data_1IKL
# 
_entry.id   1IKL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IKL         
WWPDB D_1000174174 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1IKM 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   ensemble 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IKL 
_pdbx_database_status.recvd_initial_deposition_date   1995-08-03 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rajarathnam, K.' 1 
'Clark-Lewis, I.' 2 
'Sykes, B.D.'     3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary '1H NMR solution structure of an active monomeric interleukin-8.' Biochemistry 34  12983 12990 1995 BICHAW US 0006-2960 
0033 ? 7548056 10.1021/bi00040a008 
1       'Neutrophil Activation by Monomeric Interleukin-8'                Science      264 90    ?     1994 SCIEAS US 0036-8075 
0038 ? ?       ?                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rajarathnam, K.' 1  
primary 'Clark-Lewis, I.' 2  
primary 'Sykes, B.D.'     3  
1       'Rajarathnam, K.' 4  
1       'Sykes, B.D.'     5  
1       'Kay, C.M.'       6  
1       'Dewald, B.'      7  
1       'Geiser, T.'      8  
1       'Baggiolini, M.'  9  
1       'Clark-Lewis, I.' 10 
# 
_cell.entry_id           1IKL 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IKL 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'HUMAN INTERLEUKIN-8 (MONOMERIC)' 
_entity.formula_weight             8415.832 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              'DEL(1-3), H LEU 25 MODIFIED TO N-METHYL' 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        NAP-1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       'SAKELRCQCIKTYSKPFHPKFIKE(MLE)RVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS' 
_entity_poly.pdbx_seq_one_letter_code_can   SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  ALA n 
1 3  LYS n 
1 4  GLU n 
1 5  LEU n 
1 6  ARG n 
1 7  CYS n 
1 8  GLN n 
1 9  CYS n 
1 10 ILE n 
1 11 LYS n 
1 12 THR n 
1 13 TYR n 
1 14 SER n 
1 15 LYS n 
1 16 PRO n 
1 17 PHE n 
1 18 HIS n 
1 19 PRO n 
1 20 LYS n 
1 21 PHE n 
1 22 ILE n 
1 23 LYS n 
1 24 GLU n 
1 25 MLE n 
1 26 ARG n 
1 27 VAL n 
1 28 ILE n 
1 29 GLU n 
1 30 SER n 
1 31 GLY n 
1 32 PRO n 
1 33 HIS n 
1 34 CYS n 
1 35 ALA n 
1 36 ASN n 
1 37 THR n 
1 38 GLU n 
1 39 ILE n 
1 40 ILE n 
1 41 VAL n 
1 42 LYS n 
1 43 LEU n 
1 44 SER n 
1 45 ASP n 
1 46 GLY n 
1 47 ARG n 
1 48 GLU n 
1 49 LEU n 
1 50 CYS n 
1 51 LEU n 
1 52 ASP n 
1 53 PRO n 
1 54 LYS n 
1 55 GLU n 
1 56 ASN n 
1 57 TRP n 
1 58 VAL n 
1 59 GLN n 
1 60 ARG n 
1 61 VAL n 
1 62 VAL n 
1 63 GLU n 
1 64 LYS n 
1 65 PHE n 
1 66 LEU n 
1 67 LYS n 
1 68 ARG n 
1 69 ALA n 
1 70 GLU n 
1 71 ASN n 
1 72 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IL8_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P10145 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDP
KENWVQRVVEKFLKRAENS
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1IKL 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 72 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P10145 
_struct_ref_seq.db_align_beg                  28 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  99 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       72 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MLE 'L-peptide linking' n N-METHYLLEUCINE ? 'C7 H15 N O2'    145.199 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_ensemble.entry_id                             1IKL 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    1 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.authors          BRUNGER 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1IKL 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1IKL 
_struct.title                     'NMR study of monomeric human interleukin-8 (minimized average structure)' 
_struct.pdbx_descriptor           'HUMAN INTERLEUKIN-8 (MONOMERIC), METHYL GROUP' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IKL 
_struct_keywords.pdbx_keywords   'CYTOKINE (CHEMOTACTIC)' 
_struct_keywords.text            'CYTOKINE (CHEMOTACTIC)' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ASN 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        56 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       LEU 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        66 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ASN 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         56 
_struct_conf.end_auth_comp_id        LEU 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         66 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 7  SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 7  A CYS 34 1_555 ? ? ? ? ? ? ? 2.021 ? 
disulf2 disulf ? ? A CYS 9  SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 9  A CYS 50 1_555 ? ? ? ? ? ? ? 2.020 ? 
covale1 covale ? ? A GLU 24 C  ? ? ? 1_555 A MLE 25 N  ? ? A GLU 24 A MLE 25 1_555 ? ? ? ? ? ? ? 1.317 ? 
covale2 covale ? ? A MLE 25 C  ? ? ? 1_555 A ARG 26 N  ? ? A MLE 25 A ARG 26 1_555 ? ? ? ? ? ? ? 1.303 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 47 ? LEU A 49 ? ARG A 47 LEU A 49 
A 2 VAL A 41 ? LEU A 43 ? VAL A 41 LEU A 43 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ARG 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    47 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ARG 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     47 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   LEU 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    43 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    LEU 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     43 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    1 
_struct_site.details              'BINDING SITE FOR RESIDUE CH3 A 73' 
# 
_struct_site_gen.id                   1 
_struct_site_gen.site_id              AC1 
_struct_site_gen.pdbx_num_res         1 
_struct_site_gen.label_comp_id        GLU 
_struct_site_gen.label_asym_id        A 
_struct_site_gen.label_seq_id         24 
_struct_site_gen.pdbx_auth_ins_code   ? 
_struct_site_gen.auth_comp_id         GLU 
_struct_site_gen.auth_asym_id         A 
_struct_site_gen.auth_seq_id          24 
_struct_site_gen.label_atom_id        . 
_struct_site_gen.label_alt_id         ? 
_struct_site_gen.symmetry             1_555 
_struct_site_gen.details              ? 
# 
_database_PDB_matrix.entry_id          1IKL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IKL 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . GLU A 1 4  ? -11.487 17.125  -5.187  1.00 5.27  ? 4  GLU A N    1 
ATOM   2    C CA   . GLU A 1 4  ? -10.410 16.723  -4.235  1.00 4.51  ? 4  GLU A CA   1 
ATOM   3    C C    . GLU A 1 4  ? -10.750 15.355  -3.622  1.00 3.50  ? 4  GLU A C    1 
ATOM   4    O O    . GLU A 1 4  ? -11.811 15.174  -3.053  1.00 3.52  ? 4  GLU A O    1 
ATOM   5    C CB   . GLU A 1 4  ? -10.297 17.771  -3.123  1.00 4.96  ? 4  GLU A CB   1 
ATOM   6    C CG   . GLU A 1 4  ? -9.268  18.834  -3.520  1.00 5.53  ? 4  GLU A CG   1 
ATOM   7    C CD   . GLU A 1 4  ? -7.997  18.653  -2.687  1.00 6.19  ? 4  GLU A CD   1 
ATOM   8    O OE1  . GLU A 1 4  ? -7.987  19.098  -1.550  1.00 6.59  ? 4  GLU A OE1  1 
ATOM   9    O OE2  . GLU A 1 4  ? -7.057  18.069  -3.200  1.00 6.60  ? 4  GLU A OE2  1 
ATOM   10   H HA   . GLU A 1 4  ? -9.471  16.661  -4.766  1.00 4.80  ? 4  GLU A HA   1 
ATOM   11   H HB2  . GLU A 1 4  ? -11.259 18.241  -2.972  1.00 5.42  ? 4  GLU A HB2  1 
ATOM   12   H HB3  . GLU A 1 4  ? -9.983  17.293  -2.207  1.00 4.90  ? 4  GLU A HB3  1 
ATOM   13   H HG2  . GLU A 1 4  ? -9.031  18.731  -4.569  1.00 5.54  ? 4  GLU A HG2  1 
ATOM   14   H HG3  . GLU A 1 4  ? -9.678  19.816  -3.339  1.00 5.88  ? 4  GLU A HG3  1 
ATOM   15   N N    . LEU A 1 5  ? -9.861  14.392  -3.734  1.00 3.09  ? 5  LEU A N    1 
ATOM   16   C CA   . LEU A 1 5  ? -10.135 13.039  -3.160  1.00 2.41  ? 5  LEU A CA   1 
ATOM   17   C C    . LEU A 1 5  ? -9.312  12.849  -1.880  1.00 1.80  ? 5  LEU A C    1 
ATOM   18   O O    . LEU A 1 5  ? -8.103  12.708  -1.926  1.00 2.45  ? 5  LEU A O    1 
ATOM   19   C CB   . LEU A 1 5  ? -9.755  11.964  -4.185  1.00 3.34  ? 5  LEU A CB   1 
ATOM   20   C CG   . LEU A 1 5  ? -10.249 10.595  -3.707  1.00 4.06  ? 5  LEU A CG   1 
ATOM   21   C CD1  . LEU A 1 5  ? -11.622 10.301  -4.319  1.00 4.81  ? 5  LEU A CD1  1 
ATOM   22   C CD2  . LEU A 1 5  ? -9.255  9.515   -4.143  1.00 4.70  ? 5  LEU A CD2  1 
ATOM   23   H H    . LEU A 1 5  ? -9.013  14.559  -4.196  1.00 3.58  ? 5  LEU A H    1 
ATOM   24   H HA   . LEU A 1 5  ? -11.187 12.954  -2.925  1.00 2.37  ? 5  LEU A HA   1 
ATOM   25   H HB2  . LEU A 1 5  ? -10.210 12.200  -5.136  1.00 3.77  ? 5  LEU A HB2  1 
ATOM   26   H HB3  . LEU A 1 5  ? -8.681  11.939  -4.297  1.00 3.60  ? 5  LEU A HB3  1 
ATOM   27   H HG   . LEU A 1 5  ? -10.330 10.597  -2.629  1.00 4.13  ? 5  LEU A HG   1 
ATOM   28   H HD11 . LEU A 1 5  ? -11.570 10.414  -5.392  1.00 4.98  ? 5  LEU A HD11 1 
ATOM   29   H HD12 . LEU A 1 5  ? -11.915 9.290   -4.077  1.00 5.16  ? 5  LEU A HD12 1 
ATOM   30   H HD13 . LEU A 1 5  ? -12.349 10.992  -3.919  1.00 5.24  ? 5  LEU A HD13 1 
ATOM   31   H HD21 . LEU A 1 5  ? -8.276  9.747   -3.749  1.00 4.97  ? 5  LEU A HD21 1 
ATOM   32   H HD22 . LEU A 1 5  ? -9.576  8.556   -3.765  1.00 4.98  ? 5  LEU A HD22 1 
ATOM   33   H HD23 . LEU A 1 5  ? -9.210  9.481   -5.221  1.00 5.06  ? 5  LEU A HD23 1 
ATOM   34   N N    . ARG A 1 6  ? -9.964  12.842  -0.740  1.00 1.20  ? 6  ARG A N    1 
ATOM   35   C CA   . ARG A 1 6  ? -9.240  12.663  0.557   1.00 1.33  ? 6  ARG A CA   1 
ATOM   36   C C    . ARG A 1 6  ? -8.659  11.243  0.648   1.00 1.06  ? 6  ARG A C    1 
ATOM   37   O O    . ARG A 1 6  ? -8.790  10.448  -0.266  1.00 1.06  ? 6  ARG A O    1 
ATOM   38   C CB   . ARG A 1 6  ? -10.220 12.891  1.712   1.00 2.13  ? 6  ARG A CB   1 
ATOM   39   C CG   . ARG A 1 6  ? -10.390 14.394  1.954   1.00 2.86  ? 6  ARG A CG   1 
ATOM   40   C CD   . ARG A 1 6  ? -11.612 14.636  2.844   1.00 3.47  ? 6  ARG A CD   1 
ATOM   41   N NE   . ARG A 1 6  ? -12.531 15.601  2.175   1.00 4.25  ? 6  ARG A NE   1 
ATOM   42   C CZ   . ARG A 1 6  ? -13.818 15.377  2.164   1.00 4.90  ? 6  ARG A CZ   1 
ATOM   43   N NH1  . ARG A 1 6  ? -14.349 14.670  1.200   1.00 5.40  ? 6  ARG A NH1  1 
ATOM   44   N NH2  . ARG A 1 6  ? -14.574 15.862  3.115   1.00 5.44  ? 6  ARG A NH2  1 
ATOM   45   H H    . ARG A 1 6  ? -10.937 12.955  -0.737  1.00 1.49  ? 6  ARG A H    1 
ATOM   46   H HA   . ARG A 1 6  ? -8.438  13.381  0.623   1.00 1.72  ? 6  ARG A HA   1 
ATOM   47   H HB2  . ARG A 1 6  ? -11.176 12.455  1.462   1.00 2.43  ? 6  ARG A HB2  1 
ATOM   48   H HB3  . ARG A 1 6  ? -9.838  12.427  2.605   1.00 2.57  ? 6  ARG A HB3  1 
ATOM   49   H HG2  . ARG A 1 6  ? -9.508  14.781  2.441   1.00 3.23  ? 6  ARG A HG2  1 
ATOM   50   H HG3  . ARG A 1 6  ? -10.530 14.897  1.009   1.00 3.22  ? 6  ARG A HG3  1 
ATOM   51   H HD2  . ARG A 1 6  ? -12.129 13.703  3.010   1.00 3.76  ? 6  ARG A HD2  1 
ATOM   52   H HD3  . ARG A 1 6  ? -11.291 15.043  3.792   1.00 3.63  ? 6  ARG A HD3  1 
ATOM   53   H HE   . ARG A 1 6  ? -12.170 16.404  1.744   1.00 4.56  ? 6  ARG A HE   1 
ATOM   54   H HH11 . ARG A 1 6  ? -13.770 14.300  0.473   1.00 5.32  ? 6  ARG A HH11 1 
ATOM   55   H HH12 . ARG A 1 6  ? -15.334 14.497  1.190   1.00 6.07  ? 6  ARG A HH12 1 
ATOM   56   H HH21 . ARG A 1 6  ? -14.168 16.405  3.850   1.00 5.42  ? 6  ARG A HH21 1 
ATOM   57   H HH22 . ARG A 1 6  ? -15.560 15.691  3.108   1.00 6.09  ? 6  ARG A HH22 1 
ATOM   58   N N    . CYS A 1 7  ? -8.015  10.925  1.749   1.00 0.97  ? 7  CYS A N    1 
ATOM   59   C CA   . CYS A 1 7  ? -7.419  9.565   1.920   1.00 0.76  ? 7  CYS A CA   1 
ATOM   60   C C    . CYS A 1 7  ? -8.505  8.500   1.754   1.00 0.73  ? 7  CYS A C    1 
ATOM   61   O O    . CYS A 1 7  ? -9.509  8.509   2.444   1.00 1.24  ? 7  CYS A O    1 
ATOM   62   C CB   . CYS A 1 7  ? -6.800  9.451   3.314   1.00 0.80  ? 7  CYS A CB   1 
ATOM   63   S SG   . CYS A 1 7  ? -5.098  10.068  3.273   1.00 1.40  ? 7  CYS A SG   1 
ATOM   64   H H    . CYS A 1 7  ? -7.925  11.584  2.467   1.00 1.13  ? 7  CYS A H    1 
ATOM   65   H HA   . CYS A 1 7  ? -6.653  9.410   1.175   1.00 0.80  ? 7  CYS A HA   1 
ATOM   66   H HB2  . CYS A 1 7  ? -7.379  10.034  4.014   1.00 0.95  ? 7  CYS A HB2  1 
ATOM   67   H HB3  . CYS A 1 7  ? -6.800  8.418   3.623   1.00 0.63  ? 7  CYS A HB3  1 
ATOM   68   N N    . GLN A 1 8  ? -8.305  7.584   0.840   1.00 0.62  ? 8  GLN A N    1 
ATOM   69   C CA   . GLN A 1 8  ? -9.309  6.506   0.608   1.00 0.65  ? 8  GLN A CA   1 
ATOM   70   C C    . GLN A 1 8  ? -9.333  5.530   1.798   1.00 0.58  ? 8  GLN A C    1 
ATOM   71   O O    . GLN A 1 8  ? -10.227 4.711   1.907   1.00 0.67  ? 8  GLN A O    1 
ATOM   72   C CB   . GLN A 1 8  ? -8.936  5.745   -0.668  1.00 0.83  ? 8  GLN A CB   1 
ATOM   73   C CG   . GLN A 1 8  ? -9.081  6.669   -1.882  1.00 1.40  ? 8  GLN A CG   1 
ATOM   74   C CD   . GLN A 1 8  ? -9.427  5.839   -3.121  1.00 1.92  ? 8  GLN A CD   1 
ATOM   75   O OE1  . GLN A 1 8  ? -8.556  5.485   -3.891  1.00 2.48  ? 8  GLN A OE1  1 
ATOM   76   N NE2  . GLN A 1 8  ? -10.670 5.509   -3.349  1.00 2.57  ? 8  GLN A NE2  1 
ATOM   77   H H    . GLN A 1 8  ? -7.487  7.603   0.301   1.00 0.95  ? 8  GLN A H    1 
ATOM   78   H HA   . GLN A 1 8  ? -10.287 6.947   0.487   1.00 0.71  ? 8  GLN A HA   1 
ATOM   79   H HB2  . GLN A 1 8  ? -7.913  5.403   -0.597  1.00 1.44  ? 8  GLN A HB2  1 
ATOM   80   H HB3  . GLN A 1 8  ? -9.589  4.899   -0.783  1.00 1.27  ? 8  GLN A HB3  1 
ATOM   81   H HG2  . GLN A 1 8  ? -9.868  7.386   -1.697  1.00 1.95  ? 8  GLN A HG2  1 
ATOM   82   H HG3  . GLN A 1 8  ? -8.151  7.191   -2.050  1.00 2.03  ? 8  GLN A HG3  1 
ATOM   83   H HE21 . GLN A 1 8  ? -11.375 5.792   -2.729  1.00 2.86  ? 8  GLN A HE21 1 
ATOM   84   H HE22 . GLN A 1 8  ? -10.899 4.979   -4.140  1.00 3.12  ? 8  GLN A HE22 1 
