data_1IJ3
# 
_entry.id   1IJ3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IJ3         
RCSB  RCSB013319   
WWPDB D_1000013319 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IJ3 
_pdbx_database_status.recvd_initial_deposition_date   2001-04-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Akey, D.L.'         1 
'Malashkevich, V.N.' 2 
'Kim, P.S.'          3 
# 
_citation.id                        primary 
_citation.title                     'Buried polar residues in coiled-coil interfaces.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            40 
_citation.page_first                6352 
_citation.page_last                 6360 
_citation.year                      2001 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11371197 
_citation.pdbx_database_id_DOI      10.1021/bi002829w 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Akey, D.L.'         1 
primary 'Malashkevich, V.N.' 2 
primary 'Kim, P.S.'          3 
# 
_cell.entry_id           1IJ3 
_cell.length_a           25.564 
_cell.length_b           25.839 
_cell.length_c           34.373 
_cell.angle_alpha        86.47 
_cell.angle_beta         84.49 
_cell.angle_gamma        79.40 
_cell.Z_PDB              3 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IJ3 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 'general control protein GCN4' 4004.677 3   ? N16S 'coiled coil region' ? 
2 water   nat water                          18.015   113 ? ?    ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        GCN4-PVLS 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       '(ACE)RMKQLEDKVEELLSKSYHLENEVARLKKLVGER' 
_entity_poly.pdbx_seq_one_letter_code_can   XRMKQLEDKVEELLSKSYHLENEVARLKKLVGER 
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ACE n 
1 2  ARG n 
1 3  MET n 
1 4  LYS n 
1 5  GLN n 
1 6  LEU n 
1 7  GLU n 
1 8  ASP n 
1 9  LYS n 
1 10 VAL n 
1 11 GLU n 
1 12 GLU n 
1 13 LEU n 
1 14 LEU n 
1 15 SER n 
1 16 LYS n 
1 17 SER n 
1 18 TYR n 
1 19 HIS n 
1 20 LEU n 
1 21 GLU n 
1 22 ASN n 
1 23 GLU n 
1 24 VAL n 
1 25 ALA n 
1 26 ARG n 
1 27 LEU n 
1 28 LYS n 
1 29 LYS n 
1 30 LEU n 
1 31 VAL n 
1 32 GLY n 
1 33 GLU n 
1 34 ARG n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
;THIS PROTEIN WAS CHEMICALLY SYNTHESIZED. IT IS NATURALLY FOUND IN SACCHAROMYCES CEREVISIAE (YEAST). The Peptide is a variant of the yeast GCN4 coiled coil region made by solid phase synthesis.
;
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GCN4_YEAST 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   RMKQLEDKVEELLSKNYHLENEVARLKKLVGER 
_struct_ref.pdbx_align_begin           249 
_struct_ref.pdbx_db_accession          P03069 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1IJ3 A 2 ? 34 ? P03069 249 ? 281 ? 1 33 
2 1 1IJ3 B 2 ? 34 ? P03069 249 ? 281 ? 1 33 
3 1 1IJ3 C 2 ? 34 ? P03069 249 ? 281 ? 1 33 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1IJ3 SER A 17 ? UNP P03069 ASN 264 ENGINEERED 16 1 
2 1IJ3 SER B 17 ? UNP P03069 ASN 264 ENGINEERED 16 2 
3 1IJ3 SER C 17 ? UNP P03069 ASN 264 ENGINEERED 16 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'  ? 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1IJ3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.85 
_exptl_crystal.density_percent_sol   33.43 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'0.1 M MES, 50 mM cesium chloride, 10% PEG 20000, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.2830 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.2830 
# 
_reflns.entry_id                     1IJ3 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   -3.0 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            1.80 
_reflns.number_obs                   7378 
_reflns.number_all                   7965 
_reflns.percent_possible_obs         92.6 
_reflns.pdbx_Rmerge_I_obs            0.0590000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.1 
_reflns.B_iso_Wilson_estimate        24.7 
_reflns.pdbx_redundancy              1.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.8 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   90.0 
_reflns_shell.Rmerge_I_obs           0.1800000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.5 
_reflns_shell.pdbx_redundancy        1.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1IJ3 
_refine.ls_number_reflns_obs                     7378 
_refine.ls_number_reflns_all                     7965 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               336619.33 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            1.80 
_refine.ls_percent_reflns_obs                    92.4 
_refine.ls_R_factor_obs                          0.2200000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2200000 
_refine.ls_R_factor_R_free                       0.2690000 
_refine.ls_R_factor_R_free_error                 0.010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.7 
_refine.ls_number_reflns_R_free                  719 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               31.7 
_refine.aniso_B[1][1]                            0.58 
_refine.aniso_B[2][2]                            -1.31 
_refine.aniso_B[3][3]                            0.73 
_refine.aniso_B[1][2]                            0.78 
_refine.aniso_B[1][3]                            3.10 
_refine.aniso_B[2][3]                            -4.23 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.626 
_refine.solvent_model_param_bsol                 188.4 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1IJ3 
_refine_analyze.Luzzati_coordinate_error_obs    0.22 
_refine_analyze.Luzzati_sigma_a_obs             0.16 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.28 
_refine_analyze.Luzzati_sigma_a_free            0.18 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        805 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             113 
_refine_hist.number_atoms_total               918 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      15.3  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.90  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.86 
_refine_ls_shell.number_reflns_R_work             615 
_refine_ls_shell.R_factor_R_work                  0.3700000 
_refine_ls_shell.percent_reflns_obs               90.0 
_refine_ls_shell.R_factor_R_free                  0.3920000 
_refine_ls_shell.R_factor_R_free_error            0.041 
_refine_ls_shell.percent_reflns_R_free            12.8 
_refine_ls_shell.number_reflns_R_free             90 
_refine_ls_shell.number_reflns_obs                622 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
3 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1IJ3 
_struct.title                     'GCN4-pVSL Coiled-coil trimer with Serine at the a(16) position' 
_struct.pdbx_descriptor           'general control protein GCN4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IJ3 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'GCN4 coiled coil, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 2 ? LYS A 28 ? ARG A 1 LYS A 27 1 ? 27 
HELX_P HELX_P2 2 ARG B 2 ? VAL B 31 ? ARG B 1 VAL B 30 1 ? 30 
HELX_P HELX_P3 3 ARG C 2 ? GLY C 32 ? ARG C 1 GLY C 31 1 ? 31 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A ACE 1 C ? ? ? 1_555 A ARG 2 N ? ? A ACE 0 A ARG 1 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2 covale ? ? B ACE 1 C ? ? ? 1_555 B ARG 2 N ? ? B ACE 0 B ARG 1 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale3 covale ? ? C ACE 1 C ? ? ? 1_555 C ARG 2 N ? ? C ACE 0 C ARG 1 1_555 ? ? ? ? ? ? ? 1.331 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1IJ3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IJ3 
_atom_sites.fract_transf_matrix[1][1]   0.039118 
_atom_sites.fract_transf_matrix[1][2]   -0.007321 
_atom_sites.fract_transf_matrix[1][3]   -0.003448 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.039373 
_atom_sites.fract_transf_matrix[2][3]   -0.001769 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.029257 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1   C C   . ACE A 1 1  ? -15.004 13.914  9.942   1.00 45.95 ? 0  ACE A C   1 
HETATM 2   O O   . ACE A 1 1  ? -14.020 13.963  10.677  1.00 46.38 ? 0  ACE A O   1 
HETATM 3   C CH3 . ACE A 1 1  ? -15.145 14.875  8.799   1.00 46.48 ? 0  ACE A CH3 1 
ATOM   4   N N   . ARG A 1 2  ? -15.984 13.029  10.094  1.00 46.16 ? 1  ARG A N   1 
ATOM   5   C CA  . ARG A 1 2  ? -15.996 12.035  11.159  1.00 44.62 ? 1  ARG A CA  1 
ATOM   6   C C   . ARG A 1 2  ? -14.774 11.130  11.184  1.00 41.80 ? 1  ARG A C   1 
ATOM   7   O O   . ARG A 1 2  ? -14.142 10.857  10.161  1.00 43.24 ? 1  ARG A O   1 
ATOM   8   C CB  . ARG A 1 2  ? -17.266 11.195  11.062  1.00 47.93 ? 1  ARG A CB  1 
ATOM   9   C CG  . ARG A 1 2  ? -17.510 10.618  9.678   1.00 52.06 ? 1  ARG A CG  1 
ATOM   10  C CD  . ARG A 1 2  ? -18.975 10.293  9.508   1.00 54.38 ? 1  ARG A CD  1 
ATOM   11  N NE  . ARG A 1 2  ? -19.326 10.076  8.111   1.00 58.53 ? 1  ARG A NE  1 
ATOM   12  C CZ  . ARG A 1 2  ? -20.572 10.108  7.649   1.00 60.41 ? 1  ARG A CZ  1 
ATOM   13  N NH1 . ARG A 1 2  ? -21.580 10.347  8.476   1.00 62.13 ? 1  ARG A NH1 1 
ATOM   14  N NH2 . ARG A 1 2  ? -20.810 9.913   6.361   1.00 62.37 ? 1  ARG A NH2 1 
ATOM   15  N N   . MET A 1 3  ? -14.451 10.685  12.389  1.00 38.75 ? 2  MET A N   1 
ATOM   16  C CA  . MET A 1 3  ? -13.322 9.807   12.626  1.00 35.17 ? 2  MET A CA  1 
ATOM   17  C C   . MET A 1 3  ? -13.625 8.464   11.983  1.00 31.94 ? 2  MET A C   1 
ATOM   18  O O   . MET A 1 3  ? -12.738 7.813   11.426  1.00 26.08 ? 2  MET A O   1 
ATOM   19  C CB  . MET A 1 3  ? -13.125 9.620   14.136  1.00 37.39 ? 2  MET A CB  1 
ATOM   20  C CG  . MET A 1 3  ? -11.884 8.823   14.528  1.00 39.34 ? 2  MET A CG  1 
ATOM   21  S SD  . MET A 1 3  ? -10.376 9.742   14.365  1.00 44.86 ? 2  MET A SD  1 
ATOM   22  C CE  . MET A 1 3  ? -10.307 10.134  12.615  1.00 45.56 ? 2  MET A CE  1 
ATOM   23  N N   . LYS A 1 4  ? -14.896 8.069   12.073  1.00 30.10 ? 3  LYS A N   1 
ATOM   24  C CA  . LYS A 1 4  ? -15.399 6.806   11.521  1.00 31.52 ? 3  LYS A CA  1 
ATOM   25  C C   . LYS A 1 4  ? -15.028 6.688   10.036  1.00 28.93 ? 3  LYS A C   1 
ATOM   26  O O   . LYS A 1 4  ? -14.593 5.646   9.557   1.00 29.30 ? 3  LYS A O   1 
ATOM   27  C CB  . LYS A 1 4  ? -16.923 6.771   11.700  1.00 34.07 ? 3  LYS A CB  1 
ATOM   28  C CG  . LYS A 1 4  ? -17.553 5.395   11.695  1.00 40.25 ? 3  LYS A CG  1 
ATOM   29  C CD  . LYS A 1 4  ? -17.116 4.627   12.917  1.00 41.05 ? 3  LYS A CD  1 
ATOM   30  C CE  . LYS A 1 4  ? -17.988 3.415   13.180  1.00 43.75 ? 3  LYS A CE  1 
ATOM   31  N NZ  . LYS A 1 4  ? -19.389 3.747   13.532  1.00 47.10 ? 3  LYS A NZ  1 
ATOM   32  N N   . GLN A 1 5  ? -15.198 7.797   9.328   1.00 27.41 ? 4  GLN A N   1 
ATOM   33  C CA  . GLN A 1 5  ? -14.882 7.926   7.908   1.00 26.80 ? 4  GLN A CA  1 
ATOM   34  C C   . GLN A 1 5  ? -13.426 7.501   7.649   1.00 25.18 ? 4  GLN A C   1 
ATOM   35  O O   . GLN A 1 5  ? -13.123 6.717   6.742   1.00 22.86 ? 4  GLN A O   1 
ATOM   36  C CB  . GLN A 1 5  ? -15.053 9.388   7.548   1.00 32.49 ? 4  GLN A CB  1 
ATOM   37  C CG  . GLN A 1 5  ? -14.946 9.776   6.100   1.00 36.48 ? 4  GLN A CG  1 
ATOM   38  C CD  . GLN A 1 5  ? -15.046 11.294  5.964   1.00 38.84 ? 4  GLN A CD  1 
ATOM   39  O OE1 . GLN A 1 5  ? -15.617 11.794  5.002   1.00 42.40 ? 4  GLN A OE1 1 
ATOM   40  N NE2 . GLN A 1 5  ? -14.486 12.021  6.917   1.00 37.56 ? 4  GLN A NE2 1 
ATOM   41  N N   . LEU A 1 6  ? -12.524 8.044   8.457   1.00 22.43 ? 5  LEU A N   1 
ATOM   42  C CA  . LEU A 1 6  ? -11.121 7.721   8.308   1.00 22.12 ? 5  LEU A CA  1 
ATOM   43  C C   . LEU A 1 6  ? -10.819 6.301   8.720   1.00 19.17 ? 5  LEU A C   1 
ATOM   44  O O   . LEU A 1 6  ? -9.956  5.649   8.144   1.00 19.43 ? 5  LEU A O   1 
ATOM   45  C CB  . LEU A 1 6  ? -10.283 8.680   9.153   1.00 26.72 ? 5  LEU A CB  1 
