data_1IKM
# 
_entry.id   1IKM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IKM         
WWPDB D_1000174175 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1IKL 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   'representative structure' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IKM 
_pdbx_database_status.recvd_initial_deposition_date   1995-08-03 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rajarathnam, K.' 1 
'Clark-Lewis, I.' 2 
'Sykes, B.D.'     3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary '1H NMR solution structure of an active monomeric interleukin-8.' Biochemistry 34  12983 12990 1995 BICHAW US 0006-2960 
0033 ? 7548056 10.1021/bi00040a008 
1       'Neutrophil Activation by Monomeric Interleukin-8'                Science      264 90    ?     1994 SCIEAS US 0036-8075 
0038 ? ?       ?                   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rajarathnam, K.' 1  
primary 'Clark-Lewis, I.' 2  
primary 'Sykes, B.D.'     3  
1       'Rajarathnam, K.' 4  
1       'Sykes, B.D.'     5  
1       'Kay, C.M.'       6  
1       'Dewald, B.'      7  
1       'Geiser, T.'      8  
1       'Baggiolini, M.'  9  
1       'Clark-Lewis, I.' 10 
# 
_cell.entry_id           1IKM 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IKM 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'HUMAN INTERLEUKIN-8 (MONOMERIC)' 
_entity.formula_weight             8415.832 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              'DEL(1-3), THE AMIDE PROTON OF LEU 25 MODIFIED TO N-METHYL' 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        NAP-1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       'SAKELRCQCIKTYSKPFHPKFIKE(MLE)RVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS' 
_entity_poly.pdbx_seq_one_letter_code_can   SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  ALA n 
1 3  LYS n 
1 4  GLU n 
1 5  LEU n 
1 6  ARG n 
1 7  CYS n 
1 8  GLN n 
1 9  CYS n 
1 10 ILE n 
1 11 LYS n 
1 12 THR n 
1 13 TYR n 
1 14 SER n 
1 15 LYS n 
1 16 PRO n 
1 17 PHE n 
1 18 HIS n 
1 19 PRO n 
1 20 LYS n 
1 21 PHE n 
1 22 ILE n 
1 23 LYS n 
1 24 GLU n 
1 25 MLE n 
1 26 ARG n 
1 27 VAL n 
1 28 ILE n 
1 29 GLU n 
1 30 SER n 
1 31 GLY n 
1 32 PRO n 
1 33 HIS n 
1 34 CYS n 
1 35 ALA n 
1 36 ASN n 
1 37 THR n 
1 38 GLU n 
1 39 ILE n 
1 40 ILE n 
1 41 VAL n 
1 42 LYS n 
1 43 LEU n 
1 44 SER n 
1 45 ASP n 
1 46 GLY n 
1 47 ARG n 
1 48 GLU n 
1 49 LEU n 
1 50 CYS n 
1 51 LEU n 
1 52 ASP n 
1 53 PRO n 
1 54 LYS n 
1 55 GLU n 
1 56 ASN n 
1 57 TRP n 
1 58 VAL n 
1 59 GLN n 
1 60 ARG n 
1 61 VAL n 
1 62 VAL n 
1 63 GLU n 
1 64 LYS n 
1 65 PHE n 
1 66 LEU n 
1 67 LYS n 
1 68 ARG n 
1 69 ALA n 
1 70 GLU n 
1 71 ASN n 
1 72 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IL8_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P10145 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDP
KENWVQRVVEKFLKRAENS
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1IKM 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 72 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P10145 
_struct_ref_seq.db_align_beg                  28 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  99 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       72 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MLE 'L-peptide linking' n N-METHYLLEUCINE ? 'C7 H15 N O2'    145.199 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_ensemble.entry_id                             1IKM 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    30 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.authors          BRUNGER 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1IKM 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1IKM 
_struct.title                     'NMR study of monomeric human interleukin-8 (30 structures)' 
_struct.pdbx_descriptor           'HUMAN INTERLEUKIN-8 (MONOMERIC), METHYL GROUP' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IKM 
_struct_keywords.pdbx_keywords   'CYTOKINE (CHEMOTACTIC)' 
_struct_keywords.text            'CYTOKINE (CHEMOTACTIC)' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ASN 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        56 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       LEU 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        66 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ASN 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         56 
_struct_conf.end_auth_comp_id        LEU 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         66 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 7  SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 7  A CYS 34 1_555 ? ? ? ? ? ? ? 2.018 ? 
disulf2 disulf ? ? A CYS 9  SG ? ? ? 1_555 A CYS 50 SG ? ? A CYS 9  A CYS 50 1_555 ? ? ? ? ? ? ? 2.019 ? 
covale1 covale ? ? A GLU 24 C  ? ? ? 1_555 A MLE 25 N  ? ? A GLU 24 A MLE 25 1_555 ? ? ? ? ? ? ? 1.318 ? 
covale2 covale ? ? A MLE 25 C  ? ? ? 1_555 A ARG 26 N  ? ? A MLE 25 A ARG 26 1_555 ? ? ? ? ? ? ? 1.303 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 47 ? LEU A 51 ? ARG A 47 LEU A 51 
A 2 GLU A 38 ? LEU A 43 ? GLU A 38 LEU A 43 
A 3 ILE A 22 ? ILE A 28 ? ILE A 22 ILE A 28 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 47 ? O ARG A 47 N LEU A 43 ? N LEU A 43 
A 2 3 O GLU A 38 ? O GLU A 38 N ILE A 28 ? N ILE A 28 
# 
_database_PDB_matrix.entry_id          1IKM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IKM 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . GLU A 1 4  ? -10.811 16.825  -8.660  1.00 9.58  ? 4  GLU A N    1  
ATOM   2     C CA   . GLU A 1 4  ? -9.896  16.662  -7.491  1.00 9.09  ? 4  GLU A CA   1  
ATOM   3     C C    . GLU A 1 4  ? -9.721  15.170  -7.175  1.00 8.06  ? 4  GLU A C    1  
ATOM   4     O O    . GLU A 1 4  ? -8.630  14.639  -7.270  1.00 8.10  ? 4  GLU A O    1  
ATOM   5     C CB   . GLU A 1 4  ? -10.484 17.387  -6.274  1.00 9.77  ? 4  GLU A CB   1  
ATOM   6     C CG   . GLU A 1 4  ? -9.366  17.709  -5.278  1.00 10.24 ? 4  GLU A CG   1  
ATOM   7     C CD   . GLU A 1 4  ? -9.800  18.856  -4.361  1.00 11.04 ? 4  GLU A CD   1  
ATOM   8     O OE1  . GLU A 1 4  ? -9.570  19.998  -4.723  1.00 11.49 ? 4  GLU A OE1  1  
ATOM   9     O OE2  . GLU A 1 4  ? -10.354 18.572  -3.311  1.00 11.36 ? 4  GLU A OE2  1  
ATOM   10    H HA   . GLU A 1 4  ? -8.934  17.090  -7.731  1.00 9.22  ? 4  GLU A HA   1  
ATOM   11    H HB2  . GLU A 1 4  ? -10.956 18.305  -6.595  1.00 9.96  ? 4  GLU A HB2  1  
ATOM   12    H HB3  . GLU A 1 4  ? -11.217 16.756  -5.794  1.00 9.97  ? 4  GLU A HB3  1  
ATOM   13    H HG2  . GLU A 1 4  ? -9.156  16.834  -4.683  1.00 10.27 ? 4  GLU A HG2  1  
ATOM   14    H HG3  . GLU A 1 4  ? -8.476  18.000  -5.817  1.00 10.19 ? 4  GLU A HG3  1  
ATOM   15    N N    . LEU A 1 5  ? -10.791 14.492  -6.809  1.00 7.36  ? 5  LEU A N    1  
ATOM   16    C CA   . LEU A 1 5  ? -10.713 13.030  -6.487  1.00 6.53  ? 5  LEU A CA   1  
ATOM   17    C C    . LEU A 1 5  ? -9.830  12.811  -5.247  1.00 6.17  ? 5  LEU A C    1  
ATOM   18    O O    . LEU A 1 5  ? -8.637  12.586  -5.349  1.00 6.61  ? 5  LEU A O    1  
ATOM   19    C CB   . LEU A 1 5  ? -10.134 12.263  -7.692  1.00 6.34  ? 5  LEU A CB   1  
ATOM   20    C CG   . LEU A 1 5  ? -10.840 10.909  -7.856  1.00 7.26  ? 5  LEU A CG   1  
ATOM   21    C CD1  . LEU A 1 5  ? -10.638 10.053  -6.600  1.00 7.60  ? 5  LEU A CD1  1  
ATOM   22    C CD2  . LEU A 1 5  ? -12.340 11.130  -8.089  1.00 7.86  ? 5  LEU A CD2  1  
ATOM   23    H H    . LEU A 1 5  ? -11.656 14.951  -6.749  1.00 7.57  ? 5  LEU A H    1  
ATOM   24    H HA   . LEU A 1 5  ? -11.707 12.664  -6.279  1.00 6.63  ? 5  LEU A HA   1  
ATOM   25    H HB2  . LEU A 1 5  ? -10.275 12.849  -8.588  1.00 5.88  ? 5  LEU A HB2  1  
ATOM   26    H HB3  . LEU A 1 5  ? -9.079  12.097  -7.538  1.00 6.33  ? 5  LEU A HB3  1  
ATOM   27    H HG   . LEU A 1 5  ? -10.420 10.391  -8.707  1.00 7.52  ? 5  LEU A HG   1  
ATOM   28    H HD11 . LEU A 1 5  ? -9.590  10.040  -6.339  1.00 7.24  ? 5  LEU A HD11 1  
ATOM   29    H HD12 . LEU A 1 5  ? -11.207 10.473  -5.783  1.00 7.97  ? 5  LEU A HD12 1  
ATOM   30    H HD13 . LEU A 1 5  ? -10.975 9.045   -6.793  1.00 8.07  ? 5  LEU A HD13 1  
ATOM   31    H HD21 . LEU A 1 5  ? -12.482 11.989  -8.728  1.00 7.79  ? 5  LEU A HD21 1  
ATOM   32    H HD22 . LEU A 1 5  ? -12.764 10.257  -8.561  1.00 8.13  ? 5  LEU A HD22 1  
ATOM   33    H HD23 . LEU A 1 5  ? -12.830 11.301  -7.142  1.00 8.35  ? 5  LEU A HD23 1  
ATOM   34    N N    . ARG A 1 6  ? -10.420 12.875  -4.073  1.00 5.61  ? 6  ARG A N    1  
ATOM   35    C CA   . ARG A 1 6  ? -9.644  12.672  -2.811  1.00 5.48  ? 6  ARG A CA   1  
ATOM   36    C C    . ARG A 1 6  ? -9.160  11.218  -2.709  1.00 4.69  ? 6  ARG A C    1  
ATOM   37    O O    . ARG A 1 6  ? -9.327  10.431  -3.624  1.00 4.64  ? 6  ARG A O    1  
ATOM   38    C CB   . ARG A 1 6  ? -10.537 13.000  -1.607  1.00 6.06  ? 6  ARG A CB   1  
ATOM   39    C CG   . ARG A 1 6  ? -11.790 12.115  -1.617  1.00 6.84  ? 6  ARG A CG   1  
ATOM   40    C CD   . ARG A 1 6  ? -13.039 12.993  -1.499  1.00 7.76  ? 6  ARG A CD   1  
ATOM   41    N NE   . ARG A 1 6  ? -14.217 12.141  -1.167  1.00 8.57  ? 6  ARG A NE   1  
ATOM   42    C CZ   . ARG A 1 6  ? -14.633 12.052  0.070   1.00 9.27  ? 6  ARG A CZ   1  
ATOM   43    N NH1  . ARG A 1 6  ? -15.501 12.917  0.530   1.00 9.70  ? 6  ARG A NH1  1  
ATOM   44    N NH2  . ARG A 1 6  ? -14.180 11.099  0.844   1.00 9.77  ? 6  ARG A NH2  1  
ATOM   45    H H    . ARG A 1 6  ? -11.379 13.057  -4.022  1.00 5.45  ? 6  ARG A H    1  
ATOM   46    H HA   . ARG A 1 6  ? -8.790  13.329  -2.806  1.00 5.83  ? 6  ARG A HA   1  
ATOM   47    H HB2  . ARG A 1 6  ? -9.986  12.826  -0.702  1.00 6.17  ? 6  ARG A HB2  1  
ATOM   48    H HB3  . ARG A 1 6  ? -10.830 14.036  -1.653  1.00 6.11  ? 6  ARG A HB3  1  
ATOM   49    H HG2  . ARG A 1 6  ? -11.830 11.554  -2.540  1.00 6.68  ? 6  ARG A HG2  1  
ATOM   50    H HG3  . ARG A 1 6  ? -11.754 11.432  -0.782  1.00 7.20  ? 6  ARG A HG3  1  
ATOM   51    H HD2  . ARG A 1 6  ? -12.892 13.725  -0.719  1.00 8.01  ? 6  ARG A HD2  1  
ATOM   52    H HD3  . ARG A 1 6  ? -13.214 13.498  -2.438  1.00 7.82  ? 6  ARG A HD3  1  
ATOM   53    H HE   . ARG A 1 6  ? -14.680 11.647  -1.876  1.00 8.74  ? 6  ARG A HE   1  
ATOM   54    H HH11 . ARG A 1 6  ? -15.846 13.645  -0.064  1.00 9.50  ? 6  ARG A HH11 1  
ATOM   55    H HH12 . ARG A 1 6  ? -15.820 12.852  1.476   1.00 10.35 ? 6  ARG A HH12 1  
ATOM   56    H HH21 . ARG A 1 6  ? -13.517 10.439  0.491   1.00 9.63  ? 6  ARG A HH21 1  
ATOM   57    H HH22 . ARG A 1 6  ? -14.497 11.030  1.791   1.00 10.41 ? 6  ARG A HH22 1  
ATOM   58    N N    . CYS A 1 7  ? -8.562  10.860  -1.597  1.00 4.47  ? 7  CYS A N    1  
ATOM   59    C CA   . CYS A 1 7  ? -8.065  9.463   -1.425  1.00 4.05  ? 7  CYS A CA   1  
ATOM   60    C C    . CYS A 1 7  ? -9.246  8.491   -1.441  1.00 4.38  ? 7  CYS A C    1  
ATOM   61    O O    . CYS A 1 7  ? -10.137 8.566   -0.612  1.00 4.93  ? 7  CYS A O    1  
ATOM   62    C CB   . CYS A 1 7  ? -7.328  9.333   -0.090  1.00 4.32  ? 7  CYS A CB   1  
ATOM   63    S SG   . CYS A 1 7  ? -5.577  9.730   -0.322  1.00 4.79  ? 7  CYS A SG   1  
ATOM   64    H H    . CYS A 1 7  ? -8.442  11.514  -0.876  1.00 4.87  ? 7  CYS A H    1  
ATOM   65    H HA   . CYS A 1 7  ? -7.389  9.221   -2.232  1.00 3.89  ? 7  CYS A HA   1  
ATOM   66    H HB2  . CYS A 1 7  ? -7.761  10.010  0.628   1.00 4.81  ? 7  CYS A HB2  1  
ATOM   67    H HB3  . CYS A 1 7  ? -7.421  8.322   0.272   1.00 4.30  ? 7  CYS A HB3  1  
ATOM   68    N N    . GLN A 1 8  ? -9.254  7.573   -2.374  1.00 4.51  ? 8  GLN A N    1  
ATOM   69    C CA   . GLN A 1 8  ? -10.363 6.582   -2.455  1.00 5.30  ? 8  GLN A CA   1  
ATOM   70    C C    . GLN A 1 8  ? -10.187 5.485   -1.383  1.00 5.47  ? 8  GLN A C    1  
ATOM   71    O O    . GLN A 1 8  ? -11.014 4.600   -1.263  1.00 6.21  ? 8  GLN A O    1  
ATOM   72    C CB   . GLN A 1 8  ? -10.356 5.945   -3.851  1.00 5.63  ? 8  GLN A CB   1  
ATOM   73    C CG   . GLN A 1 8  ? -9.048  5.172   -4.071  1.00 6.22  ? 8  GLN A CG   1  
ATOM   74    C CD   . GLN A 1 8  ? -8.523  5.437   -5.486  1.00 7.21  ? 8  GLN A CD   1  
ATOM   75    O OE1  . GLN A 1 8  ? -8.723  4.638   -6.378  1.00 7.78  ? 8  GLN A OE1  1  
ATOM   76    N NE2  . GLN A 1 8  ? -7.850  6.531   -5.730  1.00 7.68  ? 8  GLN A NE2  1  
ATOM   77    H H    . GLN A 1 8  ? -8.524  7.532   -3.024  1.00 4.40  ? 8  GLN A H    1  
ATOM   78    H HA   . GLN A 1 8  ? -11.306 7.084   -2.298  1.00 5.87  ? 8  GLN A HA   1  
ATOM   79    H HB2  . GLN A 1 8  ? -11.188 5.271   -3.937  1.00 5.62  ? 8  GLN A HB2  1  
ATOM   80    H HB3  . GLN A 1 8  ? -10.444 6.720   -4.598  1.00 5.89  ? 8  GLN A HB3  1  
ATOM   81    H HG2  . GLN A 1 8  ? -8.313  5.493   -3.347  1.00 6.11  ? 8  GLN A HG2  1  
ATOM   82    H HG3  . GLN A 1 8  ? -9.232  4.115   -3.950  1.00 6.39  ? 8  GLN A HG3  1  
ATOM   83    H HE21 . GLN A 1 8  ? -7.684  7.177   -5.013  1.00 7.43  ? 8  GLN A HE21 1  
ATOM   84    H HE22 . GLN A 1 8  ? -7.511  6.705   -6.633  1.00 8.44  ? 8  GLN A HE22 1  
ATOM   85    N N    . CYS A 1 9  ? -9.118  5.530   -0.610  1.00 5.04  ? 9  CYS A N    1  
ATOM   86    C CA   . CYS A 1 9  ? -8.897  4.489   0.433   1.00 5.45  ? 9  CYS A CA   1  
ATOM   87    C C    . CYS A 1 9  ? -8.814  5.150   1.812   1.00 5.99  ? 9  CYS A C    1  
ATOM   88    O O    . CYS A 1 9  ? -7.814  5.749   2.166   1.00 6.13  ? 9  CYS A O    1  
ATOM   89    C CB   . CYS A 1 9  ? -7.588  3.758   0.132   1.00 5.08  ? 9  CYS A CB   1  
ATOM   90    S SG   . CYS A 1 9  ? -7.915  2.372   -0.985  1.00 5.12  ? 9  CYS A SG   1  
ATOM   91    H H    . CYS A 1 9  ? -8.457  6.243   -0.719  1.00 4.65  ? 9  CYS A H    1  
ATOM   92    H HA   . CYS A 1 9  ? -9.713  3.783   0.425   1.00 5.89  ? 9  CYS A HA   1  
ATOM   93    H HB2  . CYS A 1 9  ? -6.893  4.440   -0.334  1.00 4.67  ? 9  CYS A HB2  1  
ATOM   94    H HB3  . CYS A 1 9  ? -7.166  3.391   1.051   1.00 5.54  ? 9  CYS A HB3  1  
ATOM   95    N N    . ILE A 1 10 ? -9.861  5.032   2.593   1.00 6.61  ? 10 ILE A N    1  
ATOM   96    C CA   . ILE A 1 10 ? -9.857  5.635   3.962   1.00 7.44  ? 10 ILE A CA   1  
ATOM   97    C C    . ILE A 1 10 ? -8.884  4.853   4.857   1.00 7.48  ? 10 ILE A C    1  
ATOM   98    O O    . ILE A 1 10 ? -8.264  5.408   5.745   1.00 8.16  ? 10 ILE A O    1  
ATOM   99    C CB   . ILE A 1 10 ? -11.273 5.573   4.557   1.00 8.38  ? 10 ILE A CB   1  
ATOM   100   C CG1  . ILE A 1 10 ? -12.228 6.419   3.705   1.00 8.63  ? 10 ILE A CG1  1  
ATOM   101   C CG2  . ILE A 1 10 ? -11.261 6.114   5.992   1.00 9.31  ? 10 ILE A CG2  1  
ATOM   102   C CD1  . ILE A 1 10 ? -13.618 5.780   3.702   1.00 9.47  ? 10 ILE A CD1  1  
ATOM   103   H H    . ILE A 1 10 ? -10.648 4.536   2.282   1.00 6.69  ? 10 ILE A H    1  
ATOM   104   H HA   . ILE A 1 10 ? -9.538  6.665   3.899   1.00 7.59  ? 10 ILE A HA   1  
ATOM   105   H HB   . ILE A 1 10 ? -11.611 4.547   4.565   1.00 8.40  ? 10 ILE A HB   1  
ATOM   106   H HG12 . ILE A 1 10 ? -12.291 7.416   4.117   1.00 8.91  ? 10 ILE A HG12 1  
ATOM   107   H HG13 . ILE A 1 10 ? -11.857 6.472   2.692   1.00 8.14  ? 10 ILE A HG13 1  
ATOM   108   H HG21 . ILE A 1 10 ? -10.715 7.046   6.021   1.00 9.72  ? 10 ILE A HG21 1  
ATOM   109   H HG22 . ILE A 1 10 ? -12.276 6.281   6.322   1.00 9.27  ? 10 ILE A HG22 1  
ATOM   110   H HG23 . ILE A 1 10 ? -10.785 5.397   6.643   1.00 9.78  ? 10 ILE A HG23 1  
ATOM   111   H HD11 . ILE A 1 10 ? -13.520 4.705   3.749   1.00 9.76  ? 10 ILE A HD11 1  
ATOM   112   H HD12 . ILE A 1 10 ? -14.175 6.128   4.559   1.00 9.66  ? 10 ILE A HD12 1  
ATOM   113   H HD13 . ILE A 1 10 ? -14.140 6.055   2.797   1.00 9.77  ? 10 ILE A HD13 1  
ATOM   114   N N    . LYS A 1 11 ? -8.746  3.569   4.620   1.00 6.93  ? 11 LYS A N    1  
ATOM   115   C CA   . LYS A 1 11 ? -7.813  2.738   5.444   1.00 7.15  ? 11 LYS A CA   1  
ATOM   116   C C    . LYS A 1 11 ? -6.779  2.077   4.526   1.00 6.42  ? 11 LYS A C    1  
ATOM   117   O O    . LYS A 1 11 ? -6.960  2.007   3.322   1.00 6.35  ? 11 LYS A O    1  
ATOM   118   C CB   . LYS A 1 11 ? -8.609  1.655   6.182   1.00 8.05  ? 11 LYS A CB   1  
ATOM   119   C CG   . LYS A 1 11 ? -9.365  2.282   7.358   1.00 8.65  ? 11 LYS A CG   1  
ATOM   120   C CD   . LYS A 1 11 ? -10.643 1.484   7.635   1.00 9.04  ? 11 LYS A CD   1  
ATOM   121   C CE   . LYS A 1 11 ? -11.775 2.441   8.016   1.00 9.50  ? 11 LYS A CE   1  
ATOM   122   N NZ   . LYS A 1 11 ? -12.487 2.891   6.785   1.00 9.69  ? 11 LYS A NZ   1  
ATOM   123   H H    . LYS A 1 11 ? -9.255  3.151   3.892   1.00 6.52  ? 11 LYS A H    1  
ATOM   124   H HA   . LYS A 1 11 ? -7.306  3.367   6.161   1.00 7.36  ? 11 LYS A HA   1  
ATOM   125   H HB2  . LYS A 1 11 ? -9.314  1.200   5.501   1.00 8.15  ? 11 LYS A HB2  1  
ATOM   126   H HB3  . LYS A 1 11 ? -7.932  0.901   6.554   1.00 8.38  ? 11 LYS A HB3  1  
ATOM   127   H HG2  . LYS A 1 11 ? -8.736  2.271   8.237   1.00 9.16  ? 11 LYS A HG2  1  
ATOM   128   H HG3  . LYS A 1 11 ? -9.625  3.302   7.117   1.00 8.50  ? 11 LYS A HG3  1  
ATOM   129   H HD2  . LYS A 1 11 ? -10.922 0.930   6.749   1.00 9.00  ? 11 LYS A HD2  1  
ATOM   130   H HD3  . LYS A 1 11 ? -10.468 0.796   8.449   1.00 9.26  ? 11 LYS A HD3  1  
ATOM   131   H HE2  . LYS A 1 11 ? -12.471 1.934   8.668   1.00 9.79  ? 11 LYS A HE2  1  
ATOM   132   H HE3  . LYS A 1 11 ? -11.364 3.299   8.528   1.00 9.62  ? 11 LYS A HE3  1  
ATOM   133   H HZ1  . LYS A 1 11 ? -11.795 3.225   6.085   1.00 9.61  ? 11 LYS A HZ1  1  
ATOM   134   H HZ2  . LYS A 1 11 ? -13.026 2.097   6.385   1.00 9.96  ? 11 LYS A HZ2  1  
ATOM   135   H HZ3  . LYS A 1 11 ? -13.138 3.666   7.027   1.00 9.86  ? 11 LYS A HZ3  1  
ATOM   136   N N    . THR A 1 12 ? -5.692  1.594   5.081   1.00 6.02  ? 12 THR A N    1  
ATOM   137   C CA   . THR A 1 12 ? -4.643  0.941   4.238   1.00 5.35  ? 12 THR A CA   1  
ATOM   138   C C    . THR A 1 12 ? -4.306  -0.454  4.771   1.00 5.31  ? 12 THR A C    1  
ATOM   139   O O    . THR A 1 12 ? -5.005  -1.006  5.601   1.00 5.80  ? 12 THR A O    1  
ATOM   140   C CB   . THR A 1 12 ? -3.373  1.799   4.203   1.00 5.23  ? 12 THR A CB   1  
ATOM   141   O OG1  . THR A 1 12 ? -3.367  2.723   5.285   1.00 5.90  ? 12 THR A OG1  1  
ATOM   142   C CG2  . THR A 1 12 ? -3.318  2.547   2.877   1.00 5.32  ? 12 THR A CG2  1  
ATOM   143   H H    . THR A 1 12 ? -5.565  1.663   6.050   1.00 6.26  ? 12 THR A H    1  
ATOM   144   H HA   . THR A 1 12 ? -5.019  0.840   3.231   1.00 5.27  ? 12 THR A HA   1  
ATOM   145   H HB   . THR A 1 12 ? -2.508  1.156   4.273   1.00 4.85  ? 12 THR A HB   1  
ATOM   146   H HG1  . THR A 1 12 ? -2.522  2.648   5.735   1.00 6.31  ? 12 THR A HG1  1  
ATOM   147   H HG21 . THR A 1 12 ? -3.349  1.834   2.064   1.00 5.41  ? 12 THR A HG21 1  
ATOM   148   H HG22 . THR A 1 12 ? -4.164  3.212   2.804   1.00 5.52  ? 12 THR A HG22 1  
ATOM   149   H HG23 . THR A 1 12 ? -2.403  3.115   2.822   1.00 5.48  ? 12 THR A HG23 1  
ATOM   150   N N    . TYR A 1 13 ? -3.247  -1.032  4.260   1.00 4.96  ? 13 TYR A N    1  
ATOM   151   C CA   . TYR A 1 13 ? -2.846  -2.399  4.674   1.00 5.03  ? 13 TYR A CA   1  
ATOM   152   C C    . TYR A 1 13 ? -1.556  -2.348  5.498   1.00 5.08  ? 13 TYR A C    1  
ATOM   153   O O    . TYR A 1 13 ? -0.529  -1.885  5.035   1.00 4.67  ? 13 TYR A O    1  
ATOM   154   C CB   . TYR A 1 13 ? -2.612  -3.230  3.408   1.00 4.85  ? 13 TYR A CB   1  
ATOM   155   C CG   . TYR A 1 13 ? -2.740  -4.700  3.701   1.00 5.22  ? 13 TYR A CG   1  
ATOM   156   C CD1  . TYR A 1 13 ? -3.614  -5.151  4.696   1.00 5.75  ? 13 TYR A CD1  1  
ATOM   157   C CD2  . TYR A 1 13 ? -1.979  -5.610  2.966   1.00 5.34  ? 13 TYR A CD2  1  
ATOM   158   C CE1  . TYR A 1 13 ? -3.724  -6.521  4.958   1.00 6.30  ? 13 TYR A CE1  1  
ATOM   159   C CE2  . TYR A 1 13 ? -2.087  -6.983  3.225   1.00 5.79  ? 13 TYR A CE2  1  
ATOM   160   C CZ   . TYR A 1 13 ? -2.960  -7.438  4.223   1.00 6.23  ? 13 TYR A CZ   1  
ATOM   161   O OH   . TYR A 1 13 ? -3.069  -8.791  4.477   1.00 6.84  ? 13 TYR A OH   1  
ATOM   162   H H    . TYR A 1 13 ? -2.724  -0.566  3.574   1.00 4.82  ? 13 TYR A H    1  
ATOM   163   H HA   . TYR A 1 13 ? -3.632  -2.847  5.259   1.00 5.34  ? 13 TYR A HA   1  
ATOM   164   H HB2  . TYR A 1 13 ? -3.339  -2.953  2.660   1.00 4.90  ? 13 TYR A HB2  1  
ATOM   165   H HB3  . TYR A 1 13 ? -1.620  -3.031  3.031   1.00 4.67  ? 13 TYR A HB3  1  
ATOM   166   H HD1  . TYR A 1 13 ? -4.204  -4.439  5.259   1.00 5.92  ? 13 TYR A HD1  1  
ATOM   167   H HD2  . TYR A 1 13 ? -1.309  -5.248  2.196   1.00 5.30  ? 13 TYR A HD2  1  
ATOM   168   H HE1  . TYR A 1 13 ? -4.394  -6.873  5.728   1.00 6.92  ? 13 TYR A HE1  1  
ATOM   169   H HE2  . TYR A 1 13 ? -1.498  -7.689  2.658   1.00 5.99  ? 13 TYR A HE2  1  
ATOM   170   H HH   . TYR A 1 13 ? -2.687  -8.965  5.339   1.00 7.17  ? 13 TYR A HH   1  
ATOM   171   N N    . SER A 1 14 ? -1.604  -2.841  6.710   1.00 5.82  ? 14 SER A N    1  
ATOM   172   C CA   . SER A 1 14 ? -0.384  -2.851  7.572   1.00 6.06  ? 14 SER A CA   1  
ATOM   173   C C    . SER A 1 14 ? 0.282   -4.231  7.491   1.00 6.51  ? 14 SER A C    1  
ATOM   174   O O    . SER A 1 14 ? 1.488   -4.348  7.614   1.00 6.88  ? 14 SER A O    1  
ATOM   175   C CB   . SER A 1 14 ? -0.769  -2.547  9.021   1.00 6.42  ? 14 SER A CB   1  
ATOM   176   O OG   . SER A 1 14 ? 0.339   -1.947  9.682   1.00 6.80  ? 14 SER A OG   1  
ATOM   177   H H    . SER A 1 14 ? -2.442  -3.221  7.051   1.00 6.33  ? 14 SER A H    1  
ATOM   178   H HA   . SER A 1 14 ? 0.308   -2.103  7.219   1.00 5.81  ? 14 SER A HA   1  
ATOM   179   H HB2  . SER A 1 14 ? -1.604  -1.867  9.041   1.00 6.57  ? 14 SER A HB2  1  
ATOM   180   H HB3  . SER A 1 14 ? -1.044  -3.466  9.522   1.00 6.52  ? 14 SER A HB3  1  
ATOM   181   H HG   . SER A 1 14 ? 0.012   -1.211  10.204  1.00 7.03  ? 14 SER A HG   1  
ATOM   182   N N    . LYS A 1 15 ? -0.489  -5.275  7.267   1.00 6.59  ? 15 LYS A N    1  
ATOM   183   C CA   . LYS A 1 15 ? 0.108   -6.641  7.160   1.00 7.06  ? 15 LYS A CA   1  
ATOM   184   C C    . LYS A 1 15 ? 0.763   -6.777  5.780   1.00 6.32  ? 15 LYS A C    1  
ATOM   185   O O    . LYS A 1 15 ? 0.209   -6.336  4.794   1.00 6.13  ? 15 LYS A O    1  
ATOM   186   C CB   . LYS A 1 15 ? -0.952  -7.744  7.308   1.00 7.75  ? 15 LYS A CB   1  
ATOM   187   C CG   . LYS A 1 15 ? -2.193  -7.258  8.078   1.00 8.64  ? 15 LYS A CG   1  
ATOM   188   C CD   . LYS A 1 15 ? -1.807  -6.900  9.517   1.00 9.43  ? 15 LYS A CD   1  
ATOM   189   C CE   . LYS A 1 15 ? -2.939  -7.306  10.464  1.00 10.20 ? 15 LYS A CE   1  
ATOM   190   N NZ   . LYS A 1 15 ? -2.374  -7.655  11.799  1.00 10.59 ? 15 LYS A NZ   1  
ATOM   191   H H    . LYS A 1 15 ? -1.449  -5.154  7.157   1.00 6.42  ? 15 LYS A H    1  
ATOM   192   H HA   . LYS A 1 15 ? 0.856   -6.758  7.929   1.00 7.57  ? 15 LYS A HA   1  
ATOM   193   H HB2  . LYS A 1 15 ? -1.242  -8.074  6.330   1.00 7.79  ? 15 LYS A HB2  1  
ATOM   194   H HB3  . LYS A 1 15 ? -0.518  -8.571  7.835   1.00 7.79  ? 15 LYS A HB3  1  
ATOM   195   H HG2  . LYS A 1 15 ? -2.609  -6.392  7.588   1.00 8.72  ? 15 LYS A HG2  1  
ATOM   196   H HG3  . LYS A 1 15 ? -2.931  -8.046  8.095   1.00 8.87  ? 15 LYS A HG3  1  
ATOM   197   H HD2  . LYS A 1 15 ? -0.902  -7.425  9.788   1.00 9.71  ? 15 LYS A HD2  1  
ATOM   198   H HD3  . LYS A 1 15 ? -1.643  -5.835  9.592   1.00 9.38  ? 15 LYS A HD3  1  
ATOM   199   H HE2  . LYS A 1 15 ? -3.632  -6.486  10.569  1.00 10.54 ? 15 LYS A HE2  1  
ATOM   200   H HE3  . LYS A 1 15 ? -3.457  -8.163  10.058  1.00 10.33 ? 15 LYS A HE3  1  
ATOM   201   H HZ1  . LYS A 1 15 ? -1.695  -8.435  11.696  1.00 10.22 ? 15 LYS A HZ1  1  
ATOM   202   H HZ2  . LYS A 1 15 ? -1.888  -6.826  12.197  1.00 11.09 ? 15 LYS A HZ2  1  
ATOM   203   H HZ3  . LYS A 1 15 ? -3.144  -7.945  12.435  1.00 10.91 ? 15 LYS A HZ3  1  
ATOM   204   N N    . PRO A 1 16 ? 1.931   -7.366  5.756   1.00 6.02  ? 16 PRO A N    1  
ATOM   205   C CA   . PRO A 1 16 ? 2.709   -7.554  4.519   1.00 5.35  ? 16 PRO A CA   1  
ATOM   206   C C    . PRO A 1 16 ? 2.251   -8.797  3.748   1.00 5.50  ? 16 PRO A C    1  
ATOM   207   O O    . PRO A 1 16 ? 1.631   -9.691  4.294   1.00 6.37  ? 16 PRO A O    1  
ATOM   208   C CB   . PRO A 1 16 ? 4.138   -7.730  5.035   1.00 5.39  ? 16 PRO A CB   1  
ATOM   209   C CG   . PRO A 1 16 ? 4.023   -8.208  6.505   1.00 6.26  ? 16 PRO A CG   1  
ATOM   210   C CD   . PRO A 1 16 ? 2.585   -7.898  6.961   1.00 6.51  ? 16 PRO A CD   1  
ATOM   211   H HA   . PRO A 1 16 ? 2.652   -6.680  3.896   1.00 4.92  ? 16 PRO A HA   1  
ATOM   212   H HB2  . PRO A 1 16 ? 4.655   -8.461  4.443   1.00 5.32  ? 16 PRO A HB2  1  
ATOM   213   H HB3  . PRO A 1 16 ? 4.659   -6.792  4.999   1.00 5.10  ? 16 PRO A HB3  1  
ATOM   214   H HG2  . PRO A 1 16 ? 4.211   -9.272  6.563   1.00 6.77  ? 16 PRO A HG2  1  
ATOM   215   H HG3  . PRO A 1 16 ? 4.725   -7.673  7.125   1.00 6.37  ? 16 PRO A HG3  1  
ATOM   216   H HD2  . PRO A 1 16 ? 2.089   -8.800  7.291   1.00 7.06  ? 16 PRO A HD2  1  
ATOM   217   H HD3  . PRO A 1 16 ? 2.579   -7.157  7.741   1.00 6.63  ? 16 PRO A HD3  1  
ATOM   218   N N    . PHE A 1 17 ? 2.570   -8.854  2.477   1.00 4.76  ? 17 PHE A N    1  
ATOM   219   C CA   . PHE A 1 17 ? 2.178   -10.034 1.642   1.00 4.96  ? 17 PHE A CA   1  
ATOM   220   C C    . PHE A 1 17 ? 3.030   -10.067 0.360   1.00 4.78  ? 17 PHE A C    1  
ATOM   221   O O    . PHE A 1 17 ? 3.551   -9.056  -0.077  1.00 4.77  ? 17 PHE A O    1  
ATOM   222   C CB   . PHE A 1 17 ? 0.674   -9.969  1.306   1.00 4.69  ? 17 PHE A CB   1  
ATOM   223   C CG   . PHE A 1 17 ? 0.383   -8.896  0.277   1.00 3.72  ? 17 PHE A CG   1  
ATOM   224   C CD1  . PHE A 1 17 ? 0.454   -7.540  0.625   1.00 3.29  ? 17 PHE A CD1  1  
ATOM   225   C CD2  . PHE A 1 17 ? 0.026   -9.263  -1.027  1.00 3.74  ? 17 PHE A CD2  1  
ATOM   226   C CE1  . PHE A 1 17 ? 0.174   -6.556  -0.331  1.00 2.59  ? 17 PHE A CE1  1  
ATOM   227   C CE2  . PHE A 1 17 ? -0.252  -8.278  -1.981  1.00 3.14  ? 17 PHE A CE2  1  
ATOM   228   C CZ   . PHE A 1 17 ? -0.178  -6.927  -1.634  1.00 2.38  ? 17 PHE A CZ   1  
ATOM   229   H H    . PHE A 1 17 ? 3.081   -8.119  2.073   1.00 4.19  ? 17 PHE A H    1  
ATOM   230   H HA   . PHE A 1 17 ? 2.371   -10.935 2.208   1.00 5.66  ? 17 PHE A HA   1  
ATOM   231   H HB2  . PHE A 1 17 ? 0.359   -10.923 0.916   1.00 5.13  ? 17 PHE A HB2  1  
ATOM   232   H HB3  . PHE A 1 17 ? 0.119   -9.755  2.209   1.00 5.06  ? 17 PHE A HB3  1  
ATOM   233   H HD1  . PHE A 1 17 ? 0.726   -7.253  1.630   1.00 3.86  ? 17 PHE A HD1  1  
ATOM   234   H HD2  . PHE A 1 17 ? -0.034  -10.307 -1.296  1.00 4.51  ? 17 PHE A HD2  1  
ATOM   235   H HE1  . PHE A 1 17 ? 0.230   -5.511  -0.065  1.00 2.72  ? 17 PHE A HE1  1  
ATOM   236   H HE2  . PHE A 1 17 ? -0.525  -8.563  -2.988  1.00 3.62  ? 17 PHE A HE2  1  
ATOM   237   H HZ   . PHE A 1 17 ? -0.394  -6.167  -2.371  1.00 2.18  ? 17 PHE A HZ   1  
ATOM   238   N N    . HIS A 1 18 ? 3.184   -11.231 -0.232  1.00 4.92  ? 18 HIS A N    1  
ATOM   239   C CA   . HIS A 1 18 ? 4.011   -11.364 -1.474  1.00 5.06  ? 18 HIS A CA   1  
ATOM   240   C C    . HIS A 1 18 ? 3.385   -10.526 -2.623  1.00 4.32  ? 18 HIS A C    1  
ATOM   241   O O    . HIS A 1 18 ? 2.177   -10.457 -2.753  1.00 4.10  ? 18 HIS A O    1  
ATOM   242   C CB   . HIS A 1 18 ? 4.116   -12.854 -1.802  1.00 5.95  ? 18 HIS A CB   1  
ATOM   243   C CG   . HIS A 1 18 ? 4.618   -13.037 -3.186  1.00 6.25  ? 18 HIS A CG   1  
ATOM   244   N ND1  . HIS A 1 18 ? 5.961   -13.176 -3.498  1.00 6.36  ? 18 HIS A ND1  1  
ATOM   245   C CD2  . HIS A 1 18 ? 3.950   -13.097 -4.354  1.00 6.72  ? 18 HIS A CD2  1  
ATOM   246   C CE1  . HIS A 1 18 ? 6.040   -13.312 -4.833  1.00 6.81  ? 18 HIS A CE1  1  
ATOM   247   N NE2  . HIS A 1 18 ? 4.839   -13.277 -5.394  1.00 7.07  ? 18 HIS A NE2  1  
ATOM   248   H H    . HIS A 1 18 ? 2.757   -12.030 0.149   1.00 5.11  ? 18 HIS A H    1  
ATOM   249   H HA   . HIS A 1 18 ? 4.994   -10.988 -1.281  1.00 5.21  ? 18 HIS A HA   1  
ATOM   250   H HB2  . HIS A 1 18 ? 4.797   -13.325 -1.110  1.00 6.63  ? 18 HIS A HB2  1  
ATOM   251   H HB3  . HIS A 1 18 ? 3.145   -13.309 -1.709  1.00 5.84  ? 18 HIS A HB3  1  
ATOM   252   H HD1  . HIS A 1 18 ? 6.710   -13.179 -2.866  1.00 6.36  ? 18 HIS A HD1  1  
ATOM   253   H HD2  . HIS A 1 18 ? 2.894   -12.966 -4.450  1.00 7.00  ? 18 HIS A HD2  1  
ATOM   254   H HE1  . HIS A 1 18 ? 6.959   -13.387 -5.388  1.00 7.12  ? 18 HIS A HE1  1  
ATOM   255   N N    . PRO A 1 19 ? 4.249   -9.851  -3.376  1.00 4.16  ? 19 PRO A N    1  
ATOM   256   C CA   . PRO A 1 19 ? 3.845   -8.924  -4.471  1.00 3.77  ? 19 PRO A CA   1  
ATOM   257   C C    . PRO A 1 19 ? 3.391   -9.608  -5.769  1.00 4.27  ? 19 PRO A C    1  
ATOM   258   O O    . PRO A 1 19 ? 2.439   -9.166  -6.381  1.00 4.32  ? 19 PRO A O    1  
ATOM   259   C CB   . PRO A 1 19 ? 5.115   -8.113  -4.736  1.00 3.96  ? 19 PRO A CB   1  
ATOM   260   C CG   . PRO A 1 19 ? 6.294   -8.972  -4.236  1.00 4.62  ? 19 PRO A CG   1  
ATOM   261   C CD   . PRO A 1 19 ? 5.715   -9.959  -3.207  1.00 4.65  ? 19 PRO A CD   1  
ATOM   262   H HA   . PRO A 1 19 ? 3.078   -8.262  -4.123  1.00 3.26  ? 19 PRO A HA   1  
ATOM   263   H HB2  . PRO A 1 19 ? 5.216   -7.919  -5.795  1.00 4.26  ? 19 PRO A HB2  1  
ATOM   264   H HB3  . PRO A 1 19 ? 5.084   -7.186  -4.189  1.00 3.57  ? 19 PRO A HB3  1  
ATOM   265   H HG2  . PRO A 1 19 ? 6.732   -9.511  -5.067  1.00 5.23  ? 19 PRO A HG2  1  
ATOM   266   H HG3  . PRO A 1 19 ? 7.036   -8.347  -3.768  1.00 4.63  ? 19 PRO A HG3  1  
ATOM   267   H HD2  . PRO A 1 19 ? 6.051   -10.962 -3.421  1.00 5.29  ? 19 PRO A HD2  1  
ATOM   268   H HD3  . PRO A 1 19 ? 5.994   -9.672  -2.207  1.00 4.56  ? 19 PRO A HD3  1  
ATOM   269   N N    . LYS A 1 20 ? 4.070   -10.637 -6.228  1.00 4.91  ? 20 LYS A N    1  
ATOM   270   C CA   . LYS A 1 20 ? 3.658   -11.286 -7.525  1.00 5.52  ? 20 LYS A CA   1  
ATOM   271   C C    . LYS A 1 20 ? 2.163   -11.663 -7.502  1.00 5.00  ? 20 LYS A C    1  
ATOM   272   O O    . LYS A 1 20 ? 1.539   -11.760 -8.543  1.00 5.39  ? 20 LYS A O    1  
ATOM   273   C CB   . LYS A 1 20 ? 4.510   -12.516 -7.821  1.00 6.44  ? 20 LYS A CB   1  
ATOM   274   C CG   . LYS A 1 20 ? 4.684   -12.676 -9.334  1.00 7.16  ? 20 LYS A CG   1  
ATOM   275   C CD   . LYS A 1 20 ? 5.886   -13.582 -9.618  1.00 7.91  ? 20 LYS A CD   1  
ATOM   276   C CE   . LYS A 1 20 ? 6.151   -13.631 -11.126 1.00 8.41  ? 20 LYS A CE   1  
ATOM   277   N NZ   . LYS A 1 20 ? 6.240   -15.051 -11.571 1.00 8.95  ? 20 LYS A NZ   1  
ATOM   278   H H    . LYS A 1 20 ? 4.855   -10.958 -5.742  1.00 5.13  ? 20 LYS A H    1  
ATOM   279   H HA   . LYS A 1 20 ? 3.816   -10.581 -8.312  1.00 5.87  ? 20 LYS A HA   1  
ATOM   280   H HB2  . LYS A 1 20 ? 5.480   -12.403 -7.359  1.00 6.91  ? 20 LYS A HB2  1  
ATOM   281   H HB3  . LYS A 1 20 ? 4.023   -13.382 -7.426  1.00 6.29  ? 20 LYS A HB3  1  
ATOM   282   H HG2  . LYS A 1 20 ? 3.791   -13.118 -9.754  1.00 7.23  ? 20 LYS A HG2  1  
ATOM   283   H HG3  . LYS A 1 20 ? 4.852   -11.708 -9.783  1.00 7.28  ? 20 LYS A HG3  1  
ATOM   284   H HD2  . LYS A 1 20 ? 6.756   -13.190 -9.112  1.00 8.14  ? 20 LYS A HD2  1  
ATOM   285   H HD3  . LYS A 1 20 ? 5.678   -14.578 -9.257  1.00 8.11  ? 20 LYS A HD3  1  
ATOM   286   H HE2  . LYS A 1 20 ? 5.344   -13.140 -11.649 1.00 8.28  ? 20 LYS A HE2  1  
ATOM   287   H HE3  . LYS A 1 20 ? 7.080   -13.127 -11.344 1.00 8.75  ? 20 LYS A HE3  1  
ATOM   288   H HZ1  . LYS A 1 20 ? 6.970   -15.544 -11.018 1.00 9.17  ? 20 LYS A HZ1  1  
ATOM   289   H HZ2  . LYS A 1 20 ? 5.323   -15.521 -11.426 1.00 9.13  ? 20 LYS A HZ2  1  
ATOM   290   H HZ3  . LYS A 1 20 ? 6.489   -15.082 -12.581 1.00 9.15  ? 20 LYS A HZ3  1  
ATOM   291   N N    . PHE A 1 21 ? 1.570   -11.832 -6.333  1.00 4.37  ? 21 PHE A N    1  
ATOM   292   C CA   . PHE A 1 21 ? 0.110   -12.149 -6.262  1.00 4.15  ? 21 PHE A CA   1  
ATOM   293   C C    . PHE A 1 21 ? -0.667  -10.980 -6.879  1.00 3.56  ? 21 PHE A C    1  
ATOM   294   O O    . PHE A 1 21 ? -1.652  -11.163 -7.569  1.00 3.88  ? 21 PHE A O    1  
ATOM   295   C CB   . PHE A 1 21 ? -0.328  -12.295 -4.807  1.00 4.02  ? 21 PHE A CB   1  
ATOM   296   C CG   . PHE A 1 21 ? 0.407   -13.417 -4.101  1.00 4.64  ? 21 PHE A CG   1  
ATOM   297   C CD1  . PHE A 1 21 ? 0.938   -14.498 -4.821  1.00 5.12  ? 21 PHE A CD1  1  
ATOM   298   C CD2  . PHE A 1 21 ? 0.548   -13.371 -2.708  1.00 5.11  ? 21 PHE A CD2  1  
ATOM   299   C CE1  . PHE A 1 21 ? 1.608   -15.526 -4.144  1.00 5.85  ? 21 PHE A CE1  1  
ATOM   300   C CE2  . PHE A 1 21 ? 1.216   -14.397 -2.035  1.00 5.85  ? 21 PHE A CE2  1  
ATOM   301   C CZ   . PHE A 1 21 ? 1.746   -15.475 -2.752  1.00 6.13  ? 21 PHE A CZ   1  
ATOM   302   H H    . PHE A 1 21 ? 2.075   -11.719 -5.505  1.00 4.29  ? 21 PHE A H    1  
ATOM   303   H HA   . PHE A 1 21 ? -0.099  -13.051 -6.793  1.00 4.82  ? 21 PHE A HA   1  
ATOM   304   H HB2  . PHE A 1 21 ? -0.127  -11.376 -4.304  1.00 3.48  ? 21 PHE A HB2  1  
ATOM   305   H HB3  . PHE A 1 21 ? -1.384  -12.489 -4.777  1.00 4.37  ? 21 PHE A HB3  1  
ATOM   306   H HD1  . PHE A 1 21 ? 0.832   -14.538 -5.893  1.00 5.18  ? 21 PHE A HD1  1  
ATOM   307   H HD2  . PHE A 1 21 ? 0.139   -12.539 -2.153  1.00 5.17  ? 21 PHE A HD2  1  
ATOM   308   H HE1  . PHE A 1 21 ? 2.017   -16.355 -4.695  1.00 6.40  ? 21 PHE A HE1  1  
ATOM   309   H HE2  . PHE A 1 21 ? 1.324   -14.356 -0.959  1.00 6.40  ? 21 PHE A HE2  1  
ATOM   310   H HZ   . PHE A 1 21 ? 2.262   -16.269 -2.231  1.00 6.79  ? 21 PHE A HZ   1  
ATOM   311   N N    . ILE A 1 22 ? -0.206  -9.776  -6.623  1.00 2.94  ? 22 ILE A N    1  
ATOM   312   C CA   . ILE A 1 22 ? -0.863  -8.550  -7.164  1.00 2.62  ? 22 ILE A CA   1  
ATOM   313   C C    . ILE A 1 22 ? -0.848  -8.581  -8.694  1.00 3.41  ? 22 ILE A C    1  
ATOM   314   O O    . ILE A 1 22 ? 0.201   -8.579  -9.313  1.00 4.13  ? 22 ILE A O    1  
ATOM   315   C CB   . ILE A 1 22 ? -0.090  -7.313  -6.684  1.00 2.18  ? 22 ILE A CB   1  
ATOM   316   C CG1  . ILE A 1 22 ? -0.099  -7.254  -5.152  1.00 2.00  ? 22 ILE A CG1  1  
ATOM   317   C CG2  . ILE A 1 22 ? -0.740  -6.049  -7.244  1.00 2.53  ? 22 ILE A CG2  1  
ATOM   318   C CD1  . ILE A 1 22 ? 1.141   -6.499  -4.664  1.00 2.47  ? 22 ILE A CD1  1  
ATOM   319   H H    . ILE A 1 22 ? 0.592   -9.681  -6.062  1.00 2.94  ? 22 ILE A H    1  
ATOM   320   H HA   . ILE A 1 22 ? -1.884  -8.495  -6.817  1.00 2.63  ? 22 ILE A HA   1  
ATOM   321   H HB   . ILE A 1 22 ? 0.930   -7.372  -7.035  1.00 2.49  ? 22 ILE A HB   1  
ATOM   322   H HG12 . ILE A 1 22 ? -0.989  -6.743  -4.816  1.00 2.23  ? 22 ILE A HG12 1  
ATOM   323   H HG13 . ILE A 1 22 ? -0.087  -8.256  -4.752  1.00 2.28  ? 22 ILE A HG13 1  
ATOM   324   H HG21 . ILE A 1 22 ? -1.812  -6.156  -7.215  1.00 2.71  ? 22 ILE A HG21 1  
ATOM   325   H HG22 . ILE A 1 22 ? -0.446  -5.198  -6.647  1.00 2.80  ? 22 ILE A HG22 1  
ATOM   326   H HG23 . ILE A 1 22 ? -0.419  -5.901  -8.264  1.00 3.07  ? 22 ILE A HG23 1  
ATOM   327   H HD11 . ILE A 1 22 ? 1.915   -6.551  -5.415  1.00 2.84  ? 22 ILE A HD11 1  
ATOM   328   H HD12 . ILE A 1 22 ? 0.885   -5.466  -4.483  1.00 2.73  ? 22 ILE A HD12 1  
ATOM   329   H HD13 . ILE A 1 22 ? 1.497   -6.947  -3.748  1.00 2.88  ? 22 ILE A HD13 1  
ATOM   330   N N    . LYS A 1 23 ? -2.004  -8.587  -9.303  1.00 3.62  ? 23 LYS A N    1  
ATOM   331   C CA   . LYS A 1 23 ? -2.066  -8.590  -10.792 1.00 4.61  ? 23 LYS A CA   1  
ATOM   332   C C    . LYS A 1 23 ? -1.933  -7.147  -11.300 1.00 5.00  ? 23 LYS A C    1  
ATOM   333   O O    . LYS A 1 23 ? -1.485  -6.915  -12.407 1.00 5.88  ? 23 LYS A O    1  
ATOM   334   C CB   . LYS A 1 23 ? -3.402  -9.179  -11.254 1.00 5.10  ? 23 LYS A CB   1  
ATOM   335   C CG   . LYS A 1 23 ? -3.219  -9.840  -12.625 1.00 5.85  ? 23 LYS A CG   1  
ATOM   336   C CD   . LYS A 1 23 ? -4.375  -10.804 -12.893 1.00 6.35  ? 23 LYS A CD   1  
ATOM   337   C CE   . LYS A 1 23 ? -4.126  -11.544 -14.211 1.00 6.93  ? 23 LYS A CE   1  
ATOM   338   N NZ   . LYS A 1 23 ? -5.257  -12.474 -14.484 1.00 7.72  ? 23 LYS A NZ   1  
ATOM   339   H H    . LYS A 1 23 ? -2.834  -8.573  -8.779  1.00 3.33  ? 23 LYS A H    1  
ATOM   340   H HA   . LYS A 1 23 ? -1.254  -9.185  -11.184 1.00 4.98  ? 23 LYS A HA   1  
ATOM   341   H HB2  . LYS A 1 23 ? -3.737  -9.917  -10.539 1.00 4.92  ? 23 LYS A HB2  1  
ATOM   342   H HB3  . LYS A 1 23 ? -4.138  -8.392  -11.332 1.00 5.36  ? 23 LYS A HB3  1  
ATOM   343   H HG2  . LYS A 1 23 ? -3.199  -9.079  -13.390 1.00 6.02  ? 23 LYS A HG2  1  
ATOM   344   H HG3  . LYS A 1 23 ? -2.287  -10.387 -12.638 1.00 6.22  ? 23 LYS A HG3  1  
ATOM   345   H HD2  . LYS A 1 23 ? -4.445  -11.518 -12.086 1.00 6.70  ? 23 LYS A HD2  1  
ATOM   346   H HD3  . LYS A 1 23 ? -5.299  -10.249 -12.964 1.00 6.30  ? 23 LYS A HD3  1  
ATOM   347   H HE2  . LYS A 1 23 ? -4.046  -10.828 -15.016 1.00 6.98  ? 23 LYS A HE2  1  
ATOM   348   H HE3  . LYS A 1 23 ? -3.206  -12.106 -14.138 1.00 7.01  ? 23 LYS A HE3  1  
ATOM   349   H HZ1  . LYS A 1 23 ? -5.375  -13.124 -13.681 1.00 7.80  ? 23 LYS A HZ1  1  
ATOM   350   H HZ2  . LYS A 1 23 ? -6.132  -11.926 -14.618 1.00 7.78  ? 23 LYS A HZ2  1  
ATOM   351   H HZ3  . LYS A 1 23 ? -5.056  -13.023 -15.343 1.00 8.36  ? 23 LYS A HZ3  1  
ATOM   352   N N    . GLU A 1 24 ? -2.312  -6.175  -10.493 1.00 4.51  ? 24 GLU A N    1  
ATOM   353   C CA   . GLU A 1 24 ? -2.202  -4.748  -10.925 1.00 5.13  ? 24 GLU A CA   1  
ATOM   354   C C    . GLU A 1 24 ? -1.820  -3.871  -9.721  1.00 4.55  ? 24 GLU A C    1  
ATOM   355   O O    . GLU A 1 24 ? -2.657  -3.532  -8.904  1.00 4.65  ? 24 GLU A O    1  
ATOM   356   C CB   . GLU A 1 24 ? -3.548  -4.278  -11.494 1.00 5.78  ? 24 GLU A CB   1  
ATOM   357   C CG   . GLU A 1 24 ? -3.664  -4.694  -12.966 1.00 6.35  ? 24 GLU A CG   1  
ATOM   358   C CD   . GLU A 1 24 ? -2.738  -3.825  -13.824 1.00 7.36  ? 24 GLU A CD   1  
ATOM   359   O OE1  . GLU A 1 24 ? -3.150  -2.735  -14.187 1.00 7.77  ? 24 GLU A OE1  1  
ATOM   360   O OE2  . GLU A 1 24 ? -1.634  -4.263  -14.102 1.00 7.92  ? 24 GLU A OE2  1  
ATOM   361   H H    . GLU A 1 24 ? -2.664  -6.387  -9.601  1.00 3.86  ? 24 GLU A H    1  
ATOM   362   H HA   . GLU A 1 24 ? -1.442  -4.663  -11.686 1.00 5.74  ? 24 GLU A HA   1  
ATOM   363   H HB2  . GLU A 1 24 ? -4.353  -4.727  -10.930 1.00 5.66  ? 24 GLU A HB2  1  
ATOM   364   H HB3  . GLU A 1 24 ? -3.614  -3.203  -11.422 1.00 6.21  ? 24 GLU A HB3  1  
ATOM   365   H HG2  . GLU A 1 24 ? -3.381  -5.732  -13.071 1.00 6.22  ? 24 GLU A HG2  1  
ATOM   366   H HG3  . GLU A 1 24 ? -4.683  -4.564  -13.297 1.00 6.40  ? 24 GLU A HG3  1  
HETATM 367   N N    . MLE A 1 25 ? -0.561  -3.501  -9.602  1.00 4.25  ? 25 MLE A N    1  
HETATM 368   C CN   . MLE A 1 25 ? 0.121   -3.026  -10.849 1.00 5.13  ? 25 MLE A CN   1  
HETATM 369   C CA   . MLE A 1 25 ? -0.137  -2.644  -8.442  1.00 3.66  ? 25 MLE A CA   1  
HETATM 370   C CB   . MLE A 1 25 ? 1.247   -3.090  -7.936  1.00 3.52  ? 25 MLE A CB   1  
HETATM 371   C CG   . MLE A 1 25 ? 1.865   -1.989  -7.054  1.00 3.28  ? 25 MLE A CG   1  
HETATM 372   C CD1  . MLE A 1 25 ? 2.399   -2.599  -5.759  1.00 2.93  ? 25 MLE A CD1  1  
HETATM 373   C CD2  . MLE A 1 25 ? 3.014   -1.305  -7.808  1.00 3.54  ? 25 MLE A CD2  1  
HETATM 374   C C    . MLE A 1 25 ? -0.074  -1.180  -8.890  1.00 4.19  ? 25 MLE A C    1  
HETATM 375   O O    . MLE A 1 25 ? 0.869   -0.761  -9.538  1.00 4.87  ? 25 MLE A O    1  
HETATM 376   H HN1  . MLE A 1 25 ? 0.144   -3.820  -11.576 1.00 5.47  ? 25 MLE A HN1  1  
HETATM 377   H HN2  . MLE A 1 25 ? -0.422  -2.181  -11.253 1.00 5.48  ? 25 MLE A HN2  1  
HETATM 378   H HN3  . MLE A 1 25 ? 1.131   -2.722  -10.614 1.00 5.42  ? 25 MLE A HN3  1  
HETATM 379   H HA   . MLE A 1 25 ? -0.858  -2.742  -7.643  1.00 3.20  ? 25 MLE A HA   1  
HETATM 380   H HB2  . MLE A 1 25 ? 1.142   -3.997  -7.359  1.00 3.37  ? 25 MLE A HB2  1  
HETATM 381   H HB3  . MLE A 1 25 ? 1.893   -3.276  -8.781  1.00 4.08  ? 25 MLE A HB3  1  
HETATM 382   H HG   . MLE A 1 25 ? 1.108   -1.257  -6.813  1.00 3.59  ? 25 MLE A HG   1  
HETATM 383   H HD11 . MLE A 1 25 ? 2.362   -3.675  -5.826  1.00 3.14  ? 25 MLE A HD11 1  
HETATM 384   H HD12 . MLE A 1 25 ? 3.419   -2.281  -5.604  1.00 2.79  ? 25 MLE A HD12 1  
HETATM 385   H HD13 . MLE A 1 25 ? 1.789   -2.268  -4.930  1.00 3.21  ? 25 MLE A HD13 1  
HETATM 386   H HD21 . MLE A 1 25 ? 3.063   -1.688  -8.817  1.00 3.89  ? 25 MLE A HD21 1  
HETATM 387   H HD22 . MLE A 1 25 ? 2.838   -0.239  -7.838  1.00 3.75  ? 25 MLE A HD22 1  
HETATM 388   H HD23 . MLE A 1 25 ? 3.947   -1.502  -7.303  1.00 3.70  ? 25 MLE A HD23 1  
ATOM   389   N N    . ARG A 1 26 ? -1.063  -0.398  -8.562  1.00 4.14  ? 26 ARG A N    1  
ATOM   390   C CA   . ARG A 1 26 ? -1.025  1.022   -8.991  1.00 4.79  ? 26 ARG A CA   1  
ATOM   391   C C    . ARG A 1 26 ? -1.130  1.942   -7.767  1.00 4.70  ? 26 ARG A C    1  
ATOM   392   O O    . ARG A 1 26 ? -2.084  1.884   -7.014  1.00 4.97  ? 26 ARG A O    1  
ATOM   393   C CB   . ARG A 1 26 ? -2.169  1.313   -9.975  1.00 5.59  ? 26 ARG A CB   1  
ATOM   394   C CG   . ARG A 1 26 ? -3.518  0.905   -9.367  1.00 5.99  ? 26 ARG A CG   1  
ATOM   395   C CD   . ARG A 1 26 ? -4.570  0.823   -10.475 1.00 6.35  ? 26 ARG A CD   1  
ATOM   396   N NE   . ARG A 1 26 ? -5.244  2.145   -10.621 1.00 7.16  ? 26 ARG A NE   1  
ATOM   397   C CZ   . ARG A 1 26 ? -6.544  2.206   -10.741 1.00 7.92  ? 26 ARG A CZ   1  
ATOM   398   N NH1  . ARG A 1 26 ? -7.297  2.253   -9.673  1.00 8.52  ? 26 ARG A NH1  1  
ATOM   399   N NH2  . ARG A 1 26 ? -7.091  2.218   -11.930 1.00 8.32  ? 26 ARG A NH2  1  
ATOM   400   H H    . ARG A 1 26 ? -1.820  -0.743  -8.042  1.00 3.85  ? 26 ARG A H    1  
ATOM   401   H HA   . ARG A 1 26 ? -0.078  1.190   -9.487  1.00 5.07  ? 26 ARG A HA   1  
ATOM   402   H HB2  . ARG A 1 26 ? -2.185  2.369   -10.200 1.00 5.95  ? 26 ARG A HB2  1  
ATOM   403   H HB3  . ARG A 1 26 ? -2.006  0.756   -10.886 1.00 5.91  ? 26 ARG A HB3  1  
ATOM   404   H HG2  . ARG A 1 26 ? -3.422  -0.059  -8.891  1.00 6.27  ? 26 ARG A HG2  1  
ATOM   405   H HG3  . ARG A 1 26 ? -3.822  1.640   -8.638  1.00 6.12  ? 26 ARG A HG3  1  
ATOM   406   H HD2  . ARG A 1 26 ? -4.091  0.560   -11.407 1.00 6.26  ? 26 ARG A HD2  1  
ATOM   407   H HD3  . ARG A 1 26 ? -5.302  0.070   -10.221 1.00 6.38  ? 26 ARG A HD3  1  
ATOM   408   H HE   . ARG A 1 26 ? -4.714  2.969   -10.628 1.00 7.28  ? 26 ARG A HE   1  
ATOM   409   H HH11 . ARG A 1 26 ? -6.879  2.244   -8.764  1.00 8.41  ? 26 ARG A HH11 1  
ATOM   410   H HH12 . ARG A 1 26 ? -8.292  2.298   -9.763  1.00 9.21  ? 26 ARG A HH12 1  
ATOM   411   H HH21 . ARG A 1 26 ? -6.514  2.181   -12.747 1.00 8.08  ? 26 ARG A HH21 1  
ATOM   412   H HH22 . ARG A 1 26 ? -8.086  2.264   -12.024 1.00 9.02  ? 26 ARG A HH22 1  
ATOM   413   N N    . VAL A 1 27 ? -0.149  2.788   -7.564  1.00 4.69  ? 27 VAL A N    1  
ATOM   414   C CA   . VAL A 1 27 ? -0.172  3.716   -6.395  1.00 4.83  ? 27 VAL A CA   1  
ATOM   415   C C    . VAL A 1 27 ? -0.831  5.043   -6.797  1.00 4.79  ? 27 VAL A C    1  
ATOM   416   O O    . VAL A 1 27 ? -0.726  5.479   -7.930  1.00 5.45  ? 27 VAL A O    1  
ATOM   417   C CB   . VAL A 1 27 ? 1.265   3.976   -5.920  1.00 5.66  ? 27 VAL A CB   1  
ATOM   418   C CG1  . VAL A 1 27 ? 1.852   2.692   -5.329  1.00 6.10  ? 27 VAL A CG1  1  
ATOM   419   C CG2  . VAL A 1 27 ? 2.143   4.433   -7.093  1.00 6.04  ? 27 VAL A CG2  1  
ATOM   420   H H    . VAL A 1 27 ? 0.609   2.812   -8.181  1.00 4.82  ? 27 VAL A H    1  
ATOM   421   H HA   . VAL A 1 27 ? -0.737  3.266   -5.593  1.00 4.74  ? 27 VAL A HA   1  
ATOM   422   H HB   . VAL A 1 27 ? 1.252   4.739   -5.165  1.00 5.89  ? 27 VAL A HB   1  
ATOM   423   H HG11 . VAL A 1 27 ? 1.114   2.216   -4.703  1.00 6.30  ? 27 VAL A HG11 1  
ATOM   424   H HG12 . VAL A 1 27 ? 2.131   2.022   -6.130  1.00 6.06  ? 27 VAL A HG12 1  
ATOM   425   H HG13 . VAL A 1 27 ? 2.724   2.933   -4.741  1.00 6.54  ? 27 VAL A HG13 1  
ATOM   426   H HG21 . VAL A 1 27 ? 1.578   5.096   -7.731  1.00 6.44  ? 27 VAL A HG21 1  
ATOM   427   H HG22 . VAL A 1 27 ? 3.009   4.953   -6.712  1.00 6.18  ? 27 VAL A HG22 1  
ATOM   428   H HG23 . VAL A 1 27 ? 2.462   3.571   -7.662  1.00 6.05  ? 27 VAL A HG23 1  
ATOM   429   N N    . ILE A 1 28 ? -1.505  5.692   -5.875  1.00 4.28  ? 28 ILE A N    1  
ATOM   430   C CA   . ILE A 1 28 ? -2.168  6.994   -6.198  1.00 4.40  ? 28 ILE A CA   1  
ATOM   431   C C    . ILE A 1 28 ? -1.222  8.144   -5.840  1.00 4.70  ? 28 ILE A C    1  
ATOM   432   O O    . ILE A 1 28 ? -0.610  8.148   -4.789  1.00 5.01  ? 28 ILE A O    1  
ATOM   433   C CB   . ILE A 1 28 ? -3.470  7.132   -5.392  1.00 4.45  ? 28 ILE A CB   1  
ATOM   434   C CG1  . ILE A 1 28 ? -4.371  5.912   -5.640  1.00 4.94  ? 28 ILE A CG1  1  
ATOM   435   C CG2  . ILE A 1 28 ? -4.210  8.403   -5.818  1.00 4.49  ? 28 ILE A CG2  1  
ATOM   436   C CD1  . ILE A 1 28 ? -4.578  5.707   -7.145  1.00 5.05  ? 28 ILE A CD1  1  
ATOM   437   H H    . ILE A 1 28 ? -1.574  5.323   -4.966  1.00 4.02  ? 28 ILE A H    1  
ATOM   438   H HA   . ILE A 1 28 ? -2.394  7.031   -7.254  1.00 4.67  ? 28 ILE A HA   1  
ATOM   439   H HB   . ILE A 1 28 ? -3.232  7.193   -4.339  1.00 4.56  ? 28 ILE A HB   1  
ATOM   440   H HG12 . ILE A 1 28 ? -3.906  5.032   -5.220  1.00 5.21  ? 28 ILE A HG12 1  
ATOM   441   H HG13 . ILE A 1 28 ? -5.328  6.073   -5.167  1.00 5.36  ? 28 ILE A HG13 1  
ATOM   442   H HG21 . ILE A 1 28 ? -4.201  8.484   -6.895  1.00 4.51  ? 28 ILE A HG21 1  
ATOM   443   H HG22 . ILE A 1 28 ? -5.232  8.359   -5.470  1.00 4.77  ? 28 ILE A HG22 1  
ATOM   444   H HG23 . ILE A 1 28 ? -3.722  9.267   -5.389  1.00 4.49  ? 28 ILE A HG23 1  
ATOM   445   H HD11 . ILE A 1 28 ? -4.725  6.665   -7.623  1.00 5.49  ? 28 ILE A HD11 1  
ATOM   446   H HD12 . ILE A 1 28 ? -3.708  5.224   -7.566  1.00 4.88  ? 28 ILE A HD12 1  
ATOM   447   H HD13 . ILE A 1 28 ? -5.448  5.088   -7.306  1.00 5.25  ? 28 ILE A HD13 1  
ATOM   448   N N    . GLU A 1 29 ? -1.097  9.116   -6.710  1.00 5.08  ? 29 GLU A N    1  
ATOM   449   C CA   . GLU A 1 29 ? -0.189  10.269  -6.434  1.00 5.75  ? 29 GLU A CA   1  
ATOM   450   C C    . GLU A 1 29 ? -0.774  11.162  -5.333  1.00 5.30  ? 29 GLU A C    1  
ATOM   451   O O    . GLU A 1 29 ? -1.904  10.997  -4.912  1.00 4.95  ? 29 GLU A O    1  
ATOM   452   C CB   . GLU A 1 29 ? 0.005   11.099  -7.708  1.00 6.63  ? 29 GLU A CB   1  
ATOM   453   C CG   . GLU A 1 29 ? -1.354  11.445  -8.337  1.00 7.40  ? 29 GLU A CG   1  
ATOM   454   C CD   . GLU A 1 29 ? -1.432  12.952  -8.592  1.00 8.35  ? 29 GLU A CD   1  
ATOM   455   O OE1  . GLU A 1 29 ? -1.595  13.686  -7.633  1.00 9.09  ? 29 GLU A OE1  1  
ATOM   456   O OE2  . GLU A 1 29 ? -1.326  13.346  -9.742  1.00 8.53  ? 29 GLU A OE2  1  
ATOM   457   H H    . GLU A 1 29 ? -1.598  9.087   -7.551  1.00 5.18  ? 29 GLU A H    1  
ATOM   458   H HA   . GLU A 1 29 ? 0.770   9.893   -6.111  1.00 6.26  ? 29 GLU A HA   1  
ATOM   459   H HB2  . GLU A 1 29 ? 0.522   12.008  -7.460  1.00 6.65  ? 29 GLU A HB2  1  
ATOM   460   H HB3  . GLU A 1 29 ? 0.592   10.537  -8.413  1.00 7.00  ? 29 GLU A HB3  1  
ATOM   461   H HG2  . GLU A 1 29 ? -1.463  10.915  -9.272  1.00 7.70  ? 29 GLU A HG2  1  
ATOM   462   H HG3  . GLU A 1 29 ? -2.148  11.154  -7.665  1.00 7.27  ? 29 GLU A HG3  1  
ATOM   463   N N    . SER A 1 30 ? 0.002   12.109  -4.869  1.00 5.67  ? 30 SER A N    1  
ATOM   464   C CA   . SER A 1 30 ? -0.475  13.030  -3.794  1.00 5.68  ? 30 SER A CA   1  
ATOM   465   C C    . SER A 1 30 ? -0.683  14.440  -4.362  1.00 6.20  ? 30 SER A C    1  
ATOM   466   O O    . SER A 1 30 ? -0.136  14.798  -5.388  1.00 6.77  ? 30 SER A O    1  
ATOM   467   C CB   . SER A 1 30 ? 0.557   13.084  -2.663  1.00 6.35  ? 30 SER A CB   1  
ATOM   468   O OG   . SER A 1 30 ? 1.862   12.858  -3.188  1.00 7.18  ? 30 SER A OG   1  
ATOM   469   H H    . SER A 1 30 ? 0.908   12.214  -5.232  1.00 6.18  ? 30 SER A H    1  
ATOM   470   H HA   . SER A 1 30 ? -1.413  12.664  -3.401  1.00 5.24  ? 30 SER A HA   1  
ATOM   471   H HB2  . SER A 1 30 ? 0.531   14.053  -2.202  1.00 6.58  ? 30 SER A HB2  1  
ATOM   472   H HB3  . SER A 1 30 ? 0.318   12.331  -1.925  1.00 6.28  ? 30 SER A HB3  1  
ATOM   473   H HG   . SER A 1 30 ? 2.093   11.939  -3.027  1.00 7.41  ? 30 SER A HG   1  
ATOM   474   N N    . GLY A 1 31 ? -1.476  15.238  -3.690  1.00 6.36  ? 31 GLY A N    1  
ATOM   475   C CA   . GLY A 1 31 ? -1.744  16.632  -4.166  1.00 7.19  ? 31 GLY A CA   1  
ATOM   476   C C    . GLY A 1 31 ? -2.714  17.319  -3.192  1.00 7.66  ? 31 GLY A C    1  
ATOM   477   O O    . GLY A 1 31 ? -2.738  16.992  -2.020  1.00 7.75  ? 31 GLY A O    1  
ATOM   478   H H    . GLY A 1 31 ? -1.901  14.916  -2.865  1.00 6.14  ? 31 GLY A H    1  
ATOM   479   H HA2  . GLY A 1 31 ? -0.819  17.180  -4.212  1.00 7.72  ? 31 GLY A HA2  1  
ATOM   480   H HA3  . GLY A 1 31 ? -2.190  16.596  -5.147  1.00 7.17  ? 31 GLY A HA3  1  
ATOM   481   N N    . PRO A 1 32 ? -3.510  18.233  -3.708  1.00 8.17  ? 32 PRO A N    1  
ATOM   482   C CA   . PRO A 1 32 ? -4.519  18.950  -2.898  1.00 8.85  ? 32 PRO A CA   1  
ATOM   483   C C    . PRO A 1 32 ? -5.684  17.998  -2.591  1.00 8.11  ? 32 PRO A C    1  
ATOM   484   O O    . PRO A 1 32 ? -6.241  18.005  -1.509  1.00 8.52  ? 32 PRO A O    1  
ATOM   485   C CB   . PRO A 1 32 ? -4.950  20.112  -3.799  1.00 9.69  ? 32 PRO A CB   1  
ATOM   486   C CG   . PRO A 1 32 ? -4.598  19.694  -5.246  1.00 9.20  ? 32 PRO A CG   1  
ATOM   487   C CD   . PRO A 1 32 ? -3.488  18.630  -5.135  1.00 8.39  ? 32 PRO A CD   1  
ATOM   488   H HA   . PRO A 1 32 ? -4.081  19.325  -1.988  1.00 9.45  ? 32 PRO A HA   1  
ATOM   489   H HB2  . PRO A 1 32 ? -6.015  20.278  -3.705  1.00 9.88  ? 32 PRO A HB2  1  
ATOM   490   H HB3  . PRO A 1 32 ? -4.408  21.007  -3.536  1.00 10.56 ? 32 PRO A HB3  1  
ATOM   491   H HG2  . PRO A 1 32 ? -5.470  19.278  -5.732  1.00 8.80  ? 32 PRO A HG2  1  
ATOM   492   H HG3  . PRO A 1 32 ? -4.232  20.545  -5.799  1.00 10.01 ? 32 PRO A HG3  1  
ATOM   493   H HD2  . PRO A 1 32 ? -3.712  17.785  -5.771  1.00 7.63  ? 32 PRO A HD2  1  
ATOM   494   H HD3  . PRO A 1 32 ? -2.529  19.054  -5.388  1.00 8.96  ? 32 PRO A HD3  1  
ATOM   495   N N    . HIS A 1 33 ? -6.016  17.158  -3.541  1.00 7.21  ? 33 HIS A N    1  
ATOM   496   C CA   . HIS A 1 33 ? -7.106  16.148  -3.357  1.00 6.64  ? 33 HIS A CA   1  
ATOM   497   C C    . HIS A 1 33 ? -6.770  15.244  -2.157  1.00 5.94  ? 33 HIS A C    1  
ATOM   498   O O    . HIS A 1 33 ? -7.642  14.835  -1.413  1.00 6.05  ? 33 HIS A O    1  
ATOM   499   C CB   . HIS A 1 33 ? -7.217  15.290  -4.634  1.00 6.27  ? 33 HIS A CB   1  
ATOM   500   C CG   . HIS A 1 33 ? -5.888  14.627  -4.922  1.00 5.79  ? 33 HIS A CG   1  
ATOM   501   N ND1  . HIS A 1 33 ? -4.848  15.299  -5.547  1.00 6.54  ? 33 HIS A ND1  1  
ATOM   502   C CD2  . HIS A 1 33 ? -5.399  13.379  -4.625  1.00 4.91  ? 33 HIS A CD2  1  
ATOM   503   C CE1  . HIS A 1 33 ? -3.795  14.468  -5.593  1.00 6.20  ? 33 HIS A CE1  1  
ATOM   504   N NE2  . HIS A 1 33 ? -4.076  13.281  -5.047  1.00 5.23  ? 33 HIS A NE2  1  
ATOM   505   H H    . HIS A 1 33 ? -5.526  17.179  -4.382  1.00 7.10  ? 33 HIS A H    1  
ATOM   506   H HA   . HIS A 1 33 ? -8.041  16.653  -3.176  1.00 7.25  ? 33 HIS A HA   1  
ATOM   507   H HB2  . HIS A 1 33 ? -7.971  14.534  -4.495  1.00 5.99  ? 33 HIS A HB2  1  
ATOM   508   H HB3  . HIS A 1 33 ? -7.492  15.919  -5.467  1.00 6.92  ? 33 HIS A HB3  1  
ATOM   509   H HD1  . HIS A 1 33 ? -4.879  16.208  -5.909  1.00 7.35  ? 33 HIS A HD1  1  
ATOM   510   H HD2  . HIS A 1 33 ? -5.956  12.593  -4.136  1.00 4.33  ? 33 HIS A HD2  1  
ATOM   511   H HE1  . HIS A 1 33 ? -2.825  14.743  -5.985  1.00 6.82  ? 33 HIS A HE1  1  
ATOM   512   N N    . CYS A 1 34 ? -5.504  14.943  -1.967  1.00 5.51  ? 34 CYS A N    1  
ATOM   513   C CA   . CYS A 1 34 ? -5.079  14.084  -0.833  1.00 5.12  ? 34 CYS A CA   1  
ATOM   514   C C    . CYS A 1 34 ? -3.604  14.360  -0.527  1.00 5.54  ? 34 CYS A C    1  
ATOM   515   O O    . CYS A 1 34 ? -2.734  14.095  -1.337  1.00 5.84  ? 34 CYS A O    1  
ATOM   516   C CB   . CYS A 1 34 ? -5.263  12.606  -1.194  1.00 4.12  ? 34 CYS A CB   1  
ATOM   517   S SG   . CYS A 1 34 ? -5.417  11.635  0.325   1.00 4.37  ? 34 CYS A SG   1  
ATOM   518   H H    . CYS A 1 34 ? -4.831  15.293  -2.573  1.00 5.68  ? 34 CYS A H    1  
ATOM   519   H HA   . CYS A 1 34 ? -5.674  14.325  0.027   1.00 5.59  ? 34 CYS A HA   1  
ATOM   520   H HB2  . CYS A 1 34 ? -6.154  12.487  -1.790  1.00 4.04  ? 34 CYS A HB2  1  
ATOM   521   H HB3  . CYS A 1 34 ? -4.406  12.263  -1.755  1.00 3.82  ? 34 CYS A HB3  1  
ATOM   522   N N    . ALA A 1 35 ? -3.319  14.897  0.633   1.00 5.90  ? 35 ALA A N    1  
ATOM   523   C CA   . ALA A 1 35 ? -1.902  15.205  1.000   1.00 6.66  ? 35 ALA A CA   1  
ATOM   524   C C    . ALA A 1 35 ? -1.107  13.905  1.175   1.00 6.33  ? 35 ALA A C    1  
ATOM   525   O O    . ALA A 1 35 ? 0.023   13.800  0.736   1.00 6.77  ? 35 ALA A O    1  
ATOM   526   C CB   . ALA A 1 35 ? -1.875  15.998  2.309   1.00 7.59  ? 35 ALA A CB   1  
ATOM   527   H H    . ALA A 1 35 ? -4.041  15.105  1.264   1.00 5.87  ? 35 ALA A H    1  
ATOM   528   H HA   . ALA A 1 35 ? -1.452  15.792  0.218   1.00 7.06  ? 35 ALA A HA   1  
ATOM   529   H HB1  . ALA A 1 35 ? -2.432  15.464  3.065   1.00 7.89  ? 35 ALA A HB1  1  
ATOM   530   H HB2  . ALA A 1 35 ? -0.852  16.122  2.635   1.00 7.72  ? 35 ALA A HB2  1  
ATOM   531   H HB3  . ALA A 1 35 ? -2.322  16.968  2.151   1.00 8.05  ? 35 ALA A HB3  1  
ATOM   532   N N    . ASN A 1 36 ? -1.684  12.922  1.820   1.00 5.85  ? 36 ASN A N    1  
ATOM   533   C CA   . ASN A 1 36 ? -0.965  11.631  2.037   1.00 5.88  ? 36 ASN A CA   1  
ATOM   534   C C    . ASN A 1 36 ? -1.060  10.752  0.784   1.00 5.34  ? 36 ASN A C    1  
ATOM   535   O O    . ASN A 1 36 ? -2.098  10.661  0.153   1.00 5.26  ? 36 ASN A O    1  
ATOM   536   C CB   . ASN A 1 36 ? -1.593  10.893  3.224   1.00 6.50  ? 36 ASN A CB   1  
ATOM   537   C CG   . ASN A 1 36 ? -0.925  11.351  4.524   1.00 7.27  ? 36 ASN A CG   1  
ATOM   538   O OD1  . ASN A 1 36 ? 0.015   10.736  4.987   1.00 7.78  ? 36 ASN A OD1  1  
ATOM   539   N ND2  . ASN A 1 36 ? -1.373  12.414  5.136   1.00 7.61  ? 36 ASN A ND2  1  
ATOM   540   H H    . ASN A 1 36 ? -2.592  13.036  2.168   1.00 5.70  ? 36 ASN A H    1  
ATOM   541   H HA   . ASN A 1 36 ? 0.074   11.833  2.253   1.00 6.19  ? 36 ASN A HA   1  
ATOM   542   H HB2  . ASN A 1 36 ? -2.650  11.111  3.264   1.00 6.55  ? 36 ASN A HB2  1  
ATOM   543   H HB3  . ASN A 1 36 ? -1.449  9.831   3.104   1.00 6.63  ? 36 ASN A HB3  1  
ATOM   544   H HD21 . ASN A 1 36 ? -2.132  12.913  4.765   1.00 7.41  ? 36 ASN A HD21 1  
ATOM   545   H HD22 . ASN A 1 36 ? -0.953  12.713  5.970   1.00 8.19  ? 36 ASN A HD22 1  
ATOM   546   N N    . THR A 1 37 ? 0.021   10.098  0.429   1.00 5.30  ? 37 THR A N    1  
ATOM   547   C CA   . THR A 1 37 ? 0.018   9.207   -0.773  1.00 5.18  ? 37 THR A CA   1  
ATOM   548   C C    . THR A 1 37 ? -0.520  7.827   -0.363  1.00 4.58  ? 37 THR A C    1  
ATOM   549   O O    . THR A 1 37 ? -0.334  7.395   0.761   1.00 4.95  ? 37 THR A O    1  
ATOM   550   C CB   . THR A 1 37 ? 1.452   9.074   -1.310  1.00 5.98  ? 37 THR A CB   1  
ATOM   551   O OG1  . THR A 1 37 ? 2.077   10.352  -1.318  1.00 6.76  ? 37 THR A OG1  1  
ATOM   552   C CG2  . THR A 1 37 ? 1.423   8.518   -2.735  1.00 6.31  ? 37 THR A CG2  1  
ATOM   553   H H    . THR A 1 37 ? 0.838   10.188  0.964   1.00 5.59  ? 37 THR A H    1  
ATOM   554   H HA   . THR A 1 37 ? -0.619  9.631   -1.535  1.00 5.45  ? 37 THR A HA   1  
ATOM   555   H HB   . THR A 1 37 ? 2.012   8.402   -0.678  1.00 6.11  ? 37 THR A HB   1  
ATOM   556   H HG1  . THR A 1 37 ? 2.864   10.301  -0.771  1.00 7.02  ? 37 THR A HG1  1  
ATOM   557   H HG21 . THR A 1 37 ? 0.877   7.587   -2.749  1.00 6.33  ? 37 THR A HG21 1  
ATOM   558   H HG22 . THR A 1 37 ? 0.941   9.230   -3.388  1.00 6.74  ? 37 THR A HG22 1  
ATOM   559   H HG23 . THR A 1 37 ? 2.434   8.347   -3.075  1.00 6.44  ? 37 THR A HG23 1  
ATOM   560   N N    . GLU A 1 38 ? -1.194  7.134   -1.255  1.00 3.94  ? 38 GLU A N    1  
ATOM   561   C CA   . GLU A 1 38 ? -1.750  5.792   -0.895  1.00 3.67  ? 38 GLU A CA   1  
ATOM   562   C C    . GLU A 1 38 ? -1.486  4.791   -2.024  1.00 2.99  ? 38 GLU A C    1  
ATOM   563   O O    . GLU A 1 38 ? -1.567  5.125   -3.191  1.00 3.33  ? 38 GLU A O    1  
ATOM   564   C CB   . GLU A 1 38 ? -3.261  5.917   -0.669  1.00 4.35  ? 38 GLU A CB   1  
ATOM   565   C CG   . GLU A 1 38 ? -3.703  4.936   0.423   1.00 4.96  ? 38 GLU A CG   1  
ATOM   566   C CD   . GLU A 1 38 ? -3.530  5.584   1.801   1.00 5.76  ? 38 GLU A CD   1  
ATOM   567   O OE1  . GLU A 1 38 ? -2.400  5.675   2.256   1.00 6.28  ? 38 GLU A OE1  1  
ATOM   568   O OE2  . GLU A 1 38 ? -4.531  5.975   2.380   1.00 6.10  ? 38 GLU A OE2  1  
ATOM   569   H H    . GLU A 1 38 ? -1.343  7.499   -2.156  1.00 3.89  ? 38 GLU A H    1  
ATOM   570   H HA   . GLU A 1 38 ? -1.279  5.440   0.011   1.00 3.96  ? 38 GLU A HA   1  
ATOM   571   H HB2  . GLU A 1 38 ? -3.496  6.927   -0.362  1.00 4.73  ? 38 GLU A HB2  1  
ATOM   572   H HB3  . GLU A 1 38 ? -3.783  5.690   -1.586  1.00 4.35  ? 38 GLU A HB3  1  
ATOM   573   H HG2  . GLU A 1 38 ? -4.742  4.678   0.274   1.00 5.14  ? 38 GLU A HG2  1  
ATOM   574   H HG3  . GLU A 1 38 ? -3.100  4.042   0.369   1.00 4.98  ? 38 GLU A HG3  1  
ATOM   575   N N    . ILE A 1 39 ? -1.182  3.561   -1.681  1.00 2.48  ? 39 ILE A N    1  
ATOM   576   C CA   . ILE A 1 39 ? -0.926  2.525   -2.728  1.00 2.38  ? 39 ILE A CA   1  
ATOM   577   C C    . ILE A 1 39 ? -2.226  1.743   -2.978  1.00 2.16  ? 39 ILE A C    1  
ATOM   578   O O    . ILE A 1 39 ? -3.110  1.726   -2.141  1.00 2.22  ? 39 ILE A O    1  
ATOM   579   C CB   . ILE A 1 39 ? 0.185   1.580   -2.229  1.00 2.57  ? 39 ILE A CB   1  
ATOM   580   C CG1  . ILE A 1 39 ? 1.524   2.333   -2.209  1.00 2.79  ? 39 ILE A CG1  1  
ATOM   581   C CG2  . ILE A 1 39 ? 0.307   0.363   -3.156  1.00 3.44  ? 39 ILE A CG2  1  
ATOM   582   C CD1  . ILE A 1 39 ? 2.130   2.286   -0.805  1.00 2.94  ? 39 ILE A CD1  1  
ATOM   583   H H    . ILE A 1 39 ? -1.133  3.313   -0.726  1.00 2.61  ? 39 ILE A H    1  
ATOM   584   H HA   . ILE A 1 39 ? -0.611  3.005   -3.643  1.00 2.85  ? 39 ILE A HA   1  
ATOM   585   H HB   . ILE A 1 39 ? -0.055  1.246   -1.231  1.00 2.54  ? 39 ILE A HB   1  
ATOM   586   H HG12 . ILE A 1 39 ? 2.206   1.872   -2.909  1.00 3.36  ? 39 ILE A HG12 1  
ATOM   587   H HG13 . ILE A 1 39 ? 1.361   3.362   -2.493  1.00 2.70  ? 39 ILE A HG13 1  
ATOM   588   H HG21 . ILE A 1 39 ? 0.393   0.695   -4.179  1.00 4.05  ? 39 ILE A HG21 1  
ATOM   589   H HG22 . ILE A 1 39 ? 1.184   -0.207  -2.887  1.00 3.75  ? 39 ILE A HG22 1  
ATOM   590   H HG23 . ILE A 1 39 ? -0.570  -0.257  -3.052  1.00 3.64  ? 39 ILE A HG23 1  
ATOM   591   H HD11 . ILE A 1 39 ? 1.509   1.682   -0.161  1.00 3.00  ? 39 ILE A HD11 1  
ATOM   592   H HD12 . ILE A 1 39 ? 3.120   1.857   -0.855  1.00 3.60  ? 39 ILE A HD12 1  
ATOM   593   H HD13 . ILE A 1 39 ? 2.194   3.288   -0.406  1.00 2.88  ? 39 ILE A HD13 1  
ATOM   594   N N    . ILE A 1 40 ? -2.358  1.102   -4.119  1.00 2.34  ? 40 ILE A N    1  
ATOM   595   C CA   . ILE A 1 40 ? -3.606  0.319   -4.402  1.00 2.36  ? 40 ILE A CA   1  
ATOM   596   C C    . ILE A 1 40 ? -3.281  -0.875  -5.302  1.00 2.37  ? 40 ILE A C    1  
ATOM   597   O O    . ILE A 1 40 ? -3.184  -0.752  -6.510  1.00 3.02  ? 40 ILE A O    1  
ATOM   598   C CB   . ILE A 1 40 ? -4.658  1.196   -5.094  1.00 3.14  ? 40 ILE A CB   1  
ATOM   599   C CG1  . ILE A 1 40 ? -5.025  2.373   -4.187  1.00 3.44  ? 40 ILE A CG1  1  
ATOM   600   C CG2  . ILE A 1 40 ? -5.908  0.351   -5.370  1.00 3.70  ? 40 ILE A CG2  1  
ATOM   601   C CD1  . ILE A 1 40 ? -5.970  3.324   -4.925  1.00 4.01  ? 40 ILE A CD1  1  
ATOM   602   H H    . ILE A 1 40 ? -1.638  1.129   -4.783  1.00 2.72  ? 40 ILE A H    1  
ATOM   603   H HA   . ILE A 1 40 ? -4.011  -0.046  -3.468  1.00 2.37  ? 40 ILE A HA   1  
ATOM   604   H HB   . ILE A 1 40 ? -4.260  1.566   -6.029  1.00 3.47  ? 40 ILE A HB   1  
ATOM   605   H HG12 . ILE A 1 40 ? -5.510  2.004   -3.296  1.00 3.44  ? 40 ILE A HG12 1  
ATOM   606   H HG13 . ILE A 1 40 ? -4.126  2.903   -3.913  1.00 3.71  ? 40 ILE A HG13 1  
ATOM   607   H HG21 . ILE A 1 40 ? -6.240  -0.109  -4.450  1.00 3.89  ? 40 ILE A HG21 1  
ATOM   608   H HG22 . ILE A 1 40 ? -6.692  0.980   -5.762  1.00 3.94  ? 40 ILE A HG22 1  
ATOM   609   H HG23 . ILE A 1 40 ? -5.671  -0.420  -6.089  1.00 4.13  ? 40 ILE A HG23 1  
ATOM   610   H HD11 . ILE A 1 40 ? -5.593  3.508   -5.919  1.00 4.43  ? 40 ILE A HD11 1  
ATOM   611   H HD12 . ILE A 1 40 ? -6.952  2.877   -4.990  1.00 4.17  ? 40 ILE A HD12 1  
ATOM   612   H HD13 . ILE A 1 40 ? -6.035  4.257   -4.386  1.00 4.33  ? 40 ILE A HD13 1  
ATOM   613   N N    . VAL A 1 41 ? -3.130  -2.032  -4.718  1.00 2.04  ? 41 VAL A N    1  
ATOM   614   C CA   . VAL A 1 41 ? -2.830  -3.250  -5.512  1.00 2.10  ? 41 VAL A CA   1  
ATOM   615   C C    . VAL A 1 41 ? -4.134  -4.002  -5.807  1.00 2.33  ? 41 VAL A C    1  
ATOM   616   O O    . VAL A 1 41 ? -5.159  -3.755  -5.198  1.00 2.79  ? 41 VAL A O    1  
ATOM   617   C CB   . VAL A 1 41 ? -1.885  -4.160  -4.717  1.00 2.21  ? 41 VAL A CB   1  
ATOM   618   C CG1  . VAL A 1 41 ? -0.575  -3.421  -4.431  1.00 2.87  ? 41 VAL A CG1  1  
ATOM   619   C CG2  . VAL A 1 41 ? -2.541  -4.576  -3.394  1.00 3.20  ? 41 VAL A CG2  1  
ATOM   620   H H    . VAL A 1 41 ? -3.219  -2.102  -3.752  1.00 2.11  ? 41 VAL A H    1  
ATOM   621   H HA   . VAL A 1 41 ? -2.361  -2.967  -6.442  1.00 2.57  ? 41 VAL A HA   1  
ATOM   622   H HB   . VAL A 1 41 ? -1.674  -5.037  -5.296  1.00 2.10  ? 41 VAL A HB   1  
ATOM   623   H HG11 . VAL A 1 41 ? -0.792  -2.432  -4.056  1.00 3.29  ? 41 VAL A HG11 1  
ATOM   624   H HG12 . VAL A 1 41 ? -0.006  -3.969  -3.693  1.00 3.43  ? 41 VAL A HG12 1  
ATOM   625   H HG13 . VAL A 1 41 ? 0.000   -3.343  -5.342  1.00 3.03  ? 41 VAL A HG13 1  
ATOM   626   H HG21 . VAL A 1 41 ? -3.478  -5.073  -3.598  1.00 3.56  ? 41 VAL A HG21 1  
ATOM   627   H HG22 . VAL A 1 41 ? -1.886  -5.249  -2.863  1.00 3.58  ? 41 VAL A HG22 1  
ATOM   628   H HG23 . VAL A 1 41 ? -2.722  -3.702  -2.791  1.00 3.72  ? 41 VAL A HG23 1  
ATOM   629   N N    . LYS A 1 42 ? -4.094  -4.924  -6.732  1.00 2.44  ? 42 LYS A N    1  
ATOM   630   C CA   . LYS A 1 42 ? -5.310  -5.712  -7.073  1.00 2.97  ? 42 LYS A CA   1  
ATOM   631   C C    . LYS A 1 42 ? -4.938  -7.200  -7.099  1.00 2.77  ? 42 LYS A C    1  
ATOM   632   O O    . LYS A 1 42 ? -4.429  -7.704  -8.083  1.00 2.98  ? 42 LYS A O    1  
ATOM   633   C CB   . LYS A 1 42 ? -5.838  -5.280  -8.445  1.00 3.77  ? 42 LYS A CB   1  
ATOM   634   C CG   . LYS A 1 42 ? -7.109  -4.444  -8.267  1.00 4.68  ? 42 LYS A CG   1  
ATOM   635   C CD   . LYS A 1 42 ? -7.895  -4.416  -9.580  1.00 5.42  ? 42 LYS A CD   1  
ATOM   636   C CE   . LYS A 1 42 ? -7.524  -3.161  -10.379 1.00 5.72  ? 42 LYS A CE   1  
ATOM   637   N NZ   . LYS A 1 42 ? -8.721  -2.279  -10.511 1.00 6.76  ? 42 LYS A NZ   1  
ATOM   638   H H    . LYS A 1 42 ? -3.257  -5.104  -7.200  1.00 2.45  ? 42 LYS A H    1  
ATOM   639   H HA   . LYS A 1 42 ? -6.069  -5.544  -6.321  1.00 3.37  ? 42 LYS A HA   1  
ATOM   640   H HB2  . LYS A 1 42 ? -5.086  -4.691  -8.951  1.00 3.94  ? 42 LYS A HB2  1  
ATOM   641   H HB3  . LYS A 1 42 ? -6.065  -6.154  -9.035  1.00 3.87  ? 42 LYS A HB3  1  
ATOM   642   H HG2  . LYS A 1 42 ? -7.720  -4.880  -7.489  1.00 4.83  ? 42 LYS A HG2  1  
ATOM   643   H HG3  . LYS A 1 42 ? -6.840  -3.435  -7.988  1.00 4.94  ? 42 LYS A HG3  1  
ATOM   644   H HD2  . LYS A 1 42 ? -7.657  -5.295  -10.160 1.00 5.79  ? 42 LYS A HD2  1  
ATOM   645   H HD3  . LYS A 1 42 ? -8.953  -4.404  -9.365  1.00 5.70  ? 42 LYS A HD3  1  
ATOM   646   H HE2  . LYS A 1 42 ? -6.738  -2.627  -9.867  1.00 5.66  ? 42 LYS A HE2  1  
ATOM   647   H HE3  . LYS A 1 42 ? -7.181  -3.450  -11.361 1.00 5.59  ? 42 LYS A HE3  1  
ATOM   648   H HZ1  . LYS A 1 42 ? -9.095  -2.058  -9.567  1.00 7.24  ? 42 LYS A HZ1  1  
ATOM   649   H HZ2  . LYS A 1 42 ? -8.447  -1.397  -10.991 1.00 6.85  ? 42 LYS A HZ2  1  
ATOM   650   H HZ3  . LYS A 1 42 ? -9.452  -2.765  -11.068 1.00 7.12  ? 42 LYS A HZ3  1  
ATOM   651   N N    . LEU A 1 43 ? -5.173  -7.895  -6.009  1.00 3.01  ? 43 LEU A N    1  
ATOM   652   C CA   . LEU A 1 43 ? -4.829  -9.348  -5.925  1.00 3.31  ? 43 LEU A CA   1  
ATOM   653   C C    . LEU A 1 43 ? -5.436  -10.126 -7.097  1.00 3.92  ? 43 LEU A C    1  
ATOM   654   O O    . LEU A 1 43 ? -6.509  -9.811  -7.583  1.00 4.54  ? 43 LEU A O    1  
ATOM   655   C CB   . LEU A 1 43 ? -5.375  -9.915  -4.617  1.00 4.01  ? 43 LEU A CB   1  
ATOM   656   C CG   . LEU A 1 43 ? -4.443  -9.533  -3.459  1.00 3.77  ? 43 LEU A CG   1  
ATOM   657   C CD1  . LEU A 1 43 ? -5.063  -9.972  -2.130  1.00 4.46  ? 43 LEU A CD1  1  
ATOM   658   C CD2  . LEU A 1 43 ? -3.084  -10.221 -3.636  1.00 3.91  ? 43 LEU A CD2  1  
ATOM   659   H H    . LEU A 1 43 ? -5.566  -7.453  -5.229  1.00 3.37  ? 43 LEU A H    1  
ATOM   660   H HA   . LEU A 1 43 ? -3.756  -9.460  -5.941  1.00 3.08  ? 43 LEU A HA   1  
ATOM   661   H HB2  . LEU A 1 43 ? -6.357  -9.512  -4.442  1.00 4.55  ? 43 LEU A HB2  1  
ATOM   662   H HB3  . LEU A 1 43 ? -5.440  -10.984 -4.691  1.00 4.52  ? 43 LEU A HB3  1  
ATOM   663   H HG   . LEU A 1 43 ? -4.306  -8.461  -3.450  1.00 3.53  ? 43 LEU A HG   1  
ATOM   664   H HD11 . LEU A 1 43 ? -6.044  -9.533  -2.027  1.00 4.51  ? 43 LEU A HD11 1  
ATOM   665   H HD12 . LEU A 1 43 ? -5.147  -11.049 -2.110  1.00 5.14  ? 43 LEU A HD12 1  
ATOM   666   H HD13 . LEU A 1 43 ? -4.435  -9.645  -1.315  1.00 4.57  ? 43 LEU A HD13 1  
ATOM   667   H HD21 . LEU A 1 43 ? -3.234  -11.238 -3.966  1.00 3.95  ? 43 LEU A HD21 1  
ATOM   668   H HD22 . LEU A 1 43 ? -2.502  -9.685  -4.372  1.00 3.96  ? 43 LEU A HD22 1  
ATOM   669   H HD23 . LEU A 1 43 ? -2.557  -10.223 -2.694  1.00 4.44  ? 43 LEU A HD23 1  
ATOM   670   N N    . SER A 1 44 ? -4.738  -11.148 -7.537  1.00 3.99  ? 44 SER A N    1  
ATOM   671   C CA   . SER A 1 44 ? -5.213  -11.994 -8.675  1.00 4.72  ? 44 SER A CA   1  
ATOM   672   C C    . SER A 1 44 ? -6.588  -12.612 -8.369  1.00 5.55  ? 44 SER A C    1  
ATOM   673   O O    . SER A 1 44 ? -7.321  -12.967 -9.274  1.00 6.08  ? 44 SER A O    1  
ATOM   674   C CB   . SER A 1 44 ? -4.203  -13.117 -8.929  1.00 4.98  ? 44 SER A CB   1  
ATOM   675   O OG   . SER A 1 44 ? -4.366  -13.608 -10.254 1.00 5.08  ? 44 SER A OG   1  
ATOM   676   H H    . SER A 1 44 ? -3.887  -11.361 -7.110  1.00 3.70  ? 44 SER A H    1  
ATOM   677   H HA   . SER A 1 44 ? -5.285  -11.380 -9.556  1.00 4.83  ? 44 SER A HA   1  
ATOM   678   H HB2  . SER A 1 44 ? -3.202  -12.736 -8.814  1.00 5.14  ? 44 SER A HB2  1  
ATOM   679   H HB3  . SER A 1 44 ? -4.366  -13.914 -8.215  1.00 5.37  ? 44 SER A HB3  1  
ATOM   680   H HG   . SER A 1 44 ? -4.885  -14.415 -10.210 1.00 5.39  ? 44 SER A HG   1  
ATOM   681   N N    . ASP A 1 45 ? -6.948  -12.742 -7.110  1.00 5.91  ? 45 ASP A N    1  
ATOM   682   C CA   . ASP A 1 45 ? -8.271  -13.329 -6.758  1.00 7.02  ? 45 ASP A CA   1  
ATOM   683   C C    . ASP A 1 45 ? -9.400  -12.298 -6.976  1.00 7.25  ? 45 ASP A C    1  
ATOM   684   O O    . ASP A 1 45 ? -10.530 -12.527 -6.586  1.00 8.19  ? 45 ASP A O    1  
ATOM   685   C CB   . ASP A 1 45 ? -8.257  -13.763 -5.287  1.00 7.64  ? 45 ASP A CB   1  
ATOM   686   C CG   . ASP A 1 45 ? -7.346  -14.983 -5.117  1.00 8.01  ? 45 ASP A CG   1  
ATOM   687   O OD1  . ASP A 1 45 ? -7.823  -16.088 -5.318  1.00 8.63  ? 45 ASP A OD1  1  
ATOM   688   O OD2  . ASP A 1 45 ? -6.186  -14.791 -4.789  1.00 7.89  ? 45 ASP A OD2  1  
ATOM   689   H H    . ASP A 1 45 ? -6.349  -12.453 -6.399  1.00 5.60  ? 45 ASP A H    1  
ATOM   690   H HA   . ASP A 1 45 ? -8.443  -14.188 -7.378  1.00 7.48  ? 45 ASP A HA   1  
ATOM   691   H HB2  . ASP A 1 45 ? -7.889  -12.950 -4.677  1.00 7.55  ? 45 ASP A HB2  1  
ATOM   692   H HB3  . ASP A 1 45 ? -9.259  -14.020 -4.978  1.00 8.18  ? 45 ASP A HB3  1  
ATOM   693   N N    . GLY A 1 46 ? -9.107  -11.168 -7.589  1.00 6.57  ? 46 GLY A N    1  
ATOM   694   C CA   . GLY A 1 46 ? -10.158 -10.135 -7.819  1.00 7.07  ? 46 GLY A CA   1  
ATOM   695   C C    . GLY A 1 46 ? -10.337 -9.300  -6.550  1.00 6.74  ? 46 GLY A C    1  
ATOM   696   O O    . GLY A 1 46 ? -11.428 -8.857  -6.242  1.00 7.17  ? 46 GLY A O    1  
ATOM   697   H H    . GLY A 1 46 ? -8.196  -10.996 -7.893  1.00 5.88  ? 46 GLY A H    1  
ATOM   698   H HA2  . GLY A 1 46 ? -9.861  -9.494  -8.636  1.00 7.41  ? 46 GLY A HA2  1  
ATOM   699   H HA3  . GLY A 1 46 ? -11.091 -10.618 -8.060  1.00 7.56  ? 46 GLY A HA3  1  
ATOM   700   N N    . ARG A 1 47 ? -9.276  -9.088  -5.803  1.00 6.21  ? 47 ARG A N    1  
ATOM   701   C CA   . ARG A 1 47 ? -9.391  -8.290  -4.550  1.00 6.07  ? 47 ARG A CA   1  
ATOM   702   C C    . ARG A 1 47 ? -8.657  -6.954  -4.717  1.00 5.32  ? 47 ARG A C    1  
ATOM   703   O O    . ARG A 1 47 ? -7.812  -6.804  -5.578  1.00 5.06  ? 47 ARG A O    1  
ATOM   704   C CB   . ARG A 1 47 ? -8.756  -9.089  -3.407  1.00 6.43  ? 47 ARG A CB   1  
ATOM   705   C CG   . ARG A 1 47 ? -9.340  -8.645  -2.061  1.00 7.27  ? 47 ARG A CG   1  
ATOM   706   C CD   . ARG A 1 47 ? -10.748 -9.226  -1.896  1.00 7.96  ? 47 ARG A CD   1  
ATOM   707   N NE   . ARG A 1 47 ? -11.302 -8.825  -0.569  1.00 8.82  ? 47 ARG A NE   1  
ATOM   708   C CZ   . ARG A 1 47 ? -11.720 -9.738  0.271   1.00 9.62  ? 47 ARG A CZ   1  
ATOM   709   N NH1  . ARG A 1 47 ? -12.870 -10.332 0.073   1.00 10.10 ? 47 ARG A NH1  1  
ATOM   710   N NH2  . ARG A 1 47 ? -10.990 -10.054 1.308   1.00 10.15 ? 47 ARG A NH2  1  
ATOM   711   H H    . ARG A 1 47 ? -8.400  -9.462  -6.063  1.00 6.06  ? 47 ARG A H    1  
ATOM   712   H HA   . ARG A 1 47 ? -10.432 -8.108  -4.327  1.00 6.58  ? 47 ARG A HA   1  
ATOM   713   H HB2  . ARG A 1 47 ? -8.956  -10.141 -3.554  1.00 6.43  ? 47 ARG A HB2  1  
ATOM   714   H HB3  . ARG A 1 47 ? -7.691  -8.925  -3.409  1.00 6.47  ? 47 ARG A HB3  1  
ATOM   715   H HG2  . ARG A 1 47 ? -8.708  -9.001  -1.261  1.00 7.60  ? 47 ARG A HG2  1  
ATOM   716   H HG3  . ARG A 1 47 ? -9.391  -7.569  -2.026  1.00 7.34  ? 47 ARG A HG3  1  
ATOM   717   H HD2  . ARG A 1 47 ? -11.387 -8.849  -2.679  1.00 7.82  ? 47 ARG A HD2  1  
ATOM   718   H HD3  . ARG A 1 47 ? -10.703 -10.304 -1.957  1.00 8.20  ? 47 ARG A HD3  1  
ATOM   719   H HE   . ARG A 1 47 ? -11.354 -7.877  -0.326  1.00 8.93  ? 47 ARG A HE   1  
ATOM   720   H HH11 . ARG A 1 47 ? -13.429 -10.089 -0.720  1.00 9.88  ? 47 ARG A HH11 1  
ATOM   721   H HH12 . ARG A 1 47 ? -13.190 -11.031 0.715   1.00 10.80 ? 47 ARG A HH12 1  
ATOM   722   H HH21 . ARG A 1 47 ? -10.112 -9.598  1.461   1.00 9.97  ? 47 ARG A HH21 1  
ATOM   723   H HH22 . ARG A 1 47 ? -11.309 -10.751 1.951   1.00 10.86 ? 47 ARG A HH22 1  
ATOM   724   N N    . GLU A 1 48 ? -8.972  -5.986  -3.892  1.00 5.24  ? 48 GLU A N    1  
ATOM   725   C CA   . GLU A 1 48 ? -8.291  -4.660  -3.977  1.00 4.73  ? 48 GLU A CA   1  
ATOM   726   C C    . GLU A 1 48 ? -7.893  -4.235  -2.564  1.00 4.69  ? 48 GLU A C    1  
ATOM   727   O O    . GLU A 1 48 ? -8.737  -4.037  -1.708  1.00 5.44  ? 48 GLU A O    1  
ATOM   728   C CB   . GLU A 1 48 ? -9.238  -3.621  -4.588  1.00 5.60  ? 48 GLU A CB   1  
ATOM   729   C CG   . GLU A 1 48 ? -8.423  -2.591  -5.379  1.00 5.76  ? 48 GLU A CG   1  
ATOM   730   C CD   . GLU A 1 48 ? -9.188  -1.268  -5.449  1.00 6.79  ? 48 GLU A CD   1  
ATOM   731   O OE1  . GLU A 1 48 ? -9.087  -0.496  -4.509  1.00 7.12  ? 48 GLU A OE1  1  
ATOM   732   O OE2  . GLU A 1 48 ? -9.858  -1.045  -6.445  1.00 7.44  ? 48 GLU A OE2  1  
ATOM   733   H H    . GLU A 1 48 ? -9.655  -6.135  -3.206  1.00 5.71  ? 48 GLU A H    1  
ATOM   734   H HA   . GLU A 1 48 ? -7.404  -4.747  -4.589  1.00 4.10  ? 48 GLU A HA   1  
ATOM   735   H HB2  . GLU A 1 48 ? -9.936  -4.115  -5.249  1.00 5.76  ? 48 GLU A HB2  1  
ATOM   736   H HB3  . GLU A 1 48 ? -9.781  -3.120  -3.800  1.00 6.30  ? 48 GLU A HB3  1  
ATOM   737   H HG2  . GLU A 1 48 ? -7.473  -2.432  -4.889  1.00 5.48  ? 48 GLU A HG2  1  
ATOM   738   H HG3  . GLU A 1 48 ? -8.253  -2.960  -6.379  1.00 5.78  ? 48 GLU A HG3  1  
ATOM   739   N N    . LEU A 1 49 ? -6.616  -4.108  -2.309  1.00 4.08  ? 49 LEU A N    1  
ATOM   740   C CA   . LEU A 1 49 ? -6.163  -3.711  -0.942  1.00 4.35  ? 49 LEU A CA   1  
ATOM   741   C C    . LEU A 1 49 ? -5.270  -2.483  -1.041  1.00 3.99  ? 49 LEU A C    1  
ATOM   742   O O    . LEU A 1 49 ? -4.296  -2.485  -1.755  1.00 3.87  ? 49 LEU A O    1  
ATOM   743   C CB   . LEU A 1 49 ? -5.349  -4.851  -0.316  1.00 4.67  ? 49 LEU A CB   1  
ATOM   744   C CG   . LEU A 1 49 ? -6.102  -5.445  0.876   1.00 4.92  ? 49 LEU A CG   1  
ATOM   745   C CD1  . LEU A 1 49 ? -7.157  -6.431  0.378   1.00 5.51  ? 49 LEU A CD1  1  
ATOM   746   C CD2  . LEU A 1 49 ? -5.112  -6.182  1.781   1.00 4.69  ? 49 LEU A CD2  1  
ATOM   747   H H    . LEU A 1 49 ? -5.952  -4.278  -3.016  1.00 3.67  ? 49 LEU A H    1  
ATOM   748   H HA   . LEU A 1 49 ? -7.019  -3.491  -0.321  1.00 4.89  ? 49 LEU A HA   1  
ATOM   749   H HB2  . LEU A 1 49 ? -5.177  -5.621  -1.054  1.00 4.69  ? 49 LEU A HB2  1  
ATOM   750   H HB3  . LEU A 1 49 ? -4.401  -4.461  0.024   1.00 5.10  ? 49 LEU A HB3  1  
ATOM   751   H HG   . LEU A 1 49 ? -6.582  -4.653  1.432   1.00 5.20  ? 49 LEU A HG   1  
ATOM   752   H HD11 . LEU A 1 49 ? -6.694  -7.147  -0.284  1.00 5.66  ? 49 LEU A HD11 1  
ATOM   753   H HD12 . LEU A 1 49 ? -7.591  -6.950  1.221   1.00 5.74  ? 49 LEU A HD12 1  
ATOM   754   H HD13 . LEU A 1 49 ? -7.929  -5.894  -0.152  1.00 5.91  ? 49 LEU A HD13 1  
ATOM   755   H HD21 . LEU A 1 49 ? -4.207  -5.601  1.872   1.00 4.66  ? 49 LEU A HD21 1  
ATOM   756   H HD22 . LEU A 1 49 ? -5.549  -6.321  2.758   1.00 5.11  ? 49 LEU A HD22 1  
ATOM   757   H HD23 . LEU A 1 49 ? -4.877  -7.146  1.350   1.00 4.52  ? 49 LEU A HD23 1  
ATOM   758   N N    . CYS A 1 50 ? -5.568  -1.447  -0.307  1.00 3.99  ? 50 CYS A N    1  
ATOM   759   C CA   . CYS A 1 50 ? -4.695  -0.241  -0.352  1.00 3.63  ? 50 CYS A CA   1  
ATOM   760   C C    . CYS A 1 50 ? -3.531  -0.488  0.598   1.00 3.49  ? 50 CYS A C    1  
ATOM   761   O O    . CYS A 1 50 ? -3.727  -0.950  1.702   1.00 4.14  ? 50 CYS A O    1  
ATOM   762   C CB   . CYS A 1 50 ? -5.442  1.009   0.098   1.00 3.72  ? 50 CYS A CB   1  
ATOM   763   S SG   . CYS A 1 50 ? -7.236  0.759   0.021   1.00 4.64  ? 50 CYS A SG   1  
ATOM   764   H H    . CYS A 1 50 ? -6.342  -1.473  0.288   1.00 4.28  ? 50 CYS A H    1  
ATOM   765   H HA   . CYS A 1 50 ? -4.323  -0.096  -1.348  1.00 3.59  ? 50 CYS A HA   1  
ATOM   766   H HB2  . CYS A 1 50 ? -5.148  1.238   1.100   1.00 3.90  ? 50 CYS A HB2  1  
ATOM   767   H HB3  . CYS A 1 50 ? -5.172  1.828   -0.545  1.00 3.38  ? 50 CYS A HB3  1  
ATOM   768   N N    . LEU A 1 51 ? -2.326  -0.209  0.183   1.00 2.91  ? 51 LEU A N    1  
ATOM   769   C CA   . LEU A 1 51 ? -1.167  -0.457  1.072   1.00 2.96  ? 51 LEU A CA   1  
ATOM   770   C C    . LEU A 1 51 ? -0.744  0.825   1.770   1.00 3.35  ? 51 LEU A C    1  
ATOM   771   O O    . LEU A 1 51 ? -1.004  1.931   1.316   1.00 3.56  ? 51 LEU A O    1  
ATOM   772   C CB   . LEU A 1 51 ? 0.009   -1.000  0.268   1.00 2.71  ? 51 LEU A CB   1  
ATOM   773   C CG   . LEU A 1 51 ? -0.291  -2.423  -0.217  1.00 2.56  ? 51 LEU A CG   1  
ATOM   774   C CD1  . LEU A 1 51 ? -1.273  -2.383  -1.382  1.00 2.98  ? 51 LEU A CD1  1  
ATOM   775   C CD2  . LEU A 1 51 ? 1.010   -3.088  -0.674  1.00 2.61  ? 51 LEU A CD2  1  
ATOM   776   H H    . LEU A 1 51 ? -2.185  0.145   -0.707  1.00 2.70  ? 51 LEU A H    1  
ATOM   777   H HA   . LEU A 1 51 ? -1.447  -1.181  1.818   1.00 3.34  ? 51 LEU A HA   1  
ATOM   778   H HB2  . LEU A 1 51 ? 0.188   -0.358  -0.569  1.00 2.95  ? 51 LEU A HB2  1  
ATOM   779   H HB3  . LEU A 1 51 ? 0.880   -1.014  0.891   1.00 2.93  ? 51 LEU A HB3  1  
ATOM   780   H HG   . LEU A 1 51 ? -0.724  -2.993  0.589   1.00 2.88  ? 51 LEU A HG   1  
ATOM   781   H HD11 . LEU A 1 51 ? -1.233  -1.416  -1.857  1.00 3.13  ? 51 LEU A HD11 1  
ATOM   782   H HD12 . LEU A 1 51 ? -1.013  -3.148  -2.096  1.00 3.38  ? 51 LEU A HD12 1  
ATOM   783   H HD13 . LEU A 1 51 ? -2.271  -2.560  -1.012  1.00 3.34  ? 51 LEU A HD13 1  
ATOM   784   H HD21 . LEU A 1 51 ? 1.556   -2.410  -1.314  1.00 3.04  ? 51 LEU A HD21 1  
ATOM   785   H HD22 . LEU A 1 51 ? 1.611   -3.332  0.187   1.00 2.85  ? 51 LEU A HD22 1  
ATOM   786   H HD23 . LEU A 1 51 ? 0.779   -3.990  -1.221  1.00 2.77  ? 51 LEU A HD23 1  
ATOM   787   N N    . ASP A 1 52 ? -0.083  0.653   2.876   1.00 3.84  ? 52 ASP A N    1  
ATOM   788   C CA   . ASP A 1 52 ? 0.397   1.800   3.688   1.00 4.35  ? 52 ASP A CA   1  
ATOM   789   C C    . ASP A 1 52 ? 1.921   1.919   3.538   1.00 4.47  ? 52 ASP A C    1  
ATOM   790   O O    . ASP A 1 52 ? 2.651   1.030   3.943   1.00 4.73  ? 52 ASP A O    1  
ATOM   791   C CB   . ASP A 1 52 ? 0.031   1.535   5.154   1.00 4.93  ? 52 ASP A CB   1  
ATOM   792   C CG   . ASP A 1 52 ? 0.122   2.828   5.971   1.00 5.39  ? 52 ASP A CG   1  
ATOM   793   O OD1  . ASP A 1 52 ? -0.365  3.847   5.502   1.00 5.96  ? 52 ASP A OD1  1  
ATOM   794   O OD2  . ASP A 1 52 ? 0.664   2.773   7.060   1.00 5.40  ? 52 ASP A OD2  1  
ATOM   795   H H    . ASP A 1 52 ? 0.103   -0.259  3.173   1.00 4.08  ? 52 ASP A H    1  
ATOM   796   H HA   . ASP A 1 52 ? -0.079  2.708   3.352   1.00 4.52  ? 52 ASP A HA   1  
ATOM   797   H HB2  . ASP A 1 52 ? -0.977  1.148   5.204   1.00 5.32  ? 52 ASP A HB2  1  
ATOM   798   H HB3  . ASP A 1 52 ? 0.710   0.803   5.564   1.00 4.91  ? 52 ASP A HB3  1  
ATOM   799   N N    . PRO A 1 53 ? 2.360   3.019   2.964   1.00 4.54  ? 53 PRO A N    1  
ATOM   800   C CA   . PRO A 1 53 ? 3.799   3.273   2.742   1.00 4.96  ? 53 PRO A CA   1  
ATOM   801   C C    . PRO A 1 53 ? 4.536   3.524   4.067   1.00 5.21  ? 53 PRO A C    1  
ATOM   802   O O    . PRO A 1 53 ? 5.751   3.588   4.095   1.00 5.67  ? 53 PRO A O    1  
ATOM   803   C CB   . PRO A 1 53 ? 3.814   4.508   1.833   1.00 5.26  ? 53 PRO A CB   1  
ATOM   804   C CG   . PRO A 1 53 ? 2.449   5.205   2.025   1.00 5.04  ? 53 PRO A CG   1  
ATOM   805   C CD   . PRO A 1 53 ? 1.476   4.117   2.513   1.00 4.55  ? 53 PRO A CD   1  
ATOM   806   H HA   . PRO A 1 53 ? 4.245   2.441   2.224   1.00 5.07  ? 53 PRO A HA   1  
ATOM   807   H HB2  . PRO A 1 53 ? 4.619   5.170   2.120   1.00 5.72  ? 53 PRO A HB2  1  
ATOM   808   H HB3  . PRO A 1 53 ? 3.927   4.208   0.802   1.00 5.40  ? 53 PRO A HB3  1  
ATOM   809   H HG2  . PRO A 1 53 ? 2.536   5.990   2.764   1.00 5.39  ? 53 PRO A HG2  1  
ATOM   810   H HG3  . PRO A 1 53 ? 2.104   5.611   1.088   1.00 5.11  ? 53 PRO A HG3  1  
ATOM   811   H HD2  . PRO A 1 53 ? 0.877   4.488   3.333   1.00 4.78  ? 53 PRO A HD2  1  
ATOM   812   H HD3  . PRO A 1 53 ? 0.847   3.780   1.703   1.00 4.27  ? 53 PRO A HD3  1  
ATOM   813   N N    . LYS A 1 54 ? 3.818   3.645   5.165   1.00 5.18  ? 54 LYS A N    1  
ATOM   814   C CA   . LYS A 1 54 ? 4.485   3.863   6.477   1.00 5.61  ? 54 LYS A CA   1  
ATOM   815   C C    . LYS A 1 54 ? 5.385   2.664   6.803   1.00 5.02  ? 54 LYS A C    1  
ATOM   816   O O    . LYS A 1 54 ? 6.400   2.811   7.457   1.00 5.42  ? 54 LYS A O    1  
ATOM   817   C CB   . LYS A 1 54 ? 3.430   4.019   7.575   1.00 6.23  ? 54 LYS A CB   1  
ATOM   818   C CG   . LYS A 1 54 ? 3.772   5.228   8.453   1.00 7.12  ? 54 LYS A CG   1  
ATOM   819   C CD   . LYS A 1 54 ? 4.588   4.769   9.664   1.00 7.85  ? 54 LYS A CD   1  
ATOM   820   C CE   . LYS A 1 54 ? 4.393   5.757   10.818  1.00 8.63  ? 54 LYS A CE   1  
ATOM   821   N NZ   . LYS A 1 54 ? 5.138   5.278   12.018  1.00 9.56  ? 54 LYS A NZ   1  
ATOM   822   H H    . LYS A 1 54 ? 2.848   3.582   5.127   1.00 5.07  ? 54 LYS A H    1  
ATOM   823   H HA   . LYS A 1 54 ? 5.079   4.755   6.421   1.00 6.14  ? 54 LYS A HA   1  
ATOM   824   H HB2  . LYS A 1 54 ? 2.463   4.167   7.122   1.00 6.01  ? 54 LYS A HB2  1  
ATOM   825   H HB3  . LYS A 1 54 ? 3.408   3.129   8.185   1.00 6.42  ? 54 LYS A HB3  1  
ATOM   826   H HG2  . LYS A 1 54 ? 4.348   5.939   7.878   1.00 7.47  ? 54 LYS A HG2  1  
ATOM   827   H HG3  . LYS A 1 54 ? 2.860   5.695   8.792   1.00 7.15  ? 54 LYS A HG3  1  
ATOM   828   H HD2  . LYS A 1 54 ? 4.257   3.787   9.971   1.00 8.02  ? 54 LYS A HD2  1  
ATOM   829   H HD3  . LYS A 1 54 ? 5.634   4.731   9.401   1.00 7.93  ? 54 LYS A HD3  1  
ATOM   830   H HE2  . LYS A 1 54 ? 4.766   6.728   10.528  1.00 8.78  ? 54 LYS A HE2  1  
ATOM   831   H HE3  . LYS A 1 54 ? 3.341   5.832   11.054  1.00 8.58  ? 54 LYS A HE3  1  
ATOM   832   H HZ1  . LYS A 1 54 ? 4.843   4.308   12.246  1.00 9.84  ? 54 LYS A HZ1  1  
ATOM   833   H HZ2  . LYS A 1 54 ? 6.160   5.294   11.821  1.00 9.93  ? 54 LYS A HZ2  1  
ATOM   834   H HZ3  . LYS A 1 54 ? 4.931   5.899   12.825  1.00 9.78  ? 54 LYS A HZ3  1  
ATOM   835   N N    . GLU A 1 55 ? 5.029   1.480   6.344   1.00 4.37  ? 55 GLU A N    1  
ATOM   836   C CA   . GLU A 1 55 ? 5.871   0.288   6.621   1.00 4.14  ? 55 GLU A CA   1  
ATOM   837   C C    . GLU A 1 55 ? 7.046   0.264   5.649   1.00 3.84  ? 55 GLU A C    1  
ATOM   838   O O    . GLU A 1 55 ? 7.095   1.011   4.689   1.00 3.83  ? 55 GLU A O    1  
ATOM   839   C CB   . GLU A 1 55 ? 5.048   -0.984  6.423   1.00 4.19  ? 55 GLU A CB   1  
ATOM   840   C CG   . GLU A 1 55 ? 4.079   -1.163  7.591   1.00 4.76  ? 55 GLU A CG   1  
ATOM   841   C CD   . GLU A 1 55 ? 2.789   -0.385  7.323   1.00 5.39  ? 55 GLU A CD   1  
ATOM   842   O OE1  . GLU A 1 55 ? 2.051   -0.786  6.438   1.00 6.13  ? 55 GLU A OE1  1  
ATOM   843   O OE2  . GLU A 1 55 ? 2.561   0.599   8.007   1.00 5.43  ? 55 GLU A OE2  1  
ATOM   844   H H    . GLU A 1 55 ? 4.213   1.375   5.810   1.00 4.29  ? 55 GLU A H    1  
ATOM   845   H HA   . GLU A 1 55 ? 6.240   0.328   7.635   1.00 4.53  ? 55 GLU A HA   1  
ATOM   846   H HB2  . GLU A 1 55 ? 4.498   -0.915  5.501   1.00 4.04  ? 55 GLU A HB2  1  
ATOM   847   H HB3  . GLU A 1 55 ? 5.708   -1.831  6.376   1.00 4.32  ? 55 GLU A HB3  1  
ATOM   848   H HG2  . GLU A 1 55 ? 3.848   -2.207  7.703   1.00 4.81  ? 55 GLU A HG2  1  
ATOM   849   H HG3  . GLU A 1 55 ? 4.538   -0.802  8.494   1.00 4.98  ? 55 GLU A HG3  1  
ATOM   850   N N    . ASN A 1 56 ? 7.977   -0.613  5.883   1.00 3.90  ? 56 ASN A N    1  
ATOM   851   C CA   . ASN A 1 56 ? 9.150   -0.732  4.976   1.00 3.93  ? 56 ASN A CA   1  
ATOM   852   C C    . ASN A 1 56 ? 8.897   -1.846  3.957   1.00 3.74  ? 56 ASN A C    1  
ATOM   853   O O    . ASN A 1 56 ? 9.570   -1.928  2.948   1.00 3.89  ? 56 ASN A O    1  
ATOM   854   C CB   . ASN A 1 56 ? 10.389  -1.056  5.793   1.00 4.29  ? 56 ASN A CB   1  
ATOM   855   C CG   . ASN A 1 56 ? 11.400  0.089   5.678   1.00 4.70  ? 56 ASN A CG   1  
ATOM   856   O OD1  . ASN A 1 56 ? 11.156  1.181   6.153   1.00 4.90  ? 56 ASN A OD1  1  
ATOM   857   N ND2  . ASN A 1 56 ? 12.535  -0.115  5.064   1.00 5.15  ? 56 ASN A ND2  1  
ATOM   858   H H    . ASN A 1 56 ? 7.894   -1.213  6.653   1.00 4.12  ? 56 ASN A H    1  
ATOM   859   H HA   . ASN A 1 56 ? 9.299   0.195   4.461   1.00 4.07  ? 56 ASN A HA   1  
ATOM   860   H HB2  . ASN A 1 56 ? 10.106  -1.187  6.820   1.00 4.38  ? 56 ASN A HB2  1  
ATOM   861   H HB3  . ASN A 1 56 ? 10.830  -1.960  5.419   1.00 4.36  ? 56 ASN A HB3  1  
ATOM   862   H HD21 . ASN A 1 56 ? 12.734  -0.995  4.681   1.00 5.31  ? 56 ASN A HD21 1  
ATOM   863   H HD22 . ASN A 1 56 ? 13.187  0.612   4.985   1.00 5.51  ? 56 ASN A HD22 1  
ATOM   864   N N    . TRP A 1 57 ? 7.929   -2.700  4.208   1.00 3.55  ? 57 TRP A N    1  
ATOM   865   C CA   . TRP A 1 57 ? 7.632   -3.794  3.256   1.00 3.47  ? 57 TRP A CA   1  
ATOM   866   C C    . TRP A 1 57 ? 6.742   -3.266  2.135   1.00 3.28  ? 57 TRP A C    1  
ATOM   867   O O    . TRP A 1 57 ? 6.894   -3.641  0.996   1.00 3.48  ? 57 TRP A O    1  
ATOM   868   C CB   . TRP A 1 57 ? 6.959   -4.958  3.991   1.00 3.64  ? 57 TRP A CB   1  
ATOM   869   C CG   . TRP A 1 57 ? 5.543   -4.656  4.350   1.00 3.70  ? 57 TRP A CG   1  
ATOM   870   C CD1  . TRP A 1 57 ? 5.141   -4.251  5.560   1.00 4.08  ? 57 TRP A CD1  1  
ATOM   871   C CD2  . TRP A 1 57 ? 4.342   -4.746  3.528   1.00 3.51  ? 57 TRP A CD2  1  
ATOM   872   N NE1  . TRP A 1 57 ? 3.771   -4.112  5.554   1.00 4.20  ? 57 TRP A NE1  1  
ATOM   873   C CE2  . TRP A 1 57 ? 3.232   -4.388  4.322   1.00 3.80  ? 57 TRP A CE2  1  
ATOM   874   C CE3  . TRP A 1 57 ? 4.107   -5.097  2.187   1.00 3.27  ? 57 TRP A CE3  1  
ATOM   875   C CZ2  . TRP A 1 57 ? 1.934   -4.380  3.813   1.00 3.76  ? 57 TRP A CZ2  1  
ATOM   876   C CZ3  . TRP A 1 57 ? 2.804   -5.088  1.670   1.00 3.17  ? 57 TRP A CZ3  1  
ATOM   877   C CH2  . TRP A 1 57 ? 1.718   -4.729  2.479   1.00 3.38  ? 57 TRP A CH2  1  
ATOM   878   H H    . TRP A 1 57 ? 7.398   -2.615  5.016   1.00 3.59  ? 57 TRP A H    1  
ATOM   879   H HA   . TRP A 1 57 ? 8.558   -4.134  2.836   1.00 3.59  ? 57 TRP A HA   1  
ATOM   880   H HB2  . TRP A 1 57 ? 6.969   -5.820  3.372   1.00 3.77  ? 57 TRP A HB2  1  
ATOM   881   H HB3  . TRP A 1 57 ? 7.513   -5.165  4.888   1.00 3.78  ? 57 TRP A HB3  1  
ATOM   882   H HD1  . TRP A 1 57 ? 5.785   -4.082  6.401   1.00 4.35  ? 57 TRP A HD1  1  
ATOM   883   H HE1  . TRP A 1 57 ? 3.235   -3.848  6.312   1.00 4.57  ? 57 TRP A HE1  1  
ATOM   884   H HE3  . TRP A 1 57 ? 4.935   -5.377  1.554   1.00 3.29  ? 57 TRP A HE3  1  
ATOM   885   H HZ2  . TRP A 1 57 ? 1.103   -4.101  4.444   1.00 4.10  ? 57 TRP A HZ2  1  
ATOM   886   H HZ3  . TRP A 1 57 ? 2.638   -5.350  0.640   1.00 3.03  ? 57 TRP A HZ3  1  
ATOM   887   H HH2  . TRP A 1 57 ? 0.716   -4.724  2.073   1.00 3.37  ? 57 TRP A HH2  1  
ATOM   888   N N    . VAL A 1 58 ? 5.825   -2.389  2.453   1.00 3.02  ? 58 VAL A N    1  
ATOM   889   C CA   . VAL A 1 58 ? 4.934   -1.818  1.398   1.00 2.84  ? 58 VAL A CA   1  
ATOM   890   C C    . VAL A 1 58 ? 5.786   -0.984  0.435   1.00 2.99  ? 58 VAL A C    1  
ATOM   891   O O    . VAL A 1 58 ? 5.621   -1.050  -0.768  1.00 3.21  ? 58 VAL A O    1  
ATOM   892   C CB   . VAL A 1 58 ? 3.872   -0.930  2.060   1.00 2.78  ? 58 VAL A CB   1  
ATOM   893   C CG1  . VAL A 1 58 ? 3.392   0.154   1.091   1.00 2.80  ? 58 VAL A CG1  1  
ATOM   894   C CG2  . VAL A 1 58 ? 2.683   -1.783  2.485   1.00 2.85  ? 58 VAL A CG2  1  
ATOM   895   H H    . VAL A 1 58 ? 5.729   -2.098  3.388   1.00 3.04  ? 58 VAL A H    1  
ATOM   896   H HA   . VAL A 1 58 ? 4.458   -2.620  0.854   1.00 2.96  ? 58 VAL A HA   1  
ATOM   897   H HB   . VAL A 1 58 ? 4.302   -0.465  2.929   1.00 3.12  ? 58 VAL A HB   1  
ATOM   898   H HG11 . VAL A 1 58 ? 3.212   -0.285  0.121   1.00 3.08  ? 58 VAL A HG11 1  
ATOM   899   H HG12 . VAL A 1 58 ? 2.479   0.591   1.464   1.00 3.10  ? 58 VAL A HG12 1  
ATOM   900   H HG13 . VAL A 1 58 ? 4.149   0.920   1.005   1.00 2.86  ? 58 VAL A HG13 1  
ATOM   901   H HG21 . VAL A 1 58 ? 2.576   -2.613  1.805   1.00 2.93  ? 58 VAL A HG21 1  
ATOM   902   H HG22 . VAL A 1 58 ? 2.849   -2.153  3.485   1.00 3.15  ? 58 VAL A HG22 1  
ATOM   903   H HG23 . VAL A 1 58 ? 1.786   -1.184  2.470   1.00 3.17  ? 58 VAL A HG23 1  
ATOM   904   N N    . GLN A 1 59 ? 6.698   -0.204  0.962   1.00 3.12  ? 59 GLN A N    1  
ATOM   905   C CA   . GLN A 1 59 ? 7.568   0.636   0.095   1.00 3.61  ? 59 GLN A CA   1  
ATOM   906   C C    . GLN A 1 59 ? 8.613   -0.244  -0.610  1.00 3.90  ? 59 GLN A C    1  
ATOM   907   O O    . GLN A 1 59 ? 9.039   0.057   -1.708  1.00 4.47  ? 59 GLN A O    1  
ATOM   908   C CB   . GLN A 1 59 ? 8.246   1.705   0.947   1.00 3.82  ? 59 GLN A CB   1  
ATOM   909   C CG   . GLN A 1 59 ? 9.157   1.030   1.958   1.00 4.33  ? 59 GLN A CG   1  
ATOM   910   C CD   . GLN A 1 59 ? 9.782   2.076   2.885   1.00 4.72  ? 59 GLN A CD   1  
ATOM   911   O OE1  . GLN A 1 59 ? 9.083   2.760   3.608   1.00 4.84  ? 59 GLN A OE1  1  
ATOM   912   N NE2  . GLN A 1 59 ? 11.078  2.228   2.900   1.00 5.29  ? 59 GLN A NE2  1  
ATOM   913   H H    . GLN A 1 59 ? 6.813   -0.174  1.935   1.00 3.04  ? 59 GLN A H    1  
ATOM   914   H HA   . GLN A 1 59 ? 6.964   1.113   -0.643  1.00 3.80  ? 59 GLN A HA   1  
ATOM   915   H HB2  . GLN A 1 59 ? 8.823   2.354   0.313   1.00 3.96  ? 59 GLN A HB2  1  
ATOM   916   H HB3  . GLN A 1 59 ? 7.494   2.280   1.466   1.00 3.78  ? 59 GLN A HB3  1  
ATOM   917   H HG2  . GLN A 1 59 ? 8.577   0.330   2.537   1.00 4.58  ? 59 GLN A HG2  1  
ATOM   918   H HG3  . GLN A 1 59 ? 9.933   0.502   1.431   1.00 4.52  ? 59 GLN A HG3  1  
ATOM   919   H HE21 . GLN A 1 59 ? 11.644  1.676   2.321   1.00 5.47  ? 59 GLN A HE21 1  
ATOM   920   H HE22 . GLN A 1 59 ? 11.486  2.895   3.490   1.00 5.70  ? 59 GLN A HE22 1  
ATOM   921   N N    . ARG A 1 60 ? 9.003   -1.344  -0.004  1.00 3.65  ? 60 ARG A N    1  
ATOM   922   C CA   . ARG A 1 60 ? 9.989   -2.254  -0.657  1.00 3.97  ? 60 ARG A CA   1  
ATOM   923   C C    . ARG A 1 60 ? 9.241   -3.096  -1.688  1.00 3.96  ? 60 ARG A C    1  
ATOM   924   O O    . ARG A 1 60 ? 9.714   -3.319  -2.786  1.00 4.42  ? 60 ARG A O    1  
ATOM   925   C CB   . ARG A 1 60 ? 10.623  -3.176  0.387   1.00 4.07  ? 60 ARG A CB   1  
ATOM   926   C CG   . ARG A 1 60 ? 11.851  -2.499  1.003   1.00 4.60  ? 60 ARG A CG   1  
ATOM   927   C CD   . ARG A 1 60 ? 12.728  -3.553  1.690   1.00 4.81  ? 60 ARG A CD   1  
ATOM   928   N NE   . ARG A 1 60 ? 11.960  -4.209  2.792   1.00 5.26  ? 60 ARG A NE   1  
ATOM   929   C CZ   . ARG A 1 60 ? 12.590  -4.723  3.816   1.00 5.84  ? 60 ARG A CZ   1  
ATOM   930   N NH1  . ARG A 1 60 ? 13.462  -5.684  3.641   1.00 6.35  ? 60 ARG A NH1  1  
ATOM   931   N NH2  . ARG A 1 60 ? 12.340  -4.280  5.021   1.00 6.25  ? 60 ARG A NH2  1  
ATOM   932   H H    . ARG A 1 60 ? 8.625   -1.583  0.866   1.00 3.35  ? 60 ARG A H    1  
ATOM   933   H HA   . ARG A 1 60 ? 10.756  -1.670  -1.149  1.00 4.24  ? 60 ARG A HA   1  
ATOM   934   H HB2  . ARG A 1 60 ? 9.902   -3.388  1.162   1.00 3.95  ? 60 ARG A HB2  1  
ATOM   935   H HB3  . ARG A 1 60 ? 10.922  -4.098  -0.085  1.00 4.07  ? 60 ARG A HB3  1  
ATOM   936   H HG2  . ARG A 1 60 ? 12.420  -2.008  0.226   1.00 4.80  ? 60 ARG A HG2  1  
ATOM   937   H HG3  . ARG A 1 60 ? 11.534  -1.768  1.732   1.00 4.99  ? 60 ARG A HG3  1  
ATOM   938   H HD2  . ARG A 1 60 ? 13.026  -4.297  0.966   1.00 4.73  ? 60 ARG A HD2  1  
ATOM   939   H HD3  . ARG A 1 60 ? 13.608  -3.076  2.097   1.00 5.10  ? 60 ARG A HD3  1  
ATOM   940   H HE   . ARG A 1 60 ? 10.982  -4.253  2.748   1.00 5.37  ? 60 ARG A HE   1  
ATOM   941   H HH11 . ARG A 1 60 ? 13.651  -6.028  2.721   1.00 6.32  ? 60 ARG A HH11 1  
ATOM   942   H HH12 . ARG A 1 60 ? 13.940  -6.075  4.427   1.00 6.96  ? 60 ARG A HH12 1  
ATOM   943   H HH21 . ARG A 1 60 ? 11.670  -3.552  5.156   1.00 6.14  ? 60 ARG A HH21 1  
ATOM   944   H HH22 . ARG A 1 60 ? 12.818  -4.671  5.808   1.00 6.86  ? 60 ARG A HH22 1  
ATOM   945   N N    . VAL A 1 61 ? 8.060   -3.550  -1.336  1.00 3.58  ? 61 VAL A N    1  
ATOM   946   C CA   . VAL A 1 61 ? 7.239   -4.367  -2.275  1.00 3.55  ? 61 VAL A CA   1  
ATOM   947   C C    . VAL A 1 61 ? 6.870   -3.517  -3.497  1.00 3.25  ? 61 VAL A C    1  
ATOM   948   O O    . VAL A 1 61 ? 6.918   -3.982  -4.620  1.00 3.52  ? 61 VAL A O    1  
ATOM   949   C CB   . VAL A 1 61 ? 5.966   -4.828  -1.544  1.00 3.59  ? 61 VAL A CB   1  
ATOM   950   C CG1  . VAL A 1 61 ? 4.890   -5.243  -2.548  1.00 3.56  ? 61 VAL A CG1  1  
ATOM   951   C CG2  . VAL A 1 61 ? 6.304   -6.015  -0.638  1.00 4.31  ? 61 VAL A CG2  1  
ATOM   952   H H    . VAL A 1 61 ? 7.704   -3.341  -0.439  1.00 3.39  ? 61 VAL A H    1  
ATOM   953   H HA   . VAL A 1 61 ? 7.807   -5.224  -2.596  1.00 3.93  ? 61 VAL A HA   1  
ATOM   954   H HB   . VAL A 1 61 ? 5.591   -4.015  -0.940  1.00 3.40  ? 61 VAL A HB   1  
ATOM   955   H HG11 . VAL A 1 61 ? 5.359   -5.595  -3.452  1.00 3.73  ? 61 VAL A HG11 1  
ATOM   956   H HG12 . VAL A 1 61 ? 4.285   -6.031  -2.123  1.00 3.88  ? 61 VAL A HG12 1  
ATOM   957   H HG13 . VAL A 1 61 ? 4.265   -4.391  -2.773  1.00 3.52  ? 61 VAL A HG13 1  
ATOM   958   H HG21 . VAL A 1 61 ? 7.102   -5.737  0.036   1.00 4.75  ? 61 VAL A HG21 1  
ATOM   959   H HG22 . VAL A 1 61 ? 5.431   -6.291  -0.067  1.00 4.45  ? 61 VAL A HG22 1  
ATOM   960   H HG23 . VAL A 1 61 ? 6.619   -6.851  -1.243  1.00 4.58  ? 61 VAL A HG23 1  
ATOM   961   N N    . VAL A 1 62 ? 6.511   -2.274  -3.285  1.00 2.99  ? 62 VAL A N    1  
ATOM   962   C CA   . VAL A 1 62 ? 6.148   -1.386  -4.430  1.00 3.22  ? 62 VAL A CA   1  
ATOM   963   C C    . VAL A 1 62 ? 7.405   -1.096  -5.266  1.00 3.80  ? 62 VAL A C    1  
ATOM   964   O O    . VAL A 1 62 ? 7.336   -0.995  -6.475  1.00 4.15  ? 62 VAL A O    1  
ATOM   965   C CB   . VAL A 1 62 ? 5.552   -0.071  -3.897  1.00 3.53  ? 62 VAL A CB   1  
ATOM   966   C CG1  . VAL A 1 62 ? 5.435   0.954   -5.031  1.00 4.40  ? 62 VAL A CG1  1  
ATOM   967   C CG2  . VAL A 1 62 ? 4.158   -0.337  -3.318  1.00 3.34  ? 62 VAL A CG2  1  
ATOM   968   H H    . VAL A 1 62 ? 6.487   -1.924  -2.369  1.00 2.92  ? 62 VAL A H    1  
ATOM   969   H HA   . VAL A 1 62 ? 5.420   -1.888  -5.051  1.00 3.17  ? 62 VAL A HA   1  
ATOM   970   H HB   . VAL A 1 62 ? 6.193   0.325   -3.122  1.00 3.69  ? 62 VAL A HB   1  
ATOM   971   H HG11 . VAL A 1 62 ? 4.998   0.483   -5.899  1.00 4.91  ? 62 VAL A HG11 1  
ATOM   972   H HG12 . VAL A 1 62 ? 4.807   1.774   -4.712  1.00 4.71  ? 62 VAL A HG12 1  
ATOM   973   H HG13 . VAL A 1 62 ? 6.417   1.330   -5.281  1.00 4.59  ? 62 VAL A HG13 1  
ATOM   974   H HG21 . VAL A 1 62 ? 4.140   -1.313  -2.855  1.00 3.11  ? 62 VAL A HG21 1  
ATOM   975   H HG22 . VAL A 1 62 ? 3.925   0.415   -2.579  1.00 3.80  ? 62 VAL A HG22 1  
ATOM   976   H HG23 . VAL A 1 62 ? 3.426   -0.302  -4.110  1.00 3.53  ? 62 VAL A HG23 1  
ATOM   977   N N    . GLU A 1 63 ? 8.550   -0.969  -4.633  1.00 4.04  ? 63 GLU A N    1  
ATOM   978   C CA   . GLU A 1 63 ? 9.801   -0.694  -5.390  1.00 4.68  ? 63 GLU A CA   1  
ATOM   979   C C    . GLU A 1 63 ? 10.219  -1.944  -6.173  1.00 4.70  ? 63 GLU A C    1  
ATOM   980   O O    . GLU A 1 63 ? 10.556  -1.862  -7.338  1.00 5.23  ? 63 GLU A O    1  
ATOM   981   C CB   . GLU A 1 63 ? 10.922  -0.294  -4.420  1.00 5.11  ? 63 GLU A CB   1  
ATOM   982   C CG   . GLU A 1 63 ? 11.174  1.214   -4.523  1.00 5.73  ? 63 GLU A CG   1  
ATOM   983   C CD   . GLU A 1 63 ? 10.124  1.974   -3.704  1.00 6.00  ? 63 GLU A CD   1  
ATOM   984   O OE1  . GLU A 1 63 ? 8.988   2.045   -4.146  1.00 6.04  ? 63 GLU A OE1  1  
ATOM   985   O OE2  . GLU A 1 63 ? 10.476  2.474   -2.648  1.00 6.46  ? 63 GLU A OE2  1  
ATOM   986   H H    . GLU A 1 63 ? 8.584   -1.054  -3.664  1.00 3.89  ? 63 GLU A H    1  
ATOM   987   H HA   . GLU A 1 63 ? 9.618   0.111   -6.075  1.00 5.00  ? 63 GLU A HA   1  
ATOM   988   H HB2  . GLU A 1 63 ? 10.631  -0.544  -3.410  1.00 4.92  ? 63 GLU A HB2  1  
ATOM   989   H HB3  . GLU A 1 63 ? 11.826  -0.826  -4.676  1.00 5.36  ? 63 GLU A HB3  1  
ATOM   990   H HG2  . GLU A 1 63 ? 12.160  1.439   -4.142  1.00 5.98  ? 63 GLU A HG2  1  
ATOM   991   H HG3  . GLU A 1 63 ? 11.111  1.520   -5.557  1.00 6.04  ? 63 GLU A HG3  1  
ATOM   992   N N    . LYS A 1 64 ? 10.192  -3.098  -5.548  1.00 4.35  ? 64 LYS A N    1  
ATOM   993   C CA   . LYS A 1 64 ? 10.579  -4.351  -6.254  1.00 4.71  ? 64 LYS A CA   1  
ATOM   994   C C    . LYS A 1 64 ? 9.573   -4.653  -7.375  1.00 4.54  ? 64 LYS A C    1  
ATOM   995   O O    . LYS A 1 64 ? 9.931   -5.178  -8.413  1.00 5.00  ? 64 LYS A O    1  
ATOM   996   C CB   . LYS A 1 64 ? 10.593  -5.516  -5.258  1.00 4.74  ? 64 LYS A CB   1  
ATOM   997   C CG   . LYS A 1 64 ? 11.789  -6.427  -5.548  1.00 5.62  ? 64 LYS A CG   1  
ATOM   998   C CD   . LYS A 1 64 ? 11.558  -7.798  -4.902  1.00 6.24  ? 64 LYS A CD   1  
ATOM   999   C CE   . LYS A 1 64 ? 11.959  -7.747  -3.424  1.00 7.07  ? 64 LYS A CE   1  
ATOM   1000  N NZ   . LYS A 1 64 ? 10.734  -7.691  -2.575  1.00 7.79  ? 64 LYS A NZ   1  
ATOM   1001  H H    . LYS A 1 64 ? 9.913   -3.141  -4.612  1.00 4.03  ? 64 LYS A H    1  
ATOM   1002  H HA   . LYS A 1 64 ? 11.561  -4.227  -6.673  1.00 5.26  ? 64 LYS A HA   1  
ATOM   1003  H HB2  . LYS A 1 64 ? 10.671  -5.128  -4.253  1.00 4.73  ? 64 LYS A HB2  1  
ATOM   1004  H HB3  . LYS A 1 64 ? 9.680   -6.083  -5.355  1.00 4.49  ? 64 LYS A HB3  1  
ATOM   1005  H HG2  . LYS A 1 64 ? 11.900  -6.546  -6.617  1.00 6.07  ? 64 LYS A HG2  1  
ATOM   1006  H HG3  . LYS A 1 64 ? 12.686  -5.985  -5.140  1.00 5.69  ? 64 LYS A HG3  1  
ATOM   1007  H HD2  . LYS A 1 64 ? 10.514  -8.062  -4.984  1.00 6.22  ? 64 LYS A HD2  1  
ATOM   1008  H HD3  . LYS A 1 64 ? 12.157  -8.539  -5.409  1.00 6.45  ? 64 LYS A HD3  1  
ATOM   1009  H HE2  . LYS A 1 64 ? 12.529  -8.631  -3.175  1.00 7.40  ? 64 LYS A HE2  1  
ATOM   1010  H HE3  . LYS A 1 64 ? 12.562  -6.869  -3.244  1.00 7.09  ? 64 LYS A HE3  1  
ATOM   1011  H HZ1  . LYS A 1 64 ? 10.153  -6.875  -2.853  1.00 7.96  ? 64 LYS A HZ1  1  
ATOM   1012  H HZ2  . LYS A 1 64 ? 10.184  -8.564  -2.700  1.00 8.09  ? 64 LYS A HZ2  1  
ATOM   1013  H HZ3  . LYS A 1 64 ? 11.010  -7.595  -1.576  1.00 8.07  ? 64 LYS A HZ3  1  
ATOM   1014  N N    . PHE A 1 65 ? 8.318   -4.329  -7.165  1.00 4.02  ? 65 PHE A N    1  
ATOM   1015  C CA   . PHE A 1 65 ? 7.277   -4.595  -8.198  1.00 3.99  ? 65 PHE A CA   1  
ATOM   1016  C C    . PHE A 1 65 ? 7.345   -3.531  -9.303  1.00 4.72  ? 65 PHE A C    1  
ATOM   1017  O O    . PHE A 1 65 ? 7.232   -3.837  -10.475 1.00 5.31  ? 65 PHE A O    1  
ATOM   1018  C CB   . PHE A 1 65 ? 5.908   -4.544  -7.520  1.00 3.16  ? 65 PHE A CB   1  
ATOM   1019  C CG   . PHE A 1 65 ? 4.924   -5.417  -8.261  1.00 3.02  ? 65 PHE A CG   1  
ATOM   1020  C CD1  . PHE A 1 65 ? 5.002   -6.813  -8.157  1.00 3.45  ? 65 PHE A CD1  1  
ATOM   1021  C CD2  . PHE A 1 65 ? 3.929   -4.829  -9.048  1.00 2.97  ? 65 PHE A CD2  1  
ATOM   1022  C CE1  . PHE A 1 65 ? 4.084   -7.616  -8.845  1.00 3.48  ? 65 PHE A CE1  1  
ATOM   1023  C CE2  . PHE A 1 65 ? 3.011   -5.632  -9.735  1.00 3.10  ? 65 PHE A CE2  1  
ATOM   1024  C CZ   . PHE A 1 65 ? 3.089   -7.026  -9.634  1.00 3.19  ? 65 PHE A CZ   1  
ATOM   1025  H H    . PHE A 1 65 ? 8.054   -3.908  -6.318  1.00 3.77  ? 65 PHE A H    1  
ATOM   1026  H HA   . PHE A 1 65 ? 7.432   -5.574  -8.626  1.00 4.30  ? 65 PHE A HA   1  
ATOM   1027  H HB2  . PHE A 1 65 ? 6.002   -4.893  -6.504  1.00 2.82  ? 65 PHE A HB2  1  
ATOM   1028  H HB3  . PHE A 1 65 ? 5.553   -3.525  -7.512  1.00 3.27  ? 65 PHE A HB3  1  
ATOM   1029  H HD1  . PHE A 1 65 ? 5.770   -7.269  -7.547  1.00 4.00  ? 65 PHE A HD1  1  
ATOM   1030  H HD2  . PHE A 1 65 ? 3.871   -3.755  -9.126  1.00 3.21  ? 65 PHE A HD2  1  
ATOM   1031  H HE1  . PHE A 1 65 ? 4.143   -8.691  -8.766  1.00 4.01  ? 65 PHE A HE1  1  
ATOM   1032  H HE2  . PHE A 1 65 ? 2.244   -5.176  -10.343 1.00 3.46  ? 65 PHE A HE2  1  
ATOM   1033  H HZ   . PHE A 1 65 ? 2.381   -7.646  -10.163 1.00 3.41  ? 65 PHE A HZ   1  
ATOM   1034  N N    . LEU A 1 66 ? 7.518   -2.284  -8.935  1.00 4.92  ? 66 LEU A N    1  
ATOM   1035  C CA   . LEU A 1 66 ? 7.581   -1.188  -9.956  1.00 5.86  ? 66 LEU A CA   1  
ATOM   1036  C C    . LEU A 1 66 ? 8.908   -1.248  -10.731 1.00 6.61  ? 66 LEU A C    1  
ATOM   1037  O O    . LEU A 1 66 ? 8.928   -1.092  -11.938 1.00 7.33  ? 66 LEU A O    1  
ATOM   1038  C CB   . LEU A 1 66 ? 7.462   0.170   -9.255  1.00 6.18  ? 66 LEU A CB   1  
ATOM   1039  C CG   . LEU A 1 66 ? 7.241   1.273   -10.298 1.00 7.14  ? 66 LEU A CG   1  
ATOM   1040  C CD1  . LEU A 1 66 ? 5.743   1.562   -10.431 1.00 7.61  ? 66 LEU A CD1  1  
ATOM   1041  C CD2  . LEU A 1 66 ? 7.972   2.545   -9.859  1.00 7.67  ? 66 LEU A CD2  1  
ATOM   1042  H H    . LEU A 1 66 ? 7.597   -2.065  -7.980  1.00 4.58  ? 66 LEU A H    1  
ATOM   1043  H HA   . LEU A 1 66 ? 6.760   -1.302  -10.648 1.00 6.03  ? 66 LEU A HA   1  
ATOM   1044  H HB2  . LEU A 1 66 ? 6.626   0.149   -8.570  1.00 5.67  ? 66 LEU A HB2  1  
ATOM   1045  H HB3  . LEU A 1 66 ? 8.369   0.374   -8.707  1.00 6.42  ? 66 LEU A HB3  1  
ATOM   1046  H HG   . LEU A 1 66 ? 7.627   0.946   -11.253 1.00 7.39  ? 66 LEU A HG   1  
ATOM   1047  H HD11 . LEU A 1 66 ? 5.222   1.171   -9.570  1.00 7.49  ? 66 LEU A HD11 1  
ATOM   1048  H HD12 . LEU A 1 66 ? 5.587   2.629   -10.490 1.00 8.02  ? 66 LEU A HD12 1  
ATOM   1049  H HD13 . LEU A 1 66 ? 5.364   1.092   -11.326 1.00 7.94  ? 66 LEU A HD13 1  
ATOM   1050  H HD21 . LEU A 1 66 ? 9.022   2.329   -9.728  1.00 7.84  ? 66 LEU A HD21 1  
ATOM   1051  H HD22 . LEU A 1 66 ? 7.852   3.307   -10.616 1.00 7.67  ? 66 LEU A HD22 1  
ATOM   1052  H HD23 . LEU A 1 66 ? 7.557   2.895   -8.926  1.00 8.14  ? 66 LEU A HD23 1  
ATOM   1053  N N    . LYS A 1 67 ? 10.012  -1.461  -10.049 1.00 6.57  ? 67 LYS A N    1  
ATOM   1054  C CA   . LYS A 1 67 ? 11.336  -1.516  -10.750 1.00 7.47  ? 67 LYS A CA   1  
ATOM   1055  C C    . LYS A 1 67 ? 11.395  -2.750  -11.660 1.00 7.85  ? 67 LYS A C    1  
ATOM   1056  O O    . LYS A 1 67 ? 11.599  -3.861  -11.204 1.00 8.14  ? 67 LYS A O    1  
ATOM   1057  C CB   . LYS A 1 67 ? 12.469  -1.582  -9.715  1.00 7.84  ? 67 LYS A CB   1  
ATOM   1058  C CG   . LYS A 1 67 ? 13.731  -0.931  -10.290 1.00 8.78  ? 67 LYS A CG   1  
ATOM   1059  C CD   . LYS A 1 67 ? 14.629  -2.001  -10.922 1.00 9.42  ? 67 LYS A CD   1  
ATOM   1060  C CE   . LYS A 1 67 ? 15.698  -2.439  -9.915  1.00 10.12 ? 67 LYS A CE   1  
ATOM   1061  N NZ   . LYS A 1 67 ? 16.719  -3.280  -10.603 1.00 10.40 ? 67 LYS A NZ   1  
ATOM   1062  H H    . LYS A 1 67 ? 9.971   -1.575  -9.077  1.00 6.04  ? 67 LYS A H    1  
ATOM   1063  H HA   . LYS A 1 67 ? 11.456  -0.626  -11.352 1.00 7.85  ? 67 LYS A HA   1  
ATOM   1064  H HB2  . LYS A 1 67 ? 12.168  -1.057  -8.821  1.00 7.78  ? 67 LYS A HB2  1  
ATOM   1065  H HB3  . LYS A 1 67 ? 12.676  -2.614  -9.472  1.00 7.75  ? 67 LYS A HB3  1  
ATOM   1066  H HG2  . LYS A 1 67 ? 13.452  -0.207  -11.042 1.00 9.30  ? 67 LYS A HG2  1  
ATOM   1067  H HG3  . LYS A 1 67 ? 14.270  -0.434  -9.497  1.00 8.71  ? 67 LYS A HG3  1  
ATOM   1068  H HD2  . LYS A 1 67 ? 14.029  -2.854  -11.204 1.00 9.58  ? 67 LYS A HD2  1  
ATOM   1069  H HD3  . LYS A 1 67 ? 15.110  -1.595  -11.798 1.00 9.47  ? 67 LYS A HD3  1  
ATOM   1070  H HE2  . LYS A 1 67 ? 16.176  -1.566  -9.495  1.00 10.35 ? 67 LYS A HE2  1  
ATOM   1071  H HE3  . LYS A 1 67 ? 15.234  -3.010  -9.124  1.00 10.41 ? 67 LYS A HE3  1  
ATOM   1072  H HZ1  . LYS A 1 67 ? 16.249  -4.075  -11.082 1.00 10.60 ? 67 LYS A HZ1  1  
ATOM   1073  H HZ2  . LYS A 1 67 ? 17.226  -2.706  -11.306 1.00 10.51 ? 67 LYS A HZ2  1  
ATOM   1074  H HZ3  . LYS A 1 67 ? 17.394  -3.648  -9.903  1.00 10.49 ? 67 LYS A HZ3  1  
ATOM   1075  N N    . ARG A 1 68 ? 11.217  -2.553  -12.945 1.00 8.12  ? 68 ARG A N    1  
ATOM   1076  C CA   . ARG A 1 68 ? 11.256  -3.696  -13.912 1.00 8.78  ? 68 ARG A CA   1  
ATOM   1077  C C    . ARG A 1 68 ? 11.259  -3.149  -15.346 1.00 8.99  ? 68 ARG A C    1  
ATOM   1078  O O    . ARG A 1 68 ? 11.395  -1.958  -15.566 1.00 8.81  ? 68 ARG A O    1  
ATOM   1079  C CB   . ARG A 1 68 ? 10.020  -4.583  -13.709 1.00 9.33  ? 68 ARG A CB   1  
ATOM   1080  C CG   . ARG A 1 68 ? 10.423  -5.876  -12.994 1.00 9.61  ? 68 ARG A CG   1  
ATOM   1081  C CD   . ARG A 1 68 ? 9.563   -7.037  -13.502 1.00 10.05 ? 68 ARG A CD   1  
ATOM   1082  N NE   . ARG A 1 68 ? 10.392  -8.275  -13.574 1.00 10.53 ? 68 ARG A NE   1  
ATOM   1083  C CZ   . ARG A 1 68 ? 10.305  -9.179  -12.633 1.00 10.90 ? 68 ARG A CZ   1  
ATOM   1084  N NH1  . ARG A 1 68 ? 10.918  -8.995  -11.491 1.00 11.35 ? 68 ARG A NH1  1  
ATOM   1085  N NH2  . ARG A 1 68 ? 9.606   -10.266 -12.834 1.00 11.02 ? 68 ARG A NH2  1  
ATOM   1086  H H    . ARG A 1 68 ? 11.056  -1.644  -13.278 1.00 8.08  ? 68 ARG A H    1  
ATOM   1087  H HA   . ARG A 1 68 ? 12.151  -4.278  -13.748 1.00 9.01  ? 68 ARG A HA   1  
ATOM   1088  H HB2  . ARG A 1 68 ? 9.293   -4.054  -13.115 1.00 9.69  ? 68 ARG A HB2  1  
ATOM   1089  H HB3  . ARG A 1 68 ? 9.588   -4.825  -14.669 1.00 9.41  ? 68 ARG A HB3  1  
ATOM   1090  H HG2  . ARG A 1 68 ? 11.465  -6.087  -13.191 1.00 9.48  ? 68 ARG A HG2  1  
ATOM   1091  H HG3  . ARG A 1 68 ? 10.274  -5.760  -11.931 1.00 9.87  ? 68 ARG A HG3  1  
ATOM   1092  H HD2  . ARG A 1 68 ? 8.736   -7.195  -12.826 1.00 10.14 ? 68 ARG A HD2  1  
ATOM   1093  H HD3  . ARG A 1 68 ? 9.183   -6.801  -14.485 1.00 10.14 ? 68 ARG A HD3  1  
ATOM   1094  H HE   . ARG A 1 68 ? 11.002  -8.413  -14.328 1.00 10.72 ? 68 ARG A HE   1  
ATOM   1095  H HH11 . ARG A 1 68 ? 11.453  -8.164  -11.338 1.00 11.42 ? 68 ARG A HH11 1  
ATOM   1096  H HH12 . ARG A 1 68 ? 10.853  -9.687  -10.771 1.00 11.76 ? 68 ARG A HH12 1  
ATOM   1097  H HH21 . ARG A 1 68 ? 9.139   -10.406 -13.707 1.00 10.82 ? 68 ARG A HH21 1  
ATOM   1098  H HH22 . ARG A 1 68 ? 9.540   -10.959 -12.115 1.00 11.44 ? 68 ARG A HH22 1  
ATOM   1099  N N    . ALA A 1 69 ? 11.102  -4.011  -16.321 1.00 9.61  ? 69 ALA A N    1  
ATOM   1100  C CA   . ALA A 1 69 ? 11.085  -3.553  -17.745 1.00 10.14 ? 69 ALA A CA   1  
ATOM   1101  C C    . ALA A 1 69 ? 9.839   -2.690  -17.979 1.00 10.89 ? 69 ALA A C    1  
ATOM   1102  O O    . ALA A 1 69 ? 8.721   -3.164  -17.881 1.00 11.20 ? 69 ALA A O    1  
ATOM   1103  C CB   . ALA A 1 69 ? 11.051  -4.769  -18.676 1.00 10.08 ? 69 ALA A CB   1  
ATOM   1104  H H    . ALA A 1 69 ? 10.989  -4.964  -16.113 1.00 9.89  ? 69 ALA A H    1  
ATOM   1105  H HA   . ALA A 1 69 ? 11.972  -2.969  -17.946 1.00 10.27 ? 69 ALA A HA   1  
ATOM   1106  H HB1  . ALA A 1 69 ? 10.330  -5.484  -18.310 1.00 10.12 ? 69 ALA A HB1  1  
ATOM   1107  H HB2  . ALA A 1 69 ? 10.772  -4.454  -19.671 1.00 10.12 ? 69 ALA A HB2  1  
ATOM   1108  H HB3  . ALA A 1 69 ? 12.029  -5.227  -18.706 1.00 10.18 ? 69 ALA A HB3  1  
ATOM   1109  N N    . GLU A 1 70 ? 10.023  -1.425  -18.274 1.00 11.37 ? 70 GLU A N    1  
ATOM   1110  C CA   . GLU A 1 70 ? 8.852   -0.523  -18.501 1.00 12.24 ? 70 GLU A CA   1  
ATOM   1111  C C    . GLU A 1 70 ? 8.678   -0.253  -20.000 1.00 12.45 ? 70 GLU A C    1  
ATOM   1112  O O    . GLU A 1 70 ? 7.630   -0.516  -20.562 1.00 12.32 ? 70 GLU A O    1  
ATOM   1113  C CB   . GLU A 1 70 ? 9.075   0.798   -17.759 1.00 12.79 ? 70 GLU A CB   1  
ATOM   1114  C CG   . GLU A 1 70 ? 8.817   0.592   -16.262 1.00 12.48 ? 70 GLU A CG   1  
ATOM   1115  C CD   . GLU A 1 70 ? 9.751   1.493   -15.448 1.00 13.18 ? 70 GLU A CD   1  
ATOM   1116  O OE1  . GLU A 1 70 ? 10.904  1.125   -15.283 1.00 13.39 ? 70 GLU A OE1  1  
ATOM   1117  O OE2  . GLU A 1 70 ? 9.297   2.533   -14.999 1.00 13.63 ? 70 GLU A OE2  1  
ATOM   1118  H H    . GLU A 1 70 ? 10.934  -1.065  -18.336 1.00 11.26 ? 70 GLU A H    1  
ATOM   1119  H HA   . GLU A 1 70 ? 7.959   -0.998  -18.120 1.00 12.53 ? 70 GLU A HA   1  
ATOM   1120  H HB2  . GLU A 1 70 ? 10.094  1.127   -17.908 1.00 13.03 ? 70 GLU A HB2  1  
ATOM   1121  H HB3  . GLU A 1 70 ? 8.396   1.545   -18.139 1.00 13.32 ? 70 GLU A HB3  1  
ATOM   1122  H HG2  . GLU A 1 70 ? 7.790   0.839   -16.037 1.00 12.20 ? 70 GLU A HG2  1  
ATOM   1123  H HG3  . GLU A 1 70 ? 9.004   -0.440  -16.005 1.00 12.23 ? 70 GLU A HG3  1  
ATOM   1124  N N    . ASN A 1 71 ? 9.688   0.273   -20.652 1.00 12.96 ? 71 ASN A N    1  
ATOM   1125  C CA   . ASN A 1 71 ? 9.571   0.562   -22.114 1.00 13.39 ? 71 ASN A CA   1  
ATOM   1126  C C    . ASN A 1 71 ? 10.946  0.457   -22.785 1.00 13.77 ? 71 ASN A C    1  
ATOM   1127  O O    . ASN A 1 71 ? 11.971  0.640   -22.153 1.00 13.98 ? 71 ASN A O    1  
ATOM   1128  C CB   . ASN A 1 71 ? 9.013   1.976   -22.309 1.00 13.14 ? 71 ASN A CB   1  
ATOM   1129  C CG   . ASN A 1 71 ? 8.202   2.032   -23.608 1.00 12.70 ? 71 ASN A CG   1  
ATOM   1130  O OD1  . ASN A 1 71 ? 7.044   1.665   -23.631 1.00 12.77 ? 71 ASN A OD1  1  
ATOM   1131  N ND2  . ASN A 1 71 ? 8.765   2.480   -24.699 1.00 12.41 ? 71 ASN A ND2  1  
ATOM   1132  H H    . ASN A 1 71 ? 10.523  0.480   -20.178 1.00 13.17 ? 71 ASN A H    1  
ATOM   1133  H HA   . ASN A 1 71 ? 8.899   -0.153  -22.566 1.00 13.80 ? 71 ASN A HA   1  
ATOM   1134  H HB2  . ASN A 1 71 ? 8.373   2.228   -21.475 1.00 13.36 ? 71 ASN A HB2  1  
ATOM   1135  H HB3  . ASN A 1 71 ? 9.828   2.682   -22.364 1.00 13.26 ? 71 ASN A HB3  1  
ATOM   1136  H HD21 . ASN A 1 71 ? 9.699   2.776   -24.684 1.00 12.47 ? 71 ASN A HD21 1  
ATOM   1137  H HD22 . ASN A 1 71 ? 8.252   2.519   -25.533 1.00 12.23 ? 71 ASN A HD22 1  
ATOM   1138  N N    . SER A 1 72 ? 10.964  0.163   -24.069 1.00 14.02 ? 72 SER A N    1  
ATOM   1139  C CA   . SER A 1 72 ? 12.257  0.038   -24.823 1.00 14.59 ? 72 SER A CA   1  
ATOM   1140  C C    . SER A 1 72 ? 13.100  -1.130  -24.264 1.00 15.09 ? 72 SER A C    1  
ATOM   1141  O O    . SER A 1 72 ? 12.533  -1.996  -23.615 1.00 15.38 ? 72 SER A O    1  
ATOM   1142  C CB   . SER A 1 72 ? 13.047  1.353   -24.718 1.00 14.66 ? 72 SER A CB   1  
ATOM   1143  O OG   . SER A 1 72 ? 12.193  2.446   -25.033 1.00 14.60 ? 72 SER A OG   1  
ATOM   1144  O OXT  . SER A 1 72 ? 14.297  -1.144  -24.507 1.00 15.30 ? 72 SER A OXT  1  
ATOM   1145  H H    . SER A 1 72 ? 10.116  0.025   -24.544 1.00 13.94 ? 72 SER A H    1  
ATOM   1146  H HA   . SER A 1 72 ? 12.038  -0.157  -25.863 1.00 14.77 ? 72 SER A HA   1  
ATOM   1147  H HB2  . SER A 1 72 ? 13.419  1.471   -23.715 1.00 14.69 ? 72 SER A HB2  1  
ATOM   1148  H HB3  . SER A 1 72 ? 13.882  1.325   -25.406 1.00 14.91 ? 72 SER A HB3  1  
ATOM   1149  H HG   . SER A 1 72 ? 11.931  2.867   -24.210 1.00 14.50 ? 72 SER A HG   1  
ATOM   1150  N N    . GLU A 1 4  ? -6.336  15.000  -9.679  1.00 9.58  ? 4  GLU A N    2  
ATOM   1151  C CA   . GLU A 1 4  ? -7.610  15.752  -9.465  1.00 9.09  ? 4  GLU A CA   2  
ATOM   1152  C C    . GLU A 1 4  ? -8.644  14.841  -8.779  1.00 8.06  ? 4  GLU A C    2  
ATOM   1153  O O    . GLU A 1 4  ? -9.788  14.760  -9.193  1.00 8.10  ? 4  GLU A O    2  
ATOM   1154  C CB   . GLU A 1 4  ? -8.147  16.231  -10.820 1.00 9.77  ? 4  GLU A CB   2  
ATOM   1155  C CG   . GLU A 1 4  ? -8.993  17.494  -10.625 1.00 10.24 ? 4  GLU A CG   2  
ATOM   1156  C CD   . GLU A 1 4  ? -8.942  18.347  -11.896 1.00 11.04 ? 4  GLU A CD   2  
ATOM   1157  O OE1  . GLU A 1 4  ? -9.780  18.140  -12.759 1.00 11.49 ? 4  GLU A OE1  2  
ATOM   1158  O OE2  . GLU A 1 4  ? -8.067  19.192  -11.984 1.00 11.36 ? 4  GLU A OE2  2  
ATOM   1159  H H    . GLU A 1 4  ? -6.547  14.056  -10.061 1.00 9.81  ? 4  GLU A H    2  
ATOM   1160  H HA   . GLU A 1 4  ? -7.416  16.608  -8.834  1.00 9.22  ? 4  GLU A HA   2  
ATOM   1161  H HB2  . GLU A 1 4  ? -7.319  16.452  -11.477 1.00 9.96  ? 4  GLU A HB2  2  
ATOM   1162  H HB3  . GLU A 1 4  ? -8.757  15.457  -11.260 1.00 9.97  ? 4  GLU A HB3  2  
ATOM   1163  H HG2  . GLU A 1 4  ? -10.016 17.213  -10.419 1.00 10.27 ? 4  GLU A HG2  2  
ATOM   1164  H HG3  . GLU A 1 4  ? -8.602  18.064  -9.796  1.00 10.19 ? 4  GLU A HG3  2  
ATOM   1165  N N    . LEU A 1 5  ? -8.250  14.158  -7.730  1.00 7.36  ? 5  LEU A N    2  
ATOM   1166  C CA   . LEU A 1 5  ? -9.199  13.254  -7.010  1.00 6.53  ? 5  LEU A CA   2  
ATOM   1167  C C    . LEU A 1 5  ? -8.652  12.951  -5.611  1.00 6.17  ? 5  LEU A C    2  
ATOM   1168  O O    . LEU A 1 5  ? -7.489  12.632  -5.452  1.00 6.61  ? 5  LEU A O    2  
ATOM   1169  C CB   . LEU A 1 5  ? -9.354  11.942  -7.790  1.00 6.34  ? 5  LEU A CB   2  
ATOM   1170  C CG   . LEU A 1 5  ? -10.497 11.117  -7.190  1.00 7.26  ? 5  LEU A CG   2  
ATOM   1171  C CD1  . LEU A 1 5  ? -11.826 11.549  -7.813  1.00 7.60  ? 5  LEU A CD1  2  
ATOM   1172  C CD2  . LEU A 1 5  ? -10.259 9.631   -7.473  1.00 7.86  ? 5  LEU A CD2  2  
ATOM   1173  H H    . LEU A 1 5  ? -7.325  14.242  -7.412  1.00 7.57  ? 5  LEU A H    2  
ATOM   1174  H HA   . LEU A 1 5  ? -10.161 13.738  -6.922  1.00 6.63  ? 5  LEU A HA   2  
ATOM   1175  H HB2  . LEU A 1 5  ? -9.571  12.163  -8.824  1.00 5.88  ? 5  LEU A HB2  2  
ATOM   1176  H HB3  . LEU A 1 5  ? -8.435  11.379  -7.726  1.00 6.33  ? 5  LEU A HB3  2  
ATOM   1177  H HG   . LEU A 1 5  ? -10.535 11.279  -6.121  1.00 7.52  ? 5  LEU A HG   2  
ATOM   1178  H HD11 . LEU A 1 5  ? -11.942 12.617  -7.710  1.00 7.97  ? 5  LEU A HD11 2  
ATOM   1179  H HD12 . LEU A 1 5  ? -11.836 11.285  -8.860  1.00 8.07  ? 5  LEU A HD12 2  
ATOM   1180  H HD13 . LEU A 1 5  ? -12.640 11.048  -7.309  1.00 7.24  ? 5  LEU A HD13 2  
ATOM   1181  H HD21 . LEU A 1 5  ? -10.074 9.490   -8.528  1.00 7.79  ? 5  LEU A HD21 2  
ATOM   1182  H HD22 . LEU A 1 5  ? -9.404  9.289   -6.909  1.00 8.13  ? 5  LEU A HD22 2  
ATOM   1183  H HD23 . LEU A 1 5  ? -11.132 9.065   -7.181  1.00 8.35  ? 5  LEU A HD23 2  
ATOM   1184  N N    . ARG A 1 6  ? -9.485  13.045  -4.601  1.00 5.61  ? 6  ARG A N    2  
ATOM   1185  C CA   . ARG A 1 6  ? -9.028  12.765  -3.206  1.00 5.48  ? 6  ARG A CA   2  
ATOM   1186  C C    . ARG A 1 6  ? -8.596  11.299  -3.070  1.00 4.69  ? 6  ARG A C    2  
ATOM   1187  O O    . ARG A 1 6  ? -8.627  10.538  -4.022  1.00 4.64  ? 6  ARG A O    2  
ATOM   1188  C CB   . ARG A 1 6  ? -10.172 13.053  -2.224  1.00 6.06  ? 6  ARG A CB   2  
ATOM   1189  C CG   . ARG A 1 6  ? -11.422 12.252  -2.613  1.00 6.84  ? 6  ARG A CG   2  
ATOM   1190  C CD   . ARG A 1 6  ? -12.522 13.207  -3.088  1.00 7.76  ? 6  ARG A CD   2  
ATOM   1191  N NE   . ARG A 1 6  ? -13.382 13.600  -1.933  1.00 8.57  ? 6  ARG A NE   2  
ATOM   1192  C CZ   . ARG A 1 6  ? -14.304 12.781  -1.492  1.00 9.27  ? 6  ARG A CZ   2  
ATOM   1193  N NH1  . ARG A 1 6  ? -15.361 12.532  -2.224  1.00 9.77  ? 6  ARG A NH1  2  
ATOM   1194  N NH2  . ARG A 1 6  ? -14.169 12.213  -0.322  1.00 9.70  ? 6  ARG A NH2  2  
ATOM   1195  H H    . ARG A 1 6  ? -10.416 13.303  -4.760  1.00 5.45  ? 6  ARG A H    2  
ATOM   1196  H HA   . ARG A 1 6  ? -8.190  13.405  -2.972  1.00 5.83  ? 6  ARG A HA   2  
ATOM   1197  H HB2  . ARG A 1 6  ? -9.864  12.773  -1.233  1.00 6.17  ? 6  ARG A HB2  2  
ATOM   1198  H HB3  . ARG A 1 6  ? -10.400 14.105  -2.242  1.00 6.11  ? 6  ARG A HB3  2  
ATOM   1199  H HG2  . ARG A 1 6  ? -11.176 11.563  -3.407  1.00 6.68  ? 6  ARG A HG2  2  
ATOM   1200  H HG3  . ARG A 1 6  ? -11.775 11.700  -1.755  1.00 7.20  ? 6  ARG A HG3  2  
ATOM   1201  H HD2  . ARG A 1 6  ? -12.072 14.090  -3.517  1.00 8.01  ? 6  ARG A HD2  2  
ATOM   1202  H HD3  . ARG A 1 6  ? -13.127 12.714  -3.835  1.00 7.82  ? 6  ARG A HD3  2  
ATOM   1203  H HE   . ARG A 1 6  ? -13.255 14.470  -1.501  1.00 8.74  ? 6  ARG A HE   2  
ATOM   1204  H HH11 . ARG A 1 6  ? -15.465 12.967  -3.119  1.00 9.63  ? 6  ARG A HH11 2  
ATOM   1205  H HH12 . ARG A 1 6  ? -16.066 11.907  -1.888  1.00 10.41 ? 6  ARG A HH12 2  
ATOM   1206  H HH21 . ARG A 1 6  ? -13.361 12.404  0.237   1.00 9.50  ? 6  ARG A HH21 2  
ATOM   1207  H HH22 . ARG A 1 6  ? -14.873 11.588  0.016   1.00 10.35 ? 6  ARG A HH22 2  
ATOM   1208  N N    . CYS A 1 7  ? -8.192  10.899  -1.888  1.00 4.47  ? 7  CYS A N    2  
ATOM   1209  C CA   . CYS A 1 7  ? -7.755  9.487   -1.681  1.00 4.05  ? 7  CYS A CA   2  
ATOM   1210  C C    . CYS A 1 7  ? -8.962  8.552   -1.800  1.00 4.38  ? 7  CYS A C    2  
ATOM   1211  O O    . CYS A 1 7  ? -9.938  8.692   -1.086  1.00 4.93  ? 7  CYS A O    2  
ATOM   1212  C CB   . CYS A 1 7  ? -7.137  9.333   -0.291  1.00 4.32  ? 7  CYS A CB   2  
ATOM   1213  S SG   . CYS A 1 7  ? -5.397  9.823   -0.346  1.00 4.79  ? 7  CYS A SG   2  
ATOM   1214  H H    . CYS A 1 7  ? -8.178  11.531  -1.137  1.00 4.87  ? 7  CYS A H    2  
ATOM   1215  H HA   . CYS A 1 7  ? -7.022  9.228   -2.429  1.00 3.89  ? 7  CYS A HA   2  
ATOM   1216  H HB2  . CYS A 1 7  ? -7.667  9.958   0.410   1.00 4.81  ? 7  CYS A HB2  2  
ATOM   1217  H HB3  . CYS A 1 7  ? -7.211  8.304   0.020   1.00 4.30  ? 7  CYS A HB3  2  
ATOM   1218  N N    . GLN A 1 8  ? -8.897  7.595   -2.693  1.00 4.51  ? 8  GLN A N    2  
ATOM   1219  C CA   . GLN A 1 8  ? -10.033 6.637   -2.856  1.00 5.30  ? 8  GLN A CA   2  
ATOM   1220  C C    . GLN A 1 8  ? -9.955  5.531   -1.787  1.00 5.47  ? 8  GLN A C    2  
ATOM   1221  O O    . GLN A 1 8  ? -10.823 4.682   -1.711  1.00 6.21  ? 8  GLN A O    2  
ATOM   1222  C CB   . GLN A 1 8  ? -9.971  6.004   -4.252  1.00 5.63  ? 8  GLN A CB   2  
ATOM   1223  C CG   . GLN A 1 8  ? -11.361 6.034   -4.895  1.00 6.22  ? 8  GLN A CG   2  
ATOM   1224  C CD   . GLN A 1 8  ? -12.112 4.740   -4.559  1.00 7.21  ? 8  GLN A CD   2  
ATOM   1225  O OE1  . GLN A 1 8  ? -11.788 3.686   -5.070  1.00 7.78  ? 8  GLN A OE1  2  
ATOM   1226  N NE2  . GLN A 1 8  ? -13.109 4.775   -3.716  1.00 7.68  ? 8  GLN A NE2  2  
ATOM   1227  H H    . GLN A 1 8  ? -8.095  7.500   -3.251  1.00 4.40  ? 8  GLN A H    2  
ATOM   1228  H HA   . GLN A 1 8  ? -10.966 7.171   -2.747  1.00 5.87  ? 8  GLN A HA   2  
ATOM   1229  H HB2  . GLN A 1 8  ? -9.278  6.561   -4.867  1.00 5.62  ? 8  GLN A HB2  2  
ATOM   1230  H HB3  . GLN A 1 8  ? -9.635  4.981   -4.169  1.00 5.89  ? 8  GLN A HB3  2  
ATOM   1231  H HG2  . GLN A 1 8  ? -11.914 6.881   -4.516  1.00 6.11  ? 8  GLN A HG2  2  
ATOM   1232  H HG3  . GLN A 1 8  ? -11.259 6.120   -5.966  1.00 6.39  ? 8  GLN A HG3  2  
ATOM   1233  H HE21 . GLN A 1 8  ? -13.373 5.623   -3.301  1.00 7.43  ? 8  GLN A HE21 2  
ATOM   1234  H HE22 . GLN A 1 8  ? -13.595 3.952   -3.499  1.00 8.44  ? 8  GLN A HE22 2  
ATOM   1235  N N    . CYS A 1 9  ? -8.924  5.528   -0.965  1.00 5.04  ? 9  CYS A N    2  
ATOM   1236  C CA   . CYS A 1 9  ? -8.800  4.476   0.082   1.00 5.45  ? 9  CYS A CA   2  
ATOM   1237  C C    . CYS A 1 9  ? -8.705  5.132   1.461   1.00 5.99  ? 9  CYS A C    2  
ATOM   1238  O O    . CYS A 1 9  ? -7.674  5.659   1.840   1.00 6.13  ? 9  CYS A O    2  
ATOM   1239  C CB   . CYS A 1 9  ? -7.539  3.655   -0.187  1.00 5.08  ? 9  CYS A CB   2  
ATOM   1240  S SG   . CYS A 1 9  ? -7.949  2.249   -1.252  1.00 5.12  ? 9  CYS A SG   2  
ATOM   1241  H H    . CYS A 1 9  ? -8.230  6.215   -1.038  1.00 4.65  ? 9  CYS A H    2  
ATOM   1242  H HA   . CYS A 1 9  ? -9.663  3.827   0.053   1.00 5.89  ? 9  CYS A HA   2  
ATOM   1243  H HB2  . CYS A 1 9  ? -6.803  4.275   -0.675  1.00 4.67  ? 9  CYS A HB2  2  
ATOM   1244  H HB3  . CYS A 1 9  ? -7.141  3.297   0.747   1.00 5.54  ? 9  CYS A HB3  2  
ATOM   1245  N N    . ILE A 1 10 ? -9.774  5.088   2.220   1.00 6.61  ? 10 ILE A N    2  
ATOM   1246  C CA   . ILE A 1 10 ? -9.757  5.693   3.589   1.00 7.44  ? 10 ILE A CA   2  
ATOM   1247  C C    . ILE A 1 10 ? -8.869  4.837   4.507   1.00 7.48  ? 10 ILE A C    2  
ATOM   1248  O O    . ILE A 1 10 ? -8.241  5.341   5.418   1.00 8.16  ? 10 ILE A O    2  
ATOM   1249  C CB   . ILE A 1 10 ? -11.188 5.740   4.153   1.00 8.38  ? 10 ILE A CB   2  
ATOM   1250  C CG1  . ILE A 1 10 ? -12.095 6.530   3.199   1.00 8.63  ? 10 ILE A CG1  2  
ATOM   1251  C CG2  . ILE A 1 10 ? -11.185 6.425   5.524   1.00 9.31  ? 10 ILE A CG2  2  
ATOM   1252  C CD1  . ILE A 1 10 ? -13.067 5.574   2.504   1.00 9.47  ? 10 ILE A CD1  2  
ATOM   1253  H H    . ILE A 1 10 ? -10.586 4.648   1.892   1.00 6.69  ? 10 ILE A H    2  
ATOM   1254  H HA   . ILE A 1 10 ? -9.357  6.694   3.535   1.00 7.59  ? 10 ILE A HA   2  
ATOM   1255  H HB   . ILE A 1 10 ? -11.564 4.733   4.259   1.00 8.40  ? 10 ILE A HB   2  
ATOM   1256  H HG12 . ILE A 1 10 ? -12.654 7.265   3.761   1.00 8.91  ? 10 ILE A HG12 2  
ATOM   1257  H HG13 . ILE A 1 10 ? -11.491 7.029   2.456   1.00 8.14  ? 10 ILE A HG13 2  
ATOM   1258  H HG21 . ILE A 1 10 ? -10.780 7.422   5.429   1.00 9.78  ? 10 ILE A HG21 2  
ATOM   1259  H HG22 . ILE A 1 10 ? -12.196 6.483   5.900   1.00 9.72  ? 10 ILE A HG22 2  
ATOM   1260  H HG23 . ILE A 1 10 ? -10.577 5.855   6.211   1.00 9.27  ? 10 ILE A HG23 2  
ATOM   1261  H HD11 . ILE A 1 10 ? -13.127 4.651   3.063   1.00 9.66  ? 10 ILE A HD11 2  
ATOM   1262  H HD12 . ILE A 1 10 ? -14.045 6.027   2.453   1.00 9.77  ? 10 ILE A HD12 2  
ATOM   1263  H HD13 . ILE A 1 10 ? -12.714 5.366   1.504   1.00 9.76  ? 10 ILE A HD13 2  
ATOM   1264  N N    . LYS A 1 11 ? -8.813  3.548   4.261   1.00 6.93  ? 11 LYS A N    2  
ATOM   1265  C CA   . LYS A 1 11 ? -7.968  2.646   5.101   1.00 7.15  ? 11 LYS A CA   2  
ATOM   1266  C C    . LYS A 1 11 ? -6.876  2.013   4.231   1.00 6.42  ? 11 LYS A C    2  
ATOM   1267  O O    . LYS A 1 11 ? -6.941  2.052   3.014   1.00 6.35  ? 11 LYS A O    2  
ATOM   1268  C CB   . LYS A 1 11 ? -8.843  1.540   5.702   1.00 8.05  ? 11 LYS A CB   2  
ATOM   1269  C CG   . LYS A 1 11 ? -9.665  2.107   6.863   1.00 8.65  ? 11 LYS A CG   2  
ATOM   1270  C CD   . LYS A 1 11 ? -8.841  2.049   8.151   1.00 9.04  ? 11 LYS A CD   2  
ATOM   1271  C CE   . LYS A 1 11 ? -9.510  2.909   9.226   1.00 9.50  ? 11 LYS A CE   2  
ATOM   1272  N NZ   . LYS A 1 11 ? -9.176  2.374   10.578  1.00 9.69  ? 11 LYS A NZ   2  
ATOM   1273  H H    . LYS A 1 11 ? -9.327  3.171   3.513   1.00 6.52  ? 11 LYS A H    2  
ATOM   1274  H HA   . LYS A 1 11 ? -7.509  3.216   5.897   1.00 7.36  ? 11 LYS A HA   2  
ATOM   1275  H HB2  . LYS A 1 11 ? -9.508  1.157   4.942   1.00 8.15  ? 11 LYS A HB2  2  
ATOM   1276  H HB3  . LYS A 1 11 ? -8.215  0.741   6.065   1.00 8.38  ? 11 LYS A HB3  2  
ATOM   1277  H HG2  . LYS A 1 11 ? -9.931  3.132   6.649   1.00 9.16  ? 11 LYS A HG2  2  
ATOM   1278  H HG3  . LYS A 1 11 ? -10.564 1.521   6.986   1.00 8.50  ? 11 LYS A HG3  2  
ATOM   1279  H HD2  . LYS A 1 11 ? -8.780  1.026   8.493   1.00 9.00  ? 11 LYS A HD2  2  
ATOM   1280  H HD3  . LYS A 1 11 ? -7.847  2.425   7.961   1.00 9.26  ? 11 LYS A HD3  2  
ATOM   1281  H HE2  . LYS A 1 11 ? -9.156  3.926   9.145   1.00 9.79  ? 11 LYS A HE2  2  
ATOM   1282  H HE3  . LYS A 1 11 ? -10.582 2.890   9.088   1.00 9.62  ? 11 LYS A HE3  2  
ATOM   1283  H HZ1  . LYS A 1 11 ? -8.142  2.319   10.684  1.00 9.61  ? 11 LYS A HZ1  2  
ATOM   1284  H HZ2  . LYS A 1 11 ? -9.562  3.006   11.306  1.00 9.96  ? 11 LYS A HZ2  2  
ATOM   1285  H HZ3  . LYS A 1 11 ? -9.588  1.424   10.687  1.00 9.86  ? 11 LYS A HZ3  2  
ATOM   1286  N N    . THR A 1 12 ? -5.871  1.430   4.841   1.00 6.02  ? 12 THR A N    2  
ATOM   1287  C CA   . THR A 1 12 ? -4.776  0.797   4.043   1.00 5.35  ? 12 THR A CA   2  
ATOM   1288  C C    . THR A 1 12 ? -4.418  -0.585  4.598   1.00 5.31  ? 12 THR A C    2  
ATOM   1289  O O    . THR A 1 12 ? -5.131  -1.153  5.407   1.00 5.80  ? 12 THR A O    2  
ATOM   1290  C CB   . THR A 1 12 ? -3.527  1.688   4.046   1.00 5.23  ? 12 THR A CB   2  
ATOM   1291  O OG1  . THR A 1 12 ? -3.585  2.619   5.119   1.00 5.90  ? 12 THR A OG1  2  
ATOM   1292  C CG2  . THR A 1 12 ? -3.443  2.427   2.717   1.00 5.32  ? 12 THR A CG2  2  
ATOM   1293  H H    . THR A 1 12 ? -5.837  1.410   5.822   1.00 6.26  ? 12 THR A H    2  
ATOM   1294  H HA   . THR A 1 12 ? -5.112  0.678   3.026   1.00 5.27  ? 12 THR A HA   2  
ATOM   1295  H HB   . THR A 1 12 ? -2.650  1.069   4.155   1.00 4.85  ? 12 THR A HB   2  
ATOM   1296  H HG1  . THR A 1 12 ? -3.201  2.202   5.894   1.00 6.31  ? 12 THR A HG1  2  
ATOM   1297  H HG21 . THR A 1 12 ? -3.401  1.707   1.912   1.00 5.52  ? 12 THR A HG21 2  
ATOM   1298  H HG22 . THR A 1 12 ? -4.315  3.051   2.597   1.00 5.48  ? 12 THR A HG22 2  
ATOM   1299  H HG23 . THR A 1 12 ? -2.554  3.037   2.701   1.00 5.41  ? 12 THR A HG23 2  
ATOM   1300  N N    . TYR A 1 13 ? -3.325  -1.133  4.131   1.00 4.96  ? 13 TYR A N    2  
ATOM   1301  C CA   . TYR A 1 13 ? -2.896  -2.484  4.568   1.00 5.03  ? 13 TYR A CA   2  
ATOM   1302  C C    . TYR A 1 13 ? -1.656  -2.380  5.459   1.00 5.08  ? 13 TYR A C    2  
ATOM   1303  O O    . TYR A 1 13 ? -0.660  -1.788  5.086   1.00 4.67  ? 13 TYR A O    2  
ATOM   1304  C CB   . TYR A 1 13 ? -2.556  -3.301  3.317   1.00 4.85  ? 13 TYR A CB   2  
ATOM   1305  C CG   . TYR A 1 13 ? -2.616  -4.779  3.602   1.00 5.22  ? 13 TYR A CG   2  
ATOM   1306  C CD1  . TYR A 1 13 ? -3.415  -5.272  4.637   1.00 5.34  ? 13 TYR A CD1  2  
ATOM   1307  C CD2  . TYR A 1 13 ? -1.857  -5.653  2.820   1.00 5.75  ? 13 TYR A CD2  2  
ATOM   1308  C CE1  . TYR A 1 13 ? -3.457  -6.647  4.893   1.00 5.79  ? 13 TYR A CE1  2  
ATOM   1309  C CE2  . TYR A 1 13 ? -1.897  -7.030  3.073   1.00 6.30  ? 13 TYR A CE2  2  
ATOM   1310  C CZ   . TYR A 1 13 ? -2.697  -7.528  4.111   1.00 6.23  ? 13 TYR A CZ   2  
ATOM   1311  O OH   . TYR A 1 13 ? -2.736  -8.885  4.363   1.00 6.84  ? 13 TYR A OH   2  
ATOM   1312  H H    . TYR A 1 13 ? -2.792  -0.655  3.463   1.00 4.82  ? 13 TYR A H    2  
ATOM   1313  H HA   . TYR A 1 13 ? -3.695  -2.961  5.109   1.00 5.34  ? 13 TYR A HA   2  
ATOM   1314  H HB2  . TYR A 1 13 ? -3.259  -3.062  2.533   1.00 4.90  ? 13 TYR A HB2  2  
ATOM   1315  H HB3  . TYR A 1 13 ? -1.559  -3.048  2.991   1.00 4.67  ? 13 TYR A HB3  2  
ATOM   1316  H HD1  . TYR A 1 13 ? -4.003  -4.589  5.234   1.00 5.30  ? 13 TYR A HD1  2  
ATOM   1317  H HD2  . TYR A 1 13 ? -1.242  -5.261  2.018   1.00 5.92  ? 13 TYR A HD2  2  
ATOM   1318  H HE1  . TYR A 1 13 ? -4.075  -7.030  5.693   1.00 5.99  ? 13 TYR A HE1  2  
ATOM   1319  H HE2  . TYR A 1 13 ? -1.311  -7.708  2.471   1.00 6.92  ? 13 TYR A HE2  2  
ATOM   1320  H HH   . TYR A 1 13 ? -3.610  -9.206  4.132   1.00 7.17  ? 13 TYR A HH   2  
ATOM   1321  N N    . SER A 1 14 ? -1.709  -2.973  6.626   1.00 5.82  ? 14 SER A N    2  
ATOM   1322  C CA   . SER A 1 14 ? -0.535  -2.939  7.546   1.00 6.06  ? 14 SER A CA   2  
ATOM   1323  C C    . SER A 1 14 ? 0.221   -4.269  7.446   1.00 6.51  ? 14 SER A C    2  
ATOM   1324  O O    . SER A 1 14 ? 1.434   -4.303  7.536   1.00 6.88  ? 14 SER A O    2  
ATOM   1325  C CB   . SER A 1 14 ? -1.005  -2.717  8.988   1.00 6.42  ? 14 SER A CB   2  
ATOM   1326  O OG   . SER A 1 14 ? -1.936  -3.732  9.349   1.00 6.80  ? 14 SER A OG   2  
ATOM   1327  H H    . SER A 1 14 ? -2.521  -3.454  6.890   1.00 6.33  ? 14 SER A H    2  
ATOM   1328  H HA   . SER A 1 14 ? 0.126   -2.138  7.254   1.00 5.81  ? 14 SER A HA   2  
ATOM   1329  H HB2  . SER A 1 14 ? -0.160  -2.759  9.655   1.00 6.57  ? 14 SER A HB2  2  
ATOM   1330  H HB3  . SER A 1 14 ? -1.472  -1.744  9.065   1.00 6.52  ? 14 SER A HB3  2  
ATOM   1331  H HG   . SER A 1 14 ? -2.819  -3.361  9.289   1.00 7.03  ? 14 SER A HG   2  
ATOM   1332  N N    . LYS A 1 15 ? -0.484  -5.359  7.244   1.00 6.59  ? 15 LYS A N    2  
ATOM   1333  C CA   . LYS A 1 15 ? 0.199   -6.679  7.120   1.00 7.06  ? 15 LYS A CA   2  
ATOM   1334  C C    . LYS A 1 15 ? 0.846   -6.758  5.733   1.00 6.32  ? 15 LYS A C    2  
ATOM   1335  O O    . LYS A 1 15 ? 0.271   -6.313  4.762   1.00 6.13  ? 15 LYS A O    2  
ATOM   1336  C CB   . LYS A 1 15 ? -0.792  -7.839  7.274   1.00 7.75  ? 15 LYS A CB   2  
ATOM   1337  C CG   . LYS A 1 15 ? -2.007  -7.419  8.116   1.00 8.64  ? 15 LYS A CG   2  
ATOM   1338  C CD   . LYS A 1 15 ? -2.541  -8.627  8.891   1.00 9.43  ? 15 LYS A CD   2  
ATOM   1339  C CE   . LYS A 1 15 ? -1.940  -8.641  10.301  1.00 10.20 ? 15 LYS A CE   2  
ATOM   1340  N NZ   . LYS A 1 15 ? -0.567  -9.224  10.259  1.00 10.59 ? 15 LYS A NZ   2  
ATOM   1341  H H    . LYS A 1 15 ? -1.457  -5.305  7.163   1.00 6.42  ? 15 LYS A H    2  
ATOM   1342  H HA   . LYS A 1 15 ? 0.960   -6.756  7.881   1.00 7.57  ? 15 LYS A HA   2  
ATOM   1343  H HB2  . LYS A 1 15 ? -1.115  -8.149  6.299   1.00 7.79  ? 15 LYS A HB2  2  
ATOM   1344  H HB3  . LYS A 1 15 ? -0.297  -8.659  7.755   1.00 7.79  ? 15 LYS A HB3  2  
ATOM   1345  H HG2  . LYS A 1 15 ? -1.713  -6.647  8.812   1.00 8.72  ? 15 LYS A HG2  2  
ATOM   1346  H HG3  . LYS A 1 15 ? -2.782  -7.041  7.467   1.00 8.87  ? 15 LYS A HG3  2  
ATOM   1347  H HD2  . LYS A 1 15 ? -3.617  -8.562  8.959   1.00 9.71  ? 15 LYS A HD2  2  
ATOM   1348  H HD3  . LYS A 1 15 ? -2.268  -9.537  8.377   1.00 9.38  ? 15 LYS A HD3  2  
ATOM   1349  H HE2  . LYS A 1 15 ? -1.890  -7.631  10.681  1.00 10.54 ? 15 LYS A HE2  2  
ATOM   1350  H HE3  . LYS A 1 15 ? -2.563  -9.238  10.951  1.00 10.33 ? 15 LYS A HE3  2  
ATOM   1351  H HZ1  . LYS A 1 15 ? -0.570  -10.080 9.667   1.00 10.91 ? 15 LYS A HZ1  2  
ATOM   1352  H HZ2  . LYS A 1 15 ? 0.094   -8.528  9.859   1.00 10.22 ? 15 LYS A HZ2  2  
ATOM   1353  H HZ3  . LYS A 1 15 ? -0.265  -9.471  11.221  1.00 11.09 ? 15 LYS A HZ3  2  
ATOM   1354  N N    . PRO A 1 16 ? 2.034   -7.300  5.689   1.00 6.02  ? 16 PRO A N    2  
ATOM   1355  C CA   . PRO A 1 16 ? 2.809   -7.428  4.444   1.00 5.35  ? 16 PRO A CA   2  
ATOM   1356  C C    . PRO A 1 16 ? 2.398   -8.677  3.655   1.00 5.50  ? 16 PRO A C    2  
ATOM   1357  O O    . PRO A 1 16 ? 1.803   -9.595  4.190   1.00 6.37  ? 16 PRO A O    2  
ATOM   1358  C CB   . PRO A 1 16 ? 4.247   -7.550  4.948   1.00 5.39  ? 16 PRO A CB   2  
ATOM   1359  C CG   . PRO A 1 16 ? 4.164   -8.069  6.407   1.00 6.26  ? 16 PRO A CG   2  
ATOM   1360  C CD   . PRO A 1 16 ? 2.718   -7.833  6.878   1.00 6.51  ? 16 PRO A CD   2  
ATOM   1361  H HA   . PRO A 1 16 ? 2.709   -6.545  3.837   1.00 4.92  ? 16 PRO A HA   2  
ATOM   1362  H HB2  . PRO A 1 16 ? 4.794   -8.240  4.335   1.00 5.32  ? 16 PRO A HB2  2  
ATOM   1363  H HB3  . PRO A 1 16 ? 4.723   -6.588  4.933   1.00 5.10  ? 16 PRO A HB3  2  
ATOM   1364  H HG2  . PRO A 1 16 ? 4.399   -9.125  6.438   1.00 6.77  ? 16 PRO A HG2  2  
ATOM   1365  H HG3  . PRO A 1 16 ? 4.846   -7.518  7.036   1.00 6.37  ? 16 PRO A HG3  2  
ATOM   1366  H HD2  . PRO A 1 16 ? 2.264   -8.766  7.186   1.00 7.06  ? 16 PRO A HD2  2  
ATOM   1367  H HD3  . PRO A 1 16 ? 2.683   -7.114  7.677   1.00 6.63  ? 16 PRO A HD3  2  
ATOM   1368  N N    . PHE A 1 17 ? 2.727   -8.716  2.385   1.00 4.76  ? 17 PHE A N    2  
ATOM   1369  C CA   . PHE A 1 17 ? 2.376   -9.905  1.544   1.00 4.96  ? 17 PHE A CA   2  
ATOM   1370  C C    . PHE A 1 17 ? 3.221   -9.907  0.258   1.00 4.78  ? 17 PHE A C    2  
ATOM   1371  O O    . PHE A 1 17 ? 3.734   -8.884  -0.161  1.00 4.77  ? 17 PHE A O    2  
ATOM   1372  C CB   . PHE A 1 17 ? 0.869   -9.897  1.213   1.00 4.69  ? 17 PHE A CB   2  
ATOM   1373  C CG   . PHE A 1 17 ? 0.526   -8.830  0.193   1.00 3.72  ? 17 PHE A CG   2  
ATOM   1374  C CD1  . PHE A 1 17 ? 0.567   -7.475  0.544   1.00 3.29  ? 17 PHE A CD1  2  
ATOM   1375  C CD2  . PHE A 1 17 ? 0.150   -9.203  -1.105  1.00 3.74  ? 17 PHE A CD2  2  
ATOM   1376  C CE1  . PHE A 1 17 ? 0.234   -6.496  -0.401  1.00 2.59  ? 17 PHE A CE1  2  
ATOM   1377  C CE2  . PHE A 1 17 ? -0.181  -8.225  -2.048  1.00 3.14  ? 17 PHE A CE2  2  
ATOM   1378  C CZ   . PHE A 1 17 ? -0.140  -6.872  -1.696  1.00 2.38  ? 17 PHE A CZ   2  