ATOM   85   N N    . CYS A 1 9  ? -8.365  5.606   2.687   1.00 0.49  ? 9  CYS A N    1 
ATOM   86   C CA   . CYS A 1 9  ? -8.345  4.679   3.856   1.00 0.49  ? 9  CYS A CA   1 
ATOM   87   C C    . CYS A 1 9  ? -8.125  5.459   5.154   1.00 0.47  ? 9  CYS A C    1 
ATOM   88   O O    . CYS A 1 9  ? -7.033  5.919   5.433   1.00 0.49  ? 9  CYS A O    1 
ATOM   89   C CB   . CYS A 1 9  ? -7.212  3.664   3.685   1.00 0.54  ? 9  CYS A CB   1 
ATOM   90   S SG   . CYS A 1 9  ? -7.889  2.085   3.114   1.00 0.85  ? 9  CYS A SG   1 
ATOM   91   H H    . CYS A 1 9  ? -7.649  6.271   2.584   1.00 0.49  ? 9  CYS A H    1 
ATOM   92   H HA   . CYS A 1 9  ? -9.287  4.153   3.914   1.00 0.56  ? 9  CYS A HA   1 
ATOM   93   H HB2  . CYS A 1 9  ? -6.505  4.035   2.960   1.00 0.54  ? 9  CYS A HB2  1 
ATOM   94   H HB3  . CYS A 1 9  ? -6.713  3.522   4.630   1.00 0.51  ? 9  CYS A HB3  1 
ATOM   95   N N    . ILE A 1 10 ? -9.149  5.578   5.966   1.00 0.54  ? 10 ILE A N    1 
ATOM   96   C CA   . ILE A 1 10 ? -8.993  6.288   7.273   1.00 0.60  ? 10 ILE A CA   1 
ATOM   97   C C    . ILE A 1 10 ? -8.110  5.417   8.178   1.00 0.59  ? 10 ILE A C    1 
ATOM   98   O O    . ILE A 1 10 ? -7.317  5.912   8.957   1.00 0.64  ? 10 ILE A O    1 
ATOM   99   C CB   . ILE A 1 10 ? -10.369 6.494   7.926   1.00 0.74  ? 10 ILE A CB   1 
ATOM   100  C CG1  . ILE A 1 10 ? -11.245 7.367   7.017   1.00 0.82  ? 10 ILE A CG1  1 
ATOM   101  C CG2  . ILE A 1 10 ? -10.200 7.188   9.281   1.00 0.83  ? 10 ILE A CG2  1 
ATOM   102  C CD1  . ILE A 1 10 ? -12.542 6.625   6.688   1.00 1.62  ? 10 ILE A CD1  1 
ATOM   103  H H    . ILE A 1 10 ? -10.011 5.174   5.729   1.00 0.62  ? 10 ILE A H    1 
ATOM   104  H HA   . ILE A 1 10 ? -8.516  7.244   7.112   1.00 0.61  ? 10 ILE A HA   1 
ATOM   105  H HB   . ILE A 1 10 ? -10.842 5.533   8.072   1.00 0.77  ? 10 ILE A HB   1 
ATOM   106  H HG12 . ILE A 1 10 ? -11.478 8.292   7.524   1.00 1.13  ? 10 ILE A HG12 1 
ATOM   107  H HG13 . ILE A 1 10 ? -10.714 7.583   6.102   1.00 1.11  ? 10 ILE A HG13 1 
ATOM   108  H HG21 . ILE A 1 10 ? -9.638  8.101   9.151   1.00 1.22  ? 10 ILE A HG21 1 
ATOM   109  H HG22 . ILE A 1 10 ? -11.173 7.419   9.690   1.00 1.40  ? 10 ILE A HG22 1 
ATOM   110  H HG23 . ILE A 1 10 ? -9.672  6.533   9.959   1.00 1.29  ? 10 ILE A HG23 1 
ATOM   111  H HD11 . ILE A 1 10 ? -12.309 5.682   6.217   1.00 2.13  ? 10 ILE A HD11 1 
ATOM   112  H HD12 . ILE A 1 10 ? -13.096 6.447   7.598   1.00 2.16  ? 10 ILE A HD12 1 
ATOM   113  H HD13 . ILE A 1 10 ? -13.138 7.225   6.016   1.00 2.04  ? 10 ILE A HD13 1 
ATOM   114  N N    . LYS A 1 11 ? -8.235  4.115   8.049   1.00 0.58  ? 11 LYS A N    1 
ATOM   115  C CA   . LYS A 1 11 ? -7.405  3.176   8.856   1.00 0.61  ? 11 LYS A CA   1 
ATOM   116  C C    . LYS A 1 11 ? -6.561  2.345   7.885   1.00 0.52  ? 11 LYS A C    1 
ATOM   117  O O    . LYS A 1 11 ? -7.088  1.606   7.073   1.00 0.78  ? 11 LYS A O    1 
ATOM   118  C CB   . LYS A 1 11 ? -8.314  2.251   9.674   1.00 0.75  ? 11 LYS A CB   1 
ATOM   119  C CG   . LYS A 1 11 ? -8.973  3.047   10.805  1.00 1.54  ? 11 LYS A CG   1 
ATOM   120  C CD   . LYS A 1 11 ? -10.323 2.415   11.162  1.00 1.88  ? 11 LYS A CD   1 
ATOM   121  C CE   . LYS A 1 11 ? -10.164 1.520   12.394  1.00 2.70  ? 11 LYS A CE   1 
ATOM   122  N NZ   . LYS A 1 11 ? -11.161 0.412   12.340  1.00 3.38  ? 11 LYS A NZ   1 
ATOM   123  H H    . LYS A 1 11 ? -8.870  3.753   7.394   1.00 0.61  ? 11 LYS A H    1 
ATOM   124  H HA   . LYS A 1 11 ? -6.758  3.734   9.517   1.00 0.63  ? 11 LYS A HA   1 
ATOM   125  H HB2  . LYS A 1 11 ? -9.078  1.837   9.031   1.00 1.22  ? 11 LYS A HB2  1 
ATOM   126  H HB3  . LYS A 1 11 ? -7.726  1.450   10.096  1.00 1.19  ? 11 LYS A HB3  1 
ATOM   127  H HG2  . LYS A 1 11 ? -8.329  3.037   11.673  1.00 2.12  ? 11 LYS A HG2  1 
ATOM   128  H HG3  . LYS A 1 11 ? -9.129  4.066   10.485  1.00 2.14  ? 11 LYS A HG3  1 
ATOM   129  H HD2  . LYS A 1 11 ? -11.039 3.196   11.375  1.00 2.26  ? 11 LYS A HD2  1 
ATOM   130  H HD3  . LYS A 1 11 ? -10.675 1.822   10.331  1.00 2.08  ? 11 LYS A HD3  1 
ATOM   131  H HE2  . LYS A 1 11 ? -9.167  1.105   12.411  1.00 3.14  ? 11 LYS A HE2  1 
ATOM   132  H HE3  . LYS A 1 11 ? -10.324 2.106   13.287  1.00 3.04  ? 11 LYS A HE3  1 
ATOM   133  H HZ1  . LYS A 1 11 ? -12.120 0.809   12.267  1.00 3.75  ? 11 LYS A HZ1  1 
ATOM   134  H HZ2  . LYS A 1 11 ? -10.969 -0.188  11.512  1.00 3.66  ? 11 LYS A HZ2  1 
ATOM   135  H HZ3  . LYS A 1 11 ? -11.092 -0.159  13.206  1.00 3.76  ? 11 LYS A HZ3  1 
ATOM   136  N N    . THR A 1 12 ? -5.260  2.478   7.940   1.00 0.42  ? 12 THR A N    1 
ATOM   137  C CA   . THR A 1 12 ? -4.388  1.713   6.995   1.00 0.31  ? 12 THR A CA   1 
ATOM   138  C C    . THR A 1 12 ? -4.002  0.351   7.573   1.00 0.30  ? 12 THR A C    1 
ATOM   139  O O    . THR A 1 12 ? -4.440  -0.041  8.640   1.00 0.43  ? 12 THR A O    1 
ATOM   140  C CB   . THR A 1 12 ? -3.117  2.507   6.675   1.00 0.30  ? 12 THR A CB   1 
ATOM   141  O OG1  . THR A 1 12 ? -2.908  3.521   7.649   1.00 0.40  ? 12 THR A OG1  1 
ATOM   142  C CG2  . THR A 1 12 ? -3.251  3.131   5.290   1.00 0.30  ? 12 THR A CG2  1 
ATOM   143  H H    . THR A 1 12 ? -4.857  3.094   8.588   1.00 0.62  ? 12 THR A H    1 
ATOM   144  H HA   . THR A 1 12 ? -4.933  1.553   6.077   1.00 0.32  ? 12 THR A HA   1 
ATOM   145  H HB   . THR A 1 12 ? -2.273  1.837   6.674   1.00 0.29  ? 12 THR A HB   1 
ATOM   146  H HG1  . THR A 1 12 ? -2.625  3.098   8.463   1.00 0.93  ? 12 THR A HG1  1 
ATOM   147  H HG21 . THR A 1 12 ? -4.151  3.725   5.248   1.00 1.02  ? 12 THR A HG21 1 
ATOM   148  H HG22 . THR A 1 12 ? -2.394  3.755   5.092   1.00 1.05  ? 12 THR A HG22 1 
ATOM   149  H HG23 . THR A 1 12 ? -3.304  2.346   4.548   1.00 1.03  ? 12 THR A HG23 1 
ATOM   150  N N    . TYR A 1 13 ? -3.193  -0.376  6.845   1.00 0.24  ? 13 TYR A N    1 
ATOM   151  C CA   . TYR A 1 13 ? -2.764  -1.728  7.286   1.00 0.23  ? 13 TYR A CA   1 
ATOM   152  C C    . TYR A 1 13 ? -1.571  -1.619  8.237   1.00 0.24  ? 13 TYR A C    1 
ATOM   153  O O    . TYR A 1 13 ? -0.484  -1.232  7.846   1.00 0.31  ? 13 TYR A O    1 
ATOM   154  C CB   . TYR A 1 13 ? -2.357  -2.543  6.052   1.00 0.22  ? 13 TYR A CB   1 
ATOM   155  C CG   . TYR A 1 13 ? -2.397  -4.024  6.337   1.00 0.21  ? 13 TYR A CG   1 
ATOM   156  C CD1  . TYR A 1 13 ? -3.084  -4.520  7.451   1.00 1.14  ? 13 TYR A CD1  1 
ATOM   157  C CD2  . TYR A 1 13 ? -1.731  -4.899  5.475   1.00 1.23  ? 13 TYR A CD2  1 
ATOM   158  C CE1  . TYR A 1 13 ? -3.103  -5.896  7.705   1.00 1.14  ? 13 TYR A CE1  1 
ATOM   159  C CE2  . TYR A 1 13 ? -1.750  -6.277  5.726   1.00 1.24  ? 13 TYR A CE2  1 
ATOM   160  C CZ   . TYR A 1 13 ? -2.435  -6.776  6.842   1.00 0.23  ? 13 TYR A CZ   1 
ATOM   161  O OH   . TYR A 1 13 ? -2.451  -8.133  7.092   1.00 0.25  ? 13 TYR A OH   1 
ATOM   162  H H    . TYR A 1 13 ? -2.876  -0.029  5.984   1.00 0.29  ? 13 TYR A H    1 
ATOM   163  H HA   . TYR A 1 13 ? -3.583  -2.217  7.787   1.00 0.24  ? 13 TYR A HA   1 
ATOM   164  H HB2  . TYR A 1 13 ? -3.029  -2.321  5.238   1.00 0.23  ? 13 TYR A HB2  1 
ATOM   165  H HB3  . TYR A 1 13 ? -1.353  -2.273  5.768   1.00 0.23  ? 13 TYR A HB3  1 
ATOM   166  H HD1  . TYR A 1 13 ? -3.599  -3.838  8.111   1.00 2.04  ? 13 TYR A HD1  1 
ATOM   167  H HD2  . TYR A 1 13 ? -1.206  -4.506  4.611   1.00 2.12  ? 13 TYR A HD2  1 
ATOM   168  H HE1  . TYR A 1 13 ? -3.631  -6.280  8.566   1.00 2.03  ? 13 TYR A HE1  1 
ATOM   169  H HE2  . TYR A 1 13 ? -1.236  -6.955  5.063   1.00 2.14  ? 13 TYR A HE2  1 
ATOM   170  H HH   . TYR A 1 13 ? -3.166  -8.522  6.581   1.00 0.89  ? 13 TYR A HH   1 
ATOM   171  N N    . SER A 1 14 ? -1.764  -1.983  9.478   1.00 0.27  ? 14 SER A N    1 
ATOM   172  C CA   . SER A 1 14 ? -0.645  -1.934  10.462  1.00 0.28  ? 14 SER A CA   1 
ATOM   173  C C    . SER A 1 14 ? 0.079   -3.281  10.446  1.00 0.26  ? 14 SER A C    1 
ATOM   174  O O    . SER A 1 14 ? 1.286   -3.344  10.592  1.00 0.26  ? 14 SER A O    1 
ATOM   175  C CB   . SER A 1 14 ? -1.195  -1.656  11.862  1.00 0.32  ? 14 SER A CB   1 
ATOM   176  O OG   . SER A 1 14 ? -1.473  -0.267  11.988  1.00 1.32  ? 14 SER A OG   1 
ATOM   177  H H    . SER A 1 14 ? -2.646  -2.307  9.760   1.00 0.34  ? 14 SER A H    1 
ATOM   178  H HA   . SER A 1 14 ? 0.049   -1.158  10.181  1.00 0.28  ? 14 SER A HA   1 
ATOM   179  H HB2  . SER A 1 14 ? -2.105  -2.214  12.011  1.00 1.05  ? 14 SER A HB2  1 
ATOM   180  H HB3  . SER A 1 14 ? -0.465  -1.957  12.602  1.00 0.96  ? 14 SER A HB3  1 
ATOM   181  H HG   . SER A 1 14 ? -1.133  0.028   12.836  1.00 1.65  ? 14 SER A HG   1 
ATOM   182  N N    . LYS A 1 15 ? -0.647  -4.358  10.245  1.00 0.25  ? 15 LYS A N    1 
ATOM   183  C CA   . LYS A 1 15 ? 0.000   -5.698  10.191  1.00 0.25  ? 15 LYS A CA   1 
ATOM   184  C C    . LYS A 1 15 ? 0.698   -5.836  8.833   1.00 0.22  ? 15 LYS A C    1 
ATOM   185  O O    . LYS A 1 15 ? 0.173   -5.405  7.827   1.00 0.20  ? 15 LYS A O    1 
ATOM   186  C CB   . LYS A 1 15 ? -1.032  -6.823  10.335  1.00 0.27  ? 15 LYS A CB   1 
ATOM   187  C CG   . LYS A 1 15 ? -2.269  -6.345  11.107  1.00 0.30  ? 15 LYS A CG   1 
ATOM   188  C CD   . LYS A 1 15 ? -3.078  -7.554  11.580  1.00 1.07  ? 15 LYS A CD   1 
ATOM   189  C CE   . LYS A 1 15 ? -4.277  -7.074  12.401  1.00 1.54  ? 15 LYS A CE   1 
ATOM   190  N NZ   . LYS A 1 15 ? -4.543  -8.035  13.510  1.00 2.03  ? 15 LYS A NZ   1 
ATOM   191  H H    . LYS A 1 15 ? -1.612  -4.278  10.111  1.00 0.26  ? 15 LYS A H    1 
ATOM   192  H HA   . LYS A 1 15 ? 0.728   -5.772  10.984  1.00 0.26  ? 15 LYS A HA   1 
ATOM   193  H HB2  . LYS A 1 15 ? -1.320  -7.157  9.357   1.00 0.26  ? 15 LYS A HB2  1 
ATOM   194  H HB3  . LYS A 1 15 ? -0.582  -7.642  10.864  1.00 0.28  ? 15 LYS A HB3  1 
ATOM   195  H HG2  . LYS A 1 15 ? -1.958  -5.763  11.963  1.00 0.77  ? 15 LYS A HG2  1 
ATOM   196  H HG3  . LYS A 1 15 ? -2.883  -5.735  10.461  1.00 0.74  ? 15 LYS A HG3  1 
ATOM   197  H HD2  . LYS A 1 15 ? -3.427  -8.112  10.723  1.00 1.74  ? 15 LYS A HD2  1 
ATOM   198  H HD3  . LYS A 1 15 ? -2.454  -8.187  12.193  1.00 1.67  ? 15 LYS A HD3  1 
ATOM   199  H HE2  . LYS A 1 15 ? -4.064  -6.100  12.814  1.00 1.99  ? 15 LYS A HE2  1 
ATOM   200  H HE3  . LYS A 1 15 ? -5.147  -7.012  11.764  1.00 2.12  ? 15 LYS A HE3  1 
ATOM   201  H HZ1  . LYS A 1 15 ? -4.730  -8.979  13.117  1.00 2.44  ? 15 LYS A HZ1  1 
ATOM   202  H HZ2  . LYS A 1 15 ? -3.714  -8.077  14.139  1.00 2.34  ? 15 LYS A HZ2  1 
ATOM   203  H HZ3  . LYS A 1 15 ? -5.373  -7.718  14.051  1.00 2.45  ? 15 LYS A HZ3  1 
ATOM   204  N N    . PRO A 1 16 ? 1.870   -6.412  8.851   1.00 0.22  ? 16 PRO A N    1 
ATOM   205  C CA   . PRO A 1 16 ? 2.690   -6.598  7.642   1.00 0.21  ? 16 PRO A CA   1 
ATOM   206  C C    . PRO A 1 16 ? 2.271   -7.853  6.868   1.00 0.21  ? 16 PRO A C    1 
ATOM   207  O O    . PRO A 1 16 ? 1.639   -8.747  7.403   1.00 0.23  ? 16 PRO A O    1 
ATOM   208  C CB   . PRO A 1 16 ? 4.101   -6.750  8.206   1.00 0.23  ? 16 PRO A CB   1 
ATOM   209  C CG   . PRO A 1 16 ? 3.945   -7.226  9.672   1.00 0.25  ? 16 PRO A CG   1 
ATOM   210  C CD   . PRO A 1 16 ? 2.491   -6.930  10.082  1.00 0.25  ? 16 PRO A CD   1 
ATOM   211  H HA   . PRO A 1 16 ? 2.640   -5.730  7.009   1.00 0.19  ? 16 PRO A HA   1 
ATOM   212  H HB2  . PRO A 1 16 ? 4.652   -7.472  7.632   1.00 0.24  ? 16 PRO A HB2  1 
ATOM   213  H HB3  . PRO A 1 16 ? 4.607   -5.804  8.185   1.00 0.23  ? 16 PRO A HB3  1 
ATOM   214  H HG2  . PRO A 1 16 ? 4.142   -8.287  9.739   1.00 0.27  ? 16 PRO A HG2  1 
ATOM   215  H HG3  . PRO A 1 16 ? 4.622   -6.682  10.313  1.00 0.27  ? 16 PRO A HG3  1 
ATOM   216  H HD2  . PRO A 1 16 ? 1.995   -7.836  10.400  1.00 0.26  ? 16 PRO A HD2  1 
ATOM   217  H HD3  . PRO A 1 16 ? 2.450   -6.185  10.857  1.00 0.26  ? 16 PRO A HD3  1 
ATOM   218  N N    . PHE A 1 17 ? 2.634   -7.922  5.610   1.00 0.20  ? 17 PHE A N    1 
ATOM   219  C CA   . PHE A 1 17 ? 2.277   -9.115  4.780   1.00 0.21  ? 17 PHE A CA   1 
ATOM   220  C C    . PHE A 1 17 ? 3.167   -9.166  3.526   1.00 0.21  ? 17 PHE A C    1 
ATOM   221  O O    . PHE A 1 17 ? 3.696   -8.161  3.084   1.00 0.20  ? 17 PHE A O    1 
ATOM   222  C CB   . PHE A 1 17 ? 0.783   -9.065  4.397   1.00 0.20  ? 17 PHE A CB   1 
ATOM   223  C CG   . PHE A 1 17 ? 0.524   -8.053  3.299   1.00 0.16  ? 17 PHE A CG   1 
ATOM   224  C CD1  . PHE A 1 17 ? 0.742   -6.687  3.525   1.00 1.22  ? 17 PHE A CD1  1 
ATOM   225  C CD2  . PHE A 1 17 ? 0.052   -8.487  2.053   1.00 1.22  ? 17 PHE A CD2  1 
ATOM   226  C CE1  . PHE A 1 17 ? 0.490   -5.761  2.506   1.00 1.21  ? 17 PHE A CE1  1 
ATOM   227  C CE2  . PHE A 1 17 ? -0.200  -7.560  1.037   1.00 1.22  ? 17 PHE A CE2  1 
ATOM   228  C CZ   . PHE A 1 17 ? 0.019   -6.197  1.264   1.00 0.15  ? 17 PHE A CZ   1 
ATOM   229  H H    . PHE A 1 17 ? 3.151   -7.188  5.214   1.00 0.19  ? 17 PHE A H    1 
ATOM   230  H HA   . PHE A 1 17 ? 2.457   -10.006 5.364   1.00 0.24  ? 17 PHE A HA   1 
ATOM   231  H HB2  . PHE A 1 17 ? 0.474   -10.041 4.056   1.00 0.23  ? 17 PHE A HB2  1 
ATOM   232  H HB3  . PHE A 1 17 ? 0.204   -8.797  5.269   1.00 0.22  ? 17 PHE A HB3  1 
ATOM   233  H HD1  . PHE A 1 17 ? 1.102   -6.349  4.485   1.00 2.16  ? 17 PHE A HD1  1 
ATOM   234  H HD2  . PHE A 1 17 ? -0.119  -9.539  1.878   1.00 2.15  ? 17 PHE A HD2  1 
ATOM   235  H HE1  . PHE A 1 17 ? 0.659   -4.709  2.678   1.00 2.14  ? 17 PHE A HE1  1 
ATOM   236  H HE2  . PHE A 1 17 ? -0.564  -7.896  0.076   1.00 2.15  ? 17 PHE A HE2  1 
ATOM   237  H HZ   . PHE A 1 17 ? -0.176  -5.482  0.479   1.00 0.16  ? 17 PHE A HZ   1 
ATOM   238  N N    . HIS A 1 18 ? 3.342   -10.340 2.965   1.00 0.24  ? 18 HIS A N    1 
ATOM   239  C CA   . HIS A 1 18 ? 4.204   -10.499 1.752   1.00 0.25  ? 18 HIS A CA   1 
ATOM   240  C C    . HIS A 1 18 ? 3.574   -9.742  0.550   1.00 0.22  ? 18 HIS A C    1 
ATOM   241  O O    . HIS A 1 18 ? 2.367   -9.707  0.407   1.00 0.21  ? 18 HIS A O    1 
ATOM   242  C CB   . HIS A 1 18 ? 4.373   -12.001 1.501   1.00 0.29  ? 18 HIS A CB   1 
ATOM   243  C CG   . HIS A 1 18 ? 4.886   -12.241 0.129   1.00 0.29  ? 18 HIS A CG   1 