ATOM   46  C CG  . LEU A 1 6  ? -10.053 10.082  8.613   1.00 28.57 ? 5  LEU A CG  1 
ATOM   47  C CD1 . LEU A 1 6  ? -9.276  10.925  9.625   1.00 30.60 ? 5  LEU A CD1 1 
ATOM   48  C CD2 . LEU A 1 6  ? -9.284  9.971   7.305   1.00 30.99 ? 5  LEU A CD2 1 
ATOM   49  N N   . GLU A 1 7  ? -11.507 5.823   9.747   1.00 18.68 ? 6  GLU A N   1 
ATOM   50  C CA  . GLU A 1 7  ? -11.261 4.475   10.219  1.00 21.98 ? 6  GLU A CA  1 
ATOM   51  C C   . GLU A 1 7  ? -11.609 3.477   9.119   1.00 22.03 ? 6  GLU A C   1 
ATOM   52  O O   . GLU A 1 7  ? -10.875 2.508   8.910   1.00 20.23 ? 6  GLU A O   1 
ATOM   53  C CB  . GLU A 1 7  ? -12.064 4.209   11.502  1.00 23.94 ? 6  GLU A CB  1 
ATOM   54  C CG  . GLU A 1 7  ? -11.718 5.217   12.613  1.00 33.70 ? 6  GLU A CG  1 
ATOM   55  C CD  . GLU A 1 7  ? -12.646 5.151   13.816  1.00 36.94 ? 6  GLU A CD  1 
ATOM   56  O OE1 . GLU A 1 7  ? -12.149 4.997   14.952  1.00 40.28 ? 6  GLU A OE1 1 
ATOM   57  O OE2 . GLU A 1 7  ? -13.875 5.268   13.630  1.00 40.88 ? 6  GLU A OE2 1 
ATOM   58  N N   . ASP A 1 8  ? -12.696 3.730   8.389   1.00 19.33 ? 7  ASP A N   1 
ATOM   59  C CA  . ASP A 1 8  ? -13.084 2.815   7.301   1.00 20.68 ? 7  ASP A CA  1 
ATOM   60  C C   . ASP A 1 8  ? -12.065 2.817   6.159   1.00 19.19 ? 7  ASP A C   1 
ATOM   61  O O   . ASP A 1 8  ? -11.755 1.766   5.588   1.00 16.04 ? 7  ASP A O   1 
ATOM   62  C CB  . ASP A 1 8  ? -14.459 3.164   6.734   1.00 21.78 ? 7  ASP A CB  1 
ATOM   63  C CG  . ASP A 1 8  ? -15.585 3.015   7.764   1.00 32.00 ? 7  ASP A CG  1 
ATOM   64  O OD1 . ASP A 1 8  ? -15.492 2.126   8.658   1.00 33.29 ? 7  ASP A OD1 1 
ATOM   65  O OD2 . ASP A 1 8  ? -16.576 3.774   7.656   1.00 34.13 ? 7  ASP A OD2 1 
ATOM   66  N N   . LYS A 1 9  ? -11.557 4.001   5.824   1.00 15.57 ? 8  LYS A N   1 
ATOM   67  C CA  . LYS A 1 9  ? -10.564 4.123   4.763   1.00 16.09 ? 8  LYS A CA  1 
ATOM   68  C C   . LYS A 1 9  ? -9.281  3.417   5.178   1.00 12.08 ? 8  LYS A C   1 
ATOM   69  O O   . LYS A 1 9  ? -8.641  2.786   4.372   1.00 11.95 ? 8  LYS A O   1 
ATOM   70  C CB  . LYS A 1 9  ? -10.255 5.593   4.432   1.00 17.93 ? 8  LYS A CB  1 
ATOM   71  C CG  . LYS A 1 9  ? -11.330 6.345   3.606   1.00 24.40 ? 8  LYS A CG  1 
ATOM   72  C CD  . LYS A 1 9  ? -10.876 7.782   3.306   1.00 28.69 ? 8  LYS A CD  1 
ATOM   73  C CE  . LYS A 1 9  ? -11.808 8.503   2.331   1.00 31.07 ? 8  LYS A CE  1 
ATOM   74  N NZ  . LYS A 1 9  ? -13.225 8.523   2.797   1.00 32.25 ? 8  LYS A NZ  1 
ATOM   75  N N   . VAL A 1 10 ? -8.896  3.543   6.430   1.00 10.31 ? 9  VAL A N   1 
ATOM   76  C CA  . VAL A 1 10 ? -7.677  2.878   6.878   1.00 12.08 ? 9  VAL A CA  1 
ATOM   77  C C   . VAL A 1 10 ? -7.849  1.367   6.900   1.00 13.26 ? 9  VAL A C   1 
ATOM   78  O O   . VAL A 1 10 ? -6.931  0.637   6.567   1.00 14.10 ? 9  VAL A O   1 
ATOM   79  C CB  . VAL A 1 10 ? -7.267  3.421   8.251   1.00 12.54 ? 9  VAL A CB  1 
ATOM   80  C CG1 . VAL A 1 10 ? -6.149  2.554   8.881   1.00 12.65 ? 9  VAL A CG1 1 
ATOM   81  C CG2 . VAL A 1 10 ? -6.789  4.872   8.056   1.00 11.88 ? 9  VAL A CG2 1 
ATOM   82  N N   . GLU A 1 11 ? -9.038  0.895   7.277   1.00 15.28 ? 10 GLU A N   1 
ATOM   83  C CA  . GLU A 1 11 ? -9.300  -0.553  7.285   1.00 16.37 ? 10 GLU A CA  1 
ATOM   84  C C   . GLU A 1 11 ? -9.162  -1.075  5.843   1.00 14.52 ? 10 GLU A C   1 
ATOM   85  O O   . GLU A 1 11 ? -8.547  -2.119  5.586   1.00 14.94 ? 10 GLU A O   1 
ATOM   86  C CB  . GLU A 1 11 ? -10.708 -0.818  7.838   1.00 17.22 ? 10 GLU A CB  1 
ATOM   87  C CG  . GLU A 1 11 ? -10.889 -0.332  9.262   1.00 23.44 ? 10 GLU A CG  1 
ATOM   88  C CD  . GLU A 1 11 ? -12.302 -0.526  9.777   0.00 21.75 ? 10 GLU A CD  1 
ATOM   89  O OE1 . GLU A 1 11 ? -12.785 -1.677  9.786   0.00 22.39 ? 10 GLU A OE1 1 
ATOM   90  O OE2 . GLU A 1 11 ? -12.929 0.478   10.177  0.00 22.39 ? 10 GLU A OE2 1 
ATOM   91  N N   . GLU A 1 12 ? -9.714  -0.342  4.889   1.00 14.61 ? 11 GLU A N   1 
ATOM   92  C CA  . GLU A 1 12 ? -9.582  -0.726  3.494   1.00 16.95 ? 11 GLU A CA  1 
ATOM   93  C C   . GLU A 1 12 ? -8.096  -0.723  3.059   1.00 13.37 ? 11 GLU A C   1 
ATOM   94  O O   . GLU A 1 12 ? -7.646  -1.632  2.365   1.00 12.17 ? 11 GLU A O   1 
ATOM   95  C CB  . GLU A 1 12 ? -10.384 0.236   2.614   1.00 20.98 ? 11 GLU A CB  1 
ATOM   96  C CG  . GLU A 1 12 ? -10.024 0.232   1.120   1.00 30.10 ? 11 GLU A CG  1 
ATOM   97  C CD  . GLU A 1 12 ? -10.612 -0.917  0.311   1.00 38.05 ? 11 GLU A CD  1 
ATOM   98  O OE1 . GLU A 1 12 ? -10.457 -2.104  0.687   1.00 40.62 ? 11 GLU A OE1 1 
ATOM   99  O OE2 . GLU A 1 12 ? -11.222 -0.621  -0.738  1.00 43.63 ? 11 GLU A OE2 1 
ATOM   100 N N   . LEU A 1 13 ? -7.341  0.294   3.470   1.00 12.38 ? 12 LEU A N   1 
ATOM   101 C CA  . LEU A 1 13 ? -5.919  0.390   3.100   1.00 10.99 ? 12 LEU A CA  1 
ATOM   102 C C   . LEU A 1 13 ? -5.077  -0.770  3.671   1.00 13.24 ? 12 LEU A C   1 
ATOM   103 O O   . LEU A 1 13 ? -4.111  -1.223  3.040   1.00 11.37 ? 12 LEU A O   1 
ATOM   104 C CB  . LEU A 1 13 ? -5.353  1.750   3.553   1.00 14.35 ? 12 LEU A CB  1 
ATOM   105 C CG  . LEU A 1 13 ? -5.663  2.966   2.657   1.00 18.75 ? 12 LEU A CG  1 
ATOM   106 C CD1 . LEU A 1 13 ? -5.306  4.259   3.399   1.00 16.99 ? 12 LEU A CD1 1 
ATOM   107 C CD2 . LEU A 1 13 ? -4.864  2.863   1.319   1.00 17.08 ? 12 LEU A CD2 1 
ATOM   108 N N   . LEU A 1 14 ? -5.427  -1.240  4.868   1.00 13.38 ? 13 LEU A N   1 
ATOM   109 C CA  . LEU A 1 14 ? -4.696  -2.364  5.456   1.00 14.07 ? 13 LEU A CA  1 
ATOM   110 C C   . LEU A 1 14 ? -5.018  -3.631  4.667   1.00 13.16 ? 13 LEU A C   1 
ATOM   111 O O   . LEU A 1 14 ? -4.138  -4.453  4.399   1.00 15.21 ? 13 LEU A O   1 
ATOM   112 C CB  . LEU A 1 14 ? -5.072  -2.535  6.935   1.00 14.45 ? 13 LEU A CB  1 
ATOM   113 C CG  . LEU A 1 14 ? -4.525  -1.481  7.898   1.00 18.65 ? 13 LEU A CG  1 
ATOM   114 C CD1 . LEU A 1 14 ? -5.271  -1.559  9.207   1.00 16.07 ? 13 LEU A CD1 1 
ATOM   115 C CD2 . LEU A 1 14 ? -3.028  -1.669  8.121   1.00 18.36 ? 13 LEU A CD2 1 
ATOM   116 N N   . SER A 1 15 ? -6.270  -3.795  4.257   1.00 13.41 ? 14 SER A N   1 
ATOM   117 C CA  . SER A 1 15 ? -6.594  -4.985  3.471   1.00 14.66 ? 14 SER A CA  1 
ATOM   118 C C   . SER A 1 15 ? -5.917  -4.931  2.099   1.00 17.11 ? 14 SER A C   1 
ATOM   119 O O   . SER A 1 15 ? -5.391  -5.941  1.619   1.00 16.14 ? 14 SER A O   1 
ATOM   120 C CB  . SER A 1 15 ? -8.099  -5.140  3.288   1.00 18.75 ? 14 SER A CB  1 
ATOM   121 O OG  . SER A 1 15 ? -8.715  -5.298  4.547   1.00 26.58 ? 14 SER A OG  1 
ATOM   122 N N   . LYS A 1 16 ? -5.923  -3.755  1.471   1.00 14.69 ? 15 LYS A N   1 
ATOM   123 C CA  . LYS A 1 16 ? -5.296  -3.598  0.174   1.00 17.49 ? 15 LYS A CA  1 
ATOM   124 C C   . LYS A 1 16 ? -3.797  -3.911  0.262   1.00 14.84 ? 15 LYS A C   1 
ATOM   125 O O   . LYS A 1 16 ? -3.227  -4.543  -0.639  1.00 15.18 ? 15 LYS A O   1 
ATOM   126 C CB  . LYS A 1 16 ? -5.504  -2.159  -0.336  1.00 22.05 ? 15 LYS A CB  1 
ATOM   127 C CG  . LYS A 1 16 ? -6.958  -1.767  -0.617  1.00 27.31 ? 15 LYS A CG  1 
ATOM   128 C CD  . LYS A 1 16 ? -7.176  -0.259  -0.451  1.00 31.86 ? 15 LYS A CD  1 
ATOM   129 C CE  . LYS A 1 16 ? -6.406  0.589   -1.455  1.00 36.41 ? 15 LYS A CE  1 
ATOM   130 N NZ  . LYS A 1 16 ? -7.006  0.547   -2.822  1.00 42.02 ? 15 LYS A NZ  1 
ATOM   131 N N   . SER A 1 17 ? -3.177  -3.486  1.357   1.00 12.25 ? 16 SER A N   1 
ATOM   132 C CA  . SER A 1 17 ? -1.737  -3.669  1.563   1.00 13.88 ? 16 SER A CA  1 
ATOM   133 C C   . SER A 1 17 ? -1.393  -5.146  1.716   1.00 15.85 ? 16 SER A C   1 
ATOM   134 O O   . SER A 1 17 ? -0.405  -5.619  1.150   1.00 14.10 ? 16 SER A O   1 
ATOM   135 C CB  . SER A 1 17 ? -1.293  -2.880  2.804   1.00 13.95 ? 16 SER A CB  1 
ATOM   136 O OG  . SER A 1 17 ? 0.113   -2.875  2.938   1.00 22.03 ? 16 SER A OG  1 
ATOM   137 N N   . TYR A 1 18 ? -2.216  -5.855  2.491   1.00 14.04 ? 17 TYR A N   1 
ATOM   138 C CA  . TYR A 1 18 ? -2.052  -7.287  2.714   1.00 15.95 ? 17 TYR A CA  1 
ATOM   139 C C   . TYR A 1 18 ? -2.121  -8.007  1.373   1.00 14.69 ? 17 TYR A C   1 
ATOM   140 O O   . TYR A 1 18 ? -1.255  -8.832  1.077   1.00 13.66 ? 17 TYR A O   1 
ATOM   141 C CB  . TYR A 1 18 ? -3.158  -7.810  3.628   1.00 15.15 ? 17 TYR A CB  1 
ATOM   142 C CG  . TYR A 1 18 ? -3.161  -9.315  3.750   1.00 20.00 ? 17 TYR A CG  1 
ATOM   143 C CD1 . TYR A 1 18 ? -2.147  -9.984  4.437   1.00 20.92 ? 17 TYR A CD1 1 
ATOM   144 C CD2 . TYR A 1 18 ? -4.126  -10.080 3.096   1.00 19.37 ? 17 TYR A CD2 1 
ATOM   145 C CE1 . TYR A 1 18 ? -2.094  -11.389 4.453   1.00 18.48 ? 17 TYR A CE1 1 
ATOM   146 C CE2 . TYR A 1 18 ? -4.069  -11.481 3.114   1.00 17.92 ? 17 TYR A CE2 1 
ATOM   147 C CZ  . TYR A 1 18 ? -3.062  -12.119 3.779   1.00 18.42 ? 17 TYR A CZ  1 
ATOM   148 O OH  . TYR A 1 18 ? -2.994  -13.508 3.744   1.00 23.97 ? 17 TYR A OH  1 
ATOM   149 N N   . HIS A 1 19 ? -3.156  -7.709  0.575   1.00 12.00 ? 18 HIS A N   1 
ATOM   150 C CA  . HIS A 1 19 ? -3.312  -8.311  -0.757  1.00 16.17 ? 18 HIS A CA  1 
ATOM   151 C C   . HIS A 1 19 ? -2.131  -8.014  -1.701  1.00 15.80 ? 18 HIS A C   1 
ATOM   152 O O   . HIS A 1 19 ? -1.663  -8.908  -2.426  1.00 14.27 ? 18 HIS A O   1 
ATOM   153 C CB  . HIS A 1 19 ? -4.601  -7.831  -1.442  1.00 19.23 ? 18 HIS A CB  1 
ATOM   154 C CG  . HIS A 1 19 ? -4.732  -8.308  -2.859  1.00 29.16 ? 18 HIS A CG  1 
ATOM   155 N ND1 . HIS A 1 19 ? -5.104  -9.596  -3.184  1.00 31.34 ? 18 HIS A ND1 1 
ATOM   156 C CD2 . HIS A 1 19 ? -4.429  -7.701  -4.032  1.00 32.44 ? 18 HIS A CD2 1 
ATOM   157 C CE1 . HIS A 1 19 ? -5.027  -9.760  -4.492  1.00 33.09 ? 18 HIS A CE1 1 
ATOM   158 N NE2 . HIS A 1 19 ? -4.618  -8.622  -5.030  1.00 34.01 ? 18 HIS A NE2 1 
ATOM   159 N N   . LEU A 1 20 ? -1.663  -6.766  -1.696  1.00 14.55 ? 19 LEU A N   1 
ATOM   160 C CA  . LEU A 1 20 ? -0.549  -6.352  -2.553  1.00 17.97 ? 19 LEU A CA  1 
ATOM   161 C C   . LEU A 1 20 ? 0.717   -7.103  -2.192  1.00 16.00 ? 19 LEU A C   1 
ATOM   162 O O   . LEU A 1 20 ? 1.478   -7.538  -3.076  1.00 16.58 ? 19 LEU A O   1 
ATOM   163 C CB  . LEU A 1 20 ? -0.315  -4.842  -2.423  1.00 19.86 ? 19 LEU A CB  1 
ATOM   164 C CG  . LEU A 1 20 ? -1.371  -3.955  -3.097  1.00 26.37 ? 19 LEU A CG  1 
ATOM   165 C CD1 . LEU A 1 20 ? -1.224  -2.523  -2.613  1.00 28.80 ? 19 LEU A CD1 1 
ATOM   166 C CD2 . LEU A 1 20 ? -1.220  -4.045  -4.610  1.00 30.26 ? 19 LEU A CD2 1 
ATOM   167 N N   . GLU A 1 21 ? 0.933   -7.264  -0.892  1.00 16.26 ? 20 GLU A N   1 
ATOM   168 C CA  . GLU A 1 21 ? 2.098   -7.999  -0.398  1.00 22.43 ? 20 GLU A CA  1 
ATOM   169 C C   . GLU A 1 21 ? 2.100   -9.420  -0.938  1.00 21.07 ? 20 GLU A C   1 
ATOM   170 O O   . GLU A 1 21 ? 3.141   -9.910  -1.356  1.00 19.77 ? 20 GLU A O   1 
ATOM   171 C CB  . GLU A 1 21 ? 2.093   -8.055  1.125   1.00 27.47 ? 20 GLU A CB  1 
ATOM   172 C CG  . GLU A 1 21 ? 3.189   -7.261  1.769   1.00 35.75 ? 20 GLU A CG  1 
ATOM   173 C CD  . GLU A 1 21 ? 2.688   -6.530  2.986   1.00 40.80 ? 20 GLU A CD  1 
ATOM   174 O OE1 . GLU A 1 21 ? 2.051   -7.181  3.847   1.00 42.35 ? 20 GLU A OE1 1 
ATOM   175 O OE2 . GLU A 1 21 ? 2.928   -5.304  3.079   1.00 44.41 ? 20 GLU A OE2 1 
ATOM   176 N N   . ASN A 1 22 ? 0.942   -10.078 -0.926  1.00 18.71 ? 21 ASN A N   1 
ATOM   177 C CA  . ASN A 1 22 ? 0.852   -11.448 -1.438  1.00 20.79 ? 21 ASN A CA  1 
ATOM   178 C C   . ASN A 1 22 ? 1.071   -11.506 -2.951  1.00 21.22 ? 21 ASN A C   1 
ATOM   179 O O   . ASN A 1 22 ? 1.658   -12.454 -3.476  1.00 19.34 ? 21 ASN A O   1 
ATOM   180 C CB  . ASN A 1 22 ? -0.504  -12.070 -1.095  1.00 23.64 ? 21 ASN A CB  1 
ATOM   181 C CG  . ASN A 1 22 ? -0.702  -12.234 0.392   1.00 27.63 ? 21 ASN A CG  1 
ATOM   182 O OD1 . ASN A 1 22 ? 0.228   -12.608 1.110   1.00 31.93 ? 21 ASN A OD1 1 
ATOM   183 N ND2 . ASN A 1 22 ? -1.919  -11.979 0.865   1.00 27.97 ? 21 ASN A ND2 1 
ATOM   184 N N   . GLU A 1 23 ? 0.591   -10.491 -3.648  1.00 19.01 ? 22 GLU A N   1 
ATOM   185 C CA  . GLU A 1 23 ? 0.754   -10.415 -5.093  1.00 24.00 ? 22 GLU A CA  1 
