data_1IR1
# 
_entry.id   1IR1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IR1         
RCSB  RCSB005201   
WWPDB D_1000005201 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2002-03-13 
_pdbx_database_PDB_obs_spr.pdb_id           1IR1 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1BUR 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1IR2 
_pdbx_database_related.details        
;1IR2 contains Crystal Structure of same protein from 
Chlamydomonas reinhardtii Complexed with 
2-CABP
;
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IR1 
_pdbx_database_status.recvd_initial_deposition_date   2001-08-31 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mizohata, E.'  1  
'Matsumura, H.' 2  
'Okano, Y.'     3  
'Kumei, M.'     4  
'Takuma, H.'    5  
'Onodera, J.'   6  
'Kato, K.'      7  
'Shibata, N.'   8  
'Inoue, T.'     9  
'Yokota, A.'    10 
'Kai, Y.'       11 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of activated ribulose-1,5-bisphosphate carboxylase/oxygenase from green alga Chlamydomonas reinhardtii complexed with 2-carboxyarabinitol-1,5-bisphosphate.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            316 
_citation.page_first                679 
_citation.page_last                 691 
_citation.year                      2002 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11866526 
_citation.pdbx_database_id_DOI      10.1006/jmbi.2001.5381 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mizohata, E.'  1  
primary 'Matsumura, H.' 2  
primary 'Okano, Y.'     3  
primary 'Kumei, M.'     4  
primary 'Takuma, H.'    5  
primary 'Onodera, J.'   6  
primary 'Kato, K.'      7  
primary 'Shibata, N.'   8  
primary 'Inoue, T.'     9  
primary 'Yokota, A.'    10 
primary 'Kai, Y.'       11 
# 
_cell.entry_id           1IR1 
_cell.length_a           157.8 
_cell.length_b           157.8 
_cell.length_c           200.9 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IR1 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'Large subunit of Rubisco'          52849.742 4    4.1.1.39 ? ? ? 
2 polymer     nat 'Small subunit of Rubisco'          14687.708 4    4.1.1.39 ? ? ? 
3 non-polymer syn 'MAGNESIUM ION'                     24.305    4    ?        ? ? ? 
4 non-polymer syn 2-CARBOXYARABINITOL-1,5-DIPHOSPHATE 356.115   4    ?        ? ? ? 
5 water       nat water                               18.015    2272 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RIBULOSE BISPHOSPHATE CARBOXYLASE LARGE CHAIN'   
2 'RIBULOSE BISPHOSPHATE CARBOXYLASE SMALL CHAIN 2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;MSPQTETKASVEFKAGVKDYKLTYYTPEYETLDTDILAAFRVSPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTNLDRY
KGRCYHIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERD
KLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFT(KCX)DDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIK
GHYLNATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLSHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAK
ALRLSGGDHIHSGTVVGKLEGERDITLGFVDLLRDDYTEKDRSRGIYFTQSWVSTPGVLPVASGGIHVWHMPALTEIFGD
DSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNTIIREATKWSPELAAACEVWKEIKFEFPAMDTV
;
;MSPQTETKASVEFKAGVKDYKLTYYTPEYETLDTDILAAFRVSPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTNLDRY
KGRCYHIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERD
KLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYL
NATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLSHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRL
SGGDHIHSGTVVGKLEGERDITLGFVDLLRDDYTEKDRSRGIYFTQSWVSTPGVLPVASGGIHVWHMPALTEIFGDDSVL
QFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNTIIREATKWSPELAAACEVWKEIKFEFPAMDTV
;
A,B,C,D ? 
2 'polypeptide(L)' no yes 
;(MME)KVWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFG
CTDPAQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKPAGY
;
;MKVWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDP
AQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKPAGY
;
S,T,U,V ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   PRO n 
1 4   GLN n 
1 5   THR n 
1 6   GLU n 
1 7   THR n 
1 8   LYS n 
1 9   ALA n 
1 10  SER n 
1 11  VAL n 
1 12  GLU n 
1 13  PHE n 
1 14  LYS n 
1 15  ALA n 
1 16  GLY n 
1 17  VAL n 
1 18  LYS n 
1 19  ASP n 
1 20  TYR n 
1 21  LYS n 
1 22  LEU n 
1 23  THR n 
1 24  TYR n 
1 25  TYR n 
1 26  THR n 
1 27  PRO n 
1 28  GLU n 
1 29  TYR n 
1 30  GLU n 
1 31  THR n 
1 32  LEU n 
1 33  ASP n 
1 34  THR n 
1 35  ASP n 
1 36  ILE n 
1 37  LEU n 
1 38  ALA n 
1 39  ALA n 
1 40  PHE n 
1 41  ARG n 
1 42  VAL n 
1 43  SER n 
1 44  PRO n 
1 45  GLN n 
1 46  PRO n 
1 47  GLY n 
1 48  VAL n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  GLU n 
1 53  ALA n 
1 54  GLY n 
1 55  ALA n 
1 56  ALA n 
1 57  VAL n 
1 58  ALA n 
1 59  ALA n 
1 60  GLU n 
1 61  SER n 
1 62  SER n 
1 63  THR n 
1 64  GLY n 
1 65  THR n 
1 66  TRP n 
1 67  THR n 
1 68  THR n 
1 69  VAL n 
1 70  TRP n 
1 71  THR n 
1 72  ASP n 
1 73  GLY n 
1 74  LEU n 
1 75  THR n 
1 76  ASN n 
1 77  LEU n 
1 78  ASP n 
1 79  ARG n 
1 80  TYR n 
1 81  LYS n 
1 82  GLY n 
1 83  ARG n 
1 84  CYS n 
1 85  TYR n 
1 86  HIS n 
1 87  ILE n 
1 88  GLU n 
1 89  PRO n 
1 90  VAL n 
1 91  ALA n 
1 92  GLY n 
1 93  GLU n 
1 94  GLU n 
1 95  ASN n 
1 96  GLN n 
1 97  TYR n 
1 98  ILE n 
1 99  CYS n 
1 100 TYR n 
1 101 VAL n 
1 102 ALA n 
1 103 TYR n 
1 104 PRO n 
1 105 LEU n 
1 106 ASP n 
1 107 LEU n 
1 108 PHE n 
1 109 GLU n 
1 110 GLU n 
1 111 GLY n 
1 112 SER n 
1 113 VAL n 
1 114 THR n 
1 115 ASN n 
1 116 MET n 
1 117 PHE n 
1 118 THR n 
1 119 SER n 
1 120 ILE n 
1 121 VAL n 
1 122 GLY n 
1 123 ASN n 
1 124 VAL n 
1 125 PHE n 
1 126 GLY n 
1 127 PHE n 
1 128 LYS n 
1 129 ALA n 
1 130 LEU n 
1 131 ARG n 
1 132 ALA n 
1 133 LEU n 
1 134 ARG n 
1 135 LEU n 
1 136 GLU n 
1 137 ASP n 
1 138 LEU n 
1 139 ARG n 
1 140 ILE n 
1 141 PRO n 
1 142 VAL n 
1 143 ALA n 
1 144 TYR n 
1 145 VAL n 
1 146 LYS n 
1 147 THR n 
1 148 PHE n 
1 149 GLN n 
1 150 GLY n 
1 151 PRO n 
1 152 PRO n 
1 153 HIS n 
1 154 GLY n 
1 155 ILE n 
1 156 GLN n 
1 157 VAL n 
1 158 GLU n 
1 159 ARG n 
1 160 ASP n 
1 161 LYS n 
1 162 LEU n 
1 163 ASN n 
1 164 LYS n 
1 165 TYR n 
1 166 GLY n 
1 167 ARG n 
1 168 PRO n 
1 169 LEU n 
1 170 LEU n 
1 171 GLY n 
1 172 CYS n 
1 173 THR n 
1 174 ILE n 
1 175 LYS n 
1 176 PRO n 
1 177 LYS n 
1 178 LEU n 
1 179 GLY n 
1 180 LEU n 
1 181 SER n 
1 182 ALA n 
1 183 LYS n 
1 184 ASN n 
1 185 TYR n 
1 186 GLY n 
1 187 ARG n 
1 188 ALA n 
1 189 VAL n 
1 190 TYR n 
1 191 GLU n 
1 192 CYS n 
1 193 LEU n 
1 194 ARG n 
1 195 GLY n 
1 196 GLY n 
1 197 LEU n 
1 198 ASP n 
1 199 PHE n 
1 200 THR n 
1 201 KCX n 
1 202 ASP n 
1 203 ASP n 
1 204 GLU n 
1 205 ASN n 
1 206 VAL n 
1 207 ASN n 
1 208 SER n 
1 209 GLN n 
1 210 PRO n 
1 211 PHE n 
1 212 MET n 
1 213 ARG n 
1 214 TRP n 
1 215 ARG n 
1 216 ASP n 
1 217 ARG n 
1 218 PHE n 
1 219 LEU n 
1 220 PHE n 
1 221 CYS n 
1 222 ALA n 
1 223 GLU n 
1 224 ALA n 
1 225 LEU n 
1 226 TYR n 
1 227 LYS n 
1 228 ALA n 
1 229 GLN n 
1 230 ALA n 
1 231 GLU n 
1 232 THR n 
1 233 GLY n 
1 234 GLU n 
1 235 ILE n 
1 236 LYS n 
1 237 GLY n 
1 238 HIS n 
1 239 TYR n 
1 240 LEU n 
1 241 ASN n 
1 242 ALA n 
1 243 THR n 
1 244 ALA n 
1 245 GLY n 
1 246 THR n 
1 247 CYS n 
1 248 GLU n 
1 249 ASP n 
1 250 MET n 
1 251 MET n 
1 252 LYS n 
1 253 ARG n 
1 254 ALA n 
1 255 VAL n 
1 256 PHE n 
1 257 ALA n 
1 258 ARG n 
1 259 GLU n 
1 260 LEU n 
1 261 GLY n 
1 262 VAL n 
1 263 PRO n 
1 264 ILE n 
1 265 VAL n 
1 266 MET n 
1 267 HIS n 
1 268 ASP n 
1 269 TYR n 
1 270 LEU n 
1 271 THR n 
1 272 GLY n 
1 273 GLY n 
1 274 PHE n 
1 275 THR n 
1 276 ALA n 
1 277 ASN n 
1 278 THR n 
1 279 THR n 
1 280 LEU n 
1 281 SER n 
1 282 HIS n 
1 283 TYR n 
1 284 CYS n 
1 285 ARG n 
1 286 ASP n 
1 287 ASN n 
1 288 GLY n 
1 289 LEU n 
1 290 LEU n 
1 291 LEU n 
1 292 HIS n 
1 293 ILE n 
1 294 HIS n 
1 295 ARG n 
1 296 ALA n 
1 297 MET n 
1 298 HIS n 
1 299 ALA n 
1 300 VAL n 
1 301 ILE n 
1 302 ASP n 
1 303 ARG n 
1 304 GLN n 
1 305 LYS n 
1 306 ASN n 
1 307 HIS n 
1 308 GLY n 
1 309 MET n 
1 310 HIS n 
1 311 PHE n 
1 312 ARG n 
1 313 VAL n 
1 314 LEU n 
1 315 ALA n 
1 316 LYS n 
1 317 ALA n 
1 318 LEU n 
1 319 ARG n 
1 320 LEU n 
1 321 SER n 
1 322 GLY n 
1 323 GLY n 
1 324 ASP n 
1 325 HIS n 
1 326 ILE n 
1 327 HIS n 
1 328 SER n 
1 329 GLY n 
1 330 THR n 
1 331 VAL n 
1 332 VAL n 
1 333 GLY n 
1 334 LYS n 
1 335 LEU n 
1 336 GLU n 
1 337 GLY n 
1 338 GLU n 
1 339 ARG n 
1 340 ASP n 
1 341 ILE n 
1 342 THR n 
1 343 LEU n 
1 344 GLY n 
1 345 PHE n 
1 346 VAL n 
1 347 ASP n 
1 348 LEU n 
1 349 LEU n 
1 350 ARG n 
1 351 ASP n 
1 352 ASP n 
1 353 TYR n 
1 354 THR n 
1 355 GLU n 
1 356 LYS n 
1 357 ASP n 
1 358 ARG n 
1 359 SER n 
1 360 ARG n 
1 361 GLY n 
1 362 ILE n 
1 363 TYR n 
1 364 PHE n 
1 365 THR n 
1 366 GLN n 
1 367 SER n 
1 368 TRP n 
1 369 VAL n 
1 370 SER n 
1 371 THR n 
1 372 PRO n 
1 373 GLY n 
1 374 VAL n 
1 375 LEU n 
1 376 PRO n 
1 377 VAL n 
1 378 ALA n 
1 379 SER n 
1 380 GLY n 
1 381 GLY n 
1 382 ILE n 
1 383 HIS n 
1 384 VAL n 
1 385 TRP n 
1 386 HIS n 
1 387 MET n 
1 388 PRO n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 GLU n 
1 393 ILE n 
1 394 PHE n 
1 395 GLY n 
1 396 ASP n 
1 397 ASP n 
1 398 SER n 
1 399 VAL n 
1 400 LEU n 
1 401 GLN n 
1 402 PHE n 
1 403 GLY n 
1 404 GLY n 
1 405 GLY n 
1 406 THR n 
1 407 LEU n 
1 408 GLY n 
1 409 HIS n 
1 410 PRO n 
1 411 TRP n 
1 412 GLY n 
1 413 ASN n 
1 414 ALA n 
1 415 PRO n 
1 416 GLY n 
1 417 ALA n 
1 418 VAL n 
1 419 ALA n 
1 420 ASN n 
1 421 ARG n 
1 422 VAL n 
1 423 ALA n 
1 424 LEU n 
1 425 GLU n 
1 426 ALA n 
1 427 CYS n 
1 428 VAL n 
1 429 GLN n 
1 430 ALA n 
1 431 ARG n 
1 432 ASN n 
1 433 GLU n 
1 434 GLY n 
1 435 ARG n 
1 436 ASP n 
1 437 LEU n 
1 438 ALA n 
1 439 ARG n 
1 440 GLU n 
1 441 GLY n 
1 442 ASN n 
1 443 THR n 
1 444 ILE n 
1 445 ILE n 
1 446 ARG n 
1 447 GLU n 
1 448 ALA n 
1 449 THR n 
1 450 LYS n 
1 451 TRP n 
1 452 SER n 
1 453 PRO n 
1 454 GLU n 
1 455 LEU n 
1 456 ALA n 
1 457 ALA n 
1 458 ALA n 
1 459 CYS n 
1 460 GLU n 
1 461 VAL n 
1 462 TRP n 
1 463 LYS n 
1 464 GLU n 
1 465 ILE n 
1 466 LYS n 
1 467 PHE n 
1 468 GLU n 
1 469 PHE n 
1 470 PRO n 
1 471 ALA n 
1 472 MET n 
1 473 ASP n 
1 474 THR n 
1 475 VAL n 
2 1   MME n 
2 2   LYS n 
2 3   VAL n 
2 4   TRP n 
2 5   PRO n 
2 6   THR n 
2 7   GLN n 
2 8   ASN n 
2 9   MET n 
2 10  LYS n 
2 11  ARG n 
2 12  TYR n 
2 13  GLU n 
2 14  THR n 
2 15  LEU n 
2 16  SER n 
2 17  TYR n 
2 18  LEU n 
2 19  PRO n 
2 20  PRO n 
2 21  LEU n 
2 22  THR n 
2 23  THR n 
2 24  ASP n 
2 25  GLN n 
2 26  LEU n 
2 27  ALA n 
2 28  ARG n 
2 29  GLN n 
2 30  VAL n 
2 31  ASP n 
2 32  TYR n 
2 33  LEU n 
2 34  LEU n 
2 35  ASN n 
2 36  ASN n 
2 37  LYS n 
2 38  TRP n 
2 39  VAL n 
2 40  PRO n 
2 41  CYS n 
2 42  LEU n 
2 43  GLU n 
2 44  PHE n 
2 45  GLU n 
2 46  THR n 
2 47  ASP n 
2 48  HIS n 
2 49  GLY n 
2 50  PHE n 
2 51  VAL n 
2 52  TYR n 
2 53  ARG n 
2 54  GLU n 
2 55  HIS n 
2 56  HIS n 
2 57  ASN n 
2 58  SER n 
2 59  PRO n 
2 60  GLY n 
2 61  TYR n 
2 62  TYR n 
2 63  ASP n 
2 64  GLY n 
2 65  ARG n 
2 66  TYR n 
2 67  TRP n 
2 68  THR n 
2 69  MET n 
2 70  TRP n 
2 71  LYS n 
2 72  LEU n 
2 73  PRO n 
2 74  MET n 
2 75  PHE n 
2 76  GLY n 
2 77  CYS n 
2 78  THR n 
2 79  ASP n 
2 80  PRO n 
2 81  ALA n 
2 82  GLN n 
2 83  VAL n 
2 84  LEU n 
2 85  ASN n 
2 86  GLU n 
2 87  LEU n 
2 88  GLU n 
2 89  GLU n 
2 90  CYS n 
2 91  LYS n 
2 92  LYS n 
2 93  GLU n 
2 94  TYR n 
2 95  PRO n 
2 96  ASN n 
2 97  ALA n 
2 98  PHE n 
2 99  ILE n 
2 100 ARG n 
2 101 ILE n 
2 102 ILE n 
2 103 GLY n 
2 104 PHE n 
2 105 ASP n 
2 106 SER n 
2 107 ASN n 
2 108 ARG n 
2 109 GLN n 
2 110 VAL n 
2 111 GLN n 
2 112 CYS n 
2 113 VAL n 
2 114 SER n 
2 115 PHE n 
2 116 ILE n 
2 117 ALA n 
2 118 TYR n 
2 119 LYS n 
2 120 PRO n 
2 121 ALA n 
2 122 GLY n 
2 123 TYR n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? spinach 'Spinacia oleracea' 3562 Spinacia ? ? ? ? ? ? ? ? ? ? leaves ? ? ? ? ? 
2 1 sample ? ? spinach 'Spinacia oleracea' 3562 Spinacia ? ? ? ? ? ? ? ? ? ? leaves ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP RBL_SPIOL  1 
;MSPQTETKASVEFKAGVKDYKLTYYTPEYETLDTDILAAFRVSPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTNLDRY
KGRCYHIEPVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPVAYVKTFQGPPHGIQVERD
KLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEALYKAQAETGEIKGHYL
NATAGTCEDMMKRAVFARELGVPIVMHDYLTGGFTANTTLSHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRL
SGGDHIHSGTVVGKLEGERDITLGFVDLLRDDYTEKDRSRGIYFTQSWVSTPGVLPVASGGIHVWHMPALTEIFGDDSVL
QFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLAREGNTIIREATKWSPELAAACEVWKEIKFEFPAMDTV
;
1  P00875 ? 
2 UNP RBS2_SPIOL 2 
;MKVWPTQNMKRYETLSYLPPLTTDQLARQVDYLLNNKWVPCLEFETDHGFVYREHHNSPGYYDGRYWTMWKLPMFGCTDP
AQVLNELEECKKEYPNAFIRIIGFDSNRQVQCVSFIAYKPAGY
;
58 Q43832 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1IR1 A 1 ? 475 ? P00875 1  ? 475 ? 1 475 
2 1 1IR1 B 1 ? 475 ? P00875 1  ? 475 ? 1 475 
3 1 1IR1 C 1 ? 475 ? P00875 1  ? 475 ? 1 475 
4 1 1IR1 D 1 ? 475 ? P00875 1  ? 475 ? 1 475 
5 2 1IR1 S 1 ? 123 ? Q43832 58 ? 180 ? 1 123 
6 2 1IR1 T 1 ? 123 ? Q43832 58 ? 180 ? 1 123 
7 2 1IR1 U 1 ? 123 ? Q43832 58 ? 180 ? 1 123 
8 2 1IR1 V 1 ? 123 ? Q43832 58 ? 180 ? 1 123 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1IR1 KCX A 201 ? UNP P00875 LYS 201 'MODIFIED RESIDUE' 201 1 
2 1IR1 KCX B 201 ? UNP P00875 LYS 201 'MODIFIED RESIDUE' 201 2 
3 1IR1 KCX C 201 ? UNP P00875 LYS 201 'MODIFIED RESIDUE' 201 3 
4 1IR1 KCX D 201 ? UNP P00875 LYS 201 'MODIFIED RESIDUE' 201 4 
5 1IR1 MME S 1   ? UNP Q43832 MET 58  'MODIFIED RESIDUE' 1   5 
6 1IR1 MME T 1   ? UNP Q43832 MET 58  'MODIFIED RESIDUE' 1   6 
7 1IR1 MME U 1   ? UNP Q43832 MET 58  'MODIFIED RESIDUE' 1   7 
8 1IR1 MME V 1   ? UNP Q43832 MET 58  'MODIFIED RESIDUE' 1   8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                             ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                     ? 'C4 H7 N O4'     133.103 
CAP saccharide          . 2-CARBOXYARABINITOL-1,5-DIPHOSPHATE ? 'C6 H14 O13 P2'  356.115 
CYS 'L-peptide linking' y CYSTEINE                            ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                           ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                               ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                          ? 'C6 H13 N O2'    131.173 
KCX 'L-peptide linking' n 'LYSINE NZ-CARBOXYLIC ACID'         ? 'C7 H14 N2 O4'   190.197 
LEU 'L-peptide linking' y LEUCINE                             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                              ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                          ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION'                     ? 'Mg 2'           24.305  
MME 'L-peptide linking' n 'N-METHYL METHIONINE'               ? 'C6 H13 N O2 S'  163.238 
PHE 'L-peptide linking' y PHENYLALANINE                       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                              ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                           ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                          ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                              ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1IR1 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.31 
_exptl_crystal.density_percent_sol   46.84 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.9 
_exptl_crystal_grow.pdbx_details    
'PEG4000, MgCl2, NaHCO3, DTT, 2-carboxyarabinitol-1,5-bisphosphate, Bicine, pH 7.9, VAPOR DIFFUSION, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               DIFFRACTOMETER 
_diffrn_detector.type                   WEISSENBERG 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-6A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-6A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1IR1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             10 
_reflns.d_resolution_high            1.8 
_reflns.number_obs                   175568 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         76.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.8 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   47.5 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      10760 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1IR1 
_refine.ls_number_reflns_obs                     175568 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             10 
_refine.ls_d_res_high                            1.8 
_refine.ls_percent_reflns_obs                    76.9 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1550000 
_refine.ls_R_factor_R_free                       0.1790000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5 
_refine.ls_number_reflns_R_free                  8801 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ID 1BUR' 
_refine.pdbx_method_to_determine_struct          'RE-REFINEMENT of 1BUR' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1IR1 
_refine_analyze.Luzzati_coordinate_error_obs    0.176 
_refine_analyze.Luzzati_sigma_a_obs             0.244 
_refine_analyze.Luzzati_d_res_low_obs           5 
_refine_analyze.Luzzati_coordinate_error_free   0.203 
_refine_analyze.Luzzati_sigma_a_free            0.278 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        18696 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         88 
_refine_hist.number_atoms_solvent             2272 
_refine_hist.number_atoms_total               21056 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        10 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d             0.005 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg          1.36  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_deg 23.42 ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_deg 0.81  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.8 
_refine_ls_shell.d_res_low                        1.86 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.2820000 
_refine_ls_shell.percent_reflns_obs               47.5 
_refine_ls_shell.R_factor_R_free                  0.3040000 
_refine_ls_shell.R_factor_R_free_error            0.013 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             573 
_refine_ls_shell.number_reflns_obs                10760 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1IR1 
_struct.title                     
;Crystal Structure of Spinach Ribulose-1,5-Bisphosphate Carboxylase/Oxygenase (Rubisco) Complexed with CO2, Mg2+ and 2-Carboxyarabinitol-1,5-Bisphosphate
;
_struct.pdbx_descriptor           'Large subunit of Rubisco, Small subunit of Rubisco, 2-CARBOXYARABINITOL-1,5-DIPHOSPHATE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IR1 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            'ALPHA/BETA BARREL, LYASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 2 ? 
G N N 1 ? 
H N N 2 ? 
I N N 3 ? 
J N N 4 ? 
K N N 3 ? 
L N N 4 ? 
M N N 3 ? 
N N N 4 ? 
O N N 3 ? 
P N N 4 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 5 ? 
T N N 5 ? 
U N N 5 ? 
V N N 5 ? 
W N N 5 ? 
X N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;The biological assembly is a hexadecamer comprised of 8 large and 8 small subunits. A half of the hexadecamer (4 large and 4 small subunits) exists in the asymmetric unit. The rest part is generated by -x, y, -z+1/2.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   TYR A 20  ? TYR A 25  ? TYR A 20  TYR A 25  1 ? 6  
HELX_P HELX_P2   2   PRO A 49  ? GLU A 60  ? PRO A 49  GLU A 60  1 ? 12 
HELX_P HELX_P3   3   VAL A 69  ? THR A 75  ? VAL A 69  THR A 75  5 ? 7  
HELX_P HELX_P4   4   ASN A 76  ? LYS A 81  ? ASN A 76  LYS A 81  1 ? 6  
HELX_P HELX_P5   5   PRO A 104 ? PHE A 108 ? PRO A 104 PHE A 108 5 ? 5  
HELX_P HELX_P6   6   SER A 112 ? VAL A 121 ? SER A 112 VAL A 121 1 ? 10 
HELX_P HELX_P7   7   ASN A 123 ? PHE A 127 ? ASN A 123 PHE A 127 5 ? 5  
HELX_P HELX_P8   8   PRO A 141 ? LYS A 146 ? PRO A 141 LYS A 146 1 ? 6  
HELX_P HELX_P9   9   GLY A 154 ? ASN A 163 ? GLY A 154 ASN A 163 1 ? 10 
HELX_P HELX_P10  10  SER A 181 ? GLY A 195 ? SER A 181 GLY A 195 1 ? 15 
HELX_P HELX_P11  11  ARG A 213 ? GLY A 233 ? ARG A 213 GLY A 233 1 ? 21 
HELX_P HELX_P12  12  THR A 246 ? GLY A 261 ? THR A 246 GLY A 261 1 ? 16 
HELX_P HELX_P13  13  TYR A 269 ? GLY A 273 ? TYR A 269 GLY A 273 1 ? 5  
HELX_P HELX_P14  14  GLY A 273 ? GLY A 288 ? GLY A 273 GLY A 288 1 ? 16 
HELX_P HELX_P15  15  MET A 297 ? ARG A 303 ? MET A 297 ARG A 303 1 ? 7  
HELX_P HELX_P16  16  HIS A 310 ? GLY A 322 ? HIS A 310 GLY A 322 1 ? 13 
HELX_P HELX_P17  17  GLU A 338 ? ASP A 351 ? GLU A 338 ASP A 351 1 ? 14 
HELX_P HELX_P18  18  ASP A 357 ? GLY A 361 ? ASP A 357 GLY A 361 5 ? 5  
HELX_P HELX_P19  19  HIS A 383 ? TRP A 385 ? HIS A 383 TRP A 385 5 ? 3  
HELX_P HELX_P20  20  HIS A 386 ? GLY A 395 ? HIS A 386 GLY A 395 1 ? 10 
HELX_P HELX_P21  21  GLY A 403 ? GLY A 408 ? GLY A 403 GLY A 408 1 ? 6  
HELX_P HELX_P22  22  GLY A 412 ? GLU A 433 ? GLY A 412 GLU A 433 1 ? 22 
HELX_P HELX_P23  23  ASP A 436 ? LYS A 450 ? ASP A 436 LYS A 450 1 ? 15 
HELX_P HELX_P24  24  SER A 452 ? LYS A 463 ? SER A 452 LYS A 463 1 ? 12 
HELX_P HELX_P25  25  THR B 22  ? ASN B 36  ? THR S 22  ASN S 36  1 ? 15 
HELX_P HELX_P26  26  ASP B 79  ? TYR B 94  ? ASP S 79  TYR S 94  1 ? 16 
HELX_P HELX_P27  27  TYR C 20  ? TYR C 25  ? TYR B 20  TYR B 25  1 ? 6  
HELX_P HELX_P28  28  PRO C 49  ? SER C 61  ? PRO B 49  SER B 61  1 ? 13 
HELX_P HELX_P29  29  VAL C 69  ? THR C 75  ? VAL B 69  THR B 75  5 ? 7  
HELX_P HELX_P30  30  ASN C 76  ? LYS C 81  ? ASN B 76  LYS B 81  1 ? 6  
HELX_P HELX_P31  31  PRO C 104 ? PHE C 108 ? PRO B 104 PHE B 108 5 ? 5  
HELX_P HELX_P32  32  SER C 112 ? VAL C 121 ? SER B 112 VAL B 121 1 ? 10 
HELX_P HELX_P33  33  ASN C 123 ? PHE C 127 ? ASN B 123 PHE B 127 5 ? 5  
HELX_P HELX_P34  34  PRO C 141 ? LYS C 146 ? PRO B 141 LYS B 146 1 ? 6  
HELX_P HELX_P35  35  GLY C 154 ? ASN C 163 ? GLY B 154 ASN B 163 1 ? 10 
HELX_P HELX_P36  36  SER C 181 ? GLY C 195 ? SER B 181 GLY B 195 1 ? 15 
HELX_P HELX_P37  37  ARG C 213 ? GLY C 233 ? ARG B 213 GLY B 233 1 ? 21 
HELX_P HELX_P38  38  THR C 246 ? GLY C 261 ? THR B 246 GLY B 261 1 ? 16 
HELX_P HELX_P39  39  TYR C 269 ? GLY C 273 ? TYR B 269 GLY B 273 1 ? 5  
HELX_P HELX_P40  40  GLY C 273 ? GLY C 288 ? GLY B 273 GLY B 288 1 ? 16 
HELX_P HELX_P41  41  MET C 297 ? ARG C 303 ? MET B 297 ARG B 303 1 ? 7  
HELX_P HELX_P42  42  HIS C 310 ? GLY C 322 ? HIS B 310 GLY B 322 1 ? 13 
HELX_P HELX_P43  43  GLU C 338 ? ASP C 351 ? GLU B 338 ASP B 351 1 ? 14 
HELX_P HELX_P44  44  ASP C 357 ? GLY C 361 ? ASP B 357 GLY B 361 5 ? 5  
HELX_P HELX_P45  45  HIS C 383 ? TRP C 385 ? HIS B 383 TRP B 385 5 ? 3  
HELX_P HELX_P46  46  HIS C 386 ? GLY C 395 ? HIS B 386 GLY B 395 1 ? 10 
HELX_P HELX_P47  47  GLY C 403 ? GLY C 408 ? GLY B 403 GLY B 408 1 ? 6  
HELX_P HELX_P48  48  GLY C 412 ? GLU C 433 ? GLY B 412 GLU B 433 1 ? 22 
HELX_P HELX_P49  49  ASP C 436 ? LYS C 450 ? ASP B 436 LYS B 450 1 ? 15 
HELX_P HELX_P50  50  SER C 452 ? LYS C 463 ? SER B 452 LYS B 463 1 ? 12 
HELX_P HELX_P51  51  THR D 22  ? ASN D 36  ? THR T 22  ASN T 36  1 ? 15 
HELX_P HELX_P52  52  ASP D 79  ? TYR D 94  ? ASP T 79  TYR T 94  1 ? 16 
HELX_P HELX_P53  53  TYR E 20  ? TYR E 25  ? TYR C 20  TYR C 25  1 ? 6  
HELX_P HELX_P54  54  PRO E 49  ? GLU E 60  ? PRO C 49  GLU C 60  1 ? 12 
HELX_P HELX_P55  55  VAL E 69  ? THR E 75  ? VAL C 69  THR C 75  5 ? 7  
HELX_P HELX_P56  56  ASN E 76  ? LYS E 81  ? ASN C 76  LYS C 81  1 ? 6  
HELX_P HELX_P57  57  PRO E 104 ? PHE E 108 ? PRO C 104 PHE C 108 5 ? 5  
HELX_P HELX_P58  58  SER E 112 ? VAL E 121 ? SER C 112 VAL C 121 1 ? 10 
HELX_P HELX_P59  59  ASN E 123 ? PHE E 127 ? ASN C 123 PHE C 127 5 ? 5  
HELX_P HELX_P60  60  PRO E 141 ? LYS E 146 ? PRO C 141 LYS C 146 1 ? 6  
HELX_P HELX_P61  61  GLY E 154 ? ASN E 163 ? GLY C 154 ASN C 163 1 ? 10 
HELX_P HELX_P62  62  SER E 181 ? GLY E 195 ? SER C 181 GLY C 195 1 ? 15 
HELX_P HELX_P63  63  ARG E 213 ? GLY E 233 ? ARG C 213 GLY C 233 1 ? 21 
HELX_P HELX_P64  64  THR E 246 ? GLY E 261 ? THR C 246 GLY C 261 1 ? 16 
HELX_P HELX_P65  65  TYR E 269 ? GLY E 273 ? TYR C 269 GLY C 273 1 ? 5  
HELX_P HELX_P66  66  GLY E 273 ? GLY E 288 ? GLY C 273 GLY C 288 1 ? 16 
HELX_P HELX_P67  67  MET E 297 ? ARG E 303 ? MET C 297 ARG C 303 1 ? 7  
HELX_P HELX_P68  68  HIS E 310 ? GLY E 322 ? HIS C 310 GLY C 322 1 ? 13 
HELX_P HELX_P69  69  GLU E 338 ? ASP E 351 ? GLU C 338 ASP C 351 1 ? 14 
HELX_P HELX_P70  70  ASP E 357 ? GLY E 361 ? ASP C 357 GLY C 361 5 ? 5  
HELX_P HELX_P71  71  HIS E 383 ? TRP E 385 ? HIS C 383 TRP C 385 5 ? 3  
HELX_P HELX_P72  72  HIS E 386 ? GLY E 395 ? HIS C 386 GLY C 395 1 ? 10 
HELX_P HELX_P73  73  GLY E 403 ? GLY E 408 ? GLY C 403 GLY C 408 1 ? 6  
HELX_P HELX_P74  74  GLY E 412 ? GLU E 433 ? GLY C 412 GLU C 433 1 ? 22 
HELX_P HELX_P75  75  ASP E 436 ? LYS E 450 ? ASP C 436 LYS C 450 1 ? 15 
HELX_P HELX_P76  76  SER E 452 ? LYS E 463 ? SER C 452 LYS C 463 1 ? 12 
HELX_P HELX_P77  77  THR F 22  ? ASN F 36  ? THR U 22  ASN U 36  1 ? 15 
HELX_P HELX_P78  78  ASP F 79  ? TYR F 94  ? ASP U 79  TYR U 94  1 ? 16 
HELX_P HELX_P79  79  TYR G 20  ? TYR G 25  ? TYR D 20  TYR D 25  1 ? 6  
HELX_P HELX_P80  80  PRO G 49  ? GLU G 60  ? PRO D 49  GLU D 60  1 ? 12 
HELX_P HELX_P81  81  VAL G 69  ? THR G 75  ? VAL D 69  THR D 75  5 ? 7  
HELX_P HELX_P82  82  ASN G 76  ? LYS G 81  ? ASN D 76  LYS D 81  1 ? 6  
HELX_P HELX_P83  83  PRO G 104 ? PHE G 108 ? PRO D 104 PHE D 108 5 ? 5  
HELX_P HELX_P84  84  SER G 112 ? VAL G 121 ? SER D 112 VAL D 121 1 ? 10 
HELX_P HELX_P85  85  ASN G 123 ? PHE G 127 ? ASN D 123 PHE D 127 5 ? 5  
HELX_P HELX_P86  86  PRO G 141 ? LYS G 146 ? PRO D 141 LYS D 146 1 ? 6  
HELX_P HELX_P87  87  GLY G 154 ? ASN G 163 ? GLY D 154 ASN D 163 1 ? 10 
HELX_P HELX_P88  88  SER G 181 ? ARG G 194 ? SER D 181 ARG D 194 1 ? 14 
HELX_P HELX_P89  89  ARG G 213 ? GLY G 233 ? ARG D 213 GLY D 233 1 ? 21 
HELX_P HELX_P90  90  THR G 246 ? GLY G 261 ? THR D 246 GLY D 261 1 ? 16 
HELX_P HELX_P91  91  TYR G 269 ? GLY G 273 ? TYR D 269 GLY D 273 1 ? 5  
HELX_P HELX_P92  92  GLY G 273 ? GLY G 288 ? GLY D 273 GLY D 288 1 ? 16 
HELX_P HELX_P93  93  MET G 297 ? ARG G 303 ? MET D 297 ARG D 303 1 ? 7  
HELX_P HELX_P94  94  HIS G 310 ? GLY G 322 ? HIS D 310 GLY D 322 1 ? 13 
HELX_P HELX_P95  95  GLU G 338 ? ASP G 351 ? GLU D 338 ASP D 351 1 ? 14 
HELX_P HELX_P96  96  ASP G 357 ? GLY G 361 ? ASP D 357 GLY D 361 5 ? 5  
HELX_P HELX_P97  97  HIS G 383 ? TRP G 385 ? HIS D 383 TRP D 385 5 ? 3  
HELX_P HELX_P98  98  HIS G 386 ? GLY G 395 ? HIS D 386 GLY D 395 1 ? 10 
HELX_P HELX_P99  99  GLY G 403 ? GLY G 408 ? GLY D 403 GLY D 408 1 ? 6  
HELX_P HELX_P100 100 GLY G 412 ? GLU G 433 ? GLY D 412 GLU D 433 1 ? 22 
HELX_P HELX_P101 101 ASP G 436 ? LYS G 450 ? ASP D 436 LYS D 450 1 ? 15 
HELX_P HELX_P102 102 SER G 452 ? LYS G 463 ? SER D 452 LYS D 463 1 ? 12 
HELX_P HELX_P103 103 THR H 22  ? ASN H 36  ? THR V 22  ASN V 36  1 ? 15 
HELX_P HELX_P104 104 ASP H 79  ? TYR H 94  ? ASP V 79  TYR V 94  1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 247 SG ? ? ? 1_555 E CYS 247 SG  ? ? A CYS 247 C CYS 247 3_555 ? ? ? ? ? ? ? 2.547 ? 
disulf2  disulf ? ? C CYS 247 SG ? ? ? 1_555 C CYS 247 SG  ? ? B CYS 247 B CYS 247 3_555 ? ? ? ? ? ? ? 2.060 ? 
disulf3  disulf ? ? G CYS 247 SG ? ? ? 1_555 G CYS 247 SG  ? ? D CYS 247 D CYS 247 3_555 ? ? ? ? ? ? ? 2.094 ? 
metalc1  metalc ? ? I MG  .   MG ? ? ? 1_555 A KCX 201 OQ2 ? ? A MG  476 A KCX 201 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc2  metalc ? ? I MG  .   MG ? ? ? 1_555 A ASP 203 OD1 ? ? A MG  476 A ASP 203 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc3  metalc ? ? I MG  .   MG ? ? ? 1_555 A GLU 204 OE1 ? ? A MG  476 A GLU 204 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc4  metalc ? ? K MG  .   MG ? ? ? 1_555 C KCX 201 OQ2 ? ? B MG  476 B KCX 201 1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc5  metalc ? ? K MG  .   MG ? ? ? 1_555 C ASP 203 OD1 ? ? B MG  476 B ASP 203 1_555 ? ? ? ? ? ? ? 2.043 ? 
metalc6  metalc ? ? K MG  .   MG ? ? ? 1_555 C GLU 204 OE1 ? ? B MG  476 B GLU 204 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc7  metalc ? ? K MG  .   MG ? ? ? 1_555 L CAP .   O6  ? ? B MG  476 B CAP 501 1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc8  metalc ? ? M MG  .   MG ? ? ? 1_555 E KCX 201 OQ2 ? ? C MG  476 C KCX 201 1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc9  metalc ? ? M MG  .   MG ? ? ? 1_555 E ASP 203 OD1 ? ? C MG  476 C ASP 203 1_555 ? ? ? ? ? ? ? 2.014 ? 
metalc10 metalc ? ? M MG  .   MG ? ? ? 1_555 E GLU 204 OE1 ? ? C MG  476 C GLU 204 1_555 ? ? ? ? ? ? ? 2.052 ? 
metalc11 metalc ? ? O MG  .   MG ? ? ? 1_555 G KCX 201 OQ2 ? ? D MG  476 D KCX 201 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc12 metalc ? ? O MG  .   MG ? ? ? 1_555 G ASP 203 OD1 ? ? D MG  476 D ASP 203 1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc13 metalc ? ? O MG  .   MG ? ? ? 1_555 G GLU 204 OE1 ? ? D MG  476 D GLU 204 1_555 ? ? ? ? ? ? ? 2.095 ? 
metalc14 metalc ? ? O MG  .   MG ? ? ? 1_555 P CAP .   O3  ? ? D MG  476 D CAP 501 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc15 metalc ? ? O MG  .   MG ? ? ? 1_555 P CAP .   O6  ? ? D MG  476 D CAP 501 1_555 ? ? ? ? ? ? ? 2.169 ? 
covale1  covale ? ? A THR 200 C  ? ? ? 1_555 A KCX 201 N   ? ? A THR 200 A KCX 201 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2  covale ? ? A KCX 201 C  ? ? ? 1_555 A ASP 202 N   ? ? A KCX 201 A ASP 202 1_555 ? ? ? ? ? ? ? 1.333 ? 
metalc16 metalc ? ? I MG  .   MG ? ? ? 1_555 J CAP .   O6  ? ? A MG  476 A CAP 501 1_555 ? ? ? ? ? ? ? 2.251 ? 
metalc17 metalc ? ? I MG  .   MG ? ? ? 1_555 J CAP .   O3  ? ? A MG  476 A CAP 501 1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc18 metalc ? ? I MG  .   MG ? ? ? 1_555 J CAP .   O2  ? ? A MG  476 A CAP 501 1_555 ? ? ? ? ? ? ? 2.341 ? 
covale3  covale ? ? C THR 200 C  ? ? ? 1_555 C KCX 201 N   ? ? B THR 200 B KCX 201 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale4  covale ? ? C KCX 201 C  ? ? ? 1_555 C ASP 202 N   ? ? B KCX 201 B ASP 202 1_555 ? ? ? ? ? ? ? 1.330 ? 
metalc19 metalc ? ? K MG  .   MG ? ? ? 1_555 L CAP .   O3  ? ? B MG  476 B CAP 501 1_555 ? ? ? ? ? ? ? 2.256 ? 
metalc20 metalc ? ? K MG  .   MG ? ? ? 1_555 L CAP .   O2  ? ? B MG  476 B CAP 501 1_555 ? ? ? ? ? ? ? 2.368 ? 
covale5  covale ? ? E THR 200 C  ? ? ? 1_555 E KCX 201 N   ? ? C THR 200 C KCX 201 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale6  covale ? ? E KCX 201 C  ? ? ? 1_555 E ASP 202 N   ? ? C KCX 201 C ASP 202 1_555 ? ? ? ? ? ? ? 1.333 ? 
metalc21 metalc ? ? M MG  .   MG ? ? ? 1_555 N CAP .   O2  ? ? C MG  476 C CAP 501 1_555 ? ? ? ? ? ? ? 2.328 ? 
metalc22 metalc ? ? M MG  .   MG ? ? ? 1_555 N CAP .   O6  ? ? C MG  476 C CAP 501 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc23 metalc ? ? M MG  .   MG ? ? ? 1_555 N CAP .   O3  ? ? C MG  476 C CAP 501 1_555 ? ? ? ? ? ? ? 2.240 ? 
covale7  covale ? ? G THR 200 C  ? ? ? 1_555 G KCX 201 N   ? ? D THR 200 D KCX 201 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale8  covale ? ? G KCX 201 C  ? ? ? 1_555 G ASP 202 N   ? ? D KCX 201 D ASP 202 1_555 ? ? ? ? ? ? ? 1.331 ? 
metalc24 metalc ? ? O MG  .   MG ? ? ? 1_555 P CAP .   O2  ? ? D MG  476 D CAP 501 1_555 ? ? ? ? ? ? ? 2.337 ? 
covale9  covale ? ? B MME 1   C  ? ? ? 1_555 B LYS 2   N   ? ? S MME 1   S LYS 2   1_555 ? ? ? ? ? ? ? 1.328 ? 
covale10 covale ? ? D MME 1   C  ? ? ? 1_555 D LYS 2   N   ? ? T MME 1   T LYS 2   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale11 covale ? ? F MME 1   C  ? ? ? 1_555 F LYS 2   N   ? ? U MME 1   U LYS 2   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale12 covale ? ? H MME 1   C  ? ? ? 1_555 H LYS 2   N   ? ? V MME 1   V LYS 2   1_555 ? ? ? ? ? ? ? 1.327 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 175 A . ? LYS 175 A PRO 176 A ? PRO 176 A 1 -4.68 
2 LYS 175 C . ? LYS 175 B PRO 176 C ? PRO 176 B 1 -0.25 
3 LYS 175 E . ? LYS 175 C PRO 176 E ? PRO 176 C 1 0.12  
4 LYS 175 G . ? LYS 175 D PRO 176 G ? PRO 176 D 1 0.03  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 8 ? 
C ? 2 ? 
D ? 4 ? 
E ? 5 ? 
F ? 8 ? 
G ? 2 ? 
H ? 4 ? 
I ? 5 ? 
J ? 8 ? 
K ? 2 ? 
L ? 4 ? 
M ? 5 ? 
N ? 8 ? 
O ? 2 ? 
P ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
B 1 2 ? parallel      
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
B 7 8 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? parallel      
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? parallel      
F 6 7 ? parallel      
F 7 8 ? parallel      
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? parallel      
J 1 2 ? parallel      
J 2 3 ? parallel      
J 3 4 ? parallel      
J 4 5 ? parallel      
J 5 6 ? parallel      
J 6 7 ? parallel      
J 7 8 ? parallel      
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
M 4 5 ? parallel      
N 1 2 ? parallel      
N 2 3 ? parallel      
N 3 4 ? parallel      
N 4 5 ? parallel      
N 5 6 ? parallel      
N 6 7 ? parallel      
N 7 8 ? parallel      
O 1 2 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 83  ? PRO A 89  ? ARG A 83  PRO A 89  
A 2 TYR A 97  ? TYR A 103 ? TYR A 97  TYR A 103 
A 3 ILE A 36  ? PRO A 44  ? ILE A 36  PRO A 44  
A 4 LEU A 130 ? ARG A 139 ? LEU A 130 ARG A 139 
A 5 GLY A 308 ? MET A 309 ? GLY A 308 MET A 309 
B 1 LEU A 169 ? GLY A 171 ? LEU A 169 GLY A 171 
B 2 VAL A 399 ? GLN A 401 ? VAL A 399 GLN A 401 
B 3 LEU A 375 ? SER A 379 ? LEU A 375 SER A 379 
B 4 HIS A 325 ? HIS A 327 ? HIS A 325 HIS A 327 
B 5 LEU A 290 ? HIS A 294 ? LEU A 290 HIS A 294 
B 6 ILE A 264 ? ASP A 268 ? ILE A 264 ASP A 268 
B 7 GLY A 237 ? ASN A 241 ? GLY A 237 ASN A 241 
B 8 PHE A 199 ? KCX A 201 ? PHE A 199 KCX A 201 
C 1 TYR A 353 ? THR A 354 ? TYR A 353 THR A 354 
C 2 GLN A 366 ? SER A 367 ? GLN A 366 SER A 367 
D 1 THR B 68  ? TRP B 70  ? THR S 68  TRP S 70  
D 2 VAL B 39  ? GLU B 45  ? VAL S 39  GLU S 45  
D 3 PHE B 98  ? ASP B 105 ? PHE S 98  ASP S 105 
D 4 VAL B 110 ? TYR B 118 ? VAL S 110 TYR S 118 
E 1 ARG C 83  ? PRO C 89  ? ARG B 83  PRO B 89  
E 2 TYR C 97  ? TYR C 103 ? TYR B 97  TYR B 103 
E 3 ILE C 36  ? PRO C 44  ? ILE B 36  PRO B 44  
E 4 LEU C 130 ? ARG C 139 ? LEU B 130 ARG B 139 
E 5 GLY C 308 ? MET C 309 ? GLY B 308 MET B 309 
F 1 LEU C 169 ? GLY C 171 ? LEU B 169 GLY B 171 
F 2 VAL C 399 ? GLN C 401 ? VAL B 399 GLN B 401 
F 3 LEU C 375 ? SER C 379 ? LEU B 375 SER B 379 
F 4 HIS C 325 ? HIS C 327 ? HIS B 325 HIS B 327 
F 5 LEU C 290 ? HIS C 294 ? LEU B 290 HIS B 294 
F 6 ILE C 264 ? ASP C 268 ? ILE B 264 ASP B 268 
F 7 GLY C 237 ? ASN C 241 ? GLY B 237 ASN B 241 
F 8 PHE C 199 ? KCX C 201 ? PHE B 199 KCX B 201 
G 1 TYR C 353 ? THR C 354 ? TYR B 353 THR B 354 
G 2 GLN C 366 ? SER C 367 ? GLN B 366 SER B 367 
H 1 THR D 68  ? TRP D 70  ? THR T 68  TRP T 70  
H 2 VAL D 39  ? GLU D 45  ? VAL T 39  GLU T 45  
H 3 PHE D 98  ? ASP D 105 ? PHE T 98  ASP T 105 
H 4 VAL D 110 ? TYR D 118 ? VAL T 110 TYR T 118 
I 1 ARG E 83  ? PRO E 89  ? ARG C 83  PRO C 89  
I 2 TYR E 97  ? TYR E 103 ? TYR C 97  TYR C 103 
I 3 ILE E 36  ? PRO E 44  ? ILE C 36  PRO C 44  
I 4 LEU E 130 ? ARG E 139 ? LEU C 130 ARG C 139 
I 5 GLY E 308 ? MET E 309 ? GLY C 308 MET C 309 
J 1 LEU E 169 ? GLY E 171 ? LEU C 169 GLY C 171 
J 2 VAL E 399 ? GLN E 401 ? VAL C 399 GLN C 401 
J 3 LEU E 375 ? SER E 379 ? LEU C 375 SER C 379 
J 4 HIS E 325 ? HIS E 327 ? HIS C 325 HIS C 327 
J 5 LEU E 290 ? HIS E 294 ? LEU C 290 HIS C 294 
J 6 ILE E 264 ? ASP E 268 ? ILE C 264 ASP C 268 
J 7 GLY E 237 ? ASN E 241 ? GLY C 237 ASN C 241 
J 8 PHE E 199 ? KCX E 201 ? PHE C 199 KCX C 201 
K 1 TYR E 353 ? THR E 354 ? TYR C 353 THR C 354 
K 2 GLN E 366 ? SER E 367 ? GLN C 366 SER C 367 
L 1 THR F 68  ? TRP F 70  ? THR U 68  TRP U 70  
L 2 VAL F 39  ? GLU F 45  ? VAL U 39  GLU U 45  
L 3 PHE F 98  ? ASP F 105 ? PHE U 98  ASP U 105 
L 4 VAL F 110 ? TYR F 118 ? VAL U 110 TYR U 118 
M 1 ARG G 83  ? PRO G 89  ? ARG D 83  PRO D 89  
M 2 TYR G 97  ? TYR G 103 ? TYR D 97  TYR D 103 
M 3 ILE G 36  ? PRO G 44  ? ILE D 36  PRO D 44  
M 4 LEU G 130 ? ARG G 139 ? LEU D 130 ARG D 139 
M 5 GLY G 308 ? MET G 309 ? GLY D 308 MET D 309 
N 1 LEU G 169 ? GLY G 171 ? LEU D 169 GLY D 171 
N 2 VAL G 399 ? GLN G 401 ? VAL D 399 GLN D 401 
N 3 LEU G 375 ? SER G 379 ? LEU D 375 SER D 379 
N 4 HIS G 325 ? HIS G 327 ? HIS D 325 HIS D 327 
N 5 LEU G 290 ? HIS G 294 ? LEU D 290 HIS D 294 
N 6 ILE G 264 ? ASP G 268 ? ILE D 264 ASP D 268 
N 7 GLY G 237 ? ASN G 241 ? GLY D 237 ASN D 241 
N 8 PHE G 199 ? KCX G 201 ? PHE D 199 KCX D 201 
O 1 TYR G 353 ? THR G 354 ? TYR D 353 THR D 354 
O 2 GLN G 366 ? SER G 367 ? GLN D 366 SER D 367 
P 1 THR H 68  ? TRP H 70  ? THR V 68  TRP V 70  
P 2 VAL H 39  ? GLU H 45  ? VAL V 39  GLU V 45  
P 3 PHE H 98  ? ASP H 105 ? PHE V 98  ASP V 105 
P 4 VAL H 110 ? TYR H 118 ? VAL V 110 TYR V 118 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 88  ? N GLU A 88  O ILE A 98  ? O ILE A 98  
A 2 3 O TYR A 97  ? O TYR A 97  N VAL A 42  ? N VAL A 42  
A 3 4 N ARG A 41  ? N ARG A 41  O ARG A 134 ? O ARG A 134 
A 4 5 N LEU A 135 ? N LEU A 135 O GLY A 308 ? O GLY A 308 
B 1 2 N LEU A 169 ? N LEU A 169 O LEU A 400 ? O LEU A 400 
B 2 3 O GLN A 401 ? O GLN A 401 N ALA A 378 ? N ALA A 378 
B 3 4 O VAL A 377 ? O VAL A 377 N ILE A 326 ? N ILE A 326 
B 4 5 O HIS A 325 ? O HIS A 325 N ILE A 293 ? N ILE A 293 
B 5 6 O HIS A 292 ? O HIS A 292 N VAL A 265 ? N VAL A 265 
B 6 7 O MET A 266 ? O MET A 266 N LEU A 240 ? N LEU A 240 
B 7 8 O TYR A 239 ? O TYR A 239 N THR A 200 ? N THR A 200 
C 1 2 N THR A 354 ? N THR A 354 O GLN A 366 ? O GLN A 366 
D 1 2 O TRP B 70  ? O TRP S 70  N LEU B 42  ? N LEU S 42  
D 2 3 N CYS B 41  ? N CYS S 41  O ILE B 102 ? O ILE S 102 
D 3 4 N ILE B 99  ? N ILE S 99  O ALA B 117 ? O ALA S 117 
E 1 2 N GLU C 88  ? N GLU B 88  O ILE C 98  ? O ILE B 98  
E 2 3 O TYR C 97  ? O TYR B 97  N VAL C 42  ? N VAL B 42  
E 3 4 N ARG C 41  ? N ARG B 41  O ARG C 134 ? O ARG B 134 
E 4 5 N LEU C 135 ? N LEU B 135 O GLY C 308 ? O GLY B 308 
F 1 2 N GLY C 171 ? N GLY B 171 O LEU C 400 ? O LEU B 400 
F 2 3 O GLN C 401 ? O GLN B 401 N ALA C 378 ? N ALA B 378 
F 3 4 O VAL C 377 ? O VAL B 377 N ILE C 326 ? N ILE B 326 
F 4 5 O HIS C 325 ? O HIS B 325 N ILE C 293 ? N ILE B 293 
F 5 6 O HIS C 292 ? O HIS B 292 N VAL C 265 ? N VAL B 265 
F 6 7 O MET C 266 ? O MET B 266 N LEU C 240 ? N LEU B 240 
F 7 8 O TYR C 239 ? O TYR B 239 N THR C 200 ? N THR B 200 
G 1 2 N THR C 354 ? N THR B 354 O GLN C 366 ? O GLN B 366 
H 1 2 O THR D 68  ? O THR T 68  N PHE D 44  ? N PHE T 44  
H 2 3 N GLU D 43  ? N GLU T 43  O ARG D 100 ? O ARG T 100 
H 3 4 N ILE D 99  ? N ILE T 99  O ALA D 117 ? O ALA T 117 
I 1 2 N GLU E 88  ? N GLU C 88  O ILE E 98  ? O ILE C 98  
I 2 3 O TYR E 97  ? O TYR C 97  N VAL E 42  ? N VAL C 42  
I 3 4 N ARG E 41  ? N ARG C 41  O ARG E 134 ? O ARG C 134 
I 4 5 N LEU E 135 ? N LEU C 135 O GLY E 308 ? O GLY C 308 
J 1 2 N LEU E 169 ? N LEU C 169 O LEU E 400 ? O LEU C 400 
J 2 3 O GLN E 401 ? O GLN C 401 N ALA E 378 ? N ALA C 378 
J 3 4 O VAL E 377 ? O VAL C 377 N ILE E 326 ? N ILE C 326 
J 4 5 O HIS E 325 ? O HIS C 325 N ILE E 293 ? N ILE C 293 
J 5 6 O HIS E 292 ? O HIS C 292 N VAL E 265 ? N VAL C 265 
J 6 7 O MET E 266 ? O MET C 266 N LEU E 240 ? N LEU C 240 
J 7 8 O TYR E 239 ? O TYR C 239 N THR E 200 ? N THR C 200 
K 1 2 N THR E 354 ? N THR C 354 O GLN E 366 ? O GLN C 366 
L 1 2 O TRP F 70  ? O TRP U 70  N LEU F 42  ? N LEU U 42  
L 2 3 N VAL F 39  ? N VAL U 39  O PHE F 104 ? O PHE U 104 
L 3 4 N ILE F 99  ? N ILE U 99  O ALA F 117 ? O ALA U 117 
M 1 2 N GLU G 88  ? N GLU D 88  O ILE G 98  ? O ILE D 98  
M 2 3 O TYR G 97  ? O TYR D 97  N VAL G 42  ? N VAL D 42  
M 3 4 N ARG G 41  ? N ARG D 41  O ARG G 134 ? O ARG D 134 
M 4 5 N LEU G 135 ? N LEU D 135 O GLY G 308 ? O GLY D 308 
N 1 2 N LEU G 169 ? N LEU D 169 O LEU G 400 ? O LEU D 400 
N 2 3 O GLN G 401 ? O GLN D 401 N ALA G 378 ? N ALA D 378 
N 3 4 O VAL G 377 ? O VAL D 377 N ILE G 326 ? N ILE D 326 
N 4 5 O HIS G 325 ? O HIS D 325 N ILE G 293 ? N ILE D 293 
N 5 6 O HIS G 292 ? O HIS D 292 N VAL G 265 ? N VAL D 265 
N 6 7 O MET G 266 ? O MET D 266 N LEU G 240 ? N LEU D 240 
N 7 8 O TYR G 239 ? O TYR D 239 N THR G 200 ? N THR D 200 
O 1 2 N THR G 354 ? N THR D 354 O GLN G 366 ? O GLN D 366 
P 1 2 O TRP H 70  ? O TRP V 70  N LEU H 42  ? N LEU V 42  
P 2 3 N CYS H 41  ? N CYS V 41  O ILE H 102 ? O ILE V 102 
P 3 4 N ILE H 99  ? N ILE V 99  O ALA H 117 ? O ALA V 117 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 476'  
AC2 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG B 476'  
AC3 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG C 476'  
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG D 476'  
AC5 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE CAP A 501' 
AC6 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE CAP B 501' 
AC7 Software ? ? ? ? 29 'BINDING SITE FOR RESIDUE CAP C 501' 
AC8 Software ? ? ? ? 28 'BINDING SITE FOR RESIDUE CAP D 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  KCX A 201 ? KCX A 201 . ? 1_555 ? 