ATOM   244  N ND1  . HIS A 1 18 ? 6.232   -12.377 -0.168  1.00 0.31  ? 18 HIS A ND1  1 
ATOM   245  C CD2  . HIS A 1 18 ? 4.226   -12.366 -1.041  1.00 0.27  ? 18 HIS A CD2  1 
ATOM   246  C CE1  . HIS A 1 18 ? 6.323   -12.574 -1.494  1.00 0.31  ? 18 HIS A CE1  1 
ATOM   247  N NE2  . HIS A 1 18 ? 5.126   -12.583 -2.065  1.00 0.28  ? 18 HIS A NE2  1 
ATOM   248  H H    . HIS A 1 18 ? 2.908   -11.132 3.352   1.00 0.27  ? 18 HIS A H    1 
ATOM   249  H HA   . HIS A 1 18 ? 5.168   -10.076 1.949   1.00 0.25  ? 18 HIS A HA   1 
ATOM   250  H HB2  . HIS A 1 18 ? 5.072   -12.404 2.218   1.00 0.32  ? 18 HIS A HB2  1 
ATOM   251  H HB3  . HIS A 1 18 ? 3.421   -12.491 1.620   1.00 0.29  ? 18 HIS A HB3  1 
ATOM   252  H HD1  . HIS A 1 18 ? 6.976   -12.338 0.469   1.00 0.33  ? 18 HIS A HD1  1 
ATOM   253  H HD2  . HIS A 1 18 ? 3.168   -12.257 -1.150  1.00 0.25  ? 18 HIS A HD2  1 
ATOM   254  H HE1  . HIS A 1 18 ? 7.247   -12.663 -2.038  1.00 0.33  ? 18 HIS A HE1  1 
ATOM   255  N N    . PRO A 1 19 ? 4.430   -9.094  -0.233  1.00 0.22  ? 19 PRO A N    1 
ATOM   256  C CA   . PRO A 1 19 ? 4.013   -8.243  -1.384  1.00 0.20  ? 19 PRO A CA   1 
ATOM   257  C C    . PRO A 1 19 ? 3.586   -9.007  -2.648  1.00 0.20  ? 19 PRO A C    1 
ATOM   258  O O    . PRO A 1 19 ? 2.630   -8.620  -3.288  1.00 0.17  ? 19 PRO A O    1 
ATOM   259  C CB   . PRO A 1 19 ? 5.263   -7.418  -1.690  1.00 0.21  ? 19 PRO A CB   1 
ATOM   260  C CG   . PRO A 1 19 ? 6.461   -8.214  -1.126  1.00 0.24  ? 19 PRO A CG   1 
ATOM   261  C CD   . PRO A 1 19 ? 5.897   -9.149  -0.042  1.00 0.24  ? 19 PRO A CD   1 
ATOM   262  H HA   . PRO A 1 19 ? 3.228   -7.581  -1.081  1.00 0.19  ? 19 PRO A HA   1 
ATOM   263  H HB2  . PRO A 1 19 ? 5.366   -7.288  -2.762  1.00 0.22  ? 19 PRO A HB2  1 
ATOM   264  H HB3  . PRO A 1 19 ? 5.202   -6.458  -1.205  1.00 0.22  ? 19 PRO A HB3  1 
ATOM   265  H HG2  . PRO A 1 19 ? 6.920   -8.795  -1.916  1.00 0.25  ? 19 PRO A HG2  1 
ATOM   266  H HG3  . PRO A 1 19 ? 7.183   -7.543  -0.691  1.00 0.25  ? 19 PRO A HG3  1 
ATOM   267  H HD2  . PRO A 1 19 ? 6.263   -10.154 -0.188  1.00 0.26  ? 19 PRO A HD2  1 
ATOM   268  H HD3  . PRO A 1 19 ? 6.157   -8.791  0.940   1.00 0.25  ? 19 PRO A HD3  1 
ATOM   269  N N    . LYS A 1 20 ? 4.296   -10.036 -3.054  1.00 0.23  ? 20 LYS A N    1 
ATOM   270  C CA   . LYS A 1 20 ? 3.915   -10.753 -4.326  1.00 0.24  ? 20 LYS A CA   1 
ATOM   271  C C    . LYS A 1 20 ? 2.421   -11.130 -4.335  1.00 0.22  ? 20 LYS A C    1 
ATOM   272  O O    . LYS A 1 20 ? 1.825   -11.239 -5.390  1.00 0.21  ? 20 LYS A O    1 
ATOM   273  C CB   . LYS A 1 20 ? 4.769   -11.995 -4.542  1.00 0.31  ? 20 LYS A CB   1 
ATOM   274  C CG   . LYS A 1 20 ? 4.884   -12.281 -6.041  1.00 0.39  ? 20 LYS A CG   1 
ATOM   275  C CD   . LYS A 1 20 ? 5.935   -13.368 -6.277  1.00 1.03  ? 20 LYS A CD   1 
ATOM   276  C CE   . LYS A 1 20 ? 5.997   -13.700 -7.770  1.00 1.46  ? 20 LYS A CE   1 
ATOM   277  N NZ   . LYS A 1 20 ? 7.101   -14.669 -8.024  1.00 2.19  ? 20 LYS A NZ   1 
ATOM   278  H H    . LYS A 1 20 ? 5.090   -10.308 -2.552  1.00 0.26  ? 20 LYS A H    1 
ATOM   279  H HA   . LYS A 1 20 ? 4.095   -10.090 -5.143  1.00 0.23  ? 20 LYS A HA   1 
ATOM   280  H HB2  . LYS A 1 20 ? 5.754   -11.833 -4.127  1.00 0.31  ? 20 LYS A HB2  1 
ATOM   281  H HB3  . LYS A 1 20 ? 4.306   -12.826 -4.056  1.00 0.32  ? 20 LYS A HB3  1 
ATOM   282  H HG2  . LYS A 1 20 ? 3.928   -12.616 -6.417  1.00 0.71  ? 20 LYS A HG2  1 
ATOM   283  H HG3  . LYS A 1 20 ? 5.179   -11.380 -6.558  1.00 0.73  ? 20 LYS A HG3  1 
ATOM   284  H HD2  . LYS A 1 20 ? 6.900   -13.014 -5.946  1.00 1.58  ? 20 LYS A HD2  1 
ATOM   285  H HD3  . LYS A 1 20 ? 5.666   -14.255 -5.724  1.00 1.54  ? 20 LYS A HD3  1 
ATOM   286  H HE2  . LYS A 1 20 ? 5.059   -14.135 -8.081  1.00 1.91  ? 20 LYS A HE2  1 
ATOM   287  H HE3  . LYS A 1 20 ? 6.176   -12.795 -8.332  1.00 1.85  ? 20 LYS A HE3  1 
ATOM   288  H HZ1  . LYS A 1 20 ? 8.005   -14.256 -7.717  1.00 2.69  ? 20 LYS A HZ1  1 
ATOM   289  H HZ2  . LYS A 1 20 ? 6.925   -15.545 -7.492  1.00 2.62  ? 20 LYS A HZ2  1 
ATOM   290  H HZ3  . LYS A 1 20 ? 7.146   -14.883 -9.041  1.00 2.49  ? 20 LYS A HZ3  1 
ATOM   291  N N    . PHE A 1 21 ? 1.798   -11.292 -3.183  1.00 0.22  ? 21 PHE A N    1 
ATOM   292  C CA   . PHE A 1 21 ? 0.338   -11.612 -3.160  1.00 0.23  ? 21 PHE A CA   1 
ATOM   293  C C    . PHE A 1 21 ? -0.415  -10.461 -3.836  1.00 0.19  ? 21 PHE A C    1 
ATOM   294  O O    . PHE A 1 21 ? -1.360  -10.665 -4.573  1.00 0.21  ? 21 PHE A O    1 
ATOM   295  C CB   . PHE A 1 21 ? -0.159  -11.733 -1.723  1.00 0.26  ? 21 PHE A CB   1 
ATOM   296  C CG   . PHE A 1 21 ? 0.624   -12.765 -0.936  1.00 0.27  ? 21 PHE A CG   1 
ATOM   297  C CD1  . PHE A 1 21 ? 1.209   -13.868 -1.575  1.00 1.25  ? 21 PHE A CD1  1 
ATOM   298  C CD2  . PHE A 1 21 ? 0.754   -12.613 0.451   1.00 1.22  ? 21 PHE A CD2  1 
ATOM   299  C CE1  . PHE A 1 21 ? 1.921   -14.813 -0.824  1.00 1.25  ? 21 PHE A CE1  1 
ATOM   300  C CE2  . PHE A 1 21 ? 1.465   -13.557 1.198   1.00 1.23  ? 21 PHE A CE2  1 
ATOM   301  C CZ   . PHE A 1 21 ? 2.049   -14.657 0.561   1.00 0.33  ? 21 PHE A CZ   1 
ATOM   302  H H    . PHE A 1 21 ? 2.277   -11.172 -2.341  1.00 0.24  ? 21 PHE A H    1 
ATOM   303  H HA   . PHE A 1 21 ? 0.153   -12.525 -3.681  1.00 0.26  ? 21 PHE A HA   1 
ATOM   304  H HB2  . PHE A 1 21 ? -0.058  -10.781 -1.252  1.00 0.27  ? 21 PHE A HB2  1 
ATOM   305  H HB3  . PHE A 1 21 ? -1.197  -12.011 -1.735  1.00 0.27  ? 21 PHE A HB3  1 
ATOM   306  H HD1  . PHE A 1 21 ? 1.112   -13.990 -2.643  1.00 2.16  ? 21 PHE A HD1  1 
ATOM   307  H HD2  . PHE A 1 21 ? 0.304   -11.764 0.944   1.00 2.13  ? 21 PHE A HD2  1 
ATOM   308  H HE1  . PHE A 1 21 ? 2.372   -15.662 -1.314  1.00 2.17  ? 21 PHE A HE1  1 
ATOM   309  H HE2  . PHE A 1 21 ? 1.565   -13.435 2.267   1.00 2.14  ? 21 PHE A HE2  1 
ATOM   310  H HZ   . PHE A 1 21 ? 2.599   -15.386 1.138   1.00 0.36  ? 21 PHE A HZ   1 
ATOM   311  N N    . ILE A 1 22 ? 0.023   -9.250  -3.579  1.00 0.14  ? 22 ILE A N    1 
ATOM   312  C CA   . ILE A 1 22 ? -0.612  -8.039  -4.177  1.00 0.13  ? 22 ILE A CA   1 
ATOM   313  C C    . ILE A 1 22 ? -0.569  -8.125  -5.706  1.00 0.14  ? 22 ILE A C    1 
ATOM   314  O O    . ILE A 1 22 ? 0.486   -8.234  -6.302  1.00 0.15  ? 22 ILE A O    1 
ATOM   315  C CB   . ILE A 1 22 ? 0.166   -6.795  -3.721  1.00 0.13  ? 22 ILE A CB   1 
ATOM   316  C CG1  . ILE A 1 22 ? 0.057   -6.646  -2.199  1.00 0.17  ? 22 ILE A CG1  1 
ATOM   317  C CG2  . ILE A 1 22 ? -0.401  -5.545  -4.396  1.00 0.17  ? 22 ILE A CG2  1 
ATOM   318  C CD1  . ILE A 1 22 ? 1.312   -5.953  -1.662  1.00 1.39  ? 22 ILE A CD1  1 
ATOM   319  H H    . ILE A 1 22 ? 0.792   -9.138  -2.981  1.00 0.15  ? 22 ILE A H    1 
ATOM   320  H HA   . ILE A 1 22 ? -1.638  -7.961  -3.850  1.00 0.15  ? 22 ILE A HA   1 
ATOM   321  H HB   . ILE A 1 22 ? 1.205   -6.906  -3.997  1.00 0.15  ? 22 ILE A HB   1 
ATOM   322  H HG12 . ILE A 1 22 ? -0.814  -6.056  -1.955  1.00 0.78  ? 22 ILE A HG12 1 
ATOM   323  H HG13 . ILE A 1 22 ? -0.032  -7.622  -1.746  1.00 0.89  ? 22 ILE A HG13 1 
ATOM   324  H HG21 . ILE A 1 22 ? -1.435  -5.713  -4.649  1.00 1.03  ? 22 ILE A HG21 1 
ATOM   325  H HG22 . ILE A 1 22 ? -0.325  -4.706  -3.722  1.00 1.01  ? 22 ILE A HG22 1 
ATOM   326  H HG23 . ILE A 1 22 ? 0.161   -5.336  -5.294  1.00 1.02  ? 22 ILE A HG23 1 
ATOM   327  H HD11 . ILE A 1 22 ? 2.096   -5.999  -2.403  1.00 1.96  ? 22 ILE A HD11 1 
ATOM   328  H HD12 . ILE A 1 22 ? 1.086   -4.921  -1.441  1.00 1.95  ? 22 ILE A HD12 1 
ATOM   329  H HD13 . ILE A 1 22 ? 1.640   -6.449  -0.761  1.00 2.00  ? 22 ILE A HD13 1 
ATOM   330  N N    . LYS A 1 23 ? -1.710  -8.055  -6.336  1.00 0.17  ? 23 LYS A N    1 
ATOM   331  C CA   . LYS A 1 23 ? -1.759  -8.103  -7.825  1.00 0.20  ? 23 LYS A CA   1 
ATOM   332  C C    . LYS A 1 23 ? -1.640  -6.674  -8.380  1.00 0.21  ? 23 LYS A C    1 
ATOM   333  O O    . LYS A 1 23 ? -1.241  -6.475  -9.512  1.00 0.25  ? 23 LYS A O    1 
ATOM   334  C CB   . LYS A 1 23 ? -3.087  -8.721  -8.275  1.00 0.23  ? 23 LYS A CB   1 
ATOM   335  C CG   . LYS A 1 23 ? -2.840  -9.654  -9.462  1.00 0.73  ? 23 LYS A CG   1 
ATOM   336  C CD   . LYS A 1 23 ? -4.142  -10.370 -9.829  1.00 1.10  ? 23 LYS A CD   1 
ATOM   337  C CE   . LYS A 1 23 ? -3.870  -11.390 -10.938 1.00 1.53  ? 23 LYS A CE   1 
ATOM   338  N NZ   . LYS A 1 23 ? -5.030  -11.434 -11.874 1.00 2.24  ? 23 LYS A NZ   1 
ATOM   339  H H    . LYS A 1 23 ? -2.542  -7.951  -5.826  1.00 0.20  ? 23 LYS A H    1 
ATOM   340  H HA   . LYS A 1 23 ? -0.938  -8.701  -8.193  1.00 0.23  ? 23 LYS A HA   1 
ATOM   341  H HB2  . LYS A 1 23 ? -3.516  -9.283  -7.458  1.00 0.46  ? 23 LYS A HB2  1 
ATOM   342  H HB3  . LYS A 1 23 ? -3.769  -7.938  -8.570  1.00 0.50  ? 23 LYS A HB3  1 
ATOM   343  H HG2  . LYS A 1 23 ? -2.494  -9.076  -10.308 1.00 1.39  ? 23 LYS A HG2  1 
ATOM   344  H HG3  . LYS A 1 23 ? -2.092  -10.385 -9.196  1.00 1.22  ? 23 LYS A HG3  1 
ATOM   345  H HD2  . LYS A 1 23 ? -4.530  -10.878 -8.958  1.00 1.67  ? 23 LYS A HD2  1 
ATOM   346  H HD3  . LYS A 1 23 ? -4.865  -9.647  -10.176 1.00 1.73  ? 23 LYS A HD3  1 
ATOM   347  H HE2  . LYS A 1 23 ? -2.981  -11.103 -11.481 1.00 1.96  ? 23 LYS A HE2  1 
ATOM   348  H HE3  . LYS A 1 23 ? -3.724  -12.366 -10.500 1.00 1.98  ? 23 LYS A HE3  1 
ATOM   349  H HZ1  . LYS A 1 23 ? -5.175  -10.494 -12.294 1.00 2.54  ? 23 LYS A HZ1  1 
ATOM   350  H HZ2  . LYS A 1 23 ? -4.839  -12.122 -12.629 1.00 2.79  ? 23 LYS A HZ2  1 
ATOM   351  H HZ3  . LYS A 1 23 ? -5.885  -11.718 -11.353 1.00 2.61  ? 23 LYS A HZ3  1 
ATOM   352  N N    . GLU A 1 24 ? -1.980  -5.679  -7.586  1.00 0.21  ? 24 GLU A N    1 
ATOM   353  C CA   . GLU A 1 24 ? -1.886  -4.265  -8.060  1.00 0.25  ? 24 GLU A CA   1 
ATOM   354  C C    . GLU A 1 24 ? -1.475  -3.361  -6.887  1.00 0.22  ? 24 GLU A C    1 
ATOM   355  O O    . GLU A 1 24 ? -2.286  -3.035  -6.040  1.00 0.24  ? 24 GLU A O    1 
ATOM   356  C CB   . GLU A 1 24 ? -3.249  -3.815  -8.599  1.00 0.32  ? 24 GLU A CB   1 
ATOM   357  C CG   . GLU A 1 24 ? -3.265  -3.930  -10.127 1.00 0.74  ? 24 GLU A CG   1 
ATOM   358  C CD   . GLU A 1 24 ? -4.535  -3.276  -10.677 1.00 1.29  ? 24 GLU A CD   1 
ATOM   359  O OE1  . GLU A 1 24 ? -4.494  -2.088  -10.954 1.00 1.91  ? 24 GLU A OE1  1 
ATOM   360  O OE2  . GLU A 1 24 ? -5.528  -3.973  -10.812 1.00 1.93  ? 24 GLU A OE2  1 
ATOM   361  H H    . GLU A 1 24 ? -2.297  -5.865  -6.675  1.00 0.20  ? 24 GLU A H    1 
ATOM   362  H HA   . GLU A 1 24 ? -1.147  -4.197  -8.845  1.00 0.29  ? 24 GLU A HA   1 
ATOM   363  H HB2  . GLU A 1 24 ? -4.024  -4.442  -8.183  1.00 0.53  ? 24 GLU A HB2  1 
ATOM   364  H HB3  . GLU A 1 24 ? -3.427  -2.789  -8.317  1.00 0.59  ? 24 GLU A HB3  1 
ATOM   365  H HG2  . GLU A 1 24 ? -2.396  -3.432  -10.534 1.00 1.23  ? 24 GLU A HG2  1 
ATOM   366  H HG3  . GLU A 1 24 ? -3.248  -4.972  -10.410 1.00 1.17  ? 24 GLU A HG3  1 
HETATM 367  N N    . MLE A 1 25 ? -0.223  -2.959  -6.822  1.00 0.21  ? 25 MLE A N    1 
HETATM 368  C CN   . MLE A 1 25 ? 0.402   -2.482  -8.098  1.00 0.23  ? 25 MLE A CN   1 
HETATM 369  C CA   . MLE A 1 25 ? 0.221   -2.085  -5.683  1.00 0.20  ? 25 MLE A CA   1 
HETATM 370  C CB   . MLE A 1 25 ? 1.581   -2.569  -5.157  1.00 0.20  ? 25 MLE A CB   1 
HETATM 371  C CG   . MLE A 1 25 ? 2.228   -1.473  -4.293  1.00 0.23  ? 25 MLE A CG   1 
HETATM 372  C CD1  . MLE A 1 25 ? 2.649   -2.055  -2.946  1.00 0.24  ? 25 MLE A CD1  1 
HETATM 373  C CD2  . MLE A 1 25 ? 3.457   -0.905  -5.014  1.00 0.28  ? 25 MLE A CD2  1 
HETATM 374  C C    . MLE A 1 25 ? 0.344   -0.630  -6.156  1.00 0.21  ? 25 MLE A C    1 
HETATM 375  O O    . MLE A 1 25 ? 1.322   -0.251  -6.780  1.00 0.22  ? 25 MLE A O    1 
HETATM 376  H HN1  . MLE A 1 25 ? 0.375   -3.268  -8.833  1.00 1.02  ? 25 MLE A HN1  1 
HETATM 377  H HN2  . MLE A 1 25 ? -0.145  -1.624  -8.467  1.00 0.99  ? 25 MLE A HN2  1 
HETATM 378  H HN3  . MLE A 1 25 ? 1.428   -2.196  -7.912  1.00 1.02  ? 25 MLE A HN3  1 
HETATM 379  H HA   . MLE A 1 25 ? -0.509  -2.142  -4.887  1.00 0.21  ? 25 MLE A HA   1 
HETATM 380  H HB2  . MLE A 1 25 ? 1.438   -3.460  -4.563  1.00 0.23  ? 25 MLE A HB2  1 
HETATM 381  H HB3  . MLE A 1 25 ? 2.228   -2.795  -5.991  1.00 0.20  ? 25 MLE A HB3  1 
HETATM 382  H HG   . MLE A 1 25 ? 1.512   -0.680  -4.126  1.00 0.29  ? 25 MLE A HG   1 
HETATM 383  H HD11 . MLE A 1 25 ? 2.061   -2.936  -2.736  1.00 1.09  ? 25 MLE A HD11 1 
HETATM 384  H HD12 . MLE A 1 25 ? 3.695   -2.318  -2.979  1.00 1.03  ? 25 MLE A HD12 1 
HETATM 385  H HD13 . MLE A 1 25 ? 2.484   -1.319  -2.173  1.00 1.02  ? 25 MLE A HD13 1 
HETATM 386  H HD21 . MLE A 1 25 ? 3.416   -1.169  -6.061  1.00 1.10  ? 25 MLE A HD21 1 
HETATM 387  H HD22 . MLE A 1 25 ? 3.466   0.170   -4.916  1.00 1.06  ? 25 MLE A HD22 1 
HETATM 388  H HD23 . MLE A 1 25 ? 4.355   -1.314  -4.576  1.00 1.02  ? 25 MLE A HD23 1 
ATOM   389  N N    . ARG A 1 26 ? -0.624  0.191   -5.862  1.00 0.21  ? 26 ARG A N    1 
ATOM   390  C CA   . ARG A 1 26 ? -0.529  1.608   -6.298  1.00 0.23  ? 26 ARG A CA   1 
ATOM   391  C C    . ARG A 1 26 ? -0.624  2.530   -5.071  1.00 0.23  ? 26 ARG A C    1 
ATOM   392  O O    . ARG A 1 26 ? -1.540  2.427   -4.279  1.00 0.27  ? 26 ARG A O    1 
ATOM   393  C CB   . ARG A 1 26 ? -1.652  1.938   -7.295  1.00 0.26  ? 26 ARG A CB   1 
ATOM   394  C CG   . ARG A 1 26 ? -2.990  1.366   -6.805  1.00 1.37  ? 26 ARG A CG   1 
ATOM   395  C CD   . ARG A 1 26 ? -4.141  2.242   -7.308  1.00 1.58  ? 26 ARG A CD   1 
ATOM   396  N NE   . ARG A 1 26 ? -4.330  2.033   -8.775  1.00 2.54  ? 26 ARG A NE   1 
ATOM   397  C CZ   . ARG A 1 26 ? -5.356  2.566   -9.384  1.00 2.98  ? 26 ARG A CZ   1 
ATOM   398  N NH1  . ARG A 1 26 ? -5.316  3.821   -9.756  1.00 3.46  ? 26 ARG A NH1  1 
ATOM   399  N NH2  . ARG A 1 26 ? -6.420  1.843   -9.623  1.00 3.44  ? 26 ARG A NH2  1 
ATOM   400  H H    . ARG A 1 26 ? -1.402  -0.122  -5.354  1.00 0.21  ? 26 ARG A H    1 
ATOM   401  H HA   . ARG A 1 26 ? 0.430   1.743   -6.779  1.00 0.24  ? 26 ARG A HA   1 