ATOM   1379  H H    . PHE A 1 17 ? 3.216   -7.963  1.988   1.00 4.19  ? 17 PHE A H    2  
ATOM   1380  H HA   . PHE A 1 17 ? 2.604   -10.801 2.104   1.00 5.66  ? 17 PHE A HA   2  
ATOM   1381  H HB2  . PHE A 1 17 ? 0.591   -10.860 0.818   1.00 5.13  ? 17 PHE A HB2  2  
ATOM   1382  H HB3  . PHE A 1 17 ? 0.310   -9.714  2.119   1.00 5.06  ? 17 PHE A HB3  2  
ATOM   1383  H HD1  . PHE A 1 17 ? 0.853   -7.183  1.543   1.00 3.86  ? 17 PHE A HD1  2  
ATOM   1384  H HD2  . PHE A 1 17 ? 0.114   -10.248 -1.377  1.00 4.51  ? 17 PHE A HD2  2  
ATOM   1385  H HE1  . PHE A 1 17 ? 0.264   -5.451  -0.132  1.00 2.72  ? 17 PHE A HE1  2  
ATOM   1386  H HE2  . PHE A 1 17 ? -0.469  -8.513  -3.050  1.00 3.62  ? 17 PHE A HE2  2  
ATOM   1387  H HZ   . PHE A 1 17 ? -0.396  -6.117  -2.424  1.00 2.18  ? 17 PHE A HZ   2  
ATOM   1388  N N    . HIS A 1 18 ? 3.376   -11.059 -0.360  1.00 4.92  ? 18 HIS A N    2  
ATOM   1389  C CA   . HIS A 1 18 ? 4.196   -11.160 -1.608  1.00 5.06  ? 18 HIS A CA   2  
ATOM   1390  C C    . HIS A 1 18 ? 3.523   -10.354 -2.753  1.00 4.32  ? 18 HIS A C    2  
ATOM   1391  O O    . HIS A 1 18 ? 2.313   -10.345 -2.875  1.00 4.10  ? 18 HIS A O    2  
ATOM   1392  C CB   . HIS A 1 18 ? 4.364   -12.644 -1.939  1.00 5.95  ? 18 HIS A CB   2  
ATOM   1393  C CG   . HIS A 1 18 ? 4.868   -12.801 -3.326  1.00 6.25  ? 18 HIS A CG   2  
ATOM   1394  N ND1  . HIS A 1 18 ? 6.215   -12.879 -3.645  1.00 6.36  ? 18 HIS A ND1  2  
ATOM   1395  C CD2  . HIS A 1 18 ? 4.199   -12.884 -4.492  1.00 6.72  ? 18 HIS A CD2  2  
ATOM   1396  C CE1  . HIS A 1 18 ? 6.293   -13.001 -4.982  1.00 6.81  ? 18 HIS A CE1  2  
ATOM   1397  N NE2  . HIS A 1 18 ? 5.089   -13.016 -5.537  1.00 7.07  ? 18 HIS A NE2  2  
ATOM   1398  H H    . HIS A 1 18 ? 2.957   -11.868 0.006   1.00 5.11  ? 18 HIS A H    2  
ATOM   1399  H HA   . HIS A 1 18 ? 5.165   -10.740 -1.426  1.00 5.21  ? 18 HIS A HA   2  
ATOM   1400  H HB2  . HIS A 1 18 ? 5.068   -13.086 -1.250  1.00 6.63  ? 18 HIS A HB2  2  
ATOM   1401  H HB3  . HIS A 1 18 ? 3.413   -13.141 -1.844  1.00 5.84  ? 18 HIS A HB3  2  
ATOM   1402  H HD1  . HIS A 1 18 ? 6.967   -12.851 -3.017  1.00 6.36  ? 18 HIS A HD1  2  
ATOM   1403  H HD2  . HIS A 1 18 ? 3.137   -12.802 -4.582  1.00 7.00  ? 18 HIS A HD2  2  
ATOM   1404  H HE1  . HIS A 1 18 ? 7.211   -13.033 -5.542  1.00 7.12  ? 18 HIS A HE1  2  
ATOM   1405  N N    . PRO A 1 19 ? 4.347   -9.642  -3.513  1.00 4.16  ? 19 PRO A N    2  
ATOM   1406  C CA   . PRO A 1 19 ? 3.890   -8.738  -4.607  1.00 3.77  ? 19 PRO A CA   2  
ATOM   1407  C C    . PRO A 1 19 ? 3.449   -9.442  -5.902  1.00 4.27  ? 19 PRO A C    2  
ATOM   1408  O O    . PRO A 1 19 ? 2.472   -9.037  -6.502  1.00 4.32  ? 19 PRO A O    2  
ATOM   1409  C CB   . PRO A 1 19 ? 5.118   -7.869  -4.885  1.00 3.96  ? 19 PRO A CB   2  
ATOM   1410  C CG   . PRO A 1 19 ? 6.342   -8.665  -4.385  1.00 4.62  ? 19 PRO A CG   2  
ATOM   1411  C CD   . PRO A 1 19 ? 5.817   -9.676  -3.352  1.00 4.65  ? 19 PRO A CD   2  
ATOM   1412  H HA   . PRO A 1 19 ? 3.098   -8.111  -4.250  1.00 3.26  ? 19 PRO A HA   2  
ATOM   1413  H HB2  . PRO A 1 19 ? 5.204   -7.676  -5.945  1.00 4.26  ? 19 PRO A HB2  2  
ATOM   1414  H HB3  . PRO A 1 19 ? 5.044   -6.940  -4.342  1.00 3.57  ? 19 PRO A HB3  2  
ATOM   1415  H HG2  . PRO A 1 19 ? 6.805   -9.184  -5.215  1.00 5.23  ? 19 PRO A HG2  2  
ATOM   1416  H HG3  . PRO A 1 19 ? 7.052   -8.002  -3.919  1.00 4.63  ? 19 PRO A HG3  2  
ATOM   1417  H HD2  . PRO A 1 19 ? 6.201   -10.662 -3.567  1.00 5.29  ? 19 PRO A HD2  2  
ATOM   1418  H HD3  . PRO A 1 19 ? 6.088   -9.374  -2.354  1.00 4.56  ? 19 PRO A HD3  2  
ATOM   1419  N N    . LYS A 1 20 ? 4.162   -10.441 -6.370  1.00 4.91  ? 20 LYS A N    2  
ATOM   1420  C CA   . LYS A 1 20 ? 3.764   -11.104 -7.667  1.00 5.52  ? 20 LYS A CA   2  
ATOM   1421  C C    . LYS A 1 20 ? 2.283   -11.538 -7.640  1.00 5.00  ? 20 LYS A C    2  
ATOM   1422  O O    . LYS A 1 20 ? 1.658   -11.651 -8.678  1.00 5.39  ? 20 LYS A O    2  
ATOM   1423  C CB   . LYS A 1 20 ? 4.655   -12.305 -7.968  1.00 6.44  ? 20 LYS A CB   2  
ATOM   1424  C CG   . LYS A 1 20 ? 4.750   -12.514 -9.482  1.00 7.16  ? 20 LYS A CG   2  
ATOM   1425  C CD   . LYS A 1 20 ? 5.579   -13.770 -9.771  1.00 7.91  ? 20 LYS A CD   2  
ATOM   1426  C CE   . LYS A 1 20 ? 5.481   -14.123 -11.258 1.00 8.41  ? 20 LYS A CE   2  
ATOM   1427  N NZ   . LYS A 1 20 ? 6.261   -15.367 -11.528 1.00 8.95  ? 20 LYS A NZ   2  
ATOM   1428  H H    . LYS A 1 20 ? 4.968   -10.729 -5.895  1.00 5.13  ? 20 LYS A H    2  
ATOM   1429  H HA   . LYS A 1 20 ? 3.893   -10.397 -8.455  1.00 5.87  ? 20 LYS A HA   2  
ATOM   1430  H HB2  . LYS A 1 20 ? 5.643   -12.131 -7.567  1.00 6.91  ? 20 LYS A HB2  2  
ATOM   1431  H HB3  . LYS A 1 20 ? 4.232   -13.175 -7.515  1.00 6.29  ? 20 LYS A HB3  2  
ATOM   1432  H HG2  . LYS A 1 20 ? 3.758   -12.633 -9.893  1.00 7.23  ? 20 LYS A HG2  2  
ATOM   1433  H HG3  . LYS A 1 20 ? 5.228   -11.659 -9.936  1.00 7.28  ? 20 LYS A HG3  2  
ATOM   1434  H HD2  . LYS A 1 20 ? 6.611   -13.586 -9.511  1.00 8.14  ? 20 LYS A HD2  2  
ATOM   1435  H HD3  . LYS A 1 20 ? 5.201   -14.592 -9.183  1.00 8.11  ? 20 LYS A HD3  2  
ATOM   1436  H HE2  . LYS A 1 20 ? 4.447   -14.283 -11.523 1.00 8.28  ? 20 LYS A HE2  2  
ATOM   1437  H HE3  . LYS A 1 20 ? 5.882   -13.312 -11.848 1.00 8.75  ? 20 LYS A HE3  2  
ATOM   1438  H HZ1  . LYS A 1 20 ? 5.909   -16.138 -10.925 1.00 9.13  ? 20 LYS A HZ1  2  
ATOM   1439  H HZ2  . LYS A 1 20 ? 6.151   -15.632 -12.529 1.00 9.15  ? 20 LYS A HZ2  2  
ATOM   1440  H HZ3  . LYS A 1 20 ? 7.265   -15.200 -11.322 1.00 9.17  ? 20 LYS A HZ3  2  
ATOM   1441  N N    . PHE A 1 21 ? 1.705   -11.748 -6.472  1.00 4.37  ? 21 PHE A N    2  
ATOM   1442  C CA   . PHE A 1 21 ? 0.260   -12.130 -6.398  1.00 4.15  ? 21 PHE A CA   2  
ATOM   1443  C C    . PHE A 1 21 ? -0.582  -10.999 -7.003  1.00 3.56  ? 21 PHE A C    2  
ATOM   1444  O O    . PHE A 1 21 ? -1.571  -11.230 -7.672  1.00 3.88  ? 21 PHE A O    2  
ATOM   1445  C CB   . PHE A 1 21 ? -0.162  -12.312 -4.942  1.00 4.02  ? 21 PHE A CB   2  
ATOM   1446  C CG   . PHE A 1 21 ? 0.655   -13.383 -4.246  1.00 4.64  ? 21 PHE A CG   2  
ATOM   1447  C CD1  . PHE A 1 21 ? 1.271   -14.410 -4.976  1.00 5.12  ? 21 PHE A CD1  2  
ATOM   1448  C CD2  . PHE A 1 21 ? 0.787   -13.344 -2.851  1.00 5.11  ? 21 PHE A CD2  2  
ATOM   1449  C CE1  . PHE A 1 21 ? 2.016   -15.390 -4.309  1.00 5.85  ? 21 PHE A CE1  2  
ATOM   1450  C CE2  . PHE A 1 21 ? 1.531   -14.324 -2.188  1.00 5.85  ? 21 PHE A CE2  2  
ATOM   1451  C CZ   . PHE A 1 21 ? 2.147   -15.347 -2.916  1.00 6.13  ? 21 PHE A CZ   2  
ATOM   1452  H H    . PHE A 1 21 ? 2.209   -11.628 -5.645  1.00 4.29  ? 21 PHE A H    2  
ATOM   1453  H HA   . PHE A 1 21 ? 0.091   -13.037 -6.934  1.00 4.82  ? 21 PHE A HA   2  
ATOM   1454  H HB2  . PHE A 1 21 ? -0.026  -11.383 -4.436  1.00 3.48  ? 21 PHE A HB2  2  
ATOM   1455  H HB3  . PHE A 1 21 ? -1.202  -12.582 -4.910  1.00 4.37  ? 21 PHE A HB3  2  
ATOM   1456  H HD1  . PHE A 1 21 ? 1.173   -14.445 -6.050  1.00 5.18  ? 21 PHE A HD1  2  
ATOM   1457  H HD2  . PHE A 1 21 ? 0.312   -12.554 -2.288  1.00 5.17  ? 21 PHE A HD2  2  
ATOM   1458  H HE1  . PHE A 1 21 ? 2.493   -16.178 -4.868  1.00 6.40  ? 21 PHE A HE1  2  
ATOM   1459  H HE2  . PHE A 1 21 ? 1.632   -14.287 -1.111  1.00 6.40  ? 21 PHE A HE2  2  
ATOM   1460  H HZ   . PHE A 1 21 ? 2.721   -16.104 -2.404  1.00 6.79  ? 21 PHE A HZ   2  
ATOM   1461  N N    . ILE A 1 22 ? -0.179  -9.775  -6.755  1.00 2.94  ? 22 ILE A N    2  
ATOM   1462  C CA   . ILE A 1 22 ? -0.912  -8.586  -7.284  1.00 2.62  ? 22 ILE A CA   2  
ATOM   1463  C C    . ILE A 1 22 ? -0.904  -8.599  -8.814  1.00 3.41  ? 22 ILE A C    2  
ATOM   1464  O O    . ILE A 1 22 ? 0.138   -8.578  -9.442  1.00 4.13  ? 22 ILE A O    2  
ATOM   1465  C CB   . ILE A 1 22 ? -0.220  -7.307  -6.790  1.00 2.18  ? 22 ILE A CB   2  
ATOM   1466  C CG1  . ILE A 1 22 ? -0.199  -7.288  -5.257  1.00 2.00  ? 22 ILE A CG1  2  
ATOM   1467  C CG2  . ILE A 1 22 ? -0.977  -6.083  -7.300  1.00 2.53  ? 22 ILE A CG2  2  
ATOM   1468  C CD1  . ILE A 1 22 ? 1.056   -6.555  -4.773  1.00 2.47  ? 22 ILE A CD1  2  
ATOM   1469  H H    . ILE A 1 22 ? 0.623   -9.638  -6.208  1.00 2.94  ? 22 ILE A H    2  
ATOM   1470  H HA   . ILE A 1 22 ? -1.933  -8.599  -6.932  1.00 2.63  ? 22 ILE A HA   2  
ATOM   1471  H HB   . ILE A 1 22 ? 0.793   -7.282  -7.166  1.00 2.49  ? 22 ILE A HB   2  
ATOM   1472  H HG12 . ILE A 1 22 ? -1.077  -6.778  -4.891  1.00 2.23  ? 22 ILE A HG12 2  
ATOM   1473  H HG13 . ILE A 1 22 ? -0.187  -8.300  -4.883  1.00 2.28  ? 22 ILE A HG13 2  
ATOM   1474  H HG21 . ILE A 1 22 ? -2.035  -6.290  -7.294  1.00 2.71  ? 22 ILE A HG21 2  
ATOM   1475  H HG22 . ILE A 1 22 ? -0.771  -5.238  -6.659  1.00 2.80  ? 22 ILE A HG22 2  
ATOM   1476  H HG23 . ILE A 1 22 ? -0.659  -5.857  -8.306  1.00 3.07  ? 22 ILE A HG23 2  
ATOM   1477  H HD11 . ILE A 1 22 ? 1.803   -6.565  -5.554  1.00 2.88  ? 22 ILE A HD11 2  
ATOM   1478  H HD12 . ILE A 1 22 ? 0.804   -5.535  -4.530  1.00 2.84  ? 22 ILE A HD12 2  
ATOM   1479  H HD13 . ILE A 1 22 ? 1.445   -7.050  -3.897  1.00 2.73  ? 22 ILE A HD13 2  
ATOM   1480  N N    . LYS A 1 23 ? -2.068  -8.612  -9.412  1.00 3.62  ? 23 LYS A N    2  
ATOM   1481  C CA   . LYS A 1 23 ? -2.155  -8.598  -10.900 1.00 4.61  ? 23 LYS A CA   2  
ATOM   1482  C C    . LYS A 1 23 ? -2.111  -7.142  -11.393 1.00 5.00  ? 23 LYS A C    2  
ATOM   1483  O O    . LYS A 1 23 ? -1.718  -6.874  -12.513 1.00 5.88  ? 23 LYS A O    2  
ATOM   1484  C CB   . LYS A 1 23 ? -3.469  -9.253  -11.343 1.00 5.10  ? 23 LYS A CB   2  
ATOM   1485  C CG   . LYS A 1 23 ? -3.390  -9.616  -12.830 1.00 5.85  ? 23 LYS A CG   2  
ATOM   1486  C CD   . LYS A 1 23 ? -4.722  -10.224 -13.285 1.00 6.35  ? 23 LYS A CD   2  
ATOM   1487  C CE   . LYS A 1 23 ? -5.709  -9.104  -13.631 1.00 6.93  ? 23 LYS A CE   2  
ATOM   1488  N NZ   . LYS A 1 23 ? -5.570  -8.738  -15.071 1.00 7.72  ? 23 LYS A NZ   2  
ATOM   1489  H H    . LYS A 1 23 ? -2.890  -8.612  -8.876  1.00 3.33  ? 23 LYS A H    2  
ATOM   1490  H HA   . LYS A 1 23 ? -1.321  -9.143  -11.316 1.00 4.98  ? 23 LYS A HA   2  
ATOM   1491  H HB2  . LYS A 1 23 ? -3.637  -10.149 -10.762 1.00 4.92  ? 23 LYS A HB2  2  
ATOM   1492  H HB3  . LYS A 1 23 ? -4.285  -8.564  -11.186 1.00 5.36  ? 23 LYS A HB3  2  
ATOM   1493  H HG2  . LYS A 1 23 ? -3.184  -8.726  -13.407 1.00 6.02  ? 23 LYS A HG2  2  
ATOM   1494  H HG3  . LYS A 1 23 ? -2.599  -10.334 -12.983 1.00 6.22  ? 23 LYS A HG3  2  
ATOM   1495  H HD2  . LYS A 1 23 ? -4.555  -10.840 -14.156 1.00 6.70  ? 23 LYS A HD2  2  
ATOM   1496  H HD3  . LYS A 1 23 ? -5.131  -10.829 -12.490 1.00 6.30  ? 23 LYS A HD3  2  
ATOM   1497  H HE2  . LYS A 1 23 ? -6.717  -9.444  -13.443 1.00 6.98  ? 23 LYS A HE2  2  
ATOM   1498  H HE3  . LYS A 1 23 ? -5.502  -8.240  -13.019 1.00 7.01  ? 23 LYS A HE3  2  
ATOM   1499  H HZ1  . LYS A 1 23 ? -5.722  -9.580  -15.662 1.00 8.36  ? 23 LYS A HZ1  2  
ATOM   1500  H HZ2  . LYS A 1 23 ? -6.277  -8.016  -15.315 1.00 7.80  ? 23 LYS A HZ2  2  
ATOM   1501  H HZ3  . LYS A 1 23 ? -4.615  -8.360  -15.243 1.00 7.78  ? 23 LYS A HZ3  2  
ATOM   1502  N N    . GLU A 1 24 ? -2.510  -6.201  -10.560 1.00 4.51  ? 24 GLU A N    2  
ATOM   1503  C CA   . GLU A 1 24 ? -2.491  -4.762  -10.973 1.00 5.13  ? 24 GLU A CA   2  
ATOM   1504  C C    . GLU A 1 24 ? -2.103  -3.888  -9.770  1.00 4.55  ? 24 GLU A C    2  
ATOM   1505  O O    . GLU A 1 24 ? -2.920  -3.613  -8.909  1.00 4.65  ? 24 GLU A O    2  
ATOM   1506  C CB   . GLU A 1 24 ? -3.883  -4.357  -11.474 1.00 5.78  ? 24 GLU A CB   2  
ATOM   1507  C CG   . GLU A 1 24 ? -3.975  -4.587  -12.986 1.00 6.35  ? 24 GLU A CG   2  
ATOM   1508  C CD   . GLU A 1 24 ? -5.445  -4.694  -13.398 1.00 7.36  ? 24 GLU A CD   2  
ATOM   1509  O OE1  . GLU A 1 24 ? -6.000  -5.773  -13.270 1.00 7.92  ? 24 GLU A OE1  2  
ATOM   1510  O OE2  . GLU A 1 24 ? -5.991  -3.694  -13.833 1.00 7.77  ? 24 GLU A OE2  2  
ATOM   1511  H H    . GLU A 1 24 ? -2.819  -6.442  -9.659  1.00 3.86  ? 24 GLU A H    2  
ATOM   1512  H HA   . GLU A 1 24 ? -1.771  -4.627  -11.766 1.00 5.74  ? 24 GLU A HA   2  
ATOM   1513  H HB2  . GLU A 1 24 ? -4.633  -4.952  -10.972 1.00 5.66  ? 24 GLU A HB2  2  
ATOM   1514  H HB3  . GLU A 1 24 ? -4.052  -3.311  -11.263 1.00 6.21  ? 24 GLU A HB3  2  
ATOM   1515  H HG2  . GLU A 1 24 ? -3.513  -3.760  -13.505 1.00 6.22  ? 24 GLU A HG2  2  
ATOM   1516  H HG3  . GLU A 1 24 ? -3.465  -5.504  -13.243 1.00 6.40  ? 24 GLU A HG3  2  
HETATM 1517  N N    . MLE A 1 25 ? -0.862  -3.451  -9.697  1.00 4.25  ? 25 MLE A N    2  
HETATM 1518  C CN   . MLE A 1 25 ? -0.282  -2.923  -10.975 1.00 5.13  ? 25 MLE A CN   2  
HETATM 1519  C CA   . MLE A 1 25 ? -0.434  -2.598  -8.534  1.00 3.66  ? 25 MLE A CA   2  
HETATM 1520  C CB   . MLE A 1 25 ? 0.945   -3.051  -8.030  1.00 3.52  ? 25 MLE A CB   2  
HETATM 1521  C CG   . MLE A 1 25 ? 1.481   -2.031  -7.012  1.00 3.28  ? 25 MLE A CG   2  
HETATM 1522  C CD1  . MLE A 1 25 ? 2.082   -2.764  -5.816  1.00 2.93  ? 25 MLE A CD1  2  
HETATM 1523  C CD2  . MLE A 1 25 ? 2.559   -1.159  -7.670  1.00 3.54  ? 25 MLE A CD2  2  
HETATM 1524  C C    . MLE A 1 25 ? -0.351  -1.129  -8.965  1.00 4.19  ? 25 MLE A C    2  
HETATM 1525  O O    . MLE A 1 25 ? 0.595   -0.717  -9.614  1.00 4.87  ? 25 MLE A O    2  
HETATM 1526  H HN1  . MLE A 1 25 ? -0.871  -2.080  -11.314 1.00 5.47  ? 25 MLE A HN1  2  
HETATM 1527  H HN2  . MLE A 1 25 ? 0.735   -2.601  -10.804 1.00 5.48  ? 25 MLE A HN2  2  
HETATM 1528  H HN3  . MLE A 1 25 ? -0.293  -3.694  -11.725 1.00 5.42  ? 25 MLE A HN3  2  
HETATM 1529  H HA   . MLE A 1 25 ? -1.154  -2.697  -7.733  1.00 3.20  ? 25 MLE A HA   2  
HETATM 1530  H HB2  . MLE A 1 25 ? 0.854   -4.020  -7.558  1.00 3.37  ? 25 MLE A HB2  2  
HETATM 1531  H HB3  . MLE A 1 25 ? 1.628   -3.119  -8.863  1.00 4.08  ? 25 MLE A HB3  2  
HETATM 1532  H HG   . MLE A 1 25 ? 0.670   -1.404  -6.673  1.00 3.59  ? 25 MLE A HG   2  
HETATM 1533  H HD11 . MLE A 1 25 ? 1.573   -3.705  -5.679  1.00 2.79  ? 25 MLE A HD11 2  
HETATM 1534  H HD12 . MLE A 1 25 ? 3.131   -2.942  -5.992  1.00 3.21  ? 25 MLE A HD12 2  
HETATM 1535  H HD13 . MLE A 1 25 ? 1.962   -2.157  -4.930  1.00 3.14  ? 25 MLE A HD13 2  
HETATM 1536  H HD21 . MLE A 1 25 ? 2.794   -1.551  -8.649  1.00 3.75  ? 25 MLE A HD21 2  
HETATM 1537  H HD22 . MLE A 1 25 ? 2.189   -0.147  -7.770  1.00 3.70  ? 25 MLE A HD22 2  
HETATM 1538  H HD23 . MLE A 1 25 ? 3.448   -1.157  -7.060  1.00 3.89  ? 25 MLE A HD23 2  
ATOM   1539  N N    . ARG A 1 26 ? -1.323  -0.334  -8.618  1.00 4.14  ? 26 ARG A N    2  
ATOM   1540  C CA   . ARG A 1 26 ? -1.266  1.091   -9.024  1.00 4.79  ? 26 ARG A CA   2  
ATOM   1541  C C    . ARG A 1 26 ? -1.273  1.988   -7.781  1.00 4.70  ? 26 ARG A C    2  
ATOM   1542  O O    . ARG A 1 26 ? -2.134  1.873   -6.929  1.00 4.97  ? 26 ARG A O    2  
ATOM   1543  C CB   . ARG A 1 26 ? -2.458  1.432   -9.908  1.00 5.59  ? 26 ARG A CB   2  
ATOM   1544  C CG   . ARG A 1 26 ? -2.441  0.567   -11.174 1.00 5.99  ? 26 ARG A CG   2  
ATOM   1545  C CD   . ARG A 1 26 ? -3.373  -0.634  -10.988 1.00 6.35  ? 26 ARG A CD   2  
ATOM   1546  N NE   . ARG A 1 26 ? -4.787  -0.210  -11.194 1.00 7.16  ? 26 ARG A NE   2  
ATOM   1547  C CZ   . ARG A 1 26 ? -5.756  -0.871  -10.617 1.00 7.92  ? 26 ARG A CZ   2  
ATOM   1548  N NH1  . ARG A 1 26 ? -6.046  -0.642  -9.361  1.00 8.32  ? 26 ARG A NH1  2  
ATOM   1549  N NH2  . ARG A 1 26 ? -6.433  -1.762  -11.295 1.00 8.52  ? 26 ARG A NH2  2  
ATOM   1550  H H    . ARG A 1 26 ? -2.082  -0.673  -8.096  1.00 3.85  ? 26 ARG A H    2  
ATOM   1551  H HA   . ARG A 1 26 ? -0.365  1.247   -9.576  1.00 5.07  ? 26 ARG A HA   2  
ATOM   1552  H HB2  . ARG A 1 26 ? -3.355  1.244   -9.359  1.00 5.95  ? 26 ARG A HB2  2  
ATOM   1553  H HB3  . ARG A 1 26 ? -2.417  2.474   -10.185 1.00 5.91  ? 26 ARG A HB3  2  
ATOM   1554  H HG2  . ARG A 1 26 ? -2.776  1.157   -12.016 1.00 6.27  ? 26 ARG A HG2  2  
ATOM   1555  H HG3  . ARG A 1 26 ? -1.437  0.217   -11.358 1.00 6.12  ? 26 ARG A HG3  2  
ATOM   1556  H HD2  . ARG A 1 26 ? -3.119  -1.399  -11.705 1.00 6.26  ? 26 ARG A HD2  2  
ATOM   1557  H HD3  . ARG A 1 26 ? -3.257  -1.026  -9.988  1.00 6.38  ? 26 ARG A HD3  2  
ATOM   1558  H HE   . ARG A 1 26 ? -4.991  0.564   -11.761 1.00 7.28  ? 26 ARG A HE   2  
ATOM   1559  H HH11 . ARG A 1 26 ? -5.526  0.038   -8.844  1.00 8.08  ? 26 ARG A HH11 2  
ATOM   1560  H HH12 . ARG A 1 26 ? -6.788  -1.146  -8.918  1.00 9.02  ? 26 ARG A HH12 2  
ATOM   1561  H HH21 . ARG A 1 26 ? -6.209  -1.937  -12.254 1.00 8.41  ? 26 ARG A HH21 2  
ATOM   1562  H HH22 . ARG A 1 26 ? -7.174  -2.269  -10.856 1.00 9.21  ? 26 ARG A HH22 2  
ATOM   1563  N N    . VAL A 1 27 ? -0.320  2.880   -7.672  1.00 4.69  ? 27 VAL A N    2  
ATOM   1564  C CA   . VAL A 1 27 ? -0.261  3.788   -6.491  1.00 4.83  ? 27 VAL A CA   2  
ATOM   1565  C C    . VAL A 1 27 ? -0.805  5.171   -6.875  1.00 4.79  ? 27 VAL A C    2  
ATOM   1566  O O    . VAL A 1 27 ? -0.689  5.597   -8.010  1.00 5.45  ? 27 VAL A O    2  
ATOM   1567  C CB   . VAL A 1 27 ? 1.193   3.916   -6.017  1.00 5.66  ? 27 VAL A CB   2  
ATOM   1568  C CG1  . VAL A 1 27 ? 1.642   2.598   -5.381  1.00 6.10  ? 27 VAL A CG1  2  
ATOM   1569  C CG2  . VAL A 1 27 ? 2.112   4.245   -7.201  1.00 6.04  ? 27 VAL A CG2  2  
ATOM   1570  H H    . VAL A 1 27 ? 0.360   2.954   -8.369  1.00 4.82  ? 27 VAL A H    2  
ATOM   1571  H HA   . VAL A 1 27 ? -0.863  3.377   -5.693  1.00 4.74  ? 27 VAL A HA   2  
ATOM   1572  H HB   . VAL A 1 27 ? 1.255   4.702   -5.288  1.00 5.89  ? 27 VAL A HB   2  
ATOM   1573  H HG11 . VAL A 1 27 ? 0.891   2.264   -4.683  1.00 6.54  ? 27 VAL A HG11 2  
ATOM   1574  H HG12 . VAL A 1 27 ? 1.774   1.854   -6.152  1.00 6.30  ? 27 VAL A HG12 2  
ATOM   1575  H HG13 . VAL A 1 27 ? 2.575   2.749   -4.861  1.00 6.06  ? 27 VAL A HG13 2  
ATOM   1576  H HG21 . VAL A 1 27 ? 1.622   4.949   -7.855  1.00 6.44  ? 27 VAL A HG21 2  
ATOM   1577  H HG22 . VAL A 1 27 ? 3.032   4.675   -6.833  1.00 6.18  ? 27 VAL A HG22 2  
ATOM   1578  H HG23 . VAL A 1 27 ? 2.334   3.340   -7.748  1.00 6.05  ? 27 VAL A HG23 2  
ATOM   1579  N N    . ILE A 1 28 ? -1.395  5.878   -5.937  1.00 4.28  ? 28 ILE A N    2  
ATOM   1580  C CA   . ILE A 1 28 ? -1.940  7.237   -6.251  1.00 4.40  ? 28 ILE A CA   2  
ATOM   1581  C C    . ILE A 1 28 ? -0.947  8.299   -5.768  1.00 4.70  ? 28 ILE A C    2  
ATOM   1582  O O    . ILE A 1 28 ? -0.353  8.168   -4.715  1.00 5.01  ? 28 ILE A O    2  
ATOM   1583  C CB   . ILE A 1 28 ? -3.289  7.435   -5.545  1.00 4.45  ? 28 ILE A CB   2  
ATOM   1584  C CG1  . ILE A 1 28 ? -4.277  6.357   -6.005  1.00 4.94  ? 28 ILE A CG1  2  
ATOM   1585  C CG2  . ILE A 1 28 ? -3.852  8.818   -5.894  1.00 4.49  ? 28 ILE A CG2  2  
ATOM   1586  C CD1  . ILE A 1 28 ? -5.523  6.388   -5.116  1.00 5.05  ? 28 ILE A CD1  2  
ATOM   1587  H H    . ILE A 1 28 ? -1.473  5.519   -5.025  1.00 4.02  ? 28 ILE A H    2  
ATOM   1588  H HA   . ILE A 1 28 ? -2.075  7.331   -7.319  1.00 4.67  ? 28 ILE A HA   2  
ATOM   1589  H HB   . ILE A 1 28 ? -3.148  7.364   -4.476  1.00 4.56  ? 28 ILE A HB   2  
ATOM   1590  H HG12 . ILE A 1 28 ? -4.561  6.543   -7.032  1.00 5.21  ? 28 ILE A HG12 2  
ATOM   1591  H HG13 . ILE A 1 28 ? -3.810  5.385   -5.932  1.00 5.36  ? 28 ILE A HG13 2  
ATOM   1592  H HG21 . ILE A 1 28 ? -3.765  8.986   -6.957  1.00 4.49  ? 28 ILE A HG21 2  
ATOM   1593  H HG22 . ILE A 1 28 ? -4.892  8.868   -5.607  1.00 4.51  ? 28 ILE A HG22 2  
ATOM   1594  H HG23 . ILE A 1 28 ? -3.296  9.577   -5.363  1.00 4.77  ? 28 ILE A HG23 2  
ATOM   1595  H HD11 . ILE A 1 28 ? -5.815  7.412   -4.940  1.00 5.25  ? 28 ILE A HD11 2  
ATOM   1596  H HD12 . ILE A 1 28 ? -6.330  5.865   -5.608  1.00 5.49  ? 28 ILE A HD12 2  
ATOM   1597  H HD13 . ILE A 1 28 ? -5.306  5.908   -4.174  1.00 4.88  ? 28 ILE A HD13 2  
ATOM   1598  N N    . GLU A 1 29 ? -0.765  9.350   -6.531  1.00 5.08  ? 29 GLU A N    2  
ATOM   1599  C CA   . GLU A 1 29 ? 0.185   10.427  -6.126  1.00 5.75  ? 29 GLU A CA   2  
ATOM   1600  C C    . GLU A 1 29 ? -0.448  11.294  -5.030  1.00 5.30  ? 29 GLU A C    2  
ATOM   1601  O O    . GLU A 1 29 ? -1.619  11.164  -4.720  1.00 4.95  ? 29 GLU A O    2  
ATOM   1602  C CB   . GLU A 1 29 ? 0.505   11.302  -7.341  1.00 6.63  ? 29 GLU A CB   2  
ATOM   1603  C CG   . GLU A 1 29 ? 1.289   10.488  -8.375  1.00 7.40  ? 29 GLU A CG   2  
ATOM   1604  C CD   . GLU A 1 29 ? 2.215   11.417  -9.165  1.00 8.35  ? 29 GLU A CD   2  
ATOM   1605  O OE1  . GLU A 1 29 ? 1.775   11.942  -10.176 1.00 9.09  ? 29 GLU A OE1  2  
ATOM   1606  O OE2  . GLU A 1 29 ? 3.348   11.589  -8.747  1.00 8.53  ? 29 GLU A OE2  2  
ATOM   1607  H H    . GLU A 1 29 ? -1.255  9.433   -7.375  1.00 5.18  ? 29 GLU A H    2  
ATOM   1608  H HA   . GLU A 1 29 ? 1.096   9.983   -5.753  1.00 6.26  ? 29 GLU A HA   2  
ATOM   1609  H HB2  . GLU A 1 29 ? -0.415  11.654  -7.779  1.00 6.65  ? 29 GLU A HB2  2  
ATOM   1610  H HB3  . GLU A 1 29 ? 1.096   12.144  -7.027  1.00 7.00  ? 29 GLU A HB3  2  
ATOM   1611  H HG2  . GLU A 1 29 ? 1.879   9.735   -7.870  1.00 7.70  ? 29 GLU A HG2  2  
ATOM   1612  H HG3  . GLU A 1 29 ? 0.599   10.008  -9.054  1.00 7.27  ? 29 GLU A HG3  2  
ATOM   1613  N N    . SER A 1 30 ? 0.320   12.179  -4.444  1.00 5.67  ? 30 SER A N    2  
ATOM   1614  C CA   . SER A 1 30 ? -0.222  13.062  -3.368  1.00 5.68  ? 30 SER A CA   2  
ATOM   1615  C C    . SER A 1 30 ? -0.315  14.504  -3.879  1.00 6.20  ? 30 SER A C    2  
ATOM   1616  O O    . SER A 1 30 ? 0.350   14.887  -4.824  1.00 6.77  ? 30 SER A O    2  
ATOM   1617  C CB   . SER A 1 30 ? 0.696   13.017  -2.143  1.00 6.35  ? 30 SER A CB   2  
ATOM   1618  O OG   . SER A 1 30 ? 2.037   12.763  -2.550  1.00 7.18  ? 30 SER A OG   2  
ATOM   1619  H H    . SER A 1 30 ? 1.258   12.265  -4.714  1.00 6.18  ? 30 SER A H    2  
ATOM   1620  H HA   . SER A 1 30 ? -1.208  12.720  -3.089  1.00 5.24  ? 30 SER A HA   2  
ATOM   1621  H HB2  . SER A 1 30 ? 0.658   13.962  -1.634  1.00 6.58  ? 30 SER A HB2  2  
ATOM   1622  H HB3  . SER A 1 30 ? 0.357   12.239  -1.473  1.00 6.28  ? 30 SER A HB3  2  
ATOM   1623  H HG   . SER A 1 30 ? 2.466   13.609  -2.696  1.00 7.41  ? 30 SER A HG   2  
ATOM   1624  N N    . GLY A 1 31 ? -1.143  15.300  -3.253  1.00 6.36  ? 31 GLY A N    2  
ATOM   1625  C CA   . GLY A 1 31 ? -1.302  16.724  -3.682  1.00 7.19  ? 31 GLY A CA   2  
ATOM   1626  C C    . GLY A 1 31 ? -2.339  17.410  -2.783  1.00 7.66  ? 31 GLY A C    2  
ATOM   1627  O O    . GLY A 1 31 ? -2.497  17.038  -1.636  1.00 7.75  ? 31 GLY A O    2  
ATOM   1628  H H    . GLY A 1 31 ? -1.665  14.958  -2.495  1.00 6.14  ? 31 GLY A H    2  
ATOM   1629  H HA2  . GLY A 1 31 ? -0.355  17.230  -3.608  1.00 7.72  ? 31 GLY A HA2  2  
ATOM   1630  H HA3  . GLY A 1 31 ? -1.643  16.753  -4.705  1.00 7.17  ? 31 GLY A HA3  2  
ATOM   1631  N N    . PRO A 1 32 ? -3.041  18.375  -3.338  1.00 8.17  ? 32 PRO A N    2  
ATOM   1632  C CA   . PRO A 1 32 ? -4.100  19.099  -2.606  1.00 8.85  ? 32 PRO A CA   2  
ATOM   1633  C C    . PRO A 1 32 ? -5.326  18.184  -2.465  1.00 8.11  ? 32 PRO A C    2  
ATOM   1634  O O    . PRO A 1 32 ? -6.016  18.200  -1.464  1.00 8.52  ? 32 PRO A O    2  
ATOM   1635  C CB   . PRO A 1 32 ? -4.390  20.315  -3.492  1.00 9.69  ? 32 PRO A CB   2  
ATOM   1636  C CG   . PRO A 1 32 ? -3.902  19.944  -4.912  1.00 9.20  ? 32 PRO A CG   2  
ATOM   1637  C CD   . PRO A 1 32 ? -2.855  18.827  -4.736  1.00 8.39  ? 32 PRO A CD   2  
ATOM   1638  H HA   . PRO A 1 32 ? -3.747  19.417  -1.638  1.00 9.45  ? 32 PRO A HA   2  
ATOM   1639  H HB2  . PRO A 1 32 ? -5.451  20.522  -3.502  1.00 9.88  ? 32 PRO A HB2  2  
ATOM   1640  H HB3  . PRO A 1 32 ? -3.846  21.174  -3.133  1.00 10.56 ? 32 PRO A HB3  2  
ATOM   1641  H HG2  . PRO A 1 32 ? -4.732  19.589  -5.507  1.00 8.80  ? 32 PRO A HG2  2  
ATOM   1642  H HG3  . PRO A 1 32 ? -3.445  20.801  -5.383  1.00 10.01 ? 32 PRO A HG3  2  
ATOM   1643  H HD2  . PRO A 1 32 ? -3.045  18.019  -5.427  1.00 7.63  ? 32 PRO A HD2  2  
ATOM   1644  H HD3  . PRO A 1 32 ? -1.858  19.217  -4.870  1.00 8.96  ? 32 PRO A HD3  2  
ATOM   1645  N N    . HIS A 1 33 ? -5.564  17.367  -3.466  1.00 7.21  ? 33 HIS A N    2  
ATOM   1646  C CA   . HIS A 1 33 ? -6.707  16.399  -3.435  1.00 6.64  ? 33 HIS A CA   2  
ATOM   1647  C C    . HIS A 1 33 ? -6.563  15.475  -2.212  1.00 5.94  ? 33 HIS A C    2  
ATOM   1648  O O    . HIS A 1 33 ? -7.535  15.128  -1.569  1.00 6.05  ? 33 HIS A O    2  
ATOM   1649  C CB   . HIS A 1 33 ? -6.694  15.555  -4.725  1.00 6.27  ? 33 HIS A CB   2  
ATOM   1650  C CG   . HIS A 1 33 ? -5.334  14.917  -4.918  1.00 5.79  ? 33 HIS A CG   2  
ATOM   1651  N ND1  . HIS A 1 33 ? -4.273  15.594  -5.507  1.00 6.54  ? 33 HIS A ND1  2  
ATOM   1652  C CD2  . HIS A 1 33 ? -4.837  13.684  -4.568  1.00 4.91  ? 33 HIS A CD2  2  
ATOM   1653  C CE1  . HIS A 1 33 ? -3.205  14.779  -5.483  1.00 6.20  ? 33 HIS A CE1  2  
ATOM   1654  N NE2  . HIS A 1 33 ? -3.495  13.600  -4.924  1.00 5.23  ? 33 HIS A NE2  2  
ATOM   1655  H H    . HIS A 1 33 ? -4.972  17.381  -4.239  1.00 7.10  ? 33 HIS A H    2  
ATOM   1656  H HA   . HIS A 1 33 ? -7.636  16.941  -3.367  1.00 7.25  ? 33 HIS A HA   2  
ATOM   1657  H HB2  . HIS A 1 33 ? -7.444  14.783  -4.653  1.00 5.99  ? 33 HIS A HB2  2  
ATOM   1658  H HB3  . HIS A 1 33 ? -6.914  16.190  -5.571  1.00 6.92  ? 33 HIS A HB3  2  
ATOM   1659  H HD1  . HIS A 1 33 ? -4.301  16.497  -5.884  1.00 7.35  ? 33 HIS A HD1  2  
ATOM   1660  H HD2  . HIS A 1 33 ? -5.403  12.900  -4.087  1.00 4.33  ? 33 HIS A HD2  2  
ATOM   1661  H HE1  . HIS A 1 33 ? -2.221  15.059  -5.837  1.00 6.82  ? 33 HIS A HE1  2  
ATOM   1662  N N    . CYS A 1 34 ? -5.349  15.090  -1.889  1.00 5.51  ? 34 CYS A N    2  
ATOM   1663  C CA   . CYS A 1 34 ? -5.109  14.209  -0.717  1.00 5.12  ? 34 CYS A CA   2  
ATOM   1664  C C    . CYS A 1 34 ? -3.713  14.496  -0.157  1.00 5.54  ? 34 CYS A C    2  
ATOM   1665  O O    . CYS A 1 34 ? -2.718  14.340  -0.842  1.00 5.84  ? 34 CYS A O    2  
ATOM   1666  C CB   . CYS A 1 34 ? -5.199  12.736  -1.132  1.00 4.12  ? 34 CYS A CB   2  
ATOM   1667  S SG   . CYS A 1 34 ? -5.402  11.717  0.349   1.00 4.37  ? 34 CYS A SG   2  
ATOM   1668  H H    . CYS A 1 34 ? -4.593  15.394  -2.414  1.00 5.68  ? 34 CYS A H    2  
ATOM   1669  H HA   . CYS A 1 34 ? -5.846  14.421  0.031   1.00 5.59  ? 34 CYS A HA   2  
ATOM   1670  H HB2  . CYS A 1 34 ? -6.044  12.591  -1.789  1.00 4.04  ? 34 CYS A HB2  2  
ATOM   1671  H HB3  . CYS A 1 34 ? -4.292  12.450  -1.643  1.00 3.82  ? 34 CYS A HB3  2  
ATOM   1672  N N    . ALA A 1 35 ? -3.636  14.922  1.080   1.00 5.90  ? 35 ALA A N    2  
ATOM   1673  C CA   . ALA A 1 35 ? -2.307  15.234  1.694   1.00 6.66  ? 35 ALA A CA   2  
ATOM   1674  C C    . ALA A 1 35 ? -1.466  13.957  1.830   1.00 6.33  ? 35 ALA A C    2  
ATOM   1675  O O    . ALA A 1 35 ? -0.274  13.967  1.587   1.00 6.77  ? 35 ALA A O    2  
ATOM   1676  C CB   . ALA A 1 35 ? -2.518  15.853  3.078   1.00 7.59  ? 35 ALA A CB   2  
ATOM   1677  H H    . ALA A 1 35 ? -4.456  15.044  1.605   1.00 5.87  ? 35 ALA A H    2  
ATOM   1678  H HA   . ALA A 1 35 ? -1.783  15.936  1.067   1.00 7.06  ? 35 ALA A HA   2  
ATOM   1679  H HB1  . ALA A 1 35 ? -3.277  16.619  3.019   1.00 7.72  ? 35 ALA A HB1  2  
ATOM   1680  H HB2  . ALA A 1 35 ? -2.834  15.086  3.771   1.00 8.05  ? 35 ALA A HB2  2  
ATOM   1681  H HB3  . ALA A 1 35 ? -1.592  16.288  3.423   1.00 7.89  ? 35 ALA A HB3  2  
ATOM   1682  N N    . ASN A 1 36 ? -2.076  12.866  2.222   1.00 5.85  ? 36 ASN A N    2  
ATOM   1683  C CA   . ASN A 1 36 ? -1.313  11.590  2.385   1.00 5.88  ? 36 ASN A CA   2  
ATOM   1684  C C    . ASN A 1 36 ? -1.360  10.770  1.090   1.00 5.34  ? 36 ASN A C    2  
ATOM   1685  O O    . ASN A 1 36 ? -2.351  10.758  0.384   1.00 5.26  ? 36 ASN A O    2  
ATOM   1686  C CB   . ASN A 1 36 ? -1.928  10.772  3.525   1.00 6.50  ? 36 ASN A CB   2  
ATOM   1687  C CG   . ASN A 1 36 ? -1.243  11.133  4.845   1.00 7.27  ? 36 ASN A CG   2  
ATOM   1688  O OD1  . ASN A 1 36 ? -0.391  10.408  5.318   1.00 7.78  ? 36 ASN A OD1  2  
ATOM   1689  N ND2  . ASN A 1 36 ? -1.580  12.233  5.467   1.00 7.61  ? 36 ASN A ND2  2  
ATOM   1690  H H    . ASN A 1 36 ? -3.034  12.887  2.416   1.00 5.70  ? 36 ASN A H    2  
ATOM   1691  H HA   . ASN A 1 36 ? -0.285  11.817  2.626   1.00 6.19  ? 36 ASN A HA   2  
ATOM   1692  H HB2  . ASN A 1 36 ? -2.984  10.990  3.596   1.00 6.55  ? 36 ASN A HB2  2  
ATOM   1693  H HB3  . ASN A 1 36 ? -1.791  9.721   3.327   1.00 6.63  ? 36 ASN A HB3  2  
ATOM   1694  H HD21 . ASN A 1 36 ? -2.266  12.821  5.088   1.00 7.41  ? 36 ASN A HD21 2  
ATOM   1695  H HD22 . ASN A 1 36 ? -1.146  12.469  6.313   1.00 8.19  ? 36 ASN A HD22 2  
ATOM   1696  N N    . THR A 1 37 ? -0.289  10.075  0.787   1.00 5.30  ? 37 THR A N    2  
ATOM   1697  C CA   . THR A 1 37 ? -0.248  9.233   -0.449  1.00 5.18  ? 37 THR A CA   2  
ATOM   1698  C C    . THR A 1 37 ? -0.834  7.851   -0.121  1.00 4.58  ? 37 THR A C    2  
ATOM   1699  O O    . THR A 1 37 ? -0.849  7.439   1.026   1.00 4.95  ? 37 THR A O    2  
ATOM   1700  C CB   . THR A 1 37 ? 1.208   9.083   -0.919  1.00 5.98  ? 37 THR A CB   2  
ATOM   1701  O OG1  . THR A 1 37 ? 1.922   10.287  -0.657  1.00 6.76  ? 37 THR A OG1  2  
ATOM   1702  C CG2  . THR A 1 37 ? 1.240   8.797   -2.420  1.00 6.31  ? 37 THR A CG2  2  
ATOM   1703  H H    . THR A 1 37 ? 0.489   10.098  1.383   1.00 5.59  ? 37 THR A H    2  
ATOM   1704  H HA   . THR A 1 37 ? -0.836  9.700   -1.227  1.00 5.45  ? 37 THR A HA   2  
ATOM   1705  H HB   . THR A 1 37 ? 1.675   8.266   -0.392  1.00 6.11  ? 37 THR A HB   2  
ATOM   1706  H HG1  . THR A 1 37 ? 2.720   10.060  -0.175  1.00 7.02  ? 37 THR A HG1  2  
ATOM   1707  H HG21 . THR A 1 37 ? 0.581   9.483   -2.932  1.00 6.74  ? 37 THR A HG21 2  
ATOM   1708  H HG22 . THR A 1 37 ? 2.248   8.923   -2.789  1.00 6.44  ? 37 THR A HG22 2  
ATOM   1709  H HG23 . THR A 1 37 ? 0.916   7.783   -2.601  1.00 6.33  ? 37 THR A HG23 2  
ATOM   1710  N N    . GLU A 1 38 ? -1.325  7.131   -1.107  1.00 3.94  ? 38 GLU A N    2  
ATOM   1711  C CA   . GLU A 1 38 ? -1.914  5.787   -0.820  1.00 3.67  ? 38 GLU A CA   2  
ATOM   1712  C C    . GLU A 1 38 ? -1.600  4.813   -1.958  1.00 2.99  ? 38 GLU A C    2  
ATOM   1713  O O    . GLU A 1 38 ? -1.711  5.147   -3.123  1.00 3.33  ? 38 GLU A O    2  
ATOM   1714  C CB   . GLU A 1 38 ? -3.434  5.918   -0.669  1.00 4.35  ? 38 GLU A CB   2  
ATOM   1715  C CG   . GLU A 1 38 ? -3.926  4.957   0.419   1.00 4.96  ? 38 GLU A CG   2  
ATOM   1716  C CD   . GLU A 1 38 ? -3.803  5.627   1.791   1.00 5.76  ? 38 GLU A CD   2  
ATOM   1717  O OE1  . GLU A 1 38 ? -2.743  5.524   2.388   1.00 6.28  ? 38 GLU A OE1  2  
ATOM   1718  O OE2  . GLU A 1 38 ? -4.771  6.232   2.222   1.00 6.10  ? 38 GLU A OE2  2  
ATOM   1719  H H    . GLU A 1 38 ? -1.313  7.476   -2.027  1.00 3.89  ? 38 GLU A H    2  
ATOM   1720  H HA   . GLU A 1 38 ? -1.497  5.404   0.099   1.00 3.96  ? 38 GLU A HA   2  
ATOM   1721  H HB2  . GLU A 1 38 ? -3.683  6.933   -0.394  1.00 4.73  ? 38 GLU A HB2  2  
ATOM   1722  H HB3  . GLU A 1 38 ? -3.912  5.672   -1.605  1.00 4.35  ? 38 GLU A HB3  2  
ATOM   1723  H HG2  . GLU A 1 38 ? -4.960  4.704   0.233   1.00 5.14  ? 38 GLU A HG2  2  
ATOM   1724  H HG3  . GLU A 1 38 ? -3.326  4.059   0.405   1.00 4.98  ? 38 GLU A HG3  2  
ATOM   1725  N N    . ILE A 1 39 ? -1.223  3.604   -1.620  1.00 2.48  ? 39 ILE A N    2  
ATOM   1726  C CA   . ILE A 1 39 ? -0.912  2.584   -2.663  1.00 2.38  ? 39 ILE A CA   2  
ATOM   1727  C C    . ILE A 1 39 ? -2.179  1.756   -2.930  1.00 2.16  ? 39 ILE A C    2  
ATOM   1728  O O    . ILE A 1 39 ? -3.077  1.708   -2.111  1.00 2.22  ? 39 ILE A O    2  
ATOM   1729  C CB   . ILE A 1 39 ? 0.221   1.676   -2.142  1.00 2.57  ? 39 ILE A CB   2  
ATOM   1730  C CG1  . ILE A 1 39 ? 1.546   2.452   -2.155  1.00 2.79  ? 39 ILE A CG1  2  
ATOM   1731  C CG2  . ILE A 1 39 ? 0.360   0.427   -3.021  1.00 3.44  ? 39 ILE A CG2  2  
ATOM   1732  C CD1  . ILE A 1 39 ? 2.043   2.657   -0.722  1.00 2.94  ? 39 ILE A CD1  2  
ATOM   1733  H H    . ILE A 1 39 ? -1.153  3.360   -0.669  1.00 2.61  ? 39 ILE A H    2  
ATOM   1734  H HA   . ILE A 1 39 ? -0.598  3.075   -3.573  1.00 2.85  ? 39 ILE A HA   2  
ATOM   1735  H HB   . ILE A 1 39 ? -0.006  1.374   -1.130  1.00 2.54  ? 39 ILE A HB   2  
ATOM   1736  H HG12 . ILE A 1 39 ? 2.283   1.894   -2.714  1.00 3.36  ? 39 ILE A HG12 2  
ATOM   1737  H HG13 . ILE A 1 39 ? 1.395   3.414   -2.621  1.00 2.70  ? 39 ILE A HG13 2  
ATOM   1738  H HG21 . ILE A 1 39 ? 0.280   0.704   -4.061  1.00 3.75  ? 39 ILE A HG21 2  
ATOM   1739  H HG22 . ILE A 1 39 ? 1.322   -0.032  -2.845  1.00 3.64  ? 39 ILE A HG22 2  
ATOM   1740  H HG23 . ILE A 1 39 ? -0.422  -0.277  -2.775  1.00 4.05  ? 39 ILE A HG23 2  
ATOM   1741  H HD11 . ILE A 1 39 ? 1.538   1.969   -0.060  1.00 3.60  ? 39 ILE A HD11 2  
ATOM   1742  H HD12 . ILE A 1 39 ? 3.108   2.477   -0.681  1.00 2.88  ? 39 ILE A HD12 2  
ATOM   1743  H HD13 . ILE A 1 39 ? 1.839   3.670   -0.411  1.00 3.00  ? 39 ILE A HD13 2  
ATOM   1744  N N    . ILE A 1 40 ? -2.258  1.103   -4.065  1.00 2.34  ? 40 ILE A N    2  
ATOM   1745  C CA   . ILE A 1 40 ? -3.456  0.262   -4.372  1.00 2.36  ? 40 ILE A CA   2  
ATOM   1746  C C    . ILE A 1 40 ? -3.010  -0.951  -5.188  1.00 2.37  ? 40 ILE A C    2  
ATOM   1747  O O    . ILE A 1 40 ? -2.206  -0.840  -6.093  1.00 3.02  ? 40 ILE A O    2  
ATOM   1748  C CB   . ILE A 1 40 ? -4.499  1.049   -5.177  1.00 3.14  ? 40 ILE A CB   2  
ATOM   1749  C CG1  . ILE A 1 40 ? -4.837  2.358   -4.457  1.00 3.44  ? 40 ILE A CG1  2  
ATOM   1750  C CG2  . ILE A 1 40 ? -5.770  0.202   -5.311  1.00 3.70  ? 40 ILE A CG2  2  
ATOM   1751  C CD1  . ILE A 1 40 ? -5.703  3.233   -5.365  1.00 4.01  ? 40 ILE A CD1  2  
ATOM   1752  H H    . ILE A 1 40 ? -1.523  1.156   -4.712  1.00 2.72  ? 40 ILE A H    2  
ATOM   1753  H HA   . ILE A 1 40 ? -3.899  -0.077  -3.446  1.00 2.37  ? 40 ILE A HA   2  
ATOM   1754  H HB   . ILE A 1 40 ? -4.108  1.265   -6.160  1.00 3.47  ? 40 ILE A HB   2  
ATOM   1755  H HG12 . ILE A 1 40 ? -5.374  2.141   -3.545  1.00 3.44  ? 40 ILE A HG12 2  
ATOM   1756  H HG13 . ILE A 1 40 ? -3.925  2.881   -4.220  1.00 3.71  ? 40 ILE A HG13 2  
ATOM   1757  H HG21 . ILE A 1 40 ? -5.999  -0.258  -4.360  1.00 3.89  ? 40 ILE A HG21 2  
ATOM   1758  H HG22 . ILE A 1 40 ? -6.594  0.830   -5.615  1.00 3.94  ? 40 ILE A HG22 2  
ATOM   1759  H HG23 . ILE A 1 40 ? -5.612  -0.568  -6.052  1.00 4.13  ? 40 ILE A HG23 2  
ATOM   1760  H HD11 . ILE A 1 40 ? -6.440  2.618   -5.861  1.00 4.33  ? 40 ILE A HD11 2  
ATOM   1761  H HD12 . ILE A 1 40 ? -6.202  3.984   -4.773  1.00 4.43  ? 40 ILE A HD12 2  
ATOM   1762  H HD13 . ILE A 1 40 ? -5.079  3.713   -6.105  1.00 4.17  ? 40 ILE A HD13 2  
ATOM   1763  N N    . VAL A 1 41 ? -3.524  -2.106  -4.868  1.00 2.04  ? 41 VAL A N    2  
ATOM   1764  C CA   . VAL A 1 41 ? -3.145  -3.334  -5.601  1.00 2.10  ? 41 VAL A CA   2  
ATOM   1765  C C    . VAL A 1 41 ? -4.400  -4.180  -5.853  1.00 2.33  ? 41 VAL A C    2  
ATOM   1766  O O    . VAL A 1 41 ? -5.425  -3.989  -5.225  1.00 2.79  ? 41 VAL A O    2  
ATOM   1767  C CB   . VAL A 1 41 ? -2.146  -4.131  -4.759  1.00 2.21  ? 41 VAL A CB   2  
ATOM   1768  C CG1  . VAL A 1 41 ? -0.830  -3.359  -4.651  1.00 2.87  ? 41 VAL A CG1  2  
ATOM   1769  C CG2  . VAL A 1 41 ? -2.705  -4.380  -3.354  1.00 3.20  ? 41 VAL A CG2  2  
ATOM   1770  H H    . VAL A 1 41 ? -4.157  -2.168  -4.137  1.00 2.11  ? 41 VAL A H    2  
ATOM   1771  H HA   . VAL A 1 41 ? -2.692  -3.069  -6.543  1.00 2.57  ? 41 VAL A HA   2  
ATOM   1772  H HB   . VAL A 1 41 ? -1.968  -5.067  -5.239  1.00 2.10  ? 41 VAL A HB   2  
ATOM   1773  H HG11 . VAL A 1 41 ? -0.498  -3.073  -5.638  1.00 3.29  ? 41 VAL A HG11 2  
ATOM   1774  H HG12 . VAL A 1 41 ? -0.979  -2.474  -4.051  1.00 3.43  ? 41 VAL A HG12 2  
ATOM   1775  H HG13 . VAL A 1 41 ? -0.082  -3.985  -4.189  1.00 3.03  ? 41 VAL A HG13 2  
ATOM   1776  H HG21 . VAL A 1 41 ? -3.783  -4.407  -3.392  1.00 3.56  ? 41 VAL A HG21 2  
ATOM   1777  H HG22 . VAL A 1 41 ? -2.335  -5.325  -2.982  1.00 3.58  ? 41 VAL A HG22 2  
ATOM   1778  H HG23 . VAL A 1 41 ? -2.387  -3.586  -2.694  1.00 3.72  ? 41 VAL A HG23 2  
ATOM   1779  N N    . LYS A 1 42 ? -4.322  -5.112  -6.764  1.00 2.44  ? 42 LYS A N    2  
ATOM   1780  C CA   . LYS A 1 42 ? -5.498  -5.979  -7.059  1.00 2.97  ? 42 LYS A CA   2  
ATOM   1781  C C    . LYS A 1 42 ? -5.054  -7.446  -7.025  1.00 2.77  ? 42 LYS A C    2  
ATOM   1782  O O    . LYS A 1 42 ? -4.522  -7.965  -7.990  1.00 2.98  ? 42 LYS A O    2  
ATOM   1783  C CB   . LYS A 1 42 ? -6.058  -5.633  -8.445  1.00 3.77  ? 42 LYS A CB   2  
ATOM   1784  C CG   . LYS A 1 42 ? -7.572  -5.432  -8.351  1.00 4.68  ? 42 LYS A CG   2  
ATOM   1785  C CD   . LYS A 1 42 ? -8.188  -5.512  -9.750  1.00 5.42  ? 42 LYS A CD   2  
ATOM   1786  C CE   . LYS A 1 42 ? -9.711  -5.381  -9.649  1.00 5.72  ? 42 LYS A CE   2  
ATOM   1787  N NZ   . LYS A 1 42 ? -10.093 -3.939  -9.647  1.00 6.76  ? 42 LYS A NZ   2  
ATOM   1788  H H    . LYS A 1 42 ? -3.489  -5.244  -7.252  1.00 2.45  ? 42 LYS A H    2  
ATOM   1789  H HA   . LYS A 1 42 ? -6.259  -5.815  -6.309  1.00 3.37  ? 42 LYS A HA   2  
ATOM   1790  H HB2  . LYS A 1 42 ? -5.596  -4.724  -8.804  1.00 3.94  ? 42 LYS A HB2  2  
ATOM   1791  H HB3  . LYS A 1 42 ? -5.847  -6.439  -9.132  1.00 3.87  ? 42 LYS A HB3  2  
ATOM   1792  H HG2  . LYS A 1 42 ? -7.999  -6.202  -7.724  1.00 4.83  ? 42 LYS A HG2  2  
ATOM   1793  H HG3  . LYS A 1 42 ? -7.781  -4.463  -7.922  1.00 4.94  ? 42 LYS A HG3  2  
ATOM   1794  H HD2  . LYS A 1 42 ? -7.797  -4.710  -10.361 1.00 5.79  ? 42 LYS A HD2  2  
ATOM   1795  H HD3  . LYS A 1 42 ? -7.940  -6.462  -10.200 1.00 5.70  ? 42 LYS A HD3  2  
ATOM   1796  H HE2  . LYS A 1 42 ? -10.170 -5.874  -10.494 1.00 5.66  ? 42 LYS A HE2  2  
ATOM   1797  H HE3  . LYS A 1 42 ? -10.053 -5.845  -8.734  1.00 5.59  ? 42 LYS A HE3  2  
ATOM   1798  H HZ1  . LYS A 1 42 ? -9.642  -3.462  -8.840  1.00 6.85  ? 42 LYS A HZ1  2  
ATOM   1799  H HZ2  . LYS A 1 42 ? -9.778  -3.495  -10.534 1.00 7.12  ? 42 LYS A HZ2  2  
ATOM   1800  H HZ3  . LYS A 1 42 ? -11.125 -3.853  -9.569  1.00 7.24  ? 42 LYS A HZ3  2  
ATOM   1801  N N    . LEU A 1 43 ? -5.261  -8.111  -5.911  1.00 3.01  ? 43 LEU A N    2  
ATOM   1802  C CA   . LEU A 1 43 ? -4.852  -9.542  -5.781  1.00 3.31  ? 43 LEU A CA   2  
ATOM   1803  C C    . LEU A 1 43 ? -5.466  -10.380 -6.906  1.00 3.92  ? 43 LEU A C    2  
ATOM   1804  O O    . LEU A 1 43 ? -6.580  -10.138 -7.343  1.00 4.54  ? 43 LEU A O    2  
ATOM   1805  C CB   . LEU A 1 43 ? -5.334  -10.089 -4.438  1.00 4.01  ? 43 LEU A CB   2  
ATOM   1806  C CG   . LEU A 1 43 ? -4.407  -9.606  -3.316  1.00 3.77  ? 43 LEU A CG   2  
ATOM   1807  C CD1  . LEU A 1 43 ? -5.009  -9.971  -1.957  1.00 4.46  ? 43 LEU A CD1  2  
ATOM   1808  C CD2  . LEU A 1 43 ? -3.034  -10.272 -3.459  1.00 3.91  ? 43 LEU A CD2  2  
ATOM   1809  H H    . LEU A 1 43 ? -5.677  -7.662  -5.147  1.00 3.37  ? 43 LEU A H    2  
ATOM   1810  H HA   . LEU A 1 43 ? -3.776  -9.612  -5.829  1.00 3.08  ? 43 LEU A HA   2  
ATOM   1811  H HB2  . LEU A 1 43 ? -6.336  -9.742  -4.257  1.00 4.55  ? 43 LEU A HB2  2  
ATOM   1812  H HB3  . LEU A 1 43 ? -5.333  -11.163 -4.470  1.00 4.52  ? 43 LEU A HB3  2  
ATOM   1813  H HG   . LEU A 1 43 ? -4.297  -8.533  -3.381  1.00 3.53  ? 43 LEU A HG   2  
ATOM   1814  H HD11 . LEU A 1 43 ? -5.393  -10.980 -1.991  1.00 4.51  ? 43 LEU A HD11 2  
ATOM   1815  H HD12 . LEU A 1 43 ? -4.245  -9.903  -1.195  1.00 5.14  ? 43 LEU A HD12 2  
ATOM   1816  H HD13 . LEU A 1 43 ? -5.812  -9.288  -1.722  1.00 4.57  ? 43 LEU A HD13 2  
ATOM   1817  H HD21 . LEU A 1 43 ? -3.162  -11.305 -3.746  1.00 4.44  ? 43 LEU A HD21 2  
ATOM   1818  H HD22 . LEU A 1 43 ? -2.462  -9.756  -4.215  1.00 3.95  ? 43 LEU A HD22 2  
ATOM   1819  H HD23 . LEU A 1 43 ? -2.511  -10.223 -2.516  1.00 3.96  ? 43 LEU A HD23 2  
ATOM   1820  N N    . SER A 1 44 ? -4.734  -11.369 -7.363  1.00 3.99  ? 44 SER A N    2  
ATOM   1821  C CA   . SER A 1 44 ? -5.221  -12.262 -8.458  1.00 4.72  ? 44 SER A CA   2  
ATOM   1822  C C    . SER A 1 44 ? -6.535  -12.953 -8.059  1.00 5.55  ? 44 SER A C    2  
ATOM   1823  O O    . SER A 1 44 ? -7.303  -13.366 -8.909  1.00 6.08  ? 44 SER A O    2  
ATOM   1824  C CB   . SER A 1 44 ? -4.161  -13.327 -8.754  1.00 4.98  ? 44 SER A CB   2  
ATOM   1825  O OG   . SER A 1 44 ? -3.199  -12.793 -9.655  1.00 5.08  ? 44 SER A OG   2  
ATOM   1826  H H    . SER A 1 44 ? -3.853  -11.526 -6.977  1.00 3.70  ? 44 SER A H    2  
ATOM   1827  H HA   . SER A 1 44 ? -5.383  -11.671 -9.343  1.00 4.83  ? 44 SER A HA   2  
ATOM   1828  H HB2  . SER A 1 44 ? -3.669  -13.611 -7.838  1.00 5.14  ? 44 SER A HB2  2  
ATOM   1829  H HB3  . SER A 1 44 ? -4.636  -14.196 -9.190  1.00 5.37  ? 44 SER A HB3  2  
ATOM   1830  H HG   . SER A 1 44 ? -3.172  -13.358 -10.430 1.00 5.39  ? 44 SER A HG   2  
ATOM   1831  N N    . ASP A 1 45 ? -6.805  -13.077 -6.777  1.00 5.91  ? 45 ASP A N    2  
ATOM   1832  C CA   . ASP A 1 45 ? -8.067  -13.730 -6.327  1.00 7.02  ? 45 ASP A CA   2  
ATOM   1833  C C    . ASP A 1 45 ? -9.270  -12.787 -6.532  1.00 7.25  ? 45 ASP A C    2  
ATOM   1834  O O    . ASP A 1 45 ? -10.380 -13.108 -6.147  1.00 8.19  ? 45 ASP A O    2  
ATOM   1835  C CB   . ASP A 1 45 ? -7.950  -14.088 -4.841  1.00 7.64  ? 45 ASP A CB   2  
ATOM   1836  C CG   . ASP A 1 45 ? -6.872  -15.158 -4.649  1.00 8.01  ? 45 ASP A CG   2  
ATOM   1837  O OD1  . ASP A 1 45 ? -7.205  -16.328 -4.732  1.00 8.63  ? 45 ASP A OD1  2  
ATOM   1838  O OD2  . ASP A 1 45 ? -5.730  -14.787 -4.423  1.00 7.89  ? 45 ASP A OD2  2  
ATOM   1839  H H    . ASP A 1 45 ? -6.180  -12.739 -6.112  1.00 5.60  ? 45 ASP A H    2  
ATOM   1840  H HA   . ASP A 1 45 ? -8.213  -14.628 -6.896  1.00 7.48  ? 45 ASP A HA   2  
ATOM   1841  H HB2  . ASP A 1 45 ? -7.685  -13.204 -4.280  1.00 7.55  ? 45 ASP A HB2  2  
ATOM   1842  H HB3  . ASP A 1 45 ? -8.898  -14.466 -4.486  1.00 8.18  ? 45 ASP A HB3  2  
ATOM   1843  N N    . GLY A 1 46 ? -9.064  -11.627 -7.121  1.00 6.57  ? 46 GLY A N    2  
ATOM   1844  C CA   . GLY A 1 46 ? -10.192 -10.673 -7.332  1.00 7.07  ? 46 GLY A CA   2  
ATOM   1845  C C    . GLY A 1 46 ? -10.357 -9.805  -6.083  1.00 6.74  ? 46 GLY A C    2  
ATOM   1846  O O    . GLY A 1 46 ? -11.459 -9.434  -5.721  1.00 7.17  ? 46 GLY A O    2  
ATOM   1847  H H    . GLY A 1 46 ? -8.168  -11.378 -7.417  1.00 5.88  ? 46 GLY A H    2  
ATOM   1848  H HA2  . GLY A 1 46 ? -9.978  -10.045 -8.186  1.00 7.41  ? 46 GLY A HA2  2  
ATOM   1849  H HA3  . GLY A 1 46 ? -11.101 -11.223 -7.507  1.00 7.56  ? 46 GLY A HA3  2  
ATOM   1850  N N    . ARG A 1 47 ? -9.272  -9.488  -5.415  1.00 6.21  ? 47 ARG A N    2  
ATOM   1851  C CA   . ARG A 1 47 ? -9.365  -8.656  -4.181  1.00 6.07  ? 47 ARG A CA   2  
ATOM   1852  C C    . ARG A 1 47 ? -8.741  -7.277  -4.434  1.00 5.32  ? 47 ARG A C    2  
ATOM   1853  O O    . ARG A 1 47 ? -7.964  -7.097  -5.352  1.00 5.06  ? 47 ARG A O    2  
ATOM   1854  C CB   . ARG A 1 47 ? -8.601  -9.371  -3.059  1.00 6.43  ? 47 ARG A CB   2  
ATOM   1855  C CG   . ARG A 1 47 ? -9.122  -8.921  -1.690  1.00 7.27  ? 47 ARG A CG   2  
ATOM   1856  C CD   . ARG A 1 47 ? -10.427 -9.656  -1.371  1.00 7.96  ? 47 ARG A CD   2  
ATOM   1857  N NE   . ARG A 1 47 ? -10.532 -9.873  0.102   1.00 8.82  ? 47 ARG A NE   2  
ATOM   1858  C CZ   . ARG A 1 47 ? -11.677 -9.697  0.710   1.00 9.62  ? 47 ARG A CZ   2  
ATOM   1859  N NH1  . ARG A 1 47 ? -12.623 -10.596 0.598   1.00 10.15 ? 47 ARG A NH1  2  
ATOM   1860  N NH2  . ARG A 1 47 ? -11.875 -8.625  1.432   1.00 10.10 ? 47 ARG A NH2  2  
ATOM   1861  H H    . ARG A 1 47 ? -8.390  -9.808  -5.721  1.00 6.06  ? 47 ARG A H    2  
ATOM   1862  H HA   . ARG A 1 47 ? -10.399 -8.542  -3.895  1.00 6.58  ? 47 ARG A HA   2  
ATOM   1863  H HB2  . ARG A 1 47 ? -8.735  -10.438 -3.161  1.00 6.43  ? 47 ARG A HB2  2  
ATOM   1864  H HB3  . ARG A 1 47 ? -7.552  -9.134  -3.140  1.00 6.47  ? 47 ARG A HB3  2  
ATOM   1865  H HG2  . ARG A 1 47 ? -8.384  -9.152  -0.934  1.00 7.60  ? 47 ARG A HG2  2  
ATOM   1866  H HG3  . ARG A 1 47 ? -9.302  -7.859  -1.701  1.00 7.34  ? 47 ARG A HG3  2  
ATOM   1867  H HD2  . ARG A 1 47 ? -11.265 -9.063  -1.707  1.00 7.82  ? 47 ARG A HD2  2  
ATOM   1868  H HD3  . ARG A 1 47 ? -10.437 -10.610 -1.876  1.00 8.20  ? 47 ARG A HD3  2  
ATOM   1869  H HE   . ARG A 1 47 ? -9.744  -10.149 0.615   1.00 8.93  ? 47 ARG A HE   2  
ATOM   1870  H HH11 . ARG A 1 47 ? -12.471 -11.417 0.048   1.00 9.97  ? 47 ARG A HH11 2  
ATOM   1871  H HH12 . ARG A 1 47 ? -13.499 -10.461 1.063   1.00 10.86 ? 47 ARG A HH12 2  
ATOM   1872  H HH21 . ARG A 1 47 ? -11.151 -7.940  1.519   1.00 9.88  ? 47 ARG A HH21 2  
ATOM   1873  H HH22 . ARG A 1 47 ? -12.750 -8.488  1.896   1.00 10.80 ? 47 ARG A HH22 2  
ATOM   1874  N N    . GLU A 1 48 ? -9.074  -6.309  -3.618  1.00 5.24  ? 48 GLU A N    2  
ATOM   1875  C CA   . GLU A 1 48 ? -8.498  -4.941  -3.782  1.00 4.73  ? 48 GLU A CA   2  
ATOM   1876  C C    . GLU A 1 48 ? -8.004  -4.463  -2.414  1.00 4.69  ? 48 GLU A C    2  
ATOM   1877  O O    . GLU A 1 48 ? -8.786  -4.263  -1.501  1.00 5.44  ? 48 GLU A O    2  
ATOM   1878  C CB   . GLU A 1 48 ? -9.567  -3.981  -4.316  1.00 5.60  ? 48 GLU A CB   2  
ATOM   1879  C CG   . GLU A 1 48 ? -8.937  -3.036  -5.344  1.00 5.76  ? 48 GLU A CG   2  
ATOM   1880  C CD   . GLU A 1 48 ? -9.953  -1.966  -5.750  1.00 6.79  ? 48 GLU A CD   2  
ATOM   1881  O OE1  . GLU A 1 48 ? -10.130 -1.026  -4.992  1.00 7.44  ? 48 GLU A OE1  2  
ATOM   1882  O OE2  . GLU A 1 48 ? -10.535 -2.103  -6.814  1.00 7.12  ? 48 GLU A OE2  2  
ATOM   1883  H H    . GLU A 1 48 ? -9.698  -6.485  -2.884  1.00 5.71  ? 48 GLU A H    2  
ATOM   1884  H HA   . GLU A 1 48 ? -7.665  -4.980  -4.471  1.00 4.10  ? 48 GLU A HA   2  
ATOM   1885  H HB2  . GLU A 1 48 ? -10.359 -4.548  -4.786  1.00 5.76  ? 48 GLU A HB2  2  
ATOM   1886  H HB3  . GLU A 1 48 ? -9.974  -3.404  -3.500  1.00 6.30  ? 48 GLU A HB3  2  
ATOM   1887  H HG2  . GLU A 1 48 ? -8.068  -2.563  -4.910  1.00 5.48  ? 48 GLU A HG2  2  
ATOM   1888  H HG3  . GLU A 1 48 ? -8.642  -3.599  -6.218  1.00 5.78  ? 48 GLU A HG3  2  
ATOM   1889  N N    . LEU A 1 49 ? -6.714  -4.301  -2.259  1.00 4.08  ? 49 LEU A N    2  
ATOM   1890  C CA   . LEU A 1 49 ? -6.168  -3.859  -0.937  1.00 4.35  ? 49 LEU A CA   2  
ATOM   1891  C C    . LEU A 1 49 ? -5.275  -2.631  -1.113  1.00 3.99  ? 49 LEU A C    2  
ATOM   1892  O O    . LEU A 1 49 ? -4.307  -2.660  -1.842  1.00 3.87  ? 49 LEU A O    2  
ATOM   1893  C CB   . LEU A 1 49 ? -5.326  -4.985  -0.327  1.00 4.67  ? 49 LEU A CB   2  
ATOM   1894  C CG   . LEU A 1 49 ? -6.039  -5.574  0.894   1.00 4.92  ? 49 LEU A CG   2  
ATOM   1895  C CD1  . LEU A 1 49 ? -7.093  -6.585  0.440   1.00 5.51  ? 49 LEU A CD1  2  
ATOM   1896  C CD2  . LEU A 1 49 ? -5.011  -6.280  1.780   1.00 4.69  ? 49 LEU A CD2  2  
ATOM   1897  H H    . LEU A 1 49 ? -6.103  -4.482  -3.007  1.00 3.67  ? 49 LEU A H    2  
ATOM   1898  H HA   . LEU A 1 49 ? -6.983  -3.618  -0.271  1.00 4.89  ? 49 LEU A HA   2  
ATOM   1899  H HB2  . LEU A 1 49 ? -5.169  -5.760  -1.062  1.00 4.69  ? 49 LEU A HB2  2  
ATOM   1900  H HB3  . LEU A 1 49 ? -4.373  -4.582  -0.018  1.00 5.10  ? 49 LEU A HB3  2  
ATOM   1901  H HG   . LEU A 1 49 ? -6.516  -4.781  1.452   1.00 5.20  ? 49 LEU A HG   2  
ATOM   1902  H HD11 . LEU A 1 49 ? -6.675  -7.220  -0.328  1.00 5.91  ? 49 LEU A HD11 2  
ATOM   1903  H HD12 . LEU A 1 49 ? -7.396  -7.189  1.282   1.00 5.66  ? 49 LEU A HD12 2  
ATOM   1904  H HD13 . LEU A 1 49 ? -7.949  -6.059  0.046   1.00 5.74  ? 49 LEU A HD13 2  
ATOM   1905  H HD21 . LEU A 1 49 ? -4.118  -5.677  1.847   1.00 4.52  ? 49 LEU A HD21 2  
ATOM   1906  H HD22 . LEU A 1 49 ? -5.423  -6.421  2.768   1.00 4.66  ? 49 LEU A HD22 2  
ATOM   1907  H HD23 . LEU A 1 49 ? -4.763  -7.241  1.353   1.00 5.11  ? 49 LEU A HD23 2  
ATOM   1908  N N    . CYS A 1 50 ? -5.566  -1.567  -0.414  1.00 3.99  ? 50 CYS A N    2  
ATOM   1909  C CA   . CYS A 1 50 ? -4.701  -0.357  -0.511  1.00 3.63  ? 50 CYS A CA   2  
ATOM   1910  C C    . CYS A 1 50 ? -3.560  -0.544  0.479   1.00 3.49  ? 50 CYS A C    2  
ATOM   1911  O O    . CYS A 1 50 ? -3.780  -0.937  1.604   1.00 4.14  ? 50 CYS A O    2  
ATOM   1912  C CB   . CYS A 1 50 ? -5.469  0.910   -0.149  1.00 3.72  ? 50 CYS A CB   2  
ATOM   1913  S SG   . CYS A 1 50 ? -7.260  0.640   -0.247  1.00 4.64  ? 50 CYS A SG   2  
ATOM   1914  H H    . CYS A 1 50 ? -6.324  -1.579  0.200   1.00 4.28  ? 50 CYS A H    2  
ATOM   1915  H HA   . CYS A 1 50 ? -4.307  -0.268  -1.505  1.00 3.59  ? 50 CYS A HA   2  
ATOM   1916  H HB2  . CYS A 1 50 ? -5.196  1.201   0.842   1.00 3.90  ? 50 CYS A HB2  2  
ATOM   1917  H HB3  . CYS A 1 50 ? -5.192  1.693   -0.834  1.00 3.38  ? 50 CYS A HB3  2  
ATOM   1918  N N    . LEU A 1 51 ? -2.346  -0.306  0.070   1.00 2.91  ? 51 LEU A N    2  
ATOM   1919  C CA   . LEU A 1 51 ? -1.203  -0.517  0.991   1.00 2.96  ? 51 LEU A CA   2  
ATOM   1920  C C    . LEU A 1 51 ? -0.823  0.769   1.713   1.00 3.35  ? 51 LEU A C    2  
ATOM   1921  O O    . LEU A 1 51 ? -1.057  1.870   1.245   1.00 3.56  ? 51 LEU A O    2  
ATOM   1922  C CB   . LEU A 1 51 ? 0.000   -1.029  0.208   1.00 2.71  ? 51 LEU A CB   2  
ATOM   1923  C CG   . LEU A 1 51 ? -0.369  -2.291  -0.596  1.00 2.56  ? 51 LEU A CG   2  
ATOM   1924  C CD1  . LEU A 1 51 ? 0.888   -3.124  -0.818  1.00 2.98  ? 51 LEU A CD1  2  
ATOM   1925  C CD2  . LEU A 1 51 ? -1.390  -3.145  0.169   1.00 2.61  ? 51 LEU A CD2  2  
ATOM   1926  H H    . LEU A 1 51 ? -2.185  -0.022  -0.842  1.00 2.70  ? 51 LEU A H    2  
ATOM   1927  H HA   . LEU A 1 51 ? -1.478  -1.254  1.723   1.00 3.34  ? 51 LEU A HA   2  
ATOM   1928  H HB2  . LEU A 1 51 ? 0.337   -0.258  -0.459  1.00 2.95  ? 51 LEU A HB2  2  
ATOM   1929  H HB3  . LEU A 1 51 ? 0.785   -1.266  0.896   1.00 2.93  ? 51 LEU A HB3  2  
ATOM   1930  H HG   . LEU A 1 51 ? -0.781  -2.000  -1.552  1.00 2.88  ? 51 LEU A HG   2  
ATOM   1931  H HD11 . LEU A 1 51 ? 1.678   -2.493  -1.193  1.00 3.34  ? 51 LEU A HD11 2  
ATOM   1932  H HD12 . LEU A 1 51 ? 1.193   -3.565  0.120   1.00 3.13  ? 51 LEU A HD12 2  
ATOM   1933  H HD13 . LEU A 1 51 ? 0.678   -3.906  -1.531  1.00 3.38  ? 51 LEU A HD13 2  
ATOM   1934  H HD21 . LEU A 1 51 ? -1.110  -3.193  1.211   1.00 3.04  ? 51 LEU A HD21 2  
ATOM   1935  H HD22 . LEU A 1 51 ? -2.370  -2.703  0.079   1.00 2.85  ? 51 LEU A HD22 2  
ATOM   1936  H HD23 . LEU A 1 51 ? -1.407  -4.142  -0.245  1.00 2.77  ? 51 LEU A HD23 2  
ATOM   1937  N N    . ASP A 1 52 ? -0.222  0.605   2.862   1.00 3.84  ? 52 ASP A N    2  
ATOM   1938  C CA   . ASP A 1 52 ? 0.209   1.764   3.686   1.00 4.35  ? 52 ASP A CA   2  
ATOM   1939  C C    . ASP A 1 52 ? 1.726   1.963   3.526   1.00 4.47  ? 52 ASP A C    2  
ATOM   1940  O O    . ASP A 1 52 ? 2.502   1.095   3.885   1.00 4.73  ? 52 ASP A O    2  
ATOM   1941  C CB   . ASP A 1 52 ? -0.121  1.470   5.156   1.00 4.93  ? 52 ASP A CB   2  
ATOM   1942  C CG   . ASP A 1 52 ? -0.281  2.780   5.940   1.00 5.39  ? 52 ASP A CG   2  
ATOM   1943  O OD1  . ASP A 1 52 ? 0.531   3.673   5.755   1.00 5.96  ? 52 ASP A OD1  2  
ATOM   1944  O OD2  . ASP A 1 52 ? -1.213  2.864   6.721   1.00 5.40  ? 52 ASP A OD2  2  
ATOM   1945  H H    . ASP A 1 52 ? -0.052  -0.303  3.180   1.00 4.08  ? 52 ASP A H    2  
ATOM   1946  H HA   . ASP A 1 52 ? -0.314  2.652   3.368   1.00 4.52  ? 52 ASP A HA   2  
ATOM   1947  H HB2  . ASP A 1 52 ? -1.044  0.907   5.208   1.00 5.32  ? 52 ASP A HB2  2  
ATOM   1948  H HB3  . ASP A 1 52 ? 0.674   0.888   5.590   1.00 4.91  ? 52 ASP A HB3  2  
ATOM   1949  N N    . PRO A 1 53 ? 2.107   3.108   2.997   1.00 4.54  ? 53 PRO A N    2  
ATOM   1950  C CA   . PRO A 1 53 ? 3.529   3.443   2.774   1.00 4.96  ? 53 PRO A CA   2  
ATOM   1951  C C    . PRO A 1 53 ? 4.268   3.671   4.104   1.00 5.21  ? 53 PRO A C    2  
ATOM   1952  O O    . PRO A 1 53 ? 5.480   3.775   4.129   1.00 5.67  ? 53 PRO A O    2  
ATOM   1953  C CB   . PRO A 1 53 ? 3.473   4.714   1.918   1.00 5.26  ? 53 PRO A CB   2  
ATOM   1954  C CG   . PRO A 1 53 ? 2.076   5.333   2.148   1.00 5.04  ? 53 PRO A CG   2  
ATOM   1955  C CD   . PRO A 1 53 ? 1.165   4.180   2.604   1.00 4.55  ? 53 PRO A CD   2  
ATOM   1956  H HA   . PRO A 1 53 ? 4.011   2.656   2.216   1.00 5.07  ? 53 PRO A HA   2  
ATOM   1957  H HB2  . PRO A 1 53 ? 4.245   5.405   2.230   1.00 5.72  ? 53 PRO A HB2  2  
ATOM   1958  H HB3  . PRO A 1 53 ? 3.594   4.467   0.876   1.00 5.40  ? 53 PRO A HB3  2  
ATOM   1959  H HG2  . PRO A 1 53 ? 2.130   6.095   2.914   1.00 5.39  ? 53 PRO A HG2  2  
ATOM   1960  H HG3  . PRO A 1 53 ? 1.700   5.754   1.229   1.00 5.11  ? 53 PRO A HG3  2  
ATOM   1961  H HD2  . PRO A 1 53 ? 0.562   4.488   3.447   1.00 4.78  ? 53 PRO A HD2  2  
ATOM   1962  H HD3  . PRO A 1 53 ? 0.540   3.847   1.790   1.00 4.27  ? 53 PRO A HD3  2  
ATOM   1963  N N    . LYS A 1 54 ? 3.552   3.731   5.208   1.00 5.18  ? 54 LYS A N    2  
ATOM   1964  C CA   . LYS A 1 54 ? 4.209   3.927   6.529   1.00 5.61  ? 54 LYS A CA   2  
ATOM   1965  C C    . LYS A 1 54 ? 5.158   2.756   6.818   1.00 5.02  ? 54 LYS A C    2  
ATOM   1966  O O    . LYS A 1 54 ? 6.157   2.917   7.495   1.00 5.42  ? 54 LYS A O    2  
ATOM   1967  C CB   . LYS A 1 54 ? 3.143   3.997   7.628   1.00 6.23  ? 54 LYS A CB   2  
ATOM   1968  C CG   . LYS A 1 54 ? 2.743   5.456   7.870   1.00 7.12  ? 54 LYS A CG   2  
ATOM   1969  C CD   . LYS A 1 54 ? 1.811   5.538   9.083   1.00 7.85  ? 54 LYS A CD   2  
ATOM   1970  C CE   . LYS A 1 54 ? 1.854   6.952   9.674   1.00 8.63  ? 54 LYS A CE   2  
ATOM   1971  N NZ   . LYS A 1 54 ? 0.975   7.858   8.879   1.00 9.56  ? 54 LYS A NZ   2  
ATOM   1972  H H    . LYS A 1 54 ? 2.584   3.636   5.168   1.00 5.07  ? 54 LYS A H    2  
ATOM   1973  H HA   . LYS A 1 54 ? 4.765   4.844   6.510   1.00 6.14  ? 54 LYS A HA   2  
ATOM   1974  H HB2  . LYS A 1 54 ? 2.276   3.431   7.324   1.00 6.01  ? 54 LYS A HB2  2  
ATOM   1975  H HB3  . LYS A 1 54 ? 3.542   3.578   8.540   1.00 6.42  ? 54 LYS A HB3  2  
ATOM   1976  H HG2  . LYS A 1 54 ? 3.629   6.046   8.054   1.00 7.47  ? 54 LYS A HG2  2  
ATOM   1977  H HG3  . LYS A 1 54 ? 2.230   5.837   6.999   1.00 7.15  ? 54 LYS A HG3  2  
ATOM   1978  H HD2  . LYS A 1 54 ? 0.802   5.306   8.776   1.00 8.02  ? 54 LYS A HD2  2  
ATOM   1979  H HD3  . LYS A 1 54 ? 2.131   4.828   9.832   1.00 7.93  ? 54 LYS A HD3  2  
ATOM   1980  H HE2  . LYS A 1 54 ? 1.508   6.923   10.697  1.00 8.78  ? 54 LYS A HE2  2  
ATOM   1981  H HE3  . LYS A 1 54 ? 2.868   7.321   9.649   1.00 8.58  ? 54 LYS A HE3  2  
ATOM   1982  H HZ1  . LYS A 1 54 ? 0.018   7.451   8.820   1.00 9.93  ? 54 LYS A HZ1  2  
ATOM   1983  H HZ2  . LYS A 1 54 ? 0.928   8.788   9.341   1.00 9.78  ? 54 LYS A HZ2  2  
ATOM   1984  H HZ3  . LYS A 1 54 ? 1.364   7.970   7.922   1.00 9.84  ? 54 LYS A HZ3  2  
ATOM   1985  N N    . GLU A 1 55 ? 4.863   1.579   6.306   1.00 4.37  ? 55 GLU A N    2  
ATOM   1986  C CA   . GLU A 1 55 ? 5.750   0.412   6.548   1.00 4.14  ? 55 GLU A CA   2  
ATOM   1987  C C    . GLU A 1 55 ? 6.913   0.439   5.566   1.00 3.84  ? 55 GLU A C    2  
ATOM   1988  O O    . GLU A 1 55 ? 6.893   1.143   4.571   1.00 3.83  ? 55 GLU A O    2  
ATOM   1989  C CB   . GLU A 1 55 ? 4.976   -0.885  6.322   1.00 4.19  ? 55 GLU A CB   2  
ATOM   1990  C CG   . GLU A 1 55 ? 3.907   -1.053  7.397   1.00 4.76  ? 55 GLU A CG   2  
ATOM   1991  C CD   . GLU A 1 55 ? 2.567   -0.535  6.870   1.00 5.39  ? 55 GLU A CD   2  
ATOM   1992  O OE1  . GLU A 1 55 ? 1.978   -1.209  6.041   1.00 6.13  ? 55 GLU A OE1  2  
ATOM   1993  O OE2  . GLU A 1 55 ? 2.155   0.530   7.301   1.00 5.43  ? 55 GLU A OE2  2  
ATOM   1994  H H    . GLU A 1 55 ? 4.059   1.461   5.756   1.00 4.29  ? 55 GLU A H    2  
ATOM   1995  H HA   . GLU A 1 55 ? 6.125   0.439   7.560   1.00 4.53  ? 55 GLU A HA   2  
ATOM   1996  H HB2  . GLU A 1 55 ? 4.512   -0.856  5.350   1.00 4.04  ? 55 GLU A HB2  2  
ATOM   1997  H HB3  . GLU A 1 55 ? 5.657   -1.714  6.365   1.00 4.32  ? 55 GLU A HB3  2  
ATOM   1998  H HG2  . GLU A 1 55 ? 3.816   -2.094  7.652   1.00 4.81  ? 55 GLU A HG2  2  
ATOM   1999  H HG3  . GLU A 1 55 ? 4.191   -0.498  8.270   1.00 4.98  ? 55 GLU A HG3  2  
ATOM   2000  N N    . ASN A 1 56 ? 7.905   -0.361  5.823   1.00 3.90  ? 56 ASN A N    2  
ATOM   2001  C CA   . ASN A 1 56 ? 9.068   -0.443  4.902   1.00 3.93  ? 56 ASN A CA   2  
ATOM   2002  C C    . ASN A 1 56 ? 8.825   -1.562  3.886   1.00 3.74  ? 56 ASN A C    2  
ATOM   2003  O O    . ASN A 1 56 ? 9.477   -1.626  2.863   1.00 3.89  ? 56 ASN A O    2  
ATOM   2004  C CB   . ASN A 1 56 ? 10.330  -0.735  5.698   1.00 4.29  ? 56 ASN A CB   2  
ATOM   2005  C CG   . ASN A 1 56 ? 11.296  0.447   5.580   1.00 4.70  ? 56 ASN A CG   2  
ATOM   2006  O OD1  . ASN A 1 56 ? 11.414  1.242   6.492   1.00 4.90  ? 56 ASN A OD1  2  
ATOM   2007  N ND2  . ASN A 1 56 ? 11.995  0.600   4.487   1.00 5.15  ? 56 ASN A ND2  2  
ATOM   2008  H H    . ASN A 1 56 ? 7.869   -0.938  6.615   1.00 4.12  ? 56 ASN A H    2  
ATOM   2009  H HA   . ASN A 1 56 ? 9.184   0.488   4.386   1.00 4.07  ? 56 ASN A HA   2  
ATOM   2010  H HB2  . ASN A 1 56 ? 10.067  -0.885  6.728   1.00 4.38  ? 56 ASN A HB2  2  
ATOM   2011  H HB3  . ASN A 1 56 ? 10.798  -1.622  5.311   1.00 4.36  ? 56 ASN A HB3  2  
ATOM   2012  H HD21 . ASN A 1 56 ? 11.901  -0.040  3.750   1.00 5.31  ? 56 ASN A HD21 2  
ATOM   2013  H HD22 . ASN A 1 56 ? 12.614  1.355   4.404   1.00 5.51  ? 56 ASN A HD22 2  
ATOM   2014  N N    . TRP A 1 57 ? 7.884   -2.442  4.160   1.00 3.55  ? 57 TRP A N    2  
ATOM   2015  C CA   . TRP A 1 57 ? 7.591   -3.545  3.218   1.00 3.47  ? 57 TRP A CA   2  
ATOM   2016  C C    . TRP A 1 57 ? 6.689   -3.038  2.098   1.00 3.28  ? 57 TRP A C    2  
ATOM   2017  O O    . TRP A 1 57 ? 6.849   -3.414  0.961   1.00 3.48  ? 57 TRP A O    2  
ATOM   2018  C CB   . TRP A 1 57 ? 6.937   -4.712  3.967   1.00 3.64  ? 57 TRP A CB   2  
ATOM   2019  C CG   . TRP A 1 57 ? 5.511   -4.438  4.316   1.00 3.70  ? 57 TRP A CG   2  
ATOM   2020  C CD1  . TRP A 1 57 ? 5.089   -4.046  5.526   1.00 4.08  ? 57 TRP A CD1  2  
ATOM   2021  C CD2  . TRP A 1 57 ? 4.317   -4.551  3.485   1.00 3.51  ? 57 TRP A CD2  2  
ATOM   2022  N NE1  . TRP A 1 57 ? 3.716   -3.942  5.510   1.00 4.20  ? 57 TRP A NE1  2  
ATOM   2023  C CE2  . TRP A 1 57 ? 3.193   -4.224  4.274   1.00 3.80  ? 57 TRP A CE2  2  
ATOM   2024  C CE3  . TRP A 1 57 ? 4.100   -4.901  2.142   1.00 3.27  ? 57 TRP A CE3  2  
ATOM   2025  C CZ2  . TRP A 1 57 ? 1.899   -4.244  3.758   1.00 3.76  ? 57 TRP A CZ2  2  
ATOM   2026  C CZ3  . TRP A 1 57 ? 2.799   -4.918  1.616   1.00 3.17  ? 57 TRP A CZ3  2  
ATOM   2027  C CH2  . TRP A 1 57 ? 1.700   -4.590  2.422   1.00 3.38  ? 57 TRP A CH2  2  
ATOM   2028  H H    . TRP A 1 57 ? 7.371   -2.372  4.982   1.00 3.59  ? 57 TRP A H    2  
ATOM   2029  H HA   . TRP A 1 57 ? 8.518   -3.879  2.795   1.00 3.59  ? 57 TRP A HA   2  
ATOM   2030  H HB2  . TRP A 1 57 ? 6.969   -5.583  3.361   1.00 3.77  ? 57 TRP A HB2  2  
ATOM   2031  H HB3  . TRP A 1 57 ? 7.491   -4.896  4.869   1.00 3.78  ? 57 TRP A HB3  2  
ATOM   2032  H HD1  . TRP A 1 57 ? 5.722   -3.862  6.373   1.00 4.35  ? 57 TRP A HD1  2  
ATOM   2033  H HE1  . TRP A 1 57 ? 3.167   -3.696  6.265   1.00 4.57  ? 57 TRP A HE1  2  
ATOM   2034  H HE3  . TRP A 1 57 ? 4.938   -5.155  1.511   1.00 3.29  ? 57 TRP A HE3  2  
ATOM   2035  H HZ2  . TRP A 1 57 ? 1.058   -3.988  4.388   1.00 4.10  ? 57 TRP A HZ2  2  
ATOM   2036  H HZ3  . TRP A 1 57 ? 2.646   -5.179  0.586   1.00 3.03  ? 57 TRP A HZ3  2  
ATOM   2037  H HH2  . TRP A 1 57 ? 0.702   -4.605  2.009   1.00 3.37  ? 57 TRP A HH2  2  
ATOM   2038  N N    . VAL A 1 58 ? 5.751   -2.177  2.405   1.00 3.02  ? 58 VAL A N    2  
ATOM   2039  C CA   . VAL A 1 58 ? 4.857   -1.638  1.336   1.00 2.84  ? 58 VAL A CA   2  
ATOM   2040  C C    . VAL A 1 58 ? 5.706   -0.820  0.353   1.00 2.99  ? 58 VAL A C    2  
ATOM   2041  O O    . VAL A 1 58 ? 5.550   -0.927  -0.848  1.00 3.21  ? 58 VAL A O    2  
ATOM   2042  C CB   . VAL A 1 58 ? 3.776   -0.745  1.963   1.00 2.78  ? 58 VAL A CB   2  
ATOM   2043  C CG1  . VAL A 1 58 ? 3.226   0.240   0.928   1.00 2.80  ? 58 VAL A CG1  2  
ATOM   2044  C CG2  . VAL A 1 58 ? 2.631   -1.606  2.481   1.00 2.85  ? 58 VAL A CG2  2  
ATOM   2045  H H    . VAL A 1 58 ? 5.644   -1.882  3.338   1.00 3.04  ? 58 VAL A H    2  
ATOM   2046  H HA   . VAL A 1 58 ? 4.393   -2.458  0.809   1.00 2.96  ? 58 VAL A HA   2  
ATOM   2047  H HB   . VAL A 1 58 ? 4.207   -0.199  2.783   1.00 3.12  ? 58 VAL A HB   2  
ATOM   2048  H HG11 . VAL A 1 58 ? 3.061   -0.275  -0.006  1.00 3.10  ? 58 VAL A HG11 2  
ATOM   2049  H HG12 . VAL A 1 58 ? 2.292   0.650   1.283   1.00 2.86  ? 58 VAL A HG12 2  
ATOM   2050  H HG13 . VAL A 1 58 ? 3.936   1.039   0.779   1.00 3.08  ? 58 VAL A HG13 2  
ATOM   2051  H HG21 . VAL A 1 58 ? 2.454   -2.417  1.793   1.00 2.93  ? 58 VAL A HG21 2  
ATOM   2052  H HG22 . VAL A 1 58 ? 2.892   -2.002  3.449   1.00 3.15  ? 58 VAL A HG22 2  
ATOM   2053  H HG23 . VAL A 1 58 ? 1.739   -1.005  2.564   1.00 3.17  ? 58 VAL A HG23 2  
ATOM   2054  N N    . GLN A 1 59 ? 6.611   -0.011  0.859   1.00 3.12  ? 59 GLN A N    2  
ATOM   2055  C CA   . GLN A 1 59 ? 7.474   0.805   -0.040  1.00 3.61  ? 59 GLN A CA   2  
ATOM   2056  C C    . GLN A 1 59 ? 8.502   -0.098  -0.741  1.00 3.90  ? 59 GLN A C    2  
ATOM   2057  O O    . GLN A 1 59 ? 8.899   0.164   -1.859  1.00 4.47  ? 59 GLN A O    2  
ATOM   2058  C CB   . GLN A 1 59 ? 8.177   1.896   0.768   1.00 3.82  ? 59 GLN A CB   2  
ATOM   2059  C CG   . GLN A 1 59 ? 9.086   1.250   1.800   1.00 4.33  ? 59 GLN A CG   2  
ATOM   2060  C CD   . GLN A 1 59 ? 9.784   2.334   2.629   1.00 4.72  ? 59 GLN A CD   2  
ATOM   2061  O OE1  . GLN A 1 59 ? 10.867  2.766   2.292   1.00 4.84  ? 59 GLN A OE1  2  
ATOM   2062  N NE2  . GLN A 1 59 ? 9.207   2.792   3.709   1.00 5.29  ? 59 GLN A NE2  2  
ATOM   2063  H H    . GLN A 1 59 ? 6.727   0.051   1.829   1.00 3.04  ? 59 GLN A H    2  
ATOM   2064  H HA   . GLN A 1 59 ? 6.863   1.268   -0.779  1.00 3.80  ? 59 GLN A HA   2  
ATOM   2065  H HB2  . GLN A 1 59 ? 8.760   2.508   0.105   1.00 3.96  ? 59 GLN A HB2  2  
ATOM   2066  H HB3  . GLN A 1 59 ? 7.439   2.505   1.268   1.00 3.78  ? 59 GLN A HB3  2  
ATOM   2067  H HG2  . GLN A 1 59 ? 8.493   0.623   2.442   1.00 4.58  ? 59 GLN A HG2  2  
ATOM   2068  H HG3  . GLN A 1 59 ? 9.821   0.653   1.292   1.00 4.52  ? 59 GLN A HG3  2  
ATOM   2069  H HE21 . GLN A 1 59 ? 8.332   2.445   3.984   1.00 5.47  ? 59 GLN A HE21 2  
ATOM   2070  H HE22 . GLN A 1 59 ? 9.649   3.485   4.242   1.00 5.70  ? 59 GLN A HE22 2  
ATOM   2071  N N    . ARG A 1 60 ? 8.911   -1.175  -0.107  1.00 3.65  ? 60 ARG A N    2  
ATOM   2072  C CA   . ARG A 1 60 ? 9.885   -2.107  -0.755  1.00 3.97  ? 60 ARG A CA   2  
ATOM   2073  C C    . ARG A 1 60 ? 9.124   -2.956  -1.771  1.00 3.96  ? 60 ARG A C    2  
ATOM   2074  O O    . ARG A 1 60 ? 9.582   -3.183  -2.872  1.00 4.42  ? 60 ARG A O    2  
ATOM   2075  C CB   . ARG A 1 60 ? 10.519  -3.018  0.300   1.00 4.07  ? 60 ARG A CB   2  
ATOM   2076  C CG   . ARG A 1 60 ? 11.898  -3.479  -0.181  1.00 4.60  ? 60 ARG A CG   2  
ATOM   2077  C CD   . ARG A 1 60 ? 12.966  -2.486  0.285   1.00 4.81  ? 60 ARG A CD   2  
ATOM   2078  N NE   . ARG A 1 60 ? 14.124  -2.527  -0.655  1.00 5.26  ? 60 ARG A NE   2  
ATOM   2079  C CZ   . ARG A 1 60 ? 15.121  -3.340  -0.430  1.00 5.84  ? 60 ARG A CZ   2  
ATOM   2080  N NH1  . ARG A 1 60 ? 16.124  -2.953  0.318   1.00 6.25  ? 60 ARG A NH1  2  
ATOM   2081  N NH2  . ARG A 1 60 ? 15.116  -4.541  -0.952  1.00 6.35  ? 60 ARG A NH2  2  
ATOM   2082  H H    . ARG A 1 60 ? 8.556   -1.385  0.781   1.00 3.35  ? 60 ARG A H    2  
ATOM   2083  H HA   . ARG A 1 60 ? 10.653  -1.538  -1.258  1.00 4.24  ? 60 ARG A HA   2  
ATOM   2084  H HB2  . ARG A 1 60 ? 10.620  -2.478  1.227   1.00 3.95  ? 60 ARG A HB2  2  
ATOM   2085  H HB3  . ARG A 1 60 ? 9.889   -3.881  0.455   1.00 4.07  ? 60 ARG A HB3  2  
ATOM   2086  H HG2  . ARG A 1 60 ? 12.112  -4.456  0.229   1.00 4.80  ? 60 ARG A HG2  2  
ATOM   2087  H HG3  . ARG A 1 60 ? 11.905  -3.532  -1.259  1.00 4.99  ? 60 ARG A HG3  2  
ATOM   2088  H HD2  . ARG A 1 60 ? 12.549  -1.489  0.300   1.00 4.73  ? 60 ARG A HD2  2  
ATOM   2089  H HD3  . ARG A 1 60 ? 13.297  -2.753  1.277   1.00 5.10  ? 60 ARG A HD3  2  
ATOM   2090  H HE   . ARG A 1 60 ? 14.134  -1.944  -1.443  1.00 5.37  ? 60 ARG A HE   2  
ATOM   2091  H HH11 . ARG A 1 60 ? 16.127  -2.035  0.717   1.00 6.14  ? 60 ARG A HH11 2  
ATOM   2092  H HH12 . ARG A 1 60 ? 16.890  -3.574  0.492   1.00 6.86  ? 60 ARG A HH12 2  
ATOM   2093  H HH21 . ARG A 1 60 ? 14.349  -4.835  -1.523  1.00 6.32  ? 60 ARG A HH21 2  
ATOM   2094  H HH22 . ARG A 1 60 ? 15.879  -5.165  -0.780  1.00 6.96  ? 60 ARG A HH22 2  
ATOM   2095  N N    . VAL A 1 61 ? 7.952   -3.409  -1.398  1.00 3.58  ? 61 VAL A N    2  
ATOM   2096  C CA   . VAL A 1 61 ? 7.115   -4.231  -2.320  1.00 3.55  ? 61 VAL A CA   2  
ATOM   2097  C C    . VAL A 1 61 ? 6.783   -3.408  -3.571  1.00 3.25  ? 61 VAL A C    2  
ATOM   2098  O O    . VAL A 1 61 ? 6.810   -3.912  -4.678  1.00 3.52  ? 61 VAL A O    2  
ATOM   2099  C CB   . VAL A 1 61 ? 5.823   -4.631  -1.585  1.00 3.59  ? 61 VAL A CB   2  
ATOM   2100  C CG1  . VAL A 1 61 ? 4.732   -5.021  -2.584  1.00 3.56  ? 61 VAL A CG1  2  
ATOM   2101  C CG2  . VAL A 1 61 ? 6.113   -5.816  -0.662  1.00 4.31  ? 61 VAL A CG2  2  
ATOM   2102  H H    . VAL A 1 61 ? 7.613   -3.195  -0.497  1.00 3.39  ? 61 VAL A H    2  
ATOM   2103  H HA   . VAL A 1 61 ? 7.659   -5.115  -2.608  1.00 3.93  ? 61 VAL A HA   2  
ATOM   2104  H HB   . VAL A 1 61 ? 5.478   -3.795  -0.994  1.00 3.40  ? 61 VAL A HB   2  
ATOM   2105  H HG11 . VAL A 1 61 ? 5.189   -5.346  -3.507  1.00 3.73  ? 61 VAL A HG11 2  
ATOM   2106  H HG12 . VAL A 1 61 ? 4.139   -5.822  -2.173  1.00 3.88  ? 61 VAL A HG12 2  
ATOM   2107  H HG13 . VAL A 1 61 ? 4.101   -4.165  -2.776  1.00 3.52  ? 61 VAL A HG13 2  
ATOM   2108  H HG21 . VAL A 1 61 ? 6.642   -6.579  -1.211  1.00 4.58  ? 61 VAL A HG21 2  
ATOM   2109  H HG22 . VAL A 1 61 ? 6.719   -5.484  0.168   1.00 4.75  ? 61 VAL A HG22 2  
ATOM   2110  H HG23 . VAL A 1 61 ? 5.183   -6.217  -0.289  1.00 4.45  ? 61 VAL A HG23 2  
ATOM   2111  N N    . VAL A 1 62 ? 6.480   -2.144  -3.401  1.00 2.99  ? 62 VAL A N    2  
ATOM   2112  C CA   . VAL A 1 62 ? 6.155   -1.276  -4.574  1.00 3.22  ? 62 VAL A CA   2  
ATOM   2113  C C    . VAL A 1 62 ? 7.414   -1.094  -5.434  1.00 3.80  ? 62 VAL A C    2  
ATOM   2114  O O    . VAL A 1 62 ? 7.346   -1.125  -6.647  1.00 4.15  ? 62 VAL A O    2  
ATOM   2115  C CB   . VAL A 1 62 ? 5.650   0.090   -4.079  1.00 3.53  ? 62 VAL A CB   2  
ATOM   2116  C CG1  . VAL A 1 62 ? 5.551   1.072   -5.251  1.00 4.40  ? 62 VAL A CG1  2  
ATOM   2117  C CG2  . VAL A 1 62 ? 4.266   -0.078  -3.442  1.00 3.34  ? 62 VAL A CG2  2  
ATOM   2118  H H    . VAL A 1 62 ? 6.473   -1.764  -2.497  1.00 2.92  ? 62 VAL A H    2  
ATOM   2119  H HA   . VAL A 1 62 ? 5.386   -1.751  -5.166  1.00 3.17  ? 62 VAL A HA   2  
ATOM   2120  H HB   . VAL A 1 62 ? 6.339   0.480   -3.343  1.00 3.69  ? 62 VAL A HB   2  
ATOM   2121  H HG11 . VAL A 1 62 ? 5.030   0.603   -6.072  1.00 4.91  ? 62 VAL A HG11 2  
ATOM   2122  H HG12 . VAL A 1 62 ? 5.009   1.952   -4.937  1.00 4.71  ? 62 VAL A HG12 2  
ATOM   2123  H HG13 . VAL A 1 62 ? 6.544   1.356   -5.568  1.00 4.59  ? 62 VAL A HG13 2  
ATOM   2124  H HG21 . VAL A 1 62 ? 4.184   -1.064  -3.010  1.00 3.80  ? 62 VAL A HG21 2  
ATOM   2125  H HG22 . VAL A 1 62 ? 4.133   0.666   -2.671  1.00 3.53  ? 62 VAL A HG22 2  
ATOM   2126  H HG23 . VAL A 1 62 ? 3.504   0.048   -4.197  1.00 3.11  ? 62 VAL A HG23 2  
ATOM   2127  N N    . GLU A 1 63 ? 8.560   -0.910  -4.818  1.00 4.04  ? 63 GLU A N    2  
ATOM   2128  C CA   . GLU A 1 63 ? 9.816   -0.735  -5.598  1.00 4.68  ? 63 GLU A CA   2  
ATOM   2129  C C    . GLU A 1 63 ? 10.176  -2.053  -6.296  1.00 4.70  ? 63 GLU A C    2  
ATOM   2130  O O    . GLU A 1 63 ? 10.530  -2.064  -7.458  1.00 5.23  ? 63 GLU A O    2  
ATOM   2131  C CB   . GLU A 1 63 ? 10.959  -0.319  -4.665  1.00 5.11  ? 63 GLU A CB   2  
ATOM   2132  C CG   . GLU A 1 63 ? 11.183  1.195   -4.768  1.00 5.73  ? 63 GLU A CG   2  
ATOM   2133  C CD   . GLU A 1 63 ? 10.250  1.923   -3.795  1.00 6.00  ? 63 GLU A CD   2  
ATOM   2134  O OE1  . GLU A 1 63 ? 9.093   2.108   -4.137  1.00 6.46  ? 63 GLU A OE1  2  
ATOM   2135  O OE2  . GLU A 1 63 ? 10.710  2.284   -2.724  1.00 6.04  ? 63 GLU A OE2  2  
ATOM   2136  H H    . GLU A 1 63 ? 8.592   -0.889  -3.844  1.00 3.89  ? 63 GLU A H    2  
ATOM   2137  H HA   . GLU A 1 63 ? 9.662   0.028   -6.339  1.00 5.00  ? 63 GLU A HA   2  
ATOM   2138  H HB2  . GLU A 1 63 ? 10.706  -0.578  -3.647  1.00 4.92  ? 63 GLU A HB2  2  
ATOM   2139  H HB3  . GLU A 1 63 ? 11.864  -0.833  -4.952  1.00 5.36  ? 63 GLU A HB3  2  
ATOM   2140  H HG2  . GLU A 1 63 ? 12.209  1.422   -4.522  1.00 5.98  ? 63 GLU A HG2  2  
ATOM   2141  H HG3  . GLU A 1 63 ? 10.974  1.522   -5.775  1.00 6.04  ? 63 GLU A HG3  2  
ATOM   2142  N N    . LYS A 1 64 ? 10.082  -3.163  -5.597  1.00 4.35  ? 64 LYS A N    2  
ATOM   2143  C CA   . LYS A 1 64 ? 10.409  -4.478  -6.218  1.00 4.71  ? 64 LYS A CA   2  
ATOM   2144  C C    . LYS A 1 64 ? 9.417   -4.780  -7.351  1.00 4.54  ? 64 LYS A C    2  
ATOM   2145  O O    . LYS A 1 64 ? 9.777   -5.360  -8.358  1.00 5.00  ? 64 LYS A O    2  
ATOM   2146  C CB   . LYS A 1 64 ? 10.327  -5.583  -5.157  1.00 4.74  ? 64 LYS A CB   2  
ATOM   2147  C CG   . LYS A 1 64 ? 11.214  -6.763  -5.565  1.00 5.62  ? 64 LYS A CG   2  
ATOM   2148  C CD   . LYS A 1 64 ? 12.689  -6.372  -5.423  1.00 6.24  ? 64 LYS A CD   2  
ATOM   2149  C CE   . LYS A 1 64 ? 13.538  -7.631  -5.225  1.00 7.07  ? 64 LYS A CE   2  
ATOM   2150  N NZ   . LYS A 1 64 ? 14.983  -7.284  -5.358  1.00 7.79  ? 64 LYS A NZ   2  
ATOM   2151  H H    . LYS A 1 64 ? 9.792   -3.131  -4.664  1.00 4.03  ? 64 LYS A H    2  
ATOM   2152  H HA   . LYS A 1 64 ? 11.407  -4.437  -6.614  1.00 5.26  ? 64 LYS A HA   2  
ATOM   2153  H HB2  . LYS A 1 64 ? 10.661  -5.193  -4.206  1.00 4.73  ? 64 LYS A HB2  2  
ATOM   2154  H HB3  . LYS A 1 64 ? 9.305   -5.919  -5.067  1.00 4.49  ? 64 LYS A HB3  2  
ATOM   2155  H HG2  . LYS A 1 64 ? 11.002  -7.609  -4.928  1.00 6.07  ? 64 LYS A HG2  2  
ATOM   2156  H HG3  . LYS A 1 64 ? 11.012  -7.027  -6.593  1.00 5.69  ? 64 LYS A HG3  2  
ATOM   2157  H HD2  . LYS A 1 64 ? 13.012  -5.857  -6.316  1.00 6.22  ? 64 LYS A HD2  2  
ATOM   2158  H HD3  . LYS A 1 64 ? 12.808  -5.722  -4.570  1.00 6.45  ? 64 LYS A HD3  2  
ATOM   2159  H HE2  . LYS A 1 64 ? 13.356  -8.036  -4.240  1.00 7.40  ? 64 LYS A HE2  2  
ATOM   2160  H HE3  . LYS A 1 64 ? 13.274  -8.366  -5.971  1.00 7.09  ? 64 LYS A HE3  2  
ATOM   2161  H HZ1  . LYS A 1 64 ? 15.231  -6.551  -4.662  1.00 8.07  ? 64 LYS A HZ1  2  
ATOM   2162  H HZ2  . LYS A 1 64 ? 15.560  -8.131  -5.191  1.00 7.96  ? 64 LYS A HZ2  2  
ATOM   2163  H HZ3  . LYS A 1 64 ? 15.168  -6.927  -6.318  1.00 8.09  ? 64 LYS A HZ3  2  
ATOM   2164  N N    . PHE A 1 65 ? 8.173   -4.388  -7.190  1.00 4.02  ? 65 PHE A N    2  
ATOM   2165  C CA   . PHE A 1 65 ? 7.150   -4.644  -8.244  1.00 3.99  ? 65 PHE A CA   2  
ATOM   2166  C C    . PHE A 1 65 ? 7.341   -3.657  -9.404  1.00 4.72  ? 65 PHE A C    2  
ATOM   2167  O O    . PHE A 1 65 ? 7.301   -4.034  -10.560 1.00 5.31  ? 65 PHE A O    2  
ATOM   2168  C CB   . PHE A 1 65 ? 5.763   -4.452  -7.629  1.00 3.16  ? 65 PHE A CB   2  
ATOM   2169  C CG   . PHE A 1 65 ? 4.738   -5.260  -8.390  1.00 3.02  ? 65 PHE A CG   2  
ATOM   2170  C CD1  . PHE A 1 65 ? 4.755   -6.659  -8.325  1.00 3.45  ? 65 PHE A CD1  2  
ATOM   2171  C CD2  . PHE A 1 65 ? 3.768   -4.607  -9.158  1.00 2.97  ? 65 PHE A CD2  2  
ATOM   2172  C CE1  . PHE A 1 65 ? 3.801   -7.404  -9.029  1.00 3.48  ? 65 PHE A CE1  2  
ATOM   2173  C CE2  . PHE A 1 65 ? 2.815   -5.351  -9.862  1.00 3.10  ? 65 PHE A CE2  2  
ATOM   2174  C CZ   . PHE A 1 65 ? 2.830   -6.749  -9.797  1.00 3.19  ? 65 PHE A CZ   2  
ATOM   2175  H H    . PHE A 1 65 ? 7.909   -3.921  -6.368  1.00 3.77  ? 65 PHE A H    2  
ATOM   2176  H HA   . PHE A 1 65 ? 7.249   -5.656  -8.607  1.00 4.30  ? 65 PHE A HA   2  
ATOM   2177  H HB2  . PHE A 1 65 ? 5.782   -4.775  -6.600  1.00 2.82  ? 65 PHE A HB2  2  
ATOM   2178  H HB3  . PHE A 1 65 ? 5.501   -3.406  -7.668  1.00 3.27  ? 65 PHE A HB3  2  
ATOM   2179  H HD1  . PHE A 1 65 ? 5.505   -7.165  -7.731  1.00 4.00  ? 65 PHE A HD1  2  
ATOM   2180  H HD2  . PHE A 1 65 ? 3.757   -3.530  -9.207  1.00 3.21  ? 65 PHE A HD2  2  
ATOM   2181  H HE1  . PHE A 1 65 ? 3.814   -8.481  -8.978  1.00 4.01  ? 65 PHE A HE1  2  
ATOM   2182  H HE2  . PHE A 1 65 ? 2.066   -4.845  -10.453 1.00 3.46  ? 65 PHE A HE2  2  
ATOM   2183  H HZ   . PHE A 1 65 ? 2.094   -7.323  -10.340 1.00 3.41  ? 65 PHE A HZ   2  
ATOM   2184  N N    . LEU A 1 66 ? 7.546   -2.397  -9.098  1.00 4.92  ? 66 LEU A N    2  
ATOM   2185  C CA   . LEU A 1 66 ? 7.737   -1.370  -10.171 1.00 5.86  ? 66 LEU A CA   2  
ATOM   2186  C C    . LEU A 1 66 ? 9.041   -1.642  -10.934 1.00 6.61  ? 66 LEU A C    2  
ATOM   2187  O O    . LEU A 1 66 ? 9.070   -1.597  -12.150 1.00 7.33  ? 66 LEU A O    2  
ATOM   2188  C CB   . LEU A 1 66 ? 7.796   0.025   -9.537  1.00 6.18  ? 66 LEU A CB   2  
ATOM   2189  C CG   . LEU A 1 66 ? 7.678   1.096   -10.627 1.00 7.14  ? 66 LEU A CG   2  
ATOM   2190  C CD1  . LEU A 1 66 ? 6.821   2.257   -10.117 1.00 7.61  ? 66 LEU A CD1  2  
ATOM   2191  C CD2  . LEU A 1 66 ? 9.073   1.615   -10.990 1.00 7.67  ? 66 LEU A CD2  2  
ATOM   2192  H H    . LEU A 1 66 ? 7.571   -2.125  -8.155  1.00 4.58  ? 66 LEU A H    2  
ATOM   2193  H HA   . LEU A 1 66 ? 6.905   -1.415  -10.858 1.00 6.03  ? 66 LEU A HA   2  
ATOM   2194  H HB2  . LEU A 1 66 ? 6.982   0.134   -8.835  1.00 5.67  ? 66 LEU A HB2  2  
ATOM   2195  H HB3  . LEU A 1 66 ? 8.735   0.145   -9.018  1.00 6.42  ? 66 LEU A HB3  2  
ATOM   2196  H HG   . LEU A 1 66 ? 7.213   0.666   -11.505 1.00 7.39  ? 66 LEU A HG   2  
ATOM   2197  H HD11 . LEU A 1 66 ? 5.924   1.867   -9.657  1.00 8.02  ? 66 LEU A HD11 2  
ATOM   2198  H HD12 . LEU A 1 66 ? 7.381   2.825   -9.388  1.00 7.94  ? 66 LEU A HD12 2  
ATOM   2199  H HD13 . LEU A 1 66 ? 6.552   2.898   -10.943 1.00 7.49  ? 66 LEU A HD13 2  
ATOM   2200  H HD21 . LEU A 1 66 ? 9.671   1.699   -10.094 1.00 7.84  ? 66 LEU A HD21 2  
ATOM   2201  H HD22 . LEU A 1 66 ? 9.546   0.927   -11.675 1.00 7.67  ? 66 LEU A HD22 2  
ATOM   2202  H HD23 . LEU A 1 66 ? 8.987   2.585   -11.457 1.00 8.14  ? 66 LEU A HD23 2  
ATOM   2203  N N    . LYS A 1 67 ? 10.117  -1.918  -10.230 1.00 6.57  ? 67 LYS A N    2  
ATOM   2204  C CA   . LYS A 1 67 ? 11.425  -2.191  -10.911 1.00 7.47  ? 67 LYS A CA   2  
ATOM   2205  C C    . LYS A 1 67 ? 11.265  -3.360  -11.892 1.00 7.85  ? 67 LYS A C    2  
ATOM   2206  O O    . LYS A 1 67 ? 10.836  -4.439  -11.521 1.00 8.14  ? 67 LYS A O    2  
ATOM   2207  C CB   . LYS A 1 67 ? 12.488  -2.547  -9.865  1.00 7.84  ? 67 LYS A CB   2  
ATOM   2208  C CG   . LYS A 1 67 ? 13.074  -1.265  -9.261  1.00 8.78  ? 67 LYS A CG   2  
ATOM   2209  C CD   . LYS A 1 67 ? 14.201  -0.741  -10.156 1.00 9.42  ? 67 LYS A CD   2  
ATOM   2210  C CE   . LYS A 1 67 ? 15.161  0.118   -9.326  1.00 10.12 ? 67 LYS A CE   2  
ATOM   2211  N NZ   . LYS A 1 67 ? 16.261  0.623   -10.197 1.00 10.40 ? 67 LYS A NZ   2  
ATOM   2212  H H    . LYS A 1 67 ? 10.062  -1.942  -9.248  1.00 6.04  ? 67 LYS A H    2  
ATOM   2213  H HA   . LYS A 1 67 ? 11.736  -1.310  -11.452 1.00 7.85  ? 67 LYS A HA   2  
ATOM   2214  H HB2  . LYS A 1 67 ? 12.037  -3.139  -9.081  1.00 7.78  ? 67 LYS A HB2  2  
ATOM   2215  H HB3  . LYS A 1 67 ? 13.279  -3.114  -10.333 1.00 7.75  ? 67 LYS A HB3  2  
ATOM   2216  H HG2  . LYS A 1 67 ? 12.298  -0.516  -9.183  1.00 9.30  ? 67 LYS A HG2  2  
ATOM   2217  H HG3  . LYS A 1 67 ? 13.467  -1.478  -8.278  1.00 8.71  ? 67 LYS A HG3  2  
ATOM   2218  H HD2  . LYS A 1 67 ? 14.739  -1.574  -10.582 1.00 9.58  ? 67 LYS A HD2  2  
ATOM   2219  H HD3  . LYS A 1 67 ? 13.779  -0.141  -10.949 1.00 9.47  ? 67 LYS A HD3  2  
ATOM   2220  H HE2  . LYS A 1 67 ? 14.623  0.955   -8.906  1.00 10.35 ? 67 LYS A HE2  2  
ATOM   2221  H HE3  . LYS A 1 67 ? 15.578  -0.478  -8.528  1.00 10.41 ? 67 LYS A HE3  2  
ATOM   2222  H HZ1  . LYS A 1 67 ? 16.739  -0.179  -10.655 1.00 10.51 ? 67 LYS A HZ1  2  
ATOM   2223  H HZ2  . LYS A 1 67 ? 15.867  1.255   -10.924 1.00 10.49 ? 67 LYS A HZ2  2  
ATOM   2224  H HZ3  . LYS A 1 67 ? 16.948  1.147   -9.618  1.00 10.60 ? 67 LYS A HZ3  2  
ATOM   2225  N N    . ARG A 1 68 ? 11.603  -3.149  -13.144 1.00 8.12  ? 68 ARG A N    2  
ATOM   2226  C CA   . ARG A 1 68 ? 11.470  -4.241  -14.161 1.00 8.78  ? 68 ARG A CA   2  
ATOM   2227  C C    . ARG A 1 68 ? 12.852  -4.811  -14.507 1.00 8.99  ? 68 ARG A C    2  
ATOM   2228  O O    . ARG A 1 68 ? 13.860  -4.409  -13.955 1.00 8.81  ? 68 ARG A O    2  
ATOM   2229  C CB   . ARG A 1 68 ? 10.809  -3.691  -15.435 1.00 9.33  ? 68 ARG A CB   2  
ATOM   2230  C CG   . ARG A 1 68 ? 11.639  -2.536  -16.011 1.00 9.61  ? 68 ARG A CG   2  
ATOM   2231  C CD   . ARG A 1 68 ? 10.820  -1.240  -15.975 1.00 10.05 ? 68 ARG A CD   2  
ATOM   2232  N NE   . ARG A 1 68 ? 11.463  -0.264  -15.046 1.00 10.53 ? 68 ARG A NE   2  
ATOM   2233  C CZ   . ARG A 1 68 ? 12.626  0.258   -15.343 1.00 10.90 ? 68 ARG A CZ   2  
ATOM   2234  N NH1  . ARG A 1 68 ? 12.718  1.157   -16.290 1.00 11.02 ? 68 ARG A NH1  2  
ATOM   2235  N NH2  . ARG A 1 68 ? 13.697  -0.120  -14.690 1.00 11.35 ? 68 ARG A NH2  2  
ATOM   2236  H H    . ARG A 1 68 ? 11.943  -2.271  -13.413 1.00 8.08  ? 68 ARG A H    2  
ATOM   2237  H HA   . ARG A 1 68 ? 10.854  -5.031  -13.755 1.00 9.01  ? 68 ARG A HA   2  
ATOM   2238  H HB2  . ARG A 1 68 ? 10.739  -4.481  -16.168 1.00 9.69  ? 68 ARG A HB2  2  
ATOM   2239  H HB3  . ARG A 1 68 ? 9.820   -3.341  -15.199 1.00 9.41  ? 68 ARG A HB3  2  
ATOM   2240  H HG2  . ARG A 1 68 ? 12.538  -2.412  -15.428 1.00 9.48  ? 68 ARG A HG2  2  
ATOM   2241  H HG3  . ARG A 1 68 ? 11.903  -2.761  -17.034 1.00 9.87  ? 68 ARG A HG3  2  
ATOM   2242  H HD2  . ARG A 1 68 ? 10.775  -0.815  -16.967 1.00 10.14 ? 68 ARG A HD2  2  
ATOM   2243  H HD3  . ARG A 1 68 ? 9.819   -1.457  -15.630 1.00 10.14 ? 68 ARG A HD3  2  
ATOM   2244  H HE   . ARG A 1 68 ? 11.013  -0.014  -14.212 1.00 10.72 ? 68 ARG A HE   2  
ATOM   2245  H HH11 . ARG A 1 68 ? 11.900  1.446   -16.788 1.00 10.82 ? 68 ARG A HH11 2  
ATOM   2246  H HH12 . ARG A 1 68 ? 13.608  1.555   -16.518 1.00 11.44 ? 68 ARG A HH12 2  
ATOM   2247  H HH21 . ARG A 1 68 ? 13.625  -0.806  -13.967 1.00 11.42 ? 68 ARG A HH21 2  
ATOM   2248  H HH22 . ARG A 1 68 ? 14.586  0.278   -14.916 1.00 11.76 ? 68 ARG A HH22 2  
ATOM   2249  N N    . ALA A 1 69 ? 12.896  -5.747  -15.425 1.00 9.61  ? 69 ALA A N    2  
ATOM   2250  C CA   . ALA A 1 69 ? 14.199  -6.358  -15.828 1.00 10.14 ? 69 ALA A CA   2  
ATOM   2251  C C    . ALA A 1 69 ? 14.086  -6.910  -17.258 1.00 10.89 ? 69 ALA A C    2  
ATOM   2252  O O    . ALA A 1 69 ? 14.441  -8.044  -17.530 1.00 11.20 ? 69 ALA A O    2  
ATOM   2253  C CB   . ALA A 1 69 ? 14.549  -7.494  -14.859 1.00 10.08 ? 69 ALA A CB   2  
ATOM   2254  H H    . ALA A 1 69 ? 12.064  -6.045  -15.852 1.00 9.89  ? 69 ALA A H    2  
ATOM   2255  H HA   . ALA A 1 69 ? 14.975  -5.607  -15.796 1.00 10.27 ? 69 ALA A HA   2  
ATOM   2256  H HB1  . ALA A 1 69 ? 14.583  -7.110  -13.850 1.00 10.12 ? 69 ALA A HB1  2  
ATOM   2257  H HB2  . ALA A 1 69 ? 13.796  -8.267  -14.922 1.00 10.12 ? 69 ALA A HB2  2  
ATOM   2258  H HB3  . ALA A 1 69 ? 15.513  -7.908  -15.120 1.00 10.18 ? 69 ALA A HB3  2  
ATOM   2259  N N    . GLU A 1 70 ? 13.590  -6.112  -18.176 1.00 11.37 ? 70 GLU A N    2  
ATOM   2260  C CA   . GLU A 1 70 ? 13.447  -6.580  -19.589 1.00 12.24 ? 70 GLU A CA   2  
ATOM   2261  C C    . GLU A 1 70 ? 14.113  -5.572  -20.535 1.00 12.45 ? 70 GLU A C    2  
ATOM   2262  O O    . GLU A 1 70 ? 15.069  -5.893  -21.214 1.00 12.32 ? 70 GLU A O    2  
ATOM   2263  C CB   . GLU A 1 70 ? 11.959  -6.711  -19.939 1.00 12.79 ? 70 GLU A CB   2  
ATOM   2264  C CG   . GLU A 1 70 ? 11.338  -7.861  -19.140 1.00 12.48 ? 70 GLU A CG   2  
ATOM   2265  C CD   . GLU A 1 70 ? 9.852   -7.574  -18.898 1.00 13.18 ? 70 GLU A CD   2  
ATOM   2266  O OE1  . GLU A 1 70 ? 9.557   -6.774  -18.024 1.00 13.39 ? 70 GLU A OE1  2  
ATOM   2267  O OE2  . GLU A 1 70 ? 9.036   -8.159  -19.591 1.00 13.63 ? 70 GLU A OE2  2  
ATOM   2268  H H    . GLU A 1 70 ? 13.311  -5.204  -17.933 1.00 11.26 ? 70 GLU A H    2  
ATOM   2269  H HA   . GLU A 1 70 ? 13.927  -7.542  -19.699 1.00 12.53 ? 70 GLU A HA   2  
ATOM   2270  H HB2  . GLU A 1 70 ? 11.452  -5.789  -19.697 1.00 13.03 ? 70 GLU A HB2  2  
ATOM   2271  H HB3  . GLU A 1 70 ? 11.854  -6.913  -20.996 1.00 13.32 ? 70 GLU A HB3  2  
ATOM   2272  H HG2  . GLU A 1 70 ? 11.441  -8.782  -19.695 1.00 12.20 ? 70 GLU A HG2  2  
ATOM   2273  H HG3  . GLU A 1 70 ? 11.842  -7.955  -18.190 1.00 12.23 ? 70 GLU A HG3  2  
ATOM   2274  N N    . ASN A 1 71 ? 13.611  -4.359  -20.584 1.00 12.96 ? 71 ASN A N    2  
ATOM   2275  C CA   . ASN A 1 71 ? 14.210  -3.325  -21.489 1.00 13.39 ? 71 ASN A CA   2  
ATOM   2276  C C    . ASN A 1 71 ? 13.656  -1.938  -21.135 1.00 13.77 ? 71 ASN A C    2  
ATOM   2277  O O    . ASN A 1 71 ? 12.609  -1.816  -20.525 1.00 13.98 ? 71 ASN A O    2  
ATOM   2278  C CB   . ASN A 1 71 ? 13.869  -3.651  -22.951 1.00 13.14 ? 71 ASN A CB   2  
ATOM   2279  C CG   . ASN A 1 71 ? 12.359  -3.880  -23.101 1.00 12.70 ? 71 ASN A CG   2  
ATOM   2280  O OD1  . ASN A 1 71 ? 11.610  -2.949  -23.320 1.00 12.77 ? 71 ASN A OD1  2  
ATOM   2281  N ND2  . ASN A 1 71 ? 11.879  -5.090  -22.993 1.00 12.41 ? 71 ASN A ND2  2  
ATOM   2282  H H    . ASN A 1 71 ? 12.838  -4.128  -20.027 1.00 13.17 ? 71 ASN A H    2  
ATOM   2283  H HA   . ASN A 1 71 ? 15.282  -3.322  -21.365 1.00 13.80 ? 71 ASN A HA   2  
ATOM   2284  H HB2  . ASN A 1 71 ? 14.171  -2.828  -23.581 1.00 13.36 ? 71 ASN A HB2  2  
ATOM   2285  H HB3  . ASN A 1 71 ? 14.396  -4.545  -23.251 1.00 13.26 ? 71 ASN A HB3  2  
ATOM   2286  H HD21 . ASN A 1 71 ? 12.482  -5.843  -22.819 1.00 12.47 ? 71 ASN A HD21 2  
ATOM   2287  H HD22 . ASN A 1 71 ? 10.917  -5.245  -23.086 1.00 12.23 ? 71 ASN A HD22 2  
ATOM   2288  N N    . SER A 1 72 ? 14.356  -0.892  -21.521 1.00 14.02 ? 72 SER A N    2  
ATOM   2289  C CA   . SER A 1 72 ? 13.891  0.506   -21.226 1.00 14.59 ? 72 SER A CA   2  
ATOM   2290  C C    . SER A 1 72 ? 13.837  0.757   -19.703 1.00 15.09 ? 72 SER A C    2  
ATOM   2291  O O    . SER A 1 72 ? 14.428  -0.015  -18.962 1.00 15.38 ? 72 SER A O    2  
ATOM   2292  C CB   . SER A 1 72 ? 12.501  0.719   -21.843 1.00 14.66 ? 72 SER A CB   2  
ATOM   2293  O OG   . SER A 1 72 ? 12.386  2.065   -22.288 1.00 14.60 ? 72 SER A OG   2  
ATOM   2294  O OXT  . SER A 1 72 ? 13.213  1.728   -19.303 1.00 15.30 ? 72 SER A OXT  2  
ATOM   2295  H H    . SER A 1 72 ? 15.193  -1.027  -22.014 1.00 13.94 ? 72 SER A H    2  
ATOM   2296  H HA   . SER A 1 72 ? 14.583  1.207   -21.671 1.00 14.77 ? 72 SER A HA   2  
ATOM   2297  H HB2  . SER A 1 72 ? 12.371  0.057   -22.683 1.00 14.69 ? 72 SER A HB2  2  
ATOM   2298  H HB3  . SER A 1 72 ? 11.742  0.508   -21.100 1.00 14.91 ? 72 SER A HB3  2  
ATOM   2299  H HG   . SER A 1 72 ? 12.023  2.054   -23.176 1.00 14.50 ? 72 SER A HG   2  
ATOM   2300  N N    . GLU A 1 4  ? -15.390 15.199  -4.934  1.00 9.58  ? 4  GLU A N    3  
ATOM   2301  C CA   . GLU A 1 4  ? -14.228 15.854  -5.609  1.00 9.09  ? 4  GLU A CA   3  
ATOM   2302  C C    . GLU A 1 4  ? -12.985 15.763  -4.713  1.00 8.06  ? 4  GLU A C    3  
ATOM   2303  O O    . GLU A 1 4  ? -13.088 15.816  -3.503  1.00 8.10  ? 4  GLU A O    3  
ATOM   2304  C CB   . GLU A 1 4  ? -14.555 17.327  -5.880  1.00 9.77  ? 4  GLU A CB   3  
ATOM   2305  C CG   . GLU A 1 4  ? -15.396 17.442  -7.157  1.00 10.24 ? 4  GLU A CG   3  
ATOM   2306  C CD   . GLU A 1 4  ? -15.225 18.838  -7.762  1.00 11.04 ? 4  GLU A CD   3  
ATOM   2307  O OE1  . GLU A 1 4  ? -14.227 19.055  -8.431  1.00 11.49 ? 4  GLU A OE1  3  
ATOM   2308  O OE2  . GLU A 1 4  ? -16.096 19.666  -7.550  1.00 11.36 ? 4  GLU A OE2  3  
ATOM   2309  H H    . GLU A 1 4  ? -15.549 15.641  -4.007  1.00 9.61  ? 4  GLU A H    3  
ATOM   2310  H HA   . GLU A 1 4  ? -14.033 15.353  -6.547  1.00 9.22  ? 4  GLU A HA   3  
ATOM   2311  H HB2  . GLU A 1 4  ? -15.110 17.732  -5.045  1.00 9.96  ? 4  GLU A HB2  3  
ATOM   2312  H HB3  . GLU A 1 4  ? -13.637 17.882  -6.005  1.00 9.97  ? 4  GLU A HB3  3  
ATOM   2313  H HG2  . GLU A 1 4  ? -15.071 16.698  -7.869  1.00 10.27 ? 4  GLU A HG2  3  
ATOM   2314  H HG3  . GLU A 1 4  ? -16.436 17.281  -6.917  1.00 10.19 ? 4  GLU A HG3  3  
ATOM   2315  N N    . LEU A 1 5  ? -11.816 15.628  -5.317  1.00 7.36  ? 5  LEU A N    3  
ATOM   2316  C CA   . LEU A 1 5  ? -10.519 15.527  -4.556  1.00 6.53  ? 5  LEU A CA   3  
ATOM   2317  C C    . LEU A 1 5  ? -10.696 14.762  -3.230  1.00 6.17  ? 5  LEU A C    3  
ATOM   2318  O O    . LEU A 1 5  ? -10.340 15.242  -2.168  1.00 6.61  ? 5  LEU A O    3  
ATOM   2319  C CB   . LEU A 1 5  ? -9.948  16.935  -4.292  1.00 6.34  ? 5  LEU A CB   3  
ATOM   2320  C CG   . LEU A 1 5  ? -10.812 17.699  -3.274  1.00 7.26  ? 5  LEU A CG   3  
ATOM   2321  C CD1  . LEU A 1 5  ? -9.922  18.254  -2.158  1.00 7.60  ? 5  LEU A CD1  3  
ATOM   2322  C CD2  . LEU A 1 5  ? -11.535 18.854  -3.973  1.00 7.86  ? 5  LEU A CD2  3  
ATOM   2323  H H    . LEU A 1 5  ? -11.789 15.592  -6.297  1.00 7.57  ? 5  LEU A H    3  
ATOM   2324  H HA   . LEU A 1 5  ? -9.812  14.981  -5.166  1.00 6.63  ? 5  LEU A HA   3  
ATOM   2325  H HB2  . LEU A 1 5  ? -8.943  16.842  -3.906  1.00 5.88  ? 5  LEU A HB2  3  
ATOM   2326  H HB3  . LEU A 1 5  ? -9.920  17.483  -5.221  1.00 6.33  ? 5  LEU A HB3  3  
ATOM   2327  H HG   . LEU A 1 5  ? -11.538 17.030  -2.843  1.00 7.52  ? 5  LEU A HG   3  
ATOM   2328  H HD11 . LEU A 1 5  ? -9.109  18.818  -2.591  1.00 7.24  ? 5  LEU A HD11 3  
ATOM   2329  H HD12 . LEU A 1 5  ? -10.507 18.897  -1.518  1.00 7.97  ? 5  LEU A HD12 3  
ATOM   2330  H HD13 . LEU A 1 5  ? -9.523  17.436  -1.577  1.00 8.07  ? 5  LEU A HD13 3  
ATOM   2331  H HD21 . LEU A 1 5  ? -11.085 19.030  -4.940  1.00 8.13  ? 5  LEU A HD21 3  
ATOM   2332  H HD22 . LEU A 1 5  ? -12.576 18.599  -4.101  1.00 8.35  ? 5  LEU A HD22 3  
ATOM   2333  H HD23 . LEU A 1 5  ? -11.454 19.747  -3.370  1.00 7.79  ? 5  LEU A HD23 3  
ATOM   2334  N N    . ARG A 1 6  ? -11.233 13.572  -3.281  1.00 5.61  ? 6  ARG A N    3  
ATOM   2335  C CA   . ARG A 1 6  ? -11.419 12.790  -2.024  1.00 5.48  ? 6  ARG A CA   3  
ATOM   2336  C C    . ARG A 1 6  ? -10.506 11.569  -2.035  1.00 4.69  ? 6  ARG A C    3  
ATOM   2337  O O    . ARG A 1 6  ? -10.296 10.943  -3.058  1.00 4.64  ? 6  ARG A O    3  
ATOM   2338  C CB   . ARG A 1 6  ? -12.873 12.328  -1.862  1.00 6.06  ? 6  ARG A CB   3  
ATOM   2339  C CG   . ARG A 1 6  ? -13.622 12.376  -3.197  1.00 6.84  ? 6  ARG A CG   3  
ATOM   2340  C CD   . ARG A 1 6  ? -15.110 12.138  -2.947  1.00 7.76  ? 6  ARG A CD   3  
ATOM   2341  N NE   . ARG A 1 6  ? -15.732 11.525  -4.157  1.00 8.57  ? 6  ARG A NE   3  
ATOM   2342  C CZ   . ARG A 1 6  ? -17.030 11.392  -4.231  1.00 9.27  ? 6  ARG A CZ   3  
ATOM   2343  N NH1  . ARG A 1 6  ? -17.621 10.395  -3.621  1.00 9.70  ? 6  ARG A NH1  3  
ATOM   2344  N NH2  . ARG A 1 6  ? -17.736 12.256  -4.915  1.00 9.77  ? 6  ARG A NH2  3  
ATOM   2345  H H    . ARG A 1 6  ? -11.506 13.191  -4.141  1.00 5.45  ? 6  ARG A H    3  
ATOM   2346  H HA   . ARG A 1 6  ? -11.157 13.414  -1.185  1.00 5.83  ? 6  ARG A HA   3  
ATOM   2347  H HB2  . ARG A 1 6  ? -12.881 11.314  -1.490  1.00 6.17  ? 6  ARG A HB2  3  
ATOM   2348  H HB3  . ARG A 1 6  ? -13.366 12.969  -1.151  1.00 6.11  ? 6  ARG A HB3  3  
ATOM   2349  H HG2  . ARG A 1 6  ? -13.486 13.344  -3.655  1.00 6.68  ? 6  ARG A HG2  3  
ATOM   2350  H HG3  . ARG A 1 6  ? -13.241 11.609  -3.854  1.00 7.20  ? 6  ARG A HG3  3  
ATOM   2351  H HD2  . ARG A 1 6  ? -15.229 11.473  -2.104  1.00 8.01  ? 6  ARG A HD2  3  
ATOM   2352  H HD3  . ARG A 1 6  ? -15.591 13.080  -2.732  1.00 7.82  ? 6  ARG A HD3  3  
ATOM   2353  H HE   . ARG A 1 6  ? -15.166 11.219  -4.897  1.00 8.74  ? 6  ARG A HE   3  
ATOM   2354  H HH11 . ARG A 1 6  ? -17.078 9.735   -3.100  1.00 9.50  ? 6  ARG A HH11 3  
ATOM   2355  H HH12 . ARG A 1 6  ? -18.613 10.291  -3.675  1.00 10.35 ? 6  ARG A HH12 3  
ATOM   2356  H HH21 . ARG A 1 6  ? -17.283 13.016  -5.381  1.00 9.63  ? 6  ARG A HH21 3  
ATOM   2357  H HH22 . ARG A 1 6  ? -18.730 12.158  -4.972  1.00 10.41 ? 6  ARG A HH22 3  
ATOM   2358  N N    . CYS A 1 7  ? -9.971  11.230  -0.892  1.00 4.47  ? 7  CYS A N    3  
ATOM   2359  C CA   . CYS A 1 7  ? -9.069  10.044  -0.790  1.00 4.05  ? 7  CYS A CA   3  
ATOM   2360  C C    . CYS A 1 7  ? -9.839  8.786   -1.198  1.00 4.38  ? 7  CYS A C    3  
ATOM   2361  O O    . CYS A 1 7  ? -10.762 8.363   -0.523  1.00 4.93  ? 7  CYS A O    3  
ATOM   2362  C CB   . CYS A 1 7  ? -8.575  9.904   0.653   1.00 4.32  ? 7  CYS A CB   3  
ATOM   2363  S SG   . CYS A 1 7  ? -7.800  11.453  1.188   1.00 4.79  ? 7  CYS A SG   3  
ATOM   2364  H H    . CYS A 1 7  ? -10.170 11.760  -0.091  1.00 4.87  ? 7  CYS A H    3  
ATOM   2365  H HA   . CYS A 1 7  ? -8.223  10.169  -1.448  1.00 3.89  ? 7  CYS A HA   3  
ATOM   2366  H HB2  . CYS A 1 7  ? -9.410  9.677   1.299   1.00 4.81  ? 7  CYS A HB2  3  
ATOM   2367  H HB3  . CYS A 1 7  ? -7.855  9.108   0.706   1.00 4.30  ? 7  CYS A HB3  3  
ATOM   2368  N N    . GLN A 1 8  ? -9.464  8.188   -2.306  1.00 4.51  ? 8  GLN A N    3  
ATOM   2369  C CA   . GLN A 1 8  ? -10.162 6.954   -2.780  1.00 5.30  ? 8  GLN A CA   3  
ATOM   2370  C C    . GLN A 1 8  ? -10.044 5.846   -1.723  1.00 5.47  ? 8  GLN A C    3  
ATOM   2371  O O    . GLN A 1 8  ? -10.893 4.979   -1.634  1.00 6.21  ? 8  GLN A O    3  
ATOM   2372  C CB   . GLN A 1 8  ? -9.525  6.481   -4.093  1.00 5.63  ? 8  GLN A CB   3  
ATOM   2373  C CG   . GLN A 1 8  ? -10.459 5.489   -4.797  1.00 6.22  ? 8  GLN A CG   3  
ATOM   2374  C CD   . GLN A 1 8  ? -11.389 6.242   -5.755  1.00 7.21  ? 8  GLN A CD   3  
ATOM   2375  O OE1  . GLN A 1 8  ? -12.217 7.024   -5.327  1.00 7.78  ? 8  GLN A OE1  3  
ATOM   2376  N NE2  . GLN A 1 8  ? -11.291 6.037   -7.041  1.00 7.68  ? 8  GLN A NE2  3  
ATOM   2377  H H    . GLN A 1 8  ? -8.720  8.556   -2.828  1.00 4.40  ? 8  GLN A H    3  
ATOM   2378  H HA   . GLN A 1 8  ? -11.205 7.176   -2.948  1.00 5.87  ? 8  GLN A HA   3  
ATOM   2379  H HB2  . GLN A 1 8  ? -9.353  7.333   -4.735  1.00 5.62  ? 8  GLN A HB2  3  
ATOM   2380  H HB3  . GLN A 1 8  ? -8.584  5.995   -3.881  1.00 5.89  ? 8  GLN A HB3  3  
ATOM   2381  H HG2  . GLN A 1 8  ? -9.868  4.777   -5.356  1.00 6.11  ? 8  GLN A HG2  3  
ATOM   2382  H HG3  . GLN A 1 8  ? -11.051 4.966   -4.062  1.00 6.39  ? 8  GLN A HG3  3  
ATOM   2383  H HE21 . GLN A 1 8  ? -10.628 5.404   -7.389  1.00 7.43  ? 8  GLN A HE21 3  
ATOM   2384  H HE22 . GLN A 1 8  ? -11.882 6.515   -7.659  1.00 8.44  ? 8  GLN A HE22 3  
ATOM   2385  N N    . CYS A 1 9  ? -9.003  5.870   -0.922  1.00 5.04  ? 9  CYS A N    3  
ATOM   2386  C CA   . CYS A 1 9  ? -8.837  4.825   0.124   1.00 5.45  ? 9  CYS A CA   3  
ATOM   2387  C C    . CYS A 1 9  ? -8.628  5.490   1.490   1.00 5.99  ? 9  CYS A C    3  
ATOM   2388  O O    . CYS A 1 9  ? -7.524  5.864   1.846   1.00 6.13  ? 9  CYS A O    3  
ATOM   2389  C CB   . CYS A 1 9  ? -7.624  3.955   -0.214  1.00 5.08  ? 9  CYS A CB   3  
ATOM   2390  S SG   . CYS A 1 9  ? -8.150  2.533   -1.204  1.00 5.12  ? 9  CYS A SG   3  
ATOM   2391  H H    . CYS A 1 9  ? -8.330  6.580   -1.008  1.00 4.65  ? 9  CYS A H    3  
ATOM   2392  H HA   . CYS A 1 9  ? -9.722  4.206   0.160   1.00 5.89  ? 9  CYS A HA   3  
ATOM   2393  H HB2  . CYS A 1 9  ? -6.911  4.539   -0.773  1.00 4.67  ? 9  CYS A HB2  3  
ATOM   2394  H HB3  . CYS A 1 9  ? -7.167  3.612   0.697   1.00 5.54  ? 9  CYS A HB3  3  
ATOM   2395  N N    . ILE A 1 10 ? -9.681  5.628   2.260   1.00 6.61  ? 10 ILE A N    3  
ATOM   2396  C CA   . ILE A 1 10 ? -9.554  6.252   3.615   1.00 7.44  ? 10 ILE A CA   3  
ATOM   2397  C C    . ILE A 1 10 ? -8.757  5.304   4.526   1.00 7.48  ? 10 ILE A C    3  
ATOM   2398  O O    . ILE A 1 10 ? -8.057  5.735   5.424   1.00 8.16  ? 10 ILE A O    3  
ATOM   2399  C CB   . ILE A 1 10 ? -10.952 6.492   4.210   1.00 8.38  ? 10 ILE A CB   3  
ATOM   2400  C CG1  . ILE A 1 10 ? -11.728 7.472   3.321   1.00 8.63  ? 10 ILE A CG1  3  
ATOM   2401  C CG2  . ILE A 1 10 ? -10.825 7.082   5.618   1.00 9.31  ? 10 ILE A CG2  3  
ATOM   2402  C CD1  . ILE A 1 10 ? -13.147 6.946   3.096   1.00 9.47  ? 10 ILE A CD1  3  
ATOM   2403  H H    . ILE A 1 10 ? -10.555 5.309   1.951   1.00 6.69  ? 10 ILE A H    3  
ATOM   2404  H HA   . ILE A 1 10 ? -9.030  7.193   3.531   1.00 7.59  ? 10 ILE A HA   3  
ATOM   2405  H HB   . ILE A 1 10 ? -11.484 5.551   4.262   1.00 8.40  ? 10 ILE A HB   3  
ATOM   2406  H HG12 . ILE A 1 10 ? -11.774 8.437   3.805   1.00 8.91  ? 10 ILE A HG12 3  
ATOM   2407  H HG13 . ILE A 1 10 ? -11.227 7.571   2.370   1.00 8.14  ? 10 ILE A HG13 3  
ATOM   2408  H HG21 . ILE A 1 10 ? -10.060 7.843   5.624   1.00 9.78  ? 10 ILE A HG21 3  
ATOM   2409  H HG22 . ILE A 1 10 ? -11.769 7.520   5.911   1.00 9.72  ? 10 ILE A HG22 3  
ATOM   2410  H HG23 . ILE A 1 10 ? -10.561 6.300   6.315   1.00 9.27  ? 10 ILE A HG23 3  
ATOM   2411  H HD11 . ILE A 1 10 ? -13.122 5.869   3.007   1.00 9.76  ? 10 ILE A HD11 3  
ATOM   2412  H HD12 . ILE A 1 10 ? -13.771 7.225   3.932   1.00 9.66  ? 10 ILE A HD12 3  
ATOM   2413  H HD13 . ILE A 1 10 ? -13.548 7.371   2.189   1.00 9.77  ? 10 ILE A HD13 3  
ATOM   2414  N N    . LYS A 1 11 ? -8.856  4.016   4.287   1.00 6.93  ? 11 LYS A N    3  
ATOM   2415  C CA   . LYS A 1 11 ? -8.110  3.021   5.110   1.00 7.15  ? 11 LYS A CA   3  
ATOM   2416  C C    . LYS A 1 11 ? -7.086  2.310   4.219   1.00 6.42  ? 11 LYS A C    3  
ATOM   2417  O O    . LYS A 1 11 ? -7.310  2.126   3.035   1.00 6.35  ? 11 LYS A O    3  
ATOM   2418  C CB   . LYS A 1 11 ? -9.097  1.998   5.681   1.00 8.05  ? 11 LYS A CB   3  
ATOM   2419  C CG   . LYS A 1 11 ? -8.509  1.362   6.942   1.00 8.65  ? 11 LYS A CG   3  
ATOM   2420  C CD   . LYS A 1 11 ? -9.637  1.027   7.922   1.00 9.04  ? 11 LYS A CD   3  
ATOM   2421  C CE   . LYS A 1 11 ? -10.293 -0.298  7.520   1.00 9.50  ? 11 LYS A CE   3  
ATOM   2422  N NZ   . LYS A 1 11 ? -11.683 -0.353  8.059   1.00 9.69  ? 11 LYS A NZ   3  
ATOM   2423  H H    . LYS A 1 11 ? -9.419  3.702   3.548   1.00 6.52  ? 11 LYS A H    3  
ATOM   2424  H HA   . LYS A 1 11 ? -7.600  3.525   5.918   1.00 7.36  ? 11 LYS A HA   3  
ATOM   2425  H HB2  . LYS A 1 11 ? -10.027 2.493   5.926   1.00 8.15  ? 11 LYS A HB2  3  
ATOM   2426  H HB3  . LYS A 1 11 ? -9.284  1.229   4.946   1.00 8.38  ? 11 LYS A HB3  3  
ATOM   2427  H HG2  . LYS A 1 11 ? -7.982  0.458   6.675   1.00 9.16  ? 11 LYS A HG2  3  
ATOM   2428  H HG3  . LYS A 1 11 ? -7.825  2.054   7.407   1.00 8.50  ? 11 LYS A HG3  3  
ATOM   2429  H HD2  . LYS A 1 11 ? -9.232  0.940   8.919   1.00 9.00  ? 11 LYS A HD2  3  
ATOM   2430  H HD3  . LYS A 1 11 ? -10.377 1.814   7.901   1.00 9.26  ? 11 LYS A HD3  3  
ATOM   2431  H HE2  . LYS A 1 11 ? -10.324 -0.372  6.443   1.00 9.79  ? 11 LYS A HE2  3  
ATOM   2432  H HE3  . LYS A 1 11 ? -9.719  -1.119  7.921   1.00 9.62  ? 11 LYS A HE3  3  
ATOM   2433  H HZ1  . LYS A 1 11 ? -12.222 0.468   7.715   1.00 9.86  ? 11 LYS A HZ1  3  
ATOM   2434  H HZ2  . LYS A 1 11 ? -12.143 -1.229  7.739   1.00 9.61  ? 11 LYS A HZ2  3  
ATOM   2435  H HZ3  . LYS A 1 11 ? -11.654 -0.340  9.098   1.00 9.96  ? 11 LYS A HZ3  3  
ATOM   2436  N N    . THR A 1 12 ? -5.963  1.919   4.770   1.00 6.02  ? 12 THR A N    3  
ATOM   2437  C CA   . THR A 1 12 ? -4.926  1.232   3.939   1.00 5.35  ? 12 THR A CA   3  
ATOM   2438  C C    . THR A 1 12 ? -4.584  -0.144  4.507   1.00 5.31  ? 12 THR A C    3  
ATOM   2439  O O    . THR A 1 12 ? -5.229  -0.642  5.412   1.00 5.80  ? 12 THR A O    3  
ATOM   2440  C CB   . THR A 1 12 ? -3.652  2.078   3.868   1.00 5.23  ? 12 THR A CB   3  
ATOM   2441  O OG1  . THR A 1 12 ? -3.624  3.029   4.926   1.00 5.90  ? 12 THR A OG1  3  
ATOM   2442  C CG2  . THR A 1 12 ? -3.613  2.790   2.524   1.00 5.32  ? 12 THR A CG2  3  
ATOM   2443  H H    . THR A 1 12 ? -5.798  2.083   5.722   1.00 6.26  ? 12 THR A H    3  
ATOM   2444  H HA   . THR A 1 12 ? -5.311  1.104   2.938   1.00 5.27  ? 12 THR A HA   3  
ATOM   2445  H HB   . THR A 1 12 ? -2.791  1.432   3.944   1.00 4.85  ? 12 THR A HB   3  
ATOM   2446  H HG1  . THR A 1 12 ? -3.101  2.660   5.642   1.00 6.31  ? 12 THR A HG1  3  
ATOM   2447  H HG21 . THR A 1 12 ? -4.531  3.338   2.381   1.00 5.48  ? 12 THR A HG21 3  
ATOM   2448  H HG22 . THR A 1 12 ? -2.777  3.468   2.501   1.00 5.41  ? 12 THR A HG22 3  
ATOM   2449  H HG23 . THR A 1 12 ? -3.506  2.056   1.737   1.00 5.52  ? 12 THR A HG23 3  
ATOM   2450  N N    . TYR A 1 13 ? -3.573  -0.763  3.951   1.00 4.96  ? 13 TYR A N    3  
ATOM   2451  C CA   . TYR A 1 13 ? -3.157  -2.114  4.401   1.00 5.03  ? 13 TYR A CA   3  
ATOM   2452  C C    . TYR A 1 13 ? -1.847  -2.021  5.192   1.00 5.08  ? 13 TYR A C    3  
ATOM   2453  O O    . TYR A 1 13 ? -0.834  -1.572  4.686   1.00 4.67  ? 13 TYR A O    3  
ATOM   2454  C CB   . TYR A 1 13 ? -2.958  -2.984  3.161   1.00 4.85  ? 13 TYR A CB   3  
ATOM   2455  C CG   . TYR A 1 13 ? -2.986  -4.443  3.523   1.00 5.22  ? 13 TYR A CG   3  
ATOM   2456  C CD1  . TYR A 1 13 ? -3.857  -4.910  4.512   1.00 5.34  ? 13 TYR A CD1  3  
ATOM   2457  C CD2  . TYR A 1 13 ? -2.146  -5.330  2.849   1.00 5.75  ? 13 TYR A CD2  3  
ATOM   2458  C CE1  . TYR A 1 13 ? -3.886  -6.272  4.830   1.00 5.79  ? 13 TYR A CE1  3  
ATOM   2459  C CE2  . TYR A 1 13 ? -2.170  -6.694  3.166   1.00 6.30  ? 13 TYR A CE2  3  
ATOM   2460  C CZ   . TYR A 1 13 ? -3.041  -7.166  4.157   1.00 6.23  ? 13 TYR A CZ   3  
ATOM   2461  O OH   . TYR A 1 13 ? -3.068  -8.511  4.468   1.00 6.84  ? 13 TYR A OH   3  
ATOM   2462  H H    . TYR A 1 13 ? -3.089  -0.333  3.214   1.00 4.82  ? 13 TYR A H    3  
ATOM   2463  H HA   . TYR A 1 13 ? -3.927  -2.541  5.024   1.00 5.34  ? 13 TYR A HA   3  
ATOM   2464  H HB2  . TYR A 1 13 ? -3.749  -2.784  2.456   1.00 4.90  ? 13 TYR A HB2  3  
ATOM   2465  H HB3  . TYR A 1 13 ? -2.007  -2.747  2.706   1.00 4.67  ? 13 TYR A HB3  3  
ATOM   2466  H HD1  . TYR A 1 13 ? -4.506  -4.212  5.030   1.00 5.30  ? 13 TYR A HD1  3  
ATOM   2467  H HD2  . TYR A 1 13 ? -1.476  -4.956  2.085   1.00 5.92  ? 13 TYR A HD2  3  
ATOM   2468  H HE1  . TYR A 1 13 ? -4.558  -6.636  5.594   1.00 5.99  ? 13 TYR A HE1  3  
ATOM   2469  H HE2  . TYR A 1 13 ? -1.520  -7.381  2.645   1.00 6.92  ? 13 TYR A HE2  3  
ATOM   2470  H HH   . TYR A 1 13 ? -2.236  -8.737  4.889   1.00 7.17  ? 13 TYR A HH   3  
ATOM   2471  N N    . SER A 1 14 ? -1.866  -2.453  6.429   1.00 5.82  ? 14 SER A N    3  
ATOM   2472  C CA   . SER A 1 14 ? -0.631  -2.409  7.273   1.00 6.06  ? 14 SER A CA   3  
ATOM   2473  C C    . SER A 1 14 ? 0.063   -3.772  7.241   1.00 6.51  ? 14 SER A C    3  
ATOM   2474  O O    . SER A 1 14 ? 1.277   -3.851  7.259   1.00 6.88  ? 14 SER A O    3  
ATOM   2475  C CB   . SER A 1 14 ? -1.005  -2.058  8.718   1.00 6.42  ? 14 SER A CB   3  
ATOM   2476  O OG   . SER A 1 14 ? -2.058  -2.910  9.156   1.00 6.80  ? 14 SER A OG   3  
ATOM   2477  H H    . SER A 1 14 ? -2.697  -2.812  6.804   1.00 6.33  ? 14 SER A H    3  
ATOM   2478  H HA   . SER A 1 14 ? 0.046   -1.663  6.886   1.00 5.81  ? 14 SER A HA   3  
ATOM   2479  H HB2  . SER A 1 14 ? -0.150  -2.196  9.357   1.00 6.57  ? 14 SER A HB2  3  
ATOM   2480  H HB3  . SER A 1 14 ? -1.323  -1.024  8.764   1.00 6.52  ? 14 SER A HB3  3  
ATOM   2481  H HG   . SER A 1 14 ? -1.687  -3.552  9.763   1.00 7.03  ? 14 SER A HG   3  
ATOM   2482  N N    . LYS A 1 15 ? -0.692  -4.845  7.184   1.00 6.59  ? 15 LYS A N    3  
ATOM   2483  C CA   . LYS A 1 15 ? -0.060  -6.197  7.139   1.00 7.06  ? 15 LYS A CA   3  
ATOM   2484  C C    . LYS A 1 15 ? 0.630   -6.362  5.781   1.00 6.32  ? 15 LYS A C    3  
ATOM   2485  O O    . LYS A 1 15 ? 0.106   -5.940  4.770   1.00 6.13  ? 15 LYS A O    3  
ATOM   2486  C CB   . LYS A 1 15 ? -1.099  -7.310  7.310   1.00 7.75  ? 15 LYS A CB   3  
ATOM   2487  C CG   . LYS A 1 15 ? -2.308  -6.818  8.114   1.00 8.64  ? 15 LYS A CG   3  
ATOM   2488  C CD   . LYS A 1 15 ? -2.977  -8.002  8.818   1.00 9.43  ? 15 LYS A CD   3  
ATOM   2489  C CE   . LYS A 1 15 ? -4.494  -7.912  8.634   1.00 10.20 ? 15 LYS A CE   3  
ATOM   2490  N NZ   . LYS A 1 15 ? -5.149  -9.070  9.306   1.00 10.59 ? 15 LYS A NZ   3  
ATOM   2491  H H    . LYS A 1 15 ? -1.665  -4.758  7.161   1.00 6.42  ? 15 LYS A H    3  
ATOM   2492  H HA   . LYS A 1 15 ? 0.672   -6.266  7.928   1.00 7.57  ? 15 LYS A HA   3  
ATOM   2493  H HB2  . LYS A 1 15 ? -1.416  -7.639  6.340   1.00 7.79  ? 15 LYS A HB2  3  
ATOM   2494  H HB3  . LYS A 1 15 ? -0.644  -8.135  7.827   1.00 7.79  ? 15 LYS A HB3  3  
ATOM   2495  H HG2  . LYS A 1 15 ? -1.983  -6.100  8.853   1.00 8.72  ? 15 LYS A HG2  3  
ATOM   2496  H HG3  . LYS A 1 15 ? -3.018  -6.352  7.448   1.00 8.87  ? 15 LYS A HG3  3  
ATOM   2497  H HD2  . LYS A 1 15 ? -2.614  -8.927  8.392   1.00 9.71  ? 15 LYS A HD2  3  
ATOM   2498  H HD3  . LYS A 1 15 ? -2.740  -7.974  9.872   1.00 9.38  ? 15 LYS A HD3  3  
ATOM   2499  H HE2  . LYS A 1 15 ? -4.855  -6.992  9.069   1.00 10.54 ? 15 LYS A HE2  3  
ATOM   2500  H HE3  . LYS A 1 15 ? -4.730  -7.928  7.580   1.00 10.33 ? 15 LYS A HE3  3  
ATOM   2501  H HZ1  . LYS A 1 15 ? -4.883  -9.087  10.311  1.00 10.22 ? 15 LYS A HZ1  3  
ATOM   2502  H HZ2  . LYS A 1 15 ? -6.181  -8.979  9.225   1.00 11.09 ? 15 LYS A HZ2  3  
ATOM   2503  H HZ3  . LYS A 1 15 ? -4.842  -9.954  8.850   1.00 10.91 ? 15 LYS A HZ3  3  
ATOM   2504  N N    . PRO A 1 16 ? 1.797   -6.948  5.808   1.00 6.02  ? 16 PRO A N    3  
ATOM   2505  C CA   . PRO A 1 16 ? 2.612   -7.161  4.602   1.00 5.35  ? 16 PRO A CA   3  
ATOM   2506  C C    . PRO A 1 16 ? 2.178   -8.427  3.854   1.00 5.50  ? 16 PRO A C    3  
ATOM   2507  O O    . PRO A 1 16 ? 1.547   -9.308  4.410   1.00 6.37  ? 16 PRO A O    3  
ATOM   2508  C CB   . PRO A 1 16 ? 4.023   -7.315  5.165   1.00 5.39  ? 16 PRO A CB   3  
ATOM   2509  C CG   . PRO A 1 16 ? 3.867   -7.767  6.639   1.00 6.26  ? 16 PRO A CG   3  
ATOM   2510  C CD   . PRO A 1 16 ? 2.414   -7.455  7.045   1.00 6.51  ? 16 PRO A CD   3  
ATOM   2511  H HA   . PRO A 1 16 ? 2.569   -6.305  3.954   1.00 4.92  ? 16 PRO A HA   3  
ATOM   2512  H HB2  . PRO A 1 16 ? 4.567   -8.049  4.601   1.00 5.32  ? 16 PRO A HB2  3  
ATOM   2513  H HB3  . PRO A 1 16 ? 4.536   -6.373  5.127   1.00 5.10  ? 16 PRO A HB3  3  
ATOM   2514  H HG2  . PRO A 1 16 ? 4.059   -8.828  6.722   1.00 6.77  ? 16 PRO A HG2  3  
ATOM   2515  H HG3  . PRO A 1 16 ? 4.548   -7.215  7.269   1.00 6.37  ? 16 PRO A HG3  3  
ATOM   2516  H HD2  . PRO A 1 16 ? 1.912   -8.355  7.373   1.00 7.06  ? 16 PRO A HD2  3  
ATOM   2517  H HD3  . PRO A 1 16 ? 2.380   -6.702  7.811   1.00 6.63  ? 16 PRO A HD3  3  
ATOM   2518  N N    . PHE A 1 17 ? 2.529   -8.520  2.595   1.00 4.76  ? 17 PHE A N    3  
ATOM   2519  C CA   . PHE A 1 17 ? 2.159   -9.727  1.789   1.00 4.96  ? 17 PHE A CA   3  
ATOM   2520  C C    . PHE A 1 17 ? 3.035   -9.799  0.524   1.00 4.78  ? 17 PHE A C    3  
ATOM   2521  O O    . PHE A 1 17 ? 3.621   -8.818  0.105   1.00 4.77  ? 17 PHE A O    3  
ATOM   2522  C CB   . PHE A 1 17 ? 0.661   -9.681  1.422   1.00 4.69  ? 17 PHE A CB   3  
ATOM   2523  C CG   . PHE A 1 17 ? 0.377   -8.625  0.371   1.00 3.72  ? 17 PHE A CG   3  
ATOM   2524  C CD1  . PHE A 1 17 ? 0.460   -7.264  0.690   1.00 3.29  ? 17 PHE A CD1  3  
ATOM   2525  C CD2  . PHE A 1 17 ? 0.021   -9.018  -0.925  1.00 3.74  ? 17 PHE A CD2  3  
ATOM   2526  C CE1  . PHE A 1 17 ? 0.185   -6.298  -0.287  1.00 2.59  ? 17 PHE A CE1  3  
ATOM   2527  C CE2  . PHE A 1 17 ? -0.253  -8.052  -1.900  1.00 3.14  ? 17 PHE A CE2  3  
ATOM   2528  C CZ   . PHE A 1 17 ? -0.170  -6.694  -1.581  1.00 2.38  ? 17 PHE A CZ   3  
ATOM   2529  H H    . PHE A 1 17 ? 3.046   -7.795  2.183   1.00 4.19  ? 17 PHE A H    3  
ATOM   2530  H HA   . PHE A 1 17 ? 2.344   -10.609 2.386   1.00 5.66  ? 17 PHE A HA   3  
ATOM   2531  H HB2  . PHE A 1 17 ? 0.362   -10.646 1.040   1.00 5.13  ? 17 PHE A HB2  3  
ATOM   2532  H HB3  . PHE A 1 17 ? 0.085   -9.460  2.309   1.00 5.06  ? 17 PHE A HB3  3  
ATOM   2533  H HD1  . PHE A 1 17 ? 0.732   -6.958  1.689   1.00 3.86  ? 17 PHE A HD1  3  
ATOM   2534  H HD2  . PHE A 1 17 ? -0.047  -10.067 -1.172  1.00 4.51  ? 17 PHE A HD2  3  
ATOM   2535  H HE1  . PHE A 1 17 ? 0.248   -5.247  -0.042  1.00 2.72  ? 17 PHE A HE1  3  
ATOM   2536  H HE2  . PHE A 1 17 ? -0.528  -8.357  -2.899  1.00 3.62  ? 17 PHE A HE2  3  
ATOM   2537  H HZ   . PHE A 1 17 ? -0.381  -5.950  -2.334  1.00 2.18  ? 17 PHE A HZ   3  
ATOM   2538  N N    . HIS A 1 18 ? 3.135   -10.967 -0.071  1.00 4.92  ? 18 HIS A N    3  
ATOM   2539  C CA   . HIS A 1 18 ? 3.980   -11.141 -1.295  1.00 5.06  ? 18 HIS A CA   3  
ATOM   2540  C C    . HIS A 1 18 ? 3.368   -10.350 -2.485  1.00 4.32  ? 18 HIS A C    3  
ATOM   2541  O O    . HIS A 1 18 ? 2.161   -10.275 -2.622  1.00 4.10  ? 18 HIS A O    3  
ATOM   2542  C CB   . HIS A 1 18 ? 4.097   -12.644 -1.564  1.00 5.95  ? 18 HIS A CB   3  
ATOM   2543  C CG   . HIS A 1 18 ? 4.596   -12.886 -2.941  1.00 6.25  ? 18 HIS A CG   3  
ATOM   2544  N ND1  . HIS A 1 18 ? 5.937   -13.060 -3.249  1.00 6.36  ? 18 HIS A ND1  3  
ATOM   2545  C CD2  . HIS A 1 18 ? 3.925   -12.983 -4.106  1.00 6.72  ? 18 HIS A CD2  3  
ATOM   2546  C CE1  . HIS A 1 18 ? 6.011   -13.250 -4.576  1.00 6.81  ? 18 HIS A CE1  3  
ATOM   2547  N NE2  . HIS A 1 18 ? 4.809   -13.220 -5.139  1.00 7.07  ? 18 HIS A NE2  3  
ATOM   2548  H H    . HIS A 1 18 ? 2.657   -11.743 0.298   1.00 5.11  ? 18 HIS A H    3  
ATOM   2549  H HA   . HIS A 1 18 ? 4.959   -10.754 -1.103  1.00 5.21  ? 18 HIS A HA   3  
ATOM   2550  H HB2  . HIS A 1 18 ? 4.783   -13.081 -0.854  1.00 6.63  ? 18 HIS A HB2  3  
ATOM   2551  H HB3  . HIS A 1 18 ? 3.128   -13.101 -1.448  1.00 5.84  ? 18 HIS A HB3  3  
ATOM   2552  H HD1  . HIS A 1 18 ? 6.687   -13.044 -2.619  1.00 6.36  ? 18 HIS A HD1  3  
ATOM   2553  H HD2  . HIS A 1 18 ? 2.870   -12.844 -4.206  1.00 7.00  ? 18 HIS A HD2  3  
ATOM   2554  H HE1  . HIS A 1 18 ? 6.928   -13.368 -5.128  1.00 7.12  ? 18 HIS A HE1  3  
ATOM   2555  N N    . PRO A 1 19 ? 4.242   -9.725  -3.268  1.00 4.16  ? 19 PRO A N    3  
ATOM   2556  C CA   . PRO A 1 19 ? 3.854   -8.849  -4.411  1.00 3.77  ? 19 PRO A CA   3  
ATOM   2557  C C    . PRO A 1 19 ? 3.396   -9.583  -5.679  1.00 4.27  ? 19 PRO A C    3  
ATOM   2558  O O    . PRO A 1 19 ? 2.441   -9.164  -6.304  1.00 4.32  ? 19 PRO A O    3  
ATOM   2559  C CB   . PRO A 1 19 ? 5.132   -8.067  -4.712  1.00 3.96  ? 19 PRO A CB   3  
ATOM   2560  C CG   . PRO A 1 19 ? 6.301   -8.908  -4.156  1.00 4.62  ? 19 PRO A CG   3  
ATOM   2561  C CD   . PRO A 1 19 ? 5.706   -9.840  -3.086  1.00 4.65  ? 19 PRO A CD   3  
ATOM   2562  H HA   . PRO A 1 19 ? 3.095   -8.160  -4.099  1.00 3.26  ? 19 PRO A HA   3  
ATOM   2563  H HB2  . PRO A 1 19 ? 5.242   -7.938  -5.781  1.00 4.26  ? 19 PRO A HB2  3  
ATOM   2564  H HB3  . PRO A 1 19 ? 5.107   -7.110  -4.224  1.00 3.57  ? 19 PRO A HB3  3  
ATOM   2565  H HG2  . PRO A 1 19 ? 6.746   -9.492  -4.952  1.00 5.23  ? 19 PRO A HG2  3  
ATOM   2566  H HG3  . PRO A 1 19 ? 7.041   -8.264  -3.709  1.00 4.63  ? 19 PRO A HG3  3  
ATOM   2567  H HD2  . PRO A 1 19 ? 6.031   -10.854 -3.253  1.00 5.29  ? 19 PRO A HD2  3  
ATOM   2568  H HD3  . PRO A 1 19 ? 5.984   -9.509  -2.100  1.00 4.56  ? 19 PRO A HD3  3  
ATOM   2569  N N    . LYS A 1 20 ? 4.079   -10.622 -6.104  1.00 4.91  ? 20 LYS A N    3  
ATOM   2570  C CA   . LYS A 1 20 ? 3.671   -11.315 -7.379  1.00 5.52  ? 20 LYS A CA   3  
ATOM   2571  C C    . LYS A 1 20 ? 2.170   -11.668 -7.368  1.00 5.00  ? 20 LYS A C    3  
ATOM   2572  O O    . LYS A 1 20 ? 1.558   -11.774 -8.415  1.00 5.39  ? 20 LYS A O    3  
ATOM   2573  C CB   . LYS A 1 20 ? 4.502   -12.570 -7.610  1.00 6.44  ? 20 LYS A CB   3  
ATOM   2574  C CG   . LYS A 1 20 ? 4.662   -12.812 -9.113  1.00 7.16  ? 20 LYS A CG   3  
ATOM   2575  C CD   . LYS A 1 20 ? 6.101   -12.501 -9.534  1.00 7.91  ? 20 LYS A CD   3  
ATOM   2576  C CE   . LYS A 1 20 ? 6.402   -13.181 -10.872 1.00 8.41  ? 20 LYS A CE   3  
ATOM   2577  N NZ   . LYS A 1 20 ? 7.821   -12.928 -11.255 1.00 8.95  ? 20 LYS A NZ   3  
ATOM   2578  H H    . LYS A 1 20 ? 4.869   -10.918 -5.611  1.00 5.13  ? 20 LYS A H    3  
ATOM   2579  H HA   . LYS A 1 20 ? 3.852   -10.648 -8.192  1.00 5.87  ? 20 LYS A HA   3  
ATOM   2580  H HB2  . LYS A 1 20 ? 5.475   -12.447 -7.158  1.00 6.91  ? 20 LYS A HB2  3  
ATOM   2581  H HB3  . LYS A 1 20 ? 4.003   -13.404 -7.167  1.00 6.29  ? 20 LYS A HB3  3  
ATOM   2582  H HG2  . LYS A 1 20 ? 4.436   -13.845 -9.336  1.00 7.23  ? 20 LYS A HG2  3  
ATOM   2583  H HG3  . LYS A 1 20 ? 3.983   -12.171 -9.656  1.00 7.28  ? 20 LYS A HG3  3  
ATOM   2584  H HD2  . LYS A 1 20 ? 6.222   -11.432 -9.637  1.00 8.14  ? 20 LYS A HD2  3  
ATOM   2585  H HD3  . LYS A 1 20 ? 6.783   -12.870 -8.783  1.00 8.11  ? 20 LYS A HD3  3  
ATOM   2586  H HE2  . LYS A 1 20 ? 6.240   -14.245 -10.779 1.00 8.28  ? 20 LYS A HE2  3  
ATOM   2587  H HE3  . LYS A 1 20 ? 5.747   -12.783 -11.633 1.00 8.75  ? 20 LYS A HE3  3  
ATOM   2588  H HZ1  . LYS A 1 20 ? 8.452   -13.268 -10.501 1.00 9.13  ? 20 LYS A HZ1  3  
ATOM   2589  H HZ2  . LYS A 1 20 ? 8.035   -13.431 -12.140 1.00 9.15  ? 20 LYS A HZ2  3  
ATOM   2590  H HZ3  . LYS A 1 20 ? 7.967   -11.908 -11.393 1.00 9.17  ? 20 LYS A HZ3  3  
ATOM   2591  N N    . PHE A 1 21 ? 1.560   -11.812 -6.206  1.00 4.37  ? 21 PHE A N    3  
ATOM   2592  C CA   . PHE A 1 21 ? 0.094   -12.111 -6.155  1.00 4.15  ? 21 PHE A CA   3  
ATOM   2593  C C    . PHE A 1 21 ? -0.663  -10.945 -6.802  1.00 3.56  ? 21 PHE A C    3  
ATOM   2594  O O    . PHE A 1 21 ? -1.638  -11.132 -7.504  1.00 3.88  ? 21 PHE A O    3  
ATOM   2595  C CB   . PHE A 1 21 ? -0.371  -12.234 -4.706  1.00 4.02  ? 21 PHE A CB   3  
ATOM   2596  C CG   . PHE A 1 21 ? 0.388   -13.308 -3.954  1.00 4.64  ? 21 PHE A CG   3  
ATOM   2597  C CD1  . PHE A 1 21 ? 0.942   -14.408 -4.626  1.00 5.11  ? 21 PHE A CD1  3  
ATOM   2598  C CD2  . PHE A 1 21 ? 0.522   -13.202 -2.563  1.00 5.12  ? 21 PHE A CD2  3  
ATOM   2599  C CE1  . PHE A 1 21 ? 1.632   -15.392 -3.905  1.00 5.85  ? 21 PHE A CE1  3  
ATOM   2600  C CE2  . PHE A 1 21 ? 1.208   -14.188 -1.846  1.00 5.85  ? 21 PHE A CE2  3  
ATOM   2601  C CZ   . PHE A 1 21 ? 1.764   -15.282 -2.517  1.00 6.13  ? 21 PHE A CZ   3  
ATOM   2602  H H    . PHE A 1 21 ? 2.053   -11.695 -5.372  1.00 4.29  ? 21 PHE A H    3  
ATOM   2603  H HA   . PHE A 1 21 ? -0.114  -13.018 -6.676  1.00 4.82  ? 21 PHE A HA   3  
ATOM   2604  H HB2  . PHE A 1 21 ? -0.217  -11.295 -4.223  1.00 3.48  ? 21 PHE A HB2  3  
ATOM   2605  H HB3  . PHE A 1 21 ? -1.419  -12.467 -4.695  1.00 4.37  ? 21 PHE A HB3  3  
ATOM   2606  H HD1  . PHE A 1 21 ? 0.841   -14.493 -5.697  1.00 5.17  ? 21 PHE A HD1  3  
ATOM   2607  H HD2  . PHE A 1 21 ? 0.096   -12.357 -2.043  1.00 5.18  ? 21 PHE A HD2  3  
ATOM   2608  H HE1  . PHE A 1 21 ? 2.061   -16.235 -4.421  1.00 6.40  ? 21 PHE A HE1  3  
ATOM   2609  H HE2  . PHE A 1 21 ? 1.312   -14.100 -0.772  1.00 6.40  ? 21 PHE A HE2  3  
ATOM   2610  H HZ   . PHE A 1 21 ? 2.293   -16.043 -1.962  1.00 6.79  ? 21 PHE A HZ   3  
ATOM   2611  N N    . ILE A 1 22 ? -0.201  -9.742  -6.554  1.00 2.94  ? 22 ILE A N    3  
ATOM   2612  C CA   . ILE A 1 22 ? -0.848  -8.521  -7.121  1.00 2.62  ? 22 ILE A CA   3  
ATOM   2613  C C    . ILE A 1 22 ? -0.817  -8.565  -8.651  1.00 3.41  ? 22 ILE A C    3  
ATOM   2614  O O    . ILE A 1 22 ? 0.221   -8.755  -9.259  1.00 4.13  ? 22 ILE A O    3  
ATOM   2615  C CB   . ILE A 1 22 ? -0.080  -7.279  -6.640  1.00 2.18  ? 22 ILE A CB   3  
ATOM   2616  C CG1  . ILE A 1 22 ? -0.108  -7.216  -5.109  1.00 2.00  ? 22 ILE A CG1  3  
ATOM   2617  C CG2  . ILE A 1 22 ? -0.728  -6.017  -7.211  1.00 2.53  ? 22 ILE A CG2  3  
ATOM   2618  C CD1  . ILE A 1 22 ? 1.139   -6.487  -4.604  1.00 2.47  ? 22 ILE A CD1  3  
ATOM   2619  H H    . ILE A 1 22 ? 0.587   -9.640  -5.980  1.00 2.94  ? 22 ILE A H    3  
ATOM   2620  H HA   . ILE A 1 22 ? -1.872  -8.460  -6.785  1.00 2.63  ? 22 ILE A HA   3  
ATOM   2621  H HB   . ILE A 1 22 ? 0.943   -7.339  -6.981  1.00 2.49  ? 22 ILE A HB   3  
ATOM   2622  H HG12 . ILE A 1 22 ? -0.992  -6.686  -4.786  1.00 2.23  ? 22 ILE A HG12 3  
ATOM   2623  H HG13 . ILE A 1 22 ? -0.123  -8.217  -4.707  1.00 2.28  ? 22 ILE A HG13 3  
ATOM   2624  H HG21 . ILE A 1 22 ? -1.797  -6.081  -7.095  1.00 2.71  ? 22 ILE A HG21 3  
ATOM   2625  H HG22 . ILE A 1 22 ? -0.358  -5.151  -6.682  1.00 2.80  ? 22 ILE A HG22 3  
ATOM   2626  H HG23 . ILE A 1 22 ? -0.484  -5.929  -8.259  1.00 3.07  ? 22 ILE A HG23 3  
ATOM   2627  H HD11 . ILE A 1 22 ? 1.918   -6.543  -5.349  1.00 2.73  ? 22 ILE A HD11 3  
ATOM   2628  H HD12 . ILE A 1 22 ? 0.899   -5.452  -4.411  1.00 2.88  ? 22 ILE A HD12 3  
ATOM   2629  H HD13 . ILE A 1 22 ? 1.482   -6.951  -3.691  1.00 2.84  ? 22 ILE A HD13 3  
ATOM   2630  N N    . LYS A 1 23 ? -1.952  -8.366  -9.270  1.00 3.62  ? 23 LYS A N    3  
ATOM   2631  C CA   . LYS A 1 23 ? -2.018  -8.363  -10.760 1.00 4.61  ? 23 LYS A CA   3  
ATOM   2632  C C    . LYS A 1 23 ? -2.073  -6.910  -11.264 1.00 5.00  ? 23 LYS A C    3  
ATOM   2633  O O    . LYS A 1 23 ? -1.856  -6.649  -12.432 1.00 5.88  ? 23 LYS A O    3  
ATOM   2634  C CB   . LYS A 1 23 ? -3.273  -9.114  -11.218 1.00 5.10  ? 23 LYS A CB   3  
ATOM   2635  C CG   . LYS A 1 23 ? -3.045  -9.687  -12.621 1.00 5.85  ? 23 LYS A CG   3  
ATOM   2636  C CD   . LYS A 1 23 ? -4.136  -10.713 -12.943 1.00 6.35  ? 23 LYS A CD   3  
ATOM   2637  C CE   . LYS A 1 23 ? -3.827  -11.380 -14.286 1.00 6.93  ? 23 LYS A CE   3  
ATOM   2638  N NZ   . LYS A 1 23 ? -4.757  -12.527 -14.500 1.00 7.72  ? 23 LYS A NZ   3  
ATOM   2639  H H    . LYS A 1 23 ? -2.766  -8.201  -8.748  1.00 3.33  ? 23 LYS A H    3  
ATOM   2640  H HA   . LYS A 1 23 ? -1.141  -8.850  -11.160 1.00 4.98  ? 23 LYS A HA   3  
ATOM   2641  H HB2  . LYS A 1 23 ? -3.481  -9.920  -10.529 1.00 4.92  ? 23 LYS A HB2  3  
ATOM   2642  H HB3  . LYS A 1 23 ? -4.111  -8.433  -11.242 1.00 5.36  ? 23 LYS A HB3  3  
ATOM   2643  H HG2  . LYS A 1 23 ? -3.078  -8.886  -13.345 1.00 6.02  ? 23 LYS A HG2  3  
ATOM   2644  H HG3  . LYS A 1 23 ? -2.079  -10.168 -12.661 1.00 6.22  ? 23 LYS A HG3  3  
ATOM   2645  H HD2  . LYS A 1 23 ? -4.165  -11.462 -12.166 1.00 6.70  ? 23 LYS A HD2  3  
ATOM   2646  H HD3  . LYS A 1 23 ? -5.092  -10.216 -13.001 1.00 6.30  ? 23 LYS A HD3  3  
ATOM   2647  H HE2  . LYS A 1 23 ? -3.954  -10.662 -15.083 1.00 6.98  ? 23 LYS A HE2  3  
ATOM   2648  H HE3  . LYS A 1 23 ? -2.808  -11.739 -14.284 1.00 7.01  ? 23 LYS A HE3  3  
ATOM   2649  H HZ1  . LYS A 1 23 ? -5.739  -12.190 -14.463 1.00 7.80  ? 23 LYS A HZ1  3  
ATOM   2650  H HZ2  . LYS A 1 23 ? -4.571  -12.952 -15.432 1.00 7.78  ? 23 LYS A HZ2  3  
ATOM   2651  H HZ3  . LYS A 1 23 ? -4.608  -13.238 -13.757 1.00 8.36  ? 23 LYS A HZ3  3  
ATOM   2652  N N    . GLU A 1 24 ? -2.362  -5.962  -10.393 1.00 4.51  ? 24 GLU A N    3  
ATOM   2653  C CA   . GLU A 1 24 ? -2.430  -4.537  -10.824 1.00 5.13  ? 24 GLU A CA   3  
ATOM   2654  C C    . GLU A 1 24 ? -2.029  -3.618  -9.657  1.00 4.55  ? 24 GLU A C    3  
ATOM   2655  O O    . GLU A 1 24 ? -2.858  -3.230  -8.851  1.00 4.65  ? 24 GLU A O    3  
ATOM   2656  C CB   . GLU A 1 24 ? -3.860  -4.213  -11.268 1.00 5.78  ? 24 GLU A CB   3  
ATOM   2657  C CG   . GLU A 1 24 ? -3.813  -3.252  -12.455 1.00 6.35  ? 24 GLU A CG   3  
ATOM   2658  C CD   . GLU A 1 24 ? -4.988  -2.275  -12.371 1.00 7.36  ? 24 GLU A CD   3  
ATOM   2659  O OE1  . GLU A 1 24 ? -6.045  -2.601  -12.886 1.00 7.77  ? 24 GLU A OE1  3  
ATOM   2660  O OE2  . GLU A 1 24 ? -4.812  -1.216  -11.791 1.00 7.92  ? 24 GLU A OE2  3  
ATOM   2661  H H    . GLU A 1 24 ? -2.535  -6.190  -9.457  1.00 3.86  ? 24 GLU A H    3  
ATOM   2662  H HA   . GLU A 1 24 ? -1.754  -4.381  -11.651 1.00 5.74  ? 24 GLU A HA   3  
ATOM   2663  H HB2  . GLU A 1 24 ? -4.362  -5.124  -11.562 1.00 5.66  ? 24 GLU A HB2  3  
ATOM   2664  H HB3  . GLU A 1 24 ? -4.397  -3.751  -10.454 1.00 6.21  ? 24 GLU A HB3  3  
ATOM   2665  H HG2  . GLU A 1 24 ? -2.882  -2.703  -12.432 1.00 6.22  ? 24 GLU A HG2  3  
ATOM   2666  H HG3  . GLU A 1 24 ? -3.878  -3.815  -13.372 1.00 6.40  ? 24 GLU A HG3  3  
HETATM 2667  N N    . MLE A 1 25 ? -0.765  -3.260  -9.559  1.00 4.25  ? 25 MLE A N    3  
HETATM 2668  C CN   . MLE A 1 25 ? -0.034  -2.907  -10.820 1.00 5.13  ? 25 MLE A CN   3  
HETATM 2669  C CA   . MLE A 1 25 ? -0.318  -2.357  -8.441  1.00 3.66  ? 25 MLE A CA   3  
HETATM 2670  C CB   . MLE A 1 25 ? 1.015   -2.857  -7.858  1.00 3.52  ? 25 MLE A CB   3  
HETATM 2671  C CG   . MLE A 1 25 ? 1.665   -1.748  -7.010  1.00 3.28  ? 25 MLE A CG   3  
HETATM 2672  C CD1  . MLE A 1 25 ? 2.091   -2.312  -5.657  1.00 2.93  ? 25 MLE A CD1  3  
HETATM 2673  C CD2  . MLE A 1 25 ? 2.897   -1.187  -7.732  1.00 3.54  ? 25 MLE A CD2  3  
HETATM 2674  C C    . MLE A 1 25 ? -0.138  -0.938  -8.985  1.00 4.19  ? 25 MLE A C    3  
HETATM 2675  O O    . MLE A 1 25 ? 0.881   -0.613  -9.568  1.00 4.87  ? 25 MLE A O    3  
HETATM 2676  H HN1  . MLE A 1 25 ? -0.046  -3.747  -11.494 1.00 5.47  ? 25 MLE A HN1  3  
HETATM 2677  H HN2  . MLE A 1 25 ? -0.517  -2.059  -11.288 1.00 5.48  ? 25 MLE A HN2  3  
HETATM 2678  H HN3  . MLE A 1 25 ? 0.987   -2.649  -10.582 1.00 5.42  ? 25 MLE A HN3  3  
HETATM 2679  H HA   . MLE A 1 25 ? -1.071  -2.344  -7.659  1.00 3.20  ? 25 MLE A HA   3  
HETATM 2680  H HB2  . MLE A 1 25 ? 0.833   -3.724  -7.239  1.00 3.37  ? 25 MLE A HB2  3  
HETATM 2681  H HB3  . MLE A 1 25 ? 1.680   -3.126  -8.665  1.00 4.08  ? 25 MLE A HB3  3  
HETATM 2682  H HG   . MLE A 1 25 ? 0.950   -0.954  -6.851  1.00 3.59  ? 25 MLE A HG   3  
HETATM 2683  H HD11 . MLE A 1 25 ? 2.107   -3.390  -5.706  1.00 3.21  ? 25 MLE A HD11 3  
HETATM 2684  H HD12 . MLE A 1 25 ? 3.075   -1.946  -5.409  1.00 3.14  ? 25 MLE A HD12 3  
HETATM 2685  H HD13 . MLE A 1 25 ? 1.389   -1.995  -4.902  1.00 2.79  ? 25 MLE A HD13 3  
HETATM 2686  H HD21 . MLE A 1 25 ? 2.983   -1.641  -8.709  1.00 3.75  ? 25 MLE A HD21 3  
HETATM 2687  H HD22 . MLE A 1 25 ? 2.792   -0.116  -7.842  1.00 3.70  ? 25 MLE A HD22 3  
HETATM 2688  H HD23 . MLE A 1 25 ? 3.785   -1.403  -7.157  1.00 3.89  ? 25 MLE A HD23 3  
ATOM   2689  N N    . ARG A 1 26 ? -1.110  -0.093  -8.808  1.00 4.14  ? 26 ARG A N    3  
ATOM   2690  C CA   . ARG A 1 26 ? -0.963  1.288   -9.324  1.00 4.79  ? 26 ARG A CA   3  
ATOM   2691  C C    . ARG A 1 26 ? -1.019  2.277   -8.160  1.00 4.70  ? 26 ARG A C    3  
ATOM   2692  O O    . ARG A 1 26 ? -2.059  2.504   -7.568  1.00 4.97  ? 26 ARG A O    3  
ATOM   2693  C CB   . ARG A 1 26 ? -2.064  1.600   -10.351 1.00 5.59  ? 26 ARG A CB   3  
ATOM   2694  C CG   . ARG A 1 26 ? -3.432  1.149   -9.820  1.00 5.99  ? 26 ARG A CG   3  
ATOM   2695  C CD   . ARG A 1 26 ? -4.502  2.165   -10.221 1.00 6.35  ? 26 ARG A CD   3  
ATOM   2696  N NE   . ARG A 1 26 ? -5.817  1.757   -9.645  1.00 7.16  ? 26 ARG A NE   3  
ATOM   2697  C CZ   . ARG A 1 26 ? -6.888  2.469   -9.881  1.00 7.92  ? 26 ARG A CZ   3  
ATOM   2698  N NH1  . ARG A 1 26 ? -7.194  3.468   -9.094  1.00 8.52  ? 26 ARG A NH1  3  
ATOM   2699  N NH2  . ARG A 1 26 ? -7.654  2.179   -10.902 1.00 8.32  ? 26 ARG A NH2  3  
ATOM   2700  H H    . ARG A 1 26 ? -1.926  -0.365  -8.339  1.00 3.85  ? 26 ARG A H    3  
ATOM   2701  H HA   . ARG A 1 26 ? 0.003   1.358   -9.800  1.00 5.07  ? 26 ARG A HA   3  
ATOM   2702  H HB2  . ARG A 1 26 ? -2.086  2.664   -10.538 1.00 5.95  ? 26 ARG A HB2  3  
ATOM   2703  H HB3  . ARG A 1 26 ? -1.850  1.079   -11.272 1.00 5.91  ? 26 ARG A HB3  3  
ATOM   2704  H HG2  . ARG A 1 26 ? -3.677  0.184   -10.239 1.00 6.27  ? 26 ARG A HG2  3  
ATOM   2705  H HG3  . ARG A 1 26 ? -3.396  1.074   -8.745  1.00 6.12  ? 26 ARG A HG3  3  
ATOM   2706  H HD2  . ARG A 1 26 ? -4.232  3.141   -9.845  1.00 6.26  ? 26 ARG A HD2  3  
ATOM   2707  H HD3  . ARG A 1 26 ? -4.578  2.202   -11.299 1.00 6.38  ? 26 ARG A HD3  3  
ATOM   2708  H HE   . ARG A 1 26 ? -5.878  0.952   -9.087  1.00 7.28  ? 26 ARG A HE   3  
ATOM   2709  H HH11 . ARG A 1 26 ? -6.609  3.688   -8.313  1.00 8.41  ? 26 ARG A HH11 3  
ATOM   2710  H HH12 . ARG A 1 26 ? -8.014  4.014   -9.271  1.00 9.21  ? 26 ARG A HH12 3  
ATOM   2711  H HH21 . ARG A 1 26 ? -7.420  1.413   -11.502 1.00 8.08  ? 26 ARG A HH21 3  
ATOM   2712  H HH22 . ARG A 1 26 ? -8.475  2.722   -11.084 1.00 9.02  ? 26 ARG A HH22 3  
ATOM   2713  N N    . VAL A 1 27 ? 0.102   2.861   -7.826  1.00 4.69  ? 27 VAL A N    3  
ATOM   2714  C CA   . VAL A 1 27 ? 0.149   3.833   -6.701  1.00 4.83  ? 27 VAL A CA   3  
ATOM   2715  C C    . VAL A 1 27 ? -0.360  5.200   -7.178  1.00 4.79  ? 27 VAL A C    3  
ATOM   2716  O O    . VAL A 1 27 ? 0.026   5.685   -8.226  1.00 5.45  ? 27 VAL A O    3  
ATOM   2717  C CB   . VAL A 1 27 ? 1.599   3.954   -6.201  1.00 5.66  ? 27 VAL A CB   3  
ATOM   2718  C CG1  . VAL A 1 27 ? 2.162   2.563   -5.906  1.00 6.10  ? 27 VAL A CG1  3  
ATOM   2719  C CG2  . VAL A 1 27 ? 2.477   4.626   -7.264  1.00 6.04  ? 27 VAL A CG2  3  
ATOM   2720  H H    . VAL A 1 27 ? 0.923   2.655   -8.315  1.00 4.82  ? 27 VAL A H    3  
ATOM   2721  H HA   . VAL A 1 27 ? -0.478  3.478   -5.896  1.00 4.74  ? 27 VAL A HA   3  
ATOM   2722  H HB   . VAL A 1 27 ? 1.613   4.542   -5.301  1.00 5.89  ? 27 VAL A HB   3  
ATOM   2723  H HG11 . VAL A 1 27 ? 1.411   1.968   -5.411  1.00 6.30  ? 27 VAL A HG11 3  
ATOM   2724  H HG12 . VAL A 1 27 ? 2.447   2.086   -6.832  1.00 6.06  ? 27 VAL A HG12 3  
ATOM   2725  H HG13 . VAL A 1 27 ? 3.028   2.654   -5.266  1.00 6.54  ? 27 VAL A HG13 3  
ATOM   2726  H HG21 . VAL A 1 27 ? 2.214   4.247   -8.240  1.00 6.18  ? 27 VAL A HG21 3  
ATOM   2727  H HG22 . VAL A 1 27 ? 2.319   5.693   -7.238  1.00 6.05  ? 27 VAL A HG22 3  
ATOM   2728  H HG23 . VAL A 1 27 ? 3.516   4.409   -7.061  1.00 6.44  ? 27 VAL A HG23 3  
ATOM   2729  N N    . ILE A 1 28 ? -1.221  5.828   -6.413  1.00 4.28  ? 28 ILE A N    3  
ATOM   2730  C CA   . ILE A 1 28 ? -1.744  7.169   -6.818  1.00 4.40  ? 28 ILE A CA   3  
ATOM   2731  C C    . ILE A 1 28 ? -0.918  8.252   -6.111  1.00 4.70  ? 28 ILE A C    3  
ATOM   2732  O O    . ILE A 1 28 ? -0.609  8.138   -4.939  1.00 5.01  ? 28 ILE A O    3  
ATOM   2733  C CB   . ILE A 1 28 ? -3.227  7.297   -6.429  1.00 4.45  ? 28 ILE A CB   3  
ATOM   2734  C CG1  . ILE A 1 28 ? -4.053  6.270   -7.219  1.00 4.94  ? 28 ILE A CG1  3  
ATOM   2735  C CG2  . ILE A 1 28 ? -3.724  8.710   -6.761  1.00 4.49  ? 28 ILE A CG2  3  
ATOM   2736  C CD1  . ILE A 1 28 ? -5.514  6.324   -6.764  1.00 5.05  ? 28 ILE A CD1  3  
ATOM   2737  H H    . ILE A 1 28 ? -1.516  5.422   -5.570  1.00 4.02  ? 28 ILE A H    3  
ATOM   2738  H HA   . ILE A 1 28 ? -1.642  7.284   -7.888  1.00 4.67  ? 28 ILE A HA   3  
ATOM   2739  H HB   . ILE A 1 28 ? -3.338  7.115   -5.370  1.00 4.56  ? 28 ILE A HB   3  
ATOM   2740  H HG12 . ILE A 1 28 ? -3.995  6.498   -8.273  1.00 5.21  ? 28 ILE A HG12 3  
ATOM   2741  H HG13 . ILE A 1 28 ? -3.660  5.280   -7.044  1.00 5.36  ? 28 ILE A HG13 3  
ATOM   2742  H HG21 . ILE A 1 28 ? -3.528  8.926   -7.801  1.00 4.51  ? 28 ILE A HG21 3  
ATOM   2743  H HG22 . ILE A 1 28 ? -4.787  8.772   -6.575  1.00 4.77  ? 28 ILE A HG22 3  
ATOM   2744  H HG23 . ILE A 1 28 ? -3.209  9.429   -6.143  1.00 4.49  ? 28 ILE A HG23 3  
ATOM   2745  H HD11 . ILE A 1 28 ? -5.559  6.251   -5.687  1.00 4.88  ? 28 ILE A HD11 3  
ATOM   2746  H HD12 . ILE A 1 28 ? -5.956  7.256   -7.081  1.00 5.25  ? 28 ILE A HD12 3  
ATOM   2747  H HD13 . ILE A 1 28 ? -6.057  5.500   -7.204  1.00 5.49  ? 28 ILE A HD13 3  
ATOM   2748  N N    . GLU A 1 29 ? -0.550  9.292   -6.822  1.00 5.08  ? 29 GLU A N    3  
ATOM   2749  C CA   . GLU A 1 29 ? 0.268   10.385  -6.210  1.00 5.75  ? 29 GLU A CA   3  
ATOM   2750  C C    . GLU A 1 29 ? -0.537  11.121  -5.130  1.00 5.30  ? 29 GLU A C    3  
ATOM   2751  O O    . GLU A 1 29 ? -1.709  10.865  -4.923  1.00 4.95  ? 29 GLU A O    3  
ATOM   2752  C CB   . GLU A 1 29 ? 0.694   11.382  -7.294  1.00 6.63  ? 29 GLU A CB   3  
ATOM   2753  C CG   . GLU A 1 29 ? -0.519  11.810  -8.132  1.00 7.40  ? 29 GLU A CG   3  
ATOM   2754  C CD   . GLU A 1 29 ? -0.419  13.304  -8.454  1.00 8.35  ? 29 GLU A CD   3  
ATOM   2755  O OE1  . GLU A 1 29 ? 0.174   13.633  -9.467  1.00 8.53  ? 29 GLU A OE1  3  
ATOM   2756  O OE2  . GLU A 1 29 ? -0.940  14.091  -7.681  1.00 9.09  ? 29 GLU A OE2  3  
ATOM   2757  H H    . GLU A 1 29 ? -0.805  9.353   -7.765  1.00 5.18  ? 29 GLU A H    3  
ATOM   2758  H HA   . GLU A 1 29 ? 1.150   9.954   -5.760  1.00 6.26  ? 29 GLU A HA   3  
ATOM   2759  H HB2  . GLU A 1 29 ? 1.127   12.247  -6.827  1.00 6.65  ? 29 GLU A HB2  3  
ATOM   2760  H HB3  . GLU A 1 29 ? 1.426   10.919  -7.934  1.00 7.00  ? 29 GLU A HB3  3  
ATOM   2761  H HG2  . GLU A 1 29 ? -0.538  11.243  -9.052  1.00 7.70  ? 29 GLU A HG2  3  
ATOM   2762  H HG3  . GLU A 1 29 ? -1.425  11.623  -7.575  1.00 7.27  ? 29 GLU A HG3  3  
ATOM   2763  N N    . SER A 1 30 ? 0.099   12.035  -4.441  1.00 5.67  ? 30 SER A N    3  
ATOM   2764  C CA   . SER A 1 30 ? -0.598  12.802  -3.366  1.00 5.68  ? 30 SER A CA   3  
ATOM   2765  C C    . SER A 1 30 ? -0.881  14.234  -3.842  1.00 6.20  ? 30 SER A C    3  
ATOM   2766  O O    . SER A 1 30 ? -0.320  14.699  -4.817  1.00 6.77  ? 30 SER A O    3  
ATOM   2767  C CB   . SER A 1 30 ? 0.283   12.843  -2.111  1.00 6.35  ? 30 SER A CB   3  
ATOM   2768  O OG   . SER A 1 30 ? 1.656   12.822  -2.486  1.00 7.18  ? 30 SER A OG   3  
ATOM   2769  H H    . SER A 1 30 ? 1.043   12.218  -4.631  1.00 6.18  ? 30 SER A H    3  
ATOM   2770  H HA   . SER A 1 30 ? -1.533  12.315  -3.129  1.00 5.24  ? 30 SER A HA   3  
ATOM   2771  H HB2  . SER A 1 30 ? 0.084   13.745  -1.564  1.00 6.58  ? 30 SER A HB2  3  
ATOM   2772  H HB3  . SER A 1 30 ? 0.056   11.989  -1.486  1.00 6.28  ? 30 SER A HB3  3  
ATOM   2773  H HG   . SER A 1 30 ? 2.125   12.262  -1.862  1.00 7.41  ? 30 SER A HG   3  
ATOM   2774  N N    . GLY A 1 31 ? -1.749  14.930  -3.153  1.00 6.36  ? 31 GLY A N    3  
ATOM   2775  C CA   . GLY A 1 31 ? -2.089  16.333  -3.542  1.00 7.19  ? 31 GLY A CA   3  
ATOM   2776  C C    . GLY A 1 31 ? -2.988  16.947  -2.460  1.00 7.66  ? 31 GLY A C    3  
ATOM   2777  O O    . GLY A 1 31 ? -2.912  16.560  -1.308  1.00 7.75  ? 31 GLY A O    3  
ATOM   2778  H H    . GLY A 1 31 ? -2.184  14.525  -2.371  1.00 6.14  ? 31 GLY A H    3  
ATOM   2779  H HA2  . GLY A 1 31 ? -1.185  16.907  -3.641  1.00 7.72  ? 31 GLY A HA2  3  
ATOM   2780  H HA3  . GLY A 1 31 ? -2.616  16.326  -4.483  1.00 7.17  ? 31 GLY A HA3  3  
ATOM   2781  N N    . PRO A 1 32 ? -3.841  17.866  -2.862  1.00 8.17  ? 32 PRO A N    3  
ATOM   2782  C CA   . PRO A 1 32 ? -4.797  18.514  -1.938  1.00 8.85  ? 32 PRO A CA   3  
ATOM   2783  C C    . PRO A 1 32 ? -5.906  17.511  -1.586  1.00 8.11  ? 32 PRO A C    3  
ATOM   2784  O O    . PRO A 1 32 ? -6.403  17.475  -0.476  1.00 8.52  ? 32 PRO A O    3  
ATOM   2785  C CB   . PRO A 1 32 ? -5.331  19.704  -2.742  1.00 9.69  ? 32 PRO A CB   3  
ATOM   2786  C CG   . PRO A 1 32 ? -5.088  19.365  -4.231  1.00 9.20  ? 32 PRO A CG   3  
ATOM   2787  C CD   . PRO A 1 32 ? -3.944  18.334  -4.263  1.00 8.39  ? 32 PRO A CD   3  
ATOM   2788  H HA   . PRO A 1 32 ? -4.293  18.857  -1.048  1.00 9.45  ? 32 PRO A HA   3  
ATOM   2789  H HB2  . PRO A 1 32 ? -6.389  19.833  -2.554  1.00 9.88  ? 32 PRO A HB2  3  
ATOM   2790  H HB3  . PRO A 1 32 ? -4.793  20.602  -2.482  1.00 10.56 ? 32 PRO A HB3  3  
ATOM   2791  H HG2  . PRO A 1 32 ? -5.986  18.942  -4.665  1.00 8.80  ? 32 PRO A HG2  3  
ATOM   2792  H HG3  . PRO A 1 32 ? -4.795  20.251  -4.772  1.00 10.01 ? 32 PRO A HG3  3  
ATOM   2793  H HD2  . PRO A 1 32 ? -4.193  17.514  -4.924  1.00 7.63  ? 32 PRO A HD2  3  
ATOM   2794  H HD3  . PRO A 1 32 ? -3.021  18.802  -4.568  1.00 8.96  ? 32 PRO A HD3  3  
ATOM   2795  N N    . HIS A 1 33 ? -6.263  16.681  -2.537  1.00 7.21  ? 33 HIS A N    3  
ATOM   2796  C CA   . HIS A 1 33 ? -7.306  15.631  -2.319  1.00 6.64  ? 33 HIS A CA   3  
ATOM   2797  C C    . HIS A 1 33 ? -6.853  14.673  -1.202  1.00 5.94  ? 33 HIS A C    3  
ATOM   2798  O O    . HIS A 1 33 ? -7.659  14.180  -0.433  1.00 6.05  ? 33 HIS A O    3  
ATOM   2799  C CB   . HIS A 1 33 ? -7.502  14.833  -3.625  1.00 6.27  ? 33 HIS A CB   3  
ATOM   2800  C CG   . HIS A 1 33 ? -6.187  14.237  -4.073  1.00 5.79  ? 33 HIS A CG   3  
ATOM   2801  N ND1  . HIS A 1 33 ? -5.223  14.973  -4.752  1.00 6.54  ? 33 HIS A ND1  3  
ATOM   2802  C CD2  . HIS A 1 33 ? -5.650  12.990  -3.903  1.00 4.91  ? 33 HIS A CD2  3  
ATOM   2803  C CE1  . HIS A 1 33 ? -4.163  14.171  -4.949  1.00 6.20  ? 33 HIS A CE1  3  
ATOM   2804  N NE2  . HIS A 1 33 ? -4.371  12.947  -4.454  1.00 5.23  ? 33 HIS A NE2  3  
ATOM   2805  H H    . HIS A 1 33 ? -5.824  16.739  -3.403  1.00 7.10  ? 33 HIS A H    3  
ATOM   2806  H HA   . HIS A 1 33 ? -8.235  16.099  -2.037  1.00 7.25  ? 33 HIS A HA   3  
ATOM   2807  H HB2  . HIS A 1 33 ? -8.214  14.038  -3.454  1.00 5.99  ? 33 HIS A HB2  3  
ATOM   2808  H HB3  . HIS A 1 33 ? -7.879  15.490  -4.392  1.00 6.92  ? 33 HIS A HB3  3  
ATOM   2809  H HD1  . HIS A 1 33 ? -5.308  15.900  -5.053  1.00 7.35  ? 33 HIS A HD1  3  
ATOM   2810  H HD2  . HIS A 1 33 ? -6.147  12.165  -3.418  1.00 4.33  ? 33 HIS A HD2  3  
ATOM   2811  H HE1  . HIS A 1 33 ? -3.241  14.491  -5.418  1.00 6.82  ? 33 HIS A HE1  3  
ATOM   2812  N N    . CYS A 1 34 ? -5.568  14.414  -1.116  1.00 5.51  ? 34 CYS A N    3  
ATOM   2813  C CA   . CYS A 1 34 ? -5.032  13.502  -0.071  1.00 5.12  ? 34 CYS A CA   3  
ATOM   2814  C C    . CYS A 1 34 ? -3.518  13.719  0.040   1.00 5.54  ? 34 CYS A C    3  
ATOM   2815  O O    . CYS A 1 34 ? -2.771  13.421  -0.875  1.00 5.84  ? 34 CYS A O    3  
ATOM   2816  C CB   . CYS A 1 34 ? -5.326  12.046  -0.454  1.00 4.12  ? 34 CYS A CB   3  