2   AC1 4  ASP A 203 ? ASP A 203 . ? 1_555 ? 
3   AC1 4  GLU A 204 ? GLU A 204 . ? 1_555 ? 
4   AC1 4  CAP J .   ? CAP A 501 . ? 1_555 ? 
5   AC2 4  KCX C 201 ? KCX B 201 . ? 1_555 ? 
6   AC2 4  ASP C 203 ? ASP B 203 . ? 1_555 ? 
7   AC2 4  GLU C 204 ? GLU B 204 . ? 1_555 ? 
8   AC2 4  CAP L .   ? CAP B 501 . ? 1_555 ? 
9   AC3 4  KCX E 201 ? KCX C 201 . ? 1_555 ? 
10  AC3 4  ASP E 203 ? ASP C 203 . ? 1_555 ? 
11  AC3 4  GLU E 204 ? GLU C 204 . ? 1_555 ? 
12  AC3 4  CAP N .   ? CAP C 501 . ? 1_555 ? 
13  AC4 4  KCX G 201 ? KCX D 201 . ? 1_555 ? 
14  AC4 4  ASP G 203 ? ASP D 203 . ? 1_555 ? 
15  AC4 4  GLU G 204 ? GLU D 204 . ? 1_555 ? 
16  AC4 4  CAP P .   ? CAP D 501 . ? 1_555 ? 
17  AC5 29 THR A 173 ? THR A 173 . ? 1_555 ? 
18  AC5 29 LYS A 175 ? LYS A 175 . ? 1_555 ? 
19  AC5 29 LYS A 177 ? LYS A 177 . ? 1_555 ? 
20  AC5 29 KCX A 201 ? KCX A 201 . ? 1_555 ? 
21  AC5 29 ASP A 203 ? ASP A 203 . ? 1_555 ? 
22  AC5 29 GLU A 204 ? GLU A 204 . ? 1_555 ? 
23  AC5 29 HIS A 294 ? HIS A 294 . ? 1_555 ? 
24  AC5 29 ARG A 295 ? ARG A 295 . ? 1_555 ? 
25  AC5 29 HIS A 327 ? HIS A 327 . ? 1_555 ? 
26  AC5 29 LYS A 334 ? LYS A 334 . ? 1_555 ? 
27  AC5 29 LEU A 335 ? LEU A 335 . ? 1_555 ? 
28  AC5 29 SER A 379 ? SER A 379 . ? 1_555 ? 
29  AC5 29 GLY A 380 ? GLY A 380 . ? 1_555 ? 
30  AC5 29 GLY A 381 ? GLY A 381 . ? 1_555 ? 
31  AC5 29 GLY A 403 ? GLY A 403 . ? 1_555 ? 
32  AC5 29 GLY A 404 ? GLY A 404 . ? 1_555 ? 
33  AC5 29 MG  I .   ? MG  A 476 . ? 1_555 ? 
34  AC5 29 HOH Q .   ? HOH A 503 . ? 1_555 ? 
35  AC5 29 HOH Q .   ? HOH A 505 . ? 1_555 ? 
36  AC5 29 HOH Q .   ? HOH A 508 . ? 1_555 ? 
37  AC5 29 HOH Q .   ? HOH A 520 . ? 1_555 ? 
38  AC5 29 HOH Q .   ? HOH A 524 . ? 1_555 ? 
39  AC5 29 HOH Q .   ? HOH A 558 . ? 1_555 ? 
40  AC5 29 HOH Q .   ? HOH A 580 . ? 1_555 ? 
41  AC5 29 HOH Q .   ? HOH A 623 . ? 1_555 ? 
42  AC5 29 GLU E 60  ? GLU C 60  . ? 3_555 ? 
43  AC5 29 THR E 65  ? THR C 65  . ? 3_555 ? 
44  AC5 29 TRP E 66  ? TRP C 66  . ? 3_555 ? 
45  AC5 29 ASN E 123 ? ASN C 123 . ? 3_555 ? 
46  AC6 28 GLU C 60  ? GLU B 60  . ? 3_555 ? 
47  AC6 28 THR C 65  ? THR B 65  . ? 3_555 ? 
48  AC6 28 TRP C 66  ? TRP B 66  . ? 3_555 ? 
49  AC6 28 ASN C 123 ? ASN B 123 . ? 3_555 ? 
50  AC6 28 THR C 173 ? THR B 173 . ? 1_555 ? 
51  AC6 28 LYS C 175 ? LYS B 175 . ? 1_555 ? 
52  AC6 28 LYS C 177 ? LYS B 177 . ? 1_555 ? 
53  AC6 28 KCX C 201 ? KCX B 201 . ? 1_555 ? 
54  AC6 28 ASP C 203 ? ASP B 203 . ? 1_555 ? 
55  AC6 28 GLU C 204 ? GLU B 204 . ? 1_555 ? 
56  AC6 28 HIS C 294 ? HIS B 294 . ? 1_555 ? 
57  AC6 28 ARG C 295 ? ARG B 295 . ? 1_555 ? 
58  AC6 28 HIS C 327 ? HIS B 327 . ? 1_555 ? 
59  AC6 28 LYS C 334 ? LYS B 334 . ? 1_555 ? 
60  AC6 28 LEU C 335 ? LEU B 335 . ? 1_555 ? 
61  AC6 28 SER C 379 ? SER B 379 . ? 1_555 ? 
62  AC6 28 GLY C 380 ? GLY B 380 . ? 1_555 ? 
63  AC6 28 GLY C 381 ? GLY B 381 . ? 1_555 ? 
64  AC6 28 GLY C 403 ? GLY B 403 . ? 1_555 ? 
65  AC6 28 GLY C 404 ? GLY B 404 . ? 1_555 ? 
66  AC6 28 MG  K .   ? MG  B 476 . ? 1_555 ? 
67  AC6 28 HOH S .   ? HOH B 507 . ? 1_555 ? 
68  AC6 28 HOH S .   ? HOH B 522 . ? 1_555 ? 
69  AC6 28 HOH S .   ? HOH B 547 . ? 1_555 ? 
70  AC6 28 HOH S .   ? HOH B 548 . ? 1_555 ? 
71  AC6 28 HOH S .   ? HOH B 550 . ? 1_555 ? 
72  AC6 28 HOH S .   ? HOH B 602 . ? 1_555 ? 
73  AC6 28 HOH S .   ? HOH B 695 . ? 1_555 ? 
74  AC7 29 GLU A 60  ? GLU A 60  . ? 3_555 ? 
75  AC7 29 THR A 65  ? THR A 65  . ? 3_555 ? 
76  AC7 29 TRP A 66  ? TRP A 66  . ? 3_555 ? 
77  AC7 29 ASN A 123 ? ASN A 123 . ? 3_555 ? 
78  AC7 29 THR E 173 ? THR C 173 . ? 1_555 ? 
79  AC7 29 LYS E 175 ? LYS C 175 . ? 1_555 ? 
80  AC7 29 LYS E 177 ? LYS C 177 . ? 1_555 ? 
81  AC7 29 KCX E 201 ? KCX C 201 . ? 1_555 ? 
82  AC7 29 ASP E 203 ? ASP C 203 . ? 1_555 ? 
83  AC7 29 GLU E 204 ? GLU C 204 . ? 1_555 ? 
84  AC7 29 HIS E 294 ? HIS C 294 . ? 1_555 ? 
85  AC7 29 ARG E 295 ? ARG C 295 . ? 1_555 ? 
86  AC7 29 HIS E 327 ? HIS C 327 . ? 1_555 ? 
87  AC7 29 LYS E 334 ? LYS C 334 . ? 1_555 ? 
88  AC7 29 LEU E 335 ? LEU C 335 . ? 1_555 ? 
89  AC7 29 SER E 379 ? SER C 379 . ? 1_555 ? 
90  AC7 29 GLY E 380 ? GLY C 380 . ? 1_555 ? 
91  AC7 29 GLY E 381 ? GLY C 381 . ? 1_555 ? 
92  AC7 29 GLY E 403 ? GLY C 403 . ? 1_555 ? 
93  AC7 29 GLY E 404 ? GLY C 404 . ? 1_555 ? 
94  AC7 29 MG  M .   ? MG  C 476 . ? 1_555 ? 
95  AC7 29 HOH U .   ? HOH C 502 . ? 1_555 ? 
96  AC7 29 HOH U .   ? HOH C 504 . ? 1_555 ? 
97  AC7 29 HOH U .   ? HOH C 548 . ? 1_555 ? 
98  AC7 29 HOH U .   ? HOH C 549 . ? 1_555 ? 
99  AC7 29 HOH U .   ? HOH C 551 . ? 1_555 ? 
100 AC7 29 HOH U .   ? HOH C 554 . ? 1_555 ? 
101 AC7 29 HOH U .   ? HOH C 575 . ? 1_555 ? 
102 AC7 29 HOH U .   ? HOH C 598 . ? 1_555 ? 
103 AC8 28 GLU G 60  ? GLU D 60  . ? 3_555 ? 
104 AC8 28 THR G 65  ? THR D 65  . ? 3_555 ? 
105 AC8 28 TRP G 66  ? TRP D 66  . ? 3_555 ? 
106 AC8 28 ASN G 123 ? ASN D 123 . ? 3_555 ? 
107 AC8 28 THR G 173 ? THR D 173 . ? 1_555 ? 
108 AC8 28 LYS G 175 ? LYS D 175 . ? 1_555 ? 
109 AC8 28 LYS G 177 ? LYS D 177 . ? 1_555 ? 
110 AC8 28 KCX G 201 ? KCX D 201 . ? 1_555 ? 
111 AC8 28 ASP G 203 ? ASP D 203 . ? 1_555 ? 
112 AC8 28 GLU G 204 ? GLU D 204 . ? 1_555 ? 
113 AC8 28 HIS G 294 ? HIS D 294 . ? 1_555 ? 
114 AC8 28 ARG G 295 ? ARG D 295 . ? 1_555 ? 
115 AC8 28 HIS G 327 ? HIS D 327 . ? 1_555 ? 
116 AC8 28 LYS G 334 ? LYS D 334 . ? 1_555 ? 
117 AC8 28 LEU G 335 ? LEU D 335 . ? 1_555 ? 
118 AC8 28 SER G 379 ? SER D 379 . ? 1_555 ? 
119 AC8 28 GLY G 380 ? GLY D 380 . ? 1_555 ? 
120 AC8 28 GLY G 381 ? GLY D 381 . ? 1_555 ? 
121 AC8 28 GLY G 403 ? GLY D 403 . ? 1_555 ? 
122 AC8 28 GLY G 404 ? GLY D 404 . ? 1_555 ? 
123 AC8 28 MG  O .   ? MG  D 476 . ? 1_555 ? 
124 AC8 28 HOH W .   ? HOH D 507 . ? 1_555 ? 
125 AC8 28 HOH W .   ? HOH D 526 . ? 1_555 ? 
126 AC8 28 HOH W .   ? HOH D 551 . ? 1_555 ? 
127 AC8 28 HOH W .   ? HOH D 555 . ? 1_555 ? 
128 AC8 28 HOH W .   ? HOH D 559 . ? 1_555 ? 
129 AC8 28 HOH W .   ? HOH D 585 . ? 1_555 ? 
130 AC8 28 HOH W .   ? HOH D 610 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1IR1 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IR1 
_atom_sites.fract_transf_matrix[1][1]   0.006337 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006337 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004978 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . GLU A 1 12  ? -39.540 63.889  82.027  1.00 40.23 ? 12  GLU A N   1 
ATOM   2     C  CA  . GLU A 1 12  ? -40.101 62.936  83.030  1.00 39.96 ? 12  GLU A CA  1 
ATOM   3     C  C   . GLU A 1 12  ? -40.259 61.568  82.392  1.00 36.59 ? 12  GLU A C   1 
ATOM   4     O  O   . GLU A 1 12  ? -40.779 61.443  81.279  1.00 37.06 ? 12  GLU A O   1 
ATOM   5     C  CB  . GLU A 1 12  ? -41.484 63.383  83.506  1.00 44.34 ? 12  GLU A CB  1 
ATOM   6     C  CG  . GLU A 1 12  ? -41.578 64.805  84.011  1.00 49.67 ? 12  GLU A CG  1 
ATOM   7     C  CD  . GLU A 1 12  ? -42.972 65.127  84.518  1.00 52.79 ? 12  GLU A CD  1 
ATOM   8     O  OE1 . GLU A 1 12  ? -43.954 64.722  83.854  1.00 54.95 ? 12  GLU A OE1 1 
ATOM   9     O  OE2 . GLU A 1 12  ? -43.085 65.786  85.573  1.00 54.72 ? 12  GLU A OE2 1 
ATOM   10    N  N   . PHE A 1 13  ? -39.799 60.542  83.089  1.00 31.95 ? 13  PHE A N   1 
ATOM   11    C  CA  . PHE A 1 13  ? -39.954 59.208  82.563  1.00 27.45 ? 13  PHE A CA  1 
ATOM   12    C  C   . PHE A 1 13  ? -41.139 58.544  83.239  1.00 25.43 ? 13  PHE A C   1 
ATOM   13    O  O   . PHE A 1 13  ? -41.155 58.361  84.454  1.00 25.89 ? 13  PHE A O   1 
ATOM   14    C  CB  . PHE A 1 13  ? -38.712 58.355  82.795  1.00 22.91 ? 13  PHE A CB  1 
ATOM   15    C  CG  . PHE A 1 13  ? -38.931 56.898  82.485  1.00 18.60 ? 13  PHE A CG  1 
ATOM   16    C  CD1 . PHE A 1 13  ? -39.425 56.507  81.240  1.00 15.90 ? 13  PHE A CD1 1 
ATOM   17    C  CD2 . PHE A 1 13  ? -38.665 55.919  83.436  1.00 14.55 ? 13  PHE A CD2 1 
ATOM   18    C  CE1 . PHE A 1 13  ? -39.650 55.160  80.949  1.00 16.84 ? 13  PHE A CE1 1 
ATOM   19    C  CE2 . PHE A 1 13  ? -38.884 54.572  83.156  1.00 14.68 ? 13  PHE A CE2 1 
ATOM   20    C  CZ  . PHE A 1 13  ? -39.377 54.190  81.911  1.00 15.08 ? 13  PHE A CZ  1 
ATOM   21    N  N   . LYS A 1 14  ? -42.137 58.195  82.441  1.00 24.44 ? 14  LYS A N   1 
ATOM   22    C  CA  . LYS A 1 14  ? -43.312 57.523  82.959  1.00 24.50 ? 14  LYS A CA  1 
ATOM   23    C  C   . LYS A 1 14  ? -43.447 56.216  82.194  1.00 21.87 ? 14  LYS A C   1 
ATOM   24    O  O   . LYS A 1 14  ? -43.684 56.212  80.987  1.00 21.20 ? 14  LYS A O   1 
ATOM   25    C  CB  . LYS A 1 14  ? -44.557 58.394  82.772  1.00 27.50 ? 14  LYS A CB  1 
ATOM   26    C  CG  . LYS A 1 14  ? -45.772 57.906  83.546  1.00 32.13 ? 14  LYS A CG  1 
ATOM   27    C  CD  . LYS A 1 14  ? -45.419 57.591  85.001  1.00 37.11 ? 14  LYS A CD  1 
ATOM   28    C  CE  . LYS A 1 14  ? -44.802 58.793  85.714  1.00 39.12 ? 14  LYS A CE  1 
ATOM   29    N  NZ  . LYS A 1 14  ? -43.539 58.431  86.427  1.00 41.29 ? 14  LYS A NZ  1 
ATOM   30    N  N   . ALA A 1 15  ? -43.275 55.106  82.899  1.00 19.40 ? 15  ALA A N   1 
ATOM   31    C  CA  . ALA A 1 15  ? -43.362 53.794  82.276  1.00 19.30 ? 15  ALA A CA  1 
ATOM   32    C  C   . ALA A 1 15  ? -44.786 53.491  81.827  1.00 18.25 ? 15  ALA A C   1 
ATOM   33    O  O   . ALA A 1 15  ? -45.752 53.992  82.404  1.00 17.27 ? 15  ALA A O   1 
ATOM   34    C  CB  . ALA A 1 15  ? -42.879 52.725  83.245  1.00 18.58 ? 15  ALA A CB  1 
ATOM   35    N  N   . GLY A 1 16  ? -44.911 52.674  80.788  1.00 15.98 ? 16  GLY A N   1 
ATOM   36    C  CA  . GLY A 1 16  ? -46.228 52.323  80.292  1.00 15.55 ? 16  GLY A CA  1 
ATOM   37    C  C   . GLY A 1 16  ? -46.377 52.504  78.795  1.00 14.54 ? 16  GLY A C   1 
ATOM   38    O  O   . GLY A 1 16  ? -45.534 53.115  78.145  1.00 13.13 ? 16  GLY A O   1 
ATOM   39    N  N   . VAL A 1 17  ? -47.468 51.973  78.255  1.00 15.13 ? 17  VAL A N   1 
ATOM   40    C  CA  . VAL A 1 17  ? -47.743 52.054  76.830  1.00 15.00 ? 17  VAL A CA  1 
ATOM   41    C  C   . VAL A 1 17  ? -48.595 53.270  76.478  1.00 17.28 ? 17  VAL A C   1 
ATOM   42    O  O   . VAL A 1 17  ? -49.531 53.610  77.198  1.00 16.80 ? 17  VAL A O   1 
ATOM   43    C  CB  . VAL A 1 17  ? -48.483 50.784  76.344  1.00 16.83 ? 17  VAL A CB  1 
ATOM   44    C  CG1 . VAL A 1 17  ? -48.726 50.863  74.838  1.00 15.57 ? 17  VAL A CG1 1 
ATOM   45    C  CG2 . VAL A 1 17  ? -47.676 49.539  76.700  1.00 15.80 ? 17  VAL A CG2 1 
ATOM   46    N  N   . LYS A 1 18  ? -48.251 53.921  75.369  1.00 19.01 ? 18  LYS A N   1 
ATOM   47    C  CA  . LYS A 1 18  ? -48.988 55.083  74.868  1.00 19.82 ? 18  LYS A CA  1 
ATOM   48    C  C   . LYS A 1 18  ? -49.245 54.806  73.392  1.00 19.08 ? 18  LYS A C   1 
ATOM   49    O  O   . LYS A 1 18  ? -48.569 53.971  72.793  1.00 19.56 ? 18  LYS A O   1 
ATOM   50    C  CB  . LYS A 1 18  ? -48.154 56.363  74.949  1.00 22.78 ? 18  LYS A CB  1 
ATOM   51    C  CG  . LYS A 1 18  ? -47.521 56.677  76.281  1.00 28.44 ? 18  LYS A CG  1 
ATOM   52    C  CD  . LYS A 1 18  ? -46.731 57.979  76.171  1.00 33.52 ? 18  LYS A CD  1 
ATOM   53    C  CE  . LYS A 1 18  ? -45.713 57.925  75.030  1.00 36.25 ? 18  LYS A CE  1 
ATOM   54    N  NZ  . LYS A 1 18  ? -44.997 59.218  74.839  1.00 38.77 ? 18  LYS A NZ  1 
ATOM   55    N  N   . ASP A 1 19  ? -50.207 55.504  72.801  1.00 17.92 ? 19  ASP A N   1 
ATOM   56    C  CA  . ASP A 1 19  ? -50.482 55.316  71.382  1.00 17.00 ? 19  ASP A CA  1 
ATOM   57    C  C   . ASP A 1 19  ? -49.301 55.894  70.614  1.00 15.59 ? 19  ASP A C   1 
ATOM   58    O  O   . ASP A 1 19  ? -48.695 56.878  71.046  1.00 15.60 ? 19  ASP A O   1 
ATOM   59    C  CB  . ASP A 1 19  ? -51.757 56.053  70.948  1.00 18.72 ? 19  ASP A CB  1 
ATOM   60    C  CG  . ASP A 1 19  ? -53.019 55.478  71.572  1.00 23.09 ? 19  ASP A CG  1 
ATOM   61    O  OD1 . ASP A 1 19  ? -53.113 54.240  71.715  1.00 24.02 ? 19  ASP A OD1 1 
ATOM   62    O  OD2 . ASP A 1 19  ? -53.929 56.270  71.901  1.00 24.63 ? 19  ASP A OD2 1 
ATOM   63    N  N   . TYR A 1 20  ? -48.975 55.284  69.481  1.00 13.34 ? 20  TYR A N   1 
ATOM   64    C  CA  . TYR A 1 20  ? -47.873 55.752  68.653  1.00 13.04 ? 20  TYR A CA  1 
ATOM   65    C  C   . TYR A 1 20  ? -48.155 57.151  68.089  1.00 13.98 ? 20  TYR A C   1 
ATOM   66    O  O   . TYR A 1 20  ? -47.236 57.949  67.902  1.00 14.60 ? 20  TYR A O   1 
ATOM   67    C  CB  . TYR A 1 20  ? -47.646 54.793  67.477  1.00 11.67 ? 20  TYR A CB  1 
ATOM   68    C  CG  . TYR A 1 20  ? -47.037 53.448  67.815  1.00 9.13  ? 20  TYR A CG  1 
ATOM   69    C  CD1 . TYR A 1 20  ? -45.685 53.329  68.155  1.00 9.38  ? 20  TYR A CD1 1 
ATOM   70    C  CD2 . TYR A 1 20  ? -47.799 52.282  67.740  1.00 10.27 ? 20  TYR A CD2 1 
ATOM   71    C  CE1 . TYR A 1 20  ? -45.111 52.076  68.402  1.00 8.53  ? 20  TYR A CE1 1 
ATOM   72    C  CE2 . TYR A 1 20  ? -47.237 51.029  67.986  1.00 8.27  ? 20  TYR A CE2 1 
ATOM   73    C  CZ  . TYR A 1 20  ? -45.897 50.931  68.315  1.00 9.09  ? 20  TYR A CZ  1 
ATOM   74    O  OH  . TYR A 1 20  ? -45.349 49.685  68.544  1.00 9.35  ? 20  TYR A OH  1 
ATOM   75    N  N   . LYS A 1 21  ? -49.425 57.445  67.818  1.00 13.74 ? 21  LYS A N   1 
ATOM   76    C  CA  . LYS A 1 21  ? -49.802 58.733  67.241  1.00 14.76 ? 21  LYS A CA  1 
ATOM   77    C  C   . LYS A 1 21  ? -49.465 59.948  68.083  1.00 14.06 ? 21  LYS A C   1 
ATOM   78    O  O   . LYS A 1 21  ? -49.336 61.046  67.546  1.00 13.63 ? 21  LYS A O   1 
ATOM   79    C  CB  . LYS A 1 21  ? -51.298 58.764  66.902  1.00 16.47 ? 21  LYS A CB  1 
ATOM   80    C  CG  . LYS A 1 21  ? -52.225 58.558  68.086  1.00 19.07 ? 21  LYS A CG  1 
ATOM   81    C  CD  . LYS A 1 21  ? -53.672 58.619  67.629  1.00 23.14 ? 21  LYS A CD  1 
ATOM   82    C  CE  . LYS A 1 21  ? -54.546 57.668  68.432  1.00 26.64 ? 21  LYS A CE  1 
ATOM   83    N  NZ  . LYS A 1 21  ? -55.931 57.594  67.879  1.00 29.59 ? 21  LYS A NZ  1 
ATOM   84    N  N   . LEU A 1 22  ? -49.326 59.764  69.392  1.00 13.41 ? 22  LEU A N   1 
ATOM   85    C  CA  . LEU A 1 22  ? -49.003 60.879  70.278  1.00 14.33 ? 22  LEU A CA  1 
ATOM   86    C  C   . LEU A 1 22  ? -47.618 61.452  69.984  1.00 14.68 ? 22  LEU A C   1 
ATOM   87    O  O   . LEU A 1 22  ? -47.356 62.624  70.241  1.00 15.96 ? 22  LEU A O   1 
ATOM   88    C  CB  . LEU A 1 22  ? -49.057 60.433  71.745  1.00 15.11 ? 22  LEU A CB  1 
ATOM   89    C  CG  . LEU A 1 22  ? -50.363 59.823  72.260  1.00 16.47 ? 22  LEU A CG  1 
ATOM   90    C  CD1 . LEU A 1 22  ? -50.230 59.515  73.742  1.00 15.50 ? 22  LEU A CD1 1 
ATOM   91    C  CD2 . LEU A 1 22  ? -51.512 60.791  72.021  1.00 17.37 ? 22  LEU A CD2 1 
ATOM   92    N  N   . THR A 1 23  ? -46.734 60.622  69.438  1.00 13.82 ? 23  THR A N   1 
ATOM   93    C  CA  . THR A 1 23  ? -45.374 61.056  69.138  1.00 12.06 ? 23  THR A CA  1 
ATOM   94    C  C   . THR A 1 23  ? -45.017 61.015  67.657  1.00 12.47 ? 23  THR A C   1 
ATOM   95    O  O   . THR A 1 23  ? -44.266 61.865  67.171  1.00 12.46 ? 23  THR A O   1 
ATOM   96    C  CB  . THR A 1 23  ? -44.352 60.170  69.880  1.00 12.08 ? 23  THR A CB  1 
ATOM   97    O  OG1 . THR A 1 23  ? -44.608 60.227  71.286  1.00 14.97 ? 23  THR A OG1 1 
ATOM   98    C  CG2 . THR A 1 23  ? -42.922 60.631  69.600  1.00 11.90 ? 23  THR A CG2 1 
ATOM   99    N  N   . TYR A 1 24  ? -45.566 60.038  66.942  1.00 12.02 ? 24  TYR A N   1 
ATOM   100   C  CA  . TYR A 1 24  ? -45.235 59.843  65.537  1.00 12.15 ? 24  TYR A CA  1 
ATOM   101   C  C   . TYR A 1 24  ? -46.200 60.313  64.452  1.00 12.56 ? 24  TYR A C   1 
ATOM   102   O  O   . TYR A 1 24  ? -45.930 60.127  63.267  1.00 14.08 ? 24  TYR A O   1 
ATOM   103   C  CB  . TYR A 1 24  ? -44.879 58.371  65.333  1.00 11.25 ? 24  TYR A CB  1 
ATOM   104   C  CG  . TYR A 1 24  ? -43.676 57.945  66.156  1.00 11.13 ? 24  TYR A CG  1 
ATOM   105   C  CD1 . TYR A 1 24  ? -42.379 58.142  65.684  1.00 8.71  ? 24  TYR A CD1 1 
ATOM   106   C  CD2 . TYR A 1 24  ? -43.836 57.390  67.426  1.00 10.49 ? 24  TYR A CD2 1 
ATOM   107   C  CE1 . TYR A 1 24  ? -41.270 57.797  66.455  1.00 10.31 ? 24  TYR A CE1 1 
ATOM   108   C  CE2 . TYR A 1 24  ? -42.730 57.042  68.208  1.00 10.28 ? 24  TYR A CE2 1 
ATOM   109   C  CZ  . TYR A 1 24  ? -41.454 57.250  67.717  1.00 9.89  ? 24  TYR A CZ  1 
ATOM   110   O  OH  . TYR A 1 24  ? -40.361 56.924  68.488  1.00 11.71 ? 24  TYR A OH  1 
ATOM   111   N  N   . TYR A 1 25  ? -47.323 60.908  64.838  1.00 12.93 ? 25  TYR A N   1 
ATOM   112   C  CA  . TYR A 1 25  ? -48.257 61.443  63.854  1.00 12.99 ? 25  TYR A CA  1 
ATOM   113   C  C   . TYR A 1 25  ? -48.123 62.957  63.946  1.00 13.57 ? 25  TYR A C   1 
ATOM   114   O  O   . TYR A 1 25  ? -48.540 63.567  64.928  1.00 15.12 ? 25  TYR A O   1 
ATOM   115   C  CB  . TYR A 1 25  ? -49.699 61.024  64.150  1.00 13.05 ? 25  TYR A CB  1 
ATOM   116   C  CG  . TYR A 1 25  ? -50.697 61.623  63.179  1.00 14.32 ? 25  TYR A CG  1 
ATOM   117   C  CD1 . TYR A 1 25  ? -50.555 61.441  61.800  1.00 15.12 ? 25  TYR A CD1 1 
ATOM   118   C  CD2 . TYR A 1 25  ? -51.776 62.380  63.635  1.00 15.17 ? 25  TYR A CD2 1 
ATOM   119   C  CE1 . TYR A 1 25  ? -51.464 62.001  60.903  1.00 15.72 ? 25  TYR A CE1 1 
ATOM   120   C  CE2 . TYR A 1 25  ? -52.692 62.945  62.745  1.00 13.92 ? 25  TYR A CE2 1 
ATOM   121   C  CZ  . TYR A 1 25  ? -52.530 62.750  61.384  1.00 15.88 ? 25  TYR A CZ  1 
ATOM   122   O  OH  . TYR A 1 25  ? -53.435 63.298  60.506  1.00 16.98 ? 25  TYR A OH  1 
ATOM   123   N  N   . THR A 1 26  ? -47.528 63.554  62.920  1.00 12.68 ? 26  THR A N   1 
ATOM   124   C  CA  . THR A 1 26  ? -47.289 64.991  62.892  1.00 12.65 ? 26  THR A CA  1 
ATOM   125   C  C   . THR A 1 26  ? -47.762 65.605  61.579  1.00 13.72 ? 26  THR A C   1 
ATOM   126   O  O   . THR A 1 26  ? -46.957 65.922  60.710  1.00 14.94 ? 26  THR A O   1 
ATOM   127   C  CB  . THR A 1 26  ? -45.781 65.284  63.063  1.00 13.36 ? 26  THR A CB  1 
ATOM   128   O  OG1 . THR A 1 26  ? -45.043 64.608  62.037  1.00 11.24 ? 26  THR A OG1 1 
ATOM   129   C  CG2 . THR A 1 26  ? -45.291 64.789  64.413  1.00 14.08 ? 26  THR A CG2 1 
ATOM   130   N  N   . PRO A 1 27  ? -49.082 65.789  61.425  1.00 14.58 ? 27  PRO A N   1 
ATOM   131   C  CA  . PRO A 1 27  ? -49.658 66.368  60.207  1.00 14.84 ? 27  PRO A CA  1 
ATOM   132   C  C   . PRO A 1 27  ? -49.236 67.804  59.873  1.00 15.74 ? 27  PRO A C   1 
ATOM   133   O  O   . PRO A 1 27  ? -49.475 68.274  58.761  1.00 16.95 ? 27  PRO A O   1 
ATOM   134   C  CB  . PRO A 1 27  ? -51.163 66.238  60.444  1.00 14.65 ? 27  PRO A CB  1 
ATOM   135   C  CG  . PRO A 1 27  ? -51.282 66.317  61.943  1.00 15.90 ? 27  PRO A CG  1 
ATOM   136   C  CD  . PRO A 1 27  ? -50.136 65.441  62.394  1.00 15.19 ? 27  PRO A CD  1 
ATOM   137   N  N   . GLU A 1 28  ? -48.606 68.494  60.819  1.00 15.74 ? 28  GLU A N   1 
ATOM   138   C  CA  . GLU A 1 28  ? -48.164 69.873  60.592  1.00 17.41 ? 28  GLU A CA  1 
ATOM   139   C  C   . GLU A 1 28  ? -46.702 69.960  60.151  1.00 17.20 ? 28  GLU A C   1 
ATOM   140   O  O   . GLU A 1 28  ? -46.193 71.045  59.872  1.00 15.96 ? 28  GLU A O   1 
ATOM   141   C  CB  . GLU A 1 28  ? -48.345 70.711  61.864  1.00 20.93 ? 28  GLU A CB  1 
ATOM   142   C  CG  . GLU A 1 28  ? -47.335 70.412  62.974  1.00 25.27 ? 28  GLU A CG  1 
ATOM   143   C  CD  . GLU A 1 28  ? -47.554 69.061  63.633  1.00 27.30 ? 28  GLU A CD  1 
ATOM   144   O  OE1 . GLU A 1 28  ? -46.675 68.628  64.407  1.00 29.66 ? 28  GLU A OE1 1 
ATOM   145   O  OE2 . GLU A 1 28  ? -48.606 68.436  63.390  1.00 29.25 ? 28  GLU A OE2 1 
ATOM   146   N  N   . TYR A 1 29  ? -46.028 68.815  60.091  1.00 16.21 ? 29  TYR A N   1 
ATOM   147   C  CA  . TYR A 1 29  ? -44.623 68.770  59.701  1.00 14.47 ? 29  TYR A CA  1 
ATOM   148   C  C   . TYR A 1 29  ? -44.383 69.100  58.235  1.00 14.89 ? 29  TYR A C   1 
ATOM   149   O  O   . TYR A 1 29  ? -45.052 68.573  57.350  1.00 14.35 ? 29  TYR A O   1 
ATOM   150   C  CB  . TYR A 1 29  ? -44.042 67.381  59.989  1.00 13.67 ? 29  TYR A CB  1 
ATOM   151   C  CG  . TYR A 1 29  ? -42.576 67.222  59.629  1.00 13.09 ? 29  TYR A CG  1 
ATOM   152   C  CD1 . TYR A 1 29  ? -41.584 67.887  60.351  1.00 12.15 ? 29  TYR A CD1 1 
ATOM   153   C  CD2 . TYR A 1 29  ? -42.181 66.394  58.576  1.00 13.54 ? 29  TYR A CD2 1 
ATOM   154   C  CE1 . TYR A 1 29  ? -40.233 67.729  60.042  1.00 10.35 ? 29  TYR A CE1 1 
ATOM   155   C  CE2 . TYR A 1 29  ? -40.830 66.227  58.255  1.00 11.74 ? 29  TYR A CE2 1 
ATOM   156   C  CZ  . TYR A 1 29  ? -39.865 66.899  58.994  1.00 11.49 ? 29  TYR A CZ  1 
ATOM   157   O  OH  . TYR A 1 29  ? -38.533 66.726  58.700  1.00 12.46 ? 29  TYR A OH  1 
ATOM   158   N  N   . GLU A 1 30  ? -43.427 69.987  57.986  1.00 15.65 ? 30  GLU A N   1 
ATOM   159   C  CA  . GLU A 1 30  ? -43.056 70.340  56.624  1.00 18.80 ? 30  GLU A CA  1 
ATOM   160   C  C   . GLU A 1 30  ? -41.740 69.608  56.367  1.00 17.11 ? 30  GLU A C   1 
ATOM   161   O  O   . GLU A 1 30  ? -40.771 69.782  57.105  1.00 16.54 ? 30  GLU A O   1 
ATOM   162   C  CB  . GLU A 1 30  ? -42.878 71.854  56.475  1.00 22.31 ? 30  GLU A CB  1 
ATOM   163   C  CG  . GLU A 1 30  ? -44.192 72.620  56.507  1.00 30.04 ? 30  GLU A CG  1 
ATOM   164   C  CD  . GLU A 1 30  ? -44.042 74.066  56.073  1.00 35.27 ? 30  GLU A CD  1 
ATOM   165   O  OE1 . GLU A 1 30  ? -43.381 74.846  56.794  1.00 37.66 ? 30  GLU A OE1 1 
ATOM   166   O  OE2 . GLU A 1 30  ? -44.585 74.420  55.003  1.00 38.07 ? 30  GLU A OE2 1 
ATOM   167   N  N   . THR A 1 31  ? -41.719 68.775  55.331  1.00 15.73 ? 31  THR A N   1 
ATOM   168   C  CA  . THR A 1 31  ? -40.533 67.989  55.010  1.00 15.06 ? 31  THR A CA  1 
ATOM   169   C  C   . THR A 1 31  ? -39.307 68.810  54.630  1.00 15.08 ? 31  THR A C   1 
ATOM   170   O  O   . THR A 1 31  ? -39.413 69.907  54.080  1.00 14.81 ? 31  THR A O   1 
ATOM   171   C  CB  . THR A 1 31  ? -40.815 66.993  53.869  1.00 14.94 ? 31  THR A CB  1 
ATOM   172   O  OG1 . THR A 1 31  ? -41.149 67.711  52.675  1.00 15.59 ? 31  THR A OG1 1 
ATOM   173   C  CG2 . THR A 1 31  ? -41.974 66.068  54.245  1.00 14.55 ? 31  THR A CG2 1 
ATOM   174   N  N   . LEU A 1 32  ? -38.141 68.255  54.944  1.00 14.75 ? 32  LEU A N   1 
ATOM   175   C  CA  . LEU A 1 32  ? -36.855 68.874  54.650  1.00 13.69 ? 32  LEU A CA  1 
ATOM   176   C  C   . LEU A 1 32  ? -36.336 68.283  53.346  1.00 13.59 ? 32  LEU A C   1 
ATOM   177   O  O   . LEU A 1 32  ? -36.702 67.166  52.981  1.00 12.94 ? 32  LEU A O   1 
ATOM   178   C  CB  . LEU A 1 32  ? -35.866 68.572  55.780  1.00 15.90 ? 32  LEU A CB  1 
ATOM   179   C  CG  . LEU A 1 32  ? -35.774 69.492  57.007  1.00 18.21 ? 32  LEU A CG  1 
ATOM   180   C  CD1 . LEU A 1 32  ? -37.109 70.137  57.307  1.00 19.07 ? 32  LEU A CD1 1 
ATOM   181   C  CD2 . LEU A 1 32  ? -35.275 68.681  58.197  1.00 16.10 ? 32  LEU A CD2 1 
ATOM   182   N  N   . ASP A 1 33  ? -35.484 69.022  52.644  1.00 13.18 ? 33  ASP A N   1 
ATOM   183   C  CA  . ASP A 1 33  ? -34.925 68.532  51.389  1.00 12.73 ? 33  ASP A CA  1 
ATOM   184   C  C   . ASP A 1 33  ? -33.939 67.389  51.604  1.00 11.24 ? 33  ASP A C   1 
ATOM   185   O  O   . ASP A 1 33  ? -33.505 66.750  50.645  1.00 10.62 ? 33  ASP A O   1 
ATOM   186   C  CB  . ASP A 1 33  ? -34.227 69.663  50.627  1.00 16.73 ? 33  ASP A CB  1 
ATOM   187   C  CG  . ASP A 1 33  ? -35.207 70.677  50.074  1.00 21.56 ? 33  ASP A CG  1 
ATOM   188   O  OD1 . ASP A 1 33  ? -36.259 70.252  49.553  1.00 22.57 ? 33  ASP A OD1 1 
ATOM   189   O  OD2 . ASP A 1 33  ? -34.924 71.891  50.151  1.00 24.66 ? 33  ASP A OD2 1 
ATOM   190   N  N   . THR A 1 34  ? -33.587 67.134  52.861  1.00 8.13  ? 34  THR A N   1 
ATOM   191   C  CA  . THR A 1 34  ? -32.652 66.060  53.189  1.00 8.52  ? 34  THR A CA  1 
ATOM   192   C  C   . THR A 1 34  ? -33.361 64.819  53.738  1.00 7.99  ? 34  THR A C   1 
ATOM   193   O  O   . THR A 1 34  ? -32.717 63.803  54.008  1.00 7.81  ? 34  THR A O   1 
ATOM   194   C  CB  . THR A 1 34  ? -31.616 66.528  54.223  1.00 9.35  ? 34  THR A CB  1 
ATOM   195   O  OG1 . THR A 1 34  ? -32.295 67.075  55.358  1.00 8.78  ? 34  THR A OG1 1 
ATOM   196   C  CG2 . THR A 1 34  ? -30.691 67.591  53.620  1.00 8.69  ? 34  THR A CG2 1 
ATOM   197   N  N   . ASP A 1 35  ? -34.680 64.906  53.907  1.00 7.47  ? 35  ASP A N   1 
ATOM   198   C  CA  . ASP A 1 35  ? -35.473 63.782  54.418  1.00 8.31  ? 35  ASP A CA  1 
ATOM   199   C  C   . ASP A 1 35  ? -35.713 62.711  53.356  1.00 8.24  ? 35  ASP A C   1 
ATOM   200   O  O   . ASP A 1 35  ? -35.809 63.014  52.169  1.00 9.71  ? 35  ASP A O   1 
ATOM   201   C  CB  . ASP A 1 35  ? -36.867 64.235  54.877  1.00 9.57  ? 35  ASP A CB  1 
ATOM   202   C  CG  . ASP A 1 35  ? -36.855 65.028  56.171  1.00 11.33 ? 35  ASP A CG  1 
ATOM   203   O  OD1 . ASP A 1 35  ? -35.878 64.938  56.944  1.00 11.99 ? 35  ASP A OD1 1 
ATOM   204   O  OD2 . ASP A 1 35  ? -37.860 65.733  56.419  1.00 10.78 ? 35  ASP A OD2 1 
ATOM   205   N  N   . ILE A 1 36  ? -35.809 61.459  53.791  1.00 8.56  ? 36  ILE A N   1 
ATOM   206   C  CA  . ILE A 1 36  ? -36.137 60.366  52.884  1.00 9.05  ? 36  ILE A CA  1 
ATOM   207   C  C   . ILE A 1 36  ? -37.650 60.250  53.087  1.00 8.47  ? 36  ILE A C   1 
ATOM   208   O  O   . ILE A 1 36  ? -38.117 60.091  54.218  1.00 8.70  ? 36  ILE A O   1 
ATOM   209   C  CB  . ILE A 1 36  ? -35.476 59.019  53.288  1.00 10.37 ? 36  ILE A CB  1 
ATOM   210   C  CG1 . ILE A 1 36  ? -34.016 58.968  52.823  1.00 11.70 ? 36  ILE A CG1 1 
ATOM   211   C  CG2 . ILE A 1 36  ? -36.234 57.865  52.654  1.00 8.34  ? 36  ILE A CG2 1 
ATOM   212   C  CD1 . ILE A 1 36  ? -33.089 59.928  53.540  1.00 16.06 ? 36  ILE A CD1 1 
ATOM   213   N  N   . LEU A 1 37  ? -38.420 60.365  52.012  1.00 8.51  ? 37  LEU A N   1 
ATOM   214   C  CA  . LEU A 1 37  ? -39.874 60.289  52.123  1.00 8.86  ? 37  LEU A CA  1 
ATOM   215   C  C   . LEU A 1 37  ? -40.369 58.954  51.597  1.00 9.55  ? 37  LEU A C   1 
ATOM   216   O  O   . LEU A 1 37  ? -39.835 58.423  50.616  1.00 10.56 ? 37  LEU A O   1 
ATOM   217   C  CB  . LEU A 1 37  ? -40.526 61.442  51.348  1.00 8.64  ? 37  LEU A CB  1 
ATOM   218   C  CG  . LEU A 1 37  ? -39.963 62.843  51.641  1.00 8.75  ? 37  LEU A CG  1 
ATOM   219   C  CD1 . LEU A 1 37  ? -40.688 63.878  50.784  1.00 8.97  ? 37  LEU A CD1 1 
ATOM   220   C  CD2 . LEU A 1 37  ? -40.118 63.176  53.123  1.00 7.71  ? 37  LEU A CD2 1 
ATOM   221   N  N   . ALA A 1 38  ? -41.387 58.410  52.256  1.00 9.22  ? 38  ALA A N   1 
ATOM   222   C  CA  . ALA A 1 38  ? -41.946 57.125  51.863  1.00 9.29  ? 38  ALA A CA  1 
ATOM   223   C  C   . ALA A 1 38  ? -43.468 57.181  51.775  1.00 9.22  ? 38  ALA A C   1 
ATOM   224   O  O   . ALA A 1 38  ? -44.121 57.826  52.594  1.00 9.62  ? 38  ALA A O   1 
ATOM   225   C  CB  . ALA A 1 38  ? -41.524 56.059  52.861  1.00 6.62  ? 38  ALA A CB  1 
ATOM   226   N  N   . ALA A 1 39  ? -44.023 56.506  50.771  1.00 9.07  ? 39  ALA A N   1 
ATOM   227   C  CA  . ALA A 1 39  ? -45.472 56.450  50.581  1.00 8.75  ? 39  ALA A CA  1 
ATOM   228   C  C   . ALA A 1 39  ? -45.906 55.004  50.780  1.00 8.87  ? 39  ALA A C   1 
ATOM   229   O  O   . ALA A 1 39  ? -45.610 54.138  49.957  1.00 9.31  ? 39  ALA A O   1 
ATOM   230   C  CB  . ALA A 1 39  ? -45.852 56.928  49.173  1.00 7.16  ? 39  ALA A CB  1 
ATOM   231   N  N   . PHE A 1 40  ? -46.605 54.754  51.880  1.00 8.77  ? 40  PHE A N   1 
ATOM   232   C  CA  . PHE A 1 40  ? -47.079 53.416  52.223  1.00 7.69  ? 40  PHE A CA  1 
ATOM   233   C  C   . PHE A 1 40  ? -48.574 53.265  51.944  1.00 8.94  ? 40  PHE A C   1 
ATOM   234   O  O   . PHE A 1 40  ? -49.350 54.177  52.224  1.00 8.98  ? 40  PHE A O   1 
ATOM   235   C  CB  . PHE A 1 40  ? -46.862 53.151  53.718  1.00 8.03  ? 40  PHE A CB  1 
ATOM   236   C  CG  . PHE A 1 40  ? -45.429 52.921  54.118  1.00 8.32  ? 40  PHE A CG  1 
ATOM   237   C  CD1 . PHE A 1 40  ? -44.836 51.673  53.943  1.00 7.94  ? 40  PHE A CD1 1 
ATOM   238   C  CD2 . PHE A 1 40  ? -44.696 53.930  54.743  1.00 6.85  ? 40  PHE A CD2 1 
ATOM   239   C  CE1 . PHE A 1 40  ? -43.538 51.430  54.393  1.00 5.95  ? 40  PHE A CE1 1 
ATOM   240   C  CE2 . PHE A 1 40  ? -43.400 53.695  55.196  1.00 6.09  ? 40  PHE A CE2 1 
ATOM   241   C  CZ  . PHE A 1 40  ? -42.821 52.441  55.020  1.00 5.73  ? 40  PHE A CZ  1 
ATOM   242   N  N   . ARG A 1 41  ? -48.968 52.116  51.400  1.00 8.78  ? 41  ARG A N   1 
ATOM   243   C  CA  . ARG A 1 41  ? -50.380 51.817  51.153  1.00 8.82  ? 41  ARG A CA  1 
ATOM   244   C  C   . ARG A 1 41  ? -50.726 50.979  52.382  1.00 9.86  ? 41  ARG A C   1 
ATOM   245   O  O   . ARG A 1 41  ? -50.330 49.814  52.483  1.00 7.94  ? 41  ARG A O   1 
ATOM   246   C  CB  . ARG A 1 41  ? -50.552 50.991  49.872  1.00 10.64 ? 41  ARG A CB  1 
ATOM   247   C  CG  . ARG A 1 41  ? -52.007 50.618  49.549  1.00 10.78 ? 41  ARG A CG  1 
ATOM   248   C  CD  . ARG A 1 41  ? -52.096 49.749  48.293  1.00 12.49 ? 41  ARG A CD  1 
ATOM   249   N  NE  . ARG A 1 41  ? -51.634 50.447  47.093  1.00 14.75 ? 41  ARG A NE  1 
ATOM   250   C  CZ  . ARG A 1 41  ? -52.396 51.229  46.331  1.00 16.86 ? 41  ARG A CZ  1 
ATOM   251   N  NH1 . ARG A 1 41  ? -53.675 51.418  46.633  1.00 17.73 ? 41  ARG A NH1 1 
ATOM   252   N  NH2 . ARG A 1 41  ? -51.876 51.834  45.270  1.00 16.26 ? 41  ARG A NH2 1 
ATOM   253   N  N   . VAL A 1 42  ? -51.448 51.585  53.320  1.00 9.16  ? 42  VAL A N   1 
ATOM   254   C  CA  . VAL A 1 42  ? -51.796 50.931  54.578  1.00 8.64  ? 42  VAL A CA  1 
ATOM   255   C  C   . VAL A 1 42  ? -53.226 50.408  54.703  1.00 10.02 ? 42  VAL A C   1 
ATOM   256   O  O   . VAL A 1 42  ? -54.194 51.135  54.459  1.00 9.67  ? 42  VAL A O   1 
ATOM   257   C  CB  . VAL A 1 42  ? -51.534 51.892  55.762  1.00 9.03  ? 42  VAL A CB  1 
ATOM   258   C  CG1 . VAL A 1 42  ? -51.770 51.175  57.084  1.00 10.68 ? 42  VAL A CG1 1 
ATOM   259   C  CG2 . VAL A 1 42  ? -50.110 52.439  55.687  1.00 10.12 ? 42  VAL A CG2 1 
ATOM   260   N  N   . SER A 1 43  ? -53.343 49.142  55.100  1.00 9.08  ? 43  SER A N   1 
ATOM   261   C  CA  . SER A 1 43  ? -54.635 48.487  55.301  1.00 9.35  ? 43  SER A CA  1 
ATOM   262   C  C   . SER A 1 43  ? -54.712 48.058  56.769  1.00 10.02 ? 43  SER A C   1 
ATOM   263   O  O   . SER A 1 43  ? -54.269 46.969  57.135  1.00 11.62 ? 43  SER A O   1 
ATOM   264   C  CB  . SER A 1 43  ? -54.764 47.255  54.398  1.00 7.80  ? 43  SER A CB  1 
ATOM   265   O  OG  . SER A 1 43  ? -54.694 47.604  53.025  1.00 9.07  ? 43  SER A OG  1 
ATOM   266   N  N   . PRO A 1 44  ? -55.278 48.914  57.630  1.00 10.08 ? 44  PRO A N   1 
ATOM   267   C  CA  . PRO A 1 44  ? -55.397 48.608  59.060  1.00 10.36 ? 44  PRO A CA  1 
ATOM   268   C  C   . PRO A 1 44  ? -56.409 47.514  59.377  1.00 11.56 ? 44  PRO A C   1 
ATOM   269   O  O   . PRO A 1 44  ? -57.306 47.227  58.583  1.00 10.60 ? 44  PRO A O   1 
ATOM   270   C  CB  . PRO A 1 44  ? -55.830 49.945  59.674  1.00 11.50 ? 44  PRO A CB  1 
ATOM   271   C  CG  . PRO A 1 44  ? -55.485 50.976  58.620  1.00 12.51 ? 44  PRO A CG  1 
ATOM   272   C  CD  . PRO A 1 44  ? -55.795 50.259  57.343  1.00 10.36 ? 44  PRO A CD  1 
ATOM   273   N  N   . GLN A 1 45  ? -56.253 46.904  60.544  1.00 11.05 ? 45  GLN A N   1 
ATOM   274   C  CA  . GLN A 1 45  ? -57.186 45.886  60.998  1.00 13.75 ? 45  GLN A CA  1 
ATOM   275   C  C   . GLN A 1 45  ? -58.428 46.675  61.402  1.00 15.20 ? 45  GLN A C   1 
ATOM   276   O  O   . GLN A 1 45  ? -58.349 47.880  61.661  1.00 14.72 ? 45  GLN A O   1 
ATOM   277   C  CB  . GLN A 1 45  ? -56.628 45.154  62.221  1.00 13.57 ? 45  GLN A CB  1 
ATOM   278   C  CG  . GLN A 1 45  ? -55.507 44.170  61.921  1.00 15.31 ? 45  GLN A CG  1 
ATOM   279   C  CD  . GLN A 1 45  ? -56.023 42.856  61.377  1.00 15.95 ? 45  GLN A CD  1 
ATOM   280   O  OE1 . GLN A 1 45  ? -57.228 42.671  61.210  1.00 17.07 ? 45  GLN A OE1 1 
ATOM   281   N  NE2 . GLN A 1 45  ? -55.111 41.929  61.103  1.00 17.44 ? 45  GLN A NE2 1 
ATOM   282   N  N   . PRO A 1 46  ? -59.594 46.019  61.447  1.00 16.45 ? 46  PRO A N   1 
ATOM   283   C  CA  . PRO A 1 46  ? -60.803 46.748  61.838  1.00 17.99 ? 46  PRO A CA  1 
ATOM   284   C  C   . PRO A 1 46  ? -60.626 47.327  63.240  1.00 18.80 ? 46  PRO A C   1 
ATOM   285   O  O   . PRO A 1 46  ? -60.138 46.638  64.140  1.00 20.33 ? 46  PRO A O   1 
ATOM   286   C  CB  . PRO A 1 46  ? -61.881 45.670  61.795  1.00 17.24 ? 46  PRO A CB  1 
ATOM   287   C  CG  . PRO A 1 46  ? -61.389 44.751  60.716  1.00 18.27 ? 46  PRO A CG  1 
ATOM   288   C  CD  . PRO A 1 46  ? -59.917 44.644  61.028  1.00 17.71 ? 46  PRO A CD  1 
ATOM   289   N  N   . GLY A 1 47  ? -60.997 48.591  63.424  1.00 19.27 ? 47  GLY A N   1 
ATOM   290   C  CA  . GLY A 1 47  ? -60.874 49.198  64.738  1.00 20.17 ? 47  GLY A CA  1 
ATOM   291   C  C   . GLY A 1 47  ? -59.609 49.998  64.994  1.00 21.15 ? 47  GLY A C   1 
ATOM   292   O  O   . GLY A 1 47  ? -59.502 50.663  66.024  1.00 23.12 ? 47  GLY A O   1 
ATOM   293   N  N   . VAL A 1 48  ? -58.646 49.927  64.080  1.00 18.81 ? 48  VAL A N   1 
ATOM   294   C  CA  . VAL A 1 48  ? -57.401 50.677  64.226  1.00 16.63 ? 48  VAL A CA  1 
ATOM   295   C  C   . VAL A 1 48  ? -57.494 51.936  63.358  1.00 16.62 ? 48  VAL A C   1 
ATOM   296   O  O   . VAL A 1 48  ? -57.602 51.851  62.133  1.00 15.82 ? 48  VAL A O   1 
ATOM   297   C  CB  . VAL A 1 48  ? -56.171 49.836  63.776  1.00 15.61 ? 48  VAL A CB  1 
ATOM   298   C  CG1 . VAL A 1 48  ? -54.893 50.646  63.943  1.00 13.48 ? 48  VAL A CG1 1 
ATOM   299   C  CG2 . VAL A 1 48  ? -56.091 48.550  64.588  1.00 13.35 ? 48  VAL A CG2 1 
ATOM   300   N  N   . PRO A 1 49  ? -57.470 53.123  63.987  1.00 15.59 ? 49  PRO A N   1 
ATOM   301   C  CA  . PRO A 1 49  ? -57.554 54.387  63.249  1.00 14.59 ? 49  PRO A CA  1 
ATOM   302   C  C   . PRO A 1 49  ? -56.378 54.534  62.287  1.00 15.28 ? 49  PRO A C   1 
ATOM   303   O  O   . PRO A 1 49  ? -55.267 54.094  62.584  1.00 13.87 ? 49  PRO A O   1 
ATOM   304   C  CB  . PRO A 1 49  ? -57.507 55.441  64.354  1.00 15.17 ? 49  PRO A CB  1 
ATOM   305   C  CG  . PRO A 1 49  ? -58.037 54.724  65.552  1.00 16.15 ? 49  PRO A CG  1 
ATOM   306   C  CD  . PRO A 1 49  ? -57.390 53.372  65.436  1.00 15.58 ? 49  PRO A CD  1 
ATOM   307   N  N   . PRO A 1 50  ? -56.606 55.156  61.122  1.00 15.19 ? 50  PRO A N   1 
ATOM   308   C  CA  . PRO A 1 50  ? -55.491 55.311  60.186  1.00 15.00 ? 50  PRO A CA  1 
ATOM   309   C  C   . PRO A 1 50  ? -54.330 56.106  60.783  1.00 15.14 ? 50  PRO A C   1 
ATOM   310   O  O   . PRO A 1 50  ? -53.167 55.849  60.464  1.00 15.09 ? 50  PRO A O   1 
ATOM   311   C  CB  . PRO A 1 50  ? -56.138 55.993  58.974  1.00 15.50 ? 50  PRO A CB  1 
ATOM   312   C  CG  . PRO A 1 50  ? -57.332 56.709  59.561  1.00 15.92 ? 50  PRO A CG  1 
ATOM   313   C  CD  . PRO A 1 50  ? -57.853 55.713  60.569  1.00 15.44 ? 50  PRO A CD  1 
ATOM   314   N  N   . GLU A 1 51  ? -54.641 57.058  61.660  1.00 15.30 ? 51  GLU A N   1 
ATOM   315   C  CA  . GLU A 1 51  ? -53.597 57.866  62.293  1.00 15.25 ? 51  GLU A CA  1 
ATOM   316   C  C   . GLU A 1 51  ? -52.680 56.986  63.138  1.00 15.43 ? 51  GLU A C   1 
ATOM   317   O  O   . GLU A 1 51  ? -51.462 57.174  63.150  1.00 15.22 ? 51  GLU A O   1 