ATOM   402  H HB2  . ARG A 1 26 ? -1.736  3.010   -7.395  1.00 1.07  ? 26 ARG A HB2  1 
ATOM   403  H HB3  . ARG A 1 26 ? -1.412  1.508   -8.257  1.00 1.03  ? 26 ARG A HB3  1 
ATOM   404  H HG2  . ARG A 1 26 ? -3.110  0.361   -7.183  1.00 2.04  ? 26 ARG A HG2  1 
ATOM   405  H HG3  . ARG A 1 26 ? -3.001  1.347   -5.726  1.00 2.08  ? 26 ARG A HG3  1 
ATOM   406  H HD2  . ARG A 1 26 ? -5.049  1.975   -6.788  1.00 1.73  ? 26 ARG A HD2  1 
ATOM   407  H HD3  . ARG A 1 26 ? -3.911  3.280   -7.120  1.00 1.85  ? 26 ARG A HD3  1 
ATOM   408  H HE   . ARG A 1 26 ? -3.685  1.496   -9.282  1.00 3.15  ? 26 ARG A HE   1 
ATOM   409  H HH11 . ARG A 1 26 ? -4.500  4.371   -9.576  1.00 3.62  ? 26 ARG A HH11 1 
ATOM   410  H HH12 . ARG A 1 26 ? -6.101  4.231   -10.221 1.00 3.96  ? 26 ARG A HH12 1 
ATOM   411  H HH21 . ARG A 1 26 ? -6.447  0.884   -9.341  1.00 3.60  ? 26 ARG A HH21 1 
ATOM   412  H HH22 . ARG A 1 26 ? -7.207  2.249   -10.088 1.00 3.91  ? 26 ARG A HH22 1 
ATOM   413  N N    . VAL A 1 27 ? 0.321   3.423   -4.906  1.00 0.23  ? 27 VAL A N    1 
ATOM   414  C CA   . VAL A 1 27 ? 0.297   4.344   -3.729  1.00 0.24  ? 27 VAL A CA   1 
ATOM   415  C C    . VAL A 1 27 ? -0.303  5.701   -4.128  1.00 0.28  ? 27 VAL A C    1 
ATOM   416  O O    . VAL A 1 27 ? -0.216  6.115   -5.270  1.00 0.32  ? 27 VAL A O    1 
ATOM   417  C CB   . VAL A 1 27 ? 1.728   4.548   -3.215  1.00 0.26  ? 27 VAL A CB   1 
ATOM   418  C CG1  . VAL A 1 27 ? 2.244   3.246   -2.600  1.00 0.26  ? 27 VAL A CG1  1 
ATOM   419  C CG2  . VAL A 1 27 ? 2.653   4.965   -4.366  1.00 0.29  ? 27 VAL A CG2  1 
ATOM   420  H H    . VAL A 1 27 ? 1.054   3.485   -5.549  1.00 0.26  ? 27 VAL A H    1 
ATOM   421  H HA   . VAL A 1 27 ? -0.304  3.906   -2.945  1.00 0.24  ? 27 VAL A HA   1 
ATOM   422  H HB   . VAL A 1 27 ? 1.723   5.318   -2.465  1.00 0.29  ? 27 VAL A HB   1 
ATOM   423  H HG11 . VAL A 1 27 ? 1.499   2.847   -1.930  1.00 1.01  ? 27 VAL A HG11 1 
ATOM   424  H HG12 . VAL A 1 27 ? 2.443   2.531   -3.384  1.00 1.04  ? 27 VAL A HG12 1 
ATOM   425  H HG13 . VAL A 1 27 ? 3.153   3.442   -2.051  1.00 1.05  ? 27 VAL A HG13 1 
ATOM   426  H HG21 . VAL A 1 27 ? 2.149   5.688   -4.989  1.00 1.07  ? 27 VAL A HG21 1 
ATOM   427  H HG22 . VAL A 1 27 ? 3.553   5.403   -3.962  1.00 1.01  ? 27 VAL A HG22 1 
ATOM   428  H HG23 . VAL A 1 27 ? 2.908   4.097   -4.955  1.00 1.09  ? 27 VAL A HG23 1 
ATOM   429  N N    . ILE A 1 28 ? -0.900  6.400   -3.188  1.00 0.30  ? 28 ILE A N    1 
ATOM   430  C CA   . ILE A 1 28 ? -1.495  7.737   -3.500  1.00 0.35  ? 28 ILE A CA   1 
ATOM   431  C C    . ILE A 1 28 ? -0.588  8.829   -2.920  1.00 0.33  ? 28 ILE A C    1 
ATOM   432  O O    . ILE A 1 28 ? -0.159  8.749   -1.783  1.00 0.40  ? 28 ILE A O    1 
ATOM   433  C CB   . ILE A 1 28 ? -2.900  7.841   -2.883  1.00 0.41  ? 28 ILE A CB   1 
ATOM   434  C CG1  . ILE A 1 28 ? -3.857  6.910   -3.639  1.00 0.58  ? 28 ILE A CG1  1 
ATOM   435  C CG2  . ILE A 1 28 ? -3.407  9.286   -2.986  1.00 0.45  ? 28 ILE A CG2  1 
ATOM   436  C CD1  . ILE A 1 28 ? -5.251  6.973   -3.005  1.00 0.90  ? 28 ILE A CD1  1 
ATOM   437  H H    . ILE A 1 28 ? -0.949  6.049   -2.270  1.00 0.30  ? 28 ILE A H    1 
ATOM   438  H HA   . ILE A 1 28 ? -1.561  7.858   -4.571  1.00 0.43  ? 28 ILE A HA   1 
ATOM   439  H HB   . ILE A 1 28 ? -2.858  7.549   -1.843  1.00 0.40  ? 28 ILE A HB   1 
ATOM   440  H HG12 . ILE A 1 28 ? -3.918  7.219   -4.672  1.00 1.17  ? 28 ILE A HG12 1 
ATOM   441  H HG13 . ILE A 1 28 ? -3.487  5.897   -3.588  1.00 0.87  ? 28 ILE A HG13 1 
ATOM   442  H HG21 . ILE A 1 28 ? -3.212  9.667   -3.977  1.00 1.15  ? 28 ILE A HG21 1 
ATOM   443  H HG22 . ILE A 1 28 ? -4.470  9.310   -2.795  1.00 1.07  ? 28 ILE A HG22 1 
ATOM   444  H HG23 . ILE A 1 28 ? -2.898  9.899   -2.258  1.00 1.05  ? 28 ILE A HG23 1 
ATOM   445  H HD11 . ILE A 1 28 ? -5.184  6.707   -1.960  1.00 1.50  ? 28 ILE A HD11 1 
ATOM   446  H HD12 . ILE A 1 28 ? -5.644  7.974   -3.098  1.00 1.58  ? 28 ILE A HD12 1 
ATOM   447  H HD13 . ILE A 1 28 ? -5.907  6.281   -3.511  1.00 1.33  ? 28 ILE A HD13 1 
ATOM   448  N N    . GLU A 1 29 ? -0.293  9.847   -3.695  1.00 0.41  ? 29 GLU A N    1 
ATOM   449  C CA   . GLU A 1 29 ? 0.586   10.948  -3.201  1.00 0.46  ? 29 GLU A CA   1 
ATOM   450  C C    . GLU A 1 29 ? -0.161  11.792  -2.158  1.00 0.38  ? 29 GLU A C    1 
ATOM   451  O O    . GLU A 1 29 ? -1.337  11.596  -1.909  1.00 0.35  ? 29 GLU A O    1 
ATOM   452  C CB   . GLU A 1 29 ? 0.986   11.839  -4.379  1.00 0.61  ? 29 GLU A CB   1 
ATOM   453  C CG   . GLU A 1 29 ? 1.962   11.086  -5.289  1.00 1.53  ? 29 GLU A CG   1 
ATOM   454  C CD   . GLU A 1 29 ? 2.408   12.000  -6.433  1.00 2.08  ? 29 GLU A CD   1 
ATOM   455  O OE1  . GLU A 1 29 ? 1.733   12.017  -7.450  1.00 2.63  ? 29 GLU A OE1  1 
ATOM   456  O OE2  . GLU A 1 29 ? 3.419   12.666  -6.274  1.00 2.59  ? 29 GLU A OE2  1 
ATOM   457  H H    . GLU A 1 29 ? -0.650  9.887   -4.606  1.00 0.52  ? 29 GLU A H    1 
ATOM   458  H HA   . GLU A 1 29 ? 1.474   10.527  -2.753  1.00 0.51  ? 29 GLU A HA   1 
ATOM   459  H HB2  . GLU A 1 29 ? 0.104   12.109  -4.939  1.00 1.02  ? 29 GLU A HB2  1 
ATOM   460  H HB3  . GLU A 1 29 ? 1.459   12.730  -4.008  1.00 1.12  ? 29 GLU A HB3  1 
ATOM   461  H HG2  . GLU A 1 29 ? 2.824   10.780  -4.714  1.00 2.05  ? 29 GLU A HG2  1 
ATOM   462  H HG3  . GLU A 1 29 ? 1.474   10.214  -5.697  1.00 2.12  ? 29 GLU A HG3  1 
ATOM   463  N N    . SER A 1 30 ? 0.520   12.731  -1.547  1.00 0.42  ? 30 SER A N    1 
ATOM   464  C CA   . SER A 1 30 ? -0.132  13.595  -0.519  1.00 0.40  ? 30 SER A CA   1 
ATOM   465  C C    . SER A 1 30 ? -0.404  14.987  -1.103  1.00 0.39  ? 30 SER A C    1 
ATOM   466  O O    . SER A 1 30 ? 0.167   15.376  -2.106  1.00 0.41  ? 30 SER A O    1 
ATOM   467  C CB   . SER A 1 30 ? 0.783   13.725  0.705   1.00 0.51  ? 30 SER A CB   1 
ATOM   468  O OG   . SER A 1 30 ? 2.145   13.634  0.302   1.00 0.57  ? 30 SER A OG   1 
ATOM   469  H H    . SER A 1 30 ? 1.465   12.869  -1.766  1.00 0.49  ? 30 SER A H    1 
ATOM   470  H HA   . SER A 1 30 ? -1.067  13.147  -0.216  1.00 0.39  ? 30 SER A HA   1 
ATOM   471  H HB2  . SER A 1 30 ? 0.621   14.679  1.174   1.00 0.54  ? 30 SER A HB2  1 
ATOM   472  H HB3  . SER A 1 30 ? 0.551   12.938  1.409   1.00 0.55  ? 30 SER A HB3  1 
ATOM   473  H HG   . SER A 1 30 ? 2.622   13.145  0.976   1.00 1.13  ? 30 SER A HG   1 
ATOM   474  N N    . GLY A 1 31 ? -1.278  15.733  -0.477  1.00 0.42  ? 31 GLY A N    1 
ATOM   475  C CA   . GLY A 1 31 ? -1.612  17.104  -0.973  1.00 0.47  ? 31 GLY A CA   1 
ATOM   476  C C    . GLY A 1 31 ? -2.591  17.765  0.007   1.00 0.54  ? 31 GLY A C    1 
ATOM   477  O O    . GLY A 1 31 ? -2.576  17.462  1.186   1.00 0.56  ? 31 GLY A O    1 
ATOM   478  H H    . GLY A 1 31 ? -1.721  15.388  0.327   1.00 0.44  ? 31 GLY A H    1 
ATOM   479  H HA2  . GLY A 1 31 ? -0.712  17.688  -1.049  1.00 0.51  ? 31 GLY A HA2  1 
ATOM   480  H HA3  . GLY A 1 31 ? -2.075  17.030  -1.944  1.00 0.51  ? 31 GLY A HA3  1 
ATOM   481  N N    . PRO A 1 32 ? -3.441  18.625  -0.511  1.00 0.64  ? 32 PRO A N    1 
ATOM   482  C CA   . PRO A 1 32 ? -4.469  19.307  0.303   1.00 0.78  ? 32 PRO A CA   1 
ATOM   483  C C    . PRO A 1 32 ? -5.574  18.299  0.650   1.00 0.81  ? 32 PRO A C    1 
ATOM   484  O O    . PRO A 1 32 ? -6.170  18.347  1.710   1.00 0.90  ? 32 PRO A O    1 
ATOM   485  C CB   . PRO A 1 32 ? -4.979  20.424  -0.615  1.00 0.89  ? 32 PRO A CB   1 
ATOM   486  C CG   . PRO A 1 32 ? -4.630  19.992  -2.059  1.00 0.81  ? 32 PRO A CG   1 
ATOM   487  C CD   . PRO A 1 32 ? -3.467  18.989  -1.946  1.00 0.66  ? 32 PRO A CD   1 
ATOM   488  H HA   . PRO A 1 32 ? -4.035  19.725  1.196   1.00 0.83  ? 32 PRO A HA   1 
ATOM   489  H HB2  . PRO A 1 32 ? -6.050  20.535  -0.505  1.00 1.00  ? 32 PRO A HB2  1 
ATOM   490  H HB3  . PRO A 1 32 ? -4.482  21.353  -0.383  1.00 0.94  ? 32 PRO A HB3  1 
ATOM   491  H HG2  . PRO A 1 32 ? -5.485  19.522  -2.519  1.00 0.87  ? 32 PRO A HG2  1 
ATOM   492  H HG3  . PRO A 1 32 ? -4.319  20.847  -2.638  1.00 0.85  ? 32 PRO A HG3  1 
ATOM   493  H HD2  . PRO A 1 32 ? -3.659  18.119  -2.558  1.00 0.64  ? 32 PRO A HD2  1 
ATOM   494  H HD3  . PRO A 1 32 ? -2.536  19.455  -2.228  1.00 0.64  ? 32 PRO A HD3  1 
ATOM   495  N N    . HIS A 1 33 ? -5.814  17.369  -0.243  1.00 0.77  ? 33 HIS A N    1 
ATOM   496  C CA   . HIS A 1 33 ? -6.838  16.303  -0.016  1.00 0.83  ? 33 HIS A CA   1 
ATOM   497  C C    . HIS A 1 33 ? -6.425  15.435  1.187   1.00 0.75  ? 33 HIS A C    1 
ATOM   498  O O    . HIS A 1 33 ? -7.256  14.982  1.949   1.00 0.85  ? 33 HIS A O    1 
ATOM   499  C CB   . HIS A 1 33 ? -6.934  15.417  -1.275  1.00 0.85  ? 33 HIS A CB   1 
ATOM   500  C CG   . HIS A 1 33 ? -5.571  14.852  -1.614  1.00 0.71  ? 33 HIS A CG   1 
ATOM   501  N ND1  . HIS A 1 33 ? -4.627  15.576  -2.330  1.00 0.67  ? 33 HIS A ND1  1 
ATOM   502  C CD2  . HIS A 1 33 ? -4.963  13.661  -1.298  1.00 0.68  ? 33 HIS A CD2  1 
ATOM   503  C CE1  . HIS A 1 33 ? -3.513  14.829  -2.408  1.00 0.61  ? 33 HIS A CE1  1 
ATOM   504  N NE2  . HIS A 1 33 ? -3.664  13.650  -1.800  1.00 0.64  ? 33 HIS A NE2  1 
ATOM   505  H H    . HIS A 1 33 ? -5.298  17.363  -1.070  1.00 0.72  ? 33 HIS A H    1 
ATOM   506  H HA   . HIS A 1 33 ? -7.796  16.758  0.179   1.00 0.97  ? 33 HIS A HA   1 
ATOM   507  H HB2  . HIS A 1 33 ? -7.620  14.609  -1.088  1.00 0.92  ? 33 HIS A HB2  1 
ATOM   508  H HB3  . HIS A 1 33 ? -7.294  16.007  -2.103  1.00 0.93  ? 33 HIS A HB3  1 
ATOM   509  H HD1  . HIS A 1 33 ? -4.753  16.464  -2.721  1.00 0.71  ? 33 HIS A HD1  1 
ATOM   510  H HD2  . HIS A 1 33 ? -5.423  12.856  -0.744  1.00 0.73  ? 33 HIS A HD2  1 
ATOM   511  H HE1  . HIS A 1 33 ? -2.593  15.162  -2.872  1.00 0.61  ? 33 HIS A HE1  1 
ATOM   512  N N    . CYS A 1 34 ? -5.141  15.206  1.354   1.00 0.59  ? 34 CYS A N    1 
ATOM   513  C CA   . CYS A 1 34 ? -4.649  14.378  2.488   1.00 0.55  ? 34 CYS A CA   1 
ATOM   514  C C    . CYS A 1 34 ? -3.146  14.621  2.668   1.00 0.51  ? 34 CYS A C    1 
ATOM   515  O O    . CYS A 1 34 ? -2.342  14.220  1.847   1.00 0.50  ? 34 CYS A O    1 
ATOM   516  C CB   . CYS A 1 34 ? -4.905  12.892  2.198   1.00 0.50  ? 34 CYS A CB   1 
ATOM   517  S SG   . CYS A 1 34 ? -5.264  12.026  3.747   1.00 0.66  ? 34 CYS A SG   1 
ATOM   518  H H    . CYS A 1 34 ? -4.499  15.585  0.730   1.00 0.54  ? 34 CYS A H    1 
ATOM   519  H HA   . CYS A 1 34 ? -5.168  14.668  3.381   1.00 0.67  ? 34 CYS A HA   1 
ATOM   520  H HB2  . CYS A 1 34 ? -5.747  12.794  1.529   1.00 0.54  ? 34 CYS A HB2  1 
ATOM   521  H HB3  . CYS A 1 34 ? -4.029  12.459  1.739   1.00 0.52  ? 34 CYS A HB3  1 
ATOM   522  N N    . ALA A 1 35 ? -2.768  15.284  3.735   1.00 0.64  ? 35 ALA A N    1 
ATOM   523  C CA   . ALA A 1 35 ? -1.318  15.571  3.979   1.00 0.72  ? 35 ALA A CA   1 
ATOM   524  C C    . ALA A 1 35 ? -0.542  14.263  4.189   1.00 0.57  ? 35 ALA A C    1 
ATOM   525  O O    . ALA A 1 35 ? 0.608   14.153  3.808   1.00 0.60  ? 35 ALA A O    1 
ATOM   526  C CB   . ALA A 1 35 ? -1.177  16.451  5.224   1.00 0.97  ? 35 ALA A CB   1 
ATOM   527  H H    . ALA A 1 35 ? -3.440  15.599  4.375   1.00 0.75  ? 35 ALA A H    1 
ATOM   528  H HA   . ALA A 1 35 ? -0.911  16.092  3.128   1.00 0.81  ? 35 ALA A HA   1 
ATOM   529  H HB1  . ALA A 1 35 ? -1.829  17.307  5.136   1.00 1.44  ? 35 ALA A HB1  1 
ATOM   530  H HB2  . ALA A 1 35 ? -1.447  15.881  6.101   1.00 1.49  ? 35 ALA A HB2  1 
ATOM   531  H HB3  . ALA A 1 35 ? -0.154  16.786  5.314   1.00 1.43  ? 35 ALA A HB3  1 
ATOM   532  N N    . ASN A 1 36 ? -1.161  13.276  4.791   1.00 0.51  ? 36 ASN A N    1 
ATOM   533  C CA   . ASN A 1 36 ? -0.463  11.977  5.026   1.00 0.46  ? 36 ASN A CA   1 
ATOM   534  C C    . ASN A 1 36 ? -0.549  11.106  3.767   1.00 0.39  ? 36 ASN A C    1 
ATOM   535  O O    . ASN A 1 36 ? -1.600  10.966  3.169   1.00 0.38  ? 36 ASN A O    1 
ATOM   536  C CB   . ASN A 1 36 ? -1.125  11.246  6.198   1.00 0.57  ? 36 ASN A CB   1 
ATOM   537  C CG   . ASN A 1 36 ? -0.442  11.651  7.508   1.00 0.69  ? 36 ASN A CG   1 
ATOM   538  O OD1  . ASN A 1 36 ? 0.303   10.880  8.080   1.00 1.27  ? 36 ASN A OD1  1 
ATOM   539  N ND2  . ASN A 1 36 ? -0.663  12.836  8.011   1.00 1.35  ? 36 ASN A ND2  1 
ATOM   540  H H    . ASN A 1 36 ? -2.087  13.391  5.088   1.00 0.58  ? 36 ASN A H    1 
ATOM   541  H HA   . ASN A 1 36 ? 0.574   12.166  5.261   1.00 0.52  ? 36 ASN A HA   1 
ATOM   542  H HB2  . ASN A 1 36 ? -2.173  11.507  6.241   1.00 0.61  ? 36 ASN A HB2  1 
ATOM   543  H HB3  . ASN A 1 36 ? -1.026  10.181  6.059   1.00 0.60  ? 36 ASN A HB3  1 
ATOM   544  H HD21 . ASN A 1 36 ? -1.262  13.461  7.551   1.00 2.08  ? 36 ASN A HD21 1 
ATOM   545  H HD22 . ASN A 1 36 ? -0.229  13.101  8.849   1.00 1.41  ? 36 ASN A HD22 1 
ATOM   546  N N    . THR A 1 37 ? 0.554   10.516  3.370   1.00 0.40  ? 37 THR A N    1 
ATOM   547  C CA   . THR A 1 37 ? 0.555   9.640   2.156   1.00 0.35  ? 37 THR A CA   1 
ATOM   548  C C    . THR A 1 37 ? -0.146  8.317   2.494   1.00 0.32  ? 37 THR A C    1 
ATOM   549  O O    . THR A 1 37 ? -0.081  7.843   3.615   1.00 0.42  ? 37 THR A O    1 
ATOM   550  C CB   . THR A 1 37 ? 2.005   9.367   1.727   1.00 0.45  ? 37 THR A CB   1 
ATOM   551  O OG1  . THR A 1 37 ? 2.694   10.602  1.577   1.00 0.57  ? 37 THR A OG1  1 
ATOM   552  C CG2  . THR A 1 37 ? 2.025   8.613   0.395   1.00 0.47  ? 37 THR A CG2  1 
ATOM   553  H H    . THR A 1 37 ? 1.383   10.645  3.877   1.00 0.47  ? 37 THR A H    1 
ATOM   554  H HA   . THR A 1 37 ? 0.027   10.134  1.354   1.00 0.34  ? 37 THR A HA   1 
ATOM   555  H HB   . THR A 1 37 ? 2.497   8.770   2.480   1.00 0.52  ? 37 THR A HB   1 
ATOM   556  H HG1  . THR A 1 37 ? 3.346   10.667  2.278   1.00 0.94  ? 37 THR A HG1  1 
ATOM   557  H HG21 . THR A 1 37 ? 1.363   7.762   0.452   1.00 1.14  ? 37 THR A HG21 1 
ATOM   558  H HG22 . THR A 1 37 ? 1.699   9.272   -0.396  1.00 1.12  ? 37 THR A HG22 1 
ATOM   559  H HG23 . THR A 1 37 ? 3.029   8.273   0.189   1.00 1.10  ? 37 THR A HG23 1 