ATOM   2817  S SG   . CYS A 1 34 ? -5.815  11.113  1.018   1.00 4.37  ? 34 CYS A SG   3  
ATOM   2818  H H    . CYS A 1 34 ? -4.952  14.828  -1.743  1.00 5.68  ? 34 CYS A H    3  
ATOM   2819  H HA   . CYS A 1 34 ? -5.499  13.732  0.866   1.00 5.59  ? 34 CYS A HA   3  
ATOM   2820  H HB2  . CYS A 1 34 ? -6.127  12.022  -1.177  1.00 4.04  ? 34 CYS A HB2  3  
ATOM   2821  H HB3  . CYS A 1 34 ? -4.440  11.602  -0.884  1.00 3.82  ? 34 CYS A HB3  3  
ATOM   2822  N N    . ALA A 1 35 ? -3.065  14.253  1.148   1.00 5.90  ? 35 ALA A N    3  
ATOM   2823  C CA   . ALA A 1 35 ? -1.600  14.516  1.326   1.00 6.66  ? 35 ALA A CA   3  
ATOM   2824  C C    . ALA A 1 35 ? -0.814  13.199  1.409   1.00 6.33  ? 35 ALA A C    3  
ATOM   2825  O O    . ALA A 1 35 ? 0.333   13.135  1.007   1.00 6.77  ? 35 ALA A O    3  
ATOM   2826  C CB   . ALA A 1 35 ? -1.381  15.319  2.611   1.00 7.59  ? 35 ALA A CB   3  
ATOM   2827  H H    . ALA A 1 35 ? -3.691  14.496  1.862   1.00 5.87  ? 35 ALA A H    3  
ATOM   2828  H HA   . ALA A 1 35 ? -1.241  15.089  0.486   1.00 7.06  ? 35 ALA A HA   3  
ATOM   2829  H HB1  . ALA A 1 35 ? -2.117  16.105  2.674   1.00 7.72  ? 35 ALA A HB1  3  
ATOM   2830  H HB2  . ALA A 1 35 ? -1.479  14.665  3.465   1.00 8.05  ? 35 ALA A HB2  3  
ATOM   2831  H HB3  . ALA A 1 35 ? -0.391  15.751  2.600   1.00 7.89  ? 35 ALA A HB3  3  
ATOM   2832  N N    . ASN A 1 36 ? -1.410  12.155  1.932   1.00 5.85  ? 36 ASN A N    3  
ATOM   2833  C CA   . ASN A 1 36 ? -0.688  10.850  2.047   1.00 5.88  ? 36 ASN A CA   3  
ATOM   2834  C C    . ASN A 1 36 ? -0.779  10.078  0.725   1.00 5.34  ? 36 ASN A C    3  
ATOM   2835  O O    . ASN A 1 36 ? -1.825  10.014  0.103   1.00 5.26  ? 36 ASN A O    3  
ATOM   2836  C CB   . ASN A 1 36 ? -1.314  10.016  3.169   1.00 6.50  ? 36 ASN A CB   3  
ATOM   2837  C CG   . ASN A 1 36 ? -0.624  10.342  4.498   1.00 7.27  ? 36 ASN A CG   3  
ATOM   2838  O OD1  . ASN A 1 36 ? -0.938  11.331  5.131   1.00 7.78  ? 36 ASN A OD1  3  
ATOM   2839  N ND2  . ASN A 1 36 ? 0.311   9.549   4.952   1.00 7.61  ? 36 ASN A ND2  3  
ATOM   2840  H H    . ASN A 1 36 ? -2.332  12.231  2.256   1.00 5.70  ? 36 ASN A H    3  
ATOM   2841  H HA   . ASN A 1 36 ? 0.351   11.038  2.279   1.00 6.19  ? 36 ASN A HA   3  
ATOM   2842  H HB2  . ASN A 1 36 ? -2.367  10.248  3.244   1.00 6.55  ? 36 ASN A HB2  3  
ATOM   2843  H HB3  . ASN A 1 36 ? -1.191  8.968   2.950   1.00 6.63  ? 36 ASN A HB3  3  
ATOM   2844  H HD21 . ASN A 1 36 ? 0.567   8.751   4.444   1.00 7.41  ? 36 ASN A HD21 3  
ATOM   2845  H HD22 . ASN A 1 36 ? 0.755   9.753   5.801   1.00 8.19  ? 36 ASN A HD22 3  
ATOM   2846  N N    . THR A 1 37 ? 0.312   9.485   0.300   1.00 5.30  ? 37 THR A N    3  
ATOM   2847  C CA   . THR A 1 37 ? 0.307   8.701   -0.976  1.00 5.18  ? 37 THR A CA   3  
ATOM   2848  C C    . THR A 1 37 ? -0.231  7.291   -0.694  1.00 4.58  ? 37 THR A C    3  
ATOM   2849  O O    . THR A 1 37 ? -0.085  6.775   0.399   1.00 4.95  ? 37 THR A O    3  
ATOM   2850  C CB   . THR A 1 37 ? 1.737   8.611   -1.534  1.00 5.98  ? 37 THR A CB   3  
ATOM   2851  O OG1  . THR A 1 37 ? 2.429   9.829   -1.279  1.00 6.76  ? 37 THR A OG1  3  
ATOM   2852  C CG2  . THR A 1 37 ? 1.686   8.366   -3.044  1.00 6.31  ? 37 THR A CG2  3  
ATOM   2853  H H    . THR A 1 37 ? 1.137   9.549   0.827   1.00 5.59  ? 37 THR A H    3  
ATOM   2854  H HA   . THR A 1 37 ? -0.332  9.192   -1.696  1.00 5.45  ? 37 THR A HA   3  
ATOM   2855  H HB   . THR A 1 37 ? 2.259   7.794   -1.060  1.00 6.11  ? 37 THR A HB   3  
ATOM   2856  H HG1  . THR A 1 37 ? 3.116   9.651   -0.632  1.00 7.02  ? 37 THR A HG1  3  
ATOM   2857  H HG21 . THR A 1 37 ? 1.078   9.126   -3.511  1.00 6.33  ? 37 THR A HG21 3  
ATOM   2858  H HG22 . THR A 1 37 ? 2.687   8.407   -3.449  1.00 6.74  ? 37 THR A HG22 3  
ATOM   2859  H HG23 . THR A 1 37 ? 1.259   7.393   -3.237  1.00 6.44  ? 37 THR A HG23 3  
ATOM   2860  N N    . GLU A 1 38 ? -0.865  6.670   -1.662  1.00 3.94  ? 38 GLU A N    3  
ATOM   2861  C CA   . GLU A 1 38 ? -1.427  5.300   -1.436  1.00 3.67  ? 38 GLU A CA   3  
ATOM   2862  C C    . GLU A 1 38 ? -1.011  4.353   -2.569  1.00 2.99  ? 38 GLU A C    3  
ATOM   2863  O O    . GLU A 1 38 ? -0.919  4.746   -3.717  1.00 3.33  ? 38 GLU A O    3  
ATOM   2864  C CB   . GLU A 1 38 ? -2.958  5.389   -1.390  1.00 4.35  ? 38 GLU A CB   3  
ATOM   2865  C CG   . GLU A 1 38 ? -3.482  4.664   -0.147  1.00 4.96  ? 38 GLU A CG   3  
ATOM   2866  C CD   . GLU A 1 38 ? -3.521  5.633   1.040   1.00 5.76  ? 38 GLU A CD   3  
ATOM   2867  O OE1  . GLU A 1 38 ? -2.504  5.773   1.701   1.00 6.10  ? 38 GLU A OE1  3  
ATOM   2868  O OE2  . GLU A 1 38 ? -4.568  6.216   1.269   1.00 6.28  ? 38 GLU A OE2  3  
ATOM   2869  H H    . GLU A 1 38 ? -0.982  7.108   -2.533  1.00 3.89  ? 38 GLU A H    3  
ATOM   2870  H HA   . GLU A 1 38 ? -1.064  4.914   -0.495  1.00 3.96  ? 38 GLU A HA   3  
ATOM   2871  H HB2  . GLU A 1 38 ? -3.256  6.427   -1.355  1.00 4.73  ? 38 GLU A HB2  3  
ATOM   2872  H HB3  . GLU A 1 38 ? -3.371  4.928   -2.274  1.00 4.35  ? 38 GLU A HB3  3  
ATOM   2873  H HG2  . GLU A 1 38 ? -4.478  4.294   -0.341  1.00 5.14  ? 38 GLU A HG2  3  
ATOM   2874  H HG3  . GLU A 1 38 ? -2.831  3.837   0.088   1.00 4.98  ? 38 GLU A HG3  3  
ATOM   2875  N N    . ILE A 1 39 ? -0.775  3.100   -2.249  1.00 2.48  ? 39 ILE A N    3  
ATOM   2876  C CA   . ILE A 1 39 ? -0.381  2.103   -3.301  1.00 2.38  ? 39 ILE A CA   3  
ATOM   2877  C C    . ILE A 1 39 ? -1.570  1.152   -3.523  1.00 2.16  ? 39 ILE A C    3  
ATOM   2878  O O    . ILE A 1 39 ? -1.820  0.272   -2.728  1.00 2.22  ? 39 ILE A O    3  
ATOM   2879  C CB   . ILE A 1 39 ? 0.853   1.321   -2.817  1.00 2.57  ? 39 ILE A CB   3  
ATOM   2880  C CG1  . ILE A 1 39 ? 2.102   2.207   -2.929  1.00 2.79  ? 39 ILE A CG1  3  
ATOM   2881  C CG2  . ILE A 1 39 ? 1.046   0.060   -3.663  1.00 3.44  ? 39 ILE A CG2  3  
ATOM   2882  C CD1  . ILE A 1 39 ? 2.534   2.670   -1.535  1.00 2.94  ? 39 ILE A CD1  3  
ATOM   2883  H H    . ILE A 1 39 ? -0.871  2.809   -1.308  1.00 2.61  ? 39 ILE A H    3  
ATOM   2884  H HA   . ILE A 1 39 ? -0.151  2.618   -4.223  1.00 2.85  ? 39 ILE A HA   3  
ATOM   2885  H HB   . ILE A 1 39 ? 0.712   1.040   -1.786  1.00 2.54  ? 39 ILE A HB   3  
ATOM   2886  H HG12 . ILE A 1 39 ? 2.903   1.642   -3.383  1.00 3.36  ? 39 ILE A HG12 3  
ATOM   2887  H HG13 . ILE A 1 39 ? 1.879   3.069   -3.539  1.00 2.70  ? 39 ILE A HG13 3  
ATOM   2888  H HG21 . ILE A 1 39 ? 0.977   0.313   -4.710  1.00 3.75  ? 39 ILE A HG21 3  
ATOM   2889  H HG22 . ILE A 1 39 ? 2.016   -0.367  -3.459  1.00 3.64  ? 39 ILE A HG22 3  
ATOM   2890  H HG23 . ILE A 1 39 ? 0.280   -0.660  -3.416  1.00 4.05  ? 39 ILE A HG23 3  
ATOM   2891  H HD11 . ILE A 1 39 ? 2.657   1.813   -0.892  1.00 3.60  ? 39 ILE A HD11 3  
ATOM   2892  H HD12 . ILE A 1 39 ? 3.471   3.203   -1.607  1.00 2.88  ? 39 ILE A HD12 3  
ATOM   2893  H HD13 . ILE A 1 39 ? 1.780   3.324   -1.123  1.00 3.00  ? 39 ILE A HD13 3  
ATOM   2894  N N    . ILE A 1 40 ? -2.319  1.323   -4.586  1.00 2.34  ? 40 ILE A N    3  
ATOM   2895  C CA   . ILE A 1 40 ? -3.504  0.433   -4.797  1.00 2.36  ? 40 ILE A CA   3  
ATOM   2896  C C    . ILE A 1 40 ? -3.114  -0.803  -5.605  1.00 2.37  ? 40 ILE A C    3  
ATOM   2897  O O    . ILE A 1 40 ? -2.734  -0.715  -6.756  1.00 3.02  ? 40 ILE A O    3  
ATOM   2898  C CB   . ILE A 1 40 ? -4.622  1.195   -5.519  1.00 3.14  ? 40 ILE A CB   3  
ATOM   2899  C CG1  . ILE A 1 40 ? -4.956  2.475   -4.740  1.00 3.44  ? 40 ILE A CG1  3  
ATOM   2900  C CG2  . ILE A 1 40 ? -5.873  0.311   -5.588  1.00 3.70  ? 40 ILE A CG2  3  
ATOM   2901  C CD1  . ILE A 1 40 ? -5.850  3.380   -5.591  1.00 4.01  ? 40 ILE A CD1  3  
ATOM   2902  H H    . ILE A 1 40 ? -2.116  2.035   -5.229  1.00 2.72  ? 40 ILE A H    3  
ATOM   2903  H HA   . ILE A 1 40 ? -3.872  0.112   -3.832  1.00 2.37  ? 40 ILE A HA   3  
ATOM   2904  H HB   . ILE A 1 40 ? -4.302  1.449   -6.519  1.00 3.47  ? 40 ILE A HB   3  
ATOM   2905  H HG12 . ILE A 1 40 ? -5.472  2.216   -3.825  1.00 3.44  ? 40 ILE A HG12 3  
ATOM   2906  H HG13 . ILE A 1 40 ? -4.044  2.999   -4.499  1.00 3.71  ? 40 ILE A HG13 3  
ATOM   2907  H HG21 . ILE A 1 40 ? -5.636  -0.610  -6.102  1.00 3.89  ? 40 ILE A HG21 3  
ATOM   2908  H HG22 . ILE A 1 40 ? -6.211  0.087   -4.587  1.00 3.94  ? 40 ILE A HG22 3  
ATOM   2909  H HG23 . ILE A 1 40 ? -6.654  0.831   -6.123  1.00 4.13  ? 40 ILE A HG23 3  
ATOM   2910  H HD11 . ILE A 1 40 ? -5.368  3.575   -6.538  1.00 4.17  ? 40 ILE A HD11 3  
ATOM   2911  H HD12 . ILE A 1 40 ? -6.798  2.890   -5.764  1.00 4.33  ? 40 ILE A HD12 3  
ATOM   2912  H HD13 . ILE A 1 40 ? -6.016  4.311   -5.073  1.00 4.43  ? 40 ILE A HD13 3  
ATOM   2913  N N    . VAL A 1 41 ? -3.217  -1.954  -4.994  1.00 2.04  ? 41 VAL A N    3  
ATOM   2914  C CA   . VAL A 1 41 ? -2.873  -3.221  -5.681  1.00 2.10  ? 41 VAL A CA   3  
ATOM   2915  C C    . VAL A 1 41 ? -4.157  -4.015  -5.958  1.00 2.33  ? 41 VAL A C    3  
ATOM   2916  O O    . VAL A 1 41 ? -5.178  -3.800  -5.332  1.00 2.79  ? 41 VAL A O    3  
ATOM   2917  C CB   . VAL A 1 41 ? -1.942  -4.039  -4.779  1.00 2.21  ? 41 VAL A CB   3  
ATOM   2918  C CG1  . VAL A 1 41 ? -0.714  -3.204  -4.416  1.00 2.87  ? 41 VAL A CG1  3  
ATOM   2919  C CG2  . VAL A 1 41 ? -2.675  -4.451  -3.495  1.00 3.20  ? 41 VAL A CG2  3  
ATOM   2920  H H    . VAL A 1 41 ? -3.525  -1.987  -4.073  1.00 2.11  ? 41 VAL A H    3  
ATOM   2921  H HA   . VAL A 1 41 ? -2.375  -3.006  -6.613  1.00 2.57  ? 41 VAL A HA   3  
ATOM   2922  H HB   . VAL A 1 41 ? -1.630  -4.915  -5.307  1.00 2.10  ? 41 VAL A HB   3  
ATOM   2923  H HG11 . VAL A 1 41 ? -0.372  -2.671  -5.290  1.00 3.29  ? 41 VAL A HG11 3  
ATOM   2924  H HG12 . VAL A 1 41 ? -0.974  -2.497  -3.642  1.00 3.43  ? 41 VAL A HG12 3  
ATOM   2925  H HG13 . VAL A 1 41 ? 0.072   -3.852  -4.060  1.00 3.03  ? 41 VAL A HG13 3  
ATOM   2926  H HG21 . VAL A 1 41 ? -3.620  -4.909  -3.749  1.00 3.56  ? 41 VAL A HG21 3  
ATOM   2927  H HG22 . VAL A 1 41 ? -2.070  -5.157  -2.947  1.00 3.58  ? 41 VAL A HG22 3  
ATOM   2928  H HG23 . VAL A 1 41 ? -2.850  -3.578  -2.886  1.00 3.72  ? 41 VAL A HG23 3  
ATOM   2929  N N    . LYS A 1 42 ? -4.106  -4.929  -6.887  1.00 2.44  ? 42 LYS A N    3  
ATOM   2930  C CA   . LYS A 1 42 ? -5.309  -5.748  -7.211  1.00 2.97  ? 42 LYS A CA   3  
ATOM   2931  C C    . LYS A 1 42 ? -4.939  -7.236  -7.143  1.00 2.77  ? 42 LYS A C    3  
ATOM   2932  O O    . LYS A 1 42 ? -4.485  -7.818  -8.112  1.00 2.98  ? 42 LYS A O    3  
ATOM   2933  C CB   . LYS A 1 42 ? -5.806  -5.393  -8.617  1.00 3.77  ? 42 LYS A CB   3  
ATOM   2934  C CG   . LYS A 1 42 ? -7.324  -5.197  -8.590  1.00 4.68  ? 42 LYS A CG   3  
ATOM   2935  C CD   . LYS A 1 42 ? -7.831  -4.950  -10.011 1.00 5.42  ? 42 LYS A CD   3  
ATOM   2936  C CE   . LYS A 1 42 ? -9.329  -4.633  -9.973  1.00 5.72  ? 42 LYS A CE   3  
ATOM   2937  N NZ   . LYS A 1 42 ? -9.528  -3.159  -9.861  1.00 6.76  ? 42 LYS A NZ   3  
ATOM   2938  H H    . LYS A 1 42 ? -3.274  -5.079  -7.373  1.00 2.45  ? 42 LYS A H    3  
ATOM   2939  H HA   . LYS A 1 42 ? -6.088  -5.540  -6.489  1.00 3.37  ? 42 LYS A HA   3  
ATOM   2940  H HB2  . LYS A 1 42 ? -5.333  -4.479  -8.945  1.00 3.94  ? 42 LYS A HB2  3  
ATOM   2941  H HB3  . LYS A 1 42 ? -5.562  -6.191  -9.300  1.00 3.87  ? 42 LYS A HB3  3  
ATOM   2942  H HG2  . LYS A 1 42 ? -7.793  -6.084  -8.187  1.00 4.83  ? 42 LYS A HG2  3  
ATOM   2943  H HG3  . LYS A 1 42 ? -7.566  -4.348  -7.969  1.00 4.94  ? 42 LYS A HG3  3  
ATOM   2944  H HD2  . LYS A 1 42 ? -7.296  -4.116  -10.444 1.00 5.79  ? 42 LYS A HD2  3  
ATOM   2945  H HD3  . LYS A 1 42 ? -7.667  -5.833  -10.611 1.00 5.70  ? 42 LYS A HD3  3  
ATOM   2946  H HE2  . LYS A 1 42 ? -9.794  -4.989  -10.880 1.00 5.66  ? 42 LYS A HE2  3  
ATOM   2947  H HE3  . LYS A 1 42 ? -9.780  -5.124  -9.122  1.00 5.59  ? 42 LYS A HE3  3  
ATOM   2948  H HZ1  . LYS A 1 42 ? -9.058  -2.810  -9.000  1.00 6.85  ? 42 LYS A HZ1  3  
ATOM   2949  H HZ2  . LYS A 1 42 ? -9.123  -2.688  -10.694 1.00 7.12  ? 42 LYS A HZ2  3  
ATOM   2950  H HZ3  . LYS A 1 42 ? -10.546 -2.951  -9.807  1.00 7.24  ? 42 LYS A HZ3  3  
ATOM   2951  N N    . LEU A 1 43 ? -5.118  -7.845  -5.992  1.00 3.01  ? 43 LEU A N    3  
ATOM   2952  C CA   . LEU A 1 43 ? -4.779  -9.291  -5.814  1.00 3.31  ? 43 LEU A CA   3  
ATOM   2953  C C    . LEU A 1 43 ? -5.390  -10.146 -6.931  1.00 3.92  ? 43 LEU A C    3  
ATOM   2954  O O    . LEU A 1 43 ? -6.487  -9.889  -7.401  1.00 4.54  ? 43 LEU A O    3  
ATOM   2955  C CB   . LEU A 1 43 ? -5.329  -9.768  -4.472  1.00 4.01  ? 43 LEU A CB   3  
ATOM   2956  C CG   . LEU A 1 43 ? -4.422  -9.275  -3.336  1.00 3.77  ? 43 LEU A CG   3  
ATOM   2957  C CD1  . LEU A 1 43 ? -5.115  -9.498  -1.989  1.00 4.46  ? 43 LEU A CD1  3  
ATOM   2958  C CD2  . LEU A 1 43 ? -3.097  -10.046 -3.360  1.00 3.91  ? 43 LEU A CD2  3  
ATOM   2959  H H    . LEU A 1 43 ? -5.468  -7.342  -5.230  1.00 3.37  ? 43 LEU A H    3  
ATOM   2960  H HA   . LEU A 1 43 ? -3.706  -9.410  -5.820  1.00 3.08  ? 43 LEU A HA   3  
ATOM   2961  H HB2  . LEU A 1 43 ? -6.322  -9.375  -4.341  1.00 4.55  ? 43 LEU A HB2  3  
ATOM   2962  H HB3  . LEU A 1 43 ? -5.371  -10.840 -4.463  1.00 4.52  ? 43 LEU A HB3  3  
ATOM   2963  H HG   . LEU A 1 43 ? -4.228  -8.220  -3.466  1.00 3.53  ? 43 LEU A HG   3  
ATOM   2964  H HD11 . LEU A 1 43 ? -5.371  -10.542 -1.882  1.00 4.57  ? 43 LEU A HD11 3  
ATOM   2965  H HD12 . LEU A 1 43 ? -4.449  -9.208  -1.190  1.00 4.51  ? 43 LEU A HD12 3  
ATOM   2966  H HD13 . LEU A 1 43 ? -6.014  -8.901  -1.942  1.00 5.14  ? 43 LEU A HD13 3  
ATOM   2967  H HD21 . LEU A 1 43 ? -2.960  -10.500 -4.330  1.00 3.96  ? 43 LEU A HD21 3  
ATOM   2968  H HD22 . LEU A 1 43 ? -2.282  -9.365  -3.164  1.00 4.44  ? 43 LEU A HD22 3  
ATOM   2969  H HD23 . LEU A 1 43 ? -3.112  -10.815 -2.602  1.00 3.95  ? 43 LEU A HD23 3  
ATOM   2970  N N    . SER A 1 44 ? -4.672  -11.168 -7.340  1.00 3.99  ? 44 SER A N    3  
ATOM   2971  C CA   . SER A 1 44 ? -5.149  -12.082 -8.424  1.00 4.72  ? 44 SER A CA   3  
ATOM   2972  C C    . SER A 1 44 ? -6.470  -12.765 -8.031  1.00 5.55  ? 44 SER A C    3  
ATOM   2973  O O    . SER A 1 44 ? -7.200  -13.236 -8.884  1.00 6.08  ? 44 SER A O    3  
ATOM   2974  C CB   . SER A 1 44 ? -4.089  -13.156 -8.685  1.00 4.98  ? 44 SER A CB   3  
ATOM   2975  O OG   . SER A 1 44 ? -4.238  -13.652 -10.008 1.00 5.08  ? 44 SER A OG   3  
ATOM   2976  H H    . SER A 1 44 ? -3.806  -11.333 -6.926  1.00 3.70  ? 44 SER A H    3  
ATOM   2977  H HA   . SER A 1 44 ? -5.297  -11.509 -9.321  1.00 4.83  ? 44 SER A HA   3  
ATOM   2978  H HB2  . SER A 1 44 ? -3.106  -12.729 -8.577  1.00 5.14  ? 44 SER A HB2  3  
ATOM   2979  H HB3  . SER A 1 44 ? -4.208  -13.960 -7.971  1.00 5.37  ? 44 SER A HB3  3  
ATOM   2980  H HG   . SER A 1 44 ? -4.270  -14.612 -9.964  1.00 5.39  ? 44 SER A HG   3  
ATOM   2981  N N    . ASP A 1 45 ? -6.789  -12.820 -6.756  1.00 5.91  ? 45 ASP A N    3  
ATOM   2982  C CA   . ASP A 1 45 ? -8.060  -13.467 -6.324  1.00 7.02  ? 45 ASP A CA   3  
ATOM   2983  C C    . ASP A 1 45 ? -9.258  -12.527 -6.570  1.00 7.25  ? 45 ASP A C    3  
ATOM   2984  O O    . ASP A 1 45 ? -10.353 -12.783 -6.100  1.00 8.19  ? 45 ASP A O    3  
ATOM   2985  C CB   . ASP A 1 45 ? -7.973  -13.799 -4.830  1.00 7.64  ? 45 ASP A CB   3  
ATOM   2986  C CG   . ASP A 1 45 ? -7.186  -15.099 -4.637  1.00 8.01  ? 45 ASP A CG   3  
ATOM   2987  O OD1  . ASP A 1 45 ? -5.972  -15.023 -4.532  1.00 7.89  ? 45 ASP A OD1  3  
ATOM   2988  O OD2  . ASP A 1 45 ? -7.810  -16.146 -4.598  1.00 8.63  ? 45 ASP A OD2  3  
ATOM   2989  H H    . ASP A 1 45 ? -6.196  -12.439 -6.086  1.00 5.60  ? 45 ASP A H    3  
ATOM   2990  H HA   . ASP A 1 45 ? -8.194  -14.373 -6.881  1.00 7.48  ? 45 ASP A HA   3  
ATOM   2991  H HB2  . ASP A 1 45 ? -7.472  -12.994 -4.310  1.00 7.55  ? 45 ASP A HB2  3  
ATOM   2992  H HB3  . ASP A 1 45 ? -8.967  -13.920 -4.429  1.00 8.18  ? 45 ASP A HB3  3  
ATOM   2993  N N    . GLY A 1 46 ? -9.066  -11.441 -7.294  1.00 6.57  ? 46 GLY A N    3  
ATOM   2994  C CA   . GLY A 1 46 ? -10.190 -10.496 -7.552  1.00 7.07  ? 46 GLY A CA   3  
ATOM   2995  C C    . GLY A 1 46 ? -10.379 -9.592  -6.332  1.00 6.74  ? 46 GLY A C    3  
ATOM   2996  O O    . GLY A 1 46 ? -11.486 -9.199  -6.014  1.00 7.17  ? 46 GLY A O    3  
ATOM   2997  H H    . GLY A 1 46 ? -8.183  -11.243 -7.659  1.00 5.88  ? 46 GLY A H    3  
ATOM   2998  H HA2  . GLY A 1 46 ? -9.961  -9.893  -8.420  1.00 7.41  ? 46 GLY A HA2  3  
ATOM   2999  H HA3  . GLY A 1 46 ? -11.096 -11.052 -7.727  1.00 7.56  ? 46 GLY A HA3  3  
ATOM   3000  N N    . ARG A 1 47 ? -9.310  -9.268  -5.641  1.00 6.21  ? 47 ARG A N    3  
ATOM   3001  C CA   . ARG A 1 47 ? -9.431  -8.397  -4.435  1.00 6.07  ? 47 ARG A CA   3  
ATOM   3002  C C    . ARG A 1 47 ? -8.699  -7.070  -4.675  1.00 5.32  ? 47 ARG A C    3  
ATOM   3003  O O    . ARG A 1 47 ? -7.783  -6.995  -5.468  1.00 5.06  ? 47 ARG A O    3  
ATOM   3004  C CB   . ARG A 1 47 ? -8.804  -9.123  -3.236  1.00 6.43  ? 47 ARG A CB   3  
ATOM   3005  C CG   . ARG A 1 47 ? -9.211  -8.436  -1.927  1.00 7.27  ? 47 ARG A CG   3  
ATOM   3006  C CD   . ARG A 1 47 ? -10.687 -8.717  -1.632  1.00 7.96  ? 47 ARG A CD   3  
ATOM   3007  N NE   . ARG A 1 47 ? -11.058 -8.099  -0.327  1.00 8.82  ? 47 ARG A NE   3  
ATOM   3008  C CZ   . ARG A 1 47 ? -11.891 -7.092  -0.293  1.00 9.62  ? 47 ARG A CZ   3  
ATOM   3009  N NH1  . ARG A 1 47 ? -11.465 -5.883  -0.556  1.00 10.15 ? 47 ARG A NH1  3  
ATOM   3010  N NH2  . ARG A 1 47 ? -13.149 -7.294  0.004   1.00 10.10 ? 47 ARG A NH2  3  
ATOM   3011  H H    . ARG A 1 47 ? -8.421  -9.604  -5.914  1.00 6.06  ? 47 ARG A H    3  
ATOM   3012  H HA   . ARG A 1 47 ? -10.474 -8.201  -4.232  1.00 6.58  ? 47 ARG A HA   3  
ATOM   3013  H HB2  . ARG A 1 47 ? -9.144  -10.149 -3.222  1.00 6.43  ? 47 ARG A HB2  3  
ATOM   3014  H HB3  . ARG A 1 47 ? -7.731  -9.104  -3.329  1.00 6.47  ? 47 ARG A HB3  3  
ATOM   3015  H HG2  . ARG A 1 47 ? -8.605  -8.818  -1.119  1.00 7.60  ? 47 ARG A HG2  3  
ATOM   3016  H HG3  . ARG A 1 47 ? -9.061  -7.372  -2.016  1.00 7.34  ? 47 ARG A HG3  3  
ATOM   3017  H HD2  . ARG A 1 47 ? -11.298 -8.296  -2.417  1.00 7.82  ? 47 ARG A HD2  3  
ATOM   3018  H HD3  . ARG A 1 47 ? -10.847 -9.783  -1.584  1.00 8.20  ? 47 ARG A HD3  3  
ATOM   3019  H HE   . ARG A 1 47 ? -10.678 -8.448  0.507   1.00 8.93  ? 47 ARG A HE   3  
ATOM   3020  H HH11 . ARG A 1 47 ? -10.502 -5.730  -0.782  1.00 9.97  ? 47 ARG A HH11 3  
ATOM   3021  H HH12 . ARG A 1 47 ? -12.101 -5.112  -0.531  1.00 10.86 ? 47 ARG A HH12 3  
ATOM   3022  H HH21 . ARG A 1 47 ? -13.473 -8.220  0.204   1.00 9.88  ? 47 ARG A HH21 3  
ATOM   3023  H HH22 . ARG A 1 47 ? -13.788 -6.525  0.030   1.00 10.80 ? 47 ARG A HH22 3  
ATOM   3024  N N    . GLU A 1 48 ? -9.091  -6.030  -3.983  1.00 5.24  ? 48 GLU A N    3  
ATOM   3025  C CA   . GLU A 1 48 ? -8.412  -4.710  -4.144  1.00 4.73  ? 48 GLU A CA   3  
ATOM   3026  C C    . GLU A 1 48 ? -8.021  -4.206  -2.753  1.00 4.69  ? 48 GLU A C    3  
ATOM   3027  O O    . GLU A 1 48 ? -8.872  -3.967  -1.914  1.00 5.44  ? 48 GLU A O    3  
ATOM   3028  C CB   . GLU A 1 48 ? -9.357  -3.708  -4.815  1.00 5.60  ? 48 GLU A CB   3  
ATOM   3029  C CG   . GLU A 1 48 ? -8.547  -2.513  -5.331  1.00 5.76  ? 48 GLU A CG   3  
ATOM   3030  C CD   . GLU A 1 48 ? -9.475  -1.532  -6.053  1.00 6.79  ? 48 GLU A CD   3  
ATOM   3031  O OE1  . GLU A 1 48 ? -10.090 -0.722  -5.378  1.00 7.44  ? 48 GLU A OE1  3  
ATOM   3032  O OE2  . GLU A 1 48 ? -9.552  -1.606  -7.268  1.00 7.12  ? 48 GLU A OE2  3  
ATOM   3033  H H    . GLU A 1 48 ? -9.828  -6.121  -3.343  1.00 5.71  ? 48 GLU A H    3  
ATOM   3034  H HA   . GLU A 1 48 ? -7.522  -4.832  -4.745  1.00 4.10  ? 48 GLU A HA   3  
ATOM   3035  H HB2  . GLU A 1 48 ? -9.861  -4.189  -5.643  1.00 5.76  ? 48 GLU A HB2  3  
ATOM   3036  H HB3  . GLU A 1 48 ? -10.088 -3.365  -4.098  1.00 6.30  ? 48 GLU A HB3  3  
ATOM   3037  H HG2  . GLU A 1 48 ? -8.074  -2.014  -4.498  1.00 5.48  ? 48 GLU A HG2  3  
ATOM   3038  H HG3  . GLU A 1 48 ? -7.791  -2.861  -6.018  1.00 5.78  ? 48 GLU A HG3  3  
ATOM   3039  N N    . LEU A 1 49 ? -6.745  -4.065  -2.492  1.00 4.08  ? 49 LEU A N    3  
ATOM   3040  C CA   . LEU A 1 49 ? -6.308  -3.600  -1.140  1.00 4.35  ? 49 LEU A CA   3  
ATOM   3041  C C    . LEU A 1 49 ? -5.456  -2.338  -1.263  1.00 3.99  ? 49 LEU A C    3  
ATOM   3042  O O    . LEU A 1 49 ? -4.454  -2.328  -1.948  1.00 3.87  ? 49 LEU A O    3  
ATOM   3043  C CB   . LEU A 1 49 ? -5.460  -4.691  -0.472  1.00 4.67  ? 49 LEU A CB   3  
ATOM   3044  C CG   . LEU A 1 49 ? -6.228  -5.329  0.689   1.00 4.92  ? 49 LEU A CG   3  
ATOM   3045  C CD1  . LEU A 1 49 ? -7.222  -6.359  0.151   1.00 5.51  ? 49 LEU A CD1  3  
ATOM   3046  C CD2  . LEU A 1 49 ? -5.238  -6.030  1.623   1.00 4.69  ? 49 LEU A CD2  3  
ATOM   3047  H H    . LEU A 1 49 ? -6.072  -4.280  -3.182  1.00 3.67  ? 49 LEU A H    3  
ATOM   3048  H HA   . LEU A 1 49 ? -7.173  -3.393  -0.528  1.00 4.89  ? 49 LEU A HA   3  
ATOM   3049  H HB2  . LEU A 1 49 ? -5.213  -5.452  -1.200  1.00 4.69  ? 49 LEU A HB2  3  
ATOM   3050  H HB3  . LEU A 1 49 ? -4.550  -4.249  -0.094  1.00 5.10  ? 49 LEU A HB3  3  
ATOM   3051  H HG   . LEU A 1 49 ? -6.761  -4.563  1.235   1.00 5.20  ? 49 LEU A HG   3  
ATOM   3052  H HD11 . LEU A 1 49 ? -6.751  -6.941  -0.627  1.00 5.66  ? 49 LEU A HD11 3  
ATOM   3053  H HD12 . LEU A 1 49 ? -7.531  -7.012  0.953   1.00 5.74  ? 49 LEU A HD12 3  
ATOM   3054  H HD13 . LEU A 1 49 ? -8.084  -5.849  -0.251  1.00 5.91  ? 49 LEU A HD13 3  
ATOM   3055  H HD21 . LEU A 1 49 ? -4.318  -5.466  1.661   1.00 4.52  ? 49 LEU A HD21 3  
ATOM   3056  H HD22 . LEU A 1 49 ? -5.661  -6.095  2.614   1.00 4.66  ? 49 LEU A HD22 3  
ATOM   3057  H HD23 . LEU A 1 49 ? -5.034  -7.025  1.253   1.00 5.11  ? 49 LEU A HD23 3  
ATOM   3058  N N    . CYS A 1 50 ? -5.814  -1.286  -0.567  1.00 3.99  ? 50 CYS A N    3  
ATOM   3059  C CA   . CYS A 1 50 ? -4.980  -0.049  -0.614  1.00 3.63  ? 50 CYS A CA   3  
ATOM   3060  C C    . CYS A 1 50 ? -3.719  -0.332  0.205   1.00 3.49  ? 50 CYS A C    3  
ATOM   3061  O O    . CYS A 1 50 ? -3.724  -1.198  1.056   1.00 4.14  ? 50 CYS A O    3  
ATOM   3062  C CB   . CYS A 1 50 ? -5.727  1.148   -0.028  1.00 3.72  ? 50 CYS A CB   3  
ATOM   3063  S SG   . CYS A 1 50 ? -7.522  0.923   -0.155  1.00 4.64  ? 50 CYS A SG   3  
ATOM   3064  H H    . CYS A 1 50 ? -6.599  -1.326  0.010   1.00 4.28  ? 50 CYS A H    3  
ATOM   3065  H HA   . CYS A 1 50 ? -4.706  0.163   -1.629  1.00 3.59  ? 50 CYS A HA   3  
ATOM   3066  H HB2  . CYS A 1 50 ? -5.453  1.260   0.999   1.00 3.90  ? 50 CYS A HB2  3  
ATOM   3067  H HB3  . CYS A 1 50 ? -5.443  2.033   -0.572  1.00 3.38  ? 50 CYS A HB3  3  
ATOM   3068  N N    . LEU A 1 51 ? -2.635  0.355   -0.042  1.00 2.91  ? 51 LEU A N    3  
ATOM   3069  C CA   . LEU A 1 51 ? -1.398  0.063   0.729   1.00 2.96  ? 51 LEU A CA   3  
ATOM   3070  C C    . LEU A 1 51 ? -0.941  1.287   1.489   1.00 3.35  ? 51 LEU A C    3  
ATOM   3071  O O    . LEU A 1 51 ? -1.225  2.418   1.129   1.00 3.56  ? 51 LEU A O    3  
ATOM   3072  C CB   . LEU A 1 51 ? -0.283  -0.373  -0.203  1.00 2.71  ? 51 LEU A CB   3  
ATOM   3073  C CG   . LEU A 1 51 ? -0.296  -1.895  -0.397  1.00 2.56  ? 51 LEU A CG   3  
ATOM   3074  C CD1  . LEU A 1 51 ? -0.051  -2.582  0.942   1.00 2.98  ? 51 LEU A CD1  3  
ATOM   3075  C CD2  . LEU A 1 51 ? -1.642  -2.352  -0.965  1.00 2.61  ? 51 LEU A CD2  3  
ATOM   3076  H H    . LEU A 1 51 ? -2.629  1.045   -0.730  1.00 2.70  ? 51 LEU A H    3  
ATOM   3077  H HA   . LEU A 1 51 ? -1.598  -0.733  1.431   1.00 3.34  ? 51 LEU A HA   3  
ATOM   3078  H HB2  . LEU A 1 51 ? -0.414  0.110   -1.134  1.00 2.95  ? 51 LEU A HB2  3  
ATOM   3079  H HB3  . LEU A 1 51 ? 0.662   -0.077  0.218   1.00 2.93  ? 51 LEU A HB3  3  
ATOM   3080  H HG   . LEU A 1 51 ? 0.492   -2.165  -1.081  1.00 2.88  ? 51 LEU A HG   3  
ATOM   3081  H HD11 . LEU A 1 51 ? -0.148  -1.863  1.743   1.00 3.38  ? 51 LEU A HD11 3  
ATOM   3082  H HD12 . LEU A 1 51 ? -0.772  -3.374  1.079   1.00 3.34  ? 51 LEU A HD12 3  
ATOM   3083  H HD13 . LEU A 1 51 ? 0.943   -2.997  0.949   1.00 3.13  ? 51 LEU A HD13 3  
ATOM   3084  H HD21 . LEU A 1 51 ? -2.076  -1.558  -1.554  1.00 2.85  ? 51 LEU A HD21 3  
ATOM   3085  H HD22 . LEU A 1 51 ? -1.492  -3.220  -1.589  1.00 2.77  ? 51 LEU A HD22 3  
ATOM   3086  H HD23 . LEU A 1 51 ? -2.308  -2.604  -0.154  1.00 3.04  ? 51 LEU A HD23 3  
ATOM   3087  N N    . ASP A 1 52 ? -0.219  1.033   2.532   1.00 3.84  ? 52 ASP A N    3  
ATOM   3088  C CA   . ASP A 1 52 ? 0.306   2.117   3.403   1.00 4.35  ? 52 ASP A CA   3  
ATOM   3089  C C    . ASP A 1 52 ? 1.836   2.196   3.280   1.00 4.47  ? 52 ASP A C    3  
ATOM   3090  O O    . ASP A 1 52 ? 2.542   1.311   3.738   1.00 4.73  ? 52 ASP A O    3  
ATOM   3091  C CB   . ASP A 1 52 ? -0.086  1.800   4.854   1.00 4.93  ? 52 ASP A CB   3  
ATOM   3092  C CG   . ASP A 1 52 ? -0.018  3.063   5.727   1.00 5.39  ? 52 ASP A CG   3  
ATOM   3093  O OD1  . ASP A 1 52 ? -0.212  4.151   5.202   1.00 5.40  ? 52 ASP A OD1  3  
ATOM   3094  O OD2  . ASP A 1 52 ? 0.219   2.919   6.914   1.00 5.96  ? 52 ASP A OD2  3  
ATOM   3095  H H    . ASP A 1 52 ? -0.015  0.100   2.740   1.00 4.08  ? 52 ASP A H    3  
ATOM   3096  H HA   . ASP A 1 52 ? -0.134  3.058   3.111   1.00 4.52  ? 52 ASP A HA   3  
ATOM   3097  H HB2  . ASP A 1 52 ? -1.093  1.405   4.872   1.00 5.32  ? 52 ASP A HB2  3  
ATOM   3098  H HB3  . ASP A 1 52 ? 0.590   1.056   5.251   1.00 4.91  ? 52 ASP A HB3  3  
ATOM   3099  N N    . PRO A 1 53 ? 2.309   3.270   2.682   1.00 4.54  ? 53 PRO A N    3  
ATOM   3100  C CA   . PRO A 1 53 ? 3.757   3.494   2.494   1.00 4.96  ? 53 PRO A CA   3  
ATOM   3101  C C    . PRO A 1 53 ? 4.446   3.802   3.835   1.00 5.21  ? 53 PRO A C    3  
ATOM   3102  O O    . PRO A 1 53 ? 5.657   3.889   3.905   1.00 5.67  ? 53 PRO A O    3  
ATOM   3103  C CB   . PRO A 1 53 ? 3.820   4.686   1.532   1.00 5.26  ? 53 PRO A CB   3  
ATOM   3104  C CG   . PRO A 1 53 ? 2.461   5.410   1.650   1.00 5.04  ? 53 PRO A CG   3  
ATOM   3105  C CD   . PRO A 1 53 ? 1.455   4.365   2.164   1.00 4.55  ? 53 PRO A CD   3  
ATOM   3106  H HA   . PRO A 1 53 ? 4.210   2.632   2.033   1.00 5.07  ? 53 PRO A HA   3  
ATOM   3107  H HB2  . PRO A 1 53 ? 4.625   5.350   1.815   1.00 5.72  ? 53 PRO A HB2  3  
ATOM   3108  H HB3  . PRO A 1 53 ? 3.960   4.339   0.520   1.00 5.40  ? 53 PRO A HB3  3  
ATOM   3109  H HG2  . PRO A 1 53 ? 2.539   6.230   2.351   1.00 5.39  ? 53 PRO A HG2  3  
ATOM   3110  H HG3  . PRO A 1 53 ? 2.147   5.774   0.684   1.00 5.11  ? 53 PRO A HG3  3  
ATOM   3111  H HD2  . PRO A 1 53 ? 0.848   4.783   2.954   1.00 4.78  ? 53 PRO A HD2  3  
ATOM   3112  H HD3  . PRO A 1 53 ? 0.836   4.004   1.357   1.00 4.27  ? 53 PRO A HD3  3  
ATOM   3113  N N    . LYS A 1 54 ? 3.685   3.946   4.903   1.00 5.18  ? 54 LYS A N    3  
ATOM   3114  C CA   . LYS A 1 54 ? 4.291   4.221   6.232   1.00 5.61  ? 54 LYS A CA   3  
ATOM   3115  C C    . LYS A 1 54 ? 5.206   3.055   6.636   1.00 5.02  ? 54 LYS A C    3  
ATOM   3116  O O    . LYS A 1 54 ? 6.177   3.247   7.345   1.00 5.42  ? 54 LYS A O    3  
ATOM   3117  C CB   . LYS A 1 54 ? 3.183   4.385   7.278   1.00 6.23  ? 54 LYS A CB   3  
ATOM   3118  C CG   . LYS A 1 54 ? 2.828   5.868   7.430   1.00 7.12  ? 54 LYS A CG   3  
ATOM   3119  C CD   . LYS A 1 54 ? 3.752   6.518   8.467   1.00 7.85  ? 54 LYS A CD   3  
ATOM   3120  C CE   . LYS A 1 54 ? 3.777   8.035   8.258   1.00 8.63  ? 54 LYS A CE   3  
ATOM   3121  N NZ   . LYS A 1 54 ? 4.836   8.386   7.268   1.00 9.56  ? 54 LYS A NZ   3  
ATOM   3122  H H    . LYS A 1 54 ? 2.719   3.864   4.830   1.00 5.07  ? 54 LYS A H    3  
ATOM   3123  H HA   . LYS A 1 54 ? 4.866   5.126   6.174   1.00 6.14  ? 54 LYS A HA   3  
ATOM   3124  H HB2  . LYS A 1 54 ? 2.309   3.839   6.959   1.00 6.01  ? 54 LYS A HB2  3  
ATOM   3125  H HB3  . LYS A 1 54 ? 3.523   3.997   8.225   1.00 6.42  ? 54 LYS A HB3  3  
ATOM   3126  H HG2  . LYS A 1 54 ? 2.946   6.367   6.479   1.00 7.47  ? 54 LYS A HG2  3  
ATOM   3127  H HG3  . LYS A 1 54 ? 1.803   5.960   7.758   1.00 7.15  ? 54 LYS A HG3  3  
ATOM   3128  H HD2  . LYS A 1 54 ? 3.386   6.298   9.460   1.00 8.02  ? 54 LYS A HD2  3  
ATOM   3129  H HD3  . LYS A 1 54 ? 4.751   6.124   8.356   1.00 7.93  ? 54 LYS A HD3  3  
ATOM   3130  H HE2  . LYS A 1 54 ? 2.817   8.365   7.889   1.00 8.78  ? 54 LYS A HE2  3  
ATOM   3131  H HE3  . LYS A 1 54 ? 3.988   8.524   9.197   1.00 8.58  ? 54 LYS A HE3  3  
ATOM   3132  H HZ1  . LYS A 1 54 ? 5.759   8.053   7.613   1.00 9.93  ? 54 LYS A HZ1  3  
ATOM   3133  H HZ2  . LYS A 1 54 ? 4.623   7.936   6.355   1.00 9.78  ? 54 LYS A HZ2  3  
ATOM   3134  H HZ3  . LYS A 1 54 ? 4.865   9.418   7.143   1.00 9.84  ? 54 LYS A HZ3  3  
ATOM   3135  N N    . GLU A 1 55 ? 4.919   1.848   6.181   1.00 4.37  ? 55 GLU A N    3  
ATOM   3136  C CA   . GLU A 1 55 ? 5.792   0.693   6.534   1.00 4.14  ? 55 GLU A CA   3  
ATOM   3137  C C    . GLU A 1 55 ? 6.978   0.652   5.573   1.00 3.84  ? 55 GLU A C    3  
ATOM   3138  O O    . GLU A 1 55 ? 7.026   1.369   4.589   1.00 3.83  ? 55 GLU A O    3  
ATOM   3139  C CB   . GLU A 1 55 ? 5.007   -0.618  6.410   1.00 4.19  ? 55 GLU A CB   3  
ATOM   3140  C CG   . GLU A 1 55 ? 4.215   -0.878  7.696   1.00 4.76  ? 55 GLU A CG   3  
ATOM   3141  C CD   . GLU A 1 55 ? 4.651   -2.205  8.326   1.00 5.39  ? 55 GLU A CD   3  
ATOM   3142  O OE1  . GLU A 1 55 ? 5.828   -2.341  8.629   1.00 5.43  ? 55 GLU A OE1  3  
ATOM   3143  O OE2  . GLU A 1 55 ? 3.800   -3.061  8.507   1.00 6.13  ? 55 GLU A OE2  3  
ATOM   3144  H H    . GLU A 1 55 ? 4.141   1.707   5.597   1.00 4.29  ? 55 GLU A H    3  
ATOM   3145  H HA   . GLU A 1 55 ? 6.152   0.805   7.546   1.00 4.53  ? 55 GLU A HA   3  
ATOM   3146  H HB2  . GLU A 1 55 ? 4.337   -0.552  5.574   1.00 4.04  ? 55 GLU A HB2  3  
ATOM   3147  H HB3  . GLU A 1 55 ? 5.691   -1.428  6.246   1.00 4.32  ? 55 GLU A HB3  3  
ATOM   3148  H HG2  . GLU A 1 55 ? 4.403   -0.082  8.391   1.00 4.81  ? 55 GLU A HG2  3  
ATOM   3149  H HG3  . GLU A 1 55 ? 3.161   -0.919  7.469   1.00 4.98  ? 55 GLU A HG3  3  
ATOM   3150  N N    . ASN A 1 56 ? 7.922   -0.201  5.844   1.00 3.90  ? 56 ASN A N    3  
ATOM   3151  C CA   . ASN A 1 56 ? 9.109   -0.328  4.951   1.00 3.93  ? 56 ASN A CA   3  
ATOM   3152  C C    . ASN A 1 56 ? 8.893   -1.486  3.974   1.00 3.74  ? 56 ASN A C    3  
ATOM   3153  O O    . ASN A 1 56 ? 9.583   -1.600  2.979   1.00 3.89  ? 56 ASN A O    3  
ATOM   3154  C CB   . ASN A 1 56 ? 10.354  -0.593  5.786   1.00 4.29  ? 56 ASN A CB   3  
ATOM   3155  C CG   . ASN A 1 56 ? 11.338  0.570   5.629   1.00 4.70  ? 56 ASN A CG   3  
ATOM   3156  O OD1  . ASN A 1 56 ? 12.039  0.656   4.640   1.00 4.90  ? 56 ASN A OD1  3  
ATOM   3157  N ND2  . ASN A 1 56 ? 11.420  1.475   6.567   1.00 5.15  ? 56 ASN A ND2  3  
ATOM   3158  H H    . ASN A 1 56 ? 7.839   -0.776  6.633   1.00 4.12  ? 56 ASN A H    3  
ATOM   3159  H HA   . ASN A 1 56 ? 9.243   0.581   4.400   1.00 4.07  ? 56 ASN A HA   3  
ATOM   3160  H HB2  . ASN A 1 56 ? 10.067  -0.690  6.818   1.00 4.38  ? 56 ASN A HB2  3  
ATOM   3161  H HB3  . ASN A 1 56 ? 10.819  -1.503  5.450   1.00 4.36  ? 56 ASN A HB3  3  
ATOM   3162  H HD21 . ASN A 1 56 ? 10.855  1.408   7.366   1.00 5.31  ? 56 ASN A HD21 3  
ATOM   3163  H HD22 . ASN A 1 56 ? 12.047  2.222   6.473   1.00 5.51  ? 56 ASN A HD22 3  
ATOM   3164  N N    . TRP A 1 57 ? 7.940   -2.344  4.251   1.00 3.55  ? 57 TRP A N    3  
ATOM   3165  C CA   . TRP A 1 57 ? 7.674   -3.487  3.352   1.00 3.47  ? 57 TRP A CA   3  
ATOM   3166  C C    . TRP A 1 57 ? 6.823   -3.027  2.171   1.00 3.28  ? 57 TRP A C    3  
ATOM   3167  O O    . TRP A 1 57 ? 6.999   -3.486  1.066   1.00 3.48  ? 57 TRP A O    3  
ATOM   3168  C CB   . TRP A 1 57 ? 6.974   -4.600  4.137   1.00 3.64  ? 57 TRP A CB   3  
ATOM   3169  C CG   . TRP A 1 57 ? 5.551   -4.267  4.432   1.00 3.70  ? 57 TRP A CG   3  
ATOM   3170  C CD1  . TRP A 1 57 ? 5.111   -3.774  5.598   1.00 4.08  ? 57 TRP A CD1  3  
ATOM   3171  C CD2  . TRP A 1 57 ? 4.381   -4.414  3.580   1.00 3.51  ? 57 TRP A CD2  3  
ATOM   3172  N NE1  . TRP A 1 57 ? 3.741   -3.635  5.534   1.00 4.20  ? 57 TRP A NE1  3  
ATOM   3173  C CE2  . TRP A 1 57 ? 3.245   -4.003  4.308   1.00 3.80  ? 57 TRP A CE2  3  
ATOM   3174  C CE3  . TRP A 1 57 ? 4.197   -4.860  2.264   1.00 3.27  ? 57 TRP A CE3  3  
ATOM   3175  C CZ2  . TRP A 1 57 ? 1.969   -4.036  3.755   1.00 3.76  ? 57 TRP A CZ2  3  
ATOM   3176  C CZ3  . TRP A 1 57 ? 2.915   -4.890  1.700   1.00 3.17  ? 57 TRP A CZ3  3  
ATOM   3177  C CH2  . TRP A 1 57 ? 1.802   -4.479  2.445   1.00 3.38  ? 57 TRP A CH2  3  
ATOM   3178  H H    . TRP A 1 57 ? 7.401   -2.235  5.050   1.00 3.59  ? 57 TRP A H    3  
ATOM   3179  H HA   . TRP A 1 57 ? 8.613   -3.855  2.987   1.00 3.59  ? 57 TRP A HA   3  
ATOM   3180  H HB2  . TRP A 1 57 ? 6.994   -5.499  3.573   1.00 3.77  ? 57 TRP A HB2  3  
ATOM   3181  H HB3  . TRP A 1 57 ? 7.499   -4.754  5.061   1.00 3.78  ? 57 TRP A HB3  3  
ATOM   3182  H HD1  . TRP A 1 57 ? 5.728   -3.539  6.444   1.00 4.35  ? 57 TRP A HD1  3  
ATOM   3183  H HE1  . TRP A 1 57 ? 3.177   -3.315  6.256   1.00 4.57  ? 57 TRP A HE1  3  
ATOM   3184  H HE3  . TRP A 1 57 ? 5.046   -5.181  1.683   1.00 3.29  ? 57 TRP A HE3  3  
ATOM   3185  H HZ2  . TRP A 1 57 ? 1.114   -3.717  4.336   1.00 4.10  ? 57 TRP A HZ2  3  
ATOM   3186  H HZ3  . TRP A 1 57 ? 2.787   -5.222  0.686   1.00 3.03  ? 57 TRP A HZ3  3  
ATOM   3187  H HH2  . TRP A 1 57 ? 0.818   -4.509  2.004   1.00 3.37  ? 57 TRP A HH2  3  
ATOM   3188  N N    . VAL A 1 58 ? 5.913   -2.115  2.392   1.00 3.02  ? 58 VAL A N    3  
ATOM   3189  C CA   . VAL A 1 58 ? 5.065   -1.617  1.267   1.00 2.84  ? 58 VAL A CA   3  
ATOM   3190  C C    . VAL A 1 58 ? 5.958   -0.868  0.269   1.00 2.99  ? 58 VAL A C    3  
ATOM   3191  O O    . VAL A 1 58 ? 5.829   -1.028  -0.929  1.00 3.21  ? 58 VAL A O    3  
ATOM   3192  C CB   . VAL A 1 58 ? 3.988   -0.673  1.825   1.00 2.78  ? 58 VAL A CB   3  
ATOM   3193  C CG1  . VAL A 1 58 ? 3.551   0.343   0.763   1.00 2.80  ? 58 VAL A CG1  3  
ATOM   3194  C CG2  . VAL A 1 58 ? 2.777   -1.484  2.271   1.00 2.85  ? 58 VAL A CG2  3  
ATOM   3195  H H    . VAL A 1 58 ? 5.794   -1.752  3.299   1.00 3.04  ? 58 VAL A H    3  
ATOM   3196  H HA   . VAL A 1 58 ? 4.597   -2.453  0.769   1.00 2.96  ? 58 VAL A HA   3  
ATOM   3197  H HB   . VAL A 1 58 ? 4.394   -0.151  2.672   1.00 3.12  ? 58 VAL A HB   3  
ATOM   3198  H HG11 . VAL A 1 58 ? 3.388   -0.165  -0.177  1.00 3.10  ? 58 VAL A HG11 3  
ATOM   3199  H HG12 . VAL A 1 58 ? 2.635   0.820   1.077   1.00 2.86  ? 58 VAL A HG12 3  
ATOM   3200  H HG13 . VAL A 1 58 ? 4.322   1.089   0.641   1.00 3.08  ? 58 VAL A HG13 3  
ATOM   3201  H HG21 . VAL A 1 58 ? 2.705   -2.380  1.673   1.00 3.17  ? 58 VAL A HG21 3  
ATOM   3202  H HG22 . VAL A 1 58 ? 2.888   -1.751  3.311   1.00 2.93  ? 58 VAL A HG22 3  
ATOM   3203  H HG23 . VAL A 1 58 ? 1.882   -0.894  2.144   1.00 3.15  ? 58 VAL A HG23 3  
ATOM   3204  N N    . GLN A 1 59 ? 6.865   -0.055  0.760   1.00 3.12  ? 59 GLN A N    3  
ATOM   3205  C CA   . GLN A 1 59 ? 7.769   0.703   -0.150  1.00 3.61  ? 59 GLN A CA   3  
ATOM   3206  C C    . GLN A 1 59 ? 8.808   -0.242  -0.775  1.00 3.90  ? 59 GLN A C    3  
ATOM   3207  O O    . GLN A 1 59 ? 9.257   -0.023  -1.885  1.00 4.47  ? 59 GLN A O    3  
ATOM   3208  C CB   . GLN A 1 59 ? 8.459   1.819   0.631   1.00 3.82  ? 59 GLN A CB   3  
ATOM   3209  C CG   . GLN A 1 59 ? 9.323   1.207   1.721   1.00 4.33  ? 59 GLN A CG   3  
ATOM   3210  C CD   . GLN A 1 59 ? 9.975   2.315   2.553   1.00 4.72  ? 59 GLN A CD   3  
ATOM   3211  O OE1  . GLN A 1 59 ? 9.386   2.812   3.492   1.00 4.84  ? 59 GLN A OE1  3  
ATOM   3212  N NE2  . GLN A 1 59 ? 11.176  2.727   2.246   1.00 5.29  ? 59 GLN A NE2  3  
ATOM   3213  H H    . GLN A 1 59 ? 6.951   0.054   1.730   1.00 3.04  ? 59 GLN A H    3  
ATOM   3214  H HA   . GLN A 1 59 ? 7.187   1.135   -0.930  1.00 3.80  ? 59 GLN A HA   3  
ATOM   3215  H HB2  . GLN A 1 59 ? 9.074   2.394   -0.036  1.00 3.96  ? 59 GLN A HB2  3  
ATOM   3216  H HB3  . GLN A 1 59 ? 7.715   2.458   1.080   1.00 3.78  ? 59 GLN A HB3  3  
ATOM   3217  H HG2  . GLN A 1 59 ? 8.704   0.592   2.353   1.00 4.58  ? 59 GLN A HG2  3  
ATOM   3218  H HG3  . GLN A 1 59 ? 10.085  0.601   1.264   1.00 4.52  ? 59 GLN A HG3  3  
ATOM   3219  H HE21 . GLN A 1 59 ? 11.654  2.328   1.490   1.00 5.47  ? 59 GLN A HE21 3  
ATOM   3220  H HE22 . GLN A 1 59 ? 11.599  3.437   2.774   1.00 5.70  ? 59 GLN A HE22 3  
ATOM   3221  N N    . ARG A 1 60 ? 9.170   -1.303  -0.089  1.00 3.65  ? 60 ARG A N    3  
ATOM   3222  C CA   . ARG A 1 60 ? 10.150  -2.271  -0.662  1.00 3.97  ? 60 ARG A CA   3  
ATOM   3223  C C    . ARG A 1 60 ? 9.399   -3.186  -1.627  1.00 3.96  ? 60 ARG A C    3  
ATOM   3224  O O    . ARG A 1 60 ? 9.871   -3.489  -2.706  1.00 4.42  ? 60 ARG A O    3  
ATOM   3225  C CB   . ARG A 1 60 ? 10.775  -3.109  0.459   1.00 4.07  ? 60 ARG A CB   3  
ATOM   3226  C CG   . ARG A 1 60 ? 12.182  -3.557  0.045   1.00 4.60  ? 60 ARG A CG   3  
ATOM   3227  C CD   . ARG A 1 60 ? 12.082  -4.746  -0.919  1.00 4.81  ? 60 ARG A CD   3  
ATOM   3228  N NE   . ARG A 1 60 ? 12.781  -5.927  -0.336  1.00 5.26  ? 60 ARG A NE   3  
ATOM   3229  C CZ   . ARG A 1 60 ? 13.646  -6.597  -1.052  1.00 5.84  ? 60 ARG A CZ   3  
ATOM   3230  N NH1  . ARG A 1 60 ? 13.234  -7.344  -2.045  1.00 6.25  ? 60 ARG A NH1  3  
ATOM   3231  N NH2  . ARG A 1 60 ? 14.921  -6.520  -0.774  1.00 6.35  ? 60 ARG A NH2  3  
ATOM   3232  H H    . ARG A 1 60 ? 8.775   -1.476  0.791   1.00 3.35  ? 60 ARG A H    3  
ATOM   3233  H HA   . ARG A 1 60 ? 10.923  -1.734  -1.195  1.00 4.24  ? 60 ARG A HA   3  
ATOM   3234  H HB2  . ARG A 1 60 ? 10.836  -2.516  1.357   1.00 3.95  ? 60 ARG A HB2  3  
ATOM   3235  H HB3  . ARG A 1 60 ? 10.162  -3.978  0.642   1.00 4.07  ? 60 ARG A HB3  3  
ATOM   3236  H HG2  . ARG A 1 60 ? 12.691  -2.738  -0.442  1.00 4.80  ? 60 ARG A HG2  3  
ATOM   3237  H HG3  . ARG A 1 60 ? 12.737  -3.854  0.923   1.00 4.99  ? 60 ARG A HG3  3  
ATOM   3238  H HD2  . ARG A 1 60 ? 11.043  -4.990  -1.083  1.00 4.73  ? 60 ARG A HD2  3  
ATOM   3239  H HD3  . ARG A 1 60 ? 12.543  -4.482  -1.860  1.00 5.10  ? 60 ARG A HD3  3  
ATOM   3240  H HE   . ARG A 1 60 ? 12.590  -6.204  0.585   1.00 5.37  ? 60 ARG A HE   3  
ATOM   3241  H HH11 . ARG A 1 60 ? 12.258  -7.404  -2.256  1.00 6.14  ? 60 ARG A HH11 3  
ATOM   3242  H HH12 . ARG A 1 60 ? 13.895  -7.857  -2.593  1.00 6.86  ? 60 ARG A HH12 3  
ATOM   3243  H HH21 . ARG A 1 60 ? 15.234  -5.951  -0.014  1.00 6.32  ? 60 ARG A HH21 3  
ATOM   3244  H HH22 . ARG A 1 60 ? 15.584  -7.033  -1.321  1.00 6.96  ? 60 ARG A HH22 3  
ATOM   3245  N N    . VAL A 1 61 ? 8.218   -3.612  -1.241  1.00 3.58  ? 61 VAL A N    3  
ATOM   3246  C CA   . VAL A 1 61 ? 7.398   -4.492  -2.122  1.00 3.55  ? 61 VAL A CA   3  
ATOM   3247  C C    . VAL A 1 61 ? 7.071   -3.738  -3.417  1.00 3.25  ? 61 VAL A C    3  
ATOM   3248  O O    . VAL A 1 61 ? 7.166   -4.285  -4.498  1.00 3.52  ? 61 VAL A O    3  
ATOM   3249  C CB   . VAL A 1 61 ? 6.106   -4.876  -1.382  1.00 3.59  ? 61 VAL A CB   3  
ATOM   3250  C CG1  . VAL A 1 61 ? 5.066   -5.404  -2.367  1.00 3.56  ? 61 VAL A CG1  3  
ATOM   3251  C CG2  . VAL A 1 61 ? 6.413   -5.963  -0.348  1.00 4.31  ? 61 VAL A CG2  3  
ATOM   3252  H H    . VAL A 1 61 ? 7.863   -3.336  -0.364  1.00 3.39  ? 61 VAL A H    3  
ATOM   3253  H HA   . VAL A 1 61 ? 7.959   -5.380  -2.361  1.00 3.93  ? 61 VAL A HA   3  
ATOM   3254  H HB   . VAL A 1 61 ? 5.708   -4.005  -0.879  1.00 3.40  ? 61 VAL A HB   3  
ATOM   3255  H HG11 . VAL A 1 61 ? 5.465   -6.267  -2.873  1.00 3.88  ? 61 VAL A HG11 3  
ATOM   3256  H HG12 . VAL A 1 61 ? 4.172   -5.681  -1.829  1.00 3.52  ? 61 VAL A HG12 3  
ATOM   3257  H HG13 . VAL A 1 61 ? 4.830   -4.637  -3.089  1.00 3.73  ? 61 VAL A HG13 3  
ATOM   3258  H HG21 . VAL A 1 61 ? 7.155   -5.599  0.348   1.00 4.45  ? 61 VAL A HG21 3  
ATOM   3259  H HG22 . VAL A 1 61 ? 5.510   -6.215  0.188   1.00 4.58  ? 61 VAL A HG22 3  
ATOM   3260  H HG23 . VAL A 1 61 ? 6.792   -6.840  -0.850  1.00 4.75  ? 61 VAL A HG23 3  
ATOM   3261  N N    . VAL A 1 62 ? 6.703   -2.482  -3.312  1.00 2.99  ? 62 VAL A N    3  
ATOM   3262  C CA   . VAL A 1 62 ? 6.387   -1.681  -4.534  1.00 3.22  ? 62 VAL A CA   3  
ATOM   3263  C C    . VAL A 1 62 ? 7.665   -1.521  -5.371  1.00 3.80  ? 62 VAL A C    3  
ATOM   3264  O O    . VAL A 1 62 ? 7.626   -1.575  -6.585  1.00 4.15  ? 62 VAL A O    3  
ATOM   3265  C CB   . VAL A 1 62 ? 5.854   -0.300  -4.124  1.00 3.53  ? 62 VAL A CB   3  
ATOM   3266  C CG1  . VAL A 1 62 ? 5.719   0.597   -5.359  1.00 4.40  ? 62 VAL A CG1  3  
ATOM   3267  C CG2  . VAL A 1 62 ? 4.481   -0.459  -3.465  1.00 3.34  ? 62 VAL A CG2  3  
ATOM   3268  H H    . VAL A 1 62 ? 6.648   -2.061  -2.427  1.00 2.92  ? 62 VAL A H    3  
ATOM   3269  H HA   . VAL A 1 62 ? 5.640   -2.198  -5.118  1.00 3.17  ? 62 VAL A HA   3  
ATOM   3270  H HB   . VAL A 1 62 ? 6.539   0.155   -3.423  1.00 3.69  ? 62 VAL A HB   3  
ATOM   3271  H HG11 . VAL A 1 62 ? 5.254   0.040   -6.159  1.00 4.59  ? 62 VAL A HG11 3  
ATOM   3272  H HG12 . VAL A 1 62 ? 5.112   1.456   -5.116  1.00 4.91  ? 62 VAL A HG12 3  
ATOM   3273  H HG13 . VAL A 1 62 ? 6.699   0.926   -5.672  1.00 4.71  ? 62 VAL A HG13 3  
ATOM   3274  H HG21 . VAL A 1 62 ? 4.443   -1.396  -2.929  1.00 3.53  ? 62 VAL A HG21 3  
ATOM   3275  H HG22 . VAL A 1 62 ? 4.315   0.356   -2.776  1.00 3.11  ? 62 VAL A HG22 3  
ATOM   3276  H HG23 . VAL A 1 62 ? 3.714   -0.449  -4.225  1.00 3.80  ? 62 VAL A HG23 3  
ATOM   3277  N N    . GLU A 1 63 ? 8.797   -1.327  -4.729  1.00 4.04  ? 63 GLU A N    3  
ATOM   3278  C CA   . GLU A 1 63 ? 10.076  -1.168  -5.475  1.00 4.68  ? 63 GLU A CA   3  
ATOM   3279  C C    . GLU A 1 63 ? 10.415  -2.474  -6.205  1.00 4.70  ? 63 GLU A C    3  
ATOM   3280  O O    . GLU A 1 63 ? 10.738  -2.465  -7.376  1.00 5.23  ? 63 GLU A O    3  
ATOM   3281  C CB   . GLU A 1 63 ? 11.206  -0.816  -4.500  1.00 5.11  ? 63 GLU A CB   3  
ATOM   3282  C CG   . GLU A 1 63 ? 11.680  0.619   -4.758  1.00 5.73  ? 63 GLU A CG   3  
ATOM   3283  C CD   . GLU A 1 63 ? 12.322  1.186   -3.488  1.00 6.00  ? 63 GLU A CD   3  
ATOM   3284  O OE1  . GLU A 1 63 ? 11.587  1.556   -2.587  1.00 6.04  ? 63 GLU A OE1  3  
ATOM   3285  O OE2  . GLU A 1 63 ? 13.540  1.244   -3.439  1.00 6.46  ? 63 GLU A OE2  3  
ATOM   3286  H H    . GLU A 1 63 ? 8.802   -1.287  -3.755  1.00 3.89  ? 63 GLU A H    3  
ATOM   3287  H HA   . GLU A 1 63 ? 9.960   -0.378  -6.194  1.00 5.00  ? 63 GLU A HA   3  
ATOM   3288  H HB2  . GLU A 1 63 ? 10.846  -0.900  -3.485  1.00 4.92  ? 63 GLU A HB2  3  
ATOM   3289  H HB3  . GLU A 1 63 ? 12.032  -1.496  -4.645  1.00 5.36  ? 63 GLU A HB3  3  
ATOM   3290  H HG2  . GLU A 1 63 ? 12.404  0.619   -5.559  1.00 5.98  ? 63 GLU A HG2  3  
ATOM   3291  H HG3  . GLU A 1 63 ? 10.835  1.233   -5.036  1.00 6.04  ? 63 GLU A HG3  3  
ATOM   3292  N N    . LYS A 1 64 ? 10.341  -3.594  -5.522  1.00 4.35  ? 64 LYS A N    3  
ATOM   3293  C CA   . LYS A 1 64 ? 10.653  -4.896  -6.176  1.00 4.71  ? 64 LYS A CA   3  
ATOM   3294  C C    . LYS A 1 64 ? 9.611   -5.203  -7.264  1.00 4.54  ? 64 LYS A C    3  
ATOM   3295  O O    . LYS A 1 64 ? 9.896   -5.890  -8.228  1.00 5.00  ? 64 LYS A O    3  
ATOM   3296  C CB   . LYS A 1 64 ? 10.640  -6.013  -5.125  1.00 4.74  ? 64 LYS A CB   3  
ATOM   3297  C CG   . LYS A 1 64 ? 11.740  -7.033  -5.442  1.00 5.62  ? 64 LYS A CG   3  
ATOM   3298  C CD   . LYS A 1 64 ? 11.105  -8.355  -5.888  1.00 6.24  ? 64 LYS A CD   3  
ATOM   3299  C CE   . LYS A 1 64 ? 12.165  -9.462  -5.877  1.00 7.07  ? 64 LYS A CE   3  
ATOM   3300  N NZ   . LYS A 1 64 ? 12.227  -10.085 -4.521  1.00 7.79  ? 64 LYS A NZ   3  
ATOM   3301  H H    . LYS A 1 64 ? 10.076  -3.579  -4.582  1.00 4.03  ? 64 LYS A H    3  
ATOM   3302  H HA   . LYS A 1 64 ? 11.630  -4.836  -6.621  1.00 5.26  ? 64 LYS A HA   3  
ATOM   3303  H HB2  . LYS A 1 64 ? 10.816  -5.589  -4.148  1.00 4.73  ? 64 LYS A HB2  3  
ATOM   3304  H HB3  . LYS A 1 64 ? 9.680   -6.507  -5.134  1.00 4.49  ? 64 LYS A HB3  3  
ATOM   3305  H HG2  . LYS A 1 64 ? 12.369  -6.650  -6.233  1.00 6.07  ? 64 LYS A HG2  3  
ATOM   3306  H HG3  . LYS A 1 64 ? 12.335  -7.203  -4.558  1.00 5.69  ? 64 LYS A HG3  3  
ATOM   3307  H HD2  . LYS A 1 64 ? 10.305  -8.616  -5.211  1.00 6.22  ? 64 LYS A HD2  3  
ATOM   3308  H HD3  . LYS A 1 64 ? 10.712  -8.247  -6.887  1.00 6.45  ? 64 LYS A HD3  3  
ATOM   3309  H HE2  . LYS A 1 64 ? 11.904  -10.215 -6.606  1.00 7.40  ? 64 LYS A HE2  3  
ATOM   3310  H HE3  . LYS A 1 64 ? 13.128  -9.041  -6.124  1.00 7.09  ? 64 LYS A HE3  3  
ATOM   3311  H HZ1  . LYS A 1 64 ? 11.298  -10.485 -4.280  1.00 7.96  ? 64 LYS A HZ1  3  
ATOM   3312  H HZ2  . LYS A 1 64 ? 12.939  -10.841 -4.519  1.00 8.09  ? 64 LYS A HZ2  3  
ATOM   3313  H HZ3  . LYS A 1 64 ? 12.487  -9.361  -3.819  1.00 8.07  ? 64 LYS A HZ3  3  
ATOM   3314  N N    . PHE A 1 65 ? 8.407   -4.699  -7.114  1.00 4.02  ? 65 PHE A N    3  
ATOM   3315  C CA   . PHE A 1 65 ? 7.337   -4.950  -8.120  1.00 3.99  ? 65 PHE A CA   3  
ATOM   3316  C C    . PHE A 1 65 ? 7.521   -4.023  -9.332  1.00 4.72  ? 65 PHE A C    3  
ATOM   3317  O O    . PHE A 1 65 ? 7.407   -4.447  -10.467 1.00 5.31  ? 65 PHE A O    3  
ATOM   3318  C CB   . PHE A 1 65 ? 5.981   -4.663  -7.469  1.00 3.16  ? 65 PHE A CB   3  
ATOM   3319  C CG   . PHE A 1 65 ? 4.893   -5.448  -8.164  1.00 3.02  ? 65 PHE A CG   3  
ATOM   3320  C CD1  . PHE A 1 65 ? 4.899   -6.849  -8.126  1.00 2.97  ? 65 PHE A CD1  3  
ATOM   3321  C CD2  . PHE A 1 65 ? 3.876   -4.771  -8.845  1.00 3.45  ? 65 PHE A CD2  3  
ATOM   3322  C CE1  . PHE A 1 65 ? 3.886   -7.570  -8.771  1.00 3.10  ? 65 PHE A CE1  3  
ATOM   3323  C CE2  . PHE A 1 65 ? 2.863   -5.491  -9.489  1.00 3.48  ? 65 PHE A CE2  3  
ATOM   3324  C CZ   . PHE A 1 65 ? 2.869   -6.890  -9.452  1.00 3.19  ? 65 PHE A CZ   3  
ATOM   3325  H H    . PHE A 1 65 ? 8.204   -4.151  -6.327  1.00 3.77  ? 65 PHE A H    3  
ATOM   3326  H HA   . PHE A 1 65 ? 7.374   -5.980  -8.441  1.00 4.30  ? 65 PHE A HA   3  
ATOM   3327  H HB2  . PHE A 1 65 ? 6.019   -4.942  -6.428  1.00 2.82  ? 65 PHE A HB2  3  
ATOM   3328  H HB3  . PHE A 1 65 ? 5.770   -3.608  -7.544  1.00 3.27  ? 65 PHE A HB3  3  
ATOM   3329  H HD1  . PHE A 1 65 ? 5.685   -7.374  -7.599  1.00 3.21  ? 65 PHE A HD1  3  
ATOM   3330  H HD2  . PHE A 1 65 ? 3.872   -3.692  -8.872  1.00 4.00  ? 65 PHE A HD2  3  
ATOM   3331  H HE1  . PHE A 1 65 ? 3.889   -8.649  -8.742  1.00 3.46  ? 65 PHE A HE1  3  
ATOM   3332  H HE2  . PHE A 1 65 ? 2.080   -4.968  -10.015 1.00 4.01  ? 65 PHE A HE2  3  
ATOM   3333  H HZ   . PHE A 1 65 ? 2.088   -7.446  -9.950  1.00 3.41  ? 65 PHE A HZ   3  
ATOM   3334  N N    . LEU A 1 66 ? 7.786   -2.759  -9.094  1.00 4.92  ? 66 LEU A N    3  
ATOM   3335  C CA   . LEU A 1 66 ? 7.956   -1.791  -10.223 1.00 5.86  ? 66 LEU A CA   3  
ATOM   3336  C C    . LEU A 1 66 ? 9.336   -1.961  -10.874 1.00 6.61  ? 66 LEU A C    3  
ATOM   3337  O O    . LEU A 1 66 ? 9.440   -2.153  -12.072 1.00 7.33  ? 66 LEU A O    3  
ATOM   3338  C CB   . LEU A 1 66 ? 7.810   -0.359  -9.689  1.00 6.18  ? 66 LEU A CB   3  
ATOM   3339  C CG   . LEU A 1 66 ? 7.453   0.589   -10.837 1.00 7.14  ? 66 LEU A CG   3  
ATOM   3340  C CD1  . LEU A 1 66 ? 5.954   0.492   -11.138 1.00 7.61  ? 66 LEU A CD1  3  
ATOM   3341  C CD2  . LEU A 1 66 ? 7.799   2.027   -10.438 1.00 7.67  ? 66 LEU A CD2  3  
ATOM   3342  H H    . LEU A 1 66 ? 7.859   -2.444  -8.166  1.00 4.58  ? 66 LEU A H    3  
ATOM   3343  H HA   . LEU A 1 66 ? 7.190   -1.971  -10.963 1.00 6.03  ? 66 LEU A HA   3  
ATOM   3344  H HB2  . LEU A 1 66 ? 7.029   -0.333  -8.942  1.00 5.67  ? 66 LEU A HB2  3  
ATOM   3345  H HB3  . LEU A 1 66 ? 8.743   -0.046  -9.242  1.00 6.42  ? 66 LEU A HB3  3  
ATOM   3346  H HG   . LEU A 1 66 ? 8.013   0.313   -11.719 1.00 7.39  ? 66 LEU A HG   3  
ATOM   3347  H HD11 . LEU A 1 66 ? 5.648   -0.543  -11.117 1.00 7.49  ? 66 LEU A HD11 3  
ATOM   3348  H HD12 . LEU A 1 66 ? 5.399   1.045   -10.393 1.00 8.02  ? 66 LEU A HD12 3  
ATOM   3349  H HD13 . LEU A 1 66 ? 5.755   0.907   -12.115 1.00 7.94  ? 66 LEU A HD13 3  
ATOM   3350  H HD21 . LEU A 1 66 ? 7.308   2.272   -9.508  1.00 7.84  ? 66 LEU A HD21 3  
ATOM   3351  H HD22 . LEU A 1 66 ? 8.868   2.118   -10.316 1.00 7.67  ? 66 LEU A HD22 3  
ATOM   3352  H HD23 . LEU A 1 66 ? 7.466   2.704   -11.211 1.00 8.14  ? 66 LEU A HD23 3  
ATOM   3353  N N    . LYS A 1 67 ? 10.394  -1.882  -10.100 1.00 6.57  ? 67 LYS A N    3  
ATOM   3354  C CA   . LYS A 1 67 ? 11.766  -2.029  -10.680 1.00 7.47  ? 67 LYS A CA   3  
ATOM   3355  C C    . LYS A 1 67 ? 12.019  -3.495  -11.053 1.00 7.85  ? 67 LYS A C    3  
ATOM   3356  O O    . LYS A 1 67 ? 11.835  -4.390  -10.248 1.00 8.14  ? 67 LYS A O    3  
ATOM   3357  C CB   . LYS A 1 67 ? 12.813  -1.574  -9.655  1.00 7.84  ? 67 LYS A CB   3  
ATOM   3358  C CG   . LYS A 1 67 ? 12.914  -0.046  -9.662  1.00 8.78  ? 67 LYS A CG   3  
ATOM   3359  C CD   . LYS A 1 67 ? 13.753  0.410   -10.859 1.00 9.42  ? 67 LYS A CD   3  
ATOM   3360  C CE   . LYS A 1 67 ? 13.931  1.931   -10.814 1.00 10.12 ? 67 LYS A CE   3  
ATOM   3361  N NZ   . LYS A 1 67 ? 13.851  2.486   -12.195 1.00 10.40 ? 67 LYS A NZ   3  
ATOM   3362  H H    . LYS A 1 67 ? 10.284  -1.721  -9.139  1.00 6.04  ? 67 LYS A H    3  
ATOM   3363  H HA   . LYS A 1 67 ? 11.846  -1.418  -11.566 1.00 7.85  ? 67 LYS A HA   3  
ATOM   3364  H HB2  . LYS A 1 67 ? 12.522  -1.913  -8.671  1.00 7.78  ? 67 LYS A HB2  3  
ATOM   3365  H HB3  . LYS A 1 67 ? 13.773  -1.998  -9.911  1.00 7.75  ? 67 LYS A HB3  3  
ATOM   3366  H HG2  . LYS A 1 67 ? 11.923  0.380   -9.733  1.00 9.30  ? 67 LYS A HG2  3  
ATOM   3367  H HG3  . LYS A 1 67 ? 13.384  0.287   -8.749  1.00 8.71  ? 67 LYS A HG3  3  
ATOM   3368  H HD2  . LYS A 1 67 ? 14.722  -0.066  -10.822 1.00 9.58  ? 67 LYS A HD2  3  
ATOM   3369  H HD3  . LYS A 1 67 ? 13.252  0.137   -11.775 1.00 9.47  ? 67 LYS A HD3  3  
ATOM   3370  H HE2  . LYS A 1 67 ? 13.151  2.368   -10.207 1.00 10.35 ? 67 LYS A HE2  3  
ATOM   3371  H HE3  . LYS A 1 67 ? 14.894  2.169   -10.386 1.00 10.41 ? 67 LYS A HE3  3  
ATOM   3372  H HZ1  . LYS A 1 67 ? 14.568  2.028   -12.795 1.00 10.49 ? 67 LYS A HZ1  3  
ATOM   3373  H HZ2  . LYS A 1 67 ? 12.905  2.310   -12.587 1.00 10.60 ? 67 LYS A HZ2  3  
ATOM   3374  H HZ3  . LYS A 1 67 ? 14.027  3.511   -12.168 1.00 10.51 ? 67 LYS A HZ3  3  
ATOM   3375  N N    . ARG A 1 68 ? 12.438  -3.741  -12.273 1.00 8.12  ? 68 ARG A N    3  
ATOM   3376  C CA   . ARG A 1 68 ? 12.707  -5.146  -12.715 1.00 8.78  ? 68 ARG A CA   3  
ATOM   3377  C C    . ARG A 1 68 ? 13.628  -5.142  -13.945 1.00 8.99  ? 68 ARG A C    3  
ATOM   3378  O O    . ARG A 1 68 ? 14.083  -4.105  -14.393 1.00 8.81  ? 68 ARG A O    3  
ATOM   3379  C CB   . ARG A 1 68 ? 11.384  -5.841  -13.071 1.00 9.33  ? 68 ARG A CB   3  
ATOM   3380  C CG   . ARG A 1 68 ? 10.640  -5.032  -14.141 1.00 9.61  ? 68 ARG A CG   3  
ATOM   3381  C CD   . ARG A 1 68 ? 9.234   -5.603  -14.334 1.00 10.05 ? 68 ARG A CD   3  
ATOM   3382  N NE   . ARG A 1 68 ? 8.489   -4.764  -15.317 1.00 10.53 ? 68 ARG A NE   3  
ATOM   3383  C CZ   . ARG A 1 68 ? 8.091   -3.562  -14.986 1.00 10.90 ? 68 ARG A CZ   3  
ATOM   3384  N NH1  . ARG A 1 68 ? 7.040   -3.409  -14.219 1.00 11.35 ? 68 ARG A NH1  3  
ATOM   3385  N NH2  . ARG A 1 68 ? 8.742   -2.515  -15.422 1.00 11.02 ? 68 ARG A NH2  3  
ATOM   3386  H H    . ARG A 1 68 ? 12.575  -2.999  -12.899 1.00 8.08  ? 68 ARG A H    3  
ATOM   3387  H HA   . ARG A 1 68 ? 13.188  -5.686  -11.913 1.00 9.01  ? 68 ARG A HA   3  
ATOM   3388  H HB2  . ARG A 1 68 ? 11.590  -6.831  -13.451 1.00 9.69  ? 68 ARG A HB2  3  
ATOM   3389  H HB3  . ARG A 1 68 ? 10.771  -5.917  -12.189 1.00 9.41  ? 68 ARG A HB3  3  
ATOM   3390  H HG2  . ARG A 1 68 ? 10.570  -4.000  -13.826 1.00 9.48  ? 68 ARG A HG2  3  
ATOM   3391  H HG3  . ARG A 1 68 ? 11.180  -5.088  -15.074 1.00 9.87  ? 68 ARG A HG3  3  
ATOM   3392  H HD2  . ARG A 1 68 ? 9.304   -6.614  -14.704 1.00 10.14 ? 68 ARG A HD2  3  
ATOM   3393  H HD3  . ARG A 1 68 ? 8.710   -5.601  -13.388 1.00 10.14 ? 68 ARG A HD3  3  
ATOM   3394  H HE   . ARG A 1 68 ? 8.298   -5.114  -16.212 1.00 10.72 ? 68 ARG A HE   3  
ATOM   3395  H HH11 . ARG A 1 68 ? 6.542   -4.210  -13.887 1.00 11.42 ? 68 ARG A HH11 3  
ATOM   3396  H HH12 . ARG A 1 68 ? 6.736   -2.491  -13.965 1.00 11.76 ? 68 ARG A HH12 3  
ATOM   3397  H HH21 . ARG A 1 68 ? 9.544   -2.632  -16.008 1.00 10.82 ? 68 ARG A HH21 3  
ATOM   3398  H HH22 . ARG A 1 68 ? 8.440   -1.595  -15.169 1.00 11.44 ? 68 ARG A HH22 3  
ATOM   3399  N N    . ALA A 1 69 ? 13.898  -6.301  -14.492 1.00 9.61  ? 69 ALA A N    3  
ATOM   3400  C CA   . ALA A 1 69 ? 14.778  -6.389  -15.697 1.00 10.14 ? 69 ALA A CA   3  
ATOM   3401  C C    . ALA A 1 69 ? 14.278  -7.525  -16.601 1.00 10.89 ? 69 ALA A C    3  
ATOM   3402  O O    . ALA A 1 69 ? 14.860  -8.594  -16.654 1.00 11.20 ? 69 ALA A O    3  
ATOM   3403  C CB   . ALA A 1 69 ? 16.222  -6.660  -15.259 1.00 10.08 ? 69 ALA A CB   3  
ATOM   3404  H H    . ALA A 1 69 ? 13.513  -7.120  -14.111 1.00 9.89  ? 69 ALA A H    3  
ATOM   3405  H HA   . ALA A 1 69 ? 14.736  -5.457  -16.240 1.00 10.27 ? 69 ALA A HA   3  
ATOM   3406  H HB1  . ALA A 1 69 ? 16.261  -7.580  -14.694 1.00 10.12 ? 69 ALA A HB1  3  
ATOM   3407  H HB2  . ALA A 1 69 ? 16.853  -6.747  -16.131 1.00 10.18 ? 69 ALA A HB2  3  
ATOM   3408  H HB3  . ALA A 1 69 ? 16.570  -5.845  -14.643 1.00 10.12 ? 69 ALA A HB3  3  
ATOM   3409  N N    . GLU A 1 70 ? 13.194  -7.297  -17.302 1.00 11.37 ? 70 GLU A N    3  
ATOM   3410  C CA   . GLU A 1 70 ? 12.635  -8.355  -18.199 1.00 12.24 ? 70 GLU A CA   3  
ATOM   3411  C C    . GLU A 1 70 ? 11.921  -7.707  -19.394 1.00 12.45 ? 70 GLU A C    3  
ATOM   3412  O O    . GLU A 1 70 ? 11.658  -6.518  -19.403 1.00 12.32 ? 70 GLU A O    3  
ATOM   3413  C CB   . GLU A 1 70 ? 11.639  -9.221  -17.414 1.00 12.79 ? 70 GLU A CB   3  
ATOM   3414  C CG   . GLU A 1 70 ? 10.583  -8.331  -16.742 1.00 12.48 ? 70 GLU A CG   3  
ATOM   3415  C CD   . GLU A 1 70 ? 9.945   -9.080  -15.570 1.00 13.18 ? 70 GLU A CD   3  
ATOM   3416  O OE1  . GLU A 1 70 ? 8.991   -9.803  -15.803 1.00 13.63 ? 70 GLU A OE1  3  
ATOM   3417  O OE2  . GLU A 1 70 ? 10.420  -8.915  -14.458 1.00 13.39 ? 70 GLU A OE2  3  
ATOM   3418  H H    . GLU A 1 70 ? 12.743  -6.429  -17.233 1.00 11.26 ? 70 GLU A H    3  
ATOM   3419  H HA   . GLU A 1 70 ? 13.439  -8.978  -18.562 1.00 12.53 ? 70 GLU A HA   3  
ATOM   3420  H HB2  . GLU A 1 70 ? 11.151  -9.909  -18.090 1.00 13.03 ? 70 GLU A HB2  3  
ATOM   3421  H HB3  . GLU A 1 70 ? 12.170  -9.778  -16.657 1.00 13.32 ? 70 GLU A HB3  3  
ATOM   3422  H HG2  . GLU A 1 70 ? 11.051  -7.428  -16.380 1.00 12.20 ? 70 GLU A HG2  3  
ATOM   3423  H HG3  . GLU A 1 70 ? 9.820   -8.075  -17.462 1.00 12.23 ? 70 GLU A HG3  3  
ATOM   3424  N N    . ASN A 1 71 ? 11.605  -8.487  -20.400 1.00 12.96 ? 71 ASN A N    3  
ATOM   3425  C CA   . ASN A 1 71 ? 10.907  -7.929  -21.600 1.00 13.39 ? 71 ASN A CA   3  
ATOM   3426  C C    . ASN A 1 71 ? 9.396   -7.881  -21.342 1.00 13.77 ? 71 ASN A C    3  
ATOM   3427  O O    . ASN A 1 71 ? 8.776   -6.841  -21.463 1.00 13.98 ? 71 ASN A O    3  
ATOM   3428  C CB   . ASN A 1 71 ? 11.190  -8.817  -22.819 1.00 13.14 ? 71 ASN A CB   3  
ATOM   3429  C CG   . ASN A 1 71 ? 12.650  -8.648  -23.252 1.00 12.70 ? 71 ASN A CG   3  
ATOM   3430  O OD1  . ASN A 1 71 ? 12.982  -7.712  -23.952 1.00 12.77 ? 71 ASN A OD1  3  
ATOM   3431  N ND2  . ASN A 1 71 ? 13.541  -9.521  -22.865 1.00 12.41 ? 71 ASN A ND2  3  
ATOM   3432  H H    . ASN A 1 71 ? 11.826  -9.441  -20.366 1.00 13.17 ? 71 ASN A H    3  
ATOM   3433  H HA   . ASN A 1 71 ? 11.269  -6.929  -21.792 1.00 13.80 ? 71 ASN A HA   3  
ATOM   3434  H HB2  . ASN A 1 71 ? 11.008  -9.850  -22.562 1.00 13.36 ? 71 ASN A HB2  3  
ATOM   3435  H HB3  . ASN A 1 71 ? 10.541  -8.528  -23.633 1.00 13.26 ? 71 ASN A HB3  3  
ATOM   3436  H HD21 . ASN A 1 71 ? 13.277  -10.276 -22.300 1.00 12.47 ? 71 ASN A HD21 3  
ATOM   3437  H HD22 . ASN A 1 71 ? 14.477  -9.418  -23.139 1.00 12.23 ? 71 ASN A HD22 3  
ATOM   3438  N N    . SER A 1 72 ? 8.802   -9.004  -20.985 1.00 14.02 ? 72 SER A N    3  
ATOM   3439  C CA   . SER A 1 72 ? 7.326   -9.051  -20.712 1.00 14.59 ? 72 SER A CA   3  
ATOM   3440  C C    . SER A 1 72 ? 6.538   -8.595  -21.960 1.00 15.09 ? 72 SER A C    3  
ATOM   3441  O O    . SER A 1 72 ? 5.503   -7.966  -21.798 1.00 15.38 ? 72 SER A O    3  
ATOM   3442  C CB   . SER A 1 72 ? 6.998   -8.150  -19.511 1.00 14.66 ? 72 SER A CB   3  
ATOM   3443  O OG   . SER A 1 72 ? 7.748   -8.580  -18.382 1.00 14.60 ? 72 SER A OG   3  
ATOM   3444  O OXT  . SER A 1 72 ? 6.978   -8.897  -23.059 1.00 15.30 ? 72 SER A OXT  3  
ATOM   3445  H H    . SER A 1 72 ? 9.332   -9.823  -20.897 1.00 13.94 ? 72 SER A H    3  
ATOM   3446  H HA   . SER A 1 72 ? 7.047   -10.067 -20.476 1.00 14.77 ? 72 SER A HA   3  
ATOM   3447  H HB2  . SER A 1 72 ? 7.257   -7.130  -19.740 1.00 14.69 ? 72 SER A HB2  3  
ATOM   3448  H HB3  . SER A 1 72 ? 5.939   -8.211  -19.297 1.00 14.91 ? 72 SER A HB3  3  
ATOM   3449  H HG   . SER A 1 72 ? 7.246   -9.266  -17.936 1.00 14.50 ? 72 SER A HG   3  
ATOM   3450  N N    . GLU A 1 4  ? -7.883  14.635  -9.805  1.00 9.58  ? 4  GLU A N    4  
ATOM   3451  C CA   . GLU A 1 4  ? -8.981  15.240  -8.995  1.00 9.09  ? 4  GLU A CA   4  
ATOM   3452  C C    . GLU A 1 4  ? -9.787  14.124  -8.310  1.00 8.06  ? 4  GLU A C    4  
ATOM   3453  O O    . GLU A 1 4  ? -10.928 13.865  -8.651  1.00 8.10  ? 4  GLU A O    4  
ATOM   3454  C CB   . GLU A 1 4  ? -9.900  16.062  -9.912  1.00 9.77  ? 4  GLU A CB   4  
ATOM   3455  C CG   . GLU A 1 4  ? -9.298  17.453  -10.132 1.00 10.24 ? 4  GLU A CG   4  
ATOM   3456  C CD   . GLU A 1 4  ? -10.136 18.218  -11.160 1.00 11.04 ? 4  GLU A CD   4  
ATOM   3457  O OE1  . GLU A 1 4  ? -11.168 18.748  -10.780 1.00 11.49 ? 4  GLU A OE1  4  
ATOM   3458  O OE2  . GLU A 1 4  ? -9.731  18.260  -12.311 1.00 11.36 ? 4  GLU A OE2  4  
ATOM   3459  H H    . GLU A 1 4  ? -8.281  13.940  -10.469 1.00 9.61  ? 4  GLU A H    4  
ATOM   3460  H HA   . GLU A 1 4  ? -8.554  15.887  -8.243  1.00 9.22  ? 4  GLU A HA   4  
ATOM   3461  H HB2  . GLU A 1 4  ? -10.002 15.559  -10.863 1.00 9.96  ? 4  GLU A HB2  4  
ATOM   3462  H HB3  . GLU A 1 4  ? -10.872 16.162  -9.453  1.00 9.97  ? 4  GLU A HB3  4  
ATOM   3463  H HG2  . GLU A 1 4  ? -9.293  17.994  -9.197  1.00 10.27 ? 4  GLU A HG2  4  
ATOM   3464  H HG3  . GLU A 1 4  ? -8.288  17.354  -10.496 1.00 10.19 ? 4  GLU A HG3  4  
ATOM   3465  N N    . LEU A 1 5  ? -9.195  13.458  -7.347  1.00 7.36  ? 5  LEU A N    4  
ATOM   3466  C CA   . LEU A 1 5  ? -9.915  12.356  -6.638  1.00 6.53  ? 5  LEU A CA   4  
ATOM   3467  C C    . LEU A 1 5  ? -9.301  12.149  -5.248  1.00 6.17  ? 5  LEU A C    4  
ATOM   3468  O O    . LEU A 1 5  ? -8.112  11.926  -5.114  1.00 6.61  ? 5  LEU A O    4  
ATOM   3469  C CB   . LEU A 1 5  ? -9.794  11.061  -7.449  1.00 6.34  ? 5  LEU A CB   4  
ATOM   3470  C CG   . LEU A 1 5  ? -11.062 10.219  -7.269  1.00 7.26  ? 5  LEU A CG   4  
ATOM   3471  C CD1  . LEU A 1 5  ? -11.423 9.547   -8.596  1.00 7.60  ? 5  LEU A CD1  4  
ATOM   3472  C CD2  . LEU A 1 5  ? -10.815 9.145   -6.203  1.00 7.86  ? 5  LEU A CD2  4  
ATOM   3473  H H    . LEU A 1 5  ? -8.275  13.681  -7.092  1.00 7.57  ? 5  LEU A H    4  
ATOM   3474  H HA   . LEU A 1 5  ? -10.958 12.618  -6.533  1.00 6.63  ? 5  LEU A HA   4  
ATOM   3475  H HB2  . LEU A 1 5  ? -9.669  11.304  -8.495  1.00 5.88  ? 5  LEU A HB2  4  
ATOM   3476  H HB3  . LEU A 1 5  ? -8.938  10.499  -7.107  1.00 6.33  ? 5  LEU A HB3  4  
ATOM   3477  H HG   . LEU A 1 5  ? -11.876 10.857  -6.956  1.00 7.52  ? 5  LEU A HG   4  
ATOM   3478  H HD11 . LEU A 1 5  ? -10.545 9.076   -9.012  1.00 7.24  ? 5  LEU A HD11 4  
ATOM   3479  H HD12 . LEU A 1 5  ? -12.187 8.803   -8.427  1.00 7.97  ? 5  LEU A HD12 4  
ATOM   3480  H HD13 . LEU A 1 5  ? -11.793 10.292  -9.287  1.00 8.07  ? 5  LEU A HD13 4  
ATOM   3481  H HD21 . LEU A 1 5  ? -9.815  9.251   -5.807  1.00 7.79  ? 5  LEU A HD21 4  
ATOM   3482  H HD22 . LEU A 1 5  ? -11.532 9.259   -5.404  1.00 8.13  ? 5  LEU A HD22 4  
ATOM   3483  H HD23 . LEU A 1 5  ? -10.923 8.165   -6.646  1.00 8.35  ? 5  LEU A HD23 4  
ATOM   3484  N N    . ARG A 1 6  ? -10.109 12.224  -4.215  1.00 5.61  ? 6  ARG A N    4  
ATOM   3485  C CA   . ARG A 1 6  ? -9.590  12.038  -2.823  1.00 5.48  ? 6  ARG A CA   4  
ATOM   3486  C C    . ARG A 1 6  ? -9.070  10.609  -2.626  1.00 4.69  ? 6  ARG A C    4  
ATOM   3487  O O    . ARG A 1 6  ? -9.167  9.771   -3.505  1.00 4.64  ? 6  ARG A O    4  
ATOM   3488  C CB   . ARG A 1 6  ? -10.712 12.313  -1.814  1.00 6.06  ? 6  ARG A CB   4  
ATOM   3489  C CG   . ARG A 1 6  ? -11.963 11.495  -2.165  1.00 6.84  ? 6  ARG A CG   4  
ATOM   3490  C CD   . ARG A 1 6  ? -12.233 10.468  -1.062  1.00 7.76  ? 6  ARG A CD   4  
ATOM   3491  N NE   . ARG A 1 6  ? -13.387 10.919  -0.231  1.00 8.57  ? 6  ARG A NE   4  
ATOM   3492  C CZ   . ARG A 1 6  ? -13.372 10.740  1.063   1.00 9.27  ? 6  ARG A CZ   4  
ATOM   3493  N NH1  . ARG A 1 6  ? -12.644 11.517  1.825   1.00 9.77  ? 6  ARG A NH1  4  
ATOM   3494  N NH2  . ARG A 1 6  ? -14.089 9.783   1.598   1.00 9.70  ? 6  ARG A NH2  4  
ATOM   3495  H H    . ARG A 1 6  ? -11.060 12.406  -4.353  1.00 5.45  ? 6  ARG A H    4  
ATOM   3496  H HA   . ARG A 1 6  ? -8.784  12.734  -2.651  1.00 5.83  ? 6  ARG A HA   4  
ATOM   3497  H HB2  . ARG A 1 6  ? -10.375 12.042  -0.830  1.00 6.17  ? 6  ARG A HB2  4  
ATOM   3498  H HB3  . ARG A 1 6  ? -10.955 13.362  -1.829  1.00 6.11  ? 6  ARG A HB3  4  
ATOM   3499  H HG2  . ARG A 1 6  ? -12.811 12.157  -2.257  1.00 6.68  ? 6  ARG A HG2  4  
ATOM   3500  H HG3  . ARG A 1 6  ? -11.807 10.979  -3.101  1.00 7.20  ? 6  ARG A HG3  4  
ATOM   3501  H HD2  . ARG A 1 6  ? -12.464 9.512   -1.510  1.00 8.01  ? 6  ARG A HD2  4  
ATOM   3502  H HD3  . ARG A 1 6  ? -11.356 10.369  -0.438  1.00 7.82  ? 6  ARG A HD3  4  
ATOM   3503  H HE   . ARG A 1 6  ? -14.159 11.349  -0.656  1.00 8.74  ? 6  ARG A HE   4  
ATOM   3504  H HH11 . ARG A 1 6  ? -12.099 12.250  1.415   1.00 9.63  ? 6  ARG A HH11 4  
ATOM   3505  H HH12 . ARG A 1 6  ? -12.632 11.382  2.815   1.00 10.41 ? 6  ARG A HH12 4  
ATOM   3506  H HH21 . ARG A 1 6  ? -14.646 9.190   1.017   1.00 9.50  ? 6  ARG A HH21 4  
ATOM   3507  H HH22 . ARG A 1 6  ? -14.079 9.644   2.589   1.00 10.35 ? 6  ARG A HH22 4  
ATOM   3508  N N    . CYS A 1 7  ? -8.518  10.330  -1.468  1.00 4.47  ? 7  CYS A N    4  
ATOM   3509  C CA   . CYS A 1 7  ? -7.986  8.962   -1.193  1.00 4.05  ? 7  CYS A CA   4  
ATOM   3510  C C    . CYS A 1 7  ? -9.141  7.958   -1.174  1.00 4.38  ? 7  CYS A C    4  
ATOM   3511  O O    . CYS A 1 7  ? -10.070 8.083   -0.395  1.00 4.93  ? 7  CYS A O    4  
ATOM   3512  C CB   . CYS A 1 7  ? -7.280  8.945   0.165   1.00 4.32  ? 7  CYS A CB   4  
ATOM   3513  S SG   . CYS A 1 7  ? -5.542  9.401   -0.054  1.00 4.79  ? 7  CYS A SG   4  
ATOM   3514  H H    . CYS A 1 7  ? -8.458  11.026  -0.779  1.00 4.87  ? 7  CYS A H    4  
ATOM   3515  H HA   . CYS A 1 7  ? -7.283  8.689   -1.964  1.00 3.89  ? 7  CYS A HA   4  
ATOM   3516  H HB2  . CYS A 1 7  ? -7.758  9.646   0.830   1.00 4.81  ? 7  CYS A HB2  4  
ATOM   3517  H HB3  . CYS A 1 7  ? -7.340  7.955   0.587   1.00 4.30  ? 7  CYS A HB3  4  
ATOM   3518  N N    . GLN A 1 8  ? -9.088  6.964   -2.026  1.00 4.51  ? 8  GLN A N    4  
ATOM   3519  C CA   . GLN A 1 8  ? -10.174 5.943   -2.068  1.00 5.30  ? 8  GLN A CA   4  
ATOM   3520  C C    . GLN A 1 8  ? -10.066 4.977   -0.871  1.00 5.47  ? 8  GLN A C    4  
ATOM   3521  O O    . GLN A 1 8  ? -10.920 4.130   -0.684  1.00 6.21  ? 8  GLN A O    4  
ATOM   3522  C CB   . GLN A 1 8  ? -10.067 5.154   -3.379  1.00 5.63  ? 8  GLN A CB   4  
ATOM   3523  C CG   . GLN A 1 8  ? -8.756  4.355   -3.409  1.00 6.22  ? 8  GLN A CG   4  
ATOM   3524  C CD   . GLN A 1 8  ? -9.067  2.864   -3.569  1.00 7.21  ? 8  GLN A CD   4  
ATOM   3525  O OE1  . GLN A 1 8  ? -9.577  2.237   -2.660  1.00 7.78  ? 8  GLN A OE1  4  
ATOM   3526  N NE2  . GLN A 1 8  ? -8.783  2.263   -4.692  1.00 7.68  ? 8  GLN A NE2  4  
ATOM   3527  H H    . GLN A 1 8  ? -8.331  6.886   -2.641  1.00 4.40  ? 8  GLN A H    4  
ATOM   3528  H HA   . GLN A 1 8  ? -11.132 6.443   -2.035  1.00 5.87  ? 8  GLN A HA   4  
ATOM   3529  H HB2  . GLN A 1 8  ? -10.900 4.479   -3.455  1.00 5.62  ? 8  GLN A HB2  4  
ATOM   3530  H HB3  . GLN A 1 8  ? -10.086 5.840   -4.213  1.00 5.89  ? 8  GLN A HB3  4  
ATOM   3531  H HG2  . GLN A 1 8  ? -8.153  4.688   -4.241  1.00 6.11  ? 8  GLN A HG2  4  
ATOM   3532  H HG3  . GLN A 1 8  ? -8.215  4.511   -2.488  1.00 6.39  ? 8  GLN A HG3  4  
ATOM   3533  H HE21 . GLN A 1 8  ? -8.373  2.766   -5.427  1.00 7.43  ? 8  GLN A HE21 4  
ATOM   3534  H HE22 . GLN A 1 8  ? -8.980  1.311   -4.801  1.00 8.44  ? 8  GLN A HE22 4  
ATOM   3535  N N    . CYS A 1 9  ? -9.029  5.088   -0.064  1.00 5.04  ? 9  CYS A N    4  
ATOM   3536  C CA   . CYS A 1 9  ? -8.887  4.166   1.103   1.00 5.45  ? 9  CYS A CA   4  
ATOM   3537  C C    . CYS A 1 9  ? -8.751  4.967   2.399   1.00 5.99  ? 9  CYS A C    4  
ATOM   3538  O O    . CYS A 1 9  ? -7.722  5.562   2.668   1.00 6.13  ? 9  CYS A O    4  
ATOM   3539  C CB   . CYS A 1 9  ? -7.644  3.289   0.917   1.00 5.08  ? 9  CYS A CB   4  
ATOM   3540  S SG   . CYS A 1 9  ? -8.139  1.642   0.351   1.00 5.12  ? 9  CYS A SG   4  
ATOM   3541  H H    . CYS A 1 9  ? -8.346  5.774   -0.227  1.00 4.65  ? 9  CYS A H    4  
ATOM   3542  H HA   . CYS A 1 9  ? -9.760  3.534   1.170   1.00 5.89  ? 9  CYS A HA   4  
ATOM   3543  H HB2  . CYS A 1 9  ? -6.993  3.738   0.183   1.00 4.67  ? 9  CYS A HB2  4  
ATOM   3544  H HB3  . CYS A 1 9  ? -7.119  3.203   1.857   1.00 5.54  ? 9  CYS A HB3  4  
ATOM   3545  N N    . ILE A 1 10 ? -9.777  4.958   3.220   1.00 6.61  ? 10 ILE A N    4  
ATOM   3546  C CA   . ILE A 1 10 ? -9.704  5.684   4.526   1.00 7.44  ? 10 ILE A CA   4  
ATOM   3547  C C    . ILE A 1 10 ? -8.690  4.955   5.417   1.00 7.48  ? 10 ILE A C    4  
ATOM   3548  O O    . ILE A 1 10 ? -7.973  5.563   6.190   1.00 8.16  ? 10 ILE A O    4  
ATOM   3549  C CB   . ILE A 1 10 ? -11.086 5.688   5.199   1.00 8.38  ? 10 ILE A CB   4  
ATOM   3550  C CG1  . ILE A 1 10 ? -12.097 6.408   4.297   1.00 8.63  ? 10 ILE A CG1  4  
ATOM   3551  C CG2  . ILE A 1 10 ? -11.002 6.415   6.545   1.00 9.31  ? 10 ILE A CG2  4  
ATOM   3552  C CD1  . ILE A 1 10 ? -13.092 5.395   3.725   1.00 9.47  ? 10 ILE A CD1  4  
ATOM   3553  H H    . ILE A 1 10 ? -10.583 4.449   2.988   1.00 6.69  ? 10 ILE A H    4  
ATOM   3554  H HA   . ILE A 1 10 ? -9.376  6.699   4.358   1.00 7.59  ? 10 ILE A HA   4  
ATOM   3555  H HB   . ILE A 1 10 ? -11.407 4.669   5.364   1.00 8.40  ? 10 ILE A HB   4  
ATOM   3556  H HG12 . ILE A 1 10 ? -12.631 7.149   4.874   1.00 8.91  ? 10 ILE A HG12 4  
ATOM   3557  H HG13 . ILE A 1 10 ? -11.575 6.893   3.486   1.00 8.14  ? 10 ILE A HG13 4  
ATOM   3558  H HG21 . ILE A 1 10 ? -10.414 7.314   6.433   1.00 9.27  ? 10 ILE A HG21 4  
ATOM   3559  H HG22 . ILE A 1 10 ? -11.997 6.675   6.877   1.00 9.78  ? 10 ILE A HG22 4  
ATOM   3560  H HG23 . ILE A 1 10 ? -10.537 5.769   7.276   1.00 9.72  ? 10 ILE A HG23 4  
ATOM   3561  H HD11 . ILE A 1 10 ? -13.055 4.485   4.305   1.00 9.66  ? 10 ILE A HD11 4  
ATOM   3562  H HD12 . ILE A 1 10 ? -14.090 5.808   3.767   1.00 9.77  ? 10 ILE A HD12 4  
ATOM   3563  H HD13 . ILE A 1 10 ? -12.836 5.179   2.699   1.00 9.76  ? 10 ILE A HD13 4  
ATOM   3564  N N    . LYS A 1 11 ? -8.620  3.650   5.285   1.00 6.93  ? 11 LYS A N    4  
ATOM   3565  C CA   . LYS A 1 11 ? -7.651  2.844   6.081   1.00 7.15  ? 11 LYS A CA   4  
ATOM   3566  C C    . LYS A 1 11 ? -6.793  2.037   5.101   1.00 6.42  ? 11 LYS A C    4  
ATOM   3567  O O    . LYS A 1 11 ? -7.310  1.337   4.249   1.00 6.35  ? 11 LYS A O    4  
ATOM   3568  C CB   . LYS A 1 11 ? -8.412  1.895   7.014   1.00 8.05  ? 11 LYS A CB   4  
ATOM   3569  C CG   . LYS A 1 11 ? -9.230  2.712   8.021   1.00 8.65  ? 11 LYS A CG   4  
ATOM   3570  C CD   . LYS A 1 11 ? -10.160 1.782   8.809   1.00 9.04  ? 11 LYS A CD   4  
ATOM   3571  C CE   . LYS A 1 11 ? -9.442  1.280   10.065  1.00 9.50  ? 11 LYS A CE   4  
ATOM   3572  N NZ   . LYS A 1 11 ? -9.074  -0.154  9.892   1.00 9.69  ? 11 LYS A NZ   4  
ATOM   3573  H H    . LYS A 1 11 ? -9.202  3.198   4.639   1.00 6.52  ? 11 LYS A H    4  
ATOM   3574  H HA   . LYS A 1 11 ? -7.019  3.502   6.661   1.00 7.36  ? 11 LYS A HA   4  
ATOM   3575  H HB2  . LYS A 1 11 ? -9.074  1.272   6.431   1.00 8.15  ? 11 LYS A HB2  4  
ATOM   3576  H HB3  . LYS A 1 11 ? -7.708  1.274   7.547   1.00 8.38  ? 11 LYS A HB3  4  
ATOM   3577  H HG2  . LYS A 1 11 ? -8.561  3.215   8.703   1.00 9.16  ? 11 LYS A HG2  4  
ATOM   3578  H HG3  . LYS A 1 11 ? -9.823  3.444   7.493   1.00 8.50  ? 11 LYS A HG3  4  
ATOM   3579  H HD2  . LYS A 1 11 ? -11.049 2.325   9.096   1.00 9.00  ? 11 LYS A HD2  4  
ATOM   3580  H HD3  . LYS A 1 11 ? -10.436 0.940   8.193   1.00 9.26  ? 11 LYS A HD3  4  
ATOM   3581  H HE2  . LYS A 1 11 ? -8.548  1.864   10.229  1.00 9.79  ? 11 LYS A HE2  4  
ATOM   3582  H HE3  . LYS A 1 11 ? -10.097 1.381   10.918  1.00 9.62  ? 11 LYS A HE3  4  
ATOM   3583  H HZ1  . LYS A 1 11 ? -8.480  -0.259  9.043   1.00 9.86  ? 11 LYS A HZ1  4  
ATOM   3584  H HZ2  . LYS A 1 11 ? -8.546  -0.480  10.726  1.00 9.61  ? 11 LYS A HZ2  4  
ATOM   3585  H HZ3  . LYS A 1 11 ? -9.935  -0.725  9.786   1.00 9.96  ? 11 LYS A HZ3  4  
ATOM   3586  N N    . THR A 1 12 ? -5.489  2.144   5.195   1.00 6.02  ? 12 THR A N    4  
ATOM   3587  C CA   . THR A 1 12 ? -4.605  1.396   4.248   1.00 5.35  ? 12 THR A CA   4  
ATOM   3588  C C    . THR A 1 12 ? -4.260  0.013   4.794   1.00 5.31  ? 12 THR A C    4  
ATOM   3589  O O    . THR A 1 12 ? -4.733  -0.403  5.836   1.00 5.80  ? 12 THR A O    4  
ATOM   3590  C CB   . THR A 1 12 ? -3.305  2.171   3.992   1.00 5.23  ? 12 THR A CB   4  
ATOM   3591  O OG1  . THR A 1 12 ? -3.096  3.141   5.012   1.00 5.90  ? 12 THR A OG1  4  
ATOM   3592  C CG2  . THR A 1 12 ? -3.383  2.850   2.629   1.00 5.32  ? 12 THR A CG2  4  
ATOM   3593  H H    . THR A 1 12 ? -5.094  2.727   5.879   1.00 6.26  ? 12 THR A H    4  
ATOM   3594  H HA   . THR A 1 12 ? -5.125  1.276   3.309   1.00 5.27  ? 12 THR A HA   4  
ATOM   3595  H HB   . THR A 1 12 ? -2.479  1.475   3.986   1.00 4.85  ? 12 THR A HB   4  
ATOM   3596  H HG1  . THR A 1 12 ? -2.749  2.689   5.785   1.00 6.31  ? 12 THR A HG1  4  
ATOM   3597  H HG21 . THR A 1 12 ? -4.282  3.442   2.572   1.00 5.52  ? 12 THR A HG21 4  
ATOM   3598  H HG22 . THR A 1 12 ? -2.521  3.485   2.496   1.00 5.48  ? 12 THR A HG22 4  
ATOM   3599  H HG23 . THR A 1 12 ? -3.397  2.095   1.854   1.00 5.41  ? 12 THR A HG23 4  
ATOM   3600  N N    . TYR A 1 13 ? -3.438  -0.704  4.070   1.00 4.96  ? 13 TYR A N    4  
ATOM   3601  C CA   . TYR A 1 13 ? -3.041  -2.072  4.490   1.00 5.03  ? 13 TYR A CA   4  
ATOM   3602  C C    . TYR A 1 13 ? -1.737  -2.014  5.292   1.00 5.08  ? 13 TYR A C    4  
ATOM   3603  O O    . TYR A 1 13 ? -0.673  -1.763  4.752   1.00 4.67  ? 13 TYR A O    4  
ATOM   3604  C CB   . TYR A 1 13 ? -2.841  -2.925  3.233   1.00 4.85  ? 13 TYR A CB   4  
ATOM   3605  C CG   . TYR A 1 13 ? -2.917  -4.390  3.565   1.00 5.22  ? 13 TYR A CG   4  
ATOM   3606  C CD1  . TYR A 1 13 ? -3.748  -4.843  4.594   1.00 5.34  ? 13 TYR A CD1  4  
ATOM   3607  C CD2  . TYR A 1 13 ? -2.151  -5.294  2.827   1.00 5.75  ? 13 TYR A CD2  4  
ATOM   3608  C CE1  . TYR A 1 13 ? -3.811  -6.209  4.890   1.00 5.79  ? 13 TYR A CE1  4  
ATOM   3609  C CE2  . TYR A 1 13 ? -2.211  -6.662  3.119   1.00 6.30  ? 13 TYR A CE2  4  
ATOM   3610  C CZ   . TYR A 1 13 ? -3.042  -7.120  4.152   1.00 6.23  ? 13 TYR A CZ   4  
ATOM   3611  O OH   . TYR A 1 13 ? -3.105  -8.469  4.440   1.00 6.84  ? 13 TYR A OH   4  
ATOM   3612  H H    . TYR A 1 13 ? -3.087  -0.337  3.232   1.00 4.82  ? 13 TYR A H    4  
ATOM   3613  H HA   . TYR A 1 13 ? -3.821  -2.501  5.097   1.00 5.34  ? 13 TYR A HA   4  
ATOM   3614  H HB2  . TYR A 1 13 ? -3.606  -2.686  2.512   1.00 4.90  ? 13 TYR A HB2  4  
ATOM   3615  H HB3  . TYR A 1 13 ? -1.873  -2.712  2.810   1.00 4.67  ? 13 TYR A HB3  4  
ATOM   3616  H HD1  . TYR A 1 13 ? -4.340  -4.133  5.158   1.00 5.30  ? 13 TYR A HD1  4  
ATOM   3617  H HD2  . TYR A 1 13 ? -1.514  -4.930  2.028   1.00 5.92  ? 13 TYR A HD2  4  
ATOM   3618  H HE1  . TYR A 1 13 ? -4.452  -6.562  5.685   1.00 5.99  ? 13 TYR A HE1  4  
ATOM   3619  H HE2  . TYR A 1 13 ? -1.619  -7.363  2.551   1.00 6.92  ? 13 TYR A HE2  4  
ATOM   3620  H HH   . TYR A 1 13 ? -2.396  -8.676  5.053   1.00 7.17  ? 13 TYR A HH   4  
ATOM   3621  N N    . SER A 1 14 ? -1.815  -2.257  6.576   1.00 5.82  ? 14 SER A N    4  
ATOM   3622  C CA   . SER A 1 14 ? -0.587  -2.238  7.429   1.00 6.06  ? 14 SER A CA   4  
ATOM   3623  C C    . SER A 1 14 ? 0.074   -3.622  7.401   1.00 6.51  ? 14 SER A C    4  
ATOM   3624  O O    . SER A 1 14 ? 1.279   -3.739  7.535   1.00 6.88  ? 14 SER A O    4  
ATOM   3625  C CB   . SER A 1 14 ? -0.965  -1.875  8.869   1.00 6.42  ? 14 SER A CB   4  
ATOM   3626  O OG   . SER A 1 14 ? -1.451  -0.540  8.905   1.00 6.80  ? 14 SER A OG   4  
ATOM   3627  H H    . SER A 1 14 ? -2.684  -2.465  6.981   1.00 6.33  ? 14 SER A H    4  
ATOM   3628  H HA   . SER A 1 14 ? 0.107   -1.506  7.042   1.00 5.81  ? 14 SER A HA   4  
ATOM   3629  H HB2  . SER A 1 14 ? -1.734  -2.542  9.220   1.00 6.57  ? 14 SER A HB2  4  
ATOM   3630  H HB3  . SER A 1 14 ? -0.092  -1.970  9.502   1.00 6.52  ? 14 SER A HB3  4  
ATOM   3631  H HG   . SER A 1 14 ? -0.709  0.042   9.092   1.00 7.03  ? 14 SER A HG   4  
ATOM   3632  N N    . LYS A 1 15 ? -0.698  -4.670  7.211   1.00 6.59  ? 15 LYS A N    4  
ATOM   3633  C CA   . LYS A 1 15 ? -0.102  -6.038  7.157   1.00 7.06  ? 15 LYS A CA   4  
ATOM   3634  C C    . LYS A 1 15 ? 0.576   -6.213  5.790   1.00 6.32  ? 15 LYS A C    4  
ATOM   3635  O O    . LYS A 1 15 ? 0.032   -5.814  4.781   1.00 6.13  ? 15 LYS A O    4  
ATOM   3636  C CB   . LYS A 1 15 ? -1.162  -7.141  7.322   1.00 7.75  ? 15 LYS A CB   4  
ATOM   3637  C CG   . LYS A 1 15 ? -2.443  -6.622  8.002   1.00 8.64  ? 15 LYS A CG   4  
ATOM   3638  C CD   . LYS A 1 15 ? -2.135  -6.193  9.442   1.00 9.43  ? 15 LYS A CD   4  
ATOM   3639  C CE   . LYS A 1 15 ? -3.254  -6.671  10.372  1.00 10.20 ? 15 LYS A CE   4  
ATOM   3640  N NZ   . LYS A 1 15 ? -2.920  -8.023  10.907  1.00 10.59 ? 15 LYS A NZ   4  
ATOM   3641  H H    . LYS A 1 15 ? -1.658  -4.552  7.091   1.00 6.42  ? 15 LYS A H    4  
ATOM   3642  H HA   . LYS A 1 15 ? 0.637   -6.132  7.940   1.00 7.57  ? 15 LYS A HA   4  
ATOM   3643  H HB2  . LYS A 1 15 ? -1.405  -7.531  6.353   1.00 7.79  ? 15 LYS A HB2  4  
ATOM   3644  H HB3  . LYS A 1 15 ? -0.747  -7.931  7.919   1.00 7.79  ? 15 LYS A HB3  4  
ATOM   3645  H HG2  . LYS A 1 15 ? -2.835  -5.783  7.449   1.00 8.72  ? 15 LYS A HG2  4  
ATOM   3646  H HG3  . LYS A 1 15 ? -3.181  -7.411  8.018   1.00 8.87  ? 15 LYS A HG3  4  
ATOM   3647  H HD2  . LYS A 1 15 ? -1.196  -6.628  9.754   1.00 9.71  ? 15 LYS A HD2  4  
ATOM   3648  H HD3  . LYS A 1 15 ? -2.067  -5.116  9.488   1.00 9.38  ? 15 LYS A HD3  4  
ATOM   3649  H HE2  . LYS A 1 15 ? -3.360  -5.976  11.193  1.00 10.54 ? 15 LYS A HE2  4  
ATOM   3650  H HE3  . LYS A 1 15 ? -4.184  -6.720  9.824   1.00 10.33 ? 15 LYS A HE3  4  
ATOM   3651  H HZ1  . LYS A 1 15 ? -2.014  -7.982  11.416  1.00 11.09 ? 15 LYS A HZ1  4  
ATOM   3652  H HZ2  . LYS A 1 15 ? -3.671  -8.332  11.559  1.00 10.91 ? 15 LYS A HZ2  4  
ATOM   3653  H HZ3  . LYS A 1 15 ? -2.844  -8.699  10.121  1.00 10.22 ? 15 LYS A HZ3  4  
ATOM   3654  N N    . PRO A 1 16 ? 1.751   -6.790  5.804   1.00 6.02  ? 16 PRO A N    4  
ATOM   3655  C CA   . PRO A 1 16 ? 2.546   -7.014  4.584   1.00 5.35  ? 16 PRO A CA   4  
ATOM   3656  C C    . PRO A 1 16 ? 2.099   -8.286  3.854   1.00 5.50  ? 16 PRO A C    4  
ATOM   3657  O O    . PRO A 1 16 ? 1.480   -9.162  4.431   1.00 6.37  ? 16 PRO A O    4  
ATOM   3658  C CB   . PRO A 1 16 ? 3.970   -7.161  5.122   1.00 5.39  ? 16 PRO A CB   4  
ATOM   3659  C CG   . PRO A 1 16 ? 3.841   -7.589  6.607   1.00 6.26  ? 16 PRO A CG   4  
ATOM   3660  C CD   . PRO A 1 16 ? 2.397   -7.269  7.037   1.00 6.51  ? 16 PRO A CD   4  
ATOM   3661  H HA   . PRO A 1 16 ? 2.490   -6.162  3.930   1.00 4.92  ? 16 PRO A HA   4  
ATOM   3662  H HB2  . PRO A 1 16 ? 4.499   -7.907  4.560   1.00 5.32  ? 16 PRO A HB2  4  
ATOM   3663  H HB3  . PRO A 1 16 ? 4.484   -6.221  5.058   1.00 5.10  ? 16 PRO A HB3  4  
ATOM   3664  H HG2  . PRO A 1 16 ? 4.034   -8.649  6.703   1.00 6.77  ? 16 PRO A HG2  4  
ATOM   3665  H HG3  . PRO A 1 16 ? 4.534   -7.029  7.214   1.00 6.37  ? 16 PRO A HG3  4  
ATOM   3666  H HD2  . PRO A 1 16 ? 1.906   -8.162  7.399   1.00 7.06  ? 16 PRO A HD2  4  
ATOM   3667  H HD3  . PRO A 1 16 ? 2.378   -6.498  7.786   1.00 6.63  ? 16 PRO A HD3  4  
ATOM   3668  N N    . PHE A 1 17 ? 2.419   -8.388  2.586   1.00 4.76  ? 17 PHE A N    4  
ATOM   3669  C CA   . PHE A 1 17 ? 2.028   -9.602  1.801   1.00 4.96  ? 17 PHE A CA   4  
ATOM   3670  C C    . PHE A 1 17 ? 2.892   -9.714  0.531   1.00 4.78  ? 17 PHE A C    4  
ATOM   3671  O O    . PHE A 1 17 ? 3.477   -8.747  0.077   1.00 4.77  ? 17 PHE A O    4  
ATOM   3672  C CB   . PHE A 1 17 ? 0.527   -9.542  1.445   1.00 4.69  ? 17 PHE A CB   4  
ATOM   3673  C CG   . PHE A 1 17 ? 0.247   -8.508  0.373   1.00 3.72  ? 17 PHE A CG   4  
ATOM   3674  C CD1  . PHE A 1 17 ? 0.338   -7.140  0.666   1.00 3.29  ? 17 PHE A CD1  4  
ATOM   3675  C CD2  . PHE A 1 17 ? -0.117  -8.922  -0.915  1.00 3.74  ? 17 PHE A CD2  4  
ATOM   3676  C CE1  . PHE A 1 17 ? 0.066   -6.191  -0.327  1.00 2.59  ? 17 PHE A CE1  4  
ATOM   3677  C CE2  . PHE A 1 17 ? -0.387  -7.973  -1.907  1.00 3.14  ? 17 PHE A CE2  4  
ATOM   3678  C CZ   . PHE A 1 17 ? -0.296  -6.607  -1.613  1.00 2.38  ? 17 PHE A CZ   4  
ATOM   3679  H H    . PHE A 1 17 ? 2.926   -7.667  2.155   1.00 4.19  ? 17 PHE A H    4  
ATOM   3680  H HA   . PHE A 1 17 ? 2.204   -10.476 2.412   1.00 5.66  ? 17 PHE A HA   4  
ATOM   3681  H HB2  . PHE A 1 17 ? 0.211   -10.511 1.089   1.00 5.13  ? 17 PHE A HB2  4  
ATOM   3682  H HB3  . PHE A 1 17 ? -0.037  -9.294  2.333   1.00 5.06  ? 17 PHE A HB3  4  
ATOM   3683  H HD1  . PHE A 1 17 ? 0.614   -6.818  1.659   1.00 3.86  ? 17 PHE A HD1  4  
ATOM   3684  H HD2  . PHE A 1 17 ? -0.192  -9.975  -1.143  1.00 4.51  ? 17 PHE A HD2  4  
ATOM   3685  H HE1  . PHE A 1 17 ? 0.135   -5.137  -0.101  1.00 2.72  ? 17 PHE A HE1  4  
ATOM   3686  H HE2  . PHE A 1 17 ? -0.667  -8.293  -2.900  1.00 3.62  ? 17 PHE A HE2  4  
ATOM   3687  H HZ   . PHE A 1 17 ? -0.504  -5.876  -2.379  1.00 2.18  ? 17 PHE A HZ   4  
ATOM   3688  N N    . HIS A 1 18 ? 2.984   -10.901 -0.027  1.00 4.92  ? 18 HIS A N    4  
ATOM   3689  C CA   . HIS A 1 18 ? 3.817   -11.122 -1.252  1.00 5.06  ? 18 HIS A CA   4  
ATOM   3690  C C    . HIS A 1 18 ? 3.191   -10.385 -2.469  1.00 4.32  ? 18 HIS A C    4  
ATOM   3691  O O    . HIS A 1 18 ? 1.984   -10.331 -2.602  1.00 4.10  ? 18 HIS A O    4  
ATOM   3692  C CB   . HIS A 1 18 ? 3.936   -12.632 -1.462  1.00 5.95  ? 18 HIS A CB   4  
ATOM   3693  C CG   . HIS A 1 18 ? 4.436   -12.921 -2.831  1.00 6.25  ? 18 HIS A CG   4  
ATOM   3694  N ND1  . HIS A 1 18 ? 5.776   -13.100 -3.129  1.00 6.36  ? 18 HIS A ND1  4  
ATOM   3695  C CD2  . HIS A 1 18 ? 3.768   -13.051 -3.996  1.00 6.72  ? 18 HIS A CD2  4  
ATOM   3696  C CE1  . HIS A 1 18 ? 5.856   -13.328 -4.451  1.00 6.81  ? 18 HIS A CE1  4  
ATOM   3697  N NE2  . HIS A 1 18 ? 4.657   -13.315 -5.016  1.00 7.07  ? 18 HIS A NE2  4  
ATOM   3698  H H    . HIS A 1 18 ? 2.508   -11.663 0.372   1.00 5.11  ? 18 HIS A H    4  
ATOM   3699  H HA   . HIS A 1 18 ? 4.798   -10.723 -1.085  1.00 5.21  ? 18 HIS A HA   4  
ATOM   3700  H HB2  . HIS A 1 18 ? 4.624   -13.042 -0.738  1.00 6.63  ? 18 HIS A HB2  4  
ATOM   3701  H HB3  . HIS A 1 18 ? 2.969   -13.087 -1.330  1.00 5.84  ? 18 HIS A HB3  4  
ATOM   3702  H HD1  . HIS A 1 18 ? 6.525   -13.065 -2.497  1.00 6.36  ? 18 HIS A HD1  4  
ATOM   3703  H HD2  . HIS A 1 18 ? 2.710   -12.917 -4.104  1.00 7.00  ? 18 HIS A HD2  4  
ATOM   3704  H HE1  . HIS A 1 18 ? 6.773   -13.460 -4.996  1.00 7.12  ? 18 HIS A HE1  4  
ATOM   3705  N N    . PRO A 1 19 ? 4.054   -9.780  -3.280  1.00 4.16  ? 19 PRO A N    4  
ATOM   3706  C CA   . PRO A 1 19 ? 3.646   -8.957  -4.453  1.00 3.77  ? 19 PRO A CA   4  
ATOM   3707  C C    . PRO A 1 19 ? 3.181   -9.743  -5.690  1.00 4.27  ? 19 PRO A C    4  
ATOM   3708  O O    . PRO A 1 19 ? 2.219   -9.355  -6.316  1.00 4.32  ? 19 PRO A O    4  
ATOM   3709  C CB   . PRO A 1 19 ? 4.914   -8.173  -4.798  1.00 3.96  ? 19 PRO A CB   4  
ATOM   3710  C CG   . PRO A 1 19 ? 6.097   -8.975  -4.218  1.00 4.62  ? 19 PRO A CG   4  
ATOM   3711  C CD   . PRO A 1 19 ? 5.522   -9.863  -3.101  1.00 4.65  ? 19 PRO A CD   4  
ATOM   3712  H HA   . PRO A 1 19 ? 2.884   -8.264  -4.162  1.00 3.26  ? 19 PRO A HA   4  
ATOM   3713  H HB2  . PRO A 1 19 ? 5.013   -8.086  -5.872  1.00 4.26  ? 19 PRO A HB2  4  
ATOM   3714  H HB3  . PRO A 1 19 ? 4.880   -7.196  -4.347  1.00 3.57  ? 19 PRO A HB3  4  
ATOM   3715  H HG2  . PRO A 1 19 ? 6.538   -9.588  -4.993  1.00 5.23  ? 19 PRO A HG2  4  
ATOM   3716  H HG3  . PRO A 1 19 ? 6.834   -8.304  -3.810  1.00 4.63  ? 19 PRO A HG3  4  
ATOM   3717  H HD2  . PRO A 1 19 ? 5.864   -10.880 -3.219  1.00 5.29  ? 19 PRO A HD2  4  
ATOM   3718  H HD3  . PRO A 1 19 ? 5.799   -9.480  -2.133  1.00 4.56  ? 19 PRO A HD3  4  
ATOM   3719  N N    . LYS A 1 20 ? 3.868   -10.790 -6.091  1.00 4.91  ? 20 LYS A N    4  
ATOM   3720  C CA   . LYS A 1 20 ? 3.456   -11.533 -7.342  1.00 5.52  ? 20 LYS A CA   4  
ATOM   3721  C C    . LYS A 1 20 ? 1.943   -11.832 -7.353  1.00 5.00  ? 20 LYS A C    4  
ATOM   3722  O O    . LYS A 1 20 ? 1.346   -11.923 -8.411  1.00 5.39  ? 20 LYS A O    4  
ATOM   3723  C CB   . LYS A 1 20 ? 4.247   -12.825 -7.503  1.00 6.44  ? 20 LYS A CB   4  
ATOM   3724  C CG   . LYS A 1 20 ? 4.303   -13.219 -8.983  1.00 7.16  ? 20 LYS A CG   4  
ATOM   3725  C CD   . LYS A 1 20 ? 5.059   -14.543 -9.130  1.00 7.91  ? 20 LYS A CD   4  
ATOM   3726  C CE   . LYS A 1 20 ? 5.386   -14.790 -10.607 1.00 8.41  ? 20 LYS A CE   4  
ATOM   3727  N NZ   . LYS A 1 20 ? 5.845   -16.198 -10.790 1.00 8.95  ? 20 LYS A NZ   4  
ATOM   3728  H H    . LYS A 1 20 ? 4.670   -11.060 -5.599  1.00 5.13  ? 20 LYS A H    4  
ATOM   3729  H HA   . LYS A 1 20 ? 3.678   -10.911 -8.180  1.00 5.87  ? 20 LYS A HA   4  
ATOM   3730  H HB2  . LYS A 1 20 ? 5.251   -12.682 -7.132  1.00 6.91  ? 20 LYS A HB2  4  
ATOM   3731  H HB3  . LYS A 1 20 ? 3.765   -13.599 -6.948  1.00 6.29  ? 20 LYS A HB3  4  
ATOM   3732  H HG2  . LYS A 1 20 ? 3.298   -13.333 -9.364  1.00 7.23  ? 20 LYS A HG2  4  
ATOM   3733  H HG3  . LYS A 1 20 ? 4.816   -12.450 -9.542  1.00 7.28  ? 20 LYS A HG3  4  
ATOM   3734  H HD2  . LYS A 1 20 ? 5.977   -14.498 -8.562  1.00 8.14  ? 20 LYS A HD2  4  
ATOM   3735  H HD3  . LYS A 1 20 ? 4.445   -15.351 -8.760  1.00 8.11  ? 20 LYS A HD3  4  
ATOM   3736  H HE2  . LYS A 1 20 ? 4.502   -14.620 -11.205 1.00 8.28  ? 20 LYS A HE2  4  
ATOM   3737  H HE3  . LYS A 1 20 ? 6.167   -14.114 -10.920 1.00 8.75  ? 20 LYS A HE3  4  
ATOM   3738  H HZ1  . LYS A 1 20 ? 5.091   -16.851 -10.487 1.00 9.15  ? 20 LYS A HZ1  4  
ATOM   3739  H HZ2  . LYS A 1 20 ? 6.065   -16.363 -11.792 1.00 9.17  ? 20 LYS A HZ2  4  
ATOM   3740  H HZ3  . LYS A 1 20 ? 6.697   -16.363 -10.218 1.00 9.13  ? 20 LYS A HZ3  4  
ATOM   3741  N N    . PHE A 1 21 ? 1.308   -11.953 -6.203  1.00 4.37  ? 21 PHE A N    4  
ATOM   3742  C CA   . PHE A 1 21 ? -0.168  -12.204 -6.181  1.00 4.15  ? 21 PHE A CA   4  
ATOM   3743  C C    . PHE A 1 21 ? -0.878  -11.013 -6.842  1.00 3.56  ? 21 PHE A C    4  
ATOM   3744  O O    . PHE A 1 21 ? -1.863  -11.169 -7.540  1.00 3.88  ? 21 PHE A O    4  
ATOM   3745  C CB   . PHE A 1 21 ? -0.669  -12.317 -4.743  1.00 4.02  ? 21 PHE A CB   4  
ATOM   3746  C CG   . PHE A 1 21 ? 0.123   -13.330 -3.941  1.00 4.64  ? 21 PHE A CG   4  
ATOM   3747  C CD1  . PHE A 1 21 ? 0.667   -14.467 -4.553  1.00 5.12  ? 21 PHE A CD1  4  
ATOM   3748  C CD2  . PHE A 1 21 ? 0.297   -13.126 -2.567  1.00 5.11  ? 21 PHE A CD2  4  
ATOM   3749  C CE1  . PHE A 1 21 ? 1.385   -15.395 -3.788  1.00 5.85  ? 21 PHE A CE1  4  
ATOM   3750  C CE2  . PHE A 1 21 ? 1.014   -14.053 -1.805  1.00 5.85  ? 21 PHE A CE2  4  
ATOM   3751  C CZ   . PHE A 1 21 ? 1.558   -15.188 -2.415  1.00 6.13  ? 21 PHE A CZ   4  
ATOM   3752  H H    . PHE A 1 21 ? 1.792   -11.852 -5.361  1.00 4.29  ? 21 PHE A H    4  
ATOM   3753  H HA   . PHE A 1 21 ? -0.396  -13.102 -6.709  1.00 4.82  ? 21 PHE A HA   4  
ATOM   3754  H HB2  . PHE A 1 21 ? -0.582  -11.359 -4.282  1.00 3.48  ? 21 PHE A HB2  4  
ATOM   3755  H HB3  . PHE A 1 21 ? -1.703  -12.608 -4.756  1.00 4.37  ? 21 PHE A HB3  4  
ATOM   3756  H HD1  . PHE A 1 21 ? 0.535   -14.628 -5.613  1.00 5.18  ? 21 PHE A HD1  4  
ATOM   3757  H HD2  . PHE A 1 21 ? -0.122  -12.250 -2.094  1.00 5.17  ? 21 PHE A HD2  4  
ATOM   3758  H HE1  . PHE A 1 21 ? 1.806   -16.270 -4.256  1.00 6.40  ? 21 PHE A HE1  4  
ATOM   3759  H HE2  . PHE A 1 21 ? 1.148   -13.890 -0.744  1.00 6.40  ? 21 PHE A HE2  4  
ATOM   3760  H HZ   . PHE A 1 21 ? 2.112   -15.905 -1.826  1.00 6.79  ? 21 PHE A HZ   4  
ATOM   3761  N N    . ILE A 1 22 ? -0.367  -9.826  -6.614  1.00 2.94  ? 22 ILE A N    4  
ATOM   3762  C CA   . ILE A 1 22 ? -0.962  -8.585  -7.198  1.00 2.62  ? 22 ILE A CA   4  
ATOM   3763  C C    . ILE A 1 22 ? -0.900  -8.638  -8.726  1.00 3.41  ? 22 ILE A C    4  
ATOM   3764  O O    . ILE A 1 22 ? 0.157   -8.786  -9.312  1.00 4.13  ? 22 ILE A O    4  
ATOM   3765  C CB   . ILE A 1 22 ? -0.163  -7.367  -6.708  1.00 2.18  ? 22 ILE A CB   4  
ATOM   3766  C CG1  . ILE A 1 22 ? -0.222  -7.288  -5.178  1.00 2.00  ? 22 ILE A CG1  4  
ATOM   3767  C CG2  . ILE A 1 22 ? -0.751  -6.088  -7.302  1.00 2.53  ? 22 ILE A CG2  4  
ATOM   3768  C CD1  . ILE A 1 22 ? 1.039   -6.596  -4.654  1.00 2.47  ? 22 ILE A CD1  4  
ATOM   3769  H H    . ILE A 1 22 ? 0.427   -9.750  -6.043  1.00 2.94  ? 22 ILE A H    4  
ATOM   3770  H HA   . ILE A 1 22 ? -1.990  -8.488  -6.884  1.00 2.63  ? 22 ILE A HA   4  
ATOM   3771  H HB   . ILE A 1 22 ? 0.864   -7.466  -7.023  1.00 2.49  ? 22 ILE A HB   4  
ATOM   3772  H HG12 . ILE A 1 22 ? -1.094  -6.724  -4.880  1.00 2.23  ? 22 ILE A HG12 4  
ATOM   3773  H HG13 . ILE A 1 22 ? -0.280  -8.285  -4.768  1.00 2.28  ? 22 ILE A HG13 4  
ATOM   3774  H HG21 . ILE A 1 22 ? -1.826  -6.133  -7.249  1.00 2.71  ? 22 ILE A HG21 4  
ATOM   3775  H HG22 . ILE A 1 22 ? -0.397  -5.234  -6.743  1.00 2.80  ? 22 ILE A HG22 4  
ATOM   3776  H HG23 . ILE A 1 22 ? -0.445  -5.996  -8.334  1.00 3.07  ? 22 ILE A HG23 4  
ATOM   3777  H HD11 . ILE A 1 22 ? 1.816   -6.647  -5.403  1.00 2.84  ? 22 ILE A HD11 4  
ATOM   3778  H HD12 . ILE A 1 22 ? 0.818   -5.562  -4.436  1.00 2.73  ? 22 ILE A HD12 4  
ATOM   3779  H HD13 . ILE A 1 22 ? 1.374   -7.090  -3.755  1.00 2.88  ? 22 ILE A HD13 4  
ATOM   3780  N N    . LYS A 1 23 ? -2.028  -8.492  -9.369  1.00 3.62  ? 23 LYS A N    4  
ATOM   3781  C CA   . LYS A 1 23 ? -2.058  -8.500  -10.858 1.00 4.61  ? 23 LYS A CA   4  
ATOM   3782  C C    . LYS A 1 23 ? -1.952  -7.054  -11.372 1.00 5.00  ? 23 LYS A C    4  
ATOM   3783  O O    . LYS A 1 23 ? -1.547  -6.820  -12.496 1.00 5.88  ? 23 LYS A O    4  
ATOM   3784  C CB   . LYS A 1 23 ? -3.372  -9.124  -11.344 1.00 5.10  ? 23 LYS A CB   4  
ATOM   3785  C CG   . LYS A 1 23 ? -3.183  -9.691  -12.756 1.00 5.85  ? 23 LYS A CG   4  
ATOM   3786  C CD   . LYS A 1 23 ? -2.430  -11.024 -12.681 1.00 6.35  ? 23 LYS A CD   4  
ATOM   3787  C CE   . LYS A 1 23 ? -1.456  -11.130 -13.858 1.00 6.93  ? 23 LYS A CE   4  
ATOM   3788  N NZ   . LYS A 1 23 ? -0.358  -12.080 -13.515 1.00 7.72  ? 23 LYS A NZ   4  
ATOM   3789  H H    . LYS A 1 23 ? -2.861  -8.357  -8.867  1.00 3.33  ? 23 LYS A H    4  
ATOM   3790  H HA   . LYS A 1 23 ? -1.224  -9.075  -11.233 1.00 4.98  ? 23 LYS A HA   4  
ATOM   3791  H HB2  . LYS A 1 23 ? -3.661  -9.919  -10.672 1.00 4.92  ? 23 LYS A HB2  4  
ATOM   3792  H HB3  . LYS A 1 23 ? -4.143  -8.369  -11.363 1.00 5.36  ? 23 LYS A HB3  4  
ATOM   3793  H HG2  . LYS A 1 23 ? -4.150  -9.849  -13.211 1.00 6.02  ? 23 LYS A HG2  4  
ATOM   3794  H HG3  . LYS A 1 23 ? -2.616  -8.992  -13.351 1.00 6.22  ? 23 LYS A HG3  4  
ATOM   3795  H HD2  . LYS A 1 23 ? -1.881  -11.077 -11.752 1.00 6.70  ? 23 LYS A HD2  4  
ATOM   3796  H HD3  . LYS A 1 23 ? -3.137  -11.839 -12.728 1.00 6.30  ? 23 LYS A HD3  4  
ATOM   3797  H HE2  . LYS A 1 23 ? -1.982  -11.489 -14.730 1.00 6.98  ? 23 LYS A HE2  4  
ATOM   3798  H HE3  . LYS A 1 23 ? -1.036  -10.156 -14.067 1.00 7.01  ? 23 LYS A HE3  4  
ATOM   3799  H HZ1  . LYS A 1 23 ? -0.764  -12.999 -13.247 1.00 8.36  ? 23 LYS A HZ1  4  
ATOM   3800  H HZ2  . LYS A 1 23 ? 0.263   -12.205 -14.339 1.00 7.80  ? 23 LYS A HZ2  4  
ATOM   3801  H HZ3  . LYS A 1 23 ? 0.195   -11.698 -12.719 1.00 7.78  ? 23 LYS A HZ3  4  
ATOM   3802  N N    . GLU A 1 24 ? -2.312  -6.082  -10.556 1.00 4.51  ? 24 GLU A N    4  
ATOM   3803  C CA   . GLU A 1 24 ? -2.233  -4.654  -10.995 1.00 5.13  ? 24 GLU A CA   4  
ATOM   3804  C C    . GLU A 1 24 ? -1.791  -3.772  -9.813  1.00 4.55  ? 24 GLU A C    4  
ATOM   3805  O O    . GLU A 1 24 ? -2.584  -3.443  -8.951  1.00 4.65  ? 24 GLU A O    4  
ATOM   3806  C CB   . GLU A 1 24 ? -3.611  -4.195  -11.481 1.00 5.78  ? 24 GLU A CB   4  
ATOM   3807  C CG   . GLU A 1 24 ? -3.820  -4.639  -12.933 1.00 6.35  ? 24 GLU A CG   4  
ATOM   3808  C CD   . GLU A 1 24 ? -5.294  -4.474  -13.311 1.00 7.36  ? 24 GLU A CD   4  
ATOM   3809  O OE1  . GLU A 1 24 ? -6.079  -5.337  -12.949 1.00 7.92  ? 24 GLU A OE1  4  
ATOM   3810  O OE2  . GLU A 1 24 ? -5.614  -3.489  -13.954 1.00 7.77  ? 24 GLU A OE2  4  
ATOM   3811  H H    . GLU A 1 24 ? -2.634  -6.295  -9.651  1.00 3.86  ? 24 GLU A H    4  
ATOM   3812  H HA   . GLU A 1 24 ? -1.520  -4.564  -11.799 1.00 5.74  ? 24 GLU A HA   4  
ATOM   3813  H HB2  . GLU A 1 24 ? -4.377  -4.633  -10.857 1.00 5.66  ? 24 GLU A HB2  4  
ATOM   3814  H HB3  . GLU A 1 24 ? -3.674  -3.119  -11.425 1.00 6.21  ? 24 GLU A HB3  4  
ATOM   3815  H HG2  . GLU A 1 24 ? -3.210  -4.032  -13.586 1.00 6.22  ? 24 GLU A HG2  4  
ATOM   3816  H HG3  . GLU A 1 24 ? -3.538  -5.675  -13.036 1.00 6.40  ? 24 GLU A HG3  4  
HETATM 3817  N N    . MLE A 1 25 ? -0.532  -3.389  -9.761  1.00 4.25  ? 25 MLE A N    4  
HETATM 3818  C CN   . MLE A 1 25 ? 0.034   -2.880  -11.055 1.00 5.13  ? 25 MLE A CN   4  
HETATM 3819  C CA   . MLE A 1 25 ? -0.055  -2.532  -8.619  1.00 3.66  ? 25 MLE A CA   4  
HETATM 3820  C CB   . MLE A 1 25 ? 1.320   -3.024  -8.139  1.00 3.52  ? 25 MLE A CB   4  
HETATM 3821  C CG   . MLE A 1 25 ? 1.965   -1.966  -7.226  1.00 3.28  ? 25 MLE A CG   4  
HETATM 3822  C CD1  . MLE A 1 25 ? 2.494   -2.630  -5.957  1.00 2.93  ? 25 MLE A CD1  4  
HETATM 3823  C CD2  . MLE A 1 25 ? 3.120   -1.281  -7.966  1.00 3.54  ? 25 MLE A CD2  4  
HETATM 3824  C C    . MLE A 1 25 ? 0.053   -1.070  -9.073  1.00 4.19  ? 25 MLE A C    4  
HETATM 3825  O O    . MLE A 1 25 ? 1.007   -0.683  -9.725  1.00 4.87  ? 25 MLE A O    4  
HETATM 3826  H HN1  . MLE A 1 25 ? 1.069   -2.606  -10.913 1.00 5.47  ? 25 MLE A HN1  4  
HETATM 3827  H HN2  . MLE A 1 25 ? -0.035  -3.645  -11.808 1.00 5.48  ? 25 MLE A HN2  4  
HETATM 3828  H HN3  . MLE A 1 25 ? -0.525  -2.009  -11.372 1.00 5.42  ? 25 MLE A HN3  4  
HETATM 3829  H HA   . MLE A 1 25 ? -0.761  -2.600  -7.803  1.00 3.20  ? 25 MLE A HA   4  
HETATM 3830  H HB2  . MLE A 1 25 ? 1.197   -3.947  -7.590  1.00 3.37  ? 25 MLE A HB2  4  
HETATM 3831  H HB3  . MLE A 1 25 ? 1.958   -3.197  -8.992  1.00 4.08  ? 25 MLE A HB3  4  
HETATM 3832  H HG   . MLE A 1 25 ? 1.223   -1.227  -6.956  1.00 3.59  ? 25 MLE A HG   4  
HETATM 3833  H HD11 . MLE A 1 25 ? 2.115   -3.638  -5.893  1.00 3.21  ? 25 MLE A HD11 4  
HETATM 3834  H HD12 . MLE A 1 25 ? 3.572   -2.650  -5.985  1.00 3.14  ? 25 MLE A HD12 4  
HETATM 3835  H HD13 . MLE A 1 25 ? 2.166   -2.065  -5.096  1.00 2.79  ? 25 MLE A HD13 4  
HETATM 3836  H HD21 . MLE A 1 25 ? 3.147   -1.623  -8.990  1.00 3.70  ? 25 MLE A HD21 4  
HETATM 3837  H HD22 . MLE A 1 25 ? 2.973   -0.210  -7.949  1.00 3.89  ? 25 MLE A HD22 4  
HETATM 3838  H HD23 . MLE A 1 25 ? 4.054   -1.522  -7.483  1.00 3.75  ? 25 MLE A HD23 4  
ATOM   3839  N N    . ARG A 1 26 ? -0.911  -0.255  -8.742  1.00 4.14  ? 26 ARG A N    4  
ATOM   3840  C CA   . ARG A 1 26 ? -0.833  1.166   -9.172  1.00 4.79  ? 26 ARG A CA   4  
ATOM   3841  C C    . ARG A 1 26 ? -0.944  2.091   -7.951  1.00 4.70  ? 26 ARG A C    4  
ATOM   3842  O O    . ARG A 1 26 ? -1.861  1.981   -7.159  1.00 4.97  ? 26 ARG A O    4  
ATOM   3843  C CB   . ARG A 1 26 ? -1.956  1.479   -10.174 1.00 5.59  ? 26 ARG A CB   4  
ATOM   3844  C CG   . ARG A 1 26 ? -3.298  0.946   -9.657  1.00 5.99  ? 26 ARG A CG   4  
ATOM   3845  C CD   . ARG A 1 26 ? -4.442  1.632   -10.406 1.00 6.35  ? 26 ARG A CD   4  
ATOM   3846  N NE   . ARG A 1 26 ? -4.959  2.775   -9.598  1.00 7.16  ? 26 ARG A NE   4  
ATOM   3847  C CZ   . ARG A 1 26 ? -5.911  3.532   -10.074 1.00 7.92  ? 26 ARG A CZ   4  
ATOM   3848  N NH1  . ARG A 1 26 ? -7.154  3.124   -10.029 1.00 8.32  ? 26 ARG A NH1  4  
ATOM   3849  N NH2  . ARG A 1 26 ? -5.620  4.696   -10.595 1.00 8.52  ? 26 ARG A NH2  4  
ATOM   3850  H H    . ARG A 1 26 ? -1.676  -0.575  -8.218  1.00 3.85  ? 26 ARG A H    4  
ATOM   3851  H HA   . ARG A 1 26 ? 0.125   1.314   -9.652  1.00 5.07  ? 26 ARG A HA   4  
ATOM   3852  H HB2  . ARG A 1 26 ? -2.024  2.549   -10.310 1.00 5.95  ? 26 ARG A HB2  4  
ATOM   3853  H HB3  . ARG A 1 26 ? -1.730  1.013   -11.121 1.00 5.91  ? 26 ARG A HB3  4  
ATOM   3854  H HG2  . ARG A 1 26 ? -3.348  -0.120  -9.818  1.00 6.27  ? 26 ARG A HG2  4  
ATOM   3855  H HG3  . ARG A 1 26 ? -3.386  1.155   -8.601  1.00 6.12  ? 26 ARG A HG3  4  
ATOM   3856  H HD2  . ARG A 1 26 ? -4.082  1.999   -11.356 1.00 6.26  ? 26 ARG A HD2  4  
ATOM   3857  H HD3  . ARG A 1 26 ? -5.239  0.921   -10.575 1.00 6.38  ? 26 ARG A HD3  4  
ATOM   3858  H HE   . ARG A 1 26 ? -4.584  2.958   -8.710  1.00 7.28  ? 26 ARG A HE   4  
ATOM   3859  H HH11 . ARG A 1 26 ? -7.374  2.232   -9.631  1.00 8.08  ? 26 ARG A HH11 4  
ATOM   3860  H HH12 . ARG A 1 26 ? -7.886  3.702   -10.394 1.00 9.02  ? 26 ARG A HH12 4  
ATOM   3861  H HH21 . ARG A 1 26 ? -4.669  5.007   -10.630 1.00 8.41  ? 26 ARG A HH21 4  
ATOM   3862  H HH22 . ARG A 1 26 ? -6.347  5.279   -10.961 1.00 9.21  ? 26 ARG A HH22 4  
ATOM   3863  N N    . VAL A 1 27 ? -0.009  2.997   -7.794  1.00 4.69  ? 27 VAL A N    4  
ATOM   3864  C CA   . VAL A 1 27 ? -0.039  3.933   -6.631  1.00 4.83  ? 27 VAL A CA   4  
ATOM   3865  C C    . VAL A 1 27 ? -0.572  5.304   -7.075  1.00 4.79  ? 27 VAL A C    4  
ATOM   3866  O O    . VAL A 1 27 ? -0.378  5.715   -8.206  1.00 5.45  ? 27 VAL A O    4  
ATOM   3867  C CB   . VAL A 1 27 ? 1.383   4.092   -6.074  1.00 5.66  ? 27 VAL A CB   4  
ATOM   3868  C CG1  . VAL A 1 27 ? 1.826   2.783   -5.420  1.00 6.10  ? 27 VAL A CG1  4  
ATOM   3869  C CG2  . VAL A 1 27 ? 2.361   4.446   -7.201  1.00 6.04  ? 27 VAL A CG2  4  
ATOM   3870  H H    . VAL A 1 27 ? 0.720   3.061   -8.442  1.00 4.82  ? 27 VAL A H    4  
ATOM   3871  H HA   . VAL A 1 27 ? -0.682  3.531   -5.861  1.00 4.74  ? 27 VAL A HA   4  
ATOM   3872  H HB   . VAL A 1 27 ? 1.386   4.875   -5.339  1.00 5.89  ? 27 VAL A HB   4  
ATOM   3873  H HG11 . VAL A 1 27 ? 1.030   2.406   -4.800  1.00 6.54  ? 27 VAL A HG11 4  
ATOM   3874  H HG12 . VAL A 1 27 ? 2.060   2.059   -6.186  1.00 6.30  ? 27 VAL A HG12 4  
ATOM   3875  H HG13 . VAL A 1 27 ? 2.702   2.961   -4.813  1.00 6.06  ? 27 VAL A HG13 4  
ATOM   3876  H HG21 . VAL A 1 27 ? 1.909   5.175   -7.857  1.00 6.05  ? 27 VAL A HG21 4  
ATOM   3877  H HG22 . VAL A 1 27 ? 3.266   4.854   -6.776  1.00 6.44  ? 27 VAL A HG22 4  
ATOM   3878  H HG23 . VAL A 1 27 ? 2.600   3.554   -7.764  1.00 6.18  ? 27 VAL A HG23 4  
ATOM   3879  N N    . ILE A 1 28 ? -1.232  6.019   -6.191  1.00 4.28  ? 28 ILE A N    4  
ATOM   3880  C CA   . ILE A 1 28 ? -1.766  7.368   -6.562  1.00 4.40  ? 28 ILE A CA   4  
ATOM   3881  C C    . ILE A 1 28 ? -0.861  8.448   -5.958  1.00 4.70  ? 28 ILE A C    4  
ATOM   3882  O O    . ILE A 1 28 ? -0.374  8.312   -4.850  1.00 5.01  ? 28 ILE A O    4  
ATOM   3883  C CB   . ILE A 1 28 ? -3.196  7.535   -6.027  1.00 4.45  ? 28 ILE A CB   4  
ATOM   3884  C CG1  . ILE A 1 28 ? -4.116  6.505   -6.693  1.00 4.94  ? 28 ILE A CG1  4  
ATOM   3885  C CG2  . ILE A 1 28 ? -3.704  8.948   -6.345  1.00 4.49  ? 28 ILE A CG2  4  
ATOM   3886  C CD1  . ILE A 1 28 ? -5.519  6.599   -6.085  1.00 5.05  ? 28 ILE A CD1  4  
ATOM   3887  H H    . ILE A 1 28 ? -1.371  5.673   -5.279  1.00 4.02  ? 28 ILE A H    4  
ATOM   3888  H HA   . ILE A 1 28 ? -1.770  7.468   -7.637  1.00 4.67  ? 28 ILE A HA   4  
ATOM   3889  H HB   . ILE A 1 28 ? -3.199  7.384   -4.957  1.00 4.56  ? 28 ILE A HB   4  
ATOM   3890  H HG12 . ILE A 1 28 ? -4.170  6.703   -7.754  1.00 5.21  ? 28 ILE A HG12 4  
ATOM   3891  H HG13 . ILE A 1 28 ? -3.723  5.513   -6.532  1.00 5.36  ? 28 ILE A HG13 4  
ATOM   3892  H HG21 . ILE A 1 28 ? -3.526  9.169   -7.386  1.00 4.51  ? 28 ILE A HG21 4  
ATOM   3893  H HG22 . ILE A 1 28 ? -4.763  9.006   -6.139  1.00 4.77  ? 28 ILE A HG22 4  
ATOM   3894  H HG23 . ILE A 1 28 ? -3.180  9.665   -5.730  1.00 4.49  ? 28 ILE A HG23 4  
ATOM   3895  H HD11 . ILE A 1 28 ? -5.913  7.593   -6.238  1.00 5.49  ? 28 ILE A HD11 4  
ATOM   3896  H HD12 . ILE A 1 28 ? -6.167  5.877   -6.561  1.00 4.88  ? 28 ILE A HD12 4  
ATOM   3897  H HD13 . ILE A 1 28 ? -5.467  6.392   -5.026  1.00 5.25  ? 28 ILE A HD13 4  
ATOM   3898  N N    . GLU A 1 29 ? -0.634  9.519   -6.680  1.00 5.08  ? 29 GLU A N    4  
ATOM   3899  C CA   . GLU A 1 29 ? 0.237   10.615  -6.162  1.00 5.75  ? 29 GLU A CA   4  
ATOM   3900  C C    . GLU A 1 29 ? -0.507  11.406  -5.077  1.00 5.30  ? 29 GLU A C    4  
ATOM   3901  O O    . GLU A 1 29 ? -1.679  11.187  -4.826  1.00 4.95  ? 29 GLU A O    4  
ATOM   3902  C CB   . GLU A 1 29 ? 0.601   11.553  -7.314  1.00 6.63  ? 29 GLU A CB   4  
ATOM   3903  C CG   . GLU A 1 29 ? 1.554   10.844  -8.279  1.00 7.40  ? 29 GLU A CG   4  
ATOM   3904  C CD   . GLU A 1 29 ? 2.253   11.879  -9.167  1.00 8.35  ? 29 GLU A CD   4  
ATOM   3905  O OE1  . GLU A 1 29 ? 3.187   12.505  -8.693  1.00 9.09  ? 29 GLU A OE1  4  
ATOM   3906  O OE2  . GLU A 1 29 ? 1.841   12.027  -10.307 1.00 8.53  ? 29 GLU A OE2  4  
ATOM   3907  H H    . GLU A 1 29 ? -1.037  9.604   -7.568  1.00 5.18  ? 29 GLU A H    4  
ATOM   3908  H HA   . GLU A 1 29 ? 1.139   10.192  -5.744  1.00 6.26  ? 29 GLU A HA   4  
ATOM   3909  H HB2  . GLU A 1 29 ? -0.298  11.841  -7.839  1.00 6.65  ? 29 GLU A HB2  4  
ATOM   3910  H HB3  . GLU A 1 29 ? 1.080   12.433  -6.920  1.00 7.00  ? 29 GLU A HB3  4  
ATOM   3911  H HG2  . GLU A 1 29 ? 2.295   10.295  -7.716  1.00 7.70  ? 29 GLU A HG2  4  
ATOM   3912  H HG3  . GLU A 1 29 ? 0.994   10.160  -8.901  1.00 7.27  ? 29 GLU A HG3  4  
ATOM   3913  N N    . SER A 1 30 ? 0.167   12.328  -4.436  1.00 5.67  ? 30 SER A N    4  
ATOM   3914  C CA   . SER A 1 30 ? -0.487  13.144  -3.370  1.00 5.68  ? 30 SER A CA   4  
ATOM   3915  C C    . SER A 1 30 ? -0.765  14.555  -3.901  1.00 6.20  ? 30 SER A C    4  
ATOM   3916  O O    . SER A 1 30 ? -0.161  15.001  -4.860  1.00 6.77  ? 30 SER A O    4  
ATOM   3917  C CB   . SER A 1 30 ? 0.427   13.231  -2.143  1.00 6.35  ? 30 SER A CB   4  
ATOM   3918  O OG   . SER A 1 30 ? 1.788   13.152  -2.548  1.00 7.18  ? 30 SER A OG   4  
ATOM   3919  H H    . SER A 1 30 ? 1.108   12.488  -4.659  1.00 6.18  ? 30 SER A H    4  
ATOM   3920  H HA   . SER A 1 30 ? -1.423  12.681  -3.086  1.00 5.24  ? 30 SER A HA   4  
ATOM   3921  H HB2  . SER A 1 30 ? 0.266   14.169  -1.643  1.00 6.58  ? 30 SER A HB2  4  
ATOM   3922  H HB3  . SER A 1 30 ? 0.192   12.421  -1.466  1.00 6.28  ? 30 SER A HB3  4  
ATOM   3923  H HG   . SER A 1 30 ? 2.112   12.275  -2.331  1.00 7.41  ? 30 SER A HG   4  
ATOM   3924  N N    . GLY A 1 31 ? -1.678  15.255  -3.279  1.00 6.36  ? 31 GLY A N    4  
ATOM   3925  C CA   . GLY A 1 31 ? -2.016  16.640  -3.731  1.00 7.19  ? 31 GLY A CA   4  
ATOM   3926  C C    . GLY A 1 31 ? -3.081  17.231  -2.796  1.00 7.66  ? 31 GLY A C    4  
ATOM   3927  O O    . GLY A 1 31 ? -3.137  16.882  -1.632  1.00 7.75  ? 31 GLY A O    4  
ATOM   3928  H H    . GLY A 1 31 ? -2.146  14.866  -2.509  1.00 6.14  ? 31 GLY A H    4  
ATOM   3929  H HA2  . GLY A 1 31 ? -1.130  17.250  -3.713  1.00 7.72  ? 31 GLY A HA2  4  
ATOM   3930  H HA3  . GLY A 1 31 ? -2.406  16.603  -4.736  1.00 7.17  ? 31 GLY A HA3  4  
ATOM   3931  N N    . PRO A 1 32 ? -3.919  18.090  -3.339  1.00 8.17  ? 32 PRO A N    4  
ATOM   3932  C CA   . PRO A 1 32 ? -5.017  18.714  -2.571  1.00 8.85  ? 32 PRO A CA   4  
ATOM   3933  C C    . PRO A 1 32 ? -6.118  17.671  -2.335  1.00 8.11  ? 32 PRO A C    4  
ATOM   3934  O O    . PRO A 1 32 ? -6.742  17.632  -1.290  1.00 8.52  ? 32 PRO A O    4  
ATOM   3935  C CB   . PRO A 1 32 ? -5.490  19.857  -3.477  1.00 9.69  ? 32 PRO A CB   4  
ATOM   3936  C CG   . PRO A 1 32 ? -5.034  19.495  -4.909  1.00 9.20  ? 32 PRO A CG   4  
ATOM   3937  C CD   . PRO A 1 32 ? -3.857  18.511  -4.757  1.00 8.39  ? 32 PRO A CD   4  
ATOM   3938  H HA   . PRO A 1 32 ? -4.654  19.105  -1.635  1.00 9.45  ? 32 PRO A HA   4  
ATOM   3939  H HB2  . PRO A 1 32 ? -6.568  19.938  -3.436  1.00 9.88  ? 32 PRO A HB2  4  
ATOM   3940  H HB3  . PRO A 1 32 ? -5.034  20.785  -3.173  1.00 10.56 ? 32 PRO A HB3  4  
ATOM   3941  H HG2  . PRO A 1 32 ? -5.846  19.027  -5.448  1.00 8.80  ? 32 PRO A HG2  4  
ATOM   3942  H HG3  . PRO A 1 32 ? -4.704  20.381  -5.428  1.00 10.01 ? 32 PRO A HG3  4  
ATOM   3943  H HD2  . PRO A 1 32 ? -3.989  17.662  -5.414  1.00 7.63  ? 32 PRO A HD2  4  
ATOM   3944  H HD3  . PRO A 1 32 ? -2.920  19.006  -4.958  1.00 8.96  ? 32 PRO A HD3  4  
ATOM   3945  N N    . HIS A 1 33 ? -6.327  16.811  -3.304  1.00 7.21  ? 33 HIS A N    4  
ATOM   3946  C CA   . HIS A 1 33 ? -7.347  15.722  -3.185  1.00 6.64  ? 33 HIS A CA   4  
ATOM   3947  C C    . HIS A 1 33 ? -7.018  14.839  -1.967  1.00 5.94  ? 33 HIS A C    4  
ATOM   3948  O O    . HIS A 1 33 ? -7.899  14.389  -1.259  1.00 6.05  ? 33 HIS A O    4  
ATOM   3949  C CB   . HIS A 1 33 ? -7.324  14.867  -4.468  1.00 6.27  ? 33 HIS A CB   4  
ATOM   3950  C CG   . HIS A 1 33 ? -5.928  14.337  -4.716  1.00 5.79  ? 33 HIS A CG   4  
ATOM   3951  N ND1  . HIS A 1 33 ? -4.938  15.105  -5.315  1.00 6.54  ? 33 HIS A ND1  4  
ATOM   3952  C CD2  . HIS A 1 33 ? -5.330  13.140  -4.406  1.00 4.91  ? 33 HIS A CD2  4  
ATOM   3953  C CE1  . HIS A 1 33 ? -3.810  14.377  -5.334  1.00 6.20  ? 33 HIS A CE1  4  
ATOM   3954  N NE2  . HIS A 1 33 ? -3.993  13.168  -4.797  1.00 5.23  ? 33 HIS A NE2  4  
ATOM   3955  H H    . HIS A 1 33 ? -5.790  16.874  -4.114  1.00 7.10  ? 33 HIS A H    4  
ATOM   3956  H HA   . HIS A 1 33 ? -8.325  16.157  -3.059  1.00 7.25  ? 33 HIS A HA   4  
ATOM   3957  H HB2  . HIS A 1 33 ? -8.008  14.039  -4.358  1.00 5.99  ? 33 HIS A HB2  4  
ATOM   3958  H HB3  . HIS A 1 33 ? -7.632  15.473  -5.307  1.00 6.92  ? 33 HIS A HB3  4  
ATOM   3959  H HD1  . HIS A 1 33 ? -5.047  16.009  -5.677  1.00 7.35  ? 33 HIS A HD1  4  
ATOM   3960  H HD2  . HIS A 1 33 ? -5.822  12.302  -3.934  1.00 4.33  ? 33 HIS A HD2  4  
ATOM   3961  H HE1  . HIS A 1 33 ? -2.859  14.742  -5.703  1.00 6.82  ? 33 HIS A HE1  4  
ATOM   3962  N N    . CYS A 1 34 ? -5.749  14.608  -1.716  1.00 5.51  ? 34 CYS A N    4  
ATOM   3963  C CA   . CYS A 1 34 ? -5.330  13.783  -0.554  1.00 5.12  ? 34 CYS A CA   4  
ATOM   3964  C C    . CYS A 1 34 ? -3.917  14.206  -0.137  1.00 5.54  ? 34 CYS A C    4  
ATOM   3965  O O    . CYS A 1 34 ? -2.973  14.078  -0.897  1.00 5.84  ? 34 CYS A O    4  
ATOM   3966  C CB   . CYS A 1 34 ? -5.334  12.293  -0.922  1.00 4.12  ? 34 CYS A CB   4  
ATOM   3967  S SG   . CYS A 1 34 ? -5.447  11.311  0.594   1.00 4.37  ? 34 CYS A SG   4  
ATOM   3968  H H    . CYS A 1 34 ? -5.069  14.994  -2.291  1.00 5.68  ? 34 CYS A H    4  
ATOM   3969  H HA   . CYS A 1 34 ? -6.008  13.958  0.257   1.00 5.59  ? 34 CYS A HA   4  
ATOM   3970  H HB2  . CYS A 1 34 ? -6.180  12.073  -1.558  1.00 4.04  ? 34 CYS A HB2  4  
ATOM   3971  H HB3  . CYS A 1 34 ? -4.420  12.047  -1.443  1.00 3.82  ? 34 CYS A HB3  4  
ATOM   3972  N N    . ALA A 1 35 ? -3.770  14.721  1.059   1.00 5.90  ? 35 ALA A N    4  
ATOM   3973  C CA   . ALA A 1 35 ? -2.423  15.172  1.534   1.00 6.66  ? 35 ALA A CA   4  
ATOM   3974  C C    . ALA A 1 35 ? -1.456  13.984  1.613   1.00 6.33  ? 35 ALA A C    4  
ATOM   3975  O O    . ALA A 1 35 ? -0.297  14.098  1.259   1.00 6.77  ? 35 ALA A O    4  
ATOM   3976  C CB   . ALA A 1 35 ? -2.559  15.811  2.920   1.00 7.59  ? 35 ALA A CB   4  
ATOM   3977  H H    . ALA A 1 35 ? -4.550  14.820  1.646   1.00 5.87  ? 35 ALA A H    4  
ATOM   3978  H HA   . ALA A 1 35 ? -2.032  15.901  0.845   1.00 7.06  ? 35 ALA A HA   4  
ATOM   3979  H HB1  . ALA A 1 35 ? -3.448  16.423  2.949   1.00 8.05  ? 35 ALA A HB1  4  
ATOM   3980  H HB2  . ALA A 1 35 ? -2.631  15.035  3.667   1.00 7.89  ? 35 ALA A HB2  4  
ATOM   3981  H HB3  . ALA A 1 35 ? -1.692  16.423  3.120   1.00 7.72  ? 35 ALA A HB3  4  
ATOM   3982  N N    . ASN A 1 36 ? -1.919  12.852  2.080   1.00 5.85  ? 36 ASN A N    4  
ATOM   3983  C CA   . ASN A 1 36 ? -1.027  11.659  2.192   1.00 5.88  ? 36 ASN A CA   4  
ATOM   3984  C C    . ASN A 1 36 ? -1.094  10.825  0.906   1.00 5.34  ? 36 ASN A C    4  
ATOM   3985  O O    . ASN A 1 36 ? -2.126  10.730  0.267   1.00 5.26  ? 36 ASN A O    4  
ATOM   3986  C CB   . ASN A 1 36 ? -1.475  10.804  3.381   1.00 6.50  ? 36 ASN A CB   4  
ATOM   3987  C CG   . ASN A 1 36 ? -0.785  11.299  4.656   1.00 7.27  ? 36 ASN A CG   4  
ATOM   3988  O OD1  . ASN A 1 36 ? -1.337  12.097  5.387   1.00 7.78  ? 36 ASN A OD1  4  
ATOM   3989  N ND2  . ASN A 1 36 ? 0.409   10.859  4.955   1.00 7.61  ? 36 ASN A ND2  4  
ATOM   3990  H H    . ASN A 1 36 ? -2.854  12.787  2.362   1.00 5.70  ? 36 ASN A H    4  
ATOM   3991  H HA   . ASN A 1 36 ? -0.010  11.987  2.352   1.00 6.19  ? 36 ASN A HA   4  
ATOM   3992  H HB2  . ASN A 1 36 ? -2.546  10.883  3.498   1.00 6.55  ? 36 ASN A HB2  4  
ATOM   3993  H HB3  . ASN A 1 36 ? -1.208  9.775   3.205   1.00 6.63  ? 36 ASN A HB3  4  
ATOM   3994  H HD21 . ASN A 1 36 ? 0.858   10.217  4.366   1.00 7.41  ? 36 ASN A HD21 4  
ATOM   3995  H HD22 . ASN A 1 36 ? 0.855   11.170  5.769   1.00 8.19  ? 36 ASN A HD22 4  
ATOM   3996  N N    . THR A 1 37 ? 0.006   10.212  0.533   1.00 5.30  ? 37 THR A N    4  
ATOM   3997  C CA   . THR A 1 37 ? 0.028   9.367   -0.704  1.00 5.18  ? 37 THR A CA   4  
ATOM   3998  C C    . THR A 1 37 ? -0.572  7.989   -0.376  1.00 4.58  ? 37 THR A C    4  
ATOM   3999  O O    . THR A 1 37 ? -0.606  7.584   0.772   1.00 4.95  ? 37 THR A O    4  
ATOM   4000  C CB   . THR A 1 37 ? 1.478   9.207   -1.192  1.00 5.98  ? 37 THR A CB   4  
ATOM   4001  O OG1  . THR A 1 37 ? 2.217   10.384  -0.890  1.00 6.76  ? 37 THR A OG1  4  
ATOM   4002  C CG2  . THR A 1 37 ? 1.493   8.977   -2.704  1.00 6.31  ? 37 THR A CG2  4  
ATOM   4003  H H    . THR A 1 37 ? 0.819   10.302  1.074   1.00 5.59  ? 37 THR A H    4  
ATOM   4004  H HA   . THR A 1 37 ? -0.563  9.843   -1.474  1.00 5.45  ? 37 THR A HA   4  
ATOM   4005  H HB   . THR A 1 37 ? 1.933   8.361   -0.700  1.00 6.11  ? 37 THR A HB   4  
ATOM   4006  H HG1  . THR A 1 37 ? 2.886   10.157  -0.240  1.00 7.02  ? 37 THR A HG1  4  
ATOM   4007  H HG21 . THR A 1 37 ? 0.794   9.650   -3.179  1.00 6.44  ? 37 THR A HG21 4  
ATOM   4008  H HG22 . THR A 1 37 ? 2.486   9.163   -3.086  1.00 6.33  ? 37 THR A HG22 4  
ATOM   4009  H HG23 . THR A 1 37 ? 1.211   7.957   -2.917  1.00 6.74  ? 37 THR A HG23 4  
ATOM   4010  N N    . GLU A 1 38 ? -1.058  7.270   -1.364  1.00 3.94  ? 38 GLU A N    4  
ATOM   4011  C CA   . GLU A 1 38 ? -1.664  5.933   -1.079  1.00 3.67  ? 38 GLU A CA   4  
ATOM   4012  C C    . GLU A 1 38 ? -1.350  4.945   -2.208  1.00 2.99  ? 38 GLU A C    4  
ATOM   4013  O O    . GLU A 1 38 ? -1.404  5.284   -3.375  1.00 3.33  ? 38 GLU A O    4  
ATOM   4014  C CB   . GLU A 1 38 ? -3.184  6.089   -0.953  1.00 4.35  ? 38 GLU A CB   4  
ATOM   4015  C CG   . GLU A 1 38 ? -3.718  5.117   0.105   1.00 4.96  ? 38 GLU A CG   4  
ATOM   4016  C CD   . GLU A 1 38 ? -4.913  5.747   0.827   1.00 5.76  ? 38 GLU A CD   4  
ATOM   4017  O OE1  . GLU A 1 38 ? -5.933  5.948   0.186   1.00 6.28  ? 38 GLU A OE1  4  
ATOM   4018  O OE2  . GLU A 1 38 ? -4.789  6.016   2.011   1.00 6.10  ? 38 GLU A OE2  4  
ATOM   4019  H H    . GLU A 1 38 ? -1.035  7.612   -2.286  1.00 3.89  ? 38 GLU A H    4  
ATOM   4020  H HA   . GLU A 1 38 ? -1.268  5.550   -0.149  1.00 3.96  ? 38 GLU A HA   4  
ATOM   4021  H HB2  . GLU A 1 38 ? -3.419  7.102   -0.662  1.00 4.73  ? 38 GLU A HB2  4  
ATOM   4022  H HB3  . GLU A 1 38 ? -3.648  5.872   -1.904  1.00 4.35  ? 38 GLU A HB3  4  
ATOM   4023  H HG2  . GLU A 1 38 ? -4.028  4.199   -0.373  1.00 5.14  ? 38 GLU A HG2  4  
ATOM   4024  H HG3  . GLU A 1 38 ? -2.939  4.904   0.822   1.00 4.98  ? 38 GLU A HG3  4  
ATOM   4025  N N    . ILE A 1 39 ? -1.045  3.717   -1.859  1.00 2.48  ? 39 ILE A N    4  
ATOM   4026  C CA   . ILE A 1 39 ? -0.751  2.682   -2.896  1.00 2.38  ? 39 ILE A CA   4  
ATOM   4027  C C    . ILE A 1 39 ? -2.050  1.909   -3.183  1.00 2.16  ? 39 ILE A C    4  
ATOM   4028  O O    . ILE A 1 39 ? -2.974  1.942   -2.391  1.00 2.22  ? 39 ILE A O    4  
ATOM   4029  C CB   . ILE A 1 39 ? 0.336   1.731   -2.357  1.00 2.57  ? 39 ILE A CB   4  
ATOM   4030  C CG1  . ILE A 1 39 ? 1.683   2.467   -2.302  1.00 2.79  ? 39 ILE A CG1  4  
ATOM   4031  C CG2  . ILE A 1 39 ? 0.474   0.500   -3.262  1.00 3.44  ? 39 ILE A CG2  4  
ATOM   4032  C CD1  . ILE A 1 39 ? 2.054   2.768   -0.848  1.00 2.94  ? 39 ILE A CD1  4  
ATOM   4033  H H    . ILE A 1 39 ? -1.027  3.469   -0.904  1.00 2.61  ? 39 ILE A H    4  
ATOM   4034  H HA   . ILE A 1 39 ? -0.404  3.159   -3.802  1.00 2.85  ? 39 ILE A HA   4  
ATOM   4035  H HB   . ILE A 1 39 ? 0.063   1.412   -1.363  1.00 2.54  ? 39 ILE A HB   4  
ATOM   4036  H HG12 . ILE A 1 39 ? 2.448   1.847   -2.746  1.00 3.36  ? 39 ILE A HG12 4  
ATOM   4037  H HG13 . ILE A 1 39 ? 1.610   3.394   -2.851  1.00 2.70  ? 39 ILE A HG13 4  
ATOM   4038  H HG21 . ILE A 1 39 ? 0.547   0.815   -4.292  1.00 3.64  ? 39 ILE A HG21 4  
ATOM   4039  H HG22 . ILE A 1 39 ? 1.364   -0.048  -2.990  1.00 4.05  ? 39 ILE A HG22 4  
ATOM   4040  H HG23 . ILE A 1 39 ? -0.390  -0.134  -3.141  1.00 3.75  ? 39 ILE A HG23 4  
ATOM   4041  H HD11 . ILE A 1 39 ? 1.530   2.088   -0.194  1.00 3.60  ? 39 ILE A HD11 4  
ATOM   4042  H HD12 . ILE A 1 39 ? 3.120   2.642   -0.716  1.00 2.88  ? 39 ILE A HD12 4  
ATOM   4043  H HD13 . ILE A 1 39 ? 1.779   3.784   -0.609  1.00 3.00  ? 39 ILE A HD13 4  
ATOM   4044  N N    . ILE A 1 40 ? -2.144  1.224   -4.302  1.00 2.34  ? 40 ILE A N    4  
ATOM   4045  C CA   . ILE A 1 40 ? -3.399  0.460   -4.604  1.00 2.36  ? 40 ILE A CA   4  
ATOM   4046  C C    . ILE A 1 40 ? -3.077  -0.766  -5.459  1.00 2.37  ? 40 ILE A C    4  
ATOM   4047  O O    . ILE A 1 40 ? -2.898  -0.671  -6.660  1.00 3.02  ? 40 ILE A O    4  
ATOM   4048  C CB   . ILE A 1 40 ? -4.404  1.335   -5.364  1.00 3.14  ? 40 ILE A CB   4  
ATOM   4049  C CG1  . ILE A 1 40 ? -4.714  2.599   -4.556  1.00 3.44  ? 40 ILE A CG1  4  
ATOM   4050  C CG2  . ILE A 1 40 ? -5.695  0.535   -5.579  1.00 3.70  ? 40 ILE A CG2  4  
ATOM   4051  C CD1  . ILE A 1 40 ? -5.508  3.580   -5.419  1.00 4.01  ? 40 ILE A CD1  4  
ATOM   4052  H H    . ILE A 1 40 ? -1.397  1.211   -4.935  1.00 2.72  ? 40 ILE A H    4  
ATOM   4053  H HA   . ILE A 1 40 ? -3.846  0.134   -3.675  1.00 2.37  ? 40 ILE A HA   4  
ATOM   4054  H HB   . ILE A 1 40 ? -3.990  1.609   -6.324  1.00 3.47  ? 40 ILE A HB   4  
ATOM   4055  H HG12 . ILE A 1 40 ? -5.291  2.337   -3.683  1.00 3.44  ? 40 ILE A HG12 4  
ATOM   4056  H HG13 . ILE A 1 40 ? -3.788  3.060   -4.250  1.00 3.71  ? 40 ILE A HG13 4  
ATOM   4057  H HG21 . ILE A 1 40 ? -5.471  -0.370  -6.128  1.00 3.94  ? 40 ILE A HG21 4  
ATOM   4058  H HG22 . ILE A 1 40 ? -6.122  0.276   -4.621  1.00 4.13  ? 40 ILE A HG22 4  
ATOM   4059  H HG23 . ILE A 1 40 ? -6.401  1.128   -6.139  1.00 3.89  ? 40 ILE A HG23 4  
ATOM   4060  H HD11 . ILE A 1 40 ? -6.336  3.066   -5.883  1.00 4.17  ? 40 ILE A HD11 4  
ATOM   4061  H HD12 . ILE A 1 40 ? -5.885  4.380   -4.798  1.00 4.33  ? 40 ILE A HD12 4  
ATOM   4062  H HD13 . ILE A 1 40 ? -4.866  3.991   -6.182  1.00 4.43  ? 40 ILE A HD13 4  
ATOM   4063  N N    . VAL A 1 41 ? -3.024  -1.921  -4.851  1.00 2.04  ? 41 VAL A N    4  
ATOM   4064  C CA   . VAL A 1 41 ? -2.742  -3.161  -5.618  1.00 2.10  ? 41 VAL A CA   4  
ATOM   4065  C C    . VAL A 1 41 ? -4.061  -3.885  -5.915  1.00 2.33  ? 41 VAL A C    4  
ATOM   4066  O O    . VAL A 1 41 ? -5.087  -3.602  -5.322  1.00 2.79  ? 41 VAL A O    4  
ATOM   4067  C CB   . VAL A 1 41 ? -1.826  -4.077  -4.799  1.00 2.21  ? 41 VAL A CB   4  
ATOM   4068  C CG1  . VAL A 1 41 ? -0.506  -3.361  -4.502  1.00 2.87  ? 41 VAL A CG1  4  
ATOM   4069  C CG2  . VAL A 1 41 ? -2.514  -4.471  -3.484  1.00 3.20  ? 41 VAL A CG2  4  
ATOM   4070  H H    . VAL A 1 41 ? -3.179  -1.975  -3.891  1.00 2.11  ? 41 VAL A H    4  
ATOM   4071  H HA   . VAL A 1 41 ? -2.258  -2.905  -6.547  1.00 2.57  ? 41 VAL A HA   4  
ATOM   4072  H HB   . VAL A 1 41 ? -1.624  -4.960  -5.370  1.00 2.10  ? 41 VAL A HB   4  
ATOM   4073  H HG11 . VAL A 1 41 ? -0.709  -2.354  -4.167  1.00 3.43  ? 41 VAL A HG11 4  
ATOM   4074  H HG12 . VAL A 1 41 ? 0.029   -3.895  -3.732  1.00 3.03  ? 41 VAL A HG12 4  
ATOM   4075  H HG13 . VAL A 1 41 ? 0.094   -3.326  -5.399  1.00 3.29  ? 41 VAL A HG13 4  
ATOM   4076  H HG21 . VAL A 1 41 ? -3.475  -3.984  -3.419  1.00 3.56  ? 41 VAL A HG21 4  
ATOM   4077  H HG22 . VAL A 1 41 ? -2.652  -5.542  -3.458  1.00 3.58  ? 41 VAL A HG22 4  
ATOM   4078  H HG23 . VAL A 1 41 ? -1.901  -4.170  -2.650  1.00 3.72  ? 41 VAL A HG23 4  
ATOM   4079  N N    . LYS A 1 42 ? -4.035  -4.821  -6.826  1.00 2.44  ? 42 LYS A N    4  
ATOM   4080  C CA   . LYS A 1 42 ? -5.268  -5.582  -7.172  1.00 2.97  ? 42 LYS A CA   4  
ATOM   4081  C C    . LYS A 1 42 ? -4.904  -7.063  -7.324  1.00 2.77  ? 42 LYS A C    4  
ATOM   4082  O O    . LYS A 1 42 ? -4.463  -7.496  -8.373  1.00 2.98  ? 42 LYS A O    4  
ATOM   4083  C CB   . LYS A 1 42 ? -5.850  -5.049  -8.488  1.00 3.77  ? 42 LYS A CB   4  
ATOM   4084  C CG   . LYS A 1 42 ? -7.170  -4.323  -8.207  1.00 4.68  ? 42 LYS A CG   4  
ATOM   4085  C CD   . LYS A 1 42 ? -7.992  -4.236  -9.497  1.00 5.42  ? 42 LYS A CD   4  
ATOM   4086  C CE   . LYS A 1 42 ? -7.459  -3.098  -10.374 1.00 5.72  ? 42 LYS A CE   4  
ATOM   4087  N NZ   . LYS A 1 42 ? -8.093  -1.810  -9.969  1.00 6.76  ? 42 LYS A NZ   4  
ATOM   4088  H H    . LYS A 1 42 ? -3.198  -5.026  -7.281  1.00 2.45  ? 42 LYS A H    4  
ATOM   4089  H HA   . LYS A 1 42 ? -5.994  -5.468  -6.380  1.00 3.37  ? 42 LYS A HA   4  
ATOM   4090  H HB2  . LYS A 1 42 ? -5.149  -4.361  -8.938  1.00 3.94  ? 42 LYS A HB2  4  
ATOM   4091  H HB3  . LYS A 1 42 ? -6.031  -5.871  -9.162  1.00 3.87  ? 42 LYS A HB3  4  
ATOM   4092  H HG2  . LYS A 1 42 ? -7.728  -4.869  -7.461  1.00 4.83  ? 42 LYS A HG2  4  
ATOM   4093  H HG3  . LYS A 1 42 ? -6.963  -3.327  -7.847  1.00 4.94  ? 42 LYS A HG3  4  
ATOM   4094  H HD2  . LYS A 1 42 ? -7.918  -5.171  -10.034 1.00 5.79  ? 42 LYS A HD2  4  
ATOM   4095  H HD3  . LYS A 1 42 ? -9.026  -4.044  -9.251  1.00 5.70  ? 42 LYS A HD3  4  
ATOM   4096  H HE2  . LYS A 1 42 ? -6.389  -3.025  -10.258 1.00 5.66  ? 42 LYS A HE2  4  
ATOM   4097  H HE3  . LYS A 1 42 ? -7.694  -3.304  -11.409 1.00 5.59  ? 42 LYS A HE3  4  
ATOM   4098  H HZ1  . LYS A 1 42 ? -9.128  -1.892  -10.041 1.00 7.24  ? 42 LYS A HZ1  4  
ATOM   4099  H HZ2  . LYS A 1 42 ? -7.831  -1.587  -8.986  1.00 6.85  ? 42 LYS A HZ2  4  
ATOM   4100  H HZ3  . LYS A 1 42 ? -7.764  -1.049  -10.596 1.00 7.12  ? 42 LYS A HZ3  4  
ATOM   4101  N N    . LEU A 1 43 ? -5.073  -7.834  -6.274  1.00 3.01  ? 43 LEU A N    4  
ATOM   4102  C CA   . LEU A 1 43 ? -4.733  -9.287  -6.323  1.00 3.31  ? 43 LEU A CA   4  
ATOM   4103  C C    . LEU A 1 43 ? -5.416  -9.964  -7.516  1.00 3.92  ? 43 LEU A C    4  
ATOM   4104  O O    . LEU A 1 43 ? -6.538  -9.642  -7.871  1.00 4.54  ? 43 LEU A O    4  
ATOM   4105  C CB   . LEU A 1 43 ? -5.201  -9.957  -5.034  1.00 4.01  ? 43 LEU A CB   4  
ATOM   4106  C CG   . LEU A 1 43 ? -4.328  -9.491  -3.858  1.00 3.77  ? 43 LEU A CG   4  
ATOM   4107  C CD1  . LEU A 1 43 ? -4.855  -10.085 -2.550  1.00 4.46  ? 43 LEU A CD1  4  
ATOM   4108  C CD2  . LEU A 1 43 ? -2.883  -9.950  -4.078  1.00 3.91  ? 43 LEU A CD2  4  
ATOM   4109  H H    . LEU A 1 43 ? -5.413  -7.452  -5.441  1.00 3.37  ? 43 LEU A H    4  
ATOM   4110  H HA   . LEU A 1 43 ? -3.663  -9.400  -6.415  1.00 3.08  ? 43 LEU A HA   4  
ATOM   4111  H HB2  . LEU A 1 43 ? -6.228  -9.694  -4.851  1.00 4.55  ? 43 LEU A HB2  4  
ATOM   4112  H HB3  . LEU A 1 43 ? -5.124  -11.021 -5.139  1.00 4.52  ? 43 LEU A HB3  4  
ATOM   4113  H HG   . LEU A 1 43 ? -4.358  -8.412  -3.799  1.00 3.53  ? 43 LEU A HG   4  
ATOM   4114  H HD11 . LEU A 1 43 ? -5.934  -10.064 -2.552  1.00 4.57  ? 43 LEU A HD11 4  
ATOM   4115  H HD12 . LEU A 1 43 ? -4.514  -11.105 -2.452  1.00 4.51  ? 43 LEU A HD12 4  
ATOM   4116  H HD13 . LEU A 1 43 ? -4.486  -9.502  -1.718  1.00 5.14  ? 43 LEU A HD13 4  
ATOM   4117  H HD21 . LEU A 1 43 ? -2.880  -10.940 -4.509  1.00 3.95  ? 43 LEU A HD21 4  
ATOM   4118  H HD22 . LEU A 1 43 ? -2.385  -9.265  -4.748  1.00 3.96  ? 43 LEU A HD22 4  
ATOM   4119  H HD23 . LEU A 1 43 ? -2.363  -9.968  -3.131  1.00 4.44  ? 43 LEU A HD23 4  
ATOM   4120  N N    . SER A 1 44 ? -4.731  -10.900 -8.129  1.00 3.99  ? 44 SER A N    4  
ATOM   4121  C CA   . SER A 1 44 ? -5.287  -11.627 -9.308  1.00 4.72  ? 44 SER A CA   4  
ATOM   4122  C C    . SER A 1 44 ? -6.575  -12.376 -8.935  1.00 5.55  ? 44 SER A C    4  
ATOM   4123  O O    . SER A 1 44 ? -7.415  -12.617 -9.782  1.00 6.08  ? 44 SER A O    4  
ATOM   4124  C CB   . SER A 1 44 ? -4.247  -12.621 -9.836  1.00 4.98  ? 44 SER A CB   4  
ATOM   4125  O OG   . SER A 1 44 ? -3.745  -13.404 -8.760  1.00 5.08  ? 44 SER A OG   4  
ATOM   4126  H H    . SER A 1 44 ? -3.837  -11.122 -7.810  1.00 3.70  ? 44 SER A H    4  
ATOM   4127  H HA   . SER A 1 44 ? -5.509  -10.910 -10.077 1.00 4.83  ? 44 SER A HA   4  
ATOM   4128  H HB2  . SER A 1 44 ? -4.706  -13.272 -10.563 1.00 5.14  ? 44 SER A HB2  4  
ATOM   4129  H HB3  . SER A 1 44 ? -3.439  -12.077 -10.307 1.00 5.37  ? 44 SER A HB3  4  
ATOM   4130  H HG   . SER A 1 44 ? -2.849  -13.671 -8.981  1.00 5.39  ? 44 SER A HG   4  
ATOM   4131  N N    . ASP A 1 45 ? -6.748  -12.736 -7.680  1.00 5.91  ? 45 ASP A N    4  
ATOM   4132  C CA   . ASP A 1 45 ? -7.991  -13.452 -7.271  1.00 7.02  ? 45 ASP A CA   4  
ATOM   4133  C C    . ASP A 1 45 ? -9.209  -12.518 -7.414  1.00 7.25  ? 45 ASP A C    4  
ATOM   4134  O O    . ASP A 1 45 ? -10.342 -12.957 -7.347  1.00 8.19  ? 45 ASP A O    4  
ATOM   4135  C CB   . ASP A 1 45 ? -7.863  -13.927 -5.811  1.00 7.64  ? 45 ASP A CB   4  
ATOM   4136  C CG   . ASP A 1 45 ? -8.114  -12.759 -4.844  1.00 8.01  ? 45 ASP A CG   4  
ATOM   4137  O OD1  . ASP A 1 45 ? -7.168  -12.050 -4.547  1.00 8.63  ? 45 ASP A OD1  4  
ATOM   4138  O OD2  . ASP A 1 45 ? -9.247  -12.598 -4.415  1.00 7.89  ? 45 ASP A OD2  4  
ATOM   4139  H H    . ASP A 1 45 ? -6.070  -12.528 -7.011  1.00 5.60  ? 45 ASP A H    4  
ATOM   4140  H HA   . ASP A 1 45 ? -8.123  -14.306 -7.909  1.00 7.48  ? 45 ASP A HA   4  
ATOM   4141  H HB2  . ASP A 1 45 ? -8.586  -14.708 -5.624  1.00 7.55  ? 45 ASP A HB2  4  
ATOM   4142  H HB3  . ASP A 1 45 ? -6.869  -14.316 -5.649  1.00 8.18  ? 45 ASP A HB3  4  
ATOM   4143  N N    . GLY A 1 46 ? -8.979  -11.235 -7.600  1.00 6.57  ? 46 GLY A N    4  
ATOM   4144  C CA   . GLY A 1 46 ? -10.106 -10.270 -7.738  1.00 7.07  ? 46 GLY A CA   4  
ATOM   4145  C C    . GLY A 1 46 ? -10.227 -9.445  -6.454  1.00 6.74  ? 46 GLY A C    4  
ATOM   4146  O O    . GLY A 1 46 ? -11.315 -9.072  -6.056  1.00 7.17  ? 46 GLY A O    4  
ATOM   4147  H H    . GLY A 1 46 ? -8.059  -10.905 -7.644  1.00 5.88  ? 46 GLY A H    4  
ATOM   4148  H HA2  . GLY A 1 46 ? -9.917  -9.613  -8.575  1.00 7.41  ? 46 GLY A HA2  4  
ATOM   4149  H HA3  . GLY A 1 46 ? -11.025 -10.809 -7.902  1.00 7.56  ? 46 GLY A HA3  4  
ATOM   4150  N N    . ARG A 1 47 ? -9.123  -9.163  -5.797  1.00 6.21  ? 47 ARG A N    4  
ATOM   4151  C CA   . ARG A 1 47 ? -9.183  -8.370  -4.535  1.00 6.07  ? 47 ARG A CA   4  
ATOM   4152  C C    . ARG A 1 47 ? -8.511  -7.005  -4.743  1.00 5.32  ? 47 ARG A C    4  
ATOM   4153  O O    . ARG A 1 47 ? -7.688  -6.837  -5.619  1.00 5.06  ? 47 ARG A O    4  
ATOM   4154  C CB   . ARG A 1 47 ? -8.444  -9.143  -3.437  1.00 6.43  ? 47 ARG A CB   4  
ATOM   4155  C CG   . ARG A 1 47 ? -8.895  -8.660  -2.054  1.00 7.27  ? 47 ARG A CG   4  
ATOM   4156  C CD   . ARG A 1 47 ? -10.192 -9.370  -1.658  1.00 7.96  ? 47 ARG A CD   4  
ATOM   4157  N NE   . ARG A 1 47 ? -10.504 -9.077  -0.230  1.00 8.82  ? 47 ARG A NE   4  
ATOM   4158  C CZ   . ARG A 1 47 ? -11.707 -8.698  0.114   1.00 9.62  ? 47 ARG A CZ   4  
ATOM   4159  N NH1  . ARG A 1 47 ? -12.669 -9.580  0.213   1.00 10.15 ? 47 ARG A NH1  4  
ATOM   4160  N NH2  . ARG A 1 47 ? -11.947 -7.435  0.362   1.00 10.10 ? 47 ARG A NH2  4  
ATOM   4161  H H    . ARG A 1 47 ? -8.250  -9.481  -6.133  1.00 6.06  ? 47 ARG A H    4  
ATOM   4162  H HA   . ARG A 1 47 ? -10.212 -8.226  -4.244  1.00 6.58  ? 47 ARG A HA   4  
ATOM   4163  H HB2  . ARG A 1 47 ? -8.659  -10.197 -3.537  1.00 6.43  ? 47 ARG A HB2  4  
ATOM   4164  H HB3  . ARG A 1 47 ? -7.384  -8.983  -3.544  1.00 6.47  ? 47 ARG A HB3  4  
ATOM   4165  H HG2  . ARG A 1 47 ? -8.126  -8.885  -1.328  1.00 7.60  ? 47 ARG A HG2  4  
ATOM   4166  H HG3  . ARG A 1 47 ? -9.064  -7.596  -2.078  1.00 7.34  ? 47 ARG A HG3  4  
ATOM   4167  H HD2  . ARG A 1 47 ? -11.000 -9.020  -2.284  1.00 7.82  ? 47 ARG A HD2  4  
ATOM   4168  H HD3  . ARG A 1 47 ? -10.073 -10.436 -1.789  1.00 8.20  ? 47 ARG A HD3  4  
ATOM   4169  H HE   . ARG A 1 47 ? -9.807  -9.169  0.453   1.00 8.93  ? 47 ARG A HE   4  
ATOM   4170  H HH11 . ARG A 1 47 ? -12.484 -10.546 0.025   1.00 9.97  ? 47 ARG A HH11 4  
ATOM   4171  H HH12 . ARG A 1 47 ? -13.590 -9.291  0.477   1.00 10.86 ? 47 ARG A HH12 4  
ATOM   4172  H HH21 . ARG A 1 47 ? -11.212 -6.762  0.287   1.00 9.88  ? 47 ARG A HH21 4  
ATOM   4173  H HH22 . ARG A 1 47 ? -12.867 -7.142  0.627   1.00 10.80 ? 47 ARG A HH22 4  
ATOM   4174  N N    . GLU A 1 48 ? -8.854  -6.035  -3.931  1.00 5.24  ? 48 GLU A N    4  
ATOM   4175  C CA   . GLU A 1 48 ? -8.231  -4.682  -4.049  1.00 4.73  ? 48 GLU A CA   4  
ATOM   4176  C C    . GLU A 1 48 ? -7.849  -4.207  -2.647  1.00 4.69  ? 48 GLU A C    4  
ATOM   4177  O O    . GLU A 1 48 ? -8.690  -4.081  -1.775  1.00 5.44  ? 48 GLU A O    4  
ATOM   4178  C CB   . GLU A 1 48 ? -9.221  -3.697  -4.681  1.00 5.60  ? 48 GLU A CB   4  
ATOM   4179  C CG   . GLU A 1 48 ? -8.471  -2.427  -5.099  1.00 5.76  ? 48 GLU A CG   4  
ATOM   4180  C CD   . GLU A 1 48 ? -9.392  -1.531  -5.933  1.00 6.79  ? 48 GLU A CD   4  
ATOM   4181  O OE1  . GLU A 1 48 ? -9.434  -1.718  -7.139  1.00 7.12  ? 48 GLU A OE1  4  
ATOM   4182  O OE2  . GLU A 1 48 ? -10.035 -0.672  -5.352  1.00 7.44  ? 48 GLU A OE2  4  
ATOM   4183  H H    . GLU A 1 48 ? -9.516  -6.201  -3.229  1.00 5.71  ? 48 GLU A H    4  
ATOM   4184  H HA   . GLU A 1 48 ? -7.339  -4.744  -4.660  1.00 4.10  ? 48 GLU A HA   4  
ATOM   4185  H HB2  . GLU A 1 48 ? -9.677  -4.150  -5.549  1.00 5.76  ? 48 GLU A HB2  4  
ATOM   4186  H HB3  . GLU A 1 48 ? -9.985  -3.441  -3.962  1.00 6.30  ? 48 GLU A HB3  4  
ATOM   4187  H HG2  . GLU A 1 48 ? -8.150  -1.892  -4.217  1.00 5.48  ? 48 GLU A HG2  4  
ATOM   4188  H HG3  . GLU A 1 48 ? -7.607  -2.697  -5.688  1.00 5.78  ? 48 GLU A HG3  4  
ATOM   4189  N N    . LEU A 1 49 ? -6.584  -3.959  -2.421  1.00 4.08  ? 49 LEU A N    4  
ATOM   4190  C CA   . LEU A 1 49 ? -6.137  -3.508  -1.072  1.00 4.35  ? 49 LEU A CA   4  
ATOM   4191  C C    . LEU A 1 49 ? -5.163  -2.347  -1.222  1.00 3.99  ? 49 LEU A C    4  
ATOM   4192  O O    . LEU A 1 49 ? -4.131  -2.482  -1.839  1.00 3.87  ? 49 LEU A O    4  
ATOM   4193  C CB   . LEU A 1 49 ? -5.404  -4.653  -0.364  1.00 4.67  ? 49 LEU A CB   4  
ATOM   4194  C CG   . LEU A 1 49 ? -6.239  -5.190  0.801   1.00 4.92  ? 49 LEU A CG   4  
ATOM   4195  C CD1  . LEU A 1 49 ? -7.298  -6.159  0.278   1.00 5.51  ? 49 LEU A CD1  4  
ATOM   4196  C CD2  . LEU A 1 49 ? -5.321  -5.932  1.776   1.00 4.69  ? 49 LEU A CD2  4  
ATOM   4197  H H    . LEU A 1 49 ? -5.925  -4.075  -3.144  1.00 3.67  ? 49 LEU A H    4  
ATOM   4198  H HA   . LEU A 1 49 ? -6.987  -3.200  -0.483  1.00 4.89  ? 49 LEU A HA   4  
ATOM   4199  H HB2  . LEU A 1 49 ? -5.213  -5.449  -1.068  1.00 4.69  ? 49 LEU A HB2  4  
ATOM   4200  H HB3  . LEU A 1 49 ? -4.466  -4.278  0.017   1.00 5.10  ? 49 LEU A HB3  4  
ATOM   4201  H HG   . LEU A 1 49 ? -6.720  -4.369  1.311   1.00 5.20  ? 49 LEU A HG   4  
ATOM   4202  H HD11 . LEU A 1 49 ? -6.961  -6.592  -0.653  1.00 5.91  ? 49 LEU A HD11 4  
ATOM   4203  H HD12 . LEU A 1 49 ? -7.454  -6.945  1.003   1.00 5.66  ? 49 LEU A HD12 4  
ATOM   4204  H HD13 . LEU A 1 49 ? -8.223  -5.629  0.116   1.00 5.74  ? 49 LEU A HD13 4  
ATOM   4205  H HD21 . LEU A 1 49 ? -4.356  -5.449  1.799   1.00 4.66  ? 49 LEU A HD21 4  
ATOM   4206  H HD22 . LEU A 1 49 ? -5.755  -5.916  2.764   1.00 5.11  ? 49 LEU A HD22 4  
ATOM   4207  H HD23 . LEU A 1 49 ? -5.203  -6.956  1.451   1.00 4.52  ? 49 LEU A HD23 4  
ATOM   4208  N N    . CYS A 1 50 ? -5.457  -1.221  -0.634  1.00 3.99  ? 50 CYS A N    4  
ATOM   4209  C CA   . CYS A 1 50 ? -4.515  -0.075  -0.722  1.00 3.63  ? 50 CYS A CA   4  
ATOM   4210  C C    . CYS A 1 50 ? -3.409  -0.309  0.299   1.00 3.49  ? 50 CYS A C    4  
ATOM   4211  O O    . CYS A 1 50 ? -3.654  -0.827  1.369   1.00 4.14  ? 50 CYS A O    4  
ATOM   4212  C CB   . CYS A 1 50 ? -5.226  1.228   -0.415  1.00 3.72  ? 50 CYS A CB   4  
ATOM   4213  S SG   . CYS A 1 50 ? -6.875  1.233   -1.170  1.00 4.64  ? 50 CYS A SG   4  
ATOM   4214  H H    . CYS A 1 50 ? -6.275  -1.141  -0.111  1.00 4.28  ? 50 CYS A H    4  
ATOM   4215  H HA   . CYS A 1 50 ? -4.092  -0.026  -1.704  1.00 3.59  ? 50 CYS A HA   4  
ATOM   4216  H HB2  . CYS A 1 50 ? -5.300  1.331   0.640   1.00 3.90  ? 50 CYS A HB2  4  
ATOM   4217  H HB3  . CYS A 1 50 ? -4.651  2.045   -0.811  1.00 3.38  ? 50 CYS A HB3  4  
ATOM   4218  N N    . LEU A 1 51 ? -2.199  0.036   -0.026  1.00 2.91  ? 51 LEU A N    4  
ATOM   4219  C CA   . LEU A 1 51 ? -1.081  -0.202  0.918   1.00 2.96  ? 51 LEU A CA   4  
ATOM   4220  C C    . LEU A 1 51 ? -0.705  1.079   1.645   1.00 3.35  ? 51 LEU A C    4  
ATOM   4221  O O    . LEU A 1 51 ? -0.969  2.184   1.196   1.00 3.56  ? 51 LEU A O    4  
ATOM   4222  C CB   . LEU A 1 51 ? 0.132   -0.734  0.167   1.00 2.71  ? 51 LEU A CB   4  
ATOM   4223  C CG   . LEU A 1 51 ? -0.138  -2.155  -0.343  1.00 2.56  ? 51 LEU A CG   4  
ATOM   4224  C CD1  . LEU A 1 51 ? -1.135  -2.119  -1.498  1.00 2.98  ? 51 LEU A CD1  4  
ATOM   4225  C CD2  . LEU A 1 51 ? 1.174   -2.780  -0.823  1.00 2.61  ? 51 LEU A CD2  4  
ATOM   4226  H H    . LEU A 1 51 ? -2.023  0.433   -0.891  1.00 2.70  ? 51 LEU A H    4  
ATOM   4227  H HA   . LEU A 1 51 ? -1.390  -0.932  1.644   1.00 3.34  ? 51 LEU A HA   4  
ATOM   4228  H HB2  . LEU A 1 51 ? 0.350   -0.085  -0.654  1.00 2.95  ? 51 LEU A HB2  4  
ATOM   4229  H HB3  . LEU A 1 51 ? 0.973   -0.751  0.831   1.00 2.93  ? 51 LEU A HB3  4  
ATOM   4230  H HG   . LEU A 1 51 ? -0.552  -2.750  0.453   1.00 2.88  ? 51 LEU A HG   4  
ATOM   4231  H HD11 . LEU A 1 51 ? -1.192  -1.118  -1.896  1.00 3.34  ? 51 LEU A HD11 4  
ATOM   4232  H HD12 . LEU A 1 51 ? -0.812  -2.795  -2.270  1.00 3.13  ? 51 LEU A HD12 4  
ATOM   4233  H HD13 . LEU A 1 51 ? -2.106  -2.421  -1.138  1.00 3.38  ? 51 LEU A HD13 4  
ATOM   4234  H HD21 . LEU A 1 51 ? 1.640   -2.128  -1.548  1.00 2.77  ? 51 LEU A HD21 4  
ATOM   4235  H HD22 . LEU A 1 51 ? 1.838   -2.915  0.018   1.00 3.04  ? 51 LEU A HD22 4  
ATOM   4236  H HD23 . LEU A 1 51 ? 0.972   -3.739  -1.278  1.00 2.85  ? 51 LEU A HD23 4  
ATOM   4237  N N    . ASP A 1 52 ? -0.079  0.905   2.774   1.00 3.84  ? 52 ASP A N    4  
ATOM   4238  C CA   . ASP A 1 52 ? 0.352   2.052   3.615   1.00 4.35  ? 52 ASP A CA   4  
ATOM   4239  C C    . ASP A 1 52 ? 1.870   2.248   3.472   1.00 4.47  ? 52 ASP A C    4  
ATOM   4240  O O    . ASP A 1 52 ? 2.643   1.384   3.852   1.00 4.73  ? 52 ASP A O    4  
ATOM   4241  C CB   . ASP A 1 52 ? 0.002   1.738   5.079   1.00 4.93  ? 52 ASP A CB   4  
ATOM   4242  C CG   . ASP A 1 52 ? 0.027   3.016   5.934   1.00 5.39  ? 52 ASP A CG   4  
ATOM   4243  O OD1  . ASP A 1 52 ? -0.244  4.083   5.403   1.00 5.96  ? 52 ASP A OD1  4  
ATOM   4244  O OD2  . ASP A 1 52 ? 0.305   2.899   7.115   1.00 5.40  ? 52 ASP A OD2  4  
ATOM   4245  H H    . ASP A 1 52 ? 0.110   -0.009  3.069   1.00 4.08  ? 52 ASP A H    4  
ATOM   4246  H HA   . ASP A 1 52 ? -0.166  2.945   3.302   1.00 4.52  ? 52 ASP A HA   4  
ATOM   4247  H HB2  . ASP A 1 52 ? -0.986  1.300   5.121   1.00 5.32  ? 52 ASP A HB2  4  
ATOM   4248  H HB3  . ASP A 1 52 ? 0.718   1.032   5.473   1.00 4.91  ? 52 ASP A HB3  4  
ATOM   4249  N N    . PRO A 1 53 ? 2.257   3.388   2.937   1.00 4.54  ? 53 PRO A N    4  
ATOM   4250  C CA   . PRO A 1 53 ? 3.682   3.717   2.734   1.00 4.96  ? 53 PRO A CA   4  
ATOM   4251  C C    . PRO A 1 53 ? 4.400   3.959   4.072   1.00 5.21  ? 53 PRO A C    4  
ATOM   4252  O O    . PRO A 1 53 ? 5.608   4.104   4.109   1.00 5.67  ? 53 PRO A O    4  
ATOM   4253  C CB   . PRO A 1 53 ? 3.646   4.978   1.864   1.00 5.26  ? 53 PRO A CB   4  
ATOM   4254  C CG   . PRO A 1 53 ? 2.248   5.605   2.065   1.00 5.04  ? 53 PRO A CG   4  
ATOM   4255  C CD   . PRO A 1 53 ? 1.324   4.456   2.511   1.00 4.55  ? 53 PRO A CD   4  