ATOM   186 C C   . GLU A 1 23 ? 2.234   -10.253 -5.435  1.00 22.55 ? 22 GLU A C   1 
ATOM   187 O O   . GLU A 1 23 ? 2.744   -10.896 -6.362  1.00 22.26 ? 22 GLU A O   1 
ATOM   188 C CB  . GLU A 1 23 ? -0.033  -9.221  -5.641  1.00 28.52 ? 22 GLU A CB  1 
ATOM   189 C CG  . GLU A 1 23 ? -1.501  -9.484  -5.873  1.00 36.01 ? 22 GLU A CG  1 
ATOM   190 C CD  . GLU A 1 23 ? -1.787  -9.830  -7.321  1.00 41.67 ? 22 GLU A CD  1 
ATOM   191 O OE1 . GLU A 1 23 ? -1.682  -8.923  -8.173  1.00 47.16 ? 22 GLU A OE1 1 
ATOM   192 O OE2 . GLU A 1 23 ? -2.100  -11.003 -7.617  1.00 46.19 ? 22 GLU A OE2 1 
ATOM   193 N N   . VAL A 1 24 ? 2.924   -9.419  -4.666  1.00 23.26 ? 23 VAL A N   1 
ATOM   194 C CA  . VAL A 1 24 ? 4.345   -9.169  -4.889  1.00 26.08 ? 23 VAL A CA  1 
ATOM   195 C C   . VAL A 1 24 ? 5.148   -10.454 -4.665  1.00 27.76 ? 23 VAL A C   1 
ATOM   196 O O   . VAL A 1 24 ? 6.121   -10.721 -5.384  1.00 26.71 ? 23 VAL A O   1 
ATOM   197 C CB  . VAL A 1 24 ? 4.856   -8.043  -3.962  1.00 27.28 ? 23 VAL A CB  1 
ATOM   198 C CG1 . VAL A 1 24 ? 6.365   -7.871  -4.114  1.00 28.55 ? 23 VAL A CG1 1 
ATOM   199 C CG2 . VAL A 1 24 ? 4.154   -6.733  -4.313  1.00 29.07 ? 23 VAL A CG2 1 
ATOM   200 N N   . ALA A 1 25 ? 4.715   -11.245 -3.682  1.00 28.06 ? 24 ALA A N   1 
ATOM   201 C CA  . ALA A 1 25 ? 5.337   -12.529 -3.333  1.00 28.55 ? 24 ALA A CA  1 
ATOM   202 C C   . ALA A 1 25 ? 5.119   -13.571 -4.435  1.00 28.67 ? 24 ALA A C   1 
ATOM   203 O O   . ALA A 1 25 ? 6.021   -14.348 -4.750  1.00 27.88 ? 24 ALA A O   1 
ATOM   204 C CB  . ALA A 1 25 ? 4.756   -13.052 -1.998  1.00 28.92 ? 24 ALA A CB  1 
ATOM   205 N N   . ARG A 1 26 ? 3.914   -13.594 -5.002  1.00 29.86 ? 25 ARG A N   1 
ATOM   206 C CA  . ARG A 1 26 ? 3.582   -14.522 -6.081  1.00 32.59 ? 25 ARG A CA  1 
ATOM   207 C C   . ARG A 1 26 ? 4.394   -14.164 -7.316  1.00 34.85 ? 25 ARG A C   1 
ATOM   208 O O   . ARG A 1 26 ? 4.898   -15.038 -8.041  1.00 33.51 ? 25 ARG A O   1 
ATOM   209 C CB  . ARG A 1 26 ? 2.092   -14.447 -6.422  1.00 35.15 ? 25 ARG A CB  1 
ATOM   210 C CG  . ARG A 1 26 ? 1.134   -15.092 -5.418  1.00 41.07 ? 25 ARG A CG  1 
ATOM   211 C CD  . ARG A 1 26 ? -0.305  -14.835 -5.845  1.00 44.87 ? 25 ARG A CD  1 
ATOM   212 N NE  . ARG A 1 26 ? -1.300  -15.423 -4.946  1.00 50.31 ? 25 ARG A NE  1 
ATOM   213 C CZ  . ARG A 1 26 ? -1.618  -16.721 -4.882  1.00 51.70 ? 25 ARG A CZ  1 
ATOM   214 N NH1 . ARG A 1 26 ? -1.042  -17.612 -5.666  1.00 54.17 ? 25 ARG A NH1 1 
ATOM   215 N NH2 . ARG A 1 26 ? -2.546  -17.130 -4.035  1.00 53.86 ? 25 ARG A NH2 1 
ATOM   216 N N   . LEU A 1 27 ? 4.535   -12.867 -7.554  1.00 35.17 ? 26 LEU A N   1 
ATOM   217 C CA  . LEU A 1 27 ? 5.300   -12.412 -8.705  1.00 38.58 ? 26 LEU A CA  1 
ATOM   218 C C   . LEU A 1 27 ? 6.795   -12.673 -8.583  1.00 39.82 ? 26 LEU A C   1 
ATOM   219 O O   . LEU A 1 27 ? 7.433   -13.005 -9.567  1.00 40.12 ? 26 LEU A O   1 
ATOM   220 C CB  . LEU A 1 27 ? 5.074   -10.917 -8.941  1.00 39.56 ? 26 LEU A CB  1 
ATOM   221 C CG  . LEU A 1 27 ? 3.646   -10.504 -9.291  1.00 40.89 ? 26 LEU A CG  1 
ATOM   222 C CD1 . LEU A 1 27 ? 3.593   -9.004  -9.563  1.00 39.80 ? 26 LEU A CD1 1 
ATOM   223 C CD2 . LEU A 1 27 ? 3.167   -11.281 -10.494 1.00 41.60 ? 26 LEU A CD2 1 
ATOM   224 N N   . LYS A 1 28 ? 7.367   -12.493 -7.396  1.00 42.07 ? 27 LYS A N   1 
ATOM   225 C CA  . LYS A 1 28 ? 8.809   -12.734 -7.229  1.00 45.74 ? 27 LYS A CA  1 
ATOM   226 C C   . LYS A 1 28 ? 9.110   -14.224 -7.123  1.00 49.10 ? 27 LYS A C   1 
ATOM   227 O O   . LYS A 1 28 ? 10.271  -14.634 -7.068  1.00 50.21 ? 27 LYS A O   1 
ATOM   228 C CB  . LYS A 1 28 ? 9.372   -12.053 -5.973  1.00 48.73 ? 27 LYS A CB  1 
ATOM   229 C CG  . LYS A 1 28 ? 8.882   -12.650 -4.650  1.00 53.32 ? 27 LYS A CG  1 
ATOM   230 C CD  . LYS A 1 28 ? 9.528   -11.945 -3.459  1.00 52.76 ? 27 LYS A CD  1 
ATOM   231 C CE  . LYS A 1 28 ? 9.014   -12.480 -2.132  1.00 54.54 ? 27 LYS A CE  1 
ATOM   232 N NZ  . LYS A 1 28 ? 9.594   -11.778 -0.966  1.00 55.64 ? 27 LYS A NZ  1 
ATOM   233 N N   . LYS A 1 29 ? 8.056   -15.032 -7.077  1.00 50.38 ? 28 LYS A N   1 
ATOM   234 C CA  . LYS A 1 29 ? 8.198   -16.488 -6.985  1.00 52.63 ? 28 LYS A CA  1 
ATOM   235 C C   . LYS A 1 29 ? 8.093   -17.056 -8.389  1.00 54.79 ? 28 LYS A C   1 
ATOM   236 O O   . LYS A 1 29 ? 8.960   -17.815 -8.839  1.00 54.07 ? 28 LYS A O   1 
ATOM   237 C CB  . LYS A 1 29 ? 7.070   -17.086 -6.155  1.00 52.65 ? 28 LYS A CB  1 
ATOM   238 C CG  . LYS A 1 29 ? 7.016   -18.613 -6.193  1.00 55.02 ? 28 LYS A CG  1 
ATOM   239 C CD  . LYS A 1 29 ? 5.870   -19.182 -5.350  1.00 55.51 ? 28 LYS A CD  1 
ATOM   240 C CE  . LYS A 1 29 ? 5.777   -18.546 -3.961  1.00 57.74 ? 28 LYS A CE  1 
ATOM   241 N NZ  . LYS A 1 29 ? 4.503   -18.824 -3.282  1.00 58.53 ? 28 LYS A NZ  1 
ATOM   242 N N   . LEU A 1 30 ? 7.015   -16.645 -9.030  1.00 57.05 ? 29 LEU A N   1 
ATOM   243 C CA  . LEU A 1 30 ? 6.700   -17.055 -10.397 1.00 59.91 ? 29 LEU A CA  1 
ATOM   244 C C   . LEU A 1 30 ? 7.553   -16.239 -11.394 1.00 61.62 ? 29 LEU A C   1 
ATOM   245 O O   . LEU A 1 30 ? 7.038   -15.741 -12.406 1.00 62.85 ? 29 LEU A O   1 
ATOM   246 C CB  . LEU A 1 30 ? 5.204   -16.866 -10.665 1.00 61.08 ? 29 LEU A CB  1 
ATOM   247 C CG  . LEU A 1 30 ? 4.328   -17.924 -9.973  1.00 61.76 ? 29 LEU A CG  1 
ATOM   248 C CD1 . LEU A 1 30 ? 4.817   -19.357 -10.198 1.00 62.74 ? 29 LEU A CD1 1 
ATOM   249 C CD2 . LEU A 1 30 ? 4.262   -17.748 -8.453  1.00 60.64 ? 29 LEU A CD2 1 
ATOM   250 N N   . VAL A 1 31 ? 8.829   -16.140 -11.027 1.00 63.70 ? 30 VAL A N   1 
ATOM   251 C CA  . VAL A 1 31 ? 9.926   -15.515 -11.826 1.00 65.80 ? 30 VAL A CA  1 
ATOM   252 C C   . VAL A 1 31 ? 9.818   -13.986 -12.041 1.00 67.71 ? 30 VAL A C   1 
ATOM   253 O O   . VAL A 1 31 ? 10.573  -13.400 -12.832 1.00 68.95 ? 30 VAL A O   1 
ATOM   254 C CB  . VAL A 1 31 ? 9.991   -16.114 -13.232 1.00 65.16 ? 30 VAL A CB  1 
ATOM   255 C CG1 . VAL A 1 31 ? 11.074  -17.185 -13.376 1.00 65.09 ? 30 VAL A CG1 1 
ATOM   256 C CG2 . VAL A 1 31 ? 8.685   -16.778 -13.665 1.00 65.66 ? 30 VAL A CG2 1 
ATOM   257 N N   . GLY A 1 32 ? 8.910   -13.327 -11.352 1.00 69.39 ? 31 GLY A N   1 
ATOM   258 C CA  . GLY A 1 32 ? 8.729   -11.857 -11.502 1.00 71.04 ? 31 GLY A CA  1 
ATOM   259 C C   . GLY A 1 32 ? 9.961   -11.087 -10.966 1.00 72.20 ? 31 GLY A C   1 
ATOM   260 O O   . GLY A 1 32 ? 10.005  -9.850  -10.997 1.00 72.41 ? 31 GLY A O   1 
ATOM   261 N N   . GLU A 1 33 ? 10.914  -11.862 -10.493 1.00 73.65 ? 32 GLU A N   1 
ATOM   262 C CA  . GLU A 1 33 ? 12.189  -11.393 -9.890  1.00 75.40 ? 32 GLU A CA  1 
ATOM   263 C C   . GLU A 1 33 ? 12.327  -9.869  -9.779  0.00 76.11 ? 32 GLU A C   1 
ATOM   264 O O   . GLU A 1 33 ? 11.957  -9.137  -10.724 1.00 77.05 ? 32 GLU A O   1 
ATOM   265 C CB  . GLU A 1 33 ? 13.384  -11.900 -10.700 1.00 76.33 ? 32 GLU A CB  1 
ATOM   266 C CG  . GLU A 1 33 ? 13.805  -13.325 -10.317 1.00 78.04 ? 32 GLU A CG  1 
ATOM   267 C CD  . GLU A 1 33 ? 14.223  -13.466 -8.847  1.00 78.16 ? 32 GLU A CD  1 
ATOM   268 O OE1 . GLU A 1 33 ? 13.339  -13.370 -7.911  1.00 78.83 ? 32 GLU A OE1 1 
ATOM   269 O OE2 . GLU A 1 33 ? 15.459  -13.683 -8.544  1.00 78.64 ? 32 GLU A OE2 1 
HETATM 270 C C   . ACE B 1 1  ? -4.276  18.622  12.726  1.00 23.10 ? 0  ACE B C   1 
HETATM 271 O O   . ACE B 1 1  ? -4.026  18.183  11.598  1.00 21.05 ? 0  ACE B O   1 
HETATM 272 C CH3 . ACE B 1 1  ? -4.538  20.088  12.914  1.00 26.34 ? 0  ACE B CH3 1 
ATOM   273 N N   . ARG B 1 2  ? -4.329  17.850  13.814  1.00 19.04 ? 1  ARG B N   1 
ATOM   274 C CA  . ARG B 1 2  ? -4.070  16.414  13.737  1.00 19.64 ? 1  ARG B CA  1 
ATOM   275 C C   . ARG B 1 2  ? -5.070  15.702  12.846  1.00 19.18 ? 1  ARG B C   1 
ATOM   276 O O   . ARG B 1 2  ? -4.712  14.749  12.138  1.00 20.56 ? 1  ARG B O   1 
ATOM   277 C CB  . ARG B 1 2  ? -4.076  15.772  15.135  1.00 20.23 ? 1  ARG B CB  1 
ATOM   278 C CG  . ARG B 1 2  ? -2.817  16.064  15.933  1.00 25.04 ? 1  ARG B CG  1 
ATOM   279 C CD  . ARG B 1 2  ? -2.939  15.591  17.383  1.00 27.50 ? 1  ARG B CD  1 
ATOM   280 N NE  . ARG B 1 2  ? -2.977  14.136  17.558  1.00 25.79 ? 1  ARG B NE  1 
ATOM   281 C CZ  . ARG B 1 2  ? -3.172  13.549  18.737  1.00 29.49 ? 1  ARG B CZ  1 
ATOM   282 N NH1 . ARG B 1 2  ? -3.352  14.298  19.817  1.00 28.45 ? 1  ARG B NH1 1 
ATOM   283 N NH2 . ARG B 1 2  ? -3.186  12.229  18.847  1.00 31.77 ? 1  ARG B NH2 1 
ATOM   284 N N   . MET B 1 3  ? -6.324  16.148  12.856  1.00 16.19 ? 2  MET B N   1 
ATOM   285 C CA  . MET B 1 3  ? -7.301  15.481  12.018  1.00 18.94 ? 2  MET B CA  1 
ATOM   286 C C   . MET B 1 3  ? -7.017  15.755  10.561  1.00 17.30 ? 2  MET B C   1 
ATOM   287 O O   . MET B 1 3  ? -6.974  14.827  9.766   1.00 15.43 ? 2  MET B O   1 
ATOM   288 C CB  . MET B 1 3  ? -8.726  15.890  12.378  1.00 18.61 ? 2  MET B CB  1 
ATOM   289 C CG  . MET B 1 3  ? -9.207  15.217  13.637  1.00 30.46 ? 2  MET B CG  1 
ATOM   290 S SD  . MET B 1 3  ? -9.291  13.428  13.388  1.00 37.89 ? 2  MET B SD  1 
ATOM   291 C CE  . MET B 1 3  ? -10.488 13.377  12.054  1.00 32.76 ? 2  MET B CE  1 
ATOM   292 N N   . LYS B 1 4  ? -6.825  17.024  10.216  1.00 18.12 ? 3  LYS B N   1 
ATOM   293 C CA  . LYS B 1 4  ? -6.526  17.396  8.837   1.00 19.59 ? 3  LYS B CA  1 
ATOM   294 C C   . LYS B 1 4  ? -5.274  16.633  8.390   1.00 16.54 ? 3  LYS B C   1 
ATOM   295 O O   . LYS B 1 4  ? -5.194  16.182  7.254   1.00 17.45 ? 3  LYS B O   1 
ATOM   296 C CB  . LYS B 1 4  ? -6.274  18.902  8.772   1.00 21.94 ? 3  LYS B CB  1 
ATOM   297 C CG  . LYS B 1 4  ? -6.161  19.492  7.392   1.00 31.07 ? 3  LYS B CG  1 
ATOM   298 C CD  . LYS B 1 4  ? -7.506  19.469  6.693   1.00 35.23 ? 3  LYS B CD  1 
ATOM   299 C CE  . LYS B 1 4  ? -7.531  20.475  5.552   1.00 40.85 ? 3  LYS B CE  1 
ATOM   300 N NZ  . LYS B 1 4  ? -6.433  20.294  4.576   1.00 39.69 ? 3  LYS B NZ  1 
ATOM   301 N N   . GLN B 1 5  ? -4.290  16.514  9.282   1.00 13.48 ? 4  GLN B N   1 
ATOM   302 C CA  . GLN B 1 5  ? -3.060  15.790  8.969   1.00 17.14 ? 4  GLN B CA  1 
ATOM   303 C C   . GLN B 1 5  ? -3.337  14.316  8.620   1.00 15.54 ? 4  GLN B C   1 
ATOM   304 O O   . GLN B 1 5  ? -2.755  13.773  7.673   1.00 11.83 ? 4  GLN B O   1 
ATOM   305 C CB  . GLN B 1 5  ? -2.060  15.853  10.135  1.00 19.25 ? 4  GLN B CB  1 
ATOM   306 C CG  . GLN B 1 5  ? -0.673  15.375  9.722   1.00 23.93 ? 4  GLN B CG  1 
ATOM   307 C CD  . GLN B 1 5  ? 0.357   15.452  10.830  1.00 27.52 ? 4  GLN B CD  1 
ATOM   308 O OE1 . GLN B 1 5  ? 1.545   15.648  10.562  1.00 31.86 ? 4  GLN B OE1 1 
ATOM   309 N NE2 . GLN B 1 5  ? -0.079  15.280  12.074  1.00 27.14 ? 4  GLN B NE2 1 
ATOM   310 N N   . LEU B 1 6  ? -4.223  13.677  9.372   1.00 13.57 ? 5  LEU B N   1 
ATOM   311 C CA  . LEU B 1 6  ? -4.552  12.274  9.111   1.00 15.59 ? 5  LEU B CA  1 
ATOM   312 C C   . LEU B 1 6  ? -5.226  12.119  7.757   1.00 13.63 ? 5  LEU B C   1 
ATOM   313 O O   . LEU B 1 6  ? -4.929  11.192  6.991   1.00 11.64 ? 5  LEU B O   1 
ATOM   314 C CB  . LEU B 1 6  ? -5.468  11.723  10.200  1.00 18.87 ? 5  LEU B CB  1 
ATOM   315 C CG  . LEU B 1 6  ? -4.737  11.297  11.463  1.00 23.97 ? 5  LEU B CG  1 
ATOM   316 C CD1 . LEU B 1 6  ? -5.739  11.029  12.568  1.00 28.49 ? 5  LEU B CD1 1 
ATOM   317 C CD2 . LEU B 1 6  ? -3.904  10.036  11.160  1.00 27.93 ? 5  LEU B CD2 1 
ATOM   318 N N   . GLU B 1 7  ? -6.150  13.027  7.479   1.00 14.43 ? 6  GLU B N   1 
ATOM   319 C CA  . GLU B 1 7  ? -6.846  13.018  6.200   1.00 17.20 ? 6  GLU B CA  1 
ATOM   320 C C   . GLU B 1 7  ? -5.847  13.138  5.047   1.00 14.40 ? 6  GLU B C   1 
ATOM   321 O O   . GLU B 1 7  ? -5.984  12.430  4.042   1.00 13.18 ? 6  GLU B O   1 
ATOM   322 C CB  . GLU B 1 7  ? -7.860  14.163  6.164   1.00 17.63 ? 6  GLU B CB  1 
ATOM   323 C CG  . GLU B 1 7  ? -8.862  14.061  7.304   1.00 29.34 ? 6  GLU B CG  1 
ATOM   324 C CD  . GLU B 1 7  ? -9.862  15.200  7.308   1.00 33.75 ? 6  GLU B CD  1 