ATOM   560  N N    . GLU A 1 38 ? -0.819  7.719   1.539   1.00 0.29  ? 38 GLU A N    1 
ATOM   561  C CA   . GLU A 1 38 ? -1.525  6.432   1.812   1.00 0.38  ? 38 GLU A CA   1 
ATOM   562  C C    . GLU A 1 38 ? -1.214  5.429   0.701   1.00 0.34  ? 38 GLU A C    1 
ATOM   563  O O    . GLU A 1 38 ? -1.374  5.718   -0.471  1.00 0.39  ? 38 GLU A O    1 
ATOM   564  C CB   . GLU A 1 38 ? -3.036  6.682   1.874   1.00 0.52  ? 38 GLU A CB   1 
ATOM   565  C CG   . GLU A 1 38 ? -3.663  5.781   2.943   1.00 1.19  ? 38 GLU A CG   1 
ATOM   566  C CD   . GLU A 1 38 ? -3.487  6.420   4.324   1.00 1.65  ? 38 GLU A CD   1 
ATOM   567  O OE1  . GLU A 1 38 ? -2.449  6.205   4.929   1.00 2.15  ? 38 GLU A OE1  1 
ATOM   568  O OE2  . GLU A 1 38 ? -4.394  7.114   4.753   1.00 2.34  ? 38 GLU A OE2  1 
ATOM   569  H H    . GLU A 1 38 ? -0.861  8.117   0.641   1.00 0.30  ? 38 GLU A H    1 
ATOM   570  H HA   . GLU A 1 38 ? -1.189  6.032   2.758   1.00 0.45  ? 38 GLU A HA   1 
ATOM   571  H HB2  . GLU A 1 38 ? -3.220  7.718   2.122   1.00 0.97  ? 38 GLU A HB2  1 
ATOM   572  H HB3  . GLU A 1 38 ? -3.478  6.459   0.914   1.00 0.90  ? 38 GLU A HB3  1 
ATOM   573  H HG2  . GLU A 1 38 ? -4.716  5.657   2.734   1.00 1.68  ? 38 GLU A HG2  1 
ATOM   574  H HG3  . GLU A 1 38 ? -3.178  4.817   2.930   1.00 1.84  ? 38 GLU A HG3  1 
ATOM   575  N N    . ILE A 1 39 ? -0.776  4.249   1.063   1.00 0.29  ? 39 ILE A N    1 
ATOM   576  C CA   . ILE A 1 39 ? -0.457  3.215   0.037   1.00 0.27  ? 39 ILE A CA   1 
ATOM   577  C C    . ILE A 1 39 ? -1.727  2.405   -0.263  1.00 0.28  ? 39 ILE A C    1 
ATOM   578  O O    . ILE A 1 39 ? -2.651  2.377   0.526   1.00 0.44  ? 39 ILE A O    1 
ATOM   579  C CB   . ILE A 1 39 ? 0.648   2.296   0.595   1.00 0.27  ? 39 ILE A CB   1 
ATOM   580  C CG1  . ILE A 1 39 ? 1.980   3.059   0.626   1.00 0.28  ? 39 ILE A CG1  1 
ATOM   581  C CG2  . ILE A 1 39 ? 0.803   1.043   -0.276  1.00 0.28  ? 39 ILE A CG2  1 
ATOM   582  C CD1  . ILE A 1 39 ? 2.396   3.321   2.076   1.00 0.36  ? 39 ILE A CD1  1 
ATOM   583  H H    . ILE A 1 39 ? -0.661  4.038   2.019   1.00 0.30  ? 39 ILE A H    1 
ATOM   584  H HA   . ILE A 1 39 ? -0.109  3.693   -0.867  1.00 0.26  ? 39 ILE A HA   1 
ATOM   585  H HB   . ILE A 1 39 ? 0.384   1.998   1.599   1.00 0.30  ? 39 ILE A HB   1 
ATOM   586  H HG12 . ILE A 1 39 ? 2.743   2.472   0.135   1.00 0.35  ? 39 ILE A HG12 1 
ATOM   587  H HG13 . ILE A 1 39 ? 1.868   4.002   0.111   1.00 0.35  ? 39 ILE A HG13 1 
ATOM   588  H HG21 . ILE A 1 39 ? 0.775   1.321   -1.319  1.00 1.03  ? 39 ILE A HG21 1 
ATOM   589  H HG22 . ILE A 1 39 ? 1.747   0.567   -0.056  1.00 1.04  ? 39 ILE A HG22 1 
ATOM   590  H HG23 . ILE A 1 39 ? -0.003  0.356   -0.065  1.00 1.08  ? 39 ILE A HG23 1 
ATOM   591  H HD11 . ILE A 1 39 ? 1.979   2.557   2.715   1.00 1.06  ? 39 ILE A HD11 1 
ATOM   592  H HD12 . ILE A 1 39 ? 3.474   3.303   2.150   1.00 1.09  ? 39 ILE A HD12 1 
ATOM   593  H HD13 . ILE A 1 39 ? 2.032   4.289   2.387   1.00 1.11  ? 39 ILE A HD13 1 
ATOM   594  N N    . ILE A 1 40 ? -1.779  1.744   -1.394  1.00 0.23  ? 40 ILE A N    1 
ATOM   595  C CA   . ILE A 1 40 ? -2.980  0.920   -1.731  1.00 0.24  ? 40 ILE A CA   1 
ATOM   596  C C    . ILE A 1 40 ? -2.533  -0.307  -2.523  1.00 0.24  ? 40 ILE A C    1 
ATOM   597  O O    . ILE A 1 40 ? -1.771  -0.208  -3.464  1.00 0.50  ? 40 ILE A O    1 
ATOM   598  C CB   . ILE A 1 40 ? -3.991  1.720   -2.564  1.00 0.27  ? 40 ILE A CB   1 
ATOM   599  C CG1  . ILE A 1 40 ? -4.407  2.982   -1.800  1.00 0.31  ? 40 ILE A CG1  1 
ATOM   600  C CG2  . ILE A 1 40 ? -5.228  0.848   -2.820  1.00 0.28  ? 40 ILE A CG2  1 
ATOM   601  C CD1  . ILE A 1 40 ? -5.301  3.850   -2.687  1.00 0.38  ? 40 ILE A CD1  1 
ATOM   602  H H    . ILE A 1 40 ? -1.023  1.779   -2.017  1.00 0.29  ? 40 ILE A H    1 
ATOM   603  H HA   . ILE A 1 40 ? -3.452  0.594   -0.815  1.00 0.23  ? 40 ILE A HA   1 
ATOM   604  H HB   . ILE A 1 40 ? -3.544  1.996   -3.507  1.00 0.30  ? 40 ILE A HB   1 
ATOM   605  H HG12 . ILE A 1 40 ? -4.947  2.702   -0.908  1.00 0.31  ? 40 ILE A HG12 1 
ATOM   606  H HG13 . ILE A 1 40 ? -3.525  3.540   -1.526  1.00 0.31  ? 40 ILE A HG13 1 
ATOM   607  H HG21 . ILE A 1 40 ? -5.514  0.352   -1.904  1.00 0.98  ? 40 ILE A HG21 1 
ATOM   608  H HG22 . ILE A 1 40 ? -6.043  1.467   -3.163  1.00 1.03  ? 40 ILE A HG22 1 
ATOM   609  H HG23 . ILE A 1 40 ? -4.996  0.108   -3.572  1.00 0.97  ? 40 ILE A HG23 1 
ATOM   610  H HD11 . ILE A 1 40 ? -6.089  3.244   -3.108  1.00 1.19  ? 40 ILE A HD11 1 
ATOM   611  H HD12 . ILE A 1 40 ? -5.733  4.643   -2.095  1.00 1.07  ? 40 ILE A HD12 1 
ATOM   612  H HD13 . ILE A 1 40 ? -4.711  4.277   -3.485  1.00 1.00  ? 40 ILE A HD13 1 
ATOM   613  N N    . VAL A 1 41 ? -3.005  -1.459  -2.142  1.00 0.25  ? 41 VAL A N    1 
ATOM   614  C CA   . VAL A 1 41 ? -2.630  -2.705  -2.845  1.00 0.21  ? 41 VAL A CA   1 
ATOM   615  C C    . VAL A 1 41 ? -3.896  -3.521  -3.129  1.00 0.21  ? 41 VAL A C    1 
ATOM   616  O O    . VAL A 1 41 ? -4.946  -3.273  -2.565  1.00 0.23  ? 41 VAL A O    1 
ATOM   617  C CB   . VAL A 1 41 ? -1.678  -3.518  -1.967  1.00 0.17  ? 41 VAL A CB   1 
ATOM   618  C CG1  . VAL A 1 41 ? -0.349  -2.774  -1.823  1.00 0.20  ? 41 VAL A CG1  1 
ATOM   619  C CG2  . VAL A 1 41 ? -2.286  -3.745  -0.579  1.00 0.18  ? 41 VAL A CG2  1 
ATOM   620  H H    . VAL A 1 41 ? -3.608  -1.508  -1.387  1.00 0.45  ? 41 VAL A H    1 
ATOM   621  H HA   . VAL A 1 41 ? -2.140  -2.462  -3.777  1.00 0.21  ? 41 VAL A HA   1 
ATOM   622  H HB   . VAL A 1 41 ? -1.507  -4.462  -2.435  1.00 0.19  ? 41 VAL A HB   1 
ATOM   623  H HG11 . VAL A 1 41 ? -0.534  -1.771  -1.470  1.00 1.01  ? 41 VAL A HG11 1 
ATOM   624  H HG12 . VAL A 1 41 ? 0.280   -3.294  -1.115  1.00 1.01  ? 41 VAL A HG12 1 
ATOM   625  H HG13 . VAL A 1 41 ? 0.145   -2.734  -2.782  1.00 1.00  ? 41 VAL A HG13 1 
ATOM   626  H HG21 . VAL A 1 41 ? -3.363  -3.771  -0.657  1.00 1.02  ? 41 VAL A HG21 1 
ATOM   627  H HG22 . VAL A 1 41 ? -1.932  -4.684  -0.181  1.00 0.99  ? 41 VAL A HG22 1 
ATOM   628  H HG23 . VAL A 1 41 ? -1.992  -2.941  0.079   1.00 1.04  ? 41 VAL A HG23 1 
ATOM   629  N N    . LYS A 1 42 ? -3.800  -4.493  -3.996  1.00 0.20  ? 42 LYS A N    1 
ATOM   630  C CA   . LYS A 1 42 ? -4.987  -5.334  -4.321  1.00 0.22  ? 42 LYS A CA   1 
ATOM   631  C C    . LYS A 1 42 ? -4.563  -6.805  -4.352  1.00 0.21  ? 42 LYS A C    1 
ATOM   632  O O    . LYS A 1 42 ? -4.095  -7.302  -5.359  1.00 0.25  ? 42 LYS A O    1 
ATOM   633  C CB   . LYS A 1 42 ? -5.550  -4.921  -5.687  1.00 0.27  ? 42 LYS A CB   1 
ATOM   634  C CG   . LYS A 1 42 ? -7.018  -4.517  -5.533  1.00 0.37  ? 42 LYS A CG   1 
ATOM   635  C CD   . LYS A 1 42 ? -7.574  -4.081  -6.890  1.00 0.92  ? 42 LYS A CD   1 
ATOM   636  C CE   . LYS A 1 42 ? -9.104  -4.107  -6.849  1.00 1.41  ? 42 LYS A CE   1 
ATOM   637  N NZ   . LYS A 1 42 ? -9.648  -3.288  -7.970  1.00 2.00  ? 42 LYS A NZ   1 
ATOM   638  H H    . LYS A 1 42 ? -2.943  -4.670  -4.433  1.00 0.20  ? 42 LYS A H    1 
ATOM   639  H HA   . LYS A 1 42 ? -5.743  -5.195  -3.562  1.00 0.22  ? 42 LYS A HA   1 
ATOM   640  H HB2  . LYS A 1 42 ? -4.984  -4.084  -6.071  1.00 0.30  ? 42 LYS A HB2  1 
ATOM   641  H HB3  . LYS A 1 42 ? -5.478  -5.750  -6.375  1.00 0.32  ? 42 LYS A HB3  1 
ATOM   642  H HG2  . LYS A 1 42 ? -7.586  -5.359  -5.163  1.00 0.76  ? 42 LYS A HG2  1 
ATOM   643  H HG3  . LYS A 1 42 ? -7.095  -3.696  -4.835  1.00 0.75  ? 42 LYS A HG3  1 
ATOM   644  H HD2  . LYS A 1 42 ? -7.235  -3.080  -7.113  1.00 1.46  ? 42 LYS A HD2  1 
ATOM   645  H HD3  . LYS A 1 42 ? -7.226  -4.758  -7.656  1.00 1.68  ? 42 LYS A HD3  1 
ATOM   646  H HE2  . LYS A 1 42 ? -9.449  -5.126  -6.948  1.00 2.04  ? 42 LYS A HE2  1 
ATOM   647  H HE3  . LYS A 1 42 ? -9.446  -3.701  -5.908  1.00 1.91  ? 42 LYS A HE3  1 
ATOM   648  H HZ1  . LYS A 1 42 ? -9.284  -3.650  -8.874  1.00 2.37  ? 42 LYS A HZ1  1 
ATOM   649  H HZ2  . LYS A 1 42 ? -10.686 -3.346  -7.969  1.00 2.40  ? 42 LYS A HZ2  1 
ATOM   650  H HZ3  . LYS A 1 42 ? -9.355  -2.296  -7.849  1.00 2.49  ? 42 LYS A HZ3  1 
ATOM   651  N N    . LEU A 1 43 ? -4.716  -7.499  -3.246  1.00 0.19  ? 43 LEU A N    1 
ATOM   652  C CA   . LEU A 1 43 ? -4.321  -8.939  -3.178  1.00 0.20  ? 43 LEU A CA   1 
ATOM   653  C C    . LEU A 1 43 ? -4.917  -9.717  -4.352  1.00 0.24  ? 43 LEU A C    1 
ATOM   654  O O    . LEU A 1 43 ? -6.039  -9.477  -4.767  1.00 0.26  ? 43 LEU A O    1 
ATOM   655  C CB   . LEU A 1 43 ? -4.840  -9.547  -1.878  1.00 0.22  ? 43 LEU A CB   1 
ATOM   656  C CG   . LEU A 1 43 ? -4.005  -9.043  -0.695  1.00 0.20  ? 43 LEU A CG   1 
ATOM   657  C CD1  . LEU A 1 43 ? -4.704  -9.404  0.617   1.00 0.25  ? 43 LEU A CD1  1 
ATOM   658  C CD2  . LEU A 1 43 ? -2.620  -9.696  -0.730  1.00 0.24  ? 43 LEU A CD2  1 
ATOM   659  H H    . LEU A 1 43 ? -5.086  -7.068  -2.449  1.00 0.22  ? 43 LEU A H    1 
ATOM   660  H HA   . LEU A 1 43 ? -3.245  -9.016  -3.204  1.00 0.21  ? 43 LEU A HA   1 
ATOM   661  H HB2  . LEU A 1 43 ? -5.869  -9.266  -1.745  1.00 0.24  ? 43 LEU A HB2  1 
ATOM   662  H HB3  . LEU A 1 43 ? -4.773  -10.617 -1.936  1.00 0.25  ? 43 LEU A HB3  1 
ATOM   663  H HG   . LEU A 1 43 ? -3.900  -7.970  -0.762  1.00 0.20  ? 43 LEU A HG   1 
ATOM   664  H HD11 . LEU A 1 43 ? -5.159  -10.379 0.527   1.00 1.02  ? 43 LEU A HD11 1 
ATOM   665  H HD12 . LEU A 1 43 ? -3.979  -9.417  1.418   1.00 1.03  ? 43 LEU A HD12 1 
ATOM   666  H HD13 . LEU A 1 43 ? -5.465  -8.669  0.833   1.00 1.06  ? 43 LEU A HD13 1 
ATOM   667  H HD21 . LEU A 1 43 ? -2.719  -10.736 -1.004  1.00 1.04  ? 43 LEU A HD21 1 
ATOM   668  H HD22 . LEU A 1 43 ? -2.001  -9.190  -1.456  1.00 1.05  ? 43 LEU A HD22 1 
ATOM   669  H HD23 . LEU A 1 43 ? -2.163  -9.623  0.246   1.00 1.00  ? 43 LEU A HD23 1 
ATOM   670  N N    . SER A 1 44 ? -4.163  -10.654 -4.875  1.00 0.28  ? 44 SER A N    1 
ATOM   671  C CA   . SER A 1 44 ? -4.638  -11.484 -6.021  1.00 0.33  ? 44 SER A CA   1 
ATOM   672  C C    . SER A 1 44 ? -5.917  -12.241 -5.641  1.00 0.32  ? 44 SER A C    1 
ATOM   673  O O    . SER A 1 44 ? -6.717  -12.576 -6.495  1.00 0.35  ? 44 SER A O    1 
ATOM   674  C CB   . SER A 1 44 ? -3.551  -12.487 -6.410  1.00 0.40  ? 44 SER A CB   1 
ATOM   675  O OG   . SER A 1 44 ? -2.503  -11.804 -7.084  1.00 1.45  ? 44 SER A OG   1 
ATOM   676  H H    . SER A 1 44 ? -3.277  -10.814 -4.504  1.00 0.29  ? 44 SER A H    1 
ATOM   677  H HA   . SER A 1 44 ? -4.841  -10.838 -6.856  1.00 0.35  ? 44 SER A HA   1 
ATOM   678  H HB2  . SER A 1 44 ? -3.156  -12.955 -5.523  1.00 1.01  ? 44 SER A HB2  1 
ATOM   679  H HB3  . SER A 1 44 ? -3.975  -13.245 -7.056  1.00 1.14  ? 44 SER A HB3  1 
ATOM   680  H HG   . SER A 1 44 ? -2.482  -12.114 -7.993  1.00 1.81  ? 44 SER A HG   1 
ATOM   681  N N    . ASP A 1 45 ? -6.123  -12.502 -4.368  1.00 0.32  ? 45 ASP A N    1 
ATOM   682  C CA   . ASP A 1 45 ? -7.353  -13.219 -3.932  1.00 0.35  ? 45 ASP A CA   1 
ATOM   683  C C    . ASP A 1 45 ? -8.591  -12.341 -4.193  1.00 0.36  ? 45 ASP A C    1 
ATOM   684  O O    . ASP A 1 45 ? -9.712  -12.810 -4.130  1.00 0.51  ? 45 ASP A O    1 
ATOM   685  C CB   . ASP A 1 45 ? -7.262  -13.530 -2.433  1.00 0.36  ? 45 ASP A CB   1 
ATOM   686  C CG   . ASP A 1 45 ? -6.077  -14.464 -2.167  1.00 1.16  ? 45 ASP A CG   1 
ATOM   687  O OD1  . ASP A 1 45 ? -6.260  -15.666 -2.267  1.00 1.90  ? 45 ASP A OD1  1 
ATOM   688  O OD2  . ASP A 1 45 ? -5.006  -13.960 -1.869  1.00 1.89  ? 45 ASP A OD2  1 
ATOM   689  H H    . ASP A 1 45 ? -5.473  -12.217 -3.699  1.00 0.33  ? 45 ASP A H    1 
ATOM   690  H HA   . ASP A 1 45 ? -7.438  -14.137 -4.483  1.00 0.41  ? 45 ASP A HA   1 
ATOM   691  H HB2  . ASP A 1 45 ? -7.125  -12.610 -1.883  1.00 0.88  ? 45 ASP A HB2  1 
ATOM   692  H HB3  . ASP A 1 45 ? -8.174  -14.009 -2.109  1.00 0.92  ? 45 ASP A HB3  1 
ATOM   693  N N    . GLY A 1 46 ? -8.394  -11.070 -4.478  1.00 0.34  ? 46 GLY A N    1 
ATOM   694  C CA   . GLY A 1 46 ? -9.545  -10.157 -4.735  1.00 0.36  ? 46 GLY A CA   1 
ATOM   695  C C    . GLY A 1 46 ? -9.780  -9.285  -3.499  1.00 0.33  ? 46 GLY A C    1 
ATOM   696  O O    . GLY A 1 46 ? -10.906 -8.974  -3.159  1.00 0.36  ? 46 GLY A O    1 
ATOM   697  H H    . GLY A 1 46 ? -7.484  -10.713 -4.518  1.00 0.41  ? 46 GLY A H    1 
ATOM   698  H HA2  . GLY A 1 46 ? -9.324  -9.529  -5.586  1.00 0.36  ? 46 GLY A HA2  1 
ATOM   699  H HA3  . GLY A 1 46 ? -10.430 -10.738 -4.934  1.00 0.40  ? 46 GLY A HA3  1 
ATOM   700  N N    . ARG A 1 47 ? -8.725  -8.897  -2.820  1.00 0.28  ? 47 ARG A N    1 
ATOM   701  C CA   . ARG A 1 47 ? -8.884  -8.054  -1.597  1.00 0.28  ? 47 ARG A CA   1 
ATOM   702  C C    . ARG A 1 47 ? -8.251  -6.676  -1.824  1.00 0.25  ? 47 ARG A C    1 
ATOM   703  O O    . ARG A 1 47 ? -7.382  -6.512  -2.656  1.00 0.27  ? 47 ARG A O    1 
ATOM   704  C CB   . ARG A 1 47 ? -8.189  -8.753  -0.421  1.00 0.28  ? 47 ARG A CB   1 
ATOM   705  C CG   . ARG A 1 47 ? -8.640  -8.134  0.907   1.00 0.34  ? 47 ARG A CG   1 
ATOM   706  C CD   . ARG A 1 47 ? -10.119 -8.446  1.148   1.00 0.86  ? 47 ARG A CD   1 
ATOM   707  N NE   . ARG A 1 47 ? -10.529 -7.911  2.479   1.00 0.94  ? 47 ARG A NE   1 
ATOM   708  C CZ   . ARG A 1 47 ? -10.604 -8.709  3.512   1.00 1.40  ? 47 ARG A CZ   1 
ATOM   709  N NH1  . ARG A 1 47 ? -9.556  -8.889  4.275   1.00 2.19  ? 47 ARG A NH1  1 
ATOM   710  N NH2  . ARG A 1 47 ? -11.727 -9.324  3.782   1.00 2.01  ? 47 ARG A NH2  1 
ATOM   711  H H    . ARG A 1 47 ? -7.822  -9.169  -3.112  1.00 0.27  ? 47 ARG A H    1 
ATOM   712  H HA   . ARG A 1 47 ? -9.934  -7.935  -1.374  1.00 0.33  ? 47 ARG A HA   1 
ATOM   713  H HB2  . ARG A 1 47 ? -8.442  -9.804  -0.430  1.00 0.33  ? 47 ARG A HB2  1 
ATOM   714  H HB3  . ARG A 1 47 ? -7.121  -8.643  -0.523  1.00 0.24  ? 47 ARG A HB3  1 
ATOM   715  H HG2  . ARG A 1 47 ? -8.050  -8.547  1.713   1.00 0.51  ? 47 ARG A HG2  1 
ATOM   716  H HG3  . ARG A 1 47 ? -8.500  -7.065  0.872   1.00 0.61  ? 47 ARG A HG3  1 
ATOM   717  H HD2  . ARG A 1 47 ? -10.716 -7.983  0.376   1.00 1.19  ? 47 ARG A HD2  1 