ATOM   4256  H HA   . PRO A 1 53 ? 4.171   2.923   2.193   1.00 5.07  ? 53 PRO A HA   4  
ATOM   4257  H HB2  . PRO A 1 53 ? 4.415   5.670   2.181   1.00 5.72  ? 53 PRO A HB2  4  
ATOM   4258  H HB3  . PRO A 1 53 ? 3.782   4.719   0.826   1.00 5.40  ? 53 PRO A HB3  4  
ATOM   4259  H HG2  . PRO A 1 53 ? 2.291   6.370   2.828   1.00 5.39  ? 53 PRO A HG2  4  
ATOM   4260  H HG3  . PRO A 1 53 ? 1.890   6.022   1.136   1.00 5.11  ? 53 PRO A HG3  4  
ATOM   4261  H HD2  . PRO A 1 53 ? 0.702   4.774   3.336   1.00 4.78  ? 53 PRO A HD2  4  
ATOM   4262  H HD3  . PRO A 1 53 ? 0.718   4.117   1.686   1.00 4.27  ? 53 PRO A HD3  4  
ATOM   4263  N N    . LYS A 1 54 ? 3.675   3.986   5.173   1.00 5.18  ? 54 LYS A N    4  
ATOM   4264  C CA   . LYS A 1 54 ? 4.323   4.194   6.496   1.00 5.61  ? 54 LYS A CA   4  
ATOM   4265  C C    . LYS A 1 54 ? 5.299   3.043   6.781   1.00 5.02  ? 54 LYS A C    4  
ATOM   4266  O O    . LYS A 1 54 ? 6.303   3.230   7.443   1.00 5.42  ? 54 LYS A O    4  
ATOM   4267  C CB   . LYS A 1 54 ? 3.257   4.237   7.594   1.00 6.23  ? 54 LYS A CB   4  
ATOM   4268  C CG   . LYS A 1 54 ? 2.829   5.688   7.843   1.00 7.12  ? 54 LYS A CG   4  
ATOM   4269  C CD   . LYS A 1 54 ? 3.559   6.238   9.070   1.00 7.85  ? 54 LYS A CD   4  
ATOM   4270  C CE   . LYS A 1 54 ? 2.741   5.942   10.331  1.00 8.63  ? 54 LYS A CE   4  
ATOM   4271  N NZ   . LYS A 1 54 ? 3.365   6.620   11.503  1.00 9.56  ? 54 LYS A NZ   4  
ATOM   4272  H H    . LYS A 1 54 ? 2.712   3.859   5.130   1.00 5.07  ? 54 LYS A H    4  
ATOM   4273  H HA   . LYS A 1 54 ? 4.859   5.123   6.480   1.00 6.14  ? 54 LYS A HA   4  
ATOM   4274  H HB2  . LYS A 1 54 ? 2.403   3.658   7.285   1.00 6.01  ? 54 LYS A HB2  4  
ATOM   4275  H HB3  . LYS A 1 54 ? 3.662   3.823   8.504   1.00 6.42  ? 54 LYS A HB3  4  
ATOM   4276  H HG2  . LYS A 1 54 ? 3.073   6.288   6.978   1.00 7.47  ? 54 LYS A HG2  4  
ATOM   4277  H HG3  . LYS A 1 54 ? 1.763   5.723   8.015   1.00 7.15  ? 54 LYS A HG3  4  
ATOM   4278  H HD2  . LYS A 1 54 ? 4.529   5.769   9.152   1.00 8.02  ? 54 LYS A HD2  4  
ATOM   4279  H HD3  . LYS A 1 54 ? 3.683   7.305   8.966   1.00 7.93  ? 54 LYS A HD3  4  
ATOM   4280  H HE2  . LYS A 1 54 ? 1.733   6.309   10.200  1.00 8.78  ? 54 LYS A HE2  4  
ATOM   4281  H HE3  . LYS A 1 54 ? 2.717   4.877   10.502  1.00 8.58  ? 54 LYS A HE3  4  
ATOM   4282  H HZ1  . LYS A 1 54 ? 4.346   6.293   11.612  1.00 9.84  ? 54 LYS A HZ1  4  
ATOM   4283  H HZ2  . LYS A 1 54 ? 3.357   7.650   11.356  1.00 9.93  ? 54 LYS A HZ2  4  
ATOM   4284  H HZ3  . LYS A 1 54 ? 2.829   6.388   12.363  1.00 9.78  ? 54 LYS A HZ3  4  
ATOM   4285  N N    . GLU A 1 55 ? 5.022   1.856   6.277   1.00 4.37  ? 55 GLU A N    4  
ATOM   4286  C CA   . GLU A 1 55 ? 5.942   0.712   6.513   1.00 4.14  ? 55 GLU A CA   4  
ATOM   4287  C C    . GLU A 1 55 ? 7.032   0.713   5.445   1.00 3.84  ? 55 GLU A C    4  
ATOM   4288  O O    . GLU A 1 55 ? 6.963   1.429   4.463   1.00 3.83  ? 55 GLU A O    4  
ATOM   4289  C CB   . GLU A 1 55 ? 5.171   -0.608  6.407   1.00 4.19  ? 55 GLU A CB   4  
ATOM   4290  C CG   . GLU A 1 55 ? 4.414   -0.900  7.701   1.00 4.76  ? 55 GLU A CG   4  
ATOM   4291  C CD   . GLU A 1 55 ? 5.402   -1.039  8.863   1.00 5.39  ? 55 GLU A CD   4  
ATOM   4292  O OE1  . GLU A 1 55 ? 6.027   -2.082  8.964   1.00 5.43  ? 55 GLU A OE1  4  
ATOM   4293  O OE2  . GLU A 1 55 ? 5.517   -0.098  9.632   1.00 6.13  ? 55 GLU A OE2  4  
ATOM   4294  H H    . GLU A 1 55 ? 4.215   1.721   5.734   1.00 4.29  ? 55 GLU A H    4  
ATOM   4295  H HA   . GLU A 1 55 ? 6.389   0.796   7.491   1.00 4.53  ? 55 GLU A HA   4  
ATOM   4296  H HB2  . GLU A 1 55 ? 4.477   -0.547  5.590   1.00 4.04  ? 55 GLU A HB2  4  
ATOM   4297  H HB3  . GLU A 1 55 ? 5.863   -1.406  6.219   1.00 4.32  ? 55 GLU A HB3  4  
ATOM   4298  H HG2  . GLU A 1 55 ? 3.728   -0.099  7.901   1.00 4.81  ? 55 GLU A HG2  4  
ATOM   4299  H HG3  . GLU A 1 55 ? 3.863   -1.821  7.591   1.00 4.98  ? 55 GLU A HG3  4  
ATOM   4300  N N    . ASN A 1 56 ? 8.017   -0.118  5.620   1.00 3.90  ? 56 ASN A N    4  
ATOM   4301  C CA   . ASN A 1 56 ? 9.109   -0.220  4.611   1.00 3.93  ? 56 ASN A CA   4  
ATOM   4302  C C    . ASN A 1 56 ? 8.808   -1.392  3.670   1.00 3.74  ? 56 ASN A C    4  
ATOM   4303  O O    . ASN A 1 56 ? 9.374   -1.493  2.601   1.00 3.89  ? 56 ASN A O    4  
ATOM   4304  C CB   . ASN A 1 56 ? 10.439  -0.453  5.309   1.00 4.29  ? 56 ASN A CB   4  
ATOM   4305  C CG   . ASN A 1 56 ? 11.379  0.721   5.022   1.00 4.70  ? 56 ASN A CG   4  
ATOM   4306  O OD1  . ASN A 1 56 ? 12.261  0.619   4.191   1.00 4.90  ? 56 ASN A OD1  4  
ATOM   4307  N ND2  . ASN A 1 56 ? 11.229  1.842   5.676   1.00 5.15  ? 56 ASN A ND2  4  
ATOM   4308  H H    . ASN A 1 56 ? 8.023   -0.700  6.408   1.00 4.12  ? 56 ASN A H    4  
ATOM   4309  H HA   . ASN A 1 56 ? 9.162   0.688   4.047   1.00 4.07  ? 56 ASN A HA   4  
ATOM   4310  H HB2  . ASN A 1 56 ? 10.272  -0.534  6.367   1.00 4.38  ? 56 ASN A HB2  4  
ATOM   4311  H HB3  . ASN A 1 56 ? 10.880  -1.362  4.939   1.00 4.36  ? 56 ASN A HB3  4  
ATOM   4312  H HD21 . ASN A 1 56 ? 10.518  1.928   6.344   1.00 5.31  ? 56 ASN A HD21 4  
ATOM   4313  H HD22 . ASN A 1 56 ? 11.826  2.597   5.495   1.00 5.51  ? 56 ASN A HD22 4  
ATOM   4314  N N    . TRP A 1 57 ? 7.916   -2.277  4.065   1.00 3.55  ? 57 TRP A N    4  
ATOM   4315  C CA   . TRP A 1 57 ? 7.569   -3.436  3.211   1.00 3.47  ? 57 TRP A CA   4  
ATOM   4316  C C    . TRP A 1 57 ? 6.679   -2.979  2.058   1.00 3.28  ? 57 TRP A C    4  
ATOM   4317  O O    . TRP A 1 57 ? 6.802   -3.458  0.957   1.00 3.48  ? 57 TRP A O    4  
ATOM   4318  C CB   . TRP A 1 57 ? 6.871   -4.509  4.058   1.00 3.64  ? 57 TRP A CB   4  
ATOM   4319  C CG   . TRP A 1 57 ? 5.452   -4.156  4.367   1.00 3.70  ? 57 TRP A CG   4  
ATOM   4320  C CD1  . TRP A 1 57 ? 5.029   -3.672  5.543   1.00 4.08  ? 57 TRP A CD1  4  
ATOM   4321  C CD2  . TRP A 1 57 ? 4.268   -4.272  3.523   1.00 3.51  ? 57 TRP A CD2  4  
ATOM   4322  N NE1  . TRP A 1 57 ? 3.662   -3.509  5.495   1.00 4.20  ? 57 TRP A NE1  4  
ATOM   4323  C CE2  . TRP A 1 57 ? 3.146   -3.849  4.267   1.00 3.80  ? 57 TRP A CE2  4  
ATOM   4324  C CE3  . TRP A 1 57 ? 4.060   -4.697  2.202   1.00 3.27  ? 57 TRP A CE3  4  
ATOM   4325  C CZ2  . TRP A 1 57 ? 1.860   -3.852  3.726   1.00 3.76  ? 57 TRP A CZ2  4  
ATOM   4326  C CZ3  . TRP A 1 57 ? 2.773   -4.695  1.650   1.00 3.17  ? 57 TRP A CZ3  4  
ATOM   4327  C CH2  . TRP A 1 57 ? 1.672   -4.273  2.410   1.00 3.38  ? 57 TRP A CH2  4  
ATOM   4328  H H    . TRP A 1 57 ? 7.477   -2.176  4.923   1.00 3.59  ? 57 TRP A H    4  
ATOM   4329  H HA   . TRP A 1 57 ? 8.477   -3.843  2.811   1.00 3.59  ? 57 TRP A HA   4  
ATOM   4330  H HB2  . TRP A 1 57 ? 6.877   -5.434  3.533   1.00 3.77  ? 57 TRP A HB2  4  
ATOM   4331  H HB3  . TRP A 1 57 ? 7.413   -4.628  4.980   1.00 3.78  ? 57 TRP A HB3  4  
ATOM   4332  H HD1  . TRP A 1 57 ? 5.654   -3.460  6.387   1.00 4.35  ? 57 TRP A HD1  4  
ATOM   4333  H HE1  . TRP A 1 57 ? 3.114   -3.190  6.226   1.00 4.57  ? 57 TRP A HE1  4  
ATOM   4334  H HE3  . TRP A 1 57 ? 4.897   -5.025  1.608   1.00 3.29  ? 57 TRP A HE3  4  
ATOM   4335  H HZ2  . TRP A 1 57 ? 1.019   -3.524  4.319   1.00 4.10  ? 57 TRP A HZ2  4  
ATOM   4336  H HZ3  . TRP A 1 57 ? 2.628   -5.011  0.633   1.00 3.03  ? 57 TRP A HZ3  4  
ATOM   4337  H HH2  . TRP A 1 57 ? 0.683   -4.273  1.978   1.00 3.37  ? 57 TRP A HH2  4  
ATOM   4338  N N    . VAL A 1 58 ? 5.787   -2.054  2.301   1.00 3.02  ? 58 VAL A N    4  
ATOM   4339  C CA   . VAL A 1 58 ? 4.900   -1.565  1.198   1.00 2.84  ? 58 VAL A CA   4  
ATOM   4340  C C    . VAL A 1 58 ? 5.763   -0.883  0.130   1.00 2.99  ? 58 VAL A C    4  
ATOM   4341  O O    . VAL A 1 58 ? 5.592   -1.110  -1.052  1.00 3.21  ? 58 VAL A O    4  
ATOM   4342  C CB   . VAL A 1 58 ? 3.885   -0.563  1.766   1.00 2.78  ? 58 VAL A CB   4  
ATOM   4343  C CG1  . VAL A 1 58 ? 3.347   0.345   0.657   1.00 2.80  ? 58 VAL A CG1  4  
ATOM   4344  C CG2  . VAL A 1 58 ? 2.721   -1.313  2.403   1.00 2.85  ? 58 VAL A CG2  4  
ATOM   4345  H H    . VAL A 1 58 ? 5.705   -1.679  3.207   1.00 3.04  ? 58 VAL A H    4  
ATOM   4346  H HA   . VAL A 1 58 ? 4.383   -2.403  0.756   1.00 2.96  ? 58 VAL A HA   4  
ATOM   4347  H HB   . VAL A 1 58 ? 4.368   0.036   2.515   1.00 3.12  ? 58 VAL A HB   4  
ATOM   4348  H HG11 . VAL A 1 58 ? 3.098   -0.250  -0.209  1.00 3.08  ? 58 VAL A HG11 4  
ATOM   4349  H HG12 . VAL A 1 58 ? 2.462   0.855   1.009   1.00 3.10  ? 58 VAL A HG12 4  
ATOM   4350  H HG13 . VAL A 1 58 ? 4.100   1.072   0.391   1.00 2.86  ? 58 VAL A HG13 4  
ATOM   4351  H HG21 . VAL A 1 58 ? 2.461   -2.159  1.787   1.00 2.93  ? 58 VAL A HG21 4  
ATOM   4352  H HG22 . VAL A 1 58 ? 3.011   -1.656  3.384   1.00 3.15  ? 58 VAL A HG22 4  
ATOM   4353  H HG23 . VAL A 1 58 ? 1.871   -0.655  2.488   1.00 3.17  ? 58 VAL A HG23 4  
ATOM   4354  N N    . GLN A 1 59 ? 6.690   -0.054  0.543   1.00 3.12  ? 59 GLN A N    4  
ATOM   4355  C CA   . GLN A 1 59 ? 7.569   0.643   -0.436  1.00 3.61  ? 59 GLN A CA   4  
ATOM   4356  C C    . GLN A 1 59 ? 8.615   -0.333  -0.999  1.00 3.90  ? 59 GLN A C    4  
ATOM   4357  O O    . GLN A 1 59 ? 9.103   -0.152  -2.098  1.00 4.47  ? 59 GLN A O    4  
ATOM   4358  C CB   . GLN A 1 59 ? 8.251   1.827   0.248   1.00 3.82  ? 59 GLN A CB   4  
ATOM   4359  C CG   . GLN A 1 59 ? 9.204   1.308   1.311   1.00 4.33  ? 59 GLN A CG   4  
ATOM   4360  C CD   . GLN A 1 59 ? 9.850   2.482   2.053   1.00 4.72  ? 59 GLN A CD   4  
ATOM   4361  O OE1  . GLN A 1 59 ? 9.309   2.974   3.022   1.00 4.84  ? 59 GLN A OE1  4  
ATOM   4362  N NE2  . GLN A 1 59 ? 10.993  2.956   1.634   1.00 5.29  ? 59 GLN A NE2  4  
ATOM   4363  H H    . GLN A 1 59 ? 6.811   0.107   1.500   1.00 3.04  ? 59 GLN A H    4  
ATOM   4364  H HA   . GLN A 1 59 ? 6.971   1.009   -1.240  1.00 3.80  ? 59 GLN A HA   4  
ATOM   4365  H HB2  . GLN A 1 59 ? 8.796   2.394   -0.483  1.00 3.96  ? 59 GLN A HB2  4  
ATOM   4366  H HB3  . GLN A 1 59 ? 7.503   2.455   0.711   1.00 3.78  ? 59 GLN A HB3  4  
ATOM   4367  H HG2  . GLN A 1 59 ? 8.650   0.697   2.005   1.00 4.58  ? 59 GLN A HG2  4  
ATOM   4368  H HG3  . GLN A 1 59 ? 9.967   0.715   0.837   1.00 4.52  ? 59 GLN A HG3  4  
ATOM   4369  H HE21 . GLN A 1 59 ? 11.432  2.561   0.851   1.00 5.47  ? 59 GLN A HE21 4  
ATOM   4370  H HE22 . GLN A 1 59 ? 11.412  3.709   2.101   1.00 5.70  ? 59 GLN A HE22 4  
ATOM   4371  N N    . ARG A 1 60 ? 8.942   -1.378  -0.271  1.00 3.65  ? 60 ARG A N    4  
ATOM   4372  C CA   . ARG A 1 60 ? 9.932   -2.372  -0.781  1.00 3.97  ? 60 ARG A CA   4  
ATOM   4373  C C    . ARG A 1 60 ? 9.201   -3.354  -1.691  1.00 3.96  ? 60 ARG A C    4  
ATOM   4374  O O    . ARG A 1 60 ? 9.707   -3.754  -2.720  1.00 4.42  ? 60 ARG A O    4  
ATOM   4375  C CB   . ARG A 1 60 ? 10.561  -3.130  0.392   1.00 4.07  ? 60 ARG A CB   4  
ATOM   4376  C CG   . ARG A 1 60 ? 11.818  -2.393  0.862   1.00 4.60  ? 60 ARG A CG   4  
ATOM   4377  C CD   . ARG A 1 60 ? 12.271  -2.956  2.213   1.00 4.81  ? 60 ARG A CD   4  
ATOM   4378  N NE   . ARG A 1 60 ? 12.638  -4.393  2.059   1.00 5.26  ? 60 ARG A NE   4  
ATOM   4379  C CZ   . ARG A 1 60 ? 12.296  -5.259  2.977   1.00 5.84  ? 60 ARG A CZ   4  
ATOM   4380  N NH1  . ARG A 1 60 ? 11.037  -5.578  3.138   1.00 6.25  ? 60 ARG A NH1  4  
ATOM   4381  N NH2  . ARG A 1 60 ? 13.214  -5.805  3.733   1.00 6.35  ? 60 ARG A NH2  4  
ATOM   4382  H H    . ARG A 1 60 ? 8.518   -1.522  0.600   1.00 3.35  ? 60 ARG A H    4  
ATOM   4383  H HA   . ARG A 1 60 ? 10.702  -1.862  -1.342  1.00 4.24  ? 60 ARG A HA   4  
ATOM   4384  H HB2  . ARG A 1 60 ? 9.851   -3.192  1.203   1.00 3.95  ? 60 ARG A HB2  4  
ATOM   4385  H HB3  . ARG A 1 60 ? 10.829  -4.125  0.073   1.00 4.07  ? 60 ARG A HB3  4  
ATOM   4386  H HG2  . ARG A 1 60 ? 12.605  -2.524  0.134   1.00 4.80  ? 60 ARG A HG2  4  
ATOM   4387  H HG3  . ARG A 1 60 ? 11.599  -1.341  0.969   1.00 4.99  ? 60 ARG A HG3  4  
ATOM   4388  H HD2  . ARG A 1 60 ? 13.127  -2.400  2.565   1.00 4.73  ? 60 ARG A HD2  4  
ATOM   4389  H HD3  . ARG A 1 60 ? 11.466  -2.864  2.928   1.00 5.10  ? 60 ARG A HD3  4  
ATOM   4390  H HE   . ARG A 1 60 ? 13.138  -4.689  1.269   1.00 5.37  ? 60 ARG A HE   4  
ATOM   4391  H HH11 . ARG A 1 60 ? 10.336  -5.160  2.558   1.00 6.14  ? 60 ARG A HH11 4  
ATOM   4392  H HH12 . ARG A 1 60 ? 10.774  -6.241  3.840   1.00 6.86  ? 60 ARG A HH12 4  
ATOM   4393  H HH21 . ARG A 1 60 ? 14.177  -5.561  3.609   1.00 6.32  ? 60 ARG A HH21 4  
ATOM   4394  H HH22 . ARG A 1 60 ? 12.955  -6.467  4.436   1.00 6.96  ? 60 ARG A HH22 4  
ATOM   4395  N N    . VAL A 1 61 ? 8.000   -3.730  -1.319  1.00 3.58  ? 61 VAL A N    4  
ATOM   4396  C CA   . VAL A 1 61 ? 7.203   -4.670  -2.156  1.00 3.55  ? 61 VAL A CA   4  
ATOM   4397  C C    . VAL A 1 61 ? 6.820   -3.963  -3.462  1.00 3.25  ? 61 VAL A C    4  
ATOM   4398  O O    . VAL A 1 61 ? 6.862   -4.549  -4.525  1.00 3.52  ? 61 VAL A O    4  
ATOM   4399  C CB   . VAL A 1 61 ? 5.943   -5.083  -1.381  1.00 3.59  ? 61 VAL A CB   4  
ATOM   4400  C CG1  . VAL A 1 61 ? 4.953   -5.775  -2.314  1.00 3.56  ? 61 VAL A CG1  4  
ATOM   4401  C CG2  . VAL A 1 61 ? 6.332   -6.047  -0.255  1.00 4.31  ? 61 VAL A CG2  4  
ATOM   4402  H H    . VAL A 1 61 ? 7.614   -3.379  -0.484  1.00 3.39  ? 61 VAL A H    4  
ATOM   4403  H HA   . VAL A 1 61 ? 7.796   -5.541  -2.382  1.00 3.93  ? 61 VAL A HA   4  
ATOM   4404  H HB   . VAL A 1 61 ? 5.479   -4.204  -0.957  1.00 3.40  ? 61 VAL A HB   4  
ATOM   4405  H HG11 . VAL A 1 61 ? 5.437   -6.612  -2.792  1.00 3.73  ? 61 VAL A HG11 4  
ATOM   4406  H HG12 . VAL A 1 61 ? 4.107   -6.127  -1.742  1.00 3.88  ? 61 VAL A HG12 4  
ATOM   4407  H HG13 . VAL A 1 61 ? 4.614   -5.074  -3.063  1.00 3.52  ? 61 VAL A HG13 4  
ATOM   4408  H HG21 . VAL A 1 61 ? 7.116   -5.605  0.342   1.00 4.75  ? 61 VAL A HG21 4  
ATOM   4409  H HG22 . VAL A 1 61 ? 5.471   -6.237  0.367   1.00 4.45  ? 61 VAL A HG22 4  
ATOM   4410  H HG23 . VAL A 1 61 ? 6.682   -6.974  -0.680  1.00 4.58  ? 61 VAL A HG23 4  
ATOM   4411  N N    . VAL A 1 62 ? 6.467   -2.699  -3.387  1.00 2.99  ? 62 VAL A N    4  
ATOM   4412  C CA   . VAL A 1 62 ? 6.103   -1.941  -4.622  1.00 3.22  ? 62 VAL A CA   4  
ATOM   4413  C C    . VAL A 1 62 ? 7.363   -1.773  -5.483  1.00 3.80  ? 62 VAL A C    4  
ATOM   4414  O O    . VAL A 1 62 ? 7.328   -1.958  -6.686  1.00 4.15  ? 62 VAL A O    4  
ATOM   4415  C CB   . VAL A 1 62 ? 5.538   -0.563  -4.235  1.00 3.53  ? 62 VAL A CB   4  
ATOM   4416  C CG1  . VAL A 1 62 ? 5.440   0.332   -5.476  1.00 4.40  ? 62 VAL A CG1  4  
ATOM   4417  C CG2  . VAL A 1 62 ? 4.142   -0.734  -3.629  1.00 3.34  ? 62 VAL A CG2  4  
ATOM   4418  H H    . VAL A 1 62 ? 6.457   -2.247  -2.516  1.00 2.92  ? 62 VAL A H    4  
ATOM   4419  H HA   . VAL A 1 62 ? 5.359   -2.494  -5.176  1.00 3.17  ? 62 VAL A HA   4  
ATOM   4420  H HB   . VAL A 1 62 ? 6.192   -0.098  -3.510  1.00 3.69  ? 62 VAL A HB   4  
ATOM   4421  H HG11 . VAL A 1 62 ? 4.938   -0.204  -6.268  1.00 4.59  ? 62 VAL A HG11 4  
ATOM   4422  H HG12 . VAL A 1 62 ? 4.881   1.224   -5.234  1.00 4.91  ? 62 VAL A HG12 4  
ATOM   4423  H HG13 . VAL A 1 62 ? 6.433   0.607   -5.801  1.00 4.71  ? 62 VAL A HG13 4  
ATOM   4424  H HG21 . VAL A 1 62 ? 4.052   -1.722  -3.202  1.00 3.11  ? 62 VAL A HG21 4  
ATOM   4425  H HG22 . VAL A 1 62 ? 3.992   0.006   -2.856  1.00 3.80  ? 62 VAL A HG22 4  
ATOM   4426  H HG23 . VAL A 1 62 ? 3.396   -0.606  -4.399  1.00 3.53  ? 62 VAL A HG23 4  
ATOM   4427  N N    . GLU A 1 63 ? 8.476   -1.433  -4.871  1.00 4.04  ? 63 GLU A N    4  
ATOM   4428  C CA   . GLU A 1 63 ? 9.742   -1.261  -5.635  1.00 4.68  ? 63 GLU A CA   4  
ATOM   4429  C C    . GLU A 1 63 ? 10.170  -2.607  -6.231  1.00 4.70  ? 63 GLU A C    4  
ATOM   4430  O O    . GLU A 1 63 ? 10.524  -2.688  -7.388  1.00 5.23  ? 63 GLU A O    4  
ATOM   4431  C CB   . GLU A 1 63 ? 10.837  -0.741  -4.699  1.00 5.11  ? 63 GLU A CB   4  
ATOM   4432  C CG   . GLU A 1 63 ? 10.742  0.784   -4.595  1.00 5.73  ? 63 GLU A CG   4  
ATOM   4433  C CD   . GLU A 1 63 ? 11.766  1.295   -3.577  1.00 6.00  ? 63 GLU A CD   4  
ATOM   4434  O OE1  . GLU A 1 63 ? 12.926  1.413   -3.940  1.00 6.46  ? 63 GLU A OE1  4  
ATOM   4435  O OE2  . GLU A 1 63 ? 11.374  1.563   -2.452  1.00 6.04  ? 63 GLU A OE2  4  
ATOM   4436  H H    . GLU A 1 63 ? 8.479   -1.294  -3.907  1.00 3.89  ? 63 GLU A H    4  
ATOM   4437  H HA   . GLU A 1 63 ? 9.578   -0.554  -6.427  1.00 5.00  ? 63 GLU A HA   4  
ATOM   4438  H HB2  . GLU A 1 63 ? 10.711  -1.177  -3.719  1.00 4.92  ? 63 GLU A HB2  4  
ATOM   4439  H HB3  . GLU A 1 63 ? 11.803  -1.012  -5.092  1.00 5.36  ? 63 GLU A HB3  4  
ATOM   4440  H HG2  . GLU A 1 63 ? 10.943  1.224   -5.561  1.00 5.98  ? 63 GLU A HG2  4  
ATOM   4441  H HG3  . GLU A 1 63 ? 9.749   1.062   -4.273  1.00 6.04  ? 63 GLU A HG3  4  
ATOM   4442  N N    . LYS A 1 64 ? 10.129  -3.666  -5.452  1.00 4.35  ? 64 LYS A N    4  
ATOM   4443  C CA   . LYS A 1 64 ? 10.518  -5.007  -5.977  1.00 4.71  ? 64 LYS A CA   4  
ATOM   4444  C C    . LYS A 1 64 ? 9.553   -5.421  -7.100  1.00 4.54  ? 64 LYS A C    4  
ATOM   4445  O O    . LYS A 1 64 ? 9.922   -6.132  -8.015  1.00 5.00  ? 64 LYS A O    4  
ATOM   4446  C CB   . LYS A 1 64 ? 10.457  -6.037  -4.844  1.00 4.74  ? 64 LYS A CB   4  
ATOM   4447  C CG   . LYS A 1 64 ? 11.436  -7.182  -5.129  1.00 5.62  ? 64 LYS A CG   4  
ATOM   4448  C CD   . LYS A 1 64 ? 12.228  -7.507  -3.858  1.00 6.24  ? 64 LYS A CD   4  
ATOM   4449  C CE   . LYS A 1 64 ? 11.363  -8.343  -2.911  1.00 7.07  ? 64 LYS A CE   4  
ATOM   4450  N NZ   . LYS A 1 64 ? 11.550  -9.793  -3.208  1.00 7.79  ? 64 LYS A NZ   4  
ATOM   4451  H H    . LYS A 1 64 ? 9.835   -3.580  -4.526  1.00 4.03  ? 64 LYS A H    4  
ATOM   4452  H HA   . LYS A 1 64 ? 11.521  -4.955  -6.362  1.00 5.26  ? 64 LYS A HA   4  
ATOM   4453  H HB2  . LYS A 1 64 ? 10.723  -5.561  -3.911  1.00 4.73  ? 64 LYS A HB2  4  
ATOM   4454  H HB3  . LYS A 1 64 ? 9.456   -6.433  -4.772  1.00 4.49  ? 64 LYS A HB3  4  
ATOM   4455  H HG2  . LYS A 1 64 ? 10.885  -8.055  -5.443  1.00 6.07  ? 64 LYS A HG2  4  
ATOM   4456  H HG3  . LYS A 1 64 ? 12.120  -6.887  -5.910  1.00 5.69  ? 64 LYS A HG3  4  
ATOM   4457  H HD2  . LYS A 1 64 ? 13.117  -8.062  -4.123  1.00 6.22  ? 64 LYS A HD2  4  
ATOM   4458  H HD3  . LYS A 1 64 ? 12.512  -6.588  -3.366  1.00 6.45  ? 64 LYS A HD3  4  
ATOM   4459  H HE2  . LYS A 1 64 ? 11.653  -8.146  -1.890  1.00 7.40  ? 64 LYS A HE2  4  
ATOM   4460  H HE3  . LYS A 1 64 ? 10.324  -8.080  -3.045  1.00 7.09  ? 64 LYS A HE3  4  
ATOM   4461  H HZ1  . LYS A 1 64 ? 11.366  -9.968  -4.217  1.00 8.09  ? 64 LYS A HZ1  4  
ATOM   4462  H HZ2  . LYS A 1 64 ? 12.527  -10.071 -2.980  1.00 8.07  ? 64 LYS A HZ2  4  
ATOM   4463  H HZ3  . LYS A 1 64 ? 10.887  -10.353 -2.636  1.00 7.96  ? 64 LYS A HZ3  4  
ATOM   4464  N N    . PHE A 1 65 ? 8.320   -4.970  -7.031  1.00 4.02  ? 65 PHE A N    4  
ATOM   4465  C CA   . PHE A 1 65 ? 7.314   -5.315  -8.077  1.00 3.99  ? 65 PHE A CA   4  
ATOM   4466  C C    . PHE A 1 65 ? 7.669   -4.613  -9.394  1.00 4.72  ? 65 PHE A C    4  
ATOM   4467  O O    . PHE A 1 65 ? 7.740   -5.239  -10.436 1.00 5.31  ? 65 PHE A O    4  
ATOM   4468  C CB   . PHE A 1 65 ? 5.932   -4.843  -7.608  1.00 3.16  ? 65 PHE A CB   4  
ATOM   4469  C CG   . PHE A 1 65 ? 4.846   -5.570  -8.369  1.00 3.02  ? 65 PHE A CG   4  
ATOM   4470  C CD1  . PHE A 1 65 ? 4.632   -5.289  -9.724  1.00 2.97  ? 65 PHE A CD1  4  
ATOM   4471  C CD2  . PHE A 1 65 ? 4.051   -6.520  -7.719  1.00 3.45  ? 65 PHE A CD2  4  
ATOM   4472  C CE1  . PHE A 1 65 ? 3.625   -5.958  -10.428 1.00 3.10  ? 65 PHE A CE1  4  
ATOM   4473  C CE2  . PHE A 1 65 ? 3.045   -7.190  -8.423  1.00 3.48  ? 65 PHE A CE2  4  
ATOM   4474  C CZ   . PHE A 1 65 ? 2.831   -6.909  -9.778  1.00 3.19  ? 65 PHE A CZ   4  
ATOM   4475  H H    . PHE A 1 65 ? 8.054   -4.397  -6.282  1.00 3.77  ? 65 PHE A H    4  
ATOM   4476  H HA   . PHE A 1 65 ? 7.298   -6.385  -8.227  1.00 4.30  ? 65 PHE A HA   4  
ATOM   4477  H HB2  . PHE A 1 65 ? 5.827   -5.042  -6.553  1.00 2.82  ? 65 PHE A HB2  4  
ATOM   4478  H HB3  . PHE A 1 65 ? 5.842   -3.782  -7.780  1.00 3.27  ? 65 PHE A HB3  4  
ATOM   4479  H HD1  . PHE A 1 65 ? 5.245   -4.557  -10.225 1.00 3.21  ? 65 PHE A HD1  4  
ATOM   4480  H HD2  . PHE A 1 65 ? 4.216   -6.738  -6.674  1.00 4.00  ? 65 PHE A HD2  4  
ATOM   4481  H HE1  . PHE A 1 65 ? 3.462   -5.741  -11.472 1.00 3.46  ? 65 PHE A HE1  4  
ATOM   4482  H HE2  . PHE A 1 65 ? 2.433   -7.923  -7.923  1.00 4.01  ? 65 PHE A HE2  4  
ATOM   4483  H HZ   . PHE A 1 65 ? 2.054   -7.426  -10.321 1.00 3.41  ? 65 PHE A HZ   4  
ATOM   4484  N N    . LEU A 1 66 ? 7.880   -3.317  -9.356  1.00 4.92  ? 66 LEU A N    4  
ATOM   4485  C CA   . LEU A 1 66 ? 8.215   -2.571  -10.610 1.00 5.86  ? 66 LEU A CA   4  
ATOM   4486  C C    . LEU A 1 66 ? 9.727   -2.614  -10.858 1.00 6.61  ? 66 LEU A C    4  
ATOM   4487  O O    . LEU A 1 66 ? 10.183  -3.180  -11.833 1.00 7.33  ? 66 LEU A O    4  
ATOM   4488  C CB   . LEU A 1 66 ? 7.756   -1.114  -10.478 1.00 6.18  ? 66 LEU A CB   4  
ATOM   4489  C CG   . LEU A 1 66 ? 6.268   -1.008  -10.823 1.00 7.14  ? 66 LEU A CG   4  
ATOM   4490  C CD1  . LEU A 1 66 ? 5.680   0.246   -10.173 1.00 7.61  ? 66 LEU A CD1  4  
ATOM   4491  C CD2  . LEU A 1 66 ? 6.100   -0.921  -12.344 1.00 7.67  ? 66 LEU A CD2  4  
ATOM   4492  H H    . LEU A 1 66 ? 7.809   -2.833  -8.504  1.00 4.58  ? 66 LEU A H    4  
ATOM   4493  H HA   . LEU A 1 66 ? 7.705   -3.031  -11.444 1.00 6.03  ? 66 LEU A HA   4  
ATOM   4494  H HB2  . LEU A 1 66 ? 7.916   -0.778  -9.463  1.00 5.67  ? 66 LEU A HB2  4  
ATOM   4495  H HB3  . LEU A 1 66 ? 8.326   -0.495  -11.156 1.00 6.42  ? 66 LEU A HB3  4  
ATOM   4496  H HG   . LEU A 1 66 ? 5.750   -1.881  -10.452 1.00 7.39  ? 66 LEU A HG   4  
ATOM   4497  H HD11 . LEU A 1 66 ? 5.881   0.230   -9.111  1.00 7.94  ? 66 LEU A HD11 4  
ATOM   4498  H HD12 . LEU A 1 66 ? 6.131   1.125   -10.611 1.00 7.49  ? 66 LEU A HD12 4  
ATOM   4499  H HD13 . LEU A 1 66 ? 4.613   0.270   -10.336 1.00 8.02  ? 66 LEU A HD13 4  
ATOM   4500  H HD21 . LEU A 1 66 ? 6.727   -0.131  -12.730 1.00 7.67  ? 66 LEU A HD21 4  
ATOM   4501  H HD22 . LEU A 1 66 ? 6.386   -1.860  -12.792 1.00 8.14  ? 66 LEU A HD22 4  
ATOM   4502  H HD23 . LEU A 1 66 ? 5.068   -0.709  -12.581 1.00 7.84  ? 66 LEU A HD23 4  
ATOM   4503  N N    . LYS A 1 67 ? 10.504  -2.019  -9.985  1.00 6.57  ? 67 LYS A N    4  
ATOM   4504  C CA   . LYS A 1 67 ? 11.989  -2.021  -10.167 1.00 7.47  ? 67 LYS A CA   4  
ATOM   4505  C C    . LYS A 1 67 ? 12.556  -3.409  -9.840  1.00 7.85  ? 67 LYS A C    4  
ATOM   4506  O O    . LYS A 1 67 ? 11.882  -4.251  -9.274  1.00 8.14  ? 67 LYS A O    4  
ATOM   4507  C CB   . LYS A 1 67 ? 12.621  -0.979  -9.237  1.00 7.84  ? 67 LYS A CB   4  
ATOM   4508  C CG   . LYS A 1 67 ? 12.662  0.382   -9.940  1.00 8.78  ? 67 LYS A CG   4  
ATOM   4509  C CD   . LYS A 1 67 ? 13.878  0.447   -10.868 1.00 9.42  ? 67 LYS A CD   4  
ATOM   4510  C CE   . LYS A 1 67 ? 14.317  1.905   -11.037 1.00 10.12 ? 67 LYS A CE   4  
ATOM   4511  N NZ   . LYS A 1 67 ? 15.180  2.032   -12.247 1.00 10.40 ? 67 LYS A NZ   4  
ATOM   4512  H H    . LYS A 1 67 ? 10.109  -1.570  -9.207  1.00 6.04  ? 67 LYS A H    4  
ATOM   4513  H HA   . LYS A 1 67 ? 12.223  -1.773  -11.191 1.00 7.85  ? 67 LYS A HA   4  
ATOM   4514  H HB2  . LYS A 1 67 ? 12.034  -0.900  -8.333  1.00 7.78  ? 67 LYS A HB2  4  
ATOM   4515  H HB3  . LYS A 1 67 ? 13.627  -1.282  -8.985  1.00 7.75  ? 67 LYS A HB3  4  
ATOM   4516  H HG2  . LYS A 1 67 ? 11.759  0.514   -10.519 1.00 9.30  ? 67 LYS A HG2  4  
ATOM   4517  H HG3  . LYS A 1 67 ? 12.732  1.167   -9.201  1.00 8.71  ? 67 LYS A HG3  4  
ATOM   4518  H HD2  . LYS A 1 67 ? 14.689  -0.125  -10.441 1.00 9.58  ? 67 LYS A HD2  4  
ATOM   4519  H HD3  . LYS A 1 67 ? 13.618  0.039   -11.833 1.00 9.47  ? 67 LYS A HD3  4  
ATOM   4520  H HE2  . LYS A 1 67 ? 13.445  2.532   -11.151 1.00 10.35 ? 67 LYS A HE2  4  
ATOM   4521  H HE3  . LYS A 1 67 ? 14.873  2.217   -10.165 1.00 10.41 ? 67 LYS A HE3  4  
ATOM   4522  H HZ1  . LYS A 1 67 ? 15.979  1.369   -12.175 1.00 10.49 ? 67 LYS A HZ1  4  
ATOM   4523  H HZ2  . LYS A 1 67 ? 14.621  1.813   -13.097 1.00 10.60 ? 67 LYS A HZ2  4  
ATOM   4524  H HZ3  . LYS A 1 67 ? 15.540  3.004   -12.315 1.00 10.51 ? 67 LYS A HZ3  4  
ATOM   4525  N N    . ARG A 1 68 ? 13.794  -3.649  -10.194 1.00 8.12  ? 68 ARG A N    4  
ATOM   4526  C CA   . ARG A 1 68 ? 14.420  -4.977  -9.910  1.00 8.78  ? 68 ARG A CA   4  
ATOM   4527  C C    . ARG A 1 68 ? 15.080  -4.951  -8.524  1.00 8.99  ? 68 ARG A C    4  
ATOM   4528  O O    . ARG A 1 68 ? 15.179  -3.913  -7.894  1.00 8.81  ? 68 ARG A O    4  
ATOM   4529  C CB   . ARG A 1 68 ? 15.479  -5.283  -10.977 1.00 9.33  ? 68 ARG A CB   4  
ATOM   4530  C CG   . ARG A 1 68 ? 14.819  -5.351  -12.359 1.00 9.61  ? 68 ARG A CG   4  
ATOM   4531  C CD   . ARG A 1 68 ? 14.209  -6.738  -12.574 1.00 10.05 ? 68 ARG A CD   4  
ATOM   4532  N NE   . ARG A 1 68 ? 13.528  -6.780  -13.901 1.00 10.53 ? 68 ARG A NE   4  
ATOM   4533  C CZ   . ARG A 1 68 ? 14.223  -6.977  -14.990 1.00 10.90 ? 68 ARG A CZ   4  
ATOM   4534  N NH1  . ARG A 1 68 ? 14.620  -8.184  -15.303 1.00 11.35 ? 68 ARG A NH1  4  
ATOM   4535  N NH2  . ARG A 1 68 ? 14.523  -5.966  -15.765 1.00 11.02 ? 68 ARG A NH2  4  
ATOM   4536  H H    . ARG A 1 68 ? 14.316  -2.953  -10.647 1.00 8.08  ? 68 ARG A H    4  
ATOM   4537  H HA   . ARG A 1 68 ? 13.659  -5.744  -9.930  1.00 9.01  ? 68 ARG A HA   4  
ATOM   4538  H HB2  . ARG A 1 68 ? 16.227  -4.503  -10.973 1.00 9.69  ? 68 ARG A HB2  4  
ATOM   4539  H HB3  . ARG A 1 68 ? 15.948  -6.231  -10.757 1.00 9.41  ? 68 ARG A HB3  4  
ATOM   4540  H HG2  . ARG A 1 68 ? 14.043  -4.602  -12.424 1.00 9.48  ? 68 ARG A HG2  4  
ATOM   4541  H HG3  . ARG A 1 68 ? 15.562  -5.165  -13.120 1.00 9.87  ? 68 ARG A HG3  4  
ATOM   4542  H HD2  . ARG A 1 68 ? 14.990  -7.484  -12.547 1.00 10.14 ? 68 ARG A HD2  4  
ATOM   4543  H HD3  . ARG A 1 68 ? 13.491  -6.941  -11.794 1.00 10.14 ? 68 ARG A HD3  4  
ATOM   4544  H HE   . ARG A 1 68 ? 12.555  -6.659  -13.955 1.00 10.72 ? 68 ARG A HE   4  
ATOM   4545  H HH11 . ARG A 1 68 ? 14.391  -8.956  -14.710 1.00 11.42 ? 68 ARG A HH11 4  
ATOM   4546  H HH12 . ARG A 1 68 ? 15.153  -8.337  -16.136 1.00 11.76 ? 68 ARG A HH12 4  
ATOM   4547  H HH21 . ARG A 1 68 ? 14.220  -5.044  -15.525 1.00 10.82 ? 68 ARG A HH21 4  
ATOM   4548  H HH22 . ARG A 1 68 ? 15.056  -6.114  -16.599 1.00 11.44 ? 68 ARG A HH22 4  
ATOM   4549  N N    . ALA A 1 69 ? 15.533  -6.085  -8.049  1.00 9.61  ? 69 ALA A N    4  
ATOM   4550  C CA   . ALA A 1 69 ? 16.192  -6.136  -6.709  1.00 10.14 ? 69 ALA A CA   4  
ATOM   4551  C C    . ALA A 1 69 ? 17.713  -6.102  -6.890  1.00 10.89 ? 69 ALA A C    4  
ATOM   4552  O O    . ALA A 1 69 ? 18.283  -6.940  -7.565  1.00 11.20 ? 69 ALA A O    4  
ATOM   4553  C CB   . ALA A 1 69 ? 15.788  -7.425  -5.988  1.00 10.08 ? 69 ALA A CB   4  
ATOM   4554  H H    . ALA A 1 69 ? 15.443  -6.907  -8.579  1.00 9.89  ? 69 ALA A H    4  
ATOM   4555  H HA   . ALA A 1 69 ? 15.881  -5.284  -6.122  1.00 10.27 ? 69 ALA A HA   4  
ATOM   4556  H HB1  . ALA A 1 69 ? 16.052  -8.276  -6.597  1.00 10.12 ? 69 ALA A HB1  4  
ATOM   4557  H HB2  . ALA A 1 69 ? 16.306  -7.485  -5.041  1.00 10.18 ? 69 ALA A HB2  4  
ATOM   4558  H HB3  . ALA A 1 69 ? 14.722  -7.423  -5.815  1.00 10.12 ? 69 ALA A HB3  4  
ATOM   4559  N N    . GLU A 1 70 ? 18.373  -5.138  -6.292  1.00 11.37 ? 70 GLU A N    4  
ATOM   4560  C CA   . GLU A 1 70 ? 19.860  -5.044  -6.429  1.00 12.24 ? 70 GLU A CA   4  
ATOM   4561  C C    . GLU A 1 70 ? 20.451  -4.296  -5.225  1.00 12.45 ? 70 GLU A C    4  
ATOM   4562  O O    . GLU A 1 70 ? 19.777  -3.525  -4.566  1.00 12.32 ? 70 GLU A O    4  
ATOM   4563  C CB   . GLU A 1 70 ? 20.214  -4.295  -7.721  1.00 12.79 ? 70 GLU A CB   4  
ATOM   4564  C CG   . GLU A 1 70 ? 19.560  -2.907  -7.722  1.00 12.48 ? 70 GLU A CG   4  
ATOM   4565  C CD   . GLU A 1 70 ? 18.811  -2.695  -9.040  1.00 13.18 ? 70 GLU A CD   4  
ATOM   4566  O OE1  . GLU A 1 70 ? 19.445  -2.296  -10.003 1.00 13.63 ? 70 GLU A OE1  4  
ATOM   4567  O OE2  . GLU A 1 70 ? 17.615  -2.933  -9.063  1.00 13.39 ? 70 GLU A OE2  4  
ATOM   4568  H H    . GLU A 1 70 ? 17.888  -4.474  -5.757  1.00 11.26 ? 70 GLU A H    4  
ATOM   4569  H HA   . GLU A 1 70 ? 20.278  -6.039  -6.469  1.00 12.53 ? 70 GLU A HA   4  
ATOM   4570  H HB2  . GLU A 1 70 ? 21.288  -4.186  -7.787  1.00 13.03 ? 70 GLU A HB2  4  
ATOM   4571  H HB3  . GLU A 1 70 ? 19.860  -4.860  -8.571  1.00 13.32 ? 70 GLU A HB3  4  
ATOM   4572  H HG2  . GLU A 1 70 ? 18.866  -2.835  -6.896  1.00 12.20 ? 70 GLU A HG2  4  
ATOM   4573  H HG3  . GLU A 1 70 ? 20.323  -2.150  -7.617  1.00 12.23 ? 70 GLU A HG3  4  
ATOM   4574  N N    . ASN A 1 71 ? 21.712  -4.519  -4.943  1.00 12.96 ? 71 ASN A N    4  
ATOM   4575  C CA   . ASN A 1 71 ? 22.365  -3.829  -3.791  1.00 13.39 ? 71 ASN A CA   4  
ATOM   4576  C C    . ASN A 1 71 ? 23.229  -2.674  -4.316  1.00 13.77 ? 71 ASN A C    4  
ATOM   4577  O O    . ASN A 1 71 ? 24.380  -2.857  -4.672  1.00 13.98 ? 71 ASN A O    4  
ATOM   4578  C CB   . ASN A 1 71 ? 23.241  -4.831  -3.027  1.00 13.14 ? 71 ASN A CB   4  
ATOM   4579  C CG   . ASN A 1 71 ? 23.389  -4.381  -1.570  1.00 12.70 ? 71 ASN A CG   4  
ATOM   4580  O OD1  . ASN A 1 71 ? 22.408  -4.163  -0.886  1.00 12.77 ? 71 ASN A OD1  4  
ATOM   4581  N ND2  . ASN A 1 71 ? 24.582  -4.235  -1.059  1.00 12.41 ? 71 ASN A ND2  4  
ATOM   4582  H H    . ASN A 1 71 ? 22.232  -5.141  -5.494  1.00 13.17 ? 71 ASN A H    4  
ATOM   4583  H HA   . ASN A 1 71 ? 21.607  -3.438  -3.129  1.00 13.80 ? 71 ASN A HA   4  
ATOM   4584  H HB2  . ASN A 1 71 ? 22.778  -5.807  -3.056  1.00 13.36 ? 71 ASN A HB2  4  
ATOM   4585  H HB3  . ASN A 1 71 ? 24.216  -4.882  -3.487  1.00 13.26 ? 71 ASN A HB3  4  
ATOM   4586  H HD21 . ASN A 1 71 ? 25.376  -4.411  -1.606  1.00 12.47 ? 71 ASN A HD21 4  
ATOM   4587  H HD22 . ASN A 1 71 ? 24.684  -3.949  -0.127  1.00 12.23 ? 71 ASN A HD22 4  
ATOM   4588  N N    . SER A 1 72 ? 22.678  -1.485  -4.371  1.00 14.02 ? 72 SER A N    4  
ATOM   4589  C CA   . SER A 1 72 ? 23.458  -0.313  -4.874  1.00 14.59 ? 72 SER A CA   4  
ATOM   4590  C C    . SER A 1 72 ? 24.069  0.444   -3.687  1.00 15.09 ? 72 SER A C    4  
ATOM   4591  O O    . SER A 1 72 ? 23.312  0.976   -2.887  1.00 15.38 ? 72 SER A O    4  
ATOM   4592  C CB   . SER A 1 72 ? 22.531  0.617   -5.661  1.00 14.66 ? 72 SER A CB   4  
ATOM   4593  O OG   . SER A 1 72 ? 22.219  0.019   -6.913  1.00 14.60 ? 72 SER A OG   4  
ATOM   4594  O OXT  . SER A 1 72 ? 25.287  0.471   -3.594  1.00 15.30 ? 72 SER A OXT  4  
ATOM   4595  H H    . SER A 1 72 ? 21.749  -1.362  -4.081  1.00 13.94 ? 72 SER A H    4  
ATOM   4596  H HA   . SER A 1 72 ? 24.250  -0.662  -5.521  1.00 14.77 ? 72 SER A HA   4  
ATOM   4597  H HB2  . SER A 1 72 ? 21.621  0.776   -5.108  1.00 14.69 ? 72 SER A HB2  4  
ATOM   4598  H HB3  . SER A 1 72 ? 23.025  1.567   -5.818  1.00 14.91 ? 72 SER A HB3  4  
ATOM   4599  H HG   . SER A 1 72 ? 22.627  0.545   -7.605  1.00 14.50 ? 72 SER A HG   4  
ATOM   4600  N N    . GLU A 1 4  ? -5.990  13.593  -8.055  1.00 9.58  ? 4  GLU A N    5  
ATOM   4601  C CA   . GLU A 1 4  ? -7.383  14.122  -8.166  1.00 9.09  ? 4  GLU A CA   5  
ATOM   4602  C C    . GLU A 1 4  ? -8.311  13.331  -7.234  1.00 8.06  ? 4  GLU A C    5  
ATOM   4603  O O    . GLU A 1 4  ? -8.112  12.150  -7.008  1.00 8.10  ? 4  GLU A O    5  
ATOM   4604  C CB   . GLU A 1 4  ? -7.869  13.985  -9.613  1.00 9.77  ? 4  GLU A CB   5  
ATOM   4605  C CG   . GLU A 1 4  ? -8.654  15.239  -10.009 1.00 10.24 ? 4  GLU A CG   5  
ATOM   4606  C CD   . GLU A 1 4  ? -9.370  14.999  -11.342 1.00 11.04 ? 4  GLU A CD   5  
ATOM   4607  O OE1  . GLU A 1 4  ? -10.348 14.270  -11.346 1.00 11.49 ? 4  GLU A OE1  5  
ATOM   4608  O OE2  . GLU A 1 4  ? -8.927  15.552  -12.336 1.00 11.36 ? 4  GLU A OE2  5  
ATOM   4609  H H    . GLU A 1 4  ? -5.696  13.596  -7.056  1.00 9.89  ? 4  GLU A H    5  
ATOM   4610  H HA   . GLU A 1 4  ? -7.392  15.163  -7.881  1.00 9.22  ? 4  GLU A HA   5  
ATOM   4611  H HB2  . GLU A 1 4  ? -7.017  13.873  -10.269 1.00 9.96  ? 4  GLU A HB2  5  
ATOM   4612  H HB3  . GLU A 1 4  ? -8.508  13.119  -9.700  1.00 9.97  ? 4  GLU A HB3  5  
ATOM   4613  H HG2  . GLU A 1 4  ? -9.385  15.462  -9.243  1.00 10.27 ? 4  GLU A HG2  5  
ATOM   4614  H HG3  . GLU A 1 4  ? -7.976  16.071  -10.111 1.00 10.19 ? 4  GLU A HG3  5  
ATOM   4615  N N    . LEU A 1 5  ? -9.320  13.982  -6.691  1.00 7.36  ? 5  LEU A N    5  
ATOM   4616  C CA   . LEU A 1 5  ? -10.282 13.299  -5.762  1.00 6.53  ? 5  LEU A CA   5  
ATOM   4617  C C    . LEU A 1 5  ? -9.584  12.979  -4.431  1.00 6.17  ? 5  LEU A C    5  
ATOM   4618  O O    . LEU A 1 5  ? -8.386  12.777  -4.380  1.00 6.61  ? 5  LEU A O    5  
ATOM   4619  C CB   . LEU A 1 5  ? -10.804 12.001  -6.394  1.00 6.34  ? 5  LEU A CB   5  
ATOM   4620  C CG   . LEU A 1 5  ? -12.160 11.639  -5.780  1.00 7.26  ? 5  LEU A CG   5  
ATOM   4621  C CD1  . LEU A 1 5  ? -13.283 12.275  -6.601  1.00 7.60  ? 5  LEU A CD1  5  
ATOM   4622  C CD2  . LEU A 1 5  ? -12.327 10.117  -5.775  1.00 7.86  ? 5  LEU A CD2  5  
ATOM   4623  H H    . LEU A 1 5  ? -9.446  14.933  -6.896  1.00 7.57  ? 5  LEU A H    5  
ATOM   4624  H HA   . LEU A 1 5  ? -11.114 13.960  -5.572  1.00 6.63  ? 5  LEU A HA   5  
ATOM   4625  H HB2  . LEU A 1 5  ? -10.915 12.140  -7.461  1.00 5.88  ? 5  LEU A HB2  5  
ATOM   4626  H HB3  . LEU A 1 5  ? -10.102 11.202  -6.208  1.00 6.33  ? 5  LEU A HB3  5  
ATOM   4627  H HG   . LEU A 1 5  ? -12.205 12.010  -4.767  1.00 7.52  ? 5  LEU A HG   5  
ATOM   4628  H HD11 . LEU A 1 5  ? -13.111 12.093  -7.652  1.00 7.24  ? 5  LEU A HD11 5  
ATOM   4629  H HD12 . LEU A 1 5  ? -14.230 11.842  -6.312  1.00 7.97  ? 5  LEU A HD12 5  
ATOM   4630  H HD13 . LEU A 1 5  ? -13.304 13.340  -6.420  1.00 8.07  ? 5  LEU A HD13 5  
ATOM   4631  H HD21 . LEU A 1 5  ? -12.125 9.728   -6.762  1.00 8.13  ? 5  LEU A HD21 5  
ATOM   4632  H HD22 . LEU A 1 5  ? -11.635 9.682   -5.068  1.00 8.35  ? 5  LEU A HD22 5  
ATOM   4633  H HD23 . LEU A 1 5  ? -13.338 9.866   -5.489  1.00 7.79  ? 5  LEU A HD23 5  
ATOM   4634  N N    . ARG A 1 6  ? -10.333 12.937  -3.353  1.00 5.61  ? 6  ARG A N    5  
ATOM   4635  C CA   . ARG A 1 6  ? -9.728  12.638  -2.016  1.00 5.48  ? 6  ARG A CA   5  
ATOM   4636  C C    . ARG A 1 6  ? -9.155  11.213  -1.990  1.00 4.69  ? 6  ARG A C    5  
ATOM   4637  O O    . ARG A 1 6  ? -9.136  10.515  -2.989  1.00 4.64  ? 6  ARG A O    5  
ATOM   4638  C CB   . ARG A 1 6  ? -10.800 12.777  -0.925  1.00 6.06  ? 6  ARG A CB   5  
ATOM   4639  C CG   . ARG A 1 6  ? -10.710 14.168  -0.285  1.00 6.84  ? 6  ARG A CG   5  
ATOM   4640  C CD   . ARG A 1 6  ? -11.535 15.168  -1.098  1.00 7.76  ? 6  ARG A CD   5  
ATOM   4641  N NE   . ARG A 1 6  ? -10.671 15.811  -2.131  1.00 8.57  ? 6  ARG A NE   5  
ATOM   4642  C CZ   . ARG A 1 6  ? -11.085 16.879  -2.760  1.00 9.27  ? 6  ARG A CZ   5  
ATOM   4643  N NH1  . ARG A 1 6  ? -12.008 16.778  -3.684  1.00 9.70  ? 6  ARG A NH1  5  
ATOM   4644  N NH2  . ARG A 1 6  ? -10.578 18.048  -2.465  1.00 9.77  ? 6  ARG A NH2  5  
ATOM   4645  H H    . ARG A 1 6  ? -11.296 13.107  -3.423  1.00 5.45  ? 6  ARG A H    5  
ATOM   4646  H HA   . ARG A 1 6  ? -8.933  13.342  -1.822  1.00 5.83  ? 6  ARG A HA   5  
ATOM   4647  H HB2  . ARG A 1 6  ? -11.775 12.643  -1.363  1.00 6.17  ? 6  ARG A HB2  5  
ATOM   4648  H HB3  . ARG A 1 6  ? -10.641 12.025  -0.168  1.00 6.11  ? 6  ARG A HB3  5  
ATOM   4649  H HG2  . ARG A 1 6  ? -11.093 14.120  0.725   1.00 6.68  ? 6  ARG A HG2  5  
ATOM   4650  H HG3  . ARG A 1 6  ? -9.679  14.488  -0.262  1.00 7.20  ? 6  ARG A HG3  5  
ATOM   4651  H HD2  . ARG A 1 6  ? -12.353 14.654  -1.582  1.00 8.01  ? 6  ARG A HD2  5  
ATOM   4652  H HD3  . ARG A 1 6  ? -11.930 15.928  -0.438  1.00 7.82  ? 6  ARG A HD3  5  
ATOM   4653  H HE   . ARG A 1 6  ? -9.791  15.430  -2.340  1.00 8.74  ? 6  ARG A HE   5  
ATOM   4654  H HH11 . ARG A 1 6  ? -12.394 15.883  -3.908  1.00 9.50  ? 6  ARG A HH11 5  
ATOM   4655  H HH12 . ARG A 1 6  ? -12.327 17.595  -4.164  1.00 10.35 ? 6  ARG A HH12 5  
ATOM   4656  H HH21 . ARG A 1 6  ? -9.874  18.124  -1.758  1.00 9.63  ? 6  ARG A HH21 5  
ATOM   4657  H HH22 . ARG A 1 6  ? -10.894 18.867  -2.944  1.00 10.41 ? 6  ARG A HH22 5  
ATOM   4658  N N    . CYS A 1 7  ? -8.687  10.784  -0.844  1.00 4.47  ? 7  CYS A N    5  
ATOM   4659  C CA   . CYS A 1 7  ? -8.105  9.414   -0.718  1.00 4.05  ? 7  CYS A CA   5  
ATOM   4660  C C    . CYS A 1 7  ? -9.208  8.373   -0.919  1.00 4.38  ? 7  CYS A C    5  
ATOM   4661  O O    . CYS A 1 7  ? -10.118 8.255   -0.118  1.00 4.93  ? 7  CYS A O    5  
ATOM   4662  C CB   . CYS A 1 7  ? -7.477  9.244   0.673   1.00 4.32  ? 7  CYS A CB   5  
ATOM   4663  S SG   . CYS A 1 7  ? -6.641  10.776  1.175   1.00 4.79  ? 7  CYS A SG   5  
ATOM   4664  H H    . CYS A 1 7  ? -8.719  11.368  -0.062  1.00 4.87  ? 7  CYS A H    5  
ATOM   4665  H HA   . CYS A 1 7  ? -7.346  9.270   -1.472  1.00 3.89  ? 7  CYS A HA   5  
ATOM   4666  H HB2  . CYS A 1 7  ? -8.251  9.008   1.390   1.00 4.81  ? 7  CYS A HB2  5  
ATOM   4667  H HB3  . CYS A 1 7  ? -6.763  8.441   0.642   1.00 4.30  ? 7  CYS A HB3  5  
ATOM   4668  N N    . GLN A 1 8  ? -9.126  7.616   -1.989  1.00 4.51  ? 8  GLN A N    5  
ATOM   4669  C CA   . GLN A 1 8  ? -10.157 6.569   -2.262  1.00 5.30  ? 8  GLN A CA   5  
ATOM   4670  C C    . GLN A 1 8  ? -10.127 5.512   -1.150  1.00 5.47  ? 8  GLN A C    5  
ATOM   4671  O O    . GLN A 1 8  ? -11.133 4.899   -0.844  1.00 6.21  ? 8  GLN A O    5  
ATOM   4672  C CB   . GLN A 1 8  ? -9.866  5.907   -3.611  1.00 5.63  ? 8  GLN A CB   5  
ATOM   4673  C CG   . GLN A 1 8  ? -10.572 6.681   -4.729  1.00 6.22  ? 8  GLN A CG   5  
ATOM   4674  C CD   . GLN A 1 8  ? -9.559  7.055   -5.816  1.00 7.21  ? 8  GLN A CD   5  
ATOM   4675  O OE1  . GLN A 1 8  ? -8.631  7.800   -5.568  1.00 7.78  ? 8  GLN A OE1  5  
ATOM   4676  N NE2  . GLN A 1 8  ? -9.701  6.567   -7.019  1.00 7.68  ? 8  GLN A NE2  5  
ATOM   4677  H H    . GLN A 1 8  ? -8.380  7.735   -2.613  1.00 4.40  ? 8  GLN A H    5  
ATOM   4678  H HA   . GLN A 1 8  ? -11.134 7.029   -2.291  1.00 5.87  ? 8  GLN A HA   5  
ATOM   4679  H HB2  . GLN A 1 8  ? -8.800  5.907   -3.789  1.00 5.62  ? 8  GLN A HB2  5  
ATOM   4680  H HB3  . GLN A 1 8  ? -10.226 4.890   -3.598  1.00 5.89  ? 8  GLN A HB3  5  
ATOM   4681  H HG2  . GLN A 1 8  ? -11.349 6.065   -5.156  1.00 6.11  ? 8  GLN A HG2  5  
ATOM   4682  H HG3  . GLN A 1 8  ? -11.009 7.581   -4.323  1.00 6.39  ? 8  GLN A HG3  5  
ATOM   4683  H HE21 . GLN A 1 8  ? -10.451 5.968   -7.222  1.00 7.43  ? 8  GLN A HE21 5  
ATOM   4684  H HE22 . GLN A 1 8  ? -9.056  6.799   -7.720  1.00 8.44  ? 8  GLN A HE22 5  
ATOM   4685  N N    . CYS A 1 9  ? -8.984  5.307   -0.534  1.00 5.04  ? 9  CYS A N    5  
ATOM   4686  C CA   . CYS A 1 9  ? -8.891  4.305   0.568   1.00 5.45  ? 9  CYS A CA   5  
ATOM   4687  C C    . CYS A 1 9  ? -8.625  5.026   1.891   1.00 5.99  ? 9  CYS A C    5  
ATOM   4688  O O    . CYS A 1 9  ? -7.498  5.360   2.214   1.00 6.13  ? 9  CYS A O    5  
ATOM   4689  C CB   . CYS A 1 9  ? -7.760  3.307   0.285   1.00 5.08  ? 9  CYS A CB   5  
ATOM   4690  S SG   . CYS A 1 9  ? -8.457  1.757   -0.339  1.00 5.12  ? 9  CYS A SG   5  
ATOM   4691  H H    . CYS A 1 9  ? -8.189  5.826   -0.791  1.00 4.65  ? 9  CYS A H    5  
ATOM   4692  H HA   . CYS A 1 9  ? -9.828  3.769   0.641   1.00 5.89  ? 9  CYS A HA   5  
ATOM   4693  H HB2  . CYS A 1 9  ? -7.093  3.721   -0.452  1.00 4.67  ? 9  CYS A HB2  5  
ATOM   4694  H HB3  . CYS A 1 9  ? -7.213  3.113   1.195   1.00 5.54  ? 9  CYS A HB3  5  
ATOM   4695  N N    . ILE A 1 10 ? -9.660  5.253   2.666   1.00 6.61  ? 10 ILE A N    5  
ATOM   4696  C CA   . ILE A 1 10 ? -9.481  5.934   3.986   1.00 7.44  ? 10 ILE A CA   5  
ATOM   4697  C C    . ILE A 1 10 ? -8.675  5.007   4.907   1.00 7.48  ? 10 ILE A C    5  
ATOM   4698  O O    . ILE A 1 10 ? -7.928  5.457   5.756   1.00 8.16  ? 10 ILE A O    5  
ATOM   4699  C CB   . ILE A 1 10 ? -10.857 6.230   4.614   1.00 8.38  ? 10 ILE A CB   5  
ATOM   4700  C CG1  . ILE A 1 10 ? -11.641 7.214   3.728   1.00 8.63  ? 10 ILE A CG1  5  
ATOM   4701  C CG2  . ILE A 1 10 ? -10.671 6.840   6.009   1.00 9.31  ? 10 ILE A CG2  5  
ATOM   4702  C CD1  . ILE A 1 10 ? -10.789 8.453   3.428   1.00 9.47  ? 10 ILE A CD1  5  
ATOM   4703  H H    . ILE A 1 10 ? -10.553 4.960   2.385   1.00 6.69  ? 10 ILE A H    5  
ATOM   4704  H HA   . ILE A 1 10 ? -8.941  6.858   3.845   1.00 7.59  ? 10 ILE A HA   5  
ATOM   4705  H HB   . ILE A 1 10 ? -11.412 5.307   4.703   1.00 8.40  ? 10 ILE A HB   5  
ATOM   4706  H HG12 . ILE A 1 10 ? -11.908 6.729   2.801   1.00 8.91  ? 10 ILE A HG12 5  
ATOM   4707  H HG13 . ILE A 1 10 ? -12.541 7.518   4.243   1.00 8.14  ? 10 ILE A HG13 5  
ATOM   4708  H HG21 . ILE A 1 10 ? -9.869  7.564   5.982   1.00 9.27  ? 10 ILE A HG21 5  
ATOM   4709  H HG22 . ILE A 1 10 ? -11.586 7.330   6.312   1.00 9.78  ? 10 ILE A HG22 5  
ATOM   4710  H HG23 . ILE A 1 10 ? -10.429 6.060   6.715   1.00 9.72  ? 10 ILE A HG23 5  
ATOM   4711  H HD11 . ILE A 1 10 ? -10.194 8.700   4.295   1.00 9.77  ? 10 ILE A HD11 5  
ATOM   4712  H HD12 . ILE A 1 10 ? -10.137 8.247   2.592   1.00 9.76  ? 10 ILE A HD12 5  
ATOM   4713  H HD13 . ILE A 1 10 ? -11.434 9.284   3.185   1.00 9.66  ? 10 ILE A HD13 5  
ATOM   4714  N N    . LYS A 1 11 ? -8.811  3.714   4.722   1.00 6.93  ? 11 LYS A N    5  
ATOM   4715  C CA   . LYS A 1 11 ? -8.051  2.739   5.553   1.00 7.15  ? 11 LYS A CA   5  
ATOM   4716  C C    . LYS A 1 11 ? -7.132  1.942   4.626   1.00 6.42  ? 11 LYS A C    5  
ATOM   4717  O O    . LYS A 1 11 ? -7.590  1.185   3.789   1.00 6.35  ? 11 LYS A O    5  
ATOM   4718  C CB   . LYS A 1 11 ? -9.027  1.791   6.257   1.00 8.05  ? 11 LYS A CB   5  
ATOM   4719  C CG   . LYS A 1 11 ? -9.920  2.589   7.214   1.00 8.65  ? 11 LYS A CG   5  
ATOM   4720  C CD   . LYS A 1 11 ? -9.298  2.602   8.613   1.00 9.04  ? 11 LYS A CD   5  
ATOM   4721  C CE   . LYS A 1 11 ? -10.049 1.620   9.519   1.00 9.50  ? 11 LYS A CE   5  
ATOM   4722  N NZ   . LYS A 1 11 ? -9.082  0.665   10.131  1.00 9.69  ? 11 LYS A NZ   5  
ATOM   4723  H H    . LYS A 1 11 ? -9.409  3.383   4.019   1.00 6.52  ? 11 LYS A H    5  
ATOM   4724  H HA   . LYS A 1 11 ? -7.459  3.266   6.287   1.00 7.36  ? 11 LYS A HA   5  
ATOM   4725  H HB2  . LYS A 1 11 ? -9.641  1.295   5.520   1.00 8.15  ? 11 LYS A HB2  5  
ATOM   4726  H HB3  . LYS A 1 11 ? -8.471  1.053   6.817   1.00 8.38  ? 11 LYS A HB3  5  
ATOM   4727  H HG2  . LYS A 1 11 ? -10.019 3.602   6.854   1.00 9.16  ? 11 LYS A HG2  5  
ATOM   4728  H HG3  . LYS A 1 11 ? -10.896 2.128   7.260   1.00 8.50  ? 11 LYS A HG3  5  
ATOM   4729  H HD2  . LYS A 1 11 ? -8.260  2.312   8.548   1.00 9.00  ? 11 LYS A HD2  5  
ATOM   4730  H HD3  . LYS A 1 11 ? -9.369  3.596   9.027   1.00 9.26  ? 11 LYS A HD3  5  
ATOM   4731  H HE2  . LYS A 1 11 ? -10.555 2.168   10.301  1.00 9.79  ? 11 LYS A HE2  5  
ATOM   4732  H HE3  . LYS A 1 11 ? -10.774 1.073   8.936   1.00 9.62  ? 11 LYS A HE3  5  
ATOM   4733  H HZ1  . LYS A 1 11 ? -8.523  0.207   9.382   1.00 9.96  ? 11 LYS A HZ1  5  
ATOM   4734  H HZ2  . LYS A 1 11 ? -8.444  1.179   10.773  1.00 9.86  ? 11 LYS A HZ2  5  
ATOM   4735  H HZ3  . LYS A 1 11 ? -9.602  -0.060  10.665  1.00 9.61  ? 11 LYS A HZ3  5  
ATOM   4736  N N    . THR A 1 12 ? -5.841  2.121   4.748   1.00 6.02  ? 12 THR A N    5  
ATOM   4737  C CA   . THR A 1 12 ? -4.898  1.387   3.852   1.00 5.35  ? 12 THR A CA   5  
ATOM   4738  C C    . THR A 1 12 ? -4.514  0.036   4.453   1.00 5.31  ? 12 THR A C    5  
ATOM   4739  O O    . THR A 1 12 ? -5.076  -0.408  5.439   1.00 5.80  ? 12 THR A O    5  
ATOM   4740  C CB   . THR A 1 12 ? -3.636  2.222   3.603   1.00 5.23  ? 12 THR A CB   5  
ATOM   4741  O OG1  . THR A 1 12 ? -3.504  3.230   4.600   1.00 5.90  ? 12 THR A OG1  5  
ATOM   4742  C CG2  . THR A 1 12 ? -3.729  2.858   2.220   1.00 5.32  ? 12 THR A CG2  5  
ATOM   4743  H H    . THR A 1 12 ? -5.493  2.749   5.417   1.00 6.26  ? 12 THR A H    5  
ATOM   4744  H HA   . THR A 1 12 ? -5.388  1.214   2.905   1.00 5.27  ? 12 THR A HA   5  
ATOM   4745  H HB   . THR A 1 12 ? -2.774  1.575   3.633   1.00 4.85  ? 12 THR A HB   5  
ATOM   4746  H HG1  . THR A 1 12 ? -2.698  3.720   4.424   1.00 6.31  ? 12 THR A HG1  5  
ATOM   4747  H HG21 . THR A 1 12 ? -4.618  3.465   2.164   1.00 5.41  ? 12 THR A HG21 5  
ATOM   4748  H HG22 . THR A 1 12 ? -2.858  3.471   2.047   1.00 5.52  ? 12 THR A HG22 5  
ATOM   4749  H HG23 . THR A 1 12 ? -3.775  2.079   1.471   1.00 5.48  ? 12 THR A HG23 5  
ATOM   4750  N N    . TYR A 1 13 ? -3.575  -0.632  3.835   1.00 4.96  ? 13 TYR A N    5  
ATOM   4751  C CA   . TYR A 1 13 ? -3.149  -1.972  4.312   1.00 5.03  ? 13 TYR A CA   5  
ATOM   4752  C C    . TYR A 1 13 ? -1.903  -1.859  5.196   1.00 5.08  ? 13 TYR A C    5  
ATOM   4753  O O    . TYR A 1 13 ? -0.879  -1.343  4.784   1.00 4.67  ? 13 TYR A O    5  
ATOM   4754  C CB   . TYR A 1 13 ? -2.835  -2.839  3.089   1.00 4.85  ? 13 TYR A CB   5  
ATOM   4755  C CG   . TYR A 1 13 ? -2.954  -4.302  3.424   1.00 5.22  ? 13 TYR A CG   5  
ATOM   4756  C CD1  . TYR A 1 13 ? -3.854  -4.737  4.403   1.00 5.34  ? 13 TYR A CD1  5  
ATOM   4757  C CD2  . TYR A 1 13 ? -2.154  -5.222  2.745   1.00 5.75  ? 13 TYR A CD2  5  
ATOM   4758  C CE1  . TYR A 1 13 ? -3.951  -6.101  4.707   1.00 5.79  ? 13 TYR A CE1  5  
ATOM   4759  C CE2  . TYR A 1 13 ? -2.250  -6.588  3.045   1.00 6.30  ? 13 TYR A CE2  5  
ATOM   4760  C CZ   . TYR A 1 13 ? -3.148  -7.027  4.028   1.00 6.23  ? 13 TYR A CZ   5  
ATOM   4761  O OH   . TYR A 1 13 ? -3.245  -8.371  4.322   1.00 6.84  ? 13 TYR A OH   5  
ATOM   4762  H H    . TYR A 1 13 ? -3.162  -0.254  3.029   1.00 4.82  ? 13 TYR A H    5  
ATOM   4763  H HA   . TYR A 1 13 ? -3.950  -2.421  4.876   1.00 5.34  ? 13 TYR A HA   5  
ATOM   4764  H HB2  . TYR A 1 13 ? -3.524  -2.600  2.295   1.00 4.90  ? 13 TYR A HB2  5  
ATOM   4765  H HB3  . TYR A 1 13 ? -1.828  -2.635  2.762   1.00 4.67  ? 13 TYR A HB3  5  
ATOM   4766  H HD1  . TYR A 1 13 ? -4.474  -4.017  4.922   1.00 5.30  ? 13 TYR A HD1  5  
ATOM   4767  H HD2  . TYR A 1 13 ? -1.465  -4.875  1.984   1.00 5.92  ? 13 TYR A HD2  5  
ATOM   4768  H HE1  . TYR A 1 13 ? -4.644  -6.438  5.465   1.00 5.99  ? 13 TYR A HE1  5  
ATOM   4769  H HE2  . TYR A 1 13 ? -1.628  -7.301  2.524   1.00 6.92  ? 13 TYR A HE2  5  
ATOM   4770  H HH   . TYR A 1 13 ? -2.729  -8.542  5.113   1.00 7.17  ? 13 TYR A HH   5  
ATOM   4771  N N    . SER A 1 14 ? -1.985  -2.361  6.403   1.00 5.82  ? 14 SER A N    5  
ATOM   4772  C CA   . SER A 1 14 ? -0.812  -2.319  7.327   1.00 6.06  ? 14 SER A CA   5  
ATOM   4773  C C    . SER A 1 14 ? -0.106  -3.679  7.306   1.00 6.51  ? 14 SER A C    5  
ATOM   4774  O O    . SER A 1 14 ? 1.099   -3.758  7.464   1.00 6.88  ? 14 SER A O    5  
ATOM   4775  C CB   . SER A 1 14 ? -1.281  -2.003  8.752   1.00 6.42  ? 14 SER A CB   5  
ATOM   4776  O OG   . SER A 1 14 ? -2.316  -2.907  9.123   1.00 6.80  ? 14 SER A OG   5  
ATOM   4777  H H    . SER A 1 14 ? -2.820  -2.782  6.698   1.00 6.33  ? 14 SER A H    5  
ATOM   4778  H HA   . SER A 1 14 ? -0.123  -1.557  6.997   1.00 5.81  ? 14 SER A HA   5  
ATOM   4779  H HB2  . SER A 1 14 ? -0.456  -2.112  9.435   1.00 6.57  ? 14 SER A HB2  5  
ATOM   4780  H HB3  . SER A 1 14 ? -1.645  -0.985  8.791   1.00 6.52  ? 14 SER A HB3  5  
ATOM   4781  H HG   . SER A 1 14 ? -2.337  -2.956  10.082  1.00 7.03  ? 14 SER A HG   5  
ATOM   4782  N N    . LYS A 1 15 ? -0.843  -4.749  7.099   1.00 6.59  ? 15 LYS A N    5  
ATOM   4783  C CA   . LYS A 1 15 ? -0.210  -6.101  7.053   1.00 7.06  ? 15 LYS A CA   5  
ATOM   4784  C C    . LYS A 1 15 ? 0.498   -6.261  5.702   1.00 6.32  ? 15 LYS A C    5  
ATOM   4785  O O    . LYS A 1 15 ? -0.034  -5.873  4.683   1.00 6.13  ? 15 LYS A O    5  
ATOM   4786  C CB   . LYS A 1 15 ? -1.251  -7.221  7.196   1.00 7.75  ? 15 LYS A CB   5  
ATOM   4787  C CG   . LYS A 1 15 ? -2.547  -6.703  7.834   1.00 8.64  ? 15 LYS A CG   5  
ATOM   4788  C CD   . LYS A 1 15 ? -3.413  -7.887  8.270   1.00 9.43  ? 15 LYS A CD   5  
ATOM   4789  C CE   . LYS A 1 15 ? -4.846  -7.409  8.517   1.00 10.20 ? 15 LYS A CE   5  
ATOM   4790  N NZ   . LYS A 1 15 ? -5.606  -8.457  9.257   1.00 10.59 ? 15 LYS A NZ   5  
ATOM   4791  H H    . LYS A 1 15 ? -1.805  -4.658  6.963   1.00 6.42  ? 15 LYS A H    5  
ATOM   4792  H HA   . LYS A 1 15 ? 0.513   -6.180  7.851   1.00 7.57  ? 15 LYS A HA   5  
ATOM   4793  H HB2  . LYS A 1 15 ? -1.462  -7.621  6.224   1.00 7.79  ? 15 LYS A HB2  5  
ATOM   4794  H HB3  . LYS A 1 15 ? -0.843  -8.000  7.811   1.00 7.79  ? 15 LYS A HB3  5  
ATOM   4795  H HG2  . LYS A 1 15 ? -2.307  -6.098  8.696   1.00 8.72  ? 15 LYS A HG2  5  
ATOM   4796  H HG3  . LYS A 1 15 ? -3.091  -6.109  7.116   1.00 8.87  ? 15 LYS A HG3  5  
ATOM   4797  H HD2  . LYS A 1 15 ? -3.414  -8.640  7.494   1.00 9.71  ? 15 LYS A HD2  5  
ATOM   4798  H HD3  . LYS A 1 15 ? -3.015  -8.310  9.180   1.00 9.38  ? 15 LYS A HD3  5  
ATOM   4799  H HE2  . LYS A 1 15 ? -4.825  -6.501  9.103   1.00 10.54 ? 15 LYS A HE2  5  
ATOM   4800  H HE3  . LYS A 1 15 ? -5.328  -7.214  7.571   1.00 10.33 ? 15 LYS A HE3  5  
ATOM   4801  H HZ1  . LYS A 1 15 ? -5.133  -8.658  10.160  1.00 10.22 ? 15 LYS A HZ1  5  
ATOM   4802  H HZ2  . LYS A 1 15 ? -6.571  -8.119  9.441   1.00 11.09 ? 15 LYS A HZ2  5  
ATOM   4803  H HZ3  . LYS A 1 15 ? -5.645  -9.325  8.683   1.00 10.91 ? 15 LYS A HZ3  5  
ATOM   4804  N N    . PRO A 1 16 ? 1.684   -6.811  5.739   1.00 6.02  ? 16 PRO A N    5  
ATOM   4805  C CA   . PRO A 1 16 ? 2.507   -7.016  4.536   1.00 5.35  ? 16 PRO A CA   5  
ATOM   4806  C C    . PRO A 1 16 ? 2.114   -8.301  3.799   1.00 5.50  ? 16 PRO A C    5  
ATOM   4807  O O    . PRO A 1 16 ? 1.538   -9.210  4.369   1.00 6.37  ? 16 PRO A O    5  
ATOM   4808  C CB   . PRO A 1 16 ? 3.922   -7.125  5.101   1.00 5.39  ? 16 PRO A CB   5  
ATOM   4809  C CG   . PRO A 1 16 ? 3.777   -7.554  6.582   1.00 6.26  ? 16 PRO A CG   5  
ATOM   4810  C CD   . PRO A 1 16 ? 2.317   -7.277  6.984   1.00 6.51  ? 16 PRO A CD   5  
ATOM   4811  H HA   . PRO A 1 16 ? 2.441   -6.168  3.879   1.00 4.92  ? 16 PRO A HA   5  
ATOM   4812  H HB2  . PRO A 1 16 ? 4.482   -7.857  4.550   1.00 5.32  ? 16 PRO A HB2  5  
ATOM   4813  H HB3  . PRO A 1 16 ? 4.411   -6.172  5.044   1.00 5.10  ? 16 PRO A HB3  5  
ATOM   4814  H HG2  . PRO A 1 16 ? 3.999   -8.608  6.684   1.00 6.77  ? 16 PRO A HG2  5  
ATOM   4815  H HG3  . PRO A 1 16 ? 4.442   -6.974  7.203   1.00 6.37  ? 16 PRO A HG3  5  
ATOM   4816  H HD2  . PRO A 1 16 ? 1.842   -8.185  7.333   1.00 7.06  ? 16 PRO A HD2  5  
ATOM   4817  H HD3  . PRO A 1 16 ? 2.260   -6.511  7.737   1.00 6.63  ? 16 PRO A HD3  5  
ATOM   4818  N N    . PHE A 1 17 ? 2.438   -8.376  2.531   1.00 4.76  ? 17 PHE A N    5  
ATOM   4819  C CA   . PHE A 1 17 ? 2.107   -9.598  1.731   1.00 4.96  ? 17 PHE A CA   5  
ATOM   4820  C C    . PHE A 1 17 ? 2.997   -9.660  0.476   1.00 4.78  ? 17 PHE A C    5  
ATOM   4821  O O    . PHE A 1 17 ? 3.533   -8.659  0.033   1.00 4.77  ? 17 PHE A O    5  
ATOM   4822  C CB   . PHE A 1 17 ? 0.611   -9.595  1.349   1.00 4.69  ? 17 PHE A CB   5  
ATOM   4823  C CG   . PHE A 1 17 ? 0.309   -8.573  0.272   1.00 3.72  ? 17 PHE A CG   5  
ATOM   4824  C CD1  . PHE A 1 17 ? 0.315   -7.203  0.570   1.00 3.74  ? 17 PHE A CD1  5  
ATOM   4825  C CD2  . PHE A 1 17 ? 0.003   -9.002  -1.026  1.00 3.29  ? 17 PHE A CD2  5  
ATOM   4826  C CE1  . PHE A 1 17 ? 0.022   -6.268  -0.430  1.00 3.14  ? 17 PHE A CE1  5  
ATOM   4827  C CE2  . PHE A 1 17 ? -0.291  -8.067  -2.023  1.00 2.59  ? 17 PHE A CE2  5  
ATOM   4828  C CZ   . PHE A 1 17 ? -0.282  -6.700  -1.726  1.00 2.38  ? 17 PHE A CZ   5  
ATOM   4829  H H    . PHE A 1 17 ? 2.912   -7.628  2.108   1.00 4.19  ? 17 PHE A H    5  
ATOM   4830  H HA   . PHE A 1 17 ? 2.309   -10.470 2.337   1.00 5.66  ? 17 PHE A HA   5  
ATOM   4831  H HB2  . PHE A 1 17 ? 0.339   -10.573 0.988   1.00 5.13  ? 17 PHE A HB2  5  
ATOM   4832  H HB3  . PHE A 1 17 ? 0.023   -9.368  2.228   1.00 5.06  ? 17 PHE A HB3  5  
ATOM   4833  H HD1  . PHE A 1 17 ? 0.546   -6.868  1.571   1.00 4.51  ? 17 PHE A HD1  5  
ATOM   4834  H HD2  . PHE A 1 17 ? -0.005  -10.057 -1.258  1.00 3.86  ? 17 PHE A HD2  5  
ATOM   4835  H HE1  . PHE A 1 17 ? 0.028   -5.213  -0.204  1.00 3.62  ? 17 PHE A HE1  5  
ATOM   4836  H HE2  . PHE A 1 17 ? -0.527  -8.400  -3.024  1.00 2.72  ? 17 PHE A HE2  5  
ATOM   4837  H HZ   . PHE A 1 17 ? -0.511  -5.979  -2.497  1.00 2.18  ? 17 PHE A HZ   5  
ATOM   4838  N N    . HIS A 1 18 ? 3.169   -10.837 -0.084  1.00 4.92  ? 18 HIS A N    5  
ATOM   4839  C CA   . HIS A 1 18 ? 4.035   -10.997 -1.295  1.00 5.06  ? 18 HIS A CA   5  
ATOM   4840  C C    . HIS A 1 18 ? 3.416   -10.234 -2.499  1.00 4.32  ? 18 HIS A C    5  
ATOM   4841  O O    . HIS A 1 18 ? 2.211   -10.213 -2.662  1.00 4.10  ? 18 HIS A O    5  
ATOM   4842  C CB   . HIS A 1 18 ? 4.202   -12.498 -1.553  1.00 5.95  ? 18 HIS A CB   5  
ATOM   4843  C CG   . HIS A 1 18 ? 4.738   -12.727 -2.918  1.00 6.25  ? 18 HIS A CG   5  
ATOM   4844  N ND1  . HIS A 1 18 ? 6.090   -12.843 -3.200  1.00 6.36  ? 18 HIS A ND1  5  
ATOM   4845  C CD2  . HIS A 1 18 ? 4.095   -12.857 -4.095  1.00 6.72  ? 18 HIS A CD2  5  
ATOM   4846  C CE1  . HIS A 1 18 ? 6.198   -13.035 -4.526  1.00 6.81  ? 18 HIS A CE1  5  
ATOM   4847  N NE2  . HIS A 1 18 ? 5.009   -13.059 -5.111  1.00 7.07  ? 18 HIS A NE2  5  
ATOM   4848  H H    . HIS A 1 18 ? 2.732   -11.629 0.303   1.00 5.11  ? 18 HIS A H    5  
ATOM   4849  H HA   . HIS A 1 18 ? 4.999   -10.578 -1.093  1.00 5.21  ? 18 HIS A HA   5  
ATOM   4850  H HB2  . HIS A 1 18 ? 4.886   -12.911 -0.827  1.00 6.63  ? 18 HIS A HB2  5  
ATOM   4851  H HB3  . HIS A 1 18 ? 3.246   -12.983 -1.456  1.00 5.84  ? 18 HIS A HB3  5  
ATOM   4852  H HD1  . HIS A 1 18 ? 6.827   -12.796 -2.555  1.00 6.36  ? 18 HIS A HD1  5  
ATOM   4853  H HD2  . HIS A 1 18 ? 3.038   -12.760 -4.215  1.00 7.00  ? 18 HIS A HD2  5  
ATOM   4854  H HE1  . HIS A 1 18 ? 7.130   -13.110 -5.060  1.00 7.12  ? 18 HIS A HE1  5  
ATOM   4855  N N    . PRO A 1 19 ? 4.279   -9.570  -3.263  1.00 4.16  ? 19 PRO A N    5  
ATOM   4856  C CA   . PRO A 1 19 ? 3.875   -8.713  -4.412  1.00 3.77  ? 19 PRO A CA   5  
ATOM   4857  C C    . PRO A 1 19 ? 3.461   -9.475  -5.679  1.00 4.27  ? 19 PRO A C    5  
ATOM   4858  O O    . PRO A 1 19 ? 2.499   -9.098  -6.321  1.00 4.32  ? 19 PRO A O    5  
ATOM   4859  C CB   . PRO A 1 19 ? 5.128   -7.882  -4.696  1.00 3.96  ? 19 PRO A CB   5  
ATOM   4860  C CG   . PRO A 1 19 ? 6.319   -8.677  -4.118  1.00 4.62  ? 19 PRO A CG   5  
ATOM   4861  C CD   . PRO A 1 19 ? 5.742   -9.621  -3.050  1.00 4.65  ? 19 PRO A CD   5  
ATOM   4862  H HA   . PRO A 1 19 ? 3.085   -8.055  -4.114  1.00 3.26  ? 19 PRO A HA   5  
ATOM   4863  H HB2  . PRO A 1 19 ? 5.248   -7.747  -5.764  1.00 4.26  ? 19 PRO A HB2  5  
ATOM   4864  H HB3  . PRO A 1 19 ? 5.056   -6.926  -4.206  1.00 3.57  ? 19 PRO A HB3  5  
ATOM   4865  H HG2  . PRO A 1 19 ? 6.796   -9.249  -4.904  1.00 5.23  ? 19 PRO A HG2  5  
ATOM   4866  H HG3  . PRO A 1 19 ? 7.029   -8.004  -3.665  1.00 4.63  ? 19 PRO A HG3  5  
ATOM   4867  H HD2  . PRO A 1 19 ? 6.114   -10.624 -3.197  1.00 5.29  ? 19 PRO A HD2  5  
ATOM   4868  H HD3  . PRO A 1 19 ? 5.985   -9.269  -2.061  1.00 4.56  ? 19 PRO A HD3  5  
ATOM   4869  N N    . LYS A 1 20 ? 4.180   -10.498 -6.080  1.00 4.91  ? 20 LYS A N    5  
ATOM   4870  C CA   . LYS A 1 20 ? 3.805   -11.224 -7.347  1.00 5.52  ? 20 LYS A CA   5  
ATOM   4871  C C    . LYS A 1 20 ? 2.331   -11.677 -7.311  1.00 5.00  ? 20 LYS A C    5  
ATOM   4872  O O    . LYS A 1 20 ? 1.727   -11.886 -8.348  1.00 5.39  ? 20 LYS A O    5  
ATOM   4873  C CB   . LYS A 1 20 ? 4.720   -12.418 -7.589  1.00 6.44  ? 20 LYS A CB   5  
ATOM   4874  C CG   . LYS A 1 20 ? 4.920   -12.610 -9.096  1.00 7.16  ? 20 LYS A CG   5  
ATOM   4875  C CD   . LYS A 1 20 ? 5.531   -13.989 -9.363  1.00 7.91  ? 20 LYS A CD   5  
ATOM   4876  C CE   . LYS A 1 20 ? 4.479   -14.904 -9.999  1.00 8.41  ? 20 LYS A CE   5  
ATOM   4877  N NZ   . LYS A 1 20 ? 5.155   -15.981 -10.779 1.00 8.95  ? 20 LYS A NZ   5  
ATOM   4878  H H    . LYS A 1 20 ? 4.972   -10.766 -5.571  1.00 5.13  ? 20 LYS A H    5  
ATOM   4879  H HA   . LYS A 1 20 ? 3.928   -10.547 -8.163  1.00 5.87  ? 20 LYS A HA   5  
ATOM   4880  H HB2  . LYS A 1 20 ? 5.677   -12.242 -7.119  1.00 6.91  ? 20 LYS A HB2  5  
ATOM   4881  H HB3  . LYS A 1 20 ? 4.271   -13.294 -7.175  1.00 6.29  ? 20 LYS A HB3  5  
ATOM   4882  H HG2  . LYS A 1 20 ? 3.965   -12.534 -9.596  1.00 7.23  ? 20 LYS A HG2  5  
ATOM   4883  H HG3  . LYS A 1 20 ? 5.584   -11.846 -9.470  1.00 7.28  ? 20 LYS A HG3  5  
ATOM   4884  H HD2  . LYS A 1 20 ? 6.371   -13.884 -10.034 1.00 8.14  ? 20 LYS A HD2  5  
ATOM   4885  H HD3  . LYS A 1 20 ? 5.866   -14.422 -8.432  1.00 8.11  ? 20 LYS A HD3  5  
ATOM   4886  H HE2  . LYS A 1 20 ? 3.873   -15.349 -9.223  1.00 8.28  ? 20 LYS A HE2  5  
ATOM   4887  H HE3  . LYS A 1 20 ? 3.849   -14.325 -10.658 1.00 8.75  ? 20 LYS A HE3  5  
ATOM   4888  H HZ1  . LYS A 1 20 ? 5.738   -15.556 -11.526 1.00 9.13  ? 20 LYS A HZ1  5  
ATOM   4889  H HZ2  . LYS A 1 20 ? 5.759   -16.543 -10.143 1.00 9.15  ? 20 LYS A HZ2  5  
ATOM   4890  H HZ3  . LYS A 1 20 ? 4.438   -16.597 -11.210 1.00 9.17  ? 20 LYS A HZ3  5  
ATOM   4891  N N    . PHE A 1 21 ? 1.733   -11.791 -6.139  1.00 4.37  ? 21 PHE A N    5  
ATOM   4892  C CA   . PHE A 1 21 ? 0.290   -12.178 -6.057  1.00 4.15  ? 21 PHE A CA   5  
ATOM   4893  C C    . PHE A 1 21 ? -0.541  -11.096 -6.755  1.00 3.56  ? 21 PHE A C    5  
ATOM   4894  O O    . PHE A 1 21 ? -1.523  -11.376 -7.417  1.00 3.88  ? 21 PHE A O    5  
ATOM   4895  C CB   . PHE A 1 21 ? -0.148  -12.250 -4.597  1.00 4.02  ? 21 PHE A CB   5  
ATOM   4896  C CG   . PHE A 1 21 ? 0.594   -13.329 -3.834  1.00 4.64  ? 21 PHE A CG   5  
ATOM   4897  C CD1  . PHE A 1 21 ? 1.162   -14.425 -4.501  1.00 5.11  ? 21 PHE A CD1  5  
ATOM   4898  C CD2  . PHE A 1 21 ? 0.703   -13.229 -2.441  1.00 5.12  ? 21 PHE A CD2  5  
ATOM   4899  C CE1  . PHE A 1 21 ? 1.838   -15.411 -3.772  1.00 5.85  ? 21 PHE A CE1  5  
ATOM   4900  C CE2  . PHE A 1 21 ? 1.377   -14.216 -1.716  1.00 5.85  ? 21 PHE A CE2  5  
ATOM   4901  C CZ   . PHE A 1 21 ? 1.946   -15.306 -2.381  1.00 6.13  ? 21 PHE A CZ   5  
ATOM   4902  H H    . PHE A 1 21 ? 2.219   -11.589 -5.318  1.00 4.29  ? 21 PHE A H    5  
ATOM   4903  H HA   . PHE A 1 21 ? 0.134   -13.125 -6.526  1.00 4.82  ? 21 PHE A HA   5  
ATOM   4904  H HB2  . PHE A 1 21 ? 0.048   -11.304 -4.143  1.00 3.48  ? 21 PHE A HB2  5  
ATOM   4905  H HB3  . PHE A 1 21 ? -1.204  -12.448 -4.557  1.00 4.37  ? 21 PHE A HB3  5  
ATOM   4906  H HD1  . PHE A 1 21 ? 1.080   -14.508 -5.574  1.00 5.17  ? 21 PHE A HD1  5  
ATOM   4907  H HD2  . PHE A 1 21 ? 0.267   -12.386 -1.927  1.00 5.18  ? 21 PHE A HD2  5  
ATOM   4908  H HE1  . PHE A 1 21 ? 2.279   -16.251 -4.284  1.00 6.40  ? 21 PHE A HE1  5  
ATOM   4909  H HE2  . PHE A 1 21 ? 1.460   -14.132 -0.641  1.00 6.40  ? 21 PHE A HE2  5  
ATOM   4910  H HZ   . PHE A 1 21 ? 2.466   -16.070 -1.821  1.00 6.79  ? 21 PHE A HZ   5  
ATOM   4911  N N    . ILE A 1 22 ? -0.134  -9.858  -6.594  1.00 2.94  ? 22 ILE A N    5  
ATOM   4912  C CA   . ILE A 1 22 ? -0.851  -8.705  -7.217  1.00 2.62  ? 22 ILE A CA   5  
ATOM   4913  C C    . ILE A 1 22 ? -0.812  -8.824  -8.743  1.00 3.41  ? 22 ILE A C    5  
ATOM   4914  O O    . ILE A 1 22 ? 0.244   -8.836  -9.350  1.00 4.13  ? 22 ILE A O    5  
ATOM   4915  C CB   . ILE A 1 22 ? -0.159  -7.400  -6.794  1.00 2.18  ? 22 ILE A CB   5  
ATOM   4916  C CG1  . ILE A 1 22 ? -0.178  -7.274  -5.266  1.00 2.00  ? 22 ILE A CG1  5  
ATOM   4917  C CG2  . ILE A 1 22 ? -0.887  -6.206  -7.406  1.00 2.53  ? 22 ILE A CG2  5  
ATOM   4918  C CD1  . ILE A 1 22 ? 1.069   -6.519  -4.799  1.00 2.47  ? 22 ILE A CD1  5  
ATOM   4919  H H    . ILE A 1 22 ? 0.663   -9.683  -6.050  1.00 2.94  ? 22 ILE A H    5  
ATOM   4920  H HA   . ILE A 1 22 ? -1.879  -8.691  -6.887  1.00 2.63  ? 22 ILE A HA   5  
ATOM   4921  H HB   . ILE A 1 22 ? 0.863   -7.410  -7.142  1.00 2.49  ? 22 ILE A HB   5  
ATOM   4922  H HG12 . ILE A 1 22 ? -1.062  -6.735  -4.959  1.00 2.23  ? 22 ILE A HG12 5  
ATOM   4923  H HG13 . ILE A 1 22 ? -0.186  -8.258  -4.823  1.00 2.28  ? 22 ILE A HG13 5  
ATOM   4924  H HG21 . ILE A 1 22 ? -1.947  -6.401  -7.412  1.00 2.71  ? 22 ILE A HG21 5  
ATOM   4925  H HG22 . ILE A 1 22 ? -0.686  -5.321  -6.819  1.00 2.80  ? 22 ILE A HG22 5  
ATOM   4926  H HG23 . ILE A 1 22 ? -0.542  -6.053  -8.417  1.00 3.07  ? 22 ILE A HG23 5  
ATOM   4927  H HD11 . ILE A 1 22 ? 1.817   -6.537  -5.579  1.00 2.84  ? 22 ILE A HD11 5  
ATOM   4928  H HD12 . ILE A 1 22 ? 0.807   -5.496  -4.575  1.00 2.73  ? 22 ILE A HD12 5  
ATOM   4929  H HD13 . ILE A 1 22 ? 1.464   -6.991  -3.912  1.00 2.88  ? 22 ILE A HD13 5  
ATOM   4930  N N    . LYS A 1 23 ? -1.963  -8.890  -9.362  1.00 3.62  ? 23 LYS A N    5  
ATOM   4931  C CA   . LYS A 1 23 ? -2.018  -8.978  -10.849 1.00 4.61  ? 23 LYS A CA   5  
ATOM   4932  C C    . LYS A 1 23 ? -1.851  -7.569  -11.441 1.00 5.00  ? 23 LYS A C    5  
ATOM   4933  O O    . LYS A 1 23 ? -1.392  -7.410  -12.557 1.00 5.88  ? 23 LYS A O    5  
ATOM   4934  C CB   . LYS A 1 23 ? -3.371  -9.561  -11.280 1.00 5.10  ? 23 LYS A CB   5  
ATOM   4935  C CG   . LYS A 1 23 ? -3.151  -10.877 -12.031 1.00 5.85  ? 23 LYS A CG   5  
ATOM   4936  C CD   . LYS A 1 23 ? -4.489  -11.603 -12.199 1.00 6.35  ? 23 LYS A CD   5  
ATOM   4937  C CE   . LYS A 1 23 ? -4.282  -12.882 -13.017 1.00 6.93  ? 23 LYS A CE   5  
ATOM   4938  N NZ   . LYS A 1 23 ? -3.942  -14.011 -12.104 1.00 7.72  ? 23 LYS A NZ   5  
ATOM   4939  H H    . LYS A 1 23 ? -2.796  -8.861  -8.844  1.00 3.33  ? 23 LYS A H    5  
ATOM   4940  H HA   . LYS A 1 23 ? -1.220  -9.615  -11.203 1.00 4.98  ? 23 LYS A HA   5  
ATOM   4941  H HB2  . LYS A 1 23 ? -3.978  -9.745  -10.404 1.00 4.92  ? 23 LYS A HB2  5  
ATOM   4942  H HB3  . LYS A 1 23 ? -3.877  -8.859  -11.927 1.00 5.36  ? 23 LYS A HB3  5  
ATOM   4943  H HG2  . LYS A 1 23 ? -2.730  -10.668 -13.005 1.00 6.02  ? 23 LYS A HG2  5  
ATOM   4944  H HG3  . LYS A 1 23 ? -2.472  -11.503 -11.473 1.00 6.22  ? 23 LYS A HG3  5  
ATOM   4945  H HD2  . LYS A 1 23 ? -4.883  -11.858 -11.225 1.00 6.70  ? 23 LYS A HD2  5  
ATOM   4946  H HD3  . LYS A 1 23 ? -5.187  -10.959 -12.711 1.00 6.30  ? 23 LYS A HD3  5  
ATOM   4947  H HE2  . LYS A 1 23 ? -5.191  -13.115 -13.554 1.00 6.98  ? 23 LYS A HE2  5  
ATOM   4948  H HE3  . LYS A 1 23 ? -3.478  -12.732 -13.722 1.00 7.01  ? 23 LYS A HE3  5  
ATOM   4949  H HZ1  . LYS A 1 23 ? -4.703  -14.137 -11.407 1.00 7.80  ? 23 LYS A HZ1  5  
ATOM   4950  H HZ2  . LYS A 1 23 ? -3.832  -14.884 -12.660 1.00 7.78  ? 23 LYS A HZ2  5  
ATOM   4951  H HZ3  . LYS A 1 23 ? -3.052  -13.801 -11.608 1.00 8.36  ? 23 LYS A HZ3  5  
ATOM   4952  N N    . GLU A 1 24 ? -2.216  -6.546  -10.694 1.00 4.51  ? 24 GLU A N    5  
ATOM   4953  C CA   . GLU A 1 24 ? -2.077  -5.144  -11.198 1.00 5.13  ? 24 GLU A CA   5  
ATOM   4954  C C    . GLU A 1 24 ? -1.756  -4.211  -10.019 1.00 4.55  ? 24 GLU A C    5  
ATOM   4955  O O    . GLU A 1 24 ? -2.605  -3.945  -9.188  1.00 4.65  ? 24 GLU A O    5  
ATOM   4956  C CB   . GLU A 1 24 ? -3.390  -4.706  -11.860 1.00 5.78  ? 24 GLU A CB   5  
ATOM   4957  C CG   . GLU A 1 24 ? -3.514  -5.359  -13.240 1.00 6.35  ? 24 GLU A CG   5  
ATOM   4958  C CD   . GLU A 1 24 ? -4.458  -4.534  -14.117 1.00 7.36  ? 24 GLU A CD   5  
ATOM   4959  O OE1  . GLU A 1 24 ? -3.998  -3.565  -14.700 1.00 7.77  ? 24 GLU A OE1  5  
ATOM   4960  O OE2  . GLU A 1 24 ? -5.625  -4.886  -14.192 1.00 7.92  ? 24 GLU A OE2  5  
ATOM   4961  H H    . GLU A 1 24 ? -2.579  -6.704  -9.793  1.00 3.86  ? 24 GLU A H    5  
ATOM   4962  H HA   . GLU A 1 24 ? -1.277  -5.100  -11.922 1.00 5.74  ? 24 GLU A HA   5  
ATOM   4963  H HB2  . GLU A 1 24 ? -4.223  -5.008  -11.241 1.00 5.66  ? 24 GLU A HB2  5  
ATOM   4964  H HB3  . GLU A 1 24 ? -3.396  -3.632  -11.971 1.00 6.21  ? 24 GLU A HB3  5  
ATOM   4965  H HG2  . GLU A 1 24 ? -2.540  -5.407  -13.706 1.00 6.22  ? 24 GLU A HG2  5  
ATOM   4966  H HG3  . GLU A 1 24 ? -3.909  -6.359  -13.131 1.00 6.40  ? 24 GLU A HG3  5  
HETATM 4967  N N    . MLE A 1 25 ? -0.536  -3.723  -9.927  1.00 4.25  ? 25 MLE A N    5  
HETATM 4968  C CN   . MLE A 1 25 ? 0.088   -3.227  -11.197 1.00 5.13  ? 25 MLE A CN   5  
HETATM 4969  C CA   . MLE A 1 25 ? -0.170  -2.821  -8.778  1.00 3.66  ? 25 MLE A CA   5  
HETATM 4970  C CB   . MLE A 1 25 ? 1.163   -3.280  -8.166  1.00 3.52  ? 25 MLE A CB   5  
HETATM 4971  C CG   . MLE A 1 25 ? 1.691   -2.207  -7.202  1.00 3.28  ? 25 MLE A CG   5  
HETATM 4972  C CD1  . MLE A 1 25 ? 2.178   -2.866  -5.913  1.00 2.93  ? 25 MLE A CD1  5  
HETATM 4973  C CD2  . MLE A 1 25 ? 2.849   -1.446  -7.861  1.00 3.54  ? 25 MLE A CD2  5  
HETATM 4974  C C    . MLE A 1 25 ? -0.028  -1.370  -9.261  1.00 4.19  ? 25 MLE A C    5  
HETATM 4975  O O    . MLE A 1 25 ? 0.942   -1.014  -9.908  1.00 4.87  ? 25 MLE A O    5  
HETATM 4976  H HN1  . MLE A 1 25 ? 1.111   -2.933  -11.004 1.00 5.47  ? 25 MLE A HN1  5  
HETATM 4977  H HN2  . MLE A 1 25 ? 0.072   -4.004  -11.940 1.00 5.48  ? 25 MLE A HN2  5  
HETATM 4978  H HN3  . MLE A 1 25 ? -0.467  -2.370  -11.557 1.00 5.42  ? 25 MLE A HN3  5  
HETATM 4979  H HA   . MLE A 1 25 ? -0.943  -2.876  -8.023  1.00 3.20  ? 25 MLE A HA   5  
HETATM 4980  H HB2  . MLE A 1 25 ? 1.010   -4.206  -7.629  1.00 3.37  ? 25 MLE A HB2  5  
HETATM 4981  H HB3  . MLE A 1 25 ? 1.882   -3.438  -8.955  1.00 4.08  ? 25 MLE A HB3  5  
HETATM 4982  H HG   . MLE A 1 25 ? 0.895   -1.514  -6.967  1.00 3.59  ? 25 MLE A HG   5  
HETATM 4983  H HD11 . MLE A 1 25 ? 1.686   -3.818  -5.789  1.00 2.79  ? 25 MLE A HD11 5  
HETATM 4984  H HD12 . MLE A 1 25 ? 3.246   -3.014  -5.966  1.00 3.21  ? 25 MLE A HD12 5  
HETATM 4985  H HD13 . MLE A 1 25 ? 1.943   -2.227  -5.075  1.00 3.14  ? 25 MLE A HD13 5  
HETATM 4986  H HD21 . MLE A 1 25 ? 3.071   -1.886  -8.822  1.00 3.89  ? 25 MLE A HD21 5  
HETATM 4987  H HD22 . MLE A 1 25 ? 2.568   -0.411  -7.996  1.00 3.75  ? 25 MLE A HD22 5  
HETATM 4988  H HD23 . MLE A 1 25 ? 3.724   -1.500  -7.230  1.00 3.70  ? 25 MLE A HD23 5  
ATOM   4989  N N    . ARG A 1 26 ? -0.973  -0.528  -8.951  1.00 4.14  ? 26 ARG A N    5  
ATOM   4990  C CA   . ARG A 1 26 ? -0.861  0.883   -9.401  1.00 4.79  ? 26 ARG A CA   5  
ATOM   4991  C C    . ARG A 1 26 ? -0.949  1.828   -8.195  1.00 4.70  ? 26 ARG A C    5  
ATOM   4992  O O    . ARG A 1 26 ? -1.874  1.759   -7.409  1.00 4.97  ? 26 ARG A O    5  
ATOM   4993  C CB   . ARG A 1 26 ? -1.979  1.199   -10.383 1.00 5.59  ? 26 ARG A CB   5  
ATOM   4994  C CG   . ARG A 1 26 ? -1.384  1.595   -11.737 1.00 5.99  ? 26 ARG A CG   5  
ATOM   4995  C CD   . ARG A 1 26 ? -2.508  2.052   -12.670 1.00 6.35  ? 26 ARG A CD   5  
ATOM   4996  N NE   . ARG A 1 26 ? -1.961  2.991   -13.693 1.00 7.16  ? 26 ARG A NE   5  
ATOM   4997  C CZ   . ARG A 1 26 ? -2.630  3.216   -14.793 1.00 7.92  ? 26 ARG A CZ   5  
ATOM   4998  N NH1  . ARG A 1 26 ? -3.594  4.101   -14.799 1.00 8.52  ? 26 ARG A NH1  5  
ATOM   4999  N NH2  . ARG A 1 26 ? -2.337  2.555   -15.884 1.00 8.32  ? 26 ARG A NH2  5  
ATOM   5000  H H    . ARG A 1 26 ? -1.748  -0.821  -8.425  1.00 3.85  ? 26 ARG A H    5  
ATOM   5001  H HA   . ARG A 1 26 ? 0.083   1.006   -9.894  1.00 5.07  ? 26 ARG A HA   5  
ATOM   5002  H HB2  . ARG A 1 26 ? -2.599  0.328   -10.506 1.00 5.95  ? 26 ARG A HB2  5  
ATOM   5003  H HB3  . ARG A 1 26 ? -2.568  2.012   -10.000 1.00 5.91  ? 26 ARG A HB3  5  
ATOM   5004  H HG2  . ARG A 1 26 ? -0.679  2.402   -11.598 1.00 6.27  ? 26 ARG A HG2  5  
ATOM   5005  H HG3  . ARG A 1 26 ? -0.880  0.747   -12.172 1.00 6.12  ? 26 ARG A HG3  5  
ATOM   5006  H HD2  . ARG A 1 26 ? -2.937  1.194   -13.163 1.00 6.26  ? 26 ARG A HD2  5  
ATOM   5007  H HD3  . ARG A 1 26 ? -3.272  2.555   -12.094 1.00 6.38  ? 26 ARG A HD3  5  
ATOM   5008  H HE   . ARG A 1 26 ? -1.102  3.439   -13.540 1.00 7.28  ? 26 ARG A HE   5  
ATOM   5009  H HH11 . ARG A 1 26 ? -3.818  4.604   -13.963 1.00 8.41  ? 26 ARG A HH11 5  
ATOM   5010  H HH12 . ARG A 1 26 ? -4.108  4.275   -15.639 1.00 9.21  ? 26 ARG A HH12 5  
ATOM   5011  H HH21 . ARG A 1 26 ? -1.601  1.878   -15.877 1.00 8.08  ? 26 ARG A HH21 5  
ATOM   5012  H HH22 . ARG A 1 26 ? -2.850  2.726   -16.726 1.00 9.02  ? 26 ARG A HH22 5  
ATOM   5013  N N    . VAL A 1 27 ? 0.006   2.715   -8.047  1.00 4.69  ? 27 VAL A N    5  
ATOM   5014  C CA   . VAL A 1 27 ? -0.016  3.668   -6.899  1.00 4.83  ? 27 VAL A CA   5  
ATOM   5015  C C    . VAL A 1 27 ? -0.478  5.050   -7.385  1.00 4.79  ? 27 VAL A C    5  
ATOM   5016  O O    . VAL A 1 27 ? -0.260  5.421   -8.525  1.00 5.45  ? 27 VAL A O    5  
ATOM   5017  C CB   . VAL A 1 27 ? 1.393   3.771   -6.299  1.00 5.66  ? 27 VAL A CB   5  
ATOM   5018  C CG1  . VAL A 1 27 ? 1.777   2.435   -5.660  1.00 6.10  ? 27 VAL A CG1  5  
ATOM   5019  C CG2  . VAL A 1 27 ? 2.415   4.123   -7.388  1.00 6.04  ? 27 VAL A CG2  5  
ATOM   5020  H H    . VAL A 1 27 ? 0.741   2.755   -8.689  1.00 4.82  ? 27 VAL A H    5  
ATOM   5021  H HA   . VAL A 1 27 ? -0.699  3.306   -6.146  1.00 4.74  ? 27 VAL A HA   5  
ATOM   5022  H HB   . VAL A 1 27 ? 1.395   4.538   -5.547  1.00 5.89  ? 27 VAL A HB   5  
ATOM   5023  H HG11 . VAL A 1 27 ? 0.942   2.054   -5.093  1.00 6.30  ? 27 VAL A HG11 5  
ATOM   5024  H HG12 . VAL A 1 27 ? 2.039   1.728   -6.434  1.00 6.06  ? 27 VAL A HG12 5  
ATOM   5025  H HG13 . VAL A 1 27 ? 2.622   2.579   -5.003  1.00 6.54  ? 27 VAL A HG13 5  
ATOM   5026  H HG21 . VAL A 1 27 ? 2.006   4.883   -8.036  1.00 6.18  ? 27 VAL A HG21 5  
ATOM   5027  H HG22 . VAL A 1 27 ? 3.319   4.492   -6.926  1.00 6.05  ? 27 VAL A HG22 5  
ATOM   5028  H HG23 . VAL A 1 27 ? 2.642   3.240   -7.967  1.00 6.44  ? 27 VAL A HG23 5  
ATOM   5029  N N    . ILE A 1 28 ? -1.117  5.816   -6.528  1.00 4.28  ? 28 ILE A N    5  
ATOM   5030  C CA   . ILE A 1 28 ? -1.593  7.175   -6.935  1.00 4.40  ? 28 ILE A CA   5  
ATOM   5031  C C    . ILE A 1 28 ? -0.649  8.237   -6.361  1.00 4.70  ? 28 ILE A C    5  
ATOM   5032  O O    . ILE A 1 28 ? -0.057  8.051   -5.314  1.00 5.01  ? 28 ILE A O    5  
ATOM   5033  C CB   . ILE A 1 28 ? -3.014  7.409   -6.402  1.00 4.45  ? 28 ILE A CB   5  
ATOM   5034  C CG1  . ILE A 1 28 ? -3.957  6.335   -6.958  1.00 4.94  ? 28 ILE A CG1  5  
ATOM   5035  C CG2  . ILE A 1 28 ? -3.511  8.793   -6.842  1.00 4.49  ? 28 ILE A CG2  5  
ATOM   5036  C CD1  . ILE A 1 28 ? -5.319  6.436   -6.267  1.00 5.05  ? 28 ILE A CD1  5  
ATOM   5037  H H    . ILE A 1 28 ? -1.280  5.496   -5.612  1.00 4.02  ? 28 ILE A H    5  
ATOM   5038  H HA   . ILE A 1 28 ? -1.597  7.246   -8.014  1.00 4.67  ? 28 ILE A HA   5  
ATOM   5039  H HB   . ILE A 1 28 ? -3.006  7.359   -5.322  1.00 4.56  ? 28 ILE A HB   5  
ATOM   5040  H HG12 . ILE A 1 28 ? -4.082  6.482   -8.022  1.00 5.21  ? 28 ILE A HG12 5  
ATOM   5041  H HG13 . ILE A 1 28 ? -3.536  5.357   -6.777  1.00 5.36  ? 28 ILE A HG13 5  
ATOM   5042  H HG21 . ILE A 1 28 ? -3.333  8.918   -7.901  1.00 4.77  ? 28 ILE A HG21 5  
ATOM   5043  H HG22 . ILE A 1 28 ? -4.568  8.877   -6.642  1.00 4.49  ? 28 ILE A HG22 5  
ATOM   5044  H HG23 . ILE A 1 28 ? -2.979  9.557   -6.296  1.00 4.51  ? 28 ILE A HG23 5  
ATOM   5045  H HD11 . ILE A 1 28 ? -5.670  7.457   -6.307  1.00 5.25  ? 28 ILE A HD11 5  
ATOM   5046  H HD12 . ILE A 1 28 ? -6.028  5.794   -6.770  1.00 5.49  ? 28 ILE A HD12 5  
ATOM   5047  H HD13 . ILE A 1 28 ? -5.224  6.129   -5.235  1.00 4.88  ? 28 ILE A HD13 5  
ATOM   5048  N N    . GLU A 1 29 ? -0.511  9.352   -7.039  1.00 5.08  ? 29 GLU A N    5  
ATOM   5049  C CA   . GLU A 1 29 ? 0.386   10.436  -6.545  1.00 5.75  ? 29 GLU A CA   5  
ATOM   5050  C C    . GLU A 1 29 ? -0.257  11.134  -5.336  1.00 5.30  ? 29 GLU A C    5  
ATOM   5051  O O    . GLU A 1 29 ? -1.398  10.879  -4.994  1.00 4.95  ? 29 GLU A O    5  
ATOM   5052  C CB   . GLU A 1 29 ? 0.604   11.456  -7.664  1.00 6.63  ? 29 GLU A CB   5  
ATOM   5053  C CG   . GLU A 1 29 ? 1.390   10.809  -8.810  1.00 7.40  ? 29 GLU A CG   5  
ATOM   5054  C CD   . GLU A 1 29 ? 2.317   11.847  -9.448  1.00 8.35  ? 29 GLU A CD   5  
ATOM   5055  O OE1  . GLU A 1 29 ? 3.375   12.092  -8.889  1.00 8.53  ? 29 GLU A OE1  5  
ATOM   5056  O OE2  . GLU A 1 29 ? 1.955   12.379  -10.485 1.00 9.09  ? 29 GLU A OE2  5  
ATOM   5057  H H    . GLU A 1 29 ? -1.001  9.478   -7.877  1.00 5.18  ? 29 GLU A H    5  
ATOM   5058  H HA   . GLU A 1 29 ? 1.336   10.014  -6.252  1.00 6.26  ? 29 GLU A HA   5  
ATOM   5059  H HB2  . GLU A 1 29 ? -0.353  11.797  -8.030  1.00 6.65  ? 29 GLU A HB2  5  
ATOM   5060  H HB3  . GLU A 1 29 ? 1.158   12.293  -7.279  1.00 7.00  ? 29 GLU A HB3  5  
ATOM   5061  H HG2  . GLU A 1 29 ? 1.978   9.988   -8.425  1.00 7.70  ? 29 GLU A HG2  5  
ATOM   5062  H HG3  . GLU A 1 29 ? 0.701   10.439  -9.555  1.00 7.27  ? 29 GLU A HG3  5  
ATOM   5063  N N    . SER A 1 30 ? 0.471   12.012  -4.691  1.00 5.67  ? 30 SER A N    5  
ATOM   5064  C CA   . SER A 1 30 ? -0.083  12.730  -3.504  1.00 5.68  ? 30 SER A CA   5  
ATOM   5065  C C    . SER A 1 30 ? -0.379  14.192  -3.869  1.00 6.20  ? 30 SER A C    5  
ATOM   5066  O O    . SER A 1 30 ? 0.114   14.711  -4.853  1.00 6.77  ? 30 SER A O    5  
ATOM   5067  C CB   . SER A 1 30 ? 0.928   12.684  -2.352  1.00 6.35  ? 30 SER A CB   5  
ATOM   5068  O OG   . SER A 1 30 ? 2.252   12.630  -2.873  1.00 7.18  ? 30 SER A OG   5  
ATOM   5069  H H    . SER A 1 30 ? 1.386   12.198  -4.986  1.00 6.18  ? 30 SER A H    5  
ATOM   5070  H HA   . SER A 1 30 ? -0.999  12.251  -3.191  1.00 5.24  ? 30 SER A HA   5  
ATOM   5071  H HB2  . SER A 1 30 ? 0.826   13.570  -1.751  1.00 6.58  ? 30 SER A HB2  5  
ATOM   5072  H HB3  . SER A 1 30 ? 0.734   11.814  -1.741  1.00 6.28  ? 30 SER A HB3  5  
ATOM   5073  H HG   . SER A 1 30 ? 2.551   11.718  -2.829  1.00 7.41  ? 30 SER A HG   5  
ATOM   5074  N N    . GLY A 1 31 ? -1.185  14.851  -3.076  1.00 6.36  ? 31 GLY A N    5  
ATOM   5075  C CA   . GLY A 1 31 ? -1.533  16.279  -3.353  1.00 7.19  ? 31 GLY A CA   5  
ATOM   5076  C C    . GLY A 1 31 ? -2.345  16.838  -2.176  1.00 7.66  ? 31 GLY A C    5  
ATOM   5077  O O    . GLY A 1 31 ? -2.273  16.318  -1.077  1.00 7.75  ? 31 GLY A O    5  
ATOM   5078  H H    . GLY A 1 31 ? -1.567  14.403  -2.289  1.00 6.14  ? 31 GLY A H    5  
ATOM   5079  H HA2  . GLY A 1 31 ? -0.630  16.851  -3.483  1.00 7.72  ? 31 GLY A HA2  5  
ATOM   5080  H HA3  . GLY A 1 31 ? -2.127  16.335  -4.251  1.00 7.17  ? 31 GLY A HA3  5  
ATOM   5081  N N    . PRO A 1 32 ? -3.122  17.864  -2.444  1.00 8.17  ? 32 PRO A N    5  
ATOM   5082  C CA   . PRO A 1 32 ? -3.993  18.484  -1.423  1.00 8.85  ? 32 PRO A CA   5  
ATOM   5083  C C    . PRO A 1 32 ? -5.186  17.555  -1.159  1.00 8.11  ? 32 PRO A C    5  
ATOM   5084  O O    . PRO A 1 32 ? -5.641  17.406  -0.041  1.00 8.52  ? 32 PRO A O    5  
ATOM   5085  C CB   . PRO A 1 32 ? -4.426  19.804  -2.068  1.00 9.69  ? 32 PRO A CB   5  
ATOM   5086  C CG   . PRO A 1 32 ? -4.248  19.621  -3.594  1.00 9.20  ? 32 PRO A CG   5  
ATOM   5087  C CD   . PRO A 1 32 ? -3.215  18.494  -3.781  1.00 8.39  ? 32 PRO A CD   5  
ATOM   5088  H HA   . PRO A 1 32 ? -3.444  18.672  -0.515  1.00 9.45  ? 32 PRO A HA   5  
ATOM   5089  H HB2  . PRO A 1 32 ? -5.462  20.009  -1.832  1.00 9.88  ? 32 PRO A HB2  5  
ATOM   5090  H HB3  . PRO A 1 32 ? -3.798  20.611  -1.723  1.00 10.56 ? 32 PRO A HB3  5  
ATOM   5091  H HG2  . PRO A 1 32 ? -5.192  19.343  -4.044  1.00 8.80  ? 32 PRO A HG2  5  
ATOM   5092  H HG3  . PRO A 1 32 ? -3.879  20.532  -4.037  1.00 10.01 ? 32 PRO A HG3  5  
ATOM   5093  H HD2  . PRO A 1 32 ? -3.562  17.782  -4.516  1.00 7.63  ? 32 PRO A HD2  5  
ATOM   5094  H HD3  . PRO A 1 32 ? -2.258  18.901  -4.067  1.00 8.96  ? 32 PRO A HD3  5  
ATOM   5095  N N    . HIS A 1 33 ? -5.662  16.911  -2.198  1.00 7.21  ? 33 HIS A N    5  
ATOM   5096  C CA   . HIS A 1 33 ? -6.799  15.945  -2.079  1.00 6.64  ? 33 HIS A CA   5  
ATOM   5097  C C    . HIS A 1 33 ? -6.419  14.816  -1.101  1.00 5.94  ? 33 HIS A C    5  
ATOM   5098  O O    . HIS A 1 33 ? -7.247  14.320  -0.360  1.00 6.05  ? 33 HIS A O    5  
ATOM   5099  C CB   . HIS A 1 33 ? -7.095  15.348  -3.468  1.00 6.27  ? 33 HIS A CB   5  
ATOM   5100  C CG   . HIS A 1 33 ? -5.846  14.696  -4.028  1.00 5.79  ? 33 HIS A CG   5  
ATOM   5101  N ND1  . HIS A 1 33 ? -4.855  15.424  -4.671  1.00 6.54  ? 33 HIS A ND1  5  
ATOM   5102  C CD2  . HIS A 1 33 ? -5.394  13.400  -3.999  1.00 4.91  ? 33 HIS A CD2  5  
ATOM   5103  C CE1  . HIS A 1 33 ? -3.864  14.574  -4.988  1.00 6.20  ? 33 HIS A CE1  5  
ATOM   5104  N NE2  . HIS A 1 33 ? -4.142  13.325  -4.604  1.00 5.23  ? 33 HIS A NE2  5  
ATOM   5105  H H    . HIS A 1 33 ? -5.250  17.051  -3.069  1.00 7.10  ? 33 HIS A H    5  
ATOM   5106  H HA   . HIS A 1 33 ? -7.673  16.460  -1.713  1.00 7.25  ? 33 HIS A HA   5  
ATOM   5107  H HB2  . HIS A 1 33 ? -7.876  14.610  -3.381  1.00 5.99  ? 33 HIS A HB2  5  
ATOM   5108  H HB3  . HIS A 1 33 ? -7.418  16.134  -4.136  1.00 6.92  ? 33 HIS A HB3  5  
ATOM   5109  H HD1  . HIS A 1 33 ? -4.881  16.381  -4.877  1.00 7.35  ? 33 HIS A HD1  5  
ATOM   5110  H HD2  . HIS A 1 33 ? -5.928  12.564  -3.571  1.00 4.33  ? 33 HIS A HD2  5  
ATOM   5111  H HE1  . HIS A 1 33 ? -2.937  14.873  -5.461  1.00 6.82  ? 33 HIS A HE1  5  
ATOM   5112  N N    . CYS A 1 34 ? -5.166  14.420  -1.098  1.00 5.51  ? 34 CYS A N    5  
ATOM   5113  C CA   . CYS A 1 34 ? -4.696  13.344  -0.187  1.00 5.12  ? 34 CYS A CA   5  
ATOM   5114  C C    . CYS A 1 34 ? -3.241  13.638  0.201   1.00 5.54  ? 34 CYS A C    5  
ATOM   5115  O O    . CYS A 1 34 ? -2.335  13.497  -0.600  1.00 5.84  ? 34 CYS A O    5  
ATOM   5116  C CB   . CYS A 1 34 ? -4.788  11.985  -0.895  1.00 4.12  ? 34 CYS A CB   5  
ATOM   5117  S SG   . CYS A 1 34 ? -4.807  10.655  0.335   1.00 4.37  ? 34 CYS A SG   5  
ATOM   5118  H H    . CYS A 1 34 ? -4.529  14.841  -1.696  1.00 5.68  ? 34 CYS A H    5  
ATOM   5119  H HA   . CYS A 1 34 ? -5.309  13.340  0.692   1.00 5.59  ? 34 CYS A HA   5  
ATOM   5120  H HB2  . CYS A 1 34 ? -5.695  11.945  -1.479  1.00 4.04  ? 34 CYS A HB2  5  
ATOM   5121  H HB3  . CYS A 1 34 ? -3.936  11.861  -1.546  1.00 3.82  ? 34 CYS A HB3  5  
ATOM   5122  N N    . ALA A 1 35 ? -3.020  14.068  1.423   1.00 5.90  ? 35 ALA A N    5  
ATOM   5123  C CA   . ALA A 1 35 ? -1.633  14.405  1.881   1.00 6.66  ? 35 ALA A CA   5  
ATOM   5124  C C    . ALA A 1 35 ? -0.688  13.214  1.685   1.00 6.33  ? 35 ALA A C    5  
ATOM   5125  O O    . ALA A 1 35 ? 0.338   13.330  1.040   1.00 6.77  ? 35 ALA A O    5  
ATOM   5126  C CB   . ALA A 1 35 ? -1.666  14.791  3.363   1.00 7.59  ? 35 ALA A CB   5  
ATOM   5127  H H    . ALA A 1 35 ? -3.775  14.187  2.037   1.00 5.87  ? 35 ALA A H    5  
ATOM   5128  H HA   . ALA A 1 35 ? -1.267  15.240  1.308   1.00 7.06  ? 35 ALA A HA   5  
ATOM   5129  H HB1  . ALA A 1 35 ? -2.145  14.007  3.929   1.00 7.72  ? 35 ALA A HB1  5  
ATOM   5130  H HB2  . ALA A 1 35 ? -0.656  14.929  3.722   1.00 8.05  ? 35 ALA A HB2  5  
ATOM   5131  H HB3  . ALA A 1 35 ? -2.219  15.711  3.483   1.00 7.89  ? 35 ALA A HB3  5  
ATOM   5132  N N    . ASN A 1 36 ? -1.020  12.078  2.243   1.00 5.85  ? 36 ASN A N    5  
ATOM   5133  C CA   . ASN A 1 36 ? -0.136  10.881  2.102   1.00 5.88  ? 36 ASN A CA   5  
ATOM   5134  C C    . ASN A 1 36 ? -0.383  10.194  0.754   1.00 5.34  ? 36 ASN A C    5  
ATOM   5135  O O    . ASN A 1 36 ? -1.446  10.308  0.170   1.00 5.26  ? 36 ASN A O    5  
ATOM   5136  C CB   . ASN A 1 36 ? -0.431  9.894   3.237   1.00 6.50  ? 36 ASN A CB   5  
ATOM   5137  C CG   . ASN A 1 36 ? 0.442   10.229  4.449   1.00 7.27  ? 36 ASN A CG   5  
ATOM   5138  O OD1  . ASN A 1 36 ? 1.430   9.567   4.702   1.00 7.78  ? 36 ASN A OD1  5  
ATOM   5139  N ND2  . ASN A 1 36 ? 0.119   11.237  5.215   1.00 7.61  ? 36 ASN A ND2  5  
ATOM   5140  H H    . ASN A 1 36 ? -1.847  12.016  2.762   1.00 5.70  ? 36 ASN A H    5  
ATOM   5141  H HA   . ASN A 1 36 ? 0.897   11.191  2.160   1.00 6.19  ? 36 ASN A HA   5  
ATOM   5142  H HB2  . ASN A 1 36 ? -1.473  9.961   3.513   1.00 6.55  ? 36 ASN A HB2  5  
ATOM   5143  H HB3  . ASN A 1 36 ? -0.211  8.891   2.906   1.00 6.63  ? 36 ASN A HB3  5  
ATOM   5144  H HD21 . ASN A 1 36 ? -0.676  11.773  5.013   1.00 7.41  ? 36 ASN A HD21 5  
ATOM   5145  H HD22 . ASN A 1 36 ? 0.674   11.459  5.992   1.00 8.19  ? 36 ASN A HD22 5  
ATOM   5146  N N    . THR A 1 37 ? 0.597   9.470   0.267   1.00 5.30  ? 37 THR A N    5  
ATOM   5147  C CA   . THR A 1 37 ? 0.443   8.753   -1.037  1.00 5.18  ? 37 THR A CA   5  
ATOM   5148  C C    . THR A 1 37 ? -0.510  7.564   -0.843  1.00 4.58  ? 37 THR A C    5  
ATOM   5149  O O    . THR A 1 37 ? -0.622  7.024   0.244   1.00 4.95  ? 37 THR A O    5  
ATOM   5150  C CB   . THR A 1 37 ? 1.814   8.246   -1.510  1.00 5.98  ? 37 THR A CB   5  
ATOM   5151  O OG1  . THR A 1 37 ? 2.809   9.220   -1.217  1.00 6.76  ? 37 THR A OG1  5  
ATOM   5152  C CG2  . THR A 1 37 ? 1.783   7.993   -3.017  1.00 6.31  ? 37 THR A CG2  5  
ATOM   5153  H H    . THR A 1 37 ? 1.437   9.393   0.766   1.00 5.59  ? 37 THR A H    5  
ATOM   5154  H HA   . THR A 1 37 ? 0.031   9.429   -1.774  1.00 5.45  ? 37 THR A HA   5  
ATOM   5155  H HB   . THR A 1 37 ? 2.053   7.326   -1.001  1.00 6.11  ? 37 THR A HB   5  
ATOM   5156  H HG1  . THR A 1 37 ? 3.448   8.822   -0.622  1.00 7.02  ? 37 THR A HG1  5  
ATOM   5157  H HG21 . THR A 1 37 ? 1.347   8.846   -3.517  1.00 6.33  ? 37 THR A HG21 5  
ATOM   5158  H HG22 . THR A 1 37 ? 2.791   7.842   -3.378  1.00 6.74  ? 37 THR A HG22 5  
ATOM   5159  H HG23 . THR A 1 37 ? 1.191   7.114   -3.224  1.00 6.44  ? 37 THR A HG23 5  
ATOM   5160  N N    . GLU A 1 38 ? -1.204  7.156   -1.878  1.00 3.94  ? 38 GLU A N    5  
ATOM   5161  C CA   . GLU A 1 38 ? -2.151  6.012   -1.740  1.00 3.67  ? 38 GLU A CA   5  
ATOM   5162  C C    . GLU A 1 38 ? -1.761  4.901   -2.715  1.00 2.99  ? 38 GLU A C    5  
ATOM   5163  O O    . GLU A 1 38 ? -1.863  5.061   -3.918  1.00 3.33  ? 38 GLU A O    5  
ATOM   5164  C CB   . GLU A 1 38 ? -3.570  6.494   -2.065  1.00 4.35  ? 38 GLU A CB   5  
ATOM   5165  C CG   . GLU A 1 38 ? -4.275  6.961   -0.785  1.00 4.96  ? 38 GLU A CG   5  
ATOM   5166  C CD   . GLU A 1 38 ? -4.351  5.808   0.225   1.00 5.76  ? 38 GLU A CD   5  
ATOM   5167  O OE1  . GLU A 1 38 ? -5.009  4.825   -0.074  1.00 6.10  ? 38 GLU A OE1  5  
ATOM   5168  O OE2  . GLU A 1 38 ? -3.750  5.930   1.279   1.00 6.28  ? 38 GLU A OE2  5  
ATOM   5169  H H    . GLU A 1 38 ? -1.109  7.603   -2.746  1.00 3.89  ? 38 GLU A H    5  
ATOM   5170  H HA   . GLU A 1 38 ? -2.120  5.634   -0.730  1.00 3.96  ? 38 GLU A HA   5  
ATOM   5171  H HB2  . GLU A 1 38 ? -3.516  7.316   -2.764  1.00 4.73  ? 38 GLU A HB2  5  
ATOM   5172  H HB3  . GLU A 1 38 ? -4.127  5.686   -2.507  1.00 4.35  ? 38 GLU A HB3  5  
ATOM   5173  H HG2  . GLU A 1 38 ? -3.722  7.783   -0.351  1.00 5.14  ? 38 GLU A HG2  5  
ATOM   5174  H HG3  . GLU A 1 38 ? -5.275  7.290   -1.027  1.00 4.98  ? 38 GLU A HG3  5  
ATOM   5175  N N    . ILE A 1 39 ? -1.325  3.769   -2.212  1.00 2.48  ? 39 ILE A N    5  
ATOM   5176  C CA   . ILE A 1 39 ? -0.946  2.651   -3.124  1.00 2.38  ? 39 ILE A CA   5  
ATOM   5177  C C    . ILE A 1 39 ? -2.206  1.829   -3.435  1.00 2.16  ? 39 ILE A C    5  
ATOM   5178  O O    . ILE A 1 39 ? -3.162  1.848   -2.685  1.00 2.22  ? 39 ILE A O    5  
ATOM   5179  C CB   . ILE A 1 39 ? 0.116   1.777   -2.433  1.00 2.57  ? 39 ILE A CB   5  
ATOM   5180  C CG1  . ILE A 1 39 ? 1.462   2.516   -2.436  1.00 2.79  ? 39 ILE A CG1  5  
ATOM   5181  C CG2  . ILE A 1 39 ? 0.275   0.442   -3.170  1.00 3.44  ? 39 ILE A CG2  5  
ATOM   5182  C CD1  . ILE A 1 39 ? 1.903   2.801   -0.998  1.00 2.94  ? 39 ILE A CD1  5  
ATOM   5183  H H    . ILE A 1 39 ? -1.257  3.648   -1.233  1.00 2.61  ? 39 ILE A H    5  
ATOM   5184  H HA   . ILE A 1 39 ? -0.543  3.055   -4.043  1.00 2.85  ? 39 ILE A HA   5  
ATOM   5185  H HB   . ILE A 1 39 ? -0.187  1.588   -1.414  1.00 2.54  ? 39 ILE A HB   5  
ATOM   5186  H HG12 . ILE A 1 39 ? 2.206   1.903   -2.925  1.00 3.36  ? 39 ILE A HG12 5  
ATOM   5187  H HG13 . ILE A 1 39 ? 1.359   3.449   -2.970  1.00 2.70  ? 39 ILE A HG13 5  
ATOM   5188  H HG21 . ILE A 1 39 ? 0.290   0.617   -4.235  1.00 4.05  ? 39 ILE A HG21 5  
ATOM   5189  H HG22 . ILE A 1 39 ? 1.200   -0.027  -2.869  1.00 3.75  ? 39 ILE A HG22 5  
ATOM   5190  H HG23 . ILE A 1 39 ? -0.553  -0.207  -2.923  1.00 3.64  ? 39 ILE A HG23 5  
ATOM   5191  H HD11 . ILE A 1 39 ? 1.400   2.125   -0.323  1.00 3.60  ? 39 ILE A HD11 5  
ATOM   5192  H HD12 . ILE A 1 39 ? 2.972   2.661   -0.916  1.00 2.88  ? 39 ILE A HD12 5  
ATOM   5193  H HD13 . ILE A 1 39 ? 1.653   3.819   -0.740  1.00 3.00  ? 39 ILE A HD13 5  
ATOM   5194  N N    . ILE A 1 40 ? -2.218  1.112   -4.532  1.00 2.34  ? 40 ILE A N    5  
ATOM   5195  C CA   . ILE A 1 40 ? -3.416  0.284   -4.876  1.00 2.36  ? 40 ILE A CA   5  
ATOM   5196  C C    . ILE A 1 40 ? -2.957  -0.969  -5.617  1.00 2.37  ? 40 ILE A C    5  
ATOM   5197  O O    . ILE A 1 40 ? -2.146  -0.905  -6.520  1.00 3.02  ? 40 ILE A O    5  
ATOM   5198  C CB   . ILE A 1 40 ? -4.395  1.062   -5.765  1.00 3.14  ? 40 ILE A CB   5  
ATOM   5199  C CG1  . ILE A 1 40 ? -4.730  2.411   -5.121  1.00 3.44  ? 40 ILE A CG1  5  
ATOM   5200  C CG2  . ILE A 1 40 ? -5.683  0.243   -5.930  1.00 3.70  ? 40 ILE A CG2  5  
ATOM   5201  C CD1  . ILE A 1 40 ? -5.511  3.278   -6.111  1.00 4.01  ? 40 ILE A CD1  5  
ATOM   5202  H H    . ILE A 1 40 ? -1.439  1.114   -5.129  1.00 2.72  ? 40 ILE A H    5  
ATOM   5203  H HA   . ILE A 1 40 ? -3.918  -0.009  -3.964  1.00 2.37  ? 40 ILE A HA   5  
ATOM   5204  H HB   . ILE A 1 40 ? -3.948  1.224   -6.735  1.00 3.47  ? 40 ILE A HB   5  
ATOM   5205  H HG12 . ILE A 1 40 ? -5.325  2.251   -4.233  1.00 3.44  ? 40 ILE A HG12 5  
ATOM   5206  H HG13 . ILE A 1 40 ? -3.814  2.915   -4.851  1.00 3.71  ? 40 ILE A HG13 5  
ATOM   5207  H HG21 . ILE A 1 40 ? -5.436  -0.748  -6.286  1.00 3.89  ? 40 ILE A HG21 5  
ATOM   5208  H HG22 . ILE A 1 40 ? -6.185  0.165   -4.977  1.00 3.94  ? 40 ILE A HG22 5  
ATOM   5209  H HG23 . ILE A 1 40 ? -6.332  0.729   -6.641  1.00 4.13  ? 40 ILE A HG23 5  
ATOM   5210  H HD11 . ILE A 1 40 ? -6.257  2.674   -6.607  1.00 4.43  ? 40 ILE A HD11 5  
ATOM   5211  H HD12 . ILE A 1 40 ? -5.996  4.083   -5.579  1.00 4.17  ? 40 ILE A HD12 5  
ATOM   5212  H HD13 . ILE A 1 40 ? -4.833  3.688   -6.843  1.00 4.33  ? 40 ILE A HD13 5  
ATOM   5213  N N    . VAL A 1 41 ? -3.470  -2.104  -5.237  1.00 2.04  ? 41 VAL A N    5  
ATOM   5214  C CA   . VAL A 1 41 ? -3.082  -3.371  -5.897  1.00 2.10  ? 41 VAL A CA   5  
ATOM   5215  C C    . VAL A 1 41 ? -4.337  -4.215  -6.153  1.00 2.33  ? 41 VAL A C    5  
ATOM   5216  O O    . VAL A 1 41 ? -5.384  -3.974  -5.583  1.00 2.79  ? 41 VAL A O    5  
ATOM   5217  C CB   . VAL A 1 41 ? -2.120  -4.135  -4.986  1.00 2.21  ? 41 VAL A CB   5  
ATOM   5218  C CG1  . VAL A 1 41 ? -0.819  -3.344  -4.827  1.00 2.87  ? 41 VAL A CG1  5  
ATOM   5219  C CG2  . VAL A 1 41 ? -2.750  -4.358  -3.605  1.00 3.20  ? 41 VAL A CG2  5  
ATOM   5220  H H    . VAL A 1 41 ? -4.111  -2.129  -4.511  1.00 2.11  ? 41 VAL A H    5  
ATOM   5221  H HA   . VAL A 1 41 ? -2.591  -3.155  -6.835  1.00 2.57  ? 41 VAL A HA   5  
ATOM   5222  H HB   . VAL A 1 41 ? -1.908  -5.079  -5.434  1.00 2.10  ? 41 VAL A HB   5  
ATOM   5223  H HG11 . VAL A 1 41 ? -0.427  -3.099  -5.803  1.00 3.29  ? 41 VAL A HG11 5  
ATOM   5224  H HG12 . VAL A 1 41 ? -1.016  -2.434  -4.281  1.00 3.43  ? 41 VAL A HG12 5  
ATOM   5225  H HG13 . VAL A 1 41 ? -0.099  -3.939  -4.288  1.00 3.03  ? 41 VAL A HG13 5  
ATOM   5226  H HG21 . VAL A 1 41 ? -3.827  -4.355  -3.694  1.00 3.56  ? 41 VAL A HG21 5  
ATOM   5227  H HG22 . VAL A 1 41 ? -2.425  -5.309  -3.211  1.00 3.58  ? 41 VAL A HG22 5  
ATOM   5228  H HG23 . VAL A 1 41 ? -2.443  -3.567  -2.936  1.00 3.72  ? 41 VAL A HG23 5  
ATOM   5229  N N    . LYS A 1 42 ? -4.234  -5.200  -7.002  1.00 2.44  ? 42 LYS A N    5  
ATOM   5230  C CA   . LYS A 1 42 ? -5.407  -6.071  -7.295  1.00 2.97  ? 42 LYS A CA   5  
ATOM   5231  C C    . LYS A 1 42 ? -4.978  -7.538  -7.191  1.00 2.77  ? 42 LYS A C    5  
ATOM   5232  O O    . LYS A 1 42 ? -4.420  -8.098  -8.118  1.00 2.98  ? 42 LYS A O    5  
ATOM   5233  C CB   . LYS A 1 42 ? -5.934  -5.778  -8.705  1.00 3.77  ? 42 LYS A CB   5  
ATOM   5234  C CG   . LYS A 1 42 ? -7.348  -5.197  -8.614  1.00 4.68  ? 42 LYS A CG   5  
ATOM   5235  C CD   . LYS A 1 42 ? -8.103  -5.473  -9.917  1.00 5.42  ? 42 LYS A CD   5  
ATOM   5236  C CE   . LYS A 1 42 ? -9.248  -4.466  -10.072 1.00 5.72  ? 42 LYS A CE   5  
ATOM   5237  N NZ   . LYS A 1 42 ? -8.739  -3.222  -10.718 1.00 6.76  ? 42 LYS A NZ   5  
ATOM   5238  H H    . LYS A 1 42 ? -3.381  -5.370  -7.443  1.00 2.45  ? 42 LYS A H    5  
ATOM   5239  H HA   . LYS A 1 42 ? -6.186  -5.874  -6.569  1.00 3.37  ? 42 LYS A HA   5  
ATOM   5240  H HB2  . LYS A 1 42 ? -5.283  -5.067  -9.193  1.00 3.94  ? 42 LYS A HB2  5  
ATOM   5241  H HB3  . LYS A 1 42 ? -5.960  -6.693  -9.278  1.00 3.87  ? 42 LYS A HB3  5  
ATOM   5242  H HG2  . LYS A 1 42 ? -7.873  -5.658  -7.789  1.00 4.83  ? 42 LYS A HG2  5  
ATOM   5243  H HG3  . LYS A 1 42 ? -7.289  -4.131  -8.452  1.00 4.94  ? 42 LYS A HG3  5  
ATOM   5244  H HD2  . LYS A 1 42 ? -7.424  -5.379  -10.752 1.00 5.79  ? 42 LYS A HD2  5  
ATOM   5245  H HD3  . LYS A 1 42 ? -8.508  -6.473  -9.893  1.00 5.70  ? 42 LYS A HD3  5  
ATOM   5246  H HE2  . LYS A 1 42 ? -10.025 -4.898  -10.685 1.00 5.66  ? 42 LYS A HE2  5  
ATOM   5247  H HE3  . LYS A 1 42 ? -9.650  -4.227  -9.098  1.00 5.59  ? 42 LYS A HE3  5  
ATOM   5248  H HZ1  . LYS A 1 42 ? -8.326  -3.456  -11.645 1.00 6.85  ? 42 LYS A HZ1  5  
ATOM   5249  H HZ2  . LYS A 1 42 ? -9.523  -2.552  -10.847 1.00 7.12  ? 42 LYS A HZ2  5  
ATOM   5250  H HZ3  . LYS A 1 42 ? -8.011  -2.788  -10.114 1.00 7.24  ? 42 LYS A HZ3  5  
ATOM   5251  N N    . LEU A 1 43 ? -5.225  -8.155  -6.059  1.00 3.01  ? 43 LEU A N    5  
ATOM   5252  C CA   . LEU A 1 43 ? -4.833  -9.581  -5.859  1.00 3.31  ? 43 LEU A CA   5  
ATOM   5253  C C    . LEU A 1 43 ? -5.425  -10.463 -6.961  1.00 3.92  ? 43 LEU A C    5  
ATOM   5254  O O    . LEU A 1 43 ? -6.527  -10.236 -7.433  1.00 4.54  ? 43 LEU A O    5  
ATOM   5255  C CB   . LEU A 1 43 ? -5.354  -10.062 -4.508  1.00 4.01  ? 43 LEU A CB   5  
ATOM   5256  C CG   . LEU A 1 43 ? -4.474  -9.499  -3.384  1.00 3.77  ? 43 LEU A CG   5  
ATOM   5257  C CD1  . LEU A 1 43 ? -5.145  -9.748  -2.031  1.00 4.46  ? 43 LEU A CD1  5  
ATOM   5258  C CD2  . LEU A 1 43 ? -3.103  -10.187 -3.410  1.00 3.91  ? 43 LEU A CD2  5  
ATOM   5259  H H    . LEU A 1 43 ? -5.663  -7.673  -5.329  1.00 3.37  ? 43 LEU A H    5  
ATOM   5260  H HA   . LEU A 1 43 ? -3.757  -9.663  -5.876  1.00 3.08  ? 43 LEU A HA   5  
ATOM   5261  H HB2  . LEU A 1 43 ? -6.368  -9.725  -4.380  1.00 4.55  ? 43 LEU A HB2  5  
ATOM   5262  H HB3  . LEU A 1 43 ? -5.334  -11.135 -4.478  1.00 4.52  ? 43 LEU A HB3  5  
ATOM   5263  H HG   . LEU A 1 43 ? -4.347  -8.435  -3.529  1.00 3.53  ? 43 LEU A HG   5  
ATOM   5264  H HD11 . LEU A 1 43 ? -5.474  -10.775 -1.975  1.00 5.14  ? 43 LEU A HD11 5  
ATOM   5265  H HD12 . LEU A 1 43 ? -4.437  -9.553  -1.238  1.00 4.57  ? 43 LEU A HD12 5  
ATOM   5266  H HD13 . LEU A 1 43 ? -5.994  -9.090  -1.923  1.00 4.51  ? 43 LEU A HD13 5  
ATOM   5267  H HD21 . LEU A 1 43 ? -3.043  -10.842 -4.267  1.00 3.95  ? 43 LEU A HD21 5  
ATOM   5268  H HD22 . LEU A 1 43 ? -2.327  -9.439  -3.475  1.00 3.96  ? 43 LEU A HD22 5  
ATOM   5269  H HD23 . LEU A 1 43 ? -2.972  -10.763 -2.507  1.00 4.44  ? 43 LEU A HD23 5  
ATOM   5270  N N    . SER A 1 44 ? -4.686  -11.472 -7.359  1.00 3.99  ? 44 SER A N    5  
ATOM   5271  C CA   . SER A 1 44 ? -5.149  -12.410 -8.428  1.00 4.72  ? 44 SER A CA   5  
ATOM   5272  C C    . SER A 1 44 ? -6.486  -13.061 -8.041  1.00 5.55  ? 44 SER A C    5  
ATOM   5273  O O    . SER A 1 44 ? -7.249  -13.470 -8.898  1.00 6.08  ? 44 SER A O    5  
ATOM   5274  C CB   . SER A 1 44 ? -4.094  -13.501 -8.637  1.00 4.98  ? 44 SER A CB   5  
ATOM   5275  O OG   . SER A 1 44 ? -3.862  -14.178 -7.407  1.00 5.08  ? 44 SER A OG   5  
ATOM   5276  H H    . SER A 1 44 ? -3.814  -11.613 -6.947  1.00 3.70  ? 44 SER A H    5  
ATOM   5277  H HA   . SER A 1 44 ? -5.272  -11.859 -9.343  1.00 4.83  ? 44 SER A HA   5  
ATOM   5278  H HB2  . SER A 1 44 ? -4.447  -14.209 -9.369  1.00 5.14  ? 44 SER A HB2  5  
ATOM   5279  H HB3  . SER A 1 44 ? -3.177  -13.050 -8.990  1.00 5.37  ? 44 SER A HB3  5  
ATOM   5280  H HG   . SER A 1 44 ? -2.959  -14.505 -7.414  1.00 5.39  ? 44 SER A HG   5  
ATOM   5281  N N    . ASP A 1 45 ? -6.781  -13.155 -6.763  1.00 5.91  ? 45 ASP A N    5  
ATOM   5282  C CA   . ASP A 1 45 ? -8.065  -13.770 -6.324  1.00 7.02  ? 45 ASP A CA   5  
ATOM   5283  C C    . ASP A 1 45 ? -9.250  -12.836 -6.644  1.00 7.25  ? 45 ASP A C    5  
ATOM   5284  O O    . ASP A 1 45 ? -10.392 -13.175 -6.394  1.00 8.19  ? 45 ASP A O    5  
ATOM   5285  C CB   . ASP A 1 45 ? -8.018  -14.024 -4.810  1.00 7.64  ? 45 ASP A CB   5  
ATOM   5286  C CG   . ASP A 1 45 ? -6.868  -14.981 -4.481  1.00 8.01  ? 45 ASP A CG   5  
ATOM   5287  O OD1  . ASP A 1 45 ? -7.102  -16.179 -4.478  1.00 7.89  ? 45 ASP A OD1  5  
ATOM   5288  O OD2  . ASP A 1 45 ? -5.772  -14.500 -4.237  1.00 8.63  ? 45 ASP A OD2  5  
ATOM   5289  H H    . ASP A 1 45 ? -6.159  -12.820 -6.093  1.00 5.60  ? 45 ASP A H    5  
ATOM   5290  H HA   . ASP A 1 45 ? -8.196  -14.705 -6.834  1.00 7.48  ? 45 ASP A HA   5  
ATOM   5291  H HB2  . ASP A 1 45 ? -7.863  -13.087 -4.295  1.00 7.55  ? 45 ASP A HB2  5  
ATOM   5292  H HB3  . ASP A 1 45 ? -8.950  -14.461 -4.490  1.00 8.18  ? 45 ASP A HB3  5  
ATOM   5293  N N    . GLY A 1 46 ? -8.990  -11.662 -7.180  1.00 6.57  ? 46 GLY A N    5  
ATOM   5294  C CA   . GLY A 1 46 ? -10.094 -10.710 -7.498  1.00 7.07  ? 46 GLY A CA   5  
ATOM   5295  C C    . GLY A 1 46 ? -10.307 -9.779  -6.304  1.00 6.74  ? 46 GLY A C    5  
ATOM   5296  O O    . GLY A 1 46 ? -11.420 -9.388  -6.007  1.00 7.17  ? 46 GLY A O    5  
ATOM   5297  H H    . GLY A 1 46 ? -8.067  -11.399 -7.365  1.00 5.88  ? 46 GLY A H    5  
ATOM   5298  H HA2  . GLY A 1 46 ? -9.829  -10.129 -8.371  1.00 7.41  ? 46 GLY A HA2  5  
ATOM   5299  H HA3  . GLY A 1 46 ? -11.001 -11.258 -7.689  1.00 7.56  ? 46 GLY A HA3  5  
ATOM   5300  N N    . ARG A 1 47 ? -9.248  -9.433  -5.608  1.00 6.21  ? 47 ARG A N    5  
ATOM   5301  C CA   . ARG A 1 47 ? -9.384  -8.541  -4.421  1.00 6.07  ? 47 ARG A CA   5  
ATOM   5302  C C    . ARG A 1 47 ? -8.755  -7.174  -4.719  1.00 5.32  ? 47 ARG A C    5  
ATOM   5303  O O    . ARG A 1 47 ? -7.922  -7.042  -5.595  1.00 5.06  ? 47 ARG A O    5  
ATOM   5304  C CB   . ARG A 1 47 ? -8.660  -9.193  -3.239  1.00 6.43  ? 47 ARG A CB   5  
ATOM   5305  C CG   . ARG A 1 47 ? -9.194  -8.637  -1.915  1.00 7.27  ? 47 ARG A CG   5  
ATOM   5306  C CD   . ARG A 1 47 ? -10.390 -9.471  -1.451  1.00 7.96  ? 47 ARG A CD   5  
ATOM   5307  N NE   . ARG A 1 47 ? -10.898 -8.937  -0.154  1.00 8.82  ? 47 ARG A NE   5  
ATOM   5308  C CZ   . ARG A 1 47 ? -10.540 -9.498  0.971   1.00 9.62  ? 47 ARG A CZ   5  
ATOM   5309  N NH1  . ARG A 1 47 ? -11.193 -10.540 1.419   1.00 10.10 ? 47 ARG A NH1  5  
ATOM   5310  N NH2  . ARG A 1 47 ? -9.529  -9.016  1.648   1.00 10.15 ? 47 ARG A NH2  5  
ATOM   5311  H H    . ARG A 1 47 ? -8.356  -9.772  -5.863  1.00 6.06  ? 47 ARG A H    5  
ATOM   5312  H HA   . ARG A 1 47 ? -10.429 -8.414  -4.178  1.00 6.58  ? 47 ARG A HA   5  
ATOM   5313  H HB2  . ARG A 1 47 ? -8.818  -10.261 -3.268  1.00 6.43  ? 47 ARG A HB2  5  
ATOM   5314  H HB3  . ARG A 1 47 ? -7.604  -8.987  -3.314  1.00 6.47  ? 47 ARG A HB3  5  
ATOM   5315  H HG2  . ARG A 1 47 ? -8.414  -8.679  -1.168  1.00 7.60  ? 47 ARG A HG2  5  
ATOM   5316  H HG3  . ARG A 1 47 ? -9.504  -7.613  -2.049  1.00 7.34  ? 47 ARG A HG3  5  
ATOM   5317  H HD2  . ARG A 1 47 ? -11.173 -9.421  -2.193  1.00 7.82  ? 47 ARG A HD2  5  
ATOM   5318  H HD3  . ARG A 1 47 ? -10.082 -10.499 -1.321  1.00 8.20  ? 47 ARG A HD3  5  
ATOM   5319  H HE   . ARG A 1 47 ? -11.501 -8.164  -0.146  1.00 8.93  ? 47 ARG A HE   5  
ATOM   5320  H HH11 . ARG A 1 47 ? -11.964 -10.908 0.899   1.00 9.88  ? 47 ARG A HH11 5  
ATOM   5321  H HH12 . ARG A 1 47 ? -10.920 -10.971 2.279   1.00 10.80 ? 47 ARG A HH12 5  
ATOM   5322  H HH21 . ARG A 1 47 ? -9.031  -8.220  1.306   1.00 9.97  ? 47 ARG A HH21 5  
ATOM   5323  H HH22 . ARG A 1 47 ? -9.254  -9.444  2.511   1.00 10.86 ? 47 ARG A HH22 5  
ATOM   5324  N N    . GLU A 1 48 ? -9.143  -6.163  -3.984  1.00 5.24  ? 48 GLU A N    5  
ATOM   5325  C CA   . GLU A 1 48 ? -8.566  -4.804  -4.191  1.00 4.73  ? 48 GLU A CA   5  
ATOM   5326  C C    . GLU A 1 48 ? -8.104  -4.278  -2.831  1.00 4.69  ? 48 GLU A C    5  
ATOM   5327  O O    . GLU A 1 48 ? -8.905  -4.056  -1.940  1.00 5.44  ? 48 GLU A O    5  
ATOM   5328  C CB   . GLU A 1 48 ? -9.629  -3.873  -4.781  1.00 5.60  ? 48 GLU A CB   5  
ATOM   5329  C CG   . GLU A 1 48 ? -9.356  -3.668  -6.274  1.00 5.76  ? 48 GLU A CG   5  
ATOM   5330  C CD   . GLU A 1 48 ? -10.327 -2.627  -6.838  1.00 6.79  ? 48 GLU A CD   5  
ATOM   5331  O OE1  . GLU A 1 48 ? -10.136 -1.453  -6.563  1.00 7.44  ? 48 GLU A OE1  5  
ATOM   5332  O OE2  . GLU A 1 48 ? -11.246 -3.021  -7.539  1.00 7.12  ? 48 GLU A OE2  5  
ATOM   5333  H H    . GLU A 1 48 ? -9.811  -6.300  -3.282  1.00 5.71  ? 48 GLU A H    5  
ATOM   5334  H HA   . GLU A 1 48 ? -7.720  -4.866  -4.861  1.00 4.10  ? 48 GLU A HA   5  
ATOM   5335  H HB2  . GLU A 1 48 ? -10.607 -4.314  -4.650  1.00 5.76  ? 48 GLU A HB2  5  
ATOM   5336  H HB3  . GLU A 1 48 ? -9.594  -2.921  -4.275  1.00 6.30  ? 48 GLU A HB3  5  
ATOM   5337  H HG2  . GLU A 1 48 ? -8.340  -3.323  -6.409  1.00 5.48  ? 48 GLU A HG2  5  
ATOM   5338  H HG3  . GLU A 1 48 ? -9.491  -4.602  -6.797  1.00 5.78  ? 48 GLU A HG3  5  
ATOM   5339  N N    . LEU A 1 49 ? -6.818  -4.104  -2.654  1.00 4.08  ? 49 LEU A N    5  
ATOM   5340  C CA   . LEU A 1 49 ? -6.304  -3.619  -1.337  1.00 4.35  ? 49 LEU A CA   5  
ATOM   5341  C C    . LEU A 1 49 ? -5.367  -2.431  -1.537  1.00 3.99  ? 49 LEU A C    5  
ATOM   5342  O O    . LEU A 1 49 ? -4.361  -2.535  -2.207  1.00 3.87  ? 49 LEU A O    5  
ATOM   5343  C CB   . LEU A 1 49 ? -5.513  -4.738  -0.653  1.00 4.67  ? 49 LEU A CB   5  
ATOM   5344  C CG   . LEU A 1 49 ? -6.262  -5.248  0.581   1.00 4.92  ? 49 LEU A CG   5  
ATOM   5345  C CD1  . LEU A 1 49 ? -7.302  -6.288  0.162   1.00 5.51  ? 49 LEU A CD1  5  
ATOM   5346  C CD2  . LEU A 1 49 ? -5.261  -5.894  1.541   1.00 4.69  ? 49 LEU A CD2  5  
ATOM   5347  H H    . LEU A 1 49 ? -6.190  -4.306  -3.383  1.00 3.67  ? 49 LEU A H    5  
ATOM   5348  H HA   . LEU A 1 49 ? -7.130  -3.326  -0.707  1.00 4.89  ? 49 LEU A HA   5  
ATOM   5349  H HB2  . LEU A 1 49 ? -5.366  -5.553  -1.348  1.00 4.69  ? 49 LEU A HB2  5  
ATOM   5350  H HB3  . LEU A 1 49 ? -4.554  -4.349  -0.348  1.00 5.10  ? 49 LEU A HB3  5  
ATOM   5351  H HG   . LEU A 1 49 ? -6.754  -4.421  1.072   1.00 5.20  ? 49 LEU A HG   5  
ATOM   5352  H HD11 . LEU A 1 49 ? -7.702  -6.028  -0.806  1.00 5.74  ? 49 LEU A HD11 5  
ATOM   5353  H HD12 . LEU A 1 49 ? -6.837  -7.261  0.111   1.00 5.91  ? 49 LEU A HD12 5  
ATOM   5354  H HD13 . LEU A 1 49 ? -8.100  -6.308  0.889   1.00 5.66  ? 49 LEU A HD13 5  
ATOM   5355  H HD21 . LEU A 1 49 ? -4.391  -5.261  1.633   1.00 5.11  ? 49 LEU A HD21 5  
ATOM   5356  H HD22 . LEU A 1 49 ? -5.719  -6.019  2.511   1.00 4.52  ? 49 LEU A HD22 5  
ATOM   5357  H HD23 . LEU A 1 49 ? -4.963  -6.859  1.157   1.00 4.66  ? 49 LEU A HD23 5  
ATOM   5358  N N    . CYS A 1 50 ? -5.659  -1.318  -0.923  1.00 3.99  ? 50 CYS A N    5  
ATOM   5359  C CA   . CYS A 1 50 ? -4.754  -0.150  -1.045  1.00 3.63  ? 50 CYS A CA   5  
ATOM   5360  C C    . CYS A 1 50 ? -3.677  -0.298  0.022   1.00 3.49  ? 50 CYS A C    5  
ATOM   5361  O O    . CYS A 1 50 ? -3.952  -0.714  1.131   1.00 4.14  ? 50 CYS A O    5  
ATOM   5362  C CB   . CYS A 1 50 ? -5.510  1.144   -0.826  1.00 3.72  ? 50 CYS A CB   5  
ATOM   5363  S SG   . CYS A 1 50 ? -7.107  1.088   -1.686  1.00 4.64  ? 50 CYS A SG   5  
ATOM   5364  H H    . CYS A 1 50 ? -6.448  -1.265  -0.353  1.00 4.28  ? 50 CYS A H    5  
ATOM   5365  H HA   . CYS A 1 50 ? -4.300  -0.138  -2.015  1.00 3.59  ? 50 CYS A HA   5  
ATOM   5366  H HB2  . CYS A 1 50 ? -5.651  1.273   0.218   1.00 3.90  ? 50 CYS A HB2  5  
ATOM   5367  H HB3  . CYS A 1 50 ? -4.928  1.959   -1.207  1.00 3.38  ? 50 CYS A HB3  5  
ATOM   5368  N N    . LEU A 1 51 ? -2.460  0.001   -0.309  1.00 2.91  ? 51 LEU A N    5  
ATOM   5369  C CA   . LEU A 1 51 ? -1.360  -0.164  0.669   1.00 2.96  ? 51 LEU A CA   5  
ATOM   5370  C C    . LEU A 1 51 ? -1.004  1.161   1.330   1.00 3.35  ? 51 LEU A C    5  
ATOM   5371  O O    . LEU A 1 51 ? -1.225  2.238   0.792   1.00 3.56  ? 51 LEU A O    5  
ATOM   5372  C CB   . LEU A 1 51 ? -0.126  -0.715  -0.034  1.00 2.71  ? 51 LEU A CB   5  
ATOM   5373  C CG   . LEU A 1 51 ? -0.441  -2.044  -0.748  1.00 2.56  ? 51 LEU A CG   5  
ATOM   5374  C CD1  . LEU A 1 51 ? 0.829   -2.889  -0.816  1.00 2.98  ? 51 LEU A CD1  5  
ATOM   5375  C CD2  . LEU A 1 51 ? -1.511  -2.835  0.018   1.00 2.61  ? 51 LEU A CD2  5  
ATOM   5376  H H    . LEU A 1 51 ? -2.265  0.306   -1.203  1.00 2.70  ? 51 LEU A H    5  
ATOM   5377  H HA   . LEU A 1 51 ? -1.667  -0.861  1.429   1.00 3.34  ? 51 LEU A HA   5  
ATOM   5378  H HB2  . LEU A 1 51 ? 0.217   0.009   -0.751  1.00 2.95  ? 51 LEU A HB2  5  
ATOM   5379  H HB3  . LEU A 1 51 ? 0.643   -0.876  0.692   1.00 2.93  ? 51 LEU A HB3  5  
ATOM   5380  H HG   . LEU A 1 51 ? -0.789  -1.839  -1.750  1.00 2.88  ? 51 LEU A HG   5  
ATOM   5381  H HD11 . LEU A 1 51 ? 1.651   -2.277  -1.156  1.00 3.38  ? 51 LEU A HD11 5  
ATOM   5382  H HD12 . LEU A 1 51 ? 1.052   -3.277  0.167   1.00 3.34  ? 51 LEU A HD12 5  
ATOM   5383  H HD13 . LEU A 1 51 ? 0.679   -3.708  -1.502  1.00 3.13  ? 51 LEU A HD13 5  
ATOM   5384  H HD21 . LEU A 1 51 ? -1.315  -2.771  1.077   1.00 2.85  ? 51 LEU A HD21 5  
ATOM   5385  H HD22 . LEU A 1 51 ? -2.485  -2.423  -0.194  1.00 2.77  ? 51 LEU A HD22 5  
ATOM   5386  H HD23 . LEU A 1 51 ? -1.483  -3.869  -0.291  1.00 3.04  ? 51 LEU A HD23 5  
ATOM   5387  N N    . ASP A 1 52 ? -0.433  1.057   2.498   1.00 3.84  ? 52 ASP A N    5  
ATOM   5388  C CA   . ASP A 1 52 ? -0.015  2.254   3.272   1.00 4.35  ? 52 ASP A CA   5  
ATOM   5389  C C    . ASP A 1 52 ? 1.507   2.415   3.146   1.00 4.47  ? 52 ASP A C    5  
ATOM   5390  O O    . ASP A 1 52 ? 2.257   1.569   3.604   1.00 4.73  ? 52 ASP A O    5  
ATOM   5391  C CB   . ASP A 1 52 ? -0.406  2.046   4.743   1.00 4.93  ? 52 ASP A CB   5  
ATOM   5392  C CG   . ASP A 1 52 ? -0.253  3.354   5.529   1.00 5.39  ? 52 ASP A CG   5  
ATOM   5393  O OD1  . ASP A 1 52 ? -0.593  4.398   4.994   1.00 5.96  ? 52 ASP A OD1  5  
ATOM   5394  O OD2  . ASP A 1 52 ? 0.191   3.285   6.660   1.00 5.40  ? 52 ASP A OD2  5  
ATOM   5395  H H    . ASP A 1 52 ? -0.267  0.166   2.866   1.00 4.08  ? 52 ASP A H    5  
ATOM   5396  H HA   . ASP A 1 52 ? -0.514  3.129   2.883   1.00 4.52  ? 52 ASP A HA   5  
ATOM   5397  H HB2  . ASP A 1 52 ? -1.434  1.714   4.795   1.00 5.32  ? 52 ASP A HB2  5  
ATOM   5398  H HB3  . ASP A 1 52 ? 0.231   1.290   5.177   1.00 4.91  ? 52 ASP A HB3  5  
ATOM   5399  N N    . PRO A 1 53 ? 1.922   3.498   2.525   1.00 4.54  ? 53 PRO A N    5  
ATOM   5400  C CA   . PRO A 1 53 ? 3.356   3.786   2.308   1.00 4.96  ? 53 PRO A CA   5  
ATOM   5401  C C    . PRO A 1 53 ? 4.070   4.133   3.626   1.00 5.21  ? 53 PRO A C    5  
ATOM   5402  O O    . PRO A 1 53 ? 5.276   4.300   3.650   1.00 5.67  ? 53 PRO A O    5  
ATOM   5403  C CB   . PRO A 1 53 ? 3.344   4.968   1.332   1.00 5.26  ? 53 PRO A CB   5  
ATOM   5404  C CG   . PRO A 1 53 ? 1.955   5.630   1.463   1.00 5.04  ? 53 PRO A CG   5  
ATOM   5405  C CD   . PRO A 1 53 ? 1.010   4.544   2.010   1.00 4.55  ? 53 PRO A CD   5  
ATOM   5406  H HA   . PRO A 1 53 ? 3.835   2.942   1.840   1.00 5.07  ? 53 PRO A HA   5  
ATOM   5407  H HB2  . PRO A 1 53 ? 4.122   5.673   1.593   1.00 5.72  ? 53 PRO A HB2  5  
ATOM   5408  H HB3  . PRO A 1 53 ? 3.486   4.617   0.322   1.00 5.40  ? 53 PRO A HB3  5  
ATOM   5409  H HG2  . PRO A 1 53 ? 2.005   6.463   2.151   1.00 5.39  ? 53 PRO A HG2  5  
ATOM   5410  H HG3  . PRO A 1 53 ? 1.608   5.962   0.498   1.00 5.11  ? 53 PRO A HG3  5  
ATOM   5411  H HD2  . PRO A 1 53 ? 0.400   4.944   2.807   1.00 4.78  ? 53 PRO A HD2  5  
ATOM   5412  H HD3  . PRO A 1 53 ? 0.393   4.146   1.219   1.00 4.27  ? 53 PRO A HD3  5  
ATOM   5413  N N    . LYS A 1 54 ? 3.345   4.222   4.721   1.00 5.18  ? 54 LYS A N    5  
ATOM   5414  C CA   . LYS A 1 54 ? 3.986   4.532   6.024   1.00 5.61  ? 54 LYS A CA   5  
ATOM   5415  C C    . LYS A 1 54 ? 4.901   3.374   6.442   1.00 5.02  ? 54 LYS A C    5  
ATOM   5416  O O    . LYS A 1 54 ? 5.878   3.578   7.139   1.00 5.42  ? 54 LYS A O    5  
ATOM   5417  C CB   . LYS A 1 54 ? 2.910   4.748   7.092   1.00 6.23  ? 54 LYS A CB   5  
ATOM   5418  C CG   . LYS A 1 54 ? 3.127   6.101   7.773   1.00 7.12  ? 54 LYS A CG   5  
ATOM   5419  C CD   . LYS A 1 54 ? 1.971   6.381   8.737   1.00 7.85  ? 54 LYS A CD   5  
ATOM   5420  C CE   . LYS A 1 54 ? 2.487   7.173   9.942   1.00 8.63  ? 54 LYS A CE   5  
ATOM   5421  N NZ   . LYS A 1 54 ? 2.396   6.331   11.170  1.00 9.56  ? 54 LYS A NZ   5  
ATOM   5422  H H    . LYS A 1 54 ? 2.385   4.076   4.686   1.00 5.07  ? 54 LYS A H    5  
ATOM   5423  H HA   . LYS A 1 54 ? 4.568   5.427   5.918   1.00 6.14  ? 54 LYS A HA   5  
ATOM   5424  H HB2  . LYS A 1 54 ? 1.936   4.733   6.626   1.00 6.01  ? 54 LYS A HB2  5  
ATOM   5425  H HB3  . LYS A 1 54 ? 2.968   3.962   7.829   1.00 6.42  ? 54 LYS A HB3  5  
ATOM   5426  H HG2  . LYS A 1 54 ? 4.057   6.081   8.322   1.00 7.47  ? 54 LYS A HG2  5  
ATOM   5427  H HG3  . LYS A 1 54 ? 3.165   6.879   7.025   1.00 7.15  ? 54 LYS A HG3  5  
ATOM   5428  H HD2  . LYS A 1 54 ? 1.209   6.954   8.228   1.00 8.02  ? 54 LYS A HD2  5  
ATOM   5429  H HD3  . LYS A 1 54 ? 1.550   5.446   9.077   1.00 7.93  ? 54 LYS A HD3  5  
ATOM   5430  H HE2  . LYS A 1 54 ? 3.517   7.452   9.775   1.00 8.78  ? 54 LYS A HE2  5  
ATOM   5431  H HE3  . LYS A 1 54 ? 1.890   8.063   10.070  1.00 8.58  ? 54 LYS A HE3  5  
ATOM   5432  H HZ1  . LYS A 1 54 ? 2.867   5.419   11.004  1.00 9.78  ? 54 LYS A HZ1  5  
ATOM   5433  H HZ2  . LYS A 1 54 ? 2.862   6.819   11.960  1.00 9.84  ? 54 LYS A HZ2  5  
ATOM   5434  H HZ3  . LYS A 1 54 ? 1.395   6.169   11.405  1.00 9.93  ? 54 LYS A HZ3  5  
ATOM   5435  N N    . GLU A 1 55 ? 4.607   2.160   6.017   1.00 4.37  ? 55 GLU A N    5  
ATOM   5436  C CA   . GLU A 1 55 ? 5.475   1.013   6.388   1.00 4.14  ? 55 GLU A CA   5  
ATOM   5437  C C    . GLU A 1 55 ? 6.667   0.959   5.440   1.00 3.84  ? 55 GLU A C    5  
ATOM   5438  O O    . GLU A 1 55 ? 6.700   1.625   4.420   1.00 3.83  ? 55 GLU A O    5  
ATOM   5439  C CB   . GLU A 1 55 ? 4.693   -0.294  6.260   1.00 4.19  ? 55 GLU A CB   5  
ATOM   5440  C CG   . GLU A 1 55 ? 3.700   -0.428  7.415   1.00 4.76  ? 55 GLU A CG   5  
ATOM   5441  C CD   . GLU A 1 55 ? 2.415   0.338   7.091   1.00 5.39  ? 55 GLU A CD   5  
ATOM   5442  O OE1  . GLU A 1 55 ? 1.644   -0.154  6.284   1.00 6.13  ? 55 GLU A OE1  5  
ATOM   5443  O OE2  . GLU A 1 55 ? 2.223   1.400   7.658   1.00 5.43  ? 55 GLU A OE2  5  
ATOM   5444  H H    . GLU A 1 55 ? 3.824   2.002   5.449   1.00 4.29  ? 55 GLU A H    5  
ATOM   5445  H HA   . GLU A 1 55 ? 5.821   1.130   7.404   1.00 4.53  ? 55 GLU A HA   5  
ATOM   5446  H HB2  . GLU A 1 55 ? 4.164   -0.303  5.323   1.00 4.04  ? 55 GLU A HB2  5  
ATOM   5447  H HB3  . GLU A 1 55 ? 5.380   -1.120  6.285   1.00 4.32  ? 55 GLU A HB3  5  
ATOM   5448  H HG2  . GLU A 1 55 ? 3.468   -1.467  7.561   1.00 4.81  ? 55 GLU A HG2  5  
ATOM   5449  H HG3  . GLU A 1 55 ? 4.141   -0.030  8.313   1.00 4.98  ? 55 GLU A HG3  5  
ATOM   5450  N N    . ASN A 1 56 ? 7.630   0.147   5.761   1.00 3.90  ? 56 ASN A N    5  
ATOM   5451  C CA   . ASN A 1 56 ? 8.824   0.005   4.883   1.00 3.93  ? 56 ASN A CA   5  
ATOM   5452  C C    . ASN A 1 56 ? 8.615   -1.171  3.926   1.00 3.74  ? 56 ASN A C    5  
ATOM   5453  O O    . ASN A 1 56 ? 9.296   -1.286  2.926   1.00 3.89  ? 56 ASN A O    5  
ATOM   5454  C CB   . ASN A 1 56 ? 10.060  -0.246  5.732   1.00 4.29  ? 56 ASN A CB   5  
ATOM   5455  C CG   . ASN A 1 56 ? 11.056  0.900   5.547   1.00 4.70  ? 56 ASN A CG   5  
ATOM   5456  O OD1  . ASN A 1 56 ? 11.767  0.949   4.564   1.00 4.90  ? 56 ASN A OD1  5  
ATOM   5457  N ND2  . ASN A 1 56 ? 11.141  1.833   6.458   1.00 5.15  ? 56 ASN A ND2  5  
ATOM   5458  H H    . ASN A 1 56 ? 7.557   -0.391  6.576   1.00 4.12  ? 56 ASN A H    5  
ATOM   5459  H HA   . ASN A 1 56 ? 8.962   0.903   4.317   1.00 4.07  ? 56 ASN A HA   5  
ATOM   5460  H HB2  . ASN A 1 56 ? 9.768   -0.310  6.764   1.00 4.38  ? 56 ASN A HB2  5  
ATOM   5461  H HB3  . ASN A 1 56 ? 10.518  -1.170  5.429   1.00 4.36  ? 56 ASN A HB3  5  
ATOM   5462  H HD21 . ASN A 1 56 ? 10.569  1.796   7.254   1.00 5.31  ? 56 ASN A HD21 5  
ATOM   5463  H HD22 . ASN A 1 56 ? 11.777  2.570   6.346   1.00 5.51  ? 56 ASN A HD22 5  
ATOM   5464  N N    . TRP A 1 57 ? 7.674   -2.042  4.221   1.00 3.55  ? 57 TRP A N    5  
ATOM   5465  C CA   . TRP A 1 57 ? 7.421   -3.195  3.330   1.00 3.47  ? 57 TRP A CA   5  
ATOM   5466  C C    . TRP A 1 57 ? 6.539   -2.754  2.167   1.00 3.28  ? 57 TRP A C    5  
ATOM   5467  O O    . TRP A 1 57 ? 6.711   -3.202  1.059   1.00 3.48  ? 57 TRP A O    5  
ATOM   5468  C CB   . TRP A 1 57 ? 6.763   -4.331  4.122   1.00 3.64  ? 57 TRP A CB   5  
ATOM   5469  C CG   . TRP A 1 57 ? 5.327   -4.051  4.415   1.00 3.70  ? 57 TRP A CG   5  
ATOM   5470  C CD1  . TRP A 1 57 ? 4.871   -3.606  5.591   1.00 4.08  ? 57 TRP A CD1  5  
ATOM   5471  C CD2  . TRP A 1 57 ? 4.160   -4.205  3.554   1.00 3.51  ? 57 TRP A CD2  5  
ATOM   5472  N NE1  . TRP A 1 57 ? 3.499   -3.500  5.528   1.00 4.20  ? 57 TRP A NE1  5  
ATOM   5473  C CE2  . TRP A 1 57 ? 3.012   -3.842  4.292   1.00 3.80  ? 57 TRP A CE2  5  
ATOM   5474  C CE3  . TRP A 1 57 ? 3.984   -4.619  2.223   1.00 3.27  ? 57 TRP A CE3  5  
ATOM   5475  C CZ2  . TRP A 1 57 ? 1.736   -3.887  3.736   1.00 3.76  ? 57 TRP A CZ2  5  
ATOM   5476  C CZ3  . TRP A 1 57 ? 2.701   -4.662  1.657   1.00 3.17  ? 57 TRP A CZ3  5  
ATOM   5477  C CH2  . TRP A 1 57 ? 1.577   -4.298  2.412   1.00 3.38  ? 57 TRP A CH2  5  
ATOM   5478  H H    . TRP A 1 57 ? 7.136   -1.930  5.022   1.00 3.59  ? 57 TRP A H    5  
ATOM   5479  H HA   . TRP A 1 57 ? 8.362   -3.537  2.947   1.00 3.59  ? 57 TRP A HA   5  
ATOM   5480  H HB2  . TRP A 1 57 ? 6.822   -5.232  3.564   1.00 3.77  ? 57 TRP A HB2  5  
ATOM   5481  H HB3  . TRP A 1 57 ? 7.293   -4.458  5.048   1.00 3.78  ? 57 TRP A HB3  5  
ATOM   5482  H HD1  . TRP A 1 57 ? 5.480   -3.385  6.443   1.00 4.35  ? 57 TRP A HD1  5  
ATOM   5483  H HE1  . TRP A 1 57 ? 2.928   -3.217  6.256   1.00 4.57  ? 57 TRP A HE1  5  
ATOM   5484  H HE3  . TRP A 1 57 ? 4.840   -4.904  1.632   1.00 3.29  ? 57 TRP A HE3  5  
ATOM   5485  H HZ2  . TRP A 1 57 ? 0.876   -3.603  4.325   1.00 4.10  ? 57 TRP A HZ2  5  
ATOM   5486  H HZ3  . TRP A 1 57 ? 2.579   -4.973  0.635   1.00 3.03  ? 57 TRP A HZ3  5  
ATOM   5487  H HH2  . TRP A 1 57 ? 0.593   -4.334  1.971   1.00 3.37  ? 57 TRP A HH2  5  
ATOM   5488  N N    . VAL A 1 58 ? 5.605   -1.870  2.411   1.00 3.02  ? 58 VAL A N    5  
ATOM   5489  C CA   . VAL A 1 58 ? 4.723   -1.385  1.305   1.00 2.84  ? 58 VAL A CA   5  
ATOM   5490  C C    . VAL A 1 58 ? 5.582   -0.620  0.290   1.00 2.99  ? 58 VAL A C    5  
ATOM   5491  O O    . VAL A 1 58 ? 5.433   -0.782  -0.906  1.00 3.21  ? 58 VAL A O    5  
ATOM   5492  C CB   . VAL A 1 58 ? 3.646   -0.458  1.887   1.00 2.78  ? 58 VAL A CB   5  
ATOM   5493  C CG1  . VAL A 1 58 ? 3.189   0.566   0.841   1.00 2.80  ? 58 VAL A CG1  5  
ATOM   5494  C CG2  . VAL A 1 58 ? 2.443   -1.280  2.338   1.00 2.85  ? 58 VAL A CG2  5  
ATOM   5495  H H    . VAL A 1 58 ? 5.490   -1.520  3.324   1.00 3.04  ? 58 VAL A H    5  
ATOM   5496  H HA   . VAL A 1 58 ? 4.258   -2.229  0.817   1.00 2.96  ? 58 VAL A HA   5  
ATOM   5497  H HB   . VAL A 1 58 ? 4.056   0.060   2.734   1.00 3.12  ? 58 VAL A HB   5  
ATOM   5498  H HG11 . VAL A 1 58 ? 3.100   0.083   -0.121  1.00 3.08  ? 58 VAL A HG11 5  
ATOM   5499  H HG12 . VAL A 1 58 ? 2.232   0.973   1.130   1.00 3.10  ? 58 VAL A HG12 5  
ATOM   5500  H HG13 . VAL A 1 58 ? 3.916   1.363   0.779   1.00 2.86  ? 58 VAL A HG13 5  
ATOM   5501  H HG21 . VAL A 1 58 ? 2.309   -2.117  1.671   1.00 3.15  ? 58 VAL A HG21 5  
ATOM   5502  H HG22 . VAL A 1 58 ? 2.612   -1.640  3.340   1.00 3.17  ? 58 VAL A HG22 5  
ATOM   5503  H HG23 . VAL A 1 58 ? 1.558   -0.662  2.324   1.00 2.93  ? 58 VAL A HG23 5  
ATOM   5504  N N    . GLN A 1 59 ? 6.482   0.208   0.765   1.00 3.12  ? 59 GLN A N    5  
ATOM   5505  C CA   . GLN A 1 59 ? 7.357   0.985   -0.159  1.00 3.61  ? 59 GLN A CA   5  
ATOM   5506  C C    . GLN A 1 59 ? 8.404   0.056   -0.795  1.00 3.90  ? 59 GLN A C    5  
ATOM   5507  O O    . GLN A 1 59 ? 8.822   0.270   -1.918  1.00 4.47  ? 59 GLN A O    5  
ATOM   5508  C CB   . GLN A 1 59 ? 8.033   2.116   0.615   1.00 3.82  ? 59 GLN A CB   5  
ATOM   5509  C CG   . GLN A 1 59 ? 8.984   1.523   1.641   1.00 4.33  ? 59 GLN A CG   5  
ATOM   5510  C CD   . GLN A 1 59 ? 9.578   2.634   2.514   1.00 4.72  ? 59 GLN A CD   5  
ATOM   5511  O OE1  . GLN A 1 59 ? 8.935   3.117   3.424   1.00 4.84  ? 59 GLN A OE1  5  
ATOM   5512  N NE2  . GLN A 1 59 ? 10.791  3.059   2.277   1.00 5.29  ? 59 GLN A NE2  5  
ATOM   5513  H H    . GLN A 1 59 ? 6.585   0.316   1.733   1.00 3.04  ? 59 GLN A H    5  
ATOM   5514  H HA   . GLN A 1 59 ? 6.757   1.406   -0.931  1.00 3.80  ? 59 GLN A HA   5  
ATOM   5515  H HB2  . GLN A 1 59 ? 8.580   2.739   -0.070  1.00 3.96  ? 59 GLN A HB2  5  
ATOM   5516  H HB3  . GLN A 1 59 ? 7.282   2.707   1.119   1.00 3.78  ? 59 GLN A HB3  5  
ATOM   5517  H HG2  . GLN A 1 59 ? 8.440   0.827   2.257   1.00 4.58  ? 59 GLN A HG2  5  
ATOM   5518  H HG3  . GLN A 1 59 ? 9.773   1.005   1.126   1.00 4.52  ? 59 GLN A HG3  5  
ATOM   5519  H HE21 . GLN A 1 59 ? 11.314  2.670   1.545   1.00 5.47  ? 59 GLN A HE21 5  
ATOM   5520  H HE22 . GLN A 1 59 ? 11.178  3.767   2.833   1.00 5.70  ? 59 GLN A HE22 5  
ATOM   5521  N N    . ARG A 1 60 ? 8.805   -0.986  -0.102  1.00 3.65  ? 60 ARG A N    5  
ATOM   5522  C CA   . ARG A 1 60 ? 9.798   -1.941  -0.680  1.00 3.97  ? 60 ARG A CA   5  
ATOM   5523  C C    . ARG A 1 60 ? 9.059   -2.874  -1.640  1.00 3.96  ? 60 ARG A C    5  
ATOM   5524  O O    . ARG A 1 60 ? 9.535   -3.175  -2.717  1.00 4.42  ? 60 ARG A O    5  
ATOM   5525  C CB   . ARG A 1 60 ? 10.449  -2.761  0.440   1.00 4.07  ? 60 ARG A CB   5  
ATOM   5526  C CG   . ARG A 1 60 ? 11.890  -3.105  0.056   1.00 4.60  ? 60 ARG A CG   5  
ATOM   5527  C CD   . ARG A 1 60 ? 12.808  -1.933  0.413   1.00 4.81  ? 60 ARG A CD   5  
ATOM   5528  N NE   . ARG A 1 60 ? 14.189  -2.438  0.662   1.00 5.26  ? 60 ARG A NE   5  
ATOM   5529  C CZ   . ARG A 1 60 ? 14.720  -2.335  1.853   1.00 5.84  ? 60 ARG A CZ   5  
ATOM   5530  N NH1  . ARG A 1 60 ? 14.553  -3.293  2.729   1.00 6.35  ? 60 ARG A NH1  5  
ATOM   5531  N NH2  . ARG A 1 60 ? 15.417  -1.273  2.168   1.00 6.25  ? 60 ARG A NH2  5  
ATOM   5532  H H    . ARG A 1 60 ? 8.433   -1.153  0.790   1.00 3.35  ? 60 ARG A H    5  
ATOM   5533  H HA   . ARG A 1 60 ? 10.557  -1.392  -1.220  1.00 4.24  ? 60 ARG A HA   5  
ATOM   5534  H HB2  . ARG A 1 60 ? 10.449  -2.184  1.352   1.00 3.95  ? 60 ARG A HB2  5  
ATOM   5535  H HB3  . ARG A 1 60 ? 9.891   -3.673  0.590   1.00 4.07  ? 60 ARG A HB3  5  
ATOM   5536  H HG2  . ARG A 1 60 ? 12.204  -3.988  0.594   1.00 4.80  ? 60 ARG A HG2  5  
ATOM   5537  H HG3  . ARG A 1 60 ? 11.946  -3.292  -1.006  1.00 4.99  ? 60 ARG A HG3  5  
ATOM   5538  H HD2  . ARG A 1 60 ? 12.825  -1.227  -0.404  1.00 4.73  ? 60 ARG A HD2  5  
ATOM   5539  H HD3  . ARG A 1 60 ? 12.438  -1.444  1.303   1.00 5.10  ? 60 ARG A HD3  5  
ATOM   5540  H HE   . ARG A 1 60 ? 14.699  -2.848  -0.067  1.00 5.37  ? 60 ARG A HE   5  
ATOM   5541  H HH11 . ARG A 1 60 ? 14.020  -4.105  2.486   1.00 6.32  ? 60 ARG A HH11 5  
ATOM   5542  H HH12 . ARG A 1 60 ? 14.960  -3.216  3.639   1.00 6.96  ? 60 ARG A HH12 5  
ATOM   5543  H HH21 . ARG A 1 60 ? 15.544  -0.541  1.498   1.00 6.14  ? 60 ARG A HH21 5  
ATOM   5544  H HH22 . ARG A 1 60 ? 15.825  -1.193  3.078   1.00 6.86  ? 60 ARG A HH22 5  
ATOM   5545  N N    . VAL A 1 61 ? 7.884   -3.313  -1.252  1.00 3.58  ? 61 VAL A N    5  
ATOM   5546  C CA   . VAL A 1 61 ? 7.071   -4.210  -2.124  1.00 3.55  ? 61 VAL A CA   5  
ATOM   5547  C C    . VAL A 1 61 ? 6.720   -3.463  -3.418  1.00 3.25  ? 61 VAL A C    5  
ATOM   5548  O O    . VAL A 1 61 ? 6.755   -4.027  -4.496  1.00 3.52  ? 61 VAL A O    5  
ATOM   5549  C CB   . VAL A 1 61 ? 5.789   -4.600  -1.370  1.00 3.59  ? 61 VAL A CB   5  
ATOM   5550  C CG1  . VAL A 1 61 ? 4.720   -5.086  -2.348  1.00 3.56  ? 61 VAL A CG1  5  
ATOM   5551  C CG2  . VAL A 1 61 ? 6.109   -5.716  -0.374  1.00 4.31  ? 61 VAL A CG2  5  
ATOM   5552  H H    . VAL A 1 61 ? 7.526   -3.038  -0.376  1.00 3.39  ? 61 VAL A H    5  
ATOM   5553  H HA   . VAL A 1 61 ? 7.639   -5.093  -2.363  1.00 3.93  ? 61 VAL A HA   5  
ATOM   5554  H HB   . VAL A 1 61 ? 5.415   -3.740  -0.835  1.00 3.40  ? 61 VAL A HB   5  
ATOM   5555  H HG11 . VAL A 1 61 ? 5.195   -5.580  -3.181  1.00 3.52  ? 61 VAL A HG11 5  
ATOM   5556  H HG12 . VAL A 1 61 ? 4.059   -5.776  -1.846  1.00 3.73  ? 61 VAL A HG12 5  
ATOM   5557  H HG13 . VAL A 1 61 ? 4.152   -4.239  -2.707  1.00 3.88  ? 61 VAL A HG13 5  
ATOM   5558  H HG21 . VAL A 1 61 ? 6.523   -6.561  -0.901  1.00 4.75  ? 61 VAL A HG21 5  
ATOM   5559  H HG22 . VAL A 1 61 ? 6.826   -5.357  0.350   1.00 4.45  ? 61 VAL A HG22 5  
ATOM   5560  H HG23 . VAL A 1 61 ? 5.205   -6.016  0.134   1.00 4.58  ? 61 VAL A HG23 5  
ATOM   5561  N N    . VAL A 1 62 ? 6.397   -2.197  -3.314  1.00 2.99  ? 62 VAL A N    5  
ATOM   5562  C CA   . VAL A 1 62 ? 6.056   -1.399  -4.530  1.00 3.22  ? 62 VAL A CA   5  
ATOM   5563  C C    . VAL A 1 62 ? 7.323   -1.220  -5.385  1.00 3.80  ? 62 VAL A C    5  
ATOM   5564  O O    . VAL A 1 62 ? 7.260   -1.242  -6.596  1.00 4.15  ? 62 VAL A O    5  
ATOM   5565  C CB   . VAL A 1 62 ? 5.497   -0.030  -4.106  1.00 3.53  ? 62 VAL A CB   5  
ATOM   5566  C CG1  . VAL A 1 62 ? 5.462   0.923   -5.305  1.00 4.40  ? 62 VAL A CG1  5  
ATOM   5567  C CG2  . VAL A 1 62 ? 4.073   -0.207  -3.563  1.00 3.34  ? 62 VAL A CG2  5  
ATOM   5568  H H    . VAL A 1 62 ? 6.388   -1.768  -2.432  1.00 2.92  ? 62 VAL A H    5  
ATOM   5569  H HA   . VAL A 1 62 ? 5.313   -1.930  -5.107  1.00 3.17  ? 62 VAL A HA   5  
ATOM   5570  H HB   . VAL A 1 62 ? 6.125   0.389   -3.334  1.00 3.69  ? 62 VAL A HB   5  
ATOM   5571  H HG11 . VAL A 1 62 ? 5.034   0.415   -6.157  1.00 4.91  ? 62 VAL A HG11 5  
ATOM   5572  H HG12 . VAL A 1 62 ? 4.861   1.787   -5.061  1.00 4.71  ? 62 VAL A HG12 5  
ATOM   5573  H HG13 . VAL A 1 62 ? 6.467   1.240   -5.542  1.00 4.59  ? 62 VAL A HG13 5  
ATOM   5574  H HG21 . VAL A 1 62 ? 4.000   -1.150  -3.041  1.00 3.53  ? 62 VAL A HG21 5  
ATOM   5575  H HG22 . VAL A 1 62 ? 3.845   0.600   -2.882  1.00 3.11  ? 62 VAL A HG22 5  
ATOM   5576  H HG23 . VAL A 1 62 ? 3.371   -0.194  -4.384  1.00 3.80  ? 62 VAL A HG23 5  
ATOM   5577  N N    . GLU A 1 63 ? 8.469   -1.051  -4.761  1.00 4.04  ? 63 GLU A N    5  
ATOM   5578  C CA   . GLU A 1 63 ? 9.732   -0.883  -5.532  1.00 4.68  ? 63 GLU A CA   5  
ATOM   5579  C C    . GLU A 1 63 ? 10.121  -2.214  -6.179  1.00 4.70  ? 63 GLU A C    5  
ATOM   5580  O O    . GLU A 1 63 ? 10.483  -2.253  -7.333  1.00 5.23  ? 63 GLU A O    5  
ATOM   5581  C CB   . GLU A 1 63 ? 10.856  -0.417  -4.597  1.00 5.11  ? 63 GLU A CB   5  
ATOM   5582  C CG   . GLU A 1 63 ? 10.973  1.109   -4.651  1.00 5.73  ? 63 GLU A CG   5  
ATOM   5583  C CD   . GLU A 1 63 ? 11.794  1.608   -3.456  1.00 6.00  ? 63 GLU A CD   5  
ATOM   5584  O OE1  . GLU A 1 63 ? 11.307  1.509   -2.340  1.00 6.46  ? 63 GLU A OE1  5  
ATOM   5585  O OE2  . GLU A 1 63 ? 12.895  2.085   -3.676  1.00 6.04  ? 63 GLU A OE2  5  
ATOM   5586  H H    . GLU A 1 63 ? 8.497   -1.038  -3.789  1.00 3.89  ? 63 GLU A H    5  
ATOM   5587  H HA   . GLU A 1 63 ? 9.578   -0.151  -6.303  1.00 5.00  ? 63 GLU A HA   5  
ATOM   5588  H HB2  . GLU A 1 63 ? 10.633  -0.725  -3.586  1.00 4.92  ? 63 GLU A HB2  5  
ATOM   5589  H HB3  . GLU A 1 63 ? 11.791  -0.858  -4.910  1.00 5.36  ? 63 GLU A HB3  5  
ATOM   5590  H HG2  . GLU A 1 63 ? 11.464  1.399   -5.570  1.00 5.98  ? 63 GLU A HG2  5  
ATOM   5591  H HG3  . GLU A 1 63 ? 9.988   1.549   -4.616  1.00 6.04  ? 63 GLU A HG3  5  
ATOM   5592  N N    . LYS A 1 64 ? 10.045  -3.303  -5.449  1.00 4.35  ? 64 LYS A N    5  
ATOM   5593  C CA   . LYS A 1 64 ? 10.404  -4.627  -6.031  1.00 4.71  ? 64 LYS A CA   5  
ATOM   5594  C C    . LYS A 1 64 ? 9.432   -4.980  -7.171  1.00 4.54  ? 64 LYS A C    5  
ATOM   5595  O O    . LYS A 1 64 ? 9.779   -5.702  -8.087  1.00 5.00  ? 64 LYS A O    5  
ATOM   5596  C CB   . LYS A 1 64 ? 10.327  -5.702  -4.940  1.00 4.74  ? 64 LYS A CB   5  
ATOM   5597  C CG   . LYS A 1 64 ? 11.250  -6.870  -5.300  1.00 5.62  ? 64 LYS A CG   5  
ATOM   5598  C CD   . LYS A 1 64 ? 11.520  -7.711  -4.049  1.00 6.24  ? 64 LYS A CD   5  
ATOM   5599  C CE   . LYS A 1 64 ? 12.734  -8.612  -4.287  1.00 7.07  ? 64 LYS A CE   5  
ATOM   5600  N NZ   . LYS A 1 64 ? 13.267  -9.089  -2.978  1.00 7.79  ? 64 LYS A NZ   5  
ATOM   5601  H H    . LYS A 1 64 ? 9.749   -3.248  -4.521  1.00 4.03  ? 64 LYS A H    5  
ATOM   5602  H HA   . LYS A 1 64 ? 11.407  -4.580  -6.414  1.00 5.26  ? 64 LYS A HA   5  
ATOM   5603  H HB2  . LYS A 1 64 ? 10.637  -5.277  -3.996  1.00 4.73  ? 64 LYS A HB2  5  
ATOM   5604  H HB3  . LYS A 1 64 ? 9.312   -6.060  -4.859  1.00 4.49  ? 64 LYS A HB3  5  
ATOM   5605  H HG2  . LYS A 1 64 ? 10.775  -7.483  -6.052  1.00 6.07  ? 64 LYS A HG2  5  
ATOM   5606  H HG3  . LYS A 1 64 ? 12.183  -6.487  -5.682  1.00 5.69  ? 64 LYS A HG3  5  
ATOM   5607  H HD2  . LYS A 1 64 ? 11.716  -7.056  -3.212  1.00 6.22  ? 64 LYS A HD2  5  
ATOM   5608  H HD3  . LYS A 1 64 ? 10.657  -8.323  -3.834  1.00 6.45  ? 64 LYS A HD3  5  
ATOM   5609  H HE2  . LYS A 1 64 ? 12.439  -9.462  -4.886  1.00 7.40  ? 64 LYS A HE2  5  
ATOM   5610  H HE3  . LYS A 1 64 ? 13.500  -8.055  -4.806  1.00 7.09  ? 64 LYS A HE3  5  
ATOM   5611  H HZ1  . LYS A 1 64 ? 12.527  -9.618  -2.473  1.00 8.09  ? 64 LYS A HZ1  5  
ATOM   5612  H HZ2  . LYS A 1 64 ? 14.086  -9.709  -3.143  1.00 8.07  ? 64 LYS A HZ2  5  
ATOM   5613  H HZ3  . LYS A 1 64 ? 13.558  -8.273  -2.404  1.00 7.96  ? 64 LYS A HZ3  5  
ATOM   5614  N N    . PHE A 1 65 ? 8.218   -4.479  -7.114  1.00 4.02  ? 65 PHE A N    5  
ATOM   5615  C CA   . PHE A 1 65 ? 7.215   -4.778  -8.177  1.00 3.99  ? 65 PHE A CA   5  
ATOM   5616  C C    . PHE A 1 65 ? 7.319   -3.745  -9.311  1.00 4.72  ? 65 PHE A C    5  
ATOM   5617  O O    . PHE A 1 65 ? 7.339   -4.094  -10.476 1.00 5.31  ? 65 PHE A O    5  
ATOM   5618  C CB   . PHE A 1 65 ? 5.819   -4.715  -7.551  1.00 3.16  ? 65 PHE A CB   5  
ATOM   5619  C CG   . PHE A 1 65 ? 4.856   -5.559  -8.350  1.00 3.02  ? 65 PHE A CG   5  
ATOM   5620  C CD1  . PHE A 1 65 ? 4.882   -6.954  -8.234  1.00 3.45  ? 65 PHE A CD1  5  
ATOM   5621  C CD2  . PHE A 1 65 ? 3.932   -4.945  -9.202  1.00 2.97  ? 65 PHE A CD2  5  
ATOM   5622  C CE1  . PHE A 1 65 ? 3.984   -7.733  -8.970  1.00 3.48  ? 65 PHE A CE1  5  
ATOM   5623  C CE2  . PHE A 1 65 ? 3.033   -5.723  -9.938  1.00 3.10  ? 65 PHE A CE2  5  
ATOM   5624  C CZ   . PHE A 1 65 ? 3.060   -7.118  -9.824  1.00 3.19  ? 65 PHE A CZ   5  
ATOM   5625  H H    . PHE A 1 65 ? 7.961   -3.902  -6.362  1.00 3.77  ? 65 PHE A H    5  
ATOM   5626  H HA   . PHE A 1 65 ? 7.390   -5.768  -8.571  1.00 4.30  ? 65 PHE A HA   5  
ATOM   5627  H HB2  . PHE A 1 65 ? 5.866   -5.084  -6.539  1.00 2.82  ? 65 PHE A HB2  5  
ATOM   5628  H HB3  . PHE A 1 65 ? 5.480   -3.690  -7.541  1.00 3.27  ? 65 PHE A HB3  5  
ATOM   5629  H HD1  . PHE A 1 65 ? 5.596   -7.428  -7.576  1.00 4.00  ? 65 PHE A HD1  5  
ATOM   5630  H HD2  . PHE A 1 65 ? 3.914   -3.868  -9.290  1.00 3.21  ? 65 PHE A HD2  5  
ATOM   5631  H HE1  . PHE A 1 65 ? 4.005   -8.809  -8.881  1.00 4.01  ? 65 PHE A HE1  5  
ATOM   5632  H HE2  . PHE A 1 65 ? 2.321   -5.248  -10.595 1.00 3.46  ? 65 PHE A HE2  5  
ATOM   5633  H HZ   . PHE A 1 65 ? 2.366   -7.720  -10.393 1.00 3.41  ? 65 PHE A HZ   5  
ATOM   5634  N N    . LEU A 1 66 ? 7.373   -2.477  -8.972  1.00 4.92  ? 66 LEU A N    5  
ATOM   5635  C CA   . LEU A 1 66 ? 7.462   -1.404  -10.017 1.00 5.86  ? 66 LEU A CA   5  
ATOM   5636  C C    . LEU A 1 66 ? 8.914   -1.216  -10.506 1.00 6.61  ? 66 LEU A C    5  
ATOM   5637  O O    . LEU A 1 66 ? 9.156   -0.470  -11.434 1.00 7.33  ? 66 LEU A O    5  
ATOM   5638  C CB   . LEU A 1 66 ? 6.946   -0.085  -9.424  1.00 6.18  ? 66 LEU A CB   5  
ATOM   5639  C CG   . LEU A 1 66 ? 6.311   0.770   -10.526 1.00 7.14  ? 66 LEU A CG   5  
ATOM   5640  C CD1  . LEU A 1 66 ? 4.952   0.183   -10.920 1.00 7.61  ? 66 LEU A CD1  5  
ATOM   5641  C CD2  . LEU A 1 66 ? 6.116   2.198   -10.008 1.00 7.67  ? 66 LEU A CD2  5  
ATOM   5642  H H    . LEU A 1 66 ? 7.346   -2.229  -8.023  1.00 4.58  ? 66 LEU A H    5  
ATOM   5643  H HA   . LEU A 1 66 ? 6.841   -1.678  -10.856 1.00 6.03  ? 66 LEU A HA   5  
ATOM   5644  H HB2  . LEU A 1 66 ? 6.207   -0.300  -8.665  1.00 5.67  ? 66 LEU A HB2  5  
ATOM   5645  H HB3  . LEU A 1 66 ? 7.768   0.455   -8.980  1.00 6.42  ? 66 LEU A HB3  5  
ATOM   5646  H HG   . LEU A 1 66 ? 6.960   0.785   -11.390 1.00 7.39  ? 66 LEU A HG   5  
ATOM   5647  H HD11 . LEU A 1 66 ? 4.418   -0.121  -10.032 1.00 7.94  ? 66 LEU A HD11 5  
ATOM   5648  H HD12 . LEU A 1 66 ? 4.376   0.930   -11.447 1.00 7.49  ? 66 LEU A HD12 5  
ATOM   5649  H HD13 . LEU A 1 66 ? 5.101   -0.673  -11.561 1.00 8.02  ? 66 LEU A HD13 5  
ATOM   5650  H HD21 . LEU A 1 66 ? 5.579   2.172   -9.072  1.00 7.84  ? 66 LEU A HD21 5  
ATOM   5651  H HD22 . LEU A 1 66 ? 7.081   2.660   -9.857  1.00 7.67  ? 66 LEU A HD22 5  
ATOM   5652  H HD23 . LEU A 1 66 ? 5.553   2.771   -10.730 1.00 8.14  ? 66 LEU A HD23 5  
ATOM   5653  N N    . LYS A 1 67 ? 9.876   -1.874  -9.885  1.00 6.57  ? 67 LYS A N    5  
ATOM   5654  C CA   . LYS A 1 67 ? 11.318  -1.738  -10.301 1.00 7.47  ? 67 LYS A CA   5  
ATOM   5655  C C    . LYS A 1 67 ? 11.470  -1.784  -11.835 1.00 7.85  ? 67 LYS A C    5  
ATOM   5656  O O    . LYS A 1 67 ? 12.256  -1.047  -12.400 1.00 8.14  ? 67 LYS A O    5  
ATOM   5657  C CB   . LYS A 1 67 ? 12.133  -2.889  -9.696  1.00 7.84  ? 67 LYS A CB   5  
ATOM   5658  C CG   . LYS A 1 67 ? 13.517  -2.381  -9.275  1.00 8.78  ? 67 LYS A CG   5  
ATOM   5659  C CD   . LYS A 1 67 ? 13.559  -2.199  -7.755  1.00 9.42  ? 67 LYS A CD   5  
ATOM   5660  C CE   . LYS A 1 67 ? 15.006  -1.978  -7.305  1.00 10.12 ? 67 LYS A CE   5  
ATOM   5661  N NZ   . LYS A 1 67 ? 15.019  -1.377  -5.940  1.00 10.40 ? 67 LYS A NZ   5  
ATOM   5662  H H    . LYS A 1 67 ? 9.652   -2.454  -9.126  1.00 6.04  ? 67 LYS A H    5  
ATOM   5663  H HA   . LYS A 1 67 ? 11.706  -0.799  -9.935  1.00 7.85  ? 67 LYS A HA   5  
ATOM   5664  H HB2  . LYS A 1 67 ? 11.616  -3.285  -8.836  1.00 7.78  ? 67 LYS A HB2  5  
ATOM   5665  H HB3  . LYS A 1 67 ? 12.251  -3.670  -10.432 1.00 7.75  ? 67 LYS A HB3  5  
ATOM   5666  H HG2  . LYS A 1 67 ? 14.267  -3.100  -9.573  1.00 9.30  ? 67 LYS A HG2  5  
ATOM   5667  H HG3  . LYS A 1 67 ? 13.715  -1.434  -9.756  1.00 8.71  ? 67 LYS A HG3  5  
ATOM   5668  H HD2  . LYS A 1 67 ? 12.960  -1.342  -7.480  1.00 9.58  ? 67 LYS A HD2  5  
ATOM   5669  H HD3  . LYS A 1 67 ? 13.166  -3.082  -7.276  1.00 9.47  ? 67 LYS A HD3  5  
ATOM   5670  H HE2  . LYS A 1 67 ? 15.525  -2.926  -7.286  1.00 10.35 ? 67 LYS A HE2  5  
ATOM   5671  H HE3  . LYS A 1 67 ? 15.502  -1.312  -7.996  1.00 10.41 ? 67 LYS A HE3  5  
ATOM   5672  H HZ1  . LYS A 1 67 ? 14.440  -1.955  -5.299  1.00 10.51 ? 67 LYS A HZ1  5  
ATOM   5673  H HZ2  . LYS A 1 67 ? 15.998  -1.342  -5.587  1.00 10.49 ? 67 LYS A HZ2  5  
ATOM   5674  H HZ3  . LYS A 1 67 ? 14.630  -0.414  -5.982  1.00 10.60 ? 67 LYS A HZ3  5  
ATOM   5675  N N    . ARG A 1 68 ? 10.739  -2.649  -12.506 1.00 8.12  ? 68 ARG A N    5  
ATOM   5676  C CA   . ARG A 1 68 ? 10.856  -2.749  -14.000 1.00 8.78  ? 68 ARG A CA   5  
ATOM   5677  C C    . ARG A 1 68 ? 10.451  -1.425  -14.663 1.00 8.99  ? 68 ARG A C    5  
ATOM   5678  O O    . ARG A 1 68 ? 9.922   -0.531  -14.030 1.00 8.81  ? 68 ARG A O    5  
ATOM   5679  C CB   . ARG A 1 68 ? 9.944   -3.866  -14.520 1.00 9.33  ? 68 ARG A CB   5  
ATOM   5680  C CG   . ARG A 1 68 ? 10.476  -5.225  -14.058 1.00 9.61  ? 68 ARG A CG   5  
ATOM   5681  C CD   . ARG A 1 68 ? 9.451   -6.314  -14.386 1.00 10.05 ? 68 ARG A CD   5  
ATOM   5682  N NE   . ARG A 1 68 ? 10.073  -7.659  -14.206 1.00 10.53 ? 68 ARG A NE   5  
ATOM   5683  C CZ   . ARG A 1 68 ? 9.416   -8.736  -14.556 1.00 10.90 ? 68 ARG A CZ   5  
ATOM   5684  N NH1  . ARG A 1 68 ? 8.580   -9.292  -13.718 1.00 11.02 ? 68 ARG A NH1  5  
ATOM   5685  N NH2  . ARG A 1 68 ? 9.598   -9.253  -15.743 1.00 11.35 ? 68 ARG A NH2  5  
ATOM   5686  H H    . ARG A 1 68 ? 10.121  -3.240  -12.027 1.00 8.08  ? 68 ARG A H    5  
ATOM   5687  H HA   . ARG A 1 68 ? 11.880  -2.977  -14.260 1.00 9.01  ? 68 ARG A HA   5  
ATOM   5688  H HB2  . ARG A 1 68 ? 8.946   -3.717  -14.141 1.00 9.69  ? 68 ARG A HB2  5  
ATOM   5689  H HB3  . ARG A 1 68 ? 9.925   -3.839  -15.599 1.00 9.41  ? 68 ARG A HB3  5  
ATOM   5690  H HG2  . ARG A 1 68 ? 11.404  -5.440  -14.566 1.00 9.48  ? 68 ARG A HG2  5  
ATOM   5691  H HG3  . ARG A 1 68 ? 10.646  -5.203  -12.992 1.00 9.87  ? 68 ARG A HG3  5  
ATOM   5692  H HD2  . ARG A 1 68 ? 8.602   -6.220  -13.724 1.00 10.14 ? 68 ARG A HD2  5  
ATOM   5693  H HD3  . ARG A 1 68 ? 9.122   -6.204  -15.409 1.00 10.14 ? 68 ARG A HD3  5  
