.069 11.743  -1.428 1.00 69.64 ? 258 HOH B O   1 
HETATM 871 O  O   . HOH H 3 .  ? -10.250 16.188  -3.766 1.00 52.41 ? 259 HOH B O   1 
HETATM 872 O  O   . HOH I 3 .  ? 0.145   0.686   19.726 1.00 17.69 ? 204 HOH C O   1 
HETATM 873 O  O   . HOH I 3 .  ? 11.204  5.204   12.237 1.00 21.25 ? 205 HOH C O   1 
HETATM 874 O  O   . HOH I 3 .  ? 3.568   10.547  10.436 1.00 18.14 ? 206 HOH C O   1 
HETATM 875 O  O   . HOH I 3 .  ? 14.105  -3.700  2.950  1.00 34.42 ? 207 HOH C O   1 
HETATM 876 O  O   . HOH I 3 .  ? 15.667  -14.472 0.792  1.00 24.55 ? 208 HOH C O   1 
HETATM 877 O  O   . HOH I 3 .  ? -22.120 10.724  20.314 1.00 41.78 ? 209 HOH C O   1 
HETATM 878 O  O   . HOH I 3 .  ? 9.106   6.569   11.562 1.00 27.08 ? 210 HOH C O   1 
HETATM 879 O  O   . HOH I 3 .  ? -11.067 17.081  21.491 1.00 22.37 ? 211 HOH C O   1 
HETATM 880 O  O   . HOH I 3 .  ? 1.816   11.479  6.152  1.00 27.37 ? 212 HOH C O   1 
HETATM 881 O  O   . HOH I 3 .  ? 15.823  -1.811  2.442  1.00 39.28 ? 213 HOH C O   1 
HETATM 882 O  O   . HOH I 3 .  ? -8.665  16.591  8.745  1.00 38.67 ? 214 HOH C O   1 
HETATM 883 O  O   . HOH I 3 .  ? 6.364   7.503   12.746 1.00 36.05 ? 215 HOH C O   1 
HETATM 884 O  O   . HOH I 3 .  ? 19.698  -7.855  2.049  1.00 30.60 ? 216 HOH C O   1 
HETATM 885 O  O   . HOH I 3 .  ? -6.418  17.897  20.606 1.00 30.90 ? 217 HOH C O   1 
HETATM 886 O  O   . HOH I 3 .  ? -10.237 3.474   18.629 1.00 24.97 ? 218 HOH C O   1 
HETATM 887 O  O   . HOH I 3 .  ? 5.646   9.914   11.934 1.00 30.08 ? 219 HOH C O   1 
HETATM 888 O  O   . HOH I 3 .  ? -8.609  9.502   21.952 1.00 41.64 ? 220 HOH C O   1 
HETATM 889 O  O   . HOH I 3 .  ? 12.927  1.112   17.026 1.00 53.49 ? 221 HOH C O   1 
HETATM 890 O  O   . HOH I 3 .  ? -21.218 7.965   18.905 1.00 43.76 ? 222 HOH C O   1 
HETATM 891 O  O   . HOH I 3 .  ? -4.827  5.009   20.509 1.00 28.75 ? 223 HOH C O   1 
HETATM 892 O  O   . HOH I 3 .  ? -3.557  20.460  19.462 1.00 30.53 ? 224 HOH C O   1 
HETATM 893 O  O   . HOH I 3 .  ? 10.731  0.078   18.824 1.00 39.69 ? 225 HOH C O   1 
HETATM 894 O  O   . HOH I 3 .  ? 8.822   -1.917  16.791 1.00 31.47 ? 226 HOH C O   1 
HETATM 895 O  O   . HOH I 3 .  ? -21.324 13.887  22.011 1.00 33.17 ? 227 HOH C O   1 
HETATM 896 O  O   . HOH I 3 .  ? -5.939  18.948  9.994  1.00 48.35 ? 228 HOH C O   1 
HETATM 897 O  O   . HOH I 3 .  ? -4.832  17.675  13.743 1.00 34.25 ? 229 HOH C O   1 
HETATM 898 O  O   . HOH I 3 .  ? -5.242  13.275  21.685 1.00 44.95 ? 230 HOH C O   1 