ATOM   325 O OE1 . GLU B 1 7  ? -9.420  16.362  7.156   1.00 35.14 ? 6  GLU B OE1 1 
ATOM   326 O OE2 . GLU B 1 7  ? -11.077 14.930  7.485   1.00 35.23 ? 6  GLU B OE2 1 
ATOM   327 N N   . ASP B 1 8  ? -4.851  14.014  5.198   1.00 15.30 ? 7  ASP B N   1 
ATOM   328 C CA  . ASP B 1 8  ? -3.809  14.206  4.165   1.00 15.94 ? 7  ASP B CA  1 
ATOM   329 C C   . ASP B 1 8  ? -2.962  12.938  3.964   1.00 13.62 ? 7  ASP B C   1 
ATOM   330 O O   . ASP B 1 8  ? -2.622  12.570  2.847   1.00 11.17 ? 7  ASP B O   1 
ATOM   331 C CB  . ASP B 1 8  ? -2.857  15.345  4.528   1.00 17.43 ? 7  ASP B CB  1 
ATOM   332 C CG  . ASP B 1 8  ? -3.509  16.708  4.434   1.00 26.19 ? 7  ASP B CG  1 
ATOM   333 O OD1 . ASP B 1 8  ? -4.381  16.891  3.552   1.00 27.54 ? 7  ASP B OD1 1 
ATOM   334 O OD2 . ASP B 1 8  ? -3.117  17.601  5.220   1.00 27.67 ? 7  ASP B OD2 1 
ATOM   335 N N   . LYS B 1 9  ? -2.615  12.283  5.060   1.00 9.65  ? 8  LYS B N   1 
ATOM   336 C CA  . LYS B 1 9  ? -1.814  11.070  4.967   1.00 10.90 ? 8  LYS B CA  1 
ATOM   337 C C   . LYS B 1 9  ? -2.602  9.921   4.346   1.00 9.79  ? 8  LYS B C   1 
ATOM   338 O O   . LYS B 1 9  ? -2.062  9.145   3.548   1.00 10.76 ? 8  LYS B O   1 
ATOM   339 C CB  . LYS B 1 9  ? -1.278  10.678  6.355   1.00 11.93 ? 8  LYS B CB  1 
ATOM   340 C CG  . LYS B 1 9  ? -0.177  11.612  6.879   1.00 13.41 ? 8  LYS B CG  1 
ATOM   341 C CD  . LYS B 1 9  ? 0.329   11.179  8.255   1.00 21.08 ? 8  LYS B CD  1 
ATOM   342 C CE  . LYS B 1 9  ? 1.419   12.135  8.744   1.00 28.69 ? 8  LYS B CE  1 
ATOM   343 N NZ  . LYS B 1 9  ? 1.832   11.781  10.121  1.00 30.20 ? 8  LYS B NZ  1 
ATOM   344 N N   . VAL B 1 10 ? -3.879  9.799   4.709   1.00 10.35 ? 9  VAL B N   1 
ATOM   345 C CA  . VAL B 1 10 ? -4.715  8.740   4.150   1.00 9.70  ? 9  VAL B CA  1 
ATOM   346 C C   . VAL B 1 10 ? -4.898  8.995   2.655   1.00 10.68 ? 9  VAL B C   1 
ATOM   347 O O   . VAL B 1 10 ? -4.933  8.066   1.859   1.00 11.59 ? 9  VAL B O   1 
ATOM   348 C CB  . VAL B 1 10 ? -6.088  8.672   4.889   1.00 10.65 ? 9  VAL B CB  1 
ATOM   349 C CG1 . VAL B 1 10 ? -7.035  7.689   4.208   1.00 13.17 ? 9  VAL B CG1 1 
ATOM   350 C CG2 . VAL B 1 10 ? -5.857  8.205   6.319   1.00 11.32 ? 9  VAL B CG2 1 
ATOM   351 N N   . GLU B 1 11 ? -4.990  10.258  2.261   1.00 12.90 ? 10 GLU B N   1 
ATOM   352 C CA  . GLU B 1 11 ? -5.147  10.547  0.831   1.00 14.14 ? 10 GLU B CA  1 
ATOM   353 C C   . GLU B 1 11 ? -3.878  10.163  0.059   1.00 14.68 ? 10 GLU B C   1 
ATOM   354 O O   . GLU B 1 11 ? -3.959  9.648   -1.056  1.00 17.35 ? 10 GLU B O   1 
ATOM   355 C CB  . GLU B 1 11 ? -5.472  12.026  0.629   1.00 15.14 ? 10 GLU B CB  1 
ATOM   356 C CG  . GLU B 1 11 ? -4.344  12.961  0.950   1.00 26.66 ? 10 GLU B CG  1 
ATOM   357 C CD  . GLU B 1 11 ? -4.761  14.405  0.781   0.00 23.52 ? 10 GLU B CD  1 
ATOM   358 O OE1 . GLU B 1 11 ? -5.318  14.721  -0.289  0.00 24.68 ? 10 GLU B OE1 1 
ATOM   359 O OE2 . GLU B 1 11 ? -4.536  15.218  1.701   0.00 24.68 ? 10 GLU B OE2 1 
ATOM   360 N N   . GLU B 1 12 ? -2.717  10.401  0.659   1.00 11.72 ? 11 GLU B N   1 
ATOM   361 C CA  . GLU B 1 12 ? -1.443  10.063  0.059   1.00 12.97 ? 11 GLU B CA  1 
ATOM   362 C C   . GLU B 1 12 ? -1.345  8.530   -0.024  1.00 12.83 ? 11 GLU B C   1 
ATOM   363 O O   . GLU B 1 12 ? -0.915  7.987   -1.030  1.00 12.09 ? 11 GLU B O   1 
ATOM   364 C CB  . GLU B 1 12 ? -0.315  10.622  0.932   1.00 21.02 ? 11 GLU B CB  1 
ATOM   365 C CG  . GLU B 1 12 ? 1.097   10.354  0.442   1.00 30.65 ? 11 GLU B CG  1 
ATOM   366 C CD  . GLU B 1 12 ? 1.401   11.038  -0.875  1.00 34.98 ? 11 GLU B CD  1 
ATOM   367 O OE1 . GLU B 1 12 ? 1.084   12.245  -0.997  1.00 40.15 ? 11 GLU B OE1 1 
ATOM   368 O OE2 . GLU B 1 12 ? 1.975   10.383  -1.773  1.00 39.80 ? 11 GLU B OE2 1 
ATOM   369 N N   . LEU B 1 13 ? -1.792  7.837   1.029   1.00 10.17 ? 12 LEU B N   1 
ATOM   370 C CA  . LEU B 1 13 ? -1.732  6.381   1.051   1.00 10.56 ? 12 LEU B CA  1 
ATOM   371 C C   . LEU B 1 13 ? -2.634  5.748   -0.009  1.00 12.55 ? 12 LEU B C   1 
ATOM   372 O O   . LEU B 1 13 ? -2.268  4.751   -0.643  1.00 11.27 ? 12 LEU B O   1 
ATOM   373 C CB  . LEU B 1 13 ? -2.103  5.865   2.449   1.00 9.72  ? 12 LEU B CB  1 
ATOM   374 C CG  . LEU B 1 13 ? -1.033  6.054   3.515   1.00 12.40 ? 12 LEU B CG  1 
ATOM   375 C CD1 . LEU B 1 13 ? -1.637  5.777   4.883   1.00 7.05  ? 12 LEU B CD1 1 
ATOM   376 C CD2 . LEU B 1 13 ? 0.167   5.092   3.225   1.00 12.28 ? 12 LEU B CD2 1 
ATOM   377 N N   . LEU B 1 14 ? -3.823  6.309   -0.193  1.00 12.66 ? 13 LEU B N   1 
ATOM   378 C CA  . LEU B 1 14 ? -4.727  5.793   -1.200  1.00 14.73 ? 13 LEU B CA  1 
ATOM   379 C C   . LEU B 1 14 ? -4.107  5.977   -2.595  1.00 14.86 ? 13 LEU B C   1 
ATOM   380 O O   . LEU B 1 14 ? -4.222  5.083   -3.433  1.00 15.96 ? 13 LEU B O   1 
ATOM   381 C CB  . LEU B 1 14 ? -6.088  6.511   -1.108  1.00 16.59 ? 13 LEU B CB  1 
ATOM   382 C CG  . LEU B 1 14 ? -6.950  6.037   0.068   1.00 16.73 ? 13 LEU B CG  1 
ATOM   383 C CD1 . LEU B 1 14 ? -8.078  7.001   0.341   1.00 21.09 ? 13 LEU B CD1 1 
ATOM   384 C CD2 . LEU B 1 14 ? -7.475  4.642   -0.216  1.00 24.12 ? 13 LEU B CD2 1 
ATOM   385 N N   . SER B 1 15 ? -3.431  7.103   -2.826  1.00 13.88 ? 14 SER B N   1 
ATOM   386 C CA  . SER B 1 15 ? -2.823  7.350   -4.147  1.00 17.40 ? 14 SER B CA  1 
ATOM   387 C C   . SER B 1 15 ? -1.670  6.379   -4.382  1.00 17.89 ? 14 SER B C   1 
ATOM   388 O O   . SER B 1 15 ? -1.525  5.824   -5.469  1.00 19.56 ? 14 SER B O   1 
ATOM   389 C CB  . SER B 1 15 ? -2.337  8.804   -4.281  1.00 18.11 ? 14 SER B CB  1 
ATOM   390 O OG  . SER B 1 15 ? -1.197  9.118   -3.491  1.00 25.79 ? 14 SER B OG  1 
ATOM   391 N N   . LYS B 1 16 ? -0.870  6.163   -3.347  1.00 15.24 ? 15 LYS B N   1 
ATOM   392 C CA  . LYS B 1 16 ? 0.256   5.228   -3.413  1.00 16.82 ? 15 LYS B CA  1 
ATOM   393 C C   . LYS B 1 16 ? -0.231  3.804   -3.659  1.00 12.79 ? 15 LYS B C   1 
ATOM   394 O O   . LYS B 1 16 ? 0.412   3.048   -4.376  1.00 13.35 ? 15 LYS B O   1 
ATOM   395 C CB  . LYS B 1 16 ? 1.052   5.224   -2.096  1.00 16.20 ? 15 LYS B CB  1 
ATOM   396 C CG  . LYS B 1 16 ? 1.689   6.518   -1.702  1.00 24.07 ? 15 LYS B CG  1 
ATOM   397 C CD  . LYS B 1 16 ? 2.315   6.370   -0.321  1.00 27.35 ? 15 LYS B CD  1 
ATOM   398 C CE  . LYS B 1 16 ? 2.756   7.706   0.216   1.00 32.18 ? 15 LYS B CE  1 
ATOM   399 N NZ  . LYS B 1 16 ? 3.669   8.393   -0.730  1.00 38.23 ? 15 LYS B NZ  1 
ATOM   400 N N   . SER B 1 17 ? -1.347  3.429   -3.039  1.00 12.73 ? 16 SER B N   1 
ATOM   401 C CA  . SER B 1 17 ? -1.887  2.081   -3.184  1.00 15.46 ? 16 SER B CA  1 
ATOM   402 C C   . SER B 1 17 ? -2.325  1.852   -4.623  1.00 15.20 ? 16 SER B C   1 
ATOM   403 O O   . SER B 1 17 ? -2.088  0.789   -5.212  1.00 12.86 ? 16 SER B O   1 
ATOM   404 C CB  . SER B 1 17 ? -3.101  1.879   -2.268  1.00 20.21 ? 16 SER B CB  1 
ATOM   405 O OG  . SER B 1 17 ? -4.256  2.519   -2.786  1.00 23.50 ? 16 SER B OG  1 
ATOM   406 N N   . TYR B 1 18 ? -2.969  2.863   -5.193  1.00 16.23 ? 17 TYR B N   1 
ATOM   407 C CA  . TYR B 1 18 ? -3.415  2.767   -6.585  1.00 22.34 ? 17 TYR B CA  1 
ATOM   408 C C   . TYR B 1 18 ? -2.222  2.564   -7.543  1.00 21.22 ? 17 TYR B C   1 
ATOM   409 O O   . TYR B 1 18 ? -2.292  1.707   -8.436  1.00 21.23 ? 17 TYR B O   1 
ATOM   410 C CB  . TYR B 1 18 ? -4.225  4.022   -6.931  1.00 25.84 ? 17 TYR B CB  1 
ATOM   411 C CG  . TYR B 1 18 ? -5.593  4.023   -6.250  1.00 36.00 ? 17 TYR B CG  1 
ATOM   412 C CD1 . TYR B 1 18 ? -6.266  5.214   -5.979  1.00 39.21 ? 17 TYR B CD1 1 
ATOM   413 C CD2 . TYR B 1 18 ? -6.234  2.819   -5.924  1.00 38.40 ? 17 TYR B CD2 1 
ATOM   414 C CE1 . TYR B 1 18 ? -7.540  5.210   -5.398  1.00 43.09 ? 17 TYR B CE1 1 
ATOM   415 C CE2 . TYR B 1 18 ? -7.510  2.800   -5.345  1.00 43.56 ? 17 TYR B CE2 1 
ATOM   416 C CZ  . TYR B 1 18 ? -8.160  3.997   -5.085  1.00 45.30 ? 17 TYR B CZ  1 
ATOM   417 O OH  . TYR B 1 18 ? -9.427  3.980   -4.522  1.00 48.03 ? 17 TYR B OH  1 
ATOM   418 N N   A HIS B 1 19 ? -1.148  3.341   -7.333  0.41 21.83 ? 18 HIS B N   1 
ATOM   419 N N   B HIS B 1 19 ? -1.155  3.331   -7.345  0.59 22.73 ? 18 HIS B N   1 
ATOM   420 C CA  A HIS B 1 19 ? 0.100   3.282   -8.112  0.41 21.95 ? 18 HIS B CA  1 
ATOM   421 C CA  B HIS B 1 19 ? 0.045   3.263   -8.180  0.59 23.46 ? 18 HIS B CA  1 
ATOM   422 C C   A HIS B 1 19 ? 0.680   1.887   -8.078  0.41 21.19 ? 18 HIS B C   1 
ATOM   423 C C   B HIS B 1 19 ? 0.717   1.898   -8.080  0.59 22.24 ? 18 HIS B C   1 
ATOM   424 O O   A HIS B 1 19 ? 1.021   1.307   -9.110  0.41 22.05 ? 18 HIS B O   1 
ATOM   425 O O   B HIS B 1 19 ? 1.173   1.350   -9.085  0.59 22.93 ? 18 HIS B O   1 
ATOM   426 C CB  A HIS B 1 19 ? 1.164   4.222   -7.517  0.41 21.83 ? 18 HIS B CB  1 
ATOM   427 C CB  B HIS B 1 19 ? 1.003   4.367   -7.760  0.59 24.85 ? 18 HIS B CB  1 
ATOM   428 C CG  A HIS B 1 19 ? 2.593   3.740   -7.655  0.41 23.96 ? 18 HIS B CG  1 
ATOM   429 C CG  B HIS B 1 19 ? 0.450   5.742   -7.987  0.59 28.79 ? 18 HIS B CG  1 
ATOM   430 N ND1 A HIS B 1 19 ? 3.254   3.681   -8.858  0.41 25.66 ? 18 HIS B ND1 1 
ATOM   431 N ND1 B HIS B 1 19 ? -0.851  6.068   -7.682  0.59 30.87 ? 18 HIS B ND1 1 
ATOM   432 C CD2 A HIS B 1 19 ? 3.457   3.282   -6.721  0.41 23.80 ? 18 HIS B CD2 1 
ATOM   433 C CD2 B HIS B 1 19 ? 1.027   6.881   -8.441  0.59 31.33 ? 18 HIS B CD2 1 
ATOM   434 C CE1 A HIS B 1 19 ? 4.475   3.233   -8.665  0.41 25.78 ? 18 HIS B CE1 1 
ATOM   435 C CE1 B HIS B 1 19 ? -1.056  7.348   -7.937  0.59 31.61 ? 18 HIS B CE1 1 
ATOM   436 N NE2 A HIS B 1 19 ? 4.639   2.975   -7.377  0.41 25.27 ? 18 HIS B NE2 1 
ATOM   437 N NE2 B HIS B 1 19 ? 0.068   7.865   -8.399  0.59 31.69 ? 18 HIS B NE2 1 
ATOM   438 N N   . LEU B 1 20 ? 0.822   1.366   -6.868  1.00 19.57 ? 19 LEU B N   1 
ATOM   439 C CA  . LEU B 1 20 ? 1.393   0.060   -6.673  1.00 16.49 ? 19 LEU B CA  1 
ATOM   440 C C   . LEU B 1 20 ? 0.545   -1.003  -7.330  1.00 16.61 ? 19 LEU B C   1 
ATOM   441 O O   . LEU B 1 20 ? 1.053   -1.885  -7.995  1.00 15.95 ? 19 LEU B O   1 
ATOM   442 C CB  . LEU B 1 20 ? 1.520   -0.251  -5.176  1.00 15.93 ? 19 LEU B CB  1 
ATOM   443 C CG  . LEU B 1 20 ? 2.600   0.562   -4.483  1.00 22.38 ? 19 LEU B CG  1 
ATOM   444 C CD1 . LEU B 1 20 ? 2.554   0.267   -2.984  1.00 26.56 ? 19 LEU B CD1 1 
ATOM   445 C CD2 . LEU B 1 20 ? 3.960   0.197   -5.060  1.00 25.65 ? 19 LEU B CD2 1 
ATOM   446 N N   . GLU B 1 21 ? -0.780  -0.899  -7.178  1.00 14.86 ? 20 GLU B N   1 
ATOM   447 C CA  . GLU B 1 21 ? -1.641  -1.911  -7.771  1.00 22.76 ? 20 GLU B CA  1 
ATOM   448 C C   . GLU B 1 21 ? -1.501  -1.910  -9.280  1.00 23.90 ? 20 GLU B C   1 
ATOM   449 O O   . GLU B 1 21 ? -1.472  -2.965  -9.929  1.00 24.17 ? 20 GLU B O   1 
ATOM   450 C CB  . GLU B 1 21 ? -3.095  -1.695  -7.352  1.00 27.33 ? 20 GLU B CB  1 
ATOM   451 C CG  . GLU B 1 21 ? -3.328  -1.901  -5.865  1.00 36.25 ? 20 GLU B CG  1 
ATOM   452 C CD  . GLU B 1 21 ? -4.786  -2.116  -5.507  1.00 41.76 ? 20 GLU B CD  1 
ATOM   453 O OE1 . GLU B 1 21 ? -5.618  -1.224  -5.790  1.00 43.35 ? 20 GLU B OE1 1 
ATOM   454 O OE2 . GLU B 1 21 ? -5.095  -3.191  -4.938  1.00 45.54 ? 20 GLU B OE2 1 
ATOM   455 N N   . ASN B 1 22 ? -1.386  -0.716  -9.833  1.00 25.69 ? 21 ASN B N   1 
ATOM   456 C CA  . ASN B 1 22 ? -1.257  -0.576  -11.271 1.00 29.51 ? 21 ASN B CA  1 
ATOM   457 C C   . ASN B 1 22 ? 0.084   -1.113  -11.764 1.00 29.84 ? 21 ASN B C   1 
ATOM   458 O O   . ASN B 1 22 ? 0.155   -1.780  -12.818 1.00 27.67 ? 21 ASN B O   1 
ATOM   459 C CB  . ASN B 1 22 ? -1.481  0.879   -11.675 1.00 33.34 ? 21 ASN B CB  1 
ATOM   460 C CG  . ASN B 1 22 ? -2.922  1.322   -11.424 1.00 36.92 ? 21 ASN B CG  1 
ATOM   461 O OD1 . ASN B 1 22 ? -3.853  0.513   -11.490 1.00 39.88 ? 21 ASN B OD1 1 
ATOM   462 N ND2 . ASN B 1 22 ? -3.115  2.615   -11.162 1.00 41.54 ? 21 ASN B ND2 1 
ATOM   463 N N   . GLU B 1 23 ? 1.148   -0.851  -11.005 1.00 26.87 ? 22 GLU B N   1 
ATOM   464 C CA  . GLU B 1 23 ? 2.462   -1.349  -11.378 1.00 27.11 ? 22 GLU B CA  1 