ATOM   718  H HD3  . ARG A 1 47 ? -10.271 -9.515  1.127   1.00 1.18  ? 47 ARG A HD3  1 
ATOM   719  H HE   . ARG A 1 47 ? -10.743 -6.960  2.579   1.00 1.23  ? 47 ARG A HE   1 
ATOM   720  H HH11 . ARG A 1 47 ? -8.699  -8.417  4.068   1.00 2.53  ? 47 ARG A HH11 1 
ATOM   721  H HH12 . ARG A 1 47 ? -9.612  -9.499  5.066   1.00 2.80  ? 47 ARG A HH12 1 
ATOM   722  H HH21 . ARG A 1 47 ? -12.528 -9.184  3.199   1.00 2.36  ? 47 ARG A HH21 1 
ATOM   723  H HH22 . ARG A 1 47 ? -11.786 -9.935  4.572   1.00 2.56  ? 47 ARG A HH22 1 
ATOM   724  N N    . GLU A 1 48 ? -8.679  -5.687  -1.077  1.00 0.26  ? 48 GLU A N    1 
ATOM   725  C CA   . GLU A 1 48 ? -8.101  -4.318  -1.220  1.00 0.26  ? 48 GLU A CA   1 
ATOM   726  C C    . GLU A 1 48 ? -7.674  -3.828  0.167   1.00 0.24  ? 48 GLU A C    1 
ATOM   727  O O    . GLU A 1 48 ? -8.491  -3.678  1.057   1.00 0.28  ? 48 GLU A O    1 
ATOM   728  C CB   . GLU A 1 48 ? -9.150  -3.368  -1.811  1.00 0.32  ? 48 GLU A CB   1 
ATOM   729  C CG   . GLU A 1 48 ? -8.461  -2.347  -2.724  1.00 0.62  ? 48 GLU A CG   1 
ATOM   730  C CD   . GLU A 1 48 ? -8.390  -0.988  -2.021  1.00 0.98  ? 48 GLU A CD   1 
ATOM   731  O OE1  . GLU A 1 48 ? -7.645  -0.876  -1.058  1.00 1.74  ? 48 GLU A OE1  1 
ATOM   732  O OE2  . GLU A 1 48 ? -9.077  -0.081  -2.460  1.00 1.48  ? 48 GLU A OE2  1 
ATOM   733  H H    . GLU A 1 48 ? -9.378  -5.850  -0.408  1.00 0.31  ? 48 GLU A H    1 
ATOM   734  H HA   . GLU A 1 48 ? -7.238  -4.357  -1.870  1.00 0.24  ? 48 GLU A HA   1 
ATOM   735  H HB2  . GLU A 1 48 ? -9.867  -3.938  -2.385  1.00 0.51  ? 48 GLU A HB2  1 
ATOM   736  H HB3  . GLU A 1 48 ? -9.660  -2.849  -1.012  1.00 0.35  ? 48 GLU A HB3  1 
ATOM   737  H HG2  . GLU A 1 48 ? -7.462  -2.686  -2.953  1.00 0.89  ? 48 GLU A HG2  1 
ATOM   738  H HG3  . GLU A 1 48 ? -9.025  -2.247  -3.640  1.00 1.01  ? 48 GLU A HG3  1 
ATOM   739  N N    . LEU A 1 49 ? -6.399  -3.595  0.364   1.00 0.20  ? 49 LEU A N    1 
ATOM   740  C CA   . LEU A 1 49 ? -5.916  -3.134  1.703   1.00 0.19  ? 49 LEU A CA   1 
ATOM   741  C C    . LEU A 1 49 ? -4.946  -1.967  1.533   1.00 0.20  ? 49 LEU A C    1 
ATOM   742  O O    . LEU A 1 49 ? -3.954  -2.077  0.849   1.00 0.19  ? 49 LEU A O    1 
ATOM   743  C CB   . LEU A 1 49 ? -5.173  -4.278  2.399   1.00 0.18  ? 49 LEU A CB   1 
ATOM   744  C CG   . LEU A 1 49 ? -5.948  -4.747  3.631   1.00 0.20  ? 49 LEU A CG   1 
ATOM   745  C CD1  . LEU A 1 49 ? -6.925  -5.852  3.234   1.00 0.23  ? 49 LEU A CD1  1 
ATOM   746  C CD2  . LEU A 1 49 ? -4.961  -5.294  4.665   1.00 0.21  ? 49 LEU A CD2  1 
ATOM   747  H H    . LEU A 1 49 ? -5.757  -3.734  -0.367  1.00 0.21  ? 49 LEU A H    1 
ATOM   748  H HA   . LEU A 1 49 ? -6.755  -2.826  2.308   1.00 0.21  ? 49 LEU A HA   1 
ATOM   749  H HB2  . LEU A 1 49 ? -5.055  -5.104  1.712   1.00 0.19  ? 49 LEU A HB2  1 
ATOM   750  H HB3  . LEU A 1 49 ? -4.199  -3.926  2.706   1.00 0.18  ? 49 LEU A HB3  1 
ATOM   751  H HG   . LEU A 1 49 ? -6.494  -3.916  4.055   1.00 0.22  ? 49 LEU A HG   1 
ATOM   752  H HD11 . LEU A 1 49 ? -6.379  -6.669  2.784   1.00 1.01  ? 49 LEU A HD11 1 
ATOM   753  H HD12 . LEU A 1 49 ? -7.443  -6.206  4.113   1.00 1.05  ? 49 LEU A HD12 1 
ATOM   754  H HD13 . LEU A 1 49 ? -7.640  -5.463  2.526   1.00 1.03  ? 49 LEU A HD13 1 
ATOM   755  H HD21 . LEU A 1 49 ? -4.085  -4.665  4.693   1.00 0.98  ? 49 LEU A HD21 1 
ATOM   756  H HD22 . LEU A 1 49 ? -5.427  -5.307  5.638   1.00 0.98  ? 49 LEU A HD22 1 
ATOM   757  H HD23 . LEU A 1 49 ? -4.673  -6.299  4.391   1.00 0.99  ? 49 LEU A HD23 1 
ATOM   758  N N    . CYS A 1 50 ? -5.197  -0.865  2.183   1.00 0.23  ? 50 CYS A N    1 
ATOM   759  C CA   . CYS A 1 50 ? -4.261  0.286   2.080   1.00 0.24  ? 50 CYS A CA   1 
ATOM   760  C C    . CYS A 1 50 ? -3.177  0.098   3.134   1.00 0.22  ? 50 CYS A C    1 
ATOM   761  O O    . CYS A 1 50 ? -3.447  -0.360  4.224   1.00 0.25  ? 50 CYS A O    1 
ATOM   762  C CB   . CYS A 1 50 ? -4.991  1.591   2.324   1.00 0.30  ? 50 CYS A CB   1 
ATOM   763  S SG   . CYS A 1 50 ? -6.660  1.518   1.615   1.00 0.60  ? 50 CYS A SG   1 
ATOM   764  H H    . CYS A 1 50 ? -5.979  -0.805  2.762   1.00 0.25  ? 50 CYS A H    1 
ATOM   765  H HA   . CYS A 1 50 ? -3.815  0.305   1.107   1.00 0.25  ? 50 CYS A HA   1 
ATOM   766  H HB2  . CYS A 1 50 ? -5.040  1.757   3.373   1.00 0.34  ? 50 CYS A HB2  1 
ATOM   767  H HB3  . CYS A 1 50 ? -4.445  2.391   1.864   1.00 0.33  ? 50 CYS A HB3  1 
ATOM   768  N N    . LEU A 1 51 ? -1.954  0.411   2.812   1.00 0.23  ? 51 LEU A N    1 
ATOM   769  C CA   . LEU A 1 51 ? -0.853  0.207   3.784   1.00 0.22  ? 51 LEU A CA   1 
ATOM   770  C C    . LEU A 1 51 ? -0.495  1.504   4.503   1.00 0.24  ? 51 LEU A C    1 
ATOM   771  O O    . LEU A 1 51 ? -0.675  2.599   3.993   1.00 0.25  ? 51 LEU A O    1 
ATOM   772  C CB   . LEU A 1 51 ? 0.381   -0.318  3.062   1.00 0.23  ? 51 LEU A CB   1 
ATOM   773  C CG   . LEU A 1 51 ? 0.042   -1.554  2.206   1.00 0.26  ? 51 LEU A CG   1 
ATOM   774  C CD1  . LEU A 1 51 ? 1.294   -2.412  2.056   1.00 1.09  ? 51 LEU A CD1  1 
ATOM   775  C CD2  . LEU A 1 51 ? -1.051  -2.400  2.872   1.00 1.21  ? 51 LEU A CD2  1 
ATOM   776  H H    . LEU A 1 51 ? -1.757  0.749   1.928   1.00 0.29  ? 51 LEU A H    1 
ATOM   777  H HA   . LEU A 1 51 ? -1.161  -0.518  4.511   1.00 0.22  ? 51 LEU A HA   1 
ATOM   778  H HB2  . LEU A 1 51 ? 0.776   0.460   2.434   1.00 0.28  ? 51 LEU A HB2  1 
ATOM   779  H HB3  . LEU A 1 51 ? 1.118   -0.586  3.790   1.00 0.32  ? 51 LEU A HB3  1 
ATOM   780  H HG   . LEU A 1 51 ? -0.291  -1.233  1.229   1.00 1.08  ? 51 LEU A HG   1 
ATOM   781  H HD11 . LEU A 1 51 ? 2.113   -1.798  1.716   1.00 1.69  ? 51 LEU A HD11 1 
ATOM   782  H HD12 . LEU A 1 51 ? 1.543   -2.848  3.013   1.00 1.71  ? 51 LEU A HD12 1 
ATOM   783  H HD13 . LEU A 1 51 ? 1.107   -3.197  1.341   1.00 1.70  ? 51 LEU A HD13 1 
ATOM   784  H HD21 . LEU A 1 51 ? -0.927  -2.369  3.944   1.00 1.83  ? 51 LEU A HD21 1 
ATOM   785  H HD22 . LEU A 1 51 ? -2.022  -2.007  2.610   1.00 1.74  ? 51 LEU A HD22 1 
ATOM   786  H HD23 . LEU A 1 51 ? -0.974  -3.421  2.531   1.00 1.81  ? 51 LEU A HD23 1 
ATOM   787  N N    . ASP A 1 52 ? 0.031   1.355   5.689   1.00 0.25  ? 52 ASP A N    1 
ATOM   788  C CA   . ASP A 1 52 ? 0.444   2.523   6.515   1.00 0.28  ? 52 ASP A CA   1 
ATOM   789  C C    . ASP A 1 52 ? 1.966   2.704   6.394   1.00 0.27  ? 52 ASP A C    1 
ATOM   790  O O    . ASP A 1 52 ? 2.722   1.842   6.806   1.00 0.26  ? 52 ASP A O    1 
ATOM   791  C CB   . ASP A 1 52 ? 0.073   2.242   7.980   1.00 0.29  ? 52 ASP A CB   1 
ATOM   792  C CG   . ASP A 1 52 ? 0.008   3.548   8.790   1.00 0.41  ? 52 ASP A CG   1 
ATOM   793  O OD1  . ASP A 1 52 ? 0.775   4.455   8.504   1.00 1.24  ? 52 ASP A OD1  1 
ATOM   794  O OD2  . ASP A 1 52 ? -0.808  3.614   9.693   1.00 1.08  ? 52 ASP A OD2  1 
ATOM   795  H H    . ASP A 1 52 ? 0.165   0.451   6.036   1.00 0.25  ? 52 ASP A H    1 
ATOM   796  H HA   . ASP A 1 52 ? -0.065  3.411   6.174   1.00 0.30  ? 52 ASP A HA   1 
ATOM   797  H HB2  . ASP A 1 52 ? -0.891  1.753   8.014   1.00 0.34  ? 52 ASP A HB2  1 
ATOM   798  H HB3  . ASP A 1 52 ? 0.813   1.590   8.415   1.00 0.30  ? 52 ASP A HB3  1 
ATOM   799  N N    . PRO A 1 53 ? 2.377   3.824   5.837   1.00 0.31  ? 53 PRO A N    1 
ATOM   800  C CA   . PRO A 1 53 ? 3.810   4.133   5.645   1.00 0.33  ? 53 PRO A CA   1 
ATOM   801  C C    . PRO A 1 53 ? 4.525   4.394   6.983   1.00 0.35  ? 53 PRO A C    1 
ATOM   802  O O    . PRO A 1 53 ? 5.736   4.521   7.021   1.00 0.37  ? 53 PRO A O    1 
ATOM   803  C CB   . PRO A 1 53 ? 3.797   5.377   4.748   1.00 0.39  ? 53 PRO A CB   1 
ATOM   804  C CG   . PRO A 1 53 ? 2.404   6.022   4.919   1.00 0.40  ? 53 PRO A CG   1 
ATOM   805  C CD   . PRO A 1 53 ? 1.462   4.893   5.374   1.00 0.35  ? 53 PRO A CD   1 
ATOM   806  H HA   . PRO A 1 53 ? 4.293   3.323   5.123   1.00 0.32  ? 53 PRO A HA   1 
ATOM   807  H HB2  . PRO A 1 53 ? 4.571   6.067   5.059   1.00 0.42  ? 53 PRO A HB2  1 
ATOM   808  H HB3  . PRO A 1 53 ? 3.943   5.095   3.718   1.00 0.39  ? 53 PRO A HB3  1 
ATOM   809  H HG2  . PRO A 1 53 ? 2.445   6.802   5.668   1.00 0.43  ? 53 PRO A HG2  1 
ATOM   810  H HG3  . PRO A 1 53 ? 2.062   6.425   3.979   1.00 0.42  ? 53 PRO A HG3  1 
ATOM   811  H HD2  . PRO A 1 53 ? 0.829   5.233   6.182   1.00 0.36  ? 53 PRO A HD2  1 
ATOM   812  H HD3  . PRO A 1 53 ? 0.866   4.540   4.547   1.00 0.34  ? 53 PRO A HD3  1 
ATOM   813  N N    . LYS A 1 54 ? 3.800   4.455   8.080   1.00 0.35  ? 54 LYS A N    1 
ATOM   814  C CA   . LYS A 1 54 ? 4.449   4.684   9.399   1.00 0.37  ? 54 LYS A CA   1 
ATOM   815  C C    . LYS A 1 54 ? 5.363   3.498   9.745   1.00 0.34  ? 54 LYS A C    1 
ATOM   816  O O    . LYS A 1 54 ? 6.335   3.653   10.461  1.00 0.36  ? 54 LYS A O    1 
ATOM   817  C CB   . LYS A 1 54 ? 3.381   4.835   10.487  1.00 0.40  ? 54 LYS A CB   1 
ATOM   818  C CG   . LYS A 1 54 ? 3.273   6.305   10.899  1.00 0.57  ? 54 LYS A CG   1 
ATOM   819  C CD   . LYS A 1 54 ? 2.029   6.505   11.766  1.00 1.32  ? 54 LYS A CD   1 
ATOM   820  C CE   . LYS A 1 54 ? 2.031   7.922   12.345  1.00 1.79  ? 54 LYS A CE   1 
ATOM   821  N NZ   . LYS A 1 54 ? 0.976   8.037   13.392  1.00 2.49  ? 54 LYS A NZ   1 
ATOM   822  H H    . LYS A 1 54 ? 2.835   4.343   8.037   1.00 0.34  ? 54 LYS A H    1 
ATOM   823  H HA   . LYS A 1 54 ? 5.034   5.583   9.347   1.00 0.41  ? 54 LYS A HA   1 
ATOM   824  H HB2  . LYS A 1 54 ? 2.430   4.495   10.108  1.00 0.52  ? 54 LYS A HB2  1 
ATOM   825  H HB3  . LYS A 1 54 ? 3.656   4.242   11.347  1.00 0.43  ? 54 LYS A HB3  1 
ATOM   826  H HG2  . LYS A 1 54 ? 4.153   6.586   11.460  1.00 1.05  ? 54 LYS A HG2  1 
ATOM   827  H HG3  . LYS A 1 54 ? 3.197   6.921   10.016  1.00 1.07  ? 54 LYS A HG3  1 
ATOM   828  H HD2  . LYS A 1 54 ? 1.144   6.363   11.163  1.00 1.96  ? 54 LYS A HD2  1 
ATOM   829  H HD3  . LYS A 1 54 ? 2.033   5.789   12.575  1.00 1.83  ? 54 LYS A HD3  1 
ATOM   830  H HE2  . LYS A 1 54 ? 2.996   8.131   12.783  1.00 2.14  ? 54 LYS A HE2  1 
ATOM   831  H HE3  . LYS A 1 54 ? 1.834   8.633   11.555  1.00 2.24  ? 54 LYS A HE3  1 
ATOM   832  H HZ1  . LYS A 1 54 ? 0.056   7.761   12.989  1.00 2.83  ? 54 LYS A HZ1  1 
ATOM   833  H HZ2  . LYS A 1 54 ? 1.208   7.412   14.190  1.00 2.86  ? 54 LYS A HZ2  1 
ATOM   834  H HZ3  . LYS A 1 54 ? 0.926   9.019   13.728  1.00 2.95  ? 54 LYS A HZ3  1 
ATOM   835  N N    . GLU A 1 55 ? 5.064   2.317   9.244   1.00 0.30  ? 55 GLU A N    1 
ATOM   836  C CA   . GLU A 1 55 ? 5.916   1.138   9.546   1.00 0.29  ? 55 GLU A CA   1 
ATOM   837  C C    . GLU A 1 55 ? 7.080   1.079   8.561   1.00 0.29  ? 55 GLU A C    1 
ATOM   838  O O    . GLU A 1 55 ? 7.078   1.731   7.531   1.00 0.30  ? 55 GLU A O    1 
ATOM   839  C CB   . GLU A 1 55 ? 5.099   -0.143  9.387   1.00 0.27  ? 55 GLU A CB   1 
ATOM   840  C CG   . GLU A 1 55 ? 4.003   -0.209  10.450  1.00 0.39  ? 55 GLU A CG   1 
ATOM   841  C CD   . GLU A 1 55 ? 2.693   0.347   9.884   1.00 1.74  ? 55 GLU A CD   1 
ATOM   842  O OE1  . GLU A 1 55 ? 2.083   -0.335  9.075   1.00 2.50  ? 55 GLU A OE1  1 
ATOM   843  O OE2  . GLU A 1 55 ? 2.322   1.445   10.267  1.00 2.54  ? 55 GLU A OE2  1 
ATOM   844  H H    . GLU A 1 55 ? 4.280   2.203   8.666   1.00 0.29  ? 55 GLU A H    1 
ATOM   845  H HA   . GLU A 1 55 ? 6.293   1.206   10.555  1.00 0.31  ? 55 GLU A HA   1 
ATOM   846  H HB2  . GLU A 1 55 ? 4.654   -0.162  8.406   1.00 0.27  ? 55 GLU A HB2  1 
ATOM   847  H HB3  . GLU A 1 55 ? 5.750   -0.991  9.495   1.00 0.28  ? 55 GLU A HB3  1 
ATOM   848  H HG2  . GLU A 1 55 ? 3.858   -1.234  10.748  1.00 1.00  ? 55 GLU A HG2  1 
ATOM   849  H HG3  . GLU A 1 55 ? 4.302   0.370   11.304  1.00 0.87  ? 55 GLU A HG3  1 
ATOM   850  N N    . ASN A 1 56 ? 8.050   0.263   8.859   1.00 0.31  ? 56 ASN A N    1 
ATOM   851  C CA   . ASN A 1 56 ? 9.208   0.099   7.939   1.00 0.32  ? 56 ASN A CA   1 
ATOM   852  C C    . ASN A 1 56 ? 8.913   -1.055  6.977   1.00 0.30  ? 56 ASN A C    1 
ATOM   853  O O    . ASN A 1 56 ? 9.542   -1.184  5.946   1.00 0.31  ? 56 ASN A O    1 
ATOM   854  C CB   . ASN A 1 56 ? 10.464  -0.211  8.738   1.00 0.37  ? 56 ASN A CB   1 
ATOM   855  C CG   . ASN A 1 56 ? 11.501  0.892   8.508   1.00 0.42  ? 56 ASN A CG   1 
ATOM   856  O OD1  . ASN A 1 56 ? 12.417  0.727   7.726   1.00 1.10  ? 56 ASN A OD1  1 
ATOM   857  N ND2  . ASN A 1 56 ? 11.393  2.019   9.158   1.00 1.23  ? 56 ASN A ND2  1 
ATOM   858  H H    . ASN A 1 56 ? 7.999   -0.272  9.679   1.00 0.31  ? 56 ASN A H    1 
ATOM   859  H HA   . ASN A 1 56 ? 9.356   1.000   7.381   1.00 0.34  ? 56 ASN A HA   1 
ATOM   860  H HB2  . ASN A 1 56 ? 10.213  -0.260  9.781   1.00 0.37  ? 56 ASN A HB2  1 
ATOM   861  H HB3  . ASN A 1 56 ? 10.868  -1.153  8.414   1.00 0.37  ? 56 ASN A HB3  1 
ATOM   862  H HD21 . ASN A 1 56 ? 10.654  2.154   9.788   1.00 2.03  ? 56 ASN A HD21 1 
ATOM   863  H HD22 . ASN A 1 56 ? 12.051  2.731   9.015   1.00 1.25  ? 56 ASN A HD22 1 
ATOM   864  N N    . TRP A 1 57 ? 7.953   -1.893  7.307   1.00 0.27  ? 57 TRP A N    1 
ATOM   865  C CA   . TRP A 1 57 ? 7.610   -3.028  6.423   1.00 0.24  ? 57 TRP A CA   1 
ATOM   866  C C    . TRP A 1 57 ? 6.745   -2.533  5.268   1.00 0.21  ? 57 TRP A C    1 
ATOM   867  O O    . TRP A 1 57 ? 6.877   -2.992  4.159   1.00 0.20  ? 57 TRP A O    1 
ATOM   868  C CB   . TRP A 1 57 ? 6.886   -4.112  7.231   1.00 0.24  ? 57 TRP A CB   1 
ATOM   869  C CG   . TRP A 1 57 ? 5.464   -3.754  7.519   1.00 0.22  ? 57 TRP A CG   1 
ATOM   870  C CD1  . TRP A 1 57 ? 5.020   -3.302  8.700   1.00 0.24  ? 57 TRP A CD1  1 
ATOM   871  C CD2  . TRP A 1 57 ? 4.298   -3.836  6.647   1.00 0.20  ? 57 TRP A CD2  1 
ATOM   872  N NE1  . TRP A 1 57 ? 3.654   -3.131  8.629   1.00 0.23  ? 57 TRP A NE1  1 
ATOM   873  C CE2  . TRP A 1 57 ? 3.163   -3.430  7.382   1.00 0.20  ? 57 TRP A CE2  1 
ATOM   874  C CE3  . TRP A 1 57 ? 4.114   -4.219  5.311   1.00 0.18  ? 57 TRP A CE3  1 
ATOM   875  C CZ2  . TRP A 1 57 ? 1.889   -3.407  6.817   1.00 0.20  ? 57 TRP A CZ2  1 