ATOM   5694  H HE   . ARG A 1 68 ? 10.973  -7.737  -13.826 1.00 10.72 ? 68 ARG A HE   5  
ATOM   5695  H HH11 . ARG A 1 68 ? 8.442   -8.896  -12.810 1.00 10.82 ? 68 ARG A HH11 5  
ATOM   5696  H HH12 . ARG A 1 68 ? 8.078   -10.115 -13.985 1.00 11.44 ? 68 ARG A HH12 5  
ATOM   5697  H HH21 . ARG A 1 68 ? 10.237  -8.828  -16.384 1.00 11.42 ? 68 ARG A HH21 5  
ATOM   5698  H HH22 . ARG A 1 68 ? 9.097   -10.077 -16.013 1.00 11.76 ? 68 ARG A HH22 5  
ATOM   5699  N N    . ALA A 1 69 ? 10.701  -1.302  -15.944 1.00 9.61  ? 69 ALA A N    5  
ATOM   5700  C CA   . ALA A 1 69 ? 10.342  -0.046  -16.672 1.00 10.14 ? 69 ALA A CA   5  
ATOM   5701  C C    . ALA A 1 69 ? 9.907   -0.383  -18.103 1.00 10.89 ? 69 ALA A C    5  
ATOM   5702  O O    . ALA A 1 69 ? 8.798   -0.079  -18.500 1.00 11.20 ? 69 ALA A O    5  
ATOM   5703  C CB   . ALA A 1 69 ? 11.556  0.889   -16.713 1.00 10.08 ? 69 ALA A CB   5  
ATOM   5704  H H    . ALA A 1 69 ? 11.126  -2.042  -16.426 1.00 9.89  ? 69 ALA A H    5  
ATOM   5705  H HA   . ALA A 1 69 ? 9.529   0.446   -16.158 1.00 10.27 ? 69 ALA A HA   5  
ATOM   5706  H HB1  . ALA A 1 69 ? 12.379  0.390   -17.201 1.00 10.12 ? 69 ALA A HB1  5  
ATOM   5707  H HB2  . ALA A 1 69 ? 11.302  1.785   -17.261 1.00 10.18 ? 69 ALA A HB2  5  
ATOM   5708  H HB3  . ALA A 1 69 ? 11.841  1.153   -15.706 1.00 10.12 ? 69 ALA A HB3  5  
ATOM   5709  N N    . GLU A 1 70 ? 10.779  -1.006  -18.873 1.00 11.37 ? 70 GLU A N    5  
ATOM   5710  C CA   . GLU A 1 70 ? 10.455  -1.376  -20.291 1.00 12.24 ? 70 GLU A CA   5  
ATOM   5711  C C    . GLU A 1 70 ? 10.345  -0.106  -21.150 1.00 12.45 ? 70 GLU A C    5  
ATOM   5712  O O    . GLU A 1 70 ? 11.250  0.220   -21.895 1.00 12.32 ? 70 GLU A O    5  
ATOM   5713  C CB   . GLU A 1 70 ? 9.140   -2.174  -20.350 1.00 12.79 ? 70 GLU A CB   5  
ATOM   5714  C CG   . GLU A 1 70 ? 9.450   -3.668  -20.473 1.00 12.48 ? 70 GLU A CG   5  
ATOM   5715  C CD   . GLU A 1 70 ? 8.174   -4.425  -20.851 1.00 13.18 ? 70 GLU A CD   5  
ATOM   5716  O OE1  . GLU A 1 70 ? 7.424   -4.771  -19.951 1.00 13.39 ? 70 GLU A OE1  5  
ATOM   5717  O OE2  . GLU A 1 70 ? 7.965   -4.646  -22.033 1.00 13.63 ? 70 GLU A OE2  5  
ATOM   5718  H H    . GLU A 1 70 ? 11.663  -1.229  -18.513 1.00 11.26 ? 70 GLU A H    5  
ATOM   5719  H HA   . GLU A 1 70 ? 11.255  -1.989  -20.680 1.00 12.53 ? 70 GLU A HA   5  
ATOM   5720  H HB2  . GLU A 1 70 ? 8.571   -2.000  -19.449 1.00 13.03 ? 70 GLU A HB2  5  
ATOM   5721  H HB3  . GLU A 1 70 ? 8.565   -1.857  -21.206 1.00 13.32 ? 70 GLU A HB3  5  
ATOM   5722  H HG2  . GLU A 1 70 ? 10.198  -3.818  -21.239 1.00 12.20 ? 70 GLU A HG2  5  
ATOM   5723  H HG3  . GLU A 1 70 ? 9.820   -4.038  -19.530 1.00 12.23 ? 70 GLU A HG3  5  
ATOM   5724  N N    . ASN A 1 71 ? 9.251   0.614   -21.049 1.00 12.96 ? 71 ASN A N    5  
ATOM   5725  C CA   . ASN A 1 71 ? 9.086   1.863   -21.855 1.00 13.39 ? 71 ASN A CA   5  
ATOM   5726  C C    . ASN A 1 71 ? 8.276   2.890   -21.052 1.00 13.77 ? 71 ASN A C    5  
ATOM   5727  O O    . ASN A 1 71 ? 7.516   2.538   -20.168 1.00 13.98 ? 71 ASN A O    5  
ATOM   5728  C CB   . ASN A 1 71 ? 8.359   1.541   -23.170 1.00 13.14 ? 71 ASN A CB   5  
ATOM   5729  C CG   . ASN A 1 71 ? 7.034   0.827   -22.880 1.00 12.70 ? 71 ASN A CG   5  
ATOM   5730  O OD1  . ASN A 1 71 ? 6.008   1.462   -22.727 1.00 12.77 ? 71 ASN A OD1  5  
ATOM   5731  N ND2  . ASN A 1 71 ? 7.009   -0.478  -22.800 1.00 12.41 ? 71 ASN A ND2  5  
ATOM   5732  H H    . ASN A 1 71 ? 8.537   0.332   -20.439 1.00 13.17 ? 71 ASN A H    5  
ATOM   5733  H HA   . ASN A 1 71 ? 10.060  2.275   -22.077 1.00 13.80 ? 71 ASN A HA   5  
ATOM   5734  H HB2  . ASN A 1 71 ? 8.163   2.460   -23.704 1.00 13.36 ? 71 ASN A HB2  5  
ATOM   5735  H HB3  . ASN A 1 71 ? 8.984   0.901   -23.775 1.00 13.26 ? 71 ASN A HB3  5  
ATOM   5736  H HD21 . ASN A 1 71 ? 7.833   -0.992  -22.924 1.00 12.47 ? 71 ASN A HD21 5  
ATOM   5737  H HD22 . ASN A 1 71 ? 6.166   -0.941  -22.614 1.00 12.23 ? 71 ASN A HD22 5  
ATOM   5738  N N    . SER A 1 72 ? 8.440   4.161   -21.357 1.00 14.02 ? 72 SER A N    5  
ATOM   5739  C CA   . SER A 1 72 ? 7.690   5.238   -20.626 1.00 14.59 ? 72 SER A CA   5  
ATOM   5740  C C    . SER A 1 72 ? 8.032   5.203   -19.118 1.00 15.09 ? 72 SER A C    5  
ATOM   5741  O O    . SER A 1 72 ? 9.114   4.747   -18.779 1.00 15.38 ? 72 SER A O    5  
ATOM   5742  C CB   . SER A 1 72 ? 6.180   5.041   -20.834 1.00 14.66 ? 72 SER A CB   5  
ATOM   5743  O OG   . SER A 1 72 ? 5.894   5.018   -22.227 1.00 14.60 ? 72 SER A OG   5  
ATOM   5744  O OXT  . SER A 1 72 ? 7.211   5.646   -18.327 1.00 15.30 ? 72 SER A OXT  5  
ATOM   5745  H H    . SER A 1 72 ? 9.060   4.410   -22.074 1.00 13.94 ? 72 SER A H    5  
ATOM   5746  H HA   . SER A 1 72 ? 7.978   6.198   -21.026 1.00 14.77 ? 72 SER A HA   5  
ATOM   5747  H HB2  . SER A 1 72 ? 5.871   4.107   -20.395 1.00 14.69 ? 72 SER A HB2  5  
ATOM   5748  H HB3  . SER A 1 72 ? 5.643   5.852   -20.359 1.00 14.91 ? 72 SER A HB3  5  
ATOM   5749  H HG   . SER A 1 72 ? 5.704   5.917   -22.507 1.00 14.50 ? 72 SER A HG   5  
ATOM   5750  N N    . GLU A 1 4  ? -14.665 17.829  -4.181  1.00 9.58  ? 4  GLU A N    6  
ATOM   5751  C CA   . GLU A 1 4  ? -13.200 18.001  -4.417  1.00 9.09  ? 4  GLU A CA   6  
ATOM   5752  C C    . GLU A 1 4  ? -12.524 16.628  -4.529  1.00 8.06  ? 4  GLU A C    6  
ATOM   5753  O O    . GLU A 1 4  ? -13.079 15.617  -4.140  1.00 8.10  ? 4  GLU A O    6  
ATOM   5754  C CB   . GLU A 1 4  ? -12.580 18.779  -3.249  1.00 9.77  ? 4  GLU A CB   6  
ATOM   5755  C CG   . GLU A 1 4  ? -12.152 20.171  -3.726  1.00 10.24 ? 4  GLU A CG   6  
ATOM   5756  C CD   . GLU A 1 4  ? -13.295 21.166  -3.506  1.00 11.04 ? 4  GLU A CD   6  
ATOM   5757  O OE1  . GLU A 1 4  ? -13.393 21.695  -2.411  1.00 11.49 ? 4  GLU A OE1  6  
ATOM   5758  O OE2  . GLU A 1 4  ? -14.052 21.383  -4.438  1.00 11.36 ? 4  GLU A OE2  6  
ATOM   5759  H H    . GLU A 1 4  ? -15.067 17.220  -4.922  1.00 9.81  ? 4  GLU A H    6  
ATOM   5760  H HA   . GLU A 1 4  ? -13.048 18.551  -5.334  1.00 9.22  ? 4  GLU A HA   6  
ATOM   5761  H HB2  . GLU A 1 4  ? -13.308 18.878  -2.455  1.00 9.96  ? 4  GLU A HB2  6  
ATOM   5762  H HB3  . GLU A 1 4  ? -11.717 18.247  -2.879  1.00 9.97  ? 4  GLU A HB3  6  
ATOM   5763  H HG2  . GLU A 1 4  ? -11.283 20.490  -3.167  1.00 10.27 ? 4  GLU A HG2  6  
ATOM   5764  H HG3  . GLU A 1 4  ? -11.907 20.133  -4.777  1.00 10.19 ? 4  GLU A HG3  6  
ATOM   5765  N N    . LEU A 1 5  ? -11.325 16.591  -5.060  1.00 7.36  ? 5  LEU A N    6  
ATOM   5766  C CA   . LEU A 1 5  ? -10.598 15.293  -5.203  1.00 6.53  ? 5  LEU A CA   6  
ATOM   5767  C C    . LEU A 1 5  ? -9.940  14.924  -3.867  1.00 6.17  ? 5  LEU A C    6  
ATOM   5768  O O    . LEU A 1 5  ? -9.500  15.783  -3.125  1.00 6.61  ? 5  LEU A O    6  
ATOM   5769  C CB   . LEU A 1 5  ? -9.520  15.431  -6.286  1.00 6.34  ? 5  LEU A CB   6  
ATOM   5770  C CG   . LEU A 1 5  ? -9.331  14.092  -7.006  1.00 7.26  ? 5  LEU A CG   6  
ATOM   5771  C CD1  . LEU A 1 5  ? -9.064  14.344  -8.491  1.00 7.60  ? 5  LEU A CD1  6  
ATOM   5772  C CD2  . LEU A 1 5  ? -8.140  13.344  -6.398  1.00 7.86  ? 5  LEU A CD2  6  
ATOM   5773  H H    . LEU A 1 5  ? -10.902 17.422  -5.362  1.00 7.57  ? 5  LEU A H    6  
ATOM   5774  H HA   . LEU A 1 5  ? -11.296 14.519  -5.487  1.00 6.63  ? 5  LEU A HA   6  
ATOM   5775  H HB2  . LEU A 1 5  ? -9.824  16.183  -6.999  1.00 5.88  ? 5  LEU A HB2  6  
ATOM   5776  H HB3  . LEU A 1 5  ? -8.588  15.726  -5.830  1.00 6.33  ? 5  LEU A HB3  6  
ATOM   5777  H HG   . LEU A 1 5  ? -10.226 13.496  -6.899  1.00 7.52  ? 5  LEU A HG   6  
ATOM   5778  H HD11 . LEU A 1 5  ? -9.898  14.877  -8.922  1.00 7.97  ? 5  LEU A HD11 6  
ATOM   5779  H HD12 . LEU A 1 5  ? -8.165  14.934  -8.600  1.00 8.07  ? 5  LEU A HD12 6  
ATOM   5780  H HD13 . LEU A 1 5  ? -8.938  13.400  -9.000  1.00 7.24  ? 5  LEU A HD13 6  
ATOM   5781  H HD21 . LEU A 1 5  ? -8.151  13.461  -5.324  1.00 8.35  ? 5  LEU A HD21 6  
ATOM   5782  H HD22 . LEU A 1 5  ? -8.208  12.296  -6.647  1.00 7.79  ? 5  LEU A HD22 6  
ATOM   5783  H HD23 . LEU A 1 5  ? -7.220  13.748  -6.794  1.00 8.13  ? 5  LEU A HD23 6  
ATOM   5784  N N    . ARG A 1 6  ? -9.872  13.650  -3.557  1.00 5.61  ? 6  ARG A N    6  
ATOM   5785  C CA   . ARG A 1 6  ? -9.245  13.219  -2.270  1.00 5.48  ? 6  ARG A CA   6  
ATOM   5786  C C    . ARG A 1 6  ? -8.730  11.776  -2.392  1.00 4.69  ? 6  ARG A C    6  
ATOM   5787  O O    . ARG A 1 6  ? -8.581  11.252  -3.482  1.00 4.64  ? 6  ARG A O    6  
ATOM   5788  C CB   . ARG A 1 6  ? -10.285 13.306  -1.144  1.00 6.06  ? 6  ARG A CB   6  
ATOM   5789  C CG   . ARG A 1 6  ? -9.759  14.210  -0.025  1.00 6.84  ? 6  ARG A CG   6  
ATOM   5790  C CD   . ARG A 1 6  ? -10.389 13.799  1.308   1.00 7.76  ? 6  ARG A CD   6  
ATOM   5791  N NE   . ARG A 1 6  ? -9.629  12.655  1.892   1.00 8.57  ? 6  ARG A NE   6  
ATOM   5792  C CZ   . ARG A 1 6  ? -10.159 11.937  2.847   1.00 9.27  ? 6  ARG A CZ   6  
ATOM   5793  N NH1  . ARG A 1 6  ? -10.939 10.931  2.554   1.00 9.77  ? 6  ARG A NH1  6  
ATOM   5794  N NH2  . ARG A 1 6  ? -9.905  12.228  4.098   1.00 9.70  ? 6  ARG A NH2  6  
ATOM   5795  H H    . ARG A 1 6  ? -10.236 12.978  -4.171  1.00 5.45  ? 6  ARG A H    6  
ATOM   5796  H HA   . ARG A 1 6  ? -8.416  13.872  -2.042  1.00 5.83  ? 6  ARG A HA   6  
ATOM   5797  H HB2  . ARG A 1 6  ? -11.203 13.713  -1.534  1.00 6.17  ? 6  ARG A HB2  6  
ATOM   5798  H HB3  . ARG A 1 6  ? -10.471 12.319  -0.748  1.00 6.11  ? 6  ARG A HB3  6  
ATOM   5799  H HG2  . ARG A 1 6  ? -8.685  14.114  0.040   1.00 6.68  ? 6  ARG A HG2  6  
ATOM   5800  H HG3  . ARG A 1 6  ? -10.017 15.236  -0.240  1.00 7.20  ? 6  ARG A HG3  6  
ATOM   5801  H HD2  . ARG A 1 6  ? -10.360 14.635  1.992   1.00 8.01  ? 6  ARG A HD2  6  
ATOM   5802  H HD3  . ARG A 1 6  ? -11.415 13.504  1.145   1.00 7.82  ? 6  ARG A HD3  6  
ATOM   5803  H HE   . ARG A 1 6  ? -8.730  12.443  1.561   1.00 8.74  ? 6  ARG A HE   6  
ATOM   5804  H HH11 . ARG A 1 6  ? -11.132 10.708  1.598   1.00 9.63  ? 6  ARG A HH11 6  
ATOM   5805  H HH12 . ARG A 1 6  ? -11.345 10.383  3.285   1.00 10.41 ? 6  ARG A HH12 6  
ATOM   5806  H HH21 . ARG A 1 6  ? -9.308  12.998  4.323   1.00 9.50  ? 6  ARG A HH21 6  
ATOM   5807  H HH22 . ARG A 1 6  ? -10.311 11.681  4.830   1.00 10.35 ? 6  ARG A HH22 6  
ATOM   5808  N N    . CYS A 1 7  ? -8.462  11.135  -1.278  1.00 4.47  ? 7  CYS A N    6  
ATOM   5809  C CA   . CYS A 1 7  ? -7.961  9.729   -1.308  1.00 4.05  ? 7  CYS A CA   6  
ATOM   5810  C C    . CYS A 1 7  ? -9.128  8.779   -1.586  1.00 4.38  ? 7  CYS A C    6  
ATOM   5811  O O    . CYS A 1 7  ? -10.128 8.787   -0.890  1.00 4.93  ? 7  CYS A O    6  
ATOM   5812  C CB   . CYS A 1 7  ? -7.330  9.385   0.043   1.00 4.32  ? 7  CYS A CB   6  
ATOM   5813  S SG   . CYS A 1 7  ? -5.635  10.023  0.103   1.00 4.79  ? 7  CYS A SG   6  
ATOM   5814  H H    . CYS A 1 7  ? -8.593  11.582  -0.416  1.00 4.87  ? 7  CYS A H    6  
ATOM   5815  H HA   . CYS A 1 7  ? -7.221  9.622   -2.087  1.00 3.89  ? 7  CYS A HA   6  
ATOM   5816  H HB2  . CYS A 1 7  ? -7.911  9.828   0.836   1.00 4.81  ? 7  CYS A HB2  6  
ATOM   5817  H HB3  . CYS A 1 7  ? -7.315  8.315   0.168   1.00 4.30  ? 7  CYS A HB3  6  
ATOM   5818  N N    . GLN A 1 8  ? -9.001  7.960   -2.602  1.00 4.51  ? 8  GLN A N    6  
ATOM   5819  C CA   . GLN A 1 8  ? -10.094 6.998   -2.942  1.00 5.30  ? 8  GLN A CA   6  
ATOM   5820  C C    . GLN A 1 8  ? -10.106 5.822   -1.950  1.00 5.47  ? 8  GLN A C    6  
ATOM   5821  O O    . GLN A 1 8  ? -11.037 5.039   -1.931  1.00 6.21  ? 8  GLN A O    6  
ATOM   5822  C CB   . GLN A 1 8  ? -9.874  6.460   -4.362  1.00 5.63  ? 8  GLN A CB   6  
ATOM   5823  C CG   . GLN A 1 8  ? -11.226 6.204   -5.035  1.00 6.22  ? 8  GLN A CG   6  
ATOM   5824  C CD   . GLN A 1 8  ? -11.841 7.534   -5.488  1.00 7.21  ? 8  GLN A CD   6  
ATOM   5825  O OE1  . GLN A 1 8  ? -11.186 8.335   -6.127  1.00 7.78  ? 8  GLN A OE1  6  
ATOM   5826  N NE2  . GLN A 1 8  ? -13.082 7.805   -5.185  1.00 7.68  ? 8  GLN A NE2  6  
ATOM   5827  H H    . GLN A 1 8  ? -8.183  7.978   -3.142  1.00 4.40  ? 8  GLN A H    6  
ATOM   5828  H HA   . GLN A 1 8  ? -11.044 7.509   -2.899  1.00 5.87  ? 8  GLN A HA   6  
ATOM   5829  H HB2  . GLN A 1 8  ? -9.316  7.185   -4.938  1.00 5.62  ? 8  GLN A HB2  6  
ATOM   5830  H HB3  . GLN A 1 8  ? -9.317  5.536   -4.314  1.00 5.89  ? 8  GLN A HB3  6  
ATOM   5831  H HG2  . GLN A 1 8  ? -11.083 5.563   -5.894  1.00 6.11  ? 8  GLN A HG2  6  
ATOM   5832  H HG3  . GLN A 1 8  ? -11.891 5.722   -4.335  1.00 6.39  ? 8  GLN A HG3  6  
ATOM   5833  H HE21 . GLN A 1 8  ? -13.614 7.161   -4.671  1.00 7.43  ? 8  GLN A HE21 6  
ATOM   5834  H HE22 . GLN A 1 8  ? -13.482 8.652   -5.470  1.00 8.44  ? 8  GLN A HE22 6  
ATOM   5835  N N    . CYS A 1 9  ? -9.086  5.688   -1.125  1.00 5.04  ? 9  CYS A N    6  
ATOM   5836  C CA   . CYS A 1 9  ? -9.060  4.558   -0.147  1.00 5.45  ? 9  CYS A CA   6  
ATOM   5837  C C    . CYS A 1 9  ? -9.017  5.114   1.278   1.00 5.99  ? 9  CYS A C    6  
ATOM   5838  O O    . CYS A 1 9  ? -8.033  5.692   1.704   1.00 6.13  ? 9  CYS A O    6  
ATOM   5839  C CB   . CYS A 1 9  ? -7.827  3.685   -0.402  1.00 5.08  ? 9  CYS A CB   6  
ATOM   5840  S SG   . CYS A 1 9  ? -8.311  2.225   -1.361  1.00 5.12  ? 9  CYS A SG   6  
ATOM   5841  H H    . CYS A 1 9  ? -8.341  6.331   -1.148  1.00 4.65  ? 9  CYS A H    6  
ATOM   5842  H HA   . CYS A 1 9  ? -9.951  3.958   -0.262  1.00 5.89  ? 9  CYS A HA   6  
ATOM   5843  H HB2  . CYS A 1 9  ? -7.093  4.251   -0.955  1.00 4.67  ? 9  CYS A HB2  6  
ATOM   5844  H HB3  . CYS A 1 9  ? -7.406  3.373   0.541   1.00 5.54  ? 9  CYS A HB3  6  
ATOM   5845  N N    . ILE A 1 10 ? -10.083 4.930   2.017   1.00 6.61  ? 10 ILE A N    6  
ATOM   5846  C CA   . ILE A 1 10 ? -10.128 5.429   3.426   1.00 7.44  ? 10 ILE A CA   6  
ATOM   5847  C C    . ILE A 1 10 ? -9.321  4.481   4.325   1.00 7.48  ? 10 ILE A C    6  
ATOM   5848  O O    . ILE A 1 10 ? -8.782  4.886   5.338   1.00 8.16  ? 10 ILE A O    6  
ATOM   5849  C CB   . ILE A 1 10 ? -11.588 5.481   3.914   1.00 8.38  ? 10 ILE A CB   6  
ATOM   5850  C CG1  . ILE A 1 10 ? -12.429 6.382   2.993   1.00 8.63  ? 10 ILE A CG1  6  
ATOM   5851  C CG2  . ILE A 1 10 ? -11.641 6.032   5.343   1.00 9.31  ? 10 ILE A CG2  6  
ATOM   5852  C CD1  . ILE A 1 10 ? -11.744 7.740   2.807   1.00 9.47  ? 10 ILE A CD1  6  
ATOM   5853  H H    . ILE A 1 10 ? -10.854 4.452   1.645   1.00 6.69  ? 10 ILE A H    6  
ATOM   5854  H HA   . ILE A 1 10 ? -9.697  6.419   3.471   1.00 7.59  ? 10 ILE A HA   6  
ATOM   5855  H HB   . ILE A 1 10 ? -11.998 4.481   3.907   1.00 8.40  ? 10 ILE A HB   6  
ATOM   5856  H HG12 . ILE A 1 10 ? -12.545 5.905   2.031   1.00 8.91  ? 10 ILE A HG12 6  
ATOM   5857  H HG13 . ILE A 1 10 ? -13.403 6.533   3.435   1.00 8.14  ? 10 ILE A HG13 6  
ATOM   5858  H HG21 . ILE A 1 10 ? -10.950 6.858   5.438   1.00 9.78  ? 10 ILE A HG21 6  
ATOM   5859  H HG22 . ILE A 1 10 ? -12.642 6.375   5.560   1.00 9.72  ? 10 ILE A HG22 6  
ATOM   5860  H HG23 . ILE A 1 10 ? -11.369 5.254   6.040   1.00 9.27  ? 10 ILE A HG23 6  
ATOM   5861  H HD11 . ILE A 1 10 ? -11.179 7.984   3.694   1.00 9.77  ? 10 ILE A HD11 6  
ATOM   5862  H HD12 . ILE A 1 10 ? -11.079 7.694   1.957   1.00 9.76  ? 10 ILE A HD12 6  
ATOM   5863  H HD13 . ILE A 1 10 ? -12.493 8.500   2.637   1.00 9.66  ? 10 ILE A HD13 6  
ATOM   5864  N N    . LYS A 1 11 ? -9.234  3.222   3.958   1.00 6.93  ? 11 LYS A N    6  
ATOM   5865  C CA   . LYS A 1 11 ? -8.467  2.239   4.783   1.00 7.15  ? 11 LYS A CA   6  
ATOM   5866  C C    . LYS A 1 11 ? -7.219  1.787   4.014   1.00 6.42  ? 11 LYS A C    6  
ATOM   5867  O O    . LYS A 1 11 ? -7.166  1.871   2.799   1.00 6.35  ? 11 LYS A O    6  
ATOM   5868  C CB   . LYS A 1 11 ? -9.353  1.022   5.079   1.00 8.05  ? 11 LYS A CB   6  
ATOM   5869  C CG   . LYS A 1 11 ? -10.287 1.335   6.252   1.00 8.65  ? 11 LYS A CG   6  
ATOM   5870  C CD   . LYS A 1 11 ? -11.583 1.956   5.726   1.00 9.04  ? 11 LYS A CD   6  
ATOM   5871  C CE   . LYS A 1 11 ? -12.611 2.038   6.858   1.00 9.50  ? 11 LYS A CE   6  
ATOM   5872  N NZ   . LYS A 1 11 ? -13.926 1.522   6.380   1.00 9.69  ? 11 LYS A NZ   6  
ATOM   5873  H H    . LYS A 1 11 ? -9.677  2.923   3.133   1.00 6.52  ? 11 LYS A H    6  
ATOM   5874  H HA   . LYS A 1 11 ? -8.169  2.702   5.712   1.00 7.36  ? 11 LYS A HA   6  
ATOM   5875  H HB2  . LYS A 1 11 ? -9.941  0.785   4.204   1.00 8.15  ? 11 LYS A HB2  6  
ATOM   5876  H HB3  . LYS A 1 11 ? -8.731  0.178   5.333   1.00 8.38  ? 11 LYS A HB3  6  
ATOM   5877  H HG2  . LYS A 1 11 ? -10.515 0.421   6.782   1.00 9.16  ? 11 LYS A HG2  6  
ATOM   5878  H HG3  . LYS A 1 11 ? -9.804  2.029   6.924   1.00 8.50  ? 11 LYS A HG3  6  
ATOM   5879  H HD2  . LYS A 1 11 ? -11.381 2.949   5.352   1.00 9.00  ? 11 LYS A HD2  6  
ATOM   5880  H HD3  . LYS A 1 11 ? -11.977 1.345   4.928   1.00 9.26  ? 11 LYS A HD3  6  
ATOM   5881  H HE2  . LYS A 1 11 ? -12.275 1.442   7.694   1.00 9.79  ? 11 LYS A HE2  6  
ATOM   5882  H HE3  . LYS A 1 11 ? -12.721 3.066   7.170   1.00 9.62  ? 11 LYS A HE3  6  
ATOM   5883  H HZ1  . LYS A 1 11 ? -13.819 0.536   6.064   1.00 9.86  ? 11 LYS A HZ1  6  
ATOM   5884  H HZ2  . LYS A 1 11 ? -14.618 1.564   7.155   1.00 9.61  ? 11 LYS A HZ2  6  
ATOM   5885  H HZ3  . LYS A 1 11 ? -14.262 2.105   5.587   1.00 9.96  ? 11 LYS A HZ3  6  
ATOM   5886  N N    . THR A 1 12 ? -6.215  1.308   4.711   1.00 6.02  ? 12 THR A N    6  
ATOM   5887  C CA   . THR A 1 12 ? -4.971  0.847   4.017   1.00 5.35  ? 12 THR A CA   6  
ATOM   5888  C C    . THR A 1 12 ? -4.561  -0.541  4.507   1.00 5.31  ? 12 THR A C    6  
ATOM   5889  O O    . THR A 1 12 ? -5.315  -1.233  5.167   1.00 5.80  ? 12 THR A O    6  
ATOM   5890  C CB   . THR A 1 12 ? -3.820  1.831   4.251   1.00 5.23  ? 12 THR A CB   6  
ATOM   5891  O OG1  . THR A 1 12 ? -4.090  2.659   5.379   1.00 5.90  ? 12 THR A OG1  6  
ATOM   5892  C CG2  . THR A 1 12 ? -3.636  2.681   2.998   1.00 5.32  ? 12 THR A CG2  6  
ATOM   5893  H H    . THR A 1 12 ? -6.281  1.248   5.688   1.00 6.26  ? 12 THR A H    6  
ATOM   5894  H HA   . THR A 1 12 ? -5.165  0.790   2.957   1.00 5.27  ? 12 THR A HA   6  
ATOM   5895  H HB   . THR A 1 12 ? -2.913  1.273   4.427   1.00 4.85  ? 12 THR A HB   6  
ATOM   5896  H HG1  . THR A 1 12 ? -4.714  3.339   5.111   1.00 6.31  ? 12 THR A HG1  6  
ATOM   5897  H HG21 . THR A 1 12 ? -3.661  2.040   2.127   1.00 5.41  ? 12 THR A HG21 6  
ATOM   5898  H HG22 . THR A 1 12 ? -4.432  3.406   2.936   1.00 5.52  ? 12 THR A HG22 6  
ATOM   5899  H HG23 . THR A 1 12 ? -2.685  3.188   3.045   1.00 5.48  ? 12 THR A HG23 6  
ATOM   5900  N N    . TYR A 1 13 ? -3.369  -0.960  4.152   1.00 4.96  ? 13 TYR A N    6  
ATOM   5901  C CA   . TYR A 1 13 ? -2.893  -2.308  4.547   1.00 5.03  ? 13 TYR A CA   6  
ATOM   5902  C C    . TYR A 1 13 ? -1.634  -2.209  5.414   1.00 5.08  ? 13 TYR A C    6  
ATOM   5903  O O    . TYR A 1 13 ? -0.727  -1.449  5.128   1.00 4.67  ? 13 TYR A O    6  
ATOM   5904  C CB   . TYR A 1 13 ? -2.576  -3.098  3.275   1.00 4.85  ? 13 TYR A CB   6  
ATOM   5905  C CG   . TYR A 1 13 ? -2.672  -4.573  3.544   1.00 5.22  ? 13 TYR A CG   6  
ATOM   5906  C CD1  . TYR A 1 13 ? -3.597  -5.060  4.471   1.00 5.34  ? 13 TYR A CD1  6  
ATOM   5907  C CD2  . TYR A 1 13 ? -1.822  -5.445  2.867   1.00 5.75  ? 13 TYR A CD2  6  
ATOM   5908  C CE1  . TYR A 1 13 ? -3.671  -6.436  4.726   1.00 5.79  ? 13 TYR A CE1  6  
ATOM   5909  C CE2  . TYR A 1 13 ? -1.894  -6.824  3.116   1.00 6.30  ? 13 TYR A CE2  6  
ATOM   5910  C CZ   . TYR A 1 13 ? -2.818  -7.318  4.048   1.00 6.23  ? 13 TYR A CZ   6  
ATOM   5911  O OH   . TYR A 1 13 ? -2.891  -8.675  4.294   1.00 6.84  ? 13 TYR A OH   6  
ATOM   5912  H H    . TYR A 1 13 ? -2.797  -0.389  3.600   1.00 4.82  ? 13 TYR A H    6  
ATOM   5913  H HA   . TYR A 1 13 ? -3.668  -2.814  5.099   1.00 5.34  ? 13 TYR A HA   6  
ATOM   5914  H HB2  . TYR A 1 13 ? -3.276  -2.830  2.499   1.00 4.90  ? 13 TYR A HB2  6  
ATOM   5915  H HB3  . TYR A 1 13 ? -1.573  -2.864  2.949   1.00 4.67  ? 13 TYR A HB3  6  
ATOM   5916  H HD1  . TYR A 1 13 ? -4.255  -4.368  4.984   1.00 5.30  ? 13 TYR A HD1  6  
ATOM   5917  H HD2  . TYR A 1 13 ? -1.115  -5.051  2.145   1.00 5.92  ? 13 TYR A HD2  6  
ATOM   5918  H HE1  . TYR A 1 13 ? -4.381  -6.816  5.446   1.00 5.99  ? 13 TYR A HE1  6  
ATOM   5919  H HE2  . TYR A 1 13 ? -1.234  -7.504  2.598   1.00 6.92  ? 13 TYR A HE2  6  
ATOM   5920  H HH   . TYR A 1 13 ? -2.701  -8.822  5.223   1.00 7.17  ? 13 TYR A HH   6  
ATOM   5921  N N    . SER A 1 14 ? -1.580  -2.991  6.462   1.00 5.82  ? 14 SER A N    6  
ATOM   5922  C CA   . SER A 1 14 ? -0.387  -2.986  7.365   1.00 6.06  ? 14 SER A CA   6  
ATOM   5923  C C    . SER A 1 14 ? 0.326   -4.342  7.280   1.00 6.51  ? 14 SER A C    6  
ATOM   5924  O O    . SER A 1 14 ? 1.537   -4.416  7.370   1.00 6.88  ? 14 SER A O    6  
ATOM   5925  C CB   . SER A 1 14 ? -0.831  -2.729  8.808   1.00 6.42  ? 14 SER A CB   6  
ATOM   5926  O OG   . SER A 1 14 ? -1.894  -3.613  9.146   1.00 6.80  ? 14 SER A OG   6  
ATOM   5927  H H    . SER A 1 14 ? -2.327  -3.597  6.653   1.00 6.33  ? 14 SER A H    6  
ATOM   5928  H HA   . SER A 1 14 ? 0.295   -2.210  7.055   1.00 5.81  ? 14 SER A HA   6  
ATOM   5929  H HB2  . SER A 1 14 ? -0.003  -2.901  9.477   1.00 6.57  ? 14 SER A HB2  6  
ATOM   5930  H HB3  . SER A 1 14 ? -1.159  -1.703  8.904   1.00 6.52  ? 14 SER A HB3  6  
ATOM   5931  H HG   . SER A 1 14 ? -1.513  -4.397  9.552   1.00 7.03  ? 14 SER A HG   6  
ATOM   5932  N N    . LYS A 1 15 ? -0.416  -5.414  7.097   1.00 6.59  ? 15 LYS A N    6  
ATOM   5933  C CA   . LYS A 1 15 ? 0.222   -6.763  6.996   1.00 7.06  ? 15 LYS A CA   6  
ATOM   5934  C C    . LYS A 1 15 ? 0.930   -6.869  5.641   1.00 6.32  ? 15 LYS A C    6  
ATOM   5935  O O    . LYS A 1 15 ? 0.396   -6.448  4.637   1.00 6.13  ? 15 LYS A O    6  
ATOM   5936  C CB   . LYS A 1 15 ? -0.817  -7.885  7.095   1.00 7.75  ? 15 LYS A CB   6  
ATOM   5937  C CG   . LYS A 1 15 ? -2.092  -7.405  7.803   1.00 8.64  ? 15 LYS A CG   6  
ATOM   5938  C CD   . LYS A 1 15 ? -2.931  -8.611  8.237   1.00 9.43  ? 15 LYS A CD   6  
ATOM   5939  C CE   . LYS A 1 15 ? -3.647  -8.289  9.553   1.00 10.20 ? 15 LYS A CE   6  
ATOM   5940  N NZ   . LYS A 1 15 ? -5.103  -8.582  9.418   1.00 10.59 ? 15 LYS A NZ   6  
ATOM   5941  H H    . LYS A 1 15 ? -1.384  -5.326  7.019   1.00 6.42  ? 15 LYS A H    6  
ATOM   5942  H HA   . LYS A 1 15 ? 0.945   -6.872  7.791   1.00 7.57  ? 15 LYS A HA   6  
ATOM   5943  H HB2  . LYS A 1 15 ? -1.055  -8.222  6.106   1.00 7.79  ? 15 LYS A HB2  6  
ATOM   5944  H HB3  . LYS A 1 15 ? -0.398  -8.704  7.647   1.00 7.79  ? 15 LYS A HB3  6  
ATOM   5945  H HG2  . LYS A 1 15 ? -1.823  -6.823  8.672   1.00 8.72  ? 15 LYS A HG2  6  
ATOM   5946  H HG3  . LYS A 1 15 ? -2.671  -6.794  7.127   1.00 8.87  ? 15 LYS A HG3  6  
ATOM   5947  H HD2  . LYS A 1 15 ? -3.662  -8.834  7.473   1.00 9.71  ? 15 LYS A HD2  6  
ATOM   5948  H HD3  . LYS A 1 15 ? -2.288  -9.466  8.380   1.00 9.38  ? 15 LYS A HD3  6  
ATOM   5949  H HE2  . LYS A 1 15 ? -3.230  -8.892  10.346  1.00 10.54 ? 15 LYS A HE2  6  
ATOM   5950  H HE3  . LYS A 1 15 ? -3.512  -7.244  9.789   1.00 10.33 ? 15 LYS A HE3  6  
ATOM   5951  H HZ1  . LYS A 1 15 ? -5.500  -8.020  8.638   1.00 11.09 ? 15 LYS A HZ1  6  
ATOM   5952  H HZ2  . LYS A 1 15 ? -5.238  -9.596  9.221   1.00 10.91 ? 15 LYS A HZ2  6  
ATOM   5953  H HZ3  . LYS A 1 15 ? -5.590  -8.332  10.301  1.00 10.22 ? 15 LYS A HZ3  6  
ATOM   5954  N N    . PRO A 1 16 ? 2.120   -7.410  5.659   1.00 6.02  ? 16 PRO A N    6  
ATOM   5955  C CA   . PRO A 1 16 ? 2.949   -7.561  4.452   1.00 5.35  ? 16 PRO A CA   6  
ATOM   5956  C C    . PRO A 1 16 ? 2.552   -8.804  3.649   1.00 5.50  ? 16 PRO A C    6  
ATOM   5957  O O    . PRO A 1 16 ? 1.998   -9.752  4.176   1.00 6.37  ? 16 PRO A O    6  
ATOM   5958  C CB   . PRO A 1 16 ? 4.361   -7.693  5.017   1.00 5.39  ? 16 PRO A CB   6  
ATOM   5959  C CG   . PRO A 1 16 ? 4.211   -8.187  6.477   1.00 6.26  ? 16 PRO A CG   6  
ATOM   5960  C CD   . PRO A 1 16 ? 2.750   -7.923  6.886   1.00 6.51  ? 16 PRO A CD   6  
ATOM   5961  H HA   . PRO A 1 16 ? 2.888   -6.684  3.834   1.00 4.92  ? 16 PRO A HA   6  
ATOM   5962  H HB2  . PRO A 1 16 ? 4.927   -8.398  4.437   1.00 5.32  ? 16 PRO A HB2  6  
ATOM   5963  H HB3  . PRO A 1 16 ? 4.849   -6.737  5.004   1.00 5.10  ? 16 PRO A HB3  6  
ATOM   5964  H HG2  . PRO A 1 16 ? 4.427   -9.245  6.533   1.00 6.77  ? 16 PRO A HG2  6  
ATOM   5965  H HG3  . PRO A 1 16 ? 4.875   -7.637  7.126   1.00 6.37  ? 16 PRO A HG3  6  
ATOM   5966  H HD2  . PRO A 1 16 ? 2.271   -8.841  7.199   1.00 7.06  ? 16 PRO A HD2  6  
ATOM   5967  H HD3  . PRO A 1 16 ? 2.692   -7.185  7.665   1.00 6.63  ? 16 PRO A HD3  6  
ATOM   5968  N N    . PHE A 1 17 ? 2.843   -8.795  2.371   1.00 4.76  ? 17 PHE A N    6  
ATOM   5969  C CA   . PHE A 1 17 ? 2.499   -9.967  1.502   1.00 4.96  ? 17 PHE A CA   6  
ATOM   5970  C C    . PHE A 1 17 ? 3.338   -9.930  0.211   1.00 4.78  ? 17 PHE A C    6  
ATOM   5971  O O    . PHE A 1 17 ? 3.818   -8.889  -0.201  1.00 4.77  ? 17 PHE A O    6  
ATOM   5972  C CB   . PHE A 1 17 ? 0.987   -9.964  1.181   1.00 4.69  ? 17 PHE A CB   6  
ATOM   5973  C CG   . PHE A 1 17 ? 0.628   -8.898  0.158   1.00 3.72  ? 17 PHE A CG   6  
ATOM   5974  C CD1  . PHE A 1 17 ? 0.817   -7.539  0.450   1.00 3.74  ? 17 PHE A CD1  6  
ATOM   5975  C CD2  . PHE A 1 17 ? 0.092   -9.277  -1.080  1.00 3.29  ? 17 PHE A CD2  6  
ATOM   5976  C CE1  . PHE A 1 17 ? 0.473   -6.566  -0.497  1.00 3.14  ? 17 PHE A CE1  6  
ATOM   5977  C CE2  . PHE A 1 17 ? -0.254  -8.301  -2.023  1.00 2.59  ? 17 PHE A CE2  6  
ATOM   5978  C CZ   . PHE A 1 17 ? -0.062  -6.947  -1.731  1.00 2.38  ? 17 PHE A CZ   6  
ATOM   5979  H H    . PHE A 1 17 ? 3.296   -8.015  1.984   1.00 4.19  ? 17 PHE A H    6  
ATOM   5980  H HA   . PHE A 1 17 ? 2.737   -10.874 2.038   1.00 5.66  ? 17 PHE A HA   6  
ATOM   5981  H HB2  . PHE A 1 17 ? 0.709   -10.931 0.791   1.00 5.13  ? 17 PHE A HB2  6  
ATOM   5982  H HB3  . PHE A 1 17 ? 0.436   -9.780  2.091   1.00 5.06  ? 17 PHE A HB3  6  
ATOM   5983  H HD1  . PHE A 1 17 ? 1.225   -7.242  1.404   1.00 4.51  ? 17 PHE A HD1  6  
ATOM   5984  H HD2  . PHE A 1 17 ? -0.058  -10.322 -1.308  1.00 3.86  ? 17 PHE A HD2  6  
ATOM   5985  H HE1  . PHE A 1 17 ? 0.619   -5.519  -0.276  1.00 3.62  ? 17 PHE A HE1  6  
ATOM   5986  H HE2  . PHE A 1 17 ? -0.669  -8.593  -2.977  1.00 2.72  ? 17 PHE A HE2  6  
ATOM   5987  H HZ   . PHE A 1 17 ? -0.329  -6.194  -2.459  1.00 2.18  ? 17 PHE A HZ   6  
ATOM   5988  N N    . HIS A 1 18 ? 3.529   -11.073 -0.412  1.00 4.92  ? 18 HIS A N    6  
ATOM   5989  C CA   . HIS A 1 18 ? 4.348   -11.147 -1.664  1.00 5.06  ? 18 HIS A CA   6  
ATOM   5990  C C    . HIS A 1 18 ? 3.678   -10.313 -2.792  1.00 4.32  ? 18 HIS A C    6  
ATOM   5991  O O    . HIS A 1 18 ? 2.466   -10.274 -2.894  1.00 4.10  ? 18 HIS A O    6  
ATOM   5992  C CB   . HIS A 1 18 ? 4.511   -12.628 -2.020  1.00 5.95  ? 18 HIS A CB   6  
ATOM   5993  C CG   . HIS A 1 18 ? 4.976   -12.777 -3.424  1.00 6.25  ? 18 HIS A CG   6  
ATOM   5994  N ND1  . HIS A 1 18 ? 6.312   -12.884 -3.778  1.00 6.36  ? 18 HIS A ND1  6  
ATOM   5995  C CD2  . HIS A 1 18 ? 4.275   -12.837 -4.572  1.00 6.72  ? 18 HIS A CD2  6  
ATOM   5996  C CE1  . HIS A 1 18 ? 6.353   -13.001 -5.117  1.00 6.81  ? 18 HIS A CE1  6  
ATOM   5997  N NE2  . HIS A 1 18 ? 5.134   -12.985 -5.642  1.00 7.07  ? 18 HIS A NE2  6  
ATOM   5998  H H    . HIS A 1 18 ? 3.136   -11.895 -0.046  1.00 5.11  ? 18 HIS A H    6  
ATOM   5999  H HA   . HIS A 1 18 ? 5.317   -10.734 -1.474  1.00 5.21  ? 18 HIS A HA   6  
ATOM   6000  H HB2  . HIS A 1 18 ? 5.235   -13.077 -1.358  1.00 6.63  ? 18 HIS A HB2  6  
ATOM   6001  H HB3  . HIS A 1 18 ? 3.564   -13.129 -1.902  1.00 5.84  ? 18 HIS A HB3  6  
ATOM   6002  H HD1  . HIS A 1 18 ? 7.080   -12.876 -3.170  1.00 6.36  ? 18 HIS A HD1  6  
ATOM   6003  H HD2  . HIS A 1 18 ? 3.212   -12.732 -4.633  1.00 7.00  ? 18 HIS A HD2  6  
ATOM   6004  H HE1  . HIS A 1 18 ? 7.256   -13.052 -5.701  1.00 7.12  ? 18 HIS A HE1  6  
ATOM   6005  N N    . PRO A 1 19 ? 4.509   -9.613  -3.557  1.00 4.16  ? 19 PRO A N    6  
ATOM   6006  C CA   . PRO A 1 19 ? 4.060   -8.686  -4.635  1.00 3.77  ? 19 PRO A CA   6  
ATOM   6007  C C    . PRO A 1 19 ? 3.586   -9.373  -5.924  1.00 4.27  ? 19 PRO A C    6  
ATOM   6008  O O    . PRO A 1 19 ? 2.587   -8.972  -6.489  1.00 4.32  ? 19 PRO A O    6  
ATOM   6009  C CB   . PRO A 1 19 ? 5.306   -7.848  -4.928  1.00 3.96  ? 19 PRO A CB   6  
ATOM   6010  C CG   . PRO A 1 19 ? 6.516   -8.682  -4.455  1.00 4.62  ? 19 PRO A CG   6  
ATOM   6011  C CD   . PRO A 1 19 ? 5.982   -9.686  -3.419  1.00 4.65  ? 19 PRO A CD   6  
ATOM   6012  H HA   . PRO A 1 19 ? 3.289   -8.041  -4.264  1.00 3.26  ? 19 PRO A HA   6  
ATOM   6013  H HB2  . PRO A 1 19 ? 5.377   -7.650  -5.990  1.00 4.26  ? 19 PRO A HB2  6  
ATOM   6014  H HB3  . PRO A 1 19 ? 5.266   -6.922  -4.381  1.00 3.57  ? 19 PRO A HB3  6  
ATOM   6015  H HG2  . PRO A 1 19 ? 6.950   -9.209  -5.297  1.00 5.23  ? 19 PRO A HG2  6  
ATOM   6016  H HG3  . PRO A 1 19 ? 7.253   -8.042  -3.999  1.00 4.63  ? 19 PRO A HG3  6  
ATOM   6017  H HD2  . PRO A 1 19 ? 6.336   -10.679 -3.644  1.00 5.29  ? 19 PRO A HD2  6  
ATOM   6018  H HD3  . PRO A 1 19 ? 6.276   -9.396  -2.424  1.00 4.56  ? 19 PRO A HD3  6  
ATOM   6019  N N    . LYS A 1 20 ? 4.300   -10.355 -6.425  1.00 4.91  ? 20 LYS A N    6  
ATOM   6020  C CA   . LYS A 1 20 ? 3.874   -11.007 -7.715  1.00 5.52  ? 20 LYS A CA   6  
ATOM   6021  C C    . LYS A 1 20 ? 2.410   -11.485 -7.643  1.00 5.00  ? 20 LYS A C    6  
ATOM   6022  O O    . LYS A 1 20 ? 1.768   -11.650 -8.664  1.00 5.39  ? 20 LYS A O    6  
ATOM   6023  C CB   . LYS A 1 20 ? 4.790   -12.173 -8.074  1.00 6.44  ? 20 LYS A CB   6  
ATOM   6024  C CG   . LYS A 1 20 ? 4.964   -12.236 -9.594  1.00 7.16  ? 20 LYS A CG   6  
ATOM   6025  C CD   . LYS A 1 20 ? 6.285   -12.932 -9.932  1.00 7.91  ? 20 LYS A CD   6  
ATOM   6026  C CE   . LYS A 1 20 ? 6.513   -12.898 -11.447 1.00 8.41  ? 20 LYS A CE   6  
ATOM   6027  N NZ   . LYS A 1 20 ? 7.195   -11.625 -11.823 1.00 8.95  ? 20 LYS A NZ   6  
ATOM   6028  H H    . LYS A 1 20 ? 5.121   -10.638 -5.976  1.00 5.13  ? 20 LYS A H    6  
ATOM   6029  H HA   . LYS A 1 20 ? 3.951   -10.280 -8.492  1.00 5.87  ? 20 LYS A HA   6  
ATOM   6030  H HB2  . LYS A 1 20 ? 5.753   -12.035 -7.605  1.00 6.91  ? 20 LYS A HB2  6  
ATOM   6031  H HB3  . LYS A 1 20 ? 4.348   -13.084 -7.730  1.00 6.29  ? 20 LYS A HB3  6  
ATOM   6032  H HG2  . LYS A 1 20 ? 4.143   -12.792 -10.028 1.00 7.23  ? 20 LYS A HG2  6  
ATOM   6033  H HG3  . LYS A 1 20 ? 4.974   -11.235 -9.999  1.00 7.28  ? 20 LYS A HG3  6  
ATOM   6034  H HD2  . LYS A 1 20 ? 7.097   -12.422 -9.432  1.00 8.14  ? 20 LYS A HD2  6  
ATOM   6035  H HD3  . LYS A 1 20 ? 6.246   -13.958 -9.599  1.00 8.11  ? 20 LYS A HD3  6  
ATOM   6036  H HE2  . LYS A 1 20 ? 7.130   -13.735 -11.736 1.00 8.28  ? 20 LYS A HE2  6  
ATOM   6037  H HE3  . LYS A 1 20 ? 5.561   -12.960 -11.955 1.00 8.75  ? 20 LYS A HE3  6  
ATOM   6038  H HZ1  . LYS A 1 20 ? 8.003   -11.462 -11.189 1.00 9.13  ? 20 LYS A HZ1  6  
ATOM   6039  H HZ2  . LYS A 1 20 ? 7.533   -11.692 -12.804 1.00 9.15  ? 20 LYS A HZ2  6  
ATOM   6040  H HZ3  . LYS A 1 20 ? 6.526   -10.833 -11.739 1.00 9.17  ? 20 LYS A HZ3  6  
ATOM   6041  N N    . PHE A 1 21 ? 1.862   -11.675 -6.456  1.00 4.37  ? 21 PHE A N    6  
ATOM   6042  C CA   . PHE A 1 21 ? 0.433   -12.096 -6.340  1.00 4.15  ? 21 PHE A CA   6  
ATOM   6043  C C    . PHE A 1 21 ? -0.445  -11.000 -6.951  1.00 3.56  ? 21 PHE A C    6  
ATOM   6044  O O    . PHE A 1 21 ? -1.424  -11.268 -7.623  1.00 3.88  ? 21 PHE A O    6  
ATOM   6045  C CB   . PHE A 1 21 ? 0.050   -12.248 -4.870  1.00 4.02  ? 21 PHE A CB   6  
ATOM   6046  C CG   . PHE A 1 21 ? 0.828   -13.359 -4.194  1.00 4.64  ? 21 PHE A CG   6  
ATOM   6047  C CD1  . PHE A 1 21 ? 1.394   -14.402 -4.940  1.00 5.11  ? 21 PHE A CD1  6  
ATOM   6048  C CD2  . PHE A 1 21 ? 0.973   -13.342 -2.800  1.00 5.12  ? 21 PHE A CD2  6  
ATOM   6049  C CE1  . PHE A 1 21 ? 2.104   -15.420 -4.292  1.00 5.85  ? 21 PHE A CE1  6  
ATOM   6050  C CE2  . PHE A 1 21 ? 1.680   -14.361 -2.154  1.00 5.85  ? 21 PHE A CE2  6  
ATOM   6051  C CZ   . PHE A 1 21 ? 2.246   -15.400 -2.900  1.00 6.13  ? 21 PHE A CZ   6  
ATOM   6052  H H    . PHE A 1 21 ? 2.378   -11.511 -5.645  1.00 4.29  ? 21 PHE A H    6  
ATOM   6053  H HA   . PHE A 1 21 ? 0.278   -13.021 -6.849  1.00 4.82  ? 21 PHE A HA   6  
ATOM   6054  H HB2  . PHE A 1 21 ? 0.255   -11.326 -4.374  1.00 3.48  ? 21 PHE A HB2  6  
ATOM   6055  H HB3  . PHE A 1 21 ? -1.002  -12.459 -4.802  1.00 4.37  ? 21 PHE A HB3  6  
ATOM   6056  H HD1  . PHE A 1 21 ? 1.286   -14.419 -6.015  1.00 5.17  ? 21 PHE A HD1  6  
ATOM   6057  H HD2  . PHE A 1 21 ? 0.538   -12.540 -2.223  1.00 5.18  ? 21 PHE A HD2  6  
ATOM   6058  H HE1  . PHE A 1 21 ? 2.543   -16.220 -4.867  1.00 6.40  ? 21 PHE A HE1  6  
ATOM   6059  H HE2  . PHE A 1 21 ? 1.790   -14.344 -1.079  1.00 6.40  ? 21 PHE A HE2  6  
ATOM   6060  H HZ   . PHE A 1 21 ? 2.792   -16.187 -2.402  1.00 6.79  ? 21 PHE A HZ   6  
ATOM   6061  N N    . ILE A 1 22 ? -0.081  -9.763  -6.707  1.00 2.94  ? 22 ILE A N    6  
ATOM   6062  C CA   . ILE A 1 22 ? -0.849  -8.602  -7.242  1.00 2.62  ? 22 ILE A CA   6  
ATOM   6063  C C    . ILE A 1 22 ? -0.818  -8.612  -8.772  1.00 3.41  ? 22 ILE A C    6  
ATOM   6064  O O    . ILE A 1 22 ? 0.233   -8.549  -9.384  1.00 4.13  ? 22 ILE A O    6  
ATOM   6065  C CB   . ILE A 1 22 ? -0.209  -7.300  -6.740  1.00 2.18  ? 22 ILE A CB   6  
ATOM   6066  C CG1  . ILE A 1 22 ? -0.243  -7.259  -5.209  1.00 2.00  ? 22 ILE A CG1  6  
ATOM   6067  C CG2  . ILE A 1 22 ? -0.976  -6.100  -7.297  1.00 2.53  ? 22 ILE A CG2  6  
ATOM   6068  C CD1  . ILE A 1 22 ? 1.056   -6.636  -4.688  1.00 2.47  ? 22 ILE A CD1  6  
ATOM   6069  H H    . ILE A 1 22 ? 0.714   -9.596  -6.160  1.00 2.94  ? 22 ILE A H    6  
ATOM   6070  H HA   . ILE A 1 22 ? -1.873  -8.653  -6.904  1.00 2.63  ? 22 ILE A HA   6  
ATOM   6071  H HB   . ILE A 1 22 ? 0.816   -7.254  -7.080  1.00 2.49  ? 22 ILE A HB   6  
ATOM   6072  H HG12 . ILE A 1 22 ? -1.084  -6.667  -4.881  1.00 2.23  ? 22 ILE A HG12 6  
ATOM   6073  H HG13 . ILE A 1 22 ? -0.336  -8.263  -4.823  1.00 2.28  ? 22 ILE A HG13 6  
ATOM   6074  H HG21 . ILE A 1 22 ? -2.008  -6.374  -7.447  1.00 2.80  ? 22 ILE A HG21 6  
ATOM   6075  H HG22 . ILE A 1 22 ? -0.918  -5.279  -6.599  1.00 3.07  ? 22 ILE A HG22 6  
ATOM   6076  H HG23 . ILE A 1 22 ? -0.542  -5.803  -8.239  1.00 2.71  ? 22 ILE A HG23 6  
ATOM   6077  H HD11 . ILE A 1 22 ? 1.763   -6.543  -5.499  1.00 2.73  ? 22 ILE A HD11 6  
ATOM   6078  H HD12 . ILE A 1 22 ? 0.847   -5.658  -4.280  1.00 2.88  ? 22 ILE A HD12 6  
ATOM   6079  H HD13 . ILE A 1 22 ? 1.474   -7.265  -3.917  1.00 2.84  ? 22 ILE A HD13 6  
ATOM   6080  N N    . LYS A 1 23 ? -1.970  -8.664  -9.388  1.00 3.62  ? 23 LYS A N    6  
ATOM   6081  C CA   . LYS A 1 23 ? -2.033  -8.644  -10.877 1.00 4.61  ? 23 LYS A CA   6  
ATOM   6082  C C    . LYS A 1 23 ? -2.053  -7.184  -11.352 1.00 5.00  ? 23 LYS A C    6  
ATOM   6083  O O    . LYS A 1 23 ? -1.665  -6.885  -12.467 1.00 5.88  ? 23 LYS A O    6  
ATOM   6084  C CB   . LYS A 1 23 ? -3.301  -9.363  -11.352 1.00 5.10  ? 23 LYS A CB   6  
ATOM   6085  C CG   . LYS A 1 23 ? -2.966  -10.817 -11.697 1.00 5.85  ? 23 LYS A CG   6  
ATOM   6086  C CD   . LYS A 1 23 ? -2.228  -10.868 -13.038 1.00 6.35  ? 23 LYS A CD   6  
ATOM   6087  C CE   . LYS A 1 23 ? -2.066  -12.325 -13.482 1.00 6.93  ? 23 LYS A CE   6  
ATOM   6088  N NZ   . LYS A 1 23 ? -3.057  -12.635 -14.552 1.00 7.72  ? 23 LYS A NZ   6  
ATOM   6089  H H    . LYS A 1 23 ? -2.801  -8.694  -8.866  1.00 3.33  ? 23 LYS A H    6  
ATOM   6090  H HA   . LYS A 1 23 ? -1.162  -9.140  -11.280 1.00 4.98  ? 23 LYS A HA   6  
ATOM   6091  H HB2  . LYS A 1 23 ? -4.044  -9.341  -10.567 1.00 4.92  ? 23 LYS A HB2  6  
ATOM   6092  H HB3  . LYS A 1 23 ? -3.690  -8.868  -12.229 1.00 5.36  ? 23 LYS A HB3  6  
ATOM   6093  H HG2  . LYS A 1 23 ? -2.339  -11.236 -10.923 1.00 6.02  ? 23 LYS A HG2  6  
ATOM   6094  H HG3  . LYS A 1 23 ? -3.879  -11.390 -11.770 1.00 6.22  ? 23 LYS A HG3  6  
ATOM   6095  H HD2  . LYS A 1 23 ? -2.795  -10.326 -13.781 1.00 6.70  ? 23 LYS A HD2  6  
ATOM   6096  H HD3  . LYS A 1 23 ? -1.253  -10.416 -12.929 1.00 6.30  ? 23 LYS A HD3  6  
ATOM   6097  H HE2  . LYS A 1 23 ? -1.067  -12.475 -13.862 1.00 6.98  ? 23 LYS A HE2  6  
ATOM   6098  H HE3  . LYS A 1 23 ? -2.230  -12.978 -12.638 1.00 7.01  ? 23 LYS A HE3  6  
ATOM   6099  H HZ1  . LYS A 1 23 ? -4.019  -12.484 -14.189 1.00 8.36  ? 23 LYS A HZ1  6  
ATOM   6100  H HZ2  . LYS A 1 23 ? -2.895  -12.012 -15.368 1.00 7.80  ? 23 LYS A HZ2  6  
ATOM   6101  H HZ3  . LYS A 1 23 ? -2.949  -13.628 -14.844 1.00 7.78  ? 23 LYS A HZ3  6  
ATOM   6102  N N    . GLU A 1 24 ? -2.499  -6.274  -10.510 1.00 4.51  ? 24 GLU A N    6  
ATOM   6103  C CA   . GLU A 1 24 ? -2.542  -4.832  -10.897 1.00 5.13  ? 24 GLU A CA   6  
ATOM   6104  C C    . GLU A 1 24 ? -2.147  -3.968  -9.690  1.00 4.55  ? 24 GLU A C    6  
ATOM   6105  O O    . GLU A 1 24 ? -2.944  -3.743  -8.798  1.00 4.65  ? 24 GLU A O    6  
ATOM   6106  C CB   . GLU A 1 24 ? -3.962  -4.464  -11.345 1.00 5.78  ? 24 GLU A CB   6  
ATOM   6107  C CG   . GLU A 1 24 ? -4.199  -4.943  -12.782 1.00 6.35  ? 24 GLU A CG   6  
ATOM   6108  C CD   . GLU A 1 24 ? -3.414  -4.062  -13.759 1.00 7.36  ? 24 GLU A CD   6  
ATOM   6109  O OE1  . GLU A 1 24 ? -3.932  -3.023  -14.138 1.00 7.92  ? 24 GLU A OE1  6  
ATOM   6110  O OE2  . GLU A 1 24 ? -2.309  -4.441  -14.113 1.00 7.77  ? 24 GLU A OE2  6  
ATOM   6111  H H    . GLU A 1 24 ? -2.802  -6.543  -9.615  1.00 3.86  ? 24 GLU A H    6  
ATOM   6112  H HA   . GLU A 1 24 ? -1.852  -4.657  -11.709 1.00 5.74  ? 24 GLU A HA   6  
ATOM   6113  H HB2  . GLU A 1 24 ? -4.679  -4.934  -10.688 1.00 5.66  ? 24 GLU A HB2  6  
ATOM   6114  H HB3  . GLU A 1 24 ? -4.086  -3.392  -11.302 1.00 6.21  ? 24 GLU A HB3  6  
ATOM   6115  H HG2  . GLU A 1 24 ? -3.872  -5.968  -12.878 1.00 6.22  ? 24 GLU A HG2  6  
ATOM   6116  H HG3  . GLU A 1 24 ? -5.252  -4.880  -13.012 1.00 6.40  ? 24 GLU A HG3  6  
HETATM 6117  N N    . MLE A 1 25 ? -0.922  -3.484  -9.647  1.00 4.25  ? 25 MLE A N    6  
HETATM 6118  C CN   . MLE A 1 25 ? -0.346  -2.960  -10.928 1.00 5.13  ? 25 MLE A CN   6  
HETATM 6119  C CA   . MLE A 1 25 ? -0.490  -2.638  -8.481  1.00 3.66  ? 25 MLE A CA   6  
HETATM 6120  C CB   . MLE A 1 25 ? 0.885   -3.099  -7.977  1.00 3.52  ? 25 MLE A CB   6  
HETATM 6121  C CG   . MLE A 1 25 ? 1.421   -2.087  -6.950  1.00 3.28  ? 25 MLE A CG   6  
HETATM 6122  C CD1  . MLE A 1 25 ? 1.979   -2.828  -5.738  1.00 2.93  ? 25 MLE A CD1  6  
HETATM 6123  C CD2  . MLE A 1 25 ? 2.529   -1.237  -7.585  1.00 3.54  ? 25 MLE A CD2  6  
HETATM 6124  C C    . MLE A 1 25 ? -0.400  -1.172  -8.913  1.00 4.19  ? 25 MLE A C    6  
HETATM 6125  O O    . MLE A 1 25 ? 0.566   -0.758  -9.532  1.00 4.87  ? 25 MLE A O    6  
HETATM 6126  H HN1  . MLE A 1 25 ? -0.941  -2.123  -11.271 1.00 5.47  ? 25 MLE A HN1  6  
HETATM 6127  H HN2  . MLE A 1 25 ? 0.668   -2.630  -10.757 1.00 5.48  ? 25 MLE A HN2  6  
HETATM 6128  H HN3  . MLE A 1 25 ? -0.352  -3.736  -11.675 1.00 5.42  ? 25 MLE A HN3  6  
HETATM 6129  H HA   . MLE A 1 25 ? -1.213  -2.735  -7.683  1.00 3.20  ? 25 MLE A HA   6  
HETATM 6130  H HB2  . MLE A 1 25 ? 0.790   -4.071  -7.513  1.00 3.37  ? 25 MLE A HB2  6  
HETATM 6131  H HB3  . MLE A 1 25 ? 1.570   -3.162  -8.809  1.00 4.08  ? 25 MLE A HB3  6  
HETATM 6132  H HG   . MLE A 1 25 ? 0.614   -1.444  -6.629  1.00 3.59  ? 25 MLE A HG   6  
HETATM 6133  H HD11 . MLE A 1 25 ? 1.471   -3.775  -5.633  1.00 3.14  ? 25 MLE A HD11 6  
HETATM 6134  H HD12 . MLE A 1 25 ? 3.036   -2.999  -5.876  1.00 2.79  ? 25 MLE A HD12 6  
HETATM 6135  H HD13 . MLE A 1 25 ? 1.821   -2.233  -4.851  1.00 3.21  ? 25 MLE A HD13 6  
HETATM 6136  H HD21 . MLE A 1 25 ? 2.791   -1.646  -8.550  1.00 3.89  ? 25 MLE A HD21 6  
HETATM 6137  H HD22 . MLE A 1 25 ? 2.176   -0.223  -7.710  1.00 3.75  ? 25 MLE A HD22 6  
HETATM 6138  H HD23 . MLE A 1 25 ? 3.398   -1.238  -6.946  1.00 3.70  ? 25 MLE A HD23 6  
ATOM   6139  N N    . ARG A 1 26 ? -1.387  -0.381  -8.600  1.00 4.14  ? 26 ARG A N    6  
ATOM   6140  C CA   . ARG A 1 26 ? -1.321  1.043   -9.007  1.00 4.79  ? 26 ARG A CA   6  
ATOM   6141  C C    . ARG A 1 26 ? -1.375  1.947   -7.770  1.00 4.70  ? 26 ARG A C    6  
ATOM   6142  O O    . ARG A 1 26 ? -2.264  1.837   -6.947  1.00 4.97  ? 26 ARG A O    6  
ATOM   6143  C CB   . ARG A 1 26 ? -2.482  1.367   -9.940  1.00 5.59  ? 26 ARG A CB   6  
ATOM   6144  C CG   . ARG A 1 26 ? -1.952  1.651   -11.347 1.00 5.99  ? 26 ARG A CG   6  
ATOM   6145  C CD   . ARG A 1 26 ? -3.116  1.645   -12.342 1.00 6.35  ? 26 ARG A CD   6  
ATOM   6146  N NE   . ARG A 1 26 ? -2.778  2.506   -13.514 1.00 7.16  ? 26 ARG A NE   6  
ATOM   6147  C CZ   . ARG A 1 26 ? -3.473  2.407   -14.617 1.00 7.92  ? 26 ARG A CZ   6  
ATOM   6148  N NH1  . ARG A 1 26 ? -4.622  3.022   -14.723 1.00 8.32  ? 26 ARG A NH1  6  
ATOM   6149  N NH2  . ARG A 1 26 ? -3.018  1.693   -15.615 1.00 8.52  ? 26 ARG A NH2  6  
ATOM   6150  H H    . ARG A 1 26 ? -2.159  -0.721  -8.104  1.00 3.85  ? 26 ARG A H    6  
ATOM   6151  H HA   . ARG A 1 26 ? -0.398  1.198   -9.526  1.00 5.07  ? 26 ARG A HA   6  
ATOM   6152  H HB2  . ARG A 1 26 ? -3.150  0.526   -9.971  1.00 5.95  ? 26 ARG A HB2  6  
ATOM   6153  H HB3  . ARG A 1 26 ? -3.002  2.233   -9.573  1.00 5.91  ? 26 ARG A HB3  6  
ATOM   6154  H HG2  . ARG A 1 26 ? -1.469  2.618   -11.361 1.00 6.27  ? 26 ARG A HG2  6  
ATOM   6155  H HG3  . ARG A 1 26 ? -1.239  0.889   -11.625 1.00 6.12  ? 26 ARG A HG3  6  
ATOM   6156  H HD2  . ARG A 1 26 ? -3.295  0.635   -12.679 1.00 6.26  ? 26 ARG A HD2  6  
ATOM   6157  H HD3  . ARG A 1 26 ? -4.004  2.027   -11.860 1.00 6.38  ? 26 ARG A HD3  6  
ATOM   6158  H HE   . ARG A 1 26 ? -2.038  3.145   -13.457 1.00 7.28  ? 26 ARG A HE   6  
ATOM   6159  H HH11 . ARG A 1 26 ? -4.971  3.568   -13.960 1.00 8.08  ? 26 ARG A HH11 6  
ATOM   6160  H HH12 . ARG A 1 26 ? -5.155  2.947   -15.566 1.00 9.02  ? 26 ARG A HH12 6  
ATOM   6161  H HH21 . ARG A 1 26 ? -2.140  1.222   -15.534 1.00 8.41  ? 26 ARG A HH21 6  
ATOM   6162  H HH22 . ARG A 1 26 ? -3.550  1.616   -16.459 1.00 9.21  ? 26 ARG A HH22 6  
ATOM   6163  N N    . VAL A 1 27 ? -0.423  2.836   -7.637  1.00 4.69  ? 27 VAL A N    6  
ATOM   6164  C CA   . VAL A 1 27 ? -0.396  3.752   -6.460  1.00 4.83  ? 27 VAL A CA   6  
ATOM   6165  C C    . VAL A 1 27 ? -0.934  5.132   -6.861  1.00 4.79  ? 27 VAL A C    6  
ATOM   6166  O O    . VAL A 1 27 ? -0.770  5.569   -7.987  1.00 5.45  ? 27 VAL A O    6  
ATOM   6167  C CB   . VAL A 1 27 ? 1.046   3.887   -5.953  1.00 5.66  ? 27 VAL A CB   6  
ATOM   6168  C CG1  . VAL A 1 27 ? 1.478   2.579   -5.285  1.00 6.10  ? 27 VAL A CG1  6  
ATOM   6169  C CG2  . VAL A 1 27 ? 1.995   4.195   -7.118  1.00 6.04  ? 27 VAL A CG2  6  
ATOM   6170  H H    . VAL A 1 27 ? 0.282   2.901   -8.311  1.00 4.82  ? 27 VAL A H    6  
ATOM   6171  H HA   . VAL A 1 27 ? -1.015  3.344   -5.675  1.00 4.74  ? 27 VAL A HA   6  
ATOM   6172  H HB   . VAL A 1 27 ? 1.091   4.684   -5.235  1.00 5.89  ? 27 VAL A HB   6  
ATOM   6173  H HG11 . VAL A 1 27 ? 0.803   2.351   -4.475  1.00 6.30  ? 27 VAL A HG11 6  
ATOM   6174  H HG12 . VAL A 1 27 ? 1.454   1.780   -6.010  1.00 6.06  ? 27 VAL A HG12 6  
ATOM   6175  H HG13 . VAL A 1 27 ? 2.480   2.687   -4.899  1.00 6.54  ? 27 VAL A HG13 6  
ATOM   6176  H HG21 . VAL A 1 27 ? 1.506   4.861   -7.814  1.00 6.18  ? 27 VAL A HG21 6  
ATOM   6177  H HG22 . VAL A 1 27 ? 2.889   4.664   -6.739  1.00 6.05  ? 27 VAL A HG22 6  
ATOM   6178  H HG23 . VAL A 1 27 ? 2.256   3.276   -7.624  1.00 6.44  ? 27 VAL A HG23 6  
ATOM   6179  N N    . ILE A 1 28 ? -1.571  5.823   -5.944  1.00 4.28  ? 28 ILE A N    6  
ATOM   6180  C CA   . ILE A 1 28 ? -2.115  7.179   -6.264  1.00 4.40  ? 28 ILE A CA   6  
ATOM   6181  C C    . ILE A 1 28 ? -1.084  8.241   -5.869  1.00 4.70  ? 28 ILE A C    6  
ATOM   6182  O O    . ILE A 1 28 ? -0.467  8.154   -4.825  1.00 5.01  ? 28 ILE A O    6  
ATOM   6183  C CB   . ILE A 1 28 ? -3.417  7.416   -5.483  1.00 4.45  ? 28 ILE A CB   6  
ATOM   6184  C CG1  . ILE A 1 28 ? -4.439  6.334   -5.850  1.00 4.94  ? 28 ILE A CG1  6  
ATOM   6185  C CG2  . ILE A 1 28 ? -3.985  8.796   -5.839  1.00 4.49  ? 28 ILE A CG2  6  
ATOM   6186  C CD1  . ILE A 1 28 ? -5.619  6.390   -4.875  1.00 5.05  ? 28 ILE A CD1  6  
ATOM   6187  H H    . ILE A 1 28 ? -1.686  5.453   -5.042  1.00 4.02  ? 28 ILE A H    6  
ATOM   6188  H HA   . ILE A 1 28 ? -2.314  7.247   -7.324  1.00 4.67  ? 28 ILE A HA   6  
ATOM   6189  H HB   . ILE A 1 28 ? -3.210  7.376   -4.423  1.00 4.56  ? 28 ILE A HB   6  
ATOM   6190  H HG12 . ILE A 1 28 ? -4.795  6.500   -6.856  1.00 5.21  ? 28 ILE A HG12 6  
ATOM   6191  H HG13 . ILE A 1 28 ? -3.972  5.363   -5.789  1.00 5.36  ? 28 ILE A HG13 6  
ATOM   6192  H HG21 . ILE A 1 28 ? -3.939  8.939   -6.908  1.00 4.51  ? 28 ILE A HG21 6  
ATOM   6193  H HG22 . ILE A 1 28 ? -5.011  8.859   -5.510  1.00 4.77  ? 28 ILE A HG22 6  
ATOM   6194  H HG23 . ILE A 1 28 ? -3.402  9.561   -5.349  1.00 4.49  ? 28 ILE A HG23 6  
ATOM   6195  H HD11 . ILE A 1 28 ? -5.822  7.419   -4.613  1.00 4.88  ? 28 ILE A HD11 6  
ATOM   6196  H HD12 . ILE A 1 28 ? -6.492  5.959   -5.341  1.00 5.25  ? 28 ILE A HD12 6  
ATOM   6197  H HD13 . ILE A 1 28 ? -5.375  5.834   -3.982  1.00 5.49  ? 28 ILE A HD13 6  
ATOM   6198  N N    . GLU A 1 29 ? -0.898  9.242   -6.696  1.00 5.08  ? 29 GLU A N    6  
ATOM   6199  C CA   . GLU A 1 29 ? 0.089   10.315  -6.374  1.00 5.75  ? 29 GLU A CA   6  
ATOM   6200  C C    . GLU A 1 29 ? -0.455  11.196  -5.243  1.00 5.30  ? 29 GLU A C    6  
ATOM   6201  O O    . GLU A 1 29 ? -1.620  11.127  -4.892  1.00 4.95  ? 29 GLU A O    6  
ATOM   6202  C CB   . GLU A 1 29 ? 0.323   11.178  -7.616  1.00 6.63  ? 29 GLU A CB   6  
ATOM   6203  C CG   . GLU A 1 29 ? 0.891   10.318  -8.749  1.00 7.40  ? 29 GLU A CG   6  
ATOM   6204  C CD   . GLU A 1 29 ? 1.390   11.224  -9.877  1.00 8.35  ? 29 GLU A CD   6  
ATOM   6205  O OE1  . GLU A 1 29 ? 2.540   11.630  -9.820  1.00 9.09  ? 29 GLU A OE1  6  
ATOM   6206  O OE2  . GLU A 1 29 ? 0.616   11.496  -10.779 1.00 8.53  ? 29 GLU A OE2  6  
ATOM   6207  H H    . GLU A 1 29 ? -1.410  9.292   -7.529  1.00 5.18  ? 29 GLU A H    6  
ATOM   6208  H HA   . GLU A 1 29 ? 1.021   9.866   -6.066  1.00 6.26  ? 29 GLU A HA   6  
ATOM   6209  H HB2  . GLU A 1 29 ? -0.612  11.617  -7.927  1.00 6.65  ? 29 GLU A HB2  6  
ATOM   6210  H HB3  . GLU A 1 29 ? 1.021   11.959  -7.377  1.00 7.00  ? 29 GLU A HB3  6  
ATOM   6211  H HG2  . GLU A 1 29 ? 1.711   9.724   -8.373  1.00 7.70  ? 29 GLU A HG2  6  
ATOM   6212  H HG3  . GLU A 1 29 ? 0.119   9.667   -9.128  1.00 7.27  ? 29 GLU A HG3  6  
ATOM   6213  N N    . SER A 1 30 ? 0.382   12.027  -4.674  1.00 5.67  ? 30 SER A N    6  
ATOM   6214  C CA   . SER A 1 30 ? -0.072  12.919  -3.567  1.00 5.68  ? 30 SER A CA   6  
ATOM   6215  C C    . SER A 1 30 ? -0.144  14.366  -4.067  1.00 6.20  ? 30 SER A C    6  
ATOM   6216  O O    . SER A 1 30 ? 0.465   14.728  -5.057  1.00 6.77  ? 30 SER A O    6  
ATOM   6217  C CB   . SER A 1 30 ? 0.908   12.833  -2.393  1.00 6.35  ? 30 SER A CB   6  
ATOM   6218  O OG   . SER A 1 30 ? 2.218   12.549  -2.872  1.00 7.18  ? 30 SER A OG   6  
ATOM   6219  H H    . SER A 1 30 ? 1.312   12.066  -4.978  1.00 6.18  ? 30 SER A H    6  
ATOM   6220  H HA   . SER A 1 30 ? -1.053  12.609  -3.236  1.00 5.24  ? 30 SER A HA   6  
ATOM   6221  H HB2  . SER A 1 30 ? 0.923   13.773  -1.871  1.00 6.58  ? 30 SER A HB2  6  
ATOM   6222  H HB3  . SER A 1 30 ? 0.584   12.057  -1.714  1.00 6.28  ? 30 SER A HB3  6  
ATOM   6223  H HG   . SER A 1 30 ? 2.796   12.449  -2.113  1.00 7.41  ? 30 SER A HG   6  
ATOM   6224  N N    . GLY A 1 31 ? -0.892  15.192  -3.380  1.00 6.36  ? 31 GLY A N    6  
ATOM   6225  C CA   . GLY A 1 31 ? -1.025  16.624  -3.793  1.00 7.19  ? 31 GLY A CA   6  
ATOM   6226  C C    . GLY A 1 31 ? -1.940  17.353  -2.800  1.00 7.66  ? 31 GLY A C    6  
ATOM   6227  O O    . GLY A 1 31 ? -2.014  16.976  -1.645  1.00 7.75  ? 31 GLY A O    6  
ATOM   6228  H H    . GLY A 1 31 ? -1.370  14.868  -2.587  1.00 6.14  ? 31 GLY A H    6  
ATOM   6229  H HA2  . GLY A 1 31 ? -0.053  17.084  -3.808  1.00 7.72  ? 31 GLY A HA2  6  
ATOM   6230  H HA3  . GLY A 1 31 ? -1.459  16.672  -4.780  1.00 7.17  ? 31 GLY A HA3  6  
ATOM   6231  N N    . PRO A 1 32 ? -2.638  18.358  -3.285  1.00 8.17  ? 32 PRO A N    6  
ATOM   6232  C CA   . PRO A 1 32 ? -3.587  19.132  -2.460  1.00 8.85  ? 32 PRO A CA   6  
ATOM   6233  C C    . PRO A 1 32 ? -4.844  18.285  -2.215  1.00 8.11  ? 32 PRO A C    6  
ATOM   6234  O O    . PRO A 1 32 ? -5.438  18.325  -1.154  1.00 8.52  ? 32 PRO A O    6  
ATOM   6235  C CB   . PRO A 1 32 ? -3.888  20.371  -3.312  1.00 9.69  ? 32 PRO A CB   6  
ATOM   6236  C CG   . PRO A 1 32 ? -3.546  19.986  -4.772  1.00 9.20  ? 32 PRO A CG   6  
ATOM   6237  C CD   . PRO A 1 32 ? -2.551  18.811  -4.692  1.00 8.39  ? 32 PRO A CD   6  
ATOM   6238  H HA   . PRO A 1 32 ? -3.134  19.422  -1.526  1.00 9.45  ? 32 PRO A HA   6  
ATOM   6239  H HB2  . PRO A 1 32 ? -4.934  20.634  -3.228  1.00 9.88  ? 32 PRO A HB2  6  
ATOM   6240  H HB3  . PRO A 1 32 ? -3.268  21.196  -2.999  1.00 10.56 ? 32 PRO A HB3  6  
ATOM   6241  H HG2  . PRO A 1 32 ? -4.444  19.681  -5.293  1.00 8.80  ? 32 PRO A HG2  6  
ATOM   6242  H HG3  . PRO A 1 32 ? -3.087  20.820  -5.278  1.00 10.01 ? 32 PRO A HG3  6  
ATOM   6243  H HD2  . PRO A 1 32 ? -2.848  18.021  -5.367  1.00 7.63  ? 32 PRO A HD2  6  
ATOM   6244  H HD3  . PRO A 1 32 ? -1.551  19.147  -4.915  1.00 8.96  ? 32 PRO A HD3  6  
ATOM   6245  N N    . HIS A 1 33 ? -5.221  17.498  -3.195  1.00 7.21  ? 33 HIS A N    6  
ATOM   6246  C CA   . HIS A 1 33 ? -6.408  16.596  -3.067  1.00 6.64  ? 33 HIS A CA   6  
ATOM   6247  C C    . HIS A 1 33 ? -6.202  15.646  -1.875  1.00 5.94  ? 33 HIS A C    6  
ATOM   6248  O O    . HIS A 1 33 ? -7.118  15.369  -1.125  1.00 6.05  ? 33 HIS A O    6  
ATOM   6249  C CB   . HIS A 1 33 ? -6.566  15.772  -4.364  1.00 6.27  ? 33 HIS A CB   6  
ATOM   6250  C CG   . HIS A 1 33 ? -5.289  15.016  -4.663  1.00 5.79  ? 33 HIS A CG   6  
ATOM   6251  N ND1  . HIS A 1 33 ? -4.198  15.617  -5.278  1.00 6.54  ? 33 HIS A ND1  6  
ATOM   6252  C CD2  . HIS A 1 33 ? -4.900  13.726  -4.396  1.00 4.91  ? 33 HIS A CD2  6  
ATOM   6253  C CE1  . HIS A 1 33 ? -3.214  14.704  -5.348  1.00 6.20  ? 33 HIS A CE1  6  
ATOM   6254  N NE2  . HIS A 1 33 ? -3.590  13.532  -4.828  1.00 5.23  ? 33 HIS A NE2  6  
ATOM   6255  H H    . HIS A 1 33 ? -4.702  17.488  -4.020  1.00 7.10  ? 33 HIS A H    6  
ATOM   6256  H HA   . HIS A 1 33 ? -7.293  17.188  -2.905  1.00 7.25  ? 33 HIS A HA   6  
ATOM   6257  H HB2  . HIS A 1 33 ? -7.377  15.070  -4.244  1.00 5.99  ? 33 HIS A HB2  6  
ATOM   6258  H HB3  . HIS A 1 33 ? -6.789  16.438  -5.184  1.00 6.92  ? 33 HIS A HB3  6  
ATOM   6259  H HD1  . HIS A 1 33 ? -4.158  16.535  -5.618  1.00 7.35  ? 33 HIS A HD1  6  
ATOM   6260  H HD2  . HIS A 1 33 ? -5.517  12.975  -3.925  1.00 4.33  ? 33 HIS A HD2  6  
ATOM   6261  H HE1  . HIS A 1 33 ? -2.226  14.907  -5.741  1.00 6.82  ? 33 HIS A HE1  6  
ATOM   6262  N N    . CYS A 1 34 ? -4.996  15.160  -1.700  1.00 5.51  ? 34 CYS A N    6  
ATOM   6263  C CA   . CYS A 1 34 ? -4.690  14.240  -0.574  1.00 5.12  ? 34 CYS A CA   6  
ATOM   6264  C C    . CYS A 1 34 ? -3.184  14.295  -0.297  1.00 5.54  ? 34 CYS A C    6  
ATOM   6265  O O    . CYS A 1 34 ? -2.385  13.783  -1.062  1.00 5.84  ? 34 CYS A O    6  
ATOM   6266  C CB   . CYS A 1 34 ? -5.106  12.810  -0.943  1.00 4.12  ? 34 CYS A CB   6  
ATOM   6267  S SG   . CYS A 1 34 ? -5.845  11.994  0.496   1.00 4.37  ? 34 CYS A SG   6  
ATOM   6268  H H    . CYS A 1 34 ? -4.284  15.411  -2.310  1.00 5.68  ? 34 CYS A H    6  
ATOM   6269  H HA   . CYS A 1 34 ? -5.228  14.563  0.295   1.00 5.59  ? 34 CYS A HA   6  
ATOM   6270  H HB2  . CYS A 1 34 ? -5.828  12.841  -1.744  1.00 4.04  ? 34 CYS A HB2  6  
ATOM   6271  H HB3  . CYS A 1 34 ? -4.238  12.253  -1.264  1.00 3.82  ? 34 CYS A HB3  6  
ATOM   6272  N N    . ALA A 1 35 ? -2.791  14.932  0.780   1.00 5.90  ? 35 ALA A N    6  
ATOM   6273  C CA   . ALA A 1 35 ? -1.335  15.047  1.111   1.00 6.66  ? 35 ALA A CA   6  
ATOM   6274  C C    . ALA A 1 35 ? -0.722  13.655  1.315   1.00 6.33  ? 35 ALA A C    6  
ATOM   6275  O O    . ALA A 1 35 ? 0.373   13.382  0.858   1.00 6.77  ? 35 ALA A O    6  
ATOM   6276  C CB   . ALA A 1 35 ? -1.166  15.869  2.391   1.00 7.59  ? 35 ALA A CB   6  
ATOM   6277  H H    . ALA A 1 35 ? -3.457  15.347  1.368   1.00 5.87  ? 35 ALA A H    6  
ATOM   6278  H HA   . ALA A 1 35 ? -0.826  15.541  0.301   1.00 7.06  ? 35 ALA A HA   6  
ATOM   6279  H HB1  . ALA A 1 35 ? -1.814  16.732  2.352   1.00 7.89  ? 35 ALA A HB1  6  
ATOM   6280  H HB2  . ALA A 1 35 ? -1.427  15.263  3.246   1.00 7.72  ? 35 ALA A HB2  6  
ATOM   6281  H HB3  . ALA A 1 35 ? -0.140  16.193  2.478   1.00 8.05  ? 35 ALA A HB3  6  
ATOM   6282  N N    . ASN A 1 36 ? -1.416  12.781  1.998   1.00 5.85  ? 36 ASN A N    6  
ATOM   6283  C CA   . ASN A 1 36 ? -0.879  11.409  2.239   1.00 5.88  ? 36 ASN A CA   6  
ATOM   6284  C C    . ASN A 1 36 ? -1.033  10.559  0.973   1.00 5.34  ? 36 ASN A C    6  
ATOM   6285  O O    . ASN A 1 36 ? -2.063  10.577  0.323   1.00 5.26  ? 36 ASN A O    6  
ATOM   6286  C CB   . ASN A 1 36 ? -1.649  10.755  3.390   1.00 6.50  ? 36 ASN A CB   6  
ATOM   6287  C CG   . ASN A 1 36 ? -1.005  11.144  4.722   1.00 7.27  ? 36 ASN A CG   6  
ATOM   6288  O OD1  . ASN A 1 36 ? -1.463  12.051  5.390   1.00 7.78  ? 36 ASN A OD1  6  
ATOM   6289  N ND2  . ASN A 1 36 ? 0.049   10.496  5.143   1.00 7.61  ? 36 ASN A ND2  6  
ATOM   6290  H H    . ASN A 1 36 ? -2.293  13.029  2.356   1.00 5.70  ? 36 ASN A H    6  
ATOM   6291  H HA   . ASN A 1 36 ? 0.167   11.476  2.500   1.00 6.19  ? 36 ASN A HA   6  
ATOM   6292  H HB2  . ASN A 1 36 ? -2.675  11.093  3.373   1.00 6.55  ? 36 ASN A HB2  6  
ATOM   6293  H HB3  . ASN A 1 36 ? -1.622  9.684   3.278   1.00 6.63  ? 36 ASN A HB3  6  
ATOM   6294  H HD21 . ASN A 1 36 ? 0.423   9.765   4.606   1.00 7.41  ? 36 ASN A HD21 6  
ATOM   6295  H HD22 . ASN A 1 36 ? 0.467   10.740  5.995   1.00 8.19  ? 36 ASN A HD22 6  
ATOM   6296  N N    . THR A 1 37 ? -0.012  9.813   0.626   1.00 5.30  ? 37 THR A N    6  
ATOM   6297  C CA   . THR A 1 37 ? -0.079  8.948   -0.593  1.00 5.18  ? 37 THR A CA   6  
ATOM   6298  C C    . THR A 1 37 ? -0.888  7.683   -0.274  1.00 4.58  ? 37 THR A C    6  
ATOM   6299  O O    . THR A 1 37 ? -0.901  7.214   0.852   1.00 4.95  ? 37 THR A O    6  
ATOM   6300  C CB   . THR A 1 37 ? 1.344   8.553   -1.024  1.00 5.98  ? 37 THR A CB   6  
ATOM   6301  O OG1  . THR A 1 37 ? 2.230   9.650   -0.821  1.00 6.76  ? 37 THR A OG1  6  
ATOM   6302  C CG2  . THR A 1 37 ? 1.348   8.163   -2.504  1.00 6.31  ? 37 THR A CG2  6  
ATOM   6303  H H    . THR A 1 37 ? 0.802   9.818   1.173   1.00 5.59  ? 37 THR A H    6  
ATOM   6304  H HA   . THR A 1 37 ? -0.562  9.491   -1.394  1.00 5.45  ? 37 THR A HA   6  
ATOM   6305  H HB   . THR A 1 37 ? 1.676   7.712   -0.436  1.00 6.11  ? 37 THR A HB   6  
ATOM   6306  H HG1  . THR A 1 37 ? 1.942   10.376  -1.382  1.00 7.02  ? 37 THR A HG1  6  
ATOM   6307  H HG21 . THR A 1 37 ? 0.949   8.977   -3.093  1.00 6.33  ? 37 THR A HG21 6  
ATOM   6308  H HG22 . THR A 1 37 ? 2.360   7.956   -2.819  1.00 6.74  ? 37 THR A HG22 6  
ATOM   6309  H HG23 . THR A 1 37 ? 0.739   7.283   -2.648  1.00 6.44  ? 37 THR A HG23 6  
ATOM   6310  N N    . GLU A 1 38 ? -1.564  7.129   -1.252  1.00 3.94  ? 38 GLU A N    6  
ATOM   6311  C CA   . GLU A 1 38 ? -2.373  5.897   -1.004  1.00 3.67  ? 38 GLU A CA   6  
ATOM   6312  C C    . GLU A 1 38 ? -2.044  4.851   -2.072  1.00 2.99  ? 38 GLU A C    6  
ATOM   6313  O O    . GLU A 1 38 ? -2.178  5.101   -3.255  1.00 3.33  ? 38 GLU A O    6  
ATOM   6314  C CB   . GLU A 1 38 ? -3.867  6.241   -1.062  1.00 4.35  ? 38 GLU A CB   6  
ATOM   6315  C CG   . GLU A 1 38 ? -4.622  5.434   -0.001  1.00 4.96  ? 38 GLU A CG   6  
ATOM   6316  C CD   . GLU A 1 38 ? -4.510  6.134   1.358   1.00 5.76  ? 38 GLU A CD   6  
ATOM   6317  O OE1  . GLU A 1 38 ? -3.548  5.869   2.062   1.00 6.10  ? 38 GLU A OE1  6  
ATOM   6318  O OE2  . GLU A 1 38 ? -5.385  6.924   1.669   1.00 6.28  ? 38 GLU A OE2  6  
ATOM   6319  H H    . GLU A 1 38 ? -1.540  7.522   -2.151  1.00 3.89  ? 38 GLU A H    6  
ATOM   6320  H HA   . GLU A 1 38 ? -2.133  5.499   -0.029  1.00 3.96  ? 38 GLU A HA   6  
ATOM   6321  H HB2  . GLU A 1 38 ? -3.999  7.297   -0.873  1.00 4.73  ? 38 GLU A HB2  6  
ATOM   6322  H HB3  . GLU A 1 38 ? -4.256  6.000   -2.039  1.00 4.35  ? 38 GLU A HB3  6  
ATOM   6323  H HG2  . GLU A 1 38 ? -5.663  5.358   -0.282  1.00 5.14  ? 38 GLU A HG2  6  
ATOM   6324  H HG3  . GLU A 1 38 ? -4.197  4.445   0.071   1.00 4.98  ? 38 GLU A HG3  6  
ATOM   6325  N N    . ILE A 1 39 ? -1.611  3.684   -1.662  1.00 2.48  ? 39 ILE A N    6  
ATOM   6326  C CA   . ILE A 1 39 ? -1.270  2.619   -2.650  1.00 2.38  ? 39 ILE A CA   6  
ATOM   6327  C C    . ILE A 1 39 ? -2.527  1.790   -2.955  1.00 2.16  ? 39 ILE A C    6  
ATOM   6328  O O    . ILE A 1 39 ? -3.464  1.766   -2.178  1.00 2.22  ? 39 ILE A O    6  
ATOM   6329  C CB   . ILE A 1 39 ? -0.169  1.727   -2.050  1.00 2.57  ? 39 ILE A CB   6  
ATOM   6330  C CG1  . ILE A 1 39 ? 1.134   2.531   -1.949  1.00 2.79  ? 39 ILE A CG1  6  
ATOM   6331  C CG2  . ILE A 1 39 ? 0.063   0.493   -2.931  1.00 3.44  ? 39 ILE A CG2  6  
ATOM   6332  C CD1  . ILE A 1 39 ? 1.790   2.292   -0.586  1.00 2.94  ? 39 ILE A CD1  6  
ATOM   6333  H H    . ILE A 1 39 ? -1.510  3.504   -0.699  1.00 2.61  ? 39 ILE A H    6  
ATOM   6334  H HA   . ILE A 1 39 ? -0.909  3.073   -3.561  1.00 2.85  ? 39 ILE A HA   6  
ATOM   6335  H HB   . ILE A 1 39 ? -0.470  1.407   -1.063  1.00 2.54  ? 39 ILE A HB   6  
ATOM   6336  H HG12 . ILE A 1 39 ? 1.811   2.218   -2.731  1.00 3.36  ? 39 ILE A HG12 6  
ATOM   6337  H HG13 . ILE A 1 39 ? 0.918   3.583   -2.061  1.00 2.70  ? 39 ILE A HG13 6  
ATOM   6338  H HG21 . ILE A 1 39 ? 0.038   0.783   -3.971  1.00 3.75  ? 39 ILE A HG21 6  
ATOM   6339  H HG22 . ILE A 1 39 ? 1.027   0.063   -2.701  1.00 3.64  ? 39 ILE A HG22 6  
ATOM   6340  H HG23 . ILE A 1 39 ? -0.711  -0.236  -2.742  1.00 4.05  ? 39 ILE A HG23 6  
ATOM   6341  H HD11 . ILE A 1 39 ? 1.174   1.626   0.000   1.00 2.88  ? 39 ILE A HD11 6  
ATOM   6342  H HD12 . ILE A 1 39 ? 2.765   1.847   -0.729  1.00 3.00  ? 39 ILE A HD12 6  
ATOM   6343  H HD13 . ILE A 1 39 ? 1.897   3.233   -0.068  1.00 3.60  ? 39 ILE A HD13 6  
ATOM   6344  N N    . ILE A 1 40 ? -2.553  1.109   -4.076  1.00 2.34  ? 40 ILE A N    6  
ATOM   6345  C CA   . ILE A 1 40 ? -3.739  0.266   -4.424  1.00 2.36  ? 40 ILE A CA   6  
ATOM   6346  C C    . ILE A 1 40 ? -3.263  -0.942  -5.231  1.00 2.37  ? 40 ILE A C    6  
ATOM   6347  O O    . ILE A 1 40 ? -2.518  -0.810  -6.182  1.00 3.02  ? 40 ILE A O    6  
ATOM   6348  C CB   . ILE A 1 40 ? -4.763  1.054   -5.254  1.00 3.14  ? 40 ILE A CB   6  
ATOM   6349  C CG1  . ILE A 1 40 ? -5.114  2.365   -4.541  1.00 3.44  ? 40 ILE A CG1  6  
ATOM   6350  C CG2  . ILE A 1 40 ? -6.032  0.209   -5.414  1.00 3.70  ? 40 ILE A CG2  6  
ATOM   6351  C CD1  . ILE A 1 40 ? -5.918  3.264   -5.484  1.00 4.01  ? 40 ILE A CD1  6  
ATOM   6352  H H    . ILE A 1 40 ? -1.787  1.145   -4.690  1.00 2.72  ? 40 ILE A H    6  
ATOM   6353  H HA   . ILE A 1 40 ? -4.207  -0.080  -3.513  1.00 2.37  ? 40 ILE A HA   6  
ATOM   6354  H HB   . ILE A 1 40 ? -4.348  1.268   -6.229  1.00 3.47  ? 40 ILE A HB   6  
ATOM   6355  H HG12 . ILE A 1 40 ? -5.699  2.149   -3.659  1.00 3.44  ? 40 ILE A HG12 6  
ATOM   6356  H HG13 . ILE A 1 40 ? -4.205  2.869   -4.255  1.00 3.71  ? 40 ILE A HG13 6  
ATOM   6357  H HG21 . ILE A 1 40 ? -6.397  -0.081  -4.439  1.00 3.89  ? 40 ILE A HG21 6  
ATOM   6358  H HG22 . ILE A 1 40 ? -6.789  0.788   -5.923  1.00 3.94  ? 40 ILE A HG22 6  
ATOM   6359  H HG23 . ILE A 1 40 ? -5.807  -0.675  -5.991  1.00 4.13  ? 40 ILE A HG23 6  
ATOM   6360  H HD11 . ILE A 1 40 ? -6.599  2.660   -6.065  1.00 4.17  ? 40 ILE A HD11 6  
ATOM   6361  H HD12 . ILE A 1 40 ? -6.480  3.981   -4.903  1.00 4.33  ? 40 ILE A HD12 6  
ATOM   6362  H HD13 . ILE A 1 40 ? -5.244  3.785   -6.146  1.00 4.43  ? 40 ILE A HD13 6  
ATOM   6363  N N    . VAL A 1 41 ? -3.678  -2.117  -4.848  1.00 2.04  ? 41 VAL A N    6  
ATOM   6364  C CA   . VAL A 1 41 ? -3.259  -3.342  -5.568  1.00 2.10  ? 41 VAL A CA   6  
ATOM   6365  C C    . VAL A 1 41 ? -4.482  -4.232  -5.819  1.00 2.33  ? 41 VAL A C    6  
ATOM   6366  O O    . VAL A 1 41 ? -5.537  -4.031  -5.247  1.00 2.79  ? 41 VAL A O    6  
ATOM   6367  C CB   . VAL A 1 41 ? -2.244  -4.103  -4.713  1.00 2.21  ? 41 VAL A CB   6  
ATOM   6368  C CG1  . VAL A 1 41 ? -0.930  -3.321  -4.652  1.00 2.87  ? 41 VAL A CG1  6  
ATOM   6369  C CG2  . VAL A 1 41 ? -2.785  -4.300  -3.293  1.00 3.20  ? 41 VAL A CG2  6  
ATOM   6370  H H    . VAL A 1 41 ? -4.264  -2.197  -4.080  1.00 2.11  ? 41 VAL A H    6  
ATOM   6371  H HA   . VAL A 1 41 ? -2.805  -3.074  -6.511  1.00 2.57  ? 41 VAL A HA   6  
ATOM   6372  H HB   . VAL A 1 41 ? -2.066  -5.058  -5.158  1.00 2.10  ? 41 VAL A HB   6  
ATOM   6373  H HG11 . VAL A 1 41 ? -0.590  -3.111  -5.655  1.00 3.03  ? 41 VAL A HG11 6  
ATOM   6374  H HG12 . VAL A 1 41 ? -1.088  -2.393  -4.124  1.00 3.29  ? 41 VAL A HG12 6  
ATOM   6375  H HG13 . VAL A 1 41 ? -0.186  -3.908  -4.135  1.00 3.43  ? 41 VAL A HG13 6  
ATOM   6376  H HG21 . VAL A 1 41 ? -3.846  -4.498  -3.336  1.00 3.56  ? 41 VAL A HG21 6  
ATOM   6377  H HG22 . VAL A 1 41 ? -2.281  -5.133  -2.828  1.00 3.58  ? 41 VAL A HG22 6  
ATOM   6378  H HG23 . VAL A 1 41 ? -2.609  -3.405  -2.714  1.00 3.72  ? 41 VAL A HG23 6  
ATOM   6379  N N    . LYS A 1 42 ? -4.340  -5.217  -6.663  1.00 2.44  ? 42 LYS A N    6  
ATOM   6380  C CA   . LYS A 1 42 ? -5.474  -6.138  -6.950  1.00 2.97  ? 42 LYS A CA   6  
ATOM   6381  C C    . LYS A 1 42 ? -4.955  -7.577  -6.901  1.00 2.77  ? 42 LYS A C    6  
ATOM   6382  O O    . LYS A 1 42 ? -4.297  -8.039  -7.816  1.00 2.98  ? 42 LYS A O    6  
ATOM   6383  C CB   . LYS A 1 42 ? -6.046  -5.838  -8.343  1.00 3.77  ? 42 LYS A CB   6  
ATOM   6384  C CG   . LYS A 1 42 ? -7.482  -5.318  -8.210  1.00 4.68  ? 42 LYS A CG   6  
ATOM   6385  C CD   . LYS A 1 42 ? -7.753  -4.273  -9.297  1.00 5.42  ? 42 LYS A CD   6  
ATOM   6386  C CE   . LYS A 1 42 ? -7.963  -4.972  -10.644 1.00 5.72  ? 42 LYS A CE   6  
ATOM   6387  N NZ   . LYS A 1 42 ? -7.711  -4.010  -11.756 1.00 6.76  ? 42 LYS A NZ   6  
ATOM   6388  H H    . LYS A 1 42 ? -3.478  -5.356  -7.102  1.00 2.45  ? 42 LYS A H    6  
ATOM   6389  H HA   . LYS A 1 42 ? -6.243  -6.004  -6.201  1.00 3.37  ? 42 LYS A HA   6  
ATOM   6390  H HB2  . LYS A 1 42 ? -5.435  -5.092  -8.828  1.00 3.94  ? 42 LYS A HB2  6  
ATOM   6391  H HB3  . LYS A 1 42 ? -6.047  -6.742  -8.933  1.00 3.87  ? 42 LYS A HB3  6  
ATOM   6392  H HG2  . LYS A 1 42 ? -8.173  -6.142  -8.322  1.00 4.83  ? 42 LYS A HG2  6  
ATOM   6393  H HG3  . LYS A 1 42 ? -7.613  -4.868  -7.238  1.00 4.94  ? 42 LYS A HG3  6  
ATOM   6394  H HD2  . LYS A 1 42 ? -8.639  -3.711  -9.040  1.00 5.79  ? 42 LYS A HD2  6  
ATOM   6395  H HD3  . LYS A 1 42 ? -6.909  -3.602  -9.369  1.00 5.70  ? 42 LYS A HD3  6  
ATOM   6396  H HE2  . LYS A 1 42 ? -7.279  -5.803  -10.728 1.00 5.66  ? 42 LYS A HE2  6  
ATOM   6397  H HE3  . LYS A 1 42 ? -8.978  -5.335  -10.705 1.00 5.59  ? 42 LYS A HE3  6  
ATOM   6398  H HZ1  . LYS A 1 42 ? -6.747  -3.629  -11.676 1.00 7.24  ? 42 LYS A HZ1  6  
ATOM   6399  H HZ2  . LYS A 1 42 ? -7.816  -4.501  -12.668 1.00 6.85  ? 42 LYS A HZ2  6  
ATOM   6400  H HZ3  . LYS A 1 42 ? -8.395  -3.229  -11.702 1.00 7.12  ? 42 LYS A HZ3  6  
ATOM   6401  N N    . LEU A 1 43 ? -5.229  -8.280  -5.829  1.00 3.01  ? 43 LEU A N    6  
ATOM   6402  C CA   . LEU A 1 43 ? -4.740  -9.686  -5.699  1.00 3.31  ? 43 LEU A CA   6  
ATOM   6403  C C    . LEU A 1 43 ? -5.293  -10.554 -6.832  1.00 3.92  ? 43 LEU A C    6  
ATOM   6404  O O    . LEU A 1 43 ? -6.388  -10.333 -7.322  1.00 4.54  ? 43 LEU A O    6  
ATOM   6405  C CB   . LEU A 1 43 ? -5.191  -10.261 -4.359  1.00 4.01  ? 43 LEU A CB   6  
ATOM   6406  C CG   . LEU A 1 43 ? -4.300  -9.723  -3.233  1.00 3.77  ? 43 LEU A CG   6  
ATOM   6407  C CD1  . LEU A 1 43 ? -4.938  -10.034 -1.877  1.00 4.46  ? 43 LEU A CD1  6  
ATOM   6408  C CD2  . LEU A 1 43 ? -2.921  -10.387 -3.309  1.00 3.91  ? 43 LEU A CD2  6  
ATOM   6409  H H    . LEU A 1 43 ? -5.747  -7.879  -5.100  1.00 3.37  ? 43 LEU A H    6  
ATOM   6410  H HA   . LEU A 1 43 ? -3.660  -9.692  -5.741  1.00 3.08  ? 43 LEU A HA   6  
ATOM   6411  H HB2  . LEU A 1 43 ? -6.215  -9.982  -4.180  1.00 4.55  ? 43 LEU A HB2  6  
ATOM   6412  H HB3  . LEU A 1 43 ? -5.120  -11.333 -4.392  1.00 4.52  ? 43 LEU A HB3  6  
ATOM   6413  H HG   . LEU A 1 43 ? -4.193  -8.654  -3.341  1.00 3.53  ? 43 LEU A HG   6  
ATOM   6414  H HD11 . LEU A 1 43 ? -5.347  -11.034 -1.892  1.00 5.14  ? 43 LEU A HD11 6  
ATOM   6415  H HD12 . LEU A 1 43 ? -4.187  -9.964  -1.101  1.00 4.57  ? 43 LEU A HD12 6  
ATOM   6416  H HD13 . LEU A 1 43 ? -5.727  -9.325  -1.679  1.00 4.51  ? 43 LEU A HD13 6  
ATOM   6417  H HD21 . LEU A 1 43 ? -3.040  -11.444 -3.498  1.00 3.95  ? 43 LEU A HD21 6  
ATOM   6418  H HD22 . LEU A 1 43 ? -2.349  -9.940  -4.109  1.00 3.96  ? 43 LEU A HD22 6  
ATOM   6419  H HD23 . LEU A 1 43 ? -2.402  -10.246 -2.373  1.00 4.44  ? 43 LEU A HD23 6  
ATOM   6420  N N    . SER A 1 44 ? -4.525  -11.539 -7.243  1.00 3.99  ? 44 SER A N    6  
ATOM   6421  C CA   . SER A 1 44 ? -4.947  -12.455 -8.349  1.00 4.72  ? 44 SER A CA   6  
ATOM   6422  C C    . SER A 1 44 ? -6.297  -13.123 -8.040  1.00 5.55  ? 44 SER A C    6  
ATOM   6423  O O    . SER A 1 44 ? -7.028  -13.483 -8.943  1.00 6.08  ? 44 SER A O    6  
ATOM   6424  C CB   . SER A 1 44 ? -3.880  -13.535 -8.553  1.00 4.98  ? 44 SER A CB   6  
ATOM   6425  O OG   . SER A 1 44 ? -3.613  -14.180 -7.313  1.00 5.08  ? 44 SER A OG   6  
ATOM   6426  H H    . SER A 1 44 ? -3.656  -11.674 -6.821  1.00 3.70  ? 44 SER A H    6  
ATOM   6427  H HA   . SER A 1 44 ? -5.039  -11.881 -9.254  1.00 4.83  ? 44 SER A HA   6  
ATOM   6428  H HB2  . SER A 1 44 ? -4.235  -14.264 -9.262  1.00 5.14  ? 44 SER A HB2  6  
ATOM   6429  H HB3  . SER A 1 44 ? -2.977  -13.078 -8.935  1.00 5.37  ? 44 SER A HB3  6  
ATOM   6430  H HG   . SER A 1 44 ? -2.962  -14.868 -7.471  1.00 5.39  ? 44 SER A HG   6  
ATOM   6431  N N    . ASP A 1 45 ? -6.639  -13.289 -6.779  1.00 5.91  ? 45 ASP A N    6  
ATOM   6432  C CA   . ASP A 1 45 ? -7.942  -13.928 -6.434  1.00 7.02  ? 45 ASP A CA   6  
ATOM   6433  C C    . ASP A 1 45 ? -9.108  -12.948 -6.689  1.00 7.25  ? 45 ASP A C    6  
ATOM   6434  O O    . ASP A 1 45 ? -10.258 -13.278 -6.460  1.00 8.19  ? 45 ASP A O    6  
ATOM   6435  C CB   . ASP A 1 45 ? -7.934  -14.360 -4.956  1.00 7.64  ? 45 ASP A CB   6  
ATOM   6436  C CG   . ASP A 1 45 ? -8.060  -13.138 -4.037  1.00 8.01  ? 45 ASP A CG   6  
ATOM   6437  O OD1  . ASP A 1 45 ? -7.042  -12.536 -3.742  1.00 8.63  ? 45 ASP A OD1  6  
ATOM   6438  O OD2  . ASP A 1 45 ? -9.173  -12.829 -3.641  1.00 7.89  ? 45 ASP A OD2  6  
ATOM   6439  H H    . ASP A 1 45 ? -6.045  -12.994 -6.067  1.00 5.60  ? 45 ASP A H    6  
ATOM   6440  H HA   . ASP A 1 45 ? -8.070  -14.796 -7.052  1.00 7.48  ? 45 ASP A HA   6  
ATOM   6441  H HB2  . ASP A 1 45 ? -8.763  -15.030 -4.776  1.00 7.55  ? 45 ASP A HB2  6  
ATOM   6442  H HB3  . ASP A 1 45 ? -7.009  -14.874 -4.740  1.00 8.18  ? 45 ASP A HB3  6  
ATOM   6443  N N    . GLY A 1 46 ? -8.821  -11.747 -7.147  1.00 6.57  ? 46 GLY A N    6  
ATOM   6444  C CA   . GLY A 1 46 ? -9.901  -10.752 -7.400  1.00 7.07  ? 46 GLY A CA   6  
ATOM   6445  C C    . GLY A 1 46 ? -10.115 -9.916  -6.138  1.00 6.74  ? 46 GLY A C    6  
ATOM   6446  O O    . GLY A 1 46 ? -11.224 -9.524  -5.826  1.00 7.17  ? 46 GLY A O    6  
ATOM   6447  H H    . GLY A 1 46 ? -7.893  -11.495 -7.316  1.00 5.88  ? 46 GLY A H    6  
ATOM   6448  H HA2  . GLY A 1 46 ? -9.613  -10.108 -8.219  1.00 7.41  ? 46 GLY A HA2  6  
ATOM   6449  H HA3  . GLY A 1 46 ? -10.815 -11.264 -7.647  1.00 7.56  ? 46 GLY A HA3  6  
ATOM   6450  N N    . ARG A 1 47 ? -9.059  -9.647  -5.404  1.00 6.21  ? 47 ARG A N    6  
ATOM   6451  C CA   . ARG A 1 47 ? -9.194  -8.846  -4.156  1.00 6.07  ? 47 ARG A CA   6  
ATOM   6452  C C    . ARG A 1 47 ? -8.699  -7.417  -4.406  1.00 5.32  ? 47 ARG A C    6  
ATOM   6453  O O    . ARG A 1 47 ? -7.989  -7.153  -5.356  1.00 5.06  ? 47 ARG A O    6  
ATOM   6454  C CB   . ARG A 1 47 ? -8.343  -9.501  -3.065  1.00 6.43  ? 47 ARG A CB   6  
ATOM   6455  C CG   . ARG A 1 47 ? -8.915  -9.183  -1.680  1.00 7.27  ? 47 ARG A CG   6  
ATOM   6456  C CD   . ARG A 1 47 ? -10.056 -10.152 -1.360  1.00 7.96  ? 47 ARG A CD   6  
ATOM   6457  N NE   . ARG A 1 47 ? -9.988  -10.545 0.076   1.00 8.82  ? 47 ARG A NE   6  
ATOM   6458  C CZ   . ARG A 1 47 ? -10.965 -10.235 0.887   1.00 9.62  ? 47 ARG A CZ   6  
ATOM   6459  N NH1  . ARG A 1 47 ? -12.076 -10.930 0.868   1.00 10.10 ? 47 ARG A NH1  6  
ATOM   6460  N NH2  . ARG A 1 47 ? -10.832 -9.231  1.716   1.00 10.15 ? 47 ARG A NH2  6  
ATOM   6461  H H    . ARG A 1 47 ? -8.171  -9.980  -5.673  1.00 6.06  ? 47 ARG A H    6  
ATOM   6462  H HA   . ARG A 1 47 ? -10.228 -8.825  -3.845  1.00 6.58  ? 47 ARG A HA   6  
ATOM   6463  H HB2  . ARG A 1 47 ? -8.339  -10.572 -3.212  1.00 6.43  ? 47 ARG A HB2  6  
ATOM   6464  H HB3  . ARG A 1 47 ? -7.335  -9.130  -3.132  1.00 6.47  ? 47 ARG A HB3  6  
ATOM   6465  H HG2  . ARG A 1 47 ? -8.136  -9.287  -0.938  1.00 7.60  ? 47 ARG A HG2  6  
ATOM   6466  H HG3  . ARG A 1 47 ? -9.290  -8.172  -1.666  1.00 7.34  ? 47 ARG A HG3  6  
ATOM   6467  H HD2  . ARG A 1 47 ? -11.002 -9.669  -1.557  1.00 7.82  ? 47 ARG A HD2  6  
ATOM   6468  H HD3  . ARG A 1 47 ? -9.966  -11.032 -1.979  1.00 8.20  ? 47 ARG A HD3  6  
ATOM   6469  H HE   . ARG A 1 47 ? -9.209  -11.036 0.413   1.00 8.93  ? 47 ARG A HE   6  
ATOM   6470  H HH11 . ARG A 1 47 ? -12.175 -11.697 0.234   1.00 9.88  ? 47 ARG A HH11 6  
ATOM   6471  H HH12 . ARG A 1 47 ? -12.825 -10.694 1.487   1.00 10.80 ? 47 ARG A HH12 6  
ATOM   6472  H HH21 . ARG A 1 47 ? -9.983  -8.702  1.728   1.00 9.97  ? 47 ARG A HH21 6  
ATOM   6473  H HH22 . ARG A 1 47 ? -11.579 -8.991  2.337   1.00 10.86 ? 47 ARG A HH22 6  
ATOM   6474  N N    . GLU A 1 48 ? -9.065  -6.497  -3.550  1.00 5.24  ? 48 GLU A N    6  
ATOM   6475  C CA   . GLU A 1 48 ? -8.614  -5.086  -3.709  1.00 4.73  ? 48 GLU A CA   6  
ATOM   6476  C C    . GLU A 1 48 ? -8.118  -4.591  -2.348  1.00 4.69  ? 48 GLU A C    6  
ATOM   6477  O O    . GLU A 1 48 ? -8.877  -4.500  -1.400  1.00 5.44  ? 48 GLU A O    6  
ATOM   6478  C CB   . GLU A 1 48 ? -9.783  -4.218  -4.184  1.00 5.60  ? 48 GLU A CB   6  
ATOM   6479  C CG   . GLU A 1 48 ? -9.582  -3.845  -5.655  1.00 5.76  ? 48 GLU A CG   6  
ATOM   6480  C CD   . GLU A 1 48 ? -10.851 -3.178  -6.192  1.00 6.79  ? 48 GLU A CD   6  
ATOM   6481  O OE1  . GLU A 1 48 ? -10.950 -1.967  -6.087  1.00 7.12  ? 48 GLU A OE1  6  
ATOM   6482  O OE2  . GLU A 1 48 ? -11.701 -3.892  -6.700  1.00 7.44  ? 48 GLU A OE2  6  
ATOM   6483  H H    . GLU A 1 48 ? -9.634  -6.739  -2.791  1.00 5.71  ? 48 GLU A H    6  
ATOM   6484  H HA   . GLU A 1 48 ? -7.805  -5.044  -4.428  1.00 4.10  ? 48 GLU A HA   6  
ATOM   6485  H HB2  . GLU A 1 48 ? -10.706 -4.767  -4.074  1.00 5.76  ? 48 GLU A HB2  6  
ATOM   6486  H HB3  . GLU A 1 48 ? -9.826  -3.318  -3.590  1.00 6.30  ? 48 GLU A HB3  6  
ATOM   6487  H HG2  . GLU A 1 48 ? -8.750  -3.162  -5.742  1.00 5.48  ? 48 GLU A HG2  6  
ATOM   6488  H HG3  . GLU A 1 48 ? -9.377  -4.738  -6.228  1.00 5.78  ? 48 GLU A HG3  6  
ATOM   6489  N N    . LEU A 1 49 ? -6.846  -4.296  -2.236  1.00 4.08  ? 49 LEU A N    6  
ATOM   6490  C CA   . LEU A 1 49 ? -6.299  -3.838  -0.921  1.00 4.35  ? 49 LEU A CA   6  
ATOM   6491  C C    . LEU A 1 49 ? -5.471  -2.565  -1.092  1.00 3.99  ? 49 LEU A C    6  
ATOM   6492  O O    . LEU A 1 49 ? -4.473  -2.558  -1.781  1.00 3.87  ? 49 LEU A O    6  
ATOM   6493  C CB   . LEU A 1 49 ? -5.380  -4.921  -0.351  1.00 4.67  ? 49 LEU A CB   6  
ATOM   6494  C CG   . LEU A 1 49 ? -6.034  -5.605  0.853   1.00 4.92  ? 49 LEU A CG   6  
ATOM   6495  C CD1  . LEU A 1 49 ? -7.051  -6.642  0.374   1.00 5.51  ? 49 LEU A CD1  6  
ATOM   6496  C CD2  . LEU A 1 49 ? -4.952  -6.307  1.677   1.00 4.69  ? 49 LEU A CD2  6  
ATOM   6497  H H    . LEU A 1 49 ? -6.248  -4.397  -3.010  1.00 3.67  ? 49 LEU A H    6  
ATOM   6498  H HA   . LEU A 1 49 ? -7.109  -3.655  -0.231  1.00 4.89  ? 49 LEU A HA   6  
ATOM   6499  H HB2  . LEU A 1 49 ? -5.174  -5.657  -1.115  1.00 4.69  ? 49 LEU A HB2  6  
ATOM   6500  H HB3  . LEU A 1 49 ? -4.456  -4.461  -0.038  1.00 5.10  ? 49 LEU A HB3  6  
ATOM   6501  H HG   . LEU A 1 49 ? -6.531  -4.865  1.463   1.00 5.20  ? 49 LEU A HG   6  
ATOM   6502  H HD11 . LEU A 1 49 ? -7.347  -6.416  -0.639  1.00 5.66  ? 49 LEU A HD11 6  
ATOM   6503  H HD12 . LEU A 1 49 ? -6.605  -7.625  0.409   1.00 5.74  ? 49 LEU A HD12 6  
ATOM   6504  H HD13 . LEU A 1 49 ? -7.917  -6.617  1.018   1.00 5.91  ? 49 LEU A HD13 6  
ATOM   6505  H HD21 . LEU A 1 49 ? -4.102  -5.651  1.785   1.00 4.66  ? 49 LEU A HD21 6  
ATOM   6506  H HD22 . LEU A 1 49 ? -5.345  -6.552  2.652   1.00 5.11  ? 49 LEU A HD22 6  
ATOM   6507  H HD23 . LEU A 1 49 ? -4.645  -7.212  1.173   1.00 4.52  ? 49 LEU A HD23 6  
ATOM   6508  N N    . CYS A 1 50 ? -5.834  -1.507  -0.416  1.00 3.99  ? 50 CYS A N    6  
ATOM   6509  C CA   . CYS A 1 50 ? -5.017  -0.264  -0.499  1.00 3.63  ? 50 CYS A CA   6  
ATOM   6510  C C    . CYS A 1 50 ? -3.888  -0.422  0.511   1.00 3.49  ? 50 CYS A C    6  
ATOM   6511  O O    . CYS A 1 50 ? -4.113  -0.874  1.614   1.00 4.14  ? 50 CYS A O    6  
ATOM   6512  C CB   . CYS A 1 50 ? -5.831  0.977   -0.148  1.00 3.72  ? 50 CYS A CB   6  
ATOM   6513  S SG   . CYS A 1 50 ? -7.611  0.659   -0.291  1.00 4.64  ? 50 CYS A SG   6  
ATOM   6514  H H    . CYS A 1 50 ? -6.603  -1.549  0.177   1.00 4.28  ? 50 CYS A H    6  
ATOM   6515  H HA   . CYS A 1 50 ? -4.606  -0.160  -1.486  1.00 3.59  ? 50 CYS A HA   6  
ATOM   6516  H HB2  . CYS A 1 50 ? -5.592  1.268   0.851   1.00 3.90  ? 50 CYS A HB2  6  
ATOM   6517  H HB3  . CYS A 1 50 ? -5.560  1.772   -0.821  1.00 3.38  ? 50 CYS A HB3  6  
ATOM   6518  N N    . LEU A 1 51 ? -2.679  -0.107  0.145   1.00 2.91  ? 51 LEU A N    6  
ATOM   6519  C CA   . LEU A 1 51 ? -1.555  -0.300  1.089   1.00 2.96  ? 51 LEU A CA   6  
ATOM   6520  C C    . LEU A 1 51 ? -1.112  1.003   1.736   1.00 3.35  ? 51 LEU A C    6  
ATOM   6521  O O    . LEU A 1 51 ? -1.437  2.095   1.296   1.00 3.56  ? 51 LEU A O    6  
ATOM   6522  C CB   . LEU A 1 51 ? -0.392  -0.927  0.354   1.00 2.71  ? 51 LEU A CB   6  
ATOM   6523  C CG   . LEU A 1 51 ? -0.753  -2.374  0.026   1.00 2.56  ? 51 LEU A CG   6  
ATOM   6524  C CD1  . LEU A 1 51 ? -0.542  -2.640  -1.456  1.00 2.98  ? 51 LEU A CD1  6  
ATOM   6525  C CD2  . LEU A 1 51 ? 0.128   -3.310  0.840   1.00 2.61  ? 51 LEU A CD2  6  
ATOM   6526  H H    . LEU A 1 51 ? -2.505  0.216   -0.751  1.00 2.70  ? 51 LEU A H    6  
ATOM   6527  H HA   . LEU A 1 51 ? -1.872  -0.973  1.864   1.00 3.34  ? 51 LEU A HA   6  
ATOM   6528  H HB2  . LEU A 1 51 ? -0.201  -0.375  -0.548  1.00 2.95  ? 51 LEU A HB2  6  
ATOM   6529  H HB3  . LEU A 1 51 ? 0.480   -0.905  0.979   1.00 2.93  ? 51 LEU A HB3  6  
ATOM   6530  H HG   . LEU A 1 51 ? -1.790  -2.550  0.274   1.00 2.88  ? 51 LEU A HG   6  
ATOM   6531  H HD11 . LEU A 1 51 ? 0.461   -2.358  -1.730  1.00 3.34  ? 51 LEU A HD11 6  
ATOM   6532  H HD12 . LEU A 1 51 ? -0.691  -3.690  -1.654  1.00 3.13  ? 51 LEU A HD12 6  
ATOM   6533  H HD13 . LEU A 1 51 ? -1.252  -2.060  -2.026  1.00 3.38  ? 51 LEU A HD13 6  
ATOM   6534  H HD21 . LEU A 1 51 ? 0.078   -3.035  1.883   1.00 3.04  ? 51 LEU A HD21 6  
ATOM   6535  H HD22 . LEU A 1 51 ? -0.220  -4.324  0.719   1.00 2.85  ? 51 LEU A HD22 6  
ATOM   6536  H HD23 . LEU A 1 51 ? 1.149   -3.235  0.495   1.00 2.77  ? 51 LEU A HD23 6  
ATOM   6537  N N    . ASP A 1 52 ? -0.370  0.861   2.799   1.00 3.84  ? 52 ASP A N    6  
ATOM   6538  C CA   . ASP A 1 52 ? 0.130   2.029   3.568   1.00 4.35  ? 52 ASP A CA   6  
ATOM   6539  C C    . ASP A 1 52 ? 1.660   2.118   3.448   1.00 4.47  ? 52 ASP A C    6  
ATOM   6540  O O    . ASP A 1 52 ? 2.369   1.217   3.873   1.00 4.73  ? 52 ASP A O    6  
ATOM   6541  C CB   . ASP A 1 52 ? -0.258  1.826   5.039   1.00 4.93  ? 52 ASP A CB   6  
ATOM   6542  C CG   . ASP A 1 52 ? -0.422  3.182   5.740   1.00 5.39  ? 52 ASP A CG   6  
ATOM   6543  O OD1  . ASP A 1 52 ? 0.449   4.025   5.587   1.00 5.40  ? 52 ASP A OD1  6  
ATOM   6544  O OD2  . ASP A 1 52 ? -1.418  3.352   6.424   1.00 5.96  ? 52 ASP A OD2  6  
ATOM   6545  H H    . ASP A 1 52 ? -0.146  -0.044  3.101   1.00 4.08  ? 52 ASP A H    6  
ATOM   6546  H HA   . ASP A 1 52 ? -0.325  2.933   3.197   1.00 4.52  ? 52 ASP A HA   6  
ATOM   6547  H HB2  . ASP A 1 52 ? -1.191  1.280   5.087   1.00 5.32  ? 52 ASP A HB2  6  
ATOM   6548  H HB3  . ASP A 1 52 ? 0.512   1.254   5.537   1.00 4.91  ? 52 ASP A HB3  6  
ATOM   6549  N N    . PRO A 1 53 ? 2.135   3.217   2.899   1.00 4.54  ? 53 PRO A N    6  
ATOM   6550  C CA   . PRO A 1 53 ? 3.583   3.449   2.731   1.00 4.96  ? 53 PRO A CA   6  
ATOM   6551  C C    . PRO A 1 53 ? 4.264   3.684   4.091   1.00 5.21  ? 53 PRO A C    6  
ATOM   6552  O O    . PRO A 1 53 ? 5.474   3.795   4.168   1.00 5.67  ? 53 PRO A O    6  
ATOM   6553  C CB   . PRO A 1 53 ? 3.654   4.685   1.827   1.00 5.26  ? 53 PRO A CB   6  
ATOM   6554  C CG   . PRO A 1 53 ? 2.294   5.406   1.968   1.00 5.04  ? 53 PRO A CG   6  
ATOM   6555  C CD   . PRO A 1 53 ? 1.285   4.335   2.423   1.00 4.55  ? 53 PRO A CD   6  
ATOM   6556  H HA   . PRO A 1 53 ? 4.038   2.609   2.230   1.00 5.07  ? 53 PRO A HA   6  
ATOM   6557  H HB2  . PRO A 1 53 ? 4.458   5.334   2.150   1.00 5.72  ? 53 PRO A HB2  6  
ATOM   6558  H HB3  . PRO A 1 53 ? 3.804   4.388   0.801   1.00 5.40  ? 53 PRO A HB3  6  
ATOM   6559  H HG2  . PRO A 1 53 ? 2.367   6.192   2.708   1.00 5.39  ? 53 PRO A HG2  6  
ATOM   6560  H HG3  . PRO A 1 53 ? 1.990   5.814   1.018   1.00 5.11  ? 53 PRO A HG3  6  
ATOM   6561  H HD2  . PRO A 1 53 ? 0.668   4.715   3.226   1.00 4.78  ? 53 PRO A HD2  6  
ATOM   6562  H HD3  . PRO A 1 53 ? 0.675   4.012   1.593   1.00 4.27  ? 53 PRO A HD3  6  
ATOM   6563  N N    . LYS A 1 54 ? 3.498   3.739   5.165   1.00 5.18  ? 54 LYS A N    6  
ATOM   6564  C CA   . LYS A 1 54 ? 4.092   3.937   6.514   1.00 5.61  ? 54 LYS A CA   6  
ATOM   6565  C C    . LYS A 1 54 ? 5.054   2.787   6.829   1.00 5.02  ? 54 LYS A C    6  
ATOM   6566  O O    . LYS A 1 54 ? 6.031   2.970   7.532   1.00 5.42  ? 54 LYS A O    6  
ATOM   6567  C CB   . LYS A 1 54 ? 2.980   3.966   7.567   1.00 6.23  ? 54 LYS A CB   6  
ATOM   6568  C CG   . LYS A 1 54 ? 2.516   5.408   7.783   1.00 7.12  ? 54 LYS A CG   6  
ATOM   6569  C CD   . LYS A 1 54 ? 1.410   5.438   8.841   1.00 7.85  ? 54 LYS A CD   6  
ATOM   6570  C CE   . LYS A 1 54 ? 1.649   6.610   9.800   1.00 8.63  ? 54 LYS A CE   6  
ATOM   6571  N NZ   . LYS A 1 54 ? 0.958   7.829   9.286   1.00 9.56  ? 54 LYS A NZ   6  
ATOM   6572  H H    . LYS A 1 54 ? 2.535   3.638   5.085   1.00 5.07  ? 54 LYS A H    6  
ATOM   6573  H HA   . LYS A 1 54 ? 4.626   4.868   6.530   1.00 6.14  ? 54 LYS A HA   6  
ATOM   6574  H HB2  . LYS A 1 54 ? 2.149   3.365   7.228   1.00 6.01  ? 54 LYS A HB2  6  
ATOM   6575  H HB3  . LYS A 1 54 ? 3.356   3.568   8.496   1.00 6.42  ? 54 LYS A HB3  6  
ATOM   6576  H HG2  . LYS A 1 54 ? 3.350   6.009   8.114   1.00 7.47  ? 54 LYS A HG2  6  
ATOM   6577  H HG3  . LYS A 1 54 ? 2.133   5.806   6.855   1.00 7.15  ? 54 LYS A HG3  6  
ATOM   6578  H HD2  . LYS A 1 54 ? 0.452   5.558   8.356   1.00 8.02  ? 54 LYS A HD2  6  
ATOM   6579  H HD3  . LYS A 1 54 ? 1.418   4.513   9.398   1.00 7.93  ? 54 LYS A HD3  6  
ATOM   6580  H HE2  . LYS A 1 54 ? 1.259   6.361   10.775  1.00 8.78  ? 54 LYS A HE2  6  
ATOM   6581  H HE3  . LYS A 1 54 ? 2.708   6.802   9.876   1.00 8.58  ? 54 LYS A HE3  6  
ATOM   6582  H HZ1  . LYS A 1 54 ? 1.291   8.038   8.323   1.00 9.84  ? 54 LYS A HZ1  6  
ATOM   6583  H HZ2  . LYS A 1 54 ? -0.070  7.665   9.269   1.00 9.93  ? 54 LYS A HZ2  6  
ATOM   6584  H HZ3  . LYS A 1 54 ? 1.171   8.634   9.906   1.00 9.78  ? 54 LYS A HZ3  6  
ATOM   6585  N N    . GLU A 1 55 ? 4.797   1.604   6.308   1.00 4.37  ? 55 GLU A N    6  
ATOM   6586  C CA   . GLU A 1 55 ? 5.708   0.463   6.576   1.00 4.14  ? 55 GLU A CA   6  
ATOM   6587  C C    . GLU A 1 55 ? 6.871   0.512   5.593   1.00 3.84  ? 55 GLU A C    6  
ATOM   6588  O O    . GLU A 1 55 ? 6.823   1.191   4.582   1.00 3.83  ? 55 GLU A O    6  
ATOM   6589  C CB   . GLU A 1 55 ? 4.966   -0.859  6.381   1.00 4.19  ? 55 GLU A CB   6  
ATOM   6590  C CG   . GLU A 1 55 ? 3.891   -1.026  7.457   1.00 4.76  ? 55 GLU A CG   6  
ATOM   6591  C CD   . GLU A 1 55 ? 2.596   -0.336  7.011   1.00 5.39  ? 55 GLU A CD   6  
ATOM   6592  O OE1  . GLU A 1 55 ? 1.988   -0.813  6.066   1.00 5.43  ? 55 GLU A OE1  6  
ATOM   6593  O OE2  . GLU A 1 55 ? 2.235   0.658   7.621   1.00 6.13  ? 55 GLU A OE2  6  
ATOM   6594  H H    . GLU A 1 55 ? 4.012   1.469   5.733   1.00 4.29  ? 55 GLU A H    6  
ATOM   6595  H HA   . GLU A 1 55 ? 6.082   0.524   7.588   1.00 4.53  ? 55 GLU A HA   6  
ATOM   6596  H HB2  . GLU A 1 55 ? 4.510   -0.870  5.407   1.00 4.04  ? 55 GLU A HB2  6  
ATOM   6597  H HB3  . GLU A 1 55 ? 5.666   -1.669  6.453   1.00 4.32  ? 55 GLU A HB3  6  
ATOM   6598  H HG2  . GLU A 1 55 ? 3.703   -2.075  7.614   1.00 4.81  ? 55 GLU A HG2  6  
ATOM   6599  H HG3  . GLU A 1 55 ? 4.237   -0.589  8.376   1.00 4.98  ? 55 GLU A HG3  6  
ATOM   6600  N N    . ASN A 1 56 ? 7.902   -0.229  5.873   1.00 3.90  ? 56 ASN A N    6  
ATOM   6601  C CA   . ASN A 1 56 ? 9.070   -0.269  4.953   1.00 3.93  ? 56 ASN A CA   6  
ATOM   6602  C C    . ASN A 1 56 ? 8.889   -1.414  3.955   1.00 3.74  ? 56 ASN A C    6  
ATOM   6603  O O    . ASN A 1 56 ? 9.548   -1.462  2.935   1.00 3.89  ? 56 ASN A O    6  
ATOM   6604  C CB   . ASN A 1 56 ? 10.343  -0.485  5.755   1.00 4.29  ? 56 ASN A CB   6  
ATOM   6605  C CG   . ASN A 1 56 ? 11.242  0.752   5.640   1.00 4.70  ? 56 ASN A CG   6  
ATOM   6606  O OD1  . ASN A 1 56 ? 10.857  1.835   6.034   1.00 4.90  ? 56 ASN A OD1  6  
ATOM   6607  N ND2  . ASN A 1 56 ? 12.432  0.634   5.115   1.00 5.15  ? 56 ASN A ND2  6  
ATOM   6608  H H    . ASN A 1 56 ? 7.895   -0.782  6.681   1.00 4.12  ? 56 ASN A H    6  
ATOM   6609  H HA   . ASN A 1 56 ? 9.140   0.658   4.421   1.00 4.07  ? 56 ASN A HA   6  
ATOM   6610  H HB2  . ASN A 1 56 ? 10.085  -0.648  6.784   1.00 4.38  ? 56 ASN A HB2  6  
ATOM   6611  H HB3  . ASN A 1 56 ? 10.864  -1.343  5.369   1.00 4.36  ? 56 ASN A HB3  6  
ATOM   6612  H HD21 . ASN A 1 56 ? 12.746  -0.238  4.797   1.00 5.31  ? 56 ASN A HD21 6  
ATOM   6613  H HD22 . ASN A 1 56 ? 13.013  1.420   5.039   1.00 5.51  ? 56 ASN A HD22 6  
ATOM   6614  N N    . TRP A 1 57 ? 7.992   -2.333  4.235   1.00 3.55  ? 57 TRP A N    6  
ATOM   6615  C CA   . TRP A 1 57 ? 7.763   -3.459  3.307   1.00 3.47  ? 57 TRP A CA   6  
ATOM   6616  C C    . TRP A 1 57 ? 6.823   -3.015  2.190   1.00 3.28  ? 57 TRP A C    6  
ATOM   6617  O O    . TRP A 1 57 ? 6.994   -3.393  1.056   1.00 3.48  ? 57 TRP A O    6  
ATOM   6618  C CB   . TRP A 1 57 ? 7.189   -4.656  4.075   1.00 3.64  ? 57 TRP A CB   6  
ATOM   6619  C CG   . TRP A 1 57 ? 5.749   -4.471  4.420   1.00 3.70  ? 57 TRP A CG   6  
ATOM   6620  C CD1  . TRP A 1 57 ? 5.299   -4.107  5.628   1.00 4.08  ? 57 TRP A CD1  6  
ATOM   6621  C CD2  . TRP A 1 57 ? 4.570   -4.659  3.585   1.00 3.51  ? 57 TRP A CD2  6  
ATOM   6622  N NE1  . TRP A 1 57 ? 3.922   -4.083  5.604   1.00 4.20  ? 57 TRP A NE1  6  
ATOM   6623  C CE2  . TRP A 1 57 ? 3.425   -4.399  4.366   1.00 3.80  ? 57 TRP A CE2  6  
ATOM   6624  C CE3  . TRP A 1 57 ? 4.385   -5.025  2.244   1.00 3.27  ? 57 TRP A CE3  6  
ATOM   6625  C CZ2  . TRP A 1 57 ? 2.143   -4.499  3.842   1.00 3.76  ? 57 TRP A CZ2  6  
ATOM   6626  C CZ3  . TRP A 1 57 ? 3.094   -5.124  1.710   1.00 3.17  ? 57 TRP A CZ3  6  
ATOM   6627  C CH2  . TRP A 1 57 ? 1.974   -4.861  2.509   1.00 3.38  ? 57 TRP A CH2  6  
ATOM   6628  H H    . TRP A 1 57 ? 7.469   -2.276  5.052   1.00 3.59  ? 57 TRP A H    6  
ATOM   6629  H HA   . TRP A 1 57 ? 8.704   -3.740  2.878   1.00 3.59  ? 57 TRP A HA   6  
ATOM   6630  H HB2  . TRP A 1 57 ? 7.279   -5.533  3.482   1.00 3.77  ? 57 TRP A HB2  6  
ATOM   6631  H HB3  . TRP A 1 57 ? 7.755   -4.789  4.979   1.00 3.78  ? 57 TRP A HB3  6  
ATOM   6632  H HD1  . TRP A 1 57 ? 5.915   -3.885  6.477   1.00 4.35  ? 57 TRP A HD1  6  
ATOM   6633  H HE1  . TRP A 1 57 ? 3.354   -3.866  6.356   1.00 4.57  ? 57 TRP A HE1  6  
ATOM   6634  H HE3  . TRP A 1 57 ? 5.239   -5.230  1.622   1.00 3.29  ? 57 TRP A HE3  6  
ATOM   6635  H HZ2  . TRP A 1 57 ? 1.284   -4.294  4.465   1.00 4.10  ? 57 TRP A HZ2  6  
ATOM   6636  H HZ3  . TRP A 1 57 ? 2.963   -5.394  0.678   1.00 3.03  ? 57 TRP A HZ3  6  
ATOM   6637  H HH2  . TRP A 1 57 ? 0.983   -4.944  2.093   1.00 3.37  ? 57 TRP A HH2  6  
ATOM   6638  N N    . VAL A 1 58 ? 5.841   -2.205  2.499   1.00 3.02  ? 58 VAL A N    6  
ATOM   6639  C CA   . VAL A 1 58 ? 4.906   -1.726  1.434   1.00 2.84  ? 58 VAL A CA   6  
ATOM   6640  C C    . VAL A 1 58 ? 5.689   -0.865  0.437   1.00 2.99  ? 58 VAL A C    6  
ATOM   6641  O O    . VAL A 1 58 ? 5.510   -0.976  -0.761  1.00 3.21  ? 58 VAL A O    6  
ATOM   6642  C CB   . VAL A 1 58 ? 3.781   -0.894  2.069   1.00 2.78  ? 58 VAL A CB   6  
ATOM   6643  C CG1  . VAL A 1 58 ? 3.188   0.083   1.047   1.00 2.80  ? 58 VAL A CG1  6  
ATOM   6644  C CG2  . VAL A 1 58 ? 2.676   -1.819  2.568   1.00 2.85  ? 58 VAL A CG2  6  
ATOM   6645  H H    . VAL A 1 58 ? 5.727   -1.907  3.429   1.00 3.04  ? 58 VAL A H    6  
ATOM   6646  H HA   . VAL A 1 58 ? 4.486   -2.576  0.917   1.00 2.96  ? 58 VAL A HA   6  
ATOM   6647  H HB   . VAL A 1 58 ? 4.181   -0.342  2.898   1.00 3.12  ? 58 VAL A HB   6  
ATOM   6648  H HG11 . VAL A 1 58 ? 3.036   -0.427  0.106   1.00 3.10  ? 58 VAL A HG11 6  
ATOM   6649  H HG12 . VAL A 1 58 ? 2.242   0.455   1.411   1.00 2.86  ? 58 VAL A HG12 6  
ATOM   6650  H HG13 . VAL A 1 58 ? 3.868   0.910   0.903   1.00 3.08  ? 58 VAL A HG13 6  
ATOM   6651  H HG21 . VAL A 1 58 ? 2.582   -2.659  1.898   1.00 2.93  ? 58 VAL A HG21 6  
ATOM   6652  H HG22 . VAL A 1 58 ? 2.926   -2.172  3.556   1.00 3.15  ? 58 VAL A HG22 6  
ATOM   6653  H HG23 . VAL A 1 58 ? 1.742   -1.280  2.605   1.00 3.17  ? 58 VAL A HG23 6  
ATOM   6654  N N    . GLN A 1 59 ? 6.557   -0.010  0.923   1.00 3.12  ? 59 GLN A N    6  
ATOM   6655  C CA   . GLN A 1 59 ? 7.351   0.857   0.009   1.00 3.61  ? 59 GLN A CA   6  
ATOM   6656  C C    . GLN A 1 59 ? 8.426   0.026   -0.708  1.00 3.90  ? 59 GLN A C    6  
ATOM   6657  O O    . GLN A 1 59 ? 8.782   0.313   -1.835  1.00 4.47  ? 59 GLN A O    6  
ATOM   6658  C CB   . GLN A 1 59 ? 7.993   1.989   0.808   1.00 3.82  ? 59 GLN A CB   6  
ATOM   6659  C CG   . GLN A 1 59 ? 8.958   1.401   1.822   1.00 4.33  ? 59 GLN A CG   6  
ATOM   6660  C CD   . GLN A 1 59 ? 9.585   2.521   2.656   1.00 4.72  ? 59 GLN A CD   6  
ATOM   6661  O OE1  . GLN A 1 59 ? 9.006   2.968   3.627   1.00 4.84  ? 59 GLN A OE1  6  
ATOM   6662  N NE2  . GLN A 1 59 ? 10.755  2.996   2.319   1.00 5.29  ? 59 GLN A NE2  6  
ATOM   6663  H H    . GLN A 1 59 ? 6.687   0.059   1.892   1.00 3.04  ? 59 GLN A H    6  
ATOM   6664  H HA   . GLN A 1 59 ? 6.700   1.276   -0.722  1.00 3.80  ? 59 GLN A HA   6  
ATOM   6665  H HB2  . GLN A 1 59 ? 8.524   2.642   0.139   1.00 3.96  ? 59 GLN A HB2  6  
ATOM   6666  H HB3  . GLN A 1 59 ? 7.226   2.547   1.325   1.00 3.78  ? 59 GLN A HB3  6  
ATOM   6667  H HG2  . GLN A 1 59 ? 8.420   0.725   2.464   1.00 4.58  ? 59 GLN A HG2  6  
ATOM   6668  H HG3  . GLN A 1 59 ? 9.728   0.862   1.299   1.00 4.52  ? 59 GLN A HG3  6  
ATOM   6669  H HE21 . GLN A 1 59 ? 11.224  2.635   1.538   1.00 5.47  ? 59 GLN A HE21 6  
ATOM   6670  H HE22 . GLN A 1 59 ? 11.161  3.713   2.847   1.00 5.70  ? 59 GLN A HE22 6  
ATOM   6671  N N    . ARG A 1 60 ? 8.924   -1.016  -0.080  1.00 3.65  ? 60 ARG A N    6  
ATOM   6672  C CA   . ARG A 1 60 ? 9.950   -1.874  -0.744  1.00 3.97  ? 60 ARG A CA   6  
ATOM   6673  C C    . ARG A 1 60 ? 9.231   -2.817  -1.708  1.00 3.96  ? 60 ARG A C    6  
ATOM   6674  O O    . ARG A 1 60 ? 9.685   -3.057  -2.811  1.00 4.42  ? 60 ARG A O    6  
ATOM   6675  C CB   . ARG A 1 60 ? 10.710  -2.691  0.307   1.00 4.07  ? 60 ARG A CB   6  
ATOM   6676  C CG   . ARG A 1 60 ? 12.141  -2.945  -0.177  1.00 4.60  ? 60 ARG A CG   6  
ATOM   6677  C CD   . ARG A 1 60 ? 12.929  -3.693  0.903   1.00 4.81  ? 60 ARG A CD   6  
ATOM   6678  N NE   . ARG A 1 60 ? 13.374  -5.013  0.369   1.00 5.26  ? 60 ARG A NE   6  
ATOM   6679  C CZ   . ARG A 1 60 ? 14.577  -5.148  -0.129  1.00 5.84  ? 60 ARG A CZ   6  
ATOM   6680  N NH1  . ARG A 1 60 ? 15.606  -5.281  0.670   1.00 6.25  ? 60 ARG A NH1  6  
ATOM   6681  N NH2  . ARG A 1 60 ? 14.749  -5.148  -1.427  1.00 6.35  ? 60 ARG A NH2  6  
ATOM   6682  H H    . ARG A 1 60 ? 8.602   -1.246  0.816   1.00 3.35  ? 60 ARG A H    6  
ATOM   6683  H HA   . ARG A 1 60 ? 10.641  -1.251  -1.294  1.00 4.24  ? 60 ARG A HA   6  
ATOM   6684  H HB2  . ARG A 1 60 ? 10.736  -2.142  1.235   1.00 3.95  ? 60 ARG A HB2  6  
ATOM   6685  H HB3  . ARG A 1 60 ? 10.211  -3.635  0.463   1.00 4.07  ? 60 ARG A HB3  6  
ATOM   6686  H HG2  . ARG A 1 60 ? 12.114  -3.539  -1.081  1.00 4.80  ? 60 ARG A HG2  6  
ATOM   6687  H HG3  . ARG A 1 60 ? 12.623  -2.002  -0.382  1.00 4.99  ? 60 ARG A HG3  6  
ATOM   6688  H HD2  . ARG A 1 60 ? 13.793  -3.110  1.186   1.00 4.73  ? 60 ARG A HD2  6  
ATOM   6689  H HD3  . ARG A 1 60 ? 12.301  -3.848  1.769   1.00 5.10  ? 60 ARG A HD3  6  
ATOM   6690  H HE   . ARG A 1 60 ? 12.765  -5.780  0.390   1.00 5.37  ? 60 ARG A HE   6  
ATOM   6691  H HH11 . ARG A 1 60 ? 15.473  -5.279  1.662   1.00 6.14  ? 60 ARG A HH11 6  
ATOM   6692  H HH12 . ARG A 1 60 ? 16.526  -5.384  0.291   1.00 6.86  ? 60 ARG A HH12 6  
ATOM   6693  H HH21 . ARG A 1 60 ? 13.961  -5.046  -2.036  1.00 6.32  ? 60 ARG A HH21 6  
ATOM   6694  H HH22 . ARG A 1 60 ? 15.667  -5.252  -1.811  1.00 6.96  ? 60 ARG A HH22 6  
ATOM   6695  N N    . VAL A 1 61 ? 8.102   -3.338  -1.293  1.00 3.58  ? 61 VAL A N    6  
ATOM   6696  C CA   . VAL A 1 61 ? 7.313   -4.256  -2.166  1.00 3.55  ? 61 VAL A CA   6  
ATOM   6697  C C    . VAL A 1 61 ? 6.833   -3.489  -3.407  1.00 3.25  ? 61 VAL A C    6  
ATOM   6698  O O    . VAL A 1 61 ? 6.898   -3.990  -4.515  1.00 3.52  ? 61 VAL A O    6  
ATOM   6699  C CB   . VAL A 1 61 ? 6.108   -4.785  -1.369  1.00 3.59  ? 61 VAL A CB   6  
ATOM   6700  C CG1  . VAL A 1 61 ? 5.037   -5.329  -2.313  1.00 3.56  ? 61 VAL A CG1  6  
ATOM   6701  C CG2  . VAL A 1 61 ? 6.573   -5.905  -0.434  1.00 4.31  ? 61 VAL A CG2  6  
ATOM   6702  H H    . VAL A 1 61 ? 7.762   -3.115  -0.394  1.00 3.39  ? 61 VAL A H    6  
ATOM   6703  H HA   . VAL A 1 61 ? 7.936   -5.079  -2.476  1.00 3.93  ? 61 VAL A HA   6  
ATOM   6704  H HB   . VAL A 1 61 ? 5.689   -3.980  -0.782  1.00 3.40  ? 61 VAL A HB   6  
ATOM   6705  H HG11 . VAL A 1 61 ? 5.510   -5.752  -3.184  1.00 3.52  ? 61 VAL A HG11 6  
ATOM   6706  H HG12 . VAL A 1 61 ? 4.464   -6.090  -1.807  1.00 3.73  ? 61 VAL A HG12 6  
ATOM   6707  H HG13 . VAL A 1 61 ? 4.382   -4.523  -2.613  1.00 3.88  ? 61 VAL A HG13 6  
ATOM   6708  H HG21 . VAL A 1 61 ? 7.027   -6.694  -1.014  1.00 4.45  ? 61 VAL A HG21 6  
ATOM   6709  H HG22 . VAL A 1 61 ? 7.294   -5.511  0.267   1.00 4.58  ? 61 VAL A HG22 6  
ATOM   6710  H HG23 . VAL A 1 61 ? 5.725   -6.296  0.106   1.00 4.75  ? 61 VAL A HG23 6  
ATOM   6711  N N    . VAL A 1 62 ? 6.366   -2.276  -3.227  1.00 2.99  ? 62 VAL A N    6  
ATOM   6712  C CA   . VAL A 1 62 ? 5.892   -1.466  -4.390  1.00 3.22  ? 62 VAL A CA   6  
ATOM   6713  C C    . VAL A 1 62 ? 7.089   -1.129  -5.294  1.00 3.80  ? 62 VAL A C    6  
ATOM   6714  O O    . VAL A 1 62 ? 6.978   -1.147  -6.506  1.00 4.15  ? 62 VAL A O    6  
ATOM   6715  C CB   . VAL A 1 62 ? 5.232   -0.173  -3.877  1.00 3.53  ? 62 VAL A CB   6  
ATOM   6716  C CG1  . VAL A 1 62 ? 4.975   0.788   -5.042  1.00 4.40  ? 62 VAL A CG1  6  
ATOM   6717  C CG2  . VAL A 1 62 ? 3.897   -0.513  -3.204  1.00 3.34  ? 62 VAL A CG2  6  
ATOM   6718  H H    . VAL A 1 62 ? 6.336   -1.895  -2.324  1.00 2.92  ? 62 VAL A H    6  
ATOM   6719  H HA   . VAL A 1 62 ? 5.171   -2.040  -4.954  1.00 3.17  ? 62 VAL A HA   6  
ATOM   6720  H HB   . VAL A 1 62 ? 5.886   0.301   -3.159  1.00 3.69  ? 62 VAL A HB   6  
ATOM   6721  H HG11 . VAL A 1 62 ? 4.495   0.257   -5.851  1.00 4.91  ? 62 VAL A HG11 6  
ATOM   6722  H HG12 . VAL A 1 62 ? 4.334   1.592   -4.711  1.00 4.71  ? 62 VAL A HG12 6  
ATOM   6723  H HG13 . VAL A 1 62 ? 5.914   1.196   -5.386  1.00 4.59  ? 62 VAL A HG13 6  
ATOM   6724  H HG21 . VAL A 1 62 ? 3.989   -1.448  -2.672  1.00 3.53  ? 62 VAL A HG21 6  
ATOM   6725  H HG22 . VAL A 1 62 ? 3.635   0.272   -2.510  1.00 3.11  ? 62 VAL A HG22 6  
ATOM   6726  H HG23 . VAL A 1 62 ? 3.125   -0.601  -3.956  1.00 3.80  ? 62 VAL A HG23 6  
ATOM   6727  N N    . GLU A 1 63 ? 8.229   -0.829  -4.713  1.00 4.04  ? 63 GLU A N    6  
ATOM   6728  C CA   . GLU A 1 63 ? 9.431   -0.500  -5.530  1.00 4.68  ? 63 GLU A CA   6  
ATOM   6729  C C    . GLU A 1 63 ? 9.913   -1.749  -6.275  1.00 4.70  ? 63 GLU A C    6  
ATOM   6730  O O    . GLU A 1 63 ? 10.227  -1.688  -7.446  1.00 5.23  ? 63 GLU A O    6  
ATOM   6731  C CB   . GLU A 1 63 ? 10.549  0.018   -4.619  1.00 5.11  ? 63 GLU A CB   6  
ATOM   6732  C CG   . GLU A 1 63 ? 10.422  1.536   -4.461  1.00 5.73  ? 63 GLU A CG   6  
ATOM   6733  C CD   . GLU A 1 63 ? 11.405  2.026   -3.393  1.00 6.00  ? 63 GLU A CD   6  
ATOM   6734  O OE1  . GLU A 1 63 ? 11.066  1.955   -2.223  1.00 6.46  ? 63 GLU A OE1  6  
ATOM   6735  O OE2  . GLU A 1 63 ? 12.481  2.465   -3.764  1.00 6.04  ? 63 GLU A OE2  6  
ATOM   6736  H H    . GLU A 1 63 ? 8.295   -0.821  -3.742  1.00 3.89  ? 63 GLU A H    6  
ATOM   6737  H HA   . GLU A 1 63 ? 9.168   0.260   -6.243  1.00 5.00  ? 63 GLU A HA   6  
ATOM   6738  H HB2  . GLU A 1 63 ? 10.472  -0.454  -3.650  1.00 4.92  ? 63 GLU A HB2  6  
ATOM   6739  H HB3  . GLU A 1 63 ? 11.507  -0.217  -5.057  1.00 5.36  ? 63 GLU A HB3  6  
ATOM   6740  H HG2  . GLU A 1 63 ? 10.645  2.015   -5.404  1.00 5.98  ? 63 GLU A HG2  6  
ATOM   6741  H HG3  . GLU A 1 63 ? 9.415   1.784   -4.160  1.00 6.04  ? 63 GLU A HG3  6  
ATOM   6742  N N    . LYS A 1 64 ? 9.974   -2.881  -5.608  1.00 4.35  ? 64 LYS A N    6  
ATOM   6743  C CA   . LYS A 1 64 ? 10.432  -4.129  -6.283  1.00 4.71  ? 64 LYS A CA   6  
ATOM   6744  C C    . LYS A 1 64 ? 9.435   -4.521  -7.381  1.00 4.54  ? 64 LYS A C    6  
ATOM   6745  O O    . LYS A 1 64 ? 9.814   -5.046  -8.411  1.00 5.00  ? 64 LYS A O    6  
ATOM   6746  C CB   . LYS A 1 64 ? 10.535  -5.261  -5.256  1.00 4.74  ? 64 LYS A CB   6  
ATOM   6747  C CG   . LYS A 1 64 ? 11.711  -6.175  -5.616  1.00 5.62  ? 64 LYS A CG   6  
ATOM   6748  C CD   . LYS A 1 64 ? 12.158  -6.951  -4.374  1.00 6.24  ? 64 LYS A CD   6  
ATOM   6749  C CE   . LYS A 1 64 ? 11.229  -8.149  -4.154  1.00 7.07  ? 64 LYS A CE   6  
ATOM   6750  N NZ   . LYS A 1 64 ? 12.004  -9.282  -3.571  1.00 7.79  ? 64 LYS A NZ   6  
ATOM   6751  H H    . LYS A 1 64 ? 9.718   -2.910  -4.666  1.00 4.03  ? 64 LYS A H    6  
ATOM   6752  H HA   . LYS A 1 64 ? 11.399  -3.954  -6.719  1.00 5.26  ? 64 LYS A HA   6  
ATOM   6753  H HB2  . LYS A 1 64 ? 10.693  -4.842  -4.273  1.00 4.73  ? 64 LYS A HB2  6  
ATOM   6754  H HB3  . LYS A 1 64 ? 9.623   -5.837  -5.260  1.00 4.49  ? 64 LYS A HB3  6  
ATOM   6755  H HG2  . LYS A 1 64 ? 11.404  -6.869  -6.385  1.00 6.07  ? 64 LYS A HG2  6  
ATOM   6756  H HG3  . LYS A 1 64 ? 12.534  -5.577  -5.979  1.00 5.69  ? 64 LYS A HG3  6  
ATOM   6757  H HD2  . LYS A 1 64 ? 13.171  -7.300  -4.514  1.00 6.22  ? 64 LYS A HD2  6  
ATOM   6758  H HD3  . LYS A 1 64 ? 12.117  -6.304  -3.510  1.00 6.45  ? 64 LYS A HD3  6  
ATOM   6759  H HE2  . LYS A 1 64 ? 10.436  -7.870  -3.475  1.00 7.40  ? 64 LYS A HE2  6  
ATOM   6760  H HE3  . LYS A 1 64 ? 10.802  -8.452  -5.098  1.00 7.09  ? 64 LYS A HE3  6  
ATOM   6761  H HZ1  . LYS A 1 64 ? 12.449  -8.977  -2.681  1.00 8.07  ? 64 LYS A HZ1  6  
ATOM   6762  H HZ2  . LYS A 1 64 ? 11.365  -10.080 -3.384  1.00 7.96  ? 64 LYS A HZ2  6  
ATOM   6763  H HZ3  . LYS A 1 64 ? 12.740  -9.582  -4.243  1.00 8.09  ? 64 LYS A HZ3  6  
ATOM   6764  N N    . PHE A 1 65 ? 8.164   -4.265  -7.167  1.00 4.02  ? 65 PHE A N    6  
ATOM   6765  C CA   . PHE A 1 65 ? 7.135   -4.612  -8.189  1.00 3.99  ? 65 PHE A CA   6  
ATOM   6766  C C    . PHE A 1 65 ? 7.243   -3.647  -9.376  1.00 4.72  ? 65 PHE A C    6  
ATOM   6767  O O    . PHE A 1 65 ? 7.252   -4.062  -10.521 1.00 5.31  ? 65 PHE A O    6  
ATOM   6768  C CB   . PHE A 1 65 ? 5.748   -4.489  -7.554  1.00 3.16  ? 65 PHE A CB   6  
ATOM   6769  C CG   . PHE A 1 65 ? 4.746   -5.298  -8.343  1.00 3.02  ? 65 PHE A CG   6  
ATOM   6770  C CD1  . PHE A 1 65 ? 4.843   -6.695  -8.382  1.00 2.97  ? 65 PHE A CD1  6  
ATOM   6771  C CD2  . PHE A 1 65 ? 3.717   -4.649  -9.034  1.00 3.45  ? 65 PHE A CD2  6  
ATOM   6772  C CE1  . PHE A 1 65 ? 3.912   -7.440  -9.115  1.00 3.10  ? 65 PHE A CE1  6  
ATOM   6773  C CE2  . PHE A 1 65 ? 2.785   -5.394  -9.765  1.00 3.48  ? 65 PHE A CE2  6  
ATOM   6774  C CZ   . PHE A 1 65 ? 2.882   -6.789  -9.806  1.00 3.19  ? 65 PHE A CZ   6  
ATOM   6775  H H    . PHE A 1 65 ? 7.885   -3.838  -6.329  1.00 3.77  ? 65 PHE A H    6  
ATOM   6776  H HA   . PHE A 1 65 ? 7.289   -5.625  -8.529  1.00 4.30  ? 65 PHE A HA   6  
ATOM   6777  H HB2  . PHE A 1 65 ? 5.788   -4.853  -6.540  1.00 2.82  ? 65 PHE A HB2  6  
ATOM   6778  H HB3  . PHE A 1 65 ? 5.450   -3.453  -7.548  1.00 3.27  ? 65 PHE A HB3  6  
ATOM   6779  H HD1  . PHE A 1 65 ? 5.638   -7.197  -7.849  1.00 3.21  ? 65 PHE A HD1  6  
ATOM   6780  H HD2  . PHE A 1 65 ? 3.643   -3.573  -9.001  1.00 4.00  ? 65 PHE A HD2  6  
ATOM   6781  H HE1  . PHE A 1 65 ? 3.986   -8.515  -9.145  1.00 3.46  ? 65 PHE A HE1  6  
ATOM   6782  H HE2  . PHE A 1 65 ? 1.991   -4.891  -10.297 1.00 4.01  ? 65 PHE A HE2  6  
ATOM   6783  H HZ   . PHE A 1 65 ? 2.164   -7.365  -10.371 1.00 3.41  ? 65 PHE A HZ   6  
ATOM   6784  N N    . LEU A 1 66 ? 7.322   -2.365  -9.106  1.00 4.92  ? 66 LEU A N    6  
ATOM   6785  C CA   . LEU A 1 66 ? 7.430   -1.360  -10.210 1.00 5.86  ? 66 LEU A CA   6  
ATOM   6786  C C    . LEU A 1 66 ? 8.784   -1.508  -10.919 1.00 6.61  ? 66 LEU A C    6  
ATOM   6787  O O    . LEU A 1 66 ? 8.851   -1.549  -12.133 1.00 7.33  ? 66 LEU A O    6  
ATOM   6788  C CB   . LEU A 1 66 ? 7.303   0.053   -9.630  1.00 6.18  ? 66 LEU A CB   6  
ATOM   6789  C CG   . LEU A 1 66 ? 6.940   1.041   -10.744 1.00 7.14  ? 66 LEU A CG   6  
ATOM   6790  C CD1  . LEU A 1 66 ? 5.425   1.259   -10.764 1.00 7.61  ? 66 LEU A CD1  6  
ATOM   6791  C CD2  . LEU A 1 66 ? 7.644   2.376   -10.492 1.00 7.67  ? 66 LEU A CD2  6  
ATOM   6792  H H    . LEU A 1 66 ? 7.312   -2.063  -8.171  1.00 4.58  ? 66 LEU A H    6  
ATOM   6793  H HA   . LEU A 1 66 ? 6.634   -1.527  -10.922 1.00 6.03  ? 66 LEU A HA   6  
ATOM   6794  H HB2  . LEU A 1 66 ? 6.531   0.063   -8.874  1.00 5.67  ? 66 LEU A HB2  6  
ATOM   6795  H HB3  . LEU A 1 66 ? 8.243   0.344   -9.185  1.00 6.42  ? 66 LEU A HB3  6  
ATOM   6796  H HG   . LEU A 1 66 ? 7.256   0.639   -11.697 1.00 7.39  ? 66 LEU A HG   6  
ATOM   6797  H HD11 . LEU A 1 66 ? 5.095   1.580   -9.787  1.00 8.02  ? 66 LEU A HD11 6  
ATOM   6798  H HD12 . LEU A 1 66 ? 5.180   2.017   -11.494 1.00 7.94  ? 66 LEU A HD12 6  
ATOM   6799  H HD13 . LEU A 1 66 ? 4.931   0.335   -11.025 1.00 7.49  ? 66 LEU A HD13 6  
ATOM   6800  H HD21 . LEU A 1 66 ? 7.541   2.647   -9.452  1.00 7.84  ? 66 LEU A HD21 6  
ATOM   6801  H HD22 . LEU A 1 66 ? 8.692   2.283   -10.737 1.00 7.67  ? 66 LEU A HD22 6  
ATOM   6802  H HD23 . LEU A 1 66 ? 7.198   3.142   -11.108 1.00 8.14  ? 66 LEU A HD23 6  
ATOM   6803  N N    . LYS A 1 67 ? 9.858   -1.594  -10.170 1.00 6.57  ? 67 LYS A N    6  
ATOM   6804  C CA   . LYS A 1 67 ? 11.208  -1.746  -10.800 1.00 7.47  ? 67 LYS A CA   6  
ATOM   6805  C C    . LYS A 1 67 ? 11.380  -3.184  -11.310 1.00 7.85  ? 67 LYS A C    6  
ATOM   6806  O O    . LYS A 1 67 ? 10.613  -4.066  -10.968 1.00 8.14  ? 67 LYS A O    6  
ATOM   6807  C CB   . LYS A 1 67 ? 12.300  -1.437  -9.767  1.00 7.84  ? 67 LYS A CB   6  
ATOM   6808  C CG   . LYS A 1 67 ? 12.367  0.074   -9.521  1.00 8.78  ? 67 LYS A CG   6  
ATOM   6809  C CD   . LYS A 1 67 ? 13.431  0.699   -10.431 1.00 9.42  ? 67 LYS A CD   6  
ATOM   6810  C CE   . LYS A 1 67 ? 14.737  0.881   -9.650  1.00 10.12 ? 67 LYS A CE   6  
ATOM   6811  N NZ   . LYS A 1 67 ? 15.887  0.927   -10.598 1.00 10.40 ? 67 LYS A NZ   6  
ATOM   6812  H H    . LYS A 1 67 ? 9.777   -1.563  -9.192  1.00 6.04  ? 67 LYS A H    6  
ATOM   6813  H HA   . LYS A 1 67 ? 11.296  -1.059  -11.630 1.00 7.85  ? 67 LYS A HA   6  
ATOM   6814  H HB2  . LYS A 1 67 ? 12.072  -1.944  -8.840  1.00 7.78  ? 67 LYS A HB2  6  
ATOM   6815  H HB3  . LYS A 1 67 ? 13.254  -1.782  -10.138 1.00 7.75  ? 67 LYS A HB3  6  
ATOM   6816  H HG2  . LYS A 1 67 ? 11.405  0.517   -9.736  1.00 9.30  ? 67 LYS A HG2  6  
ATOM   6817  H HG3  . LYS A 1 67 ? 12.625  0.259   -8.489  1.00 8.71  ? 67 LYS A HG3  6  
ATOM   6818  H HD2  . LYS A 1 67 ? 13.605  0.051   -11.278 1.00 9.58  ? 67 LYS A HD2  6  
ATOM   6819  H HD3  . LYS A 1 67 ? 13.086  1.661   -10.778 1.00 9.47  ? 67 LYS A HD3  6  
ATOM   6820  H HE2  . LYS A 1 67 ? 14.695  1.804   -9.090  1.00 10.35 ? 67 LYS A HE2  6  
ATOM   6821  H HE3  . LYS A 1 67 ? 14.866  0.053   -8.967  1.00 10.41 ? 67 LYS A HE3  6  
ATOM   6822  H HZ1  . LYS A 1 67 ? 15.756  1.712   -11.266 1.00 10.60 ? 67 LYS A HZ1  6  
ATOM   6823  H HZ2  . LYS A 1 67 ? 16.769  1.071   -10.066 1.00 10.51 ? 67 LYS A HZ2  6  
ATOM   6824  H HZ3  . LYS A 1 67 ? 15.942  0.029   -11.122 1.00 10.49 ? 67 LYS A HZ3  6  
ATOM   6825  N N    . ARG A 1 68 ? 12.384  -3.418  -12.131 1.00 8.12  ? 68 ARG A N    6  
ATOM   6826  C CA   . ARG A 1 68 ? 12.636  -4.792  -12.685 1.00 8.78  ? 68 ARG A CA   6  
ATOM   6827  C C    . ARG A 1 68 ? 11.495  -5.204  -13.630 1.00 8.99  ? 68 ARG A C    6  
ATOM   6828  O O    . ARG A 1 68 ? 10.464  -4.557  -13.698 1.00 8.81  ? 68 ARG A O    6  
ATOM   6829  C CB   . ARG A 1 68 ? 12.757  -5.813  -11.543 1.00 9.33  ? 68 ARG A CB   6  
ATOM   6830  C CG   . ARG A 1 68 ? 13.842  -5.362  -10.560 1.00 9.61  ? 68 ARG A CG   6  
ATOM   6831  C CD   . ARG A 1 68 ? 14.134  -6.484  -9.561  1.00 10.05 ? 68 ARG A CD   6  
ATOM   6832  N NE   . ARG A 1 68 ? 14.787  -5.913  -8.348  1.00 10.53 ? 68 ARG A NE   6  
ATOM   6833  C CZ   . ARG A 1 68 ? 16.091  -5.911  -8.245  1.00 10.90 ? 68 ARG A CZ   6  
ATOM   6834  N NH1  . ARG A 1 68 ? 16.786  -4.924  -8.754  1.00 11.35 ? 68 ARG A NH1  6  
ATOM   6835  N NH2  . ARG A 1 68 ? 16.699  -6.896  -7.634  1.00 11.02 ? 68 ARG A NH2  6  
ATOM   6836  H H    . ARG A 1 68 ? 12.980  -2.682  -12.385 1.00 8.08  ? 68 ARG A H    6  
ATOM   6837  H HA   . ARG A 1 68 ? 13.562  -4.778  -13.243 1.00 9.01  ? 68 ARG A HA   6  
ATOM   6838  H HB2  . ARG A 1 68 ? 11.812  -5.891  -11.026 1.00 9.69  ? 68 ARG A HB2  6  
ATOM   6839  H HB3  . ARG A 1 68 ? 13.023  -6.777  -11.950 1.00 9.41  ? 68 ARG A HB3  6  
ATOM   6840  H HG2  . ARG A 1 68 ? 14.744  -5.121  -11.106 1.00 9.48  ? 68 ARG A HG2  6  
ATOM   6841  H HG3  . ARG A 1 68 ? 13.501  -4.487  -10.025 1.00 9.87  ? 68 ARG A HG3  6  
ATOM   6842  H HD2  . ARG A 1 68 ? 13.209  -6.965  -9.280  1.00 10.14 ? 68 ARG A HD2  6  
ATOM   6843  H HD3  . ARG A 1 68 ? 14.793  -7.208  -10.018 1.00 10.14 ? 68 ARG A HD3  6  
ATOM   6844  H HE   . ARG A 1 68 ? 14.238  -5.538  -7.627  1.00 10.72 ? 68 ARG A HE   6  
ATOM   6845  H HH11 . ARG A 1 68 ? 16.320  -4.172  -9.221  1.00 11.42 ? 68 ARG A HH11 6  
ATOM   6846  H HH12 . ARG A 1 68 ? 17.784  -4.921  -8.675  1.00 11.76 ? 68 ARG A HH12 6  
ATOM   6847  H HH21 . ARG A 1 68 ? 16.167  -7.648  -7.247  1.00 10.82 ? 68 ARG A HH21 6  
ATOM   6848  H HH22 . ARG A 1 68 ? 17.696  -6.896  -7.554  1.00 11.44 ? 68 ARG A HH22 6  
ATOM   6849  N N    . ALA A 1 69 ? 11.679  -6.275  -14.366 1.00 9.61  ? 69 ALA A N    6  
ATOM   6850  C CA   . ALA A 1 69 ? 10.617  -6.735  -15.314 1.00 10.14 ? 69 ALA A CA   6  
ATOM   6851  C C    . ALA A 1 69 ? 9.853   -7.924  -14.715 1.00 10.89 ? 69 ALA A C    6  
ATOM   6852  O O    . ALA A 1 69 ? 10.296  -8.545  -13.766 1.00 11.20 ? 69 ALA A O    6  
ATOM   6853  C CB   . ALA A 1 69 ? 11.266  -7.163  -16.634 1.00 10.08 ? 69 ALA A CB   6  
ATOM   6854  H H    . ALA A 1 69 ? 12.520  -6.775  -14.297 1.00 9.89  ? 69 ALA A H    6  
ATOM   6855  H HA   . ALA A 1 69 ? 9.928   -5.925  -15.503 1.00 10.27 ? 69 ALA A HA   6  
ATOM   6856  H HB1  . ALA A 1 69 ? 12.075  -6.490  -16.874 1.00 10.18 ? 69 ALA A HB1  6  
ATOM   6857  H HB2  . ALA A 1 69 ? 11.651  -8.168  -16.537 1.00 10.12 ? 69 ALA A HB2  6  
ATOM   6858  H HB3  . ALA A 1 69 ? 10.529  -7.136  -17.423 1.00 10.12 ? 69 ALA A HB3  6  
ATOM   6859  N N    . GLU A 1 70 ? 8.706   -8.241  -15.270 1.00 11.37 ? 70 GLU A N    6  
ATOM   6860  C CA   . GLU A 1 70 ? 7.900   -9.390  -14.750 1.00 12.24 ? 70 GLU A CA   6  
ATOM   6861  C C    . GLU A 1 70 ? 7.263   -10.151 -15.922 1.00 12.45 ? 70 GLU A C    6  
ATOM   6862  O O    . GLU A 1 70 ? 7.159   -9.643  -17.023 1.00 12.32 ? 70 GLU A O    6  
ATOM   6863  C CB   . GLU A 1 70 ? 6.798   -8.872  -13.812 1.00 12.79 ? 70 GLU A CB   6  
ATOM   6864  C CG   . GLU A 1 70 ? 6.025   -7.730  -14.483 1.00 12.48 ? 70 GLU A CG   6  
ATOM   6865  C CD   . GLU A 1 70 ? 4.677   -7.534  -13.780 1.00 13.18 ? 70 GLU A CD   6  
ATOM   6866  O OE1  . GLU A 1 70 ? 4.680   -7.106  -12.635 1.00 13.63 ? 70 GLU A OE1  6  
ATOM   6867  O OE2  . GLU A 1 70 ? 3.663   -7.812  -14.399 1.00 13.39 ? 70 GLU A OE2  6  
ATOM   6868  H H    . GLU A 1 70 ? 8.376   -7.724  -16.035 1.00 11.26 ? 70 GLU A H    6  
ATOM   6869  H HA   . GLU A 1 70 ? 8.547   -10.060 -14.203 1.00 12.53 ? 70 GLU A HA   6  
ATOM   6870  H HB2  . GLU A 1 70 ? 6.119   -9.679  -13.580 1.00 13.03 ? 70 GLU A HB2  6  
ATOM   6871  H HB3  . GLU A 1 70 ? 7.248   -8.510  -12.899 1.00 13.32 ? 70 GLU A HB3  6  
ATOM   6872  H HG2  . GLU A 1 70 ? 6.601   -6.818  -14.415 1.00 12.20 ? 70 GLU A HG2  6  
ATOM   6873  H HG3  . GLU A 1 70 ? 5.855   -7.971  -15.521 1.00 12.23 ? 70 GLU A HG3  6  
ATOM   6874  N N    . ASN A 1 71 ? 6.838   -11.369 -15.687 1.00 12.96 ? 71 ASN A N    6  
ATOM   6875  C CA   . ASN A 1 71 ? 6.209   -12.177 -16.775 1.00 13.39 ? 71 ASN A CA   6  
ATOM   6876  C C    . ASN A 1 71 ? 4.690   -11.960 -16.759 1.00 13.77 ? 71 ASN A C    6  
ATOM   6877  O O    . ASN A 1 71 ? 4.108   -11.534 -17.739 1.00 13.98 ? 71 ASN A O    6  
ATOM   6878  C CB   . ASN A 1 71 ? 6.519   -13.663 -16.558 1.00 13.14 ? 71 ASN A CB   6  
ATOM   6879  C CG   . ASN A 1 71 ? 8.037   -13.876 -16.528 1.00 12.70 ? 71 ASN A CG   6  
ATOM   6880  O OD1  . ASN A 1 71 ? 8.601   -14.152 -15.488 1.00 12.77 ? 71 ASN A OD1  6  
ATOM   6881  N ND2  . ASN A 1 71 ? 8.727   -13.756 -17.631 1.00 12.41 ? 71 ASN A ND2  6  
ATOM   6882  H H    . ASN A 1 71 ? 6.934   -11.754 -14.791 1.00 13.17 ? 71 ASN A H    6  
ATOM   6883  H HA   . ASN A 1 71 ? 6.605   -11.863 -17.731 1.00 13.80 ? 71 ASN A HA   6  
ATOM   6884  H HB2  . ASN A 1 71 ? 6.093   -13.986 -15.619 1.00 13.36 ? 71 ASN A HB2  6  
ATOM   6885  H HB3  . ASN A 1 71 ? 6.094   -14.243 -17.364 1.00 13.26 ? 71 ASN A HB3  6  
ATOM   6886  H HD21 . ASN A 1 71 ? 8.274   -13.532 -18.472 1.00 12.47 ? 71 ASN A HD21 6  
ATOM   6887  H HD22 . ASN A 1 71 ? 9.698   -13.888 -17.618 1.00 12.23 ? 71 ASN A HD22 6  
ATOM   6888  N N    . SER A 1 72 ? 4.049   -12.249 -15.650 1.00 14.02 ? 72 SER A N    6  
ATOM   6889  C CA   . SER A 1 72 ? 2.568   -12.061 -15.558 1.00 14.59 ? 72 SER A CA   6  
ATOM   6890  C C    . SER A 1 72 ? 2.253   -10.808 -14.730 1.00 15.09 ? 72 SER A C    6  
ATOM   6891  O O    . SER A 1 72 ? 2.867   -10.630 -13.688 1.00 15.38 ? 72 SER A O    6  
ATOM   6892  C CB   . SER A 1 72 ? 1.935   -13.290 -14.894 1.00 14.66 ? 72 SER A CB   6  
ATOM   6893  O OG   . SER A 1 72 ? 2.641   -13.603 -13.698 1.00 14.60 ? 72 SER A OG   6  
ATOM   6894  O OXT  . SER A 1 72 ? 1.399   -10.044 -15.152 1.00 15.30 ? 72 SER A OXT  6  
ATOM   6895  H H    . SER A 1 72 ? 4.544   -12.588 -14.875 1.00 13.94 ? 72 SER A H    6  
ATOM   6896  H HA   . SER A 1 72 ? 2.159   -11.944 -16.552 1.00 14.77 ? 72 SER A HA   6  
ATOM   6897  H HB2  . SER A 1 72 ? 0.907   -13.081 -14.652 1.00 14.69 ? 72 SER A HB2  6  
ATOM   6898  H HB3  . SER A 1 72 ? 1.976   -14.128 -15.578 1.00 14.91 ? 72 SER A HB3  6  
ATOM   6899  H HG   . SER A 1 72 ? 3.216   -14.351 -13.879 1.00 14.50 ? 72 SER A HG   6  
ATOM   6900  N N    . GLU A 1 4  ? -9.851  16.227  -10.121 1.00 9.58  ? 4  GLU A N    7  
ATOM   6901  C CA   . GLU A 1 4  ? -9.162  15.715  -8.896  1.00 9.09  ? 4  GLU A CA   7  
ATOM   6902  C C    . GLU A 1 4  ? -9.790  14.383  -8.462  1.00 8.06  ? 4  GLU A C    7  
ATOM   6903  O O    . GLU A 1 4  ? -10.883 14.037  -8.876  1.00 8.10  ? 4  GLU A O    7  
ATOM   6904  C CB   . GLU A 1 4  ? -9.308  16.735  -7.761  1.00 9.77  ? 4  GLU A CB   7  
ATOM   6905  C CG   . GLU A 1 4  ? -8.231  17.817  -7.897  1.00 10.24 ? 4  GLU A CG   7  
ATOM   6906  C CD   . GLU A 1 4  ? -8.846  19.083  -8.501  1.00 11.04 ? 4  GLU A CD   7  
ATOM   6907  O OE1  . GLU A 1 4  ? -9.416  19.859  -7.749  1.00 11.36 ? 4  GLU A OE1  7  
ATOM   6908  O OE2  . GLU A 1 4  ? -8.737  19.257  -9.704  1.00 11.49 ? 4  GLU A OE2  7  
ATOM   6909  H H    . GLU A 1 4  ? -9.796  15.509  -10.874 1.00 9.89  ? 4  GLU A H    7  
ATOM   6910  H HA   . GLU A 1 4  ? -8.115  15.565  -9.111  1.00 9.22  ? 4  GLU A HA   7  
ATOM   6911  H HB2  . GLU A 1 4  ? -10.287 17.191  -7.811  1.00 9.96  ? 4  GLU A HB2  7  
ATOM   6912  H HB3  . GLU A 1 4  ? -9.193  16.235  -6.812  1.00 9.97  ? 4  GLU A HB3  7  
ATOM   6913  H HG2  . GLU A 1 4  ? -7.824  18.043  -6.923  1.00 10.27 ? 4  GLU A HG2  7  
ATOM   6914  H HG3  . GLU A 1 4  ? -7.441  17.461  -8.542  1.00 10.19 ? 4  GLU A HG3  7  
ATOM   6915  N N    . LEU A 1 5  ? -9.109  13.642  -7.621  1.00 7.36  ? 5  LEU A N    7  
ATOM   6916  C CA   . LEU A 1 5  ? -9.658  12.334  -7.143  1.00 6.53  ? 5  LEU A CA   7  
ATOM   6917  C C    . LEU A 1 5  ? -9.528  12.256  -5.618  1.00 6.17  ? 5  LEU A C    7  
ATOM   6918  O O    . LEU A 1 5  ? -8.446  12.369  -5.075  1.00 6.61  ? 5  LEU A O    7  
ATOM   6919  C CB   . LEU A 1 5  ? -8.892  11.169  -7.792  1.00 6.34  ? 5  LEU A CB   7  
ATOM   6920  C CG   . LEU A 1 5  ? -7.384  11.314  -7.541  1.00 7.26  ? 5  LEU A CG   7  
ATOM   6921  C CD1  . LEU A 1 5  ? -6.911  10.204  -6.597  1.00 7.60  ? 5  LEU A CD1  7  
ATOM   6922  C CD2  . LEU A 1 5  ? -6.634  11.205  -8.872  1.00 7.86  ? 5  LEU A CD2  7  
ATOM   6923  H H    . LEU A 1 5  ? -8.234  13.949  -7.298  1.00 7.57  ? 5  LEU A H    7  
ATOM   6924  H HA   . LEU A 1 5  ? -10.702 12.267  -7.413  1.00 6.63  ? 5  LEU A HA   7  
ATOM   6925  H HB2  . LEU A 1 5  ? -9.236  10.237  -7.369  1.00 5.88  ? 5  LEU A HB2  7  
ATOM   6926  H HB3  . LEU A 1 5  ? -9.079  11.168  -8.855  1.00 6.33  ? 5  LEU A HB3  7  
ATOM   6927  H HG   . LEU A 1 5  ? -7.184  12.275  -7.091  1.00 7.52  ? 5  LEU A HG   7  
ATOM   6928  H HD11 . LEU A 1 5  ? -7.687  9.990   -5.877  1.00 7.24  ? 5  LEU A HD11 7  
ATOM   6929  H HD12 . LEU A 1 5  ? -6.694  9.313   -7.167  1.00 7.97  ? 5  LEU A HD12 7  
ATOM   6930  H HD13 . LEU A 1 5  ? -6.020  10.527  -6.081  1.00 8.07  ? 5  LEU A HD13 7  
ATOM   6931  H HD21 . LEU A 1 5  ? -6.930  10.300  -9.380  1.00 8.35  ? 5  LEU A HD21 7  
ATOM   6932  H HD22 . LEU A 1 5  ? -6.873  12.059  -9.489  1.00 7.79  ? 5  LEU A HD22 7  
ATOM   6933  H HD23 . LEU A 1 5  ? -5.571  11.183  -8.685  1.00 8.13  ? 5  LEU A HD23 7  
ATOM   6934  N N    . ARG A 1 6  ? -10.623 12.062  -4.923  1.00 5.61  ? 6  ARG A N    7  
ATOM   6935  C CA   . ARG A 1 6  ? -10.571 11.978  -3.431  1.00 5.48  ? 6  ARG A CA   7  
ATOM   6936  C C    . ARG A 1 6  ? -9.777  10.738  -3.000  1.00 4.69  ? 6  ARG A C    7  
ATOM   6937  O O    . ARG A 1 6  ? -9.345  9.944   -3.819  1.00 4.64  ? 6  ARG A O    7  
ATOM   6938  C CB   . ARG A 1 6  ? -11.996 11.883  -2.877  1.00 6.06  ? 6  ARG A CB   7  
ATOM   6939  C CG   . ARG A 1 6  ? -12.654 13.265  -2.894  1.00 6.84  ? 6  ARG A CG   7  
ATOM   6940  C CD   . ARG A 1 6  ? -13.626 13.383  -1.717  1.00 7.76  ? 6  ARG A CD   7  
ATOM   6941  N NE   . ARG A 1 6  ? -13.987 14.814  -1.504  1.00 8.57  ? 6  ARG A NE   7  
ATOM   6942  C CZ   . ARG A 1 6  ? -13.138 15.628  -0.933  1.00 9.27  ? 6  ARG A CZ   7  
ATOM   6943  N NH1  . ARG A 1 6  ? -12.999 15.620  0.369   1.00 9.70  ? 6  ARG A NH1  7  
ATOM   6944  N NH2  . ARG A 1 6  ? -12.428 16.450  -1.664  1.00 9.77  ? 6  ARG A NH2  7  
ATOM   6945  H H    . ARG A 1 6  ? -11.484 11.974  -5.382  1.00 5.45  ? 6  ARG A H    7  
ATOM   6946  H HA   . ARG A 1 6  ? -10.094 12.863  -3.038  1.00 5.83  ? 6  ARG A HA   7  
ATOM   6947  H HB2  . ARG A 1 6  ? -12.571 11.200  -3.482  1.00 6.17  ? 6  ARG A HB2  7  
ATOM   6948  H HB3  . ARG A 1 6  ? -11.960 11.518  -1.865  1.00 6.11  ? 6  ARG A HB3  7  
ATOM   6949  H HG2  . ARG A 1 6  ? -11.893 14.029  -2.812  1.00 6.68  ? 6  ARG A HG2  7  
ATOM   6950  H HG3  . ARG A 1 6  ? -13.195 13.394  -3.819  1.00 7.20  ? 6  ARG A HG3  7  
ATOM   6951  H HD2  . ARG A 1 6  ? -14.520 12.814  -1.930  1.00 8.01  ? 6  ARG A HD2  7  
ATOM   6952  H HD3  . ARG A 1 6  ? -13.159 12.994  -0.824  1.00 7.82  ? 6  ARG A HD3  7  
ATOM   6953  H HE   . ARG A 1 6  ? -14.864 15.146  -1.793  1.00 8.74  ? 6  ARG A HE   7  
ATOM   6954  H HH11 . ARG A 1 6  ? -13.542 14.992  0.927   1.00 9.50  ? 6  ARG A HH11 7  
ATOM   6955  H HH12 . ARG A 1 6  ? -12.349 16.241  0.808   1.00 10.35 ? 6  ARG A HH12 7  
ATOM   6956  H HH21 . ARG A 1 6  ? -12.537 16.454  -2.659  1.00 9.63  ? 6  ARG A HH21 7  
ATOM   6957  H HH22 . ARG A 1 6  ? -11.777 17.073  -1.230  1.00 10.41 ? 6  ARG A HH22 7  
ATOM   6958  N N    . CYS A 1 7  ? -9.588  10.566  -1.715  1.00 4.47  ? 7  CYS A N    7  
ATOM   6959  C CA   . CYS A 1 7  ? -8.833  9.385   -1.208  1.00 4.05  ? 7  CYS A CA   7  
ATOM   6960  C C    . CYS A 1 7  ? -9.676  8.122   -1.418  1.00 4.38  ? 7  CYS A C    7  
ATOM   6961  O O    . CYS A 1 7  ? -10.678 7.915   -0.756  1.00 4.93  ? 7  CYS A O    7  
ATOM   6962  C CB   . CYS A 1 7  ? -8.535  9.574   0.284   1.00 4.32  ? 7  CYS A CB   7  
ATOM   6963  S SG   . CYS A 1 7  ? -7.885  11.243  0.575   1.00 4.79  ? 7  CYS A SG   7  
ATOM   6964  H H    . CYS A 1 7  ? -9.952  11.216  -1.080  1.00 4.87  ? 7  CYS A H    7  
ATOM   6965  H HA   . CYS A 1 7  ? -7.905  9.288   -1.751  1.00 3.89  ? 7  CYS A HA   7  
ATOM   6966  H HB2  . CYS A 1 7  ? -9.442  9.438   0.853   1.00 4.81  ? 7  CYS A HB2  7  
ATOM   6967  H HB3  . CYS A 1 7  ? -7.805  8.847   0.594   1.00 4.30  ? 7  CYS A HB3  7  
ATOM   6968  N N    . GLN A 1 8  ? -9.277  7.283   -2.345  1.00 4.51  ? 8  GLN A N    7  
ATOM   6969  C CA   . GLN A 1 8  ? -10.042 6.030   -2.626  1.00 5.30  ? 8  GLN A CA   7  
ATOM   6970  C C    . GLN A 1 8  ? -10.003 5.091   -1.408  1.00 5.47  ? 8  GLN A C    7  
ATOM   6971  O O    . GLN A 1 8  ? -10.861 4.243   -1.254  1.00 6.21  ? 8  GLN A O    7  
ATOM   6972  C CB   . GLN A 1 8  ? -9.417  5.322   -3.833  1.00 5.63  ? 8  GLN A CB   7  
ATOM   6973  C CG   . GLN A 1 8  ? -9.542  6.205   -5.081  1.00 6.22  ? 8  GLN A CG   7  
ATOM   6974  C CD   . GLN A 1 8  ? -10.839 5.870   -5.823  1.00 7.21  ? 8  GLN A CD   7  
ATOM   6975  O OE1  . GLN A 1 8  ? -11.899 6.335   -5.454  1.00 7.78  ? 8  GLN A OE1  7  
ATOM   6976  N NE2  . GLN A 1 8  ? -10.800 5.081   -6.864  1.00 7.68  ? 8  GLN A NE2  7  
ATOM   6977  H H    . GLN A 1 8  ? -8.472  7.479   -2.866  1.00 4.40  ? 8  GLN A H    7  
ATOM   6978  H HA   . GLN A 1 8  ? -11.067 6.280   -2.853  1.00 5.87  ? 8  GLN A HA   7  
ATOM   6979  H HB2  . GLN A 1 8  ? -8.372  5.128   -3.633  1.00 5.62  ? 8  GLN A HB2  7  
ATOM   6980  H HB3  . GLN A 1 8  ? -9.927  4.391   -4.003  1.00 5.89  ? 8  GLN A HB3  7  
ATOM   6981  H HG2  . GLN A 1 8  ? -9.552  7.245   -4.788  1.00 6.11  ? 8  GLN A HG2  7  
ATOM   6982  H HG3  . GLN A 1 8  ? -8.700  6.026   -5.734  1.00 6.39  ? 8  GLN A HG3  7  
ATOM   6983  H HE21 . GLN A 1 8  ? -9.946  4.706   -7.165  1.00 7.43  ? 8  GLN A HE21 7  
ATOM   6984  H HE22 . GLN A 1 8  ? -11.626 4.863   -7.343  1.00 8.44  ? 8  GLN A HE22 7  
ATOM   6985  N N    . CYS A 1 9  ? -9.017  5.231   -0.547  1.00 5.04  ? 9  CYS A N    7  
ATOM   6986  C CA   . CYS A 1 9  ? -8.929  4.343   0.651   1.00 5.45  ? 9  CYS A CA   7  
ATOM   6987  C C    . CYS A 1 9  ? -8.857  5.180   1.931   1.00 5.99  ? 9  CYS A C    7  
ATOM   6988  O O    . CYS A 1 9  ? -7.872  5.845   2.195   1.00 6.13  ? 9  CYS A O    7  
ATOM   6989  C CB   . CYS A 1 9  ? -7.678  3.464   0.548   1.00 5.08  ? 9  CYS A CB   7  
ATOM   6990  S SG   . CYS A 1 9  ? -8.147  1.799   0.015   1.00 5.12  ? 9  CYS A SG   7  
ATOM   6991  H H    . CYS A 1 9  ? -8.334  5.920   -0.691  1.00 4.65  ? 9  CYS A H    7  
ATOM   6992  H HA   . CYS A 1 9  ? -9.804  3.711   0.695   1.00 5.89  ? 9  CYS A HA   7  
ATOM   6993  H HB2  . CYS A 1 9  ? -6.997  3.892   -0.174  1.00 4.67  ? 9  CYS A HB2  7  
ATOM   6994  H HB3  . CYS A 1 9  ? -7.194  3.412   1.510   1.00 5.54  ? 9  CYS A HB3  7  
ATOM   6995  N N    . ILE A 1 10 ? -9.884  5.123   2.747   1.00 6.61  ? 10 ILE A N    7  
ATOM   6996  C CA   . ILE A 1 10 ? -9.864  5.883   4.035   1.00 7.44  ? 10 ILE A CA   7  
ATOM   6997  C C    . ILE A 1 10 ? -8.802  5.249   4.947   1.00 7.48  ? 10 ILE A C    7  
ATOM   6998  O O    . ILE A 1 10 ? -8.157  5.923   5.729   1.00 8.16  ? 10 ILE A O    7  
ATOM   6999  C CB   . ILE A 1 10 ? -11.244 5.810   4.709   1.00 8.38  ? 10 ILE A CB   7  
ATOM   7000  C CG1  . ILE A 1 10 ? -12.304 6.421   3.781   1.00 8.63  ? 10 ILE A CG1  7  
ATOM   7001  C CG2  . ILE A 1 10 ? -11.221 6.590   6.027   1.00 9.31  ? 10 ILE A CG2  7  
ATOM   7002  C CD1  . ILE A 1 10 ? -13.550 5.530   3.764   1.00 9.47  ? 10 ILE A CD1  7  
ATOM   7003  H H    . ILE A 1 10 ? -10.655 4.561   2.522   1.00 6.69  ? 10 ILE A H    7  
ATOM   7004  H HA   . ILE A 1 10 ? -9.607  6.915   3.843   1.00 7.59  ? 10 ILE A HA   7  
ATOM   7005  H HB   . ILE A 1 10 ? -11.491 4.777   4.909   1.00 8.40  ? 10 ILE A HB   7  
ATOM   7006  H HG12 . ILE A 1 10 ? -12.572 7.405   4.141   1.00 8.91  ? 10 ILE A HG12 7  
ATOM   7007  H HG13 . ILE A 1 10 ? -11.907 6.499   2.781   1.00 8.14  ? 10 ILE A HG13 7  
ATOM   7008  H HG21 . ILE A 1 10 ? -10.941 7.615   5.833   1.00 9.72  ? 10 ILE A HG21 7  
ATOM   7009  H HG22 . ILE A 1 10 ? -12.201 6.563   6.479   1.00 9.27  ? 10 ILE A HG22 7  
ATOM   7010  H HG23 . ILE A 1 10 ? -10.503 6.142   6.699   1.00 9.78  ? 10 ILE A HG23 7  
ATOM   7011  H HD11 . ILE A 1 10 ? -13.689 5.086   4.738   1.00 9.77  ? 10 ILE A HD11 7  
ATOM   7012  H HD12 . ILE A 1 10 ? -14.415 6.127   3.513   1.00 9.76  ? 10 ILE A HD12 7  
ATOM   7013  H HD13 . ILE A 1 10 ? -13.424 4.751   3.026   1.00 9.66  ? 10 ILE A HD13 7  
ATOM   7014  N N    . LYS A 1 11 ? -8.609  3.953   4.824   1.00 6.93  ? 11 LYS A N    7  
ATOM   7015  C CA   . LYS A 1 11 ? -7.584  3.241   5.644   1.00 7.15  ? 11 LYS A CA   7  
ATOM   7016  C C    . LYS A 1 11 ? -6.683  2.437   4.700   1.00 6.42  ? 11 LYS A C    7  
ATOM   7017  O O    . LYS A 1 11 ? -7.114  2.003   3.646   1.00 6.35  ? 11 LYS A O    7  
ATOM   7018  C CB   . LYS A 1 11 ? -8.280  2.294   6.628   1.00 8.05  ? 11 LYS A CB   7  
ATOM   7019  C CG   . LYS A 1 11 ? -8.748  3.081   7.853   1.00 8.65  ? 11 LYS A CG   7  
ATOM   7020  C CD   . LYS A 1 11 ? -9.863  2.306   8.561   1.00 9.04  ? 11 LYS A CD   7  
ATOM   7021  C CE   . LYS A 1 11 ? -10.514 3.196   9.625   1.00 9.50  ? 11 LYS A CE   7  
ATOM   7022  N NZ   . LYS A 1 11 ? -9.790  3.044   10.920  1.00 9.69  ? 11 LYS A NZ   7  
ATOM   7023  H H    . LYS A 1 11 ? -9.136  3.447   4.170   1.00 6.52  ? 11 LYS A H    7  
ATOM   7024  H HA   . LYS A 1 11 ? -6.987  3.960   6.188   1.00 7.36  ? 11 LYS A HA   7  
ATOM   7025  H HB2  . LYS A 1 11 ? -9.132  1.838   6.144   1.00 8.15  ? 11 LYS A HB2  7  
ATOM   7026  H HB3  . LYS A 1 11 ? -7.588  1.525   6.938   1.00 8.38  ? 11 LYS A HB3  7  
ATOM   7027  H HG2  . LYS A 1 11 ? -7.918  3.219   8.532   1.00 9.16  ? 11 LYS A HG2  7  
ATOM   7028  H HG3  . LYS A 1 11 ? -9.124  4.044   7.542   1.00 8.50  ? 11 LYS A HG3  7  
ATOM   7029  H HD2  . LYS A 1 11 ? -10.607 2.007   7.838   1.00 9.00  ? 11 LYS A HD2  7  
ATOM   7030  H HD3  . LYS A 1 11 ? -9.447  1.429   9.034   1.00 9.26  ? 11 LYS A HD3  7  
ATOM   7031  H HE2  . LYS A 1 11 ? -10.470 4.228   9.307   1.00 9.79  ? 11 LYS A HE2  7  
ATOM   7032  H HE3  . LYS A 1 11 ? -11.546 2.904   9.752   1.00 9.62  ? 11 LYS A HE3  7  
ATOM   7033  H HZ1  . LYS A 1 11 ? -8.796  3.320   10.798  1.00 9.61  ? 11 LYS A HZ1  7  
ATOM   7034  H HZ2  . LYS A 1 11 ? -10.231 3.656   11.637  1.00 9.96  ? 11 LYS A HZ2  7  
ATOM   7035  H HZ3  . LYS A 1 11 ? -9.841  2.052   11.232  1.00 9.86  ? 11 LYS A HZ3  7  
ATOM   7036  N N    . THR A 1 12 ? -5.434  2.245   5.053   1.00 6.02  ? 12 THR A N    7  
ATOM   7037  C CA   . THR A 1 12 ? -4.515  1.482   4.151   1.00 5.35  ? 12 THR A CA   7  
ATOM   7038  C C    . THR A 1 12 ? -4.208  0.094   4.713   1.00 5.31  ? 12 THR A C    7  
ATOM   7039  O O    . THR A 1 12 ? -4.783  -0.342  5.694   1.00 5.80  ? 12 THR A O    7  
ATOM   7040  C CB   . THR A 1 12 ? -3.203  2.249   3.951   1.00 5.23  ? 12 THR A CB   7  
ATOM   7041  O OG1  . THR A 1 12 ? -3.033  3.217   4.982   1.00 5.90  ? 12 THR A OG1  7  
ATOM   7042  C CG2  . THR A 1 12 ? -3.235  2.932   2.589   1.00 5.32  ? 12 THR A CG2  7  
ATOM   7043  H H    . THR A 1 12 ? -5.100  2.610   5.898   1.00 6.26  ? 12 THR A H    7  
ATOM   7044  H HA   . THR A 1 12 ? -4.992  1.362   3.190   1.00 5.27  ? 12 THR A HA   7  
ATOM   7045  H HB   . THR A 1 12 ? -2.379  1.554   3.973   1.00 4.85  ? 12 THR A HB   7  
ATOM   7046  H HG1  . THR A 1 12 ? -2.138  3.559   4.925   1.00 6.31  ? 12 THR A HG1  7  
ATOM   7047  H HG21 . THR A 1 12 ? -4.125  3.538   2.512   1.00 5.48  ? 12 THR A HG21 7  
ATOM   7048  H HG22 . THR A 1 12 ? -2.361  3.554   2.478   1.00 5.41  ? 12 THR A HG22 7  
ATOM   7049  H HG23 . THR A 1 12 ? -3.244  2.179   1.813   1.00 5.52  ? 12 THR A HG23 7  
ATOM   7050  N N    . TYR A 1 13 ? -3.307  -0.605  4.068   1.00 4.96  ? 13 TYR A N    7  
ATOM   7051  C CA   . TYR A 1 13 ? -2.940  -1.977  4.504   1.00 5.03  ? 13 TYR A CA   7  
ATOM   7052  C C    . TYR A 1 13 ? -1.673  -1.935  5.362   1.00 5.08  ? 13 TYR A C    7  
ATOM   7053  O O    . TYR A 1 13 ? -0.661  -1.380  4.970   1.00 4.67  ? 13 TYR A O    7  
ATOM   7054  C CB   . TYR A 1 13 ? -2.683  -2.830  3.258   1.00 4.85  ? 13 TYR A CB   7  
ATOM   7055  C CG   . TYR A 1 13 ? -2.868  -4.292  3.565   1.00 5.22  ? 13 TYR A CG   7  
ATOM   7056  C CD1  . TYR A 1 13 ? -3.839  -4.705  4.482   1.00 5.34  ? 13 TYR A CD1  7  
ATOM   7057  C CD2  . TYR A 1 13 ? -2.057  -5.232  2.926   1.00 5.75  ? 13 TYR A CD2  7  
ATOM   7058  C CE1  . TYR A 1 13 ? -3.999  -6.067  4.764   1.00 5.79  ? 13 TYR A CE1  7  
ATOM   7059  C CE2  . TYR A 1 13 ? -2.215  -6.597  3.205   1.00 6.30  ? 13 TYR A CE2  7  
ATOM   7060  C CZ   . TYR A 1 13 ? -3.186  -7.013  4.125   1.00 6.23  ? 13 TYR A CZ   7  
ATOM   7061  O OH   . TYR A 1 13 ? -3.343  -8.357  4.401   1.00 6.84  ? 13 TYR A OH   7  
ATOM   7062  H H    . TYR A 1 13 ? -2.879  -0.223  3.272   1.00 4.82  ? 13 TYR A H    7  
ATOM   7063  H HA   . TYR A 1 13 ? -3.749  -2.403  5.072   1.00 5.34  ? 13 TYR A HA   7  
ATOM   7064  H HB2  . TYR A 1 13 ? -3.370  -2.540  2.477   1.00 4.90  ? 13 TYR A HB2  7  
ATOM   7065  H HB3  . TYR A 1 13 ? -1.672  -2.667  2.922   1.00 4.67  ? 13 TYR A HB3  7  
ATOM   7066  H HD1  . TYR A 1 13 ? -4.465  -3.969  4.967   1.00 5.30  ? 13 TYR A HD1  7  
ATOM   7067  H HD2  . TYR A 1 13 ? -1.310  -4.902  2.212   1.00 5.92  ? 13 TYR A HD2  7  
ATOM   7068  H HE1  . TYR A 1 13 ? -4.748  -6.389  5.475   1.00 5.99  ? 13 TYR A HE1  7  
ATOM   7069  H HE2  . TYR A 1 13 ? -1.587  -7.326  2.714   1.00 6.92  ? 13 TYR A HE2  7  
ATOM   7070  H HH   . TYR A 1 13 ? -3.993  -8.712  3.789   1.00 7.17  ? 13 TYR A HH   7  
ATOM   7071  N N    . SER A 1 14 ? -1.724  -2.535  6.524   1.00 5.82  ? 14 SER A N    7  
ATOM   7072  C CA   . SER A 1 14 ? -0.530  -2.563  7.422   1.00 6.06  ? 14 SER A CA   7  
ATOM   7073  C C    . SER A 1 14 ? 0.119   -3.949  7.359   1.00 6.51  ? 14 SER A C    7  
ATOM   7074  O O    . SER A 1 14 ? 1.325   -4.078  7.468   1.00 6.88  ? 14 SER A O    7  
ATOM   7075  C CB   . SER A 1 14 ? -0.959  -2.262  8.862   1.00 6.42  ? 14 SER A CB   7  
ATOM   7076  O OG   . SER A 1 14 ? -1.432  -0.923  8.943   1.00 6.80  ? 14 SER A OG   7  
ATOM   7077  H H    . SER A 1 14 ? -2.552  -2.982  6.803   1.00 6.33  ? 14 SER A H    7  
ATOM   7078  H HA   . SER A 1 14 ? 0.186   -1.822  7.096   1.00 5.81  ? 14 SER A HA   7  
ATOM   7079  H HB2  . SER A 1 14 ? -1.749  -2.935  9.152   1.00 6.57  ? 14 SER A HB2  7  
ATOM   7080  H HB3  . SER A 1 14 ? -0.114  -2.397  9.523   1.00 6.52  ? 14 SER A HB3  7  
ATOM   7081  H HG   . SER A 1 14 ? -2.386  -0.938  8.830   1.00 7.03  ? 14 SER A HG   7  
ATOM   7082  N N    . LYS A 1 15 ? -0.668  -4.985  7.168   1.00 6.59  ? 15 LYS A N    7  
ATOM   7083  C CA   . LYS A 1 15 ? -0.090  -6.361  7.078   1.00 7.06  ? 15 LYS A CA   7  
ATOM   7084  C C    . LYS A 1 15 ? 0.603   -6.504  5.718   1.00 6.32  ? 15 LYS A C    7  
ATOM   7085  O O    . LYS A 1 15 ? 0.099   -6.030  4.722   1.00 6.13  ? 15 LYS A O    7  
ATOM   7086  C CB   . LYS A 1 15 ? -1.179  -7.438  7.190   1.00 7.75  ? 15 LYS A CB   7  
ATOM   7087  C CG   . LYS A 1 15 ? -2.430  -6.898  7.900   1.00 8.64  ? 15 LYS A CG   7  
ATOM   7088  C CD   . LYS A 1 15 ? -3.297  -8.070  8.370   1.00 9.43  ? 15 LYS A CD   7  
ATOM   7089  C CE   . LYS A 1 15 ? -4.661  -7.551  8.841   1.00 10.20 ? 15 LYS A CE   7  
ATOM   7090  N NZ   . LYS A 1 15 ? -4.556  -7.049  10.242  1.00 10.59 ? 15 LYS A NZ   7  
ATOM   7091  H H    . LYS A 1 15 ? -1.630  -4.855  7.068   1.00 6.42  ? 15 LYS A H    7  
ATOM   7092  H HA   . LYS A 1 15 ? 0.634   -6.495  7.868   1.00 7.57  ? 15 LYS A HA   7  
ATOM   7093  H HB2  . LYS A 1 15 ? -1.440  -7.770  6.202   1.00 7.79  ? 15 LYS A HB2  7  
ATOM   7094  H HB3  . LYS A 1 15 ? -0.791  -8.271  7.746   1.00 7.79  ? 15 LYS A HB3  7  
ATOM   7095  H HG2  . LYS A 1 15 ? -2.131  -6.304  8.751   1.00 8.72  ? 15 LYS A HG2  7  
ATOM   7096  H HG3  . LYS A 1 15 ? -2.996  -6.287  7.214   1.00 8.87  ? 15 LYS A HG3  7  
ATOM   7097  H HD2  . LYS A 1 15 ? -3.438  -8.763  7.553   1.00 9.71  ? 15 LYS A HD2  7  
ATOM   7098  H HD3  . LYS A 1 15 ? -2.804  -8.575  9.188   1.00 9.38  ? 15 LYS A HD3  7  
ATOM   7099  H HE2  . LYS A 1 15 ? -4.982  -6.747  8.194   1.00 10.54 ? 15 LYS A HE2  7  
ATOM   7100  H HE3  . LYS A 1 15 ? -5.381  -8.354  8.800   1.00 10.33 ? 15 LYS A HE3  7  
ATOM   7101  H HZ1  . LYS A 1 15 ? -3.852  -6.283  10.285  1.00 10.91 ? 15 LYS A HZ1  7  
ATOM   7102  H HZ2  . LYS A 1 15 ? -5.481  -6.686  10.549  1.00 10.22 ? 15 LYS A HZ2  7  
ATOM   7103  H HZ3  . LYS A 1 15 ? -4.264  -7.824  10.869  1.00 11.09 ? 15 LYS A HZ3  7  
ATOM   7104  N N    . PRO A 1 16 ? 1.747   -7.136  5.720   1.00 6.02  ? 16 PRO A N    7  
ATOM   7105  C CA   . PRO A 1 16 ? 2.547   -7.337  4.500   1.00 5.35  ? 16 PRO A CA   7  
ATOM   7106  C C    . PRO A 1 16 ? 2.064   -8.561  3.716   1.00 5.50  ? 16 PRO A C    7  
ATOM   7107  O O    . PRO A 1 16 ? 1.401   -9.433  4.249   1.00 6.37  ? 16 PRO A O    7  
ATOM   7108  C CB   . PRO A 1 16 ? 3.955   -7.560  5.046   1.00 5.39  ? 16 PRO A CB   7  
ATOM   7109  C CG   . PRO A 1 16 ? 3.794   -8.051  6.507   1.00 6.26  ? 16 PRO A CG   7  
ATOM   7110  C CD   . PRO A 1 16 ? 2.354   -7.706  6.935   1.00 6.51  ? 16 PRO A CD   7  
ATOM   7111  H HA   . PRO A 1 16 ? 2.530   -6.457  3.880   1.00 4.92  ? 16 PRO A HA   7  
ATOM   7112  H HB2  . PRO A 1 16 ? 4.465   -8.296  4.456   1.00 5.32  ? 16 PRO A HB2  7  
ATOM   7113  H HB3  . PRO A 1 16 ? 4.503   -6.636  5.032   1.00 5.10  ? 16 PRO A HB3  7  
ATOM   7114  H HG2  . PRO A 1 16 ? 3.951   -9.121  6.556   1.00 6.77  ? 16 PRO A HG2  7  
ATOM   7115  H HG3  . PRO A 1 16 ? 4.496   -7.544  7.149   1.00 6.37  ? 16 PRO A HG3  7  
ATOM   7116  H HD2  . PRO A 1 16 ? 1.827   -8.600  7.237   1.00 7.06  ? 16 PRO A HD2  7  
ATOM   7117  H HD3  . PRO A 1 16 ? 2.349   -6.978  7.727   1.00 6.63  ? 16 PRO A HD3  7  
ATOM   7118  N N    . PHE A 1 17 ? 2.403   -8.630  2.452   1.00 4.76  ? 17 PHE A N    7  
ATOM   7119  C CA   . PHE A 1 17 ? 1.981   -9.799  1.617   1.00 4.96  ? 17 PHE A CA   7  
ATOM   7120  C C    . PHE A 1 17 ? 2.844   -9.884  0.347   1.00 4.78  ? 17 PHE A C    7  
ATOM   7121  O O    . PHE A 1 17 ? 3.425   -8.907  -0.092  1.00 4.77  ? 17 PHE A O    7  
ATOM   7122  C CB   . PHE A 1 17 ? 0.483   -9.689  1.263   1.00 4.69  ? 17 PHE A CB   7  
ATOM   7123  C CG   . PHE A 1 17 ? 0.224   -8.598  0.244   1.00 3.72  ? 17 PHE A CG   7  
ATOM   7124  C CD1  . PHE A 1 17 ? 0.295   -7.249  0.616   1.00 3.74  ? 17 PHE A CD1  7  
ATOM   7125  C CD2  . PHE A 1 17 ? -0.111  -8.941  -1.072  1.00 3.29  ? 17 PHE A CD2  7  
ATOM   7126  C CE1  . PHE A 1 17 ? 0.038   -6.248  -0.329  1.00 3.14  ? 17 PHE A CE1  7  
ATOM   7127  C CE2  . PHE A 1 17 ? -0.371  -7.941  -2.013  1.00 2.59  ? 17 PHE A CE2  7  
ATOM   7128  C CZ   . PHE A 1 17 ? -0.297  -6.594  -1.642  1.00 2.38  ? 17 PHE A CZ   7  
ATOM   7129  H H    . PHE A 1 17 ? 2.946   -7.915  2.055   1.00 4.19  ? 17 PHE A H    7  
ATOM   7130  H HA   . PHE A 1 17 ? 2.133   -10.702 2.193   1.00 5.66  ? 17 PHE A HA   7  
ATOM   7131  H HB2  . PHE A 1 17 ? 0.148   -10.629 0.859   1.00 5.13  ? 17 PHE A HB2  7  
ATOM   7132  H HB3  . PHE A 1 17 ? -0.076  -9.473  2.161   1.00 5.06  ? 17 PHE A HB3  7  