ATOM   465 C C   . GLU B 1 23 ? 2.474   -2.870  -11.324 1.00 25.93 ? 22 GLU B C   1 
ATOM   466 O O   . GLU B 1 23 ? 3.081   -3.528  -12.173 1.00 25.14 ? 22 GLU B O   1 
ATOM   467 C CB  . GLU B 1 23 ? 3.549   -0.799  -10.453 1.00 30.19 ? 22 GLU B CB  1 
ATOM   468 C CG  . GLU B 1 23 ? 3.982   0.614   -10.773 1.00 37.36 ? 22 GLU B CG  1 
ATOM   469 C CD  . GLU B 1 23 ? 4.407   0.758   -12.225 1.00 40.91 ? 22 GLU B CD  1 
ATOM   470 O OE1 . GLU B 1 23 ? 5.214   -0.070  -12.695 1.00 44.91 ? 22 GLU B OE1 1 
ATOM   471 O OE2 . GLU B 1 23 ? 3.943   1.704   -12.899 1.00 45.51 ? 22 GLU B OE2 1 
ATOM   472 N N   . VAL B 1 24 ? 1.809   -3.434  -10.325 1.00 20.28 ? 23 VAL B N   1 
ATOM   473 C CA  . VAL B 1 24 ? 1.768   -4.883  -10.210 1.00 20.39 ? 23 VAL B CA  1 
ATOM   474 C C   . VAL B 1 24 ? 0.969   -5.487  -11.375 1.00 23.03 ? 23 VAL B C   1 
ATOM   475 O O   . VAL B 1 24 ? 1.281   -6.588  -11.851 1.00 21.58 ? 23 VAL B O   1 
ATOM   476 C CB  . VAL B 1 24 ? 1.166   -5.324  -8.861  1.00 23.43 ? 23 VAL B CB  1 
ATOM   477 C CG1 . VAL B 1 24 ? 0.960   -6.829  -8.852  1.00 21.30 ? 23 VAL B CG1 1 
ATOM   478 C CG2 . VAL B 1 24 ? 2.122   -4.945  -7.728  1.00 22.87 ? 23 VAL B CG2 1 
ATOM   479 N N   . ALA B 1 25 ? -0.045  -4.765  -11.847 1.00 25.11 ? 24 ALA B N   1 
ATOM   480 C CA  . ALA B 1 25 ? -0.842  -5.256  -12.972 1.00 30.35 ? 24 ALA B CA  1 
ATOM   481 C C   . ALA B 1 25 ? -0.025  -5.183  -14.268 1.00 32.92 ? 24 ALA B C   1 
ATOM   482 O O   . ALA B 1 25 ? -0.228  -5.994  -15.175 1.00 33.23 ? 24 ALA B O   1 
ATOM   483 C CB  . ALA B 1 25 ? -2.142  -4.452  -13.100 1.00 29.91 ? 24 ALA B CB  1 
ATOM   484 N N   . ARG B 1 26 ? 0.896   -4.221  -14.360 1.00 35.37 ? 25 ARG B N   1 
ATOM   485 C CA  . ARG B 1 26 ? 1.743   -4.102  -15.548 1.00 38.11 ? 25 ARG B CA  1 
ATOM   486 C C   . ARG B 1 26 ? 2.704   -5.288  -15.538 1.00 39.91 ? 25 ARG B C   1 
ATOM   487 O O   . ARG B 1 26 ? 2.912   -5.950  -16.559 1.00 38.73 ? 25 ARG B O   1 
ATOM   488 C CB  . ARG B 1 26 ? 2.586   -2.818  -15.534 1.00 42.73 ? 25 ARG B CB  1 
ATOM   489 C CG  . ARG B 1 26 ? 3.371   -2.633  -16.836 1.00 47.60 ? 25 ARG B CG  1 
ATOM   490 C CD  . ARG B 1 26 ? 4.532   -1.628  -16.790 1.00 52.12 ? 25 ARG B CD  1 
ATOM   491 N NE  . ARG B 1 26 ? 5.712   -2.141  -16.091 1.00 54.65 ? 25 ARG B NE  1 
ATOM   492 C CZ  . ARG B 1 26 ? 6.968   -1.801  -16.387 1.00 55.55 ? 25 ARG B CZ  1 
ATOM   493 N NH1 . ARG B 1 26 ? 7.217   -0.945  -17.370 1.00 55.97 ? 25 ARG B NH1 1 
ATOM   494 N NH2 . ARG B 1 26 ? 7.981   -2.320  -15.703 1.00 54.69 ? 25 ARG B NH2 1 
ATOM   495 N N   . LEU B 1 27 ? 3.297   -5.540  -14.371 1.00 39.70 ? 26 LEU B N   1 
ATOM   496 C CA  . LEU B 1 27 ? 4.237   -6.642  -14.200 1.00 40.74 ? 26 LEU B CA  1 
ATOM   497 C C   . LEU B 1 27 ? 3.669   -8.018  -14.524 1.00 42.66 ? 26 LEU B C   1 
ATOM   498 O O   . LEU B 1 27 ? 4.426   -8.940  -14.836 1.00 42.80 ? 26 LEU B O   1 
ATOM   499 C CB  . LEU B 1 27 ? 4.801   -6.649  -12.777 1.00 38.17 ? 26 LEU B CB  1 
ATOM   500 C CG  . LEU B 1 27 ? 5.843   -5.572  -12.482 1.00 40.71 ? 26 LEU B CG  1 
ATOM   501 C CD1 . LEU B 1 27 ? 6.255   -5.622  -11.026 1.00 39.96 ? 26 LEU B CD1 1 
ATOM   502 C CD2 . LEU B 1 27 ? 7.058   -5.801  -13.383 1.00 40.31 ? 26 LEU B CD2 1 
ATOM   503 N N   . LYS B 1 28 ? 2.352   -8.173  -14.424 1.00 45.00 ? 27 LYS B N   1 
ATOM   504 C CA  . LYS B 1 28 ? 1.739   -9.453  -14.749 1.00 47.38 ? 27 LYS B CA  1 
ATOM   505 C C   . LYS B 1 28 ? 1.686   -9.583  -16.259 1.00 50.13 ? 27 LYS B C   1 
ATOM   506 O O   . LYS B 1 28 ? 1.446   -10.661 -16.800 1.00 52.00 ? 27 LYS B O   1 
ATOM   507 C CB  . LYS B 1 28 ? 0.337   -9.568  -14.142 1.00 48.67 ? 27 LYS B CB  1 
ATOM   508 C CG  . LYS B 1 28 ? 0.342   -10.298 -12.801 1.00 48.56 ? 27 LYS B CG  1 
ATOM   509 C CD  . LYS B 1 28 ? -1.039  -10.465 -12.165 1.00 50.19 ? 27 LYS B CD  1 
ATOM   510 C CE  . LYS B 1 28 ? -1.597  -9.155  -11.627 1.00 50.48 ? 27 LYS B CE  1 
ATOM   511 N NZ  . LYS B 1 28 ? -2.702  -9.403  -10.652 1.00 50.70 ? 27 LYS B NZ  1 
ATOM   512 N N   . LYS B 1 29 ? 1.935   -8.472  -16.938 1.00 50.83 ? 28 LYS B N   1 
ATOM   513 C CA  . LYS B 1 29 ? 1.931   -8.470  -18.386 1.00 51.84 ? 28 LYS B CA  1 
ATOM   514 C C   . LYS B 1 29 ? 3.368   -8.827  -18.786 1.00 51.70 ? 28 LYS B C   1 
ATOM   515 O O   . LYS B 1 29 ? 3.607   -9.813  -19.476 1.00 51.29 ? 28 LYS B O   1 
ATOM   516 C CB  . LYS B 1 29 ? 1.544   -7.078  -18.909 1.00 52.56 ? 28 LYS B CB  1 
ATOM   517 C CG  . LYS B 1 29 ? 0.815   -7.092  -20.253 1.00 55.47 ? 28 LYS B CG  1 
ATOM   518 C CD  . LYS B 1 29 ? -0.625  -7.630  -20.149 1.00 57.36 ? 28 LYS B CD  1 
ATOM   519 C CE  . LYS B 1 29 ? -1.611  -6.574  -19.626 1.00 58.86 ? 28 LYS B CE  1 
ATOM   520 N NZ  . LYS B 1 29 ? -3.013  -7.092  -19.585 1.00 60.05 ? 28 LYS B NZ  1 
ATOM   521 N N   . LEU B 1 30 ? 4.321   -8.040  -18.296 1.00 50.82 ? 29 LEU B N   1 
ATOM   522 C CA  . LEU B 1 30 ? 5.737   -8.223  -18.594 1.00 51.21 ? 29 LEU B CA  1 
ATOM   523 C C   . LEU B 1 30 ? 6.422   -9.478  -18.053 1.00 51.92 ? 29 LEU B C   1 
ATOM   524 O O   . LEU B 1 30 ? 7.579   -9.733  -18.383 1.00 51.56 ? 29 LEU B O   1 
ATOM   525 C CB  . LEU B 1 30 ? 6.506   -6.981  -18.147 1.00 51.95 ? 29 LEU B CB  1 
ATOM   526 C CG  . LEU B 1 30 ? 6.323   -5.731  -19.019 1.00 52.92 ? 29 LEU B CG  1 
ATOM   527 C CD1 . LEU B 1 30 ? 7.140   -5.890  -20.293 1.00 51.40 ? 29 LEU B CD1 1 
ATOM   528 C CD2 . LEU B 1 30 ? 4.844   -5.505  -19.338 1.00 53.84 ? 29 LEU B CD2 1 
ATOM   529 N N   . VAL B 1 31 ? 5.727   -10.255 -17.225 1.00 53.47 ? 30 VAL B N   1 
ATOM   530 C CA  . VAL B 1 31 ? 6.303   -11.491 -16.689 1.00 55.90 ? 30 VAL B CA  1 
ATOM   531 C C   . VAL B 1 31 ? 5.660   -12.617 -17.495 1.00 58.17 ? 30 VAL B C   1 
ATOM   532 O O   . VAL B 1 31 ? 6.004   -13.792 -17.351 1.00 58.46 ? 30 VAL B O   1 
ATOM   533 C CB  . VAL B 1 31 ? 5.959   -11.697 -15.185 1.00 55.31 ? 30 VAL B CB  1 
ATOM   534 C CG1 . VAL B 1 31 ? 4.542   -12.240 -15.041 1.00 56.51 ? 30 VAL B CG1 1 
ATOM   535 C CG2 . VAL B 1 31 ? 6.975   -12.624 -14.528 1.00 53.32 ? 30 VAL B CG2 1 
ATOM   536 N N   . GLY B 1 32 ? 4.720   -12.227 -18.348 1.00 60.12 ? 31 GLY B N   1 
ATOM   537 C CA  . GLY B 1 32 ? 3.997   -13.176 -19.170 1.00 62.52 ? 31 GLY B CA  1 
ATOM   538 C C   . GLY B 1 32 ? 3.585   -12.550 -20.485 1.00 64.73 ? 31 GLY B C   1 
ATOM   539 O O   . GLY B 1 32 ? 4.281   -11.615 -20.939 1.00 66.45 ? 31 GLY B O   1 
HETATM 540 C C   . ACE C 1 1  ? -8.138  6.789   21.955  1.00 44.46 ? 0  ACE C C   1 
HETATM 541 O O   . ACE C 1 1  ? -8.809  5.775   22.177  1.00 45.05 ? 0  ACE C O   1 
HETATM 542 C CH3 . ACE C 1 1  ? -7.409  7.478   23.073  1.00 45.67 ? 0  ACE C CH3 1 
ATOM   543 N N   . ARG C 1 2  ? -8.014  7.338   20.749  1.00 41.78 ? 1  ARG C N   1 
ATOM   544 C CA  . ARG C 1 2  ? -8.646  6.799   19.547  1.00 38.57 ? 1  ARG C CA  1 
ATOM   545 C C   . ARG C 1 2  ? -8.001  7.424   18.307  1.00 37.70 ? 1  ARG C C   1 
ATOM   546 O O   . ARG C 1 2  ? -7.788  6.753   17.297  1.00 37.23 ? 1  ARG C O   1 
ATOM   547 C CB  . ARG C 1 2  ? -10.139 7.103   19.541  1.00 38.53 ? 1  ARG C CB  1 
ATOM   548 C CG  . ARG C 1 2  ? -10.846 6.630   18.279  1.00 39.02 ? 1  ARG C CG  1 
ATOM   549 C CD  . ARG C 1 2  ? -12.350 6.873   18.367  1.00 39.64 ? 1  ARG C CD  1 
ATOM   550 N NE  . ARG C 1 2  ? -13.056 6.547   17.128  1.00 39.38 ? 1  ARG C NE  1 
ATOM   551 C CZ  . ARG C 1 2  ? -14.347 6.790   16.917  1.00 37.84 ? 1  ARG C CZ  1 
ATOM   552 N NH1 . ARG C 1 2  ? -15.077 7.364   17.866  1.00 38.12 ? 1  ARG C NH1 1 
ATOM   553 N NH2 . ARG C 1 2  ? -14.912 6.459   15.760  1.00 37.48 ? 1  ARG C NH2 1 
ATOM   554 N N   . MET C 1 3  ? -7.711  8.718   18.390  1.00 36.29 ? 2  MET C N   1 
ATOM   555 C CA  . MET C 1 3  ? -7.069  9.442   17.299  1.00 35.01 ? 2  MET C CA  1 
ATOM   556 C C   . MET C 1 3  ? -5.647  8.897   17.228  1.00 32.72 ? 2  MET C C   1 
ATOM   557 O O   . MET C 1 3  ? -5.113  8.682   16.147  1.00 29.25 ? 2  MET C O   1 
ATOM   558 C CB  . MET C 1 3  ? -7.061  10.944  17.590  1.00 36.19 ? 2  MET C CB  1 
ATOM   559 C CG  . MET C 1 3  ? -6.496  11.811  16.479  1.00 40.03 ? 2  MET C CG  1 
ATOM   560 S SD  . MET C 1 3  ? -6.550  13.573  16.924  1.00 43.71 ? 2  MET C SD  1 
ATOM   561 C CE  . MET C 1 3  ? -8.302  13.829  17.130  1.00 41.83 ? 2  MET C CE  1 
ATOM   562 N N   . LYS C 1 4  ? -5.053  8.662   18.397  1.00 31.50 ? 3  LYS C N   1 
ATOM   563 C CA  . LYS C 1 4  ? -3.703  8.097   18.505  1.00 29.99 ? 3  LYS C CA  1 
ATOM   564 C C   . LYS C 1 4  ? -3.704  6.733   17.808  1.00 27.13 ? 3  LYS C C   1 
ATOM   565 O O   . LYS C 1 4  ? -2.761  6.367   17.109  1.00 27.02 ? 3  LYS C O   1 
ATOM   566 C CB  . LYS C 1 4  ? -3.351  7.903   19.984  1.00 31.78 ? 3  LYS C CB  1 
ATOM   567 C CG  . LYS C 1 4  ? -2.088  7.081   20.281  1.00 33.89 ? 3  LYS C CG  1 
ATOM   568 C CD  . LYS C 1 4  ? -0.802  7.888   20.297  0.00 33.28 ? 3  LYS C CD  1 
ATOM   569 C CE  . LYS C 1 4  ? -0.414  8.414   18.936  0.00 33.50 ? 3  LYS C CE  1 
ATOM   570 N NZ  . LYS C 1 4  ? 0.902   9.099   19.030  0.00 33.43 ? 3  LYS C NZ  1 
ATOM   571 N N   . GLN C 1 5  ? -4.782  5.989   18.020  1.00 25.59 ? 4  GLN C N   1 
ATOM   572 C CA  . GLN C 1 5  ? -4.965  4.656   17.441  1.00 26.14 ? 4  GLN C CA  1 
ATOM   573 C C   . GLN C 1 5  ? -4.852  4.708   15.912  1.00 24.81 ? 4  GLN C C   1 
ATOM   574 O O   . GLN C 1 5  ? -4.124  3.922   15.294  1.00 23.08 ? 4  GLN C O   1 
ATOM   575 C CB  . GLN C 1 5  ? -6.346  4.144   17.846  1.00 32.47 ? 4  GLN C CB  1 
ATOM   576 C CG  . GLN C 1 5  ? -6.642  2.697   17.521  1.00 37.28 ? 4  GLN C CG  1 
ATOM   577 C CD  . GLN C 1 5  ? -7.992  2.264   18.069  1.00 41.74 ? 4  GLN C CD  1 
ATOM   578 O OE1 . GLN C 1 5  ? -9.047  2.695   17.591  1.00 43.50 ? 4  GLN C OE1 1 
ATOM   579 N NE2 . GLN C 1 5  ? -7.964  1.424   19.099  1.00 45.12 ? 4  GLN C NE2 1 
ATOM   580 N N   . LEU C 1 6  ? -5.586  5.639   15.311  1.00 21.79 ? 5  LEU C N   1 
ATOM   581 C CA  . LEU C 1 6  ? -5.570  5.823   13.863  1.00 20.74 ? 5  LEU C CA  1 
ATOM   582 C C   . LEU C 1 6  ? -4.197  6.310   13.373  1.00 16.88 ? 5  LEU C C   1 
ATOM   583 O O   . LEU C 1 6  ? -3.711  5.875   12.315  1.00 16.59 ? 5  LEU C O   1 
ATOM   584 C CB  . LEU C 1 6  ? -6.638  6.845   13.464  1.00 23.83 ? 5  LEU C CB  1 
ATOM   585 C CG  . LEU C 1 6  ? -7.724  6.446   12.455  1.00 30.58 ? 5  LEU C CG  1 
ATOM   586 C CD1 . LEU C 1 6  ? -8.415  7.717   11.979  1.00 28.06 ? 5  LEU C CD1 1 
ATOM   587 C CD2 . LEU C 1 6  ? -7.133  5.719   11.268  1.00 30.22 ? 5  LEU C CD2 1 
ATOM   588 N N   . GLU C 1 7  ? -3.589  7.237   14.112  1.00 15.07 ? 6  GLU C N   1 
ATOM   589 C CA  . GLU C 1 7  ? -2.280  7.774   13.741  1.00 16.18 ? 6  GLU C CA  1 
ATOM   590 C C   . GLU C 1 7  ? -1.257  6.641   13.658  1.00 18.52 ? 6  GLU C C   1 
ATOM   591 O O   . GLU C 1 7  ? -0.461  6.578   12.721  1.00 17.04 ? 6  GLU C O   1 
ATOM   592 C CB  . GLU C 1 7  ? -1.826  8.847   14.750  1.00 17.92 ? 6  GLU C CB  1 
ATOM   593 C CG  . GLU C 1 7  ? -2.745  10.086  14.745  1.00 24.15 ? 6  GLU C CG  1 
ATOM   594 C CD  . GLU C 1 7  ? -2.326  11.165  15.724  1.00 27.63 ? 6  GLU C CD  1 
ATOM   595 O OE1 . GLU C 1 7  ? -2.018  10.824  16.886  1.00 30.14 ? 6  GLU C OE1 1 
ATOM   596 O OE2 . GLU C 1 7  ? -2.329  12.357  15.339  1.00 27.35 ? 6  GLU C OE2 1 
ATOM   597 N N   . ASP C 1 8  ? -1.276  5.742   14.636  1.00 19.62 ? 7  ASP C N   1 
ATOM   598 C CA  . ASP C 1 8  ? -0.354  4.601   14.610  1.00 20.09 ? 7  ASP C CA  1 
ATOM   599 C C   . ASP C 1 8  ? -0.588  3.642   13.438  1.00 16.32 ? 7  ASP C C   1 
ATOM   600 O O   . ASP C 1 8  ? 0.365   3.081   12.886  1.00 17.72 ? 7  ASP C O   1 
ATOM   601 C CB  . ASP C 1 8  ? -0.450  3.827   15.916  1.00 25.90 ? 7  ASP C CB  1 
ATOM   602 C CG  . ASP C 1 8  ? -0.061  4.666   17.098  1.00 29.55 ? 7  ASP C CG  1 
ATOM   603 O OD1 . ASP C 1 8  ? 1.000   5.318   17.016  1.00 33.81 ? 7  ASP C OD1 1 
ATOM   604 O OD2 . ASP C 1 8  ? -0.804  4.672   18.106  1.00 37.50 ? 7  ASP C OD2 1 