ATOM   318   C  CB  . GLU A 1 51  ? -54.199 58.950  63.196  1.00 16.95 ? 51  GLU A CB  1 
ATOM   319   C  CG  . GLU A 1 51  ? -55.032 60.021  62.494  1.00 18.64 ? 51  GLU A CG  1 
ATOM   320   C  CD  . GLU A 1 51  ? -56.410 59.532  62.079  1.00 21.16 ? 51  GLU A CD  1 
ATOM   321   O  OE1 . GLU A 1 51  ? -56.876 58.510  62.627  1.00 18.04 ? 51  GLU A OE1 1 
ATOM   322   O  OE2 . GLU A 1 51  ? -57.035 60.183  61.211  1.00 24.61 ? 51  GLU A OE2 1 
ATOM   323   N  N   . GLU A 1 52  ? -53.267 56.030  63.854  1.00 13.45 ? 52  GLU A N   1 
ATOM   324   C  CA  . GLU A 1 52  ? -52.487 55.135  64.703  1.00 12.62 ? 52  GLU A CA  1 
ATOM   325   C  C   . GLU A 1 52  ? -51.685 54.155  63.848  1.00 12.22 ? 52  GLU A C   1 
ATOM   326   O  O   . GLU A 1 52  ? -50.519 53.881  64.133  1.00 12.10 ? 52  GLU A O   1 
ATOM   327   C  CB  . GLU A 1 52  ? -53.416 54.374  65.657  1.00 13.56 ? 52  GLU A CB  1 
ATOM   328   C  CG  . GLU A 1 52  ? -52.709 53.474  66.673  1.00 13.04 ? 52  GLU A CG  1 
ATOM   329   C  CD  . GLU A 1 52  ? -51.729 54.228  67.567  1.00 14.37 ? 52  GLU A CD  1 
ATOM   330   O  OE1 . GLU A 1 52  ? -51.735 55.477  67.557  1.00 14.37 ? 52  GLU A OE1 1 
ATOM   331   O  OE2 . GLU A 1 52  ? -50.954 53.566  68.290  1.00 14.47 ? 52  GLU A OE2 1 
ATOM   332   N  N   . ALA A 1 53  ? -52.306 53.637  62.792  1.00 10.71 ? 53  ALA A N   1 
ATOM   333   C  CA  . ALA A 1 53  ? -51.621 52.699  61.910  1.00 9.37  ? 53  ALA A CA  1 
ATOM   334   C  C   . ALA A 1 53  ? -50.434 53.386  61.240  1.00 11.14 ? 53  ALA A C   1 
ATOM   335   O  O   . ALA A 1 53  ? -49.340 52.821  61.163  1.00 9.75  ? 53  ALA A O   1 
ATOM   336   C  CB  . ALA A 1 53  ? -52.581 52.168  60.857  1.00 10.43 ? 53  ALA A CB  1 
ATOM   337   N  N   . GLY A 1 54  ? -50.654 54.607  60.762  1.00 9.53  ? 54  GLY A N   1 
ATOM   338   C  CA  . GLY A 1 54  ? -49.585 55.342  60.109  1.00 10.49 ? 54  GLY A CA  1 
ATOM   339   C  C   . GLY A 1 54  ? -48.461 55.638  61.080  1.00 11.89 ? 54  GLY A C   1 
ATOM   340   O  O   . GLY A 1 54  ? -47.282 55.508  60.746  1.00 12.21 ? 54  GLY A O   1 
ATOM   341   N  N   . ALA A 1 55  ? -48.835 56.029  62.294  1.00 10.67 ? 55  ALA A N   1 
ATOM   342   C  CA  . ALA A 1 55  ? -47.871 56.343  63.337  1.00 9.80  ? 55  ALA A CA  1 
ATOM   343   C  C   . ALA A 1 55  ? -47.053 55.116  63.743  1.00 10.28 ? 55  ALA A C   1 
ATOM   344   O  O   . ALA A 1 55  ? -45.864 55.231  64.030  1.00 9.95  ? 55  ALA A O   1 
ATOM   345   C  CB  . ALA A 1 55  ? -48.593 56.911  64.552  1.00 9.60  ? 55  ALA A CB  1 
ATOM   346   N  N   . ALA A 1 56  ? -47.686 53.945  63.778  1.00 9.59  ? 56  ALA A N   1 
ATOM   347   C  CA  . ALA A 1 56  ? -46.972 52.724  64.152  1.00 10.78 ? 56  ALA A CA  1 
ATOM   348   C  C   . ALA A 1 56  ? -45.907 52.392  63.106  1.00 10.55 ? 56  ALA A C   1 
ATOM   349   O  O   . ALA A 1 56  ? -44.788 51.998  63.443  1.00 11.68 ? 56  ALA A O   1 
ATOM   350   C  CB  . ALA A 1 56  ? -47.952 51.558  64.301  1.00 8.97  ? 56  ALA A CB  1 
ATOM   351   N  N   . VAL A 1 57  ? -46.252 52.549  61.833  1.00 8.39  ? 57  VAL A N   1 
ATOM   352   C  CA  . VAL A 1 57  ? -45.295 52.274  60.770  1.00 7.48  ? 57  VAL A CA  1 
ATOM   353   C  C   . VAL A 1 57  ? -44.096 53.217  60.898  1.00 8.66  ? 57  VAL A C   1 
ATOM   354   O  O   . VAL A 1 57  ? -42.950 52.782  60.837  1.00 8.21  ? 57  VAL A O   1 
ATOM   355   C  CB  . VAL A 1 57  ? -45.934 52.448  59.377  1.00 9.20  ? 57  VAL A CB  1 
ATOM   356   C  CG1 . VAL A 1 57  ? -44.867 52.312  58.297  1.00 10.31 ? 57  VAL A CG1 1 
ATOM   357   C  CG2 . VAL A 1 57  ? -47.024 51.403  59.172  1.00 10.03 ? 57  VAL A CG2 1 
ATOM   358   N  N   . ALA A 1 58  ? -44.362 54.506  61.091  1.00 7.02  ? 58  ALA A N   1 
ATOM   359   C  CA  . ALA A 1 58  ? -43.288 55.487  61.228  1.00 8.26  ? 58  ALA A CA  1 
ATOM   360   C  C   . ALA A 1 58  ? -42.400 55.190  62.433  1.00 8.55  ? 58  ALA A C   1 
ATOM   361   O  O   . ALA A 1 58  ? -41.170 55.234  62.340  1.00 10.32 ? 58  ALA A O   1 
ATOM   362   C  CB  . ALA A 1 58  ? -43.875 56.893  61.352  1.00 8.29  ? 58  ALA A CB  1 
ATOM   363   N  N   . ALA A 1 59  ? -43.034 54.874  63.557  1.00 7.17  ? 59  ALA A N   1 
ATOM   364   C  CA  . ALA A 1 59  ? -42.323 54.591  64.798  1.00 7.27  ? 59  ALA A CA  1 
ATOM   365   C  C   . ALA A 1 59  ? -41.399 53.385  64.745  1.00 7.09  ? 59  ALA A C   1 
ATOM   366   O  O   . ALA A 1 59  ? -40.204 53.505  65.008  1.00 7.65  ? 59  ALA A O   1 
ATOM   367   C  CB  . ALA A 1 59  ? -43.319 54.411  65.928  1.00 9.29  ? 59  ALA A CB  1 
ATOM   368   N  N   . GLU A 1 60  ? -41.955 52.228  64.400  1.00 6.25  ? 60  GLU A N   1 
ATOM   369   C  CA  . GLU A 1 60  ? -41.188 50.989  64.363  1.00 7.70  ? 60  GLU A CA  1 
ATOM   370   C  C   . GLU A 1 60  ? -40.241 50.820  63.174  1.00 8.66  ? 60  GLU A C   1 
ATOM   371   O  O   . GLU A 1 60  ? -39.612 49.772  63.020  1.00 8.69  ? 60  GLU A O   1 
ATOM   372   C  CB  . GLU A 1 60  ? -42.145 49.800  64.463  1.00 7.63  ? 60  GLU A CB  1 
ATOM   373   C  CG  . GLU A 1 60  ? -42.949 49.770  65.766  1.00 8.89  ? 60  GLU A CG  1 
ATOM   374   C  CD  . GLU A 1 60  ? -42.321 48.890  66.844  1.00 11.28 ? 60  GLU A CD  1 
ATOM   375   O  OE1 . GLU A 1 60  ? -41.268 48.277  66.578  1.00 10.32 ? 60  GLU A OE1 1 
ATOM   376   O  OE2 . GLU A 1 60  ? -42.884 48.806  67.958  1.00 10.12 ? 60  GLU A OE2 1 
ATOM   377   N  N   . SER A 1 61  ? -40.141 51.846  62.335  1.00 7.84  ? 61  SER A N   1 
ATOM   378   C  CA  . SER A 1 61  ? -39.227 51.805  61.203  1.00 8.75  ? 61  SER A CA  1 
ATOM   379   C  C   . SER A 1 61  ? -38.195 52.912  61.400  1.00 10.11 ? 61  SER A C   1 
ATOM   380   O  O   . SER A 1 61  ? -37.418 53.229  60.494  1.00 11.43 ? 61  SER A O   1 
ATOM   381   C  CB  . SER A 1 61  ? -39.974 52.001  59.876  1.00 7.41  ? 61  SER A CB  1 
ATOM   382   O  OG  . SER A 1 61  ? -40.619 53.259  59.811  1.00 6.96  ? 61  SER A OG  1 
ATOM   383   N  N   . SER A 1 62  ? -38.187 53.497  62.596  1.00 9.89  ? 62  SER A N   1 
ATOM   384   C  CA  . SER A 1 62  ? -37.239 54.566  62.887  1.00 10.39 ? 62  SER A CA  1 
ATOM   385   C  C   . SER A 1 62  ? -36.630 54.555  64.288  1.00 10.48 ? 62  SER A C   1 
ATOM   386   O  O   . SER A 1 62  ? -35.481 54.144  64.463  1.00 9.19  ? 62  SER A O   1 
ATOM   387   C  CB  . SER A 1 62  ? -37.881 55.940  62.612  1.00 11.52 ? 62  SER A CB  1 
ATOM   388   O  OG  . SER A 1 62  ? -38.993 56.204  63.455  1.00 10.68 ? 62  SER A OG  1 
ATOM   389   N  N   . THR A 1 63  ? -37.394 54.985  65.287  1.00 10.33 ? 63  THR A N   1 
ATOM   390   C  CA  . THR A 1 63  ? -36.861 55.063  66.646  1.00 10.29 ? 63  THR A CA  1 
ATOM   391   C  C   . THR A 1 63  ? -37.642 54.409  67.782  1.00 10.64 ? 63  THR A C   1 
ATOM   392   O  O   . THR A 1 63  ? -37.073 54.131  68.836  1.00 10.02 ? 63  THR A O   1 
ATOM   393   C  CB  . THR A 1 63  ? -36.667 56.533  67.055  1.00 11.41 ? 63  THR A CB  1 
ATOM   394   O  OG1 . THR A 1 63  ? -37.919 57.227  66.932  1.00 10.30 ? 63  THR A OG1 1 
ATOM   395   C  CG2 . THR A 1 63  ? -35.628 57.207  66.177  1.00 10.77 ? 63  THR A CG2 1 
ATOM   396   N  N   . GLY A 1 64  ? -38.931 54.160  67.588  1.00 11.03 ? 64  GLY A N   1 
ATOM   397   C  CA  . GLY A 1 64  ? -39.712 53.613  68.684  1.00 10.98 ? 64  GLY A CA  1 
ATOM   398   C  C   . GLY A 1 64  ? -39.990 52.133  68.789  1.00 10.49 ? 64  GLY A C   1 
ATOM   399   O  O   . GLY A 1 64  ? -39.709 51.353  67.881  1.00 11.67 ? 64  GLY A O   1 
ATOM   400   N  N   . THR A 1 65  ? -40.533 51.754  69.941  1.00 11.02 ? 65  THR A N   1 
ATOM   401   C  CA  . THR A 1 65  ? -40.927 50.379  70.198  1.00 10.33 ? 65  THR A CA  1 
ATOM   402   C  C   . THR A 1 65  ? -42.313 50.400  70.849  1.00 10.42 ? 65  THR A C   1 
ATOM   403   O  O   . THR A 1 65  ? -42.927 51.463  70.950  1.00 11.27 ? 65  THR A O   1 
ATOM   404   C  CB  . THR A 1 65  ? -39.901 49.617  71.080  1.00 11.07 ? 65  THR A CB  1 
ATOM   405   O  OG1 . THR A 1 65  ? -40.286 48.238  71.145  1.00 10.23 ? 65  THR A OG1 1 
ATOM   406   C  CG2 . THR A 1 65  ? -39.827 50.197  72.488  1.00 9.34  ? 65  THR A CG2 1 
ATOM   407   N  N   . TRP A 1 66  ? -42.791 49.244  71.298  1.00 11.15 ? 66  TRP A N   1 
ATOM   408   C  CA  . TRP A 1 66  ? -44.142 49.115  71.862  1.00 10.70 ? 66  TRP A CA  1 
ATOM   409   C  C   . TRP A 1 66  ? -44.485 49.736  73.216  1.00 10.40 ? 66  TRP A C   1 
ATOM   410   O  O   . TRP A 1 66  ? -45.662 49.859  73.547  1.00 9.63  ? 66  TRP A O   1 
ATOM   411   C  CB  . TRP A 1 66  ? -44.536 47.635  71.908  1.00 9.20  ? 66  TRP A CB  1 
ATOM   412   C  CG  . TRP A 1 66  ? -43.756 46.853  72.921  1.00 8.41  ? 66  TRP A CG  1 
ATOM   413   C  CD1 . TRP A 1 66  ? -42.482 46.384  72.791  1.00 7.45  ? 66  TRP A CD1 1 
ATOM   414   C  CD2 . TRP A 1 66  ? -44.181 46.504  74.246  1.00 9.63  ? 66  TRP A CD2 1 
ATOM   415   N  NE1 . TRP A 1 66  ? -42.081 45.768  73.953  1.00 7.76  ? 66  TRP A NE1 1 
ATOM   416   C  CE2 . TRP A 1 66  ? -43.103 45.827  74.864  1.00 8.78  ? 66  TRP A CE2 1 
ATOM   417   C  CE3 . TRP A 1 66  ? -45.363 46.700  74.974  1.00 10.34 ? 66  TRP A CE3 1 
ATOM   418   C  CZ2 . TRP A 1 66  ? -43.173 45.342  76.177  1.00 9.25  ? 66  TRP A CZ2 1 
ATOM   419   C  CZ3 . TRP A 1 66  ? -45.434 46.217  76.286  1.00 9.84  ? 66  TRP A CZ3 1 
ATOM   420   C  CH2 . TRP A 1 66  ? -44.344 45.547  76.870  1.00 10.27 ? 66  TRP A CH2 1 
ATOM   421   N  N   . THR A 1 67  ? -43.481 50.098  74.008  1.00 11.59 ? 67  THR A N   1 
ATOM   422   C  CA  . THR A 1 67  ? -43.729 50.703  75.315  1.00 9.63  ? 67  THR A CA  1 
ATOM   423   C  C   . THR A 1 67  ? -42.716 51.826  75.501  1.00 11.61 ? 67  THR A C   1 
ATOM   424   O  O   . THR A 1 67  ? -41.736 51.900  74.762  1.00 12.56 ? 67  THR A O   1 
ATOM   425   C  CB  . THR A 1 67  ? -43.592 49.649  76.454  1.00 11.21 ? 67  THR A CB  1 
ATOM   426   O  OG1 . THR A 1 67  ? -44.017 50.217  77.705  1.00 8.79  ? 67  THR A OG1 1 
ATOM   427   C  CG2 . THR A 1 67  ? -42.145 49.170  76.571  1.00 9.95  ? 67  THR A CG2 1 
ATOM   428   N  N   . THR A 1 68  ? -42.951 52.708  76.468  1.00 10.65 ? 68  THR A N   1 
ATOM   429   C  CA  . THR A 1 68  ? -42.039 53.825  76.706  1.00 11.26 ? 68  THR A CA  1 
ATOM   430   C  C   . THR A 1 68  ? -40.726 53.387  77.360  1.00 10.04 ? 68  THR A C   1 
ATOM   431   O  O   . THR A 1 68  ? -40.719 52.584  78.288  1.00 10.55 ? 68  THR A O   1 
ATOM   432   C  CB  . THR A 1 68  ? -42.703 54.903  77.590  1.00 11.84 ? 68  THR A CB  1 
ATOM   433   O  OG1 . THR A 1 68  ? -43.930 55.325  76.980  1.00 12.91 ? 68  THR A OG1 1 
ATOM   434   C  CG2 . THR A 1 68  ? -41.786 56.112  77.742  1.00 12.01 ? 68  THR A CG2 1 
ATOM   435   N  N   . VAL A 1 69  ? -39.616 53.919  76.859  1.00 10.27 ? 69  VAL A N   1 
ATOM   436   C  CA  . VAL A 1 69  ? -38.292 53.599  77.390  1.00 9.80  ? 69  VAL A CA  1 
ATOM   437   C  C   . VAL A 1 69  ? -37.620 54.892  77.871  1.00 10.22 ? 69  VAL A C   1 
ATOM   438   O  O   . VAL A 1 69  ? -37.723 55.937  77.223  1.00 9.08  ? 69  VAL A O   1 
ATOM   439   C  CB  . VAL A 1 69  ? -37.419 52.909  76.309  1.00 10.94 ? 69  VAL A CB  1 
ATOM   440   C  CG1 . VAL A 1 69  ? -38.060 51.582  75.900  1.00 7.18  ? 69  VAL A CG1 1 
ATOM   441   C  CG2 . VAL A 1 69  ? -37.275 53.812  75.092  1.00 9.69  ? 69  VAL A CG2 1 
ATOM   442   N  N   . TRP A 1 70  ? -36.945 54.824  79.013  1.00 10.97 ? 70  TRP A N   1 
ATOM   443   C  CA  . TRP A 1 70  ? -36.291 56.005  79.577  1.00 11.19 ? 70  TRP A CA  1 
ATOM   444   C  C   . TRP A 1 70  ? -35.137 56.557  78.744  1.00 11.27 ? 70  TRP A C   1 
ATOM   445   O  O   . TRP A 1 70  ? -34.831 57.747  78.816  1.00 12.30 ? 70  TRP A O   1 
ATOM   446   C  CB  . TRP A 1 70  ? -35.777 55.708  80.989  1.00 9.48  ? 70  TRP A CB  1 
ATOM   447   C  CG  . TRP A 1 70  ? -34.673 54.693  81.034  1.00 8.88  ? 70  TRP A CG  1 
ATOM   448   C  CD1 . TRP A 1 70  ? -34.808 53.337  81.118  1.00 9.53  ? 70  TRP A CD1 1 
ATOM   449   C  CD2 . TRP A 1 70  ? -33.263 54.952  80.992  1.00 8.21  ? 70  TRP A CD2 1 
ATOM   450   N  NE1 . TRP A 1 70  ? -33.572 52.735  81.133  1.00 8.94  ? 70  TRP A NE1 1 
ATOM   451   C  CE2 . TRP A 1 70  ? -32.607 53.704  81.056  1.00 8.59  ? 70  TRP A CE2 1 
ATOM   452   C  CE3 . TRP A 1 70  ? -32.495 56.123  80.903  1.00 9.15  ? 70  TRP A CE3 1 
ATOM   453   C  CZ2 . TRP A 1 70  ? -31.212 53.590  81.038  1.00 9.12  ? 70  TRP A CZ2 1 
ATOM   454   C  CZ3 . TRP A 1 70  ? -31.102 56.007  80.882  1.00 9.87  ? 70  TRP A CZ3 1 
ATOM   455   C  CH2 . TRP A 1 70  ? -30.479 54.747  80.950  1.00 8.56  ? 70  TRP A CH2 1 
ATOM   456   N  N   . THR A 1 71  ? -34.497 55.694  77.962  1.00 10.87 ? 71  THR A N   1 
ATOM   457   C  CA  . THR A 1 71  ? -33.362 56.094  77.136  1.00 11.63 ? 71  THR A CA  1 
ATOM   458   C  C   . THR A 1 71  ? -33.657 57.175  76.100  1.00 12.69 ? 71  THR A C   1 
ATOM   459   O  O   . THR A 1 71  ? -32.733 57.799  75.577  1.00 11.64 ? 71  THR A O   1 
ATOM   460   C  CB  . THR A 1 71  ? -32.749 54.873  76.425  1.00 11.95 ? 71  THR A CB  1 
ATOM   461   O  OG1 . THR A 1 71  ? -33.799 54.039  75.917  1.00 14.61 ? 71  THR A OG1 1 
ATOM   462   C  CG2 . THR A 1 71  ? -31.882 54.075  77.393  1.00 10.48 ? 71  THR A CG2 1 
ATOM   463   N  N   . ASP A 1 72  ? -34.935 57.399  75.799  1.00 12.53 ? 72  ASP A N   1 
ATOM   464   C  CA  . ASP A 1 72  ? -35.305 58.431  74.831  1.00 12.68 ? 72  ASP A CA  1 
ATOM   465   C  C   . ASP A 1 72  ? -34.800 59.789  75.314  1.00 12.40 ? 72  ASP A C   1 
ATOM   466   O  O   . ASP A 1 72  ? -34.405 60.639  74.514  1.00 12.08 ? 72  ASP A O   1 
ATOM   467   C  CB  . ASP A 1 72  ? -36.828 58.507  74.665  1.00 13.19 ? 72  ASP A CB  1 
ATOM   468   C  CG  . ASP A 1 72  ? -37.385 57.426  73.755  1.00 16.10 ? 72  ASP A CG  1 
ATOM   469   O  OD1 . ASP A 1 72  ? -36.608 56.593  73.239  1.00 16.27 ? 72  ASP A OD1 1 
ATOM   470   O  OD2 . ASP A 1 72  ? -38.619 57.413  73.555  1.00 19.52 ? 72  ASP A OD2 1 
ATOM   471   N  N   . GLY A 1 73  ? -34.823 59.981  76.630  1.00 12.25 ? 73  GLY A N   1 
ATOM   472   C  CA  . GLY A 1 73  ? -34.392 61.238  77.212  1.00 10.83 ? 73  GLY A CA  1 
ATOM   473   C  C   . GLY A 1 73  ? -32.906 61.531  77.137  1.00 12.71 ? 73  GLY A C   1 
ATOM   474   O  O   . GLY A 1 73  ? -32.481 62.634  77.488  1.00 11.63 ? 73  GLY A O   1 
ATOM   475   N  N   . LEU A 1 74  ? -32.116 60.556  76.693  1.00 10.85 ? 74  LEU A N   1 
ATOM   476   C  CA  . LEU A 1 74  ? -30.673 60.745  76.578  1.00 12.35 ? 74  LEU A CA  1 
ATOM   477   C  C   . LEU A 1 74  ? -30.316 61.417  75.261  1.00 13.14 ? 74  LEU A C   1 
ATOM   478   O  O   . LEU A 1 74  ? -29.219 61.944  75.105  1.00 14.25 ? 74  LEU A O   1 
ATOM   479   C  CB  . LEU A 1 74  ? -29.935 59.405  76.663  1.00 13.02 ? 74  LEU A CB  1 
ATOM   480   C  CG  . LEU A 1 74  ? -29.877 58.669  78.001  1.00 16.04 ? 74  LEU A CG  1 
ATOM   481   C  CD1 . LEU A 1 74  ? -28.999 57.432  77.853  1.00 15.66 ? 74  LEU A CD1 1 
ATOM   482   C  CD2 . LEU A 1 74  ? -29.318 59.591  79.072  1.00 16.07 ? 74  LEU A CD2 1 
ATOM   483   N  N   . THR A 1 75  ? -31.246 61.388  74.312  1.00 13.00 ? 75  THR A N   1 
ATOM   484   C  CA  . THR A 1 75  ? -31.017 61.989  73.006  1.00 13.68 ? 75  THR A CA  1 
ATOM   485   C  C   . THR A 1 75  ? -32.181 62.920  72.667  1.00 14.71 ? 75  THR A C   1 
ATOM   486   O  O   . THR A 1 75  ? -33.075 63.131  73.492  1.00 13.95 ? 75  THR A O   1 
ATOM   487   C  CB  . THR A 1 75  ? -30.857 60.875  71.922  1.00 13.62 ? 75  THR A CB  1 
ATOM   488   O  OG1 . THR A 1 75  ? -30.570 61.462  70.645  1.00 13.57 ? 75  THR A OG1 1 
ATOM   489   C  CG2 . THR A 1 75  ? -32.119 60.036  71.826  1.00 12.43 ? 75  THR A CG2 1 
ATOM   490   N  N   . ASN A 1 76  ? -32.157 63.494  71.468  1.00 14.50 ? 76  ASN A N   1 
ATOM   491   C  CA  . ASN A 1 76  ? -33.216 64.398  71.028  1.00 15.11 ? 76  ASN A CA  1 
ATOM   492   C  C   . ASN A 1 76  ? -34.064 63.653  70.005  1.00 15.04 ? 76  ASN A C   1 
ATOM   493   O  O   . ASN A 1 76  ? -33.776 63.673  68.809  1.00 14.01 ? 76  ASN A O   1 
ATOM   494   C  CB  . ASN A 1 76  ? -32.608 65.650  70.395  1.00 16.66 ? 76  ASN A CB  1 
ATOM   495   C  CG  . ASN A 1 76  ? -33.652 66.676  69.998  1.00 18.95 ? 76  ASN A CG  1 
ATOM   496   O  OD1 . ASN A 1 76  ? -34.856 66.448  70.130  1.00 21.32 ? 76  ASN A OD1 1 
ATOM   497   N  ND2 . ASN A 1 76  ? -33.191 67.819  69.501  1.00 21.53 ? 76  ASN A ND2 1 
ATOM   498   N  N   . LEU A 1 77  ? -35.114 62.997  70.480  1.00 15.07 ? 77  LEU A N   1 
ATOM   499   C  CA  . LEU A 1 77  ? -35.977 62.219  69.604  1.00 17.59 ? 77  LEU A CA  1 
ATOM   500   C  C   . LEU A 1 77  ? -36.638 63.028  68.491  1.00 18.58 ? 77  LEU A C   1 
ATOM   501   O  O   . LEU A 1 77  ? -36.976 62.481  67.444  1.00 18.25 ? 77  LEU A O   1 
ATOM   502   C  CB  . LEU A 1 77  ? -37.047 61.503  70.429  1.00 18.93 ? 77  LEU A CB  1 
ATOM   503   C  CG  . LEU A 1 77  ? -37.405 60.102  69.933  1.00 21.86 ? 77  LEU A CG  1 
ATOM   504   C  CD1 . LEU A 1 77  ? -36.162 59.230  69.949  1.00 21.73 ? 77  LEU A CD1 1 
ATOM   505   C  CD2 . LEU A 1 77  ? -38.485 59.504  70.815  1.00 23.64 ? 77  LEU A CD2 1 
ATOM   506   N  N   . ASP A 1 78  ? -36.820 64.327  68.706  1.00 20.24 ? 78  ASP A N   1 
ATOM   507   C  CA  . ASP A 1 78  ? -37.444 65.158  67.684  1.00 22.89 ? 78  ASP A CA  1 
ATOM   508   C  C   . ASP A 1 78  ? -36.632 65.249  66.397  1.00 22.44 ? 78  ASP A C   1 
ATOM   509   O  O   . ASP A 1 78  ? -37.202 65.379  65.316  1.00 22.57 ? 78  ASP A O   1 
ATOM   510   C  CB  . ASP A 1 78  ? -37.710 66.569  68.213  1.00 25.38 ? 78  ASP A CB  1 
ATOM   511   C  CG  . ASP A 1 78  ? -38.975 66.651  69.042  1.00 29.20 ? 78  ASP A CG  1 
ATOM   512   O  OD1 . ASP A 1 78  ? -40.022 66.164  68.567  1.00 31.95 ? 78  ASP A OD1 1 
ATOM   513   O  OD2 . ASP A 1 78  ? -38.929 67.205  70.160  1.00 32.53 ? 78  ASP A OD2 1 
ATOM   514   N  N   . ARG A 1 79  ? -35.308 65.178  66.502  1.00 21.68 ? 79  ARG A N   1 
ATOM   515   C  CA  . ARG A 1 79  ? -34.474 65.270  65.308  1.00 21.98 ? 79  ARG A CA  1 
ATOM   516   C  C   . ARG A 1 79  ? -34.200 63.921  64.657  1.00 19.39 ? 79  ARG A C   1 
ATOM   517   O  O   . ARG A 1 79  ? -33.693 63.864  63.539  1.00 19.20 ? 79  ARG A O   1 
ATOM   518   C  CB  . ARG A 1 79  ? -33.143 65.964  65.631  1.00 23.58 ? 79  ARG A CB  1 
ATOM   519   C  CG  . ARG A 1 79  ? -32.299 65.243  66.653  1.00 30.13 ? 79  ARG A CG  1 
ATOM   520   C  CD  . ARG A 1 79  ? -31.009 65.995  66.982  1.00 34.75 ? 79  ARG A CD  1 
ATOM   521   N  NE  . ARG A 1 79  ? -30.039 66.009  65.887  1.00 37.81 ? 79  ARG A NE  1 
ATOM   522   C  CZ  . ARG A 1 79  ? -28.719 65.994  66.065  1.00 40.90 ? 79  ARG A CZ  1 
ATOM   523   N  NH1 . ARG A 1 79  ? -28.213 65.961  67.292  1.00 41.66 ? 79  ARG A NH1 1 
ATOM   524   N  NH2 . ARG A 1 79  ? -27.901 66.013  65.019  1.00 42.03 ? 79  ARG A NH2 1 
ATOM   525   N  N   . TYR A 1 80  ? -34.554 62.837  65.344  1.00 15.85 ? 80  TYR A N   1 
ATOM   526   C  CA  . TYR A 1 80  ? -34.314 61.495  64.816  1.00 13.70 ? 80  TYR A CA  1 
ATOM   527   C  C   . TYR A 1 80  ? -35.552 60.690  64.423  1.00 11.50 ? 80  TYR A C   1 
ATOM   528   O  O   . TYR A 1 80  ? -35.487 59.842  63.533  1.00 9.43  ? 80  TYR A O   1 
ATOM   529   C  CB  . TYR A 1 80  ? -33.500 60.676  65.828  1.00 12.73 ? 80  TYR A CB  1 
ATOM   530   C  CG  . TYR A 1 80  ? -32.090 61.179  66.044  1.00 13.10 ? 80  TYR A CG  1 
ATOM   531   C  CD1 . TYR A 1 80  ? -31.174 61.211  64.993  1.00 12.73 ? 80  TYR A CD1 1 
ATOM   532   C  CD2 . TYR A 1 80  ? -31.671 61.622  67.300  1.00 11.36 ? 80  TYR A CD2 1 
ATOM   533   C  CE1 . TYR A 1 80  ? -29.870 61.670  65.184  1.00 13.64 ? 80  TYR A CE1 1 
ATOM   534   C  CE2 . TYR A 1 80  ? -30.368 62.085  67.504  1.00 13.33 ? 80  TYR A CE2 1 
ATOM   535   C  CZ  . TYR A 1 80  ? -29.475 62.108  66.439  1.00 12.42 ? 80  TYR A CZ  1 
ATOM   536   O  OH  . TYR A 1 80  ? -28.195 62.581  66.623  1.00 12.93 ? 80  TYR A OH  1 
ATOM   537   N  N   . LYS A 1 81  ? -36.680 60.953  65.071  1.00 10.36 ? 81  LYS A N   1 
ATOM   538   C  CA  . LYS A 1 81  ? -37.892 60.187  64.786  1.00 10.63 ? 81  LYS A CA  1 
ATOM   539   C  C   . LYS A 1 81  ? -38.443 60.276  63.365  1.00 10.38 ? 81  LYS A C   1 
ATOM   540   O  O   . LYS A 1 81  ? -38.373 61.315  62.704  1.00 10.46 ? 81  LYS A O   1 
ATOM   541   C  CB  . LYS A 1 81  ? -39.004 60.565  65.772  1.00 11.69 ? 81  LYS A CB  1 
ATOM   542   C  CG  . LYS A 1 81  ? -39.615 61.945  65.546  1.00 10.92 ? 81  LYS A CG  1 
ATOM   543   C  CD  . LYS A 1 81  ? -40.658 62.254  66.612  1.00 10.02 ? 81  LYS A CD  1 
ATOM   544   C  CE  . LYS A 1 81  ? -41.375 63.571  66.344  1.00 11.00 ? 81  LYS A CE  1 
ATOM   545   N  NZ  . LYS A 1 81  ? -42.348 63.907  67.430  1.00 9.19  ? 81  LYS A NZ  1 
ATOM   546   N  N   . GLY A 1 82  ? -38.983 59.157  62.899  1.00 10.82 ? 82  GLY A N   1 
ATOM   547   C  CA  . GLY A 1 82  ? -39.594 59.126  61.589  1.00 10.32 ? 82  GLY A CA  1 
ATOM   548   C  C   . GLY A 1 82  ? -40.975 59.663  61.885  1.00 11.02 ? 82  GLY A C   1 
ATOM   549   O  O   . GLY A 1 82  ? -41.428 59.584  63.029  1.00 11.18 ? 82  GLY A O   1 
ATOM   550   N  N   . ARG A 1 83  ? -41.660 60.215  60.898  1.00 11.55 ? 83  ARG A N   1 
ATOM   551   C  CA  . ARG A 1 83  ? -42.976 60.751  61.197  1.00 13.15 ? 83  ARG A CA  1 
ATOM   552   C  C   . ARG A 1 83  ? -43.983 60.713  60.063  1.00 11.96 ? 83  ARG A C   1 
ATOM   553   O  O   . ARG A 1 83  ? -43.662 61.012  58.912  1.00 12.74 ? 83  ARG A O   1 
ATOM   554   C  CB  . ARG A 1 83  ? -42.830 62.181  61.735  1.00 14.66 ? 83  ARG A CB  1 
ATOM   555   C  CG  . ARG A 1 83  ? -42.175 63.171  60.790  1.00 17.46 ? 83  ARG A CG  1 
ATOM   556   C  CD  . ARG A 1 83  ? -41.537 64.315  61.571  1.00 18.47 ? 83  ARG A CD  1 
ATOM   557   N  NE  . ARG A 1 83  ? -40.125 64.060  61.837  1.00 23.13 ? 83  ARG A NE  1 
ATOM   558   C  CZ  . ARG A 1 83  ? -39.412 64.668  62.782  1.00 22.56 ? 83  ARG A CZ  1 
ATOM   559   N  NH1 . ARG A 1 83  ? -39.984 65.577  63.567  1.00 22.83 ? 83  ARG A NH1 1 
ATOM   560   N  NH2 . ARG A 1 83  ? -38.125 64.368  62.936  1.00 18.51 ? 83  ARG A NH2 1 
ATOM   561   N  N   . CYS A 1 84  ? -45.205 60.314  60.406  1.00 10.61 ? 84  CYS A N   1 
ATOM   562   C  CA  . CYS A 1 84  ? -46.293 60.258  59.446  1.00 10.51 ? 84  CYS A CA  1 
ATOM   563   C  C   . CYS A 1 84  ? -46.831 61.684  59.412  1.00 9.74  ? 84  CYS A C   1 
ATOM   564   O  O   . CYS A 1 84  ? -47.383 62.171  60.401  1.00 10.66 ? 84  CYS A O   1 
ATOM   565   C  CB  . CYS A 1 84  ? -47.373 59.283  59.927  1.00 9.88  ? 84  CYS A CB  1 
ATOM   566   S  SG  . CYS A 1 84  ? -48.740 59.090  58.767  1.00 13.32 ? 84  CYS A SG  1 
ATOM   567   N  N   . TYR A 1 85  ? -46.656 62.361  58.281  1.00 9.63  ? 85  TYR A N   1 
ATOM   568   C  CA  . TYR A 1 85  ? -47.091 63.745  58.166  1.00 8.03  ? 85  TYR A CA  1 
ATOM   569   C  C   . TYR A 1 85  ? -48.318 63.973  57.287  1.00 9.41  ? 85  TYR A C   1 
ATOM   570   O  O   . TYR A 1 85  ? -48.836 65.089  57.218  1.00 9.62  ? 85  TYR A O   1 
ATOM   571   C  CB  . TYR A 1 85  ? -45.932 64.609  57.657  1.00 7.58  ? 85  TYR A CB  1 
ATOM   572   C  CG  . TYR A 1 85  ? -45.431 64.222  56.282  1.00 6.37  ? 85  TYR A CG  1 
ATOM   573   C  CD1 . TYR A 1 85  ? -44.506 63.191  56.115  1.00 6.77  ? 85  TYR A CD1 1 
ATOM   574   C  CD2 . TYR A 1 85  ? -45.882 64.894  55.144  1.00 5.92  ? 85  TYR A CD2 1 
ATOM   575   C  CE1 . TYR A 1 85  ? -44.041 62.837  54.846  1.00 7.17  ? 85  TYR A CE1 1 
ATOM   576   C  CE2 . TYR A 1 85  ? -45.428 64.549  53.872  1.00 6.74  ? 85  TYR A CE2 1 
ATOM   577   C  CZ  . TYR A 1 85  ? -44.504 63.525  53.732  1.00 7.32  ? 85  TYR A CZ  1 
ATOM   578   O  OH  . TYR A 1 85  ? -44.041 63.203  52.476  1.00 7.88  ? 85  TYR A OH  1 
ATOM   579   N  N   . HIS A 1 86  ? -48.788 62.929  56.613  1.00 9.61  ? 86  HIS A N   1 
ATOM   580   C  CA  . HIS A 1 86  ? -49.964 63.072  55.763  1.00 10.38 ? 86  HIS A CA  1 
ATOM   581   C  C   . HIS A 1 86  ? -50.648 61.739  55.500  1.00 10.33 ? 86  HIS A C   1 
ATOM   582   O  O   . HIS A 1 86  ? -49.992 60.703  55.356  1.00 10.35 ? 86  HIS A O   1 
ATOM   583   C  CB  . HIS A 1 86  ? -49.587 63.720  54.427  1.00 11.22 ? 86  HIS A CB  1 
ATOM   584   C  CG  . HIS A 1 86  ? -50.766 64.133  53.601  1.00 13.80 ? 86  HIS A CG  1 
ATOM   585   N  ND1 . HIS A 1 86  ? -51.605 65.166  53.966  1.00 13.28 ? 86  HIS A ND1 1 
ATOM   586   C  CD2 . HIS A 1 86  ? -51.262 63.638  52.443  1.00 13.21 ? 86  HIS A CD2 1 
ATOM   587   C  CE1 . HIS A 1 86  ? -52.564 65.288  53.067  1.00 14.22 ? 86  HIS A CE1 1 
ATOM   588   N  NE2 . HIS A 1 86  ? -52.381 64.376  52.132  1.00 15.14 ? 86  HIS A NE2 1 
ATOM   589   N  N   . ILE A 1 87  ? -51.975 61.778  55.437  1.00 9.69  ? 87  ILE A N   1 
ATOM   590   C  CA  . ILE A 1 87  ? -52.770 60.587  55.181  1.00 10.04 ? 87  ILE A CA  1 
ATOM   591   C  C   . ILE A 1 87  ? -53.915 60.903  54.232  1.00 11.81 ? 87  ILE A C   1 
ATOM   592   O  O   . ILE A 1 87  ? -54.642 61.876  54.429  1.00 12.58 ? 87  ILE A O   1 
ATOM   593   C  CB  . ILE A 1 87  ? -53.406 60.034  56.474  1.00 11.87 ? 87  ILE A CB  1 
ATOM   594   C  CG1 . ILE A 1 87  ? -52.323 59.633  57.476  1.00 11.77 ? 87  ILE A CG1 1 
ATOM   595   C  CG2 . ILE A 1 87  ? -54.304 58.841  56.142  1.00 9.62  ? 87  ILE A CG2 1 
ATOM   596   C  CD1 . ILE A 1 87  ? -52.886 59.302  58.841  1.00 12.72 ? 87  ILE A CD1 1 
ATOM   597   N  N   . GLU A 1 88  ? -54.072 60.087  53.199  1.00 13.83 ? 88  GLU A N   1 
ATOM   598   C  CA  . GLU A 1 88  ? -55.175 60.268  52.268  1.00 14.87 ? 88  GLU A CA  1 
ATOM   599   C  C   . GLU A 1 88  ? -55.797 58.911  51.963  1.00 14.40 ? 88  GLU A C   1 
ATOM   600   O  O   . GLU A 1 88  ? -55.095 57.895  51.895  1.00 11.79 ? 88  GLU A O   1 
ATOM   601   C  CB  . GLU A 1 88  ? -54.716 60.944  50.976  1.00 17.91 ? 88  GLU A CB  1 
ATOM   602   C  CG  . GLU A 1 88  ? -53.437 60.406  50.391  1.00 23.35 ? 88  GLU A CG  1 
ATOM   603   C  CD  . GLU A 1 88  ? -53.210 60.908  48.978  1.00 26.30 ? 88  GLU A CD  1 
ATOM   604   O  OE1 . GLU A 1 88  ? -53.722 62.000  48.645  1.00 28.73 ? 88  GLU A OE1 1 
ATOM   605   O  OE2 . GLU A 1 88  ? -52.520 60.217  48.199  1.00 28.09 ? 88  GLU A OE2 1 
ATOM   606   N  N   . PRO A 1 89  ? -57.129 58.874  51.799  1.00 12.58 ? 89  PRO A N   1 
ATOM   607   C  CA  . PRO A 1 89  ? -57.859 57.639  51.502  1.00 13.26 ? 89  PRO A CA  1 
ATOM   608   C  C   . PRO A 1 89  ? -57.562 57.157  50.086  1.00 13.05 ? 89  PRO A C   1 
ATOM   609   O  O   . PRO A 1 89  ? -57.151 57.938  49.223  1.00 13.10 ? 89  PRO A O   1 
ATOM   610   C  CB  . PRO A 1 89  ? -59.327 58.053  51.658  1.00 13.43 ? 89  PRO A CB  1 
ATOM   611   C  CG  . PRO A 1 89  ? -59.273 59.281  52.536  1.00 11.75 ? 89  PRO A CG  1 
ATOM   612   C  CD  . PRO A 1 89  ? -58.065 59.993  52.008  1.00 13.97 ? 89  PRO A CD  1 
ATOM   613   N  N   . VAL A 1 90  ? -57.756 55.867  49.855  1.00 14.17 ? 90  VAL A N   1 
ATOM   614   C  CA  . VAL A 1 90  ? -57.542 55.294  48.536  1.00 16.84 ? 90  VAL A CA  1 
ATOM   615   C  C   . VAL A 1 90  ? -58.940 55.176  47.939  1.00 18.37 ? 90  VAL A C   1 
ATOM   616   O  O   . VAL A 1 90  ? -59.844 54.643  48.574  1.00 16.17 ? 90  VAL A O   1 
ATOM   617   C  CB  . VAL A 1 90  ? -56.877 53.905  48.632  1.00 16.60 ? 90  VAL A CB  1 
ATOM   618   C  CG1 . VAL A 1 90  ? -56.712 53.308  47.264  1.00 15.38 ? 90  VAL A CG1 1 
ATOM   619   C  CG2 . VAL A 1 90  ? -55.519 54.031  49.281  1.00 15.74 ? 90  VAL A CG2 1 
ATOM   620   N  N   . ALA A 1 91  ? -59.122 55.685  46.727  1.00 21.23 ? 91  ALA A N   1 
ATOM   621   C  CA  . ALA A 1 91  ? -60.429 55.659  46.076  1.00 24.84 ? 91  ALA A CA  1 
ATOM   622   C  C   . ALA A 1 91  ? -60.995 54.271  45.800  1.00 27.16 ? 91  ALA A C   1 
ATOM   623   O  O   . ALA A 1 91  ? -60.318 53.404  45.244  1.00 26.45 ? 91  ALA A O   1 
ATOM   624   C  CB  . ALA A 1 91  ? -60.378 56.458  44.776  1.00 25.15 ? 91  ALA A CB  1 
ATOM   625   N  N   . GLY A 1 92  ? -62.246 54.079  46.207  1.00 30.52 ? 92  GLY A N   1 
ATOM   626   C  CA  . GLY A 1 92  ? -62.937 52.823  45.979  1.00 35.08 ? 92  GLY A CA  1 
ATOM   627   C  C   . GLY A 1 92  ? -62.502 51.624  46.793  1.00 37.67 ? 92  GLY A C   1 
ATOM   628   O  O   . GLY A 1 92  ? -63.108 50.556  46.695  1.00 39.65 ? 92  GLY A O   1 
ATOM   629   N  N   . GLU A 1 93  ? -61.460 51.784  47.597  1.00 39.49 ? 93  GLU A N   1 
ATOM   630   C  CA  . GLU A 1 93  ? -60.973 50.680  48.409  1.00 39.91 ? 93  GLU A CA  1 
ATOM   631   C  C   . GLU A 1 93  ? -61.470 50.836  49.837  1.00 39.53 ? 93  GLU A C   1 
ATOM   632   O  O   . GLU A 1 93  ? -61.465 51.933  50.385  1.00 40.62 ? 93  GLU A O   1 
ATOM   633   C  CB  . GLU A 1 93  ? -59.445 50.650  48.394  1.00 42.11 ? 93  GLU A CB  1 
ATOM   634   C  CG  . GLU A 1 93  ? -58.858 49.319  48.812  1.00 45.38 ? 93  GLU A CG  1 
ATOM   635   C  CD  . GLU A 1 93  ? -59.167 48.216  47.818  1.00 46.58 ? 93  GLU A CD  1 
ATOM   636   O  OE1 . GLU A 1 93  ? -58.797 48.369  46.634  1.00 47.36 ? 93  GLU A OE1 1 
ATOM   637   O  OE2 . GLU A 1 93  ? -59.776 47.199  48.217  1.00 46.66 ? 93  GLU A OE2 1 
ATOM   638   N  N   . GLU A 1 94  ? -61.907 49.737  50.439  1.00 39.06 ? 94  GLU A N   1 
ATOM   639   C  CA  . GLU A 1 94  ? -62.398 49.793  51.807  1.00 37.21 ? 94  GLU A CA  1 
ATOM   640   C  C   . GLU A 1 94  ? -61.253 49.750  52.817  1.00 33.21 ? 94  GLU A C   1 
ATOM   641   O  O   . GLU A 1 94  ? -60.388 48.875  52.758  1.00 32.22 ? 94  GLU A O   1 
ATOM   642   C  CB  . GLU A 1 94  ? -63.368 48.638  52.088  1.00 41.00 ? 94  GLU A CB  1 
ATOM   643   C  CG  . GLU A 1 94  ? -63.909 48.644  53.515  1.00 46.18 ? 94  GLU A CG  1 
ATOM   644   C  CD  . GLU A 1 94  ? -64.716 47.405  53.857  1.00 49.37 ? 94  GLU A CD  1 
ATOM   645   O  OE1 . GLU A 1 94  ? -65.813 47.229  53.285  1.00 51.54 ? 94  GLU A OE1 1 
ATOM   646   O  OE2 . GLU A 1 94  ? -64.248 46.609  54.701  1.00 50.16 ? 94  GLU A OE2 1 
ATOM   647   N  N   . ASN A 1 95  ? -61.250 50.718  53.727  1.00 29.04 ? 95  ASN A N   1 
ATOM   648   C  CA  . ASN A 1 95  ? -60.250 50.803  54.788  1.00 25.61 ? 95  ASN A CA  1 
ATOM   649   C  C   . ASN A 1 95  ? -58.798 50.728  54.312  1.00 21.39 ? 95  ASN A C   1 
ATOM   650   O  O   . ASN A 1 95  ? -57.998 49.973  54.862  1.00 17.42 ? 95  ASN A O   1 
ATOM   651   C  CB  . ASN A 1 95  ? -60.519 49.701  55.823  1.00 26.11 ? 95  ASN A CB  1 
ATOM   652   C  CG  . ASN A 1 95  ? -60.042 50.072  57.212  1.00 28.70 ? 95  ASN A CG  1 
ATOM   653   O  OD1 . ASN A 1 95  ? -60.011 51.250  57.575  1.00 29.91 ? 95  ASN A OD1 1 
ATOM   654   N  ND2 . ASN A 1 95  ? -59.690 49.067  58.009  1.00 27.58 ? 95  ASN A ND2 1 
ATOM   655   N  N   . GLN A 1 96  ? -58.465 51.509  53.287  1.00 18.48 ? 96  GLN A N   1 
ATOM   656   C  CA  . GLN A 1 96  ? -57.103 51.548  52.762  1.00 16.61 ? 96  GLN A CA  1 
ATOM   657   C  C   . GLN A 1 96  ? -56.691 53.010  52.623  1.00 14.64 ? 96  GLN A C   1 
ATOM   658   O  O   . GLN A 1 96  ? -57.475 53.844  52.163  1.00 13.63 ? 96  GLN A O   1 
ATOM   659   C  CB  . GLN A 1 96  ? -57.017 50.846  51.404  1.00 16.70 ? 96  GLN A CB  1 
ATOM   660   C  CG  . GLN A 1 96  ? -55.586 50.562  50.965  1.00 18.16 ? 96  GLN A CG  1 
ATOM   661   C  CD  . GLN A 1 96  ? -55.510 49.783  49.663  1.00 17.32 ? 96  GLN A CD  1 
ATOM   662   O  OE1 . GLN A 1 96  ? -55.541 50.356  48.576  1.00 17.86 ? 96  GLN A OE1 1 
ATOM   663   N  NE2 . GLN A 1 96  ? -55.422 48.466  49.774  1.00 18.48 ? 96  GLN A NE2 1 
ATOM   664   N  N   . TYR A 1 97  ? -55.463 53.318  53.030  1.00 13.30 ? 97  TYR A N   1 
ATOM   665   C  CA  . TYR A 1 97  ? -54.963 54.686  52.968  1.00 11.10 ? 97  TYR A CA  1 
ATOM   666   C  C   . TYR A 1 97  ? -53.522 54.754  52.492  1.00 10.48 ? 97  TYR A C   1 
ATOM   667   O  O   . TYR A 1 97  ? -52.796 53.760  52.530  1.00 9.48  ? 97  TYR A O   1 
ATOM   668   C  CB  . TYR A 1 97  ? -55.027 55.343  54.355  1.00 11.92 ? 97  TYR A CB  1 
ATOM   669   C  CG  . TYR A 1 97  ? -56.368 55.249  55.043  1.00 14.00 ? 97  TYR A CG  1 
ATOM   670   C  CD1 . TYR A 1 97  ? -56.785 54.058  55.645  1.00 14.81 ? 97  TYR A CD1 1 
ATOM   671   C  CD2 . TYR A 1 97  ? -57.238 56.341  55.067  1.00 14.03 ? 97  TYR A CD2 1 
ATOM   672   C  CE1 . TYR A 1 97  ? -58.034 53.957  56.254  1.00 15.33 ? 97  TYR A CE1 1 
ATOM   673   C  CE2 . TYR A 1 97  ? -58.491 56.249  55.674  1.00 16.63 ? 97  TYR A CE2 1 
ATOM   674   C  CZ  . TYR A 1 97  ? -58.881 55.054  56.261  1.00 16.88 ? 97  TYR A CZ  1 
ATOM   675   O  OH  . TYR A 1 97  ? -60.123 54.958  56.846  1.00 19.97 ? 97  TYR A OH  1 
ATOM   676   N  N   . ILE A 1 98  ? -53.119 55.932  52.029  1.00 9.42  ? 98  ILE A N   1 
ATOM   677   C  CA  . ILE A 1 98  ? -51.738 56.156  51.622  1.00 10.44 ? 98  ILE A CA  1 
ATOM   678   C  C   . ILE A 1 98  ? -51.192 57.029  52.747  1.00 12.03 ? 98  ILE A C   1 
ATOM   679   O  O   . ILE A 1 98  ? -51.669 58.149  52.951  1.00 11.02 ? 98  ILE A O   1 
ATOM   680   C  CB  . ILE A 1 98  ? -51.605 56.954  50.302  1.00 8.84  ? 98  ILE A CB  1 
ATOM   681   C  CG1 . ILE A 1 98  ? -52.230 56.179  49.139  1.00 10.57 ? 98  ILE A CG1 1 
ATOM   682   C  CG2 . ILE A 1 98  ? -50.132 57.224  50.020  1.00 10.69 ? 98  ILE A CG2 1 
ATOM   683   C  CD1 . ILE A 1 98  ? -51.579 54.836  48.863  1.00 11.68 ? 98  ILE A CD1 1 
ATOM   684   N  N   . CYS A 1 99  ? -50.224 56.508  53.492  1.00 10.17 ? 99  CYS A N   1 
ATOM   685   C  CA  . CYS A 1 99  ? -49.629 57.257  54.592  1.00 9.62  ? 99  CYS A CA  1 
ATOM   686   C  C   . CYS A 1 99  ? -48.217 57.698  54.222  1.00 8.73  ? 99  CYS A C   1 
ATOM   687   O  O   . CYS A 1 99  ? -47.377 56.878  53.840  1.00 8.61  ? 99  CYS A O   1 
ATOM   688   C  CB  . CYS A 1 99  ? -49.595 56.400  55.862  1.00 9.98  ? 99  CYS A CB  1 
ATOM   689   S  SG  . CYS A 1 99  ? -51.231 55.883  56.460  1.00 16.20 ? 99  CYS A SG  1 
ATOM   690   N  N   . TYR A 1 100 ? -47.961 58.997  54.336  1.00 8.20  ? 100 TYR A N   1 
ATOM   691   C  CA  . TYR A 1 100 ? -46.653 59.547  54.009  1.00 8.57  ? 100 TYR A CA  1 
ATOM   692   C  C   . TYR A 1 100 ? -45.791 59.666  55.253  1.00 8.40  ? 100 TYR A C   1 
ATOM   693   O  O   . TYR A 1 100 ? -46.200 60.266  56.244  1.00 9.81  ? 100 TYR A O   1 
ATOM   694   C  CB  . TYR A 1 100 ? -46.804 60.918  53.343  1.00 7.01  ? 100 TYR A CB  1 
ATOM   695   C  CG  . TYR A 1 100 ? -47.534 60.866  52.020  1.00 8.63  ? 100 TYR A CG  1 
ATOM   696   C  CD1 . TYR A 1 100 ? -48.929 60.748  51.968  1.00 8.64  ? 100 TYR A CD1 1 
ATOM   697   C  CD2 . TYR A 1 100 ? -46.831 60.915  50.818  1.00 9.17  ? 100 TYR A CD2 1 
ATOM   698   C  CE1 . TYR A 1 100 ? -49.602 60.686  50.742  1.00 9.25  ? 100 TYR A CE1 1 
ATOM   699   C  CE2 . TYR A 1 100 ? -47.489 60.854  49.592  1.00 10.77 ? 100 TYR A CE2 1 
ATOM   700   C  CZ  . TYR A 1 100 ? -48.870 60.739  49.558  1.00 11.71 ? 100 TYR A CZ  1 
ATOM   701   O  OH  . TYR A 1 100 ? -49.509 60.683  48.342  1.00 14.52 ? 100 TYR A OH  1 
ATOM   702   N  N   . VAL A 1 101 ? -44.593 59.095  55.186  1.00 9.01  ? 101 VAL A N   1 
ATOM   703   C  CA  . VAL A 1 101 ? -43.663 59.109  56.309  1.00 8.21  ? 101 VAL A CA  1 
ATOM   704   C  C   . VAL A 1 101 ? -42.319 59.723  55.922  1.00 9.30  ? 101 VAL A C   1 