ATOM   7133  H HD1  . PHE A 1 17 ? 0.551   -6.980  1.630   1.00 4.51  ? 17 PHE A HD1  7  
ATOM   7134  H HD2  . PHE A 1 17 ? -0.169  -9.980  -1.360  1.00 3.86  ? 17 PHE A HD2  7  
ATOM   7135  H HE1  . PHE A 1 17 ? 0.094   -5.209  -0.044  1.00 3.62  ? 17 PHE A HE1  7  
ATOM   7136  H HE2  . PHE A 1 17 ? -0.631  -8.207  -3.028  1.00 2.72  ? 17 PHE A HE2  7  
ATOM   7137  H HZ   . PHE A 1 17 ? -0.499  -5.821  -2.369  1.00 2.18  ? 17 PHE A HZ   7  
ATOM   7138  N N    . HIS A 1 18 ? 2.941   -11.062 -0.229  1.00 4.92  ? 18 HIS A N    7  
ATOM   7139  C CA   . HIS A 1 18 ? 3.773   -11.261 -1.458  1.00 5.06  ? 18 HIS A CA   7  
ATOM   7140  C C    . HIS A 1 18 ? 3.172   -10.458 -2.644  1.00 4.32  ? 18 HIS A C    7  
ATOM   7141  O O    . HIS A 1 18 ? 1.967   -10.361 -2.777  1.00 4.10  ? 18 HIS A O    7  
ATOM   7142  C CB   . HIS A 1 18 ? 3.848   -12.766 -1.726  1.00 5.95  ? 18 HIS A CB   7  
ATOM   7143  C CG   . HIS A 1 18 ? 4.347   -13.015 -3.102  1.00 6.25  ? 18 HIS A CG   7  
ATOM   7144  N ND1  . HIS A 1 18 ? 5.686   -13.205 -3.402  1.00 6.36  ? 18 HIS A ND1  7  
ATOM   7145  C CD2  . HIS A 1 18 ? 3.682   -13.090 -4.272  1.00 6.72  ? 18 HIS A CD2  7  
ATOM   7146  C CE1  . HIS A 1 18 ? 5.766   -13.383 -4.732  1.00 6.81  ? 18 HIS A CE1  7  
ATOM   7147  N NE2  . HIS A 1 18 ? 4.569   -13.328 -5.301  1.00 7.07  ? 18 HIS A NE2  7  
ATOM   7148  H H    . HIS A 1 18 ? 2.468   -11.831 0.159   1.00 5.11  ? 18 HIS A H    7  
ATOM   7149  H HA   . HIS A 1 18 ? 4.763   -10.899 -1.274  1.00 5.21  ? 18 HIS A HA   7  
ATOM   7150  H HB2  . HIS A 1 18 ? 4.520   -13.221 -1.015  1.00 6.63  ? 18 HIS A HB2  7  
ATOM   7151  H HB3  . HIS A 1 18 ? 2.868   -13.198 -1.615  1.00 5.84  ? 18 HIS A HB3  7  
ATOM   7152  H HD1  . HIS A 1 18 ? 6.432   -13.214 -2.766  1.00 6.36  ? 18 HIS A HD1  7  
ATOM   7153  H HD2  . HIS A 1 18 ? 2.629   -12.936 -4.376  1.00 7.00  ? 18 HIS A HD2  7  
ATOM   7154  H HE1  . HIS A 1 18 ? 6.684   -13.504 -5.280  1.00 7.12  ? 18 HIS A HE1  7  
ATOM   7155  N N    . PRO A 1 19 ? 4.054   -9.841  -3.423  1.00 4.16  ? 19 PRO A N    7  
ATOM   7156  C CA   . PRO A 1 19 ? 3.675   -8.950  -4.554  1.00 3.77  ? 19 PRO A CA   7  
ATOM   7157  C C    . PRO A 1 19 ? 3.205   -9.662  -5.836  1.00 4.27  ? 19 PRO A C    7  
ATOM   7158  O O    . PRO A 1 19 ? 2.288   -9.194  -6.480  1.00 4.32  ? 19 PRO A O    7  
ATOM   7159  C CB   . PRO A 1 19 ? 4.963   -8.176  -4.842  1.00 3.96  ? 19 PRO A CB   7  
ATOM   7160  C CG   . PRO A 1 19 ? 6.124   -9.038  -4.300  1.00 4.62  ? 19 PRO A CG   7  
ATOM   7161  C CD   . PRO A 1 19 ? 5.518   -9.980  -3.246  1.00 4.65  ? 19 PRO A CD   7  
ATOM   7162  H HA   . PRO A 1 19 ? 2.924   -8.256  -4.233  1.00 3.26  ? 19 PRO A HA   7  
ATOM   7163  H HB2  . PRO A 1 19 ? 5.074   -8.025  -5.907  1.00 4.26  ? 19 PRO A HB2  7  
ATOM   7164  H HB3  . PRO A 1 19 ? 4.948   -7.228  -4.332  1.00 3.57  ? 19 PRO A HB3  7  
ATOM   7165  H HG2  . PRO A 1 19 ? 6.561   -9.613  -5.106  1.00 5.23  ? 19 PRO A HG2  7  
ATOM   7166  H HG3  . PRO A 1 19 ? 6.872   -8.412  -3.844  1.00 4.63  ? 19 PRO A HG3  7  
ATOM   7167  H HD2  . PRO A 1 19 ? 5.828   -10.997 -3.431  1.00 5.29  ? 19 PRO A HD2  7  
ATOM   7168  H HD3  . PRO A 1 19 ? 5.803   -9.672  -2.252  1.00 4.56  ? 19 PRO A HD3  7  
ATOM   7169  N N    . LYS A 1 20 ? 3.840   -10.736 -6.250  1.00 4.91  ? 20 LYS A N    7  
ATOM   7170  C CA   . LYS A 1 20 ? 3.418   -11.404 -7.538  1.00 5.52  ? 20 LYS A CA   7  
ATOM   7171  C C    . LYS A 1 20 ? 1.901   -11.678 -7.559  1.00 5.00  ? 20 LYS A C    7  
ATOM   7172  O O    . LYS A 1 20 ? 1.302   -11.718 -8.619  1.00 5.39  ? 20 LYS A O    7  
ATOM   7173  C CB   . LYS A 1 20 ? 4.184   -12.703 -7.767  1.00 6.44  ? 20 LYS A CB   7  
ATOM   7174  C CG   . LYS A 1 20 ? 4.223   -13.029 -9.265  1.00 7.16  ? 20 LYS A CG   7  
ATOM   7175  C CD   . LYS A 1 20 ? 5.291   -12.176 -9.957  1.00 7.91  ? 20 LYS A CD   7  
ATOM   7176  C CE   . LYS A 1 20 ? 5.446   -12.631 -11.412 1.00 8.41  ? 20 LYS A CE   7  
ATOM   7177  N NZ   . LYS A 1 20 ? 6.546   -13.633 -11.510 1.00 8.95  ? 20 LYS A NZ   7  
ATOM   7178  H H    . LYS A 1 20 ? 4.605   -11.075 -5.745  1.00 5.13  ? 20 LYS A H    7  
ATOM   7179  H HA   . LYS A 1 20 ? 3.650   -10.744 -8.343  1.00 5.87  ? 20 LYS A HA   7  
ATOM   7180  H HB2  . LYS A 1 20 ? 5.193   -12.598 -7.396  1.00 6.91  ? 20 LYS A HB2  7  
ATOM   7181  H HB3  . LYS A 1 20 ? 3.691   -13.493 -7.246  1.00 6.29  ? 20 LYS A HB3  7  
ATOM   7182  H HG2  . LYS A 1 20 ? 4.457   -14.076 -9.399  1.00 7.23  ? 20 LYS A HG2  7  
ATOM   7183  H HG3  . LYS A 1 20 ? 3.258   -12.818 -9.705  1.00 7.28  ? 20 LYS A HG3  7  
ATOM   7184  H HD2  . LYS A 1 20 ? 4.993   -11.137 -9.932  1.00 8.14  ? 20 LYS A HD2  7  
ATOM   7185  H HD3  . LYS A 1 20 ? 6.232   -12.292 -9.443  1.00 8.11  ? 20 LYS A HD3  7  
ATOM   7186  H HE2  . LYS A 1 20 ? 4.523   -13.077 -11.749 1.00 8.28  ? 20 LYS A HE2  7  
ATOM   7187  H HE3  . LYS A 1 20 ? 5.680   -11.777 -12.031 1.00 8.75  ? 20 LYS A HE3  7  
ATOM   7188  H HZ1  . LYS A 1 20 ? 7.433   -13.211 -11.170 1.00 9.13  ? 20 LYS A HZ1  7  
ATOM   7189  H HZ2  . LYS A 1 20 ? 6.311   -14.466 -10.930 1.00 9.15  ? 20 LYS A HZ2  7  
ATOM   7190  H HZ3  . LYS A 1 20 ? 6.662   -13.924 -12.502 1.00 9.17  ? 20 LYS A HZ3  7  
ATOM   7191  N N    . PHE A 1 21 ? 1.265   -11.832 -6.413  1.00 4.37  ? 21 PHE A N    7  
ATOM   7192  C CA   . PHE A 1 21 ? -0.214  -12.062 -6.400  1.00 4.15  ? 21 PHE A CA   7  
ATOM   7193  C C    . PHE A 1 21 ? -0.903  -10.845 -7.025  1.00 3.56  ? 21 PHE A C    7  
ATOM   7194  O O    . PHE A 1 21 ? -1.859  -10.968 -7.766  1.00 3.88  ? 21 PHE A O    7  
ATOM   7195  C CB   . PHE A 1 21 ? -0.723  -12.214 -4.969  1.00 4.02  ? 21 PHE A CB   7  
ATOM   7196  C CG   . PHE A 1 21 ? 0.045   -13.271 -4.203  1.00 4.64  ? 21 PHE A CG   7  
ATOM   7197  C CD1  . PHE A 1 21 ? 0.625   -14.362 -4.867  1.00 5.12  ? 21 PHE A CD1  7  
ATOM   7198  C CD2  . PHE A 1 21 ? 0.163   -13.158 -2.812  1.00 5.11  ? 21 PHE A CD2  7  
ATOM   7199  C CE1  . PHE A 1 21 ? 1.323   -15.332 -4.138  1.00 5.85  ? 21 PHE A CE1  7  
ATOM   7200  C CE2  . PHE A 1 21 ? 0.860   -14.127 -2.086  1.00 5.85  ? 21 PHE A CE2  7  
ATOM   7201  C CZ   . PHE A 1 21 ? 1.440   -15.214 -2.748  1.00 6.13  ? 21 PHE A CZ   7  
ATOM   7202  H H    . PHE A 1 21 ? 1.750   -11.774 -5.569  1.00 4.29  ? 21 PHE A H    7  
ATOM   7203  H HA   . PHE A 1 21 ? -0.453  -12.939 -6.957  1.00 4.82  ? 21 PHE A HA   7  
ATOM   7204  H HB2  . PHE A 1 21 ? -0.616  -11.275 -4.474  1.00 3.48  ? 21 PHE A HB2  7  
ATOM   7205  H HB3  . PHE A 1 21 ? -1.763  -12.482 -4.996  1.00 4.37  ? 21 PHE A HB3  7  
ATOM   7206  H HD1  . PHE A 1 21 ? 0.536   -14.452 -5.939  1.00 5.18  ? 21 PHE A HD1  7  
ATOM   7207  H HD2  . PHE A 1 21 ? -0.285  -12.319 -2.301  1.00 5.17  ? 21 PHE A HD2  7  
ATOM   7208  H HE1  . PHE A 1 21 ? 1.771   -16.170 -4.647  1.00 6.40  ? 21 PHE A HE1  7  
ATOM   7209  H HE2  . PHE A 1 21 ? 0.950   -14.034 -1.012  1.00 6.40  ? 21 PHE A HE2  7  
ATOM   7210  H HZ   . PHE A 1 21 ? 1.978   -15.963 -2.186  1.00 6.79  ? 21 PHE A HZ   7  
ATOM   7211  N N    . ILE A 1 22 ? -0.404  -9.669  -6.719  1.00 2.94  ? 22 ILE A N    7  
ATOM   7212  C CA   . ILE A 1 22 ? -0.985  -8.408  -7.268  1.00 2.62  ? 22 ILE A CA   7  
ATOM   7213  C C    . ILE A 1 22 ? -0.951  -8.443  -8.798  1.00 3.41  ? 22 ILE A C    7  
ATOM   7214  O O    . ILE A 1 22 ? 0.103   -8.415  -9.406  1.00 4.13  ? 22 ILE A O    7  
ATOM   7215  C CB   . ILE A 1 22 ? -0.154  -7.214  -6.770  1.00 2.18  ? 22 ILE A CB   7  
ATOM   7216  C CG1  . ILE A 1 22 ? -0.166  -7.173  -5.238  1.00 2.00  ? 22 ILE A CG1  7  
ATOM   7217  C CG2  . ILE A 1 22 ? -0.743  -5.911  -7.313  1.00 2.53  ? 22 ILE A CG2  7  
ATOM   7218  C CD1  . ILE A 1 22 ? 1.119   -6.509  -4.737  1.00 2.47  ? 22 ILE A CD1  7  
ATOM   7219  H H    . ILE A 1 22 ? 0.369   -9.619  -6.118  1.00 2.94  ? 22 ILE A H    7  
ATOM   7220  H HA   . ILE A 1 22 ? -2.006  -8.300  -6.934  1.00 2.63  ? 22 ILE A HA   7  
ATOM   7221  H HB   . ILE A 1 22 ? 0.864   -7.316  -7.119  1.00 2.49  ? 22 ILE A HB   7  
ATOM   7222  H HG12 . ILE A 1 22 ? -1.022  -6.606  -4.900  1.00 2.23  ? 22 ILE A HG12 7  
ATOM   7223  H HG13 . ILE A 1 22 ? -0.224  -8.178  -4.851  1.00 2.28  ? 22 ILE A HG13 7  
ATOM   7224  H HG21 . ILE A 1 22 ? -1.813  -6.010  -7.394  1.00 3.07  ? 22 ILE A HG21 7  
ATOM   7225  H HG22 . ILE A 1 22 ? -0.505  -5.101  -6.639  1.00 2.71  ? 22 ILE A HG22 7  
ATOM   7226  H HG23 . ILE A 1 22 ? -0.324  -5.705  -8.286  1.00 2.80  ? 22 ILE A HG23 7  
ATOM   7227  H HD11 . ILE A 1 22 ? 1.926   -6.726  -5.422  1.00 2.88  ? 22 ILE A HD11 7  
ATOM   7228  H HD12 . ILE A 1 22 ? 0.973   -5.442  -4.679  1.00 2.84  ? 22 ILE A HD12 7  
ATOM   7229  H HD13 . ILE A 1 22 ? 1.364   -6.894  -3.758  1.00 2.73  ? 22 ILE A HD13 7  
ATOM   7230  N N    . LYS A 1 23 ? -2.100  -8.487  -9.419  1.00 3.62  ? 23 LYS A N    7  
ATOM   7231  C CA   . LYS A 1 23 ? -2.155  -8.503  -10.906 1.00 4.61  ? 23 LYS A CA   7  
ATOM   7232  C C    . LYS A 1 23 ? -1.933  -7.078  -11.429 1.00 5.00  ? 23 LYS A C    7  
ATOM   7233  O O    . LYS A 1 23 ? -1.421  -6.883  -12.515 1.00 5.88  ? 23 LYS A O    7  
ATOM   7234  C CB   . LYS A 1 23 ? -3.530  -9.006  -11.356 1.00 5.10  ? 23 LYS A CB   7  
ATOM   7235  C CG   . LYS A 1 23 ? -3.626  -10.520 -11.139 1.00 5.85  ? 23 LYS A CG   7  
ATOM   7236  C CD   . LYS A 1 23 ? -2.801  -11.252 -12.202 1.00 6.35  ? 23 LYS A CD   7  
ATOM   7237  C CE   . LYS A 1 23 ? -3.620  -11.390 -13.488 1.00 6.93  ? 23 LYS A CE   7  
ATOM   7238  N NZ   . LYS A 1 23 ? -3.043  -12.476 -14.333 1.00 7.72  ? 23 LYS A NZ   7  
ATOM   7239  H H    . LYS A 1 23 ? -2.935  -8.496  -8.905  1.00 3.33  ? 23 LYS A H    7  
ATOM   7240  H HA   . LYS A 1 23 ? -1.386  -9.155  -11.292 1.00 4.98  ? 23 LYS A HA   7  
ATOM   7241  H HB2  . LYS A 1 23 ? -4.299  -8.511  -10.780 1.00 4.92  ? 23 LYS A HB2  7  
ATOM   7242  H HB3  . LYS A 1 23 ? -3.668  -8.784  -12.399 1.00 5.36  ? 23 LYS A HB3  7  
ATOM   7243  H HG2  . LYS A 1 23 ? -3.248  -10.766 -10.157 1.00 6.02  ? 23 LYS A HG2  7  
ATOM   7244  H HG3  . LYS A 1 23 ? -4.658  -10.828 -11.213 1.00 6.22  ? 23 LYS A HG3  7  
ATOM   7245  H HD2  . LYS A 1 23 ? -1.900  -10.692 -12.407 1.00 6.70  ? 23 LYS A HD2  7  
ATOM   7246  H HD3  . LYS A 1 23 ? -2.537  -12.234 -11.838 1.00 6.30  ? 23 LYS A HD3  7  
ATOM   7247  H HE2  . LYS A 1 23 ? -4.643  -11.633 -13.240 1.00 6.98  ? 23 LYS A HE2  7  
ATOM   7248  H HE3  . LYS A 1 23 ? -3.594  -10.458 -14.033 1.00 7.01  ? 23 LYS A HE3  7  
ATOM   7249  H HZ1  . LYS A 1 23 ? -2.022  -12.322 -14.450 1.00 7.80  ? 23 LYS A HZ1  7  
ATOM   7250  H HZ2  . LYS A 1 23 ? -3.206  -13.396 -13.874 1.00 7.78  ? 23 LYS A HZ2  7  
ATOM   7251  H HZ3  . LYS A 1 23 ? -3.500  -12.468 -15.266 1.00 8.36  ? 23 LYS A HZ3  7  
ATOM   7252  N N    . GLU A 1 24 ? -2.314  -6.081  -10.655 1.00 4.51  ? 24 GLU A N    7  
ATOM   7253  C CA   . GLU A 1 24 ? -2.128  -4.665  -11.092 1.00 5.13  ? 24 GLU A CA   7  
ATOM   7254  C C    . GLU A 1 24 ? -1.761  -3.800  -9.875  1.00 4.55  ? 24 GLU A C    7  
ATOM   7255  O O    . GLU A 1 24 ? -2.591  -3.542  -9.022  1.00 4.65  ? 24 GLU A O    7  
ATOM   7256  C CB   . GLU A 1 24 ? -3.432  -4.143  -11.708 1.00 5.78  ? 24 GLU A CB   7  
ATOM   7257  C CG   . GLU A 1 24 ? -3.571  -4.659  -13.143 1.00 6.35  ? 24 GLU A CG   7  
ATOM   7258  C CD   . GLU A 1 24 ? -5.025  -4.513  -13.598 1.00 7.36  ? 24 GLU A CD   7  
ATOM   7259  O OE1  . GLU A 1 24 ? -5.359  -3.463  -14.124 1.00 7.92  ? 24 GLU A OE1  7  
ATOM   7260  O OE2  . GLU A 1 24 ? -5.782  -5.453  -13.411 1.00 7.77  ? 24 GLU A OE2  7  
ATOM   7261  H H    . GLU A 1 24 ? -2.721  -6.271  -9.781  1.00 3.86  ? 24 GLU A H    7  
ATOM   7262  H HA   . GLU A 1 24 ? -1.337  -4.614  -11.825 1.00 5.74  ? 24 GLU A HA   7  
ATOM   7263  H HB2  . GLU A 1 24 ? -4.269  -4.485  -11.118 1.00 5.66  ? 24 GLU A HB2  7  
ATOM   7264  H HB3  . GLU A 1 24 ? -3.417  -3.063  -11.718 1.00 6.21  ? 24 GLU A HB3  7  
ATOM   7265  H HG2  . GLU A 1 24 ? -2.929  -4.086  -13.796 1.00 6.22  ? 24 GLU A HG2  7  
ATOM   7266  H HG3  . GLU A 1 24 ? -3.289  -5.700  -13.181 1.00 6.40  ? 24 GLU A HG3  7  
HETATM 7267  N N    . MLE A 1 25 ? -0.527  -3.348  -9.785  1.00 4.25  ? 25 MLE A N    7  
HETATM 7268  C CN   . MLE A 1 25 ? 0.150   -2.886  -11.040 1.00 5.13  ? 25 MLE A CN   7  
HETATM 7269  C CA   . MLE A 1 25 ? -0.130  -2.497  -8.609  1.00 3.66  ? 25 MLE A CA   7  
HETATM 7270  C CB   . MLE A 1 25 ? 1.195   -3.003  -8.012  1.00 3.52  ? 25 MLE A CB   7  
HETATM 7271  C CG   . MLE A 1 25 ? 1.775   -1.940  -7.059  1.00 3.28  ? 25 MLE A CG   7  
HETATM 7272  C CD1  . MLE A 1 25 ? 2.254   -2.604  -5.771  1.00 2.93  ? 25 MLE A CD1  7  
HETATM 7273  C CD2  . MLE A 1 25 ? 2.954   -1.222  -7.730  1.00 3.54  ? 25 MLE A CD2  7  
HETATM 7274  C C    . MLE A 1 25 ? 0.043   -1.043  -9.067  1.00 4.19  ? 25 MLE A C    7  
HETATM 7275  O O    . MLE A 1 25 ? 1.051   -0.684  -9.651  1.00 4.87  ? 25 MLE A O    7  
HETATM 7276  H HN1  . MLE A 1 25 ? 0.153   -3.682  -11.766 1.00 5.47  ? 25 MLE A HN1  7  
HETATM 7277  H HN2  . MLE A 1 25 ? -0.380  -2.033  -11.441 1.00 5.48  ? 25 MLE A HN2  7  
HETATM 7278  H HN3  . MLE A 1 25 ? 1.168   -2.601  -10.816 1.00 5.42  ? 25 MLE A HN3  7  
HETATM 7279  H HA   . MLE A 1 25 ? -0.904  -2.549  -7.855  1.00 3.20  ? 25 MLE A HA   7  
HETATM 7280  H HB2  . MLE A 1 25 ? 1.015   -3.918  -7.466  1.00 3.37  ? 25 MLE A HB2  7  
HETATM 7281  H HB3  . MLE A 1 25 ? 1.900   -3.192  -8.807  1.00 4.08  ? 25 MLE A HB3  7  
HETATM 7282  H HG   . MLE A 1 25 ? 1.007   -1.219  -6.820  1.00 3.59  ? 25 MLE A HG   7  
HETATM 7283  H HD11 . MLE A 1 25 ? 1.753   -3.551  -5.646  1.00 3.21  ? 25 MLE A HD11 7  
HETATM 7284  H HD12 . MLE A 1 25 ? 3.320   -2.763  -5.823  1.00 3.14  ? 25 MLE A HD12 7  
HETATM 7285  H HD13 . MLE A 1 25 ? 2.026   -1.962  -4.933  1.00 2.79  ? 25 MLE A HD13 7  
HETATM 7286  H HD21 . MLE A 1 25 ? 3.204   -1.722  -8.655  1.00 3.70  ? 25 MLE A HD21 7  
HETATM 7287  H HD22 . MLE A 1 25 ? 2.679   -0.198  -7.939  1.00 3.89  ? 25 MLE A HD22 7  
HETATM 7288  H HD23 . MLE A 1 25 ? 3.808   -1.235  -7.070  1.00 3.75  ? 25 MLE A HD23 7  
ATOM   7289  N N    . ARG A 1 26 ? -0.921  -0.202  -8.817  1.00 4.14  ? 26 ARG A N    7  
ATOM   7290  C CA   . ARG A 1 26 ? -0.775  1.212   -9.251  1.00 4.79  ? 26 ARG A CA   7  
ATOM   7291  C C    . ARG A 1 26 ? -0.787  2.140   -8.029  1.00 4.70  ? 26 ARG A C    7  
ATOM   7292  O O    . ARG A 1 26 ? -1.639  2.036   -7.169  1.00 4.97  ? 26 ARG A O    7  
ATOM   7293  C CB   . ARG A 1 26 ? -1.909  1.595   -10.214 1.00 5.59  ? 26 ARG A CB   7  
ATOM   7294  C CG   . ARG A 1 26 ? -3.273  1.451   -9.522  1.00 5.99  ? 26 ARG A CG   7  
ATOM   7295  C CD   . ARG A 1 26 ? -4.325  1.027   -10.549 1.00 6.35  ? 26 ARG A CD   7  
ATOM   7296  N NE   . ARG A 1 26 ? -4.973  2.238   -11.133 1.00 7.16  ? 26 ARG A NE   7  
ATOM   7297  C CZ   . ARG A 1 26 ? -4.413  2.865   -12.135 1.00 7.92  ? 26 ARG A CZ   7  
ATOM   7298  N NH1  . ARG A 1 26 ? -4.567  2.417   -13.355 1.00 8.32  ? 26 ARG A NH1  7  
ATOM   7299  N NH2  . ARG A 1 26 ? -3.698  3.939   -11.914 1.00 8.52  ? 26 ARG A NH2  7  
ATOM   7300  H H    . ARG A 1 26 ? -1.730  -0.499  -8.348  1.00 3.85  ? 26 ARG A H    7  
ATOM   7301  H HA   . ARG A 1 26 ? 0.175   1.306   -9.760  1.00 5.07  ? 26 ARG A HA   7  
ATOM   7302  H HB2  . ARG A 1 26 ? -1.776  2.620   -10.529 1.00 5.95  ? 26 ARG A HB2  7  
ATOM   7303  H HB3  . ARG A 1 26 ? -1.876  0.949   -11.077 1.00 5.91  ? 26 ARG A HB3  7  
ATOM   7304  H HG2  . ARG A 1 26 ? -3.206  0.703   -8.745  1.00 6.27  ? 26 ARG A HG2  7  
ATOM   7305  H HG3  . ARG A 1 26 ? -3.557  2.397   -9.087  1.00 6.12  ? 26 ARG A HG3  7  
ATOM   7306  H HD2  . ARG A 1 26 ? -3.853  0.457   -11.337 1.00 6.26  ? 26 ARG A HD2  7  
ATOM   7307  H HD3  . ARG A 1 26 ? -5.074  0.416   -10.065 1.00 6.38  ? 26 ARG A HD3  7  
ATOM   7308  H HE   . ARG A 1 26 ? -5.822  2.564   -10.764 1.00 7.28  ? 26 ARG A HE   7  
ATOM   7309  H HH11 . ARG A 1 26 ? -5.114  1.596   -13.523 1.00 8.08  ? 26 ARG A HH11 7  
ATOM   7310  H HH12 . ARG A 1 26 ? -4.138  2.896   -14.123 1.00 9.02  ? 26 ARG A HH12 7  
ATOM   7311  H HH21 . ARG A 1 26 ? -3.581  4.280   -10.980 1.00 8.41  ? 26 ARG A HH21 7  
ATOM   7312  H HH22 . ARG A 1 26 ? -3.267  4.422   -12.678 1.00 9.21  ? 26 ARG A HH22 7  
ATOM   7313  N N    . VAL A 1 27 ? 0.156   3.046   -7.952  1.00 4.69  ? 27 VAL A N    7  
ATOM   7314  C CA   . VAL A 1 27 ? 0.213   3.987   -6.791  1.00 4.83  ? 27 VAL A CA   7  
ATOM   7315  C C    . VAL A 1 27 ? -0.449  5.320   -7.165  1.00 4.79  ? 27 VAL A C    7  
ATOM   7316  O O    . VAL A 1 27 ? -0.474  5.708   -8.319  1.00 5.45  ? 27 VAL A O    7  
ATOM   7317  C CB   . VAL A 1 27 ? 1.675   4.234   -6.384  1.00 5.66  ? 27 VAL A CB   7  
ATOM   7318  C CG1  . VAL A 1 27 ? 2.159   3.078   -5.509  1.00 6.10  ? 27 VAL A CG1  7  
ATOM   7319  C CG2  . VAL A 1 27 ? 2.573   4.338   -7.625  1.00 6.04  ? 27 VAL A CG2  7  
ATOM   7320  H H    . VAL A 1 27 ? 0.828   3.110   -8.659  1.00 4.82  ? 27 VAL A H    7  
ATOM   7321  H HA   . VAL A 1 27 ? -0.318  3.552   -5.956  1.00 4.74  ? 27 VAL A HA   7  
ATOM   7322  H HB   . VAL A 1 27 ? 1.733   5.151   -5.824  1.00 5.89  ? 27 VAL A HB   7  
ATOM   7323  H HG11 . VAL A 1 27 ? 1.510   2.982   -4.653  1.00 6.06  ? 27 VAL A HG11 7  
ATOM   7324  H HG12 . VAL A 1 27 ? 2.140   2.160   -6.079  1.00 6.54  ? 27 VAL A HG12 7  
ATOM   7325  H HG13 . VAL A 1 27 ? 3.167   3.274   -5.176  1.00 6.30  ? 27 VAL A HG13 7  
ATOM   7326  H HG21 . VAL A 1 27 ? 2.062   4.894   -8.395  1.00 6.05  ? 27 VAL A HG21 7  
ATOM   7327  H HG22 . VAL A 1 27 ? 3.490   4.843   -7.362  1.00 6.44  ? 27 VAL A HG22 7  
ATOM   7328  H HG23 . VAL A 1 27 ? 2.801   3.346   -7.989  1.00 6.18  ? 27 VAL A HG23 7  
ATOM   7329  N N    . ILE A 1 28 ? -0.984  6.023   -6.192  1.00 4.28  ? 28 ILE A N    7  
ATOM   7330  C CA   . ILE A 1 28 ? -1.647  7.333   -6.481  1.00 4.40  ? 28 ILE A CA   7  
ATOM   7331  C C    . ILE A 1 28 ? -0.709  8.476   -6.079  1.00 4.70  ? 28 ILE A C    7  
ATOM   7332  O O    . ILE A 1 28 ? 0.211   8.291   -5.304  1.00 5.01  ? 28 ILE A O    7  
ATOM   7333  C CB   . ILE A 1 28 ? -2.954  7.437   -5.676  1.00 4.45  ? 28 ILE A CB   7  
ATOM   7334  C CG1  . ILE A 1 28 ? -3.808  6.182   -5.901  1.00 4.94  ? 28 ILE A CG1  7  
ATOM   7335  C CG2  . ILE A 1 28 ? -3.745  8.672   -6.119  1.00 4.49  ? 28 ILE A CG2  7  
ATOM   7336  C CD1  . ILE A 1 28 ? -4.054  5.969   -7.400  1.00 5.05  ? 28 ILE A CD1  7  
ATOM   7337  H H    . ILE A 1 28 ? -0.949  5.688   -5.268  1.00 4.02  ? 28 ILE A H    7  
ATOM   7338  H HA   . ILE A 1 28 ? -1.867  7.404   -7.536  1.00 4.67  ? 28 ILE A HA   7  
ATOM   7339  H HB   . ILE A 1 28 ? -2.717  7.526   -4.626  1.00 4.56  ? 28 ILE A HB   7  
ATOM   7340  H HG12 . ILE A 1 28 ? -3.294  5.322   -5.496  1.00 5.21  ? 28 ILE A HG12 7  
ATOM   7341  H HG13 . ILE A 1 28 ? -4.756  6.301   -5.398  1.00 5.36  ? 28 ILE A HG13 7  
ATOM   7342  H HG21 . ILE A 1 28 ? -3.689  8.772   -7.192  1.00 4.77  ? 28 ILE A HG21 7  
ATOM   7343  H HG22 . ILE A 1 28 ? -4.779  8.564   -5.822  1.00 4.49  ? 28 ILE A HG22 7  
ATOM   7344  H HG23 . ILE A 1 28 ? -3.329  9.553   -5.653  1.00 4.51  ? 28 ILE A HG23 7  
ATOM   7345  H HD11 . ILE A 1 28 ? -3.899  6.898   -7.927  1.00 4.88  ? 28 ILE A HD11 7  
ATOM   7346  H HD12 . ILE A 1 28 ? -3.368  5.223   -7.774  1.00 5.25  ? 28 ILE A HD12 7  
ATOM   7347  H HD13 . ILE A 1 28 ? -5.068  5.632   -7.552  1.00 5.49  ? 28 ILE A HD13 7  
ATOM   7348  N N    . GLU A 1 29 ? -0.938  9.658   -6.597  1.00 5.08  ? 29 GLU A N    7  
ATOM   7349  C CA   . GLU A 1 29 ? -0.073  10.820  -6.246  1.00 5.75  ? 29 GLU A CA   7  
ATOM   7350  C C    . GLU A 1 29 ? -0.692  11.577  -5.063  1.00 5.30  ? 29 GLU A C    7  
ATOM   7351  O O    . GLU A 1 29 ? -1.730  11.202  -4.548  1.00 4.95  ? 29 GLU A O    7  
ATOM   7352  C CB   . GLU A 1 29 ? 0.033   11.753  -7.455  1.00 6.63  ? 29 GLU A CB   7  
ATOM   7353  C CG   . GLU A 1 29 ? 1.107   11.231  -8.414  1.00 7.40  ? 29 GLU A CG   7  
ATOM   7354  C CD   . GLU A 1 29 ? 2.496   11.559  -7.859  1.00 8.35  ? 29 GLU A CD   7  
ATOM   7355  O OE1  . GLU A 1 29 ? 2.935   12.685  -8.036  1.00 9.09  ? 29 GLU A OE1  7  
ATOM   7356  O OE2  . GLU A 1 29 ? 3.098   10.679  -7.267  1.00 8.53  ? 29 GLU A OE2  7  
ATOM   7357  H H    . GLU A 1 29 ? -1.685  9.784   -7.218  1.00 5.18  ? 29 GLU A H    7  
ATOM   7358  H HA   . GLU A 1 29 ? 0.911   10.468  -5.973  1.00 6.26  ? 29 GLU A HA   7  
ATOM   7359  H HB2  . GLU A 1 29 ? -0.917  11.790  -7.963  1.00 6.65  ? 29 GLU A HB2  7  
ATOM   7360  H HB3  . GLU A 1 29 ? 0.300   12.741  -7.123  1.00 7.00  ? 29 GLU A HB3  7  
ATOM   7361  H HG2  . GLU A 1 29 ? 1.004   10.160  -8.521  1.00 7.70  ? 29 GLU A HG2  7  
ATOM   7362  H HG3  . GLU A 1 29 ? 0.986   11.702  -9.379  1.00 7.27  ? 29 GLU A HG3  7  
ATOM   7363  N N    . SER A 1 30 ? -0.058  12.638  -4.632  1.00 5.67  ? 30 SER A N    7  
ATOM   7364  C CA   . SER A 1 30 ? -0.596  13.428  -3.483  1.00 5.68  ? 30 SER A CA   7  
ATOM   7365  C C    . SER A 1 30 ? -1.109  14.788  -3.980  1.00 6.20  ? 30 SER A C    7  
ATOM   7366  O O    . SER A 1 30 ? -0.776  15.232  -5.063  1.00 6.77  ? 30 SER A O    7  
ATOM   7367  C CB   . SER A 1 30 ? 0.511   13.645  -2.446  1.00 6.35  ? 30 SER A CB   7  
ATOM   7368  O OG   . SER A 1 30 ? 1.778   13.689  -3.093  1.00 7.18  ? 30 SER A OG   7  
ATOM   7369  H H    . SER A 1 30 ? 0.775   12.918  -5.062  1.00 6.18  ? 30 SER A H    7  
ATOM   7370  H HA   . SER A 1 30 ? -1.411  12.885  -3.027  1.00 5.24  ? 30 SER A HA   7  
ATOM   7371  H HB2  . SER A 1 30 ? 0.346   14.577  -1.937  1.00 6.58  ? 30 SER A HB2  7  
ATOM   7372  H HB3  . SER A 1 30 ? 0.490   12.839  -1.726  1.00 6.28  ? 30 SER A HB3  7  
ATOM   7373  H HG   . SER A 1 30 ? 2.074   14.602  -3.107  1.00 7.41  ? 30 SER A HG   7  
ATOM   7374  N N    . GLY A 1 31 ? -1.919  15.445  -3.188  1.00 6.36  ? 31 GLY A N    7  
ATOM   7375  C CA   . GLY A 1 31 ? -2.470  16.779  -3.591  1.00 7.19  ? 31 GLY A CA   7  
ATOM   7376  C C    . GLY A 1 31 ? -3.445  17.272  -2.511  1.00 7.66  ? 31 GLY A C    7  
ATOM   7377  O O    . GLY A 1 31 ? -3.392  16.816  -1.384  1.00 7.75  ? 31 GLY A O    7  
ATOM   7378  H H    . GLY A 1 31 ? -2.170  15.059  -2.321  1.00 6.14  ? 31 GLY A H    7  
ATOM   7379  H HA2  . GLY A 1 31 ? -1.662  17.482  -3.707  1.00 7.72  ? 31 GLY A HA2  7  
ATOM   7380  H HA3  . GLY A 1 31 ? -2.997  16.681  -4.527  1.00 7.17  ? 31 GLY A HA3  7  
ATOM   7381  N N    . PRO A 1 32 ? -4.331  18.170  -2.889  1.00 8.17  ? 32 PRO A N    7  
ATOM   7382  C CA   . PRO A 1 32 ? -5.353  18.709  -1.966  1.00 8.85  ? 32 PRO A CA   7  
ATOM   7383  C C    . PRO A 1 32 ? -6.426  17.637  -1.733  1.00 8.11  ? 32 PRO A C    7  
ATOM   7384  O O    . PRO A 1 32 ? -6.940  17.477  -0.642  1.00 8.52  ? 32 PRO A O    7  
ATOM   7385  C CB   . PRO A 1 32 ? -5.911  19.926  -2.710  1.00 9.69  ? 32 PRO A CB   7  
ATOM   7386  C CG   . PRO A 1 32 ? -5.596  19.701  -4.208  1.00 9.20  ? 32 PRO A CG   7  
ATOM   7387  C CD   . PRO A 1 32 ? -4.405  18.723  -4.261  1.00 8.39  ? 32 PRO A CD   7  
ATOM   7388  H HA   . PRO A 1 32 ? -4.905  19.012  -1.034  1.00 9.45  ? 32 PRO A HA   7  
ATOM   7389  H HB2  . PRO A 1 32 ? -6.980  19.995  -2.558  1.00 9.88  ? 32 PRO A HB2  7  
ATOM   7390  H HB3  . PRO A 1 32 ? -5.426  20.826  -2.367  1.00 10.56 ? 32 PRO A HB3  7  
ATOM   7391  H HG2  . PRO A 1 32 ? -6.455  19.272  -4.706  1.00 8.80  ? 32 PRO A HG2  7  
ATOM   7392  H HG3  . PRO A 1 32 ? -5.323  20.634  -4.674  1.00 10.01 ? 32 PRO A HG3  7  
ATOM   7393  H HD2  . PRO A 1 32 ? -4.593  17.939  -4.980  1.00 7.63  ? 32 PRO A HD2  7  
ATOM   7394  H HD3  . PRO A 1 32 ? -3.493  19.249  -4.499  1.00 8.96  ? 32 PRO A HD3  7  
ATOM   7395  N N    . HIS A 1 33 ? -6.730  16.882  -2.763  1.00 7.21  ? 33 HIS A N    7  
ATOM   7396  C CA   . HIS A 1 33 ? -7.729  15.774  -2.662  1.00 6.64  ? 33 HIS A CA   7  
ATOM   7397  C C    . HIS A 1 33 ? -7.282  14.778  -1.577  1.00 5.94  ? 33 HIS A C    7  
ATOM   7398  O O    . HIS A 1 33 ? -8.092  14.206  -0.871  1.00 6.05  ? 33 HIS A O    7  
ATOM   7399  C CB   . HIS A 1 33 ? -7.813  15.048  -4.017  1.00 6.27  ? 33 HIS A CB   7  
ATOM   7400  C CG   . HIS A 1 33 ? -6.435  14.585  -4.443  1.00 5.79  ? 33 HIS A CG   7  
ATOM   7401  N ND1  . HIS A 1 33 ? -5.543  15.418  -5.105  1.00 6.54  ? 33 HIS A ND1  7  
ATOM   7402  C CD2  . HIS A 1 33 ? -5.768  13.396  -4.264  1.00 4.91  ? 33 HIS A CD2  7  
ATOM   7403  C CE1  . HIS A 1 33 ? -4.401  14.731  -5.288  1.00 6.20  ? 33 HIS A CE1  7  
ATOM   7404  N NE2  . HIS A 1 33 ? -4.486  13.492  -4.797  1.00 5.23  ? 33 HIS A NE2  7  
ATOM   7405  H H    . HIS A 1 33 ? -6.276  17.037  -3.612  1.00 7.10  ? 33 HIS A H    7  
ATOM   7406  H HA   . HIS A 1 33 ? -8.695  16.178  -2.406  1.00 7.25  ? 33 HIS A HA   7  
ATOM   7407  H HB2  . HIS A 1 33 ? -8.466  14.195  -3.925  1.00 5.99  ? 33 HIS A HB2  7  
ATOM   7408  H HB3  . HIS A 1 33 ? -8.211  15.722  -4.762  1.00 6.92  ? 33 HIS A HB3  7  
ATOM   7409  H HD1  . HIS A 1 33 ? -5.718  16.335  -5.399  1.00 7.35  ? 33 HIS A HD1  7  
ATOM   7410  H HD2  . HIS A 1 33 ? -6.178  12.520  -3.785  1.00 4.33  ? 33 HIS A HD2  7  
ATOM   7411  H HE1  . HIS A 1 33 ? -3.512  15.145  -5.745  1.00 6.82  ? 33 HIS A HE1  7  
ATOM   7412  N N    . CYS A 1 34 ? -5.989  14.579  -1.445  1.00 5.51  ? 34 CYS A N    7  
ATOM   7413  C CA   . CYS A 1 34 ? -5.448  13.644  -0.427  1.00 5.12  ? 34 CYS A CA   7  
ATOM   7414  C C    . CYS A 1 34 ? -4.010  14.062  -0.099  1.00 5.54  ? 34 CYS A C    7  
ATOM   7415  O O    . CYS A 1 34 ? -3.090  13.800  -0.854  1.00 5.84  ? 34 CYS A O    7  
ATOM   7416  C CB   . CYS A 1 34 ? -5.466  12.211  -0.973  1.00 4.12  ? 34 CYS A CB   7  
ATOM   7417  S SG   . CYS A 1 34 ? -5.885  11.054  0.357   1.00 4.37  ? 34 CYS A SG   7  
ATOM   7418  H H    . CYS A 1 34 ? -5.370  15.057  -2.021  1.00 5.68  ? 34 CYS A H    7  
ATOM   7419  H HA   . CYS A 1 34 ? -6.051  13.705  0.458   1.00 5.59  ? 34 CYS A HA   7  
ATOM   7420  H HB2  . CYS A 1 34 ? -6.202  12.136  -1.759  1.00 4.04  ? 34 CYS A HB2  7  
ATOM   7421  H HB3  . CYS A 1 34 ? -4.492  11.965  -1.369  1.00 3.82  ? 34 CYS A HB3  7  
ATOM   7422  N N    . ALA A 1 35 ? -3.816  14.728  1.015   1.00 5.90  ? 35 ALA A N    7  
ATOM   7423  C CA   . ALA A 1 35 ? -2.444  15.189  1.403   1.00 6.66  ? 35 ALA A CA   7  
ATOM   7424  C C    . ALA A 1 35 ? -1.485  13.996  1.512   1.00 6.33  ? 35 ALA A C    7  
ATOM   7425  O O    . ALA A 1 35 ? -0.344  14.074  1.097   1.00 6.77  ? 35 ALA A O    7  
ATOM   7426  C CB   . ALA A 1 35 ? -2.517  15.907  2.753   1.00 7.59  ? 35 ALA A CB   7  
ATOM   7427  H H    . ALA A 1 35 ? -4.580  14.936  1.595   1.00 5.87  ? 35 ALA A H    7  
ATOM   7428  H HA   . ALA A 1 35 ? -2.075  15.872  0.657   1.00 7.06  ? 35 ALA A HA   7  
ATOM   7429  H HB1  . ALA A 1 35 ? -3.176  15.364  3.414   1.00 7.89  ? 35 ALA A HB1  7  
ATOM   7430  H HB2  . ALA A 1 35 ? -1.529  15.954  3.190   1.00 7.72  ? 35 ALA A HB2  7  
ATOM   7431  H HB3  . ALA A 1 35 ? -2.896  16.908  2.610   1.00 8.05  ? 35 ALA A HB3  7  
ATOM   7432  N N    . ASN A 1 36 ? -1.938  12.900  2.068   1.00 5.85  ? 36 ASN A N    7  
ATOM   7433  C CA   . ASN A 1 36 ? -1.054  11.704  2.210   1.00 5.88  ? 36 ASN A CA   7  
ATOM   7434  C C    . ASN A 1 36 ? -1.139  10.836  0.949   1.00 5.34  ? 36 ASN A C    7  
ATOM   7435  O O    . ASN A 1 36 ? -2.214  10.497  0.489   1.00 5.26  ? 36 ASN A O    7  
ATOM   7436  C CB   . ASN A 1 36 ? -1.498  10.880  3.425   1.00 6.50  ? 36 ASN A CB   7  
ATOM   7437  C CG   . ASN A 1 36 ? -0.756  11.356  4.678   1.00 7.27  ? 36 ASN A CG   7  
ATOM   7438  O OD1  . ASN A 1 36 ? 0.446   11.533  4.659   1.00 7.78  ? 36 ASN A OD1  7  
ATOM   7439  N ND2  . ASN A 1 36 ? -1.427  11.569  5.777   1.00 7.61  ? 36 ASN A ND2  7  
ATOM   7440  H H    . ASN A 1 36 ? -2.860  12.865  2.395   1.00 5.70  ? 36 ASN A H    7  
ATOM   7441  H HA   . ASN A 1 36 ? -0.034  12.028  2.352   1.00 6.19  ? 36 ASN A HA   7  
ATOM   7442  H HB2  . ASN A 1 36 ? -2.563  11.000  3.571   1.00 6.55  ? 36 ASN A HB2  7  
ATOM   7443  H HB3  . ASN A 1 36 ? -1.277  9.838   3.253   1.00 6.63  ? 36 ASN A HB3  7  
ATOM   7444  H HD21 . ASN A 1 36 ? -2.396  11.425  5.798   1.00 7.41  ? 36 ASN A HD21 7  
ATOM   7445  H HD22 . ASN A 1 36 ? -0.960  11.873  6.583   1.00 8.19  ? 36 ASN A HD22 7  
ATOM   7446  N N    . THR A 1 37 ? -0.006  10.465  0.398   1.00 5.30  ? 37 THR A N    7  
ATOM   7447  C CA   . THR A 1 37 ? 0.001   9.603   -0.827  1.00 5.18  ? 37 THR A CA   7  
ATOM   7448  C C    . THR A 1 37 ? -0.459  8.190   -0.442  1.00 4.58  ? 37 THR A C    7  
ATOM   7449  O O    . THR A 1 37 ? -0.404  7.812   0.715   1.00 4.95  ? 37 THR A O    7  
ATOM   7450  C CB   . THR A 1 37 ? 1.425   9.548   -1.404  1.00 5.98  ? 37 THR A CB   7  
ATOM   7451  O OG1  . THR A 1 37 ? 2.021   10.836  -1.326  1.00 6.76  ? 37 THR A OG1  7  
ATOM   7452  C CG2  . THR A 1 37 ? 1.374   9.105   -2.866  1.00 6.31  ? 37 THR A CG2  7  
ATOM   7453  H H    . THR A 1 37 ? 0.845   10.746  0.798   1.00 5.59  ? 37 THR A H    7  
ATOM   7454  H HA   . THR A 1 37 ? -0.674  10.017  -1.562  1.00 5.45  ? 37 THR A HA   7  
ATOM   7455  H HB   . THR A 1 37 ? 2.015   8.843   -0.840  1.00 6.11  ? 37 THR A HB   7  
ATOM   7456  H HG1  . THR A 1 37 ? 2.724   10.799  -0.671  1.00 7.02  ? 37 THR A HG1  7  
ATOM   7457  H HG21 . THR A 1 37 ? 0.536   9.577   -3.356  1.00 6.44  ? 37 THR A HG21 7  
ATOM   7458  H HG22 . THR A 1 37 ? 2.289   9.391   -3.361  1.00 6.33  ? 37 THR A HG22 7  
ATOM   7459  H HG23 . THR A 1 37 ? 1.259   8.032   -2.912  1.00 6.74  ? 37 THR A HG23 7  
ATOM   7460  N N    . GLU A 1 38 ? -0.924  7.406   -1.389  1.00 3.94  ? 38 GLU A N    7  
ATOM   7461  C CA   . GLU A 1 38 ? -1.394  6.032   -1.043  1.00 3.67  ? 38 GLU A CA   7  
ATOM   7462  C C    . GLU A 1 38 ? -1.115  5.063   -2.194  1.00 2.99  ? 38 GLU A C    7  
ATOM   7463  O O    . GLU A 1 38 ? -1.161  5.430   -3.353  1.00 3.33  ? 38 GLU A O    7  
ATOM   7464  C CB   . GLU A 1 38 ? -2.899  6.070   -0.771  1.00 4.35  ? 38 GLU A CB   7  
ATOM   7465  C CG   . GLU A 1 38 ? -3.228  5.165   0.418   1.00 4.96  ? 38 GLU A CG   7  
ATOM   7466  C CD   . GLU A 1 38 ? -4.347  5.797   1.249   1.00 5.76  ? 38 GLU A CD   7  
ATOM   7467  O OE1  . GLU A 1 38 ? -5.480  5.758   0.802   1.00 6.28  ? 38 GLU A OE1  7  
ATOM   7468  O OE2  . GLU A 1 38 ? -4.051  6.310   2.316   1.00 6.10  ? 38 GLU A OE2  7  
ATOM   7469  H H    . GLU A 1 38 ? -0.973  7.723   -2.320  1.00 3.89  ? 38 GLU A H    7  
ATOM   7470  H HA   . GLU A 1 38 ? -0.881  5.690   -0.156  1.00 3.96  ? 38 GLU A HA   7  
ATOM   7471  H HB2  . GLU A 1 38 ? -3.197  7.085   -0.547  1.00 4.73  ? 38 GLU A HB2  7  
ATOM   7472  H HB3  . GLU A 1 38 ? -3.432  5.723   -1.643  1.00 4.35  ? 38 GLU A HB3  7  
ATOM   7473  H HG2  . GLU A 1 38 ? -3.550  4.199   0.055   1.00 5.14  ? 38 GLU A HG2  7  
ATOM   7474  H HG3  . GLU A 1 38 ? -2.349  5.042   1.033   1.00 4.98  ? 38 GLU A HG3  7  
ATOM   7475  N N    . ILE A 1 39 ? -0.842  3.822   -1.874  1.00 2.48  ? 39 ILE A N    7  
ATOM   7476  C CA   . ILE A 1 39 ? -0.573  2.807   -2.935  1.00 2.38  ? 39 ILE A CA   7  
ATOM   7477  C C    . ILE A 1 39 ? -1.866  2.020   -3.199  1.00 2.16  ? 39 ILE A C    7  
ATOM   7478  O O    . ILE A 1 39 ? -2.783  2.038   -2.399  1.00 2.22  ? 39 ILE A O    7  
ATOM   7479  C CB   . ILE A 1 39 ? 0.540   1.860   -2.450  1.00 2.57  ? 39 ILE A CB   7  
ATOM   7480  C CG1  . ILE A 1 39 ? 1.840   2.658   -2.265  1.00 2.79  ? 39 ILE A CG1  7  
ATOM   7481  C CG2  . ILE A 1 39 ? 0.778   0.745   -3.476  1.00 3.44  ? 39 ILE A CG2  7  
ATOM   7482  C CD1  . ILE A 1 39 ? 2.468   2.318   -0.913  1.00 2.94  ? 39 ILE A CD1  7  
ATOM   7483  H H    . ILE A 1 39 ? -0.823  3.553   -0.929  1.00 2.61  ? 39 ILE A H    7  
ATOM   7484  H HA   . ILE A 1 39 ? -0.261  3.303   -3.842  1.00 2.85  ? 39 ILE A HA   7  
ATOM   7485  H HB   . ILE A 1 39 ? 0.250   1.422   -1.507  1.00 2.54  ? 39 ILE A HB   7  
ATOM   7486  H HG12 . ILE A 1 39 ? 2.532   2.405   -3.056  1.00 3.36  ? 39 ILE A HG12 7  
ATOM   7487  H HG13 . ILE A 1 39 ? 1.623   3.715   -2.301  1.00 2.70  ? 39 ILE A HG13 7  
ATOM   7488  H HG21 . ILE A 1 39 ? 0.783   1.165   -4.470  1.00 4.05  ? 39 ILE A HG21 7  
ATOM   7489  H HG22 . ILE A 1 39 ? 1.728   0.272   -3.279  1.00 3.75  ? 39 ILE A HG22 7  
ATOM   7490  H HG23 . ILE A 1 39 ? -0.012  0.011   -3.398  1.00 3.64  ? 39 ILE A HG23 7  
ATOM   7491  H HD11 . ILE A 1 39 ? 1.778   1.726   -0.330  1.00 3.00  ? 39 ILE A HD11 7  
ATOM   7492  H HD12 . ILE A 1 39 ? 3.378   1.756   -1.071  1.00 3.60  ? 39 ILE A HD12 7  
ATOM   7493  H HD13 . ILE A 1 39 ? 2.697   3.229   -0.383  1.00 2.88  ? 39 ILE A HD13 7  
ATOM   7494  N N    . ILE A 1 40 ? -1.948  1.333   -4.312  1.00 2.34  ? 40 ILE A N    7  
ATOM   7495  C CA   . ILE A 1 40 ? -3.175  0.537   -4.624  1.00 2.36  ? 40 ILE A CA   7  
ATOM   7496  C C    . ILE A 1 40 ? -2.773  -0.708  -5.413  1.00 2.37  ? 40 ILE A C    7  
ATOM   7497  O O    . ILE A 1 40 ? -1.989  -0.642  -6.340  1.00 3.02  ? 40 ILE A O    7  
ATOM   7498  C CB   . ILE A 1 40 ? -4.168  1.361   -5.456  1.00 3.14  ? 40 ILE A CB   7  
ATOM   7499  C CG1  . ILE A 1 40 ? -4.499  2.666   -4.725  1.00 3.44  ? 40 ILE A CG1  7  
ATOM   7500  C CG2  . ILE A 1 40 ? -5.454  0.551   -5.656  1.00 3.70  ? 40 ILE A CG2  7  
ATOM   7501  C CD1  . ILE A 1 40 ? -5.439  3.519   -5.583  1.00 4.01  ? 40 ILE A CD1  7  
ATOM   7502  H H    . ILE A 1 40 ? -1.197  1.335   -4.941  1.00 2.72  ? 40 ILE A H    7  
ATOM   7503  H HA   . ILE A 1 40 ? -3.646  0.234   -3.700  1.00 2.37  ? 40 ILE A HA   7  
ATOM   7504  H HB   . ILE A 1 40 ? -3.732  1.585   -6.419  1.00 3.47  ? 40 ILE A HB   7  
ATOM   7505  H HG12 . ILE A 1 40 ? -4.976  2.441   -3.783  1.00 3.44  ? 40 ILE A HG12 7  
ATOM   7506  H HG13 . ILE A 1 40 ? -3.587  3.212   -4.542  1.00 3.71  ? 40 ILE A HG13 7  
ATOM   7507  H HG21 . ILE A 1 40 ? -5.216  -0.396  -6.120  1.00 4.13  ? 40 ILE A HG21 7  
ATOM   7508  H HG22 . ILE A 1 40 ? -5.922  0.373   -4.698  1.00 3.89  ? 40 ILE A HG22 7  
ATOM   7509  H HG23 . ILE A 1 40 ? -6.133  1.099   -6.291  1.00 3.94  ? 40 ILE A HG23 7  
ATOM   7510  H HD11 . ILE A 1 40 ? -4.991  3.685   -6.551  1.00 4.33  ? 40 ILE A HD11 7  
ATOM   7511  H HD12 . ILE A 1 40 ? -6.381  3.007   -5.704  1.00 4.43  ? 40 ILE A HD12 7  
ATOM   7512  H HD13 . ILE A 1 40 ? -5.607  4.470   -5.097  1.00 4.17  ? 40 ILE A HD13 7  
ATOM   7513  N N    . VAL A 1 41 ? -3.302  -1.840  -5.044  1.00 2.04  ? 41 VAL A N    7  
ATOM   7514  C CA   . VAL A 1 41 ? -2.968  -3.099  -5.748  1.00 2.10  ? 41 VAL A CA   7  
ATOM   7515  C C    . VAL A 1 41 ? -4.252  -3.897  -6.006  1.00 2.33  ? 41 VAL A C    7  
ATOM   7516  O O    . VAL A 1 41 ? -5.288  -3.630  -5.424  1.00 2.79  ? 41 VAL A O    7  
ATOM   7517  C CB   . VAL A 1 41 ? -2.014  -3.922  -4.880  1.00 2.21  ? 41 VAL A CB   7  
ATOM   7518  C CG1  . VAL A 1 41 ? -0.679  -3.189  -4.740  1.00 2.87  ? 41 VAL A CG1  7  
ATOM   7519  C CG2  . VAL A 1 41 ? -2.619  -4.150  -3.488  1.00 3.20  ? 41 VAL A CG2  7  
ATOM   7520  H H    . VAL A 1 41 ? -3.919  -1.864  -4.297  1.00 2.11  ? 41 VAL A H    7  
ATOM   7521  H HA   . VAL A 1 41 ? -2.490  -2.871  -6.689  1.00 2.57  ? 41 VAL A HA   7  
ATOM   7522  H HB   . VAL A 1 41 ? -1.853  -4.864  -5.351  1.00 2.10  ? 41 VAL A HB   7  
ATOM   7523  H HG11 . VAL A 1 41 ? -0.314  -2.917  -5.719  1.00 3.29  ? 41 VAL A HG11 7  
ATOM   7524  H HG12 . VAL A 1 41 ? -0.817  -2.296  -4.147  1.00 3.43  ? 41 VAL A HG12 7  
ATOM   7525  H HG13 . VAL A 1 41 ? 0.037   -3.835  -4.255  1.00 3.03  ? 41 VAL A HG13 7  
ATOM   7526  H HG21 . VAL A 1 41 ? -3.696  -4.118  -3.552  1.00 3.72  ? 41 VAL A HG21 7  
ATOM   7527  H HG22 . VAL A 1 41 ? -2.309  -5.115  -3.115  1.00 3.56  ? 41 VAL A HG22 7  
ATOM   7528  H HG23 . VAL A 1 41 ? -2.275  -3.377  -2.815  1.00 3.58  ? 41 VAL A HG23 7  
ATOM   7529  N N    . LYS A 1 42 ? -4.189  -4.873  -6.872  1.00 2.44  ? 42 LYS A N    7  
ATOM   7530  C CA   . LYS A 1 42 ? -5.395  -5.700  -7.171  1.00 2.97  ? 42 LYS A CA   7  
ATOM   7531  C C    . LYS A 1 42 ? -5.018  -7.184  -7.110  1.00 2.77  ? 42 LYS A C    7  
ATOM   7532  O O    . LYS A 1 42 ? -4.506  -7.742  -8.063  1.00 2.98  ? 42 LYS A O    7  
ATOM   7533  C CB   . LYS A 1 42 ? -5.922  -5.353  -8.569  1.00 3.77  ? 42 LYS A CB   7  
ATOM   7534  C CG   . LYS A 1 42 ? -7.263  -4.624  -8.447  1.00 4.68  ? 42 LYS A CG   7  
ATOM   7535  C CD   . LYS A 1 42 ? -8.075  -4.822  -9.730  1.00 5.42  ? 42 LYS A CD   7  
ATOM   7536  C CE   . LYS A 1 42 ? -9.531  -4.412  -9.490  1.00 5.72  ? 42 LYS A CE   7  
ATOM   7537  N NZ   . LYS A 1 42 ? -10.374 -5.630  -9.310  1.00 6.76  ? 42 LYS A NZ   7  
ATOM   7538  H H    . LYS A 1 42 ? -3.344  -5.063  -7.324  1.00 2.45  ? 42 LYS A H    7  
ATOM   7539  H HA   . LYS A 1 42 ? -6.160  -5.494  -6.436  1.00 3.37  ? 42 LYS A HA   7  
ATOM   7540  H HB2  . LYS A 1 42 ? -5.211  -4.716  -9.076  1.00 3.94  ? 42 LYS A HB2  7  
ATOM   7541  H HB3  . LYS A 1 42 ? -6.060  -6.261  -9.138  1.00 3.87  ? 42 LYS A HB3  7  
ATOM   7542  H HG2  . LYS A 1 42 ? -7.815  -5.021  -7.606  1.00 4.83  ? 42 LYS A HG2  7  
ATOM   7543  H HG3  . LYS A 1 42 ? -7.087  -3.569  -8.294  1.00 4.94  ? 42 LYS A HG3  7  
ATOM   7544  H HD2  . LYS A 1 42 ? -7.655  -4.211  -10.517 1.00 5.79  ? 42 LYS A HD2  7  
ATOM   7545  H HD3  . LYS A 1 42 ? -8.039  -5.860  -10.022 1.00 5.70  ? 42 LYS A HD3  7  
ATOM   7546  H HE2  . LYS A 1 42 ? -9.591  -3.800  -8.602  1.00 5.66  ? 42 LYS A HE2  7  
ATOM   7547  H HE3  . LYS A 1 42 ? -9.891  -3.848  -10.339 1.00 5.59  ? 42 LYS A HE3  7  
ATOM   7548  H HZ1  . LYS A 1 42 ? -10.266 -6.253  -10.136 1.00 7.12  ? 42 LYS A HZ1  7  
ATOM   7549  H HZ2  . LYS A 1 42 ? -10.075 -6.137  -8.454  1.00 7.24  ? 42 LYS A HZ2  7  
ATOM   7550  H HZ3  . LYS A 1 42 ? -11.372 -5.348  -9.216  1.00 6.85  ? 42 LYS A HZ3  7  
ATOM   7551  N N    . LEU A 1 43 ? -5.262  -7.823  -5.985  1.00 3.01  ? 43 LEU A N    7  
ATOM   7552  C CA   . LEU A 1 43 ? -4.924  -9.270  -5.834  1.00 3.31  ? 43 LEU A CA   7  
ATOM   7553  C C    . LEU A 1 43 ? -5.552  -10.087 -6.962  1.00 3.92  ? 43 LEU A C    7  
ATOM   7554  O O    . LEU A 1 43 ? -6.675  -9.839  -7.374  1.00 4.54  ? 43 LEU A O    7  
ATOM   7555  C CB   . LEU A 1 43 ? -5.469  -9.786  -4.507  1.00 4.01  ? 43 LEU A CB   7  
ATOM   7556  C CG   . LEU A 1 43 ? -4.611  -9.263  -3.349  1.00 3.77  ? 43 LEU A CG   7  
ATOM   7557  C CD1  . LEU A 1 43 ? -5.278  -9.609  -2.016  1.00 4.46  ? 43 LEU A CD1  7  
ATOM   7558  C CD2  . LEU A 1 43 ? -3.223  -9.911  -3.405  1.00 3.91  ? 43 LEU A CD2  7  
ATOM   7559  H H    . LEU A 1 43 ? -5.663  -7.345  -5.233  1.00 3.37  ? 43 LEU A H    7  
ATOM   7560  H HA   . LEU A 1 43 ? -3.851  -9.394  -5.852  1.00 3.08  ? 43 LEU A HA   7  
ATOM   7561  H HB2  . LEU A 1 43 ? -6.484  -9.455  -4.390  1.00 4.55  ? 43 LEU A HB2  7  
ATOM   7562  H HB3  . LEU A 1 43 ? -5.449  -10.858 -4.511  1.00 4.52  ? 43 LEU A HB3  7  
ATOM   7563  H HG   . LEU A 1 43 ? -4.512  -8.189  -3.433  1.00 3.53  ? 43 LEU A HG   7  
ATOM   7564  H HD11 . LEU A 1 43 ? -6.340  -9.426  -2.085  1.00 5.14  ? 43 LEU A HD11 7  
ATOM   7565  H HD12 . LEU A 1 43 ? -5.105  -10.650 -1.787  1.00 4.57  ? 43 LEU A HD12 7  
ATOM   7566  H HD13 . LEU A 1 43 ? -4.858  -8.994  -1.233  1.00 4.51  ? 43 LEU A HD13 7  
ATOM   7567  H HD21 . LEU A 1 43 ? -3.320  -10.945 -3.703  1.00 3.96  ? 43 LEU A HD21 7  
ATOM   7568  H HD22 . LEU A 1 43 ? -2.609  -9.386  -4.121  1.00 4.44  ? 43 LEU A HD22 7  
ATOM   7569  H HD23 . LEU A 1 43 ? -2.761  -9.860  -2.430  1.00 3.95  ? 43 LEU A HD23 7  
ATOM   7570  N N    . SER A 1 44 ? -4.823  -11.064 -7.447  1.00 3.99  ? 44 SER A N    7  
ATOM   7571  C CA   . SER A 1 44 ? -5.322  -11.940 -8.552  1.00 4.72  ? 44 SER A CA   7  
ATOM   7572  C C    . SER A 1 44 ? -6.641  -12.620 -8.160  1.00 5.55  ? 44 SER A C    7  
ATOM   7573  O O    . SER A 1 44 ? -7.439  -12.962 -9.013  1.00 6.08  ? 44 SER A O    7  
ATOM   7574  C CB   . SER A 1 44 ? -4.275  -13.012 -8.861  1.00 4.98  ? 44 SER A CB   7  
ATOM   7575  O OG   . SER A 1 44 ? -4.505  -13.534 -10.163 1.00 5.08  ? 44 SER A OG   7  
ATOM   7576  H H    . SER A 1 44 ? -3.937  -11.224 -7.077  1.00 3.70  ? 44 SER A H    7  
ATOM   7577  H HA   . SER A 1 44 ? -5.480  -11.337 -9.427  1.00 4.83  ? 44 SER A HA   7  
ATOM   7578  H HB2  . SER A 1 44 ? -3.290  -12.578 -8.822  1.00 5.14  ? 44 SER A HB2  7  
ATOM   7579  H HB3  . SER A 1 44 ? -4.346  -13.805 -8.126  1.00 5.37  ? 44 SER A HB3  7  
ATOM   7580  H HG   . SER A 1 44 ? -4.805  -14.442 -10.071 1.00 5.39  ? 44 SER A HG   7  
ATOM   7581  N N    . ASP A 1 45 ? -6.883  -12.812 -6.882  1.00 5.91  ? 45 ASP A N    7  
ATOM   7582  C CA   . ASP A 1 45 ? -8.154  -13.460 -6.447  1.00 7.02  ? 45 ASP A CA   7  
ATOM   7583  C C    . ASP A 1 45 ? -9.351  -12.532 -6.741  1.00 7.25  ? 45 ASP A C    7  
ATOM   7584  O O    . ASP A 1 45 ? -10.492 -12.945 -6.655  1.00 8.19  ? 45 ASP A O    7  
ATOM   7585  C CB   . ASP A 1 45 ? -8.105  -13.780 -4.942  1.00 7.64  ? 45 ASP A CB   7  
ATOM   7586  C CG   . ASP A 1 45 ? -7.518  -12.600 -4.155  1.00 8.01  ? 45 ASP A CG   7  
ATOM   7587  O OD1  . ASP A 1 45 ? -8.160  -11.565 -4.104  1.00 8.63  ? 45 ASP A OD1  7  
ATOM   7588  O OD2  . ASP A 1 45 ? -6.434  -12.757 -3.617  1.00 7.89  ? 45 ASP A OD2  7  
ATOM   7589  H H    . ASP A 1 45 ? -6.233  -12.527 -6.214  1.00 5.60  ? 45 ASP A H    7  
ATOM   7590  H HA   . ASP A 1 45 ? -8.274  -14.375 -6.996  1.00 7.48  ? 45 ASP A HA   7  
ATOM   7591  H HB2  . ASP A 1 45 ? -9.105  -13.982 -4.588  1.00 7.55  ? 45 ASP A HB2  7  
ATOM   7592  H HB3  . ASP A 1 45 ? -7.489  -14.654 -4.785  1.00 8.18  ? 45 ASP A HB3  7  
ATOM   7593  N N    . GLY A 1 46 ? -9.098  -11.287 -7.089  1.00 6.57  ? 46 GLY A N    7  
ATOM   7594  C CA   . GLY A 1 46 ? -10.211 -10.339 -7.388  1.00 7.07  ? 46 GLY A CA   7  
ATOM   7595  C C    . GLY A 1 46 ? -10.430 -9.404  -6.196  1.00 6.74  ? 46 GLY A C    7  
ATOM   7596  O O    . GLY A 1 46 ? -11.548 -9.015  -5.911  1.00 7.17  ? 46 GLY A O    7  
ATOM   7597  H H    . GLY A 1 46 ? -8.172  -10.973 -7.153  1.00 5.88  ? 46 GLY A H    7  
ATOM   7598  H HA2  . GLY A 1 46 ? -9.961  -9.754  -8.263  1.00 7.41  ? 46 GLY A HA2  7  
ATOM   7599  H HA3  . GLY A 1 46 ? -11.115 -10.894 -7.574  1.00 7.56  ? 46 GLY A HA3  7  
ATOM   7600  N N    . ARG A 1 47 ? -9.380  -9.043  -5.497  1.00 6.21  ? 47 ARG A N    7  
ATOM   7601  C CA   . ARG A 1 47 ? -9.543  -8.135  -4.321  1.00 6.07  ? 47 ARG A CA   7  
ATOM   7602  C C    . ARG A 1 47 ? -8.817  -6.807  -4.577  1.00 5.32  ? 47 ARG A C    7  
ATOM   7603  O O    . ARG A 1 47 ? -7.928  -6.726  -5.403  1.00 5.06  ? 47 ARG A O    7  
ATOM   7604  C CB   . ARG A 1 47 ? -8.955  -8.819  -3.079  1.00 6.43  ? 47 ARG A CB   7  
ATOM   7605  C CG   . ARG A 1 47 ? -9.428  -8.110  -1.802  1.00 7.27  ? 47 ARG A CG   7  
ATOM   7606  C CD   . ARG A 1 47 ? -10.933 -8.327  -1.618  1.00 7.96  ? 47 ARG A CD   7  
ATOM   7607  N NE   . ARG A 1 47 ? -11.312 -8.047  -0.201  1.00 8.82  ? 47 ARG A NE   7  
ATOM   7608  C CZ   . ARG A 1 47 ? -11.232 -8.994  0.699   1.00 9.62  ? 47 ARG A CZ   7  
ATOM   7609  N NH1  . ARG A 1 47 ? -12.012 -10.042 0.622   1.00 10.10 ? 47 ARG A NH1  7  
ATOM   7610  N NH2  . ARG A 1 47 ? -10.373 -8.888  1.681   1.00 10.15 ? 47 ARG A NH2  7  
ATOM   7611  H H    . ARG A 1 47 ? -8.480  -9.372  -5.745  1.00 6.06  ? 47 ARG A H    7  
ATOM   7612  H HA   . ARG A 1 47 ? -10.593 -7.943  -4.159  1.00 6.58  ? 47 ARG A HA   7  
ATOM   7613  H HB2  . ARG A 1 47 ? -9.278  -9.849  -3.053  1.00 6.43  ? 47 ARG A HB2  7  
ATOM   7614  H HB3  . ARG A 1 47 ? -7.878  -8.783  -3.130  1.00 6.47  ? 47 ARG A HB3  7  
ATOM   7615  H HG2  . ARG A 1 47 ? -8.900  -8.517  -0.952  1.00 7.60  ? 47 ARG A HG2  7  
ATOM   7616  H HG3  . ARG A 1 47 ? -9.224  -7.054  -1.877  1.00 7.34  ? 47 ARG A HG3  7  
ATOM   7617  H HD2  . ARG A 1 47 ? -11.475 -7.659  -2.273  1.00 7.82  ? 47 ARG A HD2  7  
ATOM   7618  H HD3  . ARG A 1 47 ? -11.182 -9.349  -1.862  1.00 8.20  ? 47 ARG A HD3  7  
ATOM   7619  H HE   . ARG A 1 47 ? -11.621 -7.153  0.054   1.00 8.93  ? 47 ARG A HE   7  
ATOM   7620  H HH11 . ARG A 1 47 ? -12.670 -10.123 -0.127  1.00 9.88  ? 47 ARG A HH11 7  
ATOM   7621  H HH12 . ARG A 1 47 ? -11.950 -10.765 1.310   1.00 10.80 ? 47 ARG A HH12 7  
ATOM   7622  H HH21 . ARG A 1 47 ? -9.778  -8.086  1.742   1.00 9.97  ? 47 ARG A HH21 7  
ATOM   7623  H HH22 . ARG A 1 47 ? -10.309 -9.610  2.371   1.00 10.86 ? 47 ARG A HH22 7  
ATOM   7624  N N    . GLU A 1 48 ? -9.187  -5.772  -3.863  1.00 5.24  ? 48 GLU A N    7  
ATOM   7625  C CA   . GLU A 1 48 ? -8.516  -4.449  -4.035  1.00 4.73  ? 48 GLU A CA   7  
ATOM   7626  C C    . GLU A 1 48 ? -8.027  -3.977  -2.663  1.00 4.69  ? 48 GLU A C    7  
ATOM   7627  O O    . GLU A 1 48 ? -8.813  -3.764  -1.758  1.00 5.44  ? 48 GLU A O    7  
ATOM   7628  C CB   . GLU A 1 48 ? -9.508  -3.433  -4.611  1.00 5.60  ? 48 GLU A CB   7  
ATOM   7629  C CG   . GLU A 1 48 ? -8.738  -2.324  -5.337  1.00 5.76  ? 48 GLU A CG   7  
ATOM   7630  C CD   . GLU A 1 48 ? -9.709  -1.470  -6.156  1.00 6.79  ? 48 GLU A CD   7  
ATOM   7631  O OE1  . GLU A 1 48 ? -10.341 -0.602  -5.575  1.00 7.44  ? 48 GLU A OE1  7  
ATOM   7632  O OE2  . GLU A 1 48 ? -9.802  -1.696  -7.351  1.00 7.12  ? 48 GLU A OE2  7  
ATOM   7633  H H    . GLU A 1 48 ? -9.902  -5.869  -3.201  1.00 5.71  ? 48 GLU A H    7  
ATOM   7634  H HA   . GLU A 1 48 ? -7.673  -4.554  -4.703  1.00 4.10  ? 48 GLU A HA   7  
ATOM   7635  H HB2  . GLU A 1 48 ? -10.168 -3.929  -5.307  1.00 5.76  ? 48 GLU A HB2  7  
ATOM   7636  H HB3  . GLU A 1 48 ? -10.088 -3.000  -3.810  1.00 6.30  ? 48 GLU A HB3  7  
ATOM   7637  H HG2  . GLU A 1 48 ? -8.235  -1.702  -4.611  1.00 5.48  ? 48 GLU A HG2  7  
ATOM   7638  H HG3  . GLU A 1 48 ? -8.007  -2.767  -5.998  1.00 5.78  ? 48 GLU A HG3  7  
ATOM   7639  N N    . LEU A 1 49 ? -6.735  -3.834  -2.495  1.00 4.08  ? 49 LEU A N    7  
ATOM   7640  C CA   . LEU A 1 49 ? -6.196  -3.398  -1.170  1.00 4.35  ? 49 LEU A CA   7  
ATOM   7641  C C    . LEU A 1 49 ? -5.209  -2.246  -1.351  1.00 3.99  ? 49 LEU A C    7  
ATOM   7642  O O    . LEU A 1 49 ? -4.206  -2.383  -2.017  1.00 3.87  ? 49 LEU A O    7  
ATOM   7643  C CB   . LEU A 1 49 ? -5.449  -4.560  -0.513  1.00 4.67  ? 49 LEU A CB   7  
ATOM   7644  C CG   . LEU A 1 49 ? -6.214  -5.066  0.712   1.00 4.92  ? 49 LEU A CG   7  
ATOM   7645  C CD1  . LEU A 1 49 ? -7.303  -6.044  0.274   1.00 5.51  ? 49 LEU A CD1  7  
ATOM   7646  C CD2  . LEU A 1 49 ? -5.240  -5.784  1.650   1.00 4.69  ? 49 LEU A CD2  7  
ATOM   7647  H H    . LEU A 1 49 ? -6.118  -4.026  -3.236  1.00 3.67  ? 49 LEU A H    7  
ATOM   7648  H HA   . LEU A 1 49 ? -7.008  -3.084  -0.531  1.00 4.89  ? 49 LEU A HA   7  
ATOM   7649  H HB2  . LEU A 1 49 ? -5.336  -5.366  -1.224  1.00 4.69  ? 49 LEU A HB2  7  
ATOM   7650  H HB3  . LEU A 1 49 ? -4.474  -4.216  -0.203  1.00 5.10  ? 49 LEU A HB3  7  
ATOM   7651  H HG   . LEU A 1 49 ? -6.664  -4.229  1.228   1.00 5.20  ? 49 LEU A HG   7  
ATOM   7652  H HD11 . LEU A 1 49 ? -6.962  -6.596  -0.589  1.00 5.74  ? 49 LEU A HD11 7  
ATOM   7653  H HD12 . LEU A 1 49 ? -7.515  -6.730  1.081   1.00 5.91  ? 49 LEU A HD12 7  
ATOM   7654  H HD13 . LEU A 1 49 ? -8.198  -5.496  0.022   1.00 5.66  ? 49 LEU A HD13 7  
ATOM   7655  H HD21 . LEU A 1 49 ? -4.351  -5.184  1.774   1.00 4.52  ? 49 LEU A HD21 7  
ATOM   7656  H HD22 . LEU A 1 49 ? -5.709  -5.935  2.610   1.00 4.66  ? 49 LEU A HD22 7  
ATOM   7657  H HD23 . LEU A 1 49 ? -4.971  -6.741  1.225   1.00 5.11  ? 49 LEU A HD23 7  
ATOM   7658  N N    . CYS A 1 50 ? -5.455  -1.131  -0.719  1.00 3.99  ? 50 CYS A N    7  
ATOM   7659  C CA   . CYS A 1 50 ? -4.497  0.000   -0.819  1.00 3.63  ? 50 CYS A CA   7  
ATOM   7660  C C    . CYS A 1 50 ? -3.426  -0.218  0.241   1.00 3.49  ? 50 CYS A C    7  
ATOM   7661  O O    . CYS A 1 50 ? -3.712  -0.651  1.340   1.00 4.14  ? 50 CYS A O    7  
ATOM   7662  C CB   . CYS A 1 50 ? -5.199  1.319   -0.578  1.00 3.72  ? 50 CYS A CB   7  
ATOM   7663  S SG   . CYS A 1 50 ? -6.806  1.331   -1.421  1.00 4.64  ? 50 CYS A SG   7  
ATOM   7664  H H    . CYS A 1 50 ? -6.241  -1.052  -0.150  1.00 4.28  ? 50 CYS A H    7  
ATOM   7665  H HA   . CYS A 1 50 ? -4.046  0.009   -1.789  1.00 3.59  ? 50 CYS A HA   7  
ATOM   7666  H HB2  . CYS A 1 50 ? -5.324  1.444   0.468   1.00 3.90  ? 50 CYS A HB2  7  
ATOM   7667  H HB3  . CYS A 1 50 ? -4.590  2.116   -0.960  1.00 3.38  ? 50 CYS A HB3  7  
ATOM   7668  N N    . LEU A 1 51 ? -2.196  0.033   -0.091  1.00 2.91  ? 51 LEU A N    7  
ATOM   7669  C CA   . LEU A 1 51 ? -1.096  -0.210  0.873   1.00 2.96  ? 51 LEU A CA   7  
ATOM   7670  C C    . LEU A 1 51 ? -0.643  1.076   1.554   1.00 3.35  ? 51 LEU A C    7  
ATOM   7671  O O    . LEU A 1 51 ? -0.858  2.176   1.073   1.00 3.56  ? 51 LEU A O    7  
ATOM   7672  C CB   . LEU A 1 51 ? 0.087   -0.834  0.142   1.00 2.71  ? 51 LEU A CB   7  
ATOM   7673  C CG   . LEU A 1 51 ? -0.335  -2.140  -0.556  1.00 2.56  ? 51 LEU A CG   7  
ATOM   7674  C CD1  . LEU A 1 51 ? 0.895   -3.013  -0.762  1.00 2.98  ? 51 LEU A CD1  7  
ATOM   7675  C CD2  . LEU A 1 51 ? -1.341  -2.914  0.304   1.00 2.61  ? 51 LEU A CD2  7  
ATOM   7676  H H    . LEU A 1 51 ? -1.994  0.348   -0.983  1.00 2.70  ? 51 LEU A H    7  
ATOM   7677  H HA   . LEU A 1 51 ? -1.436  -0.898  1.626   1.00 3.34  ? 51 LEU A HA   7  
ATOM   7678  H HB2  . LEU A 1 51 ? 0.456   -0.136  -0.589  1.00 2.95  ? 51 LEU A HB2  7  
ATOM   7679  H HB3  . LEU A 1 51 ? 0.863   -1.045  0.848   1.00 2.93  ? 51 LEU A HB3  7  
ATOM   7680  H HG   . LEU A 1 51 ? -0.779  -1.909  -1.515  1.00 2.88  ? 51 LEU A HG   7  
ATOM   7681  H HD11 . LEU A 1 51 ? 1.684   -2.426  -1.203  1.00 3.13  ? 51 LEU A HD11 7  
ATOM   7682  H HD12 . LEU A 1 51 ? 1.220   -3.401  0.192   1.00 3.38  ? 51 LEU A HD12 7  
ATOM   7683  H HD13 . LEU A 1 51 ? 0.644   -3.834  -1.418  1.00 3.34  ? 51 LEU A HD13 7  
ATOM   7684  H HD21 . LEU A 1 51 ? -0.947  -3.026  1.304   1.00 2.77  ? 51 LEU A HD21 7  
ATOM   7685  H HD22 . LEU A 1 51 ? -2.276  -2.378  0.343   1.00 3.04  ? 51 LEU A HD22 7  
ATOM   7686  H HD23 . LEU A 1 51 ? -1.505  -3.891  -0.127  1.00 2.85  ? 51 LEU A HD23 7  
ATOM   7687  N N    . ASP A 1 52 ? -0.003  0.912   2.682   1.00 3.84  ? 52 ASP A N    7  
ATOM   7688  C CA   . ASP A 1 52 ? 0.504   2.067   3.468   1.00 4.35  ? 52 ASP A CA   7  
ATOM   7689  C C    . ASP A 1 52 ? 2.038   2.111   3.349   1.00 4.47  ? 52 ASP A C    7  
ATOM   7690  O O    . ASP A 1 52 ? 2.721   1.213   3.813   1.00 4.73  ? 52 ASP A O    7  
ATOM   7691  C CB   . ASP A 1 52 ? 0.089   1.869   4.933   1.00 4.93  ? 52 ASP A CB   7  
ATOM   7692  C CG   . ASP A 1 52 ? 0.455   3.098   5.777   1.00 5.39  ? 52 ASP A CG   7  
ATOM   7693  O OD1  . ASP A 1 52 ? 0.432   4.200   5.249   1.00 5.40  ? 52 ASP A OD1  7  
ATOM   7694  O OD2  . ASP A 1 52 ? 0.739   2.914   6.947   1.00 5.96  ? 52 ASP A OD2  7  
ATOM   7695  H H    . ASP A 1 52 ? 0.148   0.003   3.012   1.00 4.08  ? 52 ASP A H    7  
ATOM   7696  H HA   . ASP A 1 52 ? 0.076   2.983   3.089   1.00 4.52  ? 52 ASP A HA   7  
ATOM   7697  H HB2  . ASP A 1 52 ? -0.976  1.706   4.982   1.00 5.32  ? 52 ASP A HB2  7  
ATOM   7698  H HB3  . ASP A 1 52 ? 0.596   1.002   5.329   1.00 4.91  ? 52 ASP A HB3  7  
ATOM   7699  N N    . PRO A 1 53 ? 2.540   3.156   2.724   1.00 4.54  ? 53 PRO A N    7  
ATOM   7700  C CA   . PRO A 1 53 ? 3.993   3.330   2.512   1.00 4.96  ? 53 PRO A CA   7  
ATOM   7701  C C    . PRO A 1 53 ? 4.732   3.632   3.826   1.00 5.21  ? 53 PRO A C    7  
ATOM   7702  O O    . PRO A 1 53 ? 5.948   3.687   3.851   1.00 5.67  ? 53 PRO A O    7  
ATOM   7703  C CB   . PRO A 1 53 ? 4.079   4.498   1.524   1.00 5.26  ? 53 PRO A CB   7  
ATOM   7704  C CG   . PRO A 1 53 ? 2.746   5.270   1.644   1.00 5.04  ? 53 PRO A CG   7  
ATOM   7705  C CD   . PRO A 1 53 ? 1.716   4.267   2.198   1.00 4.55  ? 53 PRO A CD   7  
ATOM   7706  H HA   . PRO A 1 53 ? 4.407   2.445   2.054   1.00 5.07  ? 53 PRO A HA   7  
ATOM   7707  H HB2  . PRO A 1 53 ? 4.910   5.141   1.780   1.00 5.72  ? 53 PRO A HB2  7  
ATOM   7708  H HB3  . PRO A 1 53 ? 4.193   4.125   0.517   1.00 5.40  ? 53 PRO A HB3  7  
ATOM   7709  H HG2  . PRO A 1 53 ? 2.860   6.103   2.324   1.00 5.39  ? 53 PRO A HG2  7  
ATOM   7710  H HG3  . PRO A 1 53 ? 2.429   5.620   0.674   1.00 5.11  ? 53 PRO A HG3  7  
ATOM   7711  H HD2  . PRO A 1 53 ? 1.137   4.722   2.990   1.00 4.78  ? 53 PRO A HD2  7  
ATOM   7712  H HD3  . PRO A 1 53 ? 1.071   3.913   1.410   1.00 4.27  ? 53 PRO A HD3  7  
ATOM   7713  N N    . LYS A 1 54 ? 4.019   3.808   4.917   1.00 5.18  ? 54 LYS A N    7  
ATOM   7714  C CA   . LYS A 1 54 ? 4.688   4.082   6.216   1.00 5.61  ? 54 LYS A CA   7  
ATOM   7715  C C    . LYS A 1 54 ? 5.527   2.865   6.633   1.00 5.02  ? 54 LYS A C    7  
ATOM   7716  O O    . LYS A 1 54 ? 6.496   3.000   7.358   1.00 5.42  ? 54 LYS A O    7  
ATOM   7717  C CB   . LYS A 1 54 ? 3.636   4.377   7.290   1.00 6.23  ? 54 LYS A CB   7  
ATOM   7718  C CG   . LYS A 1 54 ? 3.560   5.886   7.539   1.00 7.12  ? 54 LYS A CG   7  
ATOM   7719  C CD   . LYS A 1 54 ? 2.939   6.580   6.321   1.00 7.85  ? 54 LYS A CD   7  
ATOM   7720  C CE   . LYS A 1 54 ? 2.262   7.884   6.757   1.00 8.63  ? 54 LYS A CE   7  
ATOM   7721  N NZ   . LYS A 1 54 ? 0.790   7.669   6.880   1.00 9.56  ? 54 LYS A NZ   7  
ATOM   7722  H H    . LYS A 1 54 ? 3.048   3.752   4.883   1.00 5.07  ? 54 LYS A H    7  
ATOM   7723  H HA   . LYS A 1 54 ? 5.329   4.935   6.102   1.00 6.14  ? 54 LYS A HA   7  
ATOM   7724  H HB2  . LYS A 1 54 ? 2.675   4.019   6.958   1.00 6.01  ? 54 LYS A HB2  7  
ATOM   7725  H HB3  . LYS A 1 54 ? 3.908   3.876   8.207   1.00 6.42  ? 54 LYS A HB3  7  
ATOM   7726  H HG2  . LYS A 1 54 ? 2.952   6.076   8.412   1.00 7.47  ? 54 LYS A HG2  7  
ATOM   7727  H HG3  . LYS A 1 54 ? 4.554   6.275   7.703   1.00 7.15  ? 54 LYS A HG3  7  
ATOM   7728  H HD2  . LYS A 1 54 ? 3.713   6.801   5.600   1.00 8.02  ? 54 LYS A HD2  7  
ATOM   7729  H HD3  . LYS A 1 54 ? 2.204   5.929   5.871   1.00 7.93  ? 54 LYS A HD3  7  
ATOM   7730  H HE2  . LYS A 1 54 ? 2.660   8.196   7.711   1.00 8.78  ? 54 LYS A HE2  7  
ATOM   7731  H HE3  . LYS A 1 54 ? 2.453   8.652   6.020   1.00 8.58  ? 54 LYS A HE3  7  
ATOM   7732  H HZ1  . LYS A 1 54 ? 0.606   6.882   7.532   1.00 9.78  ? 54 LYS A HZ1  7  
ATOM   7733  H HZ2  . LYS A 1 54 ? 0.344   8.533   7.249   1.00 9.84  ? 54 LYS A HZ2  7  
ATOM   7734  H HZ3  . LYS A 1 54 ? 0.393   7.447   5.943   1.00 9.93  ? 54 LYS A HZ3  7  
ATOM   7735  N N    . GLU A 1 55 ? 5.177   1.676   6.174   1.00 4.37  ? 55 GLU A N    7  
ATOM   7736  C CA   . GLU A 1 55 ? 5.968   0.475   6.541   1.00 4.14  ? 55 GLU A CA   7  
ATOM   7737  C C    . GLU A 1 55 ? 7.163   0.356   5.600   1.00 3.84  ? 55 GLU A C    7  
ATOM   7738  O O    . GLU A 1 55 ? 7.254   1.042   4.598   1.00 3.83  ? 55 GLU A O    7  
ATOM   7739  C CB   . GLU A 1 55 ? 5.106   -0.780  6.393   1.00 4.19  ? 55 GLU A CB   7  
ATOM   7740  C CG   . GLU A 1 55 ? 4.087   -0.856  7.530   1.00 4.76  ? 55 GLU A CG   7  
ATOM   7741  C CD   . GLU A 1 55 ? 2.913   0.085   7.248   1.00 5.39  ? 55 GLU A CD   7  
ATOM   7742  O OE1  . GLU A 1 55 ? 2.075   -0.275  6.438   1.00 6.13  ? 55 GLU A OE1  7  
ATOM   7743  O OE2  . GLU A 1 55 ? 2.872   1.146   7.848   1.00 5.43  ? 55 GLU A OE2  7  
ATOM   7744  H H    . GLU A 1 55 ? 4.401   1.577   5.582   1.00 4.29  ? 55 GLU A H    7  
ATOM   7745  H HA   . GLU A 1 55 ? 6.313   0.560   7.561   1.00 4.53  ? 55 GLU A HA   7  
ATOM   7746  H HB2  . GLU A 1 55 ? 4.594   -0.752  5.448   1.00 4.04  ? 55 GLU A HB2  7  
ATOM   7747  H HB3  . GLU A 1 55 ? 5.739   -1.648  6.427   1.00 4.32  ? 55 GLU A HB3  7  
ATOM   7748  H HG2  . GLU A 1 55 ? 3.723   -1.866  7.610   1.00 4.81  ? 55 GLU A HG2  7  
ATOM   7749  H HG3  . GLU A 1 55 ? 4.563   -0.573  8.453   1.00 4.98  ? 55 GLU A HG3  7  
ATOM   7750  N N    . ASN A 1 56 ? 8.064   -0.530  5.909   1.00 3.90  ? 56 ASN A N    7  
ATOM   7751  C CA   . ASN A 1 56 ? 9.253   -0.730  5.037   1.00 3.93  ? 56 ASN A CA   7  
ATOM   7752  C C    . ASN A 1 56 ? 8.976   -1.857  4.038   1.00 3.74  ? 56 ASN A C    7  
ATOM   7753  O O    . ASN A 1 56 ? 9.660   -1.983  3.041   1.00 3.89  ? 56 ASN A O    7  
ATOM   7754  C CB   . ASN A 1 56 ? 10.457  -1.094  5.897   1.00 4.29  ? 56 ASN A CB   7  
ATOM   7755  C CG   . ASN A 1 56 ? 11.508  0.021   5.834   1.00 4.70  ? 56 ASN A CG   7  
ATOM   7756  O OD1  . ASN A 1 56 ? 11.179  1.190   5.888   1.00 4.90  ? 56 ASN A OD1  7  
ATOM   7757  N ND2  . ASN A 1 56 ? 12.771  -0.296  5.730   1.00 5.15  ? 56 ASN A ND2  7  
ATOM   7758  H H    . ASN A 1 56 ? 7.947   -1.079  6.712   1.00 4.12  ? 56 ASN A H    7  
ATOM   7759  H HA   . ASN A 1 56 ? 9.461   0.173   4.502   1.00 4.07  ? 56 ASN A HA   7  
ATOM   7760  H HB2  . ASN A 1 56 ? 10.131  -1.222  6.913   1.00 4.38  ? 56 ASN A HB2  7  
ATOM   7761  H HB3  . ASN A 1 56 ? 10.885  -2.011  5.537   1.00 4.36  ? 56 ASN A HB3  7  
ATOM   7762  H HD21 . ASN A 1 56 ? 13.039  -1.238  5.694   1.00 5.31  ? 56 ASN A HD21 7  
ATOM   7763  H HD22 . ASN A 1 56 ? 13.451  0.408   5.691   1.00 5.51  ? 56 ASN A HD22 7  
ATOM   7764  N N    . TRP A 1 57 ? 7.979   -2.676  4.291   1.00 3.55  ? 57 TRP A N    7  
ATOM   7765  C CA   . TRP A 1 57 ? 7.665   -3.781  3.358   1.00 3.47  ? 57 TRP A CA   7  
ATOM   7766  C C    . TRP A 1 57 ? 6.822   -3.253  2.201   1.00 3.28  ? 57 TRP A C    7  
ATOM   7767  O O    . TRP A 1 57 ? 6.986   -3.666  1.077   1.00 3.48  ? 57 TRP A O    7  
ATOM   7768  C CB   . TRP A 1 57 ? 6.929   -4.901  4.105   1.00 3.64  ? 57 TRP A CB   7  
ATOM   7769  C CG   . TRP A 1 57 ? 5.513   -4.537  4.416   1.00 3.70  ? 57 TRP A CG   7  
ATOM   7770  C CD1  . TRP A 1 57 ? 5.088   -4.102  5.608   1.00 4.08  ? 57 TRP A CD1  7  
ATOM   7771  C CD2  . TRP A 1 57 ? 4.337   -4.591  3.557   1.00 3.51  ? 57 TRP A CD2  7  
ATOM   7772  N NE1  . TRP A 1 57 ? 3.724   -3.909  5.554   1.00 4.20  ? 57 TRP A NE1  7  
ATOM   7773  C CE2  . TRP A 1 57 ? 3.216   -4.181  4.308   1.00 3.80  ? 57 TRP A CE2  7  
ATOM   7774  C CE3  . TRP A 1 57 ? 4.137   -4.952  2.216   1.00 3.27  ? 57 TRP A CE3  7  
ATOM   7775  C CZ2  . TRP A 1 57 ? 1.937   -4.129  3.753   1.00 3.76  ? 57 TRP A CZ2  7  
ATOM   7776  C CZ3  . TRP A 1 57 ? 2.855   -4.898  1.651   1.00 3.17  ? 57 TRP A CZ3  7  
ATOM   7777  C CH2  . TRP A 1 57 ? 1.756   -4.486  2.417   1.00 3.38  ? 57 TRP A CH2  7  
ATOM   7778  H H    . TRP A 1 57 ? 7.438   -2.560  5.090   1.00 3.59  ? 57 TRP A H    7  
ATOM   7779  H HA   . TRP A 1 57 ? 8.586   -4.167  2.971   1.00 3.59  ? 57 TRP A HA   7  
ATOM   7780  H HB2  . TRP A 1 57 ? 6.923   -5.779  3.508   1.00 3.77  ? 57 TRP A HB2  7  
ATOM   7781  H HB3  . TRP A 1 57 ? 7.451   -5.106  5.021   1.00 3.78  ? 57 TRP A HB3  7  
ATOM   7782  H HD1  . TRP A 1 57 ? 5.711   -3.947  6.466   1.00 4.35  ? 57 TRP A HD1  7  
ATOM   7783  H HE1  . TRP A 1 57 ? 3.172   -3.613  6.293   1.00 4.57  ? 57 TRP A HE1  7  
ATOM   7784  H HE3  . TRP A 1 57 ? 4.974   -5.270  1.617   1.00 3.29  ? 57 TRP A HE3  7  
ATOM   7785  H HZ2  . TRP A 1 57 ? 1.097   -3.809  4.352   1.00 4.10  ? 57 TRP A HZ2  7  
ATOM   7786  H HZ3  . TRP A 1 57 ? 2.716   -5.166  0.619   1.00 3.03  ? 57 TRP A HZ3  7  
ATOM   7787  H HH2  . TRP A 1 57 ? 0.772   -4.445  1.975   1.00 3.37  ? 57 TRP A HH2  7  
ATOM   7788  N N    . VAL A 1 58 ? 5.928   -2.337  2.469   1.00 3.02  ? 58 VAL A N    7  
ATOM   7789  C CA   . VAL A 1 58 ? 5.083   -1.770  1.377   1.00 2.84  ? 58 VAL A CA   7  
ATOM   7790  C C    . VAL A 1 58 ? 5.984   -1.037  0.375   1.00 2.99  ? 58 VAL A C    7  
ATOM   7791  O O    . VAL A 1 58 ? 5.803   -1.147  -0.824  1.00 3.21  ? 58 VAL A O    7  
ATOM   7792  C CB   . VAL A 1 58 ? 4.065   -0.794  1.983   1.00 2.78  ? 58 VAL A CB   7  
ATOM   7793  C CG1  . VAL A 1 58 ? 3.584   0.207   0.931   1.00 2.80  ? 58 VAL A CG1  7  
ATOM   7794  C CG2  . VAL A 1 58 ? 2.864   -1.561  2.522   1.00 2.85  ? 58 VAL A CG2  7  
ATOM   7795  H H    . VAL A 1 58 ? 5.818   -2.018  3.394   1.00 3.04  ? 58 VAL A H    7  
ATOM   7796  H HA   . VAL A 1 58 ? 4.567   -2.572  0.869   1.00 2.96  ? 58 VAL A HA   7  
ATOM   7797  H HB   . VAL A 1 58 ? 4.534   -0.263  2.790   1.00 3.12  ? 58 VAL A HB   7  
ATOM   7798  H HG11 . VAL A 1 58 ? 3.370   -0.313  0.010   1.00 3.08  ? 58 VAL A HG11 7  
ATOM   7799  H HG12 . VAL A 1 58 ? 2.688   0.696   1.286   1.00 3.10  ? 58 VAL A HG12 7  
ATOM   7800  H HG13 . VAL A 1 58 ? 4.353   0.945   0.760   1.00 2.86  ? 58 VAL A HG13 7  
ATOM   7801  H HG21 . VAL A 1 58 ? 2.639   -2.384  1.863   1.00 3.15  ? 58 VAL A HG21 7  
ATOM   7802  H HG22 . VAL A 1 58 ? 3.093   -1.938  3.505   1.00 3.17  ? 58 VAL A HG22 7  
ATOM   7803  H HG23 . VAL A 1 58 ? 2.010   -0.903  2.578   1.00 2.93  ? 58 VAL A HG23 7  
ATOM   7804  N N    . GLN A 1 59 ? 6.952   -0.292  0.855   1.00 3.12  ? 59 GLN A N    7  
ATOM   7805  C CA   . GLN A 1 59 ? 7.859   0.442   -0.070  1.00 3.61  ? 59 GLN A CA   7  
ATOM   7806  C C    . GLN A 1 59 ? 8.874   -0.524  -0.704  1.00 3.90  ? 59 GLN A C    7  
ATOM   7807  O O    . GLN A 1 59 ? 9.340   -0.301  -1.807  1.00 4.47  ? 59 GLN A O    7  
ATOM   7808  C CB   . GLN A 1 59 ? 8.580   1.547   0.697   1.00 3.82  ? 59 GLN A CB   7  
ATOM   7809  C CG   . GLN A 1 59 ? 9.453   0.920   1.772   1.00 4.33  ? 59 GLN A CG   7  
ATOM   7810  C CD   . GLN A 1 59 ? 10.219  2.012   2.523   1.00 4.72  ? 59 GLN A CD   7  
ATOM   7811  O OE1  . GLN A 1 59 ? 9.778   2.478   3.554   1.00 4.84  ? 59 GLN A OE1  7  
ATOM   7812  N NE2  . GLN A 1 59 ? 11.358  2.440   2.046   1.00 5.29  ? 59 GLN A NE2  7  
ATOM   7813  H H    . GLN A 1 59 ? 7.083   -0.219  1.824   1.00 3.04  ? 59 GLN A H    7  
ATOM   7814  H HA   . GLN A 1 59 ? 7.276   0.885   -0.845  1.00 3.80  ? 59 GLN A HA   7  
ATOM   7815  H HB2  . GLN A 1 59 ? 9.189   2.113   0.019   1.00 3.96  ? 59 GLN A HB2  7  
ATOM   7816  H HB3  . GLN A 1 59 ? 7.854   2.198   1.161   1.00 3.78  ? 59 GLN A HB3  7  
ATOM   7817  H HG2  . GLN A 1 59 ? 8.826   0.375   2.455   1.00 4.58  ? 59 GLN A HG2  7  
ATOM   7818  H HG3  . GLN A 1 59 ? 10.150  0.244   1.305   1.00 4.52  ? 59 GLN A HG3  7  
ATOM   7819  H HE21 . GLN A 1 59 ? 11.715  2.064   1.215   1.00 5.47  ? 59 GLN A HE21 7  
ATOM   7820  H HE22 . GLN A 1 59 ? 11.853  3.141   2.519   1.00 5.70  ? 59 GLN A HE22 7  
ATOM   7821  N N    . ARG A 1 60 ? 9.199   -1.607  -0.032  1.00 3.65  ? 60 ARG A N    7  
ATOM   7822  C CA   . ARG A 1 60 ? 10.158  -2.594  -0.614  1.00 3.97  ? 60 ARG A CA   7  
ATOM   7823  C C    . ARG A 1 60 ? 9.392   -3.484  -1.591  1.00 3.96  ? 60 ARG A C    7  
ATOM   7824  O O    . ARG A 1 60 ? 9.885   -3.835  -2.644  1.00 4.42  ? 60 ARG A O    7  
ATOM   7825  C CB   . ARG A 1 60 ? 10.768  -3.453  0.501   1.00 4.07  ? 60 ARG A CB   7  
ATOM   7826  C CG   . ARG A 1 60 ? 12.205  -3.835  0.131   1.00 4.60  ? 60 ARG A CG   7  
ATOM   7827  C CD   . ARG A 1 60 ? 12.615  -5.096  0.899   1.00 4.81  ? 60 ARG A CD   7  
ATOM   7828  N NE   . ARG A 1 60 ? 14.070  -5.033  1.225   1.00 5.26  ? 60 ARG A NE   7  
ATOM   7829  C CZ   . ARG A 1 60 ? 14.461  -5.031  2.472   1.00 5.84  ? 60 ARG A CZ   7  
ATOM   7830  N NH1  . ARG A 1 60 ? 14.403  -3.927  3.174   1.00 6.25  ? 60 ARG A NH1  7  
ATOM   7831  N NH2  . ARG A 1 60 ? 14.910  -6.132  3.018   1.00 6.35  ? 60 ARG A NH2  7  
ATOM   7832  H H    . ARG A 1 60 ? 8.795   -1.782  0.843   1.00 3.35  ? 60 ARG A H    7  
ATOM   7833  H HA   . ARG A 1 60 ? 10.943  -2.070  -1.141  1.00 4.24  ? 60 ARG A HA   7  
ATOM   7834  H HB2  . ARG A 1 60 ? 10.770  -2.892  1.422   1.00 3.95  ? 60 ARG A HB2  7  
ATOM   7835  H HB3  . ARG A 1 60 ? 10.179  -4.349  0.628   1.00 4.07  ? 60 ARG A HB3  7  
ATOM   7836  H HG2  . ARG A 1 60 ? 12.264  -4.025  -0.931  1.00 4.80  ? 60 ARG A HG2  7  
ATOM   7837  H HG3  . ARG A 1 60 ? 12.870  -3.026  0.390   1.00 4.99  ? 60 ARG A HG3  7  
ATOM   7838  H HD2  . ARG A 1 60 ? 12.044  -5.163  1.814   1.00 4.73  ? 60 ARG A HD2  7  
ATOM   7839  H HD3  . ARG A 1 60 ? 12.421  -5.967  0.290   1.00 5.10  ? 60 ARG A HD3  7  
ATOM   7840  H HE   . ARG A 1 60 ? 14.733  -4.995  0.503   1.00 5.37  ? 60 ARG A HE   7  
ATOM   7841  H HH11 . ARG A 1 60 ? 14.060  -3.086  2.756   1.00 6.14  ? 60 ARG A HH11 7  
ATOM   7842  H HH12 . ARG A 1 60 ? 14.702  -3.925  4.129   1.00 6.86  ? 60 ARG A HH12 7  
ATOM   7843  H HH21 . ARG A 1 60 ? 14.955  -6.974  2.480   1.00 6.32  ? 60 ARG A HH21 7  
ATOM   7844  H HH22 . ARG A 1 60 ? 15.209  -6.133  3.972   1.00 6.96  ? 60 ARG A HH22 7  
ATOM   7845  N N    . VAL A 1 61 ? 8.175   -3.837  -1.242  1.00 3.58  ? 61 VAL A N    7  
ATOM   7846  C CA   . VAL A 1 61 ? 7.341   -4.689  -2.139  1.00 3.55  ? 61 VAL A CA   7  
ATOM   7847  C C    . VAL A 1 61 ? 7.057   -3.926  -3.441  1.00 3.25  ? 61 VAL A C    7  
ATOM   7848  O O    . VAL A 1 61 ? 7.139   -4.482  -4.520  1.00 3.52  ? 61 VAL A O    7  
ATOM   7849  C CB   . VAL A 1 61 ? 6.027   -5.031  -1.416  1.00 3.59  ? 61 VAL A CB   7  
ATOM   7850  C CG1  . VAL A 1 61 ? 4.970   -5.494  -2.420  1.00 3.56  ? 61 VAL A CG1  7  
ATOM   7851  C CG2  . VAL A 1 61 ? 6.283   -6.147  -0.400  1.00 4.31  ? 61 VAL A CG2  7  
ATOM   7852  H H    . VAL A 1 61 ? 7.803   -3.529  -0.380  1.00 3.39  ? 61 VAL A H    7  
ATOM   7853  H HA   . VAL A 1 61 ? 7.875   -5.597  -2.368  1.00 3.93  ? 61 VAL A HA   7  
ATOM   7854  H HB   . VAL A 1 61 ? 5.666   -4.153  -0.902  1.00 3.40  ? 61 VAL A HB   7  
ATOM   7855  H HG11 . VAL A 1 61 ? 5.454   -5.983  -3.250  1.00 3.73  ? 61 VAL A HG11 7  
ATOM   7856  H HG12 . VAL A 1 61 ? 4.294   -6.184  -1.937  1.00 3.88  ? 61 VAL A HG12 7  
ATOM   7857  H HG13 . VAL A 1 61 ? 4.417   -4.638  -2.777  1.00 3.52  ? 61 VAL A HG13 7  
ATOM   7858  H HG21 . VAL A 1 61 ? 7.040   -5.827  0.301   1.00 4.45  ? 61 VAL A HG21 7  
ATOM   7859  H HG22 . VAL A 1 61 ? 5.369   -6.364  0.132   1.00 4.58  ? 61 VAL A HG22 7  
ATOM   7860  H HG23 . VAL A 1 61 ? 6.619   -7.033  -0.914  1.00 4.75  ? 61 VAL A HG23 7  
ATOM   7861  N N    . VAL A 1 62 ? 6.737   -2.655  -3.345  1.00 2.99  ? 62 VAL A N    7  
ATOM   7862  C CA   . VAL A 1 62 ? 6.461   -1.848  -4.575  1.00 3.22  ? 62 VAL A CA   7  
ATOM   7863  C C    . VAL A 1 62 ? 7.750   -1.734  -5.402  1.00 3.80  ? 62 VAL A C    7  
ATOM   7864  O O    . VAL A 1 62 ? 7.728   -1.858  -6.612  1.00 4.15  ? 62 VAL A O    7  
ATOM   7865  C CB   . VAL A 1 62 ? 5.969   -0.448  -4.173  1.00 3.53  ? 62 VAL A CB   7  
ATOM   7866  C CG1  . VAL A 1 62 ? 5.838   0.438   -5.417  1.00 4.40  ? 62 VAL A CG1  7  
ATOM   7867  C CG2  . VAL A 1 62 ? 4.601   -0.559  -3.491  1.00 3.34  ? 62 VAL A CG2  7  
ATOM   7868  H H    . VAL A 1 62 ? 6.687   -2.230  -2.463  1.00 2.92  ? 62 VAL A H    7  
ATOM   7869  H HA   . VAL A 1 62 ? 5.701   -2.342  -5.162  1.00 3.17  ? 62 VAL A HA   7  
ATOM   7870  H HB   . VAL A 1 62 ? 6.677   -0.003  -3.490  1.00 3.69  ? 62 VAL A HB   7  
ATOM   7871  H HG11 . VAL A 1 62 ? 5.380   -0.126  -6.217  1.00 4.59  ? 62 VAL A HG11 7  
ATOM   7872  H HG12 . VAL A 1 62 ? 5.225   1.297   -5.186  1.00 4.91  ? 62 VAL A HG12 7  
ATOM   7873  H HG13 . VAL A 1 62 ? 6.818   0.770   -5.728  1.00 4.71  ? 62 VAL A HG13 7  
ATOM   7874  H HG21 . VAL A 1 62 ? 4.544   -1.488  -2.943  1.00 3.11  ? 62 VAL A HG21 7  
ATOM   7875  H HG22 . VAL A 1 62 ? 4.473   0.269   -2.808  1.00 3.80  ? 62 VAL A HG22 7  
ATOM   7876  H HG23 . VAL A 1 62 ? 3.822   -0.532  -4.238  1.00 3.53  ? 62 VAL A HG23 7  
ATOM   7877  N N    . GLU A 1 63 ? 8.873   -1.504  -4.755  1.00 4.04  ? 63 GLU A N    7  
ATOM   7878  C CA   . GLU A 1 63 ? 10.164  -1.388  -5.493  1.00 4.68  ? 63 GLU A CA   7  
ATOM   7879  C C    . GLU A 1 63 ? 10.503  -2.726  -6.159  1.00 4.70  ? 63 GLU A C    7  
ATOM   7880  O O    . GLU A 1 63 ? 10.927  -2.766  -7.295  1.00 5.23  ? 63 GLU A O    7  
ATOM   7881  C CB   . GLU A 1 63 ? 11.283  -1.003  -4.520  1.00 5.11  ? 63 GLU A CB   7  
ATOM   7882  C CG   . GLU A 1 63 ? 11.451  0.519   -4.504  1.00 5.73  ? 63 GLU A CG   7  
ATOM   7883  C CD   . GLU A 1 63 ? 12.495  0.911   -3.455  1.00 6.00  ? 63 GLU A CD   7  
ATOM   7884  O OE1  . GLU A 1 63 ? 13.665  0.967   -3.803  1.00 6.46  ? 63 GLU A OE1  7  
ATOM   7885  O OE2  . GLU A 1 63 ? 12.107  1.150   -2.322  1.00 6.04  ? 63 GLU A OE2  7  
ATOM   7886  H H    . GLU A 1 63 ? 8.866   -1.407  -3.785  1.00 3.89  ? 63 GLU A H    7  
ATOM   7887  H HA   . GLU A 1 63 ? 10.068  -0.627  -6.248  1.00 5.00  ? 63 GLU A HA   7  
ATOM   7888  H HB2  . GLU A 1 63 ? 11.031  -1.348  -3.528  1.00 4.92  ? 63 GLU A HB2  7  
ATOM   7889  H HB3  . GLU A 1 63 ? 12.208  -1.461  -4.836  1.00 5.36  ? 63 GLU A HB3  7  
ATOM   7890  H HG2  . GLU A 1 63 ? 11.774  0.855   -5.479  1.00 5.98  ? 63 GLU A HG2  7  
ATOM   7891  H HG3  . GLU A 1 63 ? 10.506  0.983   -4.260  1.00 6.04  ? 63 GLU A HG3  7  
ATOM   7892  N N    . LYS A 1 64 ? 10.316  -3.823  -5.462  1.00 4.35  ? 64 LYS A N    7  
ATOM   7893  C CA   . LYS A 1 64 ? 10.619  -5.154  -6.057  1.00 4.71  ? 64 LYS A CA   7  
ATOM   7894  C C    . LYS A 1 64 ? 9.624   -5.458  -7.189  1.00 4.54  ? 64 LYS A C    7  
ATOM   7895  O O    . LYS A 1 64 ? 9.934   -6.187  -8.114  1.00 5.00  ? 64 LYS A O    7  
ATOM   7896  C CB   . LYS A 1 64 ? 10.513  -6.235  -4.978  1.00 4.74  ? 64 LYS A CB   7  
ATOM   7897  C CG   . LYS A 1 64 ? 11.483  -7.373  -5.300  1.00 5.62  ? 64 LYS A CG   7  
ATOM   7898  C CD   . LYS A 1 64 ? 11.206  -8.560  -4.375  1.00 6.24  ? 64 LYS A CD   7  
ATOM   7899  C CE   . LYS A 1 64 ? 12.372  -9.550  -4.448  1.00 7.07  ? 64 LYS A CE   7  
ATOM   7900  N NZ   . LYS A 1 64 ? 12.166  -10.486 -5.590  1.00 7.79  ? 64 LYS A NZ   7  
ATOM   7901  H H    . LYS A 1 64 ? 9.975   -3.771  -4.550  1.00 4.03  ? 64 LYS A H    7  
ATOM   7902  H HA   . LYS A 1 64 ? 11.619  -5.140  -6.450  1.00 5.26  ? 64 LYS A HA   7  
ATOM   7903  H HB2  . LYS A 1 64 ? 10.762  -5.810  -4.017  1.00 4.73  ? 64 LYS A HB2  7  
ATOM   7904  H HB3  . LYS A 1 64 ? 9.504   -6.621  -4.952  1.00 4.49  ? 64 LYS A HB3  7  
ATOM   7905  H HG2  . LYS A 1 64 ? 11.351  -7.678  -6.328  1.00 6.07  ? 64 LYS A HG2  7  
ATOM   7906  H HG3  . LYS A 1 64 ? 12.498  -7.034  -5.152  1.00 5.69  ? 64 LYS A HG3  7  
ATOM   7907  H HD2  . LYS A 1 64 ? 11.095  -8.207  -3.360  1.00 6.22  ? 64 LYS A HD2  7  
ATOM   7908  H HD3  . LYS A 1 64 ? 10.297  -9.055  -4.687  1.00 6.45  ? 64 LYS A HD3  7  
ATOM   7909  H HE2  . LYS A 1 64 ? 13.296  -9.008  -4.590  1.00 7.40  ? 64 LYS A HE2  7  
ATOM   7910  H HE3  . LYS A 1 64 ? 12.424  -10.112 -3.527  1.00 7.09  ? 64 LYS A HE3  7  
ATOM   7911  H HZ1  . LYS A 1 64 ? 11.236  -10.943 -5.503  1.00 7.96  ? 64 LYS A HZ1  7  
ATOM   7912  H HZ2  . LYS A 1 64 ? 12.208  -9.958  -6.485  1.00 8.09  ? 64 LYS A HZ2  7  
ATOM   7913  H HZ3  . LYS A 1 64 ? 12.912  -11.212 -5.582  1.00 8.07  ? 64 LYS A HZ3  7  
ATOM   7914  N N    . PHE A 1 65 ? 8.435   -4.904  -7.121  1.00 4.02  ? 65 PHE A N    7  
ATOM   7915  C CA   . PHE A 1 65 ? 7.414   -5.151  -8.178  1.00 3.99  ? 65 PHE A CA   7  
ATOM   7916  C C    . PHE A 1 65 ? 7.771   -4.356  -9.442  1.00 4.72  ? 65 PHE A C    7  
ATOM   7917  O O    . PHE A 1 65 ? 7.728   -4.878  -10.540 1.00 5.31  ? 65 PHE A O    7  
ATOM   7918  C CB   . PHE A 1 65 ? 6.049   -4.700  -7.650  1.00 3.16  ? 65 PHE A CB   7  
ATOM   7919  C CG   . PHE A 1 65 ? 4.947   -5.477  -8.335  1.00 3.02  ? 65 PHE A CG   7  
ATOM   7920  C CD1  . PHE A 1 65 ? 4.877   -6.869  -8.197  1.00 2.97  ? 65 PHE A CD1  7  
ATOM   7921  C CD2  . PHE A 1 65 ? 3.994   -4.802  -9.105  1.00 3.45  ? 65 PHE A CD2  7  
ATOM   7922  C CE1  . PHE A 1 65 ? 3.855   -7.584  -8.832  1.00 3.10  ? 65 PHE A CE1  7  
ATOM   7923  C CE2  . PHE A 1 65 ? 2.971   -5.516  -9.739  1.00 3.48  ? 65 PHE A CE2  7  
ATOM   7924  C CZ   . PHE A 1 65 ? 2.901   -6.908  -9.603  1.00 3.19  ? 65 PHE A CZ   7  
ATOM   7925  H H    . PHE A 1 65 ? 8.209   -4.321  -6.366  1.00 3.77  ? 65 PHE A H    7  
ATOM   7926  H HA   . PHE A 1 65 ? 7.382   -6.205  -8.410  1.00 4.30  ? 65 PHE A HA   7  
ATOM   7927  H HB2  . PHE A 1 65 ? 6.004   -4.874  -6.586  1.00 2.82  ? 65 PHE A HB2  7  
ATOM   7928  H HB3  . PHE A 1 65 ? 5.925   -3.648  -7.843  1.00 3.27  ? 65 PHE A HB3  7  
ATOM   7929  H HD1  . PHE A 1 65 ? 5.613   -7.393  -7.603  1.00 3.21  ? 65 PHE A HD1  7  
ATOM   7930  H HD2  . PHE A 1 65 ? 4.047   -3.730  -9.209  1.00 4.00  ? 65 PHE A HD2  7  
ATOM   7931  H HE1  . PHE A 1 65 ? 3.800   -8.657  -8.726  1.00 3.46  ? 65 PHE A HE1  7  
ATOM   7932  H HE2  . PHE A 1 65 ? 2.235   -4.995  -10.334 1.00 4.01  ? 65 PHE A HE2  7  
ATOM   7933  H HZ   . PHE A 1 65 ? 2.114   -7.459  -10.093 1.00 3.41  ? 65 PHE A HZ   7  
ATOM   7934  N N    . LEU A 1 66 ? 8.121   -3.097  -9.295  1.00 4.92  ? 66 LEU A N    7  
ATOM   7935  C CA   . LEU A 1 66 ? 8.479   -2.268  -10.490 1.00 5.86  ? 66 LEU A CA   7  
ATOM   7936  C C    . LEU A 1 66 ? 9.989   -2.359  -10.748 1.00 6.61  ? 66 LEU A C    7  
ATOM   7937  O O    . LEU A 1 66 ? 10.415  -2.848  -11.777 1.00 7.33  ? 66 LEU A O    7  
ATOM   7938  C CB   . LEU A 1 66 ? 8.085   -0.807  -10.239 1.00 6.18  ? 66 LEU A CB   7  
ATOM   7939  C CG   . LEU A 1 66 ? 6.566   -0.656  -10.376 1.00 7.14  ? 66 LEU A CG   7  
ATOM   7940  C CD1  . LEU A 1 66 ? 6.110   0.610   -9.648  1.00 7.61  ? 66 LEU A CD1  7  
ATOM   7941  C CD2  . LEU A 1 66 ? 6.193   -0.553  -11.858 1.00 7.67  ? 66 LEU A CD2  7  
ATOM   7942  H H    . LEU A 1 66 ? 8.146   -2.699  -8.396  1.00 4.58  ? 66 LEU A H    7  
ATOM   7943  H HA   . LEU A 1 66 ? 7.948   -2.638  -11.354 1.00 6.03  ? 66 LEU A HA   7  
ATOM   7944  H HB2  . LEU A 1 66 ? 8.388   -0.517  -9.243  1.00 5.67  ? 66 LEU A HB2  7  
ATOM   7945  H HB3  . LEU A 1 66 ? 8.574   -0.173  -10.964 1.00 6.42  ? 66 LEU A HB3  7  
ATOM   7946  H HG   . LEU A 1 66 ? 6.079   -1.515  -9.939  1.00 7.39  ? 66 LEU A HG   7  
ATOM   7947  H HD11 . LEU A 1 66 ? 6.465   0.588   -8.629  1.00 7.94  ? 66 LEU A HD11 7  
ATOM   7948  H HD12 . LEU A 1 66 ? 6.511   1.479   -10.149 1.00 7.49  ? 66 LEU A HD12 7  
ATOM   7949  H HD13 . LEU A 1 66 ? 5.030   0.658   -9.652  1.00 8.02  ? 66 LEU A HD13 7  
ATOM   7950  H HD21 . LEU A 1 66 ? 6.782   0.221   -12.326 1.00 8.14  ? 66 LEU A HD21 7  
ATOM   7951  H HD22 . LEU A 1 66 ? 6.387   -1.498  -12.344 1.00 7.84  ? 66 LEU A HD22 7  
ATOM   7952  H HD23 . LEU A 1 66 ? 5.143   -0.312  -11.949 1.00 7.67  ? 66 LEU A HD23 7  
ATOM   7953  N N    . LYS A 1 67 ? 10.793  -1.898  -9.813  1.00 6.57  ? 67 LYS A N    7  
ATOM   7954  C CA   . LYS A 1 67 ? 12.285  -1.949  -9.965  1.00 7.47  ? 67 LYS A CA   7  
ATOM   7955  C C    . LYS A 1 67 ? 12.746  -0.946  -11.033 1.00 7.85  ? 67 LYS A C    7  
ATOM   7956  O O    . LYS A 1 67 ? 12.538  -1.141  -12.217 1.00 8.14  ? 67 LYS A O    7  
ATOM   7957  C CB   . LYS A 1 67 ? 12.729  -3.369  -10.353 1.00 7.84  ? 67 LYS A CB   7  
ATOM   7958  C CG   . LYS A 1 67 ? 14.003  -3.737  -9.585  1.00 8.78  ? 67 LYS A CG   7  
ATOM   7959  C CD   . LYS A 1 67 ? 15.229  -3.217  -10.342 1.00 9.42  ? 67 LYS A CD   7  
ATOM   7960  C CE   . LYS A 1 67 ? 16.372  -2.961  -9.355  1.00 10.12 ? 67 LYS A CE   7  
ATOM   7961  N NZ   . LYS A 1 67 ? 17.109  -1.727  -9.754  1.00 10.40 ? 67 LYS A NZ   7  
ATOM   7962  H H    . LYS A 1 67 ? 10.410  -1.516  -8.994  1.00 6.04  ? 67 LYS A H    7  
ATOM   7963  H HA   . LYS A 1 67 ? 12.740  -1.685  -9.021  1.00 7.85  ? 67 LYS A HA   7  
ATOM   7964  H HB2  . LYS A 1 67 ? 11.945  -4.070  -10.104 1.00 7.78  ? 67 LYS A HB2  7  
ATOM   7965  H HB3  . LYS A 1 67 ? 12.925  -3.410  -11.413 1.00 7.75  ? 67 LYS A HB3  7  
ATOM   7966  H HG2  . LYS A 1 67 ? 13.970  -3.292  -8.601  1.00 9.30  ? 67 LYS A HG2  7  
ATOM   7967  H HG3  . LYS A 1 67 ? 14.068  -4.810  -9.493  1.00 8.71  ? 67 LYS A HG3  7  
ATOM   7968  H HD2  . LYS A 1 67 ? 15.540  -3.951  -11.071 1.00 9.58  ? 67 LYS A HD2  7  
ATOM   7969  H HD3  . LYS A 1 67 ? 14.978  -2.295  -10.845 1.00 9.47  ? 67 LYS A HD3  7  
ATOM   7970  H HE2  . LYS A 1 67 ? 15.969  -2.833  -8.362  1.00 10.35 ? 67 LYS A HE2  7  
ATOM   7971  H HE3  . LYS A 1 67 ? 17.048  -3.803  -9.363  1.00 10.41 ? 67 LYS A HE3  7  
ATOM   7972  H HZ1  . LYS A 1 67 ? 16.446  -0.929  -9.817  1.00 10.60 ? 67 LYS A HZ1  7  
ATOM   7973  H HZ2  . LYS A 1 67 ? 17.836  -1.514  -9.043  1.00 10.51 ? 67 LYS A HZ2  7  
ATOM   7974  H HZ3  . LYS A 1 67 ? 17.563  -1.878  -10.679 1.00 10.49 ? 67 LYS A HZ3  7  
ATOM   7975  N N    . ARG A 1 68 ? 13.377  0.124   -10.614 1.00 8.12  ? 68 ARG A N    7  
ATOM   7976  C CA   . ARG A 1 68 ? 13.867  1.153   -11.585 1.00 8.78  ? 68 ARG A CA   7  
ATOM   7977  C C    . ARG A 1 68 ? 14.878  2.078   -10.896 1.00 8.99  ? 68 ARG A C    7  
ATOM   7978  O O    . ARG A 1 68 ? 15.068  2.021   -9.694  1.00 8.81  ? 68 ARG A O    7  
ATOM   7979  C CB   . ARG A 1 68 ? 12.693  1.991   -12.111 1.00 9.33  ? 68 ARG A CB   7  
ATOM   7980  C CG   . ARG A 1 68 ? 11.795  2.437   -10.951 1.00 9.61  ? 68 ARG A CG   7  
ATOM   7981  C CD   . ARG A 1 68 ? 11.776  3.966   -10.874 1.00 10.05 ? 68 ARG A CD   7  
ATOM   7982  N NE   . ARG A 1 68 ? 11.092  4.392   -9.619  1.00 10.53 ? 68 ARG A NE   7  
ATOM   7983  C CZ   . ARG A 1 68 ? 9.847   4.789   -9.654  1.00 10.90 ? 68 ARG A CZ   7  
ATOM   7984  N NH1  . ARG A 1 68 ? 8.882   3.906   -9.725  1.00 11.02 ? 68 ARG A NH1  7  
ATOM   7985  N NH2  . ARG A 1 68 ? 9.568   6.066   -9.614  1.00 11.35 ? 68 ARG A NH2  7  
ATOM   7986  H H    . ARG A 1 68 ? 13.532  0.252   -9.654  1.00 8.08  ? 68 ARG A H    7  
ATOM   7987  H HA   . ARG A 1 68 ? 14.350  0.657   -12.414 1.00 9.01  ? 68 ARG A HA   7  
ATOM   7988  H HB2  . ARG A 1 68 ? 13.078  2.863   -12.623 1.00 9.69  ? 68 ARG A HB2  7  
ATOM   7989  H HB3  . ARG A 1 68 ? 12.118  1.401   -12.803 1.00 9.41  ? 68 ARG A HB3  7  
ATOM   7990  H HG2  . ARG A 1 68 ? 10.790  2.074   -11.115 1.00 9.48  ? 68 ARG A HG2  7  
ATOM   7991  H HG3  . ARG A 1 68 ? 12.176  2.038   -10.024 1.00 9.87  ? 68 ARG A HG3  7  
ATOM   7992  H HD2  . ARG A 1 68 ? 12.790  4.339   -10.876 1.00 10.14 ? 68 ARG A HD2  7  
ATOM   7993  H HD3  . ARG A 1 68 ? 11.246  4.363   -11.727 1.00 10.14 ? 68 ARG A HD3  7  
ATOM   7994  H HE   . ARG A 1 68 ? 11.578  4.373   -8.768  1.00 10.72 ? 68 ARG A HE   7  
ATOM   7995  H HH11 . ARG A 1 68 ? 9.097   2.930   -9.753  1.00 10.82 ? 68 ARG A HH11 7  
ATOM   7996  H HH12 . ARG A 1 68 ? 7.927   4.209   -9.751  1.00 11.44 ? 68 ARG A HH12 7  
ATOM   7997  H HH21 . ARG A 1 68 ? 10.307  6.738   -9.558  1.00 11.42 ? 68 ARG A HH21 7  
ATOM   7998  H HH22 . ARG A 1 68 ? 8.616   6.373   -9.639  1.00 11.76 ? 68 ARG A HH22 7  
ATOM   7999  N N    . ALA A 1 69 ? 15.521  2.932   -11.654 1.00 9.61  ? 69 ALA A N    7  
ATOM   8000  C CA   . ALA A 1 69 ? 16.523  3.871   -11.058 1.00 10.14 ? 69 ALA A CA   7  
ATOM   8001  C C    . ALA A 1 69 ? 16.924  4.933   -12.093 1.00 10.89 ? 69 ALA A C    7  
ATOM   8002  O O    . ALA A 1 69 ? 18.095  5.158   -12.347 1.00 11.20 ? 69 ALA A O    7  
ATOM   8003  C CB   . ALA A 1 69 ? 17.763  3.083   -10.618 1.00 10.08 ? 69 ALA A CB   7  
ATOM   8004  H H    . ALA A 1 69 ? 15.341  2.956   -12.619 1.00 9.89  ? 69 ALA A H    7  
ATOM   8005  H HA   . ALA A 1 69 ? 16.087  4.359   -10.198 1.00 10.27 ? 69 ALA A HA   7  
ATOM   8006  H HB1  . ALA A 1 69 ? 18.065  2.416   -11.412 1.00 10.12 ? 69 ALA A HB1  7  
ATOM   8007  H HB2  . ALA A 1 69 ? 18.567  3.770   -10.398 1.00 10.12 ? 69 ALA A HB2  7  
ATOM   8008  H HB3  . ALA A 1 69 ? 17.530  2.508   -9.734  1.00 10.18 ? 69 ALA A HB3  7  
ATOM   8009  N N    . GLU A 1 70 ? 15.959  5.592   -12.691 1.00 11.37 ? 70 GLU A N    7  
ATOM   8010  C CA   . GLU A 1 70 ? 16.276  6.641   -13.707 1.00 12.24 ? 70 GLU A CA   7  
ATOM   8011  C C    . GLU A 1 70 ? 15.519  7.928   -13.360 1.00 12.45 ? 70 GLU A C    7  
ATOM   8012  O O    . GLU A 1 70 ? 16.114  8.919   -12.981 1.00 12.32 ? 70 GLU A O    7  
ATOM   8013  C CB   . GLU A 1 70 ? 15.860  6.151   -15.101 1.00 12.79 ? 70 GLU A CB   7  
ATOM   8014  C CG   . GLU A 1 70 ? 16.760  4.986   -15.532 1.00 12.48 ? 70 GLU A CG   7  
ATOM   8015  C CD   . GLU A 1 70 ? 18.126  5.523   -15.974 1.00 13.18 ? 70 GLU A CD   7  
ATOM   8016  O OE1  . GLU A 1 70 ? 18.228  5.967   -17.107 1.00 13.63 ? 70 GLU A OE1  7  
ATOM   8017  O OE2  . GLU A 1 70 ? 19.045  5.482   -15.173 1.00 13.39 ? 70 GLU A OE2  7  
ATOM   8018  H H    . GLU A 1 70 ? 15.024  5.396   -12.468 1.00 11.26 ? 70 GLU A H    7  
ATOM   8019  H HA   . GLU A 1 70 ? 17.338  6.839   -13.698 1.00 12.53 ? 70 GLU A HA   7  
ATOM   8020  H HB2  . GLU A 1 70 ? 14.833  5.818   -15.073 1.00 13.03 ? 70 GLU A HB2  7  
ATOM   8021  H HB3  . GLU A 1 70 ? 15.957  6.959   -15.811 1.00 13.32 ? 70 GLU A HB3  7  
ATOM   8022  H HG2  . GLU A 1 70 ? 16.892  4.307   -14.703 1.00 12.20 ? 70 GLU A HG2  7  
ATOM   8023  H HG3  . GLU A 1 70 ? 16.300  4.461   -16.356 1.00 12.23 ? 70 GLU A HG3  7  
ATOM   8024  N N    . ASN A 1 71 ? 14.211  7.916   -13.481 1.00 12.96 ? 71 ASN A N    7  
ATOM   8025  C CA   . ASN A 1 71 ? 13.404  9.132   -13.154 1.00 13.39 ? 71 ASN A CA   7  
ATOM   8026  C C    . ASN A 1 71 ? 11.921  8.756   -13.086 1.00 13.77 ? 71 ASN A C    7  
ATOM   8027  O O    . ASN A 1 71 ? 11.266  8.967   -12.081 1.00 13.98 ? 71 ASN A O    7  
ATOM   8028  C CB   . ASN A 1 71 ? 13.612  10.200  -14.238 1.00 13.14 ? 71 ASN A CB   7  
ATOM   8029  C CG   . ASN A 1 71 ? 14.326  11.414  -13.636 1.00 12.70 ? 71 ASN A CG   7  
ATOM   8030  O OD1  . ASN A 1 71 ? 15.453  11.706  -13.987 1.00 12.77 ? 71 ASN A OD1  7  
ATOM   8031  N ND2  . ASN A 1 71 ? 13.715  12.143  -12.740 1.00 12.41 ? 71 ASN A ND2  7  
ATOM   8032  H H    . ASN A 1 71 ? 13.758  7.100   -13.783 1.00 13.17 ? 71 ASN A H    7  
ATOM   8033  H HA   . ASN A 1 71 ? 13.718  9.524   -12.197 1.00 13.80 ? 71 ASN A HA   7  
ATOM   8034  H HB2  . ASN A 1 71 ? 14.211  9.790   -15.037 1.00 13.36 ? 71 ASN A HB2  7  
ATOM   8035  H HB3  . ASN A 1 71 ? 12.654  10.507  -14.630 1.00 13.26 ? 71 ASN A HB3  7  
ATOM   8036  H HD21 . ASN A 1 71 ? 12.805  11.913  -12.458 1.00 12.47 ? 71 ASN A HD21 7  
ATOM   8037  H HD22 . ASN A 1 71 ? 14.166  12.920  -12.350 1.00 12.23 ? 71 ASN A HD22 7  
ATOM   8038  N N    . SER A 1 72 ? 11.389  8.199   -14.148 1.00 14.02 ? 72 SER A N    7  
ATOM   8039  C CA   . SER A 1 72 ? 9.948   7.803   -14.156 1.00 14.59 ? 72 SER A CA   7  
ATOM   8040  C C    . SER A 1 72 ? 9.838   6.274   -14.084 1.00 15.09 ? 72 SER A C    7  
ATOM   8041  O O    . SER A 1 72 ? 9.186   5.791   -13.171 1.00 15.38 ? 72 SER A O    7  
ATOM   8042  C CB   . SER A 1 72 ? 9.289   8.310   -15.442 1.00 14.66 ? 72 SER A CB   7  
ATOM   8043  O OG   . SER A 1 72 ? 9.222   9.731   -15.407 1.00 14.60 ? 72 SER A OG   7  
ATOM   8044  O OXT  . SER A 1 72 ? 10.407  5.611   -14.940 1.00 15.30 ? 72 SER A OXT  7  
ATOM   8045  H H    . SER A 1 72 ? 11.940  8.039   -14.943 1.00 13.94 ? 72 SER A H    7  
ATOM   8046  H HA   . SER A 1 72 ? 9.451   8.239   -13.302 1.00 14.77 ? 72 SER A HA   7  
ATOM   8047  H HB2  . SER A 1 72 ? 9.874   8.005   -16.294 1.00 14.69 ? 72 SER A HB2  7  
ATOM   8048  H HB3  . SER A 1 72 ? 8.294   7.895   -15.524 1.00 14.91 ? 72 SER A HB3  7  
ATOM   8049  H HG   . SER A 1 72 ? 10.039  10.077  -15.774 1.00 14.50 ? 72 SER A HG   7  
ATOM   8050  N N    . GLU A 1 4  ? -5.409  13.199  -8.161  1.00 9.58  ? 4  GLU A N    8  
ATOM   8051  C CA   . GLU A 1 4  ? -6.558  13.355  -9.106  1.00 9.09  ? 4  GLU A CA   8  
ATOM   8052  C C    . GLU A 1 4  ? -7.875  13.146  -8.348  1.00 8.06  ? 4  GLU A C    8  
ATOM   8053  O O    . GLU A 1 4  ? -8.646  14.069  -8.171  1.00 8.10  ? 4  GLU A O    8  
ATOM   8054  C CB   . GLU A 1 4  ? -6.443  12.327  -10.240 1.00 9.77  ? 4  GLU A CB   8  
ATOM   8055  C CG   . GLU A 1 4  ? -5.256  12.679  -11.145 1.00 10.24 ? 4  GLU A CG   8  
ATOM   8056  C CD   . GLU A 1 4  ? -5.651  13.807  -12.103 1.00 11.04 ? 4  GLU A CD   8  
ATOM   8057  O OE1  . GLU A 1 4  ? -5.486  14.959  -11.730 1.00 11.49 ? 4  GLU A OE1  8  
ATOM   8058  O OE2  . GLU A 1 4  ? -6.109  13.501  -13.192 1.00 11.36 ? 4  GLU A OE2  8  
ATOM   8059  H H    . GLU A 1 4  ? -5.525  13.859  -7.365  1.00 9.89  ? 4  GLU A H    8  
ATOM   8060  H HA   . GLU A 1 4  ? -6.542  14.351  -9.523  1.00 9.22  ? 4  GLU A HA   8  
ATOM   8061  H HB2  . GLU A 1 4  ? -6.295  11.343  -9.820  1.00 9.96  ? 4  GLU A HB2  8  
ATOM   8062  H HB3  . GLU A 1 4  ? -7.352  12.335  -10.824 1.00 9.97  ? 4  GLU A HB3  8  
ATOM   8063  H HG2  . GLU A 1 4  ? -4.423  12.999  -10.537 1.00 10.27 ? 4  GLU A HG2  8  
ATOM   8064  H HG3  . GLU A 1 4  ? -4.970  11.809  -11.716 1.00 10.19 ? 4  GLU A HG3  8  
ATOM   8065  N N    . LEU A 1 5  ? -8.129  11.941  -7.893  1.00 7.36  ? 5  LEU A N    8  
ATOM   8066  C CA   . LEU A 1 5  ? -9.389  11.666  -7.135  1.00 6.53  ? 5  LEU A CA   8  
ATOM   8067  C C    . LEU A 1 5  ? -9.086  11.708  -5.633  1.00 6.17  ? 5  LEU A C    8  
ATOM   8068  O O    . LEU A 1 5  ? -7.941  11.619  -5.222  1.00 6.61  ? 5  LEU A O    8  
ATOM   8069  C CB   . LEU A 1 5  ? -9.924  10.280  -7.516  1.00 6.34  ? 5  LEU A CB   8  
ATOM   8070  C CG   . LEU A 1 5  ? -11.435 10.356  -7.767  1.00 7.26  ? 5  LEU A CG   8  
ATOM   8071  C CD1  . LEU A 1 5  ? -11.806 9.456   -8.949  1.00 7.60  ? 5  LEU A CD1  8  
ATOM   8072  C CD2  . LEU A 1 5  ? -12.188 9.887   -6.516  1.00 7.86  ? 5  LEU A CD2  8  
ATOM   8073  H H    . LEU A 1 5  ? -7.486  11.217  -8.043  1.00 7.57  ? 5  LEU A H    8  
ATOM   8074  H HA   . LEU A 1 5  ? -10.127 12.418  -7.375  1.00 6.63  ? 5  LEU A HA   8  
ATOM   8075  H HB2  . LEU A 1 5  ? -9.427  9.938   -8.413  1.00 5.88  ? 5  LEU A HB2  8  
ATOM   8076  H HB3  . LEU A 1 5  ? -9.729  9.584   -6.713  1.00 6.33  ? 5  LEU A HB3  8  
ATOM   8077  H HG   . LEU A 1 5  ? -11.711 11.376  -7.994  1.00 7.52  ? 5  LEU A HG   8  
ATOM   8078  H HD11 . LEU A 1 5  ? -11.251 9.763   -9.822  1.00 8.07  ? 5  LEU A HD11 8  
ATOM   8079  H HD12 . LEU A 1 5  ? -11.565 8.431   -8.709  1.00 7.24  ? 5  LEU A HD12 8  
ATOM   8080  H HD13 . LEU A 1 5  ? -12.864 9.541   -9.146  1.00 7.97  ? 5  LEU A HD13 8  
ATOM   8081  H HD21 . LEU A 1 5  ? -11.502 9.387   -5.848  1.00 8.35  ? 5  LEU A HD21 8  
ATOM   8082  H HD22 . LEU A 1 5  ? -12.621 10.741  -6.016  1.00 7.79  ? 5  LEU A HD22 8  
ATOM   8083  H HD23 . LEU A 1 5  ? -12.973 9.203   -6.803  1.00 8.13  ? 5  LEU A HD23 8  
ATOM   8084  N N    . ARG A 1 6  ? -10.101 11.841  -4.809  1.00 5.61  ? 6  ARG A N    8  
ATOM   8085  C CA   . ARG A 1 6  ? -9.878  11.891  -3.329  1.00 5.48  ? 6  ARG A CA   8  
ATOM   8086  C C    . ARG A 1 6  ? -9.287  10.560  -2.838  1.00 4.69  ? 6  ARG A C    8  
ATOM   8087  O O    . ARG A 1 6  ? -9.004  9.665   -3.615  1.00 4.64  ? 6  ARG A O    8  
ATOM   8088  C CB   . ARG A 1 6  ? -11.212 12.151  -2.621  1.00 6.06  ? 6  ARG A CB   8  
ATOM   8089  C CG   . ARG A 1 6  ? -11.424 13.659  -2.452  1.00 6.84  ? 6  ARG A CG   8  
ATOM   8090  C CD   . ARG A 1 6  ? -12.334 14.181  -3.566  1.00 7.76  ? 6  ARG A CD   8  
ATOM   8091  N NE   . ARG A 1 6  ? -12.557 15.643  -3.379  1.00 8.57  ? 6  ARG A NE   8  
ATOM   8092  C CZ   . ARG A 1 6  ? -13.747 16.093  -3.073  1.00 9.27  ? 6  ARG A CZ   8  
ATOM   8093  N NH1  . ARG A 1 6  ? -14.174 16.026  -1.837  1.00 9.77  ? 6  ARG A NH1  8  
ATOM   8094  N NH2  . ARG A 1 6  ? -14.508 16.612  -4.003  1.00 9.70  ? 6  ARG A NH2  8  
ATOM   8095  H H    . ARG A 1 6  ? -11.010 11.913  -5.166  1.00 5.45  ? 6  ARG A H    8  
ATOM   8096  H HA   . ARG A 1 6  ? -9.191  12.691  -3.099  1.00 5.83  ? 6  ARG A HA   8  
ATOM   8097  H HB2  . ARG A 1 6  ? -12.017 11.736  -3.207  1.00 6.17  ? 6  ARG A HB2  8  
ATOM   8098  H HB3  . ARG A 1 6  ? -11.202 11.683  -1.649  1.00 6.11  ? 6  ARG A HB3  8  
ATOM   8099  H HG2  . ARG A 1 6  ? -11.882 13.853  -1.493  1.00 6.68  ? 6  ARG A HG2  8  
ATOM   8100  H HG3  . ARG A 1 6  ? -10.470 14.165  -2.503  1.00 7.20  ? 6  ARG A HG3  8  
ATOM   8101  H HD2  . ARG A 1 6  ? -11.867 14.008  -4.525  1.00 8.01  ? 6  ARG A HD2  8  
ATOM   8102  H HD3  . ARG A 1 6  ? -13.282 13.664  -3.529  1.00 7.82  ? 6  ARG A HD3  8  
ATOM   8103  H HE   . ARG A 1 6  ? -11.811 16.270  -3.486  1.00 8.74  ? 6  ARG A HE   8  
ATOM   8104  H HH11 . ARG A 1 6  ? -13.592 15.631  -1.127  1.00 9.63  ? 6  ARG A HH11 8  
ATOM   8105  H HH12 . ARG A 1 6  ? -15.084 16.371  -1.602  1.00 10.41 ? 6  ARG A HH12 8  
ATOM   8106  H HH21 . ARG A 1 6  ? -14.180 16.666  -4.946  1.00 9.50  ? 6  ARG A HH21 8  
ATOM   8107  H HH22 . ARG A 1 6  ? -15.418 16.958  -3.771  1.00 10.35 ? 6  ARG A HH22 8  
ATOM   8108  N N    . CYS A 1 7  ? -9.098  10.430  -1.548  1.00 4.47  ? 7  CYS A N    8  
ATOM   8109  C CA   . CYS A 1 7  ? -8.522  9.172   -0.990  1.00 4.05  ? 7  CYS A CA   8  
ATOM   8110  C C    . CYS A 1 7  ? -9.519  8.024   -1.174  1.00 4.38  ? 7  CYS A C    8  
ATOM   8111  O O    . CYS A 1 7  ? -10.569 7.993   -0.556  1.00 4.93  ? 7  CYS A O    8  
ATOM   8112  C CB   . CYS A 1 7  ? -8.227  9.356   0.503   1.00 4.32  ? 7  CYS A CB   8  
ATOM   8113  S SG   . CYS A 1 7  ? -7.438  10.964  0.785   1.00 4.79  ? 7  CYS A SG   8  
ATOM   8114  H H    . CYS A 1 7  ? -9.333  11.163  -0.946  1.00 4.87  ? 7  CYS A H    8  
ATOM   8115  H HA   . CYS A 1 7  ? -7.605  8.935   -1.510  1.00 3.89  ? 7  CYS A HA   8  
ATOM   8116  H HB2  . CYS A 1 7  ? -9.148  9.305   1.061   1.00 4.81  ? 7  CYS A HB2  8  
ATOM   8117  H HB3  . CYS A 1 7  ? -7.567  8.574   0.832   1.00 4.30  ? 7  CYS A HB3  8  
ATOM   8118  N N    . GLN A 1 8  ? -9.191  7.075   -2.020  1.00 4.51  ? 8  GLN A N    8  
ATOM   8119  C CA   . GLN A 1 8  ? -10.101 5.916   -2.253  1.00 5.30  ? 8  GLN A CA   8  
ATOM   8120  C C    . GLN A 1 8  ? -10.070 4.973   -1.039  1.00 5.47  ? 8  GLN A C    8  
ATOM   8121  O O    . GLN A 1 8  ? -10.986 4.200   -0.827  1.00 6.21  ? 8  GLN A O    8  
ATOM   8122  C CB   . GLN A 1 8  ? -9.637  5.153   -3.499  1.00 5.63  ? 8  GLN A CB   8  
ATOM   8123  C CG   . GLN A 1 8  ? -9.991  5.952   -4.759  1.00 6.22  ? 8  GLN A CG   8  
ATOM   8124  C CD   . GLN A 1 8  ? -11.414 5.605   -5.207  1.00 7.21  ? 8  GLN A CD   8  
ATOM   8125  O OE1  . GLN A 1 8  ? -12.370 6.198   -4.747  1.00 7.78  ? 8  GLN A OE1  8  
ATOM   8126  N NE2  . GLN A 1 8  ? -11.598 4.664   -6.095  1.00 7.68  ? 8  GLN A NE2  8  
ATOM   8127  H H    . GLN A 1 8  ? -8.339  7.124   -2.501  1.00 4.40  ? 8  GLN A H    8  
ATOM   8128  H HA   . GLN A 1 8  ? -11.109 6.273   -2.405  1.00 5.87  ? 8  GLN A HA   8  
ATOM   8129  H HB2  . GLN A 1 8  ? -8.568  5.010   -3.453  1.00 5.62  ? 8  GLN A HB2  8  
ATOM   8130  H HB3  . GLN A 1 8  ? -10.126 4.196   -3.534  1.00 5.89  ? 8  GLN A HB3  8  
ATOM   8131  H HG2  . GLN A 1 8  ? -9.928  7.008   -4.545  1.00 6.11  ? 8  GLN A HG2  8  
ATOM   8132  H HG3  . GLN A 1 8  ? -9.297  5.702   -5.547  1.00 6.39  ? 8  GLN A HG3  8  
ATOM   8133  H HE21 . GLN A 1 8  ? -10.829 4.185   -6.471  1.00 7.43  ? 8  GLN A HE21 8  
ATOM   8134  H HE22 . GLN A 1 8  ? -12.506 4.436   -6.386  1.00 8.44  ? 8  GLN A HE22 8  
ATOM   8135  N N    . CYS A 1 9  ? -9.024  5.030   -0.242  1.00 5.04  ? 9  CYS A N    8  
ATOM   8136  C CA   . CYS A 1 9  ? -8.931  4.142   0.953   1.00 5.45  ? 9  CYS A CA   8  
ATOM   8137  C C    . CYS A 1 9  ? -8.772  4.984   2.219   1.00 5.99  ? 9  CYS A C    8  
ATOM   8138  O O    . CYS A 1 9  ? -7.714  5.526   2.484   1.00 6.13  ? 9  CYS A O    8  
ATOM   8139  C CB   . CYS A 1 9  ? -7.715  3.219   0.811   1.00 5.08  ? 9  CYS A CB   8  
ATOM   8140  S SG   . CYS A 1 9  ? -8.252  1.580   0.272   1.00 5.12  ? 9  CYS A SG   8  
ATOM   8141  H H    . CYS A 1 9  ? -8.298  5.661   -0.432  1.00 4.65  ? 9  CYS A H    8  
ATOM   8142  H HA   . CYS A 1 9  ? -9.826  3.543   1.032   1.00 5.89  ? 9  CYS A HA   8  
ATOM   8143  H HB2  . CYS A 1 9  ? -7.035  3.632   0.079   1.00 4.67  ? 9  CYS A HB2  8  
ATOM   8144  H HB3  . CYS A 1 9  ? -7.211  3.139   1.763   1.00 5.54  ? 9  CYS A HB3  8  
ATOM   8145  N N    . ILE A 1 10 ? -9.808  5.068   3.023   1.00 6.61  ? 10 ILE A N    8  
ATOM   8146  C CA   . ILE A 1 10 ? -9.705  5.841   4.299   1.00 7.44  ? 10 ILE A CA   8  
ATOM   8147  C C    . ILE A 1 10 ? -8.698  5.115   5.202   1.00 7.48  ? 10 ILE A C    8  
ATOM   8148  O O    . ILE A 1 10 ? -7.931  5.729   5.918   1.00 8.16  ? 10 ILE A O    8  
ATOM   8149  C CB   . ILE A 1 10 ? -11.079 5.909   4.991   1.00 8.38  ? 10 ILE A CB   8  
ATOM   8150  C CG1  . ILE A 1 10 ? -12.088 6.658   4.102   1.00 8.63  ? 10 ILE A CG1  8  
ATOM   8151  C CG2  . ILE A 1 10 ? -10.951 6.640   6.332   1.00 9.31  ? 10 ILE A CG2  8  
ATOM   8152  C CD1  . ILE A 1 10 ? -11.508 8.006   3.653   1.00 9.47  ? 10 ILE A CD1  8  
ATOM   8153  H H    . ILE A 1 10 ? -10.639 4.598   2.799   1.00 6.69  ? 10 ILE A H    8  
ATOM   8154  H HA   . ILE A 1 10 ? -9.349  6.839   4.091   1.00 7.59  ? 10 ILE A HA   8  
ATOM   8155  H HB   . ILE A 1 10 ? -11.436 4.905   5.169   1.00 8.40  ? 10 ILE A HB   8  
ATOM   8156  H HG12 . ILE A 1 10 ? -12.314 6.059   3.233   1.00 8.91  ? 10 ILE A HG12 8  
ATOM   8157  H HG13 . ILE A 1 10 ? -12.995 6.830   4.660   1.00 8.14  ? 10 ILE A HG13 8  
ATOM   8158  H HG21 . ILE A 1 10 ? -10.492 7.606   6.174   1.00 9.27  ? 10 ILE A HG21 8  
ATOM   8159  H HG22 . ILE A 1 10 ? -11.931 6.775   6.764   1.00 9.78  ? 10 ILE A HG22 8  
ATOM   8160  H HG23 . ILE A 1 10 ? -10.339 6.057   7.003   1.00 9.72  ? 10 ILE A HG23 8  
ATOM   8161  H HD11 . ILE A 1 10 ? -10.841 8.383   4.414   1.00 9.77  ? 10 ILE A HD11 8  
ATOM   8162  H HD12 . ILE A 1 10 ? -10.963 7.873   2.729   1.00 9.76  ? 10 ILE A HD12 8  
ATOM   8163  H HD13 . ILE A 1 10 ? -12.312 8.709   3.498   1.00 9.66  ? 10 ILE A HD13 8  
ATOM   8164  N N    . LYS A 1 11 ? -8.687  3.803   5.137   1.00 6.93  ? 11 LYS A N    8  
ATOM   8165  C CA   . LYS A 1 11 ? -7.727  2.996   5.942   1.00 7.15  ? 11 LYS A CA   8  
ATOM   8166  C C    . LYS A 1 11 ? -6.857  2.191   4.972   1.00 6.42  ? 11 LYS A C    8  
ATOM   8167  O O    . LYS A 1 11 ? -7.365  1.440   4.158   1.00 6.35  ? 11 LYS A O    8  
ATOM   8168  C CB   . LYS A 1 11 ? -8.497  2.039   6.861   1.00 8.05  ? 11 LYS A CB   8  
ATOM   8169  C CG   . LYS A 1 11 ? -8.996  2.794   8.097   1.00 8.65  ? 11 LYS A CG   8  
ATOM   8170  C CD   . LYS A 1 11 ? -10.454 3.214   7.888   1.00 9.04  ? 11 LYS A CD   8  
ATOM   8171  C CE   . LYS A 1 11 ? -10.827 4.297   8.905   1.00 9.50  ? 11 LYS A CE   8  
ATOM   8172  N NZ   . LYS A 1 11 ? -11.360 3.660   10.145  1.00 9.69  ? 11 LYS A NZ   8  
ATOM   8173  H H    . LYS A 1 11 ? -9.307  3.345   4.529   1.00 6.52  ? 11 LYS A H    8  
ATOM   8174  H HA   . LYS A 1 11 ? -7.104  3.652   6.534   1.00 7.36  ? 11 LYS A HA   8  
ATOM   8175  H HB2  . LYS A 1 11 ? -9.340  1.628   6.324   1.00 8.15  ? 11 LYS A HB2  8  
ATOM   8176  H HB3  . LYS A 1 11 ? -7.844  1.237   7.172   1.00 8.38  ? 11 LYS A HB3  8  
ATOM   8177  H HG2  . LYS A 1 11 ? -8.927  2.151   8.962   1.00 9.16  ? 11 LYS A HG2  8  
ATOM   8178  H HG3  . LYS A 1 11 ? -8.389  3.673   8.253   1.00 8.50  ? 11 LYS A HG3  8  
ATOM   8179  H HD2  . LYS A 1 11 ? -10.577 3.602   6.887   1.00 9.00  ? 11 LYS A HD2  8  
ATOM   8180  H HD3  . LYS A 1 11 ? -11.099 2.359   8.024   1.00 9.26  ? 11 LYS A HD3  8  
ATOM   8181  H HE2  . LYS A 1 11 ? -9.950  4.879   9.149   1.00 9.79  ? 11 LYS A HE2  8  
ATOM   8182  H HE3  . LYS A 1 11 ? -11.581 4.944   8.481   1.00 9.62  ? 11 LYS A HE3  8  
ATOM   8183  H HZ1  . LYS A 1 11 ? -12.192 3.082   9.907   1.00 9.86  ? 11 LYS A HZ1  8  
ATOM   8184  H HZ2  . LYS A 1 11 ? -10.626 3.057   10.568  1.00 9.61  ? 11 LYS A HZ2  8  
ATOM   8185  H HZ3  . LYS A 1 11 ? -11.632 4.399   10.823  1.00 9.96  ? 11 LYS A HZ3  8  
ATOM   8186  N N    . THR A 1 12 ? -5.557  2.351   5.031   1.00 6.02  ? 12 THR A N    8  
ATOM   8187  C CA   . THR A 1 12 ? -4.668  1.600   4.088   1.00 5.35  ? 12 THR A CA   8  
ATOM   8188  C C    . THR A 1 12 ? -4.271  0.245   4.671   1.00 5.31  ? 12 THR A C    8  
ATOM   8189  O O    . THR A 1 12 ? -4.735  -0.161  5.722   1.00 5.80  ? 12 THR A O    8  
ATOM   8190  C CB   . THR A 1 12 ? -3.402  2.406   3.782   1.00 5.23  ? 12 THR A CB   8  
ATOM   8191  O OG1  . THR A 1 12 ? -3.208  3.415   4.765   1.00 5.90  ? 12 THR A OG1  8  
ATOM   8192  C CG2  . THR A 1 12 ? -3.531  3.038   2.400   1.00 5.32  ? 12 THR A CG2  8  
ATOM   8193  H H    . THR A 1 12 ? -5.168  2.970   5.684   1.00 6.26  ? 12 THR A H    8  
ATOM   8194  H HA   . THR A 1 12 ? -5.202  1.434   3.165   1.00 5.27  ? 12 THR A HA   8  
ATOM   8195  H HB   . THR A 1 12 ? -2.552  1.742   3.782   1.00 4.85  ? 12 THR A HB   8  
ATOM   8196  H HG1  . THR A 1 12 ? -2.813  3.006   5.537   1.00 6.31  ? 12 THR A HG1  8  
ATOM   8197  H HG21 . THR A 1 12 ? -4.409  3.663   2.372   1.00 5.41  ? 12 THR A HG21 8  
ATOM   8198  H HG22 . THR A 1 12 ? -2.654  3.632   2.193   1.00 5.52  ? 12 THR A HG22 8  
ATOM   8199  H HG23 . THR A 1 12 ? -3.621  2.257   1.657   1.00 5.48  ? 12 THR A HG23 8  
ATOM   8200  N N    . TYR A 1 13 ? -3.425  -0.464  3.966   1.00 4.96  ? 13 TYR A N    8  
ATOM   8201  C CA   . TYR A 1 13 ? -2.986  -1.808  4.421   1.00 5.03  ? 13 TYR A CA   8  
ATOM   8202  C C    . TYR A 1 13 ? -1.720  -1.695  5.270   1.00 5.08  ? 13 TYR A C    8  
ATOM   8203  O O    . TYR A 1 13 ? -0.716  -1.158  4.837   1.00 4.67  ? 13 TYR A O    8  
ATOM   8204  C CB   . TYR A 1 13 ? -2.695  -2.669  3.188   1.00 4.85  ? 13 TYR A CB   8  
ATOM   8205  C CG   . TYR A 1 13 ? -2.785  -4.135  3.524   1.00 5.22  ? 13 TYR A CG   8  
ATOM   8206  C CD1  . TYR A 1 13 ? -3.560  -4.572  4.601   1.00 5.34  ? 13 TYR A CD1  8  
ATOM   8207  C CD2  . TYR A 1 13 ? -2.084  -5.055  2.741   1.00 5.75  ? 13 TYR A CD2  8  
ATOM   8208  C CE1  . TYR A 1 13 ? -3.634  -5.936  4.901   1.00 5.79  ? 13 TYR A CE1  8  
ATOM   8209  C CE2  . TYR A 1 13 ? -2.156  -6.422  3.038   1.00 6.30  ? 13 TYR A CE2  8  
ATOM   8210  C CZ   . TYR A 1 13 ? -2.932  -6.863  4.119   1.00 6.23  ? 13 TYR A CZ   8  
ATOM   8211  O OH   . TYR A 1 13 ? -3.006  -8.211  4.409   1.00 6.84  ? 13 TYR A OH   8  
ATOM   8212  H H    . TYR A 1 13 ? -3.087  -0.110  3.117   1.00 4.82  ? 13 TYR A H    8  
ATOM   8213  H HA   . TYR A 1 13 ? -3.772  -2.262  5.002   1.00 5.34  ? 13 TYR A HA   8  
ATOM   8214  H HB2  . TYR A 1 13 ? -3.407  -2.439  2.413   1.00 4.90  ? 13 TYR A HB2  8  
ATOM   8215  H HB3  . TYR A 1 13 ? -1.700  -2.452  2.836   1.00 4.67  ? 13 TYR A HB3  8  
ATOM   8216  H HD1  . TYR A 1 13 ? -4.103  -3.853  5.199   1.00 5.30  ? 13 TYR A HD1  8  
ATOM   8217  H HD2  . TYR A 1 13 ? -1.489  -4.706  1.905   1.00 5.92  ? 13 TYR A HD2  8  
ATOM   8218  H HE1  . TYR A 1 13 ? -4.232  -6.275  5.734   1.00 5.99  ? 13 TYR A HE1  8  
ATOM   8219  H HE2  . TYR A 1 13 ? -1.615  -7.135  2.436   1.00 6.92  ? 13 TYR A HE2  8  
ATOM   8220  H HH   . TYR A 1 13 ? -2.805  -8.328  5.340   1.00 7.17  ? 13 TYR A HH   8  
ATOM   8221  N N    . SER A 1 14 ? -1.759  -2.221  6.468   1.00 5.82  ? 14 SER A N    8  
ATOM   8222  C CA   . SER A 1 14 ? -0.559  -2.178  7.353   1.00 6.06  ? 14 SER A CA   8  
ATOM   8223  C C    . SER A 1 14 ? 0.125   -3.549  7.343   1.00 6.51  ? 14 SER A C    8  
ATOM   8224  O O    . SER A 1 14 ? 1.331   -3.645  7.471   1.00 6.88  ? 14 SER A O    8  
ATOM   8225  C CB   . SER A 1 14 ? -0.975  -1.809  8.782   1.00 6.42  ? 14 SER A CB   8  
ATOM   8226  O OG   . SER A 1 14 ? -1.726  -2.874  9.354   1.00 6.80  ? 14 SER A OG   8  
ATOM   8227  H H    . SER A 1 14 ? -2.578  -2.661  6.779   1.00 6.33  ? 14 SER A H    8  
ATOM   8228  H HA   . SER A 1 14 ? 0.134   -1.442  6.976   1.00 5.81  ? 14 SER A HA   8  
ATOM   8229  H HB2  . SER A 1 14 ? -0.097  -1.635  9.380   1.00 6.57  ? 14 SER A HB2  8  
ATOM   8230  H HB3  . SER A 1 14 ? -1.574  -0.907  8.758   1.00 6.52  ? 14 SER A HB3  8  
ATOM   8231  H HG   . SER A 1 14 ? -2.651  -2.731  9.147   1.00 7.03  ? 14 SER A HG   8  
ATOM   8232  N N    . LYS A 1 15 ? -0.634  -4.612  7.173   1.00 6.59  ? 15 LYS A N    8  
ATOM   8233  C CA   . LYS A 1 15 ? -0.021  -5.968  7.136   1.00 7.06  ? 15 LYS A CA   8  
ATOM   8234  C C    . LYS A 1 15 ? 0.620   -6.171  5.758   1.00 6.32  ? 15 LYS A C    8  
ATOM   8235  O O    . LYS A 1 15 ? 0.065   -5.764  4.757   1.00 6.13  ? 15 LYS A O    8  
ATOM   8236  C CB   . LYS A 1 15 ? -1.066  -7.069  7.356   1.00 7.75  ? 15 LYS A CB   8  
ATOM   8237  C CG   . LYS A 1 15 ? -2.242  -6.578  8.219   1.00 8.64  ? 15 LYS A CG   8  
ATOM   8238  C CD   . LYS A 1 15 ? -1.748  -6.246  9.630   1.00 9.43  ? 15 LYS A CD   8  
ATOM   8239  C CE   . LYS A 1 15 ? -2.944  -5.941  10.537  1.00 10.20 ? 15 LYS A CE   8  
ATOM   8240  N NZ   . LYS A 1 15 ? -2.460  -5.429  11.850  1.00 10.59 ? 15 LYS A NZ   8  
ATOM   8241  H H    . LYS A 1 15 ? -1.597  -4.512  7.057   1.00 6.42  ? 15 LYS A H    8  
ATOM   8242  H HA   . LYS A 1 15 ? 0.738   -6.034  7.901   1.00 7.57  ? 15 LYS A HA   8  
ATOM   8243  H HB2  . LYS A 1 15 ? -1.429  -7.393  6.402   1.00 7.79  ? 15 LYS A HB2  8  
ATOM   8244  H HB3  . LYS A 1 15 ? -0.598  -7.899  7.847   1.00 7.79  ? 15 LYS A HB3  8  
ATOM   8245  H HG2  . LYS A 1 15 ? -2.679  -5.699  7.771   1.00 8.72  ? 15 LYS A HG2  8  
ATOM   8246  H HG3  . LYS A 1 15 ? -2.989  -7.355  8.278   1.00 8.87  ? 15 LYS A HG3  8  
ATOM   8247  H HD2  . LYS A 1 15 ? -1.201  -7.089  10.028  1.00 9.71  ? 15 LYS A HD2  8  
ATOM   8248  H HD3  . LYS A 1 15 ? -1.099  -5.382  9.593   1.00 9.38  ? 15 LYS A HD3  8  
ATOM   8249  H HE2  . LYS A 1 15 ? -3.570  -5.196  10.070  1.00 10.54 ? 15 LYS A HE2  8  
ATOM   8250  H HE3  . LYS A 1 15 ? -3.516  -6.844  10.693  1.00 10.33 ? 15 LYS A HE3  8  
ATOM   8251  H HZ1  . LYS A 1 15 ? -1.866  -4.586  11.697  1.00 10.91 ? 15 LYS A HZ1  8  
ATOM   8252  H HZ2  . LYS A 1 15 ? -3.273  -5.177  12.445  1.00 10.22 ? 15 LYS A HZ2  8  
ATOM   8253  H HZ3  . LYS A 1 15 ? -1.900  -6.165  12.326  1.00 11.09 ? 15 LYS A HZ3  8  
ATOM   8254  N N    . PRO A 1 16 ? 1.777   -6.777  5.753   1.00 6.02  ? 16 PRO A N    8  
ATOM   8255  C CA   . PRO A 1 16 ? 2.545   -7.029  4.523   1.00 5.35  ? 16 PRO A CA   8  
ATOM   8256  C C    . PRO A 1 16 ? 2.052   -8.288  3.804   1.00 5.50  ? 16 PRO A C    8  
ATOM   8257  O O    . PRO A 1 16 ? 1.434   -9.156  4.393   1.00 6.37  ? 16 PRO A O    8  
ATOM   8258  C CB   . PRO A 1 16 ? 3.971   -7.214  5.038   1.00 5.39  ? 16 PRO A CB   8  
ATOM   8259  C CG   . PRO A 1 16 ? 3.856   -7.629  6.525   1.00 6.26  ? 16 PRO A CG   8  
ATOM   8260  C CD   . PRO A 1 16 ? 2.428   -7.269  6.977   1.00 6.51  ? 16 PRO A CD   8  
ATOM   8261  H HA   . PRO A 1 16 ? 2.503   -6.180  3.865   1.00 4.92  ? 16 PRO A HA   8  
ATOM   8262  H HB2  . PRO A 1 16 ? 4.469   -7.976  4.473   1.00 5.32  ? 16 PRO A HB2  8  
ATOM   8263  H HB3  . PRO A 1 16 ? 4.509   -6.289  4.960   1.00 5.10  ? 16 PRO A HB3  8  
ATOM   8264  H HG2  . PRO A 1 16 ? 4.021   -8.694  6.625   1.00 6.77  ? 16 PRO A HG2  8  
ATOM   8265  H HG3  . PRO A 1 16 ? 4.574   -7.086  7.118   1.00 6.37  ? 16 PRO A HG3  8  
ATOM   8266  H HD2  . PRO A 1 16 ? 1.917   -8.145  7.350   1.00 7.06  ? 16 PRO A HD2  8  
ATOM   8267  H HD3  . PRO A 1 16 ? 2.442   -6.494  7.723   1.00 6.63  ? 16 PRO A HD3  8  
ATOM   8268  N N    . PHE A 1 17 ? 2.338   -8.388  2.530   1.00 4.76  ? 17 PHE A N    8  
ATOM   8269  C CA   . PHE A 1 17 ? 1.909   -9.588  1.745   1.00 4.96  ? 17 PHE A CA   8  
ATOM   8270  C C    . PHE A 1 17 ? 2.781   -9.724  0.484   1.00 4.78  ? 17 PHE A C    8  
ATOM   8271  O O    . PHE A 1 17 ? 3.431   -8.783  0.064   1.00 4.77  ? 17 PHE A O    8  
ATOM   8272  C CB   . PHE A 1 17 ? 0.414   -9.475  1.378   1.00 4.69  ? 17 PHE A CB   8  
ATOM   8273  C CG   . PHE A 1 17 ? 0.189   -8.487  0.250   1.00 3.72  ? 17 PHE A CG   8  
ATOM   8274  C CD1  . PHE A 1 17 ? 0.310   -7.110  0.479   1.00 3.74  ? 17 PHE A CD1  8  
ATOM   8275  C CD2  . PHE A 1 17 ? -0.159  -8.954  -1.024  1.00 3.29  ? 17 PHE A CD2  8  
ATOM   8276  C CE1  . PHE A 1 17 ? 0.089   -6.203  -0.565  1.00 3.14  ? 17 PHE A CE1  8  
ATOM   8277  C CE2  . PHE A 1 17 ? -0.381  -8.047  -2.066  1.00 2.59  ? 17 PHE A CE2  8  
ATOM   8278  C CZ   . PHE A 1 17 ? -0.257  -6.672  -1.838  1.00 2.38  ? 17 PHE A CZ   8  
ATOM   8279  H H    . PHE A 1 17 ? 2.846   -7.673  2.090   1.00 4.19  ? 17 PHE A H    8  
ATOM   8280  H HA   . PHE A 1 17 ? 2.051   -10.467 2.358   1.00 5.66  ? 17 PHE A HA   8  
ATOM   8281  H HB2  . PHE A 1 17 ? 0.055   -10.444 1.071   1.00 5.13  ? 17 PHE A HB2  8  
ATOM   8282  H HB3  . PHE A 1 17 ? -0.140  -9.153  2.247   1.00 5.06  ? 17 PHE A HB3  8  
ATOM   8283  H HD1  . PHE A 1 17 ? 0.575   -6.748  1.462   1.00 4.51  ? 17 PHE A HD1  8  
ATOM   8284  H HD2  . PHE A 1 17 ? -0.254  -10.015 -1.203  1.00 3.86  ? 17 PHE A HD2  8  
ATOM   8285  H HE1  . PHE A 1 17 ? 0.182   -5.143  -0.389  1.00 3.62  ? 17 PHE A HE1  8  
ATOM   8286  H HE2  . PHE A 1 17 ? -0.650  -8.408  -3.048  1.00 2.72  ? 17 PHE A HE2  8  
ATOM   8287  H HZ   . PHE A 1 17 ? -0.430  -5.974  -2.641  1.00 2.18  ? 17 PHE A HZ   8  
ATOM   8288  N N    . HIS A 1 18 ? 2.809   -10.897 -0.104  1.00 4.92  ? 18 HIS A N    8  
ATOM   8289  C CA   . HIS A 1 18 ? 3.650   -11.123 -1.320  1.00 5.06  ? 18 HIS A CA   8  
ATOM   8290  C C    . HIS A 1 18 ? 3.061   -10.347 -2.529  1.00 4.32  ? 18 HIS A C    8  
ATOM   8291  O O    . HIS A 1 18 ? 1.858   -10.282 -2.698  1.00 4.10  ? 18 HIS A O    8  
ATOM   8292  C CB   . HIS A 1 18 ? 3.729   -12.629 -1.559  1.00 5.95  ? 18 HIS A CB   8  
ATOM   8293  C CG   . HIS A 1 18 ? 4.283   -12.897 -2.908  1.00 6.25  ? 18 HIS A CG   8  
ATOM   8294  N ND1  . HIS A 1 18 ? 5.636   -13.064 -3.160  1.00 6.36  ? 18 HIS A ND1  8  
ATOM   8295  C CD2  . HIS A 1 18 ? 3.661   -13.011 -4.097  1.00 6.72  ? 18 HIS A CD2  8  
ATOM   8296  C CE1  . HIS A 1 18 ? 5.766   -13.268 -4.482  1.00 6.81  ? 18 HIS A CE1  8  
ATOM   8297  N NE2  . HIS A 1 18 ? 4.588   -13.251 -5.090  1.00 7.07  ? 18 HIS A NE2  8  
ATOM   8298  H H    . HIS A 1 18 ? 2.284   -11.641 0.264   1.00 5.11  ? 18 HIS A H    8  
ATOM   8299  H HA   . HIS A 1 18 ? 4.639   -10.755 -1.136  1.00 5.21  ? 18 HIS A HA   8  
ATOM   8300  H HB2  . HIS A 1 18 ? 4.370   -13.076 -0.814  1.00 6.63  ? 18 HIS A HB2  8  
ATOM   8301  H HB3  . HIS A 1 18 ? 2.744   -13.055 -1.484  1.00 5.84  ? 18 HIS A HB3  8  
ATOM   8302  H HD1  . HIS A 1 18 ? 6.361   -13.036 -2.500  1.00 6.36  ? 18 HIS A HD1  8  
ATOM   8303  H HD2  . HIS A 1 18 ? 2.610   -12.875 -4.243  1.00 7.00  ? 18 HIS A HD2  8  
ATOM   8304  H HE1  . HIS A 1 18 ? 6.702   -13.378 -4.997  1.00 7.12  ? 18 HIS A HE1  8  
ATOM   8305  N N    . PRO A 1 19 ? 3.950   -9.724  -3.294  1.00 4.16  ? 19 PRO A N    8  
ATOM   8306  C CA   . PRO A 1 19 ? 3.589   -8.858  -4.452  1.00 3.77  ? 19 PRO A CA   8  
ATOM   8307  C C    . PRO A 1 19 ? 3.151   -9.611  -5.720  1.00 4.27  ? 19 PRO A C    8  
ATOM   8308  O O    . PRO A 1 19 ? 2.227   -9.182  -6.382  1.00 4.32  ? 19 PRO A O    8  
ATOM   8309  C CB   . PRO A 1 19 ? 4.874   -8.078  -4.730  1.00 3.96  ? 19 PRO A CB   8  
ATOM   8310  C CG   . PRO A 1 19 ? 6.032   -8.912  -4.135  1.00 4.62  ? 19 PRO A CG   8  
ATOM   8311  C CD   . PRO A 1 19 ? 5.410   -9.831  -3.070  1.00 4.65  ? 19 PRO A CD   8  
ATOM   8312  H HA   . PRO A 1 19 ? 2.822   -8.168  -4.164  1.00 3.26  ? 19 PRO A HA   8  
ATOM   8313  H HB2  . PRO A 1 19 ? 5.011   -7.956  -5.796  1.00 4.26  ? 19 PRO A HB2  8  
ATOM   8314  H HB3  . PRO A 1 19 ? 4.834   -7.116  -4.250  1.00 3.57  ? 19 PRO A HB3  8  
ATOM   8315  H HG2  . PRO A 1 19 ? 6.497   -9.504  -4.913  1.00 5.23  ? 19 PRO A HG2  8  
ATOM   8316  H HG3  . PRO A 1 19 ? 6.760   -8.263  -3.677  1.00 4.63  ? 19 PRO A HG3  8  
ATOM   8317  H HD2  . PRO A 1 19 ? 5.743   -10.847 -3.214  1.00 5.29  ? 19 PRO A HD2  8  
ATOM   8318  H HD3  . PRO A 1 19 ? 5.659   -9.487  -2.080  1.00 4.56  ? 19 PRO A HD3  8  
ATOM   8319  N N    . LYS A 1 20 ? 3.814   -10.681 -6.099  1.00 4.91  ? 20 LYS A N    8  
ATOM   8320  C CA   . LYS A 1 20 ? 3.416   -11.394 -7.367  1.00 5.52  ? 20 LYS A CA   8  
ATOM   8321  C C    . LYS A 1 20 ? 1.907   -11.708 -7.372  1.00 5.00  ? 20 LYS A C    8  
ATOM   8322  O O    . LYS A 1 20 ? 1.305   -11.824 -8.423  1.00 5.39  ? 20 LYS A O    8  
ATOM   8323  C CB   . LYS A 1 20 ? 4.216   -12.677 -7.558  1.00 6.44  ? 20 LYS A CB   8  
ATOM   8324  C CG   . LYS A 1 20 ? 4.272   -13.040 -9.045  1.00 7.16  ? 20 LYS A CG   8  
ATOM   8325  C CD   . LYS A 1 20 ? 5.181   -14.257 -9.237  1.00 7.91  ? 20 LYS A CD   8  
ATOM   8326  C CE   . LYS A 1 20 ? 5.080   -14.755 -10.681 1.00 8.41  ? 20 LYS A CE   8  
ATOM   8327  N NZ   . LYS A 1 20 ? 6.324   -15.496 -11.044 1.00 8.95  ? 20 LYS A NZ   8  
ATOM   8328  H H    . LYS A 1 20 ? 4.579   -10.991 -5.576  1.00 5.13  ? 20 LYS A H    8  
ATOM   8329  H HA   . LYS A 1 20 ? 3.629   -10.750 -8.190  1.00 5.87  ? 20 LYS A HA   8  
ATOM   8330  H HB2  . LYS A 1 20 ? 5.219   -12.537 -7.184  1.00 6.91  ? 20 LYS A HB2  8  
ATOM   8331  H HB3  . LYS A 1 20 ? 3.739   -13.467 -7.019  1.00 6.29  ? 20 LYS A HB3  8  
ATOM   8332  H HG2  . LYS A 1 20 ? 3.277   -13.273 -9.397  1.00 7.23  ? 20 LYS A HG2  8  
ATOM   8333  H HG3  . LYS A 1 20 ? 4.669   -12.205 -9.605  1.00 7.28  ? 20 LYS A HG3  8  
ATOM   8334  H HD2  . LYS A 1 20 ? 6.203   -13.979 -9.021  1.00 8.14  ? 20 LYS A HD2  8  
ATOM   8335  H HD3  . LYS A 1 20 ? 4.873   -15.044 -8.564  1.00 8.11  ? 20 LYS A HD3  8  
ATOM   8336  H HE2  . LYS A 1 20 ? 4.230   -15.414 -10.775 1.00 8.28  ? 20 LYS A HE2  8  
ATOM   8337  H HE3  . LYS A 1 20 ? 4.956   -13.912 -11.345 1.00 8.75  ? 20 LYS A HE3  8  
ATOM   8338  H HZ1  . LYS A 1 20 ? 6.555   -16.179 -10.294 1.00 9.17  ? 20 LYS A HZ1  8  
ATOM   8339  H HZ2  . LYS A 1 20 ? 6.176   -16.004 -11.939 1.00 9.13  ? 20 LYS A HZ2  8  
ATOM   8340  H HZ3  . LYS A 1 20 ? 7.109   -14.821 -11.154 1.00 9.15  ? 20 LYS A HZ3  8  
ATOM   8341  N N    . PHE A 1 21 ? 1.280   -11.810 -6.213  1.00 4.37  ? 21 PHE A N    8  
ATOM   8342  C CA   . PHE A 1 21 ? -0.190  -12.070 -6.167  1.00 4.15  ? 21 PHE A CA   8  
ATOM   8343  C C    . PHE A 1 21 ? -0.917  -10.916 -6.868  1.00 3.56  ? 21 PHE A C    8  
ATOM   8344  O O    . PHE A 1 21 ? -1.893  -11.111 -7.566  1.00 3.88  ? 21 PHE A O    8  
ATOM   8345  C CB   . PHE A 1 21 ? -0.666  -12.121 -4.717  1.00 4.02  ? 21 PHE A CB   8  
ATOM   8346  C CG   . PHE A 1 21 ? 0.024   -13.220 -3.934  1.00 4.64  ? 21 PHE A CG   8  
ATOM   8347  C CD1  . PHE A 1 21 ? 0.508   -14.369 -4.576  1.00 5.12  ? 21 PHE A CD1  8  
ATOM   8348  C CD2  . PHE A 1 21 ? 0.170   -13.083 -2.548  1.00 5.11  ? 21 PHE A CD2  8  
ATOM   8349  C CE1  . PHE A 1 21 ? 1.134   -15.373 -3.830  1.00 5.85  ? 21 PHE A CE1  8  
ATOM   8350  C CE2  . PHE A 1 21 ? 0.795   -14.087 -1.804  1.00 5.85  ? 21 PHE A CE2  8  
ATOM   8351  C CZ   . PHE A 1 21 ? 1.279   -15.232 -2.444  1.00 6.13  ? 21 PHE A CZ   8  
ATOM   8352  H H    . PHE A 1 21 ? 1.771   -11.688 -5.377  1.00 4.29  ? 21 PHE A H    8  
ATOM   8353  H HA   . PHE A 1 21 ? -0.416  -12.994 -6.650  1.00 4.82  ? 21 PHE A HA   8  
ATOM   8354  H HB2  . PHE A 1 21 ? -0.453  -11.180 -4.261  1.00 3.48  ? 21 PHE A HB2  8  
ATOM   8355  H HB3  . PHE A 1 21 ? -1.727  -12.289 -4.702  1.00 4.37  ? 21 PHE A HB3  8  
ATOM   8356  H HD1  . PHE A 1 21 ? 0.398   -14.478 -5.644  1.00 5.18  ? 21 PHE A HD1  8  
ATOM   8357  H HD2  . PHE A 1 21 ? -0.203  -12.198 -2.052  1.00 5.17  ? 21 PHE A HD2  8  
ATOM   8358  H HE1  . PHE A 1 21 ? 1.508   -16.257 -4.322  1.00 6.40  ? 21 PHE A HE1  8  
ATOM   8359  H HE2  . PHE A 1 21 ? 0.909   -13.975 -0.734  1.00 6.40  ? 21 PHE A HE2  8  
ATOM   8360  H HZ   . PHE A 1 21 ? 1.763   -16.008 -1.871  1.00 6.79  ? 21 PHE A HZ   8  
ATOM   8361  N N    . ILE A 1 22 ? -0.429  -9.714  -6.671  1.00 2.94  ? 22 ILE A N    8  
ATOM   8362  C CA   . ILE A 1 22 ? -1.048  -8.508  -7.295  1.00 2.62  ? 22 ILE A CA   8  
ATOM   8363  C C    . ILE A 1 22 ? -0.890  -8.559  -8.817  1.00 3.41  ? 22 ILE A C    8  
ATOM   8364  O O    . ILE A 1 22 ? 0.208   -8.624  -9.337  1.00 4.13  ? 22 ILE A O    8  
ATOM   8365  C CB   . ILE A 1 22 ? -0.349  -7.251  -6.748  1.00 2.18  ? 22 ILE A CB   8  
ATOM   8366  C CG1  . ILE A 1 22 ? -0.617  -7.114  -5.241  1.00 2.00  ? 22 ILE A CG1  8  
ATOM   8367  C CG2  . ILE A 1 22 ? -0.863  -6.006  -7.472  1.00 2.53  ? 22 ILE A CG2  8  
ATOM   8368  C CD1  . ILE A 1 22 ? -2.119  -7.234  -4.954  1.00 2.47  ? 22 ILE A CD1  8  
ATOM   8369  H H    . ILE A 1 22 ? 0.358   -9.603  -6.098  1.00 2.94  ? 22 ILE A H    8  
ATOM   8370  H HA   . ILE A 1 22 ? -2.098  -8.468  -7.048  1.00 2.63  ? 22 ILE A HA   8  
ATOM   8371  H HB   . ILE A 1 22 ? 0.718   -7.338  -6.915  1.00 2.49  ? 22 ILE A HB   8  
ATOM   8372  H HG12 . ILE A 1 22 ? -0.088  -7.894  -4.714  1.00 2.23  ? 22 ILE A HG12 8  
ATOM   8373  H HG13 . ILE A 1 22 ? -0.265  -6.151  -4.902  1.00 2.28  ? 22 ILE A HG13 8  
ATOM   8374  H HG21 . ILE A 1 22 ? -1.878  -6.175  -7.796  1.00 3.07  ? 22 ILE A HG21 8  
ATOM   8375  H HG22 . ILE A 1 22 ? -0.835  -5.162  -6.800  1.00 2.71  ? 22 ILE A HG22 8  
ATOM   8376  H HG23 . ILE A 1 22 ? -0.239  -5.804  -8.329  1.00 2.80  ? 22 ILE A HG23 8  
ATOM   8377  H HD11 . ILE A 1 22 ? -2.661  -6.526  -5.563  1.00 2.73  ? 22 ILE A HD11 8  
ATOM   8378  H HD12 . ILE A 1 22 ? -2.451  -8.235  -5.185  1.00 2.88  ? 22 ILE A HD12 8  
ATOM   8379  H HD13 . ILE A 1 22 ? -2.304  -7.026  -3.911  1.00 2.84  ? 22 ILE A HD13 8  
ATOM   8380  N N    . LYS A 1 23 ? -1.988  -8.503  -9.526  1.00 3.62  ? 23 LYS A N    8  
ATOM   8381  C CA   . LYS A 1 23 ? -1.931  -8.515  -11.017 1.00 4.61  ? 23 LYS A CA   8  
ATOM   8382  C C    . LYS A 1 23 ? -1.821  -7.069  -11.528 1.00 5.00  ? 23 LYS A C    8  
ATOM   8383  O O    . LYS A 1 23 ? -1.365  -6.829  -12.630 1.00 5.88  ? 23 LYS A O    8  
ATOM   8384  C CB   . LYS A 1 23 ? -3.204  -9.164  -11.571 1.00 5.10  ? 23 LYS A CB   8  
ATOM   8385  C CG   . LYS A 1 23 ? -2.908  -9.796  -12.933 1.00 5.85  ? 23 LYS A CG   8  
ATOM   8386  C CD   . LYS A 1 23 ? -4.216  -10.263 -13.580 1.00 6.35  ? 23 LYS A CD   8  
ATOM   8387  C CE   . LYS A 1 23 ? -4.391  -11.769 -13.361 1.00 6.93  ? 23 LYS A CE   8  
ATOM   8388  N NZ   . LYS A 1 23 ? -5.603  -12.243 -14.093 1.00 7.72  ? 23 LYS A NZ   8  
ATOM   8389  H H    . LYS A 1 23 ? -2.855  -8.432  -9.075  1.00 3.33  ? 23 LYS A H    8  
ATOM   8390  H HA   . LYS A 1 23 ? -1.068  -9.080  -11.339 1.00 4.98  ? 23 LYS A HA   8  
ATOM   8391  H HB2  . LYS A 1 23 ? -3.547  -9.927  -10.886 1.00 4.92  ? 23 LYS A HB2  8  
ATOM   8392  H HB3  . LYS A 1 23 ? -3.971  -8.412  -11.684 1.00 5.36  ? 23 LYS A HB3  8  
ATOM   8393  H HG2  . LYS A 1 23 ? -2.431  -9.067  -13.572 1.00 6.02  ? 23 LYS A HG2  8  
ATOM   8394  H HG3  . LYS A 1 23 ? -2.251  -10.643 -12.801 1.00 6.22  ? 23 LYS A HG3  8  
ATOM   8395  H HD2  . LYS A 1 23 ? -5.047  -9.735  -13.133 1.00 6.70  ? 23 LYS A HD2  8  
ATOM   8396  H HD3  . LYS A 1 23 ? -4.186  -10.056 -14.639 1.00 6.30  ? 23 LYS A HD3  8  
ATOM   8397  H HE2  . LYS A 1 23 ? -3.521  -12.290 -13.732 1.00 6.98  ? 23 LYS A HE2  8  
ATOM   8398  H HE3  . LYS A 1 23 ? -4.508  -11.968 -12.306 1.00 7.01  ? 23 LYS A HE3  8  
ATOM   8399  H HZ1  . LYS A 1 23 ? -6.428  -11.682 -13.798 1.00 7.78  ? 23 LYS A HZ1  8  
ATOM   8400  H HZ2  . LYS A 1 23 ? -5.456  -12.134 -15.116 1.00 8.36  ? 23 LYS A HZ2  8  
ATOM   8401  H HZ3  . LYS A 1 23 ? -5.769  -13.246 -13.874 1.00 7.80  ? 23 LYS A HZ3  8  
ATOM   8402  N N    . GLU A 1 24 ? -2.236  -6.104  -10.729 1.00 4.51  ? 24 GLU A N    8  
ATOM   8403  C CA   . GLU A 1 24 ? -2.157  -4.673  -11.155 1.00 5.13  ? 24 GLU A CA   8  
ATOM   8404  C C    . GLU A 1 24 ? -1.772  -3.804  -9.946  1.00 4.55  ? 24 GLU A C    8  
ATOM   8405  O O    . GLU A 1 24 ? -2.593  -3.537  -9.086  1.00 4.65  ? 24 GLU A O    8  
ATOM   8406  C CB   . GLU A 1 24 ? -3.520  -4.228  -11.700 1.00 5.78  ? 24 GLU A CB   8  
ATOM   8407  C CG   . GLU A 1 24 ? -3.336  -3.568  -13.070 1.00 6.35  ? 24 GLU A CG   8  
ATOM   8408  C CD   . GLU A 1 24 ? -4.506  -2.617  -13.345 1.00 7.36  ? 24 GLU A CD   8  
ATOM   8409  O OE1  . GLU A 1 24 ? -5.531  -3.087  -13.811 1.00 7.92  ? 24 GLU A OE1  8  
ATOM   8410  O OE2  . GLU A 1 24 ? -4.356  -1.434  -13.084 1.00 7.77  ? 24 GLU A OE2  8  
ATOM   8411  H H    . GLU A 1 24 ? -2.598  -6.325  -9.843  1.00 3.86  ? 24 GLU A H    8  
ATOM   8412  H HA   . GLU A 1 24 ? -1.409  -4.570  -11.927 1.00 5.74  ? 24 GLU A HA   8  
ATOM   8413  H HB2  . GLU A 1 24 ? -4.167  -5.088  -11.799 1.00 5.66  ? 24 GLU A HB2  8  
ATOM   8414  H HB3  . GLU A 1 24 ? -3.967  -3.519  -11.019 1.00 6.21  ? 24 GLU A HB3  8  
ATOM   8415  H HG2  . GLU A 1 24 ? -2.410  -3.010  -13.080 1.00 6.22  ? 24 GLU A HG2  8  
ATOM   8416  H HG3  . GLU A 1 24 ? -3.307  -4.328  -13.835 1.00 6.40  ? 24 GLU A HG3  8  
HETATM 8417  N N    . MLE A 1 25 ? -0.532  -3.369  -9.865  1.00 4.25  ? 25 MLE A N    8  
HETATM 8418  C CN   . MLE A 1 25 ? 0.117   -2.882  -11.127 1.00 5.13  ? 25 MLE A CN   8  
HETATM 8419  C CA   . MLE A 1 25 ? -0.108  -2.525  -8.697  1.00 3.66  ? 25 MLE A CA   8  
HETATM 8420  C CB   . MLE A 1 25 ? 1.225   -3.050  -8.138  1.00 3.52  ? 25 MLE A CB   8  
HETATM 8421  C CG   . MLE A 1 25 ? 1.825   -2.018  -7.169  1.00 3.28  ? 25 MLE A CG   8  
HETATM 8422  C CD1  . MLE A 1 25 ? 2.281   -2.714  -5.890  1.00 2.93  ? 25 MLE A CD1  8  
HETATM 8423  C CD2  . MLE A 1 25 ? 3.023   -1.321  -7.830  1.00 3.54  ? 25 MLE A CD2  8  
HETATM 8424  C C    . MLE A 1 25 ? 0.068   -1.068  -9.142  1.00 4.19  ? 25 MLE A C    8  
HETATM 8425  O O    . MLE A 1 25 ? 1.067   -0.711  -9.742  1.00 4.87  ? 25 MLE A O    8  
HETATM 8426  H HN1  . MLE A 1 25 ? 0.064   -3.647  -11.883 1.00 5.47  ? 25 MLE A HN1  8  
HETATM 8427  H HN2  . MLE A 1 25 ? -0.394  -1.994  -11.473 1.00 5.48  ? 25 MLE A HN2  8  
HETATM 8428  H HN3  . MLE A 1 25 ? 1.152   -2.643  -10.928 1.00 5.42  ? 25 MLE A HN3  8  
HETATM 8429  H HA   . MLE A 1 25 ? -0.863  -2.579  -7.922  1.00 3.20  ? 25 MLE A HA   8  
HETATM 8430  H HB2  . MLE A 1 25 ? 1.053   -3.979  -7.615  1.00 3.37  ? 25 MLE A HB2  8  
HETATM 8431  H HB3  . MLE A 1 25 ? 1.913   -3.218  -8.953  1.00 4.08  ? 25 MLE A HB3  8  
HETATM 8432  H HG   . MLE A 1 25 ? 1.073   -1.280  -6.923  1.00 3.59  ? 25 MLE A HG   8  
HETATM 8433  H HD11 . MLE A 1 25 ? 1.767   -3.658  -5.792  1.00 3.21  ? 25 MLE A HD11 8  
HETATM 8434  H HD12 . MLE A 1 25 ? 3.345   -2.884  -5.932  1.00 3.14  ? 25 MLE A HD12 8  
HETATM 8435  H HD13 . MLE A 1 25 ? 2.050   -2.088  -5.040  1.00 2.79  ? 25 MLE A HD13 8  
HETATM 8436  H HD21 . MLE A 1 25 ? 3.163   -1.710  -8.827  1.00 3.89  ? 25 MLE A HD21 8  
HETATM 8437  H HD22 . MLE A 1 25 ? 2.836   -0.258  -7.881  1.00 3.75  ? 25 MLE A HD22 8  
HETATM 8438  H HD23 . MLE A 1 25 ? 3.913   -1.501  -7.245  1.00 3.70  ? 25 MLE A HD23 8  
ATOM   8439  N N    . ARG A 1 26 ? -0.884  -0.223  -8.859  1.00 4.14  ? 26 ARG A N    8  
ATOM   8440  C CA   . ARG A 1 26 ? -0.735  1.195   -9.279  1.00 4.79  ? 26 ARG A CA   8  
ATOM   8441  C C    . ARG A 1 26 ? -0.808  2.115   -8.051  1.00 4.70  ? 26 ARG A C    8  
ATOM   8442  O O    . ARG A 1 26 ? -1.728  2.038   -7.259  1.00 4.97  ? 26 ARG A O    8  
ATOM   8443  C CB   . ARG A 1 26 ? -1.834  1.571   -10.285 1.00 5.59  ? 26 ARG A CB   8  
ATOM   8444  C CG   . ARG A 1 26 ? -3.223  1.331   -9.676  1.00 5.99  ? 26 ARG A CG   8  
ATOM   8445  C CD   . ARG A 1 26 ? -4.045  0.441   -10.609 1.00 6.35  ? 26 ARG A CD   8  
ATOM   8446  N NE   . ARG A 1 26 ? -5.453  0.375   -10.125 1.00 7.16  ? 26 ARG A NE   8  
ATOM   8447  C CZ   . ARG A 1 26 ? -6.443  0.499   -10.970 1.00 7.92  ? 26 ARG A CZ   8  
ATOM   8448  N NH1  . ARG A 1 26 ? -6.758  1.681   -11.439 1.00 8.52  ? 26 ARG A NH1  8  
ATOM   8449  N NH2  . ARG A 1 26 ? -7.116  -0.557  -11.348 1.00 8.32  ? 26 ARG A NH2  8  
ATOM   8450  H H    . ARG A 1 26 ? -1.683  -0.518  -8.375  1.00 3.85  ? 26 ARG A H    8  
ATOM   8451  H HA   . ARG A 1 26 ? 0.233   1.301   -9.750  1.00 5.07  ? 26 ARG A HA   8  
ATOM   8452  H HB2  . ARG A 1 26 ? -1.735  2.614   -10.548 1.00 5.95  ? 26 ARG A HB2  8  
ATOM   8453  H HB3  . ARG A 1 26 ? -1.726  0.966   -11.174 1.00 5.91  ? 26 ARG A HB3  8  
ATOM   8454  H HG2  . ARG A 1 26 ? -3.119  0.844   -8.717  1.00 6.27  ? 26 ARG A HG2  8  
ATOM   8455  H HG3  . ARG A 1 26 ? -3.727  2.277   -9.546  1.00 6.12  ? 26 ARG A HG3  8  
ATOM   8456  H HD2  . ARG A 1 26 ? -4.027  0.856   -11.607 1.00 6.26  ? 26 ARG A HD2  8  
ATOM   8457  H HD3  . ARG A 1 26 ? -3.622  -0.552  -10.625 1.00 6.38  ? 26 ARG A HD3  8  
ATOM   8458  H HE   . ARG A 1 26 ? -5.638  0.235   -9.171  1.00 7.28  ? 26 ARG A HE   8  
ATOM   8459  H HH11 . ARG A 1 26 ? -6.242  2.488   -11.151 1.00 8.41  ? 26 ARG A HH11 8  
ATOM   8460  H HH12 . ARG A 1 26 ? -7.513  1.777   -12.087 1.00 9.21  ? 26 ARG A HH12 8  
ATOM   8461  H HH21 . ARG A 1 26 ? -6.874  -1.459  -10.990 1.00 8.08  ? 26 ARG A HH21 8  
ATOM   8462  H HH22 . ARG A 1 26 ? -7.873  -0.464  -11.995 1.00 9.02  ? 26 ARG A HH22 8  
ATOM   8463  N N    . VAL A 1 27 ? 0.161   2.981   -7.890  1.00 4.69  ? 27 VAL A N    8  
ATOM   8464  C CA   . VAL A 1 27 ? 0.166   3.907   -6.721  1.00 4.83  ? 27 VAL A CA   8  
ATOM   8465  C C    . VAL A 1 27 ? -0.279  5.308   -7.168  1.00 4.79  ? 27 VAL A C    8  
ATOM   8466  O O    . VAL A 1 27 ? -0.035  5.715   -8.290  1.00 5.45  ? 27 VAL A O    8  
ATOM   8467  C CB   . VAL A 1 27 ? 1.583   3.977   -6.137  1.00 5.66  ? 27 VAL A CB   8  
ATOM   8468  C CG1  . VAL A 1 27 ? 1.943   2.634   -5.501  1.00 6.10  ? 27 VAL A CG1  8  
ATOM   8469  C CG2  . VAL A 1 27 ? 2.598   4.300   -7.242  1.00 6.04  ? 27 VAL A CG2  8  
ATOM   8470  H H    . VAL A 1 27 ? 0.891   3.022   -8.537  1.00 4.82  ? 27 VAL A H    8  
ATOM   8471  H HA   . VAL A 1 27 ? -0.515  3.539   -5.968  1.00 4.74  ? 27 VAL A HA   8  
ATOM   8472  H HB   . VAL A 1 27 ? 1.615   4.745   -5.389  1.00 5.89  ? 27 VAL A HB   8  
ATOM   8473  H HG11 . VAL A 1 27 ? 1.113   2.283   -4.908  1.00 6.30  ? 27 VAL A HG11 8  
ATOM   8474  H HG12 . VAL A 1 27 ? 2.162   1.913   -6.276  1.00 6.06  ? 27 VAL A HG12 8  
ATOM   8475  H HG13 . VAL A 1 27 ? 2.811   2.756   -4.868  1.00 6.54  ? 27 VAL A HG13 8  
ATOM   8476  H HG21 . VAL A 1 27 ? 2.209   5.085   -7.871  1.00 6.44  ? 27 VAL A HG21 8  
ATOM   8477  H HG22 . VAL A 1 27 ? 3.526   4.625   -6.794  1.00 6.18  ? 27 VAL A HG22 8  
ATOM   8478  H HG23 . VAL A 1 27 ? 2.776   3.416   -7.837  1.00 6.05  ? 27 VAL A HG23 8  
ATOM   8479  N N    . ILE A 1 28 ? -0.923  6.050   -6.295  1.00 4.28  ? 28 ILE A N    8  
ATOM   8480  C CA   . ILE A 1 28 ? -1.374  7.427   -6.662  1.00 4.40  ? 28 ILE A CA   8  
ATOM   8481  C C    . ILE A 1 28 ? -0.565  8.446   -5.851  1.00 4.70  ? 28 ILE A C    8  
ATOM   8482  O O    . ILE A 1 28 ? -0.318  8.257   -4.675  1.00 5.01  ? 28 ILE A O    8  
ATOM   8483  C CB   . ILE A 1 28 ? -2.873  7.587   -6.361  1.00 4.45  ? 28 ILE A CB   8  
ATOM   8484  C CG1  . ILE A 1 28 ? -3.667  6.545   -7.162  1.00 4.94  ? 28 ILE A CG1  8  
ATOM   8485  C CG2  . ILE A 1 28 ? -3.332  8.997   -6.763  1.00 4.49  ? 28 ILE A CG2  8  
ATOM   8486  C CD1  . ILE A 1 28 ? -5.161  6.674   -6.846  1.00 5.05  ? 28 ILE A CD1  8  
ATOM   8487  H H    . ILE A 1 28 ? -1.101  5.703   -5.392  1.00 4.02  ? 28 ILE A H    8  
ATOM   8488  H HA   . ILE A 1 28 ? -1.200  7.592   -7.716  1.00 4.67  ? 28 ILE A HA   8  
ATOM   8489  H HB   . ILE A 1 28 ? -3.045  7.441   -5.305  1.00 4.56  ? 28 ILE A HB   8  
ATOM   8490  H HG12 . ILE A 1 28 ? -3.507  6.707   -8.218  1.00 5.21  ? 28 ILE A HG12 8  
ATOM   8491  H HG13 . ILE A 1 28 ? -3.330  5.555   -6.896  1.00 5.36  ? 28 ILE A HG13 8  
ATOM   8492  H HG21 . ILE A 1 28 ? -2.668  9.730   -6.330  1.00 4.49  ? 28 ILE A HG21 8  
ATOM   8493  H HG22 . ILE A 1 28 ? -3.318  9.087   -7.839  1.00 4.51  ? 28 ILE A HG22 8  
ATOM   8494  H HG23 . ILE A 1 28 ? -4.337  9.163   -6.402  1.00 4.77  ? 28 ILE A HG23 8  
ATOM   8495  H HD11 . ILE A 1 28 ? -5.309  6.610   -5.779  1.00 5.49  ? 28 ILE A HD11 8  
ATOM   8496  H HD12 . ILE A 1 28 ? -5.523  7.626   -7.204  1.00 4.88  ? 28 ILE A HD12 8  
ATOM   8497  H HD13 . ILE A 1 28 ? -5.701  5.877   -7.335  1.00 5.25  ? 28 ILE A HD13 8  
ATOM   8498  N N    . GLU A 1 29 ? -0.143  9.517   -6.480  1.00 5.08  ? 29 GLU A N    8  
ATOM   8499  C CA   . GLU A 1 29 ? 0.665   10.554  -5.771  1.00 5.75  ? 29 GLU A CA   8  
ATOM   8500  C C    . GLU A 1 29 ? -0.178  11.268  -4.706  1.00 5.30  ? 29 GLU A C    8  
ATOM   8501  O O    . GLU A 1 29 ? -1.355  11.004  -4.539  1.00 4.95  ? 29 GLU A O    8  
ATOM   8502  C CB   . GLU A 1 29 ? 1.178   11.583  -6.785  1.00 6.63  ? 29 GLU A CB   8  
ATOM   8503  C CG   . GLU A 1 29 ? 0.004   12.194  -7.564  1.00 7.40  ? 29 GLU A CG   8  
ATOM   8504  C CD   . GLU A 1 29 ? 0.083   11.775  -9.035  1.00 8.35  ? 29 GLU A CD   8  
ATOM   8505  O OE1  . GLU A 1 29 ? -0.309  10.658  -9.336  1.00 8.53  ? 29 GLU A OE1  8  
ATOM   8506  O OE2  . GLU A 1 29 ? 0.534   12.580  -9.836  1.00 9.09  ? 29 GLU A OE2  8  
ATOM   8507  H H    . GLU A 1 29 ? -0.349  9.636   -7.431  1.00 5.18  ? 29 GLU A H    8  
ATOM   8508  H HA   . GLU A 1 29 ? 1.509   10.078  -5.294  1.00 6.26  ? 29 GLU A HA   8  
ATOM   8509  H HB2  . GLU A 1 29 ? 1.702   12.363  -6.262  1.00 6.65  ? 29 GLU A HB2  8  
ATOM   8510  H HB3  . GLU A 1 29 ? 1.852   11.102  -7.472  1.00 7.00  ? 29 GLU A HB3  8  
ATOM   8511  H HG2  . GLU A 1 29 ? -0.928  11.848  -7.142  1.00 7.70  ? 29 GLU A HG2  8  
ATOM   8512  H HG3  . GLU A 1 29 ? 0.049   13.271  -7.495  1.00 7.27  ? 29 GLU A HG3  8  
ATOM   8513  N N    . SER A 1 30 ? 0.431   12.178  -3.987  1.00 5.67  ? 30 SER A N    8  
ATOM   8514  C CA   . SER A 1 30 ? -0.301  12.933  -2.927  1.00 5.68  ? 30 SER A CA   8  
ATOM   8515  C C    . SER A 1 30 ? -0.609  14.353  -3.424  1.00 6.20  ? 30 SER A C    8  
ATOM   8516  O O    . SER A 1 30 ? -0.038  14.820  -4.394  1.00 6.77  ? 30 SER A O    8  
ATOM   8517  C CB   . SER A 1 30 ? 0.559   13.011  -1.660  1.00 6.35  ? 30 SER A CB   8  
ATOM   8518  O OG   . SER A 1 30 ? 1.937   13.023  -2.011  1.00 7.18  ? 30 SER A OG   8  
ATOM   8519  H H    . SER A 1 30 ? 1.379   12.368  -4.150  1.00 6.18  ? 30 SER A H    8  
ATOM   8520  H HA   . SER A 1 30 ? -1.227  12.426  -2.700  1.00 5.24  ? 30 SER A HA   8  
ATOM   8521  H HB2  . SER A 1 30 ? 0.326   13.912  -1.123  1.00 6.58  ? 30 SER A HB2  8  
ATOM   8522  H HB3  . SER A 1 30 ? 0.345   12.156  -1.031  1.00 6.28  ? 30 SER A HB3  8  
ATOM   8523  H HG   . SER A 1 30 ? 2.347   12.241  -1.635  1.00 7.41  ? 30 SER A HG   8  
ATOM   8524  N N    . GLY A 1 31 ? -1.511  15.035  -2.765  1.00 6.36  ? 31 GLY A N    8  
ATOM   8525  C CA   . GLY A 1 31 ? -1.874  16.425  -3.186  1.00 7.19  ? 31 GLY A CA   8  
ATOM   8526  C C    . GLY A 1 31 ? -3.028  16.933  -2.309  1.00 7.66  ? 31 GLY A C    8  
ATOM   8527  O O    . GLY A 1 31 ? -3.161  16.521  -1.172  1.00 7.75  ? 31 GLY A O    8  
ATOM   8528  H H    . GLY A 1 31 ? -1.955  14.631  -1.991  1.00 6.14  ? 31 GLY A H    8  
ATOM   8529  H HA2  . GLY A 1 31 ? -1.019  17.068  -3.080  1.00 7.72  ? 31 GLY A HA2  8  
ATOM   8530  H HA3  . GLY A 1 31 ? -2.190  16.416  -4.218  1.00 7.17  ? 31 GLY A HA3  8  
ATOM   8531  N N    . PRO A 1 32 ? -3.851  17.792  -2.873  1.00 8.17  ? 32 PRO A N    8  
ATOM   8532  C CA   . PRO A 1 32 ? -5.028  18.338  -2.168  1.00 8.85  ? 32 PRO A CA   8  
ATOM   8533  C C    . PRO A 1 32 ? -6.108  17.247  -2.084  1.00 8.11  ? 32 PRO A C    8  
ATOM   8534  O O    . PRO A 1 32 ? -6.824  17.136  -1.106  1.00 8.52  ? 32 PRO A O    8  
ATOM   8535  C CB   . PRO A 1 32 ? -5.467  19.514  -3.048  1.00 9.69  ? 32 PRO A CB   8  
ATOM   8536  C CG   . PRO A 1 32 ? -4.883  19.246  -4.455  1.00 9.20  ? 32 PRO A CG   8  
ATOM   8537  C CD   . PRO A 1 32 ? -3.690  18.290  -4.258  1.00 8.39  ? 32 PRO A CD   8  
ATOM   8538  H HA   . PRO A 1 32 ? -4.757  18.685  -1.184  1.00 9.45  ? 32 PRO A HA   8  
ATOM   8539  H HB2  . PRO A 1 32 ? -6.547  19.561  -3.093  1.00 9.88  ? 32 PRO A HB2  8  
ATOM   8540  H HB3  . PRO A 1 32 ? -5.070  20.438  -2.659  1.00 10.56 ? 32 PRO A HB3  8  
ATOM   8541  H HG2  . PRO A 1 32 ? -5.631  18.784  -5.085  1.00 8.80  ? 32 PRO A HG2  8  
ATOM   8542  H HG3  . PRO A 1 32 ? -4.541  20.168  -4.897  1.00 10.01 ? 32 PRO A HG3  8  
ATOM   8543  H HD2  . PRO A 1 32 ? -3.739  17.475  -4.965  1.00 7.63  ? 32 PRO A HD2  8  
ATOM   8544  H HD3  . PRO A 1 32 ? -2.757  18.824  -4.355  1.00 8.96  ? 32 PRO A HD3  8  
ATOM   8545  N N    . HIS A 1 33 ? -6.192  16.431  -3.109  1.00 7.21  ? 33 HIS A N    8  
ATOM   8546  C CA   . HIS A 1 33 ? -7.177  15.304  -3.143  1.00 6.64  ? 33 HIS A CA   8  
ATOM   8547  C C    . HIS A 1 33 ? -6.906  14.339  -1.971  1.00 5.94  ? 33 HIS A C    8  
ATOM   8548  O O    . HIS A 1 33 ? -7.821  13.776  -1.398  1.00 6.05  ? 33 HIS A O    8  
ATOM   8549  C CB   . HIS A 1 33 ? -7.025  14.549  -4.479  1.00 6.27  ? 33 HIS A CB   8  
ATOM   8550  C CG   . HIS A 1 33 ? -5.606  14.045  -4.627  1.00 5.79  ? 33 HIS A CG   8  
ATOM   8551  N ND1  . HIS A 1 33 ? -4.573  14.860  -5.070  1.00 6.54  ? 33 HIS A ND1  8  
ATOM   8552  C CD2  . HIS A 1 33 ? -5.026  12.832  -4.345  1.00 4.91  ? 33 HIS A CD2  8  
ATOM   8553  C CE1  . HIS A 1 33 ? -3.438  14.142  -5.027  1.00 6.20  ? 33 HIS A CE1  8  
ATOM   8554  N NE2  . HIS A 1 33 ? -3.658  12.896  -4.596  1.00 5.23  ? 33 HIS A NE2  8  
ATOM   8555  H H    . HIS A 1 33 ? -5.585  16.554  -3.860  1.00 7.10  ? 33 HIS A H    8  
ATOM   8556  H HA   . HIS A 1 33 ? -8.178  15.696  -3.062  1.00 7.25  ? 33 HIS A HA   8  
ATOM   8557  H HB2  . HIS A 1 33 ? -7.707  13.714  -4.499  1.00 5.99  ? 33 HIS A HB2  8  
ATOM   8558  H HB3  . HIS A 1 33 ? -7.255  15.217  -5.296  1.00 6.92  ? 33 HIS A HB3  8  
ATOM   8559  H HD1  . HIS A 1 33 ? -4.658  15.785  -5.380  1.00 7.35  ? 33 HIS A HD1  8  
ATOM   8560  H HD2  . HIS A 1 33 ? -5.552  11.961  -3.984  1.00 4.33  ? 33 HIS A HD2  8  
ATOM   8561  H HE1  . HIS A 1 33 ? -2.461  14.539  -5.271  1.00 6.82  ? 33 HIS A HE1  8  
ATOM   8562  N N    . CYS A 1 34 ? -5.653  14.156  -1.617  1.00 5.51  ? 34 CYS A N    8  
ATOM   8563  C CA   . CYS A 1 34 ? -5.293  13.250  -0.495  1.00 5.12  ? 34 CYS A CA   8  
ATOM   8564  C C    . CYS A 1 34 ? -3.967  13.720  0.116   1.00 5.54  ? 34 CYS A C    8  
ATOM   8565  O O    . CYS A 1 34 ? -2.969  13.845  -0.570  1.00 5.84  ? 34 CYS A O    8  
ATOM   8566  C CB   . CYS A 1 34 ? -5.153  11.813  -1.010  1.00 4.12  ? 34 CYS A CB   8  
ATOM   8567  S SG   . CYS A 1 34 ? -5.494  10.650  0.336   1.00 4.37  ? 34 CYS A SG   8  
ATOM   8568  H H    . CYS A 1 34 ? -4.949  14.625  -2.090  1.00 5.68  ? 34 CYS A H    8  
ATOM   8569  H HA   . CYS A 1 34 ? -6.064  13.295  0.248   1.00 5.59  ? 34 CYS A HA   8  
ATOM   8570  H HB2  . CYS A 1 34 ? -5.857  11.649  -1.813  1.00 4.04  ? 34 CYS A HB2  8  
ATOM   8571  H HB3  . CYS A 1 34 ? -4.149  11.657  -1.375  1.00 3.82  ? 34 CYS A HB3  8  