ATOM   876  C CZ3  . TRP A 1 57 ? 2.837   -4.192  4.735   1.00 0.17  ? 57 TRP A CZ3  1 
ATOM   877  C CH2  . TRP A 1 57 ? 1.725   -3.787  5.485   1.00 0.18  ? 57 TRP A CH2  1 
ATOM   878  H H    . TRP A 1 57 ? 7.458   -1.772  8.135   1.00 0.27  ? 57 TRP A H    1 
ATOM   879  H HA   . TRP A 1 57 ? 8.520   -3.435  6.029   1.00 0.25  ? 57 TRP A HA   1 
ATOM   880  H HB2  . TRP A 1 57 ? 6.895   -5.024  6.685   1.00 0.24  ? 57 TRP A HB2  1 
ATOM   881  H HB3  . TRP A 1 57 ? 7.409   -4.257  8.158   1.00 0.27  ? 57 TRP A HB3  1 
ATOM   882  H HD1  . TRP A 1 57 ? 5.632   -3.120  9.563   1.00 0.26  ? 57 TRP A HD1  1 
ATOM   883  H HE1  . TRP A 1 57 ? 3.091   -2.831  9.357   1.00 0.24  ? 57 TRP A HE1  1 
ATOM   884  H HE3  . TRP A 1 57 ? 4.962   -4.533  4.723   1.00 0.19  ? 57 TRP A HE3  1 
ATOM   885  H HZ2  . TRP A 1 57 ? 1.038   -3.093  7.405   1.00 0.22  ? 57 TRP A HZ2  1 
ATOM   886  H HZ3  . TRP A 1 57 ? 2.711   -4.479  3.708   1.00 0.16  ? 57 TRP A HZ3  1 
ATOM   887  H HH2  . TRP A 1 57 ? 0.744   -3.769  5.034   1.00 0.18  ? 57 TRP A HH2  1 
ATOM   888  N N    . VAL A 1 58 ? 5.868   -1.595  5.520   1.00 0.21  ? 58 VAL A N    1 
ATOM   889  C CA   . VAL A 1 58 ? 5.006   -1.063  4.421   1.00 0.20  ? 58 VAL A CA   1 
ATOM   890  C C    . VAL A 1 58 ? 5.896   -0.357  3.388   1.00 0.22  ? 58 VAL A C    1 
ATOM   891  O O    . VAL A 1 58 ? 5.731   -0.533  2.196   1.00 0.22  ? 58 VAL A O    1 
ATOM   892  C CB   . VAL A 1 58 ? 3.989   -0.074  5.006   1.00 0.22  ? 58 VAL A CB   1 
ATOM   893  C CG1  . VAL A 1 58 ? 3.502   0.899   3.928   1.00 0.25  ? 58 VAL A CG1  1 
ATOM   894  C CG2  . VAL A 1 58 ? 2.791   -0.837  5.561   1.00 0.22  ? 58 VAL A CG2  1 
ATOM   895  H H    . VAL A 1 58 ? 5.781   -1.240  6.434   1.00 0.23  ? 58 VAL A H    1 
ATOM   896  H HA   . VAL A 1 58 ? 4.486   -1.882  3.944   1.00 0.18  ? 58 VAL A HA   1 
ATOM   897  H HB   . VAL A 1 58 ? 4.455   0.478   5.800   1.00 0.26  ? 58 VAL A HB   1 
ATOM   898  H HG11 . VAL A 1 58 ? 3.361   0.366   2.999   1.00 1.06  ? 58 VAL A HG11 1 
ATOM   899  H HG12 . VAL A 1 58 ? 2.565   1.338   4.236   1.00 1.05  ? 58 VAL A HG12 1 
ATOM   900  H HG13 . VAL A 1 58 ? 4.236   1.678   3.789   1.00 1.04  ? 58 VAL A HG13 1 
ATOM   901  H HG21 . VAL A 1 58 ? 2.582   -1.685  4.930   1.00 0.98  ? 58 VAL A HG21 1 
ATOM   902  H HG22 . VAL A 1 58 ? 3.013   -1.176  6.562   1.00 0.98  ? 58 VAL A HG22 1 
ATOM   903  H HG23 . VAL A 1 58 ? 1.930   -0.188  5.586   1.00 0.97  ? 58 VAL A HG23 1 
ATOM   904  N N    . GLN A 1 59 ? 6.846   0.430   3.840   1.00 0.25  ? 59 GLN A N    1 
ATOM   905  C CA   . GLN A 1 59 ? 7.754   1.139   2.894   1.00 0.29  ? 59 GLN A CA   1 
ATOM   906  C C    . GLN A 1 59 ? 8.740   0.136   2.272   1.00 0.27  ? 59 GLN A C    1 
ATOM   907  O O    . GLN A 1 59 ? 9.142   0.282   1.132   1.00 0.29  ? 59 GLN A O    1 
ATOM   908  C CB   . GLN A 1 59 ? 8.501   2.244   3.641   1.00 0.34  ? 59 GLN A CB   1 
ATOM   909  C CG   . GLN A 1 59 ? 9.532   1.619   4.566   1.00 0.36  ? 59 GLN A CG   1 
ATOM   910  C CD   . GLN A 1 59 ? 10.157  2.694   5.457   1.00 0.42  ? 59 GLN A CD   1 
ATOM   911  O OE1  . GLN A 1 59 ? 9.506   3.226   6.335   1.00 1.09  ? 59 GLN A OE1  1 
ATOM   912  N NE2  . GLN A 1 59 ? 11.403  3.040   5.271   1.00 1.16  ? 59 GLN A NE2  1 
ATOM   913  H H    . GLN A 1 59 ? 6.967   0.547   4.804   1.00 0.27  ? 59 GLN A H    1 
ATOM   914  H HA   . GLN A 1 59 ? 7.174   1.580   2.116   1.00 0.30  ? 59 GLN A HA   1 
ATOM   915  H HB2  . GLN A 1 59 ? 8.993   2.884   2.931   1.00 0.40  ? 59 GLN A HB2  1 
ATOM   916  H HB3  . GLN A 1 59 ? 7.800   2.823   4.224   1.00 0.33  ? 59 GLN A HB3  1 
ATOM   917  H HG2  . GLN A 1 59 ? 9.045   0.876   5.175   1.00 0.33  ? 59 GLN A HG2  1 
ATOM   918  H HG3  . GLN A 1 59 ? 10.297  1.151   3.970   1.00 0.41  ? 59 GLN A HG3  1 
ATOM   919  H HE21 . GLN A 1 59 ? 11.931  2.611   4.565   1.00 1.93  ? 59 GLN A HE21 1 
ATOM   920  H HE22 . GLN A 1 59 ? 11.811  3.727   5.838   1.00 1.18  ? 59 GLN A HE22 1 
ATOM   921  N N    . ARG A 1 60 ? 9.103   -0.897  3.001   1.00 0.26  ? 60 ARG A N    1 
ATOM   922  C CA   . ARG A 1 60 ? 10.030  -1.926  2.448   1.00 0.27  ? 60 ARG A CA   1 
ATOM   923  C C    . ARG A 1 60 ? 9.236   -2.803  1.482   1.00 0.24  ? 60 ARG A C    1 
ATOM   924  O O    . ARG A 1 60 ? 9.705   -3.145  0.415   1.00 0.27  ? 60 ARG A O    1 
ATOM   925  C CB   . ARG A 1 60 ? 10.593  -2.782  3.586   1.00 0.29  ? 60 ARG A CB   1 
ATOM   926  C CG   . ARG A 1 60 ? 11.821  -2.091  4.185   1.00 0.78  ? 60 ARG A CG   1 
ATOM   927  C CD   . ARG A 1 60 ? 12.213  -2.784  5.493   1.00 1.25  ? 60 ARG A CD   1 
ATOM   928  N NE   . ARG A 1 60 ? 13.030  -3.995  5.188   1.00 1.76  ? 60 ARG A NE   1 
ATOM   929  C CZ   . ARG A 1 60 ? 14.336  -3.929  5.214   1.00 2.23  ? 60 ARG A CZ   1 
ATOM   930  N NH1  . ARG A 1 60 ? 14.987  -3.465  4.178   1.00 2.79  ? 60 ARG A NH1  1 
ATOM   931  N NH2  . ARG A 1 60 ? 14.989  -4.328  6.275   1.00 2.81  ? 60 ARG A NH2  1 
ATOM   932  H H    . ARG A 1 60 ? 8.744   -1.008  3.905   1.00 0.26  ? 60 ARG A H    1 
ATOM   933  H HA   . ARG A 1 60 ? 10.838  -1.441  1.919   1.00 0.29  ? 60 ARG A HA   1 
ATOM   934  H HB2  . ARG A 1 60 ? 9.838   -2.905  4.350   1.00 0.60  ? 60 ARG A HB2  1 
ATOM   935  H HB3  . ARG A 1 60 ? 10.877  -3.748  3.203   1.00 0.63  ? 60 ARG A HB3  1 
ATOM   936  H HG2  . ARG A 1 60 ? 12.642  -2.147  3.485   1.00 1.37  ? 60 ARG A HG2  1 
ATOM   937  H HG3  . ARG A 1 60 ? 11.589  -1.055  4.385   1.00 1.46  ? 60 ARG A HG3  1 
ATOM   938  H HD2  . ARG A 1 60 ? 12.790  -2.103  6.102   1.00 1.91  ? 60 ARG A HD2  1 
ATOM   939  H HD3  . ARG A 1 60 ? 11.322  -3.076  6.027   1.00 1.77  ? 60 ARG A HD3  1 
ATOM   940  H HE   . ARG A 1 60 ? 12.587  -4.841  4.968   1.00 2.27  ? 60 ARG A HE   1 
ATOM   941  H HH11 . ARG A 1 60 ? 14.486  -3.162  3.367   1.00 3.04  ? 60 ARG A HH11 1 
ATOM   942  H HH12 . ARG A 1 60 ? 15.986  -3.413  4.196   1.00 3.32  ? 60 ARG A HH12 1 
ATOM   943  H HH21 . ARG A 1 60 ? 14.490  -4.684  7.066   1.00 3.05  ? 60 ARG A HH21 1 
ATOM   944  H HH22 . ARG A 1 60 ? 15.988  -4.278  6.297   1.00 3.35  ? 60 ARG A HH22 1 
ATOM   945  N N    . VAL A 1 61 ? 8.020   -3.141  1.849   1.00 0.22  ? 61 VAL A N    1 
ATOM   946  C CA   . VAL A 1 61 ? 7.149   -3.967  0.963   1.00 0.21  ? 61 VAL A CA   1 
ATOM   947  C C    . VAL A 1 61 ? 6.959   -3.226  -0.367  1.00 0.23  ? 61 VAL A C    1 
ATOM   948  O O    . VAL A 1 61 ? 7.002   -3.819  -1.429  1.00 0.25  ? 61 VAL A O    1 
ATOM   949  C CB   . VAL A 1 61 ? 5.792   -4.176  1.655   1.00 0.21  ? 61 VAL A CB   1 
ATOM   950  C CG1  . VAL A 1 61 ? 4.698   -4.456  0.622   1.00 0.27  ? 61 VAL A CG1  1 
ATOM   951  C CG2  . VAL A 1 61 ? 5.894   -5.359  2.619   1.00 0.25  ? 61 VAL A CG2  1 
ATOM   952  H H    . VAL A 1 61 ? 7.670   -2.831  2.716   1.00 0.21  ? 61 VAL A H    1 
ATOM   953  H HA   . VAL A 1 61 ? 7.617   -4.921  0.781   1.00 0.23  ? 61 VAL A HA   1 
ATOM   954  H HB   . VAL A 1 61 ? 5.535   -3.285  2.210   1.00 0.19  ? 61 VAL A HB   1 
ATOM   955  H HG11 . VAL A 1 61 ? 5.094   -5.087  -0.158  1.00 1.04  ? 61 VAL A HG11 1 
ATOM   956  H HG12 . VAL A 1 61 ? 3.868   -4.953  1.102   1.00 1.10  ? 61 VAL A HG12 1 
ATOM   957  H HG13 . VAL A 1 61 ? 4.362   -3.523  0.195   1.00 1.01  ? 61 VAL A HG13 1 
ATOM   958  H HG21 . VAL A 1 61 ? 6.165   -6.248  2.071   1.00 1.02  ? 61 VAL A HG21 1 
ATOM   959  H HG22 . VAL A 1 61 ? 6.649   -5.152  3.364   1.00 0.98  ? 61 VAL A HG22 1 
ATOM   960  H HG23 . VAL A 1 61 ? 4.942   -5.511  3.105   1.00 1.00  ? 61 VAL A HG23 1 
ATOM   961  N N    . VAL A 1 62 ? 6.765   -1.928  -0.308  1.00 0.24  ? 62 VAL A N    1 
ATOM   962  C CA   . VAL A 1 62 ? 6.588   -1.126  -1.557  1.00 0.30  ? 62 VAL A CA   1 
ATOM   963  C C    . VAL A 1 62 ? 7.871   -1.216  -2.393  1.00 0.33  ? 62 VAL A C    1 
ATOM   964  O O    . VAL A 1 62 ? 7.815   -1.376  -3.592  1.00 0.38  ? 62 VAL A O    1 
ATOM   965  C CB   . VAL A 1 62 ? 6.292   0.338   -1.195  1.00 0.36  ? 62 VAL A CB   1 
ATOM   966  C CG1  . VAL A 1 62 ? 6.331   1.210   -2.455  1.00 0.62  ? 62 VAL A CG1  1 
ATOM   967  C CG2  . VAL A 1 62 ? 4.900   0.434   -0.560  1.00 0.58  ? 62 VAL A CG2  1 
ATOM   968  H H    . VAL A 1 62 ? 6.747   -1.480  0.562   1.00 0.24  ? 62 VAL A H    1 
ATOM   969  H HA   . VAL A 1 62 ? 5.764   -1.532  -2.127  1.00 0.29  ? 62 VAL A HA   1 
ATOM   970  H HB   . VAL A 1 62 ? 7.034   0.691   -0.492  1.00 0.62  ? 62 VAL A HB   1 
ATOM   971  H HG11 . VAL A 1 62 ? 5.775   0.726   -3.245  1.00 1.18  ? 62 VAL A HG11 1 
ATOM   972  H HG12 . VAL A 1 62 ? 5.889   2.172   -2.241  1.00 1.20  ? 62 VAL A HG12 1 
ATOM   973  H HG13 . VAL A 1 62 ? 7.356   1.347   -2.767  1.00 1.32  ? 62 VAL A HG13 1 
ATOM   974  H HG21 . VAL A 1 62 ? 4.741   -0.414  0.090   1.00 1.25  ? 62 VAL A HG21 1 
ATOM   975  H HG22 . VAL A 1 62 ? 4.829   1.345   0.015   1.00 1.21  ? 62 VAL A HG22 1 
ATOM   976  H HG23 . VAL A 1 62 ? 4.149   0.439   -1.336  1.00 1.21  ? 62 VAL A HG23 1 
ATOM   977  N N    . GLU A 1 63 ? 9.024   -1.129  -1.767  1.00 0.34  ? 63 GLU A N    1 
ATOM   978  C CA   . GLU A 1 63 ? 10.304  -1.228  -2.522  1.00 0.39  ? 63 GLU A CA   1 
ATOM   979  C C    . GLU A 1 63 ? 10.501  -2.666  -3.005  1.00 0.38  ? 63 GLU A C    1 
ATOM   980  O O    . GLU A 1 63 ? 10.960  -2.892  -4.100  1.00 0.42  ? 63 GLU A O    1 
ATOM   981  C CB   . GLU A 1 63 ? 11.466  -0.825  -1.612  1.00 0.44  ? 63 GLU A CB   1 
ATOM   982  C CG   . GLU A 1 63 ? 11.562  0.701   -1.540  1.00 0.75  ? 63 GLU A CG   1 
ATOM   983  C CD   . GLU A 1 63 ? 12.437  1.102   -0.349  1.00 1.65  ? 63 GLU A CD   1 
ATOM   984  O OE1  . GLU A 1 63 ? 13.648  1.067   -0.490  1.00 2.30  ? 63 GLU A OE1  1 
ATOM   985  O OE2  . GLU A 1 63 ? 11.880  1.439   0.684   1.00 2.36  ? 63 GLU A OE2  1 
ATOM   986  H H    . GLU A 1 63 ? 9.048   -1.006  -0.802  1.00 0.32  ? 63 GLU A H    1 
ATOM   987  H HA   . GLU A 1 63 ? 10.263  -0.574  -3.376  1.00 0.44  ? 63 GLU A HA   1 
ATOM   988  H HB2  . GLU A 1 63 ? 11.300  -1.222  -0.620  1.00 0.54  ? 63 GLU A HB2  1 
ATOM   989  H HB3  . GLU A 1 63 ? 12.386  -1.222  -2.007  1.00 0.57  ? 63 GLU A HB3  1 
ATOM   990  H HG2  . GLU A 1 63 ? 11.999  1.077   -2.453  1.00 1.10  ? 63 GLU A HG2  1 
ATOM   991  H HG3  . GLU A 1 63 ? 10.574  1.119   -1.414  1.00 1.13  ? 63 GLU A HG3  1 
ATOM   992  N N    . LYS A 1 64 ? 10.141  -3.642  -2.207  1.00 0.34  ? 64 LYS A N    1 
ATOM   993  C CA   . LYS A 1 64 ? 10.287  -5.058  -2.641  1.00 0.36  ? 64 LYS A CA   1 
ATOM   994  C C    . LYS A 1 64 ? 9.381   -5.306  -3.860  1.00 0.34  ? 64 LYS A C    1 
ATOM   995  O O    . LYS A 1 64 ? 9.622   -6.197  -4.653  1.00 0.41  ? 64 LYS A O    1 
ATOM   996  C CB   . LYS A 1 64 ? 9.874   -5.991  -1.497  1.00 0.37  ? 64 LYS A CB   1 
ATOM   997  C CG   . LYS A 1 64 ? 10.771  -7.232  -1.495  1.00 0.48  ? 64 LYS A CG   1 
ATOM   998  C CD   . LYS A 1 64 ? 11.061  -7.651  -0.052  1.00 1.17  ? 64 LYS A CD   1 
ATOM   999  C CE   . LYS A 1 64 ? 12.243  -8.625  -0.027  1.00 1.64  ? 64 LYS A CE   1 
ATOM   1000 N NZ   . LYS A 1 64 ? 11.746  -10.022 -0.184  1.00 2.47  ? 64 LYS A NZ   1 
ATOM   1001 H H    . LYS A 1 64 ? 9.764   -3.443  -1.331  1.00 0.32  ? 64 LYS A H    1 
ATOM   1002 H HA   . LYS A 1 64 ? 11.312  -5.242  -2.906  1.00 0.42  ? 64 LYS A HA   1 
ATOM   1003 H HB2  . LYS A 1 64 ? 9.978   -5.470  -0.555  1.00 0.37  ? 64 LYS A HB2  1 
ATOM   1004 H HB3  . LYS A 1 64 ? 8.846   -6.292  -1.629  1.00 0.35  ? 64 LYS A HB3  1 
ATOM   1005 H HG2  . LYS A 1 64 ? 10.269  -8.038  -2.012  1.00 0.95  ? 64 LYS A HG2  1 
ATOM   1006 H HG3  . LYS A 1 64 ? 11.700  -7.006  -1.996  1.00 0.93  ? 64 LYS A HG3  1 
ATOM   1007 H HD2  . LYS A 1 64 ? 11.303  -6.776  0.534   1.00 1.81  ? 64 LYS A HD2  1 
ATOM   1008 H HD3  . LYS A 1 64 ? 10.190  -8.134  0.365   1.00 1.81  ? 64 LYS A HD3  1 
ATOM   1009 H HE2  . LYS A 1 64 ? 12.919  -8.391  -0.836  1.00 1.91  ? 64 LYS A HE2  1 
ATOM   1010 H HE3  . LYS A 1 64 ? 12.764  -8.533  0.914   1.00 2.17  ? 64 LYS A HE3  1 
ATOM   1011 H HZ1  . LYS A 1 64 ? 11.178  -10.095 -1.052  1.00 2.90  ? 64 LYS A HZ1  1 
ATOM   1012 H HZ2  . LYS A 1 64 ? 12.557  -10.672 -0.245  1.00 2.77  ? 64 LYS A HZ2  1 
ATOM   1013 H HZ3  . LYS A 1 64 ? 11.158  -10.276 0.635   1.00 2.97  ? 64 LYS A HZ3  1 
ATOM   1014 N N    . PHE A 1 65 ? 8.338   -4.517  -4.003  1.00 0.29  ? 65 PHE A N    1 
ATOM   1015 C CA   . PHE A 1 65 ? 7.398   -4.677  -5.145  1.00 0.28  ? 65 PHE A CA   1 
ATOM   1016 C C    . PHE A 1 65 ? 7.762   -3.691  -6.271  1.00 0.38  ? 65 PHE A C    1 
ATOM   1017 O O    . PHE A 1 65 ? 7.695   -4.023  -7.439  1.00 0.45  ? 65 PHE A O    1 
ATOM   1018 C CB   . PHE A 1 65 ? 5.993   -4.367  -4.629  1.00 0.24  ? 65 PHE A CB   1 
ATOM   1019 C CG   . PHE A 1 65 ? 4.965   -5.166  -5.390  1.00 0.23  ? 65 PHE A CG   1 
ATOM   1020 C CD1  . PHE A 1 65 ? 4.878   -6.552  -5.206  1.00 1.27  ? 65 PHE A CD1  1 
ATOM   1021 C CD2  . PHE A 1 65 ? 4.093   -4.521  -6.270  1.00 1.18  ? 65 PHE A CD2  1 
ATOM   1022 C CE1  . PHE A 1 65 ? 3.919   -7.290  -5.906  1.00 1.29  ? 65 PHE A CE1  1 
ATOM   1023 C CE2  . PHE A 1 65 ? 3.132   -5.258  -6.968  1.00 1.16  ? 65 PHE A CE2  1 
ATOM   1024 C CZ   . PHE A 1 65 ? 3.044   -6.643  -6.787  1.00 0.31  ? 65 PHE A CZ   1 
ATOM   1025 H H    . PHE A 1 65 ? 8.165   -3.811  -3.346  1.00 0.28  ? 65 PHE A H    1 
ATOM   1026 H HA   . PHE A 1 65 ? 7.435   -5.690  -5.515  1.00 0.31  ? 65 PHE A HA   1 
ATOM   1027 H HB2  . PHE A 1 65 ? 5.937   -4.619  -3.581  1.00 0.27  ? 65 PHE A HB2  1 
ATOM   1028 H HB3  . PHE A 1 65 ? 5.795   -3.314  -4.750  1.00 0.29  ? 65 PHE A HB3  1 
ATOM   1029 H HD1  . PHE A 1 65 ? 5.554   -7.051  -4.526  1.00 2.17  ? 65 PHE A HD1  1 
ATOM   1030 H HD2  . PHE A 1 65 ? 4.161   -3.453  -6.410  1.00 2.10  ? 65 PHE A HD2  1 
ATOM   1031 H HE1  . PHE A 1 65 ? 3.852   -8.358  -5.764  1.00 2.21  ? 65 PHE A HE1  1 
ATOM   1032 H HE2  . PHE A 1 65 ? 2.458   -4.759  -7.647  1.00 2.07  ? 65 PHE A HE2  1 
ATOM   1033 H HZ   . PHE A 1 65 ? 2.302   -7.212  -7.327  1.00 0.36  ? 65 PHE A HZ   1 