ATOM   705   O  O   . VAL A 1 101 ? -41.767 59.414  54.865  1.00 9.31  ? 101 VAL A O   1 
ATOM   706   C  CB  . VAL A 1 101 ? -43.428 57.675  56.824  1.00 7.49  ? 101 VAL A CB  1 
ATOM   707   C  CG1 . VAL A 1 101 ? -42.469 57.685  58.011  1.00 6.47  ? 101 VAL A CG1 1 
ATOM   708   C  CG2 . VAL A 1 101 ? -44.761 57.048  57.201  1.00 5.53  ? 101 VAL A CG2 1 
ATOM   709   N  N   . ALA A 1 102 ? -41.801 60.593  56.786  1.00 8.80  ? 102 ALA A N   1 
ATOM   710   C  CA  . ALA A 1 102 ? -40.518 61.255  56.549  1.00 8.88  ? 102 ALA A CA  1 
ATOM   711   C  C   . ALA A 1 102 ? -39.452 60.728  57.511  1.00 8.28  ? 102 ALA A C   1 
ATOM   712   O  O   . ALA A 1 102 ? -39.701 60.587  58.712  1.00 9.67  ? 102 ALA A O   1 
ATOM   713   C  CB  . ALA A 1 102 ? -40.671 62.766  56.712  1.00 6.91  ? 102 ALA A CB  1 
ATOM   714   N  N   . TYR A 1 103 ? -38.267 60.447  56.974  1.00 7.85  ? 103 TYR A N   1 
ATOM   715   C  CA  . TYR A 1 103 ? -37.139 59.930  57.756  1.00 7.83  ? 103 TYR A CA  1 
ATOM   716   C  C   . TYR A 1 103 ? -35.931 60.868  57.657  1.00 7.43  ? 103 TYR A C   1 
ATOM   717   O  O   . TYR A 1 103 ? -35.458 61.165  56.557  1.00 6.02  ? 103 TYR A O   1 
ATOM   718   C  CB  . TYR A 1 103 ? -36.713 58.556  57.223  1.00 7.72  ? 103 TYR A CB  1 
ATOM   719   C  CG  . TYR A 1 103 ? -37.779 57.487  57.278  1.00 8.53  ? 103 TYR A CG  1 
ATOM   720   C  CD1 . TYR A 1 103 ? -37.971 56.728  58.429  1.00 7.64  ? 103 TYR A CD1 1 
ATOM   721   C  CD2 . TYR A 1 103 ? -38.585 57.222  56.172  1.00 9.53  ? 103 TYR A CD2 1 
ATOM   722   C  CE1 . TYR A 1 103 ? -38.939 55.723  58.478  1.00 8.31  ? 103 TYR A CE1 1 
ATOM   723   C  CE2 . TYR A 1 103 ? -39.558 56.222  56.209  1.00 9.09  ? 103 TYR A CE2 1 
ATOM   724   C  CZ  . TYR A 1 103 ? -39.729 55.476  57.365  1.00 8.59  ? 103 TYR A CZ  1 
ATOM   725   O  OH  . TYR A 1 103 ? -40.691 54.485  57.411  1.00 8.70  ? 103 TYR A OH  1 
ATOM   726   N  N   . PRO A 1 104 ? -35.413 61.341  58.802  1.00 6.92  ? 104 PRO A N   1 
ATOM   727   C  CA  . PRO A 1 104 ? -34.251 62.242  58.795  1.00 6.75  ? 104 PRO A CA  1 
ATOM   728   C  C   . PRO A 1 104 ? -33.038 61.577  58.138  1.00 6.36  ? 104 PRO A C   1 
ATOM   729   O  O   . PRO A 1 104 ? -32.859 60.366  58.239  1.00 6.42  ? 104 PRO A O   1 
ATOM   730   C  CB  . PRO A 1 104 ? -34.017 62.515  60.280  1.00 6.75  ? 104 PRO A CB  1 
ATOM   731   C  CG  . PRO A 1 104 ? -35.400 62.434  60.850  1.00 6.67  ? 104 PRO A CG  1 
ATOM   732   C  CD  . PRO A 1 104 ? -35.961 61.207  60.162  1.00 6.58  ? 104 PRO A CD  1 
ATOM   733   N  N   . LEU A 1 105 ? -32.210 62.378  57.476  1.00 6.44  ? 105 LEU A N   1 
ATOM   734   C  CA  . LEU A 1 105 ? -31.018 61.883  56.787  1.00 6.46  ? 105 LEU A CA  1 
ATOM   735   C  C   . LEU A 1 105 ? -30.076 61.111  57.710  1.00 6.14  ? 105 LEU A C   1 
ATOM   736   O  O   . LEU A 1 105 ? -29.463 60.120  57.300  1.00 5.61  ? 105 LEU A O   1 
ATOM   737   C  CB  . LEU A 1 105 ? -30.273 63.066  56.150  1.00 7.09  ? 105 LEU A CB  1 
ATOM   738   C  CG  . LEU A 1 105 ? -29.000 62.802  55.342  1.00 9.57  ? 105 LEU A CG  1 
ATOM   739   C  CD1 . LEU A 1 105 ? -29.325 61.959  54.119  1.00 8.78  ? 105 LEU A CD1 1 
ATOM   740   C  CD2 . LEU A 1 105 ? -28.386 64.135  54.920  1.00 9.87  ? 105 LEU A CD2 1 
ATOM   741   N  N   . ASP A 1 106 ? -29.965 61.565  58.954  1.00 5.60  ? 106 ASP A N   1 
ATOM   742   C  CA  . ASP A 1 106 ? -29.088 60.937  59.944  1.00 6.54  ? 106 ASP A CA  1 
ATOM   743   C  C   . ASP A 1 106 ? -29.358 59.466  60.266  1.00 6.86  ? 106 ASP A C   1 
ATOM   744   O  O   . ASP A 1 106 ? -28.506 58.799  60.845  1.00 9.71  ? 106 ASP A O   1 
ATOM   745   C  CB  . ASP A 1 106 ? -29.127 61.724  61.259  1.00 8.63  ? 106 ASP A CB  1 
ATOM   746   C  CG  . ASP A 1 106 ? -28.333 63.013  61.199  1.00 9.04  ? 106 ASP A CG  1 
ATOM   747   O  OD1 . ASP A 1 106 ? -27.770 63.321  60.131  1.00 11.79 ? 106 ASP A OD1 1 
ATOM   748   O  OD2 . ASP A 1 106 ? -28.274 63.719  62.226  1.00 11.85 ? 106 ASP A OD2 1 
ATOM   749   N  N   . LEU A 1 107 ? -30.528 58.953  59.908  1.00 6.66  ? 107 LEU A N   1 
ATOM   750   C  CA  . LEU A 1 107 ? -30.849 57.562  60.217  1.00 6.00  ? 107 LEU A CA  1 
ATOM   751   C  C   . LEU A 1 107 ? -30.197 56.530  59.298  1.00 6.56  ? 107 LEU A C   1 
ATOM   752   O  O   . LEU A 1 107 ? -30.171 55.338  59.615  1.00 7.75  ? 107 LEU A O   1 
ATOM   753   C  CB  . LEU A 1 107 ? -32.368 57.346  60.171  1.00 4.76  ? 107 LEU A CB  1 
ATOM   754   C  CG  . LEU A 1 107 ? -33.279 58.199  61.055  1.00 6.51  ? 107 LEU A CG  1 
ATOM   755   C  CD1 . LEU A 1 107 ? -34.707 57.664  60.961  1.00 4.75  ? 107 LEU A CD1 1 
ATOM   756   C  CD2 . LEU A 1 107 ? -32.797 58.159  62.498  1.00 5.59  ? 107 LEU A CD2 1 
ATOM   757   N  N   . PHE A 1 108 ? -29.647 56.984  58.179  1.00 6.25  ? 108 PHE A N   1 
ATOM   758   C  CA  . PHE A 1 108 ? -29.099 56.062  57.194  1.00 6.97  ? 108 PHE A CA  1 
ATOM   759   C  C   . PHE A 1 108 ? -27.587 55.988  57.011  1.00 8.01  ? 108 PHE A C   1 
ATOM   760   O  O   . PHE A 1 108 ? -26.889 57.000  57.086  1.00 7.45  ? 108 PHE A O   1 
ATOM   761   C  CB  . PHE A 1 108 ? -29.759 56.378  55.853  1.00 7.27  ? 108 PHE A CB  1 
ATOM   762   C  CG  . PHE A 1 108 ? -31.257 56.395  55.918  1.00 6.67  ? 108 PHE A CG  1 
ATOM   763   C  CD1 . PHE A 1 108 ? -31.981 55.212  55.830  1.00 7.94  ? 108 PHE A CD1 1 
ATOM   764   C  CD2 . PHE A 1 108 ? -31.945 57.587  56.143  1.00 7.44  ? 108 PHE A CD2 1 
ATOM   765   C  CE1 . PHE A 1 108 ? -33.364 55.206  55.968  1.00 8.19  ? 108 PHE A CE1 1 
ATOM   766   C  CE2 . PHE A 1 108 ? -33.333 57.591  56.284  1.00 9.11  ? 108 PHE A CE2 1 
ATOM   767   C  CZ  . PHE A 1 108 ? -34.041 56.401  56.197  1.00 7.23  ? 108 PHE A CZ  1 
ATOM   768   N  N   . GLU A 1 109 ? -27.085 54.777  56.763  1.00 7.21  ? 109 GLU A N   1 
ATOM   769   C  CA  . GLU A 1 109 ? -25.659 54.610  56.527  1.00 6.48  ? 109 GLU A CA  1 
ATOM   770   C  C   . GLU A 1 109 ? -25.362 54.996  55.083  1.00 6.81  ? 109 GLU A C   1 
ATOM   771   O  O   . GLU A 1 109 ? -26.029 54.532  54.154  1.00 7.20  ? 109 GLU A O   1 
ATOM   772   C  CB  . GLU A 1 109 ? -25.189 53.168  56.771  1.00 5.74  ? 109 GLU A CB  1 
ATOM   773   C  CG  . GLU A 1 109 ? -23.711 53.007  56.391  1.00 7.85  ? 109 GLU A CG  1 
ATOM   774   C  CD  . GLU A 1 109 ? -23.072 51.705  56.833  1.00 9.24  ? 109 GLU A CD  1 
ATOM   775   O  OE1 . GLU A 1 109 ? -23.733 50.885  57.507  1.00 10.64 ? 109 GLU A OE1 1 
ATOM   776   O  OE2 . GLU A 1 109 ? -21.881 51.509  56.502  1.00 9.29  ? 109 GLU A OE2 1 
ATOM   777   N  N   . GLU A 1 110 ? -24.360 55.853  54.908  1.00 6.73  ? 110 GLU A N   1 
ATOM   778   C  CA  . GLU A 1 110 ? -23.956 56.318  53.589  1.00 7.40  ? 110 GLU A CA  1 
ATOM   779   C  C   . GLU A 1 110 ? -23.630 55.172  52.631  1.00 7.76  ? 110 GLU A C   1 
ATOM   780   O  O   . GLU A 1 110 ? -22.917 54.232  52.991  1.00 7.09  ? 110 GLU A O   1 
ATOM   781   C  CB  . GLU A 1 110 ? -22.730 57.237  53.711  1.00 7.24  ? 110 GLU A CB  1 
ATOM   782   C  CG  . GLU A 1 110 ? -22.971 58.514  54.514  1.00 9.20  ? 110 GLU A CG  1 
ATOM   783   C  CD  . GLU A 1 110 ? -22.845 58.326  56.022  1.00 11.00 ? 110 GLU A CD  1 
ATOM   784   O  OE1 . GLU A 1 110 ? -22.728 57.171  56.491  1.00 11.65 ? 110 GLU A OE1 1 
ATOM   785   O  OE2 . GLU A 1 110 ? -22.867 59.349  56.741  1.00 10.74 ? 110 GLU A OE2 1 
ATOM   786   N  N   . GLY A 1 111 ? -24.163 55.255  51.415  1.00 9.33  ? 111 GLY A N   1 
ATOM   787   C  CA  . GLY A 1 111 ? -23.895 54.248  50.397  1.00 7.49  ? 111 GLY A CA  1 
ATOM   788   C  C   . GLY A 1 111 ? -24.389 52.833  50.637  1.00 9.66  ? 111 GLY A C   1 
ATOM   789   O  O   . GLY A 1 111 ? -23.931 51.897  49.976  1.00 9.33  ? 111 GLY A O   1 
ATOM   790   N  N   . SER A 1 112 ? -25.334 52.658  51.555  1.00 7.67  ? 112 SER A N   1 
ATOM   791   C  CA  . SER A 1 112 ? -25.836 51.318  51.840  1.00 6.49  ? 112 SER A CA  1 
ATOM   792   C  C   . SER A 1 112 ? -27.335 51.134  51.641  1.00 6.37  ? 112 SER A C   1 
ATOM   793   O  O   . SER A 1 112 ? -28.135 51.529  52.489  1.00 7.01  ? 112 SER A O   1 
ATOM   794   C  CB  . SER A 1 112 ? -25.468 50.914  53.270  1.00 4.86  ? 112 SER A CB  1 
ATOM   795   O  OG  . SER A 1 112 ? -26.002 49.635  53.583  1.00 5.88  ? 112 SER A OG  1 
ATOM   796   N  N   . VAL A 1 113 ? -27.712 50.529  50.518  1.00 4.47  ? 113 VAL A N   1 
ATOM   797   C  CA  . VAL A 1 113 ? -29.118 50.259  50.235  1.00 5.96  ? 113 VAL A CA  1 
ATOM   798   C  C   . VAL A 1 113 ? -29.610 49.249  51.268  1.00 6.99  ? 113 VAL A C   1 
ATOM   799   O  O   . VAL A 1 113 ? -30.765 49.281  51.685  1.00 5.80  ? 113 VAL A O   1 
ATOM   800   C  CB  . VAL A 1 113 ? -29.303 49.669  48.820  1.00 7.00  ? 113 VAL A CB  1 
ATOM   801   C  CG1 . VAL A 1 113 ? -30.692 49.068  48.678  1.00 9.94  ? 113 VAL A CG1 1 
ATOM   802   C  CG2 . VAL A 1 113 ? -29.096 50.766  47.781  1.00 8.69  ? 113 VAL A CG2 1 
ATOM   803   N  N   . THR A 1 114 ? -28.720 48.348  51.673  1.00 6.43  ? 114 THR A N   1 
ATOM   804   C  CA  . THR A 1 114 ? -29.049 47.341  52.673  1.00 6.37  ? 114 THR A CA  1 
ATOM   805   C  C   . THR A 1 114 ? -29.576 48.016  53.947  1.00 7.95  ? 114 THR A C   1 
ATOM   806   O  O   . THR A 1 114 ? -30.599 47.613  54.502  1.00 7.63  ? 114 THR A O   1 
ATOM   807   C  CB  . THR A 1 114 ? -27.800 46.486  53.012  1.00 7.45  ? 114 THR A CB  1 
ATOM   808   O  OG1 . THR A 1 114 ? -27.500 45.628  51.903  1.00 8.81  ? 114 THR A OG1 1 
ATOM   809   C  CG2 . THR A 1 114 ? -28.029 45.651  54.266  1.00 5.22  ? 114 THR A CG2 1 
ATOM   810   N  N   . ASN A 1 115 ? -28.886 49.055  54.404  1.00 8.61  ? 115 ASN A N   1 
ATOM   811   C  CA  . ASN A 1 115 ? -29.312 49.756  55.612  1.00 7.60  ? 115 ASN A CA  1 
ATOM   812   C  C   . ASN A 1 115 ? -30.626 50.503  55.396  1.00 7.77  ? 115 ASN A C   1 
ATOM   813   O  O   . ASN A 1 115 ? -31.501 50.493  56.257  1.00 8.33  ? 115 ASN A O   1 
ATOM   814   C  CB  . ASN A 1 115 ? -28.229 50.737  56.067  1.00 9.02  ? 115 ASN A CB  1 
ATOM   815   C  CG  . ASN A 1 115 ? -28.649 51.543  57.283  1.00 9.83  ? 115 ASN A CG  1 
ATOM   816   O  OD1 . ASN A 1 115 ? -29.013 52.715  57.174  1.00 10.81 ? 115 ASN A OD1 1 
ATOM   817   N  ND2 . ASN A 1 115 ? -28.609 50.911  58.448  1.00 11.58 ? 115 ASN A ND2 1 
ATOM   818   N  N   . MET A 1 116 ? -30.765 51.143  54.240  1.00 7.20  ? 116 MET A N   1 
ATOM   819   C  CA  . MET A 1 116 ? -31.979 51.890  53.931  1.00 7.66  ? 116 MET A CA  1 
ATOM   820   C  C   . MET A 1 116 ? -33.229 51.014  54.005  1.00 7.81  ? 116 MET A C   1 
ATOM   821   O  O   . MET A 1 116 ? -34.236 51.421  54.581  1.00 8.20  ? 116 MET A O   1 
ATOM   822   C  CB  . MET A 1 116 ? -31.877 52.522  52.542  1.00 8.39  ? 116 MET A CB  1 
ATOM   823   C  CG  . MET A 1 116 ? -33.072 53.388  52.188  1.00 10.50 ? 116 MET A CG  1 
ATOM   824   S  SD  . MET A 1 116 ? -32.964 54.086  50.532  1.00 14.86 ? 116 MET A SD  1 
ATOM   825   C  CE  . MET A 1 116 ? -33.336 52.645  49.534  1.00 14.03 ? 116 MET A CE  1 
ATOM   826   N  N   . PHE A 1 117 ? -33.171 49.817  53.423  1.00 5.50  ? 117 PHE A N   1 
ATOM   827   C  CA  . PHE A 1 117 ? -34.326 48.920  53.462  1.00 7.88  ? 117 PHE A CA  1 
ATOM   828   C  C   . PHE A 1 117 ? -34.544 48.304  54.842  1.00 6.70  ? 117 PHE A C   1 
ATOM   829   O  O   . PHE A 1 117 ? -35.683 48.070  55.242  1.00 7.59  ? 117 PHE A O   1 
ATOM   830   C  CB  . PHE A 1 117 ? -34.190 47.796  52.431  1.00 9.95  ? 117 PHE A CB  1 
ATOM   831   C  CG  . PHE A 1 117 ? -34.508 48.216  51.023  1.00 14.40 ? 117 PHE A CG  1 
ATOM   832   C  CD1 . PHE A 1 117 ? -35.453 49.206  50.773  1.00 17.99 ? 117 PHE A CD1 1 
ATOM   833   C  CD2 . PHE A 1 117 ? -33.900 47.588  49.945  1.00 16.90 ? 117 PHE A CD2 1 
ATOM   834   C  CE1 . PHE A 1 117 ? -35.787 49.563  49.464  1.00 19.09 ? 117 PHE A CE1 1 
ATOM   835   C  CE2 . PHE A 1 117 ? -34.229 47.938  48.634  1.00 16.96 ? 117 PHE A CE2 1 
ATOM   836   C  CZ  . PHE A 1 117 ? -35.172 48.925  48.396  1.00 16.36 ? 117 PHE A CZ  1 
ATOM   837   N  N   . THR A 1 118 ? -33.456 48.031  55.561  1.00 6.21  ? 118 THR A N   1 
ATOM   838   C  CA  . THR A 1 118 ? -33.557 47.441  56.895  1.00 6.18  ? 118 THR A CA  1 
ATOM   839   C  C   . THR A 1 118 ? -34.471 48.269  57.798  1.00 7.31  ? 118 THR A C   1 
ATOM   840   O  O   . THR A 1 118 ? -35.250 47.715  58.573  1.00 7.65  ? 118 THR A O   1 
ATOM   841   C  CB  . THR A 1 118 ? -32.163 47.294  57.551  1.00 6.02  ? 118 THR A CB  1 
ATOM   842   O  OG1 . THR A 1 118 ? -31.388 46.349  56.801  1.00 8.96  ? 118 THR A OG1 1 
ATOM   843   C  CG2 . THR A 1 118 ? -32.287 46.791  58.973  1.00 5.51  ? 118 THR A CG2 1 
ATOM   844   N  N   . SER A 1 119 ? -34.375 49.594  57.699  1.00 7.01  ? 119 SER A N   1 
ATOM   845   C  CA  . SER A 1 119 ? -35.222 50.476  58.498  1.00 8.44  ? 119 SER A CA  1 
ATOM   846   C  C   . SER A 1 119 ? -36.640 50.559  57.942  1.00 8.95  ? 119 SER A C   1 
ATOM   847   O  O   . SER A 1 119 ? -37.607 50.167  58.593  1.00 8.74  ? 119 SER A O   1 
ATOM   848   C  CB  . SER A 1 119 ? -34.651 51.901  58.541  1.00 7.22  ? 119 SER A CB  1 
ATOM   849   O  OG  . SER A 1 119 ? -33.656 52.042  59.533  1.00 7.35  ? 119 SER A OG  1 
ATOM   850   N  N   . ILE A 1 120 ? -36.747 51.066  56.719  1.00 7.42  ? 120 ILE A N   1 
ATOM   851   C  CA  . ILE A 1 120 ? -38.035 51.274  56.084  1.00 8.35  ? 120 ILE A CA  1 
ATOM   852   C  C   . ILE A 1 120 ? -38.946 50.051  55.917  1.00 8.49  ? 120 ILE A C   1 
ATOM   853   O  O   . ILE A 1 120 ? -40.152 50.182  56.068  1.00 9.28  ? 120 ILE A O   1 
ATOM   854   C  CB  . ILE A 1 120 ? -37.846 51.996  54.724  1.00 8.76  ? 120 ILE A CB  1 
ATOM   855   C  CG1 . ILE A 1 120 ? -37.007 53.266  54.944  1.00 9.30  ? 120 ILE A CG1 1 
ATOM   856   C  CG2 . ILE A 1 120 ? -39.204 52.370  54.127  1.00 9.00  ? 120 ILE A CG2 1 
ATOM   857   C  CD1 . ILE A 1 120 ? -36.818 54.127  53.703  1.00 7.96  ? 120 ILE A CD1 1 
ATOM   858   N  N   . VAL A 1 121 ? -38.396 48.871  55.629  1.00 7.52  ? 121 VAL A N   1 
ATOM   859   C  CA  . VAL A 1 121 ? -39.251 47.688  55.462  1.00 8.30  ? 121 VAL A CA  1 
ATOM   860   C  C   . VAL A 1 121 ? -38.831 46.491  56.320  1.00 8.92  ? 121 VAL A C   1 
ATOM   861   O  O   . VAL A 1 121 ? -39.242 45.356  56.069  1.00 10.65 ? 121 VAL A O   1 
ATOM   862   C  CB  . VAL A 1 121 ? -39.302 47.226  53.977  1.00 9.23  ? 121 VAL A CB  1 
ATOM   863   C  CG1 . VAL A 1 121 ? -39.730 48.387  53.077  1.00 7.37  ? 121 VAL A CG1 1 
ATOM   864   C  CG2 . VAL A 1 121 ? -37.952 46.674  53.551  1.00 9.41  ? 121 VAL A CG2 1 
ATOM   865   N  N   . GLY A 1 122 ? -38.036 46.759  57.348  1.00 6.42  ? 122 GLY A N   1 
ATOM   866   C  CA  . GLY A 1 122 ? -37.550 45.704  58.218  1.00 6.73  ? 122 GLY A CA  1 
ATOM   867   C  C   . GLY A 1 122 ? -38.546 44.887  59.029  1.00 8.22  ? 122 GLY A C   1 
ATOM   868   O  O   . GLY A 1 122 ? -38.579 43.662  58.892  1.00 7.47  ? 122 GLY A O   1 
ATOM   869   N  N   . ASN A 1 123 ? -39.345 45.538  59.877  1.00 7.04  ? 123 ASN A N   1 
ATOM   870   C  CA  . ASN A 1 123 ? -40.301 44.815  60.721  1.00 7.39  ? 123 ASN A CA  1 
ATOM   871   C  C   . ASN A 1 123 ? -41.772 45.219  60.613  1.00 8.06  ? 123 ASN A C   1 
ATOM   872   O  O   . ASN A 1 123 ? -42.646 44.445  61.005  1.00 8.44  ? 123 ASN A O   1 
ATOM   873   C  CB  . ASN A 1 123 ? -39.926 44.951  62.204  1.00 8.41  ? 123 ASN A CB  1 
ATOM   874   C  CG  . ASN A 1 123 ? -38.498 44.546  62.502  1.00 7.62  ? 123 ASN A CG  1 
ATOM   875   O  OD1 . ASN A 1 123 ? -37.974 43.587  61.938  1.00 9.04  ? 123 ASN A OD1 1 
ATOM   876   N  ND2 . ASN A 1 123 ? -37.867 45.267  63.419  1.00 10.99 ? 123 ASN A ND2 1 
ATOM   877   N  N   . VAL A 1 124 ? -42.052 46.414  60.102  1.00 7.52  ? 124 VAL A N   1 
ATOM   878   C  CA  . VAL A 1 124 ? -43.433 46.897  60.035  1.00 8.13  ? 124 VAL A CA  1 
ATOM   879   C  C   . VAL A 1 124 ? -44.452 46.118  59.205  1.00 9.62  ? 124 VAL A C   1 
ATOM   880   O  O   . VAL A 1 124 ? -45.653 46.252  59.437  1.00 10.36 ? 124 VAL A O   1 
ATOM   881   C  CB  . VAL A 1 124 ? -43.488 48.387  59.595  1.00 8.89  ? 124 VAL A CB  1 
ATOM   882   C  CG1 . VAL A 1 124 ? -42.739 49.255  60.610  1.00 8.12  ? 124 VAL A CG1 1 
ATOM   883   C  CG2 . VAL A 1 124 ? -42.897 48.553  58.204  1.00 8.55  ? 124 VAL A CG2 1 
ATOM   884   N  N   . PHE A 1 125 ? -44.003 45.311  58.249  1.00 8.75  ? 125 PHE A N   1 
ATOM   885   C  CA  . PHE A 1 125 ? -44.949 44.557  57.430  1.00 7.67  ? 125 PHE A CA  1 
ATOM   886   C  C   . PHE A 1 125 ? -45.594 43.393  58.165  1.00 9.00  ? 125 PHE A C   1 
ATOM   887   O  O   . PHE A 1 125 ? -46.584 42.830  57.689  1.00 8.23  ? 125 PHE A O   1 
ATOM   888   C  CB  . PHE A 1 125 ? -44.274 44.040  56.160  1.00 7.20  ? 125 PHE A CB  1 
ATOM   889   C  CG  . PHE A 1 125 ? -44.008 45.105  55.139  1.00 7.49  ? 125 PHE A CG  1 
ATOM   890   C  CD1 . PHE A 1 125 ? -43.073 46.106  55.383  1.00 6.41  ? 125 PHE A CD1 1 
ATOM   891   C  CD2 . PHE A 1 125 ? -44.715 45.122  53.940  1.00 6.50  ? 125 PHE A CD2 1 
ATOM   892   C  CE1 . PHE A 1 125 ? -42.840 47.109  54.446  1.00 8.67  ? 125 PHE A CE1 1 
ATOM   893   C  CE2 . PHE A 1 125 ? -44.491 46.121  52.996  1.00 9.91  ? 125 PHE A CE2 1 
ATOM   894   C  CZ  . PHE A 1 125 ? -43.554 47.116  53.251  1.00 9.91  ? 125 PHE A CZ  1 
ATOM   895   N  N   . GLY A 1 126 ? -45.043 43.040  59.324  1.00 9.66  ? 126 GLY A N   1 
ATOM   896   C  CA  . GLY A 1 126 ? -45.585 41.930  60.091  1.00 9.45  ? 126 GLY A CA  1 
ATOM   897   C  C   . GLY A 1 126 ? -46.451 42.303  61.284  1.00 10.88 ? 126 GLY A C   1 
ATOM   898   O  O   . GLY A 1 126 ? -46.914 41.424  62.007  1.00 10.70 ? 126 GLY A O   1 
ATOM   899   N  N   . PHE A 1 127 ? -46.680 43.594  61.499  1.00 11.15 ? 127 PHE A N   1 
ATOM   900   C  CA  . PHE A 1 127 ? -47.492 44.034  62.628  1.00 13.16 ? 127 PHE A CA  1 
ATOM   901   C  C   . PHE A 1 127 ? -48.904 43.466  62.639  1.00 11.80 ? 127 PHE A C   1 
ATOM   902   O  O   . PHE A 1 127 ? -49.605 43.493  61.630  1.00 11.55 ? 127 PHE A O   1 
ATOM   903   C  CB  . PHE A 1 127 ? -47.555 45.561  62.677  1.00 15.05 ? 127 PHE A CB  1 
ATOM   904   C  CG  . PHE A 1 127 ? -46.557 46.163  63.613  1.00 18.47 ? 127 PHE A CG  1 
ATOM   905   C  CD1 . PHE A 1 127 ? -45.193 46.075  63.348  1.00 20.28 ? 127 PHE A CD1 1 
ATOM   906   C  CD2 . PHE A 1 127 ? -46.974 46.747  64.801  1.00 19.21 ? 127 PHE A CD2 1 
ATOM   907   C  CE1 . PHE A 1 127 ? -44.258 46.556  64.260  1.00 22.57 ? 127 PHE A CE1 1 
ATOM   908   C  CE2 . PHE A 1 127 ? -46.051 47.231  65.718  1.00 20.96 ? 127 PHE A CE2 1 
ATOM   909   C  CZ  . PHE A 1 127 ? -44.692 47.135  65.452  1.00 20.77 ? 127 PHE A CZ  1 
ATOM   910   N  N   . LYS A 1 128 ? -49.314 42.951  63.795  1.00 9.78  ? 128 LYS A N   1 
ATOM   911   C  CA  . LYS A 1 128 ? -50.643 42.374  63.953  1.00 11.19 ? 128 LYS A CA  1 
ATOM   912   C  C   . LYS A 1 128 ? -51.748 43.395  63.698  1.00 11.49 ? 128 LYS A C   1 
ATOM   913   O  O   . LYS A 1 128 ? -52.827 43.038  63.229  1.00 12.46 ? 128 LYS A O   1 
ATOM   914   C  CB  . LYS A 1 128 ? -50.819 41.807  65.364  1.00 9.75  ? 128 LYS A CB  1 
ATOM   915   C  CG  . LYS A 1 128 ? -50.098 40.499  65.637  1.00 10.97 ? 128 LYS A CG  1 
ATOM   916   C  CD  . LYS A 1 128 ? -50.391 40.041  67.062  1.00 10.55 ? 128 LYS A CD  1 
ATOM   917   C  CE  . LYS A 1 128 ? -49.796 38.676  67.364  1.00 8.61  ? 128 LYS A CE  1 
ATOM   918   N  NZ  . LYS A 1 128 ? -50.099 38.279  68.773  1.00 8.28  ? 128 LYS A NZ  1 
ATOM   919   N  N   . ALA A 1 129 ? -51.470 44.658  64.012  1.00 10.30 ? 129 ALA A N   1 
ATOM   920   C  CA  . ALA A 1 129 ? -52.443 45.737  63.847  1.00 11.10 ? 129 ALA A CA  1 
ATOM   921   C  C   . ALA A 1 129 ? -52.746 46.097  62.392  1.00 11.09 ? 129 ALA A C   1 
ATOM   922   O  O   . ALA A 1 129 ? -53.619 46.925  62.126  1.00 11.05 ? 129 ALA A O   1 
ATOM   923   C  CB  . ALA A 1 129 ? -51.965 46.980  64.597  1.00 9.89  ? 129 ALA A CB  1 
ATOM   924   N  N   . LEU A 1 130 ? -52.029 45.477  61.460  1.00 11.30 ? 130 LEU A N   1 
ATOM   925   C  CA  . LEU A 1 130 ? -52.220 45.734  60.034  1.00 12.07 ? 130 LEU A CA  1 
ATOM   926   C  C   . LEU A 1 130 ? -52.642 44.459  59.304  1.00 13.42 ? 130 LEU A C   1 
ATOM   927   O  O   . LEU A 1 130 ? -52.197 43.364  59.653  1.00 14.60 ? 130 LEU A O   1 
ATOM   928   C  CB  . LEU A 1 130 ? -50.917 46.246  59.403  1.00 12.08 ? 130 LEU A CB  1 
ATOM   929   C  CG  . LEU A 1 130 ? -50.207 47.454  60.020  1.00 13.04 ? 130 LEU A CG  1 
ATOM   930   C  CD1 . LEU A 1 130 ? -48.927 47.732  59.243  1.00 12.88 ? 130 LEU A CD1 1 
ATOM   931   C  CD2 . LEU A 1 130 ? -51.118 48.674  59.993  1.00 15.03 ? 130 LEU A CD2 1 
ATOM   932   N  N   . ARG A 1 131 ? -53.504 44.603  58.299  1.00 12.61 ? 131 ARG A N   1 
ATOM   933   C  CA  . ARG A 1 131 ? -53.946 43.464  57.492  1.00 13.51 ? 131 ARG A CA  1 
ATOM   934   C  C   . ARG A 1 131 ? -52.955 43.314  56.343  1.00 11.92 ? 131 ARG A C   1 
ATOM   935   O  O   . ARG A 1 131 ? -52.642 42.202  55.912  1.00 10.97 ? 131 ARG A O   1 
ATOM   936   C  CB  . ARG A 1 131 ? -55.329 43.712  56.886  1.00 15.13 ? 131 ARG A CB  1 
ATOM   937   C  CG  . ARG A 1 131 ? -56.510 43.562  57.817  1.00 22.57 ? 131 ARG A CG  1 
ATOM   938   C  CD  . ARG A 1 131 ? -57.761 44.026  57.090  1.00 25.09 ? 131 ARG A CD  1 
ATOM   939   N  NE  . ARG A 1 131 ? -57.644 45.441  56.737  1.00 31.74 ? 131 ARG A NE  1 
ATOM   940   C  CZ  . ARG A 1 131 ? -58.278 46.028  55.726  1.00 32.47 ? 131 ARG A CZ  1 
ATOM   941   N  NH1 . ARG A 1 131 ? -59.088 45.323  54.945  1.00 35.16 ? 131 ARG A NH1 1 
ATOM   942   N  NH2 . ARG A 1 131 ? -58.100 47.324  55.497  1.00 30.25 ? 131 ARG A NH2 1 
ATOM   943   N  N   . ALA A 1 132 ? -52.481 44.452  55.844  1.00 10.15 ? 132 ALA A N   1 
ATOM   944   C  CA  . ALA A 1 132 ? -51.538 44.471  54.738  1.00 9.40  ? 132 ALA A CA  1 
ATOM   945   C  C   . ALA A 1 132 ? -50.810 45.809  54.660  1.00 10.42 ? 132 ALA A C   1 
ATOM   946   O  O   . ALA A 1 132 ? -51.282 46.823  55.184  1.00 9.00  ? 132 ALA A O   1 
ATOM   947   C  CB  . ALA A 1 132 ? -52.267 44.197  53.424  1.00 8.30  ? 132 ALA A CB  1 
ATOM   948   N  N   . LEU A 1 133 ? -49.660 45.799  53.994  1.00 8.63  ? 133 LEU A N   1 
ATOM   949   C  CA  . LEU A 1 133 ? -48.848 47.000  53.838  1.00 8.31  ? 133 LEU A CA  1 
ATOM   950   C  C   . LEU A 1 133 ? -48.019 46.894  52.568  1.00 8.61  ? 133 LEU A C   1 
ATOM   951   O  O   . LEU A 1 133 ? -47.486 45.827  52.256  1.00 7.84  ? 133 LEU A O   1 
ATOM   952   C  CB  . LEU A 1 133 ? -47.912 47.158  55.042  1.00 6.80  ? 133 LEU A CB  1 
ATOM   953   C  CG  . LEU A 1 133 ? -46.983 48.376  55.110  1.00 5.82  ? 133 LEU A CG  1 
ATOM   954   C  CD1 . LEU A 1 133 ? -47.808 49.660  55.232  1.00 5.29  ? 133 LEU A CD1 1 
ATOM   955   C  CD2 . LEU A 1 133 ? -46.054 48.230  56.311  1.00 6.10  ? 133 LEU A CD2 1 
ATOM   956   N  N   . ARG A 1 134 ? -47.917 47.999  51.836  1.00 8.43  ? 134 ARG A N   1 
ATOM   957   C  CA  . ARG A 1 134 ? -47.123 48.030  50.612  1.00 7.16  ? 134 ARG A CA  1 
ATOM   958   C  C   . ARG A 1 134 ? -46.388 49.357  50.479  1.00 8.56  ? 134 ARG A C   1 
ATOM   959   O  O   . ARG A 1 134 ? -46.986 50.428  50.637  1.00 9.62  ? 134 ARG A O   1 
ATOM   960   C  CB  . ARG A 1 134 ? -48.000 47.842  49.370  1.00 8.42  ? 134 ARG A CB  1 
ATOM   961   C  CG  . ARG A 1 134 ? -47.184 47.598  48.097  1.00 7.57  ? 134 ARG A CG  1 
ATOM   962   C  CD  . ARG A 1 134 ? -47.995 47.848  46.832  1.00 9.32  ? 134 ARG A CD  1 
ATOM   963   N  NE  . ARG A 1 134 ? -47.464 47.110  45.685  1.00 9.93  ? 134 ARG A NE  1 
ATOM   964   C  CZ  . ARG A 1 134 ? -47.841 47.309  44.424  1.00 11.10 ? 134 ARG A CZ  1 
ATOM   965   N  NH1 . ARG A 1 134 ? -48.748 48.236  44.133  1.00 9.83  ? 134 ARG A NH1 1 
ATOM   966   N  NH2 . ARG A 1 134 ? -47.331 46.563  43.451  1.00 8.84  ? 134 ARG A NH2 1 
ATOM   967   N  N   . LEU A 1 135 ? -45.090 49.287  50.201  1.00 6.63  ? 135 LEU A N   1 
ATOM   968   C  CA  . LEU A 1 135 ? -44.301 50.493  50.005  1.00 6.23  ? 135 LEU A CA  1 
ATOM   969   C  C   . LEU A 1 135 ? -44.433 50.822  48.521  1.00 6.04  ? 135 LEU A C   1 
ATOM   970   O  O   . LEU A 1 135 ? -43.988 50.053  47.667  1.00 8.40  ? 135 LEU A O   1 
ATOM   971   C  CB  . LEU A 1 135 ? -42.833 50.245  50.359  1.00 6.51  ? 135 LEU A CB  1 
ATOM   972   C  CG  . LEU A 1 135 ? -41.890 51.423  50.097  1.00 7.47  ? 135 LEU A CG  1 
ATOM   973   C  CD1 . LEU A 1 135 ? -42.282 52.604  50.983  1.00 7.18  ? 135 LEU A CD1 1 
ATOM   974   C  CD2 . LEU A 1 135 ? -40.445 51.001  50.377  1.00 7.26  ? 135 LEU A CD2 1 
ATOM   975   N  N   . GLU A 1 136 ? -45.057 51.954  48.220  1.00 5.55  ? 136 GLU A N   1 
ATOM   976   C  CA  . GLU A 1 136 ? -45.276 52.370  46.835  1.00 8.05  ? 136 GLU A CA  1 
ATOM   977   C  C   . GLU A 1 136 ? -44.146 53.182  46.209  1.00 8.08  ? 136 GLU A C   1 
ATOM   978   O  O   . GLU A 1 136 ? -43.817 52.995  45.034  1.00 6.89  ? 136 GLU A O   1 
ATOM   979   C  CB  . GLU A 1 136 ? -46.572 53.181  46.743  1.00 7.79  ? 136 GLU A CB  1 
ATOM   980   C  CG  . GLU A 1 136 ? -47.828 52.363  46.946  1.00 8.62  ? 136 GLU A CG  1 
ATOM   981   C  CD  . GLU A 1 136 ? -48.165 51.505  45.742  1.00 10.42 ? 136 GLU A CD  1 
ATOM   982   O  OE1 . GLU A 1 136 ? -47.453 51.599  44.715  1.00 11.74 ? 136 GLU A OE1 1 
ATOM   983   O  OE2 . GLU A 1 136 ? -49.150 50.741  45.820  1.00 10.71 ? 136 GLU A OE2 1 
ATOM   984   N  N   . ASP A 1 137 ? -43.558 54.090  46.981  1.00 8.57  ? 137 ASP A N   1 
ATOM   985   C  CA  . ASP A 1 137 ? -42.494 54.930  46.445  1.00 7.90  ? 137 ASP A CA  1 
ATOM   986   C  C   . ASP A 1 137 ? -41.600 55.466  47.548  1.00 9.07  ? 137 ASP A C   1 
ATOM   987   O  O   . ASP A 1 137 ? -41.925 55.372  48.731  1.00 8.69  ? 137 ASP A O   1 
ATOM   988   C  CB  . ASP A 1 137 ? -43.105 56.096  45.658  1.00 7.44  ? 137 ASP A CB  1 
ATOM   989   C  CG  . ASP A 1 137 ? -42.146 56.688  44.633  1.00 8.91  ? 137 ASP A CG  1 
ATOM   990   O  OD1 . ASP A 1 137 ? -40.977 56.245  44.557  1.00 8.30  ? 137 ASP A OD1 1 
ATOM   991   O  OD2 . ASP A 1 137 ? -42.569 57.602  43.894  1.00 9.06  ? 137 ASP A OD2 1 
ATOM   992   N  N   . LEU A 1 138 ? -40.481 56.055  47.142  1.00 10.10 ? 138 LEU A N   1 
ATOM   993   C  CA  . LEU A 1 138 ? -39.500 56.591  48.071  1.00 9.78  ? 138 LEU A CA  1 
ATOM   994   C  C   . LEU A 1 138 ? -38.846 57.818  47.437  1.00 10.02 ? 138 LEU A C   1 
ATOM   995   O  O   . LEU A 1 138 ? -38.440 57.772  46.274  1.00 12.40 ? 138 LEU A O   1 
ATOM   996   C  CB  . LEU A 1 138 ? -38.441 55.510  48.329  1.00 11.61 ? 138 LEU A CB  1 
ATOM   997   C  CG  . LEU A 1 138 ? -37.969 55.079  49.721  1.00 14.38 ? 138 LEU A CG  1 
ATOM   998   C  CD1 . LEU A 1 138 ? -39.121 54.997  50.703  1.00 13.27 ? 138 LEU A CD1 1 
ATOM   999   C  CD2 . LEU A 1 138 ? -37.280 53.726  49.586  1.00 13.37 ? 138 LEU A CD2 1 
ATOM   1000  N  N   . ARG A 1 139 ? -38.767 58.917  48.179  1.00 7.54  ? 139 ARG A N   1 
ATOM   1001  C  CA  . ARG A 1 139 ? -38.116 60.122  47.673  1.00 8.20  ? 139 ARG A CA  1 
ATOM   1002  C  C   . ARG A 1 139 ? -36.723 60.111  48.290  1.00 8.48  ? 139 ARG A C   1 
ATOM   1003  O  O   . ARG A 1 139 ? -36.566 60.359  49.482  1.00 8.38  ? 139 ARG A O   1 
ATOM   1004  C  CB  . ARG A 1 139 ? -38.868 61.392  48.107  1.00 7.53  ? 139 ARG A CB  1 
ATOM   1005  C  CG  . ARG A 1 139 ? -38.434 62.683  47.384  1.00 5.56  ? 139 ARG A CG  1 
ATOM   1006  C  CD  . ARG A 1 139 ? -37.029 63.167  47.774  1.00 6.19  ? 139 ARG A CD  1 
ATOM   1007  N  NE  . ARG A 1 139 ? -36.955 63.620  49.164  1.00 7.91  ? 139 ARG A NE  1 
ATOM   1008  C  CZ  . ARG A 1 139 ? -37.368 64.812  49.588  1.00 10.07 ? 139 ARG A CZ  1 
ATOM   1009  N  NH1 . ARG A 1 139 ? -37.883 65.686  48.730  1.00 9.02  ? 139 ARG A NH1 1 
ATOM   1010  N  NH2 . ARG A 1 139 ? -37.282 65.127  50.876  1.00 8.18  ? 139 ARG A NH2 1 
ATOM   1011  N  N   . ILE A 1 140 ? -35.718 59.788  47.482  1.00 9.40  ? 140 ILE A N   1 
ATOM   1012  C  CA  . ILE A 1 140 ? -34.344 59.748  47.956  1.00 9.71  ? 140 ILE A CA  1 
ATOM   1013  C  C   . ILE A 1 140 ? -33.746 61.143  47.780  1.00 9.19  ? 140 ILE A C   1 
ATOM   1014  O  O   . ILE A 1 140 ? -33.605 61.629  46.657  1.00 9.38  ? 140 ILE A O   1 
ATOM   1015  C  CB  . ILE A 1 140 ? -33.493 58.740  47.146  1.00 10.91 ? 140 ILE A CB  1 
ATOM   1016  C  CG1 . ILE A 1 140 ? -34.273 57.438  46.917  1.00 12.20 ? 140 ILE A CG1 1 
ATOM   1017  C  CG2 . ILE A 1 140 ? -32.196 58.447  47.892  1.00 11.35 ? 140 ILE A CG2 1 
ATOM   1018  C  CD1 . ILE A 1 140 ? -34.576 56.658  48.169  1.00 16.89 ? 140 ILE A CD1 1 
ATOM   1019  N  N   . PRO A 1 141 ? -33.392 61.807  48.887  1.00 8.60  ? 141 PRO A N   1 
ATOM   1020  C  CA  . PRO A 1 141 ? -32.814 63.152  48.794  1.00 8.87  ? 141 PRO A CA  1 
ATOM   1021  C  C   . PRO A 1 141 ? -31.458 63.149  48.078  1.00 8.42  ? 141 PRO A C   1 
ATOM   1022  O  O   . PRO A 1 141 ? -30.708 62.177  48.166  1.00 6.33  ? 141 PRO A O   1 
ATOM   1023  C  CB  . PRO A 1 141 ? -32.712 63.575  50.254  1.00 9.47  ? 141 PRO A CB  1 
ATOM   1024  C  CG  . PRO A 1 141 ? -32.408 62.277  50.947  1.00 10.79 ? 141 PRO A CG  1 
ATOM   1025  C  CD  . PRO A 1 141 ? -33.388 61.326  50.281  1.00 10.88 ? 141 PRO A CD  1 
ATOM   1026  N  N   . VAL A 1 142 ? -31.147 64.240  47.381  1.00 8.67  ? 142 VAL A N   1 
ATOM   1027  C  CA  . VAL A 1 142 ? -29.890 64.336  46.645  1.00 10.18 ? 142 VAL A CA  1 
ATOM   1028  C  C   . VAL A 1 142 ? -28.656 64.192  47.535  1.00 10.07 ? 142 VAL A C   1 
ATOM   1029  O  O   . VAL A 1 142 ? -27.633 63.673  47.092  1.00 11.51 ? 142 VAL A O   1 
ATOM   1030  C  CB  . VAL A 1 142 ? -29.805 65.663  45.839  1.00 10.87 ? 142 VAL A CB  1 
ATOM   1031  C  CG1 . VAL A 1 142 ? -30.981 65.748  44.872  1.00 12.34 ? 142 VAL A CG1 1 
ATOM   1032  C  CG2 . VAL A 1 142 ? -29.798 66.862  46.773  1.00 11.08 ? 142 VAL A CG2 1 
ATOM   1033  N  N   . ALA A 1 143 ? -28.753 64.633  48.788  1.00 8.57  ? 143 ALA A N   1 
ATOM   1034  C  CA  . ALA A 1 143 ? -27.623 64.523  49.708  1.00 8.30  ? 143 ALA A CA  1 
ATOM   1035  C  C   . ALA A 1 143 ? -27.296 63.060  49.992  1.00 8.28  ? 143 ALA A C   1 
ATOM   1036  O  O   . ALA A 1 143 ? -26.148 62.725  50.272  1.00 7.27  ? 143 ALA A O   1 
ATOM   1037  C  CB  . ALA A 1 143 ? -27.921 65.254  51.015  1.00 9.14  ? 143 ALA A CB  1 
ATOM   1038  N  N   . TYR A 1 144 ? -28.304 62.190  49.919  1.00 6.65  ? 144 TYR A N   1 
ATOM   1039  C  CA  . TYR A 1 144 ? -28.084 60.768  50.160  1.00 6.62  ? 144 TYR A CA  1 
ATOM   1040  C  C   . TYR A 1 144 ? -27.652 60.098  48.854  1.00 7.02  ? 144 TYR A C   1 
ATOM   1041  O  O   . TYR A 1 144 ? -26.805 59.200  48.858  1.00 6.96  ? 144 TYR A O   1 
ATOM   1042  C  CB  . TYR A 1 144 ? -29.356 60.106  50.709  1.00 6.63  ? 144 TYR A CB  1 
ATOM   1043  C  CG  . TYR A 1 144 ? -29.139 58.706  51.255  1.00 7.19  ? 144 TYR A CG  1 
ATOM   1044  C  CD1 . TYR A 1 144 ? -28.125 58.446  52.180  1.00 8.21  ? 144 TYR A CD1 1 
ATOM   1045  C  CD2 . TYR A 1 144 ? -29.951 57.645  50.855  1.00 8.84  ? 144 TYR A CD2 1 
ATOM   1046  C  CE1 . TYR A 1 144 ? -27.923 57.158  52.697  1.00 8.19  ? 144 TYR A CE1 1 
ATOM   1047  C  CE2 . TYR A 1 144 ? -29.764 56.357  51.364  1.00 7.29  ? 144 TYR A CE2 1 
ATOM   1048  C  CZ  . TYR A 1 144 ? -28.749 56.122  52.284  1.00 8.77  ? 144 TYR A CZ  1 
ATOM   1049  O  OH  . TYR A 1 144 ? -28.568 54.856  52.789  1.00 6.68  ? 144 TYR A OH  1 
ATOM   1050  N  N   . VAL A 1 145 ? -28.226 60.541  47.738  1.00 6.90  ? 145 VAL A N   1 
ATOM   1051  C  CA  . VAL A 1 145 ? -27.868 59.984  46.435  1.00 6.81  ? 145 VAL A CA  1 
ATOM   1052  C  C   . VAL A 1 145 ? -26.355 60.092  46.185  1.00 6.88  ? 145 VAL A C   1 
ATOM   1053  O  O   . VAL A 1 145 ? -25.745 59.169  45.645  1.00 6.06  ? 145 VAL A O   1 
ATOM   1054  C  CB  . VAL A 1 145 ? -28.620 60.710  45.283  1.00 7.85  ? 145 VAL A CB  1 
ATOM   1055  C  CG1 . VAL A 1 145 ? -28.040 60.299  43.924  1.00 6.16  ? 145 VAL A CG1 1 
ATOM   1056  C  CG2 . VAL A 1 145 ? -30.113 60.365  45.335  1.00 5.89  ? 145 VAL A CG2 1 
ATOM   1057  N  N   . LYS A 1 146 ? -25.753 61.213  46.582  1.00 7.95  ? 146 LYS A N   1 
ATOM   1058  C  CA  . LYS A 1 146 ? -24.320 61.430  46.379  1.00 8.99  ? 146 LYS A CA  1 
ATOM   1059  C  C   . LYS A 1 146 ? -23.393 60.513  47.180  1.00 9.81  ? 146 LYS A C   1 
ATOM   1060  O  O   . LYS A 1 146 ? -22.185 60.527  46.967  1.00 11.88 ? 146 LYS A O   1 
ATOM   1061  C  CB  . LYS A 1 146 ? -23.952 62.894  46.663  1.00 8.84  ? 146 LYS A CB  1 
ATOM   1062  C  CG  . LYS A 1 146 ? -24.485 63.885  45.631  1.00 8.90  ? 146 LYS A CG  1 
ATOM   1063  C  CD  . LYS A 1 146 ? -23.898 63.628  44.240  1.00 9.62  ? 146 LYS A CD  1 
ATOM   1064  C  CE  . LYS A 1 146 ? -22.406 63.929  44.193  1.00 11.00 ? 146 LYS A CE  1 
ATOM   1065  N  NZ  . LYS A 1 146 ? -21.846 63.729  42.826  1.00 14.15 ? 146 LYS A NZ  1 
ATOM   1066  N  N   . THR A 1 147 ? -23.942 59.715  48.093  1.00 10.29 ? 147 THR A N   1 
ATOM   1067  C  CA  . THR A 1 147 ? -23.107 58.805  48.880  1.00 8.09  ? 147 THR A CA  1 
ATOM   1068  C  C   . THR A 1 147 ? -22.969 57.463  48.172  1.00 9.08  ? 147 THR A C   1 
ATOM   1069  O  O   . THR A 1 147 ? -22.309 56.555  48.674  1.00 10.22 ? 147 THR A O   1 
ATOM   1070  C  CB  . THR A 1 147 ? -23.695 58.549  50.291  1.00 6.74  ? 147 THR A CB  1 
ATOM   1071  O  OG1 . THR A 1 147 ? -24.926 57.820  50.179  1.00 6.94  ? 147 THR A OG1 1 
ATOM   1072  C  CG2 . THR A 1 147 ? -23.951 59.860  51.008  1.00 6.39  ? 147 THR A CG2 1 
ATOM   1073  N  N   . PHE A 1 148 ? -23.594 57.342  47.002  1.00 10.00 ? 148 PHE A N   1 
ATOM   1074  C  CA  . PHE A 1 148 ? -23.548 56.106  46.226  1.00 9.58  ? 148 PHE A CA  1 
ATOM   1075  C  C   . PHE A 1 148 ? -22.744 56.242  44.939  1.00 10.14 ? 148 PHE A C   1 
ATOM   1076  O  O   . PHE A 1 148 ? -22.685 57.318  44.341  1.00 9.29  ? 148 PHE A O   1 
ATOM   1077  C  CB  . PHE A 1 148 ? -24.962 55.644  45.845  1.00 9.66  ? 148 PHE A CB  1 
ATOM   1078  C  CG  . PHE A 1 148 ? -25.810 55.226  47.010  1.00 9.74  ? 148 PHE A CG  1 
ATOM   1079  C  CD1 . PHE A 1 148 ? -26.505 56.169  47.761  1.00 8.35  ? 148 PHE A CD1 1 
ATOM   1080  C  CD2 . PHE A 1 148 ? -25.914 53.882  47.356  1.00 9.79  ? 148 PHE A CD2 1 
ATOM   1081  C  CE1 . PHE A 1 148 ? -27.290 55.775  48.847  1.00 9.98  ? 148 PHE A CE1 1 
ATOM   1082  C  CE2 . PHE A 1 148 ? -26.695 53.478  48.437  1.00 9.01  ? 148 PHE A CE2 1 
ATOM   1083  C  CZ  . PHE A 1 148 ? -27.384 54.421  49.183  1.00 9.85  ? 148 PHE A CZ  1 
ATOM   1084  N  N   . GLN A 1 149 ? -22.135 55.144  44.503  1.00 8.13  ? 149 GLN A N   1 
ATOM   1085  C  CA  . GLN A 1 149 ? -21.378 55.170  43.258  1.00 10.91 ? 149 GLN A CA  1 
ATOM   1086  C  C   . GLN A 1 149 ? -22.345 55.202  42.080  1.00 9.68  ? 149 GLN A C   1 
ATOM   1087  O  O   . GLN A 1 149 ? -22.115 55.902  41.096  1.00 10.83 ? 149 GLN A O   1 
ATOM   1088  C  CB  . GLN A 1 149 ? -20.484 53.931  43.120  1.00 10.43 ? 149 GLN A CB  1 
ATOM   1089  C  CG  . GLN A 1 149 ? -19.816 53.840  41.748  1.00 10.92 ? 149 GLN A CG  1 
ATOM   1090  C  CD  . GLN A 1 149 ? -19.246 52.465  41.441  1.00 11.88 ? 149 GLN A CD  1 
ATOM   1091  O  OE1 . GLN A 1 149 ? -18.164 52.112  41.901  1.00 13.42 ? 149 GLN A OE1 1 