ATOM   8572  N N    . ALA A 1 35 ? -3.962  14.003  1.397   1.00 5.90  ? 35 ALA A N    8  
ATOM   8573  C CA   . ALA A 1 35 ? -2.721  14.498  2.074   1.00 6.66  ? 35 ALA A CA   8  
ATOM   8574  C C    . ALA A 1 35 ? -1.552  13.520  1.886   1.00 6.33  ? 35 ALA A C    8  
ATOM   8575  O O    . ALA A 1 35 ? -0.506  13.890  1.387   1.00 6.77  ? 35 ALA A O    8  
ATOM   8576  C CB   . ALA A 1 35 ? -2.997  14.674  3.571   1.00 7.59  ? 35 ALA A CB   8  
ATOM   8577  H H    . ALA A 1 35 ? -4.790  13.907  1.915   1.00 5.87  ? 35 ALA A H    8  
ATOM   8578  H HA   . ALA A 1 35 ? -2.449  15.450  1.656   1.00 7.06  ? 35 ALA A HA   8  
ATOM   8579  H HB1  . ALA A 1 35 ? -3.478  13.785  3.956   1.00 7.89  ? 35 ALA A HB1  8  
ATOM   8580  H HB2  . ALA A 1 35 ? -2.065  14.834  4.093   1.00 7.72  ? 35 ALA A HB2  8  
ATOM   8581  H HB3  . ALA A 1 35 ? -3.644  15.525  3.719   1.00 8.05  ? 35 ALA A HB3  8  
ATOM   8582  N N    . ASN A 1 36 ? -1.714  12.290  2.299   1.00 5.85  ? 36 ASN A N    8  
ATOM   8583  C CA   . ASN A 1 36 ? -0.603  11.295  2.166   1.00 5.88  ? 36 ASN A CA   8  
ATOM   8584  C C    . ASN A 1 36 ? -0.707  10.534  0.838   1.00 5.34  ? 36 ASN A C    8  
ATOM   8585  O O    . ASN A 1 36 ? -1.720  10.569  0.162   1.00 5.26  ? 36 ASN A O    8  
ATOM   8586  C CB   . ASN A 1 36 ? -0.680  10.299  3.328   1.00 6.50  ? 36 ASN A CB   8  
ATOM   8587  C CG   . ASN A 1 36 ? 0.151   10.818  4.506   1.00 7.27  ? 36 ASN A CG   8  
ATOM   8588  O OD1  . ASN A 1 36 ? -0.383  11.406  5.425   1.00 7.78  ? 36 ASN A OD1  8  
ATOM   8589  N ND2  . ASN A 1 36 ? 1.442   10.624  4.518   1.00 7.61  ? 36 ASN A ND2  8  
ATOM   8590  H H    . ASN A 1 36 ? -2.560  12.024  2.710   1.00 5.70  ? 36 ASN A H    8  
ATOM   8591  H HA   . ASN A 1 36 ? 0.345   11.812  2.206   1.00 6.19  ? 36 ASN A HA   8  
ATOM   8592  H HB2  . ASN A 1 36 ? -1.709  10.186  3.635   1.00 6.55  ? 36 ASN A HB2  8  
ATOM   8593  H HB3  . ASN A 1 36 ? -0.292  9.345   3.010   1.00 6.63  ? 36 ASN A HB3  8  
ATOM   8594  H HD21 . ASN A 1 36 ? 1.875   10.149  3.778   1.00 7.41  ? 36 ASN A HD21 8  
ATOM   8595  H HD22 . ASN A 1 36 ? 1.979   10.954  5.268   1.00 8.19  ? 36 ASN A HD22 8  
ATOM   8596  N N    . THR A 1 37 ? 0.344   9.833   0.474   1.00 5.30  ? 37 THR A N    8  
ATOM   8597  C CA   . THR A 1 37 ? 0.337   9.044   -0.800  1.00 5.18  ? 37 THR A CA   8  
ATOM   8598  C C    . THR A 1 37 ? -0.552  7.807   -0.612  1.00 4.58  ? 37 THR A C    8  
ATOM   8599  O O    . THR A 1 37 ? -0.641  7.263   0.474   1.00 4.95  ? 37 THR A O    8  
ATOM   8600  C CB   . THR A 1 37 ? 1.771   8.602   -1.135  1.00 5.98  ? 37 THR A CB   8  
ATOM   8601  O OG1  . THR A 1 37 ? 2.677   9.656   -0.840  1.00 6.76  ? 37 THR A OG1  8  
ATOM   8602  C CG2  . THR A 1 37 ? 1.869   8.251   -2.620  1.00 6.31  ? 37 THR A CG2  8  
ATOM   8603  H H    . THR A 1 37 ? 1.140   9.819   1.046   1.00 5.59  ? 37 THR A H    8  
ATOM   8604  H HA   . THR A 1 37 ? -0.053  9.653   -1.601  1.00 5.45  ? 37 THR A HA   8  
ATOM   8605  H HB   . THR A 1 37 ? 2.027   7.734   -0.547  1.00 6.11  ? 37 THR A HB   8  
ATOM   8606  H HG1  . THR A 1 37 ? 3.266   9.357   -0.143  1.00 7.02  ? 37 THR A HG1  8  
ATOM   8607  H HG21 . THR A 1 37 ? 1.506   9.079   -3.211  1.00 6.33  ? 37 THR A HG21 8  
ATOM   8608  H HG22 . THR A 1 37 ? 2.899   8.051   -2.876  1.00 6.74  ? 37 THR A HG22 8  
ATOM   8609  H HG23 . THR A 1 37 ? 1.271   7.375   -2.823  1.00 6.44  ? 37 THR A HG23 8  
ATOM   8610  N N    . GLU A 1 38 ? -1.219  7.366   -1.652  1.00 3.94  ? 38 GLU A N    8  
ATOM   8611  C CA   . GLU A 1 38 ? -2.107  6.180   -1.520  1.00 3.67  ? 38 GLU A CA   8  
ATOM   8612  C C    . GLU A 1 38 ? -1.688  5.097   -2.514  1.00 2.99  ? 38 GLU A C    8  
ATOM   8613  O O    . GLU A 1 38 ? -1.814  5.268   -3.714  1.00 3.33  ? 38 GLU A O    8  
ATOM   8614  C CB   . GLU A 1 38 ? -3.547  6.606   -1.817  1.00 4.35  ? 38 GLU A CB   8  
ATOM   8615  C CG   . GLU A 1 38 ? -4.192  7.209   -0.564  1.00 4.96  ? 38 GLU A CG   8  
ATOM   8616  C CD   . GLU A 1 38 ? -4.300  6.147   0.537   1.00 5.76  ? 38 GLU A CD   8  
ATOM   8617  O OE1  . GLU A 1 38 ? -5.272  5.408   0.528   1.00 6.10  ? 38 GLU A OE1  8  
ATOM   8618  O OE2  . GLU A 1 38 ? -3.411  6.097   1.374   1.00 6.28  ? 38 GLU A OE2  8  
ATOM   8619  H H    . GLU A 1 38 ? -1.146  7.819   -2.519  1.00 3.89  ? 38 GLU A H    8  
ATOM   8620  H HA   . GLU A 1 38 ? -2.046  5.790   -0.516  1.00 3.96  ? 38 GLU A HA   8  
ATOM   8621  H HB2  . GLU A 1 38 ? -3.546  7.341   -2.608  1.00 4.73  ? 38 GLU A HB2  8  
ATOM   8622  H HB3  . GLU A 1 38 ? -4.111  5.747   -2.133  1.00 4.35  ? 38 GLU A HB3  8  
ATOM   8623  H HG2  . GLU A 1 38 ? -3.587  8.033   -0.212  1.00 5.14  ? 38 GLU A HG2  8  
ATOM   8624  H HG3  . GLU A 1 38 ? -5.180  7.570   -0.809  1.00 4.98  ? 38 GLU A HG3  8  
ATOM   8625  N N    . ILE A 1 39 ? -1.216  3.972   -2.031  1.00 2.48  ? 39 ILE A N    8  
ATOM   8626  C CA   . ILE A 1 39 ? -0.821  2.876   -2.959  1.00 2.38  ? 39 ILE A CA   8  
ATOM   8627  C C    . ILE A 1 39 ? -2.075  2.053   -3.282  1.00 2.16  ? 39 ILE A C    8  
ATOM   8628  O O    . ILE A 1 39 ? -3.031  2.057   -2.528  1.00 2.22  ? 39 ILE A O    8  
ATOM   8629  C CB   . ILE A 1 39 ? 0.245   1.998   -2.278  1.00 2.57  ? 39 ILE A CB   8  
ATOM   8630  C CG1  . ILE A 1 39 ? 1.595   2.728   -2.294  1.00 2.79  ? 39 ILE A CG1  8  
ATOM   8631  C CG2  . ILE A 1 39 ? 0.388   0.662   -3.019  1.00 3.44  ? 39 ILE A CG2  8  
ATOM   8632  C CD1  . ILE A 1 39 ? 2.178   2.777   -0.878  1.00 2.94  ? 39 ILE A CD1  8  
ATOM   8633  H H    . ILE A 1 39 ? -1.138  3.839   -1.054  1.00 2.61  ? 39 ILE A H    8  
ATOM   8634  H HA   . ILE A 1 39 ? -0.419  3.297   -3.870  1.00 2.85  ? 39 ILE A HA   8  
ATOM   8635  H HB   . ILE A 1 39 ? -0.051  1.810   -1.257  1.00 2.54  ? 39 ILE A HB   8  
ATOM   8636  H HG12 . ILE A 1 39 ? 2.278   2.204   -2.944  1.00 3.36  ? 39 ILE A HG12 8  
ATOM   8637  H HG13 . ILE A 1 39 ? 1.455   3.735   -2.657  1.00 2.70  ? 39 ILE A HG13 8  
ATOM   8638  H HG21 . ILE A 1 39 ? 0.522   0.845   -4.074  1.00 3.64  ? 39 ILE A HG21 8  
ATOM   8639  H HG22 . ILE A 1 39 ? 1.245   0.128   -2.635  1.00 4.05  ? 39 ILE A HG22 8  
ATOM   8640  H HG23 . ILE A 1 39 ? -0.502  0.069   -2.867  1.00 3.75  ? 39 ILE A HG23 8  
ATOM   8641  H HD11 . ILE A 1 39 ? 1.616   2.120   -0.231  1.00 2.88  ? 39 ILE A HD11 8  
ATOM   8642  H HD12 . ILE A 1 39 ? 3.211   2.460   -0.904  1.00 3.00  ? 39 ILE A HD12 8  
ATOM   8643  H HD13 . ILE A 1 39 ? 2.124   3.787   -0.501  1.00 3.60  ? 39 ILE A HD13 8  
ATOM   8644  N N    . ILE A 1 40 ? -2.091  1.352   -4.389  1.00 2.34  ? 40 ILE A N    8  
ATOM   8645  C CA   . ILE A 1 40 ? -3.291  0.528   -4.737  1.00 2.36  ? 40 ILE A CA   8  
ATOM   8646  C C    . ILE A 1 40 ? -2.841  -0.709  -5.511  1.00 2.37  ? 40 ILE A C    8  
ATOM   8647  O O    . ILE A 1 40 ? -2.051  -0.626  -6.431  1.00 3.02  ? 40 ILE A O    8  
ATOM   8648  C CB   . ILE A 1 40 ? -4.284  1.322   -5.596  1.00 3.14  ? 40 ILE A CB   8  
ATOM   8649  C CG1  . ILE A 1 40 ? -4.583  2.676   -4.938  1.00 3.44  ? 40 ILE A CG1  8  
ATOM   8650  C CG2  . ILE A 1 40 ? -5.588  0.521   -5.722  1.00 3.70  ? 40 ILE A CG2  8  
ATOM   8651  C CD1  . ILE A 1 40 ? -5.325  3.579   -5.926  1.00 4.01  ? 40 ILE A CD1  8  
ATOM   8652  H H    . ILE A 1 40 ? -1.316  1.365   -4.990  1.00 2.72  ? 40 ILE A H    8  
ATOM   8653  H HA   . ILE A 1 40 ? -3.780  0.213   -3.826  1.00 2.37  ? 40 ILE A HA   8  
ATOM   8654  H HB   . ILE A 1 40 ? -3.864  1.479   -6.579  1.00 3.47  ? 40 ILE A HB   8  
ATOM   8655  H HG12 . ILE A 1 40 ? -5.191  2.524   -4.059  1.00 3.44  ? 40 ILE A HG12 8  
ATOM   8656  H HG13 . ILE A 1 40 ? -3.654  3.147   -4.655  1.00 3.71  ? 40 ILE A HG13 8  
ATOM   8657  H HG21 . ILE A 1 40 ? -5.376  -0.443  -6.164  1.00 3.89  ? 40 ILE A HG21 8  
ATOM   8658  H HG22 . ILE A 1 40 ? -6.020  0.379   -4.743  1.00 3.94  ? 40 ILE A HG22 8  
ATOM   8659  H HG23 . ILE A 1 40 ? -6.283  1.058   -6.349  1.00 4.13  ? 40 ILE A HG23 8  
ATOM   8660  H HD11 . ILE A 1 40 ? -6.241  3.096   -6.235  1.00 4.33  ? 40 ILE A HD11 8  
ATOM   8661  H HD12 . ILE A 1 40 ? -5.557  4.519   -5.448  1.00 4.43  ? 40 ILE A HD12 8  
ATOM   8662  H HD13 . ILE A 1 40 ? -4.703  3.757   -6.790  1.00 4.17  ? 40 ILE A HD13 8  
ATOM   8663  N N    . VAL A 1 41 ? -3.340  -1.852  -5.138  1.00 2.04  ? 41 VAL A N    8  
ATOM   8664  C CA   . VAL A 1 41 ? -2.965  -3.106  -5.827  1.00 2.10  ? 41 VAL A CA   8  
ATOM   8665  C C    . VAL A 1 41 ? -4.228  -3.936  -6.083  1.00 2.33  ? 41 VAL A C    8  
ATOM   8666  O O    . VAL A 1 41 ? -5.269  -3.694  -5.501  1.00 2.79  ? 41 VAL A O    8  
ATOM   8667  C CB   . VAL A 1 41 ? -1.997  -3.893  -4.944  1.00 2.21  ? 41 VAL A CB   8  
ATOM   8668  C CG1  . VAL A 1 41 ? -0.664  -3.150  -4.844  1.00 2.87  ? 41 VAL A CG1  8  
ATOM   8669  C CG2  . VAL A 1 41 ? -2.580  -4.081  -3.539  1.00 3.20  ? 41 VAL A CG2  8  
ATOM   8670  H H    . VAL A 1 41 ? -3.967  -1.891  -4.399  1.00 2.11  ? 41 VAL A H    8  
ATOM   8671  H HA   . VAL A 1 41 ? -2.488  -2.874  -6.768  1.00 2.57  ? 41 VAL A HA   8  
ATOM   8672  H HB   . VAL A 1 41 ? -1.835  -4.849  -5.390  1.00 2.10  ? 41 VAL A HB   8  
ATOM   8673  H HG11 . VAL A 1 41 ? -0.381  -2.784  -5.819  1.00 3.43  ? 41 VAL A HG11 8  
ATOM   8674  H HG12 . VAL A 1 41 ? -0.766  -2.316  -4.163  1.00 3.03  ? 41 VAL A HG12 8  
ATOM   8675  H HG13 . VAL A 1 41 ? 0.097   -3.822  -4.476  1.00 3.29  ? 41 VAL A HG13 8  
ATOM   8676  H HG21 . VAL A 1 41 ? -3.658  -4.109  -3.597  1.00 3.56  ? 41 VAL A HG21 8  
ATOM   8677  H HG22 . VAL A 1 41 ? -2.219  -5.007  -3.120  1.00 3.58  ? 41 VAL A HG22 8  
ATOM   8678  H HG23 . VAL A 1 41 ? -2.275  -3.257  -2.910  1.00 3.72  ? 41 VAL A HG23 8  
ATOM   8679  N N    . LYS A 1 42 ? -4.141  -4.913  -6.945  1.00 2.44  ? 42 LYS A N    8  
ATOM   8680  C CA   . LYS A 1 42 ? -5.328  -5.765  -7.242  1.00 2.97  ? 42 LYS A CA   8  
ATOM   8681  C C    . LYS A 1 42 ? -4.916  -7.240  -7.192  1.00 2.77  ? 42 LYS A C    8  
ATOM   8682  O O    . LYS A 1 42 ? -4.298  -7.750  -8.108  1.00 2.98  ? 42 LYS A O    8  
ATOM   8683  C CB   . LYS A 1 42 ? -5.869  -5.425  -8.636  1.00 3.77  ? 42 LYS A CB   8  
ATOM   8684  C CG   . LYS A 1 42 ? -7.331  -4.986  -8.528  1.00 4.68  ? 42 LYS A CG   8  
ATOM   8685  C CD   . LYS A 1 42 ? -8.051  -5.275  -9.848  1.00 5.42  ? 42 LYS A CD   8  
ATOM   8686  C CE   . LYS A 1 42 ? -9.296  -4.391  -9.955  1.00 5.72  ? 42 LYS A CE   8  
ATOM   8687  N NZ   . LYS A 1 42 ? -9.950  -4.606  -11.278 1.00 6.76  ? 42 LYS A NZ   8  
ATOM   8688  H H    . LYS A 1 42 ? -3.293  -5.085  -7.398  1.00 2.45  ? 42 LYS A H    8  
ATOM   8689  H HA   . LYS A 1 42 ? -6.095  -5.581  -6.501  1.00 3.37  ? 42 LYS A HA   8  
ATOM   8690  H HB2  . LYS A 1 42 ? -5.283  -4.623  -9.063  1.00 3.94  ? 42 LYS A HB2  8  
ATOM   8691  H HB3  . LYS A 1 42 ? -5.803  -6.295  -9.271  1.00 3.87  ? 42 LYS A HB3  8  
ATOM   8692  H HG2  . LYS A 1 42 ? -7.814  -5.530  -7.729  1.00 4.83  ? 42 LYS A HG2  8  
ATOM   8693  H HG3  . LYS A 1 42 ? -7.376  -3.927  -8.321  1.00 4.94  ? 42 LYS A HG3  8  
ATOM   8694  H HD2  . LYS A 1 42 ? -7.386  -5.063  -10.674 1.00 5.79  ? 42 LYS A HD2  8  
ATOM   8695  H HD3  . LYS A 1 42 ? -8.345  -6.313  -9.879  1.00 5.70  ? 42 LYS A HD3  8  
ATOM   8696  H HE2  . LYS A 1 42 ? -9.988  -4.648  -9.166  1.00 5.66  ? 42 LYS A HE2  8  
ATOM   8697  H HE3  . LYS A 1 42 ? -9.011  -3.354  -9.860  1.00 5.59  ? 42 LYS A HE3  8  
ATOM   8698  H HZ1  . LYS A 1 42 ? -10.157 -5.618  -11.404 1.00 7.12  ? 42 LYS A HZ1  8  
ATOM   8699  H HZ2  . LYS A 1 42 ? -10.838 -4.067  -11.317 1.00 7.24  ? 42 LYS A HZ2  8  
ATOM   8700  H HZ3  . LYS A 1 42 ? -9.314  -4.283  -12.036 1.00 6.85  ? 42 LYS A HZ3  8  
ATOM   8701  N N    . LEU A 1 43 ? -5.247  -7.923  -6.123  1.00 3.01  ? 43 LEU A N    8  
ATOM   8702  C CA   . LEU A 1 43 ? -4.878  -9.363  -5.994  1.00 3.31  ? 43 LEU A CA   8  
ATOM   8703  C C    . LEU A 1 43 ? -5.511  -10.175 -7.125  1.00 3.92  ? 43 LEU A C    8  
ATOM   8704  O O    . LEU A 1 43 ? -6.629  -9.914  -7.540  1.00 4.54  ? 43 LEU A O    8  
ATOM   8705  C CB   . LEU A 1 43 ? -5.383  -9.899  -4.655  1.00 4.01  ? 43 LEU A CB   8  
ATOM   8706  C CG   . LEU A 1 43 ? -4.517  -9.343  -3.517  1.00 3.77  ? 43 LEU A CG   8  
ATOM   8707  C CD1  . LEU A 1 43 ? -5.244  -9.516  -2.182  1.00 4.46  ? 43 LEU A CD1  8  
ATOM   8708  C CD2  . LEU A 1 43 ? -3.185  -10.098 -3.467  1.00 3.91  ? 43 LEU A CD2  8  
ATOM   8709  H H    . LEU A 1 43 ? -5.737  -7.486  -5.397  1.00 3.37  ? 43 LEU A H    8  
ATOM   8710  H HA   . LEU A 1 43 ? -3.804  -9.464  -6.037  1.00 3.08  ? 43 LEU A HA   8  
ATOM   8711  H HB2  . LEU A 1 43 ? -6.406  -9.597  -4.518  1.00 4.55  ? 43 LEU A HB2  8  
ATOM   8712  H HB3  . LEU A 1 43 ? -5.331  -10.971 -4.658  1.00 4.52  ? 43 LEU A HB3  8  
ATOM   8713  H HG   . LEU A 1 43 ? -4.330  -8.293  -3.689  1.00 3.53  ? 43 LEU A HG   8  
ATOM   8714  H HD11 . LEU A 1 43 ? -5.527  -10.550 -2.056  1.00 4.57  ? 43 LEU A HD11 8  
ATOM   8715  H HD12 . LEU A 1 43 ? -4.589  -9.220  -1.375  1.00 4.51  ? 43 LEU A HD12 8  
ATOM   8716  H HD13 . LEU A 1 43 ? -6.128  -8.897  -2.170  1.00 5.14  ? 43 LEU A HD13 8  
ATOM   8717  H HD21 . LEU A 1 43 ? -2.752  -10.131 -4.456  1.00 3.95  ? 43 LEU A HD21 8  
ATOM   8718  H HD22 . LEU A 1 43 ? -2.509  -9.589  -2.796  1.00 3.96  ? 43 LEU A HD22 8  
ATOM   8719  H HD23 . LEU A 1 43 ? -3.353  -11.104 -3.114  1.00 4.44  ? 43 LEU A HD23 8  
ATOM   8720  N N    . SER A 1 44 ? -4.797  -11.163 -7.613  1.00 3.99  ? 44 SER A N    8  
ATOM   8721  C CA   . SER A 1 44 ? -5.314  -12.026 -8.718  1.00 4.72  ? 44 SER A CA   8  
ATOM   8722  C C    . SER A 1 44 ? -6.629  -12.696 -8.301  1.00 5.55  ? 44 SER A C    8  
ATOM   8723  O O    . SER A 1 44 ? -7.460  -13.007 -9.135  1.00 6.08  ? 44 SER A O    8  
ATOM   8724  C CB   . SER A 1 44 ? -4.279  -13.101 -9.058  1.00 4.98  ? 44 SER A CB   8  
ATOM   8725  O OG   . SER A 1 44 ? -3.275  -12.538 -9.891  1.00 5.08  ? 44 SER A OG   8  
ATOM   8726  H H    . SER A 1 44 ? -3.911  -11.337 -7.245  1.00 3.70  ? 44 SER A H    8  
ATOM   8727  H HA   . SER A 1 44 ? -5.487  -11.413 -9.584  1.00 4.83  ? 44 SER A HA   8  
ATOM   8728  H HB2  . SER A 1 44 ? -3.825  -13.467 -8.153  1.00 5.14  ? 44 SER A HB2  8  
ATOM   8729  H HB3  . SER A 1 44 ? -4.768  -13.921 -9.570  1.00 5.37  ? 44 SER A HB3  8  
ATOM   8730  H HG   . SER A 1 44 ? -3.280  -13.012 -10.726 1.00 5.39  ? 44 SER A HG   8  
ATOM   8731  N N    . ASP A 1 45 ? -6.833  -12.905 -7.018  1.00 5.91  ? 45 ASP A N    8  
ATOM   8732  C CA   . ASP A 1 45 ? -8.099  -13.533 -6.545  1.00 7.02  ? 45 ASP A CA   8  
ATOM   8733  C C    . ASP A 1 45 ? -9.291  -12.609 -6.864  1.00 7.25  ? 45 ASP A C    8  
ATOM   8734  O O    . ASP A 1 45 ? -10.435 -13.020 -6.799  1.00 8.19  ? 45 ASP A O    8  
ATOM   8735  C CB   . ASP A 1 45 ? -8.016  -13.756 -5.029  1.00 7.64  ? 45 ASP A CB   8  
ATOM   8736  C CG   . ASP A 1 45 ? -9.056  -14.795 -4.599  1.00 8.01  ? 45 ASP A CG   8  
ATOM   8737  O OD1  . ASP A 1 45 ? -8.759  -15.975 -4.691  1.00 7.89  ? 45 ASP A OD1  8  
ATOM   8738  O OD2  . ASP A 1 45 ? -10.132 -14.391 -4.185  1.00 8.63  ? 45 ASP A OD2  8  
ATOM   8739  H H    . ASP A 1 45 ? -6.159  -12.637 -6.366  1.00 5.60  ? 45 ASP A H    8  
ATOM   8740  H HA   . ASP A 1 45 ? -8.229  -14.477 -7.040  1.00 7.48  ? 45 ASP A HA   8  
ATOM   8741  H HB2  . ASP A 1 45 ? -7.028  -14.110 -4.772  1.00 7.55  ? 45 ASP A HB2  8  
ATOM   8742  H HB3  . ASP A 1 45 ? -8.208  -12.825 -4.517  1.00 8.18  ? 45 ASP A HB3  8  
ATOM   8743  N N    . GLY A 1 46 ? -9.029  -11.364 -7.201  1.00 6.57  ? 46 GLY A N    8  
ATOM   8744  C CA   . GLY A 1 46 ? -10.127 -10.407 -7.516  1.00 7.07  ? 46 GLY A CA   8  
ATOM   8745  C C    . GLY A 1 46 ? -10.331 -9.470  -6.324  1.00 6.74  ? 46 GLY A C    8  
ATOM   8746  O O    . GLY A 1 46 ? -11.442 -9.067  -6.031  1.00 7.17  ? 46 GLY A O    8  
ATOM   8747  H H    . GLY A 1 46 ? -8.101  -11.054 -7.241  1.00 5.88  ? 46 GLY A H    8  
ATOM   8748  H HA2  . GLY A 1 46 ? -9.864  -9.830  -8.392  1.00 7.41  ? 46 GLY A HA2  8  
ATOM   8749  H HA3  . GLY A 1 46 ? -11.038 -10.951 -7.701  1.00 7.56  ? 46 GLY A HA3  8  
ATOM   8750  N N    . ARG A 1 47 ? -9.270  -9.131  -5.626  1.00 6.21  ? 47 ARG A N    8  
ATOM   8751  C CA   . ARG A 1 47 ? -9.407  -8.234  -4.443  1.00 6.07  ? 47 ARG A CA   8  
ATOM   8752  C C    . ARG A 1 47 ? -8.748  -6.879  -4.730  1.00 5.32  ? 47 ARG A C    8  
ATOM   8753  O O    . ARG A 1 47 ? -7.972  -6.735  -5.655  1.00 5.06  ? 47 ARG A O    8  
ATOM   8754  C CB   . ARG A 1 47 ? -8.718  -8.897  -3.249  1.00 6.43  ? 47 ARG A CB   8  
ATOM   8755  C CG   . ARG A 1 47 ? -9.267  -8.323  -1.939  1.00 7.27  ? 47 ARG A CG   8  
ATOM   8756  C CD   . ARG A 1 47 ? -9.589  -9.468  -0.977  1.00 7.96  ? 47 ARG A CD   8  
ATOM   8757  N NE   . ARG A 1 47 ? -9.892  -8.914  0.374   1.00 8.82  ? 47 ARG A NE   8  
ATOM   8758  C CZ   . ARG A 1 47 ? -11.126 -8.634  0.705   1.00 9.62  ? 47 ARG A CZ   8  
ATOM   8759  N NH1  . ARG A 1 47 ? -11.944 -9.595  1.051   1.00 10.10 ? 47 ARG A NH1  8  
ATOM   8760  N NH2  . ARG A 1 47 ? -11.540 -7.392  0.689   1.00 10.15 ? 47 ARG A NH2  8  
ATOM   8761  H H    . ARG A 1 47 ? -8.380  -9.479  -5.873  1.00 6.06  ? 47 ARG A H    8  
ATOM   8762  H HA   . ARG A 1 47 ? -10.452 -8.087  -4.218  1.00 6.58  ? 47 ARG A HA   8  
ATOM   8763  H HB2  . ARG A 1 47 ? -8.898  -9.962  -3.277  1.00 6.43  ? 47 ARG A HB2  8  
ATOM   8764  H HB3  . ARG A 1 47 ? -7.657  -8.713  -3.305  1.00 6.47  ? 47 ARG A HB3  8  
ATOM   8765  H HG2  . ARG A 1 47 ? -8.527  -7.674  -1.493  1.00 7.60  ? 47 ARG A HG2  8  
ATOM   8766  H HG3  . ARG A 1 47 ? -10.167 -7.761  -2.139  1.00 7.34  ? 47 ARG A HG3  8  
ATOM   8767  H HD2  . ARG A 1 47 ? -10.446 -10.015 -1.344  1.00 7.82  ? 47 ARG A HD2  8  
ATOM   8768  H HD3  . ARG A 1 47 ? -8.741  -10.132 -0.912  1.00 8.20  ? 47 ARG A HD3  8  
ATOM   8769  H HE   . ARG A 1 47 ? -9.166  -8.757  1.014   1.00 8.93  ? 47 ARG A HE   8  
ATOM   8770  H HH11 . ARG A 1 47 ? -11.627 -10.544 1.061   1.00 9.88  ? 47 ARG A HH11 8  
ATOM   8771  H HH12 . ARG A 1 47 ? -12.889 -9.383  1.304   1.00 10.80 ? 47 ARG A HH12 8  
ATOM   8772  H HH21 . ARG A 1 47 ? -10.912 -6.660  0.425   1.00 9.97  ? 47 ARG A HH21 8  
ATOM   8773  H HH22 . ARG A 1 47 ? -12.483 -7.175  0.943   1.00 10.86 ? 47 ARG A HH22 8  
ATOM   8774  N N    . GLU A 1 48 ? -9.048  -5.887  -3.927  1.00 5.24  ? 48 GLU A N    8  
ATOM   8775  C CA   . GLU A 1 48 ? -8.439  -4.539  -4.116  1.00 4.73  ? 48 GLU A CA   8  
ATOM   8776  C C    . GLU A 1 48 ? -7.973  -4.033  -2.751  1.00 4.69  ? 48 GLU A C    8  
ATOM   8777  O O    . GLU A 1 48 ? -8.774  -3.793  -1.864  1.00 5.44  ? 48 GLU A O    8  
ATOM   8778  C CB   . GLU A 1 48 ? -9.475  -3.574  -4.707  1.00 5.60  ? 48 GLU A CB   8  
ATOM   8779  C CG   . GLU A 1 48 ? -8.758  -2.481  -5.511  1.00 5.76  ? 48 GLU A CG   8  
ATOM   8780  C CD   . GLU A 1 48 ? -9.240  -1.102  -5.052  1.00 6.79  ? 48 GLU A CD   8  
ATOM   8781  O OE1  . GLU A 1 48 ? -8.722  -0.615  -4.059  1.00 7.12  ? 48 GLU A OE1  8  
ATOM   8782  O OE2  . GLU A 1 48 ? -10.116 -0.556  -5.701  1.00 7.44  ? 48 GLU A OE2  8  
ATOM   8783  H H    . GLU A 1 48 ? -9.671  -6.036  -3.184  1.00 5.71  ? 48 GLU A H    8  
ATOM   8784  H HA   . GLU A 1 48 ? -7.591  -4.614  -4.781  1.00 4.10  ? 48 GLU A HA   8  
ATOM   8785  H HB2  . GLU A 1 48 ? -10.143 -4.120  -5.357  1.00 5.76  ? 48 GLU A HB2  8  
ATOM   8786  H HB3  . GLU A 1 48 ? -10.040 -3.119  -3.908  1.00 6.30  ? 48 GLU A HB3  8  
ATOM   8787  H HG2  . GLU A 1 48 ? -7.691  -2.560  -5.354  1.00 5.48  ? 48 GLU A HG2  8  
ATOM   8788  H HG3  . GLU A 1 48 ? -8.976  -2.605  -6.561  1.00 5.78  ? 48 GLU A HG3  8  
ATOM   8789  N N    . LEU A 1 49 ? -6.685  -3.889  -2.563  1.00 4.08  ? 49 LEU A N    8  
ATOM   8790  C CA   . LEU A 1 49 ? -6.172  -3.421  -1.240  1.00 4.35  ? 49 LEU A CA   8  
ATOM   8791  C C    . LEU A 1 49 ? -5.227  -2.239  -1.431  1.00 3.99  ? 49 LEU A C    8  
ATOM   8792  O O    . LEU A 1 49 ? -4.227  -2.338  -2.110  1.00 3.87  ? 49 LEU A O    8  
ATOM   8793  C CB   . LEU A 1 49 ? -5.399  -4.553  -0.554  1.00 4.67  ? 49 LEU A CB   8  
ATOM   8794  C CG   . LEU A 1 49 ? -6.161  -5.045  0.679   1.00 4.92  ? 49 LEU A CG   8  
ATOM   8795  C CD1  . LEU A 1 49 ? -7.143  -6.145  0.276   1.00 5.51  ? 49 LEU A CD1  8  
ATOM   8796  C CD2  . LEU A 1 49 ? -5.164  -5.609  1.692   1.00 4.69  ? 49 LEU A CD2  8  
ATOM   8797  H H    . LEU A 1 49 ? -6.056  -4.099  -3.290  1.00 3.67  ? 49 LEU A H    8  
ATOM   8798  H HA   . LEU A 1 49 ? -6.999  -3.122  -0.616  1.00 4.89  ? 49 LEU A HA   8  
ATOM   8799  H HB2  . LEU A 1 49 ? -5.263  -5.372  -1.246  1.00 4.69  ? 49 LEU A HB2  8  
ATOM   8800  H HB3  . LEU A 1 49 ? -4.434  -4.179  -0.245  1.00 5.10  ? 49 LEU A HB3  8  
ATOM   8801  H HG   . LEU A 1 49 ? -6.703  -4.222  1.122   1.00 5.20  ? 49 LEU A HG   8  
ATOM   8802  H HD11 . LEU A 1 49 ? -7.767  -5.795  -0.531  1.00 5.74  ? 49 LEU A HD11 8  
ATOM   8803  H HD12 . LEU A 1 49 ? -6.592  -7.017  -0.046  1.00 5.91  ? 49 LEU A HD12 8  
ATOM   8804  H HD13 . LEU A 1 49 ? -7.760  -6.403  1.124   1.00 5.66  ? 49 LEU A HD13 8  
ATOM   8805  H HD21 . LEU A 1 49 ? -4.316  -4.946  1.767   1.00 4.52  ? 49 LEU A HD21 8  
ATOM   8806  H HD22 . LEU A 1 49 ? -5.639  -5.696  2.657   1.00 4.66  ? 49 LEU A HD22 8  
ATOM   8807  H HD23 . LEU A 1 49 ? -4.830  -6.583  1.364   1.00 5.11  ? 49 LEU A HD23 8  
ATOM   8808  N N    . CYS A 1 50 ? -5.511  -1.134  -0.801  1.00 3.99  ? 50 CYS A N    8  
ATOM   8809  C CA   . CYS A 1 50 ? -4.608  0.039   -0.913  1.00 3.63  ? 50 CYS A CA   8  
ATOM   8810  C C    . CYS A 1 50 ? -3.519  -0.117  0.140   1.00 3.49  ? 50 CYS A C    8  
ATOM   8811  O O    . CYS A 1 50 ? -3.781  -0.531  1.253   1.00 4.14  ? 50 CYS A O    8  
ATOM   8812  C CB   . CYS A 1 50 ? -5.374  1.325   -0.678  1.00 3.72  ? 50 CYS A CB   8  
ATOM   8813  S SG   . CYS A 1 50 ? -7.069  1.166   -1.309  1.00 4.64  ? 50 CYS A SG   8  
ATOM   8814  H H    . CYS A 1 50 ? -6.298  -1.089  -0.228  1.00 4.28  ? 50 CYS A H    8  
ATOM   8815  H HA   . CYS A 1 50 ? -4.164  0.063   -1.887  1.00 3.59  ? 50 CYS A HA   8  
ATOM   8816  H HB2  . CYS A 1 50 ? -5.382  1.526   0.366   1.00 3.90  ? 50 CYS A HB2  8  
ATOM   8817  H HB3  . CYS A 1 50 ? -4.879  2.128   -1.190  1.00 3.38  ? 50 CYS A HB3  8  
ATOM   8818  N N    . LEU A 1 51 ? -2.300  0.163   -0.211  1.00 2.91  ? 51 LEU A N    8  
ATOM   8819  C CA   . LEU A 1 51 ? -1.185  -0.017  0.748   1.00 2.96  ? 51 LEU A CA   8  
ATOM   8820  C C    . LEU A 1 51 ? -0.795  1.293   1.419   1.00 3.35  ? 51 LEU A C    8  
ATOM   8821  O O    . LEU A 1 51 ? -1.052  2.382   0.924   1.00 3.56  ? 51 LEU A O    8  
ATOM   8822  C CB   . LEU A 1 51 ? 0.031   -0.572  0.014   1.00 2.71  ? 51 LEU A CB   8  
ATOM   8823  C CG   . LEU A 1 51 ? -0.296  -1.912  -0.673  1.00 2.56  ? 51 LEU A CG   8  
ATOM   8824  C CD1  . LEU A 1 51 ? 0.975   -2.751  -0.761  1.00 2.98  ? 51 LEU A CD1  8  
ATOM   8825  C CD2  . LEU A 1 51 ? -1.343  -2.697  0.128   1.00 2.61  ? 51 LEU A CD2  8  
ATOM   8826  H H    . LEU A 1 51 ? -2.113  0.459   -1.113  1.00 2.70  ? 51 LEU A H    8  
ATOM   8827  H HA   . LEU A 1 51 ? -1.484  -0.718  1.504   1.00 3.34  ? 51 LEU A HA   8  
ATOM   8828  H HB2  . LEU A 1 51 ? 0.348   0.142   -0.723  1.00 2.95  ? 51 LEU A HB2  8  
ATOM   8829  H HB3  . LEU A 1 51 ? 0.824   -0.718  0.719   1.00 2.93  ? 51 LEU A HB3  8  
ATOM   8830  H HG   . LEU A 1 51 ? -0.670  -1.721  -1.669  1.00 2.88  ? 51 LEU A HG   8  
ATOM   8831  H HD11 . LEU A 1 51 ? 1.788   -2.138  -1.121  1.00 3.38  ? 51 LEU A HD11 8  
ATOM   8832  H HD12 . LEU A 1 51 ? 1.220   -3.133  0.220   1.00 3.34  ? 51 LEU A HD12 8  
ATOM   8833  H HD13 . LEU A 1 51 ? 0.816   -3.576  -1.439  1.00 3.13  ? 51 LEU A HD13 8  
ATOM   8834  H HD21 . LEU A 1 51 ? -1.075  -2.688  1.174   1.00 3.04  ? 51 LEU A HD21 8  
ATOM   8835  H HD22 . LEU A 1 51 ? -2.312  -2.241  -0.001  1.00 2.85  ? 51 LEU A HD22 8  
ATOM   8836  H HD23 . LEU A 1 51 ? -1.376  -3.717  -0.227  1.00 2.77  ? 51 LEU A HD23 8  
ATOM   8837  N N    . ASP A 1 52 ? -0.150  1.163   2.548   1.00 3.84  ? 52 ASP A N    8  
ATOM   8838  C CA   . ASP A 1 52 ? 0.316   2.339   3.326   1.00 4.35  ? 52 ASP A CA   8  
ATOM   8839  C C    . ASP A 1 52 ? 1.844   2.443   3.185   1.00 4.47  ? 52 ASP A C    8  
ATOM   8840  O O    . ASP A 1 52 ? 2.565   1.548   3.602   1.00 4.73  ? 52 ASP A O    8  
ATOM   8841  C CB   . ASP A 1 52 ? -0.057  2.133   4.802   1.00 4.93  ? 52 ASP A CB   8  
ATOM   8842  C CG   . ASP A 1 52 ? -0.056  3.472   5.557   1.00 5.39  ? 52 ASP A CG   8  
ATOM   8843  O OD1  . ASP A 1 52 ? 0.791   4.306   5.270   1.00 5.40  ? 52 ASP A OD1  8  
ATOM   8844  O OD2  . ASP A 1 52 ? -0.900  3.638   6.421   1.00 5.96  ? 52 ASP A OD2  8  
ATOM   8845  H H    . ASP A 1 52 ? 0.043   0.262   2.881   1.00 4.08  ? 52 ASP A H    8  
ATOM   8846  H HA   . ASP A 1 52 ? -0.154  3.236   2.952   1.00 4.52  ? 52 ASP A HA   8  
ATOM   8847  H HB2  . ASP A 1 52 ? -1.044  1.692   4.858   1.00 5.32  ? 52 ASP A HB2  8  
ATOM   8848  H HB3  . ASP A 1 52 ? 0.654   1.463   5.259   1.00 4.91  ? 52 ASP A HB3  8  
ATOM   8849  N N    . PRO A 1 53 ? 2.299   3.535   2.610   1.00 4.54  ? 53 PRO A N    8  
ATOM   8850  C CA   . PRO A 1 53 ? 3.743   3.776   2.396   1.00 4.96  ? 53 PRO A CA   8  
ATOM   8851  C C    . PRO A 1 53 ? 4.481   4.015   3.726   1.00 5.21  ? 53 PRO A C    8  
ATOM   8852  O O    . PRO A 1 53 ? 5.693   4.111   3.751   1.00 5.67  ? 53 PRO A O    8  
ATOM   8853  C CB   . PRO A 1 53 ? 3.774   5.014   1.492   1.00 5.26  ? 53 PRO A CB   8  
ATOM   8854  C CG   . PRO A 1 53 ? 2.415   5.724   1.680   1.00 5.04  ? 53 PRO A CG   8  
ATOM   8855  C CD   . PRO A 1 53 ? 1.428   4.639   2.148   1.00 4.55  ? 53 PRO A CD   8  
ATOM   8856  H HA   . PRO A 1 53 ? 4.183   2.940   1.875   1.00 5.07  ? 53 PRO A HA   8  
ATOM   8857  H HB2  . PRO A 1 53 ? 4.584   5.669   1.786   1.00 5.72  ? 53 PRO A HB2  8  
ATOM   8858  H HB3  . PRO A 1 53 ? 3.890   4.718   0.460   1.00 5.40  ? 53 PRO A HB3  8  
ATOM   8859  H HG2  . PRO A 1 53 ? 2.502   6.500   2.429   1.00 5.39  ? 53 PRO A HG2  8  
ATOM   8860  H HG3  . PRO A 1 53 ? 2.080   6.143   0.744   1.00 5.11  ? 53 PRO A HG3  8  
ATOM   8861  H HD2  . PRO A 1 53 ? 0.816   5.010   2.958   1.00 4.78  ? 53 PRO A HD2  8  
ATOM   8862  H HD3  . PRO A 1 53 ? 0.812   4.308   1.327   1.00 4.27  ? 53 PRO A HD3  8  
ATOM   8863  N N    . LYS A 1 54 ? 3.764   4.096   4.829   1.00 5.18  ? 54 LYS A N    8  
ATOM   8864  C CA   . LYS A 1 54 ? 4.425   4.307   6.143   1.00 5.61  ? 54 LYS A CA   8  
ATOM   8865  C C    . LYS A 1 54 ? 5.316   3.105   6.483   1.00 5.02  ? 54 LYS A C    8  
ATOM   8866  O O    . LYS A 1 54 ? 6.317   3.252   7.161   1.00 5.42  ? 54 LYS A O    8  
ATOM   8867  C CB   . LYS A 1 54 ? 3.365   4.475   7.236   1.00 6.23  ? 54 LYS A CB   8  
ATOM   8868  C CG   . LYS A 1 54 ? 3.071   5.964   7.444   1.00 7.12  ? 54 LYS A CG   8  
ATOM   8869  C CD   . LYS A 1 54 ? 2.895   6.251   8.937   1.00 7.85  ? 54 LYS A CD   8  
ATOM   8870  C CE   . LYS A 1 54 ? 4.264   6.484   9.583   1.00 8.63  ? 54 LYS A CE   8  
ATOM   8871  N NZ   . LYS A 1 54 ? 4.284   5.876   10.946  1.00 9.56  ? 54 LYS A NZ   8  
ATOM   8872  H H    . LYS A 1 54 ? 2.796   4.011   4.791   1.00 5.07  ? 54 LYS A H    8  
ATOM   8873  H HA   . LYS A 1 54 ? 5.025   5.194   6.091   1.00 6.14  ? 54 LYS A HA   8  
ATOM   8874  H HB2  . LYS A 1 54 ? 2.459   3.966   6.939   1.00 6.01  ? 54 LYS A HB2  8  
ATOM   8875  H HB3  . LYS A 1 54 ? 3.729   4.049   8.158   1.00 6.42  ? 54 LYS A HB3  8  
ATOM   8876  H HG2  . LYS A 1 54 ? 3.894   6.549   7.058   1.00 7.47  ? 54 LYS A HG2  8  
ATOM   8877  H HG3  . LYS A 1 54 ? 2.165   6.228   6.919   1.00 7.15  ? 54 LYS A HG3  8  
ATOM   8878  H HD2  . LYS A 1 54 ? 2.283   7.132   9.063   1.00 8.02  ? 54 LYS A HD2  8  
ATOM   8879  H HD3  . LYS A 1 54 ? 2.414   5.409   9.411   1.00 7.93  ? 54 LYS A HD3  8  
ATOM   8880  H HE2  . LYS A 1 54 ? 5.032   6.028   8.975   1.00 8.78  ? 54 LYS A HE2  8  
ATOM   8881  H HE3  . LYS A 1 54 ? 4.449   7.545   9.661   1.00 8.58  ? 54 LYS A HE3  8  
ATOM   8882  H HZ1  . LYS A 1 54 ? 3.535   6.305   11.528  1.00 9.93  ? 54 LYS A HZ1  8  
ATOM   8883  H HZ2  . LYS A 1 54 ? 4.123   4.851   10.872  1.00 9.78  ? 54 LYS A HZ2  8  
ATOM   8884  H HZ3  . LYS A 1 54 ? 5.209   6.048   11.388  1.00 9.84  ? 54 LYS A HZ3  8  
ATOM   8885  N N    . GLU A 1 55 ? 4.973   1.920   6.020   1.00 4.37  ? 55 GLU A N    8  
ATOM   8886  C CA   . GLU A 1 55 ? 5.814   0.733   6.324   1.00 4.14  ? 55 GLU A CA   8  
ATOM   8887  C C    . GLU A 1 55 ? 6.985   0.671   5.353   1.00 3.84  ? 55 GLU A C    8  
ATOM   8888  O O    . GLU A 1 55 ? 6.974   1.286   4.301   1.00 3.83  ? 55 GLU A O    8  
ATOM   8889  C CB   . GLU A 1 55 ? 4.999   -0.548  6.156   1.00 4.19  ? 55 GLU A CB   8  
ATOM   8890  C CG   . GLU A 1 55 ? 3.896   -0.612  7.208   1.00 4.76  ? 55 GLU A CG   8  
ATOM   8891  C CD   . GLU A 1 55 ? 2.581   -0.110  6.606   1.00 5.39  ? 55 GLU A CD   8  
ATOM   8892  O OE1  . GLU A 1 55 ? 2.045   -0.794  5.746   1.00 5.43  ? 55 GLU A OE1  8  
ATOM   8893  O OE2  . GLU A 1 55 ? 2.134   0.949   7.012   1.00 6.13  ? 55 GLU A OE2  8  
ATOM   8894  H H    . GLU A 1 55 ? 4.166   1.812   5.471   1.00 4.29  ? 55 GLU A H    8  
ATOM   8895  H HA   . GLU A 1 55 ? 6.183   0.796   7.337   1.00 4.53  ? 55 GLU A HA   8  
ATOM   8896  H HB2  . GLU A 1 55 ? 4.567   -0.567  5.171   1.00 4.04  ? 55 GLU A HB2  8  
ATOM   8897  H HB3  . GLU A 1 55 ? 5.649   -1.396  6.272   1.00 4.32  ? 55 GLU A HB3  8  
ATOM   8898  H HG2  . GLU A 1 55 ? 3.776   -1.631  7.539   1.00 4.81  ? 55 GLU A HG2  8  
ATOM   8899  H HG3  . GLU A 1 55 ? 4.167   0.003   8.046   1.00 4.98  ? 55 GLU A HG3  8  
ATOM   8900  N N    . ASN A 1 56 ? 7.971   -0.106  5.688   1.00 3.90  ? 56 ASN A N    8  
ATOM   8901  C CA   . ASN A 1 56 ? 9.140   -0.271  4.785   1.00 3.93  ? 56 ASN A CA   8  
ATOM   8902  C C    . ASN A 1 56 ? 8.873   -1.446  3.842   1.00 3.74  ? 56 ASN A C    8  
ATOM   8903  O O    . ASN A 1 56 ? 9.529   -1.593  2.832   1.00 3.89  ? 56 ASN A O    8  
ATOM   8904  C CB   . ASN A 1 56 ? 10.393  -0.547  5.602   1.00 4.29  ? 56 ASN A CB   8  
ATOM   8905  C CG   . ASN A 1 56 ? 11.396  0.595   5.411   1.00 4.70  ? 56 ASN A CG   8  
ATOM   8906  O OD1  . ASN A 1 56 ? 12.027  0.696   4.376   1.00 4.90  ? 56 ASN A OD1  8  
ATOM   8907  N ND2  . ASN A 1 56 ? 11.573  1.465   6.369   1.00 5.15  ? 56 ASN A ND2  8  
ATOM   8908  H H    . ASN A 1 56 ? 7.925   -0.612  6.524   1.00 4.12  ? 56 ASN A H    8  
ATOM   8909  H HA   . ASN A 1 56 ? 9.282   0.622   4.212   1.00 4.07  ? 56 ASN A HA   8  
ATOM   8910  H HB2  . ASN A 1 56 ? 10.125  -0.623  6.639   1.00 4.38  ? 56 ASN A HB2  8  
ATOM   8911  H HB3  . ASN A 1 56 ? 10.834  -1.470  5.273   1.00 4.36  ? 56 ASN A HB3  8  
ATOM   8912  H HD21 . ASN A 1 56 ? 11.067  1.385   7.204   1.00 5.31  ? 56 ASN A HD21 8  
ATOM   8913  H HD22 . ASN A 1 56 ? 12.212  2.198   6.251   1.00 5.51  ? 56 ASN A HD22 8  
ATOM   8914  N N    . TRP A 1 57 ? 7.907   -2.283  4.165   1.00 3.55  ? 57 TRP A N    8  
ATOM   8915  C CA   . TRP A 1 57 ? 7.593   -3.435  3.295   1.00 3.47  ? 57 TRP A CA   8  
ATOM   8916  C C    . TRP A 1 57 ? 6.731   -2.972  2.126   1.00 3.28  ? 57 TRP A C    8  
ATOM   8917  O O    . TRP A 1 57 ? 6.897   -3.428  1.021   1.00 3.48  ? 57 TRP A O    8  
ATOM   8918  C CB   . TRP A 1 57 ? 6.882   -4.526  4.107   1.00 3.64  ? 57 TRP A CB   8  
ATOM   8919  C CG   . TRP A 1 57 ? 5.456   -4.188  4.387   1.00 3.70  ? 57 TRP A CG   8  
ATOM   8920  C CD1  . TRP A 1 57 ? 5.006   -3.721  5.559   1.00 4.08  ? 57 TRP A CD1  8  
ATOM   8921  C CD2  . TRP A 1 57 ? 4.285   -4.306  3.519   1.00 3.51  ? 57 TRP A CD2  8  
ATOM   8922  N NE1  . TRP A 1 57 ? 3.639   -3.571  5.489   1.00 4.20  ? 57 TRP A NE1  8  
ATOM   8923  C CE2  . TRP A 1 57 ? 3.149   -3.901  4.252   1.00 3.80  ? 57 TRP A CE2  8  
ATOM   8924  C CE3  . TRP A 1 57 ? 4.098   -4.719  2.192   1.00 3.27  ? 57 TRP A CE3  8  
ATOM   8925  C CZ2  . TRP A 1 57 ? 1.873   -3.902  3.696   1.00 3.76  ? 57 TRP A CZ2  8  
ATOM   8926  C CZ3  . TRP A 1 57 ? 2.814   -4.720  1.623   1.00 3.17  ? 57 TRP A CZ3  8  
ATOM   8927  C CH2  . TRP A 1 57 ? 1.703   -4.313  2.374   1.00 3.38  ? 57 TRP A CH2  8  
ATOM   8928  H H    . TRP A 1 57 ? 7.391   -2.146  4.977   1.00 3.59  ? 57 TRP A H    8  
ATOM   8929  H HA   . TRP A 1 57 ? 8.514   -3.830  2.913   1.00 3.59  ? 57 TRP A HA   8  
ATOM   8930  H HB2  . TRP A 1 57 ? 6.910   -5.441  3.569   1.00 3.77  ? 57 TRP A HB2  8  
ATOM   8931  H HB3  . TRP A 1 57 ? 7.404   -4.655  5.040   1.00 3.78  ? 57 TRP A HB3  8  
ATOM   8932  H HD1  . TRP A 1 57 ? 5.616   -3.514  6.418   1.00 4.35  ? 57 TRP A HD1  8  
ATOM   8933  H HE1  . TRP A 1 57 ? 3.074   -3.268  6.211   1.00 4.57  ? 57 TRP A HE1  8  
ATOM   8934  H HE3  . TRP A 1 57 ? 4.946   -5.036  1.605   1.00 3.29  ? 57 TRP A HE3  8  
ATOM   8935  H HZ2  . TRP A 1 57 ? 1.022   -3.584  4.284   1.00 4.10  ? 57 TRP A HZ2  8  
ATOM   8936  H HZ3  . TRP A 1 57 ? 2.683   -5.030  0.601   1.00 3.03  ? 57 TRP A HZ3  8  
ATOM   8937  H HH2  . TRP A 1 57 ? 0.719   -4.316  1.931   1.00 3.37  ? 57 TRP A HH2  8  
ATOM   8938  N N    . VAL A 1 58 ? 5.822   -2.060  2.355   1.00 3.02  ? 58 VAL A N    8  
ATOM   8939  C CA   . VAL A 1 58 ? 4.968   -1.562  1.232   1.00 2.84  ? 58 VAL A CA   8  
ATOM   8940  C C    . VAL A 1 58 ? 5.863   -0.852  0.208   1.00 2.99  ? 58 VAL A C    8  
ATOM   8941  O O    . VAL A 1 58 ? 5.717   -1.037  -0.986  1.00 3.21  ? 58 VAL A O    8  
ATOM   8942  C CB   . VAL A 1 58 ? 3.914   -0.583  1.776   1.00 2.78  ? 58 VAL A CB   8  
ATOM   8943  C CG1  . VAL A 1 58 ? 3.434   0.360   0.669   1.00 2.80  ? 58 VAL A CG1  8  
ATOM   8944  C CG2  . VAL A 1 58 ? 2.719   -1.360  2.316   1.00 2.85  ? 58 VAL A CG2  8  
ATOM   8945  H H    . VAL A 1 58 ? 5.707   -1.700  3.264   1.00 3.04  ? 58 VAL A H    8  
ATOM   8946  H HA   . VAL A 1 58 ? 4.478   -2.400  0.757   1.00 2.96  ? 58 VAL A HA   8  
ATOM   8947  H HB   . VAL A 1 58 ? 4.350   -0.007  2.571   1.00 3.12  ? 58 VAL A HB   8  
ATOM   8948  H HG11 . VAL A 1 58 ? 3.372   -0.179  -0.264  1.00 2.86  ? 58 VAL A HG11 8  
ATOM   8949  H HG12 . VAL A 1 58 ? 2.458   0.748   0.927   1.00 3.08  ? 58 VAL A HG12 8  
ATOM   8950  H HG13 . VAL A 1 58 ? 4.130   1.179   0.568   1.00 3.10  ? 58 VAL A HG13 8  
ATOM   8951  H HG21 . VAL A 1 58 ? 2.494   -2.181  1.652   1.00 2.93  ? 58 VAL A HG21 8  
ATOM   8952  H HG22 . VAL A 1 58 ? 2.955   -1.741  3.295   1.00 3.15  ? 58 VAL A HG22 8  
ATOM   8953  H HG23 . VAL A 1 58 ? 1.864   -0.705  2.381   1.00 3.17  ? 58 VAL A HG23 8  
ATOM   8954  N N    . GLN A 1 59 ? 6.794   -0.050  0.670   1.00 3.12  ? 59 GLN A N    8  
ATOM   8955  C CA   . GLN A 1 59 ? 7.705   0.670   -0.264  1.00 3.61  ? 59 GLN A CA   8  
ATOM   8956  C C    . GLN A 1 59 ? 8.744   -0.302  -0.851  1.00 3.90  ? 59 GLN A C    8  
ATOM   8957  O O    . GLN A 1 59 ? 9.242   -0.092  -1.942  1.00 4.47  ? 59 GLN A O    8  
ATOM   8958  C CB   . GLN A 1 59 ? 8.389   1.811   0.484   1.00 3.82  ? 59 GLN A CB   8  
ATOM   8959  C CG   . GLN A 1 59 ? 9.342   1.234   1.516   1.00 4.33  ? 59 GLN A CG   8  
ATOM   8960  C CD   . GLN A 1 59 ? 9.916   2.359   2.381   1.00 4.72  ? 59 GLN A CD   8  
ATOM   8961  O OE1  . GLN A 1 59 ? 11.028  2.799   2.165   1.00 4.84  ? 59 GLN A OE1  8  
ATOM   8962  N NE2  . GLN A 1 59 ? 9.202   2.846   3.360   1.00 5.29  ? 59 GLN A NE2  8  
ATOM   8963  H H    . GLN A 1 59 ? 6.896   0.076   1.635   1.00 3.04  ? 59 GLN A H    8  
ATOM   8964  H HA   . GLN A 1 59 ? 7.129   1.078   -1.064  1.00 3.80  ? 59 GLN A HA   8  
ATOM   8965  H HB2  . GLN A 1 59 ? 8.935   2.420   -0.213  1.00 3.96  ? 59 GLN A HB2  8  
ATOM   8966  H HB3  . GLN A 1 59 ? 7.642   2.412   0.982   1.00 3.78  ? 59 GLN A HB3  8  
ATOM   8967  H HG2  . GLN A 1 59 ? 8.802   0.535   2.135   1.00 4.58  ? 59 GLN A HG2  8  
ATOM   8968  H HG3  . GLN A 1 59 ? 10.140  0.722   1.008   1.00 4.52  ? 59 GLN A HG3  8  
ATOM   8969  H HE21 . GLN A 1 59 ? 8.305   2.493   3.538   1.00 5.47  ? 59 GLN A HE21 8  
ATOM   8970  H HE22 . GLN A 1 59 ? 9.563   3.566   3.919   1.00 5.70  ? 59 GLN A HE22 8  
ATOM   8971  N N    . ARG A 1 60 ? 9.052   -1.375  -0.156  1.00 3.65  ? 60 ARG A N    8  
ATOM   8972  C CA   . ARG A 1 60 ? 10.030  -2.368  -0.694  1.00 3.97  ? 60 ARG A CA   8  
ATOM   8973  C C    . ARG A 1 60 ? 9.282   -3.314  -1.636  1.00 3.96  ? 60 ARG A C    8  
ATOM   8974  O O    . ARG A 1 60 ? 9.772   -3.673  -2.689  1.00 4.42  ? 60 ARG A O    8  
ATOM   8975  C CB   . ARG A 1 60 ? 10.647  -3.171  0.456   1.00 4.07  ? 60 ARG A CB   8  
ATOM   8976  C CG   . ARG A 1 60 ? 12.091  -3.543  0.109   1.00 4.60  ? 60 ARG A CG   8  
ATOM   8977  C CD   . ARG A 1 60 ? 13.014  -2.356  0.400   1.00 4.81  ? 60 ARG A CD   8  
ATOM   8978  N NE   . ARG A 1 60 ? 14.351  -2.860  0.829   1.00 5.26  ? 60 ARG A NE   8  
ATOM   8979  C CZ   . ARG A 1 60 ? 15.257  -3.156  -0.067  1.00 5.84  ? 60 ARG A CZ   8  
ATOM   8980  N NH1  . ARG A 1 60 ? 16.026  -2.215  -0.555  1.00 6.25  ? 60 ARG A NH1  8  
ATOM   8981  N NH2  . ARG A 1 60 ? 15.395  -4.392  -0.472  1.00 6.35  ? 60 ARG A NH2  8  
ATOM   8982  H H    . ARG A 1 60 ? 8.620   -1.540  0.709   1.00 3.35  ? 60 ARG A H    8  
ATOM   8983  H HA   . ARG A 1 60 ? 10.808  -1.852  -1.240  1.00 4.24  ? 60 ARG A HA   8  
ATOM   8984  H HB2  . ARG A 1 60 ? 10.637  -2.576  1.355   1.00 3.95  ? 60 ARG A HB2  8  
ATOM   8985  H HB3  . ARG A 1 60 ? 10.074  -4.072  0.615   1.00 4.07  ? 60 ARG A HB3  8  
ATOM   8986  H HG2  . ARG A 1 60 ? 12.396  -4.392  0.705   1.00 4.80  ? 60 ARG A HG2  8  
ATOM   8987  H HG3  . ARG A 1 60 ? 12.155  -3.797  -0.938  1.00 4.99  ? 60 ARG A HG3  8  
ATOM   8988  H HD2  . ARG A 1 60 ? 13.124  -1.758  -0.493  1.00 4.73  ? 60 ARG A HD2  8  
ATOM   8989  H HD3  . ARG A 1 60 ? 12.589  -1.752  1.188   1.00 5.10  ? 60 ARG A HD3  8  
ATOM   8990  H HE   . ARG A 1 60 ? 14.550  -2.971  1.781   1.00 5.37  ? 60 ARG A HE   8  
ATOM   8991  H HH11 . ARG A 1 60 ? 15.919  -1.270  -0.245  1.00 6.14  ? 60 ARG A HH11 8  
ATOM   8992  H HH12 . ARG A 1 60 ? 16.720  -2.440  -1.241  1.00 6.86  ? 60 ARG A HH12 8  
ATOM   8993  H HH21 . ARG A 1 60 ? 14.806  -5.110  -0.097  1.00 6.32  ? 60 ARG A HH21 8  
ATOM   8994  H HH22 . ARG A 1 60 ? 16.088  -4.622  -1.156  1.00 6.96  ? 60 ARG A HH22 8  
ATOM   8995  N N    . VAL A 1 61 ? 8.084   -3.699  -1.259  1.00 3.58  ? 61 VAL A N    8  
ATOM   8996  C CA   . VAL A 1 61 ? 7.263   -4.603  -2.115  1.00 3.55  ? 61 VAL A CA   8  
ATOM   8997  C C    . VAL A 1 61 ? 6.922   -3.879  -3.425  1.00 3.25  ? 61 VAL A C    8  
ATOM   8998  O O    . VAL A 1 61 ? 6.940   -4.470  -4.488  1.00 3.52  ? 61 VAL A O    8  
ATOM   8999  C CB   . VAL A 1 61 ? 5.979   -4.973  -1.355  1.00 3.59  ? 61 VAL A CB   8  
ATOM   9000  C CG1  . VAL A 1 61 ? 4.949   -5.571  -2.313  1.00 3.56  ? 61 VAL A CG1  8  
ATOM   9001  C CG2  . VAL A 1 61 ? 6.314   -6.002  -0.273  1.00 4.31  ? 61 VAL A CG2  8  
ATOM   9002  H H    . VAL A 1 61 ? 7.716   -3.379  -0.405  1.00 3.39  ? 61 VAL A H    8  
ATOM   9003  H HA   . VAL A 1 61 ? 7.825   -5.496  -2.337  1.00 3.93  ? 61 VAL A HA   8  
ATOM   9004  H HB   . VAL A 1 61 ? 5.566   -4.088  -0.895  1.00 3.40  ? 61 VAL A HB   8  
ATOM   9005  H HG11 . VAL A 1 61 ? 5.432   -6.301  -2.943  1.00 3.73  ? 61 VAL A HG11 8  
ATOM   9006  H HG12 . VAL A 1 61 ? 4.164   -6.047  -1.746  1.00 3.88  ? 61 VAL A HG12 8  
ATOM   9007  H HG13 . VAL A 1 61 ? 4.529   -4.785  -2.924  1.00 3.52  ? 61 VAL A HG13 8  
ATOM   9008  H HG21 . VAL A 1 61 ? 6.737   -6.883  -0.732  1.00 4.58  ? 61 VAL A HG21 8  
ATOM   9009  H HG22 . VAL A 1 61 ? 7.029   -5.577  0.416   1.00 4.75  ? 61 VAL A HG22 8  
ATOM   9010  H HG23 . VAL A 1 61 ? 5.415   -6.270  0.261   1.00 4.45  ? 61 VAL A HG23 8  
ATOM   9011  N N    . VAL A 1 62 ? 6.633   -2.600  -3.354  1.00 2.99  ? 62 VAL A N    8  
ATOM   9012  C CA   . VAL A 1 62 ? 6.313   -1.827  -4.592  1.00 3.22  ? 62 VAL A CA   8  
ATOM   9013  C C    . VAL A 1 62 ? 7.594   -1.670  -5.423  1.00 3.80  ? 62 VAL A C    8  
ATOM   9014  O O    . VAL A 1 62 ? 7.568   -1.779  -6.634  1.00 4.15  ? 62 VAL A O    8  
ATOM   9015  C CB   . VAL A 1 62 ? 5.755   -0.446  -4.211  1.00 3.53  ? 62 VAL A CB   8  
ATOM   9016  C CG1  . VAL A 1 62 ? 5.753   0.478   -5.436  1.00 4.40  ? 62 VAL A CG1  8  
ATOM   9017  C CG2  . VAL A 1 62 ? 4.321   -0.599  -3.696  1.00 3.34  ? 62 VAL A CG2  8  
ATOM   9018  H H    . VAL A 1 62 ? 6.641   -2.144  -2.485  1.00 2.92  ? 62 VAL A H    8  
ATOM   9019  H HA   . VAL A 1 62 ? 5.575   -2.366  -5.170  1.00 3.17  ? 62 VAL A HA   8  
ATOM   9020  H HB   . VAL A 1 62 ? 6.373   -0.012  -3.438  1.00 3.69  ? 62 VAL A HB   8  
ATOM   9021  H HG11 . VAL A 1 62 ? 5.341   -0.049  -6.284  1.00 4.91  ? 62 VAL A HG11 8  
ATOM   9022  H HG12 . VAL A 1 62 ? 5.153   1.350   -5.228  1.00 4.71  ? 62 VAL A HG12 8  
ATOM   9023  H HG13 . VAL A 1 62 ? 6.765   0.782   -5.659  1.00 4.59  ? 62 VAL A HG13 8  
ATOM   9024  H HG21 . VAL A 1 62 ? 4.248   -1.493  -3.095  1.00 3.80  ? 62 VAL A HG21 8  
ATOM   9025  H HG22 . VAL A 1 62 ? 4.061   0.261   -3.097  1.00 3.53  ? 62 VAL A HG22 8  
ATOM   9026  H HG23 . VAL A 1 62 ? 3.643   -0.672  -4.534  1.00 3.11  ? 62 VAL A HG23 8  
ATOM   9027  N N    . GLU A 1 63 ? 8.716   -1.424  -4.780  1.00 4.04  ? 63 GLU A N    8  
ATOM   9028  C CA   . GLU A 1 63 ? 9.996   -1.271  -5.530  1.00 4.68  ? 63 GLU A CA   8  
ATOM   9029  C C    . GLU A 1 63 ? 10.375  -2.608  -6.178  1.00 4.70  ? 63 GLU A C    8  
ATOM   9030  O O    . GLU A 1 63 ? 10.838  -2.645  -7.300  1.00 5.23  ? 63 GLU A O    8  
ATOM   9031  C CB   . GLU A 1 63 ? 11.114  -0.824  -4.578  1.00 5.11  ? 63 GLU A CB   8  
ATOM   9032  C CG   . GLU A 1 63 ? 11.380  0.674   -4.763  1.00 5.73  ? 63 GLU A CG   8  
ATOM   9033  C CD   . GLU A 1 63 ? 12.789  1.013   -4.268  1.00 6.00  ? 63 GLU A CD   8  
ATOM   9034  O OE1  . GLU A 1 63 ? 12.942  1.233   -3.077  1.00 6.04  ? 63 GLU A OE1  8  
ATOM   9035  O OE2  . GLU A 1 63 ? 13.690  1.051   -5.088  1.00 6.46  ? 63 GLU A OE2  8  
ATOM   9036  H H    . GLU A 1 63 ? 8.715   -1.343  -3.810  1.00 3.89  ? 63 GLU A H    8  
ATOM   9037  H HA   . GLU A 1 63 ? 9.858   -0.531  -6.297  1.00 5.00  ? 63 GLU A HA   8  
ATOM   9038  H HB2  . GLU A 1 63 ? 10.817  -1.014  -3.557  1.00 4.92  ? 63 GLU A HB2  8  
ATOM   9039  H HB3  . GLU A 1 63 ? 12.016  -1.376  -4.799  1.00 5.36  ? 63 GLU A HB3  8  
ATOM   9040  H HG2  . GLU A 1 63 ? 11.296  0.927   -5.811  1.00 5.98  ? 63 GLU A HG2  8  
ATOM   9041  H HG3  . GLU A 1 63 ? 10.656  1.239   -4.197  1.00 6.04  ? 63 GLU A HG3  8  
ATOM   9042  N N    . LYS A 1 64 ? 10.175  -3.705  -5.488  1.00 4.35  ? 64 LYS A N    8  
ATOM   9043  C CA   . LYS A 1 64 ? 10.512  -5.033  -6.071  1.00 4.71  ? 64 LYS A CA   8  
ATOM   9044  C C    . LYS A 1 64 ? 9.501   -5.385  -7.177  1.00 4.54  ? 64 LYS A C    8  
ATOM   9045  O O    . LYS A 1 64 ? 9.812   -6.112  -8.101  1.00 5.00  ? 64 LYS A O    8  
ATOM   9046  C CB   . LYS A 1 64 ? 10.467  -6.104  -4.975  1.00 4.74  ? 64 LYS A CB   8  
ATOM   9047  C CG   . LYS A 1 64 ? 11.447  -7.230  -5.320  1.00 5.62  ? 64 LYS A CG   8  
ATOM   9048  C CD   . LYS A 1 64 ? 11.669  -8.115  -4.091  1.00 6.24  ? 64 LYS A CD   8  
ATOM   9049  C CE   . LYS A 1 64 ? 12.847  -9.060  -4.341  1.00 7.07  ? 64 LYS A CE   8  
ATOM   9050  N NZ   . LYS A 1 64 ? 13.477  -9.430  -3.041  1.00 7.79  ? 64 LYS A NZ   8  
ATOM   9051  H H    . LYS A 1 64 ? 9.801   -3.657  -4.589  1.00 4.03  ? 64 LYS A H    8  
ATOM   9052  H HA   . LYS A 1 64 ? 11.501  -4.988  -6.487  1.00 5.26  ? 64 LYS A HA   8  
ATOM   9053  H HB2  . LYS A 1 64 ? 10.745  -5.662  -4.028  1.00 4.73  ? 64 LYS A HB2  8  
ATOM   9054  H HB3  . LYS A 1 64 ? 9.469   -6.508  -4.904  1.00 4.49  ? 64 LYS A HB3  8  
ATOM   9055  H HG2  . LYS A 1 64 ? 11.041  -7.824  -6.125  1.00 6.07  ? 64 LYS A HG2  8  
ATOM   9056  H HG3  . LYS A 1 64 ? 12.390  -6.803  -5.628  1.00 5.69  ? 64 LYS A HG3  8  
ATOM   9057  H HD2  . LYS A 1 64 ? 11.881  -7.493  -3.232  1.00 6.22  ? 64 LYS A HD2  8  
ATOM   9058  H HD3  . LYS A 1 64 ? 10.778  -8.697  -3.902  1.00 6.45  ? 64 LYS A HD3  8  
ATOM   9059  H HE2  . LYS A 1 64 ? 12.494  -9.953  -4.836  1.00 7.40  ? 64 LYS A HE2  8  
ATOM   9060  H HE3  . LYS A 1 64 ? 13.577  -8.568  -4.968  1.00 7.09  ? 64 LYS A HE3  8  
ATOM   9061  H HZ1  . LYS A 1 64 ? 13.708  -8.568  -2.508  1.00 8.09  ? 64 LYS A HZ1  8  
ATOM   9062  H HZ2  . LYS A 1 64 ? 12.816  -10.014 -2.488  1.00 8.07  ? 64 LYS A HZ2  8  
ATOM   9063  H HZ3  . LYS A 1 64 ? 14.349  -9.967  -3.219  1.00 7.96  ? 64 LYS A HZ3  8  
ATOM   9064  N N    . PHE A 1 65 ? 8.292   -4.874  -7.083  1.00 4.02  ? 65 PHE A N    8  
ATOM   9065  C CA   . PHE A 1 65 ? 7.251   -5.170  -8.115  1.00 3.99  ? 65 PHE A CA   8  
ATOM   9066  C C    . PHE A 1 65 ? 7.463   -4.284  -9.348  1.00 4.72  ? 65 PHE A C    8  
ATOM   9067  O O    . PHE A 1 65 ? 7.419   -4.754  -10.470 1.00 5.31  ? 65 PHE A O    8  
ATOM   9068  C CB   . PHE A 1 65 ? 5.868   -4.882  -7.521  1.00 3.16  ? 65 PHE A CB   8  
ATOM   9069  C CG   . PHE A 1 65 ? 4.803   -5.627  -8.297  1.00 3.02  ? 65 PHE A CG   8  
ATOM   9070  C CD1  . PHE A 1 65 ? 4.710   -7.022  -8.206  1.00 2.97  ? 65 PHE A CD1  8  
ATOM   9071  C CD2  . PHE A 1 65 ? 3.909   -4.919  -9.111  1.00 3.45  ? 65 PHE A CD2  8  
ATOM   9072  C CE1  . PHE A 1 65 ? 3.724   -7.706  -8.928  1.00 3.10  ? 65 PHE A CE1  8  
ATOM   9073  C CE2  . PHE A 1 65 ? 2.923   -5.604  -9.831  1.00 3.48  ? 65 PHE A CE2  8  
ATOM   9074  C CZ   . PHE A 1 65 ? 2.832   -6.997  -9.739  1.00 3.19  ? 65 PHE A CZ   8  
ATOM   9075  H H    . PHE A 1 65 ? 8.066   -4.292  -6.327  1.00 3.77  ? 65 PHE A H    8  
ATOM   9076  H HA   . PHE A 1 65 ? 7.311   -6.210  -8.400  1.00 4.30  ? 65 PHE A HA   8  
ATOM   9077  H HB2  . PHE A 1 65 ? 5.851   -5.198  -6.491  1.00 2.82  ? 65 PHE A HB2  8  
ATOM   9078  H HB3  . PHE A 1 65 ? 5.673   -3.822  -7.570  1.00 3.27  ? 65 PHE A HB3  8  
ATOM   9079  H HD1  . PHE A 1 65 ? 5.398   -7.570  -7.578  1.00 3.21  ? 65 PHE A HD1  8  
ATOM   9080  H HD2  . PHE A 1 65 ? 3.979   -3.845  -9.181  1.00 4.00  ? 65 PHE A HD2  8  
ATOM   9081  H HE1  . PHE A 1 65 ? 3.652   -8.780  -8.857  1.00 3.46  ? 65 PHE A HE1  8  
ATOM   9082  H HE2  . PHE A 1 65 ? 2.234   -5.056  -10.459 1.00 4.01  ? 65 PHE A HE2  8  
ATOM   9083  H HZ   . PHE A 1 65 ? 2.073   -7.526  -10.297 1.00 3.41  ? 65 PHE A HZ   8  
ATOM   9084  N N    . LEU A 1 66 ? 7.681   -3.006  -9.147  1.00 4.92  ? 66 LEU A N    8  
ATOM   9085  C CA   . LEU A 1 66 ? 7.884   -2.080  -10.306 1.00 5.86  ? 66 LEU A CA   8  
ATOM   9086  C C    . LEU A 1 66 ? 9.364   -2.064  -10.709 1.00 6.61  ? 66 LEU A C    8  
ATOM   9087  O O    . LEU A 1 66 ? 9.699   -2.263  -11.861 1.00 7.33  ? 66 LEU A O    8  
ATOM   9088  C CB   . LEU A 1 66 ? 7.440   -0.667  -9.910  1.00 6.18  ? 66 LEU A CB   8  
ATOM   9089  C CG   . LEU A 1 66 ? 7.464   0.249   -11.139 1.00 7.14  ? 66 LEU A CG   8  
ATOM   9090  C CD1  . LEU A 1 66 ? 6.148   0.114   -11.910 1.00 7.61  ? 66 LEU A CD1  8  
ATOM   9091  C CD2  . LEU A 1 66 ? 7.643   1.701   -10.686 1.00 7.67  ? 66 LEU A CD2  8  
ATOM   9092  H H    . LEU A 1 66 ? 7.704   -2.654  -8.228  1.00 4.58  ? 66 LEU A H    8  
ATOM   9093  H HA   . LEU A 1 66 ? 7.290   -2.420  -11.142 1.00 6.03  ? 66 LEU A HA   8  
ATOM   9094  H HB2  . LEU A 1 66 ? 6.438   -0.705  -9.509  1.00 5.67  ? 66 LEU A HB2  8  
ATOM   9095  H HB3  . LEU A 1 66 ? 8.112   -0.277  -9.160  1.00 6.42  ? 66 LEU A HB3  8  
ATOM   9096  H HG   . LEU A 1 66 ? 8.287   -0.032  -11.781 1.00 7.39  ? 66 LEU A HG   8  
ATOM   9097  H HD11 . LEU A 1 66 ? 5.327   0.038   -11.213 1.00 7.49  ? 66 LEU A HD11 8  
ATOM   9098  H HD12 . LEU A 1 66 ? 6.008   0.982   -12.538 1.00 8.02  ? 66 LEU A HD12 8  
ATOM   9099  H HD13 . LEU A 1 66 ? 6.181   -0.774  -12.526 1.00 7.94  ? 66 LEU A HD13 8  
ATOM   9100  H HD21 . LEU A 1 66 ? 8.550   1.788   -10.107 1.00 7.84  ? 66 LEU A HD21 8  
ATOM   9101  H HD22 . LEU A 1 66 ? 7.706   2.343   -11.551 1.00 7.67  ? 66 LEU A HD22 8  
ATOM   9102  H HD23 . LEU A 1 66 ? 6.799   1.995   -10.079 1.00 8.14  ? 66 LEU A HD23 8  
ATOM   9103  N N    . LYS A 1 67 ? 10.245  -1.823  -9.762  1.00 6.57  ? 67 LYS A N    8  
ATOM   9104  C CA   . LYS A 1 67 ? 11.715  -1.784  -10.059 1.00 7.47  ? 67 LYS A CA   8  
ATOM   9105  C C    . LYS A 1 67 ? 12.035  -0.609  -11.003 1.00 7.85  ? 67 LYS A C    8  
ATOM   9106  O O    . LYS A 1 67 ? 12.951  -0.677  -11.803 1.00 8.14  ? 67 LYS A O    8  
ATOM   9107  C CB   . LYS A 1 67 ? 12.151  -3.112  -10.697 1.00 7.84  ? 67 LYS A CB   8  
ATOM   9108  C CG   . LYS A 1 67 ? 13.337  -3.690  -9.918  1.00 8.78  ? 67 LYS A CG   8  
ATOM   9109  C CD   . LYS A 1 67 ? 14.647  -3.115  -10.468 1.00 9.42  ? 67 LYS A CD   8  
ATOM   9110  C CE   . LYS A 1 67 ? 15.136  -1.982  -9.559  1.00 10.12 ? 67 LYS A CE   8  
ATOM   9111  N NZ   . LYS A 1 67 ? 16.411  -1.425  -10.097 1.00 10.40 ? 67 LYS A NZ   8  
ATOM   9112  H H    . LYS A 1 67 ? 9.937   -1.664  -8.846  1.00 6.04  ? 67 LYS A H    8  
ATOM   9113  H HA   . LYS A 1 67 ? 12.253  -1.643  -9.133  1.00 7.85  ? 67 LYS A HA   8  
ATOM   9114  H HB2  . LYS A 1 67 ? 11.328  -3.812  -10.668 1.00 7.78  ? 67 LYS A HB2  8  
ATOM   9115  H HB3  . LYS A 1 67 ? 12.444  -2.944  -11.723 1.00 7.75  ? 67 LYS A HB3  8  
ATOM   9116  H HG2  . LYS A 1 67 ? 13.241  -3.431  -8.873  1.00 9.30  ? 67 LYS A HG2  8  
ATOM   9117  H HG3  . LYS A 1 67 ? 13.347  -4.764  -10.023 1.00 8.71  ? 67 LYS A HG3  8  
ATOM   9118  H HD2  . LYS A 1 67 ? 15.394  -3.895  -10.503 1.00 9.58  ? 67 LYS A HD2  8  
ATOM   9119  H HD3  . LYS A 1 67 ? 14.482  -2.730  -11.463 1.00 9.47  ? 67 LYS A HD3  8  
ATOM   9120  H HE2  . LYS A 1 67 ? 14.390  -1.202  -9.523  1.00 10.35 ? 67 LYS A HE2  8  
ATOM   9121  H HE3  . LYS A 1 67 ? 15.302  -2.366  -8.564  1.00 10.41 ? 67 LYS A HE3  8  
ATOM   9122  H HZ1  . LYS A 1 67 ? 16.262  -1.092  -11.072 1.00 10.60 ? 67 LYS A HZ1  8  
ATOM   9123  H HZ2  . LYS A 1 67 ? 16.718  -0.628  -9.504  1.00 10.51 ? 67 LYS A HZ2  8  
ATOM   9124  H HZ3  . LYS A 1 67 ? 17.143  -2.164  -10.090 1.00 10.49 ? 67 LYS A HZ3  8  
ATOM   9125  N N    . ARG A 1 68 ? 11.292  0.469   -10.905 1.00 8.12  ? 68 ARG A N    8  
ATOM   9126  C CA   . ARG A 1 68 ? 11.549  1.655   -11.781 1.00 8.78  ? 68 ARG A CA   8  
ATOM   9127  C C    . ARG A 1 68 ? 11.310  2.942   -10.982 1.00 8.99  ? 68 ARG A C    8  
ATOM   9128  O O    . ARG A 1 68 ? 11.008  2.902   -9.802  1.00 8.81  ? 68 ARG A O    8  
ATOM   9129  C CB   . ARG A 1 68 ? 10.601  1.621   -12.986 1.00 9.33  ? 68 ARG A CB   8  
ATOM   9130  C CG   . ARG A 1 68 ? 11.268  0.885   -14.153 1.00 9.61  ? 68 ARG A CG   8  
ATOM   9131  C CD   . ARG A 1 68 ? 12.093  1.874   -14.982 1.00 10.05 ? 68 ARG A CD   8  
ATOM   9132  N NE   . ARG A 1 68 ? 11.197  2.617   -15.915 1.00 10.53 ? 68 ARG A NE   8  
ATOM   9133  C CZ   . ARG A 1 68 ? 11.685  3.153   -17.004 1.00 10.90 ? 68 ARG A CZ   8  
ATOM   9134  N NH1  . ARG A 1 68 ? 11.829  2.426   -18.082 1.00 11.35 ? 68 ARG A NH1  8  
ATOM   9135  N NH2  . ARG A 1 68 ? 12.027  4.416   -17.012 1.00 11.02 ? 68 ARG A NH2  8  
ATOM   9136  H H    . ARG A 1 68 ? 10.567  0.504   -10.247 1.00 8.08  ? 68 ARG A H    8  
ATOM   9137  H HA   . ARG A 1 68 ? 12.572  1.632   -12.126 1.00 9.01  ? 68 ARG A HA   8  
ATOM   9138  H HB2  . ARG A 1 68 ? 9.693   1.112   -12.711 1.00 9.69  ? 68 ARG A HB2  8  
ATOM   9139  H HB3  . ARG A 1 68 ? 10.368  2.631   -13.288 1.00 9.41  ? 68 ARG A HB3  8  
ATOM   9140  H HG2  . ARG A 1 68 ? 11.913  0.108   -13.769 1.00 9.48  ? 68 ARG A HG2  8  
ATOM   9141  H HG3  . ARG A 1 68 ? 10.507  0.442   -14.779 1.00 9.87  ? 68 ARG A HG3  8  
ATOM   9142  H HD2  . ARG A 1 68 ? 12.585  2.575   -14.323 1.00 10.14 ? 68 ARG A HD2  8  
ATOM   9143  H HD3  . ARG A 1 68 ? 12.836  1.334   -15.551 1.00 10.14 ? 68 ARG A HD3  8  
ATOM   9144  H HE   . ARG A 1 68 ? 10.242  2.705   -15.713 1.00 10.72 ? 68 ARG A HE   8  
ATOM   9145  H HH11 . ARG A 1 68 ? 11.566  1.461   -18.073 1.00 11.42 ? 68 ARG A HH11 8  
ATOM   9146  H HH12 . ARG A 1 68 ? 12.202  2.835   -18.915 1.00 11.76 ? 68 ARG A HH12 8  
ATOM   9147  H HH21 . ARG A 1 68 ? 11.916  4.971   -16.188 1.00 10.82 ? 68 ARG A HH21 8  
ATOM   9148  H HH22 . ARG A 1 68 ? 12.400  4.828   -17.845 1.00 11.44 ? 68 ARG A HH22 8  
ATOM   9149  N N    . ALA A 1 69 ? 11.445  4.082   -11.624 1.00 9.61  ? 69 ALA A N    8  
ATOM   9150  C CA   . ALA A 1 69 ? 11.234  5.398   -10.929 1.00 10.14 ? 69 ALA A CA   8  
ATOM   9151  C C    . ALA A 1 69 ? 12.260  5.573   -9.794  1.00 10.89 ? 69 ALA A C    8  
ATOM   9152  O O    . ALA A 1 69 ? 13.043  4.683   -9.517  1.00 11.20 ? 69 ALA A O    8  
ATOM   9153  C CB   . ALA A 1 69 ? 9.812   5.458   -10.355 1.00 10.08 ? 69 ALA A CB   8  
ATOM   9154  H H    . ALA A 1 69 ? 11.687  4.074   -12.574 1.00 9.89  ? 69 ALA A H    8  
ATOM   9155  H HA   . ALA A 1 69 ? 11.361  6.197   -11.644 1.00 10.27 ? 69 ALA A HA   8  
ATOM   9156  H HB1  . ALA A 1 69 ? 9.141   4.904   -10.995 1.00 10.12 ? 69 ALA A HB1  8  
ATOM   9157  H HB2  . ALA A 1 69 ? 9.803   5.028   -9.365  1.00 10.12 ? 69 ALA A HB2  8  
ATOM   9158  H HB3  . ALA A 1 69 ? 9.490   6.488   -10.303 1.00 10.18 ? 69 ALA A HB3  8  
ATOM   9159  N N    . GLU A 1 70 ? 12.254  6.724   -9.146  1.00 11.37 ? 70 GLU A N    8  
ATOM   9160  C CA   . GLU A 1 70 ? 13.215  7.012   -8.018  1.00 12.24 ? 70 GLU A CA   8  
ATOM   9161  C C    . GLU A 1 70 ? 14.653  6.597   -8.396  1.00 12.45 ? 70 GLU A C    8  
ATOM   9162  O O    . GLU A 1 70 ? 14.986  6.475   -9.562  1.00 12.32 ? 70 GLU A O    8  
ATOM   9163  C CB   . GLU A 1 70 ? 12.744  6.288   -6.736  1.00 12.79 ? 70 GLU A CB   8  
ATOM   9164  C CG   . GLU A 1 70 ? 13.077  4.789   -6.789  1.00 12.48 ? 70 GLU A CG   8  
ATOM   9165  C CD   . GLU A 1 70 ? 13.500  4.300   -5.400  1.00 13.18 ? 70 GLU A CD   8  
ATOM   9166  O OE1  . GLU A 1 70 ? 12.667  4.307   -4.506  1.00 13.39 ? 70 GLU A OE1  8  
ATOM   9167  O OE2  . GLU A 1 70 ? 14.652  3.923   -5.256  1.00 13.63 ? 70 GLU A OE2  8  
ATOM   9168  H H    . GLU A 1 70 ? 11.609  7.414   -9.406  1.00 11.26 ? 70 GLU A H    8  
ATOM   9169  H HA   . GLU A 1 70 ? 13.209  8.077   -7.832  1.00 12.53 ? 70 GLU A HA   8  
ATOM   9170  H HB2  . GLU A 1 70 ? 13.234  6.730   -5.881  1.00 13.03 ? 70 GLU A HB2  8  
ATOM   9171  H HB3  . GLU A 1 70 ? 11.676  6.409   -6.634  1.00 13.32 ? 70 GLU A HB3  8  
ATOM   9172  H HG2  . GLU A 1 70 ? 12.205  4.240   -7.114  1.00 12.20 ? 70 GLU A HG2  8  
ATOM   9173  H HG3  . GLU A 1 70 ? 13.885  4.621   -7.485  1.00 12.23 ? 70 GLU A HG3  8  
ATOM   9174  N N    . ASN A 1 71 ? 15.511  6.391   -7.421  1.00 12.96 ? 71 ASN A N    8  
ATOM   9175  C CA   . ASN A 1 71 ? 16.916  5.989   -7.731  1.00 13.39 ? 71 ASN A CA   8  
ATOM   9176  C C    . ASN A 1 71 ? 17.484  5.147   -6.580  1.00 13.77 ? 71 ASN A C    8  
ATOM   9177  O O    . ASN A 1 71 ? 17.941  4.038   -6.788  1.00 13.98 ? 71 ASN A O    8  
ATOM   9178  C CB   . ASN A 1 71 ? 17.778  7.240   -7.936  1.00 13.14 ? 71 ASN A CB   8  
ATOM   9179  C CG   . ASN A 1 71 ? 18.835  6.956   -9.006  1.00 12.70 ? 71 ASN A CG   8  
ATOM   9180  O OD1  . ASN A 1 71 ? 18.629  7.233   -10.171 1.00 12.77 ? 71 ASN A OD1  8  
ATOM   9181  N ND2  . ASN A 1 71 ? 19.969  6.407   -8.659  1.00 12.41 ? 71 ASN A ND2  8  
ATOM   9182  H H    . ASN A 1 71 ? 15.231  6.502   -6.489  1.00 13.17 ? 71 ASN A H    8  
ATOM   9183  H HA   . ASN A 1 71 ? 16.922  5.399   -8.636  1.00 13.80 ? 71 ASN A HA   8  
ATOM   9184  H HB2  . ASN A 1 71 ? 17.152  8.059   -8.258  1.00 13.36 ? 71 ASN A HB2  8  
ATOM   9185  H HB3  . ASN A 1 71 ? 18.266  7.501   -7.009  1.00 13.26 ? 71 ASN A HB3  8  
ATOM   9186  H HD21 . ASN A 1 71 ? 20.138  6.182   -7.721  1.00 12.47 ? 71 ASN A HD21 8  
ATOM   9187  H HD22 . ASN A 1 71 ? 20.649  6.218   -9.338  1.00 12.23 ? 71 ASN A HD22 8  
ATOM   9188  N N    . SER A 1 72 ? 17.459  5.661   -5.372  1.00 14.02 ? 72 SER A N    8  
ATOM   9189  C CA   . SER A 1 72 ? 17.998  4.889   -4.210  1.00 14.59 ? 72 SER A CA   8  
ATOM   9190  C C    . SER A 1 72 ? 16.870  4.606   -3.205  1.00 15.09 ? 72 SER A C    8  
ATOM   9191  O O    . SER A 1 72 ? 16.597  3.438   -2.972  1.00 15.38 ? 72 SER A O    8  
ATOM   9192  C CB   . SER A 1 72 ? 19.122  5.689   -3.535  1.00 14.66 ? 72 SER A CB   8  
ATOM   9193  O OG   . SER A 1 72 ? 18.651  6.987   -3.188  1.00 14.60 ? 72 SER A OG   8  
ATOM   9194  O OXT  . SER A 1 72 ? 16.293  5.558   -2.694  1.00 15.30 ? 72 SER A OXT  8  
ATOM   9195  H H    . SER A 1 72 ? 17.085  6.558   -5.229  1.00 13.94 ? 72 SER A H    8  
ATOM   9196  H HA   . SER A 1 72 ? 18.396  3.950   -4.563  1.00 14.77 ? 72 SER A HA   8  
ATOM   9197  H HB2  . SER A 1 72 ? 19.442  5.179   -2.641  1.00 14.69 ? 72 SER A HB2  8  
ATOM   9198  H HB3  . SER A 1 72 ? 19.959  5.770   -4.218  1.00 14.91 ? 72 SER A HB3  8  
ATOM   9199  H HG   . SER A 1 72 ? 19.204  7.325   -2.480  1.00 14.50 ? 72 SER A HG   8  
ATOM   9200  N N    . GLU A 1 4  ? -16.509 14.524  -0.947  1.00 9.58  ? 4  GLU A N    9  
ATOM   9201  C CA   . GLU A 1 4  ? -15.855 13.728  -2.030  1.00 9.09  ? 4  GLU A CA   9  
ATOM   9202  C C    . GLU A 1 4  ? -14.352 14.036  -2.064  1.00 8.06  ? 4  GLU A C    9  
ATOM   9203  O O    . GLU A 1 4  ? -13.931 15.151  -1.810  1.00 8.10  ? 4  GLU A O    9  
ATOM   9204  C CB   . GLU A 1 4  ? -16.488 14.072  -3.389  1.00 9.77  ? 4  GLU A CB   9  
ATOM   9205  C CG   . GLU A 1 4  ? -16.365 15.577  -3.668  1.00 10.24 ? 4  GLU A CG   9  
ATOM   9206  C CD   . GLU A 1 4  ? -16.935 15.891  -5.054  1.00 11.04 ? 4  GLU A CD   9  
ATOM   9207  O OE1  . GLU A 1 4  ? -18.125 16.147  -5.140  1.00 11.49 ? 4  GLU A OE1  9  
ATOM   9208  O OE2  . GLU A 1 4  ? -16.171 15.875  -6.006  1.00 11.36 ? 4  GLU A OE2  9  
ATOM   9209  H H    . GLU A 1 4  ? -16.216 15.519  -1.018  1.00 9.81  ? 4  GLU A H    9  
ATOM   9210  H HA   . GLU A 1 4  ? -15.997 12.676  -1.828  1.00 9.22  ? 4  GLU A HA   9  
ATOM   9211  H HB2  . GLU A 1 4  ? -15.981 13.520  -4.168  1.00 9.96  ? 4  GLU A HB2  9  
ATOM   9212  H HB3  . GLU A 1 4  ? -17.531 13.795  -3.377  1.00 9.97  ? 4  GLU A HB3  9  
ATOM   9213  H HG2  . GLU A 1 4  ? -16.916 16.127  -2.919  1.00 10.27 ? 4  GLU A HG2  9  
ATOM   9214  H HG3  . GLU A 1 4  ? -15.326 15.866  -3.635  1.00 10.19 ? 4  GLU A HG3  9  
ATOM   9215  N N    . LEU A 1 5  ? -13.539 13.053  -2.378  1.00 7.36  ? 5  LEU A N    9  
ATOM   9216  C CA   . LEU A 1 5  ? -12.061 13.283  -2.432  1.00 6.53  ? 5  LEU A CA   9  
ATOM   9217  C C    . LEU A 1 5  ? -11.416 12.356  -3.475  1.00 6.17  ? 5  LEU A C    9  
ATOM   9218  O O    . LEU A 1 5  ? -12.070 11.522  -4.077  1.00 6.61  ? 5  LEU A O    9  
ATOM   9219  C CB   . LEU A 1 5  ? -11.407 13.045  -1.047  1.00 6.34  ? 5  LEU A CB   9  
ATOM   9220  C CG   . LEU A 1 5  ? -12.004 11.827  -0.301  1.00 7.26  ? 5  LEU A CG   9  
ATOM   9221  C CD1  . LEU A 1 5  ? -13.395 12.165  0.247   1.00 7.60  ? 5  LEU A CD1  9  
ATOM   9222  C CD2  . LEU A 1 5  ? -12.099 10.612  -1.231  1.00 7.86  ? 5  LEU A CD2  9  
ATOM   9223  H H    . LEU A 1 5  ? -13.902 12.166  -2.582  1.00 7.57  ? 5  LEU A H    9  
ATOM   9224  H HA   . LEU A 1 5  ? -11.883 14.307  -2.728  1.00 6.63  ? 5  LEU A HA   9  
ATOM   9225  H HB2  . LEU A 1 5  ? -10.349 12.880  -1.185  1.00 5.88  ? 5  LEU A HB2  9  
ATOM   9226  H HB3  . LEU A 1 5  ? -11.543 13.928  -0.442  1.00 6.33  ? 5  LEU A HB3  9  
ATOM   9227  H HG   . LEU A 1 5  ? -11.357 11.583  0.531   1.00 7.52  ? 5  LEU A HG   9  
ATOM   9228  H HD11 . LEU A 1 5  ? -13.523 13.236  0.273   1.00 7.97  ? 5  LEU A HD11 9  
ATOM   9229  H HD12 . LEU A 1 5  ? -14.150 11.727  -0.390  1.00 8.07  ? 5  LEU A HD12 9  
ATOM   9230  H HD13 . LEU A 1 5  ? -13.494 11.767  1.246   1.00 7.24  ? 5  LEU A HD13 9  
ATOM   9231  H HD21 . LEU A 1 5  ? -11.223 10.571  -1.861  1.00 8.13  ? 5  LEU A HD21 9  
ATOM   9232  H HD22 . LEU A 1 5  ? -12.157 9.711   -0.639  1.00 8.35  ? 5  LEU A HD22 9  
ATOM   9233  H HD23 . LEU A 1 5  ? -12.982 10.694  -1.847  1.00 7.79  ? 5  LEU A HD23 9  
ATOM   9234  N N    . ARG A 1 6  ? -10.131 12.506  -3.688  1.00 5.61  ? 6  ARG A N    9  
ATOM   9235  C CA   . ARG A 1 6  ? -9.413  11.649  -4.685  1.00 5.48  ? 6  ARG A CA   9  
ATOM   9236  C C    . ARG A 1 6  ? -8.777  10.432  -4.000  1.00 4.69  ? 6  ARG A C    9  
ATOM   9237  O O    . ARG A 1 6  ? -8.395  9.480   -4.652  1.00 4.64  ? 6  ARG A O    9  
ATOM   9238  C CB   . ARG A 1 6  ? -8.318  12.469  -5.361  1.00 6.06  ? 6  ARG A CB   9  
ATOM   9239  C CG   . ARG A 1 6  ? -8.491  12.412  -6.881  1.00 6.84  ? 6  ARG A CG   9  
ATOM   9240  C CD   . ARG A 1 6  ? -7.129  12.595  -7.556  1.00 7.76  ? 6  ARG A CD   9  
ATOM   9241  N NE   . ARG A 1 6  ? -7.266  13.505  -8.730  1.00 8.57  ? 6  ARG A NE   9  
ATOM   9242  C CZ   . ARG A 1 6  ? -6.376  13.477  -9.687  1.00 9.27  ? 6  ARG A CZ   9  
ATOM   9243  N NH1  . ARG A 1 6  ? -5.237  14.106  -9.539  1.00 9.70  ? 6  ARG A NH1  9  
ATOM   9244  N NH2  . ARG A 1 6  ? -6.622  12.819  -10.790 1.00 9.77  ? 6  ARG A NH2  9  
ATOM   9245  H H    . ARG A 1 6  ? -9.638  13.188  -3.188  1.00 5.45  ? 6  ARG A H    9  
ATOM   9246  H HA   . ARG A 1 6  ? -10.109 11.316  -5.421  1.00 5.83  ? 6  ARG A HA   9  
ATOM   9247  H HB2  . ARG A 1 6  ? -8.389  13.488  -5.027  1.00 6.17  ? 6  ARG A HB2  9  
ATOM   9248  H HB3  . ARG A 1 6  ? -7.351  12.068  -5.095  1.00 6.11  ? 6  ARG A HB3  9  
ATOM   9249  H HG2  . ARG A 1 6  ? -8.905  11.453  -7.160  1.00 6.68  ? 6  ARG A HG2  9  
ATOM   9250  H HG3  . ARG A 1 6  ? -9.158  13.199  -7.198  1.00 7.20  ? 6  ARG A HG3  9  
ATOM   9251  H HD2  . ARG A 1 6  ? -6.432  13.023  -6.851  1.00 8.01  ? 6  ARG A HD2  9  
ATOM   9252  H HD3  . ARG A 1 6  ? -6.760  11.636  -7.886  1.00 7.82  ? 6  ARG A HD3  9  
ATOM   9253  H HE   . ARG A 1 6  ? -8.023  14.127  -8.785  1.00 8.74  ? 6  ARG A HE   9  
ATOM   9254  H HH11 . ARG A 1 6  ? -5.049  14.610  -8.695  1.00 9.50  ? 6  ARG A HH11 9  
ATOM   9255  H HH12 . ARG A 1 6  ? -4.554  14.084  -10.269 1.00 10.35 ? 6  ARG A HH12 9  
ATOM   9256  H HH21 . ARG A 1 6  ? -7.492  12.339  -10.903 1.00 9.63  ? 6  ARG A HH21 9  
ATOM   9257  H HH22 . ARG A 1 6  ? -5.940  12.796  -11.521 1.00 10.41 ? 6  ARG A HH22 9  
ATOM   9258  N N    . CYS A 1 7  ? -8.657  10.470  -2.696  1.00 4.47  ? 7  CYS A N    9  
ATOM   9259  C CA   . CYS A 1 7  ? -8.042  9.333   -1.940  1.00 4.05  ? 7  CYS A CA   9  
ATOM   9260  C C    . CYS A 1 7  ? -8.685  8.007   -2.350  1.00 4.38  ? 7  CYS A C    9  
ATOM   9261  O O    . CYS A 1 7  ? -7.998  7.088   -2.755  1.00 4.93  ? 7  CYS A O    9  
ATOM   9262  C CB   . CYS A 1 7  ? -8.233  9.545   -0.431  1.00 4.32  ? 7  CYS A CB   9  
ATOM   9263  S SG   . CYS A 1 7  ? -7.687  11.206  0.045   1.00 4.79  ? 7  CYS A SG   9  
ATOM   9264  H H    . CYS A 1 7  ? -8.968  11.256  -2.214  1.00 4.87  ? 7  CYS A H    9  
ATOM   9265  H HA   . CYS A 1 7  ? -6.991  9.285   -2.156  1.00 3.89  ? 7  CYS A HA   9  
ATOM   9266  H HB2  . CYS A 1 7  ? -9.275  9.429   -0.177  1.00 4.81  ? 7  CYS A HB2  9  
ATOM   9267  H HB3  . CYS A 1 7  ? -7.653  8.816   0.104   1.00 4.30  ? 7  CYS A HB3  9  
ATOM   9268  N N    . GLN A 1 8  ? -9.991  7.904   -2.235  1.00 4.51  ? 8  GLN A N    9  
ATOM   9269  C CA   . GLN A 1 8  ? -10.721 6.645   -2.600  1.00 5.30  ? 8  GLN A CA   9  
ATOM   9270  C C    . GLN A 1 8  ? -10.454 5.527   -1.563  1.00 5.47  ? 8  GLN A C    9  
ATOM   9271  O O    . GLN A 1 8  ? -11.233 4.599   -1.448  1.00 6.21  ? 8  GLN A O    9  
ATOM   9272  C CB   . GLN A 1 8  ? -10.291 6.188   -4.000  1.00 5.63  ? 8  GLN A CB   9  
ATOM   9273  C CG   . GLN A 1 8  ? -11.113 4.968   -4.437  1.00 6.22  ? 8  GLN A CG   9  
ATOM   9274  C CD   . GLN A 1 8  ? -11.626 5.177   -5.866  1.00 7.21  ? 8  GLN A CD   9  
ATOM   9275  O OE1  . GLN A 1 8  ? -10.850 5.226   -6.801  1.00 7.78  ? 8  GLN A OE1  9  
ATOM   9276  N NE2  . GLN A 1 8  ? -12.909 5.301   -6.078  1.00 7.68  ? 8  GLN A NE2  9  
ATOM   9277  H H    . GLN A 1 8  ? -10.498 8.661   -1.905  1.00 4.40  ? 8  GLN A H    9  
ATOM   9278  H HA   . GLN A 1 8  ? -11.780 6.855   -2.614  1.00 5.87  ? 8  GLN A HA   9  
ATOM   9279  H HB2  . GLN A 1 8  ? -10.448 6.995   -4.702  1.00 5.62  ? 8  GLN A HB2  9  
ATOM   9280  H HB3  . GLN A 1 8  ? -9.248  5.931   -3.982  1.00 5.89  ? 8  GLN A HB3  9  
ATOM   9281  H HG2  . GLN A 1 8  ? -10.490 4.086   -4.403  1.00 6.11  ? 8  GLN A HG2  9  
ATOM   9282  H HG3  . GLN A 1 8  ? -11.952 4.840   -3.771  1.00 6.39  ? 8  GLN A HG3  9  
ATOM   9283  H HE21 . GLN A 1 8  ? -13.537 5.261   -5.327  1.00 7.43  ? 8  GLN A HE21 9  
ATOM   9284  H HE22 . GLN A 1 8  ? -13.244 5.435   -6.989  1.00 8.44  ? 8  GLN A HE22 9  
ATOM   9285  N N    . CYS A 1 9  ? -9.373  5.600   -0.807  1.00 5.04  ? 9  CYS A N    9  
ATOM   9286  C CA   . CYS A 1 9  ? -9.088  4.540   0.202   1.00 5.45  ? 9  CYS A CA   9  
ATOM   9287  C C    . CYS A 1 9  ? -9.075  5.156   1.604   1.00 5.99  ? 9  CYS A C    9  
ATOM   9288  O O    . CYS A 1 9  ? -8.181  5.906   1.956   1.00 6.13  ? 9  CYS A O    9  
ATOM   9289  C CB   . CYS A 1 9  ? -7.722  3.923   -0.093  1.00 5.08  ? 9  CYS A CB   9  
ATOM   9290  S SG   . CYS A 1 9  ? -7.918  2.539   -1.241  1.00 5.12  ? 9  CYS A SG   9  
ATOM   9291  H H    . CYS A 1 9  ? -8.751  6.348   -0.902  1.00 4.65  ? 9  CYS A H    9  
ATOM   9292  H HA   . CYS A 1 9  ? -9.847  3.774   0.154   1.00 5.89  ? 9  CYS A HA   9  
ATOM   9293  H HB2  . CYS A 1 9  ? -7.079  4.669   -0.533  1.00 4.67  ? 9  CYS A HB2  9  
ATOM   9294  H HB3  . CYS A 1 9  ? -7.283  3.572   0.826   1.00 5.54  ? 9  CYS A HB3  9  
ATOM   9295  N N    . ILE A 1 10 ? -10.056 4.831   2.409   1.00 6.61  ? 10 ILE A N    9  
ATOM   9296  C CA   . ILE A 1 10 ? -10.108 5.378   3.801   1.00 7.44  ? 10 ILE A CA   9  
ATOM   9297  C C    . ILE A 1 10 ? -9.230  4.512   4.720   1.00 7.48  ? 10 ILE A C    9  
ATOM   9298  O O    . ILE A 1 10 ? -8.725  4.979   5.724   1.00 8.16  ? 10 ILE A O    9  
ATOM   9299  C CB   . ILE A 1 10 ? -11.558 5.363   4.311   1.00 8.38  ? 10 ILE A CB   9  
ATOM   9300  C CG1  . ILE A 1 10 ? -12.438 6.219   3.388   1.00 8.63  ? 10 ILE A CG1  9  
ATOM   9301  C CG2  . ILE A 1 10 ? -11.614 5.932   5.732   1.00 9.31  ? 10 ILE A CG2  9  
ATOM   9302  C CD1  . ILE A 1 10 ? -13.421 5.319   2.637   1.00 9.47  ? 10 ILE A CD1  9  
ATOM   9303  H H    . ILE A 1 10 ? -10.756 4.217   2.101   1.00 6.69  ? 10 ILE A H    9  
ATOM   9304  H HA   . ILE A 1 10 ? -9.736  6.393   3.803   1.00 7.59  ? 10 ILE A HA   9  
ATOM   9305  H HB   . ILE A 1 10 ? -11.924 4.347   4.317   1.00 8.40  ? 10 ILE A HB   9  
ATOM   9306  H HG12 . ILE A 1 10 ? -12.987 6.938   3.980   1.00 8.91  ? 10 ILE A HG12 9  
ATOM   9307  H HG13 . ILE A 1 10 ? -11.814 6.740   2.677   1.00 8.14  ? 10 ILE A HG13 9  
ATOM   9308  H HG21 . ILE A 1 10 ? -10.991 6.813   5.794   1.00 9.27  ? 10 ILE A HG21 9  
ATOM   9309  H HG22 . ILE A 1 10 ? -12.632 6.193   5.978   1.00 9.78  ? 10 ILE A HG22 9  
ATOM   9310  H HG23 . ILE A 1 10 ? -11.256 5.189   6.431   1.00 9.72  ? 10 ILE A HG23 9  
ATOM   9311  H HD11 . ILE A 1 10 ? -13.047 4.306   2.625   1.00 9.66  ? 10 ILE A HD11 9  
ATOM   9312  H HD12 . ILE A 1 10 ? -14.380 5.342   3.133   1.00 9.77  ? 10 ILE A HD12 9  
ATOM   9313  H HD13 . ILE A 1 10 ? -13.532 5.674   1.623   1.00 9.76  ? 10 ILE A HD13 9  
ATOM   9314  N N    . LYS A 1 11 ? -9.046  3.255   4.379   1.00 6.93  ? 11 LYS A N    9  
ATOM   9315  C CA   . LYS A 1 11 ? -8.203  2.353   5.224   1.00 7.15  ? 11 LYS A CA   9  
ATOM   9316  C C    . LYS A 1 11 ? -7.123  1.710   4.350   1.00 6.42  ? 11 LYS A C    9  
ATOM   9317  O O    . LYS A 1 11 ? -7.398  1.232   3.264   1.00 6.35  ? 11 LYS A O    9  
ATOM   9318  C CB   . LYS A 1 11 ? -9.080  1.253   5.833   1.00 8.05  ? 11 LYS A CB   9  
ATOM   9319  C CG   . LYS A 1 11 ? -10.026 1.855   6.877   1.00 8.65  ? 11 LYS A CG   9  
ATOM   9320  C CD   . LYS A 1 11 ? -11.270 0.972   7.004   1.00 9.04  ? 11 LYS A CD   9  
ATOM   9321  C CE   . LYS A 1 11 ? -12.073 1.384   8.241   1.00 9.50  ? 11 LYS A CE   9  
ATOM   9322  N NZ   . LYS A 1 11 ? -13.488 0.936   8.090   1.00 9.69  ? 11 LYS A NZ   9  
ATOM   9323  H H    . LYS A 1 11 ? -9.461  2.905   3.560   1.00 6.52  ? 11 LYS A H    9  
ATOM   9324  H HA   . LYS A 1 11 ? -7.738  2.924   6.013   1.00 7.36  ? 11 LYS A HA   9  
ATOM   9325  H HB2  . LYS A 1 11 ? -9.660  0.783   5.052   1.00 8.15  ? 11 LYS A HB2  9  
ATOM   9326  H HB3  . LYS A 1 11 ? -8.451  0.514   6.306   1.00 8.38  ? 11 LYS A HB3  9  
ATOM   9327  H HG2  . LYS A 1 11 ? -9.521  1.908   7.831   1.00 9.16  ? 11 LYS A HG2  9  
ATOM   9328  H HG3  . LYS A 1 11 ? -10.320 2.847   6.569   1.00 8.50  ? 11 LYS A HG3  9  
ATOM   9329  H HD2  . LYS A 1 11 ? -11.884 1.088   6.122   1.00 9.00  ? 11 LYS A HD2  9  
ATOM   9330  H HD3  . LYS A 1 11 ? -10.971 -0.061  7.100   1.00 9.26  ? 11 LYS A HD3  9  
ATOM   9331  H HE2  . LYS A 1 11 ? -11.643 0.925   9.118   1.00 9.79  ? 11 LYS A HE2  9  
ATOM   9332  H HE3  . LYS A 1 11 ? -12.046 2.459   8.347   1.00 9.62  ? 11 LYS A HE3  9  
ATOM   9333  H HZ1  . LYS A 1 11 ? -13.511 -0.086  7.900   1.00 9.96  ? 11 LYS A HZ1  9  
ATOM   9334  H HZ2  . LYS A 1 11 ? -14.011 1.139   8.965   1.00 9.86  ? 11 LYS A HZ2  9  
ATOM   9335  H HZ3  . LYS A 1 11 ? -13.930 1.443   7.297   1.00 9.61  ? 11 LYS A HZ3  9  
ATOM   9336  N N    . THR A 1 12 ? -5.897  1.689   4.813   1.00 6.02  ? 12 THR A N    9  
ATOM   9337  C CA   . THR A 1 12 ? -4.802  1.071   4.004   1.00 5.35  ? 12 THR A CA   9  
ATOM   9338  C C    . THR A 1 12 ? -4.456  -0.316  4.542   1.00 5.31  ? 12 THR A C    9  
ATOM   9339  O O    . THR A 1 12 ? -5.185  -0.896  5.329   1.00 5.80  ? 12 THR A O    9  
ATOM   9340  C CB   . THR A 1 12 ? -3.549  1.954   4.018   1.00 5.23  ? 12 THR A CB   9  
ATOM   9341  O OG1  . THR A 1 12 ? -3.593  2.867   5.109   1.00 5.90  ? 12 THR A OG1  9  
ATOM   9342  C CG2  . THR A 1 12 ? -3.470  2.714   2.701   1.00 5.32  ? 12 THR A CG2  9  
ATOM   9343  H H    . THR A 1 12 ? -5.697  2.076   5.692   1.00 6.26  ? 12 THR A H    9  
ATOM   9344  H HA   . THR A 1 12 ? -5.139  0.967   2.985   1.00 5.27  ? 12 THR A HA   9  
ATOM   9345  H HB   . THR A 1 12 ? -2.674  1.327   4.110   1.00 4.85  ? 12 THR A HB   9  
ATOM   9346  H HG1  . THR A 1 12 ? -2.745  2.836   5.558   1.00 6.31  ? 12 THR A HG1  9  
ATOM   9347  H HG21 . THR A 1 12 ? -3.419  2.006   1.886   1.00 5.52  ? 12 THR A HG21 9  
ATOM   9348  H HG22 . THR A 1 12 ? -4.347  3.330   2.589   1.00 5.48  ? 12 THR A HG22 9  
ATOM   9349  H HG23 . THR A 1 12 ? -2.587  3.333   2.697   1.00 5.41  ? 12 THR A HG23 9  
ATOM   9350  N N    . TYR A 1 13 ? -3.356  -0.860  4.091   1.00 4.96  ? 13 TYR A N    9  
ATOM   9351  C CA   . TYR A 1 13 ? -2.943  -2.216  4.520   1.00 5.03  ? 13 TYR A CA   9  
ATOM   9352  C C    . TYR A 1 13 ? -1.634  -2.138  5.309   1.00 5.08  ? 13 TYR A C    9  
ATOM   9353  O O    . TYR A 1 13 ? -0.570  -1.933  4.751   1.00 4.67  ? 13 TYR A O    9  
ATOM   9354  C CB   . TYR A 1 13 ? -2.750  -3.078  3.268   1.00 4.85  ? 13 TYR A CB   9  
ATOM   9355  C CG   . TYR A 1 13 ? -2.858  -4.539  3.609   1.00 5.22  ? 13 TYR A CG   9  
ATOM   9356  C CD1  . TYR A 1 13 ? -3.730  -4.970  4.613   1.00 5.75  ? 13 TYR A CD1  9  
ATOM   9357  C CD2  . TYR A 1 13 ? -2.075  -5.461  2.913   1.00 5.34  ? 13 TYR A CD2  9  
ATOM   9358  C CE1  . TYR A 1 13 ? -3.820  -6.331  4.924   1.00 6.30  ? 13 TYR A CE1  9  
ATOM   9359  C CE2  . TYR A 1 13 ? -2.160  -6.824  3.221   1.00 5.79  ? 13 TYR A CE2  9  
ATOM   9360  C CZ   . TYR A 1 13 ? -3.033  -7.260  4.228   1.00 6.23  ? 13 TYR A CZ   9  
ATOM   9361  O OH   . TYR A 1 13 ? -3.119  -8.603  4.535   1.00 6.84  ? 13 TYR A OH   9  
ATOM   9362  H H    . TYR A 1 13 ? -2.808  -0.375  3.438   1.00 4.82  ? 13 TYR A H    9  
ATOM   9363  H HA   . TYR A 1 13 ? -3.712  -2.648  5.140   1.00 5.34  ? 13 TYR A HA   9  
ATOM   9364  H HB2  . TYR A 1 13 ? -3.507  -2.827  2.540   1.00 4.90  ? 13 TYR A HB2  9  
ATOM   9365  H HB3  . TYR A 1 13 ? -1.774  -2.885  2.848   1.00 4.67  ? 13 TYR A HB3  9  
ATOM   9366  H HD1  . TYR A 1 13 ? -4.338  -4.247  5.143   1.00 5.92  ? 13 TYR A HD1  9  
ATOM   9367  H HD2  . TYR A 1 13 ? -1.405  -5.115  2.135   1.00 5.30  ? 13 TYR A HD2  9  
ATOM   9368  H HE1  . TYR A 1 13 ? -4.491  -6.666  5.701   1.00 6.92  ? 13 TYR A HE1  9  
ATOM   9369  H HE2  . TYR A 1 13 ? -1.555  -7.539  2.683   1.00 5.99  ? 13 TYR A HE2  9  
ATOM   9370  H HH   . TYR A 1 13 ? -3.772  -9.001  3.953   1.00 7.17  ? 13 TYR A HH   9  
ATOM   9371  N N    . SER A 1 14 ? -1.705  -2.318  6.606   1.00 5.82  ? 14 SER A N    9  
ATOM   9372  C CA   . SER A 1 14 ? -0.468  -2.280  7.442   1.00 6.06  ? 14 SER A CA   9  
ATOM   9373  C C    . SER A 1 14 ? 0.202   -3.659  7.406   1.00 6.51  ? 14 SER A C    9  
ATOM   9374  O O    . SER A 1 14 ? 1.408   -3.769  7.523   1.00 6.88  ? 14 SER A O    9  
ATOM   9375  C CB   . SER A 1 14 ? -0.829  -1.917  8.885   1.00 6.42  ? 14 SER A CB   9  
ATOM   9376  O OG   . SER A 1 14 ? 0.336   -1.447  9.555   1.00 6.80  ? 14 SER A OG   9  
ATOM   9377  H H    . SER A 1 14 ? -2.574  -2.494  7.026   1.00 6.33  ? 14 SER A H    9  
ATOM   9378  H HA   . SER A 1 14 ? 0.214   -1.542  7.043   1.00 5.81  ? 14 SER A HA   9  
ATOM   9379  H HB2  . SER A 1 14 ? -1.577  -1.142  8.888   1.00 6.57  ? 14 SER A HB2  9  
ATOM   9380  H HB3  . SER A 1 14 ? -1.218  -2.792  9.390   1.00 6.52  ? 14 SER A HB3  9  
ATOM   9381  H HG   . SER A 1 14 ? 0.120   -1.339  10.483  1.00 7.03  ? 14 SER A HG   9  
ATOM   9382  N N    . LYS A 1 15 ? -0.568  -4.709  7.223   1.00 6.59  ? 15 LYS A N    9  
ATOM   9383  C CA   . LYS A 1 15 ? 0.031   -6.075  7.159   1.00 7.06  ? 15 LYS A CA   9  
ATOM   9384  C C    . LYS A 1 15 ? 0.698   -6.242  5.788   1.00 6.32  ? 15 LYS A C    9  
ATOM   9385  O O    . LYS A 1 15 ? 0.133   -5.862  4.782   1.00 6.13  ? 15 LYS A O    9  
ATOM   9386  C CB   . LYS A 1 15 ? -1.023  -7.185  7.326   1.00 7.75  ? 15 LYS A CB   9  
ATOM   9387  C CG   . LYS A 1 15 ? -2.347  -6.653  7.901   1.00 8.64  ? 15 LYS A CG   9  
ATOM   9388  C CD   . LYS A 1 15 ? -2.135  -6.169  9.340   1.00 9.43  ? 15 LYS A CD   9  
ATOM   9389  C CE   . LYS A 1 15 ? -3.038  -4.963  9.618   1.00 10.20 ? 15 LYS A CE   9  
ATOM   9390  N NZ   . LYS A 1 15 ? -4.405  -5.433  9.989   1.00 10.59 ? 15 LYS A NZ   9  
ATOM   9391  H H    . LYS A 1 15 ? -1.530  -4.592  7.115   1.00 6.42  ? 15 LYS A H    9  
ATOM   9392  H HA   . LYS A 1 15 ? 0.778   -6.170  7.934   1.00 7.57  ? 15 LYS A HA   9  
ATOM   9393  H HB2  . LYS A 1 15 ? -1.207  -7.633  6.366   1.00 7.79  ? 15 LYS A HB2  9  
ATOM   9394  H HB3  . LYS A 1 15 ? -0.632  -7.937  7.987   1.00 7.79  ? 15 LYS A HB3  9  
ATOM   9395  H HG2  . LYS A 1 15 ? -2.706  -5.839  7.292   1.00 8.72  ? 15 LYS A HG2  9  
ATOM   9396  H HG3  . LYS A 1 15 ? -3.078  -7.447  7.900   1.00 8.87  ? 15 LYS A HG3  9  
ATOM   9397  H HD2  . LYS A 1 15 ? -2.378  -6.967  10.027  1.00 9.71  ? 15 LYS A HD2  9  
ATOM   9398  H HD3  . LYS A 1 15 ? -1.102  -5.882  9.477   1.00 9.38  ? 15 LYS A HD3  9  
ATOM   9399  H HE2  . LYS A 1 15 ? -2.625  -4.385  10.432  1.00 10.54 ? 15 LYS A HE2  9  
ATOM   9400  H HE3  . LYS A 1 15 ? -3.097  -4.346  8.734   1.00 10.33 ? 15 LYS A HE3  9  
ATOM   9401  H HZ1  . LYS A 1 15 ? -4.338  -6.116  10.772  1.00 10.91 ? 15 LYS A HZ1  9  
ATOM   9402  H HZ2  . LYS A 1 15 ? -4.983  -4.622  10.285  1.00 10.22 ? 15 LYS A HZ2  9  
ATOM   9403  H HZ3  . LYS A 1 15 ? -4.851  -5.891  9.167   1.00 11.09 ? 15 LYS A HZ3  9  
ATOM   9404  N N    . PRO A 1 16 ? 1.884   -6.791  5.791   1.00 6.02  ? 16 PRO A N    9  
ATOM   9405  C CA   . PRO A 1 16 ? 2.666   -7.008  4.564   1.00 5.35  ? 16 PRO A CA   9  
ATOM   9406  C C    . PRO A 1 16 ? 2.225   -8.289  3.851   1.00 5.50  ? 16 PRO A C    9  
ATOM   9407  O O    . PRO A 1 16 ? 1.646   -9.178  4.448   1.00 6.37  ? 16 PRO A O    9  
ATOM   9408  C CB   . PRO A 1 16 ? 4.098   -7.129  5.079   1.00 5.39  ? 16 PRO A CB   9  
ATOM   9409  C CG   . PRO A 1 16 ? 4.001   -7.546  6.569   1.00 6.26  ? 16 PRO A CG   9  
ATOM   9410  C CD   . PRO A 1 16 ? 2.559   -7.246  7.020   1.00 6.51  ? 16 PRO A CD   9  
ATOM   9411  H HA   . PRO A 1 16 ? 2.585   -6.160  3.905   1.00 4.92  ? 16 PRO A HA   9  
ATOM   9412  H HB2  . PRO A 1 16 ? 4.630   -7.874  4.515   1.00 5.32  ? 16 PRO A HB2  9  
ATOM   9413  H HB3  . PRO A 1 16 ? 4.598   -6.183  4.998   1.00 5.10  ? 16 PRO A HB3  9  
ATOM   9414  H HG2  . PRO A 1 16 ? 4.212   -8.602  6.671   1.00 6.77  ? 16 PRO A HG2  9  
ATOM   9415  H HG3  . PRO A 1 16 ? 4.695   -6.970  7.161   1.00 6.37  ? 16 PRO A HG3  9  
ATOM   9416  H HD2  . PRO A 1 16 ? 2.090   -8.144  7.399   1.00 7.06  ? 16 PRO A HD2  9  
ATOM   9417  H HD3  . PRO A 1 16 ? 2.538   -6.468  7.762   1.00 6.63  ? 16 PRO A HD3  9  
ATOM   9418  N N    . PHE A 1 17 ? 2.503   -8.383  2.574   1.00 4.76  ? 17 PHE A N    9  
ATOM   9419  C CA   . PHE A 1 17 ? 2.111   -9.606  1.803   1.00 4.96  ? 17 PHE A CA   9  
ATOM   9420  C C    . PHE A 1 17 ? 2.954   -9.715  0.523   1.00 4.78  ? 17 PHE A C    9  
ATOM   9421  O O    . PHE A 1 17 ? 3.518   -8.742  0.053   1.00 4.77  ? 17 PHE A O    9  
ATOM   9422  C CB   . PHE A 1 17 ? 0.606   -9.560  1.466   1.00 4.69  ? 17 PHE A CB   9  
ATOM   9423  C CG   . PHE A 1 17 ? 0.315   -8.571  0.352   1.00 3.72  ? 17 PHE A CG   9  
ATOM   9424  C CD1  . PHE A 1 17 ? 0.367   -7.192  0.597   1.00 3.29  ? 17 PHE A CD1  9  
ATOM   9425  C CD2  . PHE A 1 17 ? -0.026  -9.042  -0.922  1.00 3.74  ? 17 PHE A CD2  9  
ATOM   9426  C CE1  . PHE A 1 17 ? 0.080   -6.288  -0.435  1.00 2.59  ? 17 PHE A CE1  9  
ATOM   9427  C CE2  . PHE A 1 17 ? -0.311  -8.138  -1.952  1.00 3.14  ? 17 PHE A CE2  9  
ATOM   9428  C CZ   . PHE A 1 17 ? -0.258  -6.761  -1.708  1.00 2.38  ? 17 PHE A CZ   9  
ATOM   9429  H H    . PHE A 1 17 ? 2.976   -7.650  2.125   1.00 4.19  ? 17 PHE A H    9  
ATOM   9430  H HA   . PHE A 1 17 ? 2.303   -10.476 2.415   1.00 5.66  ? 17 PHE A HA   9  
ATOM   9431  H HB2  . PHE A 1 17 ? 0.285   -10.541 1.155   1.00 5.13  ? 17 PHE A HB2  9  
ATOM   9432  H HB3  . PHE A 1 17 ? 0.054   -9.271  2.349   1.00 5.06  ? 17 PHE A HB3  9  
ATOM   9433  H HD1  . PHE A 1 17 ? 0.628   -6.826  1.578   1.00 3.86  ? 17 PHE A HD1  9  
ATOM   9434  H HD2  . PHE A 1 17 ? -0.068  -10.104 -1.112  1.00 4.51  ? 17 PHE A HD2  9  
ATOM   9435  H HE1  . PHE A 1 17 ? 0.119   -5.225  -0.248  1.00 2.72  ? 17 PHE A HE1  9  
ATOM   9436  H HE2  . PHE A 1 17 ? -0.571  -8.502  -2.935  1.00 3.62  ? 17 PHE A HE2  9  
ATOM   9437  H HZ   . PHE A 1 17 ? -0.481  -6.065  -2.502  1.00 2.18  ? 17 PHE A HZ   9  
ATOM   9438  N N    . HIS A 1 18 ? 3.051   -10.902 -0.033  1.00 4.92  ? 18 HIS A N    9  
ATOM   9439  C CA   . HIS A 1 18 ? 3.862   -11.107 -1.271  1.00 5.06  ? 18 HIS A CA   9  
ATOM   9440  C C    . HIS A 1 18 ? 3.205   -10.360 -2.461  1.00 4.32  ? 18 HIS A C    9  
ATOM   9441  O O    . HIS A 1 18 ? 1.997   -10.344 -2.590  1.00 4.10  ? 18 HIS A O    9  
ATOM   9442  C CB   . HIS A 1 18 ? 3.986   -12.612 -1.509  1.00 5.95  ? 18 HIS A CB   9  
ATOM   9443  C CG   . HIS A 1 18 ? 4.517   -12.862 -2.872  1.00 6.25  ? 18 HIS A CG   9  
ATOM   9444  N ND1  . HIS A 1 18 ? 5.870   -12.969 -3.154  1.00 6.36  ? 18 HIS A ND1  9  
ATOM   9445  C CD2  . HIS A 1 18 ? 3.874   -13.009 -4.048  1.00 6.72  ? 18 HIS A CD2  9  
ATOM   9446  C CE1  . HIS A 1 18 ? 5.979   -13.172 -4.478  1.00 6.81  ? 18 HIS A CE1  9  
ATOM   9447  N NE2  . HIS A 1 18 ? 4.789   -13.211 -5.061  1.00 7.07  ? 18 HIS A NE2  9  
ATOM   9448  H H    . HIS A 1 18 ? 2.590   -11.669 0.374   1.00 5.11  ? 18 HIS A H    9  
ATOM   9449  H HA   . HIS A 1 18 ? 4.843   -10.704 -1.121  1.00 5.21  ? 18 HIS A HA   9  
ATOM   9450  H HB2  . HIS A 1 18 ? 4.659   -13.036 -0.779  1.00 6.63  ? 18 HIS A HB2  9  
ATOM   9451  H HB3  . HIS A 1 18 ? 3.017   -13.070 -1.411  1.00 5.84  ? 18 HIS A HB3  9  
ATOM   9452  H HD1  . HIS A 1 18 ? 6.607   -12.910 -2.510  1.00 6.36  ? 18 HIS A HD1  9  
ATOM   9453  H HD2  . HIS A 1 18 ? 2.815   -12.920 -4.171  1.00 7.00  ? 18 HIS A HD2  9  
ATOM   9454  H HE1  . HIS A 1 18 ? 6.909   -13.242 -5.013  1.00 7.12  ? 18 HIS A HE1  9  
ATOM   9455  N N    . PRO A 1 19 ? 4.041   -9.704  -3.252  1.00 4.16  ? 19 PRO A N    9  
ATOM   9456  C CA   . PRO A 1 19 ? 3.603   -8.857  -4.396  1.00 3.77  ? 19 PRO A CA   9  
ATOM   9457  C C    . PRO A 1 19 ? 3.184   -9.622  -5.661  1.00 4.27  ? 19 PRO A C    9  
ATOM   9458  O O    . PRO A 1 19 ? 2.241   -9.226  -6.314  1.00 4.32  ? 19 PRO A O    9  
ATOM   9459  C CB   . PRO A 1 19 ? 4.839   -8.009  -4.701  1.00 3.96  ? 19 PRO A CB   9  
ATOM   9460  C CG   . PRO A 1 19 ? 6.053   -8.785  -4.147  1.00 4.62  ? 19 PRO A CG   9  
ATOM   9461  C CD   . PRO A 1 19 ? 5.510   -9.748  -3.077  1.00 4.65  ? 19 PRO A CD   9  
ATOM   9462  H HA   . PRO A 1 19 ? 2.810   -8.208  -4.086  1.00 3.26  ? 19 PRO A HA   9  
ATOM   9463  H HB2  . PRO A 1 19 ? 4.938   -7.873  -5.768  1.00 4.26  ? 19 PRO A HB2  9  
ATOM   9464  H HB3  . PRO A 1 19 ? 4.762   -7.054  -4.211  1.00 3.57  ? 19 PRO A HB3  9  
ATOM   9465  H HG2  . PRO A 1 19 ? 6.526   -9.343  -4.945  1.00 5.23  ? 19 PRO A HG2  9  
ATOM   9466  H HG3  . PRO A 1 19 ? 6.758   -8.103  -3.702  1.00 4.63  ? 19 PRO A HG3  9  
ATOM   9467  H HD2  . PRO A 1 19 ? 5.883   -10.745 -3.248  1.00 5.29  ? 19 PRO A HD2  9  
ATOM   9468  H HD3  . PRO A 1 19 ? 5.776   -9.407  -2.090  1.00 4.56  ? 19 PRO A HD3  9  
ATOM   9469  N N    . LYS A 1 20 ? 3.886   -10.662 -6.052  1.00 4.91  ? 20 LYS A N    9  
ATOM   9470  C CA   . LYS A 1 20 ? 3.513   -11.383 -7.323  1.00 5.52  ? 20 LYS A CA   9  
ATOM   9471  C C    . LYS A 1 20 ? 2.011   -11.732 -7.349  1.00 5.00  ? 20 LYS A C    9  
ATOM   9472  O O    . LYS A 1 20 ? 1.422   -11.819 -8.411  1.00 5.39  ? 20 LYS A O    9  
ATOM   9473  C CB   . LYS A 1 20 ? 4.347   -12.644 -7.511  1.00 6.44  ? 20 LYS A CB   9  
ATOM   9474  C CG   . LYS A 1 20 ? 4.408   -13.008 -8.998  1.00 7.16  ? 20 LYS A CG   9  
ATOM   9475  C CD   . LYS A 1 20 ? 5.753   -13.668 -9.314  1.00 7.91  ? 20 LYS A CD   9  
ATOM   9476  C CE   . LYS A 1 20 ? 5.713   -15.143 -8.899  1.00 8.41  ? 20 LYS A CE   9  
ATOM   9477  N NZ   . LYS A 1 20 ? 6.464   -15.328 -7.623  1.00 8.95  ? 20 LYS A NZ   9  
ATOM   9478  H H    . LYS A 1 20 ? 4.669   -10.941 -5.537  1.00 5.13  ? 20 LYS A H    9  
ATOM   9479  H HA   . LYS A 1 20 ? 3.719   -10.731 -8.143  1.00 5.87  ? 20 LYS A HA   9  
ATOM   9480  H HB2  . LYS A 1 20 ? 5.347   -12.473 -7.141  1.00 6.91  ? 20 LYS A HB2  9  
ATOM   9481  H HB3  . LYS A 1 20 ? 3.896   -13.445 -6.969  1.00 6.29  ? 20 LYS A HB3  9  
ATOM   9482  H HG2  . LYS A 1 20 ? 3.606   -13.693 -9.234  1.00 7.23  ? 20 LYS A HG2  9  
ATOM   9483  H HG3  . LYS A 1 20 ? 4.302   -12.112 -9.593  1.00 7.28  ? 20 LYS A HG3  9  
ATOM   9484  H HD2  . LYS A 1 20 ? 5.948   -13.598 -10.374 1.00 8.14  ? 20 LYS A HD2  9  
ATOM   9485  H HD3  . LYS A 1 20 ? 6.539   -13.165 -8.769  1.00 8.11  ? 20 LYS A HD3  9  
ATOM   9486  H HE2  . LYS A 1 20 ? 4.687   -15.451 -8.760  1.00 8.28  ? 20 LYS A HE2  9  
ATOM   9487  H HE3  . LYS A 1 20 ? 6.165   -15.746 -9.673  1.00 8.75  ? 20 LYS A HE3  9  
ATOM   9488  H HZ1  . LYS A 1 20 ? 7.432   -14.964 -7.734  1.00 9.15  ? 20 LYS A HZ1  9  
ATOM   9489  H HZ2  . LYS A 1 20 ? 5.984   -14.813 -6.859  1.00 9.17  ? 20 LYS A HZ2  9  
ATOM   9490  H HZ3  . LYS A 1 20 ? 6.498   -16.340 -7.386  1.00 9.13  ? 20 LYS A HZ3  9  
ATOM   9491  N N    . PHE A 1 21 ? 1.375   -11.892 -6.203  1.00 4.37  ? 21 PHE A N    9  
ATOM   9492  C CA   . PHE A 1 21 ? -0.092  -12.184 -6.192  1.00 4.15  ? 21 PHE A CA   9  
ATOM   9493  C C    . PHE A 1 21 ? -0.822  -11.011 -6.862  1.00 3.56  ? 21 PHE A C    9  
ATOM   9494  O O    . PHE A 1 21 ? -1.779  -11.192 -7.590  1.00 3.88  ? 21 PHE A O    9  
ATOM   9495  C CB   . PHE A 1 21 ? -0.604  -12.303 -4.759  1.00 4.02  ? 21 PHE A CB   9  
ATOM   9496  C CG   . PHE A 1 21 ? 0.187   -13.316 -3.953  1.00 4.64  ? 21 PHE A CG   9  
ATOM   9497  C CD1  . PHE A 1 21 ? 0.761   -14.436 -4.570  1.00 5.11  ? 21 PHE A CD1  9  
ATOM   9498  C CD2  . PHE A 1 21 ? 0.331   -13.129 -2.573  1.00 5.12  ? 21 PHE A CD2  9  
ATOM   9499  C CE1  . PHE A 1 21 ? 1.479   -15.363 -3.804  1.00 5.85  ? 21 PHE A CE1  9  
ATOM   9500  C CE2  . PHE A 1 21 ? 1.046   -14.056 -1.809  1.00 5.85  ? 21 PHE A CE2  9  
ATOM   9501  C CZ   . PHE A 1 21 ? 1.621   -15.173 -2.425  1.00 6.13  ? 21 PHE A CZ   9  
ATOM   9502  H H    . PHE A 1 21 ? 1.851   -11.789 -5.357  1.00 4.29  ? 21 PHE A H    9  
ATOM   9503  H HA   . PHE A 1 21 ? -0.292  -13.088 -6.720  1.00 4.82  ? 21 PHE A HA   9  
ATOM   9504  H HB2  . PHE A 1 21 ? -0.524  -11.347 -4.293  1.00 3.48  ? 21 PHE A HB2  9  
ATOM   9505  H HB3  . PHE A 1 21 ? -1.636  -12.598 -4.780  1.00 4.37  ? 21 PHE A HB3  9  
ATOM   9506  H HD1  . PHE A 1 21 ? 0.652   -14.584 -5.634  1.00 5.17  ? 21 PHE A HD1  9  
ATOM   9507  H HD2  . PHE A 1 21 ? -0.111  -12.265 -2.097  1.00 5.18  ? 21 PHE A HD2  9  
ATOM   9508  H HE1  . PHE A 1 21 ? 1.924   -16.224 -4.277  1.00 6.40  ? 21 PHE A HE1  9  
ATOM   9509  H HE2  . PHE A 1 21 ? 1.156   -13.908 -0.743  1.00 6.40  ? 21 PHE A HE2  9  
ATOM   9510  H HZ   . PHE A 1 21 ? 2.173   -15.890 -1.834  1.00 6.79  ? 21 PHE A HZ   9  
ATOM   9511  N N    . ILE A 1 22 ? -0.353  -9.811  -6.606  1.00 2.94  ? 22 ILE A N    9  
ATOM   9512  C CA   . ILE A 1 22 ? -0.962  -8.580  -7.195  1.00 2.62  ? 22 ILE A CA   9  
ATOM   9513  C C    . ILE A 1 22 ? -0.950  -8.663  -8.723  1.00 3.41  ? 22 ILE A C    9  
ATOM   9514  O O    . ILE A 1 22 ? 0.094   -8.759  -9.343  1.00 4.13  ? 22 ILE A O    9  
ATOM   9515  C CB   . ILE A 1 22 ? -0.143  -7.357  -6.750  1.00 2.18  ? 22 ILE A CB   9  
ATOM   9516  C CG1  . ILE A 1 22 ? -0.189  -7.228  -5.222  1.00 2.00  ? 22 ILE A CG1  9  
ATOM   9517  C CG2  . ILE A 1 22 ? -0.716  -6.087  -7.381  1.00 2.53  ? 22 ILE A CG2  9  
ATOM   9518  C CD1  . ILE A 1 22 ? 1.033   -6.443  -4.740  1.00 2.47  ? 22 ILE A CD1  9  
ATOM   9519  H H    . ILE A 1 22 ? 0.423   -9.720  -6.014  1.00 2.94  ? 22 ILE A H    9  
ATOM   9520  H HA   . ILE A 1 22 ? -1.981  -8.473  -6.852  1.00 2.63  ? 22 ILE A HA   9  
ATOM   9521  H HB   . ILE A 1 22 ? 0.881   -7.480  -7.069  1.00 2.49  ? 22 ILE A HB   9  
ATOM   9522  H HG12 . ILE A 1 22 ? -1.091  -6.710  -4.931  1.00 2.23  ? 22 ILE A HG12 9  
ATOM   9523  H HG13 . ILE A 1 22 ? -0.180  -8.211  -4.778  1.00 2.28  ? 22 ILE A HG13 9  
ATOM   9524  H HG21 . ILE A 1 22 ? -1.780  -6.198  -7.506  1.00 2.71  ? 22 ILE A HG21 9  
ATOM   9525  H HG22 . ILE A 1 22 ? -0.514  -5.244  -6.738  1.00 2.80  ? 22 ILE A HG22 9  
ATOM   9526  H HG23 . ILE A 1 22 ? -0.254  -5.925  -8.343  1.00 3.07  ? 22 ILE A HG23 9  
ATOM   9527  H HD11 . ILE A 1 22 ? 1.844   -6.567  -5.442  1.00 2.73  ? 22 ILE A HD11 9  
ATOM   9528  H HD12 . ILE A 1 22 ? 0.781   -5.396  -4.664  1.00 2.88  ? 22 ILE A HD12 9  
ATOM   9529  H HD13 . ILE A 1 22 ? 1.338   -6.810  -3.771  1.00 2.84  ? 22 ILE A HD13 9  
ATOM   9530  N N    . LYS A 1 23 ? -2.108  -8.600  -9.328  1.00 3.62  ? 23 LYS A N    9  
ATOM   9531  C CA   . LYS A 1 23 ? -2.188  -8.640  -10.816 1.00 4.61  ? 23 LYS A CA   9  
ATOM   9532  C C    . LYS A 1 23 ? -1.904  -7.234  -11.364 1.00 5.00  ? 23 LYS A C    9  
ATOM   9533  O O    . LYS A 1 23 ? -1.410  -7.081  -12.466 1.00 5.88  ? 23 LYS A O    9  
ATOM   9534  C CB   . LYS A 1 23 ? -3.594  -9.086  -11.242 1.00 5.10  ? 23 LYS A CB   9  
ATOM   9535  C CG   . LYS A 1 23 ? -3.596  -9.456  -12.729 1.00 5.85  ? 23 LYS A CG   9  
ATOM   9536  C CD   . LYS A 1 23 ? -3.216  -10.930 -12.896 1.00 6.35  ? 23 LYS A CD   9  
ATOM   9537  C CE   . LYS A 1 23 ? -4.486  -11.783 -12.978 1.00 6.93  ? 23 LYS A CE   9  
ATOM   9538  N NZ   . LYS A 1 23 ? -4.183  -13.068 -13.673 1.00 7.72  ? 23 LYS A NZ   9  
ATOM   9539  H H    . LYS A 1 23 ? -2.928  -8.504  -8.800  1.00 3.33  ? 23 LYS A H    9  
ATOM   9540  H HA   . LYS A 1 23 ? -1.454  -9.336  -11.200 1.00 4.98  ? 23 LYS A HA   9  
ATOM   9541  H HB2  . LYS A 1 23 ? -3.891  -9.945  -10.657 1.00 4.92  ? 23 LYS A HB2  9  
ATOM   9542  H HB3  . LYS A 1 23 ? -4.292  -8.280  -11.074 1.00 5.36  ? 23 LYS A HB3  9  
ATOM   9543  H HG2  . LYS A 1 23 ? -4.581  -9.288  -13.140 1.00 6.02  ? 23 LYS A HG2  9  
ATOM   9544  H HG3  . LYS A 1 23 ? -2.880  -8.841  -13.255 1.00 6.22  ? 23 LYS A HG3  9  
ATOM   9545  H HD2  . LYS A 1 23 ? -2.641  -11.053 -13.801 1.00 6.70  ? 23 LYS A HD2  9  
ATOM   9546  H HD3  . LYS A 1 23 ? -2.627  -11.248 -12.049 1.00 6.30  ? 23 LYS A HD3  9  
ATOM   9547  H HE2  . LYS A 1 23 ? -4.846  -11.990 -11.981 1.00 6.98  ? 23 LYS A HE2  9  
ATOM   9548  H HE3  . LYS A 1 23 ? -5.245  -11.247 -13.530 1.00 7.01  ? 23 LYS A HE3  9  
ATOM   9549  H HZ1  . LYS A 1 23 ? -3.355  -13.515 -13.231 1.00 7.80  ? 23 LYS A HZ1  9  
ATOM   9550  H HZ2  . LYS A 1 23 ? -5.003  -13.703 -13.596 1.00 7.78  ? 23 LYS A HZ2  9  
ATOM   9551  H HZ3  . LYS A 1 23 ? -3.980  -12.881 -14.676 1.00 8.36  ? 23 LYS A HZ3  9  
ATOM   9552  N N    . GLU A 1 24 ? -2.210  -6.207  -10.596 1.00 4.51  ? 24 GLU A N    9  
ATOM   9553  C CA   . GLU A 1 24 ? -1.960  -4.806  -11.059 1.00 5.13  ? 24 GLU A CA   9  
ATOM   9554  C C    . GLU A 1 24 ? -1.686  -3.906  -9.843  1.00 4.55  ? 24 GLU A C    9  
ATOM   9555  O O    . GLU A 1 24 ? -2.528  -3.759  -8.976  1.00 4.65  ? 24 GLU A O    9  
ATOM   9556  C CB   . GLU A 1 24 ? -3.192  -4.288  -11.810 1.00 5.78  ? 24 GLU A CB   9  
ATOM   9557  C CG   . GLU A 1 24 ? -3.121  -4.723  -13.278 1.00 6.35  ? 24 GLU A CG   9  
ATOM   9558  C CD   . GLU A 1 24 ? -3.957  -3.772  -14.139 1.00 7.36  ? 24 GLU A CD   9  
ATOM   9559  O OE1  . GLU A 1 24 ? -5.134  -4.042  -14.313 1.00 7.92  ? 24 GLU A OE1  9  
ATOM   9560  O OE2  . GLU A 1 24 ? -3.405  -2.792  -14.612 1.00 7.77  ? 24 GLU A OE2  9  
ATOM   9561  H H    . GLU A 1 24 ? -2.603  -6.362  -9.707  1.00 3.86  ? 24 GLU A H    9  
ATOM   9562  H HA   . GLU A 1 24 ? -1.105  -4.794  -11.718 1.00 5.74  ? 24 GLU A HA   9  
ATOM   9563  H HB2  . GLU A 1 24 ? -4.086  -4.692  -11.357 1.00 5.66  ? 24 GLU A HB2  9  
ATOM   9564  H HB3  . GLU A 1 24 ? -3.219  -3.209  -11.758 1.00 6.21  ? 24 GLU A HB3  9  
ATOM   9565  H HG2  . GLU A 1 24 ? -2.093  -4.700  -13.610 1.00 6.22  ? 24 GLU A HG2  9  
ATOM   9566  H HG3  . GLU A 1 24 ? -3.508  -5.727  -13.374 1.00 6.40  ? 24 GLU A HG3  9  
HETATM 9567  N N    . MLE A 1 25 ? -0.516  -3.306  -9.768  1.00 4.25  ? 25 MLE A N    9  
HETATM 9568  C CN   . MLE A 1 25 ? 0.026   -2.731  -11.043 1.00 5.13  ? 25 MLE A CN   9  
HETATM 9569  C CA   . MLE A 1 25 ? -0.195  -2.421  -8.594  1.00 3.66  ? 25 MLE A CA   9  
HETATM 9570  C CB   . MLE A 1 25 ? 1.182   -2.800  -8.025  1.00 3.52  ? 25 MLE A CB   9  
HETATM 9571  C CG   . MLE A 1 25 ? 1.706   -1.674  -7.118  1.00 3.28  ? 25 MLE A CG   9  
HETATM 9572  C CD1  . MLE A 1 25 ? 2.240   -2.266  -5.815  1.00 2.93  ? 25 MLE A CD1  9  
HETATM 9573  C CD2  . MLE A 1 25 ? 2.833   -0.917  -7.834  1.00 3.54  ? 25 MLE A CD2  9  
HETATM 9574  C C    . MLE A 1 25 ? -0.182  -0.951  -9.036  1.00 4.19  ? 25 MLE A C    9  
HETATM 9575  O O    . MLE A 1 25 ? 0.747   -0.496  -9.681  1.00 4.87  ? 25 MLE A O    9  
HETATM 9576  H HN1  . MLE A 1 25 ? -0.602  -1.909  -11.360 1.00 5.47  ? 25 MLE A HN1  9  
HETATM 9577  H HN2  . MLE A 1 25 ? 1.030   -2.367  -10.874 1.00 5.48  ? 25 MLE A HN2  9  
HETATM 9578  H HN3  . MLE A 1 25 ? 0.041   -3.488  -11.807 1.00 5.42  ? 25 MLE A HN3  9  
HETATM 9579  H HA   . MLE A 1 25 ? -0.947  -2.557  -7.830  1.00 3.20  ? 25 MLE A HA   9  
HETATM 9580  H HB2  . MLE A 1 25 ? 1.093   -3.712  -7.452  1.00 3.37  ? 25 MLE A HB2  9  
HETATM 9581  H HB3  . MLE A 1 25 ? 1.875   -2.956  -8.838  1.00 4.08  ? 25 MLE A HB3  9  
HETATM 9582  H HG   . MLE A 1 25 ? 0.900   -0.990  -6.894  1.00 3.59  ? 25 MLE A HG   9  
HETATM 9583  H HD11 . MLE A 1 25 ? 1.982   -3.312  -5.762  1.00 3.14  ? 25 MLE A HD11 9  
HETATM 9584  H HD12 . MLE A 1 25 ? 3.313   -2.156  -5.783  1.00 2.79  ? 25 MLE A HD12 9  
HETATM 9585  H HD13 . MLE A 1 25 ? 1.800   -1.743  -4.978  1.00 3.21  ? 25 MLE A HD13 9  
HETATM 9586  H HD21 . MLE A 1 25 ? 3.026   -1.380  -8.792  1.00 3.70  ? 25 MLE A HD21 9  
HETATM 9587  H HD22 . MLE A 1 25 ? 2.537   0.110   -7.986  1.00 3.89  ? 25 MLE A HD22 9  
HETATM 9588  H HD23 . MLE A 1 25 ? 3.729   -0.949  -7.232  1.00 3.75  ? 25 MLE A HD23 9  
ATOM   9589  N N    . ARG A 1 26 ? -1.196  -0.202  -8.698  1.00 4.14  ? 26 ARG A N    9  
ATOM   9590  C CA   . ARG A 1 26 ? -1.209  1.225   -9.111  1.00 4.79  ? 26 ARG A CA   9  
ATOM   9591  C C    . ARG A 1 26 ? -1.311  2.125   -7.874  1.00 4.70  ? 26 ARG A C    9  
ATOM   9592  O O    . ARG A 1 26 ? -2.221  1.996   -7.078  1.00 4.97  ? 26 ARG A O    9  
ATOM   9593  C CB   . ARG A 1 26 ? -2.388  1.486   -10.039 1.00 5.59  ? 26 ARG A CB   9  
ATOM   9594  C CG   . ARG A 1 26 ? -1.876  1.939   -11.408 1.00 5.99  ? 26 ARG A CG   9  
ATOM   9595  C CD   . ARG A 1 26 ? -3.035  2.527   -12.219 1.00 6.35  ? 26 ARG A CD   9  
ATOM   9596  N NE   . ARG A 1 26 ? -2.508  3.126   -13.479 1.00 7.16  ? 26 ARG A NE   9  
ATOM   9597  C CZ   . ARG A 1 26 ? -2.915  2.675   -14.637 1.00 7.92  ? 26 ARG A CZ   9  
ATOM   9598  N NH1  . ARG A 1 26 ? -2.345  1.622   -15.165 1.00 8.52  ? 26 ARG A NH1  9  
ATOM   9599  N NH2  . ARG A 1 26 ? -3.893  3.277   -15.265 1.00 8.32  ? 26 ARG A NH2  9  
ATOM   9600  H H    . ARG A 1 26 ? -1.940  -0.576  -8.179  1.00 3.85  ? 26 ARG A H    9  
ATOM   9601  H HA   . ARG A 1 26 ? -0.297  1.430   -9.637  1.00 5.07  ? 26 ARG A HA   9  
ATOM   9602  H HB2  . ARG A 1 26 ? -2.958  0.580   -10.149 1.00 5.95  ? 26 ARG A HB2  9  
ATOM   9603  H HB3  . ARG A 1 26 ? -3.006  2.256   -9.615  1.00 5.91  ? 26 ARG A HB3  9  
ATOM   9604  H HG2  . ARG A 1 26 ? -1.111  2.690   -11.276 1.00 6.27  ? 26 ARG A HG2  9  
ATOM   9605  H HG3  . ARG A 1 26 ? -1.462  1.093   -11.936 1.00 6.12  ? 26 ARG A HG3  9  
ATOM   9606  H HD2  . ARG A 1 26 ? -3.739  1.743   -12.459 1.00 6.26  ? 26 ARG A HD2  9  
ATOM   9607  H HD3  . ARG A 1 26 ? -3.532  3.290   -11.637 1.00 6.38  ? 26 ARG A HD3  9  
ATOM   9608  H HE   . ARG A 1 26 ? -1.858  3.858   -13.439 1.00 7.28  ? 26 ARG A HE   9  
ATOM   9609  H HH11 . ARG A 1 26 ? -1.598  1.163   -14.683 1.00 8.41  ? 26 ARG A HH11 9  
ATOM   9610  H HH12 . ARG A 1 26 ? -2.655  1.275   -16.051 1.00 9.21  ? 26 ARG A HH12 9  
ATOM   9611  H HH21 . ARG A 1 26 ? -4.329  4.081   -14.860 1.00 8.08  ? 26 ARG A HH21 9  
ATOM   9612  H HH22 . ARG A 1 26 ? -4.207  2.934   -16.151 1.00 9.02  ? 26 ARG A HH22 9  
ATOM   9613  N N    . VAL A 1 27 ? -0.380  3.033   -7.707  1.00 4.69  ? 27 VAL A N    9  
ATOM   9614  C CA   . VAL A 1 27 ? -0.408  3.942   -6.525  1.00 4.83  ? 27 VAL A CA   9  
ATOM   9615  C C    . VAL A 1 27 ? -0.918  5.329   -6.942  1.00 4.79  ? 27 VAL A C    9  
ATOM   9616  O O    . VAL A 1 27 ? -0.694  5.773   -8.054  1.00 5.45  ? 27 VAL A O    9  
ATOM   9617  C CB   . VAL A 1 27 ? 1.011   4.061   -5.954  1.00 5.66  ? 27 VAL A CB   9  
ATOM   9618  C CG1  . VAL A 1 27 ? 1.525   2.676   -5.558  1.00 6.10  ? 27 VAL A CG1  9  
ATOM   9619  C CG2  . VAL A 1 27 ? 1.959   4.671   -6.997  1.00 6.04  ? 27 VAL A CG2  9  
ATOM   9620  H H    . VAL A 1 27 ? 0.345   3.116   -8.356  1.00 4.82  ? 27 VAL A H    9  
ATOM   9621  H HA   . VAL A 1 27 ? -1.062  3.531   -5.771  1.00 4.74  ? 27 VAL A HA   9  
ATOM   9622  H HB   . VAL A 1 27 ? 0.985   4.691   -5.085  1.00 5.89  ? 27 VAL A HB   9  
ATOM   9623  H HG11 . VAL A 1 27 ? 0.762   2.158   -4.999  1.00 6.30  ? 27 VAL A HG11 9  
ATOM   9624  H HG12 . VAL A 1 27 ? 1.764   2.112   -6.448  1.00 6.06  ? 27 VAL A HG12 9  
ATOM   9625  H HG13 . VAL A 1 27 ? 2.411   2.779   -4.949  1.00 6.54  ? 27 VAL A HG13 9  
ATOM   9626  H HG21 . VAL A 1 27 ? 1.555   5.609   -7.348  1.00 6.18  ? 27 VAL A HG21 9  
ATOM   9627  H HG22 . VAL A 1 27 ? 2.926   4.843   -6.546  1.00 6.05  ? 27 VAL A HG22 9  
ATOM   9628  H HG23 . VAL A 1 27 ? 2.067   3.991   -7.829  1.00 6.44  ? 27 VAL A HG23 9  
ATOM   9629  N N    . ILE A 1 28 ? -1.588  6.024   -6.050  1.00 4.28  ? 28 ILE A N    9  
ATOM   9630  C CA   . ILE A 1 28 ? -2.093  7.389   -6.388  1.00 4.40  ? 28 ILE A CA   9  
ATOM   9631  C C    . ILE A 1 28 ? -1.158  8.423   -5.754  1.00 4.70  ? 28 ILE A C    9  
ATOM   9632  O O    . ILE A 1 28 ? -0.806  8.318   -4.593  1.00 5.01  ? 28 ILE A O    9  
ATOM   9633  C CB   . ILE A 1 28 ? -3.521  7.572   -5.851  1.00 4.45  ? 28 ILE A CB   9  
ATOM   9634  C CG1  . ILE A 1 28 ? -4.459  6.577   -6.551  1.00 4.94  ? 28 ILE A CG1  9  
ATOM   9635  C CG2  . ILE A 1 28 ? -3.997  9.004   -6.133  1.00 4.49  ? 28 ILE A CG2  9  
ATOM   9636  C CD1  . ILE A 1 28 ? -5.875  6.707   -5.981  1.00 5.05  ? 28 ILE A CD1  9  
ATOM   9637  H H    . ILE A 1 28 ? -1.745  5.653   -5.152  1.00 4.02  ? 28 ILE A H    9  
ATOM   9638  H HA   . ILE A 1 28 ? -2.091  7.519   -7.461  1.00 4.67  ? 28 ILE A HA   9  
ATOM   9639  H HB   . ILE A 1 28 ? -3.531  7.394   -4.786  1.00 4.56  ? 28 ILE A HB   9  
ATOM   9640  H HG12 . ILE A 1 28 ? -4.477  6.786   -7.610  1.00 5.21  ? 28 ILE A HG12 9  
ATOM   9641  H HG13 . ILE A 1 28 ? -4.100  5.571   -6.388  1.00 5.36  ? 28 ILE A HG13 9  
ATOM   9642  H HG21 . ILE A 1 28 ? -3.949  9.197   -7.195  1.00 4.77  ? 28 ILE A HG21 9  
ATOM   9643  H HG22 . ILE A 1 28 ? -5.016  9.119   -5.793  1.00 4.49  ? 28 ILE A HG22 9  
ATOM   9644  H HG23 . ILE A 1 28 ? -3.362  9.704   -5.612  1.00 4.51  ? 28 ILE A HG23 9  
ATOM   9645  H HD11 . ILE A 1 28 ? -5.842  6.610   -4.905  1.00 4.88  ? 28 ILE A HD11 9  
ATOM   9646  H HD12 . ILE A 1 28 ? -6.281  7.673   -6.243  1.00 5.25  ? 28 ILE A HD12 9  
ATOM   9647  H HD13 . ILE A 1 28 ? -6.501  5.931   -6.393  1.00 5.49  ? 28 ILE A HD13 9  
ATOM   9648  N N    . GLU A 1 29 ? -0.746  9.412   -6.512  1.00 5.08  ? 29 GLU A N    9  
ATOM   9649  C CA   . GLU A 1 29 ? 0.180   10.451  -5.969  1.00 5.75  ? 29 GLU A CA   9  
ATOM   9650  C C    . GLU A 1 29 ? -0.501  11.263  -4.861  1.00 5.30  ? 29 GLU A C    9  
ATOM   9651  O O    . GLU A 1 29 ? -1.689  11.141  -4.617  1.00 4.95  ? 29 GLU A O    9  
ATOM   9652  C CB   . GLU A 1 29 ? 0.618   11.398  -7.093  1.00 6.63  ? 29 GLU A CB   9  
ATOM   9653  C CG   . GLU A 1 29 ? -0.603  11.936  -7.852  1.00 7.40  ? 29 GLU A CG   9  
ATOM   9654  C CD   . GLU A 1 29 ? -0.612  11.379  -9.280  1.00 8.35  ? 29 GLU A CD   9  
ATOM   9655  O OE1  . GLU A 1 29 ? 0.106   11.913  -10.109 1.00 8.53  ? 29 GLU A OE1  9  
ATOM   9656  O OE2  . GLU A 1 29 ? -1.338  10.427  -9.518  1.00 9.09  ? 29 GLU A OE2  9  
ATOM   9657  H H    . GLU A 1 29 ? -1.038  9.465   -7.444  1.00 5.18  ? 29 GLU A H    9  
ATOM   9658  H HA   . GLU A 1 29 ? 1.053   9.965   -5.560  1.00 6.26  ? 29 GLU A HA   9  
ATOM   9659  H HB2  . GLU A 1 29 ? 1.161   12.223  -6.667  1.00 6.65  ? 29 GLU A HB2  9  
ATOM   9660  H HB3  . GLU A 1 29 ? 1.260   10.867  -7.774  1.00 7.00  ? 29 GLU A HB3  9  
ATOM   9661  H HG2  . GLU A 1 29 ? -1.506  11.635  -7.342  1.00 7.70  ? 29 GLU A HG2  9  
ATOM   9662  H HG3  . GLU A 1 29 ? -0.555  13.014  -7.891  1.00 7.27  ? 29 GLU A HG3  9  
ATOM   9663  N N    . SER A 1 30 ? 0.257   12.094  -4.195  1.00 5.67  ? 30 SER A N    9  
ATOM   9664  C CA   . SER A 1 30 ? -0.311  12.932  -3.097  1.00 5.68  ? 30 SER A CA   9  
ATOM   9665  C C    . SER A 1 30 ? -0.556  14.356  -3.608  1.00 6.20  ? 30 SER A C    9  
ATOM   9666  O O    . SER A 1 30 ? -0.041  14.759  -4.637  1.00 6.77  ? 30 SER A O    9  
ATOM   9667  C CB   . SER A 1 30 ? 0.666   12.971  -1.917  1.00 6.35  ? 30 SER A CB   9  
ATOM   9668  O OG   . SER A 1 30 ? 2.006   12.896  -2.392  1.00 7.18  ? 30 SER A OG   9  
ATOM   9669  H H    . SER A 1 30 ? 1.208   12.170  -4.421  1.00 6.18  ? 30 SER A H    9  
ATOM   9670  H HA   . SER A 1 30 ? -1.248  12.506  -2.771  1.00 5.24  ? 30 SER A HA   9  
ATOM   9671  H HB2  . SER A 1 30 ? 0.538   13.891  -1.376  1.00 6.58  ? 30 SER A HB2  9  
ATOM   9672  H HB3  . SER A 1 30 ? 0.461   12.139  -1.256  1.00 6.28  ? 30 SER A HB3  9  
ATOM   9673  H HG   . SER A 1 30 ? 2.503   12.336  -1.793  1.00 7.41  ? 30 SER A HG   9  
ATOM   9674  N N    . GLY A 1 31 ? -1.343  15.116  -2.891  1.00 6.36  ? 31 GLY A N    9  
ATOM   9675  C CA   . GLY A 1 31 ? -1.644  16.518  -3.312  1.00 7.19  ? 31 GLY A CA   9  
ATOM   9676  C C    . GLY A 1 31 ? -2.631  17.138  -2.313  1.00 7.66  ? 31 GLY A C    9  
ATOM   9677  O O    . GLY A 1 31 ? -2.647  16.764  -1.156  1.00 7.75  ? 31 GLY A O    9  
ATOM   9678  H H    . GLY A 1 31 ? -1.743  14.759  -2.070  1.00 6.14  ? 31 GLY A H    9  
ATOM   9679  H HA2  . GLY A 1 31 ? -0.733  17.091  -3.337  1.00 7.72  ? 31 GLY A HA2  9  
ATOM   9680  H HA3  . GLY A 1 31 ? -2.090  16.510  -4.294  1.00 7.17  ? 31 GLY A HA3  9  
ATOM   9681  N N    . PRO A 1 32 ? -3.449  18.047  -2.795  1.00 8.17  ? 32 PRO A N    9  
ATOM   9682  C CA   . PRO A 1 32 ? -4.479  18.700  -1.962  1.00 8.85  ? 32 PRO A CA   9  
ATOM   9683  C C    . PRO A 1 32 ? -5.627  17.708  -1.716  1.00 8.11  ? 32 PRO A C    9  
ATOM   9684  O O    . PRO A 1 32 ? -6.242  17.697  -0.665  1.00 8.52  ? 32 PRO A O    9  
ATOM   9685  C CB   . PRO A 1 32 ? -4.926  19.896  -2.810  1.00 9.69  ? 32 PRO A CB   9  
ATOM   9686  C CG   . PRO A 1 32 ? -4.553  19.556  -4.273  1.00 9.20  ? 32 PRO A CG   9  
ATOM   9687  C CD   . PRO A 1 32 ? -3.429  18.503  -4.203  1.00 8.39  ? 32 PRO A CD   9  
ATOM   9688  H HA   . PRO A 1 32 ? -4.058  19.040  -1.030  1.00 9.45  ? 32 PRO A HA   9  
ATOM   9689  H HB2  . PRO A 1 32 ? -5.996  20.034  -2.719  1.00 9.88  ? 32 PRO A HB2  9  
ATOM   9690  H HB3  . PRO A 1 32 ? -4.406  20.788  -2.500  1.00 10.56 ? 32 PRO A HB3  9  
ATOM   9691  H HG2  . PRO A 1 32 ? -5.412  19.152  -4.790  1.00 8.80  ? 32 PRO A HG2  9  
ATOM   9692  H HG3  . PRO A 1 32 ? -4.194  20.438  -4.780  1.00 10.01 ? 32 PRO A HG3  9  
ATOM   9693  H HD2  . PRO A 1 32 ? -3.641  17.681  -4.874  1.00 7.63  ? 32 PRO A HD2  9  
ATOM   9694  H HD3  . PRO A 1 32 ? -2.476  18.950  -4.437  1.00 8.96  ? 32 PRO A HD3  9  
ATOM   9695  N N    . HIS A 1 33 ? -5.891  16.865  -2.687  1.00 7.21  ? 33 HIS A N    9  
ATOM   9696  C CA   . HIS A 1 33 ? -6.969  15.831  -2.565  1.00 6.64  ? 33 HIS A CA   9  
ATOM   9697  C C    . HIS A 1 33 ? -6.652  14.868  -1.409  1.00 5.94  ? 33 HIS A C    9  
ATOM   9698  O O    . HIS A 1 33 ? -7.541  14.421  -0.708  1.00 6.05  ? 33 HIS A O    9  
ATOM   9699  C CB   . HIS A 1 33 ? -7.059  15.011  -3.868  1.00 6.27  ? 33 HIS A CB   9  
ATOM   9700  C CG   . HIS A 1 33 ? -5.701  14.447  -4.226  1.00 5.79  ? 33 HIS A CG   9  
ATOM   9701  N ND1  . HIS A 1 33 ? -4.720  15.200  -4.856  1.00 6.54  ? 33 HIS A ND1  9  
ATOM   9702  C CD2  . HIS A 1 33 ? -5.133  13.220  -3.989  1.00 4.91  ? 33 HIS A CD2  9  
ATOM   9703  C CE1  . HIS A 1 33 ? -3.622  14.432  -4.964  1.00 6.20  ? 33 HIS A CE1  9  
ATOM   9704  N NE2  . HIS A 1 33 ? -3.820  13.212  -4.455  1.00 5.23  ? 33 HIS A NE2  9  
ATOM   9705  H H    . HIS A 1 33 ? -5.365  16.908  -3.504  1.00 7.10  ? 33 HIS A H    9  
ATOM   9706  H HA   . HIS A 1 33 ? -7.912  16.316  -2.379  1.00 7.25  ? 33 HIS A HA   9  
ATOM   9707  H HB2  . HIS A 1 33 ? -7.744  14.197  -3.717  1.00 5.99  ? 33 HIS A HB2  9  
ATOM   9708  H HB3  . HIS A 1 33 ? -7.418  15.631  -4.673  1.00 6.92  ? 33 HIS A HB3  9  
ATOM   9709  H HD1  . HIS A 1 33 ? -4.816  16.116  -5.186  1.00 7.35  ? 33 HIS A HD1  9  
ATOM   9710  H HD2  . HIS A 1 33 ? -5.632  12.387  -3.514  1.00 4.33  ? 33 HIS A HD2  9  
ATOM   9711  H HE1  . HIS A 1 33 ? -2.679  14.776  -5.368  1.00 6.82  ? 33 HIS A HE1  9  
ATOM   9712  N N    . CYS A 1 34 ? -5.395  14.532  -1.221  1.00 5.51  ? 34 CYS A N    9  
ATOM   9713  C CA   . CYS A 1 34 ? -5.017  13.589  -0.140  1.00 5.12  ? 34 CYS A CA   9  
ATOM   9714  C C    . CYS A 1 34 ? -3.651  13.994  0.427   1.00 5.54  ? 34 CYS A C    9  
ATOM   9715  O O    . CYS A 1 34 ? -2.678  14.105  -0.298  1.00 5.84  ? 34 CYS A O    9  
ATOM   9716  C CB   . CYS A 1 34 ? -4.942  12.173  -0.716  1.00 4.12  ? 34 CYS A CB   9  
ATOM   9717  S SG   . CYS A 1 34 ? -5.712  11.007  0.431   1.00 4.37  ? 34 CYS A SG   9  
ATOM   9718  H H    . CYS A 1 34 ? -4.707  14.892  -1.799  1.00 5.68  ? 34 CYS A H    9  
ATOM   9719  H HA   . CYS A 1 34 ? -5.755  13.626  0.632   1.00 5.59  ? 34 CYS A HA   9  
ATOM   9720  H HB2  . CYS A 1 34 ? -5.464  12.143  -1.659  1.00 4.04  ? 34 CYS A HB2  9  
ATOM   9721  H HB3  . CYS A 1 34 ? -3.908  11.898  -0.868  1.00 3.82  ? 34 CYS A HB3  9  
ATOM   9722  N N    . ALA A 1 35 ? -3.574  14.224  1.718   1.00 5.90  ? 35 ALA A N    9  
ATOM   9723  C CA   . ALA A 1 35 ? -2.277  14.639  2.344   1.00 6.66  ? 35 ALA A CA   9  
ATOM   9724  C C    . ALA A 1 35 ? -1.223  13.537  2.181   1.00 6.33  ? 35 ALA A C    9  
ATOM   9725  O O    . ALA A 1 35 ? -0.135  13.781  1.691   1.00 6.77  ? 35 ALA A O    9  
ATOM   9726  C CB   . ALA A 1 35 ? -2.496  14.923  3.834   1.00 7.59  ? 35 ALA A CB   9  
ATOM   9727  H H    . ALA A 1 35 ? -4.376  14.134  2.275   1.00 5.87  ? 35 ALA A H    9  
ATOM   9728  H HA   . ALA A 1 35 ? -1.924  15.534  1.862   1.00 7.06  ? 35 ALA A HA   9  
ATOM   9729  H HB1  . ALA A 1 35 ? -3.087  14.131  4.269   1.00 7.72  ? 35 ALA A HB1  9  
ATOM   9730  H HB2  . ALA A 1 35 ? -1.540  14.975  4.335   1.00 8.05  ? 35 ALA A HB2  9  
ATOM   9731  H HB3  . ALA A 1 35 ? -3.013  15.864  3.949   1.00 7.89  ? 35 ALA A HB3  9  
ATOM   9732  N N    . ASN A 1 36 ? -1.532  12.332  2.591   1.00 5.85  ? 36 ASN A N    9  
ATOM   9733  C CA   . ASN A 1 36 ? -0.547  11.214  2.470   1.00 5.88  ? 36 ASN A CA   9  
ATOM   9734  C C    . ASN A 1 36 ? -0.767  10.448  1.160   1.00 5.34  ? 36 ASN A C    9  
ATOM   9735  O O    . ASN A 1 36 ? -1.869  10.376  0.643   1.00 5.26  ? 36 ASN A O    9  
ATOM   9736  C CB   . ASN A 1 36 ? -0.717  10.251  3.651   1.00 6.50  ? 36 ASN A CB   9  
ATOM   9737  C CG   . ASN A 1 36 ? 0.198   10.680  4.802   1.00 7.27  ? 36 ASN A CG   9  
ATOM   9738  O OD1  . ASN A 1 36 ? 1.294   10.172  4.942   1.00 7.78  ? 36 ASN A OD1  9  
ATOM   9739  N ND2  . ASN A 1 36 ? -0.205  11.597  5.639   1.00 7.61  ? 36 ASN A ND2  9  
ATOM   9740  H H    . ASN A 1 36 ? -2.413  12.166  2.985   1.00 5.70  ? 36 ASN A H    9  
ATOM   9741  H HA   . ASN A 1 36 ? 0.454   11.617  2.483   1.00 6.19  ? 36 ASN A HA   9  
ATOM   9742  H HB2  . ASN A 1 36 ? -1.745  10.266  3.983   1.00 6.55  ? 36 ASN A HB2  9  
ATOM   9743  H HB3  . ASN A 1 36 ? -0.456  9.252   3.339   1.00 6.63  ? 36 ASN A HB3  9  
ATOM   9744  H HD21 . ASN A 1 36 ? -1.088  12.009  5.529   1.00 7.41  ? 36 ASN A HD21 9  
ATOM   9745  H HD22 . ASN A 1 36 ? 0.374   11.872  6.380   1.00 8.19  ? 36 ASN A HD22 9  
ATOM   9746  N N    . THR A 1 37 ? 0.282   9.863   0.631   1.00 5.30  ? 37 THR A N    9  
ATOM   9747  C CA   . THR A 1 37 ? 0.166   9.078   -0.639  1.00 5.18  ? 37 THR A CA   9  
ATOM   9748  C C    . THR A 1 37 ? -0.517  7.736   -0.329  1.00 4.58  ? 37 THR A C    9  
ATOM   9749  O O    . THR A 1 37 ? -0.429  7.233   0.779   1.00 4.95  ? 37 THR A O    9  
ATOM   9750  C CB   . THR A 1 37 ? 1.570   8.831   -1.216  1.00 5.98  ? 37 THR A CB   9  
ATOM   9751  O OG1  . THR A 1 37 ? 2.378   9.986   -1.015  1.00 6.76  ? 37 THR A OG1  9  
ATOM   9752  C CG2  . THR A 1 37 ? 1.474   8.541   -2.714  1.00 6.31  ? 37 THR A CG2  9  
ATOM   9753  H H    . THR A 1 37 ? 1.152   9.933   1.079   1.00 5.59  ? 37 THR A H    9  
ATOM   9754  H HA   . THR A 1 37 ? -0.429  9.631   -1.352  1.00 5.45  ? 37 THR A HA   9  
ATOM   9755  H HB   . THR A 1 37 ? 2.021   7.987   -0.719  1.00 6.11  ? 37 THR A HB   9  
ATOM   9756  H HG1  . THR A 1 37 ? 3.113   9.738   -0.449  1.00 7.02  ? 37 THR A HG1  9  
ATOM   9757  H HG21 . THR A 1 37 ? 0.930   9.338   -3.201  1.00 6.33  ? 37 THR A HG21 9  
ATOM   9758  H HG22 . THR A 1 37 ? 2.467   8.476   -3.132  1.00 6.74  ? 37 THR A HG22 9  
ATOM   9759  H HG23 . THR A 1 37 ? 0.957   7.606   -2.867  1.00 6.44  ? 37 THR A HG23 9  
ATOM   9760  N N    . GLU A 1 38 ? -1.206  7.156   -1.284  1.00 3.94  ? 38 GLU A N    9  
ATOM   9761  C CA   . GLU A 1 38 ? -1.901  5.859   -1.021  1.00 3.67  ? 38 GLU A CA   9  
ATOM   9762  C C    . GLU A 1 38 ? -1.611  4.867   -2.149  1.00 2.99  ? 38 GLU A C    9  
ATOM   9763  O O    . GLU A 1 38 ? -1.744  5.184   -3.317  1.00 3.33  ? 38 GLU A O    9  
ATOM   9764  C CB   . GLU A 1 38 ? -3.414  6.101   -0.936  1.00 4.35  ? 38 GLU A CB   9  
ATOM   9765  C CG   . GLU A 1 38 ? -4.005  5.286   0.220   1.00 4.96  ? 38 GLU A CG   9  
ATOM   9766  C CD   . GLU A 1 38 ? -3.775  6.028   1.542   1.00 5.76  ? 38 GLU A CD   9  
ATOM   9767  O OE1  . GLU A 1 38 ? -4.624  6.825   1.906   1.00 6.10  ? 38 GLU A OE1  9  
ATOM   9768  O OE2  . GLU A 1 38 ? -2.755  5.784   2.166   1.00 6.28  ? 38 GLU A OE2  9  
ATOM   9769  H H    . GLU A 1 38 ? -1.276  7.578   -2.170  1.00 3.89  ? 38 GLU A H    9  
ATOM   9770  H HA   . GLU A 1 38 ? -1.552  5.448   -0.086  1.00 3.96  ? 38 GLU A HA   9  
ATOM   9771  H HB2  . GLU A 1 38 ? -3.601  7.152   -0.769  1.00 4.73  ? 38 GLU A HB2  9  
ATOM   9772  H HB3  . GLU A 1 38 ? -3.880  5.796   -1.861  1.00 4.35  ? 38 GLU A HB3  9  
ATOM   9773  H HG2  . GLU A 1 38 ? -5.065  5.155   0.061   1.00 5.14  ? 38 GLU A HG2  9  
ATOM   9774  H HG3  . GLU A 1 38 ? -3.525  4.320   0.263   1.00 4.98  ? 38 GLU A HG3  9  
ATOM   9775  N N    . ILE A 1 39 ? -1.235  3.659   -1.803  1.00 2.48  ? 39 ILE A N    9  
ATOM   9776  C CA   . ILE A 1 39 ? -0.957  2.629   -2.847  1.00 2.38  ? 39 ILE A CA   9  
ATOM   9777  C C    . ILE A 1 39 ? -2.255  1.846   -3.106  1.00 2.16  ? 39 ILE A C    9  
ATOM   9778  O O    . ILE A 1 39 ? -3.154  1.851   -2.285  1.00 2.22  ? 39 ILE A O    9  
ATOM   9779  C CB   . ILE A 1 39 ? 0.154   1.693   -2.336  1.00 2.57  ? 39 ILE A CB   9  
ATOM   9780  C CG1  . ILE A 1 39 ? 1.502   2.424   -2.403  1.00 2.79  ? 39 ILE A CG1  9  
ATOM   9781  C CG2  . ILE A 1 39 ? 0.230   0.424   -3.193  1.00 3.44  ? 39 ILE A CG2  9  
ATOM   9782  C CD1  . ILE A 1 39 ? 2.013   2.707   -0.988  1.00 2.94  ? 39 ILE A CD1  9  
ATOM   9783  H H    . ILE A 1 39 ? -1.151  3.423   -0.849  1.00 2.61  ? 39 ILE A H    9  
ATOM   9784  H HA   . ILE A 1 39 ? -0.637  3.111   -3.759  1.00 2.85  ? 39 ILE A HA   9  
ATOM   9785  H HB   . ILE A 1 39 ? -0.055  1.421   -1.313  1.00 2.54  ? 39 ILE A HB   9  
ATOM   9786  H HG12 . ILE A 1 39 ? 2.219   1.809   -2.927  1.00 3.36  ? 39 ILE A HG12 9  
ATOM   9787  H HG13 . ILE A 1 39 ? 1.379   3.358   -2.931  1.00 2.70  ? 39 ILE A HG13 9  
ATOM   9788  H HG21 . ILE A 1 39 ? 0.351   0.694   -4.230  1.00 4.05  ? 39 ILE A HG21 9  
ATOM   9789  H HG22 . ILE A 1 39 ? 1.072   -0.174  -2.876  1.00 3.75  ? 39 ILE A HG22 9  
ATOM   9790  H HG23 . ILE A 1 39 ? -0.679  -0.146  -3.074  1.00 3.64  ? 39 ILE A HG23 9  
ATOM   9791  H HD11 . ILE A 1 39 ? 1.497   2.074   -0.283  1.00 2.88  ? 39 ILE A HD11 9  
ATOM   9792  H HD12 . ILE A 1 39 ? 3.074   2.507   -0.943  1.00 3.00  ? 39 ILE A HD12 9  
ATOM   9793  H HD13 . ILE A 1 39 ? 1.834   3.743   -0.741  1.00 3.60  ? 39 ILE A HD13 9  
ATOM   9794  N N    . ILE A 1 40 ? -2.374  1.185   -4.235  1.00 2.34  ? 40 ILE A N    9  
ATOM   9795  C CA   . ILE A 1 40 ? -3.624  0.409   -4.521  1.00 2.36  ? 40 ILE A CA   9  
ATOM   9796  C C    . ILE A 1 40 ? -3.295  -0.802  -5.398  1.00 2.37  ? 40 ILE A C    9  
ATOM   9797  O O    . ILE A 1 40 ? -3.187  -0.696  -6.606  1.00 3.02  ? 40 ILE A O    9  
ATOM   9798  C CB   . ILE A 1 40 ? -4.657  1.280   -5.250  1.00 3.14  ? 40 ILE A CB   9  
ATOM   9799  C CG1  . ILE A 1 40 ? -4.981  2.525   -4.415  1.00 3.44  ? 40 ILE A CG1  9  
ATOM   9800  C CG2  . ILE A 1 40 ? -5.935  0.461   -5.462  1.00 3.70  ? 40 ILE A CG2  9  
ATOM   9801  C CD1  . ILE A 1 40 ? -5.754  3.534   -5.267  1.00 4.01  ? 40 ILE A CD1  9  
ATOM   9802  H H    . ILE A 1 40 ? -1.645  1.198   -4.891  1.00 2.72  ? 40 ILE A H    9  
ATOM   9803  H HA   . ILE A 1 40 ? -4.047  0.064   -3.588  1.00 2.37  ? 40 ILE A HA   9  
ATOM   9804  H HB   . ILE A 1 40 ? -4.262  1.580   -6.210  1.00 3.47  ? 40 ILE A HB   9  
ATOM   9805  H HG12 . ILE A 1 40 ? -5.579  2.241   -3.561  1.00 3.44  ? 40 ILE A HG12 9  
ATOM   9806  H HG13 . ILE A 1 40 ? -4.061  2.975   -4.076  1.00 3.71  ? 40 ILE A HG13 9  
ATOM   9807  H HG21 . ILE A 1 40 ? -5.693  -0.453  -5.984  1.00 3.89  ? 40 ILE A HG21 9  
ATOM   9808  H HG22 . ILE A 1 40 ? -6.372  0.222   -4.504  1.00 3.94  ? 40 ILE A HG22 9  
ATOM   9809  H HG23 . ILE A 1 40 ? -6.639  1.034   -6.047  1.00 4.13  ? 40 ILE A HG23 9  
ATOM   9810  H HD11 . ILE A 1 40 ? -5.231  3.695   -6.199  1.00 4.43  ? 40 ILE A HD11 9  
ATOM   9811  H HD12 . ILE A 1 40 ? -6.743  3.151   -5.472  1.00 4.17  ? 40 ILE A HD12 9  
ATOM   9812  H HD13 . ILE A 1 40 ? -5.833  4.469   -4.734  1.00 4.33  ? 40 ILE A HD13 9  
ATOM   9813  N N    . VAL A 1 41 ? -3.147  -1.954  -4.799  1.00 2.04  ? 41 VAL A N    9  
ATOM   9814  C CA   . VAL A 1 41 ? -2.840  -3.175  -5.585  1.00 2.10  ? 41 VAL A CA   9  
ATOM   9815  C C    . VAL A 1 41 ? -4.134  -3.959  -5.847  1.00 2.33  ? 41 VAL A C    9  
ATOM   9816  O O    . VAL A 1 41 ? -5.171  -3.682  -5.269  1.00 2.79  ? 41 VAL A O    9  
ATOM   9817  C CB   . VAL A 1 41 ? -1.859  -4.056  -4.805  1.00 2.21  ? 41 VAL A CB   9  
ATOM   9818  C CG1  . VAL A 1 41 ? -0.574  -3.272  -4.520  1.00 2.87  ? 41 VAL A CG1  9  
ATOM   9819  C CG2  . VAL A 1 41 ? -2.491  -4.510  -3.481  1.00 3.20  ? 41 VAL A CG2  9  
ATOM   9820  H H    . VAL A 1 41 ? -3.241  -2.017  -3.832  1.00 2.11  ? 41 VAL A H    9  
ATOM   9821  H HA   . VAL A 1 41 ? -2.399  -2.890  -6.528  1.00 2.57  ? 41 VAL A HA   9  
ATOM   9822  H HB   . VAL A 1 41 ? -1.621  -4.916  -5.397  1.00 2.10  ? 41 VAL A HB   9  
ATOM   9823  H HG11 . VAL A 1 41 ? -0.822  -2.317  -4.082  1.00 3.43  ? 41 VAL A HG11 9  
ATOM   9824  H HG12 . VAL A 1 41 ? 0.045   -3.833  -3.836  1.00 3.03  ? 41 VAL A HG12 9  
ATOM   9825  H HG13 . VAL A 1 41 ? -0.038  -3.115  -5.445  1.00 3.29  ? 41 VAL A HG13 9  
ATOM   9826  H HG21 . VAL A 1 41 ? -3.351  -3.897  -3.262  1.00 3.58  ? 41 VAL A HG21 9  
ATOM   9827  H HG22 . VAL A 1 41 ? -2.799  -5.541  -3.568  1.00 3.72  ? 41 VAL A HG22 9  
ATOM   9828  H HG23 . VAL A 1 41 ? -1.769  -4.418  -2.684  1.00 3.56  ? 41 VAL A HG23 9  
ATOM   9829  N N    . LYS A 1 42 ? -4.071  -4.937  -6.713  1.00 2.44  ? 42 LYS A N    9  
ATOM   9830  C CA   . LYS A 1 42 ? -5.276  -5.756  -7.023  1.00 2.97  ? 42 LYS A CA   9  
ATOM   9831  C C    . LYS A 1 42 ? -4.896  -7.240  -6.961  1.00 2.77  ? 42 LYS A C    9  
ATOM   9832  O O    . LYS A 1 42 ? -4.390  -7.801  -7.916  1.00 2.98  ? 42 LYS A O    9  
ATOM   9833  C CB   . LYS A 1 42 ? -5.793  -5.404  -8.424  1.00 3.77  ? 42 LYS A CB   9  
ATOM   9834  C CG   . LYS A 1 42 ? -7.249  -4.939  -8.334  1.00 4.68  ? 42 LYS A CG   9  
ATOM   9835  C CD   . LYS A 1 42 ? -8.185  -6.127  -8.574  1.00 5.42  ? 42 LYS A CD   9  
ATOM   9836  C CE   . LYS A 1 42 ? -9.612  -5.745  -8.171  1.00 5.72  ? 42 LYS A CE   9  
ATOM   9837  N NZ   . LYS A 1 42 ? -10.293 -5.071  -9.316  1.00 6.76  ? 42 LYS A NZ   9  
ATOM   9838  H H    . LYS A 1 42 ? -3.224  -5.137  -7.156  1.00 2.45  ? 42 LYS A H    9  
ATOM   9839  H HA   . LYS A 1 42 ? -6.046  -5.552  -6.292  1.00 3.37  ? 42 LYS A HA   9  
ATOM   9840  H HB2  . LYS A 1 42 ? -5.188  -4.614  -8.843  1.00 3.94  ? 42 LYS A HB2  9  
ATOM   9841  H HB3  . LYS A 1 42 ? -5.735  -6.276  -9.060  1.00 3.87  ? 42 LYS A HB3  9  
ATOM   9842  H HG2  . LYS A 1 42 ? -7.435  -4.526  -7.354  1.00 4.83  ? 42 LYS A HG2  9  
ATOM   9843  H HG3  . LYS A 1 42 ? -7.432  -4.184  -9.083  1.00 4.94  ? 42 LYS A HG3  9  
ATOM   9844  H HD2  . LYS A 1 42 ? -8.164  -6.396  -9.620  1.00 5.79  ? 42 LYS A HD2  9  
ATOM   9845  H HD3  . LYS A 1 42 ? -7.859  -6.968  -7.980  1.00 5.70  ? 42 LYS A HD3  9  
ATOM   9846  H HE2  . LYS A 1 42 ? -10.161 -6.636  -7.902  1.00 5.66  ? 42 LYS A HE2  9  
ATOM   9847  H HE3  . LYS A 1 42 ? -9.580  -5.074  -7.326  1.00 5.59  ? 42 LYS A HE3  9  
ATOM   9848  H HZ1  . LYS A 1 42 ? -10.296 -5.703  -10.141 1.00 7.12  ? 42 LYS A HZ1  9  
ATOM   9849  H HZ2  . LYS A 1 42 ? -11.273 -4.846  -9.052  1.00 7.24  ? 42 LYS A HZ2  9  
ATOM   9850  H HZ3  . LYS A 1 42 ? -9.786  -4.193  -9.551  1.00 6.85  ? 42 LYS A HZ3  9  
ATOM   9851  N N    . LEU A 1 43 ? -5.126  -7.870  -5.831  1.00 3.01  ? 43 LEU A N    9  
ATOM   9852  C CA   . LEU A 1 43 ? -4.779  -9.315  -5.663  1.00 3.31  ? 43 LEU A CA   9  
ATOM   9853  C C    . LEU A 1 43 ? -5.350  -10.155 -6.810  1.00 3.92  ? 43 LEU A C    9  
ATOM   9854  O O    . LEU A 1 43 ? -6.401  -9.859  -7.356  1.00 4.54  ? 43 LEU A O    9  
ATOM   9855  C CB   . LEU A 1 43 ? -5.366  -9.822  -4.348  1.00 4.01  ? 43 LEU A CB   9  
ATOM   9856  C CG   . LEU A 1 43 ? -4.428  -9.473  -3.186  1.00 3.77  ? 43 LEU A CG   9  
ATOM   9857  C CD1  . LEU A 1 43 ? -5.099  -9.843  -1.861  1.00 4.46  ? 43 LEU A CD1  9  
ATOM   9858  C CD2  . LEU A 1 43 ? -3.115  -10.252 -3.327  1.00 3.91  ? 43 LEU A CD2  9  
ATOM   9859  H H    . LEU A 1 43 ? -5.517  -7.384  -5.078  1.00 3.37  ? 43 LEU A H    9  
ATOM   9860  H HA   . LEU A 1 43 ? -3.706  -9.425  -5.639  1.00 3.08  ? 43 LEU A HA   9  
ATOM   9861  H HB2  . LEU A 1 43 ? -6.323  -9.358  -4.189  1.00 4.55  ? 43 LEU A HB2  9  
ATOM   9862  H HB3  . LEU A 1 43 ? -5.496  -10.887 -4.401  1.00 4.52  ? 43 LEU A HB3  9  
ATOM   9863  H HG   . LEU A 1 43 ? -4.223  -8.412  -3.198  1.00 3.53  ? 43 LEU A HG   9  
ATOM   9864  H HD11 . LEU A 1 43 ? -5.403  -10.880 -1.888  1.00 4.51  ? 43 LEU A HD11 9  
ATOM   9865  H HD12 . LEU A 1 43 ? -4.402  -9.692  -1.050  1.00 5.14  ? 43 LEU A HD12 9  
ATOM   9866  H HD13 . LEU A 1 43 ? -5.967  -9.218  -1.710  1.00 4.57  ? 43 LEU A HD13 9  
ATOM   9867  H HD21 . LEU A 1 43 ? -3.327  -11.265 -3.635  1.00 4.44  ? 43 LEU A HD21 9  
ATOM   9868  H HD22 . LEU A 1 43 ? -2.490  -9.773  -4.066  1.00 3.95  ? 43 LEU A HD22 9  
ATOM   9869  H HD23 . LEU A 1 43 ? -2.601  -10.265 -2.377  1.00 3.96  ? 43 LEU A HD23 9  
ATOM   9870  N N    . SER A 1 44 ? -4.651  -11.211 -7.158  1.00 3.99  ? 44 SER A N    9  
ATOM   9871  C CA   . SER A 1 44 ? -5.096  -12.122 -8.259  1.00 4.72  ? 44 SER A CA   9  
ATOM   9872  C C    . SER A 1 44 ? -6.488  -12.705 -7.963  1.00 5.55  ? 44 SER A C    9  
ATOM   9873  O O    . SER A 1 44 ? -7.182  -13.139 -8.865  1.00 6.08  ? 44 SER A O    9  
ATOM   9874  C CB   . SER A 1 44 ? -4.089  -13.268 -8.412  1.00 4.98  ? 44 SER A CB   9  
ATOM   9875  O OG   . SER A 1 44 ? -3.767  -13.795 -7.129  1.00 5.08  ? 44 SER A OG   9  
ATOM   9876  H H    . SER A 1 44 ? -3.822  -11.408 -6.685  1.00 3.70  ? 44 SER A H    9  
ATOM   9877  H HA   . SER A 1 44 ? -5.132  -11.563 -9.177  1.00 4.83  ? 44 SER A HA   9  
ATOM   9878  H HB2  . SER A 1 44 ? -4.520  -14.050 -9.017  1.00 5.14  ? 44 SER A HB2  9  
ATOM   9879  H HB3  . SER A 1 44 ? -3.195  -12.897 -8.895  1.00 5.37  ? 44 SER A HB3  9  
ATOM   9880  H HG   . SER A 1 44 ? -4.342  -14.545 -6.961  1.00 5.39  ? 44 SER A HG   9  
ATOM   9881  N N    . ASP A 1 45 ? -6.907  -12.718 -6.715  1.00 5.91  ? 45 ASP A N    9  
ATOM   9882  C CA   . ASP A 1 45 ? -8.249  -13.265 -6.372  1.00 7.02  ? 45 ASP A CA   9  
ATOM   9883  C C    . ASP A 1 45 ? -9.347  -12.212 -6.630  1.00 7.25  ? 45 ASP A C    9  
ATOM   9884  O O    . ASP A 1 45 ? -10.432 -12.296 -6.080  1.00 8.19  ? 45 ASP A O    9  
ATOM   9885  C CB   . ASP A 1 45 ? -8.261  -13.669 -4.891  1.00 7.64  ? 45 ASP A CB   9  
ATOM   9886  C CG   . ASP A 1 45 ? -9.196  -14.865 -4.686  1.00 8.01  ? 45 ASP A CG   9  
ATOM   9887  O OD1  . ASP A 1 45 ? -8.779  -15.975 -4.975  1.00 7.89  ? 45 ASP A OD1  9  
ATOM   9888  O OD2  . ASP A 1 45 ? -10.313 -14.651 -4.245  1.00 8.63  ? 45 ASP A OD2  9  
ATOM   9889  H H    . ASP A 1 45 ? -6.342  -12.369 -6.007  1.00 5.60  ? 45 ASP A H    9  
ATOM   9890  H HA   . ASP A 1 45 ? -8.433  -14.131 -6.976  1.00 7.48  ? 45 ASP A HA   9  
ATOM   9891  H HB2  . ASP A 1 45 ? -7.261  -13.938 -4.585  1.00 7.55  ? 45 ASP A HB2  9  
ATOM   9892  H HB3  . ASP A 1 45 ? -8.608  -12.839 -4.294  1.00 8.18  ? 45 ASP A HB3  9  
ATOM   9893  N N    . GLY A 1 46 ? -9.081  -11.218 -7.456  1.00 6.57  ? 46 GLY A N    9  
ATOM   9894  C CA   . GLY A 1 46 ? -10.104 -10.168 -7.735  1.00 7.07  ? 46 GLY A CA   9  
ATOM   9895  C C    . GLY A 1 46 ? -10.311 -9.305  -6.487  1.00 6.74  ? 46 GLY A C    9  
ATOM   9896  O O    . GLY A 1 46 ? -11.410 -8.865  -6.208  1.00 7.17  ? 46 GLY A O    9  
ATOM   9897  H H    . GLY A 1 46 ? -8.208  -11.160 -7.887  1.00 5.88  ? 46 GLY A H    9  
ATOM   9898  H HA2  . GLY A 1 46 ? -9.767  -9.546  -8.553  1.00 7.41  ? 46 GLY A HA2  9  
ATOM   9899  H HA3  . GLY A 1 46 ? -11.036 -10.638 -8.001  1.00 7.56  ? 46 GLY A HA3  9  
ATOM   9900  N N    . ARG A 1 47 ? -9.265  -9.068  -5.730  1.00 6.21  ? 47 ARG A N    9  
ATOM   9901  C CA   . ARG A 1 47 ? -9.406  -8.239  -4.496  1.00 6.07  ? 47 ARG A CA   9  
ATOM   9902  C C    . ARG A 1 47 ? -8.659  -6.911  -4.676  1.00 5.32  ? 47 ARG A C    9  
ATOM   9903  O O    . ARG A 1 47 ? -7.765  -6.801  -5.490  1.00 5.06  ? 47 ARG A O    9  
ATOM   9904  C CB   . ARG A 1 47 ? -8.810  -9.013  -3.310  1.00 6.43  ? 47 ARG A CB   9  
ATOM   9905  C CG   . ARG A 1 47 ? -9.284  -8.405  -1.984  1.00 7.27  ? 47 ARG A CG   9  
ATOM   9906  C CD   . ARG A 1 47 ? -10.749 -8.776  -1.735  1.00 7.96  ? 47 ARG A CD   9  
ATOM   9907  N NE   . ARG A 1 47 ? -11.205 -8.162  -0.455  1.00 8.82  ? 47 ARG A NE   9  
ATOM   9908  C CZ   . ARG A 1 47 ? -12.078 -7.189  -0.466  1.00 9.62  ? 47 ARG A CZ   9  
ATOM   9909  N NH1  . ARG A 1 47 ? -11.703 -5.976  -0.788  1.00 10.15 ? 47 ARG A NH1  9  
ATOM   9910  N NH2  . ARG A 1 47 ? -13.326 -7.428  -0.156  1.00 10.10 ? 47 ARG A NH2  9  
ATOM   9911  H H    . ARG A 1 47 ? -8.382  -9.440  -5.972  1.00 6.06  ? 47 ARG A H    9  
ATOM   9912  H HA   . ARG A 1 47 ? -10.450 -8.043  -4.308  1.00 6.58  ? 47 ARG A HA   9  
ATOM   9913  H HB2  . ARG A 1 47 ? -9.124  -10.045 -3.363  1.00 6.43  ? 47 ARG A HB2  9  
ATOM   9914  H HB3  . ARG A 1 47 ? -7.735  -8.965  -3.359  1.00 6.47  ? 47 ARG A HB3  9  
ATOM   9915  H HG2  . ARG A 1 47 ? -8.676  -8.790  -1.178  1.00 7.60  ? 47 ARG A HG2  9  
ATOM   9916  H HG3  . ARG A 1 47 ? -9.188  -7.332  -2.023  1.00 7.34  ? 47 ARG A HG3  9  
ATOM   9917  H HD2  . ARG A 1 47 ? -11.357 -8.407  -2.549  1.00 7.82  ? 47 ARG A HD2  9  
ATOM   9918  H HD3  . ARG A 1 47 ? -10.843 -9.849  -1.673  1.00 8.20  ? 47 ARG A HD3  9  
ATOM   9919  H HE   . ARG A 1 47 ? -10.850 -8.490  0.399   1.00 8.93  ? 47 ARG A HE   9  
ATOM   9920  H HH11 . ARG A 1 47 ? -10.748 -5.794  -1.023  1.00 9.97  ? 47 ARG A HH11 9  
ATOM   9921  H HH12 . ARG A 1 47 ? -12.370 -5.231  -0.797  1.00 10.86 ? 47 ARG A HH12 9  
ATOM   9922  H HH21 . ARG A 1 47 ? -13.613 -8.354  0.092   1.00 9.88  ? 47 ARG A HH21 9  
ATOM   9923  H HH22 . ARG A 1 47 ? -13.997 -6.684  -0.164  1.00 10.80 ? 47 ARG A HH22 9  
ATOM   9924  N N    . GLU A 1 48 ? -9.019  -5.908  -3.915  1.00 5.24  ? 48 GLU A N    9  
ATOM   9925  C CA   . GLU A 1 48 ? -8.330  -4.587  -4.018  1.00 4.73  ? 48 GLU A CA   9  
ATOM   9926  C C    . GLU A 1 48 ? -7.936  -4.142  -2.609  1.00 4.69  ? 48 GLU A C    9  
ATOM   9927  O O    . GLU A 1 48 ? -8.779  -3.957  -1.750  1.00 5.44  ? 48 GLU A O    9  
ATOM   9928  C CB   . GLU A 1 48 ? -9.271  -3.554  -4.645  1.00 5.60  ? 48 GLU A CB   9  
ATOM   9929  C CG   . GLU A 1 48 ? -8.444  -2.427  -5.273  1.00 5.76  ? 48 GLU A CG   9  
ATOM   9930  C CD   . GLU A 1 48 ? -9.270  -1.138  -5.307  1.00 6.79  ? 48 GLU A CD   9  
ATOM   9931  O OE1  . GLU A 1 48 ? -10.109 -1.017  -6.185  1.00 7.12  ? 48 GLU A OE1  9  
ATOM   9932  O OE2  . GLU A 1 48 ? -9.048  -0.292  -4.455  1.00 7.44  ? 48 GLU A OE2  9  
ATOM   9933  H H    . GLU A 1 48 ? -9.742  -6.027  -3.264  1.00 5.71  ? 48 GLU A H    9  
ATOM   9934  H HA   . GLU A 1 48 ? -7.440  -4.687  -4.625  1.00 4.10  ? 48 GLU A HA   9  
ATOM   9935  H HB2  . GLU A 1 48 ? -9.870  -4.030  -5.409  1.00 5.76  ? 48 GLU A HB2  9  
ATOM   9936  H HB3  . GLU A 1 48 ? -9.917  -3.144  -3.884  1.00 6.30  ? 48 GLU A HB3  9  
ATOM   9937  H HG2  . GLU A 1 48 ? -7.551  -2.266  -4.686  1.00 5.48  ? 48 GLU A HG2  9  
ATOM   9938  H HG3  . GLU A 1 48 ? -8.168  -2.701  -6.279  1.00 5.78  ? 48 GLU A HG3  9  
ATOM   9939  N N    . LEU A 1 49 ? -6.660  -3.981  -2.361  1.00 4.08  ? 49 LEU A N    9  
ATOM   9940  C CA   . LEU A 1 49 ? -6.207  -3.561  -1.001  1.00 4.35  ? 49 LEU A CA   9  
ATOM   9941  C C    . LEU A 1 49 ? -5.295  -2.347  -1.126  1.00 3.99  ? 49 LEU A C    9  
ATOM   9942  O O    . LEU A 1 49 ? -4.300  -2.389  -1.811  1.00 3.87  ? 49 LEU A O    9  
ATOM   9943  C CB   . LEU A 1 49 ? -5.415  -4.698  -0.345  1.00 4.67  ? 49 LEU A CB   9  
ATOM   9944  C CG   . LEU A 1 49 ? -6.204  -5.289  0.828   1.00 4.92  ? 49 LEU A CG   9  
ATOM   9945  C CD1  . LEU A 1 49 ? -7.236  -6.288  0.305   1.00 5.51  ? 49 LEU A CD1  9  
ATOM   9946  C CD2  . LEU A 1 49 ? -5.237  -6.013  1.769   1.00 4.69  ? 49 LEU A CD2  9  
ATOM   9947  H H    . LEU A 1 49 ? -5.996  -4.141  -3.071  1.00 3.67  ? 49 LEU A H    9  
ATOM   9948  H HA   . LEU A 1 49 ? -7.061  -3.312  -0.390  1.00 4.89  ? 49 LEU A HA   9  
ATOM   9949  H HB2  . LEU A 1 49 ? -5.220  -5.471  -1.074  1.00 4.69  ? 49 LEU A HB2  9  
ATOM   9950  H HB3  . LEU A 1 49 ? -4.479  -4.304  0.022   1.00 5.10  ? 49 LEU A HB3  9  
ATOM   9951  H HG   . LEU A 1 49 ? -6.706  -4.496  1.363   1.00 5.20  ? 49 LEU A HG   9  
ATOM   9952  H HD11 . LEU A 1 49 ? -6.797  -6.881  -0.483  1.00 5.74  ? 49 LEU A HD11 9  
ATOM   9953  H HD12 . LEU A 1 49 ? -7.549  -6.935  1.113   1.00 5.91  ? 49 LEU A HD12 9  
ATOM   9954  H HD13 . LEU A 1 49 ? -8.091  -5.753  -0.079  1.00 5.66  ? 49 LEU A HD13 9  
ATOM   9955  H HD21 . LEU A 1 49 ? -4.306  -5.470  1.813   1.00 4.66  ? 49 LEU A HD21 9  
ATOM   9956  H HD22 . LEU A 1 49 ? -5.669  -6.069  2.756   1.00 5.11  ? 49 LEU A HD22 9  
ATOM   9957  H HD23 . LEU A 1 49 ? -5.053  -7.011  1.398   1.00 4.52  ? 49 LEU A HD23 9  
ATOM   9958  N N    . CYS A 1 50 ? -5.603  -1.279  -0.445  1.00 3.99  ? 50 CYS A N    9  
ATOM   9959  C CA   . CYS A 1 50 ? -4.719  -0.082  -0.513  1.00 3.63  ? 50 CYS A CA   9  
ATOM   9960  C C    . CYS A 1 50 ? -3.564  -0.317  0.453   1.00 3.49  ? 50 CYS A C    9  
ATOM   9961  O O    . CYS A 1 50 ? -3.770  -0.774  1.555   1.00 4.14  ? 50 CYS A O    9  
ATOM   9962  C CB   . CYS A 1 50 ? -5.463  1.184   -0.101  1.00 3.72  ? 50 CYS A CB   9  
ATOM   9963  S SG   . CYS A 1 50 ? -7.258  0.940   -0.200  1.00 4.64  ? 50 CYS A SG   9  
ATOM   9964  H H    . CYS A 1 50 ? -6.392  -1.275  0.128   1.00 4.28  ? 50 CYS A H    9  
ATOM   9965  H HA   . CYS A 1 50 ? -4.336  0.035   -1.509  1.00 3.59  ? 50 CYS A HA   9  
ATOM   9966  H HB2  . CYS A 1 50 ? -5.184  1.434   0.898   1.00 3.90  ? 50 CYS A HB2  9  
ATOM   9967  H HB3  . CYS A 1 50 ? -5.178  1.987   -0.759  1.00 3.38  ? 50 CYS A HB3  9  
ATOM   9968  N N    . LEU A 1 51 ? -2.353  -0.038  0.052   1.00 2.91  ? 51 LEU A N    9  
ATOM   9969  C CA   . LEU A 1 51 ? -1.203  -0.280  0.957   1.00 2.96  ? 51 LEU A CA   9  
ATOM   9970  C C    . LEU A 1 51 ? -0.811  1.000   1.679   1.00 3.35  ? 51 LEU A C    9  
ATOM   9971  O O    . LEU A 1 51 ? -1.088  2.107   1.240   1.00 3.56  ? 51 LEU A O    9  
ATOM   9972  C CB   . LEU A 1 51 ? -0.007  -0.796  0.164   1.00 2.71  ? 51 LEU A CB   9  
ATOM   9973  C CG   . LEU A 1 51 ? -0.266  -2.225  -0.332  1.00 2.56  ? 51 LEU A CG   9  
ATOM   9974  C CD1  . LEU A 1 51 ? -1.300  -2.214  -1.455  1.00 2.98  ? 51 LEU A CD1  9  
ATOM   9975  C CD2  . LEU A 1 51 ? 1.042   -2.825  -0.855  1.00 2.61  ? 51 LEU A CD2  9  
ATOM   9976  H H    . LEU A 1 51 ? -2.200  0.310   -0.838  1.00 2.70  ? 51 LEU A H    9  
ATOM   9977  H HA   . LEU A 1 51 ? -1.484  -1.016  1.690   1.00 3.34  ? 51 LEU A HA   9  
ATOM   9978  H HB2  . LEU A 1 51 ? 0.169   -0.147  -0.667  1.00 2.95  ? 51 LEU A HB2  9  
ATOM   9979  H HB3  . LEU A 1 51 ? 0.857   -0.793  0.798   1.00 2.93  ? 51 LEU A HB3  9  
ATOM   9980  H HG   . LEU A 1 51 ? -0.639  -2.826  0.481   1.00 2.88  ? 51 LEU A HG   9  
ATOM   9981  H HD11 . LEU A 1 51 ? -1.401  -1.214  -1.844  1.00 3.38  ? 51 LEU A HD11 9  
ATOM   9982  H HD12 . LEU A 1 51 ? -0.981  -2.876  -2.241  1.00 3.34  ? 51 LEU A HD12 9  
ATOM   9983  H HD13 . LEU A 1 51 ? -2.250  -2.549  -1.068  1.00 3.13  ? 51 LEU A HD13 9  
ATOM   9984  H HD21 . LEU A 1 51 ? 1.547   -2.102  -1.478  1.00 2.85  ? 51 LEU A HD21 9  
ATOM   9985  H HD22 . LEU A 1 51 ? 1.677   -3.086  -0.022  1.00 2.77  ? 51 LEU A HD22 9  
ATOM   9986  H HD23 . LEU A 1 51 ? 0.826   -3.711  -1.435  1.00 3.04  ? 51 LEU A HD23 9  
ATOM   9987  N N    . ASP A 1 52 ? -0.159  0.824   2.792   1.00 3.84  ? 52 ASP A N    9  
ATOM   9988  C CA   . ASP A 1 52 ? 0.288   1.971   3.629   1.00 4.35  ? 52 ASP A CA   9  
ATOM   9989  C C    . ASP A 1 52 ? 1.794   2.195   3.429   1.00 4.47  ? 52 ASP A C    9  
ATOM   9990  O O    . ASP A 1 52 ? 2.600   1.348   3.781   1.00 4.73  ? 52 ASP A O    9  
ATOM   9991  C CB   . ASP A 1 52 ? -0.011  1.635   5.097   1.00 4.93  ? 52 ASP A CB   9  
ATOM   9992  C CG   . ASP A 1 52 ? 0.300   2.834   6.000   1.00 5.39  ? 52 ASP A CG   9  
ATOM   9993  O OD1  . ASP A 1 52 ? -0.127  3.932   5.674   1.00 5.96  ? 52 ASP A OD1  9  
ATOM   9994  O OD2  . ASP A 1 52 ? 0.953   2.629   7.007   1.00 5.40  ? 52 ASP A OD2  9  
ATOM   9995  H H    . ASP A 1 52 ? 0.039   -0.088  3.080   1.00 4.08  ? 52 ASP A H    9  
ATOM   9996  H HA   . ASP A 1 52 ? -0.256  2.859   3.345   1.00 4.52  ? 52 ASP A HA   9  
ATOM   9997  H HB2  . ASP A 1 52 ? -1.054  1.374   5.197   1.00 5.32  ? 52 ASP A HB2  9  
ATOM   9998  H HB3  . ASP A 1 52 ? 0.596   0.792   5.401   1.00 4.91  ? 52 ASP A HB3  9  
ATOM   9999  N N    . PRO A 1 53 ? 2.132   3.338   2.872   1.00 4.54  ? 53 PRO A N    9  
ATOM   10000 C CA   . PRO A 1 53 ? 3.539   3.707   2.602   1.00 4.96  ? 53 PRO A CA   9  
ATOM   10001 C C    . PRO A 1 53 ? 4.310   3.987   3.903   1.00 5.21  ? 53 PRO A C    9  
ATOM   10002 O O    . PRO A 1 53 ? 5.521   4.107   3.889   1.00 5.67  ? 53 PRO A O    9  
ATOM   10003 C CB   . PRO A 1 53 ? 3.423   4.959   1.723   1.00 5.26  ? 53 PRO A CB   9  
ATOM   10004 C CG   . PRO A 1 53 ? 2.020   5.546   1.984   1.00 5.04  ? 53 PRO A CG   9  
ATOM   10005 C CD   . PRO A 1 53 ? 1.151   4.378   2.486   1.00 4.55  ? 53 PRO A CD   9  
ATOM   10006 H HA   . PRO A 1 53 ? 4.026   2.922   2.045   1.00 5.07  ? 53 PRO A HA   9  
ATOM   10007 H HB2  . PRO A 1 53 ? 4.187   5.674   1.995   1.00 5.72  ? 53 PRO A HB2  9  
ATOM   10008 H HB3  . PRO A 1 53 ? 3.517   4.691   0.682   1.00 5.40  ? 53 PRO A HB3  9  
ATOM   10009 H HG2  . PRO A 1 53 ? 2.076   6.322   2.737   1.00 5.39  ? 53 PRO A HG2  9  