HETATM 899 O  O   . HOH I 3 .  ? -2.510  10.736  19.968 1.00 37.90 ? 231 HOH C O   1 
HETATM 900 O  O   . HOH I 3 .  ? -4.728  9.178   19.539 1.00 37.96 ? 232 HOH C O   1 
HETATM 901 O  O   . HOH I 3 .  ? 3.322   7.435   17.268 1.00 37.95 ? 233 HOH C O   1 
HETATM 902 O  O   . HOH I 3 .  ? 6.323   10.549  14.179 1.00 38.04 ? 234 HOH C O   1 
HETATM 903 O  O   . HOH I 3 .  ? 7.557   4.465   5.134  1.00 39.96 ? 235 HOH C O   1 
HETATM 904 O  O   . HOH I 3 .  ? 8.616   7.097   9.226  1.00 42.05 ? 236 HOH C O   1 
HETATM 905 O  O   . HOH I 3 .  ? -17.590 11.827  16.728 1.00 48.94 ? 237 HOH C O   1 
HETATM 906 O  O   . HOH I 3 .  ? 14.660  1.105   10.619 1.00 37.56 ? 238 HOH C O   1 
HETATM 907 O  O   . HOH I 3 .  ? 21.001  -4.231  13.679 1.00 44.53 ? 239 HOH C O   1 
HETATM 908 O  O   . HOH I 3 .  ? -1.367  18.930  19.700 1.00 61.09 ? 240 HOH C O   1 
HETATM 909 O  O   . HOH I 3 .  ? 11.118  3.748   1.816  1.00 57.11 ? 241 HOH C O   1 
HETATM 910 O  O   . HOH I 3 .  ? 14.228  0.719   1.745  1.00 56.64 ? 242 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ACE 1  0  0  ACE ACE A . n 
A 1 2  ARG 2  1  1  ARG ARG A . n 
A 1 3  MET 3  2  2  MET MET A . n 
A 1 4  LYS 4  3  3  LYS LYS A . n 
A 1 5  GLN 5  4  4  GLN GLN A . n 
A 1 6  LEU 6  5  5  LEU LEU A . n 
A 1 7  GLU 7  6  6  GLU GLU A . n 
A 1 8  ASP 8  7  7  ASP ASP A . n 
A 1 9  LYS 9  8  8  LYS LYS A . n 
A 1 10 VAL 10 9  9  VAL VAL A . n 
A 1 11 GLU 11 10 10 GLU GLU A . n 
A 1 12 GLU 12 11 11 GLU GLU A . n 
A 1 13 SER 13 12 12 SER SER A . n 
A 1 14 LEU 14 13 13 LEU LEU A . n 
A 1 15 SER 15 14 14 SER SER A . n 
A 1 16 LYS 16 15 15 LYS LYS A . n 
A 1 17 VAL 17 16 16 VAL VAL A . n 
A 1 18 TYR 18 17 17 TYR TYR A . n 
A 1 19 HIS 19 18 18 HIS HIS A . n 
A 1 20 LEU 20 19 19 LEU LEU A . n 
A 1 21 GLU 21 20 20 GLU GLU A . n 
A 1 22 ASN 22 21 21 ASN ASN A . n 
A 1 23 GLU 23 22 22 GLU GLU A . n 
A 1 24 VAL 24 23 23 VAL VAL A . n 
A 1 25 ALA 25 24 24 ALA ALA A . n 
A 1 26 ARG 26 25 25 ARG ARG A . n 
A 1 27 LEU 27 26 26 LEU LEU A . n 
A 1 28 LYS 28 27 27 LYS LYS A . n 
A 1 29 LYS 29 28 28 LYS LYS A . n 
A 1 30 LEU 30 29 29 LEU LEU A . n 
A 1 31 VAL 31 30 30 VAL VAL A . n 
A 1 32 GLY 32 31 31 GLY GLY A . n 
A 1 33 GLU 33 32 ?  ?   ?   A . n 
A 1 34 ARG 34 33 ?  ?   ?   A . n 
B 1 1  ACE 1  0  0  ACE ACE B . n 
B 1 2  ARG 2  1  1  ARG ARG B . n 
B 1 3  MET 3  2  2  MET MET B . n 
B 1 4  LYS 4  3  3  LYS LYS B . n 