ATOM   1092  N  NE2 . GLN A 1 149 ? -19.984 51.678  40.661  1.00 9.41  ? 149 GLN A NE2 1 
ATOM   1093  N  N   . GLY A 1 150 ? -23.430 54.440  42.190  1.00 9.25  ? 150 GLY A N   1 
ATOM   1094  C  CA  . GLY A 1 150 ? -24.402 54.370  41.114  1.00 9.73  ? 150 GLY A CA  1 
ATOM   1095  C  C   . GLY A 1 150 ? -23.927 53.391  40.054  1.00 9.14  ? 150 GLY A C   1 
ATOM   1096  O  O   . GLY A 1 150 ? -23.047 52.576  40.327  1.00 8.32  ? 150 GLY A O   1 
ATOM   1097  N  N   . PRO A 1 151 ? -24.485 53.439  38.836  1.00 8.40  ? 151 PRO A N   1 
ATOM   1098  C  CA  . PRO A 1 151 ? -24.077 52.530  37.761  1.00 8.88  ? 151 PRO A CA  1 
ATOM   1099  C  C   . PRO A 1 151 ? -22.575 52.586  37.502  1.00 9.36  ? 151 PRO A C   1 
ATOM   1100  O  O   . PRO A 1 151 ? -21.976 53.661  37.523  1.00 10.73 ? 151 PRO A O   1 
ATOM   1101  C  CB  . PRO A 1 151 ? -24.873 53.037  36.564  1.00 10.33 ? 151 PRO A CB  1 
ATOM   1102  C  CG  . PRO A 1 151 ? -26.130 53.549  37.197  1.00 9.20  ? 151 PRO A CG  1 
ATOM   1103  C  CD  . PRO A 1 151 ? -25.605 54.292  38.404  1.00 8.48  ? 151 PRO A CD  1 
ATOM   1104  N  N   . PRO A 1 152 ? -21.944 51.427  37.258  1.00 8.54  ? 152 PRO A N   1 
ATOM   1105  C  CA  . PRO A 1 152 ? -20.502 51.443  37.001  1.00 7.41  ? 152 PRO A CA  1 
ATOM   1106  C  C   . PRO A 1 152 ? -20.177 52.326  35.797  1.00 7.36  ? 152 PRO A C   1 
ATOM   1107  O  O   . PRO A 1 152 ? -19.126 52.964  35.752  1.00 7.53  ? 152 PRO A O   1 
ATOM   1108  C  CB  . PRO A 1 152 ? -20.182 49.973  36.747  1.00 7.52  ? 152 PRO A CB  1 
ATOM   1109  C  CG  . PRO A 1 152 ? -21.175 49.268  37.610  1.00 8.26  ? 152 PRO A CG  1 
ATOM   1110  C  CD  . PRO A 1 152 ? -22.445 50.045  37.351  1.00 6.41  ? 152 PRO A CD  1 
ATOM   1111  N  N   . HIS A 1 153 ? -21.091 52.371  34.827  1.00 6.47  ? 153 HIS A N   1 
ATOM   1112  C  CA  . HIS A 1 153 ? -20.877 53.177  33.631  1.00 6.99  ? 153 HIS A CA  1 
ATOM   1113  C  C   . HIS A 1 153 ? -22.075 54.022  33.217  1.00 6.97  ? 153 HIS A C   1 
ATOM   1114  O  O   . HIS A 1 153 ? -21.976 55.244  33.138  1.00 7.32  ? 153 HIS A O   1 
ATOM   1115  C  CB  . HIS A 1 153 ? -20.437 52.273  32.477  1.00 7.12  ? 153 HIS A CB  1 
ATOM   1116  C  CG  . HIS A 1 153 ? -19.188 51.507  32.776  1.00 6.60  ? 153 HIS A CG  1 
ATOM   1117  N  ND1 . HIS A 1 153 ? -19.209 50.228  33.294  1.00 7.08  ? 153 HIS A ND1 1 
ATOM   1118  C  CD2 . HIS A 1 153 ? -17.887 51.873  32.733  1.00 5.93  ? 153 HIS A CD2 1 
ATOM   1119  C  CE1 . HIS A 1 153 ? -17.971 49.844  33.559  1.00 7.97  ? 153 HIS A CE1 1 
ATOM   1120  N  NE2 . HIS A 1 153 ? -17.152 50.826  33.229  1.00 8.51  ? 153 HIS A NE2 1 
ATOM   1121  N  N   . GLY A 1 154 ? -23.208 53.379  32.954  1.00 7.06  ? 154 GLY A N   1 
ATOM   1122  C  CA  . GLY A 1 154 ? -24.380 54.136  32.557  1.00 4.88  ? 154 GLY A CA  1 
ATOM   1123  C  C   . GLY A 1 154 ? -24.546 54.179  31.051  1.00 6.94  ? 154 GLY A C   1 
ATOM   1124  O  O   . GLY A 1 154 ? -23.622 53.849  30.304  1.00 5.76  ? 154 GLY A O   1 
ATOM   1125  N  N   . ILE A 1 155 ? -25.721 54.620  30.614  1.00 5.38  ? 155 ILE A N   1 
ATOM   1126  C  CA  . ILE A 1 155 ? -26.077 54.687  29.201  1.00 6.48  ? 155 ILE A CA  1 
ATOM   1127  C  C   . ILE A 1 155 ? -25.057 55.321  28.259  1.00 8.10  ? 155 ILE A C   1 
ATOM   1128  O  O   . ILE A 1 155 ? -24.625 54.691  27.296  1.00 7.50  ? 155 ILE A O   1 
ATOM   1129  C  CB  . ILE A 1 155 ? -27.442 55.404  29.026  1.00 5.04  ? 155 ILE A CB  1 
ATOM   1130  C  CG1 . ILE A 1 155 ? -28.512 54.663  29.835  1.00 6.25  ? 155 ILE A CG1 1 
ATOM   1131  C  CG2 . ILE A 1 155 ? -27.835 55.445  27.550  1.00 4.28  ? 155 ILE A CG2 1 
ATOM   1132  C  CD1 . ILE A 1 155 ? -29.868 55.349  29.857  1.00 5.75  ? 155 ILE A CD1 1 
ATOM   1133  N  N   . GLN A 1 156 ? -24.678 56.564  28.529  1.00 7.60  ? 156 GLN A N   1 
ATOM   1134  C  CA  . GLN A 1 156 ? -23.722 57.269  27.682  1.00 8.95  ? 156 GLN A CA  1 
ATOM   1135  C  C   . GLN A 1 156 ? -22.417 56.498  27.490  1.00 8.41  ? 156 GLN A C   1 
ATOM   1136  O  O   . GLN A 1 156 ? -21.996 56.232  26.363  1.00 8.11  ? 156 GLN A O   1 
ATOM   1137  C  CB  . GLN A 1 156 ? -23.400 58.634  28.286  1.00 10.72 ? 156 GLN A CB  1 
ATOM   1138  C  CG  . GLN A 1 156 ? -22.433 59.462  27.453  1.00 13.53 ? 156 GLN A CG  1 
ATOM   1139  C  CD  . GLN A 1 156 ? -21.665 60.466  28.291  1.00 15.05 ? 156 GLN A CD  1 
ATOM   1140  O  OE1 . GLN A 1 156 ? -20.756 60.101  29.040  1.00 15.27 ? 156 GLN A OE1 1 
ATOM   1141  N  NE2 . GLN A 1 156 ? -22.033 61.735  28.180  1.00 12.23 ? 156 GLN A NE2 1 
ATOM   1142  N  N   . VAL A 1 157 ? -21.773 56.152  28.600  1.00 7.92  ? 157 VAL A N   1 
ATOM   1143  C  CA  . VAL A 1 157 ? -20.506 55.434  28.550  1.00 6.91  ? 157 VAL A CA  1 
ATOM   1144  C  C   . VAL A 1 157 ? -20.621 54.068  27.880  1.00 6.92  ? 157 VAL A C   1 
ATOM   1145  O  O   . VAL A 1 157 ? -19.721 53.667  27.138  1.00 7.75  ? 157 VAL A O   1 
ATOM   1146  C  CB  . VAL A 1 157 ? -19.910 55.261  29.974  1.00 9.15  ? 157 VAL A CB  1 
ATOM   1147  C  CG1 . VAL A 1 157 ? -18.638 54.410  29.919  1.00 6.77  ? 157 VAL A CG1 1 
ATOM   1148  C  CG2 . VAL A 1 157 ? -19.601 56.634  30.579  1.00 8.40  ? 157 VAL A CG2 1 
ATOM   1149  N  N   . GLU A 1 158 ? -21.720 53.355  28.128  1.00 6.30  ? 158 GLU A N   1 
ATOM   1150  C  CA  . GLU A 1 158 ? -21.891 52.037  27.528  1.00 6.65  ? 158 GLU A CA  1 
ATOM   1151  C  C   . GLU A 1 158 ? -21.946 52.127  26.010  1.00 7.73  ? 158 GLU A C   1 
ATOM   1152  O  O   . GLU A 1 158 ? -21.276 51.368  25.312  1.00 8.58  ? 158 GLU A O   1 
ATOM   1153  C  CB  . GLU A 1 158 ? -23.159 51.347  28.045  1.00 7.58  ? 158 GLU A CB  1 
ATOM   1154  C  CG  . GLU A 1 158 ? -23.402 50.003  27.370  1.00 6.85  ? 158 GLU A CG  1 
ATOM   1155  C  CD  . GLU A 1 158 ? -24.412 49.126  28.089  1.00 10.22 ? 158 GLU A CD  1 
ATOM   1156  O  OE1 . GLU A 1 158 ? -24.874 49.508  29.186  1.00 8.09  ? 158 GLU A OE1 1 
ATOM   1157  O  OE2 . GLU A 1 158 ? -24.734 48.041  27.552  1.00 5.97  ? 158 GLU A OE2 1 
ATOM   1158  N  N   . ARG A 1 159 ? -22.749 53.054  25.500  1.00 5.97  ? 159 ARG A N   1 
ATOM   1159  C  CA  . ARG A 1 159 ? -22.859 53.232  24.059  1.00 6.63  ? 159 ARG A CA  1 
ATOM   1160  C  C   . ARG A 1 159 ? -21.506 53.627  23.463  1.00 6.26  ? 159 ARG A C   1 
ATOM   1161  O  O   . ARG A 1 159 ? -21.151 53.188  22.365  1.00 5.76  ? 159 ARG A O   1 
ATOM   1162  C  CB  . ARG A 1 159 ? -23.913 54.302  23.732  1.00 7.43  ? 159 ARG A CB  1 
ATOM   1163  C  CG  . ARG A 1 159 ? -25.365 53.819  23.836  1.00 4.89  ? 159 ARG A CG  1 
ATOM   1164  C  CD  . ARG A 1 159 ? -26.331 54.885  23.331  1.00 6.17  ? 159 ARG A CD  1 
ATOM   1165  N  NE  . ARG A 1 159 ? -27.716 54.416  23.213  1.00 6.55  ? 159 ARG A NE  1 
ATOM   1166  C  CZ  . ARG A 1 159 ? -28.140 53.530  22.315  1.00 6.67  ? 159 ARG A CZ  1 
ATOM   1167  N  NH1 . ARG A 1 159 ? -27.293 52.998  21.447  1.00 6.67  ? 159 ARG A NH1 1 
ATOM   1168  N  NH2 . ARG A 1 159 ? -29.422 53.189  22.270  1.00 8.51  ? 159 ARG A NH2 1 
ATOM   1169  N  N   . ASP A 1 160 ? -20.748 54.448  24.190  1.00 6.70  ? 160 ASP A N   1 
ATOM   1170  C  CA  . ASP A 1 160 ? -19.442 54.889  23.709  1.00 7.74  ? 160 ASP A CA  1 
ATOM   1171  C  C   . ASP A 1 160 ? -18.416 53.761  23.688  1.00 7.98  ? 160 ASP A C   1 
ATOM   1172  O  O   . ASP A 1 160 ? -17.572 53.706  22.795  1.00 8.85  ? 160 ASP A O   1 
ATOM   1173  C  CB  . ASP A 1 160 ? -18.908 56.056  24.554  1.00 6.16  ? 160 ASP A CB  1 
ATOM   1174  C  CG  . ASP A 1 160 ? -19.661 57.354  24.303  1.00 9.88  ? 160 ASP A CG  1 
ATOM   1175  O  OD1 . ASP A 1 160 ? -20.256 57.500  23.211  1.00 9.12  ? 160 ASP A OD1 1 
ATOM   1176  O  OD2 . ASP A 1 160 ? -19.644 58.237  25.190  1.00 6.76  ? 160 ASP A OD2 1 
ATOM   1177  N  N   . LYS A 1 161 ? -18.489 52.862  24.664  1.00 8.63  ? 161 LYS A N   1 
ATOM   1178  C  CA  . LYS A 1 161 ? -17.557 51.735  24.738  1.00 9.78  ? 161 LYS A CA  1 
ATOM   1179  C  C   . LYS A 1 161 ? -17.841 50.713  23.638  1.00 9.63  ? 161 LYS A C   1 
ATOM   1180  O  O   . LYS A 1 161 ? -16.920 50.173  23.028  1.00 10.28 ? 161 LYS A O   1 
ATOM   1181  C  CB  . LYS A 1 161 ? -17.669 51.030  26.094  1.00 10.19 ? 161 LYS A CB  1 
ATOM   1182  C  CG  . LYS A 1 161 ? -17.208 51.840  27.304  1.00 13.01 ? 161 LYS A CG  1 
ATOM   1183  C  CD  . LYS A 1 161 ? -15.695 51.905  27.407  1.00 14.33 ? 161 LYS A CD  1 
ATOM   1184  C  CE  . LYS A 1 161 ? -15.251 52.554  28.719  1.00 14.57 ? 161 LYS A CE  1 
ATOM   1185  N  NZ  . LYS A 1 161 ? -15.625 51.742  29.914  1.00 13.33 ? 161 LYS A NZ  1 
ATOM   1186  N  N   . LEU A 1 162 ? -19.123 50.457  23.393  1.00 9.64  ? 162 LEU A N   1 
ATOM   1187  C  CA  . LEU A 1 162 ? -19.541 49.481  22.393  1.00 10.14 ? 162 LEU A CA  1 
ATOM   1188  C  C   . LEU A 1 162 ? -19.668 50.058  20.991  1.00 10.43 ? 162 LEU A C   1 
ATOM   1189  O  O   . LEU A 1 162 ? -19.783 49.311  20.023  1.00 11.18 ? 162 LEU A O   1 
ATOM   1190  C  CB  . LEU A 1 162 ? -20.878 48.856  22.805  1.00 10.27 ? 162 LEU A CB  1 
ATOM   1191  C  CG  . LEU A 1 162 ? -20.944 48.266  24.216  1.00 13.91 ? 162 LEU A CG  1 
ATOM   1192  C  CD1 . LEU A 1 162 ? -22.315 47.644  24.444  1.00 13.56 ? 162 LEU A CD1 1 
ATOM   1193  C  CD2 . LEU A 1 162 ? -19.848 47.227  24.395  1.00 14.99 ? 162 LEU A CD2 1 
ATOM   1194  N  N   . ASN A 1 163 ? -19.656 51.383  20.888  1.00 11.66 ? 163 ASN A N   1 
ATOM   1195  C  CA  . ASN A 1 163 ? -19.762 52.055  19.598  1.00 12.59 ? 163 ASN A CA  1 
ATOM   1196  C  C   . ASN A 1 163 ? -21.104 51.727  18.938  1.00 12.36 ? 163 ASN A C   1 
ATOM   1197  O  O   . ASN A 1 163 ? -21.169 51.425  17.747  1.00 14.13 ? 163 ASN A O   1 
ATOM   1198  C  CB  . ASN A 1 163 ? -18.593 51.628  18.697  1.00 15.05 ? 163 ASN A CB  1 
ATOM   1199  C  CG  . ASN A 1 163 ? -18.206 52.697  17.682  1.00 18.52 ? 163 ASN A CG  1 
ATOM   1200  O  OD1 . ASN A 1 163 ? -18.228 53.890  17.982  1.00 19.69 ? 163 ASN A OD1 1 
ATOM   1201  N  ND2 . ASN A 1 163 ? -17.826 52.269  16.483  1.00 18.57 ? 163 ASN A ND2 1 
ATOM   1202  N  N   . LYS A 1 164 ? -22.174 51.796  19.725  1.00 10.25 ? 164 LYS A N   1 
ATOM   1203  C  CA  . LYS A 1 164 ? -23.518 51.508  19.233  1.00 9.75  ? 164 LYS A CA  1 
ATOM   1204  C  C   . LYS A 1 164 ? -24.454 52.681  19.508  1.00 8.33  ? 164 LYS A C   1 
ATOM   1205  O  O   . LYS A 1 164 ? -24.632 53.090  20.657  1.00 9.55  ? 164 LYS A O   1 
ATOM   1206  C  CB  . LYS A 1 164 ? -24.041 50.226  19.882  1.00 10.04 ? 164 LYS A CB  1 
ATOM   1207  C  CG  . LYS A 1 164 ? -23.228 48.996  19.488  1.00 9.01  ? 164 LYS A CG  1 
ATOM   1208  C  CD  . LYS A 1 164 ? -23.700 47.738  20.190  1.00 9.10  ? 164 LYS A CD  1 
ATOM   1209  C  CE  . LYS A 1 164 ? -22.773 46.555  19.891  1.00 7.33  ? 164 LYS A CE  1 
ATOM   1210  N  NZ  . LYS A 1 164 ? -22.863 46.064  18.481  1.00 4.81  ? 164 LYS A NZ  1 
ATOM   1211  N  N   . TYR A 1 165 ? -25.047 53.215  18.443  1.00 7.64  ? 165 TYR A N   1 
ATOM   1212  C  CA  . TYR A 1 165 ? -25.940 54.371  18.542  1.00 8.18  ? 165 TYR A CA  1 
ATOM   1213  C  C   . TYR A 1 165 ? -27.120 54.299  17.574  1.00 9.16  ? 165 TYR A C   1 
ATOM   1214  O  O   . TYR A 1 165 ? -27.079 53.577  16.578  1.00 8.95  ? 165 TYR A O   1 
ATOM   1215  C  CB  . TYR A 1 165 ? -25.165 55.656  18.213  1.00 8.06  ? 165 TYR A CB  1 
ATOM   1216  C  CG  . TYR A 1 165 ? -23.832 55.824  18.916  1.00 10.64 ? 165 TYR A CG  1 
ATOM   1217  C  CD1 . TYR A 1 165 ? -23.765 56.315  20.222  1.00 8.45  ? 165 TYR A CD1 1 
ATOM   1218  C  CD2 . TYR A 1 165 ? -22.635 55.515  18.265  1.00 8.87  ? 165 TYR A CD2 1 
ATOM   1219  C  CE1 . TYR A 1 165 ? -22.536 56.498  20.862  1.00 8.75  ? 165 TYR A CE1 1 
ATOM   1220  C  CE2 . TYR A 1 165 ? -21.402 55.691  18.897  1.00 10.69 ? 165 TYR A CE2 1 
ATOM   1221  C  CZ  . TYR A 1 165 ? -21.362 56.185  20.193  1.00 8.09  ? 165 TYR A CZ  1 
ATOM   1222  O  OH  . TYR A 1 165 ? -20.149 56.388  20.811  1.00 11.81 ? 165 TYR A OH  1 
ATOM   1223  N  N   . GLY A 1 166 ? -28.165 55.067  17.877  1.00 10.06 ? 166 GLY A N   1 
ATOM   1224  C  CA  . GLY A 1 166 ? -29.323 55.153  17.002  1.00 10.13 ? 166 GLY A CA  1 
ATOM   1225  C  C   . GLY A 1 166 ? -30.381 54.068  16.973  1.00 10.00 ? 166 GLY A C   1 
ATOM   1226  O  O   . GLY A 1 166 ? -31.243 54.087  16.097  1.00 10.67 ? 166 GLY A O   1 
ATOM   1227  N  N   . ARG A 1 167 ? -30.334 53.131  17.910  1.00 9.95  ? 167 ARG A N   1 
ATOM   1228  C  CA  . ARG A 1 167 ? -31.325 52.057  17.940  1.00 9.90  ? 167 ARG A CA  1 
ATOM   1229  C  C   . ARG A 1 167 ? -31.239 51.309  19.253  1.00 9.38  ? 167 ARG A C   1 
ATOM   1230  O  O   . ARG A 1 167 ? -30.257 51.437  19.989  1.00 8.22  ? 167 ARG A O   1 
ATOM   1231  C  CB  . ARG A 1 167 ? -31.067 51.046  16.815  1.00 8.72  ? 167 ARG A CB  1 
ATOM   1232  C  CG  . ARG A 1 167 ? -29.793 50.218  17.020  1.00 8.73  ? 167 ARG A CG  1 
ATOM   1233  C  CD  . ARG A 1 167 ? -29.600 49.159  15.949  1.00 10.45 ? 167 ARG A CD  1 
ATOM   1234  N  NE  . ARG A 1 167 ? -28.279 48.527  16.018  1.00 11.71 ? 167 ARG A NE  1 
ATOM   1235  C  CZ  . ARG A 1 167 ? -27.949 47.519  16.823  1.00 13.68 ? 167 ARG A CZ  1 
ATOM   1236  N  NH1 . ARG A 1 167 ? -28.838 46.990  17.654  1.00 10.01 ? 167 ARG A NH1 1 
ATOM   1237  N  NH2 . ARG A 1 167 ? -26.711 47.040  16.802  1.00 11.73 ? 167 ARG A NH2 1 
ATOM   1238  N  N   . PRO A 1 168 ? -32.286 50.535  19.579  1.00 8.48  ? 168 PRO A N   1 
ATOM   1239  C  CA  . PRO A 1 168 ? -32.280 49.757  20.817  1.00 7.74  ? 168 PRO A CA  1 
ATOM   1240  C  C   . PRO A 1 168 ? -31.254 48.647  20.589  1.00 7.64  ? 168 PRO A C   1 
ATOM   1241  O  O   . PRO A 1 168 ? -30.995 48.268  19.441  1.00 7.72  ? 168 PRO A O   1 
ATOM   1242  C  CB  . PRO A 1 168 ? -33.700 49.196  20.882  1.00 6.39  ? 168 PRO A CB  1 
ATOM   1243  C  CG  . PRO A 1 168 ? -34.508 50.243  20.192  1.00 8.42  ? 168 PRO A CG  1 
ATOM   1244  C  CD  . PRO A 1 168 ? -33.642 50.592  19.004  1.00 8.02  ? 168 PRO A CD  1 
ATOM   1245  N  N   . LEU A 1 169 ? -30.659 48.136  21.660  1.00 8.57  ? 169 LEU A N   1 
ATOM   1246  C  CA  . LEU A 1 169 ? -29.692 47.052  21.524  1.00 8.74  ? 169 LEU A CA  1 
ATOM   1247  C  C   . LEU A 1 169 ? -30.494 45.751  21.529  1.00 9.42  ? 169 LEU A C   1 
ATOM   1248  O  O   . LEU A 1 169 ? -31.626 45.728  22.012  1.00 9.94  ? 169 LEU A O   1 
ATOM   1249  C  CB  . LEU A 1 169 ? -28.689 47.087  22.681  1.00 9.32  ? 169 LEU A CB  1 
ATOM   1250  C  CG  . LEU A 1 169 ? -27.950 48.426  22.821  1.00 12.00 ? 169 LEU A CG  1 
ATOM   1251  C  CD1 . LEU A 1 169 ? -26.925 48.338  23.936  1.00 14.51 ? 169 LEU A CD1 1 
ATOM   1252  C  CD2 . LEU A 1 169 ? -27.275 48.783  21.506  1.00 13.75 ? 169 LEU A CD2 1 
ATOM   1253  N  N   . LEU A 1 170 ? -29.920 44.680  20.983  1.00 8.48  ? 170 LEU A N   1 
ATOM   1254  C  CA  . LEU A 1 170 ? -30.608 43.392  20.910  1.00 7.98  ? 170 LEU A CA  1 
ATOM   1255  C  C   . LEU A 1 170 ? -29.888 42.267  21.650  1.00 10.35 ? 170 LEU A C   1 
ATOM   1256  O  O   . LEU A 1 170 ? -28.688 42.043  21.445  1.00 8.00  ? 170 LEU A O   1 
ATOM   1257  C  CB  . LEU A 1 170 ? -30.796 42.980  19.444  1.00 9.97  ? 170 LEU A CB  1 
ATOM   1258  C  CG  . LEU A 1 170 ? -31.783 43.786  18.599  1.00 11.50 ? 170 LEU A CG  1 
ATOM   1259  C  CD1 . LEU A 1 170 ? -31.605 43.444  17.125  1.00 12.14 ? 170 LEU A CD1 1 
ATOM   1260  C  CD2 . LEU A 1 170 ? -33.207 43.491  19.063  1.00 12.80 ? 170 LEU A CD2 1 
ATOM   1261  N  N   . GLY A 1 171 ? -30.638 41.557  22.492  1.00 8.77  ? 171 GLY A N   1 
ATOM   1262  C  CA  . GLY A 1 171 ? -30.077 40.460  23.259  1.00 10.53 ? 171 GLY A CA  1 
ATOM   1263  C  C   . GLY A 1 171 ? -30.851 39.169  23.069  1.00 10.48 ? 171 GLY A C   1 
ATOM   1264  O  O   . GLY A 1 171 ? -31.830 39.128  22.321  1.00 8.62  ? 171 GLY A O   1 
ATOM   1265  N  N   . CYS A 1 172 ? -30.423 38.119  23.763  1.00 10.63 ? 172 CYS A N   1 
ATOM   1266  C  CA  . CYS A 1 172 ? -31.055 36.807  23.655  1.00 10.20 ? 172 CYS A CA  1 
ATOM   1267  C  C   . CYS A 1 172 ? -30.594 35.858  24.757  1.00 10.95 ? 172 CYS A C   1 
ATOM   1268  O  O   . CYS A 1 172 ? -29.389 35.686  24.966  1.00 10.04 ? 172 CYS A O   1 
ATOM   1269  C  CB  . CYS A 1 172 ? -30.713 36.192  22.292  1.00 11.30 ? 172 CYS A CB  1 
ATOM   1270  S  SG  . CYS A 1 172 ? -30.850 34.381  22.183  1.00 11.00 ? 172 CYS A SG  1 
ATOM   1271  N  N   . THR A 1 173 ? -31.546 35.245  25.458  1.00 10.38 ? 173 THR A N   1 
ATOM   1272  C  CA  . THR A 1 173 ? -31.205 34.292  26.508  1.00 8.92  ? 173 THR A CA  1 
ATOM   1273  C  C   . THR A 1 173 ? -31.115 32.906  25.875  1.00 9.48  ? 173 THR A C   1 
ATOM   1274  O  O   . THR A 1 173 ? -32.035 32.471  25.181  1.00 9.61  ? 173 THR A O   1 
ATOM   1275  C  CB  . THR A 1 173 ? -32.275 34.226  27.628  1.00 9.03  ? 173 THR A CB  1 
ATOM   1276  O  OG1 . THR A 1 173 ? -32.569 35.544  28.107  1.00 7.85  ? 173 THR A OG1 1 
ATOM   1277  C  CG2 . THR A 1 173 ? -31.763 33.381  28.792  1.00 8.41  ? 173 THR A CG2 1 
ATOM   1278  N  N   . ILE A 1 174 ? -30.013 32.209  26.119  1.00 7.46  ? 174 ILE A N   1 
ATOM   1279  C  CA  . ILE A 1 174 ? -29.831 30.872  25.567  1.00 7.03  ? 174 ILE A CA  1 
ATOM   1280  C  C   . ILE A 1 174 ? -30.792 29.879  26.226  1.00 7.80  ? 174 ILE A C   1 
ATOM   1281  O  O   . ILE A 1 174 ? -31.054 29.961  27.426  1.00 8.09  ? 174 ILE A O   1 
ATOM   1282  C  CB  . ILE A 1 174 ? -28.376 30.386  25.770  1.00 6.14  ? 174 ILE A CB  1 
ATOM   1283  C  CG1 . ILE A 1 174 ? -27.405 31.397  25.146  1.00 6.55  ? 174 ILE A CG1 1 
ATOM   1284  C  CG2 . ILE A 1 174 ? -28.183 29.006  25.139  1.00 6.58  ? 174 ILE A CG2 1 
ATOM   1285  C  CD1 . ILE A 1 174 ? -27.571 31.599  23.635  1.00 7.57  ? 174 ILE A CD1 1 
ATOM   1286  N  N   . LYS A 1 175 ? -31.312 28.947  25.433  1.00 8.59  ? 175 LYS A N   1 
ATOM   1287  C  CA  . LYS A 1 175 ? -32.253 27.932  25.917  1.00 9.97  ? 175 LYS A CA  1 
ATOM   1288  C  C   . LYS A 1 175 ? -31.790 26.552  25.432  1.00 10.34 ? 175 LYS A C   1 
ATOM   1289  O  O   . LYS A 1 175 ? -31.109 26.452  24.411  1.00 12.26 ? 175 LYS A O   1 
ATOM   1290  C  CB  . LYS A 1 175 ? -33.659 28.240  25.420  1.00 8.03  ? 175 LYS A CB  1 
ATOM   1291  C  CG  . LYS A 1 175 ? -34.169 29.637  25.772  1.00 7.96  ? 175 LYS A CG  1 
ATOM   1292  C  CD  . LYS A 1 175 ? -34.389 29.815  27.280  1.00 8.41  ? 175 LYS A CD  1 
ATOM   1293  C  CE  . LYS A 1 175 ? -34.826 31.244  27.609  1.00 8.13  ? 175 LYS A CE  1 
ATOM   1294  N  NZ  . LYS A 1 175 ? -35.042 31.472  29.070  1.00 7.62  ? 175 LYS A NZ  1 
ATOM   1295  N  N   . PRO A 1 176 ? -32.217 25.468  26.112  1.00 9.24  ? 176 PRO A N   1 
ATOM   1296  C  CA  . PRO A 1 176 ? -33.016 25.446  27.346  1.00 9.44  ? 176 PRO A CA  1 
ATOM   1297  C  C   . PRO A 1 176 ? -32.336 26.113  28.526  1.00 8.85  ? 176 PRO A C   1 
ATOM   1298  O  O   . PRO A 1 176 ? -31.112 26.227  28.552  1.00 8.95  ? 176 PRO A O   1 
ATOM   1299  C  CB  . PRO A 1 176 ? -33.269 23.949  27.566  1.00 10.19 ? 176 PRO A CB  1 
ATOM   1300  C  CG  . PRO A 1 176 ? -32.049 23.311  26.963  1.00 9.11  ? 176 PRO A CG  1 
ATOM   1301  C  CD  . PRO A 1 176 ? -31.882 24.098  25.688  1.00 10.81 ? 176 PRO A CD  1 
ATOM   1302  N  N   . LYS A 1 177 ? -33.129 26.557  29.499  1.00 8.74  ? 177 LYS A N   1 
ATOM   1303  C  CA  . LYS A 1 177 ? -32.592 27.235  30.675  1.00 7.46  ? 177 LYS A CA  1 
ATOM   1304  C  C   . LYS A 1 177 ? -31.396 26.492  31.252  1.00 6.60  ? 177 LYS A C   1 
ATOM   1305  O  O   . LYS A 1 177 ? -30.326 27.071  31.416  1.00 5.41  ? 177 LYS A O   1 
ATOM   1306  C  CB  . LYS A 1 177 ? -33.674 27.387  31.749  1.00 9.10  ? 177 LYS A CB  1 
ATOM   1307  C  CG  . LYS A 1 177 ? -34.923 28.134  31.283  1.00 8.78  ? 177 LYS A CG  1 
ATOM   1308  C  CD  . LYS A 1 177 ? -35.968 28.218  32.387  1.00 8.74  ? 177 LYS A CD  1 
ATOM   1309  C  CE  . LYS A 1 177 ? -35.494 29.084  33.553  1.00 10.00 ? 177 LYS A CE  1 
ATOM   1310  N  NZ  . LYS A 1 177 ? -35.363 30.521  33.173  1.00 7.53  ? 177 LYS A NZ  1 
ATOM   1311  N  N   . LEU A 1 178 ? -31.580 25.209  31.548  1.00 7.05  ? 178 LEU A N   1 
ATOM   1312  C  CA  . LEU A 1 178 ? -30.513 24.380  32.110  1.00 7.20  ? 178 LEU A CA  1 
ATOM   1313  C  C   . LEU A 1 178 ? -30.394 23.087  31.308  1.00 8.85  ? 178 LEU A C   1 
ATOM   1314  O  O   . LEU A 1 178 ? -31.306 22.731  30.561  1.00 9.38  ? 178 LEU A O   1 
ATOM   1315  C  CB  . LEU A 1 178 ? -30.824 24.037  33.574  1.00 5.67  ? 178 LEU A CB  1 
ATOM   1316  C  CG  . LEU A 1 178 ? -31.064 25.188  34.557  1.00 6.68  ? 178 LEU A CG  1 
ATOM   1317  C  CD1 . LEU A 1 178 ? -31.507 24.623  35.909  1.00 5.82  ? 178 LEU A CD1 1 
ATOM   1318  C  CD2 . LEU A 1 178 ? -29.794 26.012  34.715  1.00 5.84  ? 178 LEU A CD2 1 
ATOM   1319  N  N   . GLY A 1 179 ? -29.270 22.390  31.456  1.00 8.52  ? 179 GLY A N   1 
ATOM   1320  C  CA  . GLY A 1 179 ? -29.099 21.138  30.744  1.00 10.17 ? 179 GLY A CA  1 
ATOM   1321  C  C   . GLY A 1 179 ? -28.080 21.103  29.617  1.00 9.75  ? 179 GLY A C   1 
ATOM   1322  O  O   . GLY A 1 179 ? -27.673 20.018  29.200  1.00 10.48 ? 179 GLY A O   1 
ATOM   1323  N  N   . LEU A 1 180 ? -27.665 22.262  29.116  1.00 9.33  ? 180 LEU A N   1 
ATOM   1324  C  CA  . LEU A 1 180 ? -26.692 22.295  28.031  1.00 11.10 ? 180 LEU A CA  1 
ATOM   1325  C  C   . LEU A 1 180 ? -25.256 22.241  28.546  1.00 9.12  ? 180 LEU A C   1 
ATOM   1326  O  O   . LEU A 1 180 ? -24.964 22.731  29.634  1.00 10.50 ? 180 LEU A O   1 
ATOM   1327  C  CB  . LEU A 1 180 ? -26.874 23.562  27.192  1.00 12.66 ? 180 LEU A CB  1 
ATOM   1328  C  CG  . LEU A 1 180 ? -27.900 23.612  26.055  1.00 15.41 ? 180 LEU A CG  1 
ATOM   1329  C  CD1 . LEU A 1 180 ? -27.729 24.924  25.278  1.00 15.39 ? 180 LEU A CD1 1 
ATOM   1330  C  CD2 . LEU A 1 180 ? -27.686 22.424  25.130  1.00 15.31 ? 180 LEU A CD2 1 
ATOM   1331  N  N   . SER A 1 181 ? -24.368 21.639  27.760  1.00 7.35  ? 181 SER A N   1 
ATOM   1332  C  CA  . SER A 1 181 ? -22.957 21.538  28.121  1.00 7.28  ? 181 SER A CA  1 
ATOM   1333  C  C   . SER A 1 181 ? -22.260 22.856  27.785  1.00 7.72  ? 181 SER A C   1 
ATOM   1334  O  O   . SER A 1 181 ? -22.803 23.693  27.057  1.00 6.68  ? 181 SER A O   1 
ATOM   1335  C  CB  . SER A 1 181 ? -22.282 20.405  27.343  1.00 7.57  ? 181 SER A CB  1 
ATOM   1336  O  OG  . SER A 1 181 ? -22.167 20.731  25.964  1.00 9.09  ? 181 SER A OG  1 
ATOM   1337  N  N   . ALA A 1 182 ? -21.054 23.037  28.312  1.00 7.91  ? 182 ALA A N   1 
ATOM   1338  C  CA  . ALA A 1 182 ? -20.293 24.254  28.060  1.00 7.51  ? 182 ALA A CA  1 
ATOM   1339  C  C   . ALA A 1 182 ? -20.017 24.472  26.570  1.00 8.70  ? 182 ALA A C   1 
ATOM   1340  O  O   . ALA A 1 182 ? -20.126 25.594  26.079  1.00 7.65  ? 182 ALA A O   1 
ATOM   1341  C  CB  . ALA A 1 182 ? -18.985 24.220  28.837  1.00 6.85  ? 182 ALA A CB  1 
ATOM   1342  N  N   . LYS A 1 183 ? -19.667 23.413  25.841  1.00 8.08  ? 183 LYS A N   1 
ATOM   1343  C  CA  . LYS A 1 183 ? -19.391 23.585  24.414  1.00 9.55  ? 183 LYS A CA  1 
ATOM   1344  C  C   . LYS A 1 183 ? -20.640 23.887  23.584  1.00 9.83  ? 183 LYS A C   1 
ATOM   1345  O  O   . LYS A 1 183 ? -20.587 24.698  22.653  1.00 8.62  ? 183 LYS A O   1 
ATOM   1346  C  CB  . LYS A 1 183 ? -18.681 22.365  23.819  1.00 11.17 ? 183 LYS A CB  1 
ATOM   1347  C  CG  . LYS A 1 183 ? -18.371 22.580  22.340  1.00 13.08 ? 183 LYS A CG  1 
ATOM   1348  C  CD  . LYS A 1 183 ? -17.557 21.472  21.716  1.00 17.05 ? 183 LYS A CD  1 
ATOM   1349  C  CE  . LYS A 1 183 ? -17.309 21.784  20.244  1.00 17.04 ? 183 LYS A CE  1 
ATOM   1350  N  NZ  . LYS A 1 183 ? -16.363 20.831  19.610  1.00 20.26 ? 183 LYS A NZ  1 
ATOM   1351  N  N   . ASN A 1 184 ? -21.755 23.232  23.903  1.00 8.24  ? 184 ASN A N   1 
ATOM   1352  C  CA  . ASN A 1 184 ? -22.990 23.481  23.167  1.00 8.63  ? 184 ASN A CA  1 
ATOM   1353  C  C   . ASN A 1 184 ? -23.490 24.890  23.454  1.00 8.87  ? 184 ASN A C   1 
ATOM   1354  O  O   . ASN A 1 184 ? -24.144 25.515  22.615  1.00 8.20  ? 184 ASN A O   1 
ATOM   1355  C  CB  . ASN A 1 184 ? -24.073 22.457  23.532  1.00 8.42  ? 184 ASN A CB  1 
ATOM   1356  C  CG  . ASN A 1 184 ? -23.906 21.140  22.786  1.00 10.00 ? 184 ASN A CG  1 
ATOM   1357  O  OD1 . ASN A 1 184 ? -23.385 21.110  21.672  1.00 12.59 ? 184 ASN A OD1 1 
ATOM   1358  N  ND2 . ASN A 1 184 ? -24.373 20.048  23.388  1.00 11.06 ? 184 ASN A ND2 1 
ATOM   1359  N  N   . TYR A 1 185 ? -23.176 25.395  24.643  1.00 7.91  ? 185 TYR A N   1 
ATOM   1360  C  CA  . TYR A 1 185 ? -23.585 26.741  25.014  1.00 7.76  ? 185 TYR A CA  1 
ATOM   1361  C  C   . TYR A 1 185 ? -22.857 27.738  24.111  1.00 7.15  ? 185 TYR A C   1 
ATOM   1362  O  O   . TYR A 1 185 ? -23.470 28.660  23.568  1.00 8.74  ? 185 TYR A O   1 
ATOM   1363  C  CB  . TYR A 1 185 ? -23.239 27.024  26.477  1.00 7.57  ? 185 TYR A CB  1 
ATOM   1364  C  CG  . TYR A 1 185 ? -24.284 27.842  27.202  1.00 6.64  ? 185 TYR A CG  1 
ATOM   1365  C  CD1 . TYR A 1 185 ? -25.464 27.254  27.648  1.00 7.74  ? 185 TYR A CD1 1 
ATOM   1366  C  CD2 . TYR A 1 185 ? -24.099 29.205  27.433  1.00 7.84  ? 185 TYR A CD2 1 
ATOM   1367  C  CE1 . TYR A 1 185 ? -26.440 27.999  28.311  1.00 7.97  ? 185 TYR A CE1 1 
ATOM   1368  C  CE2 . TYR A 1 185 ? -25.069 29.962  28.094  1.00 8.01  ? 185 TYR A CE2 1 
ATOM   1369  C  CZ  . TYR A 1 185 ? -26.239 29.348  28.528  1.00 7.10  ? 185 TYR A CZ  1 
ATOM   1370  O  OH  . TYR A 1 185 ? -27.210 30.082  29.172  1.00 8.04  ? 185 TYR A OH  1 
ATOM   1371  N  N   . GLY A 1 186 ? -21.549 27.539  23.949  1.00 5.78  ? 186 GLY A N   1 
ATOM   1372  C  CA  . GLY A 1 186 ? -20.750 28.421  23.108  1.00 5.66  ? 186 GLY A CA  1 
ATOM   1373  C  C   . GLY A 1 186 ? -21.158 28.313  21.648  1.00 6.76  ? 186 GLY A C   1 
ATOM   1374  O  O   . GLY A 1 186 ? -21.100 29.283  20.892  1.00 7.21  ? 186 GLY A O   1 
ATOM   1375  N  N   . ARG A 1 187 ? -21.571 27.113  21.254  1.00 6.71  ? 187 ARG A N   1 
ATOM   1376  C  CA  . ARG A 1 187 ? -22.023 26.856  19.892  1.00 9.51  ? 187 ARG A CA  1 
ATOM   1377  C  C   . ARG A 1 187 ? -23.280 27.693  19.624  1.00 10.07 ? 187 ARG A C   1 
ATOM   1378  O  O   . ARG A 1 187 ? -23.390 28.371  18.594  1.00 9.54  ? 187 ARG A O   1 
ATOM   1379  C  CB  . ARG A 1 187 ? -22.319 25.361  19.743  1.00 9.98  ? 187 ARG A CB  1 
ATOM   1380  C  CG  . ARG A 1 187 ? -23.038 24.956  18.481  1.00 12.79 ? 187 ARG A CG  1 
ATOM   1381  C  CD  . ARG A 1 187 ? -23.181 23.437  18.423  1.00 12.51 ? 187 ARG A CD  1 
ATOM   1382  N  NE  . ARG A 1 187 ? -22.055 22.799  17.743  1.00 13.72 ? 187 ARG A NE  1 
ATOM   1383  C  CZ  . ARG A 1 187 ? -21.247 21.895  18.290  1.00 14.43 ? 187 ARG A CZ  1 
ATOM   1384  N  NH1 . ARG A 1 187 ? -21.417 21.502  19.547  1.00 14.25 ? 187 ARG A NH1 1 
ATOM   1385  N  NH2 . ARG A 1 187 ? -20.275 21.366  17.562  1.00 13.09 ? 187 ARG A NH2 1 
ATOM   1386  N  N   . ALA A 1 188 ? -24.222 27.654  20.563  1.00 9.76  ? 188 ALA A N   1 
ATOM   1387  C  CA  . ALA A 1 188 ? -25.462 28.414  20.433  1.00 9.79  ? 188 ALA A CA  1 
ATOM   1388  C  C   . ALA A 1 188 ? -25.175 29.917  20.425  1.00 10.03 ? 188 ALA A C   1 
ATOM   1389  O  O   . ALA A 1 188 ? -25.799 30.674  19.682  1.00 10.58 ? 188 ALA A O   1 
ATOM   1390  C  CB  . ALA A 1 188 ? -26.403 28.069  21.577  1.00 8.85  ? 188 ALA A CB  1 
ATOM   1391  N  N   . VAL A 1 189 ? -24.227 30.340  21.258  1.00 8.52  ? 189 VAL A N   1 
ATOM   1392  C  CA  . VAL A 1 189 ? -23.845 31.744  21.355  1.00 8.77  ? 189 VAL A CA  1 
ATOM   1393  C  C   . VAL A 1 189 ? -23.266 32.292  20.050  1.00 9.04  ? 189 VAL A C   1 
ATOM   1394  O  O   . VAL A 1 189 ? -23.678 33.353  19.584  1.00 10.34 ? 189 VAL A O   1 
ATOM   1395  C  CB  . VAL A 1 189 ? -22.820 31.956  22.504  1.00 8.53  ? 189 VAL A CB  1 
ATOM   1396  C  CG1 . VAL A 1 189 ? -22.194 33.353  22.421  1.00 7.81  ? 189 VAL A CG1 1 
ATOM   1397  C  CG2 . VAL A 1 189 ? -23.521 31.765  23.851  1.00 8.43  ? 189 VAL A CG2 1 
ATOM   1398  N  N   . TYR A 1 190 ? -22.308 31.580  19.463  1.00 6.95  ? 190 TYR A N   1 
ATOM   1399  C  CA  . TYR A 1 190 ? -21.712 32.039  18.215  1.00 7.26  ? 190 TYR A CA  1 
ATOM   1400  C  C   . TYR A 1 190 ? -22.772 32.216  17.127  1.00 7.43  ? 190 TYR A C   1 
ATOM   1401  O  O   . TYR A 1 190 ? -22.812 33.247  16.456  1.00 6.22  ? 190 TYR A O   1 
ATOM   1402  C  CB  . TYR A 1 190 ? -20.628 31.057  17.741  1.00 7.00  ? 190 TYR A CB  1 
ATOM   1403  C  CG  . TYR A 1 190 ? -20.306 31.164  16.265  1.00 7.59  ? 190 TYR A CG  1 
ATOM   1404  C  CD1 . TYR A 1 190 ? -19.759 32.329  15.726  1.00 9.59  ? 190 TYR A CD1 1 
ATOM   1405  C  CD2 . TYR A 1 190 ? -20.580 30.106  15.402  1.00 8.30  ? 190 TYR A CD2 1 
ATOM   1406  C  CE1 . TYR A 1 190 ? -19.495 32.438  14.356  1.00 9.91  ? 190 TYR A CE1 1 
ATOM   1407  C  CE2 . TYR A 1 190 ? -20.319 30.201  14.036  1.00 10.29 ? 190 TYR A CE2 1 
ATOM   1408  C  CZ  . TYR A 1 190 ? -19.781 31.366  13.519  1.00 10.16 ? 190 TYR A CZ  1 
ATOM   1409  O  OH  . TYR A 1 190 ? -19.541 31.455  12.166  1.00 11.07 ? 190 TYR A OH  1 
ATOM   1410  N  N   . GLU A 1 191 ? -23.632 31.215  16.959  1.00 5.98  ? 191 GLU A N   1 
ATOM   1411  C  CA  . GLU A 1 191 ? -24.676 31.277  15.942  1.00 6.97  ? 191 GLU A CA  1 
ATOM   1412  C  C   . GLU A 1 191 ? -25.621 32.464  16.146  1.00 8.65  ? 191 GLU A C   1 
ATOM   1413  O  O   . GLU A 1 191 ? -26.013 33.122  15.185  1.00 8.79  ? 191 GLU A O   1 
ATOM   1414  C  CB  . GLU A 1 191 ? -25.474 29.969  15.918  1.00 7.72  ? 191 GLU A CB  1 
ATOM   1415  C  CG  . GLU A 1 191 ? -24.694 28.740  15.406  1.00 10.27 ? 191 GLU A CG  1 
ATOM   1416  C  CD  . GLU A 1 191 ? -24.199 28.882  13.967  1.00 10.47 ? 191 GLU A CD  1 
ATOM   1417  O  OE1 . GLU A 1 191 ? -24.800 29.654  13.189  1.00 13.78 ? 191 GLU A OE1 1 
ATOM   1418  O  OE2 . GLU A 1 191 ? -23.216 28.205  13.603  1.00 11.00 ? 191 GLU A OE2 1 
ATOM   1419  N  N   . CYS A 1 192 ? -25.983 32.736  17.397  1.00 7.38  ? 192 CYS A N   1 
ATOM   1420  C  CA  . CYS A 1 192 ? -26.871 33.852  17.708  1.00 7.99  ? 192 CYS A CA  1 
ATOM   1421  C  C   . CYS A 1 192 ? -26.226 35.201  17.384  1.00 8.68  ? 192 CYS A C   1 
ATOM   1422  O  O   . CYS A 1 192 ? -26.805 36.032  16.679  1.00 7.72  ? 192 CYS A O   1 
ATOM   1423  C  CB  . CYS A 1 192 ? -27.251 33.836  19.195  1.00 6.99  ? 192 CYS A CB  1 
ATOM   1424  S  SG  . CYS A 1 192 ? -28.474 32.593  19.681  1.00 11.00 ? 192 CYS A SG  1 
ATOM   1425  N  N   . LEU A 1 193 ? -25.029 35.419  17.918  1.00 8.77  ? 193 LEU A N   1 
ATOM   1426  C  CA  . LEU A 1 193 ? -24.316 36.671  17.705  1.00 8.71  ? 193 LEU A CA  1 
ATOM   1427  C  C   . LEU A 1 193 ? -23.976 36.993  16.247  1.00 9.40  ? 193 LEU A C   1 
ATOM   1428  O  O   . LEU A 1 193 ? -24.040 38.156  15.839  1.00 10.64 ? 193 LEU A O   1 
ATOM   1429  C  CB  . LEU A 1 193 ? -23.037 36.683  18.547  1.00 8.60  ? 193 LEU A CB  1 
ATOM   1430  C  CG  . LEU A 1 193 ? -23.250 36.682  20.067  1.00 9.55  ? 193 LEU A CG  1 
ATOM   1431  C  CD1 . LEU A 1 193 ? -21.905 36.570  20.780  1.00 8.99  ? 193 LEU A CD1 1 
ATOM   1432  C  CD2 . LEU A 1 193 ? -23.979 37.954  20.487  1.00 7.62  ? 193 LEU A CD2 1 
ATOM   1433  N  N   . ARG A 1 194 ? -23.624 35.980  15.460  1.00 9.40  ? 194 ARG A N   1 
ATOM   1434  C  CA  . ARG A 1 194 ? -23.253 36.214  14.066  1.00 9.29  ? 194 ARG A CA  1 
ATOM   1435  C  C   . ARG A 1 194 ? -24.427 36.647  13.191  1.00 10.87 ? 194 ARG A C   1 
ATOM   1436  O  O   . ARG A 1 194 ? -24.228 37.148  12.084  1.00 10.23 ? 194 ARG A O   1 
ATOM   1437  C  CB  . ARG A 1 194 ? -22.581 34.964  13.469  1.00 10.26 ? 194 ARG A CB  1 
ATOM   1438  C  CG  . ARG A 1 194 ? -23.517 33.933  12.838  1.00 9.10  ? 194 ARG A CG  1 
ATOM   1439  C  CD  . ARG A 1 194 ? -22.736 32.689  12.428  1.00 10.21 ? 194 ARG A CD  1 
ATOM   1440  N  NE  . ARG A 1 194 ? -23.499 31.800  11.552  1.00 10.46 ? 194 ARG A NE  1 
ATOM   1441  C  CZ  . ARG A 1 194 ? -23.680 31.999  10.248  1.00 11.30 ? 194 ARG A CZ  1 
ATOM   1442  N  NH1 . ARG A 1 194 ? -23.150 33.057  9.648   1.00 7.56  ? 194 ARG A NH1 1 
ATOM   1443  N  NH2 . ARG A 1 194 ? -24.396 31.136  9.539   1.00 9.75  ? 194 ARG A NH2 1 
ATOM   1444  N  N   . GLY A 1 195 ? -25.644 36.462  13.698  1.00 10.35 ? 195 GLY A N   1 
ATOM   1445  C  CA  . GLY A 1 195 ? -26.831 36.834  12.949  1.00 10.94 ? 195 GLY A CA  1 
ATOM   1446  C  C   . GLY A 1 195 ? -27.315 38.265  13.130  1.00 11.47 ? 195 GLY A C   1 
ATOM   1447  O  O   . GLY A 1 195 ? -28.309 38.657  12.522  1.00 12.23 ? 195 GLY A O   1 
ATOM   1448  N  N   . GLY A 1 196 ? -26.643 39.051  13.967  1.00 9.95  ? 196 GLY A N   1 
ATOM   1449  C  CA  . GLY A 1 196 ? -27.073 40.427  14.148  1.00 8.43  ? 196 GLY A CA  1 
ATOM   1450  C  C   . GLY A 1 196 ? -27.409 40.878  15.559  1.00 8.37  ? 196 GLY A C   1 
ATOM   1451  O  O   . GLY A 1 196 ? -27.698 42.054  15.774  1.00 8.76  ? 196 GLY A O   1 
ATOM   1452  N  N   . LEU A 1 197 ? -27.392 39.962  16.520  1.00 7.92  ? 197 LEU A N   1 
ATOM   1453  C  CA  . LEU A 1 197 ? -27.679 40.327  17.907  1.00 8.61  ? 197 LEU A CA  1 
ATOM   1454  C  C   . LEU A 1 197 ? -26.410 40.910  18.516  1.00 8.19  ? 197 LEU A C   1 
ATOM   1455  O  O   . LEU A 1 197 ? -25.307 40.477  18.185  1.00 8.00  ? 197 LEU A O   1 
ATOM   1456  C  CB  . LEU A 1 197 ? -28.109 39.100  18.715  1.00 9.39  ? 197 LEU A CB  1 
ATOM   1457  C  CG  . LEU A 1 197 ? -29.378 38.368  18.267  1.00 10.01 ? 197 LEU A CG  1 
ATOM   1458  C  CD1 . LEU A 1 197 ? -29.626 37.166  19.161  1.00 9.16  ? 197 LEU A CD1 1 
ATOM   1459  C  CD2 . LEU A 1 197 ? -30.556 39.322  18.318  1.00 9.32  ? 197 LEU A CD2 1 
ATOM   1460  N  N   . ASP A 1 198 ? -26.567 41.890  19.400  1.00 7.11  ? 198 ASP A N   1 
ATOM   1461  C  CA  . ASP A 1 198 ? -25.429 42.522  20.056  1.00 8.77  ? 198 ASP A CA  1 
ATOM   1462  C  C   . ASP A 1 198 ? -24.970 41.693  21.248  1.00 9.37  ? 198 ASP A C   1 
ATOM   1463  O  O   . ASP A 1 198 ? -23.777 41.629  21.554  1.00 8.62  ? 198 ASP A O   1 
ATOM   1464  C  CB  . ASP A 1 198 ? -25.811 43.919  20.550  1.00 8.69  ? 198 ASP A CB  1 
ATOM   1465  C  CG  . ASP A 1 198 ? -26.342 44.805  19.445  1.00 11.10 ? 198 ASP A CG  1 
ATOM   1466  O  OD1 . ASP A 1 198 ? -25.572 45.119  18.516  1.00 11.63 ? 198 ASP A OD1 1 
ATOM   1467  O  OD2 . ASP A 1 198 ? -27.532 45.186  19.506  1.00 11.50 ? 198 ASP A OD2 1 
ATOM   1468  N  N   . PHE A 1 199 ? -25.928 41.053  21.914  1.00 8.87  ? 199 PHE A N   1 
ATOM   1469  C  CA  . PHE A 1 199 ? -25.645 40.257  23.101  1.00 7.44  ? 199 PHE A CA  1 
ATOM   1470  C  C   . PHE A 1 199 ? -26.418 38.946  23.154  1.00 7.90  ? 199 PHE A C   1 
ATOM   1471  O  O   . PHE A 1 199 ? -27.457 38.790  22.513  1.00 7.82  ? 199 PHE A O   1 
ATOM   1472  C  CB  . PHE A 1 199 ? -26.066 41.000  24.378  1.00 7.79  ? 199 PHE A CB  1 
ATOM   1473  C  CG  . PHE A 1 199 ? -25.554 42.406  24.503  1.00 10.09 ? 199 PHE A CG  1 
ATOM   1474  C  CD1 . PHE A 1 199 ? -24.201 42.665  24.665  1.00 10.40 ? 199 PHE A CD1 1 
ATOM   1475  C  CD2 . PHE A 1 199 ? -26.452 43.469  24.575  1.00 10.93 ? 199 PHE A CD2 1 
ATOM   1476  C  CE1 . PHE A 1 199 ? -23.747 43.962  24.904  1.00 12.28 ? 199 PHE A CE1 1 
ATOM   1477  C  CE2 . PHE A 1 199 ? -26.010 44.768  24.813  1.00 12.54 ? 199 PHE A CE2 1 
ATOM   1478  C  CZ  . PHE A 1 199 ? -24.653 45.014  24.982  1.00 12.58 ? 199 PHE A CZ  1 