ATOM   605 N N   . LYS C 1 9  ? -1.846  3.438   13.065  1.00 15.01 ? 8  LYS C N   1 
ATOM   606 C CA  . LYS C 1 9  ? -2.157  2.543   11.958  1.00 16.61 ? 8  LYS C CA  1 
ATOM   607 C C   . LYS C 1 9  ? -1.688  3.169   10.655  1.00 13.85 ? 8  LYS C C   1 
ATOM   608 O O   . LYS C 1 9  ? -1.204  2.470   9.759   1.00 14.22 ? 8  LYS C O   1 
ATOM   609 C CB  . LYS C 1 9  ? -3.655  2.245   11.871  1.00 18.86 ? 8  LYS C CB  1 
ATOM   610 C CG  . LYS C 1 9  ? -4.201  1.420   13.049  1.00 24.54 ? 8  LYS C CG  1 
ATOM   611 C CD  . LYS C 1 9  ? -5.665  1.050   12.873  1.00 25.18 ? 8  LYS C CD  1 
ATOM   612 C CE  . LYS C 1 9  ? -6.156  0.261   14.077  1.00 29.98 ? 8  LYS C CE  1 
ATOM   613 N NZ  . LYS C 1 9  ? -7.586  -0.123  13.987  1.00 33.47 ? 8  LYS C NZ  1 
ATOM   614 N N   . VAL C 1 10 ? -1.819  4.484   10.561  1.00 13.36 ? 9  VAL C N   1 
ATOM   615 C CA  . VAL C 1 10 ? -1.399  5.217   9.355   1.00 11.95 ? 9  VAL C CA  1 
ATOM   616 C C   . VAL C 1 10 ? 0.124   5.209   9.236   1.00 13.21 ? 9  VAL C C   1 
ATOM   617 O O   . VAL C 1 10 ? 0.676   5.062   8.157   1.00 13.06 ? 9  VAL C O   1 
ATOM   618 C CB  . VAL C 1 10 ? -1.920  6.668   9.410   1.00 14.84 ? 9  VAL C CB  1 
ATOM   619 C CG1 . VAL C 1 10 ? -1.323  7.513   8.265   1.00 14.90 ? 9  VAL C CG1 1 
ATOM   620 C CG2 . VAL C 1 10 ? -3.424  6.647   9.341   1.00 14.16 ? 9  VAL C CG2 1 
ATOM   621 N N   . GLU C 1 11 ? 0.813   5.350   10.357  1.00 13.47 ? 10 GLU C N   1 
ATOM   622 C CA  . GLU C 1 11 ? 2.266   5.355   10.311  1.00 14.83 ? 10 GLU C CA  1 
ATOM   623 C C   . GLU C 1 11 ? 2.757   4.000   9.868   1.00 14.16 ? 10 GLU C C   1 
ATOM   624 O O   . GLU C 1 11 ? 3.732   3.891   9.123   1.00 15.61 ? 10 GLU C O   1 
ATOM   625 C CB  . GLU C 1 11 ? 2.845   5.697   11.681  1.00 20.01 ? 10 GLU C CB  1 
ATOM   626 C CG  . GLU C 1 11 ? 4.354   5.813   11.656  1.00 29.48 ? 10 GLU C CG  1 
ATOM   627 C CD  . GLU C 1 11 ? 4.897   6.494   12.893  1.00 34.34 ? 10 GLU C CD  1 
ATOM   628 O OE1 . GLU C 1 11 ? 4.687   5.962   14.004  1.00 38.77 ? 10 GLU C OE1 1 
ATOM   629 O OE2 . GLU C 1 11 ? 5.529   7.569   12.749  1.00 41.25 ? 10 GLU C OE2 1 
ATOM   630 N N   . GLU C 1 12 ? 2.080   2.948   10.311  1.00 15.44 ? 11 GLU C N   1 
ATOM   631 C CA  . GLU C 1 12 ? 2.478   1.608   9.908   1.00 19.10 ? 11 GLU C CA  1 
ATOM   632 C C   . GLU C 1 12 ? 2.174   1.356   8.431   1.00 17.05 ? 11 GLU C C   1 
ATOM   633 O O   . GLU C 1 12 ? 2.917   0.639   7.762   1.00 13.91 ? 11 GLU C O   1 
ATOM   634 C CB  . GLU C 1 12 ? 1.832   0.564   10.823  1.00 24.70 ? 11 GLU C CB  1 
ATOM   635 C CG  . GLU C 1 12 ? 2.757   0.226   11.994  1.00 36.88 ? 11 GLU C CG  1 
ATOM   636 C CD  . GLU C 1 12 ? 3.281   1.457   12.732  1.00 41.23 ? 11 GLU C CD  1 
ATOM   637 O OE1 . GLU C 1 12 ? 2.504   2.114   13.462  1.00 45.20 ? 11 GLU C OE1 1 
ATOM   638 O OE2 . GLU C 1 12 ? 4.480   1.782   12.574  1.00 45.81 ? 11 GLU C OE2 1 
ATOM   639 N N   . LEU C 1 13 ? 1.099   1.968   7.928   1.00 12.92 ? 12 LEU C N   1 
ATOM   640 C CA  . LEU C 1 13 ? 0.731   1.846   6.515   1.00 12.08 ? 12 LEU C CA  1 
ATOM   641 C C   . LEU C 1 13 ? 1.751   2.601   5.645   1.00 10.99 ? 12 LEU C C   1 
ATOM   642 O O   . LEU C 1 13 ? 2.061   2.176   4.538   1.00 12.83 ? 12 LEU C O   1 
ATOM   643 C CB  . LEU C 1 13 ? -0.681  2.408   6.284   1.00 14.51 ? 12 LEU C CB  1 
ATOM   644 C CG  . LEU C 1 13 ? -1.894  1.550   6.672   1.00 17.00 ? 12 LEU C CG  1 
ATOM   645 C CD1 . LEU C 1 13 ? -3.162  2.393   6.509   1.00 15.92 ? 12 LEU C CD1 1 
ATOM   646 C CD2 . LEU C 1 13 ? -1.966  0.317   5.779   1.00 19.25 ? 12 LEU C CD2 1 
ATOM   647 N N   . LEU C 1 14 ? 2.254   3.726   6.135   1.00 11.27 ? 13 LEU C N   1 
ATOM   648 C CA  . LEU C 1 14 ? 3.260   4.481   5.387   1.00 14.24 ? 13 LEU C CA  1 
ATOM   649 C C   . LEU C 1 14 ? 4.528   3.645   5.267   1.00 14.28 ? 13 LEU C C   1 
ATOM   650 O O   . LEU C 1 14 ? 5.141   3.611   4.201   1.00 14.01 ? 13 LEU C O   1 
ATOM   651 C CB  . LEU C 1 14 ? 3.578   5.818   6.063   1.00 15.04 ? 13 LEU C CB  1 
ATOM   652 C CG  . LEU C 1 14 ? 2.481   6.864   5.875   1.00 17.10 ? 13 LEU C CG  1 
ATOM   653 C CD1 . LEU C 1 14 ? 2.640   7.964   6.895   1.00 18.35 ? 13 LEU C CD1 1 
ATOM   654 C CD2 . LEU C 1 14 ? 2.518   7.418   4.443   1.00 20.47 ? 13 LEU C CD2 1 
ATOM   655 N N   . SER C 1 15 ? 4.904   2.964   6.348   1.00 12.64 ? 14 SER C N   1 
ATOM   656 C CA  . SER C 1 15 ? 6.098   2.105   6.351   1.00 14.91 ? 14 SER C CA  1 
ATOM   657 C C   . SER C 1 15 ? 5.932   0.913   5.403   1.00 13.86 ? 14 SER C C   1 
ATOM   658 O O   . SER C 1 15 ? 6.841   0.597   4.630   1.00 14.40 ? 14 SER C O   1 
ATOM   659 C CB  . SER C 1 15 ? 6.390   1.592   7.771   1.00 16.63 ? 14 SER C CB  1 
ATOM   660 O OG  . SER C 1 15 ? 6.684   2.662   8.667   1.00 24.17 ? 14 SER C OG  1 
ATOM   661 N N   . LYS C 1 16 ? 4.788   0.235   5.483   1.00 13.45 ? 15 LYS C N   1 
ATOM   662 C CA  . LYS C 1 16 ? 4.518   -0.900  4.602   1.00 13.99 ? 15 LYS C CA  1 
ATOM   663 C C   . LYS C 1 16 ? 4.490   -0.467  3.137   1.00 14.14 ? 15 LYS C C   1 
ATOM   664 O O   . LYS C 1 16 ? 4.939   -1.208  2.271   1.00 15.03 ? 15 LYS C O   1 
ATOM   665 C CB  . LYS C 1 16 ? 3.171   -1.553  4.925   1.00 15.38 ? 15 LYS C CB  1 
ATOM   666 C CG  . LYS C 1 16 ? 3.170   -2.379  6.209   1.00 21.56 ? 15 LYS C CG  1 
ATOM   667 C CD  . LYS C 1 16 ? 1.820   -2.985  6.462   1.00 29.68 ? 15 LYS C CD  1 
ATOM   668 C CE  . LYS C 1 16 ? 1.812   -3.818  7.732   1.00 34.35 ? 15 LYS C CE  1 
ATOM   669 N NZ  . LYS C 1 16 ? 0.452   -4.357  8.001   1.00 35.19 ? 15 LYS C NZ  1 
ATOM   670 N N   A SER C 1 17 ? 3.966   0.730   2.881   0.41 12.48 ? 16 SER C N   1 
ATOM   671 N N   B SER C 1 17 ? 3.976   0.722   2.864   0.59 11.30 ? 16 SER C N   1 
ATOM   672 C CA  A SER C 1 17 ? 3.856   1.269   1.521   0.41 13.18 ? 16 SER C CA  1 
ATOM   673 C CA  B SER C 1 17 ? 3.890   1.194   1.479   0.59 11.72 ? 16 SER C CA  1 
ATOM   674 C C   A SER C 1 17 ? 5.233   1.522   0.909   0.41 13.05 ? 16 SER C C   1 
ATOM   675 C C   B SER C 1 17 ? 5.265   1.486   0.895   0.59 11.91 ? 16 SER C C   1 
ATOM   676 O O   A SER C 1 17 ? 5.454   1.283   -0.281  0.41 13.54 ? 16 SER C O   1 
ATOM   677 O O   B SER C 1 17 ? 5.528   1.237   -0.290  0.59 11.44 ? 16 SER C O   1 
ATOM   678 C CB  A SER C 1 17 ? 3.054   2.580   1.545   0.41 12.53 ? 16 SER C CB  1 
ATOM   679 C CB  B SER C 1 17 ? 3.003   2.434   1.425   0.59 11.27 ? 16 SER C CB  1 
ATOM   680 O OG  A SER C 1 17 ? 2.804   3.071   0.234   0.41 15.41 ? 16 SER C OG  1 
ATOM   681 O OG  B SER C 1 17 ? 1.682   2.070   1.782   0.59 13.02 ? 16 SER C OG  1 
ATOM   682 N N   . TYR C 1 18 ? 6.156   2.006   1.734   1.00 13.50 ? 17 TYR C N   1 
ATOM   683 C CA  . TYR C 1 18 ? 7.518   2.311   1.301   1.00 14.01 ? 17 TYR C CA  1 
ATOM   684 C C   . TYR C 1 18 ? 8.217   1.012   0.923   1.00 13.98 ? 17 TYR C C   1 
ATOM   685 O O   . TYR C 1 18 ? 8.868   0.913   -0.119  1.00 14.38 ? 17 TYR C O   1 
ATOM   686 C CB  . TYR C 1 18 ? 8.276   2.987   2.448   1.00 17.90 ? 17 TYR C CB  1 
ATOM   687 C CG  . TYR C 1 18 ? 9.743   3.206   2.172   1.00 20.53 ? 17 TYR C CG  1 
ATOM   688 C CD1 . TYR C 1 18 ? 10.162  4.153   1.234   1.00 21.77 ? 17 TYR C CD1 1 
ATOM   689 C CD2 . TYR C 1 18 ? 10.713  2.454   2.835   1.00 21.49 ? 17 TYR C CD2 1 
ATOM   690 C CE1 . TYR C 1 18 ? 11.522  4.343   0.963   1.00 21.25 ? 17 TYR C CE1 1 
ATOM   691 C CE2 . TYR C 1 18 ? 12.070  2.636   2.566   1.00 21.77 ? 17 TYR C CE2 1 
ATOM   692 C CZ  . TYR C 1 18 ? 12.462  3.580   1.630   1.00 21.29 ? 17 TYR C CZ  1 
ATOM   693 O OH  . TYR C 1 18 ? 13.793  3.771   1.339   1.00 25.91 ? 17 TYR C OH  1 
ATOM   694 N N   . HIS C 1 19 ? 8.065   0.023   1.784   1.00 12.82 ? 18 HIS C N   1 
ATOM   695 C CA  . HIS C 1 19 ? 8.670   -1.285  1.566   1.00 14.66 ? 18 HIS C CA  1 
ATOM   696 C C   . HIS C 1 19 ? 8.142   -1.930  0.282   1.00 14.10 ? 18 HIS C C   1 
ATOM   697 O O   . HIS C 1 19 ? 8.924   -2.413  -0.537  1.00 13.13 ? 18 HIS C O   1 
ATOM   698 C CB  . HIS C 1 19 ? 8.419   -2.179  2.780   1.00 18.84 ? 18 HIS C CB  1 
ATOM   699 C CG  . HIS C 1 19 ? 9.002   -3.553  2.644   1.00 25.44 ? 18 HIS C CG  1 
ATOM   700 N ND1 . HIS C 1 19 ? 8.277   -4.630  2.176   1.00 28.60 ? 18 HIS C ND1 1 
ATOM   701 C CD2 . HIS C 1 19 ? 10.262  -4.003  2.832   1.00 29.90 ? 18 HIS C CD2 1 
ATOM   702 C CE1 . HIS C 1 19 ? 9.067   -5.681  2.084   1.00 27.83 ? 18 HIS C CE1 1 
ATOM   703 N NE2 . HIS C 1 19 ? 10.278  -5.330  2.474   1.00 31.74 ? 18 HIS C NE2 1 
ATOM   704 N N   . LEU C 1 20 ? 6.826   -1.916  0.092   1.00 13.25 ? 19 LEU C N   1 
ATOM   705 C CA  . LEU C 1 20 ? 6.262   -2.502  -1.113  1.00 15.62 ? 19 LEU C CA  1 
ATOM   706 C C   . LEU C 1 20 ? 6.704   -1.782  -2.375  1.00 16.54 ? 19 LEU C C   1 
ATOM   707 O O   . LEU C 1 20 ? 6.926   -2.420  -3.416  1.00 14.46 ? 19 LEU C O   1 
ATOM   708 C CB  . LEU C 1 20 ? 4.736   -2.525  -1.016  1.00 18.34 ? 19 LEU C CB  1 
ATOM   709 C CG  . LEU C 1 20 ? 4.213   -3.470  0.068   1.00 22.65 ? 19 LEU C CG  1 
ATOM   710 C CD1 . LEU C 1 20 ? 2.688   -3.342  0.178   1.00 26.27 ? 19 LEU C CD1 1 
ATOM   711 C CD2 . LEU C 1 20 ? 4.625   -4.925  -0.258  1.00 27.78 ? 19 LEU C CD2 1 
ATOM   712 N N   . GLU C 1 21 ? 6.841   -0.460  -2.299  1.00 15.65 ? 20 GLU C N   1 
ATOM   713 C CA  . GLU C 1 21 ? 7.255   0.290   -3.493  1.00 19.49 ? 20 GLU C CA  1 
ATOM   714 C C   . GLU C 1 21 ? 8.679   -0.139  -3.846  1.00 20.21 ? 20 GLU C C   1 
ATOM   715 O O   . GLU C 1 21 ? 9.032   -0.243  -5.035  1.00 18.30 ? 20 GLU C O   1 
ATOM   716 C CB  . GLU C 1 21 ? 7.207   1.803   -3.262  1.00 21.98 ? 20 GLU C CB  1 
ATOM   717 C CG  . GLU C 1 21 ? 8.374   2.372   -2.501  1.00 33.73 ? 20 GLU C CG  1 
ATOM   718 C CD  . GLU C 1 21 ? 8.310   3.896   -2.354  1.00 35.30 ? 20 GLU C CD  1 
ATOM   719 O OE1 . GLU C 1 21 ? 9.391   4.513   -2.165  1.00 35.67 ? 20 GLU C OE1 1 
ATOM   720 O OE2 . GLU C 1 21 ? 7.189   4.475   -2.406  1.00 37.20 ? 20 GLU C OE2 1 
ATOM   721 N N   . ASN C 1 22 ? 9.508   -0.406  -2.832  1.00 17.04 ? 21 ASN C N   1 
ATOM   722 C CA  . ASN C 1 22 ? 10.869  -0.825  -3.133  1.00 18.40 ? 21 ASN C CA  1 
ATOM   723 C C   . ASN C 1 22 ? 10.868  -2.230  -3.722  1.00 19.43 ? 21 ASN C C   1 
ATOM   724 O O   . ASN C 1 22 ? 11.644  -2.514  -4.633  1.00 18.33 ? 21 ASN C O   1 
ATOM   725 C CB  . ASN C 1 22 ? 11.777  -0.766  -1.892  1.00 21.54 ? 21 ASN C CB  1 
ATOM   726 C CG  . ASN C 1 22 ? 11.983  0.656   -1.379  1.00 21.61 ? 21 ASN C CG  1 
ATOM   727 O OD1 . ASN C 1 22 ? 12.104  1.592   -2.161  1.00 23.46 ? 21 ASN C OD1 1 
ATOM   728 N ND2 . ASN C 1 22 ? 12.053  0.819   -0.067  1.00 24.61 ? 21 ASN C ND2 1 
ATOM   729 N N   . GLU C 1 23 ? 10.007  -3.107  -3.208  1.00 17.81 ? 22 GLU C N   1 
ATOM   730 C CA  . GLU C 1 23 ? 9.927   -4.466  -3.731  1.00 22.98 ? 22 GLU C CA  1 
ATOM   731 C C   . GLU C 1 23 ? 9.487   -4.424  -5.197  1.00 20.40 ? 22 GLU C C   1 
ATOM   732 O O   . GLU C 1 23 ? 10.038  -5.131  -6.051  1.00 21.88 ? 22 GLU C O   1 
ATOM   733 C CB  . GLU C 1 23 ? 8.912   -5.289  -2.935  1.00 25.05 ? 22 GLU C CB  1 
ATOM   734 C CG  . GLU C 1 23 ? 9.314   -5.533  -1.493  1.00 32.74 ? 22 GLU C CG  1 
ATOM   735 C CD  . GLU C 1 23 ? 10.471  -6.498  -1.394  1.00 37.52 ? 22 GLU C CD  1 
ATOM   736 O OE1 . GLU C 1 23 ? 10.298  -7.644  -1.858  1.00 40.13 ? 22 GLU C OE1 1 
ATOM   737 O OE2 . GLU C 1 23 ? 11.545  -6.119  -0.868  1.00 40.27 ? 22 GLU C OE2 1 
ATOM   738 N N   . VAL C 1 24 ? 8.492   -3.595  -5.476  1.00 17.08 ? 23 VAL C N   1 
ATOM   739 C CA  . VAL C 1 24 ? 7.971   -3.478  -6.837  1.00 19.28 ? 23 VAL C CA  1 
ATOM   740 C C   . VAL C 1 24 ? 9.066   -2.930  -7.760  1.00 19.37 ? 23 VAL C C   1 
ATOM   741 O O   . VAL C 1 24 ? 9.275   -3.442  -8.863  1.00 18.03 ? 23 VAL C O   1 
ATOM   742 C CB  . VAL C 1 24 ? 6.724   -2.555  -6.876  1.00 20.07 ? 23 VAL C CB  1 
ATOM   743 C CG1 . VAL C 1 24 ? 6.286   -2.338  -8.310  1.00 23.07 ? 23 VAL C CG1 1 