ATOM   10010 H HG3  . PRO A 1 53 ? 1.606   5.941   1.071   1.00 5.11  ? 53 PRO A HG3  9  
ATOM   10011 H HD2  . PRO A 1 53 ? 0.564   4.686   3.341   1.00 4.78  ? 53 PRO A HD2  9  
ATOM   10012 H HD3  . PRO A 1 53 ? 0.513   4.013   1.697   1.00 4.27  ? 53 PRO A HD3  9  
ATOM   10013 N N    . LYS A 1 54 ? 3.628   4.075   5.026   1.00 5.18  ? 54 LYS A N    9  
ATOM   10014 C CA   . LYS A 1 54 ? 4.331   4.324   6.315   1.00 5.61  ? 54 LYS A CA   9  
ATOM   10015 C C    . LYS A 1 54 ? 5.281   3.156   6.626   1.00 5.02  ? 54 LYS A C    9  
ATOM   10016 O O    . LYS A 1 54 ? 6.288   3.338   7.285   1.00 5.42  ? 54 LYS A O    9  
ATOM   10017 C CB   . LYS A 1 54 ? 3.307   4.467   7.448   1.00 6.23  ? 54 LYS A CB   9  
ATOM   10018 C CG   . LYS A 1 54 ? 3.552   5.777   8.205   1.00 7.12  ? 54 LYS A CG   9  
ATOM   10019 C CD   . LYS A 1 54 ? 2.682   6.886   7.607   1.00 7.85  ? 54 LYS A CD   9  
ATOM   10020 C CE   . LYS A 1 54 ? 2.892   8.185   8.392   1.00 8.63  ? 54 LYS A CE   9  
ATOM   10021 N NZ   . LYS A 1 54 ? 1.879   8.280   9.484   1.00 9.56  ? 54 LYS A NZ   9  
ATOM   10022 H H    . LYS A 1 54 ? 2.661   3.969   5.023   1.00 5.07  ? 54 LYS A H    9  
ATOM   10023 H HA   . LYS A 1 54 ? 4.897   5.232   6.230   1.00 6.14  ? 54 LYS A HA   9  
ATOM   10024 H HB2  . LYS A 1 54 ? 2.313   4.474   7.030   1.00 6.01  ? 54 LYS A HB2  9  
ATOM   10025 H HB3  . LYS A 1 54 ? 3.407   3.637   8.130   1.00 6.42  ? 54 LYS A HB3  9  
ATOM   10026 H HG2  . LYS A 1 54 ? 3.297   5.641   9.247   1.00 7.47  ? 54 LYS A HG2  9  
ATOM   10027 H HG3  . LYS A 1 54 ? 4.593   6.053   8.123   1.00 7.15  ? 54 LYS A HG3  9  
ATOM   10028 H HD2  . LYS A 1 54 ? 2.958   7.041   6.574   1.00 8.02  ? 54 LYS A HD2  9  
ATOM   10029 H HD3  . LYS A 1 54 ? 1.643   6.598   7.662   1.00 7.93  ? 54 LYS A HD3  9  
ATOM   10030 H HE2  . LYS A 1 54 ? 3.883   8.192   8.819   1.00 8.78  ? 54 LYS A HE2  9  
ATOM   10031 H HE3  . LYS A 1 54 ? 2.782   9.028   7.726   1.00 8.58  ? 54 LYS A HE3  9  
ATOM   10032 H HZ1  . LYS A 1 54 ? 1.973   7.461   10.117  1.00 9.84  ? 54 LYS A HZ1  9  
ATOM   10033 H HZ2  . LYS A 1 54 ? 2.034   9.156   10.025  1.00 9.93  ? 54 LYS A HZ2  9  
ATOM   10034 H HZ3  . LYS A 1 54 ? 0.925   8.292   9.073   1.00 9.78  ? 54 LYS A HZ3  9  
ATOM   10035 N N    . GLU A 1 55 ? 4.983   1.961   6.148   1.00 4.37  ? 55 GLU A N    9  
ATOM   10036 C CA   . GLU A 1 55 ? 5.884   0.806   6.413   1.00 4.14  ? 55 GLU A CA   9  
ATOM   10037 C C    . GLU A 1 55 ? 7.006   0.800   5.379   1.00 3.84  ? 55 GLU A C    9  
ATOM   10038 O O    . GLU A 1 55 ? 6.977   1.527   4.401   1.00 3.83  ? 55 GLU A O    9  
ATOM   10039 C CB   . GLU A 1 55 ? 5.108   -0.509  6.294   1.00 4.19  ? 55 GLU A CB   9  
ATOM   10040 C CG   . GLU A 1 55 ? 4.360   -0.801  7.597   1.00 4.76  ? 55 GLU A CG   9  
ATOM   10041 C CD   . GLU A 1 55 ? 4.878   -2.101  8.223   1.00 5.39  ? 55 GLU A CD   9  
ATOM   10042 O OE1  . GLU A 1 55 ? 6.066   -2.174  8.502   1.00 5.43  ? 55 GLU A OE1  9  
ATOM   10043 O OE2  . GLU A 1 55 ? 4.078   -3.000  8.420   1.00 6.13  ? 55 GLU A OE2  9  
ATOM   10044 H H    . GLU A 1 55 ? 4.176   1.828   5.605   1.00 4.29  ? 55 GLU A H    9  
ATOM   10045 H HA   . GLU A 1 55 ? 6.304   0.892   7.404   1.00 4.53  ? 55 GLU A HA   9  
ATOM   10046 H HB2  . GLU A 1 55 ? 4.412   -0.439  5.482   1.00 4.04  ? 55 GLU A HB2  9  
ATOM   10047 H HB3  . GLU A 1 55 ? 5.796   -1.309  6.096   1.00 4.32  ? 55 GLU A HB3  9  
ATOM   10048 H HG2  . GLU A 1 55 ? 4.520   0.008   8.284   1.00 4.81  ? 55 GLU A HG2  9  
ATOM   10049 H HG3  . GLU A 1 55 ? 3.305   -0.897  7.391   1.00 4.98  ? 55 GLU A HG3  9  
ATOM   10050 N N    . ASN A 1 56 ? 7.977   -0.039  5.581   1.00 3.90  ? 56 ASN A N    9  
ATOM   10051 C CA   . ASN A 1 56 ? 9.105   -0.141  4.611   1.00 3.93  ? 56 ASN A CA   9  
ATOM   10052 C C    . ASN A 1 56 ? 8.833   -1.290  3.637   1.00 3.74  ? 56 ASN A C    9  
ATOM   10053 O O    . ASN A 1 56 ? 9.432   -1.367  2.584   1.00 3.89  ? 56 ASN A O    9  
ATOM   10054 C CB   . ASN A 1 56 ? 10.399  -0.411  5.362   1.00 4.29  ? 56 ASN A CB   9  
ATOM   10055 C CG   . ASN A 1 56 ? 11.401  0.716   5.093   1.00 4.70  ? 56 ASN A CG   9  
ATOM   10056 O OD1  . ASN A 1 56 ? 11.895  0.854   3.990   1.00 4.90  ? 56 ASN A OD1  9  
ATOM   10057 N ND2  . ASN A 1 56 ? 11.726  1.532   6.059   1.00 5.15  ? 56 ASN A ND2  9  
ATOM   10058 H H    . ASN A 1 56 ? 7.952   -0.624  6.365   1.00 4.12  ? 56 ASN A H    9  
ATOM   10059 H HA   . ASN A 1 56 ? 9.198   0.776   4.068   1.00 4.07  ? 56 ASN A HA   9  
ATOM   10060 H HB2  . ASN A 1 56 ? 10.189  -0.465  6.415   1.00 4.38  ? 56 ASN A HB2  9  
ATOM   10061 H HB3  . ASN A 1 56 ? 10.814  -1.345  5.027   1.00 4.36  ? 56 ASN A HB3  9  
ATOM   10062 H HD21 . ASN A 1 56 ? 11.332  1.422   6.949   1.00 5.31  ? 56 ASN A HD21 9  
ATOM   10063 H HD22 . ASN A 1 56 ? 12.367  2.256   5.893   1.00 5.51  ? 56 ASN A HD22 9  
ATOM   10064 N N    . TRP A 1 57 ? 7.929   -2.181  3.981   1.00 3.55  ? 57 TRP A N    9  
ATOM   10065 C CA   . TRP A 1 57 ? 7.617   -3.319  3.087   1.00 3.47  ? 57 TRP A CA   9  
ATOM   10066 C C    . TRP A 1 57 ? 6.724   -2.849  1.942   1.00 3.28  ? 57 TRP A C    9  
ATOM   10067 O O    . TRP A 1 57 ? 6.874   -3.284  0.824   1.00 3.48  ? 57 TRP A O    9  
ATOM   10068 C CB   . TRP A 1 57 ? 6.940   -4.437  3.891   1.00 3.64  ? 57 TRP A CB   9  
ATOM   10069 C CG   . TRP A 1 57 ? 5.528   -4.107  4.244   1.00 3.70  ? 57 TRP A CG   9  
ATOM   10070 C CD1  . TRP A 1 57 ? 5.135   -3.633  5.433   1.00 4.08  ? 57 TRP A CD1  9  
ATOM   10071 C CD2  . TRP A 1 57 ? 4.318   -4.242  3.437   1.00 3.51  ? 57 TRP A CD2  9  
ATOM   10072 N NE1  . TRP A 1 57 ? 3.764   -3.492  5.429   1.00 4.20  ? 57 TRP A NE1  9  
ATOM   10073 C CE2  . TRP A 1 57 ? 3.214   -3.840  4.219   1.00 3.80  ? 57 TRP A CE2  9  
ATOM   10074 C CE3  . TRP A 1 57 ? 4.075   -4.670  2.123   1.00 3.27  ? 57 TRP A CE3  9  
ATOM   10075 C CZ2  . TRP A 1 57 ? 1.912   -3.862  3.719   1.00 3.76  ? 57 TRP A CZ2  9  
ATOM   10076 C CZ3  . TRP A 1 57 ? 2.768   -4.688  1.614   1.00 3.17  ? 57 TRP A CZ3  9  
ATOM   10077 C CH2  . TRP A 1 57 ? 1.688   -4.284  2.409   1.00 3.38  ? 57 TRP A CH2  9  
ATOM   10078 H H    . TRP A 1 57 ? 7.458   -2.097  4.827   1.00 3.59  ? 57 TRP A H    9  
ATOM   10079 H HA   . TRP A 1 57 ? 8.537   -3.691  2.681   1.00 3.59  ? 57 TRP A HA   9  
ATOM   10080 H HB2  . TRP A 1 57 ? 6.942   -5.333  3.322   1.00 3.77  ? 57 TRP A HB2  9  
ATOM   10081 H HB3  . TRP A 1 57 ? 7.501   -4.598  4.796   1.00 3.78  ? 57 TRP A HB3  9  
ATOM   10082 H HD1  . TRP A 1 57 ? 5.785   -3.414  6.259   1.00 4.35  ? 57 TRP A HD1  9  
ATOM   10083 H HE1  . TRP A 1 57 ? 3.234   -3.182  6.179   1.00 4.57  ? 57 TRP A HE1  9  
ATOM   10084 H HE3  . TRP A 1 57 ? 4.897   -4.983  1.502   1.00 3.29  ? 57 TRP A HE3  9  
ATOM   10085 H HZ2  . TRP A 1 57 ? 1.086   -3.548  4.340   1.00 4.10  ? 57 TRP A HZ2  9  
ATOM   10086 H HZ3  . TRP A 1 57 ? 2.596   -5.005  0.601   1.00 3.03  ? 57 TRP A HZ3  9  
ATOM   10087 H HH2  . TRP A 1 57 ? 0.684   -4.300  2.010   1.00 3.37  ? 57 TRP A HH2  9  
ATOM   10088 N N    . VAL A 1 58 ? 5.806   -1.958  2.209   1.00 3.02  ? 58 VAL A N    9  
ATOM   10089 C CA   . VAL A 1 58 ? 4.916   -1.452  1.121   1.00 2.84  ? 58 VAL A CA   9  
ATOM   10090 C C    . VAL A 1 58 ? 5.765   -0.695  0.091   1.00 2.99  ? 58 VAL A C    9  
ATOM   10091 O O    . VAL A 1 58 ? 5.595   -0.861  -1.102  1.00 3.21  ? 58 VAL A O    9  
ATOM   10092 C CB   . VAL A 1 58 ? 3.862   -0.516  1.728   1.00 2.78  ? 58 VAL A CB   9  
ATOM   10093 C CG1  . VAL A 1 58 ? 3.339   0.465   0.676   1.00 2.80  ? 58 VAL A CG1  9  
ATOM   10094 C CG2  . VAL A 1 58 ? 2.696   -1.336  2.266   1.00 2.85  ? 58 VAL A CG2  9  
ATOM   10095 H H    . VAL A 1 58 ? 5.709   -1.617  3.127   1.00 3.04  ? 58 VAL A H    9  
ATOM   10096 H HA   . VAL A 1 58 ? 4.432   -2.287  0.637   1.00 2.96  ? 58 VAL A HA   9  
ATOM   10097 H HB   . VAL A 1 58 ? 4.307   0.033   2.536   1.00 3.12  ? 58 VAL A HB   9  
ATOM   10098 H HG11 . VAL A 1 58 ? 3.205   -0.050  -0.263  1.00 2.86  ? 58 VAL A HG11 9  
ATOM   10099 H HG12 . VAL A 1 58 ? 2.394   0.872   1.003   1.00 3.08  ? 58 VAL A HG12 9  
ATOM   10100 H HG13 . VAL A 1 58 ? 4.051   1.268   0.549   1.00 3.10  ? 58 VAL A HG13 9  
ATOM   10101 H HG21 . VAL A 1 58 ? 2.495   -2.159  1.597   1.00 2.93  ? 58 VAL A HG21 9  
ATOM   10102 H HG22 . VAL A 1 58 ? 2.950   -1.717  3.242   1.00 3.15  ? 58 VAL A HG22 9  
ATOM   10103 H HG23 . VAL A 1 58 ? 1.820   -0.711  2.343   1.00 3.17  ? 58 VAL A HG23 9  
ATOM   10104 N N    . GLN A 1 59 ? 6.680   0.129   0.545   1.00 3.12  ? 59 GLN A N    9  
ATOM   10105 C CA   . GLN A 1 59 ? 7.543   0.892   -0.400  1.00 3.61  ? 59 GLN A CA   9  
ATOM   10106 C C    . GLN A 1 59 ? 8.609   -0.036  -1.010  1.00 3.90  ? 59 GLN A C    9  
ATOM   10107 O O    . GLN A 1 59 ? 9.040   0.166   -2.131  1.00 4.47  ? 59 GLN A O    9  
ATOM   10108 C CB   . GLN A 1 59 ? 8.196   2.060   0.336   1.00 3.82  ? 59 GLN A CB   9  
ATOM   10109 C CG   . GLN A 1 59 ? 9.123   1.523   1.415   1.00 4.33  ? 59 GLN A CG   9  
ATOM   10110 C CD   . GLN A 1 59 ? 9.716   2.685   2.218   1.00 4.72  ? 59 GLN A CD   9  
ATOM   10111 O OE1  . GLN A 1 59 ? 10.803  3.143   1.932   1.00 4.84  ? 59 GLN A OE1  9  
ATOM   10112 N NE2  . GLN A 1 59 ? 9.043   3.184   3.222   1.00 5.29  ? 59 GLN A NE2  9  
ATOM   10113 H H    . GLN A 1 59 ? 6.802   0.242   1.510   1.00 3.04  ? 59 GLN A H    9  
ATOM   10114 H HA   . GLN A 1 59 ? 6.936   1.279   -1.186  1.00 3.80  ? 59 GLN A HA   9  
ATOM   10115 H HB2  . GLN A 1 59 ? 8.759   2.652   -0.361  1.00 3.96  ? 59 GLN A HB2  9  
ATOM   10116 H HB3  . GLN A 1 59 ? 7.431   2.670   0.793   1.00 3.78  ? 59 GLN A HB3  9  
ATOM   10117 H HG2  . GLN A 1 59 ? 8.561   0.876   2.067   1.00 4.58  ? 59 GLN A HG2  9  
ATOM   10118 H HG3  . GLN A 1 59 ? 9.914   0.964   0.947   1.00 4.52  ? 59 GLN A HG3  9  
ATOM   10119 H HE21 . GLN A 1 59 ? 8.165   2.816   3.457   1.00 5.47  ? 59 GLN A HE21 9  
ATOM   10120 H HE22 . GLN A 1 59 ? 9.417   3.927   3.741   1.00 5.70  ? 59 GLN A HE22 9  
ATOM   10121 N N    . ARG A 1 60 ? 9.015   -1.066  -0.298  1.00 3.65  ? 60 ARG A N    9  
ATOM   10122 C CA   . ARG A 1 60 ? 10.025  -2.016  -0.853  1.00 3.97  ? 60 ARG A CA   9  
ATOM   10123 C C    . ARG A 1 60 ? 9.307   -2.970  -1.809  1.00 3.96  ? 60 ARG A C    9  
ATOM   10124 O O    . ARG A 1 60 ? 9.824   -3.321  -2.853  1.00 4.42  ? 60 ARG A O    9  
ATOM   10125 C CB   . ARG A 1 60 ? 10.671  -2.818  0.284   1.00 4.07  ? 60 ARG A CB   9  
ATOM   10126 C CG   . ARG A 1 60 ? 11.906  -2.074  0.802   1.00 4.60  ? 60 ARG A CG   9  
ATOM   10127 C CD   . ARG A 1 60 ? 12.181  -2.477  2.254   1.00 4.81  ? 60 ARG A CD   9  
ATOM   10128 N NE   . ARG A 1 60 ? 13.504  -3.159  2.345   1.00 5.26  ? 60 ARG A NE   9  
ATOM   10129 C CZ   . ARG A 1 60 ? 14.597  -2.454  2.490   1.00 5.84  ? 60 ARG A CZ   9  
ATOM   10130 N NH1  . ARG A 1 60 ? 14.914  -1.975  3.667   1.00 6.35  ? 60 ARG A NH1  9  
ATOM   10131 N NH2  . ARG A 1 60 ? 15.371  -2.230  1.458   1.00 6.25  ? 60 ARG A NH2  9  
ATOM   10132 H H    . ARG A 1 60 ? 8.634   -1.228  0.590   1.00 3.35  ? 60 ARG A H    9  
ATOM   10133 H HA   . ARG A 1 60 ? 10.784  -1.468  -1.390  1.00 4.24  ? 60 ARG A HA   9  
ATOM   10134 H HB2  . ARG A 1 60 ? 9.959   -2.941  1.087   1.00 3.95  ? 60 ARG A HB2  9  
ATOM   10135 H HB3  . ARG A 1 60 ? 10.966  -3.788  -0.084  1.00 4.07  ? 60 ARG A HB3  9  
ATOM   10136 H HG2  . ARG A 1 60 ? 12.760  -2.328  0.190   1.00 4.80  ? 60 ARG A HG2  9  
ATOM   10137 H HG3  . ARG A 1 60 ? 11.732  -1.010  0.752   1.00 4.99  ? 60 ARG A HG3  9  
ATOM   10138 H HD2  . ARG A 1 60 ? 12.190  -1.593  2.875   1.00 4.73  ? 60 ARG A HD2  9  
ATOM   10139 H HD3  . ARG A 1 60 ? 11.406  -3.147  2.596   1.00 5.10  ? 60 ARG A HD3  9  
ATOM   10140 H HE   . ARG A 1 60 ? 13.555  -4.137  2.298   1.00 5.37  ? 60 ARG A HE   9  
ATOM   10141 H HH11 . ARG A 1 60 ? 14.322  -2.147  4.455   1.00 6.32  ? 60 ARG A HH11 9  
ATOM   10142 H HH12 . ARG A 1 60 ? 15.750  -1.436  3.780   1.00 6.96  ? 60 ARG A HH12 9  
ATOM   10143 H HH21 . ARG A 1 60 ? 15.126  -2.597  0.560   1.00 6.14  ? 60 ARG A HH21 9  
ATOM   10144 H HH22 . ARG A 1 60 ? 16.206  -1.691  1.566   1.00 6.86  ? 60 ARG A HH22 9  
ATOM   10145 N N    . VAL A 1 61 ? 8.107   -3.376  -1.457  1.00 3.58  ? 61 VAL A N    9  
ATOM   10146 C CA   . VAL A 1 61 ? 7.325   -4.291  -2.337  1.00 3.55  ? 61 VAL A CA   9  
ATOM   10147 C C    . VAL A 1 61 ? 7.025   -3.577  -3.662  1.00 3.25  ? 61 VAL A C    9  
ATOM   10148 O O    . VAL A 1 61 ? 7.127   -4.162  -4.722  1.00 3.52  ? 61 VAL A O    9  
ATOM   10149 C CB   . VAL A 1 61 ? 6.013   -4.664  -1.628  1.00 3.59  ? 61 VAL A CB   9  
ATOM   10150 C CG1  . VAL A 1 61 ? 4.988   -5.162  -2.643  1.00 3.56  ? 61 VAL A CG1  9  
ATOM   10151 C CG2  . VAL A 1 61 ? 6.288   -5.766  -0.601  1.00 4.31  ? 61 VAL A CG2  9  
ATOM   10152 H H    . VAL A 1 61 ? 7.712   -3.066  -0.607  1.00 3.39  ? 61 VAL A H    9  
ATOM   10153 H HA   . VAL A 1 61 ? 7.900   -5.180  -2.533  1.00 3.93  ? 61 VAL A HA   9  
ATOM   10154 H HB   . VAL A 1 61 ? 5.620   -3.794  -1.123  1.00 3.40  ? 61 VAL A HB   9  
ATOM   10155 H HG11 . VAL A 1 61 ? 5.488   -5.744  -3.400  1.00 3.52  ? 61 VAL A HG11 9  
ATOM   10156 H HG12 . VAL A 1 61 ? 4.253   -5.774  -2.142  1.00 3.73  ? 61 VAL A HG12 9  
ATOM   10157 H HG13 . VAL A 1 61 ? 4.498   -4.315  -3.102  1.00 3.88  ? 61 VAL A HG13 9  
ATOM   10158 H HG21 . VAL A 1 61 ? 7.081   -5.451  0.060   1.00 4.58  ? 61 VAL A HG21 9  
ATOM   10159 H HG22 . VAL A 1 61 ? 5.394   -5.952  -0.025  1.00 4.75  ? 61 VAL A HG22 9  
ATOM   10160 H HG23 . VAL A 1 61 ? 6.583   -6.670  -1.112  1.00 4.45  ? 61 VAL A HG23 9  
ATOM   10161 N N    . VAL A 1 62 ? 6.668   -2.315  -3.603  1.00 2.99  ? 62 VAL A N    9  
ATOM   10162 C CA   . VAL A 1 62 ? 6.373   -1.548  -4.853  1.00 3.22  ? 62 VAL A CA   9  
ATOM   10163 C C    . VAL A 1 62 ? 7.649   -1.453  -5.702  1.00 3.80  ? 62 VAL A C    9  
ATOM   10164 O O    . VAL A 1 62 ? 7.613   -1.637  -6.905  1.00 4.15  ? 62 VAL A O    9  
ATOM   10165 C CB   . VAL A 1 62 ? 5.882   -0.138  -4.485  1.00 3.53  ? 62 VAL A CB   9  
ATOM   10166 C CG1  . VAL A 1 62 ? 5.860   0.755   -5.730  1.00 4.40  ? 62 VAL A CG1  9  
ATOM   10167 C CG2  . VAL A 1 62 ? 4.465   -0.224  -3.904  1.00 3.34  ? 62 VAL A CG2  9  
ATOM   10168 H H    . VAL A 1 62 ? 6.605   -1.869  -2.731  1.00 2.92  ? 62 VAL A H    9  
ATOM   10169 H HA   . VAL A 1 62 ? 5.606   -2.062  -5.415  1.00 3.17  ? 62 VAL A HA   9  
ATOM   10170 H HB   . VAL A 1 62 ? 6.546   0.290   -3.749  1.00 3.69  ? 62 VAL A HB   9  
ATOM   10171 H HG11 . VAL A 1 62 ? 5.389   0.227   -6.547  1.00 4.71  ? 62 VAL A HG11 9  
ATOM   10172 H HG12 . VAL A 1 62 ? 5.305   1.657   -5.517  1.00 4.59  ? 62 VAL A HG12 9  
ATOM   10173 H HG13 . VAL A 1 62 ? 6.872   1.013   -6.005  1.00 4.91  ? 62 VAL A HG13 9  
ATOM   10174 H HG21 . VAL A 1 62 ? 4.334   -1.177  -3.412  1.00 3.11  ? 62 VAL A HG21 9  
ATOM   10175 H HG22 . VAL A 1 62 ? 4.323   0.573   -3.190  1.00 3.80  ? 62 VAL A HG22 9  
ATOM   10176 H HG23 . VAL A 1 62 ? 3.742   -0.128  -4.701  1.00 3.53  ? 62 VAL A HG23 9  
ATOM   10177 N N    . GLU A 1 63 ? 8.776   -1.166  -5.085  1.00 4.04  ? 63 GLU A N    9  
ATOM   10178 C CA   . GLU A 1 63 ? 10.050  -1.060  -5.850  1.00 4.68  ? 63 GLU A CA   9  
ATOM   10179 C C    . GLU A 1 63 ? 10.400  -2.419  -6.470  1.00 4.70  ? 63 GLU A C    9  
ATOM   10180 O O    . GLU A 1 63 ? 10.762  -2.497  -7.628  1.00 5.23  ? 63 GLU A O    9  
ATOM   10181 C CB   . GLU A 1 63 ? 11.183  -0.610  -4.920  1.00 5.11  ? 63 GLU A CB   9  
ATOM   10182 C CG   . GLU A 1 63 ? 12.150  0.291   -5.696  1.00 5.73  ? 63 GLU A CG   9  
ATOM   10183 C CD   . GLU A 1 63 ? 13.575  0.106   -5.164  1.00 6.00  ? 63 GLU A CD   9  
ATOM   10184 O OE1  . GLU A 1 63 ? 14.163  -0.926  -5.446  1.00 6.04  ? 63 GLU A OE1  9  
ATOM   10185 O OE2  . GLU A 1 63 ? 14.055  1.003   -4.489  1.00 6.46  ? 63 GLU A OE2  9  
ATOM   10186 H H    . GLU A 1 63 ? 8.780   -1.018  -4.120  1.00 3.89  ? 63 GLU A H    9  
ATOM   10187 H HA   . GLU A 1 63 ? 9.923   -0.334  -6.633  1.00 5.00  ? 63 GLU A HA   9  
ATOM   10188 H HB2  . GLU A 1 63 ? 10.768  -0.060  -4.087  1.00 4.92  ? 63 GLU A HB2  9  
ATOM   10189 H HB3  . GLU A 1 63 ? 11.714  -1.475  -4.553  1.00 5.36  ? 63 GLU A HB3  9  
ATOM   10190 H HG2  . GLU A 1 63 ? 12.121  0.029   -6.744  1.00 5.98  ? 63 GLU A HG2  9  
ATOM   10191 H HG3  . GLU A 1 63 ? 11.854  1.323   -5.575  1.00 6.04  ? 63 GLU A HG3  9  
ATOM   10192 N N    . LYS A 1 64 ? 10.288  -3.488  -5.714  1.00 4.35  ? 64 LYS A N    9  
ATOM   10193 C CA   . LYS A 1 64 ? 10.602  -4.838  -6.265  1.00 4.71  ? 64 LYS A CA   9  
ATOM   10194 C C    . LYS A 1 64 ? 9.558   -5.217  -7.329  1.00 4.54  ? 64 LYS A C    9  
ATOM   10195 O O    . LYS A 1 64 ? 9.851   -5.943  -8.262  1.00 5.00  ? 64 LYS A O    9  
ATOM   10196 C CB   . LYS A 1 64 ? 10.584  -5.873  -5.134  1.00 4.74  ? 64 LYS A CB   9  
ATOM   10197 C CG   . LYS A 1 64 ? 11.517  -7.036  -5.485  1.00 5.62  ? 64 LYS A CG   9  
ATOM   10198 C CD   . LYS A 1 64 ? 11.794  -7.870  -4.229  1.00 6.24  ? 64 LYS A CD   9  
ATOM   10199 C CE   . LYS A 1 64 ? 13.178  -8.517  -4.337  1.00 7.07  ? 64 LYS A CE   9  
ATOM   10200 N NZ   . LYS A 1 64 ? 13.756  -8.693  -2.974  1.00 7.79  ? 64 LYS A NZ   9  
ATOM   10201 H H    . LYS A 1 64 ? 9.992   -3.405  -4.788  1.00 4.03  ? 64 LYS A H    9  
ATOM   10202 H HA   . LYS A 1 64 ? 11.579  -4.812  -6.711  1.00 5.26  ? 64 LYS A HA   9  
ATOM   10203 H HB2  . LYS A 1 64 ? 10.917  -5.408  -4.217  1.00 4.73  ? 64 LYS A HB2  9  
ATOM   10204 H HB3  . LYS A 1 64 ? 9.579   -6.246  -5.004  1.00 4.49  ? 64 LYS A HB3  9  
ATOM   10205 H HG2  . LYS A 1 64 ? 11.049  -7.658  -6.234  1.00 6.07  ? 64 LYS A HG2  9  
ATOM   10206 H HG3  . LYS A 1 64 ? 12.448  -6.648  -5.868  1.00 5.69  ? 64 LYS A HG3  9  
ATOM   10207 H HD2  . LYS A 1 64 ? 11.761  -7.230  -3.359  1.00 6.22  ? 64 LYS A HD2  9  
ATOM   10208 H HD3  . LYS A 1 64 ? 11.043  -8.641  -4.137  1.00 6.45  ? 64 LYS A HD3  9  
ATOM   10209 H HE2  . LYS A 1 64 ? 13.086  -9.482  -4.815  1.00 7.40  ? 64 LYS A HE2  9  
ATOM   10210 H HE3  . LYS A 1 64 ? 13.826  -7.885  -4.925  1.00 7.09  ? 64 LYS A HE3  9  
ATOM   10211 H HZ1  . LYS A 1 64 ? 13.127  -9.291  -2.402  1.00 8.09  ? 64 LYS A HZ1  9  
ATOM   10212 H HZ2  . LYS A 1 64 ? 14.690  -9.146  -3.051  1.00 8.07  ? 64 LYS A HZ2  9  
ATOM   10213 H HZ3  . LYS A 1 64 ? 13.858  -7.764  -2.517  1.00 7.96  ? 64 LYS A HZ3  9  
ATOM   10214 N N    . PHE A 1 65 ? 8.346   -4.725  -7.193  1.00 4.02  ? 65 PHE A N    9  
ATOM   10215 C CA   . PHE A 1 65 ? 7.274   -5.036  -8.179  1.00 3.99  ? 65 PHE A CA   9  
ATOM   10216 C C    . PHE A 1 65 ? 7.580   -4.349  -9.516  1.00 4.72  ? 65 PHE A C    9  
ATOM   10217 O O    . PHE A 1 65 ? 7.406   -4.928  -10.571 1.00 5.31  ? 65 PHE A O    9  
ATOM   10218 C CB   . PHE A 1 65 ? 5.945   -4.510  -7.634  1.00 3.16  ? 65 PHE A CB   9  
ATOM   10219 C CG   . PHE A 1 65 ? 4.787   -5.274  -8.237  1.00 3.02  ? 65 PHE A CG   9  
ATOM   10220 C CD1  . PHE A 1 65 ? 4.639   -6.646  -7.987  1.00 2.97  ? 65 PHE A CD1  9  
ATOM   10221 C CD2  . PHE A 1 65 ? 3.858   -4.607  -9.042  1.00 3.45  ? 65 PHE A CD2  9  
ATOM   10222 C CE1  . PHE A 1 65 ? 3.562   -7.346  -8.546  1.00 3.10  ? 65 PHE A CE1  9  
ATOM   10223 C CE2  . PHE A 1 65 ? 2.783   -5.308  -9.601  1.00 3.48  ? 65 PHE A CE2  9  
ATOM   10224 C CZ   . PHE A 1 65 ? 2.634   -6.677  -9.353  1.00 3.19  ? 65 PHE A CZ   9  
ATOM   10225 H H    . PHE A 1 65 ? 8.141   -4.141  -6.434  1.00 3.77  ? 65 PHE A H    9  
ATOM   10226 H HA   . PHE A 1 65 ? 7.209   -6.105  -8.325  1.00 4.30  ? 65 PHE A HA   9  
ATOM   10227 H HB2  . PHE A 1 65 ? 5.932   -4.623  -6.563  1.00 2.82  ? 65 PHE A HB2  9  
ATOM   10228 H HB3  . PHE A 1 65 ? 5.852   -3.464  -7.879  1.00 3.27  ? 65 PHE A HB3  9  
ATOM   10229 H HD1  . PHE A 1 65 ? 5.356   -7.164  -7.365  1.00 3.21  ? 65 PHE A HD1  9  
ATOM   10230 H HD2  . PHE A 1 65 ? 3.972   -3.552  -9.233  1.00 4.00  ? 65 PHE A HD2  9  
ATOM   10231 H HE1  . PHE A 1 65 ? 3.447   -8.402  -8.354  1.00 3.46  ? 65 PHE A HE1  9  
ATOM   10232 H HE2  . PHE A 1 65 ? 2.067   -4.791  -10.223 1.00 4.01  ? 65 PHE A HE2  9  
ATOM   10233 H HZ   . PHE A 1 65 ? 1.805   -7.217  -9.784  1.00 3.41  ? 65 PHE A HZ   9  
ATOM   10234 N N    . LEU A 1 66 ? 8.031   -3.116  -9.475  1.00 4.92  ? 66 LEU A N    9  
ATOM   10235 C CA   . LEU A 1 66 ? 8.345   -2.388  -10.740 1.00 5.86  ? 66 LEU A CA   9  
ATOM   10236 C C    . LEU A 1 66 ? 9.794   -2.677  -11.149 1.00 6.61  ? 66 LEU A C    9  
ATOM   10237 O O    . LEU A 1 66 ? 10.039  -3.369  -12.119 1.00 7.33  ? 66 LEU A O    9  
ATOM   10238 C CB   . LEU A 1 66 ? 8.155   -0.880  -10.528 1.00 6.18  ? 66 LEU A CB   9  
ATOM   10239 C CG   . LEU A 1 66 ? 6.660   -0.553  -10.463 1.00 7.14  ? 66 LEU A CG   9  
ATOM   10240 C CD1  . LEU A 1 66 ? 6.447   0.692   -9.598  1.00 7.61  ? 66 LEU A CD1  9  
ATOM   10241 C CD2  . LEU A 1 66 ? 6.132   -0.288  -11.876 1.00 7.67  ? 66 LEU A CD2  9  
ATOM   10242 H H    . LEU A 1 66 ? 8.161   -2.670  -8.608  1.00 4.58  ? 66 LEU A H    9  
ATOM   10243 H HA   . LEU A 1 66 ? 7.680   -2.726  -11.522 1.00 6.03  ? 66 LEU A HA   9  
ATOM   10244 H HB2  . LEU A 1 66 ? 8.630   -0.584  -9.604  1.00 5.67  ? 66 LEU A HB2  9  
ATOM   10245 H HB3  . LEU A 1 66 ? 8.603   -0.342  -11.351 1.00 6.42  ? 66 LEU A HB3  9  
ATOM   10246 H HG   . LEU A 1 66 ? 6.129   -1.386  -10.027 1.00 7.39  ? 66 LEU A HG   9  
ATOM   10247 H HD11 . LEU A 1 66 ? 7.035   1.509   -9.990  1.00 7.94  ? 66 LEU A HD11 9  
ATOM   10248 H HD12 . LEU A 1 66 ? 5.402   0.963   -9.609  1.00 7.49  ? 66 LEU A HD12 9  
ATOM   10249 H HD13 . LEU A 1 66 ? 6.754   0.482   -8.583  1.00 8.02  ? 66 LEU A HD13 9  
ATOM   10250 H HD21 . LEU A 1 66 ? 6.309   -1.156  -12.495 1.00 7.67  ? 66 LEU A HD21 9  
ATOM   10251 H HD22 . LEU A 1 66 ? 5.071   -0.089  -11.832 1.00 8.14  ? 66 LEU A HD22 9  
ATOM   10252 H HD23 . LEU A 1 66 ? 6.640   0.565   -12.298 1.00 7.84  ? 66 LEU A HD23 9  
ATOM   10253 N N    . LYS A 1 67 ? 10.751  -2.159  -10.412 1.00 6.57  ? 67 LYS A N    9  
ATOM   10254 C CA   . LYS A 1 67 ? 12.192  -2.402  -10.748 1.00 7.47  ? 67 LYS A CA   9  
ATOM   10255 C C    . LYS A 1 67 ? 13.091  -1.742  -9.693  1.00 7.85  ? 67 LYS A C    9  
ATOM   10256 O O    . LYS A 1 67 ? 13.729  -2.416  -8.904  1.00 8.14  ? 67 LYS A O    9  
ATOM   10257 C CB   . LYS A 1 67 ? 12.511  -1.815  -12.133 1.00 7.84  ? 67 LYS A CB   9  
ATOM   10258 C CG   . LYS A 1 67 ? 13.424  -2.775  -12.904 1.00 8.78  ? 67 LYS A CG   9  
ATOM   10259 C CD   . LYS A 1 67 ? 12.589  -3.603  -13.886 1.00 9.42  ? 67 LYS A CD   9  
ATOM   10260 C CE   . LYS A 1 67 ? 13.458  -4.023  -15.076 1.00 10.12 ? 67 LYS A CE   9  
ATOM   10261 N NZ   . LYS A 1 67 ? 14.114  -5.331  -14.783 1.00 10.40 ? 67 LYS A NZ   9  
ATOM   10262 H H    . LYS A 1 67 ? 10.518  -1.612  -9.630  1.00 6.04  ? 67 LYS A H    9  
ATOM   10263 H HA   . LYS A 1 67 ? 12.379  -3.467  -10.759 1.00 7.85  ? 67 LYS A HA   9  
ATOM   10264 H HB2  . LYS A 1 67 ? 11.594  -1.670  -12.683 1.00 7.78  ? 67 LYS A HB2  9  
ATOM   10265 H HB3  . LYS A 1 67 ? 13.012  -0.866  -12.015 1.00 7.75  ? 67 LYS A HB3  9  
ATOM   10266 H HG2  . LYS A 1 67 ? 14.164  -2.206  -13.450 1.00 9.30  ? 67 LYS A HG2  9  
ATOM   10267 H HG3  . LYS A 1 67 ? 13.921  -3.436  -12.210 1.00 8.71  ? 67 LYS A HG3  9  
ATOM   10268 H HD2  . LYS A 1 67 ? 12.214  -4.483  -13.385 1.00 9.58  ? 67 LYS A HD2  9  
ATOM   10269 H HD3  . LYS A 1 67 ? 11.759  -3.010  -14.242 1.00 9.47  ? 67 LYS A HD3  9  
ATOM   10270 H HE2  . LYS A 1 67 ? 12.840  -4.121  -15.955 1.00 10.35 ? 67 LYS A HE2  9  
ATOM   10271 H HE3  . LYS A 1 67 ? 14.215  -3.272  -15.252 1.00 10.41 ? 67 LYS A HE3  9  
ATOM   10272 H HZ1  . LYS A 1 67 ? 13.385  -6.054  -14.610 1.00 10.49 ? 67 LYS A HZ1  9  
ATOM   10273 H HZ2  . LYS A 1 67 ? 14.697  -5.615  -15.594 1.00 10.60 ? 67 LYS A HZ2  9  
ATOM   10274 H HZ3  . LYS A 1 67 ? 14.717  -5.238  -13.941 1.00 10.51 ? 67 LYS A HZ3  9  
ATOM   10275 N N    . ARG A 1 68 ? 13.151  -0.429  -9.678  1.00 8.12  ? 68 ARG A N    9  
ATOM   10276 C CA   . ARG A 1 68 ? 14.014  0.282   -8.683  1.00 8.78  ? 68 ARG A CA   9  
ATOM   10277 C C    . ARG A 1 68 ? 13.550  1.737   -8.539  1.00 8.99  ? 68 ARG A C    9  
ATOM   10278 O O    . ARG A 1 68 ? 12.766  2.229   -9.330  1.00 8.81  ? 68 ARG A O    9  
ATOM   10279 C CB   . ARG A 1 68 ? 15.482  0.260   -9.142  1.00 9.33  ? 68 ARG A CB   9  
ATOM   10280 C CG   . ARG A 1 68 ? 15.567  0.433   -10.664 1.00 9.61  ? 68 ARG A CG   9  
ATOM   10281 C CD   . ARG A 1 68 ? 17.035  0.456   -11.097 1.00 10.05 ? 68 ARG A CD   9  
ATOM   10282 N NE   . ARG A 1 68 ? 17.158  -0.124  -12.465 1.00 10.53 ? 68 ARG A NE   9  
ATOM   10283 C CZ   . ARG A 1 68 ? 17.596  0.612   -13.454 1.00 10.90 ? 68 ARG A CZ   9  
ATOM   10284 N NH1  . ARG A 1 68 ? 16.756  1.324   -14.159 1.00 11.35 ? 68 ARG A NH1  9  
ATOM   10285 N NH2  . ARG A 1 68 ? 18.874  0.635   -13.735 1.00 11.02 ? 68 ARG A NH2  9  
ATOM   10286 H H    . ARG A 1 68 ? 12.630  0.089   -10.327 1.00 8.08  ? 68 ARG A H    9  
ATOM   10287 H HA   . ARG A 1 68 ? 13.933  -0.212  -7.727  1.00 9.01  ? 68 ARG A HA   9  
ATOM   10288 H HB2  . ARG A 1 68 ? 16.018  1.065   -8.660  1.00 9.69  ? 68 ARG A HB2  9  
ATOM   10289 H HB3  . ARG A 1 68 ? 15.927  -0.681  -8.863  1.00 9.41  ? 68 ARG A HB3  9  
ATOM   10290 H HG2  . ARG A 1 68 ? 15.063  -0.391  -11.149 1.00 9.48  ? 68 ARG A HG2  9  
ATOM   10291 H HG3  . ARG A 1 68 ? 15.096  1.362   -10.949 1.00 9.87  ? 68 ARG A HG3  9  
ATOM   10292 H HD2  . ARG A 1 68 ? 17.392  1.476   -11.105 1.00 10.14 ? 68 ARG A HD2  9  
ATOM   10293 H HD3  . ARG A 1 68 ? 17.625  -0.126  -10.405 1.00 10.14 ? 68 ARG A HD3  9  
ATOM   10294 H HE   . ARG A 1 68 ? 16.910  -1.060  -12.624 1.00 10.72 ? 68 ARG A HE   9  
ATOM   10295 H HH11 . ARG A 1 68 ? 15.779  1.305   -13.944 1.00 11.42 ? 68 ARG A HH11 9  
ATOM   10296 H HH12 . ARG A 1 68 ? 17.089  1.887   -14.917 1.00 11.76 ? 68 ARG A HH12 9  
ATOM   10297 H HH21 . ARG A 1 68 ? 19.516  0.090   -13.195 1.00 10.82 ? 68 ARG A HH21 9  
ATOM   10298 H HH22 . ARG A 1 68 ? 19.210  1.197   -14.491 1.00 11.44 ? 68 ARG A HH22 9  
ATOM   10299 N N    . ALA A 1 69 ? 14.034  2.425   -7.532  1.00 9.61  ? 69 ALA A N    9  
ATOM   10300 C CA   . ALA A 1 69 ? 13.627  3.851   -7.328  1.00 10.14 ? 69 ALA A CA   9  
ATOM   10301 C C    . ALA A 1 69 ? 14.576  4.533   -6.333  1.00 10.89 ? 69 ALA A C    9  
ATOM   10302 O O    . ALA A 1 69 ? 15.158  3.893   -5.476  1.00 11.20 ? 69 ALA A O    9  
ATOM   10303 C CB   . ALA A 1 69 ? 12.198  3.902   -6.777  1.00 10.08 ? 69 ALA A CB   9  
ATOM   10304 H H    . ALA A 1 69 ? 14.666  2.002   -6.913  1.00 9.89  ? 69 ALA A H    9  
ATOM   10305 H HA   . ALA A 1 69 ? 13.665  4.373   -8.272  1.00 10.27 ? 69 ALA A HA   9  
ATOM   10306 H HB1  . ALA A 1 69 ? 11.625  3.083   -7.185  1.00 10.12 ? 69 ALA A HB1  9  
ATOM   10307 H HB2  . ALA A 1 69 ? 12.224  3.825   -5.701  1.00 10.18 ? 69 ALA A HB2  9  
ATOM   10308 H HB3  . ALA A 1 69 ? 11.739  4.838   -7.060  1.00 10.12 ? 69 ALA A HB3  9  
ATOM   10309 N N    . GLU A 1 70 ? 14.723  5.834   -6.439  1.00 11.37 ? 70 GLU A N    9  
ATOM   10310 C CA   . GLU A 1 70 ? 15.622  6.577   -5.500  1.00 12.24 ? 70 GLU A CA   9  
ATOM   10311 C C    . GLU A 1 70 ? 14.777  7.216   -4.388  1.00 12.45 ? 70 GLU A C    9  
ATOM   10312 O O    . GLU A 1 70 ? 13.630  6.857   -4.185  1.00 12.32 ? 70 GLU A O    9  
ATOM   10313 C CB   . GLU A 1 70 ? 16.381  7.675   -6.262  1.00 12.79 ? 70 GLU A CB   9  
ATOM   10314 C CG   . GLU A 1 70 ? 16.990  7.104   -7.547  1.00 12.48 ? 70 GLU A CG   9  
ATOM   10315 C CD   . GLU A 1 70 ? 17.861  8.172   -8.218  1.00 13.18 ? 70 GLU A CD   9  
ATOM   10316 O OE1  . GLU A 1 70 ? 19.028  8.259   -7.873  1.00 13.39 ? 70 GLU A OE1  9  
ATOM   10317 O OE2  . GLU A 1 70 ? 17.346  8.884   -9.065  1.00 13.63 ? 70 GLU A OE2  9  
ATOM   10318 H H    . GLU A 1 70 ? 14.233  6.324   -7.134  1.00 11.26 ? 70 GLU A H    9  
ATOM   10319 H HA   . GLU A 1 70 ? 16.330  5.889   -5.061  1.00 12.53 ? 70 GLU A HA   9  
ATOM   10320 H HB2  . GLU A 1 70 ? 15.698  8.475   -6.510  1.00 13.03 ? 70 GLU A HB2  9  
ATOM   10321 H HB3  . GLU A 1 70 ? 17.170  8.061   -5.636  1.00 13.32 ? 70 GLU A HB3  9  
ATOM   10322 H HG2  . GLU A 1 70 ? 17.595  6.242   -7.307  1.00 12.20 ? 70 GLU A HG2  9  
ATOM   10323 H HG3  . GLU A 1 70 ? 16.199  6.813   -8.223  1.00 12.23 ? 70 GLU A HG3  9  
ATOM   10324 N N    . ASN A 1 71 ? 15.332  8.161   -3.665  1.00 12.96 ? 71 ASN A N    9  
ATOM   10325 C CA   . ASN A 1 71 ? 14.563  8.826   -2.567  1.00 13.39 ? 71 ASN A CA   9  
ATOM   10326 C C    . ASN A 1 71 ? 15.209  10.173  -2.220  1.00 13.77 ? 71 ASN A C    9  
ATOM   10327 O O    . ASN A 1 71 ? 16.408  10.344  -2.350  1.00 13.98 ? 71 ASN A O    9  
ATOM   10328 C CB   . ASN A 1 71 ? 14.549  7.923   -1.324  1.00 13.14 ? 71 ASN A CB   9  
ATOM   10329 C CG   . ASN A 1 71 ? 15.983  7.582   -0.901  1.00 12.70 ? 71 ASN A CG   9  
ATOM   10330 O OD1  . ASN A 1 71 ? 16.573  6.651   -1.413  1.00 12.77 ? 71 ASN A OD1  9  
ATOM   10331 N ND2  . ASN A 1 71 ? 16.571  8.300   0.018   1.00 12.41 ? 71 ASN A ND2  9  
ATOM   10332 H H    . ASN A 1 71 ? 16.256  8.435   -3.846  1.00 13.17 ? 71 ASN A H    9  
ATOM   10333 H HA   . ASN A 1 71 ? 13.549  8.994   -2.896  1.00 13.80 ? 71 ASN A HA   9  
ATOM   10334 H HB2  . ASN A 1 71 ? 14.050  8.438   -0.516  1.00 13.36 ? 71 ASN A HB2  9  
ATOM   10335 H HB3  . ASN A 1 71 ? 14.016  7.011   -1.550  1.00 13.26 ? 71 ASN A HB3  9  
ATOM   10336 H HD21 . ASN A 1 71 ? 16.096  9.050   0.434   1.00 12.47 ? 71 ASN A HD21 9  
ATOM   10337 H HD22 . ASN A 1 71 ? 17.487  8.087   0.294   1.00 12.23 ? 71 ASN A HD22 9  
ATOM   10338 N N    . SER A 1 72 ? 14.414  11.124  -1.778  1.00 14.02 ? 72 SER A N    9  
ATOM   10339 C CA   . SER A 1 72 ? 14.946  12.477  -1.407  1.00 14.59 ? 72 SER A CA   9  
ATOM   10340 C C    . SER A 1 72 ? 15.578  13.151  -2.640  1.00 15.09 ? 72 SER A C    9  
ATOM   10341 O O    . SER A 1 72 ? 16.794  13.113  -2.776  1.00 15.38 ? 72 SER A O    9  
ATOM   10342 C CB   . SER A 1 72 ? 15.977  12.339  -0.275  1.00 14.66 ? 72 SER A CB   9  
ATOM   10343 O OG   . SER A 1 72 ? 15.339  11.808  0.880   1.00 14.60 ? 72 SER A OG   9  
ATOM   10344 O OXT  . SER A 1 72 ? 14.828  13.696  -3.433  1.00 15.30 ? 72 SER A OXT  9  
ATOM   10345 H H    . SER A 1 72 ? 13.454  10.946  -1.686  1.00 13.94 ? 72 SER A H    9  
ATOM   10346 H HA   . SER A 1 72 ? 14.125  13.089  -1.060  1.00 14.77 ? 72 SER A HA   9  
ATOM   10347 H HB2  . SER A 1 72 ? 16.767  11.673  -0.581  1.00 14.69 ? 72 SER A HB2  9  
ATOM   10348 H HB3  . SER A 1 72 ? 16.398  13.312  -0.053  1.00 14.91 ? 72 SER A HB3  9  
ATOM   10349 H HG   . SER A 1 72 ? 15.664  12.287  1.645   1.00 14.50 ? 72 SER A HG   9  
ATOM   10350 N N    . GLU A 1 4  ? -8.384  15.500  -8.855  1.00 9.58  ? 4  GLU A N    10 
ATOM   10351 C CA   . GLU A 1 4  ? -9.849  15.776  -8.997  1.00 9.09  ? 4  GLU A CA   10 
ATOM   10352 C C    . GLU A 1 4  ? -10.641 15.050  -7.894  1.00 8.06  ? 4  GLU A C    10 
ATOM   10353 O O    . GLU A 1 4  ? -11.620 15.570  -7.391  1.00 8.10  ? 4  GLU A O    10 
ATOM   10354 C CB   . GLU A 1 4  ? -10.344 15.324  -10.384 1.00 9.77  ? 4  GLU A CB   10 
ATOM   10355 C CG   . GLU A 1 4  ? -10.168 13.808  -10.553 1.00 10.24 ? 4  GLU A CG   10 
ATOM   10356 C CD   . GLU A 1 4  ? -10.811 13.358  -11.866 1.00 11.04 ? 4  GLU A CD   10 
ATOM   10357 O OE1  . GLU A 1 4  ? -10.162 13.475  -12.893 1.00 11.49 ? 4  GLU A OE1  10 
ATOM   10358 O OE2  . GLU A 1 4  ? -11.942 12.901  -11.823 1.00 11.36 ? 4  GLU A OE2  10 
ATOM   10359 H H    . GLU A 1 4  ? -8.104  15.612  -7.862  1.00 9.61  ? 4  GLU A H    10 
ATOM   10360 H HA   . GLU A 1 4  ? -10.012 16.840  -8.897  1.00 9.22  ? 4  GLU A HA   10 
ATOM   10361 H HB2  . GLU A 1 4  ? -11.390 15.575  -10.487 1.00 9.96  ? 4  GLU A HB2  10 
ATOM   10362 H HB3  . GLU A 1 4  ? -9.777  15.836  -11.148 1.00 9.97  ? 4  GLU A HB3  10 
ATOM   10363 H HG2  . GLU A 1 4  ? -9.114  13.568  -10.568 1.00 10.27 ? 4  GLU A HG2  10 
ATOM   10364 H HG3  . GLU A 1 4  ? -10.641 13.295  -9.730  1.00 10.19 ? 4  GLU A HG3  10 
ATOM   10365 N N    . LEU A 1 5  ? -10.230 13.859  -7.517  1.00 7.36  ? 5  LEU A N    10 
ATOM   10366 C CA   . LEU A 1 5  ? -10.963 13.107  -6.452  1.00 6.53  ? 5  LEU A CA   10 
ATOM   10367 C C    . LEU A 1 5  ? -10.023 12.843  -5.271  1.00 6.17  ? 5  LEU A C    10 
ATOM   10368 O O    . LEU A 1 5  ? -8.853  12.558  -5.452  1.00 6.61  ? 5  LEU A O    10 
ATOM   10369 C CB   . LEU A 1 5  ? -11.460 11.774  -7.020  1.00 6.34  ? 5  LEU A CB   10 
ATOM   10370 C CG   . LEU A 1 5  ? -12.525 11.178  -6.092  1.00 7.26  ? 5  LEU A CG   10 
ATOM   10371 C CD1  . LEU A 1 5  ? -13.852 11.917  -6.288  1.00 7.60  ? 5  LEU A CD1  10 
ATOM   10372 C CD2  . LEU A 1 5  ? -12.715 9.696   -6.421  1.00 7.86  ? 5  LEU A CD2  10 
ATOM   10373 H H    . LEU A 1 5  ? -9.440  13.459  -7.937  1.00 7.57  ? 5  LEU A H    10 
ATOM   10374 H HA   . LEU A 1 5  ? -11.807 13.691  -6.115  1.00 6.63  ? 5  LEU A HA   10 
ATOM   10375 H HB2  . LEU A 1 5  ? -11.887 11.937  -7.999  1.00 5.88  ? 5  LEU A HB2  10 
ATOM   10376 H HB3  . LEU A 1 5  ? -10.631 11.086  -7.100  1.00 6.33  ? 5  LEU A HB3  10 
ATOM   10377 H HG   . LEU A 1 5  ? -12.206 11.282  -5.065  1.00 7.52  ? 5  LEU A HG   10 
ATOM   10378 H HD11 . LEU A 1 5  ? -14.084 11.971  -7.341  1.00 8.07  ? 5  LEU A HD11 10 
ATOM   10379 H HD12 . LEU A 1 5  ? -14.639 11.387  -5.773  1.00 7.24  ? 5  LEU A HD12 10 
ATOM   10380 H HD13 . LEU A 1 5  ? -13.770 12.917  -5.886  1.00 7.97  ? 5  LEU A HD13 10 
ATOM   10381 H HD21 . LEU A 1 5  ? -11.757 9.198   -6.406  1.00 7.79  ? 5  LEU A HD21 10 
ATOM   10382 H HD22 . LEU A 1 5  ? -13.367 9.244   -5.688  1.00 8.13  ? 5  LEU A HD22 10 
ATOM   10383 H HD23 . LEU A 1 5  ? -13.156 9.598   -7.402  1.00 8.35  ? 5  LEU A HD23 10 
ATOM   10384 N N    . ARG A 1 6  ? -10.531 12.937  -4.064  1.00 5.61  ? 6  ARG A N    10 
ATOM   10385 C CA   . ARG A 1 6  ? -9.683  12.694  -2.858  1.00 5.48  ? 6  ARG A CA   10 
ATOM   10386 C C    . ARG A 1 6  ? -9.255  11.221  -2.795  1.00 4.69  ? 6  ARG A C    10 
ATOM   10387 O O    . ARG A 1 6  ? -9.517  10.446  -3.699  1.00 4.64  ? 6  ARG A O    10 
ATOM   10388 C CB   . ARG A 1 6  ? -10.477 13.057  -1.597  1.00 6.06  ? 6  ARG A CB   10 
ATOM   10389 C CG   . ARG A 1 6  ? -11.773 12.238  -1.528  1.00 6.84  ? 6  ARG A CG   10 
ATOM   10390 C CD   . ARG A 1 6  ? -12.979 13.156  -1.754  1.00 7.76  ? 6  ARG A CD   10 
ATOM   10391 N NE   . ARG A 1 6  ? -13.860 13.129  -0.550  1.00 8.57  ? 6  ARG A NE   10 
ATOM   10392 C CZ   . ARG A 1 6  ? -14.356 14.242  -0.077  1.00 9.27  ? 6  ARG A CZ   10 
ATOM   10393 N NH1  . ARG A 1 6  ? -15.455 14.736  -0.586  1.00 9.70  ? 6  ARG A NH1  10 
ATOM   10394 N NH2  . ARG A 1 6  ? -13.753 14.861  0.906   1.00 9.77  ? 6  ARG A NH2  10 
ATOM   10395 H H    . ARG A 1 6  ? -11.475 13.167  -3.949  1.00 5.45  ? 6  ARG A H    10 
ATOM   10396 H HA   . ARG A 1 6  ? -8.802  13.316  -2.915  1.00 5.83  ? 6  ARG A HA   10 
ATOM   10397 H HB2  . ARG A 1 6  ? -9.877  12.846  -0.729  1.00 6.17  ? 6  ARG A HB2  10 
ATOM   10398 H HB3  . ARG A 1 6  ? -10.716 14.107  -1.616  1.00 6.11  ? 6  ARG A HB3  10 
ATOM   10399 H HG2  . ARG A 1 6  ? -11.757 11.473  -2.291  1.00 6.68  ? 6  ARG A HG2  10 
ATOM   10400 H HG3  . ARG A 1 6  ? -11.854 11.775  -0.557  1.00 7.20  ? 6  ARG A HG3  10 
ATOM   10401 H HD2  . ARG A 1 6  ? -12.636 14.166  -1.927  1.00 8.01  ? 6  ARG A HD2  10 
ATOM   10402 H HD3  . ARG A 1 6  ? -13.535 12.814  -2.614  1.00 7.82  ? 6  ARG A HD3  10 
ATOM   10403 H HE   . ARG A 1 6  ? -14.068 12.276  -0.115  1.00 8.74  ? 6  ARG A HE   10 
ATOM   10404 H HH11 . ARG A 1 6  ? -15.916 14.262  -1.336  1.00 9.50  ? 6  ARG A HH11 10 
ATOM   10405 H HH12 . ARG A 1 6  ? -15.835 15.589  -0.224  1.00 10.35 ? 6  ARG A HH12 10 
ATOM   10406 H HH21 . ARG A 1 6  ? -12.913 14.482  1.295   1.00 9.63  ? 6  ARG A HH21 10 
ATOM   10407 H HH22 . ARG A 1 6  ? -14.131 15.712  1.269   1.00 10.41 ? 6  ARG A HH22 10 
ATOM   10408 N N    . CYS A 1 7  ? -8.598  10.832  -1.729  1.00 4.47  ? 7  CYS A N    10 
ATOM   10409 C CA   . CYS A 1 7  ? -8.145  9.417   -1.594  1.00 4.05  ? 7  CYS A CA   10 
ATOM   10410 C C    . CYS A 1 7  ? -9.362  8.491   -1.508  1.00 4.38  ? 7  CYS A C    10 
ATOM   10411 O O    . CYS A 1 7  ? -10.191 8.621   -0.624  1.00 4.93  ? 7  CYS A O    10 
ATOM   10412 C CB   . CYS A 1 7  ? -7.308  9.267   -0.322  1.00 4.32  ? 7  CYS A CB   10 
ATOM   10413 S SG   . CYS A 1 7  ? -5.611  9.806   -0.644  1.00 4.79  ? 7  CYS A SG   10 
ATOM   10414 H H    . CYS A 1 7  ? -8.400  11.475  -1.017  1.00 4.87  ? 7  CYS A H    10 
ATOM   10415 H HA   . CYS A 1 7  ? -7.547  9.148   -2.452  1.00 3.89  ? 7  CYS A HA   10 
ATOM   10416 H HB2  . CYS A 1 7  ? -7.735  9.870   0.463   1.00 4.81  ? 7  CYS A HB2  10 
ATOM   10417 H HB3  . CYS A 1 7  ? -7.305  8.234   -0.016  1.00 4.30  ? 7  CYS A HB3  10 
ATOM   10418 N N    . GLN A 1 8  ? -9.467  7.550   -2.413  1.00 4.51  ? 8  GLN A N    10 
ATOM   10419 C CA   . GLN A 1 8  ? -10.620 6.601   -2.385  1.00 5.30  ? 8  GLN A CA   10 
ATOM   10420 C C    . GLN A 1 8  ? -10.361 5.483   -1.355  1.00 5.47  ? 8  GLN A C    10 
ATOM   10421 O O    . GLN A 1 8  ? -11.206 4.637   -1.133  1.00 6.21  ? 8  GLN A O    10 
ATOM   10422 C CB   . GLN A 1 8  ? -10.800 5.985   -3.776  1.00 5.63  ? 8  GLN A CB   10 
ATOM   10423 C CG   . GLN A 1 8  ? -11.662 6.909   -4.644  1.00 6.22  ? 8  GLN A CG   10 
ATOM   10424 C CD   . GLN A 1 8  ? -12.382 6.085   -5.716  1.00 7.21  ? 8  GLN A CD   10 
ATOM   10425 O OE1  . GLN A 1 8  ? -13.533 5.733   -5.555  1.00 7.78  ? 8  GLN A OE1  10 
ATOM   10426 N NE2  . GLN A 1 8  ? -11.748 5.760   -6.812  1.00 7.68  ? 8  GLN A NE2  10 
ATOM   10427 H H    . GLN A 1 8  ? -8.782  7.461   -3.110  1.00 4.40  ? 8  GLN A H    10 
ATOM   10428 H HA   . GLN A 1 8  ? -11.518 7.137   -2.112  1.00 5.87  ? 8  GLN A HA   10 
ATOM   10429 H HB2  . GLN A 1 8  ? -9.833  5.855   -4.240  1.00 5.62  ? 8  GLN A HB2  10 
ATOM   10430 H HB3  . GLN A 1 8  ? -11.285 5.027   -3.684  1.00 5.89  ? 8  GLN A HB3  10 
ATOM   10431 H HG2  . GLN A 1 8  ? -12.393 7.408   -4.022  1.00 6.11  ? 8  GLN A HG2  10 
ATOM   10432 H HG3  . GLN A 1 8  ? -11.033 7.646   -5.120  1.00 6.39  ? 8  GLN A HG3  10 
ATOM   10433 H HE21 . GLN A 1 8  ? -10.820 6.042   -6.945  1.00 7.43  ? 8  GLN A HE21 10 
ATOM   10434 H HE22 . GLN A 1 8  ? -12.203 5.231   -7.500  1.00 8.44  ? 8  GLN A HE22 10 
ATOM   10435 N N    . CYS A 1 9  ? -9.202  5.474   -0.724  1.00 5.04  ? 9  CYS A N    10 
ATOM   10436 C CA   . CYS A 1 9  ? -8.894  4.418   0.284   1.00 5.45  ? 9  CYS A CA   10 
ATOM   10437 C C    . CYS A 1 9  ? -8.990  5.012   1.692   1.00 5.99  ? 9  CYS A C    10 
ATOM   10438 O O    . CYS A 1 9  ? -8.170  5.818   2.095   1.00 6.13  ? 9  CYS A O    10 
ATOM   10439 C CB   . CYS A 1 9  ? -7.478  3.888   0.043   1.00 5.08  ? 9  CYS A CB   10 
ATOM   10440 S SG   . CYS A 1 9  ? -7.545  2.486   -1.100  1.00 5.12  ? 9  CYS A SG   10 
ATOM   10441 H H    . CYS A 1 9  ? -8.532  6.163   -0.914  1.00 4.65  ? 9  CYS A H    10 
ATOM   10442 H HA   . CYS A 1 9  ? -9.601  3.607   0.191   1.00 5.89  ? 9  CYS A HA   10 
ATOM   10443 H HB2  . CYS A 1 9  ? -6.868  4.672   -0.386  1.00 4.67  ? 9  CYS A HB2  10 
ATOM   10444 H HB3  . CYS A 1 9  ? -7.048  3.570   0.979   1.00 5.54  ? 9  CYS A HB3  10 
ATOM   10445 N N    . ILE A 1 10 ? -9.986  4.611   2.444   1.00 6.61  ? 10 ILE A N    10 
ATOM   10446 C CA   . ILE A 1 10 ? -10.150 5.133   3.836   1.00 7.44  ? 10 ILE A CA   10 
ATOM   10447 C C    . ILE A 1 10 ? -9.157  4.421   4.770   1.00 7.48  ? 10 ILE A C    10 
ATOM   10448 O O    . ILE A 1 10 ? -8.734  4.970   5.771   1.00 8.16  ? 10 ILE A O    10 
ATOM   10449 C CB   . ILE A 1 10 ? -11.587 4.876   4.317   1.00 8.38  ? 10 ILE A CB   10 
ATOM   10450 C CG1  . ILE A 1 10 ? -12.576 5.577   3.376   1.00 8.63  ? 10 ILE A CG1  10 
ATOM   10451 C CG2  . ILE A 1 10 ? -11.770 5.419   5.738   1.00 9.31  ? 10 ILE A CG2  10 
ATOM   10452 C CD1  . ILE A 1 10 ? -13.702 4.610   3.004   1.00 9.47  ? 10 ILE A CD1  10 
ATOM   10453 H H    . ILE A 1 10 ? -10.628 3.956   2.092   1.00 6.69  ? 10 ILE A H    10 
ATOM   10454 H HA   . ILE A 1 10 ? -9.952  6.195   3.846   1.00 7.59  ? 10 ILE A HA   10 
ATOM   10455 H HB   . ILE A 1 10 ? -11.779 3.812   4.314   1.00 8.40  ? 10 ILE A HB   10 
ATOM   10456 H HG12 . ILE A 1 10 ? -12.995 6.442   3.872   1.00 8.91  ? 10 ILE A HG12 10 
ATOM   10457 H HG13 . ILE A 1 10 ? -12.063 5.890   2.480   1.00 8.14  ? 10 ILE A HG13 10 
ATOM   10458 H HG21 . ILE A 1 10 ? -11.353 6.414   5.800   1.00 9.27  ? 10 ILE A HG21 10 
ATOM   10459 H HG22 . ILE A 1 10 ? -12.822 5.455   5.978   1.00 9.78  ? 10 ILE A HG22 10 
ATOM   10460 H HG23 . ILE A 1 10 ? -11.263 4.772   6.438   1.00 9.72  ? 10 ILE A HG23 10 
ATOM   10461 H HD11 . ILE A 1 10 ? -14.185 4.257   3.903   1.00 9.66  ? 10 ILE A HD11 10 
ATOM   10462 H HD12 . ILE A 1 10 ? -14.422 5.118   2.382   1.00 9.77  ? 10 ILE A HD12 10 
ATOM   10463 H HD13 . ILE A 1 10 ? -13.290 3.769   2.465   1.00 9.76  ? 10 ILE A HD13 10 
ATOM   10464 N N    . LYS A 1 11 ? -8.782  3.204   4.445   1.00 6.93  ? 11 LYS A N    10 
ATOM   10465 C CA   . LYS A 1 11 ? -7.816  2.450   5.306   1.00 7.15  ? 11 LYS A CA   10 
ATOM   10466 C C    . LYS A 1 11 ? -6.739  1.802   4.425   1.00 6.42  ? 11 LYS A C    10 
ATOM   10467 O O    . LYS A 1 11 ? -6.946  1.572   3.247   1.00 6.35  ? 11 LYS A O    10 
ATOM   10468 C CB   . LYS A 1 11 ? -8.565  1.362   6.089   1.00 8.05  ? 11 LYS A CB   10 
ATOM   10469 C CG   . LYS A 1 11 ? -9.342  0.459   5.122   1.00 8.65  ? 11 LYS A CG   10 
ATOM   10470 C CD   . LYS A 1 11 ? -9.874  -0.765  5.874   1.00 9.04  ? 11 LYS A CD   10 
ATOM   10471 C CE   . LYS A 1 11 ? -8.879  -1.924  5.745   1.00 9.50  ? 11 LYS A CE   10 
ATOM   10472 N NZ   . LYS A 1 11 ? -8.215  -2.163  7.059   1.00 9.69  ? 11 LYS A NZ   10 
ATOM   10473 H H    . LYS A 1 11 ? -9.136  2.785   3.631   1.00 6.52  ? 11 LYS A H    10 
ATOM   10474 H HA   . LYS A 1 11 ? -7.347  3.131   6.000   1.00 7.36  ? 11 LYS A HA   10 
ATOM   10475 H HB2  . LYS A 1 11 ? -7.854  0.767   6.643   1.00 8.15  ? 11 LYS A HB2  10 
ATOM   10476 H HB3  . LYS A 1 11 ? -9.256  1.828   6.775   1.00 8.38  ? 11 LYS A HB3  10 
ATOM   10477 H HG2  . LYS A 1 11 ? -10.171 1.013   4.703   1.00 9.16  ? 11 LYS A HG2  10 
ATOM   10478 H HG3  . LYS A 1 11 ? -8.688  0.135   4.326   1.00 8.50  ? 11 LYS A HG3  10 
ATOM   10479 H HD2  . LYS A 1 11 ? -10.005 -0.516  6.917   1.00 9.00  ? 11 LYS A HD2  10 
ATOM   10480 H HD3  . LYS A 1 11 ? -10.823 -1.060  5.453   1.00 9.26  ? 11 LYS A HD3  10 
ATOM   10481 H HE2  . LYS A 1 11 ? -9.407  -2.816  5.442   1.00 9.79  ? 11 LYS A HE2  10 
ATOM   10482 H HE3  . LYS A 1 11 ? -8.133  -1.678  5.004   1.00 9.62  ? 11 LYS A HE3  10 
ATOM   10483 H HZ1  . LYS A 1 11 ? -8.936  -2.340  7.787   1.00 9.96  ? 11 LYS A HZ1  10 
ATOM   10484 H HZ2  . LYS A 1 11 ? -7.589  -2.991  6.983   1.00 9.86  ? 11 LYS A HZ2  10 
ATOM   10485 H HZ3  . LYS A 1 11 ? -7.655  -1.328  7.324   1.00 9.61  ? 11 LYS A HZ3  10 
ATOM   10486 N N    . THR A 1 12 ? -5.591  1.506   4.990   1.00 6.02  ? 12 THR A N    10 
ATOM   10487 C CA   . THR A 1 12 ? -4.501  0.871   4.185   1.00 5.35  ? 12 THR A CA   10 
ATOM   10488 C C    . THR A 1 12 ? -4.198  -0.536  4.697   1.00 5.31  ? 12 THR A C    10 
ATOM   10489 O O    . THR A 1 12 ? -4.945  -1.111  5.467   1.00 5.80  ? 12 THR A O    10 
ATOM   10490 C CB   . THR A 1 12 ? -3.223  1.717   4.241   1.00 5.23  ? 12 THR A CB   10 
ATOM   10491 O OG1  . THR A 1 12 ? -3.265  2.613   5.345   1.00 5.90  ? 12 THR A OG1  10 
ATOM   10492 C CG2  . THR A 1 12 ? -3.092  2.493   2.940   1.00 5.32  ? 12 THR A CG2  10 
ATOM   10493 H H    . THR A 1 12 ? -5.448  1.700   5.940   1.00 6.26  ? 12 THR A H    10 
ATOM   10494 H HA   . THR A 1 12 ? -4.822  0.800   3.158   1.00 5.27  ? 12 THR A HA   10 
ATOM   10495 H HB   . THR A 1 12 ? -2.370  1.063   4.342   1.00 4.85  ? 12 THR A HB   10 
ATOM   10496 H HG1  . THR A 1 12 ? -2.776  2.214   6.069   1.00 6.31  ? 12 THR A HG1  10 
ATOM   10497 H HG21 . THR A 1 12 ? -3.114  1.801   2.109   1.00 5.48  ? 12 THR A HG21 10 
ATOM   10498 H HG22 . THR A 1 12 ? -3.912  3.189   2.852   1.00 5.41  ? 12 THR A HG22 10 
ATOM   10499 H HG23 . THR A 1 12 ? -2.156  3.028   2.935   1.00 5.52  ? 12 THR A HG23 10 
ATOM   10500 N N    . TYR A 1 13 ? -3.109  -1.098  4.237   1.00 4.96  ? 13 TYR A N    10 
ATOM   10501 C CA   . TYR A 1 13 ? -2.732  -2.473  4.638   1.00 5.03  ? 13 TYR A CA   10 
ATOM   10502 C C    . TYR A 1 13 ? -1.410  -2.448  5.411   1.00 5.08  ? 13 TYR A C    10 
ATOM   10503 O O    . TYR A 1 13 ? -0.352  -2.240  4.843   1.00 4.67  ? 13 TYR A O    10 
ATOM   10504 C CB   . TYR A 1 13 ? -2.576  -3.310  3.366   1.00 4.85  ? 13 TYR A CB   10 
ATOM   10505 C CG   . TYR A 1 13 ? -2.680  -4.776  3.682   1.00 5.22  ? 13 TYR A CG   10 
ATOM   10506 C CD1  . TYR A 1 13 ? -3.552  -5.224  4.680   1.00 5.34  ? 13 TYR A CD1  10 
ATOM   10507 C CD2  . TYR A 1 13 ? -1.905  -5.684  2.963   1.00 5.75  ? 13 TYR A CD2  10 
ATOM   10508 C CE1  . TYR A 1 13 ? -3.642  -6.592  4.963   1.00 5.79  ? 13 TYR A CE1  10 
ATOM   10509 C CE2  . TYR A 1 13 ? -1.992  -7.053  3.243   1.00 6.30  ? 13 TYR A CE2  10 
ATOM   10510 C CZ   . TYR A 1 13 ? -2.861  -7.508  4.244   1.00 6.23  ? 13 TYR A CZ   10 
ATOM   10511 O OH   . TYR A 1 13 ? -2.951  -8.858  4.520   1.00 6.84  ? 13 TYR A OH   10 
ATOM   10512 H H    . TYR A 1 13 ? -2.546  -0.613  3.598   1.00 4.82  ? 13 TYR A H    10 
ATOM   10513 H HA   . TYR A 1 13 ? -3.507  -2.895  5.257   1.00 5.34  ? 13 TYR A HA   10 
ATOM   10514 H HB2  . TYR A 1 13 ? -3.352  -3.043  2.665   1.00 4.90  ? 13 TYR A HB2  10 
ATOM   10515 H HB3  . TYR A 1 13 ? -1.613  -3.112  2.924   1.00 4.67  ? 13 TYR A HB3  10 
ATOM   10516 H HD1  . TYR A 1 13 ? -4.152  -4.509  5.230   1.00 5.30  ? 13 TYR A HD1  10 
ATOM   10517 H HD2  . TYR A 1 13 ? -1.236  -5.323  2.190   1.00 5.92  ? 13 TYR A HD2  10 
ATOM   10518 H HE1  . TYR A 1 13 ? -4.313  -6.941  5.735   1.00 5.99  ? 13 TYR A HE1  10 
ATOM   10519 H HE2  . TYR A 1 13 ? -1.390  -7.758  2.689   1.00 6.92  ? 13 TYR A HE2  10 
ATOM   10520 H HH   . TYR A 1 13 ? -2.479  -9.027  5.338   1.00 7.17  ? 13 TYR A HH   10 
ATOM   10521 N N    . SER A 1 14 ? -1.464  -2.672  6.700   1.00 5.82  ? 14 SER A N    10 
ATOM   10522 C CA   . SER A 1 14 ? -0.213  -2.681  7.519   1.00 6.06  ? 14 SER A CA   10 
ATOM   10523 C C    . SER A 1 14 ? 0.426   -4.073  7.448   1.00 6.51  ? 14 SER A C    10 
ATOM   10524 O O    . SER A 1 14 ? 1.633   -4.206  7.514   1.00 6.88  ? 14 SER A O    10 
ATOM   10525 C CB   . SER A 1 14 ? -0.540  -2.335  8.974   1.00 6.42  ? 14 SER A CB   10 
ATOM   10526 O OG   . SER A 1 14 ? 0.664   -2.018  9.663   1.00 6.80  ? 14 SER A OG   10 
ATOM   10527 H H    . SER A 1 14 ? -2.328  -2.847  7.128   1.00 6.33  ? 14 SER A H    10 
ATOM   10528 H HA   . SER A 1 14 ? 0.481   -1.955  7.122   1.00 5.81  ? 14 SER A HA   10 
ATOM   10529 H HB2  . SER A 1 14 ? -1.198  -1.483  9.005   1.00 6.57  ? 14 SER A HB2  10 
ATOM   10530 H HB3  . SER A 1 14 ? -1.026  -3.180  9.445   1.00 6.52  ? 14 SER A HB3  10 
ATOM   10531 H HG   . SER A 1 14 ? 0.924   -2.787  10.176  1.00 7.03  ? 14 SER A HG   10 
ATOM   10532 N N    . LYS A 1 15 ? -0.370  -5.108  7.296   1.00 6.59  ? 15 LYS A N    10 
ATOM   10533 C CA   . LYS A 1 15 ? 0.203   -6.484  7.201   1.00 7.06  ? 15 LYS A CA   10 
ATOM   10534 C C    . LYS A 1 15 ? 0.828   -6.650  5.812   1.00 6.32  ? 15 LYS A C    10 
ATOM   10535 O O    . LYS A 1 15 ? 0.270   -6.199  4.832   1.00 6.13  ? 15 LYS A O    10 
ATOM   10536 C CB   . LYS A 1 15 ? -0.871  -7.566  7.385   1.00 7.75  ? 15 LYS A CB   10 
ATOM   10537 C CG   . LYS A 1 15 ? -2.078  -7.052  8.186   1.00 8.64  ? 15 LYS A CG   10 
ATOM   10538 C CD   . LYS A 1 15 ? -1.643  -6.710  9.616   1.00 9.43  ? 15 LYS A CD   10 
ATOM   10539 C CE   . LYS A 1 15 ? -1.618  -7.985  10.464  1.00 10.20 ? 15 LYS A CE   10 
ATOM   10540 N NZ   . LYS A 1 15 ? -2.827  -8.030  11.336  1.00 10.59 ? 15 LYS A NZ   10 
ATOM   10541 H H    . LYS A 1 15 ? -1.334  -4.975  7.228   1.00 6.42  ? 15 LYS A H    10 
ATOM   10542 H HA   . LYS A 1 15 ? 0.965   -6.602  7.957   1.00 7.57  ? 15 LYS A HA   10 
ATOM   10543 H HB2  . LYS A 1 15 ? -1.195  -7.897  6.418   1.00 7.79  ? 15 LYS A HB2  10 
ATOM   10544 H HB3  . LYS A 1 15 ? -0.434  -8.398  7.907   1.00 7.79  ? 15 LYS A HB3  10 
ATOM   10545 H HG2  . LYS A 1 15 ? -2.484  -6.174  7.711   1.00 8.72  ? 15 LYS A HG2  10 
ATOM   10546 H HG3  . LYS A 1 15 ? -2.837  -7.819  8.220   1.00 8.87  ? 15 LYS A HG3  10 
ATOM   10547 H HD2  . LYS A 1 15 ? -0.656  -6.271  9.595   1.00 9.71  ? 15 LYS A HD2  10 
ATOM   10548 H HD3  . LYS A 1 15 ? -2.341  -6.008  10.046  1.00 9.38  ? 15 LYS A HD3  10 
ATOM   10549 H HE2  . LYS A 1 15 ? -1.609  -8.851  9.818   1.00 10.54 ? 15 LYS A HE2  10 
ATOM   10550 H HE3  . LYS A 1 15 ? -0.730  -7.990  11.081  1.00 10.33 ? 15 LYS A HE3  10 
ATOM   10551 H HZ1  . LYS A 1 15 ? -2.860  -7.174  11.928  1.00 10.91 ? 15 LYS A HZ1  10 
ATOM   10552 H HZ2  . LYS A 1 15 ? -3.680  -8.077  10.744  1.00 10.22 ? 15 LYS A HZ2  10 
ATOM   10553 H HZ3  . LYS A 1 15 ? -2.784  -8.872  11.945  1.00 11.09 ? 15 LYS A HZ3  10 
ATOM   10554 N N    . PRO A 1 16 ? 1.974   -7.278  5.771   1.00 6.02  ? 16 PRO A N    10 
ATOM   10555 C CA   . PRO A 1 16 ? 2.716   -7.500  4.520   1.00 5.35  ? 16 PRO A CA   10 
ATOM   10556 C C    . PRO A 1 16 ? 2.192   -8.729  3.769   1.00 5.50  ? 16 PRO A C    10 
ATOM   10557 O O    . PRO A 1 16 ? 1.549   -9.594  4.337   1.00 6.37  ? 16 PRO A O    10 
ATOM   10558 C CB   . PRO A 1 16 ? 4.147   -7.728  5.003   1.00 5.39  ? 16 PRO A CB   10 
ATOM   10559 C CG   . PRO A 1 16 ? 4.049   -8.195  6.477   1.00 6.26  ? 16 PRO A CG   10 
ATOM   10560 C CD   . PRO A 1 16 ? 2.638   -7.822  6.968   1.00 6.51  ? 16 PRO A CD   10 
ATOM   10561 H HA   . PRO A 1 16 ? 2.677   -6.628  3.891   1.00 4.92  ? 16 PRO A HA   10 
ATOM   10562 H HB2  . PRO A 1 16 ? 4.624   -8.479  4.401   1.00 5.32  ? 16 PRO A HB2  10 
ATOM   10563 H HB3  . PRO A 1 16 ? 4.702   -6.809  4.950   1.00 5.10  ? 16 PRO A HB3  10 
ATOM   10564 H HG2  . PRO A 1 16 ? 4.194   -9.266  6.533   1.00 6.77  ? 16 PRO A HG2  10 
ATOM   10565 H HG3  . PRO A 1 16 ? 4.790   -7.690  7.077   1.00 6.37  ? 16 PRO A HG3  10 
ATOM   10566 H HD2  . PRO A 1 16 ? 2.119   -8.701  7.321   1.00 7.06  ? 16 PRO A HD2  10 
ATOM   10567 H HD3  . PRO A 1 16 ? 2.680   -7.073  7.738   1.00 6.63  ? 16 PRO A HD3  10 
ATOM   10568 N N    . PHE A 1 17 ? 2.477   -8.807  2.493   1.00 4.76  ? 17 PHE A N    10 
ATOM   10569 C CA   . PHE A 1 17 ? 2.017   -9.976  1.679   1.00 4.96  ? 17 PHE A CA   10 
ATOM   10570 C C    . PHE A 1 17 ? 2.859   -10.082 0.397   1.00 4.78  ? 17 PHE A C    10 
ATOM   10571 O O    . PHE A 1 17 ? 3.457   -9.119  -0.047  1.00 4.77  ? 17 PHE A O    10 
ATOM   10572 C CB   . PHE A 1 17 ? 0.517   -9.834  1.344   1.00 4.69  ? 17 PHE A CB   10 
ATOM   10573 C CG   . PHE A 1 17 ? 0.279   -8.779  0.280   1.00 3.72  ? 17 PHE A CG   10 
ATOM   10574 C CD1  . PHE A 1 17 ? 0.412   -7.419  0.590   1.00 3.29  ? 17 PHE A CD1  10 
ATOM   10575 C CD2  . PHE A 1 17 ? -0.094  -9.167  -1.014  1.00 3.74  ? 17 PHE A CD2  10 
ATOM   10576 C CE1  . PHE A 1 17 ? 0.174   -6.451  -0.394  1.00 2.59  ? 17 PHE A CE1  10 
ATOM   10577 C CE2  . PHE A 1 17 ? -0.330  -8.199  -1.996  1.00 3.14  ? 17 PHE A CE2  10 
ATOM   10578 C CZ   . PHE A 1 17 ? -0.197  -6.842  -1.686  1.00 2.38  ? 17 PHE A CZ   10 
ATOM   10579 H H    . PHE A 1 17 ? 3.005   -8.096  2.070   1.00 4.19  ? 17 PHE A H    10 
ATOM   10580 H HA   . PHE A 1 17 ? 2.160   -10.877 2.259   1.00 5.66  ? 17 PHE A HA   10 
ATOM   10581 H HB2  . PHE A 1 17 ? 0.146   -10.782 0.987   1.00 5.13  ? 17 PHE A HB2  10 
ATOM   10582 H HB3  . PHE A 1 17 ? -0.020  -9.561  2.241   1.00 5.06  ? 17 PHE A HB3  10 
ATOM   10583 H HD1  . PHE A 1 17 ? 0.699   -7.118  1.586   1.00 3.86  ? 17 PHE A HD1  10 
ATOM   10584 H HD2  . PHE A 1 17 ? -0.198  -10.216 -1.254  1.00 4.51  ? 17 PHE A HD2  10 
ATOM   10585 H HE1  . PHE A 1 17 ? 0.274   -5.403  -0.156  1.00 2.72  ? 17 PHE A HE1  10 
ATOM   10586 H HE2  . PHE A 1 17 ? -0.618  -8.499  -2.994  1.00 3.62  ? 17 PHE A HE2  10 
ATOM   10587 H HZ   . PHE A 1 17 ? -0.381  -6.095  -2.444  1.00 2.18  ? 17 PHE A HZ   10 
ATOM   10588 N N    . HIS A 1 18 ? 2.918   -11.257 -0.188  1.00 4.92  ? 18 HIS A N    10 
ATOM   10589 C CA   . HIS A 1 18 ? 3.726   -11.459 -1.430  1.00 5.06  ? 18 HIS A CA   10 
ATOM   10590 C C    . HIS A 1 18 ? 3.108   -10.651 -2.604  1.00 4.32  ? 18 HIS A C    10 
ATOM   10591 O O    . HIS A 1 18 ? 1.902   -10.581 -2.736  1.00 4.10  ? 18 HIS A O    10 
ATOM   10592 C CB   . HIS A 1 18 ? 3.791   -12.960 -1.711  1.00 5.95  ? 18 HIS A CB   10 
ATOM   10593 C CG   . HIS A 1 18 ? 4.334   -13.190 -3.072  1.00 6.25  ? 18 HIS A CG   10 
ATOM   10594 N ND1  . HIS A 1 18 ? 5.687   -13.332 -3.339  1.00 6.36  ? 18 HIS A ND1  10 
ATOM   10595 C CD2  . HIS A 1 18 ? 3.703   -13.278 -4.260  1.00 6.72  ? 18 HIS A CD2  10 
ATOM   10596 C CE1  . HIS A 1 18 ? 5.807   -13.495 -4.667  1.00 6.81  ? 18 HIS A CE1  10 
ATOM   10597 N NE2  . HIS A 1 18 ? 4.626   -13.477 -5.267  1.00 7.07  ? 18 HIS A NE2  10 
ATOM   10598 H H    . HIS A 1 18 ? 2.431   -12.019 0.198   1.00 5.11  ? 18 HIS A H    10 
ATOM   10599 H HA   . HIS A 1 18 ? 4.723   -11.101 -1.263  1.00 5.21  ? 18 HIS A HA   10 
ATOM   10600 H HB2  . HIS A 1 18 ? 4.432   -13.434 -0.985  1.00 6.63  ? 18 HIS A HB2  10 
ATOM   10601 H HB3  . HIS A 1 18 ? 2.801   -13.380 -1.643  1.00 5.84  ? 18 HIS A HB3  10 
ATOM   10602 H HD1  . HIS A 1 18 ? 6.416   -13.315 -2.684  1.00 6.36  ? 18 HIS A HD1  10 
ATOM   10603 H HD2  . HIS A 1 18 ? 2.650   -13.152 -4.396  1.00 7.00  ? 18 HIS A HD2  10 
ATOM   10604 H HE1  . HIS A 1 18 ? 6.742   -13.577 -5.193  1.00 7.12  ? 18 HIS A HE1  10 
ATOM   10605 N N    . PRO A 1 19 ? 3.975   -10.004 -3.376  1.00 4.16  ? 19 PRO A N    10 
ATOM   10606 C CA   . PRO A 1 19 ? 3.574   -9.110  -4.498  1.00 3.77  ? 19 PRO A CA   10 
ATOM   10607 C C    . PRO A 1 19 ? 3.132   -9.822  -5.788  1.00 4.27  ? 19 PRO A C    10 
ATOM   10608 O O    . PRO A 1 19 ? 2.226   -9.354  -6.447  1.00 4.32  ? 19 PRO A O    10 
ATOM   10609 C CB   . PRO A 1 19 ? 4.840   -8.297  -4.771  1.00 3.96  ? 19 PRO A CB   10 
ATOM   10610 C CG   . PRO A 1 19 ? 6.023   -9.130  -4.235  1.00 4.62  ? 19 PRO A CG   10 
ATOM   10611 C CD   . PRO A 1 19 ? 5.441   -10.108 -3.199  1.00 4.65  ? 19 PRO A CD   10 
ATOM   10612 H HA   . PRO A 1 19 ? 2.802   -8.444  -4.172  1.00 3.26  ? 19 PRO A HA   10 
ATOM   10613 H HB2  . PRO A 1 19 ? 4.950   -8.132  -5.834  1.00 4.26  ? 19 PRO A HB2  10 
ATOM   10614 H HB3  . PRO A 1 19 ? 4.794   -7.355  -4.253  1.00 3.57  ? 19 PRO A HB3  10 
ATOM   10615 H HG2  . PRO A 1 19 ? 6.483   -9.677  -5.048  1.00 5.23  ? 19 PRO A HG2  10 
ATOM   10616 H HG3  . PRO A 1 19 ? 6.748   -8.486  -3.765  1.00 4.63  ? 19 PRO A HG3  10 
ATOM   10617 H HD2  . PRO A 1 19 ? 5.780   -11.112 -3.403  1.00 5.29  ? 19 PRO A HD2  10 
ATOM   10618 H HD3  . PRO A 1 19 ? 5.717   -9.810  -2.200  1.00 4.56  ? 19 PRO A HD3  10 
ATOM   10619 N N    . LYS A 1 20 ? 3.776   -10.896 -6.194  1.00 4.91  ? 20 LYS A N    10 
ATOM   10620 C CA   . LYS A 1 20 ? 3.374   -11.562 -7.489  1.00 5.52  ? 20 LYS A CA   10 
ATOM   10621 C C    . LYS A 1 20 ? 1.854   -11.819 -7.533  1.00 5.00  ? 20 LYS A C    10 
ATOM   10622 O O    . LYS A 1 20 ? 1.266   -11.839 -8.599  1.00 5.39  ? 20 LYS A O    10 
ATOM   10623 C CB   . LYS A 1 20 ? 4.135   -12.866 -7.708  1.00 6.44  ? 20 LYS A CB   10 
ATOM   10624 C CG   . LYS A 1 20 ? 4.076   -13.258 -9.189  1.00 7.16  ? 20 LYS A CG   10 
ATOM   10625 C CD   . LYS A 1 20 ? 4.528   -14.713 -9.356  1.00 7.91  ? 20 LYS A CD   10 
ATOM   10626 C CE   . LYS A 1 20 ? 4.933   -14.962 -10.813 1.00 8.41  ? 20 LYS A CE   10 
ATOM   10627 N NZ   . LYS A 1 20 ? 4.046   -16.001 -11.410 1.00 8.95  ? 20 LYS A NZ   10 
ATOM   10628 H H    . LYS A 1 20 ? 4.532   -11.235 -5.676  1.00 5.13  ? 20 LYS A H    10 
ATOM   10629 H HA   . LYS A 1 20 ? 3.625   -10.902 -8.288  1.00 5.87  ? 20 LYS A HA   10 
ATOM   10630 H HB2  . LYS A 1 20 ? 5.166   -12.735 -7.413  1.00 6.91  ? 20 LYS A HB2  10 
ATOM   10631 H HB3  . LYS A 1 20 ? 3.688   -13.634 -7.119  1.00 6.29  ? 20 LYS A HB3  10 
ATOM   10632 H HG2  . LYS A 1 20 ? 3.064   -13.153 -9.550  1.00 7.23  ? 20 LYS A HG2  10 
ATOM   10633 H HG3  . LYS A 1 20 ? 4.729   -12.614 -9.759  1.00 7.28  ? 20 LYS A HG3  10 
ATOM   10634 H HD2  . LYS A 1 20 ? 5.372   -14.904 -8.709  1.00 8.14  ? 20 LYS A HD2  10 
ATOM   10635 H HD3  . LYS A 1 20 ? 3.716   -15.374 -9.092  1.00 8.11  ? 20 LYS A HD3  10 
ATOM   10636 H HE2  . LYS A 1 20 ? 4.842   -14.045 -11.375 1.00 8.28  ? 20 LYS A HE2  10 
ATOM   10637 H HE3  . LYS A 1 20 ? 5.958   -15.303 -10.848 1.00 8.75  ? 20 LYS A HE3  10 
ATOM   10638 H HZ1  . LYS A 1 20 ? 3.056   -15.684 -11.355 1.00 9.15  ? 20 LYS A HZ1  10 
ATOM   10639 H HZ2  . LYS A 1 20 ? 4.307   -16.149 -12.406 1.00 9.17  ? 20 LYS A HZ2  10 
ATOM   10640 H HZ3  . LYS A 1 20 ? 4.155   -16.894 -10.890 1.00 9.13  ? 20 LYS A HZ3  10 
ATOM   10641 N N    . PHE A 1 21 ? 1.206   -11.978 -6.394  1.00 4.37  ? 21 PHE A N    10 
ATOM   10642 C CA   . PHE A 1 21 ? -0.275  -12.186 -6.393  1.00 4.15  ? 21 PHE A CA   10 
ATOM   10643 C C    . PHE A 1 21 ? -0.943  -10.954 -7.017  1.00 3.56  ? 21 PHE A C    10 
ATOM   10644 O O    . PHE A 1 21 ? -1.903  -11.056 -7.755  1.00 3.88  ? 21 PHE A O    10 
ATOM   10645 C CB   . PHE A 1 21 ? -0.792  -12.337 -4.965  1.00 4.02  ? 21 PHE A CB   10 
ATOM   10646 C CG   . PHE A 1 21 ? -0.037  -13.403 -4.198  1.00 4.64  ? 21 PHE A CG   10 
ATOM   10647 C CD1  . PHE A 1 21 ? 0.512   -14.513 -4.857  1.00 5.12  ? 21 PHE A CD1  10 
ATOM   10648 C CD2  . PHE A 1 21 ? 0.101   -13.278 -2.810  1.00 5.11  ? 21 PHE A CD2  10 
ATOM   10649 C CE1  . PHE A 1 21 ? 1.199   -15.489 -4.126  1.00 5.85  ? 21 PHE A CE1  10 
ATOM   10650 C CE2  . PHE A 1 21 ? 0.787   -14.254 -2.081  1.00 5.85  ? 21 PHE A CE2  10 
ATOM   10651 C CZ   . PHE A 1 21 ? 1.336   -15.360 -2.739  1.00 6.13  ? 21 PHE A CZ   10 
ATOM   10652 H H    . PHE A 1 21 ? 1.685   -11.933 -5.545  1.00 4.29  ? 21 PHE A H    10 
ATOM   10653 H HA   . PHE A 1 21 ? -0.524  -13.058 -6.956  1.00 4.82  ? 21 PHE A HA   10 
ATOM   10654 H HB2  . PHE A 1 21 ? -0.679  -11.400 -4.467  1.00 3.48  ? 21 PHE A HB2  10 
ATOM   10655 H HB3  . PHE A 1 21 ? -1.835  -12.595 -4.996  1.00 4.37  ? 21 PHE A HB3  10 
ATOM   10656 H HD1  . PHE A 1 21 ? 0.407   -14.613 -5.927  1.00 5.18  ? 21 PHE A HD1  10 
ATOM   10657 H HD2  . PHE A 1 21 ? -0.323  -12.424 -2.300  1.00 5.17  ? 21 PHE A HD2  10 
ATOM   10658 H HE1  . PHE A 1 21 ? 1.623   -16.342 -4.631  1.00 6.40  ? 21 PHE A HE1  10 
ATOM   10659 H HE2  . PHE A 1 21 ? 0.894   -14.152 -1.010  1.00 6.40  ? 21 PHE A HE2  10 
ATOM   10660 H HZ   . PHE A 1 21 ? 1.866   -16.114 -2.176  1.00 6.79  ? 21 PHE A HZ   10 
ATOM   10661 N N    . ILE A 1 22 ? -0.419  -9.789  -6.708  1.00 2.94  ? 22 ILE A N    10 
ATOM   10662 C CA   . ILE A 1 22 ? -0.972  -8.510  -7.249  1.00 2.62  ? 22 ILE A CA   10 
ATOM   10663 C C    . ILE A 1 22 ? -0.958  -8.533  -8.779  1.00 3.41  ? 22 ILE A C    10 
ATOM   10664 O O    . ILE A 1 22 ? 0.086   -8.598  -9.402  1.00 4.13  ? 22 ILE A O    10 
ATOM   10665 C CB   . ILE A 1 22 ? -0.104  -7.342  -6.755  1.00 2.18  ? 22 ILE A CB   10 
ATOM   10666 C CG1  . ILE A 1 22 ? -0.153  -7.272  -5.224  1.00 2.00  ? 22 ILE A CG1  10 
ATOM   10667 C CG2  . ILE A 1 22 ? -0.623  -6.027  -7.337  1.00 2.53  ? 22 ILE A CG2  10 
ATOM   10668 C CD1  . ILE A 1 22 ? 1.093   -6.549  -4.705  1.00 2.47  ? 22 ILE A CD1  10 
ATOM   10669 H H    . ILE A 1 22 ? 0.355   -9.758  -6.109  1.00 2.94  ? 22 ILE A H    10 
ATOM   10670 H HA   . ILE A 1 22 ? -1.985  -8.374  -6.903  1.00 2.63  ? 22 ILE A HA   10 
ATOM   10671 H HB   . ILE A 1 22 ? 0.916   -7.496  -7.075  1.00 2.49  ? 22 ILE A HB   10 
ATOM   10672 H HG12 . ILE A 1 22 ? -1.038  -6.734  -4.916  1.00 2.23  ? 22 ILE A HG12 10 
ATOM   10673 H HG13 . ILE A 1 22 ? -0.181  -8.272  -4.818  1.00 2.28  ? 22 ILE A HG13 10 
ATOM   10674 H HG21 . ILE A 1 22 ? -1.698  -6.062  -7.392  1.00 2.80  ? 22 ILE A HG21 10 
ATOM   10675 H HG22 . ILE A 1 22 ? -0.319  -5.207  -6.702  1.00 3.07  ? 22 ILE A HG22 10 
ATOM   10676 H HG23 . ILE A 1 22 ? -0.215  -5.886  -8.326  1.00 2.71  ? 22 ILE A HG23 10 
ATOM   10677 H HD11 . ILE A 1 22 ? 1.894   -6.648  -5.423  1.00 2.88  ? 22 ILE A HD11 10 
ATOM   10678 H HD12 . ILE A 1 22 ? 0.867   -5.503  -4.560  1.00 2.84  ? 22 ILE A HD12 10 
ATOM   10679 H HD13 . ILE A 1 22 ? 1.396   -6.984  -3.765  1.00 2.73  ? 22 ILE A HD13 10 
ATOM   10680 N N    . LYS A 1 23 ? -2.117  -8.456  -9.383  1.00 3.62  ? 23 LYS A N    10 
ATOM   10681 C CA   . LYS A 1 23 ? -2.195  -8.440  -10.872 1.00 4.61  ? 23 LYS A CA   10 
ATOM   10682 C C    . LYS A 1 23 ? -1.927  -7.011  -11.367 1.00 5.00  ? 23 LYS A C    10 
ATOM   10683 O O    . LYS A 1 23 ? -1.431  -6.813  -12.460 1.00 5.88  ? 23 LYS A O    10 
ATOM   10684 C CB   . LYS A 1 23 ? -3.593  -8.888  -11.319 1.00 5.10  ? 23 LYS A CB   10 
ATOM   10685 C CG   . LYS A 1 23 ? -3.513  -9.523  -12.712 1.00 5.85  ? 23 LYS A CG   10 
ATOM   10686 C CD   . LYS A 1 23 ? -3.704  -8.446  -13.784 1.00 6.35  ? 23 LYS A CD   10 
ATOM   10687 C CE   . LYS A 1 23 ? -4.216  -9.092  -15.073 1.00 6.93  ? 23 LYS A CE   10 
ATOM   10688 N NZ   . LYS A 1 23 ? -3.778  -8.282  -16.245 1.00 7.72  ? 23 LYS A NZ   10 
ATOM   10689 H H    . LYS A 1 23 ? -2.938  -8.386  -8.852  1.00 3.33  ? 23 LYS A H    10 
ATOM   10690 H HA   . LYS A 1 23 ? -1.450  -9.111  -11.279 1.00 4.98  ? 23 LYS A HA   10 
ATOM   10691 H HB2  . LYS A 1 23 ? -3.980  -9.613  -10.615 1.00 4.92  ? 23 LYS A HB2  10 
ATOM   10692 H HB3  . LYS A 1 23 ? -4.251  -8.033  -11.352 1.00 5.36  ? 23 LYS A HB3  10 
ATOM   10693 H HG2  . LYS A 1 23 ? -2.547  -9.989  -12.839 1.00 6.02  ? 23 LYS A HG2  10 
ATOM   10694 H HG3  . LYS A 1 23 ? -4.288  -10.268 -12.811 1.00 6.22  ? 23 LYS A HG3  10 
ATOM   10695 H HD2  . LYS A 1 23 ? -4.421  -7.715  -13.437 1.00 6.70  ? 23 LYS A HD2  10 
ATOM   10696 H HD3  . LYS A 1 23 ? -2.760  -7.960  -13.978 1.00 6.30  ? 23 LYS A HD3  10 
ATOM   10697 H HE2  . LYS A 1 23 ? -3.817  -10.092 -15.158 1.00 6.98  ? 23 LYS A HE2  10 
ATOM   10698 H HE3  . LYS A 1 23 ? -5.295  -9.136  -15.049 1.00 7.01  ? 23 LYS A HE3  10 
ATOM   10699 H HZ1  . LYS A 1 23 ? -4.062  -7.291  -16.110 1.00 7.80  ? 23 LYS A HZ1  10 
ATOM   10700 H HZ2  . LYS A 1 23 ? -2.743  -8.338  -16.339 1.00 7.78  ? 23 LYS A HZ2  10 
ATOM   10701 H HZ3  . LYS A 1 23 ? -4.225  -8.652  -17.108 1.00 8.36  ? 23 LYS A HZ3  10 
ATOM   10702 N N    . GLU A 1 24 ? -2.248  -6.017  -10.564 1.00 4.51  ? 24 GLU A N    10 
ATOM   10703 C CA   . GLU A 1 24 ? -2.011  -4.600  -10.981 1.00 5.13  ? 24 GLU A CA   10 
ATOM   10704 C C    . GLU A 1 24 ? -1.655  -3.749  -9.750  1.00 4.55  ? 24 GLU A C    10 
ATOM   10705 O O    . GLU A 1 24 ? -2.504  -3.453  -8.928  1.00 4.65  ? 24 GLU A O    10 
ATOM   10706 C CB   . GLU A 1 24 ? -3.276  -4.043  -11.645 1.00 5.78  ? 24 GLU A CB   10 
ATOM   10707 C CG   . GLU A 1 24 ? -3.195  -4.255  -13.161 1.00 6.35  ? 24 GLU A CG   10 
ATOM   10708 C CD   . GLU A 1 24 ? -4.124  -3.265  -13.872 1.00 7.36  ? 24 GLU A CD   10 
ATOM   10709 O OE1  . GLU A 1 24 ? -5.310  -3.545  -13.950 1.00 7.92  ? 24 GLU A OE1  10 
ATOM   10710 O OE2  . GLU A 1 24 ? -3.633  -2.245  -14.327 1.00 7.77  ? 24 GLU A OE2  10 
ATOM   10711 H H    . GLU A 1 24 ? -2.641  -6.205  -9.683  1.00 3.86  ? 24 GLU A H    10 
ATOM   10712 H HA   . GLU A 1 24 ? -1.194  -4.569  -11.687 1.00 5.74  ? 24 GLU A HA   10 
ATOM   10713 H HB2  . GLU A 1 24 ? -4.143  -4.557  -11.253 1.00 5.66  ? 24 GLU A HB2  10 
ATOM   10714 H HB3  . GLU A 1 24 ? -3.359  -2.987  -11.436 1.00 6.21  ? 24 GLU A HB3  10 
ATOM   10715 H HG2  . GLU A 1 24 ? -2.179  -4.095  -13.492 1.00 6.22  ? 24 GLU A HG2  10 
ATOM   10716 H HG3  . GLU A 1 24 ? -3.497  -5.264  -13.400 1.00 6.40  ? 24 GLU A HG3  10 
HETATM 10717 N N    . MLE A 1 25 ? -0.405  -3.352  -9.615  1.00 4.25  ? 25 MLE A N    10 
HETATM 10718 C CN   . MLE A 1 25 ? 0.219   -2.810  -10.868 1.00 5.13  ? 25 MLE A CN   10 
HETATM 10719 C CA   . MLE A 1 25 ? 0.001   -2.518  -8.431  1.00 3.66  ? 25 MLE A CA   10 
HETATM 10720 C CB   . MLE A 1 25 ? 1.392   -2.955  -7.939  1.00 3.52  ? 25 MLE A CB   10 
HETATM 10721 C CG   . MLE A 1 25 ? 2.008   -1.858  -7.052  1.00 3.28  ? 25 MLE A CG   10 
HETATM 10722 C CD1  . MLE A 1 25 ? 2.529   -2.468  -5.752  1.00 2.93  ? 25 MLE A CD1  10 
HETATM 10723 C CD2  . MLE A 1 25 ? 3.163   -1.180  -7.800  1.00 3.54  ? 25 MLE A CD2  10 
HETATM 10724 C C    . MLE A 1 25 ? 0.035   -1.042  -8.843  1.00 4.19  ? 25 MLE A C    10 
HETATM 10725 O O    . MLE A 1 25 ? 0.979   -0.586  -9.467  1.00 4.87  ? 25 MLE A O    10 
HETATM 10726 H HN1  . MLE A 1 25 ? -0.369  -1.977  -11.229 1.00 5.47  ? 25 MLE A HN1  10 
HETATM 10727 H HN2  . MLE A 1 25 ? 1.223   -2.471  -10.652 1.00 5.48  ? 25 MLE A HN2  10 
HETATM 10728 H HN3  . MLE A 1 25 ? 0.254   -3.580  -11.620 1.00 5.42  ? 25 MLE A HN3  10 
HETATM 10729 H HA   . MLE A 1 25 ? -0.719  -2.651  -7.636  1.00 3.20  ? 25 MLE A HA   10 
HETATM 10730 H HB2  . MLE A 1 25 ? 1.298   -3.868  -7.369  1.00 3.37  ? 25 MLE A HB2  10 
HETATM 10731 H HB3  . MLE A 1 25 ? 2.033   -3.129  -8.789  1.00 4.08  ? 25 MLE A HB3  10 
HETATM 10732 H HG   . MLE A 1 25 ? 1.253   -1.121  -6.817  1.00 3.59  ? 25 MLE A HG   10 
HETATM 10733 H HD11 . MLE A 1 25 ? 2.431   -3.541  -5.793  1.00 2.79  ? 25 MLE A HD11 10 
HETATM 10734 H HD12 . MLE A 1 25 ? 3.569   -2.205  -5.623  1.00 3.21  ? 25 MLE A HD12 10 
HETATM 10735 H HD13 . MLE A 1 25 ? 1.956   -2.083  -4.923  1.00 3.14  ? 25 MLE A HD13 10 
HETATM 10736 H HD21 . MLE A 1 25 ? 3.248   -1.603  -8.791  1.00 3.89  ? 25 MLE A HD21 10 
HETATM 10737 H HD22 . MLE A 1 25 ? 2.968   -0.120  -7.877  1.00 3.75  ? 25 MLE A HD22 10 
HETATM 10738 H HD23 . MLE A 1 25 ? 4.086   -1.338  -7.262  1.00 3.70  ? 25 MLE A HD23 10 
ATOM   10739 N N    . ARG A 1 26 ? -0.980  -0.293  -8.517  1.00 4.14  ? 26 ARG A N    10 
ATOM   10740 C CA   . ARG A 1 26 ? -0.974  1.138   -8.916  1.00 4.79  ? 26 ARG A CA   10 
ATOM   10741 C C    . ARG A 1 26 ? -1.084  2.034   -7.675  1.00 4.70  ? 26 ARG A C    10 
ATOM   10742 O O    . ARG A 1 26 ? -1.981  1.885   -6.868  1.00 4.97  ? 26 ARG A O    10 
ATOM   10743 C CB   . ARG A 1 26 ? -2.140  1.425   -9.874  1.00 5.59  ? 26 ARG A CB   10 
ATOM   10744 C CG   . ARG A 1 26 ? -3.434  0.800   -9.338  1.00 5.99  ? 26 ARG A CG   10 
ATOM   10745 C CD   . ARG A 1 26 ? -4.623  1.284   -10.168 1.00 6.35  ? 26 ARG A CD   10 
ATOM   10746 N NE   . ARG A 1 26 ? -5.813  1.454   -9.285  1.00 7.16  ? 26 ARG A NE   10 
ATOM   10747 C CZ   . ARG A 1 26 ? -6.670  2.412   -9.518  1.00 7.92  ? 26 ARG A CZ   10 
ATOM   10748 N NH1  . ARG A 1 26 ? -6.406  3.634   -9.132  1.00 8.52  ? 26 ARG A NH1  10 
ATOM   10749 N NH2  . ARG A 1 26 ? -7.792  2.147   -10.139 1.00 8.32  ? 26 ARG A NH2  10 
ATOM   10750 H H    . ARG A 1 26 ? -1.738  -0.670  -8.021  1.00 3.85  ? 26 ARG A H    10 
ATOM   10751 H HA   . ARG A 1 26 ? -0.038  1.336   -9.421  1.00 5.07  ? 26 ARG A HA   10 
ATOM   10752 H HB2  . ARG A 1 26 ? -2.271  2.494   -9.967  1.00 5.95  ? 26 ARG A HB2  10 
ATOM   10753 H HB3  . ARG A 1 26 ? -1.918  1.007   -10.845 1.00 5.91  ? 26 ARG A HB3  10 
ATOM   10754 H HG2  . ARG A 1 26 ? -3.366  -0.276  -9.401  1.00 6.27  ? 26 ARG A HG2  10 
ATOM   10755 H HG3  . ARG A 1 26 ? -3.575  1.091   -8.308  1.00 6.12  ? 26 ARG A HG3  10 
ATOM   10756 H HD2  . ARG A 1 26 ? -4.380  2.230   -10.630 1.00 6.26  ? 26 ARG A HD2  10 
ATOM   10757 H HD3  . ARG A 1 26 ? -4.847  0.557   -10.936 1.00 6.38  ? 26 ARG A HD3  10 
ATOM   10758 H HE   . ARG A 1 26 ? -5.953  0.845   -8.528  1.00 7.28  ? 26 ARG A HE   10 
ATOM   10759 H HH11 . ARG A 1 26 ? -5.548  3.834   -8.657  1.00 8.41  ? 26 ARG A HH11 10 
ATOM   10760 H HH12 . ARG A 1 26 ? -7.061  4.368   -9.311  1.00 9.21  ? 26 ARG A HH12 10 
ATOM   10761 H HH21 . ARG A 1 26 ? -7.992  1.212   -10.433 1.00 8.08  ? 26 ARG A HH21 10 
ATOM   10762 H HH22 . ARG A 1 26 ? -8.449  2.879   -10.320 1.00 9.02  ? 26 ARG A HH22 10 
ATOM   10763 N N    . VAL A 1 27 ? -0.175  2.965   -7.524  1.00 4.69  ? 27 VAL A N    10 
ATOM   10764 C CA   . VAL A 1 27 ? -0.208  3.879   -6.346  1.00 4.83  ? 27 VAL A CA   10 
ATOM   10765 C C    . VAL A 1 27 ? -0.791  5.236   -6.765  1.00 4.79  ? 27 VAL A C    10 
ATOM   10766 O O    . VAL A 1 27 ? -0.600  5.683   -7.882  1.00 5.45  ? 27 VAL A O    10 
ATOM   10767 C CB   . VAL A 1 27 ? 1.220   4.072   -5.817  1.00 5.66  ? 27 VAL A CB   10 
ATOM   10768 C CG1  . VAL A 1 27 ? 1.759   2.740   -5.294  1.00 6.10  ? 27 VAL A CG1  10 
ATOM   10769 C CG2  . VAL A 1 27 ? 2.140   4.582   -6.933  1.00 6.04  ? 27 VAL A CG2  10 
ATOM   10770 H H    . VAL A 1 27 ? 0.537   3.063   -8.185  1.00 4.82  ? 27 VAL A H    10 
ATOM   10771 H HA   . VAL A 1 27 ? -0.824  3.446   -5.571  1.00 4.74  ? 27 VAL A HA   10 
ATOM   10772 H HB   . VAL A 1 27 ? 1.201   4.785   -5.015  1.00 5.89  ? 27 VAL A HB   10 
ATOM   10773 H HG11 . VAL A 1 27 ? 1.001   2.254   -4.702  1.00 6.30  ? 27 VAL A HG11 10 
ATOM   10774 H HG12 . VAL A 1 27 ? 2.023   2.107   -6.129  1.00 6.06  ? 27 VAL A HG12 10 
ATOM   10775 H HG13 . VAL A 1 27 ? 2.634   2.919   -4.686  1.00 6.54  ? 27 VAL A HG13 10 
ATOM   10776 H HG21 . VAL A 1 27 ? 1.664   5.404   -7.446  1.00 6.05  ? 27 VAL A HG21 10 
ATOM   10777 H HG22 . VAL A 1 27 ? 3.073   4.917   -6.504  1.00 6.44  ? 27 VAL A HG22 10 
ATOM   10778 H HG23 . VAL A 1 27 ? 2.333   3.782   -7.634  1.00 6.18  ? 27 VAL A HG23 10 
ATOM   10779 N N    . ILE A 1 28 ? -1.493  5.900   -5.875  1.00 4.28  ? 28 ILE A N    10 
ATOM   10780 C CA   . ILE A 1 28 ? -2.074  7.234   -6.222  1.00 4.40  ? 28 ILE A CA   10 
ATOM   10781 C C    . ILE A 1 28 ? -1.205  8.328   -5.592  1.00 4.70  ? 28 ILE A C    10 
ATOM   10782 O O    . ILE A 1 28 ? -1.004  8.355   -4.392  1.00 5.01  ? 28 ILE A O    10 
ATOM   10783 C CB   . ILE A 1 28 ? -3.515  7.333   -5.698  1.00 4.45  ? 28 ILE A CB   10 
ATOM   10784 C CG1  . ILE A 1 28 ? -4.389  6.298   -6.421  1.00 4.94  ? 28 ILE A CG1  10 
ATOM   10785 C CG2  . ILE A 1 28 ? -4.063  8.741   -5.964  1.00 4.49  ? 28 ILE A CG2  10 
ATOM   10786 C CD1  . ILE A 1 28 ? -5.836  6.401   -5.927  1.00 5.05  ? 28 ILE A CD1  10 
ATOM   10787 H H    . ILE A 1 28 ? -1.629  5.527   -4.975  1.00 4.02  ? 28 ILE A H    10 
ATOM   10788 H HA   . ILE A 1 28 ? -2.074  7.356   -7.296  1.00 4.67  ? 28 ILE A HA   10 
ATOM   10789 H HB   . ILE A 1 28 ? -3.525  7.138   -4.634  1.00 4.56  ? 28 ILE A HB   10 
ATOM   10790 H HG12 . ILE A 1 28 ? -4.360  6.485   -7.485  1.00 5.21  ? 28 ILE A HG12 10 
ATOM   10791 H HG13 . ILE A 1 28 ? -4.012  5.307   -6.220  1.00 5.36  ? 28 ILE A HG13 10 
ATOM   10792 H HG21 . ILE A 1 28 ? -3.403  9.475   -5.528  1.00 4.77  ? 28 ILE A HG21 10 
ATOM   10793 H HG22 . ILE A 1 28 ? -4.131  8.906   -7.029  1.00 4.49  ? 28 ILE A HG22 10 
ATOM   10794 H HG23 . ILE A 1 28 ? -5.045  8.835   -5.523  1.00 4.51  ? 28 ILE A HG23 10 
ATOM   10795 H HD11 . ILE A 1 28 ? -5.848  6.402   -4.846  1.00 5.25  ? 28 ILE A HD11 10 
ATOM   10796 H HD12 . ILE A 1 28 ? -6.278  7.315   -6.293  1.00 5.49  ? 28 ILE A HD12 10 
ATOM   10797 H HD13 . ILE A 1 28 ? -6.402  5.557   -6.291  1.00 4.88  ? 28 ILE A HD13 10 
ATOM   10798 N N    . GLU A 1 29 ? -0.683  9.221   -6.400  1.00 5.08  ? 29 GLU A N    10 
ATOM   10799 C CA   . GLU A 1 29 ? 0.190   10.317  -5.875  1.00 5.75  ? 29 GLU A CA   10 
ATOM   10800 C C    . GLU A 1 29 ? -0.610  11.267  -4.974  1.00 5.30  ? 29 GLU A C    10 
ATOM   10801 O O    . GLU A 1 29 ? -1.815  11.152  -4.837  1.00 4.95  ? 29 GLU A O    10 
ATOM   10802 C CB   . GLU A 1 29 ? 0.782   11.109  -7.049  1.00 6.63  ? 29 GLU A CB   10 
ATOM   10803 C CG   . GLU A 1 29 ? -0.323  11.491  -8.042  1.00 7.40  ? 29 GLU A CG   10 
ATOM   10804 C CD   . GLU A 1 29 ? -0.061  12.898  -8.588  1.00 8.35  ? 29 GLU A CD   10 
ATOM   10805 O OE1  . GLU A 1 29 ? -0.532  13.845  -7.979  1.00 9.09  ? 29 GLU A OE1  10 
ATOM   10806 O OE2  . GLU A 1 29 ? 0.607   13.004  -9.603  1.00 8.53  ? 29 GLU A OE2  10 
ATOM   10807 H H    . GLU A 1 29 ? -0.857  9.163   -7.362  1.00 5.18  ? 29 GLU A H    10 
ATOM   10808 H HA   . GLU A 1 29 ? 0.996   9.882   -5.302  1.00 6.26  ? 29 GLU A HA   10 
ATOM   10809 H HB2  . GLU A 1 29 ? 1.247   12.002  -6.672  1.00 6.65  ? 29 GLU A HB2  10 
ATOM   10810 H HB3  . GLU A 1 29 ? 1.520   10.506  -7.550  1.00 7.00  ? 29 GLU A HB3  10 
ATOM   10811 H HG2  . GLU A 1 29 ? -0.332  10.784  -8.860  1.00 7.70  ? 29 GLU A HG2  10 
ATOM   10812 H HG3  . GLU A 1 29 ? -1.280  11.474  -7.542  1.00 7.27  ? 29 GLU A HG3  10 
ATOM   10813 N N    . SER A 1 30 ? 0.066   12.208  -4.362  1.00 5.67  ? 30 SER A N    10 
ATOM   10814 C CA   . SER A 1 30 ? -0.625  13.179  -3.465  1.00 5.68  ? 30 SER A CA   10 
ATOM   10815 C C    . SER A 1 30 ? -0.887  14.488  -4.217  1.00 6.20  ? 30 SER A C    10 
ATOM   10816 O O    . SER A 1 30 ? -0.270  14.774  -5.227  1.00 6.77  ? 30 SER A O    10 
ATOM   10817 C CB   . SER A 1 30 ? 0.246   13.464  -2.237  1.00 6.35  ? 30 SER A CB   10 
ATOM   10818 O OG   . SER A 1 30 ? 1.622   13.371  -2.590  1.00 7.18  ? 30 SER A OG   10 
ATOM   10819 H H    . SER A 1 30 ? 1.035   12.275  -4.495  1.00 6.18  ? 30 SER A H    10 
ATOM   10820 H HA   . SER A 1 30 ? -1.568  12.761  -3.143  1.00 5.24  ? 30 SER A HA   10 
ATOM   10821 H HB2  . SER A 1 30 ? 0.043   14.455  -1.876  1.00 6.58  ? 30 SER A HB2  10 
ATOM   10822 H HB3  . SER A 1 30 ? 0.012   12.747  -1.462  1.00 6.28  ? 30 SER A HB3  10 
ATOM   10823 H HG   . SER A 1 30 ? 2.019   12.679  -2.057  1.00 7.41  ? 30 SER A HG   10 
ATOM   10824 N N    . GLY A 1 31 ? -1.799  15.282  -3.721  1.00 6.36  ? 31 GLY A N    10 
ATOM   10825 C CA   . GLY A 1 31 ? -2.127  16.582  -4.382  1.00 7.19  ? 31 GLY A CA   10 
ATOM   10826 C C    . GLY A 1 31 ? -3.103  17.361  -3.490  1.00 7.66  ? 31 GLY A C    10 
ATOM   10827 O O    . GLY A 1 31 ? -3.174  17.115  -2.300  1.00 7.75  ? 31 GLY A O    10 
ATOM   10828 H H    . GLY A 1 31 ? -2.275  15.020  -2.904  1.00 6.14  ? 31 GLY A H    10 
ATOM   10829 H HA2  . GLY A 1 31 ? -1.224  17.151  -4.529  1.00 7.72  ? 31 GLY A HA2  10 
ATOM   10830 H HA3  . GLY A 1 31 ? -2.592  16.393  -5.337  1.00 7.17  ? 31 GLY A HA3  10 
ATOM   10831 N N    . PRO A 1 32 ? -3.853  18.257  -4.089  1.00 8.17  ? 32 PRO A N    10 
ATOM   10832 C CA   . PRO A 1 32 ? -4.863  19.051  -3.360  1.00 8.85  ? 32 PRO A CA   10 
ATOM   10833 C C    . PRO A 1 32 ? -6.059  18.146  -3.031  1.00 8.11  ? 32 PRO A C    10 
ATOM   10834 O O    . PRO A 1 32 ? -6.679  18.262  -1.990  1.00 8.52  ? 32 PRO A O    10 
ATOM   10835 C CB   . PRO A 1 32 ? -5.238  20.160  -4.348  1.00 9.69  ? 32 PRO A CB   10 
ATOM   10836 C CG   . PRO A 1 32 ? -4.857  19.637  -5.753  1.00 9.20  ? 32 PRO A CG   10 
ATOM   10837 C CD   . PRO A 1 32 ? -3.777  18.559  -5.538  1.00 8.39  ? 32 PRO A CD   10 
ATOM   10838 H HA   . PRO A 1 32 ? -4.443  19.473  -2.462  1.00 9.45  ? 32 PRO A HA   10 
ATOM   10839 H HB2  . PRO A 1 32 ? -6.301  20.357  -4.297  1.00 9.88  ? 32 PRO A HB2  10 
ATOM   10840 H HB3  . PRO A 1 32 ? -4.681  21.056  -4.129  1.00 10.56 ? 32 PRO A HB3  10 
ATOM   10841 H HG2  . PRO A 1 32 ? -5.724  19.207  -6.235  1.00 8.80  ? 32 PRO A HG2  10 
ATOM   10842 H HG3  . PRO A 1 32 ? -4.457  20.440  -6.352  1.00 10.01 ? 32 PRO A HG3  10 
ATOM   10843 H HD2  . PRO A 1 32 ? -4.001  17.679  -6.124  1.00 7.63  ? 32 PRO A HD2  10 
ATOM   10844 H HD3  . PRO A 1 32 ? -2.800  18.944  -5.787  1.00 8.96  ? 32 PRO A HD3  10 
ATOM   10845 N N    . HIS A 1 33 ? -6.355  17.227  -3.919  1.00 7.21  ? 33 HIS A N    10 
ATOM   10846 C CA   . HIS A 1 33 ? -7.476  16.261  -3.711  1.00 6.64  ? 33 HIS A CA   10 
ATOM   10847 C C    . HIS A 1 33 ? -7.204  15.412  -2.456  1.00 5.94  ? 33 HIS A C    10 
ATOM   10848 O O    . HIS A 1 33 ? -8.100  15.129  -1.683  1.00 6.05  ? 33 HIS A O    10 
ATOM   10849 C CB   . HIS A 1 33 ? -7.585  15.341  -4.944  1.00 6.27  ? 33 HIS A CB   10 
ATOM   10850 C CG   . HIS A 1 33 ? -6.271  14.622  -5.174  1.00 5.79  ? 33 HIS A CG   10 
ATOM   10851 N ND1  . HIS A 1 33 ? -5.196  15.227  -5.812  1.00 6.54  ? 33 HIS A ND1  10 
ATOM   10852 C CD2  . HIS A 1 33 ? -5.831  13.371  -4.813  1.00 4.91  ? 33 HIS A CD2  10 
ATOM   10853 C CE1  . HIS A 1 33 ? -4.170  14.357  -5.801  1.00 6.20  ? 33 HIS A CE1  10 
ATOM   10854 N NE2  . HIS A 1 33 ? -4.504  13.207  -5.208  1.00 5.23  ? 33 HIS A NE2  10 
ATOM   10855 H H    . HIS A 1 33 ? -5.820  17.165  -4.730  1.00 7.10  ? 33 HIS A H    10 
ATOM   10856 H HA   . HIS A 1 33 ? -8.399  16.802  -3.584  1.00 7.25  ? 33 HIS A HA   10 
ATOM   10857 H HB2  . HIS A 1 33 ? -8.366  14.615  -4.780  1.00 5.99  ? 33 HIS A HB2  10 
ATOM   10858 H HB3  . HIS A 1 33 ? -7.825  15.934  -5.814  1.00 6.92  ? 33 HIS A HB3  10 
ATOM   10859 H HD1  . HIS A 1 33 ? -5.190  16.119  -6.216  1.00 7.35  ? 33 HIS A HD1  10 
ATOM   10860 H HD2  . HIS A 1 33 ? -6.423  12.627  -4.302  1.00 4.33  ? 33 HIS A HD2  10 
ATOM   10861 H HE1  . HIS A 1 33 ? -3.185  14.579  -6.190  1.00 6.82  ? 33 HIS A HE1  10 
ATOM   10862 N N    . CYS A 1 34 ? -5.969  15.014  -2.254  1.00 5.51  ? 34 CYS A N    10 
ATOM   10863 C CA   . CYS A 1 34 ? -5.610  14.196  -1.069  1.00 5.12  ? 34 CYS A CA   10 
ATOM   10864 C C    . CYS A 1 34 ? -4.233  14.632  -0.560  1.00 5.54  ? 34 CYS A C    10 
ATOM   10865 O O    . CYS A 1 34 ? -3.251  14.582  -1.278  1.00 5.84  ? 34 CYS A O    10 
ATOM   10866 C CB   . CYS A 1 34 ? -5.571  12.714  -1.454  1.00 4.12  ? 34 CYS A CB   10 
ATOM   10867 S SG   . CYS A 1 34 ? -5.557  11.703  0.045   1.00 4.37  ? 34 CYS A SG   10 
ATOM   10868 H H    . CYS A 1 34 ? -5.275  15.263  -2.883  1.00 5.68  ? 34 CYS A H    10 
ATOM   10869 H HA   . CYS A 1 34 ? -6.342  14.353  -0.304  1.00 5.59  ? 34 CYS A HA   10 
ATOM   10870 H HB2  . CYS A 1 34 ? -6.443  12.470  -2.044  1.00 4.04  ? 34 CYS A HB2  10 
ATOM   10871 H HB3  . CYS A 1 34 ? -4.680  12.515  -2.031  1.00 3.82  ? 34 CYS A HB3  10 
ATOM   10872 N N    . ALA A 1 35 ? -4.161  15.070  0.672   1.00 5.90  ? 35 ALA A N    10 
ATOM   10873 C CA   . ALA A 1 35 ? -2.858  15.531  1.243   1.00 6.66  ? 35 ALA A CA   10 
ATOM   10874 C C    . ALA A 1 35 ? -1.886  14.353  1.416   1.00 6.33  ? 35 ALA A C    10 
ATOM   10875 O O    . ALA A 1 35 ? -0.689  14.509  1.255   1.00 6.77  ? 35 ALA A O    10 
ATOM   10876 C CB   . ALA A 1 35 ? -3.110  16.184  2.607   1.00 7.59  ? 35 ALA A CB   10 
ATOM   10877 H H    . ALA A 1 35 ? -4.972  15.105  1.223   1.00 5.87  ? 35 ALA A H    10 
ATOM   10878 H HA   . ALA A 1 35 ? -2.417  16.257  0.580   1.00 7.06  ? 35 ALA A HA   10 
ATOM   10879 H HB1  . ALA A 1 35 ? -3.587  15.473  3.265   1.00 8.05  ? 35 ALA A HB1  10 
ATOM   10880 H HB2  . ALA A 1 35 ? -2.169  16.498  3.036   1.00 7.89  ? 35 ALA A HB2  10 
ATOM   10881 H HB3  . ALA A 1 35 ? -3.752  17.044  2.480   1.00 7.72  ? 35 ALA A HB3  10 
ATOM   10882 N N    . ASN A 1 36 ? -2.381  13.189  1.757   1.00 5.85  ? 36 ASN A N    10 
ATOM   10883 C CA   . ASN A 1 36 ? -1.477  12.014  1.961   1.00 5.88  ? 36 ASN A CA   10 
ATOM   10884 C C    . ASN A 1 36 ? -1.464  11.109  0.721   1.00 5.34  ? 36 ASN A C    10 
ATOM   10885 O O    . ASN A 1 36 ? -2.419  11.045  -0.031  1.00 5.26  ? 36 ASN A O    10 
ATOM   10886 C CB   . ASN A 1 36 ? -1.966  11.213  3.171   1.00 6.50  ? 36 ASN A CB   10 
ATOM   10887 C CG   . ASN A 1 36 ? -1.291  11.740  4.440   1.00 7.27  ? 36 ASN A CG   10 
ATOM   10888 O OD1  . ASN A 1 36 ? -0.363  11.139  4.942   1.00 7.78  ? 36 ASN A OD1  10 
ATOM   10889 N ND2  . ASN A 1 36 ? -1.721  12.848  4.984   1.00 7.61  ? 36 ASN A ND2  10 
ATOM   10890 H H    . ASN A 1 36 ? -3.346  13.089  1.895   1.00 5.70  ? 36 ASN A H    10 
ATOM   10891 H HA   . ASN A 1 36 ? -0.475  12.366  2.153   1.00 6.19  ? 36 ASN A HA   10 
ATOM   10892 H HB2  . ASN A 1 36 ? -3.038  11.317  3.263   1.00 6.55  ? 36 ASN A HB2  10 
ATOM   10893 H HB3  . ASN A 1 36 ? -1.718  10.173  3.038   1.00 6.63  ? 36 ASN A HB3  10 
ATOM   10894 H HD21 . ASN A 1 36 ? -2.470  13.335  4.581   1.00 7.41  ? 36 ASN A HD21 10 
ATOM   10895 H HD22 . ASN A 1 36 ? -1.294  13.191  5.797   1.00 8.19  ? 36 ASN A HD22 10 
ATOM   10896 N N    . THR A 1 37 ? -0.377  10.399  0.518   1.00 5.30  ? 37 THR A N    10 
ATOM   10897 C CA   . THR A 1 37 ? -0.265  9.474   -0.654  1.00 5.18  ? 37 THR A CA   10 
ATOM   10898 C C    . THR A 1 37 ? -0.652  8.055   -0.205  1.00 4.58  ? 37 THR A C    10 
ATOM   10899 O O    . THR A 1 37 ? -0.538  7.720   0.962   1.00 4.95  ? 37 THR A O    10 
ATOM   10900 C CB   . THR A 1 37 ? 1.185   9.481   -1.166  1.00 5.98  ? 37 THR A CB   10 
ATOM   10901 O OG1  . THR A 1 37 ? 1.699   10.807  -1.121  1.00 6.76  ? 37 THR A OG1  10 
ATOM   10902 C CG2  . THR A 1 37 ? 1.231   8.972   -2.608  1.00 6.31  ? 37 THR A CG2  10 
ATOM   10903 H H    . THR A 1 37 ? 0.369   10.470  1.149   1.00 5.59  ? 37 THR A H    10 
ATOM   10904 H HA   . THR A 1 37 ? -0.929  9.800   -1.440  1.00 5.45  ? 37 THR A HA   10 
ATOM   10905 H HB   . THR A 1 37 ? 1.791   8.841   -0.545  1.00 6.11  ? 37 THR A HB   10 
ATOM   10906 H HG1  . THR A 1 37 ? 2.216   10.899  -0.316  1.00 7.02  ? 37 THR A HG1  10 
ATOM   10907 H HG21 . THR A 1 37 ? 0.628   9.613   -3.234  1.00 6.33  ? 37 THR A HG21 10 
ATOM   10908 H HG22 . THR A 1 37 ? 2.252   8.983   -2.960  1.00 6.74  ? 37 THR A HG22 10 
ATOM   10909 H HG23 . THR A 1 37 ? 0.848   7.964   -2.647  1.00 6.44  ? 37 THR A HG23 10 
ATOM   10910 N N    . GLU A 1 38 ? -1.120  7.222   -1.109  1.00 3.94  ? 38 GLU A N    10 
ATOM   10911 C CA   . GLU A 1 38 ? -1.522  5.836   -0.707  1.00 3.67  ? 38 GLU A CA   10 
ATOM   10912 C C    . GLU A 1 38 ? -1.273  4.850   -1.852  1.00 2.99  ? 38 GLU A C    10 
ATOM   10913 O O    . GLU A 1 38 ? -1.392  5.190   -3.015  1.00 3.33  ? 38 GLU A O    10 
ATOM   10914 C CB   . GLU A 1 38 ? -3.014  5.830   -0.349  1.00 4.35  ? 38 GLU A CB   10 
ATOM   10915 C CG   . GLU A 1 38 ? -3.257  4.891   0.835   1.00 4.96  ? 38 GLU A CG   10 
ATOM   10916 C CD   . GLU A 1 38 ? -2.779  5.559   2.129   1.00 5.76  ? 38 GLU A CD   10 
ATOM   10917 O OE1  . GLU A 1 38 ? -3.568  6.268   2.732   1.00 6.28  ? 38 GLU A OE1  10 
ATOM   10918 O OE2  . GLU A 1 38 ? -1.634  5.348   2.496   1.00 6.10  ? 38 GLU A OE2  10 
ATOM   10919 H H    . GLU A 1 38 ? -1.214  7.508   -2.043  1.00 3.89  ? 38 GLU A H    10 
ATOM   10920 H HA   . GLU A 1 38 ? -0.949  5.532   0.154   1.00 3.96  ? 38 GLU A HA   10 
ATOM   10921 H HB2  . GLU A 1 38 ? -3.324  6.830   -0.086  1.00 4.73  ? 38 GLU A HB2  10 
ATOM   10922 H HB3  . GLU A 1 38 ? -3.586  5.489   -1.199  1.00 4.35  ? 38 GLU A HB3  10 
ATOM   10923 H HG2  . GLU A 1 38 ? -4.314  4.675   0.910   1.00 5.14  ? 38 GLU A HG2  10 
ATOM   10924 H HG3  . GLU A 1 38 ? -2.712  3.971   0.684   1.00 4.98  ? 38 GLU A HG3  10 
ATOM   10925 N N    . ILE A 1 39 ? -0.946  3.619   -1.525  1.00 2.48  ? 39 ILE A N    10 
ATOM   10926 C CA   . ILE A 1 39 ? -0.706  2.590   -2.584  1.00 2.38  ? 39 ILE A CA   10 
ATOM   10927 C C    . ILE A 1 39 ? -2.019  1.821   -2.820  1.00 2.16  ? 39 ILE A C    10 
ATOM   10928 O O    . ILE A 1 39 ? -2.895  1.821   -1.978  1.00 2.22  ? 39 ILE A O    10 
ATOM   10929 C CB   . ILE A 1 39 ? 0.407   1.636   -2.106  1.00 2.57  ? 39 ILE A CB   10 
ATOM   10930 C CG1  . ILE A 1 39 ? 1.753   2.374   -2.139  1.00 2.79  ? 39 ILE A CG1  10 
ATOM   10931 C CG2  . ILE A 1 39 ? 0.488   0.403   -3.013  1.00 3.44  ? 39 ILE A CG2  10 
ATOM   10932 C CD1  . ILE A 1 39 ? 2.401   2.345   -0.752  1.00 2.94  ? 39 ILE A CD1  10 
ATOM   10933 H H    . ILE A 1 39 ? -0.871  3.367   -0.574  1.00 2.61  ? 39 ILE A H    10 
ATOM   10934 H HA   . ILE A 1 39 ? -0.401  3.075   -3.500  1.00 2.85  ? 39 ILE A HA   10 
ATOM   10935 H HB   . ILE A 1 39 ? 0.195   1.322   -1.095  1.00 2.54  ? 39 ILE A HB   10 
ATOM   10936 H HG12 . ILE A 1 39 ? 2.410   1.891   -2.849  1.00 3.36  ? 39 ILE A HG12 10 
ATOM   10937 H HG13 . ILE A 1 39 ? 1.595   3.399   -2.437  1.00 2.70  ? 39 ILE A HG13 10 
ATOM   10938 H HG21 . ILE A 1 39 ? 0.520   0.715   -4.046  1.00 3.75  ? 39 ILE A HG21 10 
ATOM   10939 H HG22 . ILE A 1 39 ? 1.380   -0.158  -2.781  1.00 3.64  ? 39 ILE A HG22 10 
ATOM   10940 H HG23 . ILE A 1 39 ? -0.380  -0.220  -2.853  1.00 4.05  ? 39 ILE A HG23 10 
ATOM   10941 H HD11 . ILE A 1 39 ? 1.804   1.740   -0.085  1.00 2.88  ? 39 ILE A HD11 10 
ATOM   10942 H HD12 . ILE A 1 39 ? 3.394   1.927   -0.826  1.00 3.00  ? 39 ILE A HD12 10 
ATOM   10943 H HD13 . ILE A 1 39 ? 2.464   3.351   -0.363  1.00 3.60  ? 39 ILE A HD13 10 
ATOM   10944 N N    . ILE A 1 40 ? -2.169  1.179   -3.959  1.00 2.34  ? 40 ILE A N    10 
ATOM   10945 C CA   . ILE A 1 40 ? -3.432  0.415   -4.231  1.00 2.36  ? 40 ILE A CA   10 
ATOM   10946 C C    . ILE A 1 40 ? -3.137  -0.760  -5.169  1.00 2.37  ? 40 ILE A C    10 
ATOM   10947 O O    . ILE A 1 40 ? -3.088  -0.608  -6.377  1.00 3.02  ? 40 ILE A O    10 
ATOM   10948 C CB   . ILE A 1 40 ? -4.487  1.318   -4.888  1.00 3.14  ? 40 ILE A CB   10 
ATOM   10949 C CG1  . ILE A 1 40 ? -4.818  2.492   -3.961  1.00 3.44  ? 40 ILE A CG1  10 
ATOM   10950 C CG2  . ILE A 1 40 ? -5.757  0.499   -5.150  1.00 3.70  ? 40 ILE A CG2  10 
ATOM   10951 C CD1  . ILE A 1 40 ? -5.677  3.514   -4.709  1.00 4.01  ? 40 ILE A CD1  10 
ATOM   10952 H H    . ILE A 1 40 ? -1.456  1.198   -4.630  1.00 2.72  ? 40 ILE A H    10 
ATOM   10953 H HA   . ILE A 1 40 ? -3.822  0.032   -3.299  1.00 2.37  ? 40 ILE A HA   10 
ATOM   10954 H HB   . ILE A 1 40 ? -4.103  1.693   -5.826  1.00 3.47  ? 40 ILE A HB   10 
ATOM   10955 H HG12 . ILE A 1 40 ? -5.356  2.130   -3.098  1.00 3.44  ? 40 ILE A HG12 10 
ATOM   10956 H HG13 . ILE A 1 40 ? -3.902  2.963   -3.642  1.00 3.71  ? 40 ILE A HG13 10 
ATOM   10957 H HG21 . ILE A 1 40 ? -5.568  -0.541  -4.922  1.00 3.89  ? 40 ILE A HG21 10 
ATOM   10958 H HG22 . ILE A 1 40 ? -6.558  0.862   -4.525  1.00 3.94  ? 40 ILE A HG22 10 
ATOM   10959 H HG23 . ILE A 1 40 ? -6.037  0.592   -6.188  1.00 4.13  ? 40 ILE A HG23 10 
ATOM   10960 H HD11 . ILE A 1 40 ? -5.228  3.730   -5.666  1.00 4.33  ? 40 ILE A HD11 10 
ATOM   10961 H HD12 . ILE A 1 40 ? -6.668  3.111   -4.858  1.00 4.43  ? 40 ILE A HD12 10 
ATOM   10962 H HD13 . ILE A 1 40 ? -5.743  4.422   -4.129  1.00 4.17  ? 40 ILE A HD13 10 
ATOM   10963 N N    . VAL A 1 41 ? -2.954  -1.933  -4.624  1.00 2.04  ? 41 VAL A N    10 
ATOM   10964 C CA   . VAL A 1 41 ? -2.678  -3.122  -5.471  1.00 2.10  ? 41 VAL A CA   10 
ATOM   10965 C C    . VAL A 1 41 ? -3.988  -3.869  -5.753  1.00 2.33  ? 41 VAL A C    10 
ATOM   10966 O O    . VAL A 1 41 ? -5.003  -3.623  -5.129  1.00 2.79  ? 41 VAL A O    10 
ATOM   10967 C CB   . VAL A 1 41 ? -1.702  -4.054  -4.742  1.00 2.21  ? 41 VAL A CB   10 
ATOM   10968 C CG1  . VAL A 1 41 ? -0.402  -3.307  -4.437  1.00 2.87  ? 41 VAL A CG1  10 
ATOM   10969 C CG2  . VAL A 1 41 ? -2.328  -4.558  -3.434  1.00 3.20  ? 41 VAL A CG2  10 
ATOM   10970 H H    . VAL A 1 41 ? -3.002  -2.034  -3.656  1.00 2.11  ? 41 VAL A H    10 
ATOM   10971 H HA   . VAL A 1 41 ? -2.242  -2.802  -6.404  1.00 2.57  ? 41 VAL A HA   10 
ATOM   10972 H HB   . VAL A 1 41 ? -1.485  -4.893  -5.374  1.00 2.10  ? 41 VAL A HB   10 
ATOM   10973 H HG11 . VAL A 1 41 ? -0.632  -2.346  -3.999  1.00 3.03  ? 41 VAL A HG11 10 
ATOM   10974 H HG12 . VAL A 1 41 ? 0.192   -3.884  -3.744  1.00 3.29  ? 41 VAL A HG12 10 
ATOM   10975 H HG13 . VAL A 1 41 ? 0.151   -3.161  -5.352  1.00 3.43  ? 41 VAL A HG13 10 
ATOM   10976 H HG21 . VAL A 1 41 ? -3.174  -3.940  -3.176  1.00 3.58  ? 41 VAL A HG21 10 
ATOM   10977 H HG22 . VAL A 1 41 ? -2.656  -5.579  -3.563  1.00 3.72  ? 41 VAL A HG22 10 
ATOM   10978 H HG23 . VAL A 1 41 ? -1.596  -4.514  -2.642  1.00 3.56  ? 41 VAL A HG23 10 
ATOM   10979 N N    . LYS A 1 42 ? -3.963  -4.784  -6.688  1.00 2.44  ? 42 LYS A N    10 
ATOM   10980 C CA   . LYS A 1 42 ? -5.188  -5.564  -7.019  1.00 2.97  ? 42 LYS A CA   10 
ATOM   10981 C C    . LYS A 1 42 ? -4.848  -7.058  -7.006  1.00 2.77  ? 42 LYS A C    10 
ATOM   10982 O O    . LYS A 1 42 ? -4.323  -7.592  -7.965  1.00 2.98  ? 42 LYS A O    10 
ATOM   10983 C CB   . LYS A 1 42 ? -5.695  -5.159  -8.408  1.00 3.77  ? 42 LYS A CB   10 
ATOM   10984 C CG   . LYS A 1 42 ? -7.007  -4.380  -8.270  1.00 4.68  ? 42 LYS A CG   10 
ATOM   10985 C CD   . LYS A 1 42 ? -7.903  -4.663  -9.480  1.00 5.42  ? 42 LYS A CD   10 
ATOM   10986 C CE   . LYS A 1 42 ? -7.936  -3.435  -10.397 1.00 5.72  ? 42 LYS A CE   10 
ATOM   10987 N NZ   . LYS A 1 42 ? -6.667  -3.356  -11.179 1.00 6.76  ? 42 LYS A NZ   10 
ATOM   10988 H H    . LYS A 1 42 ? -3.132  -4.961  -7.169  1.00 2.45  ? 42 LYS A H    10 
ATOM   10989 H HA   . LYS A 1 42 ? -5.952  -5.362  -6.282  1.00 3.37  ? 42 LYS A HA   10 
ATOM   10990 H HB2  . LYS A 1 42 ? -4.956  -4.539  -8.895  1.00 3.94  ? 42 LYS A HB2  10 
ATOM   10991 H HB3  . LYS A 1 42 ? -5.866  -6.045  -9.001  1.00 3.87  ? 42 LYS A HB3  10 
ATOM   10992 H HG2  . LYS A 1 42 ? -7.515  -4.687  -7.367  1.00 4.83  ? 42 LYS A HG2  10 
ATOM   10993 H HG3  . LYS A 1 42 ? -6.793  -3.322  -8.222  1.00 4.94  ? 42 LYS A HG3  10 
ATOM   10994 H HD2  . LYS A 1 42 ? -7.512  -5.509  -10.027 1.00 5.79  ? 42 LYS A HD2  10 
ATOM   10995 H HD3  . LYS A 1 42 ? -8.903  -4.884  -9.143  1.00 5.70  ? 42 LYS A HD3  10 
ATOM   10996 H HE2  . LYS A 1 42 ? -8.772  -3.515  -11.075 1.00 5.66  ? 42 LYS A HE2  10 
ATOM   10997 H HE3  . LYS A 1 42 ? -8.045  -2.542  -9.797  1.00 5.59  ? 42 LYS A HE3  10 
ATOM   10998 H HZ1  . LYS A 1 42 ? -6.488  -4.268  -11.645 1.00 7.12  ? 42 LYS A HZ1  10 
ATOM   10999 H HZ2  . LYS A 1 42 ? -6.751  -2.613  -11.901 1.00 7.24  ? 42 LYS A HZ2  10 
ATOM   11000 H HZ3  . LYS A 1 42 ? -5.878  -3.132  -10.539 1.00 6.85  ? 42 LYS A HZ3  10 
ATOM   11001 N N    . LEU A 1 43 ? -5.133  -7.729  -5.913  1.00 3.01  ? 43 LEU A N    10 
ATOM   11002 C CA   . LEU A 1 43 ? -4.827  -9.188  -5.798  1.00 3.31  ? 43 LEU A CA   10 
ATOM   11003 C C    . LEU A 1 43 ? -5.416  -9.969  -6.979  1.00 3.92  ? 43 LEU A C    10 
ATOM   11004 O O    . LEU A 1 43 ? -6.457  -9.625  -7.515  1.00 4.54  ? 43 LEU A O    10 
ATOM   11005 C CB   . LEU A 1 43 ? -5.430  -9.725  -4.502  1.00 4.01  ? 43 LEU A CB   10 
ATOM   11006 C CG   . LEU A 1 43 ? -4.508  -9.399  -3.321  1.00 3.77  ? 43 LEU A CG   10 
ATOM   11007 C CD1  . LEU A 1 43 ? -5.175  -9.831  -2.013  1.00 4.46  ? 43 LEU A CD1  10 
ATOM   11008 C CD2  . LEU A 1 43 ? -3.177  -10.141 -3.480  1.00 3.91  ? 43 LEU A CD2  10 
ATOM   11009 H H    . LEU A 1 43 ? -5.541  -7.266  -5.154  1.00 3.37  ? 43 LEU A H    10 
ATOM   11010 H HA   . LEU A 1 43 ? -3.757  -9.328  -5.776  1.00 3.08  ? 43 LEU A HA   10 
ATOM   11011 H HB2  . LEU A 1 43 ? -6.391  -9.267  -4.346  1.00 4.55  ? 43 LEU A HB2  10 
ATOM   11012 H HB3  . LEU A 1 43 ? -5.554  -10.790 -4.579  1.00 4.52  ? 43 LEU A HB3  10 
ATOM   11013 H HG   . LEU A 1 43 ? -4.326  -8.333  -3.293  1.00 3.53  ? 43 LEU A HG   10 
ATOM   11014 H HD11 . LEU A 1 43 ? -5.430  -10.880 -2.067  1.00 4.51  ? 43 LEU A HD11 10 
ATOM   11015 H HD12 . LEU A 1 43 ? -4.495  -9.668  -1.190  1.00 5.14  ? 43 LEU A HD12 10 
ATOM   11016 H HD13 . LEU A 1 43 ? -6.073  -9.251  -1.857  1.00 4.57  ? 43 LEU A HD13 10 
ATOM   11017 H HD21 . LEU A 1 43 ? -3.364  -11.143 -3.837  1.00 4.44  ? 43 LEU A HD21 10 
ATOM   11018 H HD22 . LEU A 1 43 ? -2.555  -9.616  -4.190  1.00 3.95  ? 43 LEU A HD22 10 
ATOM   11019 H HD23 . LEU A 1 43 ? -2.674  -10.186 -2.526  1.00 3.96  ? 43 LEU A HD23 10 
ATOM   11020 N N    . SER A 1 44 ? -4.742  -11.027 -7.368  1.00 3.99  ? 44 SER A N    10 
ATOM   11021 C CA   . SER A 1 44 ? -5.205  -11.879 -8.507  1.00 4.72  ? 44 SER A CA   10 
ATOM   11022 C C    . SER A 1 44 ? -6.612  -12.440 -8.241  1.00 5.55  ? 44 SER A C    10 
ATOM   11023 O O    . SER A 1 44 ? -7.313  -12.817 -9.162  1.00 6.08  ? 44 SER A O    10 
ATOM   11024 C CB   . SER A 1 44 ? -4.225  -13.043 -8.699  1.00 4.98  ? 44 SER A CB   10 
ATOM   11025 O OG   . SER A 1 44 ? -4.096  -13.761 -7.476  1.00 5.08  ? 44 SER A OG   10 
ATOM   11026 H H    . SER A 1 44 ? -3.919  -11.263 -6.902  1.00 3.70  ? 44 SER A H    10 
ATOM   11027 H HA   . SER A 1 44 ? -5.222  -11.284 -9.402  1.00 4.83  ? 44 SER A HA   10 
ATOM   11028 H HB2  . SER A 1 44 ? -4.596  -13.706 -9.464  1.00 5.14  ? 44 SER A HB2  10 
ATOM   11029 H HB3  . SER A 1 44 ? -3.262  -12.653 -9.002  1.00 5.37  ? 44 SER A HB3  10 
ATOM   11030 H HG   . SER A 1 44 ? -4.093  -14.698 -7.682  1.00 5.39  ? 44 SER A HG   10 
ATOM   11031 N N    . ASP A 1 45 ? -7.033  -12.497 -6.997  1.00 5.91  ? 45 ASP A N    10 
ATOM   11032 C CA   . ASP A 1 45 ? -8.389  -13.028 -6.678  1.00 7.02  ? 45 ASP A CA   10 
ATOM   11033 C C    . ASP A 1 45 ? -9.460  -11.936 -6.880  1.00 7.25  ? 45 ASP A C    10 
ATOM   11034 O O    . ASP A 1 45 ? -10.541 -12.016 -6.323  1.00 8.19  ? 45 ASP A O    10 
ATOM   11035 C CB   . ASP A 1 45 ? -8.413  -13.501 -5.219  1.00 7.64  ? 45 ASP A CB   10 
ATOM   11036 C CG   . ASP A 1 45 ? -7.409  -14.643 -5.028  1.00 8.01  ? 45 ASP A CG   10 
ATOM   11037 O OD1  . ASP A 1 45 ? -6.265  -14.354 -4.715  1.00 8.63  ? 45 ASP A OD1  10 
ATOM   11038 O OD2  . ASP A 1 45 ? -7.803  -15.785 -5.198  1.00 7.89  ? 45 ASP A OD2  10 
ATOM   11039 H H    . ASP A 1 45 ? -6.461  -12.195 -6.273  1.00 5.60  ? 45 ASP A H    10 
ATOM   11040 H HA   . ASP A 1 45 ? -8.596  -13.858 -7.322  1.00 7.48  ? 45 ASP A HA   10 
ATOM   11041 H HB2  . ASP A 1 45 ? -8.150  -12.678 -4.570  1.00 7.55  ? 45 ASP A HB2  10 
ATOM   11042 H HB3  . ASP A 1 45 ? -9.404  -13.850 -4.970  1.00 8.18  ? 45 ASP A HB3  10 
ATOM   11043 N N    . GLY A 1 46 ? -9.175  -10.918 -7.667  1.00 6.57  ? 46 GLY A N    10 
ATOM   11044 C CA   . GLY A 1 46 ? -10.172 -9.831  -7.893  1.00 7.07  ? 46 GLY A CA   10 
ATOM   11045 C C    . GLY A 1 46 ? -10.335 -9.005  -6.614  1.00 6.74  ? 46 GLY A C    10 
ATOM   11046 O O    . GLY A 1 46 ? -11.408 -8.510  -6.324  1.00 7.17  ? 46 GLY A O    10 
ATOM   11047 H H    . GLY A 1 46 ? -8.306  -10.865 -8.106  1.00 5.88  ? 46 GLY A H    10 
ATOM   11048 H HA2  . GLY A 1 46 ? -9.832  -9.192  -8.696  1.00 7.41  ? 46 GLY A HA2  10 
ATOM   11049 H HA3  . GLY A 1 46 ? -11.123 -10.266 -8.158  1.00 7.56  ? 46 GLY A HA3  10 
ATOM   11050 N N    . ARG A 1 47 ? -9.281  -8.856  -5.845  1.00 6.21  ? 47 ARG A N    10 
ATOM   11051 C CA   . ARG A 1 47 ? -9.379  -8.069  -4.583  1.00 6.07  ? 47 ARG A CA   10 
ATOM   11052 C C    . ARG A 1 47 ? -8.594  -6.759  -4.732  1.00 5.32  ? 47 ARG A C    10 
ATOM   11053 O O    . ARG A 1 47 ? -7.766  -6.620  -5.611  1.00 5.06  ? 47 ARG A O    10 
ATOM   11054 C CB   . ARG A 1 47 ? -8.785  -8.905  -3.445  1.00 6.43  ? 47 ARG A CB   10 
ATOM   11055 C CG   . ARG A 1 47 ? -9.365  -8.458  -2.098  1.00 7.27  ? 47 ARG A CG   10 
ATOM   11056 C CD   . ARG A 1 47 ? -10.645 -9.242  -1.803  1.00 7.96  ? 47 ARG A CD   10 
ATOM   11057 N NE   . ARG A 1 47 ? -11.205 -8.808  -0.490  1.00 8.82  ? 47 ARG A NE   10 
ATOM   11058 C CZ   . ARG A 1 47 ? -11.964 -9.617  0.200   1.00 9.62  ? 47 ARG A CZ   10 
ATOM   11059 N NH1  . ARG A 1 47 ? -11.422 -10.527 0.969   1.00 10.15 ? 47 ARG A NH1  10 
ATOM   11060 N NH2  . ARG A 1 47 ? -13.266 -9.517  0.122   1.00 10.10 ? 47 ARG A NH2  10 
ATOM   11061 H H    . ARG A 1 47 ? -8.421  -9.269  -6.094  1.00 6.06  ? 47 ARG A H    10 
ATOM   11062 H HA   . ARG A 1 47 ? -10.414 -7.851  -4.369  1.00 6.58  ? 47 ARG A HA   10 
ATOM   11063 H HB2  . ARG A 1 47 ? -9.019  -9.947  -3.607  1.00 6.43  ? 47 ARG A HB2  10 
ATOM   11064 H HB3  . ARG A 1 47 ? -7.715  -8.778  -3.435  1.00 6.47  ? 47 ARG A HB3  10 
ATOM   11065 H HG2  . ARG A 1 47 ? -8.641  -8.644  -1.318  1.00 7.60  ? 47 ARG A HG2  10 
ATOM   11066 H HG3  . ARG A 1 47 ? -9.591  -7.405  -2.132  1.00 7.34  ? 47 ARG A HG3  10 
ATOM   11067 H HD2  . ARG A 1 47 ? -11.369 -9.055  -2.582  1.00 7.82  ? 47 ARG A HD2  10 
ATOM   11068 H HD3  . ARG A 1 47 ? -10.420 -10.298 -1.767  1.00 8.20  ? 47 ARG A HD3  10 
ATOM   11069 H HE   . ARG A 1 47 ? -11.005 -7.912  -0.144  1.00 8.93  ? 47 ARG A HE   10 
ATOM   11070 H HH11 . ARG A 1 47 ? -10.426 -10.603 1.030   1.00 9.97  ? 47 ARG A HH11 10 
ATOM   11071 H HH12 . ARG A 1 47 ? -12.003 -11.147 1.497   1.00 10.86 ? 47 ARG A HH12 10 
ATOM   11072 H HH21 . ARG A 1 47 ? -13.679 -8.819  -0.463  1.00 9.88  ? 47 ARG A HH21 10 
ATOM   11073 H HH22 . ARG A 1 47 ? -13.848 -10.136 0.649   1.00 10.80 ? 47 ARG A HH22 10 
ATOM   11074 N N    . GLU A 1 48 ? -8.848  -5.802  -3.875  1.00 5.24  ? 48 GLU A N    10 
ATOM   11075 C CA   . GLU A 1 48 ? -8.115  -4.504  -3.942  1.00 4.73  ? 48 GLU A CA   10 
ATOM   11076 C C    . GLU A 1 48 ? -7.724  -4.096  -2.521  1.00 4.69  ? 48 GLU A C    10 
ATOM   11077 O O    . GLU A 1 48 ? -8.572  -3.880  -1.674  1.00 5.44  ? 48 GLU A O    10 
ATOM   11078 C CB   . GLU A 1 48 ? -9.010  -3.426  -4.564  1.00 5.60  ? 48 GLU A CB   10 
ATOM   11079 C CG   . GLU A 1 48 ? -8.133  -2.364  -5.236  1.00 5.76  ? 48 GLU A CG   10 
ATOM   11080 C CD   . GLU A 1 48 ? -8.979  -1.136  -5.580  1.00 6.79  ? 48 GLU A CD   10 
ATOM   11081 O OE1  . GLU A 1 48 ? -9.084  -0.258  -4.738  1.00 7.44  ? 48 GLU A OE1  10 
ATOM   11082 O OE2  . GLU A 1 48 ? -9.506  -1.093  -6.680  1.00 7.12  ? 48 GLU A OE2  10 
ATOM   11083 H H    . GLU A 1 48 ? -9.520  -5.941  -3.177  1.00 5.71  ? 48 GLU A H    10 
ATOM   11084 H HA   . GLU A 1 48 ? -7.221  -4.623  -4.539  1.00 4.10  ? 48 GLU A HA   10 
ATOM   11085 H HB2  . GLU A 1 48 ? -9.658  -3.878  -5.301  1.00 5.76  ? 48 GLU A HB2  10 
ATOM   11086 H HB3  . GLU A 1 48 ? -9.607  -2.963  -3.793  1.00 6.30  ? 48 GLU A HB3  10 
ATOM   11087 H HG2  . GLU A 1 48 ? -7.338  -2.077  -4.562  1.00 5.48  ? 48 GLU A HG2  10 
ATOM   11088 H HG3  . GLU A 1 48 ? -7.707  -2.770  -6.140  1.00 5.78  ? 48 GLU A HG3  10 
ATOM   11089 N N    . LEU A 1 49 ? -6.448  -4.002  -2.252  1.00 4.08  ? 49 LEU A N    10 
ATOM   11090 C CA   . LEU A 1 49 ? -5.997  -3.621  -0.881  1.00 4.35  ? 49 LEU A CA   10 
ATOM   11091 C C    . LEU A 1 49 ? -5.057  -2.427  -0.977  1.00 3.99  ? 49 LEU A C    10 
ATOM   11092 O O    . LEU A 1 49 ? -4.055  -2.484  -1.651  1.00 3.87  ? 49 LEU A O    10 
ATOM   11093 C CB   . LEU A 1 49 ? -5.235  -4.789  -0.246  1.00 4.67  ? 49 LEU A CB   10 
ATOM   11094 C CG   . LEU A 1 49 ? -6.066  -5.421  0.873   1.00 4.92  ? 49 LEU A CG   10 
ATOM   11095 C CD1  . LEU A 1 49 ? -7.017  -6.464  0.287   1.00 5.51  ? 49 LEU A CD1  10 
ATOM   11096 C CD2  . LEU A 1 49 ? -5.126  -6.103  1.869   1.00 4.69  ? 49 LEU A CD2  10 
ATOM   11097 H H    . LEU A 1 49 ? -5.782  -4.186  -2.953  1.00 3.67  ? 49 LEU A H    10 
ATOM   11098 H HA   . LEU A 1 49 ? -6.850  -3.368  -0.270  1.00 4.89  ? 49 LEU A HA   10 
ATOM   11099 H HB2  . LEU A 1 49 ? -5.022  -5.533  -1.000  1.00 4.69  ? 49 LEU A HB2  10 
ATOM   11100 H HB3  . LEU A 1 49 ? -4.308  -4.420  0.166   1.00 5.10  ? 49 LEU A HB3  10 
ATOM   11101 H HG   . LEU A 1 49 ? -6.636  -4.654  1.379   1.00 5.20  ? 49 LEU A HG   10 
ATOM   11102 H HD11 . LEU A 1 49 ? -7.620  -6.008  -0.484  1.00 5.74  ? 49 LEU A HD11 10 
ATOM   11103 H HD12 . LEU A 1 49 ? -6.444  -7.275  -0.135  1.00 5.91  ? 49 LEU A HD12 10 
ATOM   11104 H HD13 . LEU A 1 49 ? -7.659  -6.844  1.068   1.00 5.66  ? 49 LEU A HD13 10 
ATOM   11105 H HD21 . LEU A 1 49 ? -4.223  -5.519  1.968   1.00 4.66  ? 49 LEU A HD21 10 
ATOM   11106 H HD22 . LEU A 1 49 ? -5.612  -6.180  2.830   1.00 5.11  ? 49 LEU A HD22 10 
ATOM   11107 H HD23 . LEU A 1 49 ? -4.875  -7.091  1.511   1.00 4.52  ? 49 LEU A HD23 10 
ATOM   11108 N N    . CYS A 1 50 ? -5.350  -1.360  -0.286  1.00 3.99  ? 50 CYS A N    10 
ATOM   11109 C CA   . CYS A 1 50 ? -4.437  -0.183  -0.331  1.00 3.63  ? 50 CYS A CA   10 
ATOM   11110 C C    . CYS A 1 50 ? -3.281  -0.463  0.619   1.00 3.49  ? 50 CYS A C    10 
ATOM   11111 O O    . CYS A 1 50 ? -3.488  -0.941  1.712   1.00 4.14  ? 50 CYS A O    10 
ATOM   11112 C CB   . CYS A 1 50 ? -5.147  1.093   0.112   1.00 3.72  ? 50 CYS A CB   10 
ATOM   11113 S SG   . CYS A 1 50 ? -6.948  0.910   0.011   1.00 4.64  ? 50 CYS A SG   10 
ATOM   11114 H H    . CYS A 1 50 ? -6.146  -1.345  0.278   1.00 4.28  ? 50 CYS A H    10 
ATOM   11115 H HA   . CYS A 1 50 ? -4.059  -0.054  -1.326  1.00 3.59  ? 50 CYS A HA   10 
ATOM   11116 H HB2  . CYS A 1 50 ? -4.859  1.311   1.118   1.00 3.90  ? 50 CYS A HB2  10 
ATOM   11117 H HB3  . CYS A 1 50 ? -4.837  1.904   -0.525  1.00 3.38  ? 50 CYS A HB3  10 
ATOM   11118 N N    . LEU A 1 51 ? -2.070  -0.192  0.215   1.00 2.91  ? 51 LEU A N    10 
ATOM   11119 C CA   . LEU A 1 51 ? -0.918  -0.473  1.106   1.00 2.96  ? 51 LEU A CA   10 
ATOM   11120 C C    . LEU A 1 51 ? -0.497  0.785   1.848   1.00 3.35  ? 51 LEU A C    10 
ATOM   11121 O O    . LEU A 1 51 ? -0.753  1.907   1.430   1.00 3.56  ? 51 LEU A O    10 
ATOM   11122 C CB   . LEU A 1 51 ? 0.264   -0.991  0.298   1.00 2.71  ? 51 LEU A CB   10 
ATOM   11123 C CG   . LEU A 1 51 ? -0.014  -2.417  -0.191  1.00 2.56  ? 51 LEU A CG   10 
ATOM   11124 C CD1  . LEU A 1 51 ? -1.038  -2.392  -1.323  1.00 2.98  ? 51 LEU A CD1  10 
ATOM   11125 C CD2  . LEU A 1 51 ? 1.291   -3.040  -0.698  1.00 2.61  ? 51 LEU A CD2  10 
ATOM   11126 H H    . LEU A 1 51 ? -1.917  0.174   -0.668  1.00 2.70  ? 51 LEU A H    10 
ATOM   11127 H HA   . LEU A 1 51 ? -1.207  -1.217  1.828   1.00 3.34  ? 51 LEU A HA   10 
ATOM   11128 H HB2  . LEU A 1 51 ? 0.430   -0.343  -0.536  1.00 2.95  ? 51 LEU A HB2  10 
ATOM   11129 H HB3  . LEU A 1 51 ? 1.138   -0.994  0.919   1.00 2.93  ? 51 LEU A HB3  10 
ATOM   11130 H HG   . LEU A 1 51 ? -0.403  -3.007  0.622   1.00 2.88  ? 51 LEU A HG   10 
ATOM   11131 H HD11 . LEU A 1 51 ? -1.137  -1.386  -1.699  1.00 3.13  ? 51 LEU A HD11 10 
ATOM   11132 H HD12 . LEU A 1 51 ? -0.712  -3.042  -2.117  1.00 3.38  ? 51 LEU A HD12 10 
ATOM   11133 H HD13 . LEU A 1 51 ? -1.992  -2.730  -0.948  1.00 3.34  ? 51 LEU A HD13 10 
ATOM   11134 H HD21 . LEU A 1 51 ? 1.755   -2.375  -1.411  1.00 2.77  ? 51 LEU A HD21 10 
ATOM   11135 H HD22 . LEU A 1 51 ? 1.960   -3.199  0.133   1.00 3.04  ? 51 LEU A HD22 10 
ATOM   11136 H HD23 . LEU A 1 51 ? 1.076   -3.985  -1.174  1.00 2.85  ? 51 LEU A HD23 10 
ATOM   11137 N N    . ASP A 1 52 ? 0.154   0.572   2.953   1.00 3.84  ? 52 ASP A N    10 
ATOM   11138 C CA   . ASP A 1 52 ? 0.632   1.688   3.809   1.00 4.35  ? 52 ASP A CA   10 
ATOM   11139 C C    . ASP A 1 52 ? 2.157   1.823   3.670   1.00 4.47  ? 52 ASP A C    10 
ATOM   11140 O O    . ASP A 1 52 ? 2.894   0.924   4.042   1.00 4.73  ? 52 ASP A O    10 
ATOM   11141 C CB   . ASP A 1 52 ? 0.259   1.366   5.263   1.00 4.93  ? 52 ASP A CB   10 
ATOM   11142 C CG   . ASP A 1 52 ? 0.288   2.641   6.115   1.00 5.39  ? 52 ASP A CG   10 
ATOM   11143 O OD1  . ASP A 1 52 ? -0.257  3.644   5.677   1.00 5.96  ? 52 ASP A OD1  10 
ATOM   11144 O OD2  . ASP A 1 52 ? 0.847   2.588   7.197   1.00 5.40  ? 52 ASP A OD2  10 
ATOM   11145 H H    . ASP A 1 52 ? 0.334   -0.351  3.220   1.00 4.08  ? 52 ASP A H    10 
ATOM   11146 H HA   . ASP A 1 52 ? 0.152   2.605   3.507   1.00 4.52  ? 52 ASP A HA   10 
ATOM   11147 H HB2  . ASP A 1 52 ? -0.735  0.940   5.289   1.00 5.32  ? 52 ASP A HB2  10 
ATOM   11148 H HB3  . ASP A 1 52 ? 0.963   0.650   5.663   1.00 4.91  ? 52 ASP A HB3  10 
ATOM   11149 N N    . PRO A 1 53 ? 2.590   2.947   3.140   1.00 4.54  ? 53 PRO A N    10 
ATOM   11150 C CA   . PRO A 1 53 ? 4.029   3.225   2.931   1.00 4.96  ? 53 PRO A CA   10 
ATOM   11151 C C    . PRO A 1 53 ? 4.768   3.432   4.262   1.00 5.21  ? 53 PRO A C    10 
ATOM   11152 O O    . PRO A 1 53 ? 5.982   3.519   4.289   1.00 5.67  ? 53 PRO A O    10 
ATOM   11153 C CB   . PRO A 1 53 ? 4.031   4.493   2.069   1.00 5.26  ? 53 PRO A CB   10 
ATOM   11154 C CG   . PRO A 1 53 ? 2.659   5.168   2.282   1.00 5.04  ? 53 PRO A CG   10 
ATOM   11155 C CD   . PRO A 1 53 ? 1.697   4.054   2.728   1.00 4.55  ? 53 PRO A CD   10 
ATOM   11156 H HA   . PRO A 1 53 ? 4.484   2.417   2.379   1.00 5.07  ? 53 PRO A HA   10 
ATOM   11157 H HB2  . PRO A 1 53 ? 4.828   5.153   2.384   1.00 5.72  ? 53 PRO A HB2  10 
ATOM   11158 H HB3  . PRO A 1 53 ? 4.152   4.234   1.028   1.00 5.40  ? 53 PRO A HB3  10 
ATOM   11159 H HG2  . PRO A 1 53 ? 2.735   5.928   3.048   1.00 5.39  ? 53 PRO A HG2  10 
ATOM   11160 H HG3  . PRO A 1 53 ? 2.312   5.605   1.358   1.00 5.11  ? 53 PRO A HG3  10 
ATOM   11161 H HD2  . PRO A 1 53 ? 1.093   4.387   3.560   1.00 4.78  ? 53 PRO A HD2  10 
ATOM   11162 H HD3  . PRO A 1 53 ? 1.072   3.741   1.905   1.00 4.27  ? 53 PRO A HD3  10 
ATOM   11163 N N    . LYS A 1 54 ? 4.055   3.493   5.368   1.00 5.18  ? 54 LYS A N    10 
ATOM   11164 C CA   . LYS A 1 54 ? 4.723   3.672   6.686   1.00 5.61  ? 54 LYS A CA   10 
ATOM   11165 C C    . LYS A 1 54 ? 5.630   2.465   6.980   1.00 5.02  ? 54 LYS A C    10 
ATOM   11166 O O    . LYS A 1 54 ? 6.612   2.587   7.687   1.00 5.42  ? 54 LYS A O    10 
ATOM   11167 C CB   . LYS A 1 54 ? 3.662   3.799   7.784   1.00 6.23  ? 54 LYS A CB   10 
ATOM   11168 C CG   . LYS A 1 54 ? 3.925   5.059   8.615   1.00 7.12  ? 54 LYS A CG   10 
ATOM   11169 C CD   . LYS A 1 54 ? 2.639   5.478   9.335   1.00 7.85  ? 54 LYS A CD   10 
ATOM   11170 C CE   . LYS A 1 54 ? 2.615   7.001   9.501   1.00 8.63  ? 54 LYS A CE   10 
ATOM   11171 N NZ   . LYS A 1 54 ? 3.452   7.389   10.672  1.00 9.56  ? 54 LYS A NZ   10 
ATOM   11172 H H    . LYS A 1 54 ? 3.087   3.414   5.332   1.00 5.07  ? 54 LYS A H    10 
ATOM   11173 H HA   . LYS A 1 54 ? 5.316   4.566   6.656   1.00 6.14  ? 54 LYS A HA   10 
ATOM   11174 H HB2  . LYS A 1 54 ? 2.688   3.865   7.329   1.00 6.01  ? 54 LYS A HB2  10 
ATOM   11175 H HB3  . LYS A 1 54 ? 3.701   2.932   8.426   1.00 6.42  ? 54 LYS A HB3  10 
ATOM   11176 H HG2  . LYS A 1 54 ? 4.695   4.856   9.343   1.00 7.47  ? 54 LYS A HG2  10 
ATOM   11177 H HG3  . LYS A 1 54 ? 4.247   5.859   7.964   1.00 7.15  ? 54 LYS A HG3  10 
ATOM   11178 H HD2  . LYS A 1 54 ? 1.782   5.165   8.755   1.00 8.02  ? 54 LYS A HD2  10 
ATOM   11179 H HD3  . LYS A 1 54 ? 2.604   5.011   10.309  1.00 7.93  ? 54 LYS A HD3  10 
ATOM   11180 H HE2  . LYS A 1 54 ? 3.006   7.466   8.608   1.00 8.78  ? 54 LYS A HE2  10 
ATOM   11181 H HE3  . LYS A 1 54 ? 1.597   7.329   9.660   1.00 8.58  ? 54 LYS A HE3  10 
ATOM   11182 H HZ1  . LYS A 1 54 ? 3.124   6.881   11.518  1.00 9.78  ? 54 LYS A HZ1  10 
ATOM   11183 H HZ2  . LYS A 1 54 ? 4.445   7.144   10.487  1.00 9.84  ? 54 LYS A HZ2  10 
ATOM   11184 H HZ3  . LYS A 1 54 ? 3.370   8.415   10.830  1.00 9.93  ? 54 LYS A HZ3  10 
ATOM   11185 N N    . GLU A 1 55 ? 5.321   1.303   6.432   1.00 4.37  ? 55 GLU A N    10 
ATOM   11186 C CA   . GLU A 1 55 ? 6.182   0.109   6.677   1.00 4.14  ? 55 GLU A CA   10 
ATOM   11187 C C    . GLU A 1 55 ? 7.320   0.092   5.657   1.00 3.84  ? 55 GLU A C    10 
ATOM   11188 O O    . GLU A 1 55 ? 7.349   0.870   4.720   1.00 3.83  ? 55 GLU A O    10 
ATOM   11189 C CB   . GLU A 1 55 ? 5.359   -1.175  6.512   1.00 4.19  ? 55 GLU A CB   10 
ATOM   11190 C CG   . GLU A 1 55 ? 4.645   -1.514  7.823   1.00 4.76  ? 55 GLU A CG   10 
ATOM   11191 C CD   . GLU A 1 55 ? 5.078   -2.899  8.317   1.00 5.39  ? 55 GLU A CD   10 
ATOM   11192 O OE1  . GLU A 1 55 ? 6.270   -3.102  8.494   1.00 5.43  ? 55 GLU A OE1  10 
ATOM   11193 O OE2  . GLU A 1 55 ? 4.210   -3.732  8.519   1.00 6.13  ? 55 GLU A OE2  10 
ATOM   11194 H H    . GLU A 1 55 ? 4.532   1.220   5.854   1.00 4.29  ? 55 GLU A H    10 
ATOM   11195 H HA   . GLU A 1 55 ? 6.589   0.153   7.676   1.00 4.53  ? 55 GLU A HA   10 
ATOM   11196 H HB2  . GLU A 1 55 ? 4.641   -1.040  5.729   1.00 4.04  ? 55 GLU A HB2  10 
ATOM   11197 H HB3  . GLU A 1 55 ? 6.014   -1.984  6.250   1.00 4.32  ? 55 GLU A HB3  10 
ATOM   11198 H HG2  . GLU A 1 55 ? 4.902   -0.781  8.565   1.00 4.81  ? 55 GLU A HG2  10 
ATOM   11199 H HG3  . GLU A 1 55 ? 3.578   -1.507  7.663   1.00 4.98  ? 55 GLU A HG3  10 
ATOM   11200 N N    . ASN A 1 56 ? 8.242   -0.811  5.827   1.00 3.90  ? 56 ASN A N    10 
ATOM   11201 C CA   . ASN A 1 56 ? 9.380   -0.924  4.870   1.00 3.93  ? 56 ASN A CA   10 
ATOM   11202 C C    . ASN A 1 56 ? 9.072   -2.014  3.837   1.00 3.74  ? 56 ASN A C    10 
ATOM   11203 O O    . ASN A 1 56 ? 9.694   -2.078  2.796   1.00 3.89  ? 56 ASN A O    10 
ATOM   11204 C CB   . ASN A 1 56 ? 10.650  -1.284  5.625   1.00 4.29  ? 56 ASN A CB   10 
ATOM   11205 C CG   . ASN A 1 56 ? 11.693  -0.174  5.446   1.00 4.70  ? 56 ASN A CG   10 
ATOM   11206 O OD1  . ASN A 1 56 ? 12.674  -0.355  4.752   1.00 4.90  ? 56 ASN A OD1  10 
ATOM   11207 N ND2  . ASN A 1 56 ? 11.521  0.974   6.044   1.00 5.15  ? 56 ASN A ND2  10 
ATOM   11208 H H    . ASN A 1 56 ? 8.175   -1.433  6.581   1.00 4.12  ? 56 ASN A H    10 
ATOM   11209 H HA   . ASN A 1 56 ? 9.523   0.012   4.369   1.00 4.07  ? 56 ASN A HA   10 
ATOM   11210 H HB2  . ASN A 1 56 ? 10.417  -1.396  6.668   1.00 4.38  ? 56 ASN A HB2  10 
ATOM   11211 H HB3  . ASN A 1 56 ? 11.043  -2.206  5.239   1.00 4.36  ? 56 ASN A HB3  10 
ATOM   11212 H HD21 . ASN A 1 56 ? 10.731  1.124   6.605   1.00 5.31  ? 56 ASN A HD21 10 
ATOM   11213 H HD22 . ASN A 1 56 ? 12.184  1.687   5.933   1.00 5.51  ? 56 ASN A HD22 10 
ATOM   11214 N N    . TRP A 1 57 ? 8.113   -2.869  4.120   1.00 3.55  ? 57 TRP A N    10 
ATOM   11215 C CA   . TRP A 1 57 ? 7.760   -3.947  3.167   1.00 3.47  ? 57 TRP A CA   10 
ATOM   11216 C C    . TRP A 1 57 ? 6.878   -3.380  2.057   1.00 3.28  ? 57 TRP A C    10 
ATOM   11217 O O    . TRP A 1 57 ? 6.997   -3.763  0.918   1.00 3.48  ? 57 TRP A O    10 
ATOM   11218 C CB   . TRP A 1 57 ? 7.046   -5.082  3.912   1.00 3.64  ? 57 TRP A CB   10 
ATOM   11219 C CG   . TRP A 1 57 ? 5.648   -4.719  4.287   1.00 3.70  ? 57 TRP A CG   10 
ATOM   11220 C CD1  . TRP A 1 57 ? 5.277   -4.294  5.501   1.00 4.08  ? 57 TRP A CD1  10 
ATOM   11221 C CD2  . TRP A 1 57 ? 4.433   -4.765  3.480   1.00 3.51  ? 57 TRP A CD2  10 
ATOM   11222 N NE1  . TRP A 1 57 ? 3.914   -4.097  5.510   1.00 4.20  ? 57 TRP A NE1  10 
ATOM   11223 C CE2  . TRP A 1 57 ? 3.348   -4.361  4.286   1.00 3.80  ? 57 TRP A CE2  10 
ATOM   11224 C CE3  . TRP A 1 57 ? 4.168   -5.116  2.146   1.00 3.27  ? 57 TRP A CE3  10 
ATOM   11225 C CZ2  . TRP A 1 57 ? 2.045   -4.302  3.793   1.00 3.76  ? 57 TRP A CZ2  10 
ATOM   11226 C CZ3  . TRP A 1 57 ? 2.859   -5.055  1.644   1.00 3.17  ? 57 TRP A CZ3  10 
ATOM   11227 C CH2  . TRP A 1 57 ? 1.799   -4.650  2.466   1.00 3.38  ? 57 TRP A CH2  10 
ATOM   11228 H H    . TRP A 1 57 ? 7.627   -2.799  4.956   1.00 3.59  ? 57 TRP A H    10 
ATOM   11229 H HA   . TRP A 1 57 ? 8.665   -4.327  2.735   1.00 3.59  ? 57 TRP A HA   10 
ATOM   11230 H HB2  . TRP A 1 57 ? 7.013   -5.944  3.294   1.00 3.77  ? 57 TRP A HB2  10 
ATOM   11231 H HB3  . TRP A 1 57 ? 7.601   -5.313  4.804   1.00 3.78  ? 57 TRP A HB3  10 
ATOM   11232 H HD1  . TRP A 1 57 ? 5.939   -4.143  6.332   1.00 4.35  ? 57 TRP A HD1  10 
ATOM   11233 H HE1  . TRP A 1 57 ? 3.398   -3.804  6.276   1.00 4.57  ? 57 TRP A HE1  10 
ATOM   11234 H HE3  . TRP A 1 57 ? 4.975   -5.429  1.505   1.00 3.29  ? 57 TRP A HE3  10 
ATOM   11235 H HZ2  . TRP A 1 57 ? 1.234   -3.990  4.434   1.00 4.10  ? 57 TRP A HZ2  10 
ATOM   11236 H HZ3  . TRP A 1 57 ? 2.670   -5.316  0.620   1.00 3.03  ? 57 TRP A HZ3  10 
ATOM   11237 H HH2  . TRP A 1 57 ? 0.794   -4.606  2.072   1.00 3.37  ? 57 TRP A HH2  10 
ATOM   11238 N N    . VAL A 1 58 ? 6.005   -2.463  2.382   1.00 3.02  ? 58 VAL A N    10 
ATOM   11239 C CA   . VAL A 1 58 ? 5.126   -1.860  1.334   1.00 2.84  ? 58 VAL A CA   10 
ATOM   11240 C C    . VAL A 1 58 ? 5.998   -1.062  0.357   1.00 2.99  ? 58 VAL A C    10 
ATOM   11241 O O    . VAL A 1 58 ? 5.817   -1.133  -0.843  1.00 3.21  ? 58 VAL A O    10 
ATOM   11242 C CB   . VAL A 1 58 ? 4.103   -0.932  2.005   1.00 2.78  ? 58 VAL A CB   10 
ATOM   11243 C CG1  . VAL A 1 58 ? 3.630   0.151   1.030   1.00 2.80  ? 58 VAL A CG1  10 
ATOM   11244 C CG2  . VAL A 1 58 ? 2.900   -1.743  2.468   1.00 2.85  ? 58 VAL A CG2  10 
ATOM   11245 H H    . VAL A 1 58 ? 5.933   -2.165  3.316   1.00 3.04  ? 58 VAL A H    10 
ATOM   11246 H HA   . VAL A 1 58 ? 4.616   -2.645  0.797   1.00 2.96  ? 58 VAL A HA   10 
ATOM   11247 H HB   . VAL A 1 58 ? 4.562   -0.468  2.857   1.00 3.12  ? 58 VAL A HB   10 
ATOM   11248 H HG11 . VAL A 1 58 ? 3.397   -0.299  0.077   1.00 3.08  ? 58 VAL A HG11 10 
ATOM   11249 H HG12 . VAL A 1 58 ? 2.748   0.630   1.428   1.00 3.10  ? 58 VAL A HG12 10 
ATOM   11250 H HG13 . VAL A 1 58 ? 4.411   0.885   0.901   1.00 2.86  ? 58 VAL A HG13 10 
ATOM   11251 H HG21 . VAL A 1 58 ? 2.720   -2.547  1.772   1.00 3.17  ? 58 VAL A HG21 10 
ATOM   11252 H HG22 . VAL A 1 58 ? 3.101   -2.150  3.446   1.00 2.93  ? 58 VAL A HG22 10 
ATOM   11253 H HG23 . VAL A 1 58 ? 2.031   -1.105  2.515   1.00 3.15  ? 58 VAL A HG23 10 
ATOM   11254 N N    . GLN A 1 59 ? 6.942   -0.309  0.864   1.00 3.12  ? 59 GLN A N    10 
ATOM   11255 C CA   . GLN A 1 59 ? 7.828   0.489   -0.028  1.00 3.61  ? 59 GLN A CA   10 
ATOM   11256 C C    . GLN A 1 59 ? 8.852   -0.427  -0.718  1.00 3.90  ? 59 GLN A C    10 
ATOM   11257 O O    . GLN A 1 59 ? 9.301   -0.142  -1.812  1.00 4.47  ? 59 GLN A O    10 
ATOM   11258 C CB   . GLN A 1 59 ? 8.537   1.569   0.787   1.00 3.82  ? 59 GLN A CB   10 
ATOM   11259 C CG   . GLN A 1 59 ? 9.370   0.912   1.876   1.00 4.33  ? 59 GLN A CG   10 
ATOM   11260 C CD   . GLN A 1 59 ? 10.090  1.979   2.705   1.00 4.72  ? 59 GLN A CD   10 
ATOM   11261 O OE1  . GLN A 1 59 ? 9.459   2.748   3.405   1.00 4.84  ? 59 GLN A OE1  10 
ATOM   11262 N NE2  . GLN A 1 59 ? 11.392  2.059   2.661   1.00 5.29  ? 59 GLN A NE2  10 
ATOM   11263 H H    . GLN A 1 59 ? 7.071   -0.273  1.834   1.00 3.04  ? 59 GLN A H    10 
ATOM   11264 H HA   . GLN A 1 59 ? 7.230   0.959   -0.775  1.00 3.80  ? 59 GLN A HA   10 
ATOM   11265 H HB2  . GLN A 1 59 ? 9.176   2.142   0.140   1.00 3.96  ? 59 GLN A HB2  10 
ATOM   11266 H HB3  . GLN A 1 59 ? 7.803   2.219   1.239   1.00 3.78  ? 59 GLN A HB3  10 
ATOM   11267 H HG2  . GLN A 1 59 ? 8.720   0.334   2.511   1.00 4.58  ? 59 GLN A HG2  10 
ATOM   11268 H HG3  . GLN A 1 59 ? 10.093  0.261   1.416   1.00 4.52  ? 59 GLN A HG3  10 
ATOM   11269 H HE21 . GLN A 1 59 ? 11.904  1.438   2.100   1.00 5.47  ? 59 GLN A HE21 10 
ATOM   11270 H HE22 . GLN A 1 59 ? 11.859  2.739   3.189   1.00 5.70  ? 59 GLN A HE22 10 
ATOM   11271 N N    . ARG A 1 60 ? 9.204   -1.536  -0.103  1.00 3.65  ? 60 ARG A N    10 
ATOM   11272 C CA   . ARG A 1 60 ? 10.174  -2.475  -0.740  1.00 3.97  ? 60 ARG A CA   10 
ATOM   11273 C C    . ARG A 1 60 ? 9.410   -3.336  -1.747  1.00 3.96  ? 60 ARG A C    10 
ATOM   11274 O O    . ARG A 1 60 ? 9.885   -3.605  -2.833  1.00 4.42  ? 60 ARG A O    10 
ATOM   11275 C CB   . ARG A 1 60 ? 10.810  -3.375  0.324   1.00 4.07  ? 60 ARG A CB   10 
ATOM   11276 C CG   . ARG A 1 60 ? 12.054  -2.692  0.903   1.00 4.60  ? 60 ARG A CG   10 
ATOM   11277 C CD   . ARG A 1 60 ? 13.304  -3.506  0.552   1.00 4.81  ? 60 ARG A CD   10 
ATOM   11278 N NE   . ARG A 1 60 ? 13.519  -4.563  1.584   1.00 5.26  ? 60 ARG A NE   10 
ATOM   11279 C CZ   . ARG A 1 60 ? 14.596  -4.547  2.327   1.00 5.84  ? 60 ARG A CZ   10 
ATOM   11280 N NH1  . ARG A 1 60 ? 15.724  -5.014  1.855   1.00 6.35  ? 60 ARG A NH1  10 
ATOM   11281 N NH2  . ARG A 1 60 ? 14.545  -4.063  3.542   1.00 6.25  ? 60 ARG A NH2  10 
ATOM   11282 H H    . ARG A 1 60 ? 8.814   -1.762  0.766   1.00 3.35  ? 60 ARG A H    10 
ATOM   11283 H HA   . ARG A 1 60 ? 10.942  -1.913  -1.252  1.00 4.24  ? 60 ARG A HA   10 
ATOM   11284 H HB2  . ARG A 1 60 ? 10.096  -3.555  1.113   1.00 3.95  ? 60 ARG A HB2  10 
ATOM   11285 H HB3  . ARG A 1 60 ? 11.092  -4.314  -0.123  1.00 4.07  ? 60 ARG A HB3  10 
ATOM   11286 H HG2  . ARG A 1 60 ? 12.144  -1.698  0.489   1.00 4.80  ? 60 ARG A HG2  10 
ATOM   11287 H HG3  . ARG A 1 60 ? 11.960  -2.625  1.976   1.00 4.99  ? 60 ARG A HG3  10 
ATOM   11288 H HD2  . ARG A 1 60 ? 13.174  -3.968  -0.415  1.00 4.73  ? 60 ARG A HD2  10 
ATOM   11289 H HD3  . ARG A 1 60 ? 14.162  -2.851  0.525   1.00 5.10  ? 60 ARG A HD3  10 
ATOM   11290 H HE   . ARG A 1 60 ? 12.852  -5.272  1.704   1.00 5.37  ? 60 ARG A HE   10 
ATOM   11291 H HH11 . ARG A 1 60 ? 15.764  -5.384  0.926   1.00 6.32  ? 60 ARG A HH11 10 
ATOM   11292 H HH12 . ARG A 1 60 ? 16.548  -5.002  2.423   1.00 6.96  ? 60 ARG A HH12 10 
ATOM   11293 H HH21 . ARG A 1 60 ? 13.683  -3.706  3.903   1.00 6.14  ? 60 ARG A HH21 10 
ATOM   11294 H HH22 . ARG A 1 60 ? 15.368  -4.051  4.112   1.00 6.86  ? 60 ARG A HH22 10 
ATOM   11295 N N    . VAL A 1 61 ? 8.218   -3.752  -1.387  1.00 3.58  ? 61 VAL A N    10 
ATOM   11296 C CA   . VAL A 1 61 ? 7.387   -4.579  -2.306  1.00 3.55  ? 61 VAL A CA   10 
ATOM   11297 C C    . VAL A 1 61 ? 7.029   -3.745  -3.543  1.00 3.25  ? 61 VAL A C    10 
ATOM   11298 O O    . VAL A 1 61 ? 7.065   -4.232  -4.656  1.00 3.52  ? 61 VAL A O    10 
ATOM   11299 C CB   . VAL A 1 61 ? 6.113   -5.011  -1.566  1.00 3.59  ? 61 VAL A CB   10 
ATOM   11300 C CG1  . VAL A 1 61 ? 5.050   -5.481  -2.559  1.00 3.56  ? 61 VAL A CG1  10 
ATOM   11301 C CG2  . VAL A 1 61 ? 6.451   -6.154  -0.605  1.00 4.31  ? 61 VAL A CG2  10 
ATOM   11302 H H    . VAL A 1 61 ? 7.861   -3.506  -0.501  1.00 3.39  ? 61 VAL A H    10 
ATOM   11303 H HA   . VAL A 1 61 ? 7.945   -5.449  -2.611  1.00 3.93  ? 61 VAL A HA   10 
ATOM   11304 H HB   . VAL A 1 61 ? 5.726   -4.173  -1.004  1.00 3.40  ? 61 VAL A HB   10 
ATOM   11305 H HG11 . VAL A 1 61 ? 5.524   -6.031  -3.357  1.00 3.73  ? 61 VAL A HG11 10 
ATOM   11306 H HG12 . VAL A 1 61 ? 4.341   -6.119  -2.051  1.00 3.88  ? 61 VAL A HG12 10 
ATOM   11307 H HG13 . VAL A 1 61 ? 4.536   -4.624  -2.966  1.00 3.52  ? 61 VAL A HG13 10 
ATOM   11308 H HG21 . VAL A 1 61 ? 7.272   -5.857  0.032   1.00 4.75  ? 61 VAL A HG21 10 
ATOM   11309 H HG22 . VAL A 1 61 ? 5.589   -6.381  0.003   1.00 4.45  ? 61 VAL A HG22 10 
ATOM   11310 H HG23 . VAL A 1 61 ? 6.734   -7.029  -1.170  1.00 4.58  ? 61 VAL A HG23 10 
ATOM   11311 N N    . VAL A 1 62 ? 6.699   -2.490  -3.352  1.00 2.99  ? 62 VAL A N    10 
ATOM   11312 C CA   . VAL A 1 62 ? 6.350   -1.614  -4.513  1.00 3.22  ? 62 VAL A CA   10 
ATOM   11313 C C    . VAL A 1 62 ? 7.602   -1.389  -5.376  1.00 3.80  ? 62 VAL A C    10 
ATOM   11314 O O    . VAL A 1 62 ? 7.525   -1.368  -6.590  1.00 4.15  ? 62 VAL A O    10 
ATOM   11315 C CB   . VAL A 1 62 ? 5.817   -0.267  -3.999  1.00 3.53  ? 62 VAL A CB   10 
ATOM   11316 C CG1  . VAL A 1 62 ? 5.643   0.710   -5.166  1.00 4.40  ? 62 VAL A CG1  10 
ATOM   11317 C CG2  . VAL A 1 62 ? 4.458   -0.482  -3.322  1.00 3.34  ? 62 VAL A CG2  10 
ATOM   11318 H H    . VAL A 1 62 ? 6.689   -2.121  -2.444  1.00 2.92  ? 62 VAL A H    10 
ATOM   11319 H HA   . VAL A 1 62 ? 5.591   -2.099  -5.108  1.00 3.17  ? 62 VAL A HA   10 
ATOM   11320 H HB   . VAL A 1 62 ? 6.515   0.145   -3.284  1.00 3.69  ? 62 VAL A HB   10 
ATOM   11321 H HG11 . VAL A 1 62 ? 5.011   0.264   -5.920  1.00 4.59  ? 62 VAL A HG11 10 
ATOM   11322 H HG12 . VAL A 1 62 ? 5.188   1.621   -4.806  1.00 4.91  ? 62 VAL A HG12 10 
ATOM   11323 H HG13 . VAL A 1 62 ? 6.610   0.936   -5.592  1.00 4.71  ? 62 VAL A HG13 10 
ATOM   11324 H HG21 . VAL A 1 62 ? 4.434   -1.459  -2.862  1.00 3.80  ? 62 VAL A HG21 10 
ATOM   11325 H HG22 . VAL A 1 62 ? 4.311   0.276   -2.566  1.00 3.53  ? 62 VAL A HG22 10 
ATOM   11326 H HG23 . VAL A 1 62 ? 3.672   -0.411  -4.059  1.00 3.11  ? 62 VAL A HG23 10 
ATOM   11327 N N    . GLU A 1 63 ? 8.753   -1.225  -4.760  1.00 4.04  ? 63 GLU A N    10 
ATOM   11328 C CA   . GLU A 1 63 ? 10.000  -1.010  -5.545  1.00 4.68  ? 63 GLU A CA   10 
ATOM   11329 C C    . GLU A 1 63 ? 10.385  -2.306  -6.270  1.00 4.70  ? 63 GLU A C    10 
ATOM   11330 O O    . GLU A 1 63 ? 10.763  -2.284  -7.423  1.00 5.23  ? 63 GLU A O    10 
ATOM   11331 C CB   . GLU A 1 63 ? 11.143  -0.582  -4.617  1.00 5.11  ? 63 GLU A CB   10 
ATOM   11332 C CG   . GLU A 1 63 ? 11.947  0.540   -5.284  1.00 5.73  ? 63 GLU A CG   10 
ATOM   11333 C CD   . GLU A 1 63 ? 12.614  0.016   -6.562  1.00 6.00  ? 63 GLU A CD   10 
ATOM   11334 O OE1  . GLU A 1 63 ? 13.503  -0.812  -6.450  1.00 6.46  ? 63 GLU A OE1  10 
ATOM   11335 O OE2  . GLU A 1 63 ? 12.223  0.452   -7.633  1.00 6.04  ? 63 GLU A OE2  10 
ATOM   11336 H H    . GLU A 1 63 ? 8.795   -1.245  -3.787  1.00 3.89  ? 63 GLU A H    10 
ATOM   11337 H HA   . GLU A 1 63 ? 9.821   -0.237  -6.269  1.00 5.00  ? 63 GLU A HA   10 
ATOM   11338 H HB2  . GLU A 1 63 ? 10.735  -0.227  -3.683  1.00 4.92  ? 63 GLU A HB2  10 
ATOM   11339 H HB3  . GLU A 1 63 ? 11.791  -1.425  -4.429  1.00 5.36  ? 63 GLU A HB3  10 
ATOM   11340 H HG2  . GLU A 1 63 ? 11.284  1.356   -5.533  1.00 5.98  ? 63 GLU A HG2  10 
ATOM   11341 H HG3  . GLU A 1 63 ? 12.707  0.891   -4.603  1.00 6.04  ? 63 GLU A HG3  10 
ATOM   11342 N N    . LYS A 1 64 ? 10.285  -3.433  -5.607  1.00 4.35  ? 64 LYS A N    10 
ATOM   11343 C CA   . LYS A 1 64 ? 10.636  -4.725  -6.261  1.00 4.71  ? 64 LYS A CA   10 
ATOM   11344 C C    . LYS A 1 64 ? 9.613   -5.039  -7.365  1.00 4.54  ? 64 LYS A C    10 
ATOM   11345 O O    . LYS A 1 64 ? 9.940   -5.643  -8.370  1.00 5.00  ? 64 LYS A O    10 
ATOM   11346 C CB   . LYS A 1 64 ? 10.626  -5.847  -5.218  1.00 4.74  ? 64 LYS A CB   10 
ATOM   11347 C CG   . LYS A 1 64 ? 11.623  -6.937  -5.623  1.00 5.62  ? 64 LYS A CG   10 
ATOM   11348 C CD   . LYS A 1 64 ? 13.031  -6.536  -5.174  1.00 6.24  ? 64 LYS A CD   10 
ATOM   11349 C CE   . LYS A 1 64 ? 13.967  -7.743  -5.280  1.00 7.07  ? 64 LYS A CE   10 
ATOM   11350 N NZ   . LYS A 1 64 ? 13.802  -8.617  -4.082  1.00 7.79  ? 64 LYS A NZ   10 
ATOM   11351 H H    . LYS A 1 64 ? 9.978   -3.432  -4.682  1.00 4.03  ? 64 LYS A H    10 
ATOM   11352 H HA   . LYS A 1 64 ? 11.617  -4.643  -6.690  1.00 5.26  ? 64 LYS A HA   10 
ATOM   11353 H HB2  . LYS A 1 64 ? 10.904  -5.445  -4.255  1.00 4.73  ? 64 LYS A HB2  10 
ATOM   11354 H HB3  . LYS A 1 64 ? 9.636   -6.273  -5.158  1.00 4.49  ? 64 LYS A HB3  10 
ATOM   11355 H HG2  . LYS A 1 64 ? 11.345  -7.869  -5.152  1.00 6.07  ? 64 LYS A HG2  10 
ATOM   11356 H HG3  . LYS A 1 64 ? 11.609  -7.057  -6.696  1.00 5.69  ? 64 LYS A HG3  10 
ATOM   11357 H HD2  . LYS A 1 64 ? 13.397  -5.740  -5.807  1.00 6.22  ? 64 LYS A HD2  10 
ATOM   11358 H HD3  . LYS A 1 64 ? 13.000  -6.196  -4.150  1.00 6.45  ? 64 LYS A HD3  10 
ATOM   11359 H HE2  . LYS A 1 64 ? 13.730  -8.306  -6.170  1.00 7.40  ? 64 LYS A HE2  10 
ATOM   11360 H HE3  . LYS A 1 64 ? 14.990  -7.400  -5.335  1.00 7.09  ? 64 LYS A HE3  10 
ATOM   11361 H HZ1  . LYS A 1 64 ? 13.831  -8.036  -3.219  1.00 8.09  ? 64 LYS A HZ1  10 
ATOM   11362 H HZ2  . LYS A 1 64 ? 12.887  -9.112  -4.137  1.00 8.07  ? 64 LYS A HZ2  10 
ATOM   11363 H HZ3  . LYS A 1 64 ? 14.571  -9.314  -4.052  1.00 7.96  ? 64 LYS A HZ3  10 
ATOM   11364 N N    . PHE A 1 65 ? 8.379   -4.630  -7.178  1.00 4.02  ? 65 PHE A N    10 
ATOM   11365 C CA   . PHE A 1 65 ? 7.319   -4.889  -8.195  1.00 3.99  ? 65 PHE A CA   10 
ATOM   11366 C C    . PHE A 1 65 ? 7.486   -3.929  -9.382  1.00 4.72  ? 65 PHE A C    10 
ATOM   11367 O O    . PHE A 1 65 ? 7.414   -4.332  -10.528 1.00 5.31  ? 65 PHE A O    10 
ATOM   11368 C CB   . PHE A 1 65 ? 5.956   -4.660  -7.536  1.00 3.16  ? 65 PHE A CB   10 
ATOM   11369 C CG   . PHE A 1 65 ? 4.887   -5.460  -8.242  1.00 3.02  ? 65 PHE A CG   10 
ATOM   11370 C CD1  . PHE A 1 65 ? 4.811   -6.847  -8.061  1.00 3.45  ? 65 PHE A CD1  10 
ATOM   11371 C CD2  . PHE A 1 65 ? 3.966   -4.811  -9.070  1.00 2.97  ? 65 PHE A CD2  10 
ATOM   11372 C CE1  . PHE A 1 65 ? 3.813   -7.582  -8.712  1.00 3.48  ? 65 PHE A CE1  10 
ATOM   11373 C CE2  . PHE A 1 65 ? 2.967   -5.546  -9.720  1.00 3.10  ? 65 PHE A CE2  10 
ATOM   11374 C CZ   . PHE A 1 65 ? 2.890   -6.932  -9.540  1.00 3.19  ? 65 PHE A CZ   10 
ATOM   11375 H H    . PHE A 1 65 ? 8.146   -4.143  -6.360  1.00 3.77  ? 65 PHE A H    10 
ATOM   11376 H HA   . PHE A 1 65 ? 7.388   -5.910  -8.539  1.00 4.30  ? 65 PHE A HA   10 
ATOM   11377 H HB2  . PHE A 1 65 ? 6.006   -4.965  -6.503  1.00 2.82  ? 65 PHE A HB2  10 
ATOM   11378 H HB3  . PHE A 1 65 ? 5.712   -3.610  -7.583  1.00 3.27  ? 65 PHE A HB3  10 
ATOM   11379 H HD1  . PHE A 1 65 ? 5.523   -7.351  -7.421  1.00 4.00  ? 65 PHE A HD1  10 
ATOM   11380 H HD2  . PHE A 1 65 ? 4.025   -3.744  -9.207  1.00 3.21  ? 65 PHE A HD2  10 
ATOM   11381 H HE1  . PHE A 1 65 ? 3.753   -8.652  -8.573  1.00 4.01  ? 65 PHE A HE1  10 
ATOM   11382 H HE2  . PHE A 1 65 ? 2.256   -5.043  -10.359 1.00 3.46  ? 65 PHE A HE2  10 
ATOM   11383 H HZ   . PHE A 1 65 ? 2.121   -7.499  -10.042 1.00 3.41  ? 65 PHE A HZ   10 
ATOM   11384 N N    . LEU A 1 66 ? 7.701   -2.662  -9.113  1.00 4.92  ? 66 LEU A N    10 
ATOM   11385 C CA   . LEU A 1 66 ? 7.864   -1.667  -10.219 1.00 5.86  ? 66 LEU A CA   10 
ATOM   11386 C C    . LEU A 1 66 ? 9.281   -1.751  -10.803 1.00 6.61  ? 66 LEU A C    10 
ATOM   11387 O O    . LEU A 1 66 ? 9.455   -1.924  -11.994 1.00 7.33  ? 66 LEU A O    10 
ATOM   11388 C CB   . LEU A 1 66 ? 7.618   -0.254  -9.673  1.00 6.18  ? 66 LEU A CB   10 
ATOM   11389 C CG   . LEU A 1 66 ? 7.594   0.753   -10.828 1.00 7.14  ? 66 LEU A CG   10 
ATOM   11390 C CD1  . LEU A 1 66 ? 6.175   0.855   -11.393 1.00 7.61  ? 66 LEU A CD1  10 
ATOM   11391 C CD2  . LEU A 1 66 ? 8.037   2.127   -10.314 1.00 7.67  ? 66 LEU A CD2  10 
ATOM   11392 H H    . LEU A 1 66 ? 7.749   -2.365  -8.178  1.00 4.58  ? 66 LEU A H    10 
ATOM   11393 H HA   . LEU A 1 66 ? 7.145   -1.877  -10.998 1.00 6.03  ? 66 LEU A HA   10 
ATOM   11394 H HB2  . LEU A 1 66 ? 6.671   -0.231  -9.155  1.00 5.67  ? 66 LEU A HB2  10 
ATOM   11395 H HB3  . LEU A 1 66 ? 8.410   0.008   -8.986  1.00 6.42  ? 66 LEU A HB3  10 
ATOM   11396 H HG   . LEU A 1 66 ? 8.268   0.426   -11.607 1.00 7.39  ? 66 LEU A HG   10 
ATOM   11397 H HD11 . LEU A 1 66 ? 5.466   0.903   -10.579 1.00 8.02  ? 66 LEU A HD11 10 
ATOM   11398 H HD12 . LEU A 1 66 ? 6.089   1.746   -11.998 1.00 7.94  ? 66 LEU A HD12 10 
ATOM   11399 H HD13 . LEU A 1 66 ? 5.966   -0.014  -11.999 1.00 7.49  ? 66 LEU A HD13 10 
ATOM   11400 H HD21 . LEU A 1 66 ? 7.441   2.400   -9.456  1.00 7.67  ? 66 LEU A HD21 10 
ATOM   11401 H HD22 . LEU A 1 66 ? 9.078   2.088   -10.031 1.00 8.14  ? 66 LEU A HD22 10 
ATOM   11402 H HD23 . LEU A 1 66 ? 7.904   2.864   -11.093 1.00 7.84  ? 66 LEU A HD23 10 
ATOM   11403 N N    . LYS A 1 67 ? 10.289  -1.618  -9.969  1.00 6.57  ? 67 LYS A N    10 
ATOM   11404 C CA   . LYS A 1 67 ? 11.706  -1.674  -10.450 1.00 7.47  ? 67 LYS A CA   10 
ATOM   11405 C C    . LYS A 1 67 ? 11.968  -0.503  -11.412 1.00 7.85  ? 67 LYS A C    10 
ATOM   11406 O O    . LYS A 1 67 ? 12.384  -0.694  -12.541 1.00 8.14  ? 67 LYS A O    10 
ATOM   11407 C CB   . LYS A 1 67 ? 11.969  -3.014  -11.157 1.00 7.84  ? 67 LYS A CB   10 
ATOM   11408 C CG   . LYS A 1 67 ? 13.475  -3.301  -11.167 1.00 8.78  ? 67 LYS A CG   10 
ATOM   11409 C CD   . LYS A 1 67 ? 13.817  -4.300  -10.057 1.00 9.42  ? 67 LYS A CD   10 
ATOM   11410 C CE   . LYS A 1 67 ? 13.774  -5.726  -10.618 1.00 10.12 ? 67 LYS A CE   10 
ATOM   11411 N NZ   . LYS A 1 67 ? 12.760  -6.528  -9.875  1.00 10.40 ? 67 LYS A NZ   10 
ATOM   11412 H H    . LYS A 1 67 ? 10.112  -1.470  -9.017  1.00 6.04  ? 67 LYS A H    10 
ATOM   11413 H HA   . LYS A 1 67 ? 12.368  -1.584  -9.602  1.00 7.85  ? 67 LYS A HA   10 
ATOM   11414 H HB2  . LYS A 1 67 ? 11.454  -3.804  -10.630 1.00 7.78  ? 67 LYS A HB2  10 
ATOM   11415 H HB3  . LYS A 1 67 ? 11.608  -2.965  -12.173 1.00 7.75  ? 67 LYS A HB3  10 
ATOM   11416 H HG2  . LYS A 1 67 ? 13.756  -3.715  -12.125 1.00 9.30  ? 67 LYS A HG2  10 
ATOM   11417 H HG3  . LYS A 1 67 ? 14.018  -2.382  -11.000 1.00 8.71  ? 67 LYS A HG3  10 
ATOM   11418 H HD2  . LYS A 1 67 ? 14.808  -4.092  -9.679  1.00 9.58  ? 67 LYS A HD2  10 
ATOM   11419 H HD3  . LYS A 1 67 ? 13.100  -4.210  -9.255  1.00 9.47  ? 67 LYS A HD3  10 
ATOM   11420 H HE2  . LYS A 1 67 ? 13.508  -5.692  -11.665 1.00 10.35 ? 67 LYS A HE2  10 
ATOM   11421 H HE3  . LYS A 1 67 ? 14.746  -6.183  -10.510 1.00 10.41 ? 67 LYS A HE3  10 
ATOM   11422 H HZ1  . LYS A 1 67 ? 11.828  -6.076  -9.961  1.00 10.51 ? 67 LYS A HZ1  10 
ATOM   11423 H HZ2  . LYS A 1 67 ? 12.720  -7.487  -10.274 1.00 10.49 ? 67 LYS A HZ2  10 
ATOM   11424 H HZ3  . LYS A 1 67 ? 13.027  -6.580  -8.871  1.00 10.60 ? 67 LYS A HZ3  10 
ATOM   11425 N N    . ARG A 1 68 ? 11.721  0.708   -10.958 1.00 8.12  ? 68 ARG A N    10 
ATOM   11426 C CA   . ARG A 1 68 ? 11.944  1.926   -11.811 1.00 8.78  ? 68 ARG A CA   10 
ATOM   11427 C C    . ARG A 1 68 ? 10.958  1.945   -12.991 1.00 8.99  ? 68 ARG A C    10 
ATOM   11428 O O    . ARG A 1 68 ? 10.282  0.970   -13.268 1.00 8.81  ? 68 ARG A O    10 
ATOM   11429 C CB   . ARG A 1 68 ? 13.382  1.941   -12.346 1.00 9.33  ? 68 ARG A CB   10 
ATOM   11430 C CG   . ARG A 1 68 ? 14.370  1.838   -11.181 1.00 9.61  ? 68 ARG A CG   10 
ATOM   11431 C CD   . ARG A 1 68 ? 15.795  1.728   -11.725 1.00 10.05 ? 68 ARG A CD   10 
ATOM   11432 N NE   . ARG A 1 68 ? 16.024  0.353   -12.256 1.00 10.53 ? 68 ARG A NE   10 
ATOM   11433 C CZ   . ARG A 1 68 ? 17.238  -0.048  -12.525 1.00 10.90 ? 68 ARG A CZ   10 
ATOM   11434 N NH1  . ARG A 1 68 ? 17.857  0.408   -13.584 1.00 11.35 ? 68 ARG A NH1  10 
ATOM   11435 N NH2  . ARG A 1 68 ? 17.833  -0.903  -11.734 1.00 11.02 ? 68 ARG A NH2  10 
ATOM   11436 H H    . ARG A 1 68 ? 11.387  0.821   -10.044 1.00 8.08  ? 68 ARG A H    10 
ATOM   11437 H HA   . ARG A 1 68 ? 11.784  2.807   -11.207 1.00 9.01  ? 68 ARG A HA   10 
ATOM   11438 H HB2  . ARG A 1 68 ? 13.528  1.108   -13.018 1.00 9.69  ? 68 ARG A HB2  10 
ATOM   11439 H HB3  . ARG A 1 68 ? 13.555  2.864   -12.879 1.00 9.41  ? 68 ARG A HB3  10 
ATOM   11440 H HG2  . ARG A 1 68 ? 14.286  2.718   -10.559 1.00 9.48  ? 68 ARG A HG2  10 
ATOM   11441 H HG3  . ARG A 1 68 ? 14.143  0.959   -10.594 1.00 9.87  ? 68 ARG A HG3  10 
ATOM   11442 H HD2  . ARG A 1 68 ? 15.933  2.448   -12.519 1.00 10.14 ? 68 ARG A HD2  10 
ATOM   11443 H HD3  . ARG A 1 68 ? 16.499  1.929   -10.932 1.00 10.14 ? 68 ARG A HD3  10 
ATOM   11444 H HE   . ARG A 1 68 ? 15.265  -0.249  -12.405 1.00 10.72 ? 68 ARG A HE   10 
ATOM   11445 H HH11 . ARG A 1 68 ? 17.401  1.062   -14.188 1.00 11.42 ? 68 ARG A HH11 10 
ATOM   11446 H HH12 . ARG A 1 68 ? 18.786  0.102   -13.791 1.00 11.76 ? 68 ARG A HH12 10 
ATOM   11447 H HH21 . ARG A 1 68 ? 17.359  -1.250  -10.925 1.00 10.82 ? 68 ARG A HH21 10 
ATOM   11448 H HH22 . ARG A 1 68 ? 18.763  -1.211  -11.938 1.00 11.44 ? 6