ATOM   1479  N  N   . THR A 1 200 ? -25.893 38.026  23.962  1.00 5.72  ? 200 THR A N   1 
ATOM   1480  C  CA  . THR A 1 200 ? -26.524 36.745  24.277  1.00 6.60  ? 200 THR A CA  1 
ATOM   1481  C  C   . THR A 1 200 ? -26.302 36.707  25.791  1.00 7.14  ? 200 THR A C   1 
ATOM   1482  O  O   . THR A 1 200 ? -25.571 37.555  26.319  1.00 4.39  ? 200 THR A O   1 
ATOM   1483  C  CB  . THR A 1 200 ? -25.838 35.530  23.598  1.00 7.64  ? 200 THR A CB  1 
ATOM   1484  O  OG1 . THR A 1 200 ? -24.412 35.649  23.694  1.00 10.57 ? 200 THR A OG1 1 
ATOM   1485  C  CG2 . THR A 1 200 ? -26.261 35.437  22.134  1.00 8.64  ? 200 THR A CG2 1 
HETATM 1486  N  N   . KCX A 1 201 ? -26.915 35.768  26.504  1.00 5.07  ? 201 KCX A N   1 
HETATM 1487  C  CA  . KCX A 1 201 ? -26.717 35.744  27.952  1.00 6.27  ? 201 KCX A CA  1 
HETATM 1488  C  CB  . KCX A 1 201 ? -27.662 36.785  28.618  1.00 5.00  ? 201 KCX A CB  1 
HETATM 1489  C  CG  . KCX A 1 201 ? -29.175 36.521  28.442  1.00 4.23  ? 201 KCX A CG  1 
HETATM 1490  C  CD  . KCX A 1 201 ? -30.069 37.586  29.104  1.00 5.92  ? 201 KCX A CD  1 
HETATM 1491  C  CE  . KCX A 1 201 ? -29.969 37.642  30.630  1.00 8.23  ? 201 KCX A CE  1 
HETATM 1492  N  NZ  . KCX A 1 201 ? -30.495 36.453  31.311  1.00 7.62  ? 201 KCX A NZ  1 
HETATM 1493  C  C   . KCX A 1 201 ? -26.991 34.409  28.608  1.00 7.77  ? 201 KCX A C   1 
HETATM 1494  O  O   . KCX A 1 201 ? -27.725 33.562  28.068  1.00 7.39  ? 201 KCX A O   1 
HETATM 1495  C  CX  . KCX A 1 201 ? -31.788 36.123  31.439  1.00 9.54  ? 201 KCX A CX  1 
HETATM 1496  O  OQ1 . KCX A 1 201 ? -32.715 36.959  31.268  1.00 8.77  ? 201 KCX A OQ1 1 
HETATM 1497  O  OQ2 . KCX A 1 201 ? -32.119 34.956  31.743  1.00 7.93  ? 201 KCX A OQ2 1 
ATOM   1498  N  N   . ASP A 1 202 ? -26.385 34.222  29.780  1.00 7.67  ? 202 ASP A N   1 
ATOM   1499  C  CA  . ASP A 1 202 ? -26.605 33.024  30.582  1.00 7.04  ? 202 ASP A CA  1 
ATOM   1500  C  C   . ASP A 1 202 ? -27.999 33.240  31.155  1.00 8.84  ? 202 ASP A C   1 
ATOM   1501  O  O   . ASP A 1 202 ? -28.369 34.380  31.463  1.00 8.48  ? 202 ASP A O   1 
ATOM   1502  C  CB  . ASP A 1 202 ? -25.649 32.947  31.785  1.00 6.08  ? 202 ASP A CB  1 
ATOM   1503  C  CG  . ASP A 1 202 ? -24.199 32.695  31.399  1.00 5.49  ? 202 ASP A CG  1 
ATOM   1504  O  OD1 . ASP A 1 202 ? -23.922 32.275  30.259  1.00 7.77  ? 202 ASP A OD1 1 
ATOM   1505  O  OD2 . ASP A 1 202 ? -23.331 32.903  32.273  1.00 6.72  ? 202 ASP A OD2 1 
ATOM   1506  N  N   . ASP A 1 203 ? -28.779 32.175  31.300  1.00 7.77  ? 203 ASP A N   1 
ATOM   1507  C  CA  . ASP A 1 203 ? -30.096 32.340  31.892  1.00 8.51  ? 203 ASP A CA  1 
ATOM   1508  C  C   . ASP A 1 203 ? -29.801 32.735  33.342  1.00 8.12  ? 203 ASP A C   1 
ATOM   1509  O  O   . ASP A 1 203 ? -28.694 32.496  33.836  1.00 7.98  ? 203 ASP A O   1 
ATOM   1510  C  CB  . ASP A 1 203 ? -30.894 31.033  31.845  1.00 7.76  ? 203 ASP A CB  1 
ATOM   1511  C  CG  . ASP A 1 203 ? -32.348 31.257  31.458  1.00 7.26  ? 203 ASP A CG  1 
ATOM   1512  O  OD1 . ASP A 1 203 ? -32.948 32.233  31.947  1.00 10.63 ? 203 ASP A OD1 1 
ATOM   1513  O  OD2 . ASP A 1 203 ? -32.895 30.460  30.671  1.00 10.42 ? 203 ASP A OD2 1 
ATOM   1514  N  N   . GLU A 1 204 ? -30.770 33.334  34.026  1.00 6.99  ? 204 GLU A N   1 
ATOM   1515  C  CA  . GLU A 1 204 ? -30.541 33.764  35.404  1.00 5.72  ? 204 GLU A CA  1 
ATOM   1516  C  C   . GLU A 1 204 ? -30.110 32.641  36.358  1.00 6.57  ? 204 GLU A C   1 
ATOM   1517  O  O   . GLU A 1 204 ? -29.323 32.884  37.274  1.00 4.74  ? 204 GLU A O   1 
ATOM   1518  C  CB  . GLU A 1 204 ? -31.778 34.487  35.970  1.00 6.13  ? 204 GLU A CB  1 
ATOM   1519  C  CG  . GLU A 1 204 ? -33.004 33.615  36.296  1.00 5.28  ? 204 GLU A CG  1 
ATOM   1520  C  CD  . GLU A 1 204 ? -33.722 33.089  35.067  1.00 7.86  ? 204 GLU A CD  1 
ATOM   1521  O  OE1 . GLU A 1 204 ? -33.889 33.858  34.095  1.00 6.09  ? 204 GLU A OE1 1 
ATOM   1522  O  OE2 . GLU A 1 204 ? -34.143 31.909  35.081  1.00 7.57  ? 204 GLU A OE2 1 
ATOM   1523  N  N   . ASN A 1 205 ? -30.595 31.420  36.138  1.00 4.93  ? 205 ASN A N   1 
ATOM   1524  C  CA  . ASN A 1 205 ? -30.234 30.306  37.014  1.00 6.73  ? 205 ASN A CA  1 
ATOM   1525  C  C   . ASN A 1 205 ? -29.000 29.513  36.584  1.00 6.42  ? 205 ASN A C   1 
ATOM   1526  O  O   . ASN A 1 205 ? -28.625 28.534  37.227  1.00 9.39  ? 205 ASN A O   1 
ATOM   1527  C  CB  . ASN A 1 205 ? -31.429 29.362  37.208  1.00 6.70  ? 205 ASN A CB  1 
ATOM   1528  C  CG  . ASN A 1 205 ? -32.024 28.885  35.900  1.00 8.07  ? 205 ASN A CG  1 
ATOM   1529  O  OD1 . ASN A 1 205 ? -31.661 29.365  34.825  1.00 6.97  ? 205 ASN A OD1 1 
ATOM   1530  N  ND2 . ASN A 1 205 ? -32.961 27.935  35.987  1.00 4.76  ? 205 ASN A ND2 1 
ATOM   1531  N  N   . VAL A 1 206 ? -28.372 29.934  35.494  1.00 6.76  ? 206 VAL A N   1 
ATOM   1532  C  CA  . VAL A 1 206 ? -27.158 29.279  35.026  1.00 6.11  ? 206 VAL A CA  1 
ATOM   1533  C  C   . VAL A 1 206 ? -25.993 29.900  35.799  1.00 6.80  ? 206 VAL A C   1 
ATOM   1534  O  O   . VAL A 1 206 ? -25.595 31.035  35.539  1.00 6.50  ? 206 VAL A O   1 
ATOM   1535  C  CB  . VAL A 1 206 ? -26.937 29.497  33.504  1.00 7.36  ? 206 VAL A CB  1 
ATOM   1536  C  CG1 . VAL A 1 206 ? -25.525 29.071  33.113  1.00 7.63  ? 206 VAL A CG1 1 
ATOM   1537  C  CG2 . VAL A 1 206 ? -27.965 28.695  32.707  1.00 5.56  ? 206 VAL A CG2 1 
ATOM   1538  N  N   . ASN A 1 207 ? -25.469 29.161  36.771  1.00 6.71  ? 207 ASN A N   1 
ATOM   1539  C  CA  . ASN A 1 207 ? -24.350 29.633  37.580  1.00 6.29  ? 207 ASN A CA  1 
ATOM   1540  C  C   . ASN A 1 207 ? -23.221 28.618  37.337  1.00 7.41  ? 207 ASN A C   1 
ATOM   1541  O  O   . ASN A 1 207 ? -22.415 28.789  36.422  1.00 8.79  ? 207 ASN A O   1 
ATOM   1542  C  CB  . ASN A 1 207 ? -24.757 29.680  39.065  1.00 7.12  ? 207 ASN A CB  1 
ATOM   1543  C  CG  . ASN A 1 207 ? -25.861 30.716  39.358  1.00 9.35  ? 207 ASN A CG  1 
ATOM   1544  O  OD1 . ASN A 1 207 ? -26.382 30.778  40.473  1.00 8.96  ? 207 ASN A OD1 1 
ATOM   1545  N  ND2 . ASN A 1 207 ? -26.211 31.528  38.361  1.00 6.44  ? 207 ASN A ND2 1 
ATOM   1546  N  N   . SER A 1 208 ? -23.170 27.569  38.153  1.00 6.34  ? 208 SER A N   1 
ATOM   1547  C  CA  . SER A 1 208 ? -22.187 26.498  37.987  1.00 7.87  ? 208 SER A CA  1 
ATOM   1548  C  C   . SER A 1 208 ? -22.873 25.219  38.456  1.00 7.44  ? 208 SER A C   1 
ATOM   1549  O  O   . SER A 1 208 ? -23.247 25.103  39.621  1.00 9.59  ? 208 SER A O   1 
ATOM   1550  C  CB  . SER A 1 208 ? -20.932 26.752  38.819  1.00 7.96  ? 208 SER A CB  1 
ATOM   1551  O  OG  . SER A 1 208 ? -19.933 25.795  38.496  1.00 9.70  ? 208 SER A OG  1 
ATOM   1552  N  N   . GLN A 1 209 ? -23.040 24.265  37.548  1.00 7.93  ? 209 GLN A N   1 
ATOM   1553  C  CA  . GLN A 1 209 ? -23.721 23.016  37.872  1.00 7.95  ? 209 GLN A CA  1 
ATOM   1554  C  C   . GLN A 1 209 ? -23.043 21.785  37.264  1.00 7.54  ? 209 GLN A C   1 
ATOM   1555  O  O   . GLN A 1 209 ? -22.160 21.905  36.415  1.00 9.40  ? 209 GLN A O   1 
ATOM   1556  C  CB  . GLN A 1 209 ? -25.184 23.101  37.406  1.00 7.50  ? 209 GLN A CB  1 
ATOM   1557  C  CG  . GLN A 1 209 ? -26.053 24.047  38.249  1.00 9.65  ? 209 GLN A CG  1 
ATOM   1558  C  CD  . GLN A 1 209 ? -26.432 25.335  37.532  1.00 9.14  ? 209 GLN A CD  1 
ATOM   1559  O  OE1 . GLN A 1 209 ? -25.586 26.010  36.946  1.00 11.36 ? 209 GLN A OE1 1 
ATOM   1560  N  NE2 . GLN A 1 209 ? -27.711 25.688  37.590  1.00 8.49  ? 209 GLN A NE2 1 
ATOM   1561  N  N   . PRO A 1 210 ? -23.453 20.581  37.695  1.00 9.78  ? 210 PRO A N   1 
ATOM   1562  C  CA  . PRO A 1 210 ? -22.875 19.332  37.184  1.00 9.64  ? 210 PRO A CA  1 
ATOM   1563  C  C   . PRO A 1 210 ? -22.844 19.217  35.657  1.00 9.87  ? 210 PRO A C   1 
ATOM   1564  O  O   . PRO A 1 210 ? -21.878 18.708  35.097  1.00 10.08 ? 210 PRO A O   1 
ATOM   1565  C  CB  . PRO A 1 210 ? -23.758 18.264  37.819  1.00 8.91  ? 210 PRO A CB  1 
ATOM   1566  C  CG  . PRO A 1 210 ? -24.104 18.876  39.148  1.00 9.08  ? 210 PRO A CG  1 
ATOM   1567  C  CD  . PRO A 1 210 ? -24.425 20.305  38.772  1.00 10.46 ? 210 PRO A CD  1 
ATOM   1568  N  N   . PHE A 1 211 ? -23.889 19.690  34.985  1.00 9.94  ? 211 PHE A N   1 
ATOM   1569  C  CA  . PHE A 1 211 ? -23.945 19.597  33.526  1.00 10.07 ? 211 PHE A CA  1 
ATOM   1570  C  C   . PHE A 1 211 ? -23.069 20.622  32.807  1.00 9.44  ? 211 PHE A C   1 
ATOM   1571  O  O   . PHE A 1 211 ? -22.784 20.471  31.616  1.00 8.99  ? 211 PHE A O   1 
ATOM   1572  C  CB  . PHE A 1 211 ? -25.399 19.719  33.038  1.00 9.57  ? 211 PHE A CB  1 
ATOM   1573  C  CG  . PHE A 1 211 ? -26.082 20.996  33.457  1.00 9.36  ? 211 PHE A CG  1 
ATOM   1574  C  CD1 . PHE A 1 211 ? -25.856 22.186  32.769  1.00 9.26  ? 211 PHE A CD1 1 
ATOM   1575  C  CD2 . PHE A 1 211 ? -26.925 21.014  34.564  1.00 8.52  ? 211 PHE A CD2 1 
ATOM   1576  C  CE1 . PHE A 1 211 ? -26.458 23.380  33.185  1.00 8.54  ? 211 PHE A CE1 1 
ATOM   1577  C  CE2 . PHE A 1 211 ? -27.531 22.200  34.989  1.00 7.48  ? 211 PHE A CE2 1 
ATOM   1578  C  CZ  . PHE A 1 211 ? -27.297 23.382  34.302  1.00 8.75  ? 211 PHE A CZ  1 
ATOM   1579  N  N   . MET A 1 212 ? -22.643 21.653  33.534  1.00 7.03  ? 212 MET A N   1 
ATOM   1580  C  CA  . MET A 1 212 ? -21.810 22.712  32.964  1.00 7.84  ? 212 MET A CA  1 
ATOM   1581  C  C   . MET A 1 212 ? -21.214 23.601  34.054  1.00 8.47  ? 212 MET A C   1 
ATOM   1582  O  O   . MET A 1 212 ? -21.931 24.373  34.697  1.00 8.11  ? 212 MET A O   1 
ATOM   1583  C  CB  . MET A 1 212 ? -22.640 23.574  31.994  1.00 6.66  ? 212 MET A CB  1 
ATOM   1584  C  CG  . MET A 1 212 ? -21.971 24.889  31.581  1.00 8.14  ? 212 MET A CG  1 
ATOM   1585  S  SD  . MET A 1 212 ? -22.800 25.787  30.226  1.00 9.76  ? 212 MET A SD  1 
ATOM   1586  C  CE  . MET A 1 212 ? -24.474 25.992  30.875  1.00 6.99  ? 212 MET A CE  1 
ATOM   1587  N  N   . ARG A 1 213 ? -19.903 23.492  34.261  1.00 8.28  ? 213 ARG A N   1 
ATOM   1588  C  CA  . ARG A 1 213 ? -19.223 24.297  35.275  1.00 7.29  ? 213 ARG A CA  1 
ATOM   1589  C  C   . ARG A 1 213 ? -18.926 25.681  34.704  1.00 7.96  ? 213 ARG A C   1 
ATOM   1590  O  O   . ARG A 1 213 ? -18.684 25.827  33.502  1.00 7.32  ? 213 ARG A O   1 
ATOM   1591  C  CB  . ARG A 1 213 ? -17.941 23.596  35.739  1.00 6.50  ? 213 ARG A CB  1 
ATOM   1592  C  CG  . ARG A 1 213 ? -18.202 22.283  36.500  1.00 7.80  ? 213 ARG A CG  1 
ATOM   1593  C  CD  . ARG A 1 213 ? -19.062 22.506  37.754  1.00 7.98  ? 213 ARG A CD  1 
ATOM   1594  N  NE  . ARG A 1 213 ? -19.441 21.255  38.409  1.00 6.48  ? 213 ARG A NE  1 
ATOM   1595  C  CZ  . ARG A 1 213 ? -20.288 21.167  39.432  1.00 9.50  ? 213 ARG A CZ  1 
ATOM   1596  N  NH1 . ARG A 1 213 ? -20.851 22.260  39.927  1.00 4.97  ? 213 ARG A NH1 1 
ATOM   1597  N  NH2 . ARG A 1 213 ? -20.582 19.982  39.959  1.00 7.39  ? 213 ARG A NH2 1 
ATOM   1598  N  N   . TRP A 1 214 ? -18.936 26.695  35.566  1.00 5.97  ? 214 TRP A N   1 
ATOM   1599  C  CA  . TRP A 1 214 ? -18.745 28.070  35.114  1.00 6.31  ? 214 TRP A CA  1 
ATOM   1600  C  C   . TRP A 1 214 ? -17.489 28.414  34.322  1.00 6.80  ? 214 TRP A C   1 
ATOM   1601  O  O   . TRP A 1 214 ? -17.578 29.117  33.310  1.00 7.99  ? 214 TRP A O   1 
ATOM   1602  C  CB  . TRP A 1 214 ? -18.874 29.047  36.292  1.00 8.10  ? 214 TRP A CB  1 
ATOM   1603  C  CG  . TRP A 1 214 ? -17.680 29.106  37.201  1.00 9.11  ? 214 TRP A CG  1 
ATOM   1604  C  CD1 . TRP A 1 214 ? -17.449 28.341  38.313  1.00 8.56  ? 214 TRP A CD1 1 
ATOM   1605  C  CD2 . TRP A 1 214 ? -16.542 29.969  37.065  1.00 8.36  ? 214 TRP A CD2 1 
ATOM   1606  N  NE1 . TRP A 1 214 ? -16.238 28.676  38.874  1.00 9.48  ? 214 TRP A NE1 1 
ATOM   1607  C  CE2 . TRP A 1 214 ? -15.661 29.673  38.128  1.00 10.37 ? 214 TRP A CE2 1 
ATOM   1608  C  CE3 . TRP A 1 214 ? -16.185 30.965  36.140  1.00 10.25 ? 214 TRP A CE3 1 
ATOM   1609  C  CZ2 . TRP A 1 214 ? -14.435 30.339  38.299  1.00 7.75  ? 214 TRP A CZ2 1 
ATOM   1610  C  CZ3 . TRP A 1 214 ? -14.965 31.628  36.309  1.00 10.01 ? 214 TRP A CZ3 1 
ATOM   1611  C  CH2 . TRP A 1 214 ? -14.107 31.309  37.383  1.00 9.68  ? 214 TRP A CH2 1 
ATOM   1612  N  N   . ARG A 1 215 ? -16.324 27.939  34.754  1.00 6.44  ? 215 ARG A N   1 
ATOM   1613  C  CA  . ARG A 1 215 ? -15.103 28.291  34.039  1.00 7.06  ? 215 ARG A CA  1 
ATOM   1614  C  C   . ARG A 1 215 ? -15.115 27.746  32.616  1.00 6.87  ? 215 ARG A C   1 
ATOM   1615  O  O   . ARG A 1 215 ? -14.690 28.432  31.689  1.00 7.19  ? 215 ARG A O   1 
ATOM   1616  C  CB  . ARG A 1 215 ? -13.856 27.808  34.793  1.00 7.20  ? 215 ARG A CB  1 
ATOM   1617  C  CG  . ARG A 1 215 ? -12.586 28.567  34.376  1.00 7.97  ? 215 ARG A CG  1 
ATOM   1618  C  CD  . ARG A 1 215 ? -11.366 28.155  35.197  1.00 8.36  ? 215 ARG A CD  1 
ATOM   1619  N  NE  . ARG A 1 215 ? -10.164 28.920  34.846  1.00 9.01  ? 215 ARG A NE  1 
ATOM   1620  C  CZ  . ARG A 1 215 ? -9.536  28.846  33.674  1.00 11.75 ? 215 ARG A CZ  1 
ATOM   1621  N  NH1 . ARG A 1 215 ? -9.992  28.039  32.722  1.00 10.12 ? 215 ARG A NH1 1 
ATOM   1622  N  NH2 . ARG A 1 215 ? -8.443  29.573  33.455  1.00 9.70  ? 215 ARG A NH2 1 
ATOM   1623  N  N   . ASP A 1 216 ? -15.610 26.523  32.433  1.00 7.07  ? 216 ASP A N   1 
ATOM   1624  C  CA  . ASP A 1 216 ? -15.676 25.954  31.092  1.00 7.51  ? 216 ASP A CA  1 
ATOM   1625  C  C   . ASP A 1 216 ? -16.594 26.823  30.214  1.00 7.54  ? 216 ASP A C   1 
ATOM   1626  O  O   . ASP A 1 216 ? -16.253 27.146  29.074  1.00 6.77  ? 216 ASP A O   1 
ATOM   1627  C  CB  . ASP A 1 216 ? -16.203 24.515  31.126  1.00 7.76  ? 216 ASP A CB  1 
ATOM   1628  C  CG  . ASP A 1 216 ? -15.260 23.556  31.838  1.00 7.72  ? 216 ASP A CG  1 
ATOM   1629  O  OD1 . ASP A 1 216 ? -14.029 23.757  31.767  1.00 6.23  ? 216 ASP A OD1 1 
ATOM   1630  O  OD2 . ASP A 1 216 ? -15.757 22.588  32.456  1.00 9.48  ? 216 ASP A OD2 1 
ATOM   1631  N  N   . ARG A 1 217 ? -17.752 27.204  30.751  1.00 6.99  ? 217 ARG A N   1 
ATOM   1632  C  CA  . ARG A 1 217 ? -18.687 28.040  29.998  1.00 7.69  ? 217 ARG A CA  1 
ATOM   1633  C  C   . ARG A 1 217 ? -18.044 29.370  29.587  1.00 7.36  ? 217 ARG A C   1 
ATOM   1634  O  O   . ARG A 1 217 ? -18.082 29.746  28.417  1.00 7.39  ? 217 ARG A O   1 
ATOM   1635  C  CB  . ARG A 1 217 ? -19.959 28.319  30.813  1.00 6.20  ? 217 ARG A CB  1 
ATOM   1636  C  CG  . ARG A 1 217 ? -20.953 29.210  30.065  1.00 7.45  ? 217 ARG A CG  1 
ATOM   1637  C  CD  . ARG A 1 217 ? -22.300 29.360  30.767  1.00 7.10  ? 217 ARG A CD  1 
ATOM   1638  N  NE  . ARG A 1 217 ? -22.260 30.212  31.955  1.00 8.79  ? 217 ARG A NE  1 
ATOM   1639  C  CZ  . ARG A 1 217 ? -22.159 29.767  33.204  1.00 6.81  ? 217 ARG A CZ  1 
ATOM   1640  N  NH1 . ARG A 1 217 ? -22.081 28.466  33.446  1.00 6.29  ? 217 ARG A NH1 1 
ATOM   1641  N  NH2 . ARG A 1 217 ? -22.168 30.628  34.215  1.00 6.21  ? 217 ARG A NH2 1 
ATOM   1642  N  N   . PHE A 1 218 ? -17.458 30.074  30.550  1.00 6.23  ? 218 PHE A N   1 
ATOM   1643  C  CA  . PHE A 1 218 ? -16.798 31.354  30.283  1.00 6.25  ? 218 PHE A CA  1 
ATOM   1644  C  C   . PHE A 1 218 ? -15.782 31.211  29.149  1.00 6.66  ? 218 PHE A C   1 
ATOM   1645  O  O   . PHE A 1 218 ? -15.731 32.025  28.232  1.00 7.71  ? 218 PHE A O   1 
ATOM   1646  C  CB  . PHE A 1 218 ? -16.065 31.845  31.538  1.00 6.71  ? 218 PHE A CB  1 
ATOM   1647  C  CG  . PHE A 1 218 ? -16.956 32.504  32.562  1.00 7.17  ? 218 PHE A CG  1 
ATOM   1648  C  CD1 . PHE A 1 218 ? -18.226 32.005  32.838  1.00 8.67  ? 218 PHE A CD1 1 
ATOM   1649  C  CD2 . PHE A 1 218 ? -16.501 33.606  33.280  1.00 7.68  ? 218 PHE A CD2 1 
ATOM   1650  C  CE1 . PHE A 1 218 ? -19.032 32.597  33.820  1.00 8.23  ? 218 PHE A CE1 1 
ATOM   1651  C  CE2 . PHE A 1 218 ? -17.293 34.202  34.262  1.00 8.87  ? 218 PHE A CE2 1 
ATOM   1652  C  CZ  . PHE A 1 218 ? -18.561 33.697  34.531  1.00 7.79  ? 218 PHE A CZ  1 
ATOM   1653  N  N   . LEU A 1 219 ? -14.968 30.166  29.231  1.00 6.92  ? 219 LEU A N   1 
ATOM   1654  C  CA  . LEU A 1 219 ? -13.941 29.915  28.236  1.00 7.95  ? 219 LEU A CA  1 
ATOM   1655  C  C   . LEU A 1 219 ? -14.525 29.726  26.835  1.00 6.61  ? 219 LEU A C   1 
ATOM   1656  O  O   . LEU A 1 219 ? -14.126 30.414  25.897  1.00 7.79  ? 219 LEU A O   1 
ATOM   1657  C  CB  . LEU A 1 219 ? -13.123 28.690  28.658  1.00 10.13 ? 219 LEU A CB  1 
ATOM   1658  C  CG  . LEU A 1 219 ? -11.879 28.314  27.851  1.00 14.68 ? 219 LEU A CG  1 
ATOM   1659  C  CD1 . LEU A 1 219 ? -10.833 27.742  28.798  1.00 15.18 ? 219 LEU A CD1 1 
ATOM   1660  C  CD2 . LEU A 1 219 ? -12.242 27.307  26.757  1.00 16.19 ? 219 LEU A CD2 1 
ATOM   1661  N  N   . PHE A 1 220 ? -15.478 28.807  26.692  1.00 5.89  ? 220 PHE A N   1 
ATOM   1662  C  CA  . PHE A 1 220 ? -16.090 28.551  25.390  1.00 6.74  ? 220 PHE A CA  1 
ATOM   1663  C  C   . PHE A 1 220 ? -16.890 29.732  24.840  1.00 7.46  ? 220 PHE A C   1 
ATOM   1664  O  O   . PHE A 1 220 ? -16.893 29.973  23.632  1.00 7.62  ? 220 PHE A O   1 
ATOM   1665  C  CB  . PHE A 1 220 ? -16.977 27.301  25.457  1.00 6.89  ? 220 PHE A CB  1 
ATOM   1666  C  CG  . PHE A 1 220 ? -16.200 26.009  25.424  1.00 9.31  ? 220 PHE A CG  1 
ATOM   1667  C  CD1 . PHE A 1 220 ? -15.441 25.670  24.307  1.00 9.76  ? 220 PHE A CD1 1 
ATOM   1668  C  CD2 . PHE A 1 220 ? -16.217 25.141  26.509  1.00 8.39  ? 220 PHE A CD2 1 
ATOM   1669  C  CE1 . PHE A 1 220 ? -14.705 24.485  24.273  1.00 12.16 ? 220 PHE A CE1 1 
ATOM   1670  C  CE2 . PHE A 1 220 ? -15.487 23.955  26.487  1.00 11.58 ? 220 PHE A CE2 1 
ATOM   1671  C  CZ  . PHE A 1 220 ? -14.730 23.623  25.370  1.00 10.29 ? 220 PHE A CZ  1 
ATOM   1672  N  N   . CYS A 1 221 ? -17.566 30.470  25.717  1.00 5.71  ? 221 CYS A N   1 
ATOM   1673  C  CA  . CYS A 1 221 ? -18.349 31.619  25.267  1.00 5.49  ? 221 CYS A CA  1 
ATOM   1674  C  C   . CYS A 1 221 ? -17.440 32.740  24.764  1.00 5.64  ? 221 CYS A C   1 
ATOM   1675  O  O   . CYS A 1 221 ? -17.814 33.505  23.865  1.00 5.15  ? 221 CYS A O   1 
ATOM   1676  C  CB  . CYS A 1 221 ? -19.249 32.128  26.395  1.00 6.43  ? 221 CYS A CB  1 
ATOM   1677  S  SG  . CYS A 1 221 ? -20.689 31.073  26.709  1.00 8.50  ? 221 CYS A SG  1 
ATOM   1678  N  N   . ALA A 1 222 ? -16.245 32.836  25.339  1.00 6.11  ? 222 ALA A N   1 
ATOM   1679  C  CA  . ALA A 1 222 ? -15.293 33.850  24.906  1.00 5.60  ? 222 ALA A CA  1 
ATOM   1680  C  C   . ALA A 1 222 ? -14.872 33.511  23.478  1.00 8.40  ? 222 ALA A C   1 
ATOM   1681  O  O   . ALA A 1 222 ? -14.866 34.376  22.601  1.00 8.01  ? 222 ALA A O   1 
ATOM   1682  C  CB  . ALA A 1 222 ? -14.077 33.868  25.821  1.00 6.53  ? 222 ALA A CB  1 
ATOM   1683  N  N   . GLU A 1 223 ? -14.528 32.247  23.241  1.00 8.06  ? 223 GLU A N   1 
ATOM   1684  C  CA  . GLU A 1 223 ? -14.118 31.838  21.901  1.00 9.49  ? 223 GLU A CA  1 
ATOM   1685  C  C   . GLU A 1 223 ? -15.215 32.167  20.895  1.00 8.51  ? 223 GLU A C   1 
ATOM   1686  O  O   . GLU A 1 223 ? -14.947 32.716  19.828  1.00 8.31  ? 223 GLU A O   1 
ATOM   1687  C  CB  . GLU A 1 223 ? -13.831 30.334  21.838  1.00 8.63  ? 223 GLU A CB  1 
ATOM   1688  C  CG  . GLU A 1 223 ? -13.029 29.947  20.594  1.00 10.61 ? 223 GLU A CG  1 
ATOM   1689  C  CD  . GLU A 1 223 ? -13.103 28.470  20.250  1.00 10.11 ? 223 GLU A CD  1 
ATOM   1690  O  OE1 . GLU A 1 223 ? -13.130 27.636  21.178  1.00 9.57  ? 223 GLU A OE1 1 
ATOM   1691  O  OE2 . GLU A 1 223 ? -13.119 28.145  19.040  1.00 11.14 ? 223 GLU A OE2 1 
ATOM   1692  N  N   . ALA A 1 224 ? -16.451 31.830  21.248  1.00 7.41  ? 224 ALA A N   1 
ATOM   1693  C  CA  . ALA A 1 224 ? -17.599 32.061  20.381  1.00 6.44  ? 224 ALA A CA  1 
ATOM   1694  C  C   . ALA A 1 224 ? -17.894 33.533  20.103  1.00 6.89  ? 224 ALA A C   1 
ATOM   1695  O  O   . ALA A 1 224 ? -18.169 33.908  18.960  1.00 5.85  ? 224 ALA A O   1 
ATOM   1696  C  CB  . ALA A 1 224 ? -18.839 31.393  20.973  1.00 4.30  ? 224 ALA A CB  1 
ATOM   1697  N  N   . LEU A 1 225 ? -17.847 34.376  21.130  1.00 7.18  ? 225 LEU A N   1 
ATOM   1698  C  CA  . LEU A 1 225 ? -18.150 35.781  20.908  1.00 7.95  ? 225 LEU A CA  1 
ATOM   1699  C  C   . LEU A 1 225 ? -17.053 36.481  20.110  1.00 7.33  ? 225 LEU A C   1 
ATOM   1700  O  O   . LEU A 1 225 ? -17.336 37.392  19.335  1.00 7.31  ? 225 LEU A O   1 
ATOM   1701  C  CB  . LEU A 1 225 ? -18.416 36.496  22.238  1.00 10.55 ? 225 LEU A CB  1 
ATOM   1702  C  CG  . LEU A 1 225 ? -17.293 36.955  23.163  1.00 12.28 ? 225 LEU A CG  1 
ATOM   1703  C  CD1 . LEU A 1 225 ? -16.801 38.324  22.721  1.00 11.89 ? 225 LEU A CD1 1 
ATOM   1704  C  CD2 . LEU A 1 225 ? -17.825 37.044  24.590  1.00 13.66 ? 225 LEU A CD2 1 
ATOM   1705  N  N   . TYR A 1 226 ? -15.803 36.056  20.273  1.00 7.35  ? 226 TYR A N   1 
ATOM   1706  C  CA  . TYR A 1 226 ? -14.728 36.682  19.507  1.00 8.31  ? 226 TYR A CA  1 
ATOM   1707  C  C   . TYR A 1 226 ? -14.800 36.258  18.042  1.00 8.76  ? 226 TYR A C   1 
ATOM   1708  O  O   . TYR A 1 226 ? -14.421 37.018  17.150  1.00 9.53  ? 226 TYR A O   1 
ATOM   1709  C  CB  . TYR A 1 226 ? -13.353 36.332  20.089  1.00 9.35  ? 226 TYR A CB  1 
ATOM   1710  C  CG  . TYR A 1 226 ? -13.030 37.076  21.365  1.00 9.07  ? 226 TYR A CG  1 
ATOM   1711  C  CD1 . TYR A 1 226 ? -13.273 38.446  21.471  1.00 11.16 ? 226 TYR A CD1 1 
ATOM   1712  C  CD2 . TYR A 1 226 ? -12.463 36.422  22.459  1.00 12.22 ? 226 TYR A CD2 1 
ATOM   1713  C  CE1 . TYR A 1 226 ? -12.956 39.149  22.632  1.00 11.80 ? 226 TYR A CE1 1 
ATOM   1714  C  CE2 . TYR A 1 226 ? -12.140 37.118  23.629  1.00 11.24 ? 226 TYR A CE2 1 
ATOM   1715  C  CZ  . TYR A 1 226 ? -12.390 38.478  23.707  1.00 12.64 ? 226 TYR A CZ  1 
ATOM   1716  O  OH  . TYR A 1 226 ? -12.067 39.175  24.853  1.00 13.68 ? 226 TYR A OH  1 
ATOM   1717  N  N   . LYS A 1 227 ? -15.298 35.048  17.794  1.00 6.70  ? 227 LYS A N   1 
ATOM   1718  C  CA  . LYS A 1 227 ? -15.421 34.554  16.425  1.00 9.53  ? 227 LYS A CA  1 
ATOM   1719  C  C   . LYS A 1 227 ? -16.543 35.323  15.727  1.00 9.22  ? 227 LYS A C   1 
ATOM   1720  O  O   . LYS A 1 227 ? -16.403 35.743  14.575  1.00 8.82  ? 227 LYS A O   1 
ATOM   1721  C  CB  . LYS A 1 227 ? -15.738 33.053  16.418  1.00 9.28  ? 227 LYS A CB  1 
ATOM   1722  C  CG  . LYS A 1 227 ? -15.751 32.417  15.020  1.00 10.43 ? 227 LYS A CG  1 
ATOM   1723  C  CD  . LYS A 1 227 ? -16.283 30.990  15.070  1.00 12.25 ? 227 LYS A CD  1 
ATOM   1724  C  CE  . LYS A 1 227 ? -16.343 30.349  13.685  1.00 13.52 ? 227 LYS A CE  1 
ATOM   1725  N  NZ  . LYS A 1 227 ? -14.983 30.092  13.135  1.00 15.35 ? 227 LYS A NZ  1 
ATOM   1726  N  N   . ALA A 1 228 ? -17.651 35.515  16.437  1.00 9.75  ? 228 ALA A N   1 
ATOM   1727  C  CA  . ALA A 1 228 ? -18.796 36.239  15.894  1.00 10.60 ? 228 ALA A CA  1 
ATOM   1728  C  C   . ALA A 1 228 ? -18.427 37.693  15.608  1.00 10.45 ? 228 ALA A C   1 
ATOM   1729  O  O   . ALA A 1 228 ? -18.837 38.261  14.595  1.00 12.99 ? 228 ALA A O   1 
ATOM   1730  C  CB  . ALA A 1 228 ? -19.968 36.176  16.873  1.00 8.70  ? 228 ALA A CB  1 
ATOM   1731  N  N   . GLN A 1 229 ? -17.647 38.290  16.503  1.00 11.25 ? 229 GLN A N   1 
ATOM   1732  C  CA  . GLN A 1 229 ? -17.228 39.676  16.345  1.00 11.35 ? 229 GLN A CA  1 
ATOM   1733  C  C   . GLN A 1 229 ? -16.336 39.851  15.125  1.00 10.70 ? 229 GLN A C   1 
ATOM   1734  O  O   . GLN A 1 229 ? -16.495 40.803  14.367  1.00 11.11 ? 229 GLN A O   1 
ATOM   1735  C  CB  . GLN A 1 229 ? -16.488 40.158  17.599  1.00 10.75 ? 229 GLN A CB  1 
ATOM   1736  C  CG  . GLN A 1 229 ? -16.004 41.598  17.509  1.00 13.28 ? 229 GLN A CG  1 
ATOM   1737  C  CD  . GLN A 1 229 ? -15.513 42.138  18.842  1.00 14.56 ? 229 GLN A CD  1 
ATOM   1738  O  OE1 . GLN A 1 229 ? -16.255 42.172  19.821  1.00 14.44 ? 229 GLN A OE1 1 
ATOM   1739  N  NE2 . GLN A 1 229 ? -14.258 42.570  18.881  1.00 15.30 ? 229 GLN A NE2 1 
ATOM   1740  N  N   . ALA A 1 230 ? -15.401 38.926  14.935  1.00 11.89 ? 230 ALA A N   1 
ATOM   1741  C  CA  . ALA A 1 230 ? -14.488 38.979  13.797  1.00 10.95 ? 230 ALA A CA  1 
ATOM   1742  C  C   . ALA A 1 230 ? -15.247 38.781  12.485  1.00 11.49 ? 230 ALA A C   1 
ATOM   1743  O  O   . ALA A 1 230 ? -14.915 39.388  11.461  1.00 11.76 ? 230 ALA A O   1 
ATOM   1744  C  CB  . ALA A 1 230 ? -13.413 37.902  13.945  1.00 11.83 ? 230 ALA A CB  1 
ATOM   1745  N  N   . GLU A 1 231 ? -16.269 37.933  12.521  1.00 8.54  ? 231 GLU A N   1 
ATOM   1746  C  CA  . GLU A 1 231 ? -17.073 37.642  11.337  1.00 10.22 ? 231 GLU A CA  1 
ATOM   1747  C  C   . GLU A 1 231 ? -17.968 38.803  10.891  1.00 10.25 ? 231 GLU A C   1 
ATOM   1748  O  O   . GLU A 1 231 ? -18.100 39.074  9.693   1.00 8.08  ? 231 GLU A O   1 
ATOM   1749  C  CB  . GLU A 1 231 ? -17.946 36.406  11.596  1.00 8.71  ? 231 GLU A CB  1 
ATOM   1750  C  CG  . GLU A 1 231 ? -18.791 35.966  10.397  1.00 12.43 ? 231 GLU A CG  1 
ATOM   1751  C  CD  . GLU A 1 231 ? -19.603 34.709  10.674  1.00 10.58 ? 231 GLU A CD  1 
ATOM   1752  O  OE1 . GLU A 1 231 ? -19.026 33.729  11.192  1.00 10.76 ? 231 GLU A OE1 1 
ATOM   1753  O  OE2 . GLU A 1 231 ? -20.813 34.693  10.364  1.00 11.83 ? 231 GLU A OE2 1 
ATOM   1754  N  N   . THR A 1 232 ? -18.567 39.493  11.857  1.00 9.97  ? 232 THR A N   1 
ATOM   1755  C  CA  . THR A 1 232 ? -19.493 40.587  11.568  1.00 9.13  ? 232 THR A CA  1 
ATOM   1756  C  C   . THR A 1 232 ? -18.923 41.998  11.565  1.00 10.08 ? 232 THR A C   1 
ATOM   1757  O  O   . THR A 1 232 ? -19.470 42.881  10.909  1.00 11.83 ? 232 THR A O   1 
ATOM   1758  C  CB  . THR A 1 232 ? -20.649 40.593  12.570  1.00 8.10  ? 232 THR A CB  1 
ATOM   1759  O  OG1 . THR A 1 232 ? -20.137 40.899  13.874  1.00 6.92  ? 232 THR A OG1 1 
ATOM   1760  C  CG2 . THR A 1 232 ? -21.333 39.233  12.601  1.00 6.51  ? 232 THR A CG2 1 
ATOM   1761  N  N   . GLY A 1 233 ? -17.850 42.223  12.315  1.00 9.51  ? 233 GLY A N   1 
ATOM   1762  C  CA  . GLY A 1 233 ? -17.275 43.554  12.371  1.00 9.21  ? 233 GLY A CA  1 
ATOM   1763  C  C   . GLY A 1 233 ? -18.011 44.453  13.353  1.00 10.08 ? 233 GLY A C   1 
ATOM   1764  O  O   . GLY A 1 233 ? -17.784 45.660  13.389  1.00 11.02 ? 233 GLY A O   1 
ATOM   1765  N  N   . GLU A 1 234 ? -18.918 43.873  14.136  1.00 9.97  ? 234 GLU A N   1 
ATOM   1766  C  CA  . GLU A 1 234 ? -19.651 44.636  15.143  1.00 8.92  ? 234 GLU A CA  1 
ATOM   1767  C  C   . GLU A 1 234 ? -19.257 44.093  16.518  1.00 8.88  ? 234 GLU A C   1 
ATOM   1768  O  O   . GLU A 1 234 ? -19.101 42.882  16.691  1.00 10.23 ? 234 GLU A O   1 
ATOM   1769  C  CB  . GLU A 1 234 ? -21.171 44.505  14.948  1.00 8.73  ? 234 GLU A CB  1 
ATOM   1770  C  CG  . GLU A 1 234 ? -21.687 45.051  13.613  1.00 8.70  ? 234 GLU A CG  1 
ATOM   1771  C  CD  . GLU A 1 234 ? -23.208 45.081  13.524  1.00 9.47  ? 234 GLU A CD  1 
ATOM   1772  O  OE1 . GLU A 1 234 ? -23.867 44.311  14.251  1.00 10.82 ? 234 GLU A OE1 1 
ATOM   1773  O  OE2 . GLU A 1 234 ? -23.746 45.863  12.711  1.00 9.70  ? 234 GLU A OE2 1 
ATOM   1774  N  N   . ILE A 1 235 ? -19.088 44.983  17.489  1.00 8.52  ? 235 ILE A N   1 
ATOM   1775  C  CA  . ILE A 1 235 ? -18.711 44.557  18.836  1.00 9.16  ? 235 ILE A CA  1 
ATOM   1776  C  C   . ILE A 1 235 ? -19.816 43.698  19.462  1.00 8.27  ? 235 ILE A C   1 
ATOM   1777  O  O   . ILE A 1 235 ? -21.002 44.029  19.383  1.00 7.90  ? 235 ILE A O   1 
ATOM   1778  C  CB  . ILE A 1 235 ? -18.380 45.779  19.729  1.00 9.93  ? 235 ILE A CB  1 
ATOM   1779  C  CG1 . ILE A 1 235 ? -17.124 46.469  19.181  1.00 10.28 ? 235 ILE A CG1 1 
ATOM   1780  C  CG2 . ILE A 1 235 ? -18.154 45.341  21.171  1.00 10.16 ? 235 ILE A CG2 1 
ATOM   1781  C  CD1 . ILE A 1 235 ? -16.695 47.712  19.936  1.00 9.03  ? 235 ILE A CD1 1 
ATOM   1782  N  N   . LYS A 1 236 ? -19.409 42.591  20.076  1.00 8.31  ? 236 LYS A N   1 
ATOM   1783  C  CA  . LYS A 1 236 ? -20.346 41.650  20.685  1.00 8.43  ? 236 LYS A CA  1 
ATOM   1784  C  C   . LYS A 1 236 ? -20.073 41.435  22.162  1.00 9.35  ? 236 LYS A C   1 
ATOM   1785  O  O   . LYS A 1 236 ? -18.997 41.758  22.668  1.00 9.97  ? 236 LYS A O   1 
ATOM   1786  C  CB  . LYS A 1 236 ? -20.249 40.287  19.990  1.00 6.01  ? 236 LYS A CB  1 
ATOM   1787  C  CG  . LYS A 1 236 ? -20.417 40.314  18.479  1.00 7.50  ? 236 LYS A CG  1 
ATOM   1788  C  CD  . LYS A 1 236 ? -21.839 40.687  18.076  1.00 5.70  ? 236 LYS A CD  1 
ATOM   1789  C  CE  . LYS A 1 236 ? -22.007 40.619  16.565  1.00 7.42  ? 236 LYS A CE  1 
ATOM   1790  N  NZ  . LYS A 1 236 ? -23.410 40.902  16.139  1.00 6.68  ? 236 LYS A NZ  1 
ATOM   1791  N  N   . GLY A 1 237 ? -21.057 40.859  22.842  1.00 8.15  ? 237 GLY A N   1 
ATOM   1792  C  CA  . GLY A 1 237 ? -20.917 40.566  24.251  1.00 9.01  ? 237 GLY A CA  1 
ATOM   1793  C  C   . GLY A 1 237 ? -21.831 39.431  24.673  1.00 8.98  ? 237 GLY A C   1 
ATOM   1794  O  O   . GLY A 1 237 ? -22.824 39.140  24.011  1.00 9.26  ? 237 GLY A O   1 
ATOM   1795  N  N   . HIS A 1 238 ? -21.475 38.768  25.766  1.00 8.24  ? 238 HIS A N   1 
ATOM   1796  C  CA  . HIS A 1 238 ? -22.284 37.689  26.316  1.00 9.30  ? 238 HIS A CA  1 
ATOM   1797  C  C   . HIS A 1 238 ? -22.281 37.923  27.815  1.00 9.06  ? 238 HIS A C   1 
ATOM   1798  O  O   . HIS A 1 238 ? -21.217 37.919  28.434  1.00 8.71  ? 238 HIS A O   1 
ATOM   1799  C  CB  . HIS A 1 238 ? -21.671 36.316  26.020  1.00 9.04  ? 238 HIS A CB  1 
ATOM   1800  C  CG  . HIS A 1 238 ? -22.425 35.179  26.639  1.00 8.40  ? 238 HIS A CG  1 
ATOM   1801  N  ND1 . HIS A 1 238 ? -23.547 34.624  26.058  1.00 8.66  ? 238 HIS A ND1 1 
ATOM   1802  C  CD2 . HIS A 1 238 ? -22.249 34.522  27.811  1.00 8.98  ? 238 HIS A CD2 1 
ATOM   1803  C  CE1 . HIS A 1 238 ? -24.027 33.677  26.844  1.00 7.81  ? 238 HIS A CE1 1 
ATOM   1804  N  NE2 . HIS A 1 238 ? -23.260 33.595  27.914  1.00 8.83  ? 238 HIS A NE2 1 
ATOM   1805  N  N   . TYR A 1 239 ? -23.451 38.142  28.410  1.00 8.97  ? 239 TYR A N   1 
ATOM   1806  C  CA  . TYR A 1 239 ? -23.481 38.373  29.853  1.00 8.29  ? 239 TYR A CA  1 
ATOM   1807  C  C   . TYR A 1 239 ? -23.075 37.089  30.580  1.00 8.89  ? 239 TYR A C   1 
ATOM   1808  O  O   . TYR A 1 239 ? -23.854 36.132  30.646  1.00 10.19 ? 239 TYR A O   1 
ATOM   1809  C  CB  . TYR A 1 239 ? -24.874 38.768  30.367  1.00 5.91  ? 239 TYR A CB  1 
ATOM   1810  C  CG  . TYR A 1 239 ? -25.695 39.760  29.559  1.00 8.43  ? 239 TYR A CG  1 
ATOM   1811  C  CD1 . TYR A 1 239 ? -25.114 40.624  28.623  1.00 5.31  ? 239 TYR A CD1 1 
ATOM   1812  C  CD2 . TYR A 1 239 ? -27.075 39.840  29.760  1.00 6.25  ? 239 TYR A CD2 1 
ATOM   1813  C  CE1 . TYR A 1 239 ? -25.904 41.545  27.910  1.00 6.49  ? 239 TYR A CE1 1 
ATOM   1814  C  CE2 . TYR A 1 239 ? -27.860 40.742  29.063  1.00 8.99  ? 239 TYR A CE2 1 
ATOM   1815  C  CZ  . TYR A 1 239 ? -27.277 41.591  28.142  1.00 7.17  ? 239 TYR A CZ  1 
ATOM   1816  O  OH  . TYR A 1 239 ? -28.087 42.486  27.479  1.00 9.25  ? 239 TYR A OH  1 
ATOM   1817  N  N   . LEU A 1 240 ? -21.858 37.063  31.115  1.00 7.61  ? 240 LEU A N   1 
ATOM   1818  C  CA  . LEU A 1 240 ? -21.380 35.909  31.867  1.00 7.42  ? 240 LEU A CA  1 
ATOM   1819  C  C   . LEU A 1 240 ? -21.886 36.090  33.299  1.00 6.46  ? 240 LEU A C   1 
ATOM   1820  O  O   . LEU A 1 240 ? -21.606 37.102  33.940  1.00 5.50  ? 240 LEU A O   1 
ATOM   1821  C  CB  . LEU A 1 240 ? -19.850 35.853  31.832  1.00 6.56  ? 240 LEU A CB  1 
ATOM   1822  C  CG  . LEU A 1 240 ? -19.286 35.553  30.437  1.00 7.88  ? 240 LEU A CG  1 
ATOM   1823  C  CD1 . LEU A 1 240 ? -17.782 35.760  30.416  1.00 9.32  ? 240 LEU A CD1 1 
ATOM   1824  C  CD2 . LEU A 1 240 ? -19.638 34.125  30.049  1.00 6.93  ? 240 LEU A CD2 1 
ATOM   1825  N  N   . ASN A 1 241 ? -22.635 35.109  33.791  1.00 7.08  ? 241 ASN A N   1 
ATOM   1826  C  CA  . ASN A 1 241 ? -23.221 35.183  35.126  1.00 7.22  ? 241 ASN A CA  1 
ATOM   1827  C  C   . ASN A 1 241 ? -22.237 34.976  36.274  1.00 9.10  ? 241 ASN A C   1 
ATOM   1828  O  O   . ASN A 1 241 ? -21.641 33.907  36.416  1.00 9.18  ? 241 ASN A O   1 
ATOM   1829  C  CB  . ASN A 1 241 ? -24.361 34.168  35.255  1.00 6.50  ? 241 ASN A CB  1 
ATOM   1830  C  CG  . ASN A 1 241 ? -25.448 34.632  36.207  1.00 6.44  ? 241 ASN A CG  1 
ATOM   1831  O  OD1 . ASN A 1 241 ? -25.195 35.417  37.122  1.00 6.61  ? 241 ASN A OD1 1 
ATOM   1832  N  ND2 . ASN A 1 241 ? -26.662 34.137  36.003  1.00 7.84  ? 241 ASN A ND2 1 
ATOM   1833  N  N   . ALA A 1 242 ? -22.093 36.002  37.107  1.00 9.58  ? 242 ALA A N   1 
ATOM   1834  C  CA  . ALA A 1 242 ? -21.186 35.940  38.245  1.00 8.70  ? 242 ALA A CA  1 
ATOM   1835  C  C   . ALA A 1 242 ? -21.919 35.569  39.526  1.00 8.82  ? 242 ALA A C   1 
ATOM   1836  O  O   . ALA A 1 242 ? -21.290 35.369  40.560  1.00 8.49  ? 242 ALA A O   1 
ATOM   1837  C  CB  . ALA A 1 242 ? -20.477 37.277  38.423  1.00 8.66  ? 242 ALA A CB  1 
ATOM   1838  N  N   . THR A 1 243 ? -23.248 35.488  39.460  1.00 7.40  ? 243 THR A N   1 
ATOM   1839  C  CA  . THR A 1 243 ? -24.048 35.129  40.632  1.00 6.47  ? 243 THR A CA  1 
ATOM   1840  C  C   . THR A 1 243 ? -23.504 33.842  41.255  1.00 7.80  ? 243 THR A C   1 
ATOM   1841  O  O   . THR A 1 243 ? -23.313 32.842  40.561  1.00 6.04  ? 243 THR A O   1 
ATOM   1842  C  CB  . THR A 1 243 ? -25.528 34.922  40.248  1.00 6.01  ? 243 THR A CB  1 
ATOM   1843  O  OG1 . THR A 1 243 ? -26.015 36.101  39.601  1.00 7.07  ? 243 THR A OG1 1 
ATOM   1844  C  CG2 . THR A 1 243 ? -26.371 34.654  41.488  1.00 5.34  ? 243 THR A CG2 1 
ATOM   1845  N  N   . ALA A 1 244 ? -23.263 33.865  42.565  1.00 7.60  ? 244 ALA A N   1 
ATOM   1846  C  CA  . ALA A 1 244 ? -22.715 32.698  43.248  1.00 7.12  ? 244 ALA A CA  1 
ATOM   1847  C  C   . ALA A 1 244 ? -23.201 32.578  44.689  1.00 7.03  ? 244 ALA A C   1 
ATOM   1848  O  O   . ALA A 1 244 ? -23.970 33.413  45.170  1.00 7.45  ? 244 ALA A O   1 
ATOM   1849  C  CB  . ALA A 1 244 ? -21.182 32.749  43.209  1.00 7.23  ? 244 ALA A CB  1 
ATOM   1850  N  N   . GLY A 1 245 ? -22.740 31.533  45.373  1.00 7.66  ? 245 GLY A N   1 
ATOM   1851  C  CA  . GLY A 1 245 ? -23.151 31.291  46.747  1.00 6.25  ? 245 GLY A CA  1 
ATOM   1852  C  C   . GLY A 1 245 ? -22.459 32.128  47.805  1.00 7.49  ? 245 GLY A C   1 
ATOM   1853  O  O   . GLY A 1 245 ? -23.001 32.327  48.894  1.00 7.01  ? 245 GLY A O   1 
ATOM   1854  N  N   . THR A 1 246 ? -21.259 32.613  47.493  1.00 7.43  ? 246 THR A N   1 
ATOM   1855  C  CA  . THR A 1 246 ? -20.495 33.434  48.428  1.00 8.40  ? 246 THR A CA  1 
ATOM   1856  C  C   . THR A 1 246 ? -19.867 34.610  47.689  1.00 8.61  ? 246 THR A C   1 
ATOM   1857  O  O   . THR A 1 246 ? -19.776 34.601  46.462  1.00 6.61  ? 246 THR A O   1 
ATOM   1858  C  CB  . THR A 1 246 ? -19.347 32.631  49.083  1.00 9.71  ? 246 THR A CB  1 
ATOM   1859  O  OG1 . THR A 1 246 ? -18.437 32.193  48.067  1.00 9.01  ? 246 THR A OG1 1 
ATOM   1860  C  CG2 . THR A 1 246 ? -19.890 31.419  49.835  1.00 9.85  ? 246 THR A CG2 1 
ATOM   1861  N  N   . CYS A 1 247 ? -19.437 35.619  48.443  1.00 8.11  ? 247 CYS A N   1 
ATOM   1862  C  CA  . CYS A 1 247 ? -18.788 36.792  47.865  1.00 8.03  ? 247 CYS A CA  1 
ATOM   1863  C  C   . CYS A 1 247 ? -17.510 36.359  47.148  1.00 8.83  ? 247 CYS A C   1 
ATOM   1864  O  O   . CYS A 1 247 ? -17.207 36.838  46.050  1.00 7.44  ? 247 CYS A O   1 