ATOM   744 C CG2 . VAL C 1 24 ? 5.580   -3.197  -6.074  1.00 23.58 ? 23 VAL C CG2 1 
ATOM   745 N N   . ALA C 1 25 ? 9.779   -1.904  -7.297  1.00 19.73 ? 24 ALA C N   1 
ATOM   746 C CA  . ALA C 1 25 ? 10.855  -1.310  -8.092  1.00 22.43 ? 24 ALA C CA  1 
ATOM   747 C C   . ALA C 1 25 ? 11.878  -2.379  -8.510  1.00 22.90 ? 24 ALA C C   1 
ATOM   748 O O   . ALA C 1 25 ? 12.281  -2.455  -9.683  1.00 25.04 ? 24 ALA C O   1 
ATOM   749 C CB  . ALA C 1 25 ? 11.542  -0.177  -7.295  1.00 21.60 ? 24 ALA C CB  1 
ATOM   750 N N   . ARG C 1 26 ? 12.298  -3.203  -7.560  1.00 24.44 ? 25 ARG C N   1 
ATOM   751 C CA  . ARG C 1 26 ? 13.252  -4.274  -7.851  1.00 28.50 ? 25 ARG C CA  1 
ATOM   752 C C   . ARG C 1 26 ? 12.687  -5.295  -8.856  1.00 28.77 ? 25 ARG C C   1 
ATOM   753 O O   . ARG C 1 26 ? 13.355  -5.660  -9.836  1.00 28.71 ? 25 ARG C O   1 
ATOM   754 C CB  . ARG C 1 26 ? 13.655  -5.010  -6.576  1.00 32.44 ? 25 ARG C CB  1 
ATOM   755 C CG  . ARG C 1 26 ? 14.822  -4.381  -5.825  1.00 37.21 ? 25 ARG C CG  1 
ATOM   756 C CD  . ARG C 1 26 ? 15.274  -5.241  -4.642  1.00 39.67 ? 25 ARG C CD  1 
ATOM   757 N NE  . ARG C 1 26 ? 14.345  -5.193  -3.503  1.00 42.67 ? 25 ARG C NE  1 
ATOM   758 C CZ  . ARG C 1 26 ? 14.213  -4.132  -2.700  1.00 44.70 ? 25 ARG C CZ  1 
ATOM   759 N NH1 . ARG C 1 26 ? 14.938  -3.024  -2.903  1.00 45.32 ? 25 ARG C NH1 1 
ATOM   760 N NH2 . ARG C 1 26 ? 13.377  -4.086  -1.656  1.00 44.02 ? 25 ARG C NH2 1 
ATOM   761 N N   . LEU C 1 27 ? 11.472  -5.752  -8.587  1.00 26.77 ? 26 LEU C N   1 
ATOM   762 C CA  . LEU C 1 27 ? 10.770  -6.715  -9.466  1.00 28.98 ? 26 LEU C CA  1 
ATOM   763 C C   . LEU C 1 27 ? 10.826  -6.216  -10.923 1.00 27.96 ? 26 LEU C C   1 
ATOM   764 O O   . LEU C 1 27 ? 11.114  -6.972  -11.860 1.00 27.88 ? 26 LEU C O   1 
ATOM   765 C CB  . LEU C 1 27 ? 9.277   -6.795  -9.094  1.00 32.51 ? 26 LEU C CB  1 
ATOM   766 C CG  . LEU C 1 27 ? 8.875   -7.905  -8.103  1.00 36.81 ? 26 LEU C CG  1 
ATOM   767 C CD1 . LEU C 1 27 ? 9.349   -7.638  -6.673  1.00 39.39 ? 26 LEU C CD1 1 
ATOM   768 C CD2 . LEU C 1 27 ? 7.346   -8.061  -8.000  1.00 37.05 ? 26 LEU C CD2 1 
ATOM   769 N N   . LYS C 1 28 ? 10.537  -4.928  -11.053 1.00 27.25 ? 27 LYS C N   1 
ATOM   770 C CA  . LYS C 1 28 ? 10.472  -4.229  -12.351 1.00 30.59 ? 27 LYS C CA  1 
ATOM   771 C C   . LYS C 1 28 ? 11.816  -4.212  -13.063 1.00 31.24 ? 27 LYS C C   1 
ATOM   772 O O   . LYS C 1 28 ? 11.910  -4.512  -14.251 1.00 30.81 ? 27 LYS C O   1 
ATOM   773 C CB  . LYS C 1 28 ? 10.041  -2.776  -12.148 1.00 31.62 ? 27 LYS C CB  1 
ATOM   774 C CG  . LYS C 1 28 ? 8.553   -2.626  -11.825 1.00 35.63 ? 27 LYS C CG  1 
ATOM   775 C CD  . LYS C 1 28 ? 8.153   -1.173  -11.563 1.00 38.54 ? 27 LYS C CD  1 
ATOM   776 C CE  . LYS C 1 28 ? 8.773   -0.196  -12.564 1.00 39.43 ? 27 LYS C CE  1 
ATOM   777 N NZ  . LYS C 1 28 ? 8.397   -0.487  -13.956 1.00 40.93 ? 27 LYS C NZ  1 
ATOM   778 N N   . LYS C 1 29 ? 12.862  -3.847  -12.341 1.00 31.94 ? 28 LYS C N   1 
ATOM   779 C CA  . LYS C 1 29 ? 14.178  -3.779  -12.948 1.00 34.63 ? 28 LYS C CA  1 
ATOM   780 C C   . LYS C 1 29 ? 14.664  -5.153  -13.405 1.00 37.45 ? 28 LYS C C   1 
ATOM   781 O O   . LYS C 1 29 ? 15.301  -5.270  -14.457 1.00 39.71 ? 28 LYS C O   1 
ATOM   782 C CB  . LYS C 1 29 ? 15.161  -3.164  -11.963 1.00 34.45 ? 28 LYS C CB  1 
ATOM   783 C CG  . LYS C 1 29 ? 16.450  -2.683  -12.590 1.00 36.68 ? 28 LYS C CG  1 
ATOM   784 C CD  . LYS C 1 29 ? 17.204  -1.834  -11.585 1.00 39.54 ? 28 LYS C CD  1 
ATOM   785 C CE  . LYS C 1 29 ? 18.379  -1.121  -12.222 1.00 40.65 ? 28 LYS C CE  1 
ATOM   786 N NZ  . LYS C 1 29 ? 19.000  -0.167  -11.260 1.00 41.99 ? 28 LYS C NZ  1 
ATOM   787 N N   . LEU C 1 30 ? 14.355  -6.190  -12.630 1.00 36.63 ? 29 LEU C N   1 
ATOM   788 C CA  . LEU C 1 30 ? 14.769  -7.545  -12.971 1.00 38.30 ? 29 LEU C CA  1 
ATOM   789 C C   . LEU C 1 30 ? 13.984  -8.150  -14.131 1.00 38.76 ? 29 LEU C C   1 
ATOM   790 O O   . LEU C 1 30 ? 14.436  -9.117  -14.747 1.00 39.36 ? 29 LEU C O   1 
ATOM   791 C CB  . LEU C 1 30 ? 14.668  -8.462  -11.751 1.00 39.52 ? 29 LEU C CB  1 
ATOM   792 C CG  . LEU C 1 30 ? 15.638  -8.098  -10.619 1.00 41.61 ? 29 LEU C CG  1 
ATOM   793 C CD1 . LEU C 1 30 ? 15.510  -9.091  -9.481  1.00 43.21 ? 29 LEU C CD1 1 
ATOM   794 C CD2 . LEU C 1 30 ? 17.064  -8.107  -11.151 1.00 39.48 ? 29 LEU C CD2 1 
ATOM   795 N N   . VAL C 1 31 ? 12.812  -7.594  -14.430 1.00 37.26 ? 30 VAL C N   1 
ATOM   796 C CA  . VAL C 1 31 ? 12.011  -8.107  -15.543 1.00 36.58 ? 30 VAL C CA  1 
ATOM   797 C C   . VAL C 1 31 ? 12.278  -7.302  -16.824 1.00 36.73 ? 30 VAL C C   1 
ATOM   798 O O   . VAL C 1 31 ? 12.147  -7.824  -17.939 1.00 33.45 ? 30 VAL C O   1 
ATOM   799 C CB  . VAL C 1 31 ? 10.489  -8.072  -15.238 1.00 35.91 ? 30 VAL C CB  1 
ATOM   800 C CG1 . VAL C 1 31 ? 10.183  -8.898  -13.996 1.00 36.87 ? 30 VAL C CG1 1 
ATOM   801 C CG2 . VAL C 1 31 ? 10.019  -6.651  -15.072 1.00 35.16 ? 30 VAL C CG2 1 
ATOM   802 N N   . GLY C 1 32 ? 12.660  -6.034  -16.671 1.00 35.42 ? 31 GLY C N   1 
ATOM   803 C CA  . GLY C 1 32 ? 12.931  -5.225  -17.847 1.00 37.47 ? 31 GLY C CA  1 
ATOM   804 C C   . GLY C 1 32 ? 14.402  -5.099  -18.196 1.00 39.39 ? 31 GLY C C   1 
ATOM   805 O O   . GLY C 1 32 ? 14.792  -4.041  -18.733 1.00 41.88 ? 31 GLY C O   1 
HETATM 806 O O   . HOH D 2 .  ? -1.833  -4.856  6.174   1.00 23.82 ? 34 HOH A O   1 
HETATM 807 O O   . HOH D 2 .  ? 5.060   -3.921  3.375   1.00 46.80 ? 35 HOH A O   1 
HETATM 808 O O   . HOH D 2 .  ? -2.870  0.139   1.241   1.00 32.69 ? 36 HOH A O   1 
HETATM 809 O O   . HOH D 2 .  ? -7.045  -8.539  0.888   1.00 32.73 ? 37 HOH A O   1 
HETATM 810 O O   . HOH D 2 .  ? 0.704   -11.780 3.368   1.00 70.14 ? 38 HOH A O   1 
HETATM 811 O O   . HOH D 2 .  ? -9.411  3.110   1.993   1.00 36.53 ? 39 HOH A O   1 
HETATM 812 O O   . HOH D 2 .  ? -8.392  -3.442  -3.367  1.00 48.61 ? 40 HOH A O   1 
HETATM 813 O O   . HOH D 2 .  ? 3.608   -7.835  6.024   1.00 47.14 ? 41 HOH A O   1 
HETATM 814 O O   . HOH D 2 .  ? -19.205 5.594   8.741   1.00 44.55 ? 42 HOH A O   1 
HETATM 815 O O   . HOH D 2 .  ? -9.582  2.339   -1.356  1.00 45.96 ? 43 HOH A O   1 
HETATM 816 O O   . HOH D 2 .  ? -7.265  -5.775  -2.584  1.00 34.80 ? 44 HOH A O   1 
HETATM 817 O O   . HOH D 2 .  ? -8.317  -5.344  -0.363  1.00 31.84 ? 45 HOH A O   1 
HETATM 818 O O   . HOH D 2 .  ? 3.557   -16.516 -3.213  1.00 38.64 ? 46 HOH A O   1 
HETATM 819 O O   . HOH D 2 .  ? -0.495  -7.087  5.617   1.00 37.06 ? 47 HOH A O   1 
HETATM 820 O O   . HOH D 2 .  ? 7.929   -15.080 -2.815  1.00 40.87 ? 48 HOH A O   1 
HETATM 821 O O   . HOH D 2 .  ? -17.119 2.150   10.922  1.00 32.44 ? 49 HOH A O   1 
HETATM 822 O O   . HOH D 2 .  ? -9.296  -1.241  -4.116  1.00 65.54 ? 50 HOH A O   1 
HETATM 823 O O   . HOH D 2 .  ? -15.837 12.035  14.491  1.00 44.87 ? 51 HOH A O   1 
HETATM 824 O O   . HOH D 2 .  ? -18.886 12.711  6.920   1.00 57.83 ? 52 HOH A O   1 
HETATM 825 O O   . HOH D 2 .  ? -13.775 -0.375  4.967   1.00 29.91 ? 53 HOH A O   1 
HETATM 826 O O   . HOH D 2 .  ? -0.902  -14.422 4.308   1.00 43.05 ? 54 HOH A O   1 
HETATM 827 O O   . HOH D 2 .  ? 0.296   -15.784 2.509   1.00 61.26 ? 55 HOH A O   1 
HETATM 828 O O   . HOH D 2 .  ? 2.242   -14.808 -1.903  1.00 35.01 ? 56 HOH A O   1 
HETATM 829 O O   . HOH D 2 .  ? -8.818  -10.107 -2.156  1.00 70.61 ? 57 HOH A O   1 
HETATM 830 O O   . HOH D 2 .  ? -2.554  -6.513  -7.278  1.00 56.84 ? 58 HOH A O   1 
HETATM 831 O O   . HOH D 2 .  ? -18.307 16.482  9.840   1.00 63.00 ? 59 HOH A O   1 
HETATM 832 O O   . HOH D 2 .  ? -12.736 2.615   17.637  1.00 45.87 ? 60 HOH A O   1 
HETATM 833 O O   . HOH D 2 .  ? -14.189 3.608   15.824  1.00 52.17 ? 61 HOH A O   1 
HETATM 834 O O   . HOH D 2 .  ? -9.265  1.384   11.230  1.00 41.92 ? 62 HOH A O   1 
HETATM 835 O O   . HOH D 2 .  ? 0.742   -18.241 -3.825  1.00 47.45 ? 63 HOH A O   1 
HETATM 836 O O   . HOH D 2 .  ? -15.520 6.320   5.164   1.00 54.03 ? 64 HOH A O   1 
HETATM 837 O O   . HOH D 2 .  ? -15.035 14.707  4.603   1.00 53.25 ? 65 HOH A O   1 
HETATM 838 O O   . HOH D 2 .  ? -13.795 6.701   -0.809  1.00 48.18 ? 66 HOH A O   1 
HETATM 839 O O   . HOH D 2 .  ? -11.299 -5.599  1.037   1.00 62.72 ? 67 HOH A O   1 
HETATM 840 O O   . HOH D 2 .  ? -5.544  -9.308  -7.785  1.00 52.31 ? 68 HOH A O   1 
HETATM 841 O O   . HOH D 2 .  ? 4.641   -15.787 1.064   1.00 52.69 ? 69 HOH A O   1 
HETATM 842 O O   . HOH D 2 .  ? 1.219   -16.688 -0.074  1.00 71.69 ? 70 HOH A O   1 
HETATM 843 O O   . HOH D 2 .  ? 1.831   -16.043 -11.129 1.00 66.31 ? 71 HOH A O   1 
HETATM 844 O O   . HOH D 2 .  ? 0.683   -18.636 -10.025 1.00 49.66 ? 72 HOH A O   1 
HETATM 845 O O   . HOH E 2 .  ? -7.428  18.047  14.637  1.00 25.28 ? 34 HOH B O   1 
HETATM 846 O O   . HOH E 2 .  ? -2.056  14.346  0.757   1.00 26.45 ? 35 HOH B O   1 
HETATM 847 O O   . HOH E 2 .  ? 2.742   9.146   10.443  1.00 25.43 ? 36 HOH B O   1 
HETATM 848 O O   . HOH E 2 .  ? -0.900  2.786   0.660   1.00 30.77 ? 37 HOH B O   1 
HETATM 849 O O   . HOH E 2 .  ? -12.029 16.837  10.272  1.00 40.48 ? 38 HOH B O   1 
HETATM 850 O O   . HOH E 2 .  ? -8.551  11.151  3.460   1.00 28.13 ? 39 HOH B O   1 
HETATM 851 O O   . HOH E 2 .  ? -6.067  9.792   -2.732  1.00 28.49 ? 40 HOH B O   1 
HETATM 852 O O   . HOH E 2 .  ? -0.458  -12.830 -17.929 1.00 39.35 ? 41 HOH B O   1 
HETATM 853 O O   . HOH E 2 .  ? -7.817  19.188  11.933  1.00 29.05 ? 42 HOH B O   1 
HETATM 854 O O   . HOH E 2 .  ? -0.504  11.765  11.366  1.00 42.26 ? 43 HOH B O   1 
HETATM 855 O O   . HOH E 2 .  ? 4.289   7.728   9.239   1.00 48.77 ? 44 HOH B O   1 
HETATM 856 O O   . HOH E 2 .  ? -2.952  -7.822  -15.348 1.00 49.75 ? 45 HOH B O   1 
HETATM 857 O O   . HOH E 2 .  ? 0.215   -14.005 -13.436 1.00 56.67 ? 46 HOH B O   1 
HETATM 858 O O   . HOH E 2 .  ? -1.001  12.725  21.786  1.00 75.21 ? 47 HOH B O   1 
HETATM 859 O O   . HOH E 2 .  ? 1.785   16.749  8.235   1.00 30.00 ? 48 HOH B O   1 
HETATM 860 O O   . HOH E 2 .  ? -8.761  10.630  -1.044  1.00 44.46 ? 49 HOH B O   1 
HETATM 861 O O   . HOH E 2 .  ? -3.501  5.931   -9.978  1.00 57.05 ? 50 HOH B O   1 
HETATM 862 O O   . HOH E 2 .  ? -13.141 17.911  5.248   1.00 33.67 ? 51 HOH B O   1 
HETATM 863 O O   . HOH E 2 .  ? -3.682  -11.973 -10.611 1.00 50.01 ? 52 HOH B O   1 
HETATM 864 O O   . HOH E 2 .  ? 0.793   2.238   -12.079 1.00 53.22 ? 53 HOH B O   1 
HETATM 865 O O   . HOH E 2 .  ? -10.538 21.315  8.436   1.00 41.77 ? 54 HOH B O   1 
HETATM 866 O O   . HOH E 2 .  ? -10.088 19.551  10.536  1.00 45.15 ? 55 HOH B O   1 
HETATM 867 O O   . HOH E 2 .  ? -0.801  11.759  -3.847  1.00 56.85 ? 56 HOH B O   1 
HETATM 868 O O   . HOH E 2 .  ? -2.099  19.015  7.572   1.00 30.32 ? 57 HOH B O   1 
HETATM 869 O O   . HOH E 2 .  ? -2.516  0.315   -13.983 1.00 59.56 ? 58 HOH B O   1 
HETATM 870 O O   . HOH E 2 .  ? -7.399  -6.221  -7.531  1.00 46.68 ? 59 HOH B O   1 
HETATM 871 O O   . HOH E 2 .  ? -6.416  -6.547  -9.566  1.00 62.76 ? 60 HOH B O   1 
HETATM 872 O O   . HOH E 2 .  ? -4.748  -6.974  -11.226 1.00 71.00 ? 61 HOH B O   1 
HETATM 873 O O   . HOH E 2 .  ? -8.236  -1.911  -7.038  1.00 66.16 ? 62 HOH B O   1 
HETATM 874 O O   . HOH E 2 .  ? -5.929  2.424   -11.034 1.00 51.36 ? 63 HOH B O   1 
HETATM 875 O O   . HOH E 2 .  ? -5.904  -3.666  -12.944 1.00 61.94 ? 64 HOH B O   1 
HETATM 876 O O   . HOH E 2 .  ? -4.543  -3.129  -17.012 1.00 63.65 ? 65 HOH B O   1 
HETATM 877 O O   . HOH F 2 .  ? -2.313  13.299  12.872  1.00 16.01 ? 34 HOH C O   1 
HETATM 878 O O   . HOH F 2 .  ? -0.096  9.197   11.482  1.00 28.04 ? 35 HOH C O   1 
HETATM 879 O O   . HOH F 2 .  ? 8.012   1.167   -7.148  1.00 25.24 ? 36 HOH C O   1 
HETATM 880 O O   . HOH F 2 .  ? 12.801  -0.225  -10.977 1.00 30.86 ? 37 HOH C O   1 
HETATM 881 O O   . HOH F 2 .  ? -8.007  5.012   24.497  1.00 48.89 ? 38 HOH C O   1 
HETATM 882 O O   . HOH F 2 .  ? 5.505   5.687   2.604   1.00 30.32 ? 39 HOH C O   1 
HETATM 883 O O   . HOH F 2 .  ? 0.975   10.203  16.831  1.00 39.37 ? 40 HOH C O   1 