B 1 5  GLN 5  4  4  GLN GLN B . n 
B 1 6  LEU 6  5  5  LEU LEU B . n 
B 1 7  GLU 7  6  6  GLU GLU B . n 
B 1 8  ASP 8  7  7  ASP ASP B . n 
B 1 9  LYS 9  8  8  LYS LYS B . n 
B 1 10 VAL 10 9  9  VAL VAL B . n 
B 1 11 GLU 11 10 10 GLU GLU B . n 
B 1 12 GLU 12 11 11 GLU GLU B . n 
B 1 13 SER 13 12 12 SER SER B . n 
B 1 14 LEU 14 13 13 LEU LEU B . n 
B 1 15 SER 15 14 14 SER SER B . n 
B 1 16 LYS 16 15 15 LYS LYS B . n 
B 1 17 VAL 17 16 16 VAL VAL B . n 
B 1 18 TYR 18 17 17 TYR TYR B . n 
B 1 19 HIS 19 18 18 HIS HIS B . n 
B 1 20 LEU 20 19 19 LEU LEU B . n 
B 1 21 GLU 21 20 20 GLU GLU B . n 
B 1 22 ASN 22 21 21 ASN ASN B . n 
B 1 23 GLU 23 22 22 GLU GLU B . n 
B 1 24 VAL 24 23 23 VAL VAL B . n 
B 1 25 ALA 25 24 24 ALA ALA B . n 
B 1 26 ARG 26 25 25 ARG ARG B . n 
B 1 27 LEU 27 26 26 LEU LEU B . n 
B 1 28 LYS 28 27 27 LYS LYS B . n 
B 1 29 LYS 29 28 28 LYS LYS B . n 
B 1 30 LEU 30 29 29 LEU LEU B . n 
B 1 31 VAL 31 30 30 VAL VAL B . n 
B 1 32 GLY 32 31 31 GLY GLY B . n 
B 1 33 GLU 33 32 ?  ?   ?   B . n 
B 1 34 ARG 34 33 ?  ?   ?   B . n 
C 1 1  ACE 1  0  0  ACE ACE C . n 
C 1 2  ARG 2  1  1  ARG ARG C . n 
C 1 3  MET 3  2  2  MET MET C . n 
C 1 4  LYS 4  3  3  LYS LYS C . n 
C 1 5  GLN 5  4  4  GLN GLN C . n 
C 1 6  LEU 6  5  5  LEU LEU C . n 
C 1 7  GLU 7  6  6  GLU GLU C . n 
C 1 8  ASP 8  7  7  ASP ASP C . n 
C 1 9  LYS 9  8  8  LYS LYS C . n 
C 1 10 VAL 10 9  9  VAL VAL C . n 
C 1 11 GLU 11 10 10 GLU GLU C . n 
C 1 12 GLU 12 11 11 GLU GLU C . n 
C 1 13 SER 13 12 12 SER SER C . n 
C 1 14 LEU 14 13 13 LEU LEU C . n 
C 1 15 SER 15 14 14 SER SER C . n 
C 1 16 LYS 16 15 15 LYS LYS C . n 
C 1 17 VAL 17 16 16 VAL VAL C . n 
C 1 18 TYR 18 17 17 TYR TYR C . n 
C 1 19 HIS 19 18 18 HIS HIS C . n 
C 1 20 LEU 20 19 19 LEU LEU C . n 
C 1 21 GLU 21 20 20 GLU GLU C . n 
C 1 22 ASN 22 21 21 ASN ASN C . n 
C 1 23 GLU 23 22 22 GLU GLU C . n 
C 1 24 VAL 24 23 23 VAL VAL C . n 
C 1 25 ALA 25 24 24 ALA ALA C . n 
C 1 26 ARG 26 25 25 ARG ARG C . n 
C 1 27 LEU 27 26 26 LEU LEU C . n 
C 1 28 LYS 28 27 27 LYS LYS C . n 
C 1 29 LYS 29 28 28 LYS LYS C . n 
C 1 30 LEU 30 29 29 LEU LEU C . n 
C 1 31 VAL 31 30 30 VAL VAL C . n 
C 1 32 GLY 32 31 31 GLY GLY C . n 
C 1 33 GLU 33 32 ?  ?   ?   C . n 
C 1 34 ARG 34 33 ?  ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 ZN  1  201 1   ZN  ZN  A . 
E 2 ZN  1  202 2   ZN  ZN  B . 
F 2 ZN  1  203 3   ZN  ZN  C . 
G 3 HOH 1  202 15  HOH TIP A . 