ATOM   1865  C  CB  . CYS A 1 247 ? -18.426 37.796  48.964  1.00 7.58  ? 247 CYS A CB  1 
ATOM   1866  S  SG  . CYS A 1 247 ? -19.830 38.427  49.929  1.00 16.37 ? 247 CYS A SG  1 
ATOM   1867  N  N   . GLU A 1 248 ? -16.766 35.452  47.779  1.00 8.09  ? 248 GLU A N   1 
ATOM   1868  C  CA  . GLU A 1 248 ? -15.517 34.948  47.214  1.00 8.97  ? 248 GLU A CA  1 
ATOM   1869  C  C   . GLU A 1 248 ? -15.715 34.286  45.854  1.00 9.43  ? 248 GLU A C   1 
ATOM   1870  O  O   . GLU A 1 248 ? -14.986 34.583  44.909  1.00 10.13 ? 248 GLU A O   1 
ATOM   1871  C  CB  . GLU A 1 248 ? -14.848 33.961  48.179  1.00 11.47 ? 248 GLU A CB  1 
ATOM   1872  C  CG  . GLU A 1 248 ? -14.348 34.606  49.472  1.00 14.07 ? 248 GLU A CG  1 
ATOM   1873  C  CD  . GLU A 1 248 ? -15.398 34.637  50.578  1.00 17.15 ? 248 GLU A CD  1 
ATOM   1874  O  OE1 . GLU A 1 248 ? -16.605 34.502  50.281  1.00 15.36 ? 248 GLU A OE1 1 
ATOM   1875  O  OE2 . GLU A 1 248 ? -15.008 34.807  51.752  1.00 19.30 ? 248 GLU A OE2 1 
ATOM   1876  N  N   . ASP A 1 249 ? -16.692 33.388  45.752  1.00 7.11  ? 249 ASP A N   1 
ATOM   1877  C  CA  . ASP A 1 249 ? -16.958 32.722  44.482  1.00 7.41  ? 249 ASP A CA  1 
ATOM   1878  C  C   . ASP A 1 249 ? -17.405 33.732  43.425  1.00 7.88  ? 249 ASP A C   1 
ATOM   1879  O  O   . ASP A 1 249 ? -17.009 33.640  42.258  1.00 9.70  ? 249 ASP A O   1 
ATOM   1880  C  CB  . ASP A 1 249 ? -18.019 31.627  44.655  1.00 9.27  ? 249 ASP A CB  1 
ATOM   1881  C  CG  . ASP A 1 249 ? -17.445 30.344  45.238  1.00 11.62 ? 249 ASP A CG  1 
ATOM   1882  O  OD1 . ASP A 1 249 ? -16.230 30.116  45.090  1.00 14.30 ? 249 ASP A OD1 1 
ATOM   1883  O  OD2 . ASP A 1 249 ? -18.206 29.553  45.824  1.00 15.97 ? 249 ASP A OD2 1 
ATOM   1884  N  N   . MET A 1 250 ? -18.222 34.698  43.834  1.00 6.19  ? 250 MET A N   1 
ATOM   1885  C  CA  . MET A 1 250 ? -18.704 35.727  42.916  1.00 6.90  ? 250 MET A CA  1 
ATOM   1886  C  C   . MET A 1 250 ? -17.519 36.492  42.321  1.00 7.28  ? 250 MET A C   1 
ATOM   1887  O  O   . MET A 1 250 ? -17.449 36.699  41.110  1.00 5.62  ? 250 MET A O   1 
ATOM   1888  C  CB  . MET A 1 250 ? -19.635 36.704  43.647  1.00 6.81  ? 250 MET A CB  1 
ATOM   1889  C  CG  . MET A 1 250 ? -20.144 37.853  42.780  1.00 7.68  ? 250 MET A CG  1 
ATOM   1890  S  SD  . MET A 1 250 ? -21.047 39.097  43.736  1.00 11.15 ? 250 MET A SD  1 
ATOM   1891  C  CE  . MET A 1 250 ? -19.692 39.880  44.636  1.00 9.72  ? 250 MET A CE  1 
ATOM   1892  N  N   . MET A 1 251 ? -16.588 36.901  43.179  1.00 7.89  ? 251 MET A N   1 
ATOM   1893  C  CA  . MET A 1 251 ? -15.407 37.644  42.738  1.00 10.03 ? 251 MET A CA  1 
ATOM   1894  C  C   . MET A 1 251 ? -14.493 36.829  41.825  1.00 9.38  ? 251 MET A C   1 
ATOM   1895  O  O   . MET A 1 251 ? -13.924 37.362  40.869  1.00 10.30 ? 251 MET A O   1 
ATOM   1896  C  CB  . MET A 1 251 ? -14.622 38.149  43.950  1.00 13.13 ? 251 MET A CB  1 
ATOM   1897  C  CG  . MET A 1 251 ? -15.295 39.313  44.657  1.00 18.05 ? 251 MET A CG  1 
ATOM   1898  S  SD  . MET A 1 251 ? -15.629 40.667  43.501  1.00 25.47 ? 251 MET A SD  1 
ATOM   1899  C  CE  . MET A 1 251 ? -13.973 41.164  43.131  1.00 20.73 ? 251 MET A CE  1 
ATOM   1900  N  N   . LYS A 1 252 ? -14.359 35.540  42.120  1.00 9.38  ? 252 LYS A N   1 
ATOM   1901  C  CA  . LYS A 1 252 ? -13.534 34.642  41.314  1.00 11.48 ? 252 LYS A CA  1 
ATOM   1902  C  C   . LYS A 1 252 ? -13.998 34.621  39.866  1.00 10.78 ? 252 LYS A C   1 
ATOM   1903  O  O   . LYS A 1 252 ? -13.186 34.607  38.944  1.00 9.14  ? 252 LYS A O   1 
ATOM   1904  C  CB  . LYS A 1 252 ? -13.604 33.214  41.857  1.00 15.04 ? 252 LYS A CB  1 
ATOM   1905  C  CG  . LYS A 1 252 ? -12.459 32.825  42.754  1.00 20.70 ? 252 LYS A CG  1 
ATOM   1906  C  CD  . LYS A 1 252 ? -12.615 31.385  43.201  1.00 24.38 ? 252 LYS A CD  1 
ATOM   1907  C  CE  . LYS A 1 252 ? -11.388 30.908  43.948  1.00 27.94 ? 252 LYS A CE  1 
ATOM   1908  N  NZ  . LYS A 1 252 ? -11.515 29.468  44.294  1.00 32.44 ? 252 LYS A NZ  1 
ATOM   1909  N  N   . ARG A 1 253 ? -15.312 34.602  39.672  1.00 8.77  ? 253 ARG A N   1 
ATOM   1910  C  CA  . ARG A 1 253 ? -15.871 34.570  38.329  1.00 8.44  ? 253 ARG A CA  1 
ATOM   1911  C  C   . ARG A 1 253 ? -15.683 35.896  37.601  1.00 7.49  ? 253 ARG A C   1 
ATOM   1912  O  O   . ARG A 1 253 ? -15.344 35.917  36.420  1.00 6.98  ? 253 ARG A O   1 
ATOM   1913  C  CB  . ARG A 1 253 ? -17.346 34.164  38.416  1.00 5.77  ? 253 ARG A CB  1 
ATOM   1914  C  CG  . ARG A 1 253 ? -17.458 32.790  39.071  1.00 7.52  ? 253 ARG A CG  1 
ATOM   1915  C  CD  . ARG A 1 253 ? -18.853 32.292  39.390  1.00 6.71  ? 253 ARG A CD  1 
ATOM   1916  N  NE  . ARG A 1 253 ? -18.721 31.099  40.230  1.00 6.60  ? 253 ARG A NE  1 
ATOM   1917  C  CZ  . ARG A 1 253 ? -19.699 30.251  40.534  1.00 4.68  ? 253 ARG A CZ  1 
ATOM   1918  N  NH1 . ARG A 1 253 ? -20.926 30.440  40.071  1.00 5.87  ? 253 ARG A NH1 1 
ATOM   1919  N  NH2 . ARG A 1 253 ? -19.436 29.200  41.304  1.00 2.94  ? 253 ARG A NH2 1 
ATOM   1920  N  N   . ALA A 1 254 ? -15.878 36.999  38.314  1.00 7.99  ? 254 ALA A N   1 
ATOM   1921  C  CA  . ALA A 1 254 ? -15.715 38.326  37.731  1.00 7.81  ? 254 ALA A CA  1 
ATOM   1922  C  C   . ALA A 1 254 ? -14.264 38.524  37.309  1.00 8.14  ? 254 ALA A C   1 
ATOM   1923  O  O   . ALA A 1 254 ? -13.980 39.098  36.256  1.00 8.63  ? 254 ALA A O   1 
ATOM   1924  C  CB  . ALA A 1 254 ? -16.110 39.391  38.745  1.00 8.23  ? 254 ALA A CB  1 
ATOM   1925  N  N   . VAL A 1 255 ? -13.347 38.050  38.143  1.00 8.48  ? 255 VAL A N   1 
ATOM   1926  C  CA  . VAL A 1 255 ? -11.925 38.169  37.859  1.00 9.52  ? 255 VAL A CA  1 
ATOM   1927  C  C   . VAL A 1 255 ? -11.547 37.446  36.569  1.00 9.86  ? 255 VAL A C   1 
ATOM   1928  O  O   . VAL A 1 255 ? -10.752 37.959  35.780  1.00 10.49 ? 255 VAL A O   1 
ATOM   1929  C  CB  . VAL A 1 255 ? -11.080 37.616  39.031  1.00 9.74  ? 255 VAL A CB  1 
ATOM   1930  C  CG1 . VAL A 1 255 ? -9.626  37.439  38.607  1.00 10.14 ? 255 VAL A CG1 1 
ATOM   1931  C  CG2 . VAL A 1 255 ? -11.164 38.575  40.210  1.00 10.68 ? 255 VAL A CG2 1 
ATOM   1932  N  N   . PHE A 1 256 ? -12.115 36.264  36.344  1.00 8.41  ? 256 PHE A N   1 
ATOM   1933  C  CA  . PHE A 1 256 ? -11.787 35.522  35.129  1.00 9.51  ? 256 PHE A CA  1 
ATOM   1934  C  C   . PHE A 1 256 ? -12.336 36.226  33.890  1.00 10.19 ? 256 PHE A C   1 
ATOM   1935  O  O   . PHE A 1 256 ? -11.728 36.176  32.819  1.00 11.42 ? 256 PHE A O   1 
ATOM   1936  C  CB  . PHE A 1 256 ? -12.316 34.084  35.198  1.00 9.00  ? 256 PHE A CB  1 
ATOM   1937  C  CG  . PHE A 1 256 ? -11.824 33.210  34.076  1.00 8.26  ? 256 PHE A CG  1 
ATOM   1938  C  CD1 . PHE A 1 256 ? -10.464 33.144  33.780  1.00 11.62 ? 256 PHE A CD1 1 
ATOM   1939  C  CD2 . PHE A 1 256 ? -12.715 32.465  33.307  1.00 8.82  ? 256 PHE A CD2 1 
ATOM   1940  C  CE1 . PHE A 1 256 ? -9.995  32.350  32.732  1.00 8.02  ? 256 PHE A CE1 1 
ATOM   1941  C  CE2 . PHE A 1 256 ? -12.260 31.669  32.259  1.00 8.88  ? 256 PHE A CE2 1 
ATOM   1942  C  CZ  . PHE A 1 256 ? -10.895 31.613  31.971  1.00 10.41 ? 256 PHE A CZ  1 
ATOM   1943  N  N   . ALA A 1 257 ? -13.481 36.888  34.032  1.00 10.09 ? 257 ALA A N   1 
ATOM   1944  C  CA  . ALA A 1 257 ? -14.063 37.612  32.906  1.00 9.60  ? 257 ALA A CA  1 
ATOM   1945  C  C   . ALA A 1 257 ? -13.115 38.753  32.557  1.00 9.85  ? 257 ALA A C   1 
ATOM   1946  O  O   . ALA A 1 257 ? -12.926 39.095  31.390  1.00 7.69  ? 257 ALA A O   1 
ATOM   1947  C  CB  . ALA A 1 257 ? -15.443 38.164  33.282  1.00 11.41 ? 257 ALA A CB  1 
ATOM   1948  N  N   . ARG A 1 258 ? -12.520 39.338  33.590  1.00 8.46  ? 258 ARG A N   1 
ATOM   1949  C  CA  . ARG A 1 258 ? -11.574 40.436  33.424  1.00 10.06 ? 258 ARG A CA  1 
ATOM   1950  C  C   . ARG A 1 258 ? -10.370 39.920  32.629  1.00 9.25  ? 258 ARG A C   1 
ATOM   1951  O  O   . ARG A 1 258 ? -9.895  40.580  31.707  1.00 11.08 ? 258 ARG A O   1 
ATOM   1952  C  CB  . ARG A 1 258 ? -11.126 40.930  34.805  1.00 12.25 ? 258 ARG A CB  1 
ATOM   1953  C  CG  . ARG A 1 258 ? -10.694 42.392  34.891  1.00 15.53 ? 258 ARG A CG  1 
ATOM   1954  C  CD  . ARG A 1 258 ? -9.367  42.676  34.211  1.00 17.90 ? 258 ARG A CD  1 
ATOM   1955  N  NE  . ARG A 1 258 ? -8.849  43.986  34.611  1.00 21.20 ? 258 ARG A NE  1 
ATOM   1956  C  CZ  . ARG A 1 258 ? -7.795  44.584  34.060  1.00 21.87 ? 258 ARG A CZ  1 
ATOM   1957  N  NH1 . ARG A 1 258 ? -7.136  43.993  33.072  1.00 20.69 ? 258 ARG A NH1 1 
ATOM   1958  N  NH2 . ARG A 1 258 ? -7.403  45.776  34.496  1.00 19.97 ? 258 ARG A NH2 1 
ATOM   1959  N  N   . GLU A 1 259 ? -9.895  38.728  32.986  1.00 9.51  ? 259 GLU A N   1 
ATOM   1960  C  CA  . GLU A 1 259 ? -8.747  38.113  32.319  1.00 9.95  ? 259 GLU A CA  1 
ATOM   1961  C  C   . GLU A 1 259 ? -9.024  37.813  30.844  1.00 9.71  ? 259 GLU A C   1 
ATOM   1962  O  O   . GLU A 1 259 ? -8.131  37.927  30.003  1.00 7.25  ? 259 GLU A O   1 
ATOM   1963  C  CB  . GLU A 1 259 ? -8.349  36.810  33.027  1.00 11.83 ? 259 GLU A CB  1 
ATOM   1964  C  CG  . GLU A 1 259 ? -6.954  36.305  32.658  1.00 17.02 ? 259 GLU A CG  1 
ATOM   1965  C  CD  . GLU A 1 259 ? -6.654  34.902  33.180  1.00 21.35 ? 259 GLU A CD  1 
ATOM   1966  O  OE1 . GLU A 1 259 ? -7.037  34.584  34.326  1.00 22.72 ? 259 GLU A OE1 1 
ATOM   1967  O  OE2 . GLU A 1 259 ? -6.018  34.116  32.445  1.00 23.91 ? 259 GLU A OE2 1 
ATOM   1968  N  N   . LEU A 1 260 ? -10.258 37.419  30.536  1.00 8.15  ? 260 LEU A N   1 
ATOM   1969  C  CA  . LEU A 1 260 ? -10.630 37.100  29.160  1.00 8.61  ? 260 LEU A CA  1 
ATOM   1970  C  C   . LEU A 1 260 ? -10.783 38.351  28.301  1.00 8.41  ? 260 LEU A C   1 
ATOM   1971  O  O   . LEU A 1 260 ? -10.837 38.265  27.071  1.00 9.34  ? 260 LEU A O   1 
ATOM   1972  C  CB  . LEU A 1 260 ? -11.934 36.294  29.137  1.00 8.73  ? 260 LEU A CB  1 
ATOM   1973  C  CG  . LEU A 1 260 ? -11.852 34.883  29.725  1.00 10.53 ? 260 LEU A CG  1 
ATOM   1974  C  CD1 . LEU A 1 260 ? -13.244 34.274  29.815  1.00 10.60 ? 260 LEU A CD1 1 
ATOM   1975  C  CD2 . LEU A 1 260 ? -10.947 34.020  28.853  1.00 11.58 ? 260 LEU A CD2 1 
ATOM   1976  N  N   . GLY A 1 261 ? -10.861 39.510  28.952  1.00 8.60  ? 261 GLY A N   1 
ATOM   1977  C  CA  . GLY A 1 261 ? -11.001 40.765  28.231  1.00 8.41  ? 261 GLY A CA  1 
ATOM   1978  C  C   . GLY A 1 261 ? -12.384 41.046  27.662  1.00 8.86  ? 261 GLY A C   1 
ATOM   1979  O  O   . GLY A 1 261 ? -12.544 41.976  26.868  1.00 9.38  ? 261 GLY A O   1 
ATOM   1980  N  N   . VAL A 1 262 ? -13.379 40.258  28.065  1.00 6.93  ? 262 VAL A N   1 
ATOM   1981  C  CA  . VAL A 1 262 ? -14.747 40.437  27.578  1.00 8.51  ? 262 VAL A CA  1 
ATOM   1982  C  C   . VAL A 1 262 ? -15.355 41.717  28.151  1.00 9.24  ? 262 VAL A C   1 
ATOM   1983  O  O   . VAL A 1 262 ? -14.927 42.205  29.197  1.00 10.14 ? 262 VAL A O   1 
ATOM   1984  C  CB  . VAL A 1 262 ? -15.623 39.211  27.914  1.00 7.75  ? 262 VAL A CB  1 
ATOM   1985  C  CG1 . VAL A 1 262 ? -15.070 37.984  27.197  1.00 9.19  ? 262 VAL A CG1 1 
ATOM   1986  C  CG2 . VAL A 1 262 ? -15.649 38.975  29.414  1.00 9.66  ? 262 VAL A CG2 1 
ATOM   1987  N  N   . PRO A 1 263 ? -16.378 42.269  27.481  1.00 9.01  ? 263 PRO A N   1 
ATOM   1988  C  CA  . PRO A 1 263 ? -17.016 43.509  27.930  1.00 10.35 ? 263 PRO A CA  1 
ATOM   1989  C  C   . PRO A 1 263 ? -18.103 43.535  29.003  1.00 10.83 ? 263 PRO A C   1 
ATOM   1990  O  O   . PRO A 1 263 ? -18.318 44.588  29.613  1.00 11.73 ? 263 PRO A O   1 
ATOM   1991  C  CB  . PRO A 1 263 ? -17.530 44.099  26.620  1.00 8.79  ? 263 PRO A CB  1 
ATOM   1992  C  CG  . PRO A 1 263 ? -18.022 42.874  25.920  1.00 9.86  ? 263 PRO A CG  1 
ATOM   1993  C  CD  . PRO A 1 263 ? -16.907 41.862  26.165  1.00 9.38  ? 263 PRO A CD  1 
ATOM   1994  N  N   . ILE A 1 264 ? -18.782 42.418  29.255  1.00 10.29 ? 264 ILE A N   1 
ATOM   1995  C  CA  . ILE A 1 264 ? -19.882 42.468  30.214  1.00 10.12 ? 264 ILE A CA  1 
ATOM   1996  C  C   . ILE A 1 264 ? -20.167 41.193  31.009  1.00 11.20 ? 264 ILE A C   1 
ATOM   1997  O  O   . ILE A 1 264 ? -19.986 40.077  30.515  1.00 10.73 ? 264 ILE A O   1 
ATOM   1998  C  CB  . ILE A 1 264 ? -21.177 42.914  29.457  1.00 11.94 ? 264 ILE A CB  1 
ATOM   1999  C  CG1 . ILE A 1 264 ? -22.352 43.081  30.419  1.00 11.36 ? 264 ILE A CG1 1 
ATOM   2000  C  CG2 . ILE A 1 264 ? -21.517 41.894  28.372  1.00 11.93 ? 264 ILE A CG2 1 
ATOM   2001  C  CD1 . ILE A 1 264 ? -23.570 43.739  29.768  1.00 10.54 ? 264 ILE A CD1 1 
ATOM   2002  N  N   . VAL A 1 265 ? -20.602 41.380  32.255  1.00 10.44 ? 265 VAL A N   1 
ATOM   2003  C  CA  . VAL A 1 265 ? -20.961 40.278  33.150  1.00 11.10 ? 265 VAL A CA  1 
ATOM   2004  C  C   . VAL A 1 265 ? -22.348 40.582  33.716  1.00 10.91 ? 265 VAL A C   1 
ATOM   2005  O  O   . VAL A 1 265 ? -22.833 41.708  33.583  1.00 12.23 ? 265 VAL A O   1 
ATOM   2006  C  CB  . VAL A 1 265 ? -19.967 40.145  34.331  1.00 11.57 ? 265 VAL A CB  1 
ATOM   2007  C  CG1 . VAL A 1 265 ? -18.587 39.776  33.811  1.00 11.57 ? 265 VAL A CG1 1 
ATOM   2008  C  CG2 . VAL A 1 265 ? -19.913 41.446  35.119  1.00 12.10 ? 265 VAL A CG2 1 
ATOM   2009  N  N   . MET A 1 266 ? -22.994 39.592  34.333  1.00 11.26 ? 266 MET A N   1 
ATOM   2010  C  CA  . MET A 1 266 ? -24.320 39.819  34.910  1.00 9.69  ? 266 MET A CA  1 
ATOM   2011  C  C   . MET A 1 266 ? -24.421 39.327  36.353  1.00 9.27  ? 266 MET A C   1 
ATOM   2012  O  O   . MET A 1 266 ? -23.584 38.552  36.823  1.00 9.82  ? 266 MET A O   1 
ATOM   2013  C  CB  . MET A 1 266 ? -25.419 39.165  34.051  1.00 11.07 ? 266 MET A CB  1 
ATOM   2014  C  CG  . MET A 1 266 ? -25.459 37.647  34.073  1.00 11.07 ? 266 MET A CG  1 
ATOM   2015  S  SD  . MET A 1 266 ? -26.838 36.973  33.093  1.00 11.37 ? 266 MET A SD  1 
ATOM   2016  C  CE  . MET A 1 266 ? -28.154 36.885  34.284  1.00 10.69 ? 266 MET A CE  1 
ATOM   2017  N  N   . HIS A 1 267 ? -25.451 39.796  37.050  1.00 7.54  ? 267 HIS A N   1 
ATOM   2018  C  CA  . HIS A 1 267 ? -25.684 39.420  38.439  1.00 6.52  ? 267 HIS A CA  1 
ATOM   2019  C  C   . HIS A 1 267 ? -27.175 39.480  38.775  1.00 5.83  ? 267 HIS A C   1 
ATOM   2020  O  O   . HIS A 1 267 ? -27.875 40.383  38.329  1.00 6.19  ? 267 HIS A O   1 
ATOM   2021  C  CB  . HIS A 1 267 ? -24.914 40.368  39.369  1.00 5.79  ? 267 HIS A CB  1 
ATOM   2022  C  CG  . HIS A 1 267 ? -24.937 39.956  40.809  1.00 5.81  ? 267 HIS A CG  1 
ATOM   2023  N  ND1 . HIS A 1 267 ? -25.380 40.785  41.816  1.00 4.84  ? 267 HIS A ND1 1 
ATOM   2024  C  CD2 . HIS A 1 267 ? -24.589 38.790  41.406  1.00 5.61  ? 267 HIS A CD2 1 
ATOM   2025  C  CE1 . HIS A 1 267 ? -25.308 40.151  42.972  1.00 6.00  ? 267 HIS A CE1 1 
ATOM   2026  N  NE2 . HIS A 1 267 ? -24.830 38.937  42.752  1.00 6.80  ? 267 HIS A NE2 1 
ATOM   2027  N  N   . ASP A 1 268 ? -27.662 38.509  39.543  1.00 7.02  ? 268 ASP A N   1 
ATOM   2028  C  CA  . ASP A 1 268 ? -29.064 38.506  39.963  1.00 7.43  ? 268 ASP A CA  1 
ATOM   2029  C  C   . ASP A 1 268 ? -29.023 39.256  41.294  1.00 7.64  ? 268 ASP A C   1 
ATOM   2030  O  O   . ASP A 1 268 ? -28.784 38.656  42.339  1.00 7.12  ? 268 ASP A O   1 
ATOM   2031  C  CB  . ASP A 1 268 ? -29.571 37.073  40.181  1.00 8.06  ? 268 ASP A CB  1 
ATOM   2032  C  CG  . ASP A 1 268 ? -29.297 36.167  38.994  1.00 7.83  ? 268 ASP A CG  1 
ATOM   2033  O  OD1 . ASP A 1 268 ? -29.166 36.683  37.862  1.00 9.18  ? 268 ASP A OD1 1 
ATOM   2034  O  OD2 . ASP A 1 268 ? -29.231 34.933  39.193  1.00 8.62  ? 268 ASP A OD2 1 
ATOM   2035  N  N   . TYR A 1 269 ? -29.272 40.561  41.262  1.00 8.18  ? 269 TYR A N   1 
ATOM   2036  C  CA  . TYR A 1 269 ? -29.157 41.357  42.480  1.00 6.13  ? 269 TYR A CA  1 
ATOM   2037  C  C   . TYR A 1 269 ? -30.049 41.044  43.677  1.00 7.63  ? 269 TYR A C   1 
ATOM   2038  O  O   . TYR A 1 269 ? -29.647 41.297  44.813  1.00 5.50  ? 269 TYR A O   1 
ATOM   2039  C  CB  . TYR A 1 269 ? -29.215 42.858  42.143  1.00 6.40  ? 269 TYR A CB  1 
ATOM   2040  C  CG  . TYR A 1 269 ? -30.584 43.515  42.061  1.00 8.22  ? 269 TYR A CG  1 
ATOM   2041  C  CD1 . TYR A 1 269 ? -31.539 43.100  41.129  1.00 7.16  ? 269 TYR A CD1 1 
ATOM   2042  C  CD2 . TYR A 1 269 ? -30.881 44.626  42.855  1.00 7.55  ? 269 TYR A CD2 1 
ATOM   2043  C  CE1 . TYR A 1 269 ? -32.751 43.784  40.983  1.00 7.07  ? 269 TYR A CE1 1 
ATOM   2044  C  CE2 . TYR A 1 269 ? -32.085 45.312  42.721  1.00 7.04  ? 269 TYR A CE2 1 
ATOM   2045  C  CZ  . TYR A 1 269 ? -33.011 44.891  41.781  1.00 7.44  ? 269 TYR A CZ  1 
ATOM   2046  O  OH  . TYR A 1 269 ? -34.179 45.601  41.623  1.00 6.65  ? 269 TYR A OH  1 
ATOM   2047  N  N   . LEU A 1 270 ? -31.236 40.487  43.452  1.00 6.39  ? 270 LEU A N   1 
ATOM   2048  C  CA  . LEU A 1 270 ? -32.110 40.176  44.578  1.00 8.70  ? 270 LEU A CA  1 
ATOM   2049  C  C   . LEU A 1 270 ? -31.801 38.817  45.220  1.00 9.74  ? 270 LEU A C   1 
ATOM   2050  O  O   . LEU A 1 270 ? -31.809 38.696  46.441  1.00 9.91  ? 270 LEU A O   1 
ATOM   2051  C  CB  . LEU A 1 270 ? -33.582 40.247  44.151  1.00 9.58  ? 270 LEU A CB  1 
ATOM   2052  C  CG  . LEU A 1 270 ? -34.065 41.635  43.708  1.00 10.92 ? 270 LEU A CG  1 
ATOM   2053  C  CD1 . LEU A 1 270 ? -35.516 41.556  43.234  1.00 8.99  ? 270 LEU A CD1 1 
ATOM   2054  C  CD2 . LEU A 1 270 ? -33.923 42.621  44.858  1.00 13.07 ? 270 LEU A CD2 1 
ATOM   2055  N  N   . THR A 1 271 ? -31.523 37.799  44.411  1.00 9.53  ? 271 THR A N   1 
ATOM   2056  C  CA  . THR A 1 271 ? -31.215 36.489  44.973  1.00 9.22  ? 271 THR A CA  1 
ATOM   2057  C  C   . THR A 1 271 ? -29.780 36.464  45.500  1.00 10.42 ? 271 THR A C   1 
ATOM   2058  O  O   . THR A 1 271 ? -29.453 35.704  46.414  1.00 11.69 ? 271 THR A O   1 
ATOM   2059  C  CB  . THR A 1 271 ? -31.427 35.358  43.944  1.00 9.28  ? 271 THR A CB  1 
ATOM   2060  O  OG1 . THR A 1 271 ? -30.654 35.614  42.766  1.00 10.20 ? 271 THR A OG1 1 
ATOM   2061  C  CG2 . THR A 1 271 ? -32.906 35.262  43.568  1.00 7.42  ? 271 THR A CG2 1 
ATOM   2062  N  N   . GLY A 1 272 ? -28.929 37.303  44.923  1.00 10.14 ? 272 GLY A N   1 
ATOM   2063  C  CA  . GLY A 1 272 ? -27.554 37.390  45.380  1.00 10.23 ? 272 GLY A CA  1 
ATOM   2064  C  C   . GLY A 1 272 ? -27.537 38.280  46.611  1.00 9.91  ? 272 GLY A C   1 
ATOM   2065  O  O   . GLY A 1 272 ? -26.879 37.975  47.605  1.00 10.61 ? 272 GLY A O   1 
ATOM   2066  N  N   . GLY A 1 273 ? -28.282 39.383  46.548  1.00 8.58  ? 273 GLY A N   1 
ATOM   2067  C  CA  . GLY A 1 273 ? -28.351 40.303  47.671  1.00 6.61  ? 273 GLY A CA  1 
ATOM   2068  C  C   . GLY A 1 273 ? -27.693 41.637  47.372  1.00 7.72  ? 273 GLY A C   1 
ATOM   2069  O  O   . GLY A 1 273 ? -26.763 41.703  46.564  1.00 6.60  ? 273 GLY A O   1 
ATOM   2070  N  N   . PHE A 1 274 ? -28.165 42.694  48.035  1.00 6.84  ? 274 PHE A N   1 
ATOM   2071  C  CA  . PHE A 1 274 ? -27.634 44.046  47.839  1.00 7.51  ? 274 PHE A CA  1 
ATOM   2072  C  C   . PHE A 1 274 ? -26.182 44.224  48.266  1.00 7.46  ? 274 PHE A C   1 
ATOM   2073  O  O   . PHE A 1 274 ? -25.428 44.964  47.628  1.00 7.56  ? 274 PHE A O   1 
ATOM   2074  C  CB  . PHE A 1 274 ? -28.506 45.067  48.577  1.00 9.31  ? 274 PHE A CB  1 
ATOM   2075  C  CG  . PHE A 1 274 ? -29.804 45.372  47.880  1.00 13.69 ? 274 PHE A CG  1 
ATOM   2076  C  CD1 . PHE A 1 274 ? -29.809 46.027  46.652  1.00 16.79 ? 274 PHE A CD1 1 
ATOM   2077  C  CD2 . PHE A 1 274 ? -31.017 45.000  48.443  1.00 15.75 ? 274 PHE A CD2 1 
ATOM   2078  C  CE1 . PHE A 1 274 ? -31.010 46.306  45.995  1.00 18.08 ? 274 PHE A CE1 1 
ATOM   2079  C  CE2 . PHE A 1 274 ? -32.220 45.274  47.795  1.00 15.88 ? 274 PHE A CE2 1 
ATOM   2080  C  CZ  . PHE A 1 274 ? -32.216 45.926  46.572  1.00 16.45 ? 274 PHE A CZ  1 
ATOM   2081  N  N   . THR A 1 275 ? -25.789 43.562  49.348  1.00 6.30  ? 275 THR A N   1 
ATOM   2082  C  CA  . THR A 1 275 ? -24.417 43.673  49.830  1.00 6.80  ? 275 THR A CA  1 
ATOM   2083  C  C   . THR A 1 275 ? -23.447 43.122  48.784  1.00 6.69  ? 275 THR A C   1 
ATOM   2084  O  O   . THR A 1 275 ? -22.446 43.760  48.459  1.00 7.14  ? 275 THR A O   1 
ATOM   2085  C  CB  . THR A 1 275 ? -24.240 42.923  51.166  1.00 5.06  ? 275 THR A CB  1 
ATOM   2086  O  OG1 . THR A 1 275 ? -25.000 43.587  52.185  1.00 5.93  ? 275 THR A OG1 1 
ATOM   2087  C  CG2 . THR A 1 275 ? -22.776 42.882  51.573  1.00 8.03  ? 275 THR A CG2 1 
ATOM   2088  N  N   . ALA A 1 276 ? -23.755 41.946  48.247  1.00 6.80  ? 276 ALA A N   1 
ATOM   2089  C  CA  . ALA A 1 276 ? -22.912 41.342  47.226  1.00 5.42  ? 276 ALA A CA  1 
ATOM   2090  C  C   . ALA A 1 276 ? -22.968 42.168  45.944  1.00 6.06  ? 276 ALA A C   1 
ATOM   2091  O  O   . ALA A 1 276 ? -21.949 42.361  45.281  1.00 4.46  ? 276 ALA A O   1 
ATOM   2092  C  CB  . ALA A 1 276 ? -23.363 39.912  46.946  1.00 6.82  ? 276 ALA A CB  1 
ATOM   2093  N  N   . ASN A 1 277 ? -24.151 42.667  45.594  1.00 4.02  ? 277 ASN A N   1 
ATOM   2094  C  CA  . ASN A 1 277 ? -24.271 43.454  44.368  1.00 4.11  ? 277 ASN A CA  1 
ATOM   2095  C  C   . ASN A 1 277 ? -23.449 44.733  44.391  1.00 5.74  ? 277 ASN A C   1 
ATOM   2096  O  O   . ASN A 1 277 ? -22.862 45.114  43.376  1.00 5.27  ? 277 ASN A O   1 
ATOM   2097  C  CB  . ASN A 1 277 ? -25.722 43.833  44.076  1.00 4.53  ? 277 ASN A CB  1 
ATOM   2098  C  CG  . ASN A 1 277 ? -25.890 44.398  42.680  1.00 4.66  ? 277 ASN A CG  1 
ATOM   2099  O  OD1 . ASN A 1 277 ? -25.878 43.653  41.699  1.00 6.77  ? 277 ASN A OD1 1 
ATOM   2100  N  ND2 . ASN A 1 277 ? -26.021 45.720  42.577  1.00 3.85  ? 277 ASN A ND2 1 
ATOM   2101  N  N   . THR A 1 278 ? -23.416 45.403  45.540  1.00 5.23  ? 278 THR A N   1 
ATOM   2102  C  CA  . THR A 1 278 ? -22.661 46.646  45.655  1.00 5.01  ? 278 THR A CA  1 
ATOM   2103  C  C   . THR A 1 278 ? -21.173 46.357  45.504  1.00 5.11  ? 278 THR A C   1 
ATOM   2104  O  O   . THR A 1 278 ? -20.450 47.124  44.876  1.00 6.39  ? 278 THR A O   1 
ATOM   2105  C  CB  . THR A 1 278 ? -22.941 47.346  46.998  1.00 5.55  ? 278 THR A CB  1 
ATOM   2106  O  OG1 . THR A 1 278 ? -24.359 47.452  47.180  1.00 6.15  ? 278 THR A OG1 1 
ATOM   2107  C  CG2 . THR A 1 278 ? -22.337 48.760  47.005  1.00 4.09  ? 278 THR A CG2 1 
ATOM   2108  N  N   . THR A 1 279 ? -20.723 45.244  46.076  1.00 5.10  ? 279 THR A N   1 
ATOM   2109  C  CA  . THR A 1 279 ? -19.325 44.835  45.960  1.00 6.15  ? 279 THR A CA  1 
ATOM   2110  C  C   . THR A 1 279 ? -18.973 44.635  44.481  1.00 5.86  ? 279 THR A C   1 
ATOM   2111  O  O   . THR A 1 279 ? -17.921 45.079  44.020  1.00 7.09  ? 279 THR A O   1 
ATOM   2112  C  CB  . THR A 1 279 ? -19.060 43.502  46.713  1.00 6.86  ? 279 THR A CB  1 
ATOM   2113  O  OG1 . THR A 1 279 ? -18.957 43.755  48.120  1.00 6.05  ? 279 THR A OG1 1 
ATOM   2114  C  CG2 . THR A 1 279 ? -17.784 42.840  46.218  1.00 7.41  ? 279 THR A CG2 1 
ATOM   2115  N  N   . LEU A 1 280 ? -19.854 43.964  43.741  1.00 4.96  ? 280 LEU A N   1 
ATOM   2116  C  CA  . LEU A 1 280 ? -19.612 43.708  42.319  1.00 5.97  ? 280 LEU A CA  1 
ATOM   2117  C  C   . LEU A 1 280 ? -19.675 44.995  41.500  1.00 5.35  ? 280 LEU A C   1 
ATOM   2118  O  O   . LEU A 1 280 ? -18.900 45.185  40.562  1.00 7.68  ? 280 LEU A O   1 
ATOM   2119  C  CB  . LEU A 1 280 ? -20.625 42.695  41.777  1.00 5.09  ? 280 LEU A CB  1 
ATOM   2120  C  CG  . LEU A 1 280 ? -20.421 42.236  40.327  1.00 7.89  ? 280 LEU A CG  1 
ATOM   2121  C  CD1 . LEU A 1 280 ? -19.041 41.602  40.160  1.00 9.29  ? 280 LEU A CD1 1 
ATOM   2122  C  CD2 . LEU A 1 280 ? -21.508 41.234  39.960  1.00 8.51  ? 280 LEU A CD2 1 
ATOM   2123  N  N   . SER A 1 281 ? -20.605 45.875  41.857  1.00 5.85  ? 281 SER A N   1 
ATOM   2124  C  CA  . SER A 1 281 ? -20.759 47.155  41.173  1.00 7.41  ? 281 SER A CA  1 
ATOM   2125  C  C   . SER A 1 281 ? -19.445 47.939  41.257  1.00 7.12  ? 281 SER A C   1 
ATOM   2126  O  O   . SER A 1 281 ? -18.986 48.505  40.268  1.00 6.09  ? 281 SER A O   1 
ATOM   2127  C  CB  . SER A 1 281 ? -21.899 47.960  41.819  1.00 5.93  ? 281 SER A CB  1 
ATOM   2128  O  OG  . SER A 1 281 ? -21.958 49.280  41.312  1.00 11.52 ? 281 SER A OG  1 
ATOM   2129  N  N   . HIS A 1 282 ? -18.833 47.961  42.439  1.00 6.89  ? 282 HIS A N   1 
ATOM   2130  C  CA  . HIS A 1 282 ? -17.571 48.678  42.613  1.00 8.09  ? 282 HIS A CA  1 
ATOM   2131  C  C   . HIS A 1 282 ? -16.431 48.022  41.838  1.00 7.43  ? 282 HIS A C   1 
ATOM   2132  O  O   . HIS A 1 282 ? -15.592 48.710  41.249  1.00 7.02  ? 282 HIS A O   1 
ATOM   2133  C  CB  . HIS A 1 282 ? -17.216 48.776  44.101  1.00 7.68  ? 282 HIS A CB  1 
ATOM   2134  C  CG  . HIS A 1 282 ? -18.157 49.643  44.882  1.00 11.20 ? 282 HIS A CG  1 
ATOM   2135  N  ND1 . HIS A 1 282 ? -18.039 49.834  46.242  1.00 11.91 ? 282 HIS A ND1 1 
ATOM   2136  C  CD2 . HIS A 1 282 ? -19.225 50.374  44.490  1.00 13.39 ? 282 HIS A CD2 1 
ATOM   2137  C  CE1 . HIS A 1 282 ? -18.997 50.648  46.653  1.00 13.43 ? 282 HIS A CE1 1 
ATOM   2138  N  NE2 . HIS A 1 282 ? -19.730 50.990  45.609  1.00 14.10 ? 282 HIS A NE2 1 
ATOM   2139  N  N   . TYR A 1 283 ? -16.411 46.693  41.828  1.00 6.36  ? 283 TYR A N   1 
ATOM   2140  C  CA  . TYR A 1 283 ? -15.374 45.967  41.108  1.00 6.28  ? 283 TYR A CA  1 
ATOM   2141  C  C   . TYR A 1 283 ? -15.472 46.262  39.610  1.00 7.34  ? 283 TYR A C   1 
ATOM   2142  O  O   . TYR A 1 283 ? -14.456 46.481  38.946  1.00 6.46  ? 283 TYR A O   1 
ATOM   2143  C  CB  . TYR A 1 283 ? -15.505 44.461  41.336  1.00 6.53  ? 283 TYR A CB  1 
ATOM   2144  C  CG  . TYR A 1 283 ? -14.479 43.665  40.561  1.00 6.89  ? 283 TYR A CG  1 
ATOM   2145  C  CD1 . TYR A 1 283 ? -13.159 43.562  41.008  1.00 8.89  ? 283 TYR A CD1 1 
ATOM   2146  C  CD2 . TYR A 1 283 ? -14.802 43.091  39.332  1.00 8.06  ? 283 TYR A CD2 1 
ATOM   2147  C  CE1 . TYR A 1 283 ? -12.188 42.909  40.247  1.00 9.72  ? 283 TYR A CE1 1 
ATOM   2148  C  CE2 . TYR A 1 283 ? -13.845 42.442  38.565  1.00 7.43  ? 283 TYR A CE2 1 
ATOM   2149  C  CZ  . TYR A 1 283 ? -12.539 42.358  39.022  1.00 10.08 ? 283 TYR A CZ  1 
ATOM   2150  O  OH  . TYR A 1 283 ? -11.588 41.739  38.244  1.00 8.33  ? 283 TYR A OH  1 
ATOM   2151  N  N   . CYS A 1 284 ? -16.696 46.270  39.085  1.00 7.03  ? 284 CYS A N   1 
ATOM   2152  C  CA  . CYS A 1 284 ? -16.912 46.537  37.668  1.00 7.98  ? 284 CYS A CA  1 
ATOM   2153  C  C   . CYS A 1 284 ? -16.450 47.939  37.277  1.00 8.94  ? 284 CYS A C   1 
ATOM   2154  O  O   . CYS A 1 284 ? -15.908 48.131  36.189  1.00 9.76  ? 284 CYS A O   1 
ATOM   2155  C  CB  . CYS A 1 284 ? -18.388 46.329  37.300  1.00 8.08  ? 284 CYS A CB  1 
ATOM   2156  S  SG  . CYS A 1 284 ? -18.909 44.567  37.261  1.00 10.32 ? 284 CYS A SG  1 
ATOM   2157  N  N   . ARG A 1 285 ? -16.663 48.915  38.160  1.00 8.73  ? 285 ARG A N   1 
ATOM   2158  C  CA  . ARG A 1 285 ? -16.232 50.291  37.904  1.00 7.67  ? 285 ARG A CA  1 
ATOM   2159  C  C   . ARG A 1 285 ? -14.702 50.353  37.869  1.00 8.60  ? 285 ARG A C   1 
ATOM   2160  O  O   . ARG A 1 285 ? -14.119 51.044  37.035  1.00 8.15  ? 285 ARG A O   1 
ATOM   2161  C  CB  . ARG A 1 285 ? -16.772 51.237  38.995  1.00 7.65  ? 285 ARG A CB  1 
ATOM   2162  C  CG  . ARG A 1 285 ? -16.084 52.612  39.094  1.00 7.45  ? 285 ARG A CG  1 
ATOM   2163  C  CD  . ARG A 1 285 ? -16.399 53.540  37.924  1.00 8.68  ? 285 ARG A CD  1 
ATOM   2164  N  NE  . ARG A 1 285 ? -17.797 53.975  37.903  1.00 10.65 ? 285 ARG A NE  1 
ATOM   2165  C  CZ  . ARG A 1 285 ? -18.287 54.983  38.619  1.00 11.37 ? 285 ARG A CZ  1 
ATOM   2166  N  NH1 . ARG A 1 285 ? -17.496 55.676  39.421  1.00 13.27 ? 285 ARG A NH1 1 
ATOM   2167  N  NH2 . ARG A 1 285 ? -19.573 55.305  38.526  1.00 10.52 ? 285 ARG A NH2 1 
ATOM   2168  N  N   . ASP A 1 286 ? -14.053 49.620  38.770  1.00 7.90  ? 286 ASP A N   1 
ATOM   2169  C  CA  . ASP A 1 286 ? -12.592 49.616  38.827  1.00 9.50  ? 286 ASP A CA  1 
ATOM   2170  C  C   . ASP A 1 286 ? -11.914 48.808  37.728  1.00 8.69  ? 286 ASP A C   1 
ATOM   2171  O  O   . ASP A 1 286 ? -10.714 48.959  37.501  1.00 8.28  ? 286 ASP A O   1 
ATOM   2172  C  CB  . ASP A 1 286 ? -12.104 49.082  40.173  1.00 11.93 ? 286 ASP A CB  1 
ATOM   2173  C  CG  . ASP A 1 286 ? -12.296 50.071  41.294  1.00 17.39 ? 286 ASP A CG  1 
ATOM   2174  O  OD1 . ASP A 1 286 ? -12.150 51.289  41.045  1.00 19.24 ? 286 ASP A OD1 1 
ATOM   2175  O  OD2 . ASP A 1 286 ? -12.576 49.622  42.425  1.00 21.80 ? 286 ASP A OD2 1 
ATOM   2176  N  N   . ASN A 1 287 ? -12.670 47.957  37.043  1.00 7.43  ? 287 ASN A N   1 
ATOM   2177  C  CA  . ASN A 1 287 ? -12.077 47.129  36.005  1.00 8.75  ? 287 ASN A CA  1 
ATOM   2178  C  C   . ASN A 1 287 ? -12.687 47.246  34.618  1.00 7.60  ? 287 ASN A C   1 
ATOM   2179  O  O   . ASN A 1 287 ? -12.415 46.423  33.745  1.00 9.55  ? 287 ASN A O   1 
ATOM   2180  C  CB  . ASN A 1 287 ? -12.073 45.675  36.473  1.00 8.07  ? 287 ASN A CB  1 
ATOM   2181  C  CG  . ASN A 1 287 ? -11.077 45.442  37.592  1.00 10.62 ? 287 ASN A CG  1 
ATOM   2182  O  OD1 . ASN A 1 287 ? -9.875  45.337  37.351  1.00 11.96 ? 287 ASN A OD1 1 
ATOM   2183  N  ND2 . ASN A 1 287 ? -11.567 45.390  38.824  1.00 7.71  ? 287 ASN A ND2 1 
ATOM   2184  N  N   . GLY A 1 288 ? -13.507 48.272  34.420  1.00 8.00  ? 288 GLY A N   1 
ATOM   2185  C  CA  . GLY A 1 288 ? -14.117 48.508  33.121  1.00 7.77  ? 288 GLY A CA  1 
ATOM   2186  C  C   . GLY A 1 288 ? -15.088 47.471  32.589  1.00 7.47  ? 288 GLY A C   1 
ATOM   2187  O  O   . GLY A 1 288 ? -15.239 47.335  31.379  1.00 8.74  ? 288 GLY A O   1 
ATOM   2188  N  N   . LEU A 1 289 ? -15.750 46.744  33.479  1.00 6.52  ? 289 LEU A N   1 
ATOM   2189  C  CA  . LEU A 1 289 ? -16.717 45.731  33.059  1.00 7.44  ? 289 LEU A CA  1 
ATOM   2190  C  C   . LEU A 1 289 ? -18.133 46.264  33.151  1.00 7.88  ? 289 LEU A C   1 
ATOM   2191  O  O   . LEU A 1 289 ? -18.507 46.858  34.162  1.00 7.73  ? 289 LEU A O   1 
ATOM   2192  C  CB  . LEU A 1 289 ? -16.612 44.491  33.947  1.00 7.65  ? 289 LEU A CB  1 
ATOM   2193  C  CG  . LEU A 1 289 ? -15.439 43.535  33.737  1.00 8.54  ? 289 LEU A CG  1 
ATOM   2194  C  CD1 . LEU A 1 289 ? -15.329 42.606  34.940  1.00 5.31  ? 289 LEU A CD1 1 
ATOM   2195  C  CD2 . LEU A 1 289 ? -15.648 42.737  32.448  1.00 7.54  ? 289 LEU A CD2 1 
ATOM   2196  N  N   . LEU A 1 290 ? -18.916 46.058  32.095  1.00 6.63  ? 290 LEU A N   1 
ATOM   2197  C  CA  . LEU A 1 290 ? -20.311 46.484  32.090  1.00 7.27  ? 290 LEU A CA  1 
ATOM   2198  C  C   . LEU A 1 290 ? -21.053 45.485  32.964  1.00 7.58  ? 290 LEU A C   1 
ATOM   2199  O  O   . LEU A 1 290 ? -20.673 44.312  33.024  1.00 7.57  ? 290 LEU A O   1 
ATOM   2200  C  CB  . LEU A 1 290 ? -20.880 46.456  30.670  1.00 7.04  ? 290 LEU A CB  1 
ATOM   2201  C  CG  . LEU A 1 290 ? -20.398 47.574  29.745  1.00 9.54  ? 290 LEU A CG  1 
ATOM   2202  C  CD1 . LEU A 1 290 ? -20.863 47.294  28.323  1.00 9.35  ? 290 LEU A CD1 1 
ATOM   2203  C  CD2 . LEU A 1 290 ? -20.931 48.919  30.242  1.00 8.48  ? 290 LEU A CD2 1 
ATOM   2204  N  N   . LEU A 1 291 ? -22.107 45.938  33.639  1.00 6.14  ? 291 LEU A N   1 
ATOM   2205  C  CA  . LEU A 1 291 ? -22.864 45.057  34.522  1.00 5.80  ? 291 LEU A CA  1 
ATOM   2206  C  C   . LEU A 1 291 ? -24.364 44.987  34.243  1.00 5.60  ? 291 LEU A C   1 
ATOM   2207  O  O   . LEU A 1 291 ? -25.091 45.955  34.457  1.00 7.79  ? 291 LEU A O   1 
ATOM   2208  C  CB  . LEU A 1 291 ? -22.635 45.485  35.972  1.00 5.25  ? 291 LEU A CB  1 
ATOM   2209  C  CG  . LEU A 1 291 ? -23.406 44.769  37.077  1.00 5.96  ? 291 LEU A CG  1 
ATOM   2210  C  CD1 . LEU A 1 291 ? -23.098 43.277  37.061  1.00 6.54  ? 291 LEU A CD1 1 
ATOM   2211  C  CD2 . LEU A 1 291 ? -23.022 45.392  38.420  1.00 5.55  ? 291 LEU A CD2 1 
ATOM   2212  N  N   . HIS A 1 292 ? -24.820 43.826  33.778  1.00 5.90  ? 292 HIS A N   1 
ATOM   2213  C  CA  . HIS A 1 292 ? -26.237 43.603  33.496  1.00 5.55  ? 292 HIS A CA  1 
ATOM   2214  C  C   . HIS A 1 292 ? -26.894 43.025  34.746  1.00 6.81  ? 292 HIS A C   1 
ATOM   2215  O  O   . HIS A 1 292 ? -26.416 42.038  35.301  1.00 6.59  ? 292 HIS A O   1 
ATOM   2216  C  CB  . HIS A 1 292 ? -26.409 42.610  32.342  1.00 5.94  ? 292 HIS A CB  1 
ATOM   2217  C  CG  . HIS A 1 292 ? -27.831 42.229  32.084  1.00 4.58  ? 292 HIS A CG  1 
ATOM   2218  N  ND1 . HIS A 1 292 ? -28.690 43.012  31.341  1.00 5.30  ? 292 HIS A ND1 1 
ATOM   2219  C  CD2 . HIS A 1 292 ? -28.561 41.165  32.502  1.00 5.90  ? 292 HIS A CD2 1 
ATOM   2220  C  CE1 . HIS A 1 292 ? -29.884 42.446  31.311  1.00 3.48  ? 292 HIS A CE1 1 
ATOM   2221  N  NE2 . HIS A 1 292 ? -29.832 41.327  32.008  1.00 6.37  ? 292 HIS A NE2 1 
ATOM   2222  N  N   . ILE A 1 293 ? -28.001 43.621  35.177  1.00 6.23  ? 293 ILE A N   1 
ATOM   2223  C  CA  . ILE A 1 293 ? -28.687 43.148  36.372  1.00 4.55  ? 293 ILE A CA  1 
ATOM   2224  C  C   . ILE A 1 293 ? -30.015 42.465  36.074  1.00 5.45  ? 293 ILE A C   1 
ATOM   2225  O  O   . ILE A 1 293 ? -30.896 43.044  35.442  1.00 7.24  ? 293 ILE A O   1 
ATOM   2226  C  CB  . ILE A 1 293 ? -28.944 44.311  37.358  1.00 5.35  ? 293 ILE A CB  1 
ATOM   2227  C  CG1 . ILE A 1 293 ? -27.612 44.939  37.783  1.00 3.05  ? 293 ILE A CG1 1 
ATOM   2228  C  CG2 . ILE A 1 293 ? -29.703 43.809  38.583  1.00 2.69  ? 293 ILE A CG2 1 
ATOM   2229  C  CD1 . ILE A 1 293 ? -26.724 43.998  38.567  1.00 4.53  ? 293 ILE A CD1 1 
ATOM   2230  N  N   . HIS A 1 294 ? -30.149 41.227  36.538  1.00 6.01  ? 294 HIS A N   1 
ATOM   2231  C  CA  . HIS A 1 294 ? -31.374 40.458  36.349  1.00 5.71  ? 294 HIS A CA  1 
ATOM   2232  C  C   . HIS A 1 294 ? -32.168 40.555  37.654  1.00 6.21  ? 294 HIS A C   1 
ATOM   2233  O  O   . HIS A 1 294 ? -31.607 40.392  38.744  1.00 6.13  ? 294 HIS A O   1 
ATOM   2234  C  CB  . HIS A 1 294 ? -31.026 39.003  36.020  1.00 4.36  ? 294 HIS A CB  1 
ATOM   2235  C  CG  . HIS A 1 294 ? -32.211 38.167  35.648  1.00 6.57  ? 294 HIS A CG  1 
ATOM   2236  N  ND1 . HIS A 1 294 ? -33.130 37.724  36.577  1.00 7.57  ? 294 HIS A ND1 1 
ATOM   2237  C  CD2 . HIS A 1 294 ? -32.633 37.703  34.451  1.00 6.82  ? 294 HIS A CD2 1 
ATOM   2238  C  CE1 . HIS A 1 294 ? -34.066 37.021  35.964  1.00 7.72  ? 294 HIS A CE1 1 
ATOM   2239  N  NE2 . HIS A 1 294 ? -33.788 36.991  34.674  1.00 7.75  ? 294 HIS A NE2 1 
ATOM   2240  N  N   . ARG A 1 295 ? -33.469 40.824  37.545  1.00 5.81  ? 295 ARG A N   1 
ATOM   2241  C  CA  . ARG A 1 295 ? -34.324 40.993  38.722  1.00 6.39  ? 295 ARG A CA  1 
ATOM   2242  C  C   . ARG A 1 295 ? -35.031 39.743  39.256  1.00 7.04  ? 295 ARG A C   1 
ATOM   2243  O  O   . ARG A 1 295 ? -36.105 39.844  39.845  1.00 8.03  ? 295 ARG A O   1 
ATOM   2244  C  CB  . ARG A 1 295 ? -35.363 42.087  38.443  1.00 4.30  ? 295 ARG A CB  1 
ATOM   2245  C  CG  . ARG A 1 295 ? -36.232 41.829  37.215  1.00 5.73  ? 295 ARG A CG  1 
ATOM   2246  C  CD  . ARG A 1 295 ? -37.264 42.947  37.005  1.00 6.48  ? 295 ARG A CD  1 
ATOM   2247  N  NE  . ARG A 1 295 ? -38.227 42.600  35.959  1.00 5.10  ? 295 ARG A NE  1 
ATOM   2248  C  CZ  . ARG A 1 295 ? -39.340 43.283  35.695  1.00 6.15  ? 295 ARG A CZ  1 
ATOM   2249  N  NH1 . ARG A 1 295 ? -39.641 44.367  36.397  1.00 6.26  ? 295 ARG A NH1 1 
ATOM   2250  N  NH2 . ARG A 1 295 ? -40.170 42.864  34.743  1.00 3.39  ? 295 ARG A NH2 1 
ATOM   2251  N  N   . ALA A 1 296 ? -34.425 38.575  39.066  1.00 6.81  ? 296 ALA A N   1 