ATOM   1034 N N    . LEU A 1 66 ? 8.130   -2.478  -5.920  1.00 0.44  ? 66 LEU A N    1 
ATOM   1035 C CA   . LEU A 1 66 ? 8.485   -1.445  -6.951  1.00 0.59  ? 66 LEU A CA   1 
ATOM   1036 C C    . LEU A 1 66 ? 10.016  -1.290  -7.081  1.00 0.63  ? 66 LEU A C    1 
ATOM   1037 O O    . LEU A 1 66 ? 10.495  -0.315  -7.630  1.00 0.93  ? 66 LEU A O    1 
ATOM   1038 C CB   . LEU A 1 66 ? 7.875   -0.101  -6.532  1.00 0.70  ? 66 LEU A CB   1 
ATOM   1039 C CG   . LEU A 1 66 ? 7.117   0.510   -7.711  1.00 1.12  ? 66 LEU A CG   1 
ATOM   1040 C CD1  . LEU A 1 66 ? 5.758   1.028   -7.235  1.00 1.73  ? 66 LEU A CD1  1 
ATOM   1041 C CD2  . LEU A 1 66 ? 7.929   1.669   -8.298  1.00 1.80  ? 66 LEU A CD2  1 
ATOM   1042 H H    . LEU A 1 66 ? 8.160   -2.239  -4.969  1.00 0.42  ? 66 LEU A H    1 
ATOM   1043 H HA   . LEU A 1 66 ? 8.076   -1.738  -7.905  1.00 0.70  ? 66 LEU A HA   1 
ATOM   1044 H HB2  . LEU A 1 66 ? 7.194   -0.258  -5.708  1.00 1.07  ? 66 LEU A HB2  1 
ATOM   1045 H HB3  . LEU A 1 66 ? 8.662   0.572   -6.223  1.00 1.04  ? 66 LEU A HB3  1 
ATOM   1046 H HG   . LEU A 1 66 ? 6.969   -0.246  -8.466  1.00 1.81  ? 66 LEU A HG   1 
ATOM   1047 H HD11 . LEU A 1 66 ? 5.892   1.628   -6.346  1.00 2.30  ? 66 LEU A HD11 1 
ATOM   1048 H HD12 . LEU A 1 66 ? 5.309   1.631   -8.011  1.00 2.19  ? 66 LEU A HD12 1 
ATOM   1049 H HD13 . LEU A 1 66 ? 5.112   0.192   -7.010  1.00 2.14  ? 66 LEU A HD13 1 
ATOM   1050 H HD21 . LEU A 1 66 ? 8.157   2.381   -7.518  1.00 2.23  ? 66 LEU A HD21 1 
ATOM   1051 H HD22 . LEU A 1 66 ? 8.849   1.289   -8.718  1.00 2.35  ? 66 LEU A HD22 1 
ATOM   1052 H HD23 . LEU A 1 66 ? 7.354   2.156   -9.072  1.00 2.27  ? 66 LEU A HD23 1 
ATOM   1053 N N    . LYS A 1 67 ? 10.778  -2.232  -6.571  1.00 0.58  ? 67 LYS A N    1 
ATOM   1054 C CA   . LYS A 1 67 ? 12.277  -2.155  -6.644  1.00 0.76  ? 67 LYS A CA   1 
ATOM   1055 C C    . LYS A 1 67 ? 12.753  -1.839  -8.072  1.00 1.71  ? 67 LYS A C    1 
ATOM   1056 O O    . LYS A 1 67 ? 12.080  -2.132  -9.044  1.00 2.42  ? 67 LYS A O    1 
ATOM   1057 C CB   . LYS A 1 67 ? 12.871  -3.500  -6.208  1.00 1.27  ? 67 LYS A CB   1 
ATOM   1058 C CG   . LYS A 1 67 ? 13.987  -3.267  -5.185  1.00 1.91  ? 67 LYS A CG   1 
ATOM   1059 C CD   . LYS A 1 67 ? 15.347  -3.377  -5.877  1.00 2.34  ? 67 LYS A CD   1 
ATOM   1060 C CE   . LYS A 1 67 ? 16.349  -2.444  -5.195  1.00 3.21  ? 67 LYS A CE   1 
ATOM   1061 N NZ   . LYS A 1 67 ? 17.521  -2.234  -6.092  1.00 3.89  ? 67 LYS A NZ   1 
ATOM   1062 H H    . LYS A 1 67 ? 10.362  -2.993  -6.119  1.00 0.62  ? 67 LYS A H    1 
ATOM   1063 H HA   . LYS A 1 67 ? 12.626  -1.382  -5.976  1.00 1.33  ? 67 LYS A HA   1 
ATOM   1064 H HB2  . LYS A 1 67 ? 12.097  -4.108  -5.763  1.00 1.87  ? 67 LYS A HB2  1 
ATOM   1065 H HB3  . LYS A 1 67 ? 13.277  -4.011  -7.069  1.00 1.72  ? 67 LYS A HB3  1 
ATOM   1066 H HG2  . LYS A 1 67 ? 13.880  -2.282  -4.753  1.00 2.44  ? 67 LYS A HG2  1 
ATOM   1067 H HG3  . LYS A 1 67 ? 13.921  -4.010  -4.405  1.00 2.49  ? 67 LYS A HG3  1 
ATOM   1068 H HD2  . LYS A 1 67 ? 15.701  -4.396  -5.814  1.00 2.48  ? 67 LYS A HD2  1 
ATOM   1069 H HD3  . LYS A 1 67 ? 15.246  -3.095  -6.914  1.00 2.73  ? 67 LYS A HD3  1 
ATOM   1070 H HE2  . LYS A 1 67 ? 15.877  -1.495  -4.991  1.00 3.69  ? 67 LYS A HE2  1 
ATOM   1071 H HE3  . LYS A 1 67 ? 16.681  -2.888  -4.267  1.00 3.41  ? 67 LYS A HE3  1 
ATOM   1072 H HZ1  . LYS A 1 67 ? 17.973  -3.148  -6.295  1.00 4.21  ? 67 LYS A HZ1  1 
ATOM   1073 H HZ2  . LYS A 1 67 ? 17.203  -1.797  -6.981  1.00 4.17  ? 67 LYS A HZ2  1 
ATOM   1074 H HZ3  . LYS A 1 67 ? 18.208  -1.608  -5.625  1.00 4.26  ? 67 LYS A HZ3  1 
ATOM   1075 N N    . ARG A 1 68 ? 13.925  -1.245  -8.184  1.00 2.49  ? 68 ARG A N    1 
ATOM   1076 C CA   . ARG A 1 68 ? 14.511  -0.886  -9.521  1.00 3.67  ? 68 ARG A CA   1 
ATOM   1077 C C    . ARG A 1 68 ? 13.743  0.283   -10.149 1.00 4.46  ? 68 ARG A C    1 
ATOM   1078 O O    . ARG A 1 68 ? 12.618  0.577   -9.784  1.00 4.38  ? 68 ARG A O    1 
ATOM   1079 C CB   . ARG A 1 68 ? 14.471  -2.086  -10.478 1.00 4.28  ? 68 ARG A CB   1 
ATOM   1080 C CG   . ARG A 1 68 ? 15.133  -3.307  -9.827  1.00 4.45  ? 68 ARG A CG   1 
ATOM   1081 C CD   . ARG A 1 68 ? 14.346  -4.575  -10.181 1.00 5.49  ? 68 ARG A CD   1 
ATOM   1082 N NE   . ARG A 1 68 ? 14.229  -4.701  -11.665 1.00 5.99  ? 68 ARG A NE   1 
ATOM   1083 C CZ   . ARG A 1 68 ? 15.235  -5.156  -12.367 1.00 6.70  ? 68 ARG A CZ   1 
ATOM   1084 N NH1  . ARG A 1 68 ? 15.408  -6.445  -12.501 1.00 7.02  ? 68 ARG A NH1  1 
ATOM   1085 N NH2  . ARG A 1 68 ? 16.065  -4.319  -12.936 1.00 7.37  ? 68 ARG A NH2  1 
ATOM   1086 H H    . ARG A 1 68 ? 14.432  -1.034  -7.372  1.00 2.64  ? 68 ARG A H    1 
ATOM   1087 H HA   . ARG A 1 68 ? 15.540  -0.588  -9.378  1.00 3.96  ? 68 ARG A HA   1 
ATOM   1088 H HB2  . ARG A 1 68 ? 13.446  -2.316  -10.722 1.00 4.50  ? 68 ARG A HB2  1 
ATOM   1089 H HB3  . ARG A 1 68 ? 15.003  -1.836  -11.383 1.00 4.87  ? 68 ARG A HB3  1 
ATOM   1090 H HG2  . ARG A 1 68 ? 16.147  -3.401  -10.187 1.00 4.38  ? 68 ARG A HG2  1 
ATOM   1091 H HG3  . ARG A 1 68 ? 15.144  -3.183  -8.754  1.00 4.39  ? 68 ARG A HG3  1 
ATOM   1092 H HD2  . ARG A 1 68 ? 14.861  -5.438  -9.787  1.00 5.85  ? 68 ARG A HD2  1 
ATOM   1093 H HD3  . ARG A 1 68 ? 13.359  -4.517  -9.747  1.00 5.85  ? 68 ARG A HD3  1 
ATOM   1094 H HE   . ARG A 1 68 ? 13.397  -4.444  -12.113 1.00 6.03  ? 68 ARG A HE   1 
ATOM   1095 H HH11 . ARG A 1 68 ? 14.773  -7.084  -12.066 1.00 6.76  ? 68 ARG A HH11 1 
ATOM   1096 H HH12 . ARG A 1 68 ? 16.177  -6.795  -13.038 1.00 7.70  ? 68 ARG A HH12 1 
ATOM   1097 H HH21 . ARG A 1 68 ? 15.931  -3.333  -12.834 1.00 7.38  ? 68 ARG A HH21 1 
ATOM   1098 H HH22 . ARG A 1 68 ? 16.834  -4.665  -13.474 1.00 8.03  ? 68 ARG A HH22 1 
ATOM   1099 N N    . ALA A 1 69 ? 14.353  0.944   -11.101 1.00 5.52  ? 69 ALA A N    1 
ATOM   1100 C CA   . ALA A 1 69 ? 13.690  2.095   -11.783 1.00 6.51  ? 69 ALA A CA   1 
ATOM   1101 C C    . ALA A 1 69 ? 13.600  1.799   -13.282 1.00 7.25  ? 69 ALA A C    1 
ATOM   1102 O O    . ALA A 1 69 ? 14.588  1.476   -13.918 1.00 7.69  ? 69 ALA A O    1 
ATOM   1103 C CB   . ALA A 1 69 ? 14.513  3.368   -11.559 1.00 7.27  ? 69 ALA A CB   1 
ATOM   1104 H H    . ALA A 1 69 ? 15.255  0.674   -11.373 1.00 5.79  ? 69 ALA A H    1 
ATOM   1105 H HA   . ALA A 1 69 ? 12.696  2.231   -11.382 1.00 6.49  ? 69 ALA A HA   1 
ATOM   1106 H HB1  . ALA A 1 69 ? 15.537  3.192   -11.855 1.00 7.46  ? 69 ALA A HB1  1 
ATOM   1107 H HB2  . ALA A 1 69 ? 14.100  4.172   -12.150 1.00 7.55  ? 69 ALA A HB2  1 
ATOM   1108 H HB3  . ALA A 1 69 ? 14.482  3.637   -10.513 1.00 7.64  ? 69 ALA A HB3  1 
ATOM   1109 N N    . GLU A 1 70 ? 12.422  1.890   -13.847 1.00 7.64  ? 70 GLU A N    1 
ATOM   1110 C CA   . GLU A 1 70 ? 12.259  1.599   -15.302 1.00 8.57  ? 70 GLU A CA   1 
ATOM   1111 C C    . GLU A 1 70 ? 11.979  2.906   -16.056 1.00 9.09  ? 70 GLU A C    1 
ATOM   1112 O O    . GLU A 1 70 ? 12.867  3.479   -16.659 1.00 9.29  ? 70 GLU A O    1 
ATOM   1113 C CB   . GLU A 1 70 ? 11.096  0.614   -15.494 1.00 8.91  ? 70 GLU A CB   1 
ATOM   1114 C CG   . GLU A 1 70 ? 11.546  -0.812  -15.135 1.00 8.88  ? 70 GLU A CG   1 
ATOM   1115 C CD   . GLU A 1 70 ? 11.850  -0.916  -13.633 1.00 9.64  ? 70 GLU A CD   1 
ATOM   1116 O OE1  . GLU A 1 70 ? 10.944  -0.694  -12.844 1.00 10.10 ? 70 GLU A OE1  1 
ATOM   1117 O OE2  . GLU A 1 70 ? 12.984  -1.218  -13.300 1.00 9.93  ? 70 GLU A OE2  1 
ATOM   1118 H H    . GLU A 1 70 ? 11.641  2.141   -13.310 1.00 7.47  ? 70 GLU A H    1 
ATOM   1119 H HA   . GLU A 1 70 ? 13.168  1.157   -15.683 1.00 8.89  ? 70 GLU A HA   1 
ATOM   1120 H HB2  . GLU A 1 70 ? 10.273  0.903   -14.857 1.00 9.04  ? 70 GLU A HB2  1 
ATOM   1121 H HB3  . GLU A 1 70 ? 10.776  0.637   -16.525 1.00 9.32  ? 70 GLU A HB3  1 
ATOM   1122 H HG2  . GLU A 1 70 ? 10.759  -1.507  -15.388 1.00 8.69  ? 70 GLU A HG2  1 
ATOM   1123 H HG3  . GLU A 1 70 ? 12.434  -1.059  -15.697 1.00 8.80  ? 70 GLU A HG3  1 
ATOM   1124 N N    . ASN A 1 71 ? 10.755  3.385   -16.022 1.00 9.55  ? 71 ASN A N    1 
ATOM   1125 C CA   . ASN A 1 71 ? 10.416  4.659   -16.730 1.00 10.29 ? 71 ASN A CA   1 
ATOM   1126 C C    . ASN A 1 71 ? 8.996   5.089   -16.343 1.00 10.77 ? 71 ASN A C    1 
ATOM   1127 O O    . ASN A 1 71 ? 8.025   4.697   -16.966 1.00 10.98 ? 71 ASN A O    1 
ATOM   1128 C CB   . ASN A 1 71 ? 10.502  4.450   -18.249 1.00 10.97 ? 71 ASN A CB   1 
ATOM   1129 C CG   . ASN A 1 71 ? 11.255  5.622   -18.885 1.00 11.36 ? 71 ASN A CG   1 
ATOM   1130 O OD1  . ASN A 1 71 ? 10.657  6.612   -19.258 1.00 11.35 ? 71 ASN A OD1  1 
ATOM   1131 N ND2  . ASN A 1 71 ? 12.552  5.555   -19.023 1.00 11.92 ? 71 ASN A ND2  1 
ATOM   1132 H H    . ASN A 1 71 ? 10.058  2.908   -15.524 1.00 9.57  ? 71 ASN A H    1 
ATOM   1133 H HA   . ASN A 1 71 ? 11.115  5.427   -16.433 1.00 10.24 ? 71 ASN A HA   1 
ATOM   1134 H HB2  . ASN A 1 71 ? 11.026  3.529   -18.458 1.00 11.00 ? 71 ASN A HB2  1 
ATOM   1135 H HB3  . ASN A 1 71 ? 9.506   4.399   -18.664 1.00 11.35 ? 71 ASN A HB3  1 
ATOM   1136 H HD21 . ASN A 1 71 ? 13.038  4.758   -18.722 1.00 12.06 ? 71 ASN A HD21 1 
ATOM   1137 H HD22 . ASN A 1 71 ? 13.041  6.301   -19.429 1.00 12.30 ? 71 ASN A HD22 1 
ATOM   1138 N N    . SER A 1 72 ? 8.869   5.888   -15.311 1.00 11.16 ? 72 SER A N    1 
ATOM   1139 C CA   . SER A 1 72 ? 7.516   6.345   -14.870 1.00 11.85 ? 72 SER A CA   1 
ATOM   1140 C C    . SER A 1 72 ? 7.604   7.777   -14.327 1.00 12.27 ? 72 SER A C    1 
ATOM   1141 O O    . SER A 1 72 ? 8.422   8.016   -13.451 1.00 12.28 ? 72 SER A O    1 
ATOM   1142 C CB   . SER A 1 72 ? 6.995   5.411   -13.774 1.00 12.14 ? 72 SER A CB   1 
ATOM   1143 O OG   . SER A 1 72 ? 6.554   4.194   -14.364 1.00 12.16 ? 72 SER A OG   1 
ATOM   1144 O OXT  . SER A 1 72 ? 6.849   8.612   -14.797 1.00 12.74 ? 72 SER A OXT  1 
ATOM   1145 H H    . SER A 1 72 ? 9.666   6.185   -14.823 1.00 11.13 ? 72 SER A H    1 
ATOM   1146 H HA   . SER A 1 72 ? 6.839   6.323   -15.712 1.00 12.06 ? 72 SER A HA   1 
ATOM   1147 H HB2  . SER A 1 72 ? 7.785   5.199   -13.074 1.00 12.07 ? 72 SER A HB2  1 
ATOM   1148 H HB3  . SER A 1 72 ? 6.175   5.889   -13.255 1.00 12.59 ? 72 SER A HB3  1 
ATOM   1149 H HG   . SER A 1 72 ? 5.682   4.343   -14.737 1.00 12.42 ? 72 SER A HG   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  SER 1  1  ?  ?   ?   A . n 
A 1 2  ALA 2  2  ?  ?   ?   A . n 
A 1 3  LYS 3  3  ?  ?   ?   A . n 
A 1 4  GLU 4  4  4  GLU GLU A . n 
A 1 5  LEU 5  5  5  LEU LEU A . n 
A 1 6  ARG 6  6  6  ARG ARG A . n 
A 1 7  CYS 7  7  7  CYS CYS A . n 
A 1 8  GLN 8  8  8  GLN GLN A . n 
A 1 9  CYS 9  9  9  CYS CYS A . n 
A 1 10 ILE 10 10 10 ILE ILE A . n 
A 1 11 LYS 11 11 11 LYS LYS A . n 
A 1 12 THR 12 12 12 THR THR A . n 
A 1 13 TYR 13 13 13 TYR TYR A . n 
A 1 14 SER 14 14 14 SER SER A . n 
A 1 15 LYS 15 15 15 LYS LYS A . n 
A 1 16 PRO 16 16 16 PRO PRO A . n 
A 1 17 PHE 17 17 17 PHE PHE A . n 
A 1 18 HIS 18 18 18 HIS HIS A . n 
A 1 19 PRO 19 19 19 PRO PRO A . n 
A 1 20 LYS 20 20 20 LYS LYS A . n 
A 1 21 PHE 21 21 21 PHE PHE A . n 
A 1 22 ILE 22 22 22 ILE ILE A . n 
A 1 23 LYS 23 23 23 LYS LYS A . n 
A 1 24 GLU 24 24 24 GLU GLU A . n 
A 1 25 MLE 25 25 25 MLE MLE A . n 
A 1 26 ARG 26 26 26 ARG ARG A . n 
A 1 27 VAL 27 27 27 VAL VAL A . n 
A 1 28 ILE 28 28 28 ILE ILE A . n 
A 1 29 GLU 29 29 29 GLU GLU A . n 
A 1 30 SER 30 30 30 SER SER A . n 
A 1 31 GLY 31 31 31 GLY GLY A . n 
A 1 32 PRO 32 32 32 PRO PRO A . n 
A 1 33 HIS 33 33 33 HIS HIS A . n 
A 1 34 CYS 34 34 34 CYS CYS A . n 
A 1 35 ALA 35 35 35 ALA ALA A . n 
A 1 36 ASN 36 36 36 ASN ASN A . n 
A 1 37 THR 37 37 37 THR THR A . n 
A 1 38 GLU 38 38 38 GLU GLU A . n 
A 1 39 ILE 39 39 39 ILE ILE A . n 
A 1 40 ILE 40 40 40 ILE ILE A . n 
A 1 41 VAL 41 41 41 VAL VAL A . n 
A 1 42 LYS 42 42 42 LYS LYS A . n 
A 1 43 LEU 43 43 43 LEU LEU A . n 
A 1 44 SER 44 44 44 SER SER A . n 
A 1 45 ASP 45 45 45 ASP ASP A . n 
A 1 46 GLY 46 46 46 GLY GLY A . n 
A 1 47 ARG 47 47 47 ARG ARG A . n 
A 1 48 GLU 48 48 48 GLU GLU A . n 
A 1 49 LEU 49 49 49 LEU LEU A . n 
A 1 50 CYS 50 50 50 CYS CYS A . n 
A 1 51 LEU 51 51 51 LEU LEU A . n 
A 1 52 ASP 52 52 52 ASP ASP A . n 
A 1 53 PRO 53 53 53 PRO PRO A . n 
A 1 54 LYS 54 54 54 LYS LYS A . n 
A 1 55 GLU 55 55 55 GLU GLU A . n 
A 1 56 ASN 56 56 56 ASN ASN A . n 
A 1 57 TRP 57 57 57 TRP TRP A . n 
A 1 58 VAL 58 58 58 VAL VAL A . n 
A 1 59 GLN 59 59 59 GLN GLN A . n 
A 1 60 ARG 60 60 60 ARG ARG A . n 
A 1 61 VAL 61 61 61 VAL VAL A . n 
A 1 62 VAL 62 62 62 VAL VAL A . n 
A 1 63 GLU 63 63 63 GLU GLU A . n 
A 1 64 LYS 64 64 64 LYS LYS A . n 
A 1 65 PHE 65 65 65 PHE PHE A . n 
A 1 66 LEU 66 66 66 LEU LEU A . n 
A 1 67 LYS 67 67 67 LYS LYS A . n 
A 1 68 ARG 68 68 68 ARG ARG A . n 
A 1 69 ALA 69 69 69 ALA ALA A . n 
A 1 70 GLU 70 70 70 GLU GLU A . n 
A 1 71 ASN 71 71 71 ASN ASN A . n 
A 1 72 SER 72 72 72 SER SER A . n 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    A 
_pdbx_struct_mod_residue.label_comp_id    MLE 
_pdbx_struct_mod_residue.label_seq_id     25 
_pdbx_struct_mod_residue.auth_asym_id     A 
_pdbx_struct_mod_residue.auth_comp_id     MLE 
_pdbx_struct_mod_residue.auth_seq_id      25 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   LEU 
_pdbx_struct_mod_residue.details          N-METHYLLEUCINE 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1995-10-15 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' . ? 1 
X-PLOR refinement       . ? 2 
X-PLOR phasing          . ? 3 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 6  ? ? -67.51  -178.63 
2 1 CYS A 34 ? ? -163.55 109.81  
3 1 LYS A 67 ? ? -49.23  154.33  
4 1 ARG A 68 ? ? 71.43   160.97  
5 1 GLU A 70 ? ? -109.16 -79.63  
6 1 ASN A 71 ? ? -171.20 91.17   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 ARG A 6  ? ? 0.318 'SIDE CHAIN' 
2 1 ARG A 26 ? ? 0.314 'SIDE CHAIN' 
3 1 ARG A 47 ? ? 0.317 'SIDE CHAIN' 
4 1 ARG A 60 ? ? 0.314 'SIDE CHAIN' 
5 1 ARG A 68 ? ? 0.316 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 1 ? A SER 1 
2 1 Y 1 A ALA 2 ? A ALA 2 
3 1 Y 1 A LYS 3 ? A LYS 3 
#