G 3 HOH 2  203 17  HOH TIP A . 
G 3 HOH 3  204 20  HOH TIP A . 
G 3 HOH 4  205 23  HOH TIP A . 
G 3 HOH 5  206 26  HOH TIP A . 
G 3 HOH 6  207 34  HOH TIP A . 
G 3 HOH 7  208 39  HOH TIP A . 
G 3 HOH 8  209 43  HOH TIP A . 
G 3 HOH 9  210 48  HOH TIP A . 
G 3 HOH 10 211 53  HOH TIP A . 
G 3 HOH 11 212 59  HOH TIP A . 
G 3 HOH 12 213 60  HOH TIP A . 
G 3 HOH 13 214 64  HOH TIP A . 
G 3 HOH 14 215 65  HOH TIP A . 
G 3 HOH 15 216 67  HOH TIP A . 
G 3 HOH 16 217 68  HOH TIP A . 
G 3 HOH 17 218 69  HOH TIP A . 
G 3 HOH 18 219 71  HOH TIP A . 
G 3 HOH 19 220 73  HOH TIP A . 
G 3 HOH 20 221 74  HOH TIP A . 
G 3 HOH 21 222 75  HOH TIP A . 
G 3 HOH 22 223 96  HOH TIP A . 
G 3 HOH 23 224 101 HOH TIP A . 
G 3 HOH 24 225 102 HOH TIP A . 
G 3 HOH 25 226 103 HOH TIP A . 
G 3 HOH 26 227 116 HOH TIP A . 
G 3 HOH 27 228 117 HOH TIP A . 
G 3 HOH 28 229 118 HOH TIP A . 
G 3 HOH 29 230 119 HOH TIP A . 
G 3 HOH 30 231 121 HOH TIP A . 
G 3 HOH 31 232 122 HOH TIP A . 
G 3 HOH 32 233 123 HOH TIP A . 
G 3 HOH 33 234 124 HOH TIP A . 
G 3 HOH 34 235 126 HOH TIP A . 
H 3 HOH 1  203 1   HOH TIP B . 
H 3 HOH 2  204 2   HOH TIP B . 
H 3 HOH 3  205 4   HOH TIP B . 
H 3 HOH 4  206 5   HOH TIP B . 
H 3 HOH 5  207 9   HOH TIP B . 
H 3 HOH 6  208 11  HOH TIP B . 
H 3 HOH 7  209 12  HOH TIP B . 
H 3 HOH 8  210 13  HOH TIP B . 
H 3 HOH 9  211 22  HOH TIP B . 
H 3 HOH 10 212 25  HOH TIP B . 
H 3 HOH 11 213 30  HOH TIP B . 
H 3 HOH 12 214 32  HOH TIP B . 
H 3 HOH 13 215 35  HOH TIP B . 
H 3 HOH 14 216 38  HOH TIP B . 
H 3 HOH 15 217 41  HOH TIP B . 
H 3 HOH 16 218 42  HOH TIP B . 
H 3 HOH 17 219 45  HOH TIP B . 
H 3 HOH 18 220 46  HOH TIP B . 
H 3 HOH 19 221 50  HOH TIP B . 
H 3 HOH 20 222 51  HOH TIP B . 
H 3 HOH 21 223 52  HOH TIP B . 
H 3 HOH 22 224 55  HOH TIP B . 
H 3 HOH 23 225 56  HOH TIP B . 
H 3 HOH 24 226 57  HOH TIP B . 
H 3 HOH 25 227 58  HOH TIP B . 
H 3 HOH 26 228 61  HOH TIP B . 
H 3 HOH 27 229 66  HOH TIP B . 
H 3 HOH 28 230 70  HOH TIP B . 
H 3 HOH 29 231 76  HOH TIP B . 
H 3 HOH 30 232 77  HOH TIP B . 
H 3 HOH 31 233 79  HOH TIP B . 
H 3 HOH 32 234 80  HOH TIP B . 
H 3 HOH 33 235 81  HOH TIP B . 
H 3 HOH 34 236 82  HOH TIP B . 
H 3 HOH 35 237 83  HOH TIP B . 
H 3 HOH 36 238 84  HOH TIP B . 
H 3 HOH 37 239 85  HOH TIP B . 
H 3 HOH 38 240 86  HOH TIP B . 
H 3 HOH 39 241 87  HOH TIP B . 