HETATM 884 O O   . HOH F 2 .  ? 0.315   13.578  15.683  1.00 40.35 ? 41 HOH C O   1 
HETATM 885 O O   . HOH F 2 .  ? 3.496   3.646   16.862  1.00 38.49 ? 42 HOH C O   1 
HETATM 886 O O   . HOH F 2 .  ? -9.119  4.668   15.805  1.00 32.07 ? 43 HOH C O   1 
HETATM 887 O O   . HOH F 2 .  ? -6.415  -2.756  12.029  1.00 48.55 ? 44 HOH C O   1 
HETATM 888 O O   . HOH F 2 .  ? -3.796  -2.738  12.803  1.00 36.76 ? 45 HOH C O   1 
HETATM 889 O O   . HOH F 2 .  ? -1.721  -3.657  10.972  1.00 34.95 ? 46 HOH C O   1 
HETATM 890 O O   . HOH F 2 .  ? 9.020   3.369   -6.765  1.00 43.06 ? 47 HOH C O   1 
HETATM 891 O O   . HOH F 2 .  ? -8.668  2.225   13.639  1.00 44.39 ? 48 HOH C O   1 
HETATM 892 O O   . HOH F 2 .  ? 20.839  -5.259  -19.335 1.00 58.68 ? 49 HOH C O   1 
HETATM 893 O O   . HOH F 2 .  ? -1.900  -5.314  9.016   1.00 61.55 ? 50 HOH C O   1 
HETATM 894 O O   . HOH F 2 .  ? 4.367   -1.131  8.980   1.00 39.28 ? 51 HOH C O   1 
HETATM 895 O O   . HOH F 2 .  ? -9.091  7.432   15.491  1.00 52.34 ? 52 HOH C O   1 
HETATM 896 O O   . HOH F 2 .  ? 1.692   14.302  17.900  1.00 53.71 ? 53 HOH C O   1 
HETATM 897 O O   . HOH F 2 .  ? 2.874   11.744  16.858  1.00 53.89 ? 54 HOH C O   1 
HETATM 898 O O   . HOH F 2 .  ? 2.602   -0.878  14.489  1.00 43.93 ? 55 HOH C O   1 
HETATM 899 O O   . HOH F 2 .  ? 10.749  1.631   -10.467 1.00 30.77 ? 56 HOH C O   1 
HETATM 900 O O   . HOH F 2 .  ? 17.345  -7.773  -22.480 1.00 33.35 ? 57 HOH C O   1 
HETATM 901 O O   . HOH F 2 .  ? 16.822  -6.750  -24.580 1.00 52.62 ? 58 HOH C O   1 
HETATM 902 O O   . HOH F 2 .  ? -9.228  -2.523  10.222  1.00 47.78 ? 59 HOH C O   1 
HETATM 903 O O   . HOH F 2 .  ? 6.559   -7.231  0.536   1.00 47.92 ? 60 HOH C O   1 
HETATM 904 O O   . HOH F 2 .  ? 6.045   -0.698  13.126  1.00 63.30 ? 61 HOH C O   1 
HETATM 905 O O   . HOH F 2 .  ? 8.329   -1.024  9.305   1.00 64.89 ? 62 HOH C O   1 
HETATM 906 O O   . HOH F 2 .  ? 14.869  -0.823  -7.752  1.00 45.70 ? 63 HOH C O   1 
HETATM 907 O O   . HOH F 2 .  ? 11.427  -7.232  -4.703  1.00 43.56 ? 64 HOH C O   1 
HETATM 908 O O   . HOH F 2 .  ? -14.056 9.655   17.614  1.00 65.94 ? 65 HOH C O   1 
HETATM 909 O O   . HOH F 2 .  ? -13.297 8.823   19.875  1.00 49.94 ? 66 HOH C O   1 
HETATM 910 O O   . HOH F 2 .  ? -1.357  -0.249  10.615  1.00 45.40 ? 67 HOH C O   1 
HETATM 911 O O   . HOH F 2 .  ? 3.939   4.402   -4.230  1.00 53.72 ? 68 HOH C O   1 
HETATM 912 O O   . HOH F 2 .  ? 4.753   3.983   -1.940  1.00 40.70 ? 69 HOH C O   1 
HETATM 913 O O   . HOH F 2 .  ? -6.931  2.626   24.660  1.00 51.09 ? 70 HOH C O   1 
HETATM 914 O O   . HOH F 2 .  ? -5.684  3.464   21.880  1.00 49.38 ? 71 HOH C O   1 
HETATM 915 O O   . HOH F 2 .  ? 4.701   9.723   15.627  1.00 48.36 ? 72 HOH C O   1 
HETATM 916 O O   . HOH F 2 .  ? 13.638  1.819   -5.393  1.00 66.85 ? 73 HOH C O   1 
HETATM 917 O O   . HOH F 2 .  ? 10.733  -2.682  -15.634 1.00 49.93 ? 74 HOH C O   1 
HETATM 918 O O   . HOH F 2 .  ? 11.053  -1.440  -18.856 1.00 68.75 ? 75 HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ACE 1  0  0  ACE ACE A . n 
A 1 2  ARG 2  1  1  ARG ARG A . n 
A 1 3  MET 3  2  2  MET MET A . n 
A 1 4  LYS 4  3  3  LYS LYS A . n 
A 1 5  GLN 5  4  4  GLN GLN A . n 
A 1 6  LEU 6  5  5  LEU LEU A . n 
A 1 7  GLU 7  6  6  GLU GLU A . n 
A 1 8  ASP 8  7  7  ASP ASP A . n 
A 1 9  LYS 9  8  8  LYS LYS A . n 
A 1 10 VAL 10 9  9  VAL VAL A . n 
A 1 11 GLU 11 10 10 GLU GLU A . n 
A 1 12 GLU 12 11 11 GLU GLU A . n 
A 1 13 LEU 13 12 12 LEU LEU A . n 
A 1 14 LEU 14 13 13 LEU LEU A . n 
A 1 15 SER 15 14 14 SER SER A . n 
A 1 16 LYS 16 15 15 LYS LYS A . n 
A 1 17 SER 17 16 16 SER SER A . n 
A 1 18 TYR 18 17 17 TYR TYR A . n 
A 1 19 HIS 19 18 18 HIS HIS A . n 
A 1 20 LEU 20 19 19 LEU LEU A . n 
A 1 21 GLU 21 20 20 GLU GLU A . n 
A 1 22 ASN 22 21 21 ASN ASN A . n 
A 1 23 GLU 23 22 22 GLU GLU A . n 
A 1 24 VAL 24 23 23 VAL VAL A . n 
A 1 25 ALA 25 24 24 ALA ALA A . n 
A 1 26 ARG 26 25 25 ARG ARG A . n 
A 1 27 LEU 27 26 26 LEU LEU A . n 
A 1 28 LYS 28 27 27 LYS LYS A . n 
A 1 29 LYS 29 28 28 LYS LYS A . n 
A 1 30 LEU 30 29 29 LEU LEU A . n 
A 1 31 VAL 31 30 30 VAL VAL A . n 
A 1 32 GLY 32 31 31 GLY GLY A . n 
A 1 33 GLU 33 32 32 GLU GLU A . n 
A 1 34 ARG 34 33 ?  ?   ?   A . n 
B 1 1  ACE 1  0  0  ACE ACE B . n 
B 1 2  ARG 2  1  1  ARG ARG B . n 
B 1 3  MET 3  2  2  MET MET B . n 
B 1 4  LYS 4  3  3  LYS LYS B . n 
B 1 5  GLN 5  4  4  GLN GLN B . n 
B 1 6  LEU 6  5  5  LEU LEU B . n 
B 1 7  GLU 7  6  6  GLU GLU B . n 
B 1 8  ASP 8  7  7  ASP ASP B . n 
B 1 9  LYS 9  8  8  LYS LYS B . n 
B 1 10 VAL 10 9  9  VAL VAL B . n 
B 1 11 GLU 11 10 10 GLU GLU B . n 
B 1 12 GLU 12 11 11 GLU GLU B . n 
B 1 13 LEU 13 12 12 LEU LEU B . n 
B 1 14 LEU 14 13 13 LEU LEU B . n 
B 1 15 SER 15 14 14 SER SER B . n 
B 1 16 LYS 16 15 15 LYS LYS B . n 
B 1 17 SER 17 16 16 SER SER B . n 
B 1 18 TYR 18 17 17 TYR TYR B . n 
B 1 19 HIS 19 18 18 HIS HIS B . n 
B 1 20 LEU 20 19 19 LEU LEU B . n 
B 1 21 GLU 21 20 20 GLU GLU B . n 
B 1 22 ASN 22 21 21 ASN ASN B . n 
B 1 23 GLU 23 22 22 GLU GLU B . n 
B 1 24 VAL 24 23 23 VAL VAL B . n 
B 1 25 ALA 25 24 24 ALA ALA B . n 
B 1 26 ARG 26 25 25 ARG ARG B . n 
B 1 27 LEU 27 26 26 LEU LEU B . n 
B 1 28 LYS 28 27 27 LYS LYS B . n 
B 1 29 LYS 29 28 28 LYS LYS B . n 
B 1 30 LEU 30 29 29 LEU LEU B . n 
B 1 31 VAL 31 30 30 VAL VAL B . n 
B 1 32 GLY 32 31 31 GLY GLY B . n 
B 1 33 GLU 33 32 ?  ?   ?   B . n 
B 1 34 ARG 34 33 ?  ?   ?   B . n 
C 1 1  ACE 1  0  0  ACE ACE C . n 
C 1 2  ARG 2  1  1  ARG ARG C . n 
C 1 3  MET 3  2  2  MET MET C . n 
C 1 4  LYS 4  3  3  LYS LYS C . n 
C 1 5  GLN 5  4  4  GLN GLN C . n 
C 1 6  LEU 6  5  5  LEU LEU C . n 
C 1 7  GLU 7  6  6  GLU GLU C . n 
C 1 8  ASP 8  7  7  ASP ASP C . n 
C 1 9  LYS 9  8  8  LYS LYS C . n 
C 1 10 VAL 10 9  9  VAL VAL C . n 
C 1 11 GLU 11 10 10 GLU GLU C . n 
C 1 12 GLU 12 11 11 GLU GLU C . n 
C 1 13 LEU 13 12 12 LEU LEU C . n 
C 1 14 LEU 14 13 13 LEU LEU C . n 
C 1 15 SER 15 14 14 SER SER C . n 
C 1 16 LYS 16 15 15 LYS LYS C . n 
C 1 17 SER 17 16 16 SER SER C . n 
C 1 18 TYR 18 17 17 TYR TYR C . n 
C 1 19 HIS 19 18 18 HIS HIS C . n 
C 1 20 LEU 20 19 19 LEU LEU C . n 
C 1 21 GLU 21 20 20 GLU GLU C . n 
C 1 22 ASN 22 21 21 ASN ASN C . n 
C 1 23 GLU 23 22 22 GLU GLU C . n 
C 1 24 VAL 24 23 23 VAL VAL C . n 
C 1 25 ALA 25 24 24 ALA ALA C . n 
C 1 26 ARG 26 25 25 ARG ARG C . n 
C 1 27 LEU 27 26 26 LEU LEU C . n 
C 1 28 LYS 28 27 27 LYS LYS C . n 
C 1 29 LYS 29 28 28 LYS LYS C . n 
C 1 30 LEU 30 29 29 LEU LEU C . n 
C 1 31 VAL 31 30 30 VAL VAL C . n 
C 1 32 GLY 32 31 31 GLY GLY C . n 
C 1 33 GLU 33 32 ?  ?   ?   C . n 
C 1 34 ARG 34 33 ?  ?   ?   C . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4100 ? 
1 MORE         -39  ? 
1 'SSA (A^2)'  6470 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-08-08 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .   ? 1 
CNS       refinement       0.5 ? 2 
DENZO     'data reduction' .   ? 3 
SCALEPACK 'data scaling'   .   ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             C 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              25 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             C 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              25 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             C 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              25 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                123.88 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            3.58 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    LEU 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     29 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -78.64 
_pdbx_validate_torsion.psi             44.67 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A GLU 10 ? CD  ? A GLU 11 CD  
2  1 Y 0 A GLU 10 ? OE1 ? A GLU 11 OE1 
3  1 Y 0 A GLU 10 ? OE2 ? A GLU 11 OE2 
4  1 Y 0 A GLU 32 ? C   ? A GLU 33 C   
5  1 Y 0 B GLU 10 ? CD  ? B GLU 11 CD  
6  1 Y 0 B GLU 10 ? OE1 ? B GLU 11 OE1 
7  1 Y 0 B GLU 10 ? OE2 ? B GLU 11 OE2 
8  1 Y 0 C LYS 3  ? CD  ? C LYS 4  CD  
9  1 Y 0 C LYS 3  ? CE  ? C LYS 4  CE  
10 1 Y 0 C LYS 3  ? NZ  ? C LYS 4  NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ARG 33 ? A ARG 34 
2 1 Y 1 B GLU 32 ? B GLU 33 
3 1 Y 1 B ARG 33 ? B ARG 34 
4 1 Y 1 C GLU 32 ? C GLU 33 
5 1 Y 1 C ARG 33 ? C ARG 34 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 HOH 1  34 2   HOH TIP A . 
D 2 HOH 2  35 10  HOH TIP A . 
D 2 HOH 3  36 12  HOH TIP A . 
D 2 HOH 4  37 17  HOH TIP A . 
D 2 HOH 5  38 19  HOH TIP A . 
D 2 HOH 6  39 21  HOH TIP A . 
D 2 HOH 7  40 22  HOH TIP A . 
D 2 HOH 8  41 26  HOH TIP A . 
D 2 HOH 9  42 28  HOH TIP A . 
D 2 HOH 10 43 31  HOH TIP A . 
D 2 HOH 11 44 32  HOH TIP A . 
D 2 HOH 12 45 38  HOH TIP A . 
D 2 HOH 13 46 39  HOH TIP A . 
D 2 HOH 14 47 40  HOH TIP A . 
D 2 HOH 15 48 43  HOH TIP A . 
D 2 HOH 16 49 47  HOH TIP A . 
D 2 HOH 17 50 52  HOH TIP A . 
D 2 HOH 18 51 53  HOH TIP A . 
D 2 HOH 19 52 54  HOH TIP A . 
D 2 HOH 20 53 56  HOH TIP A . 
D 2 HOH 21 54 57  HOH TIP A . 
D 2 HOH 22 55 58  HOH TIP A . 
D 2 HOH 23 56 59  HOH TIP A . 
D 2 HOH 24 57 60  HOH TIP A . 
D 2 HOH 25 58 61  HOH TIP A . 
D 2 HOH 26 59 71  HOH TIP A . 
D 2 HOH 27 60 72  HOH TIP A . 
D 2 HOH 28 61 73  HOH TIP A . 
D 2 HOH 29 62 74  HOH TIP A . 
D 2 HOH 30 63 85  HOH TIP A . 
D 2 HOH 31 64 90  HOH TIP A . 
D 2 HOH 32 65 91  HOH TIP A . 
D 2 HOH 33 66 92  HOH TIP A . 
D 2 HOH 34 67 94  HOH TIP A . 
D 2 HOH 35 68 95  HOH TIP A . 
D 2 HOH 36 69 99  HOH TIP A . 
D 2 HOH 37 70 100 HOH TIP A . 
D 2 HOH 38 71 101 HOH TIP A . 
D 2 HOH 39 72 102 HOH TIP A . 
E 2 HOH 1  34 1   HOH TIP B . 
E 2 HOH 2  35 4   HOH TIP B . 
E 2 HOH 3  36 5   HOH TIP B . 
E 2 HOH 4  37 8   HOH TIP B . 
E 2 HOH 5  38 9   HOH TIP B . 
E 2 HOH 6  39 11  HOH TIP B . 
E 2 HOH 7  40 18  HOH TIP B . 
E 2 HOH 8  41 23  HOH TIP B . 
E 2 HOH 9  42 24  HOH TIP B . 
E 2 HOH 10 43 25  HOH TIP B . 
E 2 HOH 11 44 30  HOH TIP B . 
E 2 HOH 12 45 37  HOH TIP B . 
E 2 HOH 13 46 41  HOH TIP B . 
E 2 HOH 14 47 42  HOH TIP B . 
E 2 HOH 15 48 45  HOH TIP B . 
E 2 HOH 16 49 46  HOH TIP B . 
E 2 HOH 17 50 49  HOH TIP B . 
E 2 HOH 18 51 55  HOH TIP B . 
E 2 HOH 19 52 62  HOH TIP B . 
E 2 HOH 20 53 63  HOH TIP B . 
E 2 HOH 21 54 77  HOH TIP B . 
E 2 HOH 22 55 78  HOH TIP B . 
E 2 HOH 23 56 79  HOH TIP B . 
E 2 HOH 24 57 84  HOH TIP B . 
E 2 HOH 25 58 87  HOH TIP B . 
E 2 HOH 26 59 96  HOH TIP B . 
E 2 HOH 27 60 97  HOH TIP B . 
E 2 HOH 28 61 98  HOH TIP B . 
E 2 HOH 29 62 105 HOH TIP B . 
E 2 HOH 30 63 106 HOH TIP B . 
E 2 HOH 31 64 107 HOH TIP B . 
E 2 HOH 32 65 108 HOH TIP B . 
F 2 HOH 1  34 3   HOH TIP C . 
F 2 HOH 2  35 6   HOH TIP C . 
F 2 HOH 3  36 7   HOH TIP C . 
F 2 HOH 4  37 13  HOH TIP C . 
F 2 HOH 5  38 14  HOH TIP C . 
F 2 HOH 6  39 15  HOH TIP C . 
F 2 HOH 7  40 16  HOH TIP C . 
F 2 HOH 8  41 20  HOH TIP C . 
F 2 HOH 9  42 27  HOH TIP C . 
F 2 HOH 10 43 29  HOH TIP C . 
F 2 HOH 11 44 33  HOH TIP C . 
F 2 HOH 12 45 34  HOH TIP C . 
F 2 HOH 13 46 35  HOH TIP C . 
F 2 HOH 14 47 36  HOH TIP C . 
F 2 HOH 15 48 44  HOH TIP C . 
F 2 HOH 16 49 48  HOH TIP C . 
F 2 HOH 17 50 50  HOH TIP C . 
F 2 HOH 18 51 51  HOH TIP C . 
F 2 HOH 19 52 64  HOH TIP C . 
F 2 HOH 20 53 65  HOH TIP C . 
F 2 HOH 21 54 66  HOH TIP C . 
F 2 HOH 22 55 67  HOH TIP C . 
F 2 HOH 23 56 68  HOH TIP C . 
F 2 HOH 24 57 69  HOH TIP C . 
F 2 HOH 25 58 70  HOH TIP C . 
F 2 HOH 26 59 75  HOH TIP C . 
F 2 HOH 27 60 76  HOH TIP C . 
F 2 HOH 28 61 81  HOH TIP C . 
F 2 HOH 29 62 82  HOH TIP C . 
F 2 HOH 30 63 83  HOH TIP C . 
F 2 HOH 31 64 86  HOH TIP C . 
F 2 HOH 32 65 88  HOH TIP C . 
F 2 HOH 33 66 89  HOH TIP C . 
F 2 HOH 34 67 93  HOH TIP C . 
F 2 HOH 35 68 103 HOH TIP C . 
F 2 HOH 36 69 104 HOH TIP C . 
F 2 HOH 37 70 109 HOH TIP C . 
F 2 HOH 38 71 110 HOH TIP C . 
F 2 HOH 39 72 111 HOH TIP C . 
F 2 HOH 40 73 112 HOH TIP C . 
F 2 HOH 41 74 113 HOH TIP C . 
F 2 HOH 42 75 114 HOH TIP C . 
#