H 3 HOH 40 242 100 HOH TIP B . 
H 3 HOH 41 243 104 HOH TIP B . 
H 3 HOH 42 244 105 HOH TIP B . 
H 3 HOH 43 245 106 HOH TIP B . 
H 3 HOH 44 246 107 HOH TIP B . 
H 3 HOH 45 247 108 HOH TIP B . 
H 3 HOH 46 248 109 HOH TIP B . 
H 3 HOH 47 249 110 HOH TIP B . 
H 3 HOH 48 250 111 HOH TIP B . 
H 3 HOH 49 251 115 HOH TIP B . 
H 3 HOH 50 252 128 HOH TIP B . 
H 3 HOH 51 253 129 HOH TIP B . 
H 3 HOH 52 254 130 HOH TIP B . 
H 3 HOH 53 255 131 HOH TIP B . 
H 3 HOH 54 256 132 HOH TIP B . 
H 3 HOH 55 257 133 HOH TIP B . 
H 3 HOH 56 258 134 HOH TIP B . 
H 3 HOH 57 259 135 HOH TIP B . 
I 3 HOH 1  204 3   HOH TIP C . 
I 3 HOH 2  205 6   HOH TIP C . 
I 3 HOH 3  206 7   HOH TIP C . 
I 3 HOH 4  207 8   HOH TIP C . 
I 3 HOH 5  208 10  HOH TIP C . 
I 3 HOH 6  209 14  HOH TIP C . 
I 3 HOH 7  210 16  HOH TIP C . 
I 3 HOH 8  211 18  HOH TIP C . 
I 3 HOH 9  212 19  HOH TIP C . 
I 3 HOH 10 213 21  HOH TIP C . 
I 3 HOH 11 214 24  HOH TIP C . 
I 3 HOH 12 215 27  HOH TIP C . 
I 3 HOH 13 216 28  HOH TIP C . 
I 3 HOH 14 217 29  HOH TIP C . 
I 3 HOH 15 218 31  HOH TIP C . 
I 3 HOH 16 219 33  HOH TIP C . 
I 3 HOH 17 220 36  HOH TIP C . 
I 3 HOH 18 221 40  HOH TIP C . 
I 3 HOH 19 222 44  HOH TIP C . 
I 3 HOH 20 223 47  HOH TIP C . 
I 3 HOH 21 224 49  HOH TIP C . 
I 3 HOH 22 225 54  HOH TIP C . 
I 3 HOH 23 226 72  HOH TIP C . 
I 3 HOH 24 227 88  HOH TIP C . 
I 3 HOH 25 228 89  HOH TIP C . 
I 3 HOH 26 229 90  HOH TIP C . 
I 3 HOH 27 230 91  HOH TIP C . 
I 3 HOH 28 231 92  HOH TIP C . 
I 3 HOH 29 232 93  HOH TIP C . 
I 3 HOH 30 233 94  HOH TIP C . 
I 3 HOH 31 234 95  HOH TIP C . 
I 3 HOH 32 235 97  HOH TIP C . 
I 3 HOH 33 236 98  HOH TIP C . 
I 3 HOH 34 237 112 HOH TIP C . 
I 3 HOH 35 238 113 HOH TIP C . 
I 3 HOH 36 239 114 HOH TIP C . 
I 3 HOH 37 240 120 HOH TIP C . 
I 3 HOH 38 241 127 HOH TIP C . 
I 3 HOH 39 242 136 HOH TIP C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4570 ? 
1 MORE         -120 ? 
1 'SSA (A^2)'  6230 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 19 ? A HIS 18  ? 1_555 ZN ? D ZN . ? A ZN 201 ? 1_555 OE1 ? A GLU 23 ? A GLU 22  ? 1_555 104.9 ? 
2  NE2 ? A HIS 19 ? A HIS 18  ? 1_555 ZN ? D ZN . ? A ZN 201 ? 1_555 O   ? H HOH .  ? B HOH 230 ? 1_555 144.3 ? 
3  OE1 ? A GLU 23 ? A GLU 22  ? 1_555 ZN ? D ZN . ? A ZN 201 ? 1_555 O   ? H HOH .  ? B HOH 230 ? 1_555 95.6  ? 
4  NE2 ? A HIS 19 ? A HIS 18  ? 1_555 ZN ? D ZN . ? A ZN 201 ? 1_555 OE1 ? C GLU 11 ? C GLU 10  ? 1_545 103.7 ? 
5  OE1 ? A GLU 23 ? A GLU 22  ? 1_555 ZN ? D ZN . ? A ZN 201 ? 1_555 OE1 ? C GLU 11 ? C GLU 10  ? 1_545 98.0  ? 
6  O   ? H HOH .  ? B HOH 230 ? 1_555 ZN ? D ZN . ? A ZN 201 ? 1_555 OE1 ? C GLU 11 ? C GLU 10  ? 1_545 102.0 ? 
7  NE2 ? B HIS 19 ? B HIS 18  ? 1_555 ZN ? E ZN . ? B ZN 202 ? 1_555 OE1 ? B GLU 23 ? B GLU 22  ? 1_555 112.7 ? 
8  O   ? I HOH .  ? C HOH 225 ? 1_555 ZN ? F ZN . ? C ZN 203 ? 1_555 O   ? I HOH .  ? C HOH 221 ? 1_555 68.7  ? 
9  O   ? I HOH .  ? C HOH 225 ? 1_555 ZN ? F ZN . ? C ZN 203 ? 1_555 OE2 ? C GLU 23 ? C GLU 22  ? 1_555 119.8 ? 
10 O   ? I HOH .  ? C HOH 221 ? 1_555 ZN ? F ZN . ? C ZN 203 ? 1_555 OE2 ? C GLU 23 ? C GLU 22  ? 1_555 69.6  ? 
11 O   ? I HOH .  ? C HOH 225 ? 1_555 ZN ? F ZN . ? C ZN 203 ? 1_555 NE2 ? C HIS 19 ? C HIS 18  ? 1_555 112.8 ? 
12 O   ? I HOH .  ? C HOH 221 ? 1_555 ZN ? F ZN . ? C ZN 203 ? 1_555 NE2 ? C HIS 19 ? C HIS 18  ? 1_555 103.2 ? 
13 OE2 ? C GLU 23 ? C GLU 22  ? 1_555 ZN ? F ZN . ? C ZN 203 ? 1_555 NE2 ? C HIS 19 ? C HIS 18  ? 1_555 117.6 ? 
14 O   ? I HOH .  ? C HOH 225 ? 1_555 ZN ? F ZN . ? C ZN 203 ? 1_555 O   ? I HOH .  ? C HOH 226 ? 1_555 80.5  ? 
15 O   ? I HOH .  ? C HOH 221 ? 1_555 ZN ? F ZN . ? C ZN 203 ? 1_555 O   ? I HOH .  ? C HOH 226 ? 1_555 141.2 ? 
16 OE2 ? C GLU 23 ? C GLU 22  ? 1_555 ZN ? F ZN . ? C ZN 203 ? 1_555 O   ? I HOH .  ? C HOH 226 ? 1_555 109.2 ? 
17 NE2 ? C HIS 19 ? C HIS 18  ? 1_555 ZN ? F ZN . ? C ZN 203 ? 1_555 O   ? I HOH .  ? C HOH 226 ? 1_555 110.3 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-08-08 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing        .   ? 1 
CNS       refinement     0.5 ? 2 
SCALEPACK 'data scaling' .   ? 3 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_1             C 
_pdbx_validate_rmsd_angle.auth_comp_id_1             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_1              2 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             SD 
_pdbx_validate_rmsd_angle.auth_asym_id_2             C 
_pdbx_validate_rmsd_angle.auth_comp_id_2             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_2              2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CE 
_pdbx_validate_rmsd_angle.auth_asym_id_3             C 
_pdbx_validate_rmsd_angle.auth_comp_id_3             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_3              2 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                109.82 
_pdbx_validate_rmsd_angle.angle_target_value         100.20 
_pdbx_validate_rmsd_angle.angle_deviation            9.62 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.60 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    VAL 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     30 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -82.66 
_pdbx_validate_torsion.psi             -95.11 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLU 32 ? A GLU 33 
2 1 Y 1 A ARG 33 ? A ARG 34 
3 1 Y 1 B GLU 32 ? B GLU 33 
4 1 Y 1 B ARG 33 ? B ARG 34 
5 1 Y 1 C GLU 32 ? C GLU 33 
6 1 Y 1 C ARG 33 ? C ARG 34 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION' ZN  
3 water      HOH 
#