ATOM   2252  C  CA  . ALA A 1 296 ? -35.008 37.324  39.552  1.00 7.11  ? 296 ALA A CA  1 
ATOM   2253  C  C   . ALA A 1 296 ? -35.573 37.462  40.966  1.00 8.71  ? 296 ALA A C   1 
ATOM   2254  O  O   . ALA A 1 296 ? -34.921 38.022  41.851  1.00 8.57  ? 296 ALA A O   1 
ATOM   2255  C  CB  . ALA A 1 296 ? -33.961 36.215  39.525  1.00 6.66  ? 296 ALA A CB  1 
ATOM   2256  N  N   . MET A 1 297 ? -36.793 36.952  41.148  1.00 9.27  ? 297 MET A N   1 
ATOM   2257  C  CA  . MET A 1 297 ? -37.511 36.963  42.421  1.00 9.37  ? 297 MET A CA  1 
ATOM   2258  C  C   . MET A 1 297 ? -38.264 38.257  42.768  1.00 8.90  ? 297 MET A C   1 
ATOM   2259  O  O   . MET A 1 297 ? -38.929 38.337  43.803  1.00 8.64  ? 297 MET A O   1 
ATOM   2260  C  CB  . MET A 1 297 ? -36.551 36.535  43.548  1.00 12.09 ? 297 MET A CB  1 
ATOM   2261  C  CG  . MET A 1 297 ? -36.569 37.349  44.826  1.00 17.86 ? 297 MET A CG  1 
ATOM   2262  S  SD  . MET A 1 297 ? -35.967 36.381  46.256  1.00 20.69 ? 297 MET A SD  1 
ATOM   2263  C  CE  . MET A 1 297 ? -37.336 36.610  47.379  1.00 23.28 ? 297 MET A CE  1 
ATOM   2264  N  N   . HIS A 1 298 ? -38.200 39.255  41.891  1.00 7.46  ? 298 HIS A N   1 
ATOM   2265  C  CA  . HIS A 1 298 ? -38.885 40.519  42.158  1.00 6.11  ? 298 HIS A CA  1 
ATOM   2266  C  C   . HIS A 1 298 ? -40.407 40.379  42.294  1.00 6.48  ? 298 HIS A C   1 
ATOM   2267  O  O   . HIS A 1 298 ? -41.014 41.033  43.140  1.00 7.16  ? 298 HIS A O   1 
ATOM   2268  C  CB  . HIS A 1 298 ? -38.561 41.550  41.065  1.00 5.68  ? 298 HIS A CB  1 
ATOM   2269  C  CG  . HIS A 1 298 ? -39.287 41.322  39.773  1.00 8.18  ? 298 HIS A CG  1 
ATOM   2270  N  ND1 . HIS A 1 298 ? -40.449 41.984  39.442  1.00 8.08  ? 298 HIS A ND1 1 
ATOM   2271  C  CD2 . HIS A 1 298 ? -39.022 40.489  38.734  1.00 7.87  ? 298 HIS A CD2 1 
ATOM   2272  C  CE1 . HIS A 1 298 ? -40.870 41.573  38.259  1.00 8.66  ? 298 HIS A CE1 1 
ATOM   2273  N  NE2 . HIS A 1 298 ? -40.020 40.666  37.808  1.00 8.13  ? 298 HIS A NE2 1 
ATOM   2274  N  N   . ALA A 1 299 ? -41.019 39.521  41.479  1.00 6.39  ? 299 ALA A N   1 
ATOM   2275  C  CA  . ALA A 1 299 ? -42.475 39.355  41.512  1.00 6.82  ? 299 ALA A CA  1 
ATOM   2276  C  C   . ALA A 1 299 ? -43.004 38.718  42.794  1.00 7.71  ? 299 ALA A C   1 
ATOM   2277  O  O   . ALA A 1 299 ? -44.200 38.789  43.083  1.00 10.51 ? 299 ALA A O   1 
ATOM   2278  C  CB  . ALA A 1 299 ? -42.943 38.561  40.290  1.00 5.74  ? 299 ALA A CB  1 
ATOM   2279  N  N   . VAL A 1 300 ? -42.118 38.088  43.556  1.00 7.66  ? 300 VAL A N   1 
ATOM   2280  C  CA  . VAL A 1 300 ? -42.497 37.476  44.825  1.00 8.45  ? 300 VAL A CA  1 
ATOM   2281  C  C   . VAL A 1 300 ? -42.860 38.624  45.766  1.00 9.71  ? 300 VAL A C   1 
ATOM   2282  O  O   . VAL A 1 300 ? -43.728 38.502  46.632  1.00 9.71  ? 300 VAL A O   1 
ATOM   2283  C  CB  . VAL A 1 300 ? -41.307 36.691  45.446  1.00 8.43  ? 300 VAL A CB  1 
ATOM   2284  C  CG1 . VAL A 1 300 ? -41.623 36.286  46.876  1.00 8.80  ? 300 VAL A CG1 1 
ATOM   2285  C  CG2 . VAL A 1 300 ? -41.001 35.459  44.614  1.00 8.89  ? 300 VAL A CG2 1 
ATOM   2286  N  N   . ILE A 1 301 ? -42.190 39.750  45.544  1.00 8.44  ? 301 ILE A N   1 
ATOM   2287  C  CA  . ILE A 1 301 ? -42.333 40.959  46.342  1.00 10.12 ? 301 ILE A CA  1 
ATOM   2288  C  C   . ILE A 1 301 ? -43.272 42.036  45.799  1.00 9.31  ? 301 ILE A C   1 
ATOM   2289  O  O   . ILE A 1 301 ? -44.022 42.645  46.557  1.00 10.13 ? 301 ILE A O   1 
ATOM   2290  C  CB  . ILE A 1 301 ? -40.942 41.631  46.515  1.00 13.20 ? 301 ILE A CB  1 
ATOM   2291  C  CG1 . ILE A 1 301 ? -40.012 40.710  47.301  1.00 15.76 ? 301 ILE A CG1 1 
ATOM   2292  C  CG2 . ILE A 1 301 ? -41.081 42.997  47.169  1.00 13.96 ? 301 ILE A CG2 1 
ATOM   2293  C  CD1 . ILE A 1 301 ? -38.554 41.123  47.218  1.00 16.51 ? 301 ILE A CD1 1 
ATOM   2294  N  N   . ASP A 1 302 ? -43.234 42.258  44.488  1.00 10.49 ? 302 ASP A N   1 
ATOM   2295  C  CA  . ASP A 1 302 ? -43.995 43.342  43.870  1.00 10.57 ? 302 ASP A CA  1 
ATOM   2296  C  C   . ASP A 1 302 ? -45.246 43.083  43.034  1.00 9.41  ? 302 ASP A C   1 
ATOM   2297  O  O   . ASP A 1 302 ? -45.768 44.023  42.438  1.00 10.16 ? 302 ASP A O   1 
ATOM   2298  C  CB  . ASP A 1 302 ? -43.032 44.181  43.015  1.00 8.45  ? 302 ASP A CB  1 
ATOM   2299  C  CG  . ASP A 1 302 ? -42.532 43.431  41.780  1.00 8.68  ? 302 ASP A CG  1 
ATOM   2300  O  OD1 . ASP A 1 302 ? -43.236 42.509  41.306  1.00 6.48  ? 302 ASP A OD1 1 
ATOM   2301  O  OD2 . ASP A 1 302 ? -41.447 43.777  41.262  1.00 7.96  ? 302 ASP A OD2 1 
ATOM   2302  N  N   . ARG A 1 303 ? -45.736 41.849  42.982  1.00 9.53  ? 303 ARG A N   1 
ATOM   2303  C  CA  . ARG A 1 303 ? -46.900 41.540  42.151  1.00 11.22 ? 303 ARG A CA  1 
ATOM   2304  C  C   . ARG A 1 303 ? -48.244 42.072  42.653  1.00 12.16 ? 303 ARG A C   1 
ATOM   2305  O  O   . ARG A 1 303 ? -48.992 42.690  41.894  1.00 13.51 ? 303 ARG A O   1 
ATOM   2306  C  CB  . ARG A 1 303 ? -47.013 40.024  41.946  1.00 12.55 ? 303 ARG A CB  1 
ATOM   2307  C  CG  . ARG A 1 303 ? -48.143 39.572  40.992  1.00 13.95 ? 303 ARG A CG  1 
ATOM   2308  C  CD  . ARG A 1 303 ? -47.738 39.716  39.533  1.00 13.15 ? 303 ARG A CD  1 
ATOM   2309  N  NE  . ARG A 1 303 ? -48.837 39.472  38.593  1.00 15.18 ? 303 ARG A NE  1 
ATOM   2310  C  CZ  . ARG A 1 303 ? -49.133 38.294  38.048  1.00 14.04 ? 303 ARG A CZ  1 
ATOM   2311  N  NH1 . ARG A 1 303 ? -48.420 37.213  38.338  1.00 14.94 ? 303 ARG A NH1 1 
ATOM   2312  N  NH2 . ARG A 1 303 ? -50.135 38.203  37.184  1.00 12.36 ? 303 ARG A NH2 1 
ATOM   2313  N  N   . GLN A 1 304 ? -48.546 41.837  43.927  1.00 11.32 ? 304 GLN A N   1 
ATOM   2314  C  CA  . GLN A 1 304 ? -49.828 42.250  44.493  1.00 12.59 ? 304 GLN A CA  1 
ATOM   2315  C  C   . GLN A 1 304 ? -49.939 43.707  44.931  1.00 11.10 ? 304 GLN A C   1 
ATOM   2316  O  O   . GLN A 1 304 ? -49.044 44.261  45.560  1.00 10.57 ? 304 GLN A O   1 
ATOM   2317  C  CB  . GLN A 1 304 ? -50.196 41.324  45.654  1.00 12.55 ? 304 GLN A CB  1 
ATOM   2318  C  CG  . GLN A 1 304 ? -50.174 39.833  45.295  1.00 12.78 ? 304 GLN A CG  1 
ATOM   2319  C  CD  . GLN A 1 304 ? -51.047 39.488  44.090  1.00 14.96 ? 304 GLN A CD  1 
ATOM   2320  O  OE1 . GLN A 1 304 ? -52.072 40.125  43.847  1.00 13.00 ? 304 GLN A OE1 1 
ATOM   2321  N  NE2 . GLN A 1 304 ? -50.646 38.463  43.339  1.00 12.29 ? 304 GLN A NE2 1 
ATOM   2322  N  N   . LYS A 1 305 ? -51.078 44.304  44.607  1.00 12.14 ? 305 LYS A N   1 
ATOM   2323  C  CA  . LYS A 1 305 ? -51.366 45.699  44.904  1.00 13.78 ? 305 LYS A CA  1 
ATOM   2324  C  C   . LYS A 1 305 ? -51.508 46.033  46.394  1.00 13.93 ? 305 LYS A C   1 
ATOM   2325  O  O   . LYS A 1 305 ? -51.194 47.146  46.817  1.00 13.15 ? 305 LYS A O   1 
ATOM   2326  C  CB  . LYS A 1 305 ? -52.642 46.088  44.152  1.00 15.96 ? 305 LYS A CB  1 
ATOM   2327  C  CG  . LYS A 1 305 ? -52.933 47.571  44.059  1.00 21.23 ? 305 LYS A CG  1 
ATOM   2328  C  CD  . LYS A 1 305 ? -54.141 47.788  43.150  1.00 23.25 ? 305 LYS A CD  1 
ATOM   2329  C  CE  . LYS A 1 305 ? -54.463 49.258  42.952  1.00 26.25 ? 305 LYS A CE  1 
ATOM   2330  N  NZ  . LYS A 1 305 ? -55.639 49.435  42.052  1.00 29.06 ? 305 LYS A NZ  1 
ATOM   2331  N  N   . ASN A 1 306 ? -51.958 45.066  47.188  1.00 13.03 ? 306 ASN A N   1 
ATOM   2332  C  CA  . ASN A 1 306 ? -52.182 45.279  48.618  1.00 13.85 ? 306 ASN A CA  1 
ATOM   2333  C  C   . ASN A 1 306 ? -51.008 45.054  49.576  1.00 12.27 ? 306 ASN A C   1 
ATOM   2334  O  O   . ASN A 1 306 ? -51.006 45.592  50.686  1.00 11.17 ? 306 ASN A O   1 
ATOM   2335  C  CB  . ASN A 1 306 ? -53.345 44.394  49.079  1.00 17.98 ? 306 ASN A CB  1 
ATOM   2336  C  CG  . ASN A 1 306 ? -52.962 42.919  49.146  1.00 22.06 ? 306 ASN A CG  1 
ATOM   2337  O  OD1 . ASN A 1 306 ? -52.320 42.389  48.238  1.00 24.05 ? 306 ASN A OD1 1 
ATOM   2338  N  ND2 . ASN A 1 306 ? -53.365 42.249  50.223  1.00 24.07 ? 306 ASN A ND2 1 
ATOM   2339  N  N   . HIS A 1 307 ? -50.013 44.273  49.169  1.00 10.13 ? 307 HIS A N   1 
ATOM   2340  C  CA  . HIS A 1 307 ? -48.904 43.975  50.073  1.00 9.08  ? 307 HIS A CA  1 
ATOM   2341  C  C   . HIS A 1 307 ? -47.580 43.762  49.342  1.00 9.29  ? 307 HIS A C   1 
ATOM   2342  O  O   . HIS A 1 307 ? -47.544 43.134  48.285  1.00 10.51 ? 307 HIS A O   1 
ATOM   2343  C  CB  . HIS A 1 307 ? -49.258 42.715  50.880  1.00 7.86  ? 307 HIS A CB  1 
ATOM   2344  C  CG  . HIS A 1 307 ? -48.309 42.413  51.996  1.00 8.17  ? 307 HIS A CG  1 
ATOM   2345  N  ND1 . HIS A 1 307 ? -48.537 42.816  53.296  1.00 7.43  ? 307 HIS A ND1 1 
ATOM   2346  C  CD2 . HIS A 1 307 ? -47.130 41.747  52.010  1.00 6.14  ? 307 HIS A CD2 1 
ATOM   2347  C  CE1 . HIS A 1 307 ? -47.540 42.408  54.062  1.00 7.05  ? 307 HIS A CE1 1 
ATOM   2348  N  NE2 . HIS A 1 307 ? -46.674 41.757  53.305  1.00 7.61  ? 307 HIS A NE2 1 
ATOM   2349  N  N   . GLY A 1 308 ? -46.496 44.284  49.913  1.00 7.21  ? 308 GLY A N   1 
ATOM   2350  C  CA  . GLY A 1 308 ? -45.182 44.124  49.310  1.00 7.44  ? 308 GLY A CA  1 
ATOM   2351  C  C   . GLY A 1 308 ? -44.466 45.437  49.032  1.00 7.16  ? 308 GLY A C   1 
ATOM   2352  O  O   . GLY A 1 308 ? -44.590 46.400  49.786  1.00 8.59  ? 308 GLY A O   1 
ATOM   2353  N  N   . MET A 1 309 ? -43.707 45.471  47.944  1.00 8.07  ? 309 MET A N   1 
ATOM   2354  C  CA  . MET A 1 309 ? -42.972 46.670  47.546  1.00 10.21 ? 309 MET A CA  1 
ATOM   2355  C  C   . MET A 1 309 ? -43.106 46.807  46.041  1.00 9.61  ? 309 MET A C   1 
ATOM   2356  O  O   . MET A 1 309 ? -42.849 45.853  45.313  1.00 11.99 ? 309 MET A O   1 
ATOM   2357  C  CB  . MET A 1 309 ? -41.487 46.541  47.892  1.00 11.65 ? 309 MET A CB  1 
ATOM   2358  C  CG  . MET A 1 309 ? -41.156 46.534  49.369  1.00 16.20 ? 309 MET A CG  1 
ATOM   2359  S  SD  . MET A 1 309 ? -39.393 46.194  49.616  1.00 23.82 ? 309 MET A SD  1 
ATOM   2360  C  CE  . MET A 1 309 ? -38.664 47.481  48.618  1.00 15.88 ? 309 MET A CE  1 
ATOM   2361  N  N   . HIS A 1 310 ? -43.494 47.984  45.563  1.00 10.03 ? 310 HIS A N   1 
ATOM   2362  C  CA  . HIS A 1 310 ? -43.632 48.158  44.127  1.00 8.92  ? 310 HIS A CA  1 
ATOM   2363  C  C   . HIS A 1 310 ? -42.256 48.136  43.469  1.00 9.19  ? 310 HIS A C   1 
ATOM   2364  O  O   . HIS A 1 310 ? -41.269 48.554  44.070  1.00 9.80  ? 310 HIS A O   1 
ATOM   2365  C  CB  . HIS A 1 310 ? -44.354 49.463  43.800  1.00 7.91  ? 310 HIS A CB  1 
ATOM   2366  C  CG  . HIS A 1 310 ? -44.798 49.547  42.375  1.00 10.67 ? 310 HIS A CG  1 
ATOM   2367  N  ND1 . HIS A 1 310 ? -43.932 49.825  41.340  1.00 9.90  ? 310 HIS A ND1 1 
ATOM   2368  C  CD2 . HIS A 1 310 ? -45.999 49.291  41.804  1.00 10.34 ? 310 HIS A CD2 1 
ATOM   2369  C  CE1 . HIS A 1 310 ? -44.577 49.731  40.192  1.00 11.47 ? 310 HIS A CE1 1 
ATOM   2370  N  NE2 . HIS A 1 310 ? -45.833 49.407  40.444  1.00 11.41 ? 310 HIS A NE2 1 
ATOM   2371  N  N   . PHE A 1 311 ? -42.191 47.651  42.232  1.00 8.09  ? 311 PHE A N   1 
ATOM   2372  C  CA  . PHE A 1 311 ? -40.919 47.568  41.520  1.00 7.70  ? 311 PHE A CA  1 
ATOM   2373  C  C   . PHE A 1 311 ? -40.177 48.898  41.384  1.00 7.73  ? 311 PHE A C   1 
ATOM   2374  O  O   . PHE A 1 311 ? -38.948 48.912  41.327  1.00 8.90  ? 311 PHE A O   1 
ATOM   2375  C  CB  . PHE A 1 311 ? -41.105 46.966  40.123  1.00 8.08  ? 311 PHE A CB  1 
ATOM   2376  C  CG  . PHE A 1 311 ? -39.808 46.745  39.393  1.00 9.43  ? 311 PHE A CG  1 
ATOM   2377  C  CD1 . PHE A 1 311 ? -38.882 45.813  39.865  1.00 8.09  ? 311 PHE A CD1 1 
ATOM   2378  C  CD2 . PHE A 1 311 ? -39.478 47.510  38.280  1.00 8.77  ? 311 PHE A CD2 1 
ATOM   2379  C  CE1 . PHE A 1 311 ? -37.646 45.653  39.243  1.00 9.23  ? 311 PHE A CE1 1 
ATOM   2380  C  CE2 . PHE A 1 311 ? -38.244 47.360  37.648  1.00 9.48  ? 311 PHE A CE2 1 
ATOM   2381  C  CZ  . PHE A 1 311 ? -37.324 46.430  38.131  1.00 7.24  ? 311 PHE A CZ  1 
ATOM   2382  N  N   . ARG A 1 312 ? -40.895 50.015  41.331  1.00 6.99  ? 312 ARG A N   1 
ATOM   2383  C  CA  . ARG A 1 312 ? -40.206 51.294  41.186  1.00 7.72  ? 312 ARG A CA  1 
ATOM   2384  C  C   . ARG A 1 312 ? -39.222 51.536  42.334  1.00 8.79  ? 312 ARG A C   1 
ATOM   2385  O  O   . ARG A 1 312 ? -38.196 52.194  42.151  1.00 9.21  ? 312 ARG A O   1 
ATOM   2386  C  CB  . ARG A 1 312 ? -41.207 52.453  41.073  1.00 7.04  ? 312 ARG A CB  1 
ATOM   2387  C  CG  . ARG A 1 312 ? -42.027 52.771  42.313  1.00 6.58  ? 312 ARG A CG  1 
ATOM   2388  C  CD  . ARG A 1 312 ? -42.999 53.920  42.014  1.00 5.80  ? 312 ARG A CD  1 
ATOM   2389  N  NE  . ARG A 1 312 ? -44.090 53.522  41.121  1.00 7.69  ? 312 ARG A NE  1 
ATOM   2390  C  CZ  . ARG A 1 312 ? -45.225 52.961  41.532  1.00 8.77  ? 312 ARG A CZ  1 
ATOM   2391  N  NH1 . ARG A 1 312 ? -45.421 52.737  42.823  1.00 7.81  ? 312 ARG A NH1 1 
ATOM   2392  N  NH2 . ARG A 1 312 ? -46.162 52.616  40.657  1.00 9.77  ? 312 ARG A NH2 1 
ATOM   2393  N  N   . VAL A 1 313 ? -39.528 50.997  43.511  1.00 7.59  ? 313 VAL A N   1 
ATOM   2394  C  CA  . VAL A 1 313 ? -38.646 51.148  44.662  1.00 8.75  ? 313 VAL A CA  1 
ATOM   2395  C  C   . VAL A 1 313 ? -37.424 50.250  44.467  1.00 9.32  ? 313 VAL A C   1 
ATOM   2396  O  O   . VAL A 1 313 ? -36.299 50.648  44.768  1.00 10.61 ? 313 VAL A O   1 
ATOM   2397  C  CB  . VAL A 1 313 ? -39.363 50.764  45.978  1.00 8.42  ? 313 VAL A CB  1 
ATOM   2398  C  CG1 . VAL A 1 313 ? -38.398 50.879  47.151  1.00 10.36 ? 313 VAL A CG1 1 
ATOM   2399  C  CG2 . VAL A 1 313 ? -40.567 51.670  46.190  1.00 8.41  ? 313 VAL A CG2 1 
ATOM   2400  N  N   . LEU A 1 314 ? -37.646 49.041  43.956  1.00 6.54  ? 314 LEU A N   1 
ATOM   2401  C  CA  . LEU A 1 314 ? -36.544 48.116  43.704  1.00 7.75  ? 314 LEU A CA  1 
ATOM   2402  C  C   . LEU A 1 314 ? -35.668 48.658  42.571  1.00 7.63  ? 314 LEU A C   1 
ATOM   2403  O  O   . LEU A 1 314 ? -34.454 48.435  42.548  1.00 9.29  ? 314 LEU A O   1 
ATOM   2404  C  CB  . LEU A 1 314 ? -37.078 46.729  43.328  1.00 7.36  ? 314 LEU A CB  1 
ATOM   2405  C  CG  . LEU A 1 314 ? -37.832 45.967  44.425  1.00 9.08  ? 314 LEU A CG  1 
ATOM   2406  C  CD1 . LEU A 1 314 ? -38.377 44.668  43.849  1.00 8.92  ? 314 LEU A CD1 1 
ATOM   2407  C  CD2 . LEU A 1 314 ? -36.910 45.687  45.606  1.00 10.75 ? 314 LEU A CD2 1 
ATOM   2408  N  N   . ALA A 1 315 ? -36.289 49.372  41.636  1.00 7.68  ? 315 ALA A N   1 
ATOM   2409  C  CA  . ALA A 1 315 ? -35.559 49.951  40.512  1.00 8.81  ? 315 ALA A CA  1 
ATOM   2410  C  C   . ALA A 1 315 ? -34.657 51.079  41.004  1.00 8.93  ? 315 ALA A C   1 
ATOM   2411  O  O   . ALA A 1 315 ? -33.498 51.164  40.608  1.00 8.19  ? 315 ALA A O   1 
ATOM   2412  C  CB  . ALA A 1 315 ? -36.531 50.475  39.454  1.00 6.89  ? 315 ALA A CB  1 
ATOM   2413  N  N   . LYS A 1 316 ? -35.181 51.944  41.867  1.00 8.36  ? 316 LYS A N   1 
ATOM   2414  C  CA  . LYS A 1 316 ? -34.374 53.043  42.396  1.00 10.30 ? 316 LYS A CA  1 
ATOM   2415  C  C   . LYS A 1 316 ? -33.205 52.505  43.219  1.00 9.90  ? 316 LYS A C   1 
ATOM   2416  O  O   . LYS A 1 316 ? -32.083 53.008  43.124  1.00 9.58  ? 316 LYS A O   1 
ATOM   2417  C  CB  . LYS A 1 316 ? -35.222 53.977  43.269  1.00 10.52 ? 316 LYS A CB  1 
ATOM   2418  C  CG  . LYS A 1 316 ? -36.249 54.803  42.509  1.00 8.91  ? 316 LYS A CG  1 
ATOM   2419  C  CD  . LYS A 1 316 ? -36.872 55.841  43.431  1.00 9.24  ? 316 LYS A CD  1 
ATOM   2420  C  CE  . LYS A 1 316 ? -37.918 56.673  42.712  1.00 7.46  ? 316 LYS A CE  1 
ATOM   2421  N  NZ  . LYS A 1 316 ? -38.502 57.713  43.598  1.00 7.69  ? 316 LYS A NZ  1 
ATOM   2422  N  N   . ALA A 1 317 ? -33.477 51.488  44.032  1.00 8.83  ? 317 ALA A N   1 
ATOM   2423  C  CA  . ALA A 1 317 ? -32.443 50.881  44.866  1.00 8.93  ? 317 ALA A CA  1 
ATOM   2424  C  C   . ALA A 1 317 ? -31.279 50.362  44.025  1.00 8.86  ? 317 ALA A C   1 
ATOM   2425  O  O   . ALA A 1 317 ? -30.120 50.480  44.422  1.00 10.41 ? 317 ALA A O   1 
ATOM   2426  C  CB  . ALA A 1 317 ? -33.038 49.741  45.698  1.00 7.25  ? 317 ALA A CB  1 
ATOM   2427  N  N   . LEU A 1 318 ? -31.587 49.787  42.866  1.00 9.29  ? 318 LEU A N   1 
ATOM   2428  C  CA  . LEU A 1 318 ? -30.553 49.258  41.984  1.00 7.49  ? 318 LEU A CA  1 
ATOM   2429  C  C   . LEU A 1 318 ? -29.729 50.384  41.363  1.00 7.38  ? 318 LEU A C   1 
ATOM   2430  O  O   . LEU A 1 318 ? -28.514 50.265  41.244  1.00 7.47  ? 318 LEU A O   1 
ATOM   2431  C  CB  . LEU A 1 318 ? -31.180 48.390  40.887  1.00 7.50  ? 318 LEU A CB  1 
ATOM   2432  C  CG  . LEU A 1 318 ? -30.277 47.641  39.894  1.00 9.04  ? 318 LEU A CG  1 
ATOM   2433  C  CD1 . LEU A 1 318 ? -29.810 48.576  38.787  1.00 7.32  ? 318 LEU A CD1 1 
ATOM   2434  C  CD2 . LEU A 1 318 ? -29.096 47.023  40.637  1.00 10.23 ? 318 LEU A CD2 1 
ATOM   2435  N  N   . ARG A 1 319 ? -30.379 51.475  40.971  1.00 6.13  ? 319 ARG A N   1 
ATOM   2436  C  CA  . ARG A 1 319 ? -29.649 52.588  40.377  1.00 7.24  ? 319 ARG A CA  1 
ATOM   2437  C  C   . ARG A 1 319 ? -28.622 53.131  41.369  1.00 8.08  ? 319 ARG A C   1 
ATOM   2438  O  O   . ARG A 1 319 ? -27.554 53.609  40.974  1.00 9.22  ? 319 ARG A O   1 
ATOM   2439  C  CB  . ARG A 1 319 ? -30.608 53.706  39.944  1.00 6.52  ? 319 ARG A CB  1 
ATOM   2440  C  CG  . ARG A 1 319 ? -29.936 54.789  39.103  1.00 7.21  ? 319 ARG A CG  1 
ATOM   2441  C  CD  . ARG A 1 319 ? -30.945 55.710  38.421  1.00 6.34  ? 319 ARG A CD  1 
ATOM   2442  N  NE  . ARG A 1 319 ? -30.286 56.740  37.620  1.00 6.02  ? 319 ARG A NE  1 
ATOM   2443  C  CZ  . ARG A 1 319 ? -30.917 57.745  37.014  1.00 8.37  ? 319 ARG A CZ  1 
ATOM   2444  N  NH1 . ARG A 1 319 ? -32.234 57.861  37.112  1.00 5.26  ? 319 ARG A NH1 1 
ATOM   2445  N  NH2 . ARG A 1 319 ? -30.226 58.650  36.324  1.00 6.00  ? 319 ARG A NH2 1 
ATOM   2446  N  N   . LEU A 1 320 ? -28.940 53.053  42.657  1.00 7.43  ? 320 LEU A N   1 
ATOM   2447  C  CA  . LEU A 1 320 ? -28.020 53.527  43.686  1.00 8.78  ? 320 LEU A CA  1 
ATOM   2448  C  C   . LEU A 1 320 ? -26.900 52.506  43.912  1.00 8.97  ? 320 LEU A C   1 
ATOM   2449  O  O   . LEU A 1 320 ? -25.725 52.853  43.838  1.00 8.78  ? 320 LEU A O   1 
ATOM   2450  C  CB  . LEU A 1 320 ? -28.771 53.790  44.997  1.00 8.70  ? 320 LEU A CB  1 
ATOM   2451  C  CG  . LEU A 1 320 ? -29.747 54.974  45.003  1.00 9.51  ? 320 LEU A CG  1 
ATOM   2452  C  CD1 . LEU A 1 320 ? -30.491 55.016  46.327  1.00 10.17 ? 320 LEU A CD1 1 
ATOM   2453  C  CD2 . LEU A 1 320 ? -28.989 56.281  44.785  1.00 8.42  ? 320 LEU A CD2 1 
ATOM   2454  N  N   . SER A 1 321 ? -27.267 51.252  44.184  1.00 10.21 ? 321 SER A N   1 
ATOM   2455  C  CA  . SER A 1 321 ? -26.278 50.191  44.400  1.00 9.27  ? 321 SER A CA  1 
ATOM   2456  C  C   . SER A 1 321 ? -25.384 50.095  43.168  1.00 9.21  ? 321 SER A C   1 
ATOM   2457  O  O   . SER A 1 321 ? -24.154 50.064  43.278  1.00 11.06 ? 321 SER A O   1 
ATOM   2458  C  CB  . SER A 1 321 ? -26.970 48.848  44.639  1.00 10.06 ? 321 SER A CB  1 
ATOM   2459  O  OG  . SER A 1 321 ? -26.025 47.795  44.755  1.00 10.32 ? 321 SER A OG  1 
ATOM   2460  N  N   . GLY A 1 322 ? -26.006 50.041  41.995  1.00 8.08  ? 322 GLY A N   1 
ATOM   2461  C  CA  . GLY A 1 322 ? -25.230 49.990  40.772  1.00 8.28  ? 322 GLY A CA  1 
ATOM   2462  C  C   . GLY A 1 322 ? -25.499 48.867  39.791  1.00 6.94  ? 322 GLY A C   1 
ATOM   2463  O  O   . GLY A 1 322 ? -25.443 47.686  40.127  1.00 6.56  ? 322 GLY A O   1 
ATOM   2464  N  N   . GLY A 1 323 ? -25.776 49.266  38.556  1.00 7.84  ? 323 GLY A N   1 
ATOM   2465  C  CA  . GLY A 1 323 ? -26.032 48.328  37.481  1.00 6.81  ? 323 GLY A CA  1 
ATOM   2466  C  C   . GLY A 1 323 ? -26.116 49.132  36.199  1.00 7.94  ? 323 GLY A C   1 
ATOM   2467  O  O   . GLY A 1 323 ? -26.596 50.263  36.220  1.00 11.29 ? 323 GLY A O   1 
ATOM   2468  N  N   . ASP A 1 324 ? -25.634 48.584  35.087  1.00 8.24  ? 324 ASP A N   1 
ATOM   2469  C  CA  . ASP A 1 324 ? -25.704 49.307  33.819  1.00 6.98  ? 324 ASP A CA  1 
ATOM   2470  C  C   . ASP A 1 324 ? -27.004 48.982  33.077  1.00 7.13  ? 324 ASP A C   1 
ATOM   2471  O  O   . ASP A 1 324 ? -27.504 49.806  32.310  1.00 7.18  ? 324 ASP A O   1 
ATOM   2472  C  CB  . ASP A 1 324 ? -24.481 48.990  32.950  1.00 6.08  ? 324 ASP A CB  1 
ATOM   2473  C  CG  . ASP A 1 324 ? -23.189 49.526  33.550  1.00 7.14  ? 324 ASP A CG  1 
ATOM   2474  O  OD1 . ASP A 1 324 ? -23.161 50.709  33.954  1.00 7.11  ? 324 ASP A OD1 1 
ATOM   2475  O  OD2 . ASP A 1 324 ? -22.200 48.768  33.617  1.00 4.95  ? 324 ASP A OD2 1 
ATOM   2476  N  N   . HIS A 1 325 ? -27.536 47.780  33.315  1.00 7.38  ? 325 HIS A N   1 
ATOM   2477  C  CA  . HIS A 1 325 ? -28.802 47.322  32.725  1.00 7.18  ? 325 HIS A CA  1 
ATOM   2478  C  C   . HIS A 1 325 ? -29.670 46.775  33.861  1.00 8.01  ? 325 HIS A C   1 
ATOM   2479  O  O   . HIS A 1 325 ? -29.158 46.356  34.898  1.00 6.62  ? 325 HIS A O   1 
ATOM   2480  C  CB  . HIS A 1 325 ? -28.643 46.107  31.796  1.00 7.96  ? 325 HIS A CB  1 
ATOM   2481  C  CG  . HIS A 1 325 ? -27.763 46.303  30.605  1.00 7.39  ? 325 HIS A CG  1 
ATOM   2482  N  ND1 . HIS A 1 325 ? -27.523 45.286  29.706  1.00 6.32  ? 325 HIS A ND1 1 
ATOM   2483  C  CD2 . HIS A 1 325 ? -27.060 47.373  30.161  1.00 8.82  ? 325 HIS A CD2 1 
ATOM   2484  C  CE1 . HIS A 1 325 ? -26.710 45.717  28.762  1.00 6.37  ? 325 HIS A CE1 1 
ATOM   2485  N  NE2 . HIS A 1 325 ? -26.413 46.980  29.013  1.00 7.39  ? 325 HIS A NE2 1 
ATOM   2486  N  N   . ILE A 1 326 ? -30.980 46.760  33.642  1.00 7.59  ? 326 ILE A N   1 
ATOM   2487  C  CA  . ILE A 1 326 ? -31.915 46.154  34.581  1.00 6.47  ? 326 ILE A CA  1 
ATOM   2488  C  C   . ILE A 1 326 ? -33.197 45.852  33.816  1.00 6.93  ? 326 ILE A C   1 
ATOM   2489  O  O   . ILE A 1 326 ? -33.653 46.667  33.009  1.00 7.12  ? 326 ILE A O   1 
ATOM   2490  C  CB  . ILE A 1 326 ? -32.247 47.041  35.810  1.00 6.53  ? 326 ILE A CB  1 
ATOM   2491  C  CG1 . ILE A 1 326 ? -33.006 46.177  36.830  1.00 7.11  ? 326 ILE A CG1 1 
ATOM   2492  C  CG2 . ILE A 1 326 ? -33.109 48.239  35.404  1.00 4.88  ? 326 ILE A CG2 1 
ATOM   2493  C  CD1 . ILE A 1 326 ? -33.313 46.849  38.151  1.00 9.84  ? 326 ILE A CD1 1 
ATOM   2494  N  N   . HIS A 1 327 ? -33.766 44.672  34.041  1.00 5.86  ? 327 HIS A N   1 
ATOM   2495  C  CA  . HIS A 1 327 ? -34.992 44.308  33.349  1.00 6.78  ? 327 HIS A CA  1 
ATOM   2496  C  C   . HIS A 1 327 ? -36.132 45.190  33.825  1.00 8.17  ? 327 HIS A C   1 
ATOM   2497  O  O   . HIS A 1 327 ? -36.256 45.478  35.017  1.00 7.31  ? 327 HIS A O   1 
ATOM   2498  C  CB  . HIS A 1 327 ? -35.326 42.836  33.567  1.00 5.81  ? 327 HIS A CB  1 
ATOM   2499  C  CG  . HIS A 1 327 ? -34.359 41.903  32.907  1.00 7.84  ? 327 HIS A CG  1 
ATOM   2500  N  ND1 . HIS A 1 327 ? -34.751 40.726  32.309  1.00 6.50  ? 327 HIS A ND1 1 
ATOM   2501  C  CD2 . HIS A 1 327 ? -33.015 41.970  32.766  1.00 7.26  ? 327 HIS A CD2 1 
ATOM   2502  C  CE1 . HIS A 1 327 ? -33.690 40.105  31.826  1.00 6.49  ? 327 HIS A CE1 1 
ATOM   2503  N  NE2 . HIS A 1 327 ? -32.620 40.840  32.090  1.00 7.79  ? 327 HIS A NE2 1 
ATOM   2504  N  N   . SER A 1 328 ? -36.967 45.605  32.879  1.00 8.75  ? 328 SER A N   1 
ATOM   2505  C  CA  . SER A 1 328 ? -38.079 46.497  33.167  1.00 10.56 ? 328 SER A CA  1 
ATOM   2506  C  C   . SER A 1 328 ? -39.446 45.949  32.771  1.00 10.46 ? 328 SER A C   1 
ATOM   2507  O  O   . SER A 1 328 ? -40.460 46.563  33.073  1.00 12.23 ? 328 SER A O   1 
ATOM   2508  C  CB  . SER A 1 328 ? -37.859 47.813  32.430  1.00 11.76 ? 328 SER A CB  1 
ATOM   2509  O  OG  . SER A 1 328 ? -37.885 47.593  31.028  1.00 14.72 ? 328 SER A OG  1 
ATOM   2510  N  N   . GLY A 1 329 ? -39.476 44.811  32.089  1.00 9.59  ? 329 GLY A N   1 
ATOM   2511  C  CA  . GLY A 1 329 ? -40.749 44.258  31.657  1.00 8.61  ? 329 GLY A CA  1 
ATOM   2512  C  C   . GLY A 1 329 ? -40.967 44.588  30.190  1.00 8.60  ? 329 GLY A C   1 
ATOM   2513  O  O   . GLY A 1 329 ? -40.228 45.392  29.620  1.00 8.56  ? 329 GLY A O   1 
ATOM   2514  N  N   . THR A 1 330 ? -41.986 43.988  29.581  1.00 9.53  ? 330 THR A N   1 
ATOM   2515  C  CA  . THR A 1 330 ? -42.276 44.198  28.158  1.00 9.39  ? 330 THR A CA  1 
ATOM   2516  C  C   . THR A 1 330 ? -43.675 44.757  27.905  1.00 10.44 ? 330 THR A C   1 
ATOM   2517  O  O   . THR A 1 330 ? -43.942 45.300  26.831  1.00 11.45 ? 330 THR A O   1 
ATOM   2518  C  CB  . THR A 1 330 ? -42.228 42.879  27.383  1.00 8.95  ? 330 THR A CB  1 
ATOM   2519  O  OG1 . THR A 1 330 ? -43.272 42.027  27.874  1.00 8.11  ? 330 THR A OG1 1 
ATOM   2520  C  CG2 . THR A 1 330 ? -40.880 42.179  27.555  1.00 7.61  ? 330 THR A CG2 1 
ATOM   2521  N  N   . VAL A 1 331 ? -44.557 44.593  28.887  1.00 10.87 ? 331 VAL A N   1 
ATOM   2522  C  CA  . VAL A 1 331 ? -45.954 45.021  28.800  1.00 10.69 ? 331 VAL A CA  1 
ATOM   2523  C  C   . VAL A 1 331 ? -46.749 44.031  27.946  1.00 10.87 ? 331 VAL A C   1 
ATOM   2524  O  O   . VAL A 1 331 ? -47.803 43.543  28.365  1.00 9.61  ? 331 VAL A O   1 
ATOM   2525  C  CB  . VAL A 1 331 ? -46.111 46.435  28.178  1.00 12.10 ? 331 VAL A CB  1 
ATOM   2526  C  CG1 . VAL A 1 331 ? -47.598 46.799  28.082  1.00 12.19 ? 331 VAL A CG1 1 
ATOM   2527  C  CG2 . VAL A 1 331 ? -45.378 47.463  29.019  1.00 13.17 ? 331 VAL A CG2 1 
ATOM   2528  N  N   . VAL A 1 332 ? -46.226 43.717  26.762  1.00 10.79 ? 332 VAL A N   1 
ATOM   2529  C  CA  . VAL A 1 332 ? -46.896 42.808  25.831  1.00 12.03 ? 332 VAL A CA  1 
ATOM   2530  C  C   . VAL A 1 332 ? -46.459 41.344  25.896  1.00 12.86 ? 332 VAL A C   1 
ATOM   2531  O  O   . VAL A 1 332 ? -47.054 40.493  25.233  1.00 11.62 ? 332 VAL A O   1 
ATOM   2532  C  CB  . VAL A 1 332 ? -46.703 43.288  24.372  1.00 14.05 ? 332 VAL A CB  1 
ATOM   2533  C  CG1 . VAL A 1 332 ? -47.290 44.683  24.196  1.00 14.63 ? 332 VAL A CG1 1 
ATOM   2534  C  CG2 . VAL A 1 332 ? -45.221 43.301  24.020  1.00 13.86 ? 332 VAL A CG2 1 
ATOM   2535  N  N   . GLY A 1 333 ? -45.437 41.056  26.702  1.00 12.39 ? 333 GLY A N   1 
ATOM   2536  C  CA  . GLY A 1 333 ? -44.921 39.698  26.816  1.00 12.84 ? 333 GLY A CA  1 
ATOM   2537  C  C   . GLY A 1 333 ? -45.652 38.729  27.735  1.00 12.83 ? 333 GLY A C   1 
ATOM   2538  O  O   . GLY A 1 333 ? -46.808 38.950  28.102  1.00 9.30  ? 333 GLY A O   1 
ATOM   2539  N  N   . LYS A 1 334 ? -44.958 37.656  28.116  1.00 11.44 ? 334 LYS A N   1 
ATOM   2540  C  CA  . LYS A 1 334 ? -45.525 36.613  28.971  1.00 10.47 ? 334 LYS A CA  1 
ATOM   2541  C  C   . LYS A 1 334 ? -45.612 36.982  30.454  1.00 10.88 ? 334 LYS A C   1 
ATOM   2542  O  O   . LYS A 1 334 ? -46.319 36.325  31.216  1.00 8.61  ? 334 LYS A O   1 
ATOM   2543  C  CB  . LYS A 1 334 ? -44.717 35.314  28.821  1.00 8.62  ? 334 LYS A CB  1 
ATOM   2544  C  CG  . LYS A 1 334 ? -43.283 35.407  29.339  1.00 8.45  ? 334 LYS A CG  1 
ATOM   2545  C  CD  . LYS A 1 334 ? -42.479 34.138  29.057  1.00 7.01  ? 334 LYS A CD  1 
ATOM   2546  C  CE  . LYS A 1 334 ? -41.038 34.281  29.553  1.00 5.15  ? 334 LYS A CE  1 
ATOM   2547  N  NZ  . LYS A 1 334 ? -40.196 33.108  29.188  1.00 4.61  ? 334 LYS A NZ  1 
ATOM   2548  N  N   . LEU A 1 335 ? -44.898 38.027  30.859  1.00 9.48  ? 335 LEU A N   1 
ATOM   2549  C  CA  . LEU A 1 335 ? -44.904 38.459  32.254  1.00 10.27 ? 335 LEU A CA  1 
ATOM   2550  C  C   . LEU A 1 335 ? -45.652 39.781  32.403  1.00 8.88  ? 335 LEU A C   1 
ATOM   2551  O  O   . LEU A 1 335 ? -45.656 40.608  31.491  1.00 6.43  ? 335 LEU A O   1 
ATOM   2552  C  CB  . LEU A 1 335 ? -43.464 38.583  32.755  1.00 10.70 ? 335 LEU A CB  1 
ATOM   2553  C  CG  . LEU A 1 335 ? -42.721 37.247  32.643  1.00 13.16 ? 335 LEU A CG  1 
ATOM   2554  C  CD1 . LEU A 1 335 ? -41.266 37.481  32.292  1.00 11.80 ? 335 LEU A CD1 1 
ATOM   2555  C  CD2 . LEU A 1 335 ? -42.869 36.466  33.943  1.00 15.66 ? 335 LEU A CD2 1 
ATOM   2556  N  N   . GLU A 1 336 ? -46.268 39.979  33.566  1.00 9.25  ? 336 GLU A N   1 
ATOM   2557  C  CA  . GLU A 1 336 ? -47.063 41.173  33.840  1.00 11.10 ? 336 GLU A CA  1 
ATOM   2558  C  C   . GLU A 1 336 ? -46.335 42.514  33.898  1.00 12.53 ? 336 GLU A C   1 
ATOM   2559  O  O   . GLU A 1 336 ? -45.226 42.625  34.422  1.00 12.15 ? 336 GLU A O   1 
ATOM   2560  C  CB  . GLU A 1 336 ? -47.853 40.981  35.137  1.00 13.93 ? 336 GLU A CB  1 
ATOM   2561  C  CG  . GLU A 1 336 ? -48.720 42.178  35.507  1.00 19.56 ? 336 GLU A CG  1 
ATOM   2562  C  CD  . GLU A 1 336 ? -49.589 41.925  36.728  1.00 22.78 ? 336 GLU A CD  1 
ATOM   2563  O  OE1 . GLU A 1 336 ? -50.495 41.064  36.657  1.00 22.51 ? 336 GLU A OE1 1 
ATOM   2564  O  OE2 . GLU A 1 336 ? -49.360 42.588  37.761  1.00 25.33 ? 336 GLU A OE2 1 
ATOM   2565  N  N   . GLY A 1 337 ? -47.001 43.536  33.366  1.00 11.91 ? 337 GLY A N   1 
ATOM   2566  C  CA  . GLY A 1 337 ? -46.458 44.880  33.348  1.00 13.37 ? 337 GLY A CA  1 
ATOM   2567  C  C   . GLY A 1 337 ? -47.400 45.828  32.625  1.00 15.64 ? 337 GLY A C   1 
ATOM   2568  O  O   . GLY A 1 337 ? -47.651 45.667  31.434  1.00 18.22 ? 337 GLY A O   1 
ATOM   2569  N  N   . GLU A 1 338 ? -47.936 46.808  33.344  1.00 17.35 ? 338 GLU A N   1 
ATOM   2570  C  CA  . GLU A 1 338 ? -48.853 47.784  32.752  1.00 18.06 ? 338 GLU A CA  1 
ATOM   2571  C  C   . GLU A 1 338 ? -48.075 48.929  32.106  1.00 16.79 ? 338 GLU A C   1 
ATOM   2572  O  O   . GLU A 1 338 ? -47.070 49.389  32.646  1.00 14.67 ? 338 GLU A O   1 
ATOM   2573  C  CB  . GLU A 1 338 ? -49.792 48.327  33.826  1.00 22.67 ? 338 GLU A CB  1 
ATOM   2574  C  CG  . GLU A 1 338 ? -50.790 47.311  34.348  1.00 27.38 ? 338 GLU A CG  1 
ATOM   2575  C  CD  . GLU A 1 338 ? -51.868 46.990  33.334  1.00 32.09 ? 338 GLU A CD  1 
ATOM   2576  O  OE1 . GLU A 1 338 ? -51.582 46.246  32.372  1.00 33.63 ? 338 GLU A OE1 1 
ATOM   2577  O  OE2 . GLU A 1 338 ? -53.001 47.495  33.493  1.00 34.36 ? 338 GLU A OE2 1 
ATOM   2578  N  N   . ARG A 1 339 ? -48.556 49.397  30.959  1.00 16.12 ? 339 ARG A N   1 
ATOM   2579  C  CA  . ARG A 1 339 ? -47.885 50.463  30.217  1.00 16.94 ? 339 ARG A CA  1 
ATOM   2580  C  C   . ARG A 1 339 ? -47.556 51.747  30.976  1.00 15.91 ? 339 ARG A C   1 
ATOM   2581  O  O   . ARG A 1 339 ? -46.393 52.147  31.036  1.00 14.55 ? 339 ARG A O   1 
ATOM   2582  C  CB  . ARG A 1 339 ? -48.690 50.834  28.970  1.00 19.19 ? 339 ARG A CB  1 
ATOM   2583  C  CG  . ARG A 1 339 ? -47.961 51.800  28.034  1.00 22.73 ? 339 ARG A CG  1 
ATOM   2584  C  CD  . ARG A 1 339 ? -48.933 52.451  27.064  1.00 27.24 ? 339 ARG A CD  1 
ATOM   2585  N  NE  . ARG A 1 339 ? -48.540 52.278  25.668  1.00 32.02 ? 339 ARG A NE  1 
ATOM   2586  C  CZ  . ARG A 1 339 ? -47.759 53.114  24.989  1.00 32.64 ? 339 ARG A CZ  1 
ATOM   2587  N  NH1 . ARG A 1 339 ? -47.271 54.204  25.567  1.00 34.79 ? 339 ARG A NH1 1 
ATOM   2588  N  NH2 . ARG A 1 339 ? -47.470 52.858  23.725  1.00 33.59 ? 339 ARG A NH2 1 
ATOM   2589  N  N   . ASP A 1 340 ? -48.566 52.401  31.541  1.00 15.03 ? 340 ASP A N   1 
ATOM   2590  C  CA  . ASP A 1 340 ? -48.328 53.654  32.252  1.00 16.73 ? 340 ASP A CA  1 
ATOM   2591  C  C   . ASP A 1 340 ? -47.386 53.518  33.433  1.00 15.08 ? 340 ASP A C   1 
ATOM   2592  O  O   . ASP A 1 340 ? -46.497 54.348  33.623  1.00 15.52 ? 340 ASP A O   1 
ATOM   2593  C  CB  . ASP A 1 340 ? -49.643 54.276  32.718  1.00 19.71 ? 340 ASP A CB  1 
ATOM   2594  C  CG  . ASP A 1 340 ? -50.489 54.760  31.566  1.00 24.57 ? 340 ASP A CG  1 
ATOM   2595  O  OD1 . ASP A 1 340 ? -49.912 55.251  30.570  1.00 25.26 ? 340 ASP A OD1 1 
ATOM   2596  O  OD2 . ASP A 1 340 ? -51.730 54.662  31.662  1.00 29.51 ? 340 ASP A OD2 1 
ATOM   2597  N  N   . ILE A 1 341 ? -47.583 52.479  34.232  1.00 14.42 ? 341 ILE A N   1 
ATOM   2598  C  CA  . ILE A 1 341 ? -46.722 52.258  35.379  1.00 13.87 ? 341 ILE A CA  1 
ATOM   2599  C  C   . ILE A 1 341 ? -45.287 52.004  34.915  1.00 12.87 ? 341 ILE A C   1 
ATOM   2600  O  O   . ILE A 1 341 ? -44.343 52.562  35.472  1.00 13.10 ? 341 ILE A O   1 
ATOM   2601  C  CB  . ILE A 1 341 ? -47.237 51.070  36.228  1.00 15.89 ? 341 ILE A CB  1 
ATOM   2602  C  CG1 . ILE A 1 341 ? -48.431 51.536  37.069  1.00 17.88 ? 341 ILE A CG1 1 
ATOM   2603  C  CG2 . ILE A 1 341 ? -46.119 50.510  37.110  1.00 14.79 ? 341 ILE A CG2 1 
ATOM   2604  C  CD1 . ILE A 1 341 ? -49.025 50.460  37.959  1.00 21.87 ? 341 ILE A CD1 1 
ATOM   2605  N  N   . THR A 1 342 ? -45.131 51.182  33.880  1.00 11.50 ? 342 THR A N   1 
ATOM   2606  C  CA  . THR A 1 342 ? -43.807 50.859  33.351  1.00 12.36 ? 342 THR A CA  1 
ATOM   2607  C  C   . THR A 1 342 ? -43.079 52.089  32.809  1.00 12.42 ? 342 THR A C   1 
ATOM   2608  O  O   . THR A 1 342 ? -41.895 52.288  33.087  1.00 12.21 ? 342 THR A O   1 
ATOM   2609  C  CB  . THR A 1 342 ? -43.907 49.794  32.240  1.00 10.44 ? 342 THR A CB  1 
ATOM   2610  O  OG1 . THR A 1 342 ? -44.528 48.621  32.775  1.00 7.44  ? 342 THR A OG1 1 
ATOM   2611  C  CG2 . THR A 1 342 ? -42.519 49.423  31.710  1.00 11.31 ? 342 THR A CG2 1 
ATOM   2612  N  N   . LEU A 1 343 ? -43.780 52.913  32.035  1.00 13.48 ? 343 LEU A N   1 
ATOM   2613  C  CA  . LEU A 1 343 ? -43.173 54.124  31.486  1.00 12.50 ? 343 LEU A CA  1 
ATOM   2614  C  C   . LEU A 1 343 ? -42.753 55.015  32.649  1.00 12.19 ? 343 LEU A C   1 
ATOM   2615  O  O   . LEU A 1 343 ? -41.810 55.802  32.542  1.00 11.24 ? 343 LEU A O   1 
ATOM   2616  C  CB  . LEU A 1 343 ? -44.167 54.872  30.592  1.00 14.40 ? 343 LEU A CB  1 
ATOM   2617  C  CG  . LEU A 1 343 ? -44.510 54.207  29.253  1.00 16.55 ? 343 LEU A CG  1 
ATOM   2618  C  CD1 . LEU A 1 343 ? -45.620 54.980  28.557  1.00 15.13 ? 343 LEU A CD1 1 
ATOM   2619  C  CD2 . LEU A 1 343 ? -43.267 54.150  28.379  1.00 16.36 ? 343 LEU A CD2 1 
ATOM   2620  N  N   . GLY A 1 344 ? -43.467 54.874  33.761  1.00 11.15 ? 344 GLY A N   1 
ATOM   2621  C  CA  . GLY A 1 344 ? -43.161 55.650  34.943  1.00 10.84 ? 344 GLY A CA  1 
ATOM   2622  C  C   . GLY A 1 344 ? -41.793 55.314  35.512  1.00 11.83 ? 344 GLY A C   1 
ATOM   2623  O  O   . GLY A 1 344 ? -40.952 56.208  35.648  1.00 11.32 ? 344 GLY A O   1 
ATOM   2624  N  N   . PHE A 1 345 ? -41.542 54.045  35.842  1.00 9.49  ? 345 PHE A N   1 
ATOM   2625  C  CA  . PHE A 1 345 ? -40.237 53.722  36.403  1.00 10.08 ? 345 PHE A CA  1 
ATOM   2626  C  C   . PHE A 1 345 ? -39.097 53.678  35.388  1.00 10.87 ? 345 PHE A C   1 
ATOM   2627  O  O   . PHE A 1 345 ? -37.925 53.710  35.767  1.00 10.86 ? 345 PHE A O   1 
ATOM   2628  C  CB  . PHE A 1 345 ? -40.284 52.451  37.282  1.00 10.17 ? 345 PHE A CB  1 
ATOM   2629  C  CG  . PHE A 1 345 ? -40.782 51.207  36.593  1.00 8.43  ? 345 PHE A CG  1 
ATOM   2630  C  CD1 . PHE A 1 345 ? -40.020 50.569  35.616  1.00 9.13  ? 345 PHE A CD1 1 
ATOM   2631  C  CD2 . PHE A 1 345 ? -41.980 50.615  36.998  1.00 7.92  ? 345 PHE A CD2 1 
ATOM   2632  C  CE1 . PHE A 1 345 ? -40.439 49.357  35.058  1.00 6.35  ? 345 PHE A CE1 1 
ATOM   2633  C  CE2 . PHE A 1 345 ? -42.408 49.400  36.444  1.00 7.99  ? 345 PHE A CE2 1 
ATOM   2634  C  CZ  . PHE A 1 345 ? -41.632 48.773  35.475  1.00 8.08  ? 345 PHE A CZ  1 
ATOM   2635  N  N   . VAL A 1 346 ? -39.427 53.628  34.099  1.00 9.99  ? 346 VAL A N   1 
ATOM   2636  C  CA  . VAL A 1 346 ? -38.384 53.656  33.082  1.00 11.00 ? 346 VAL A CA  1 
ATOM   2637  C  C   . VAL A 1 346 ? -37.777 55.064  33.114  1.00 11.15 ? 346 VAL A C   1 
ATOM   2638  O  O   . VAL A 1 346 ? -36.564 55.225  32.975  1.00 10.86 ? 346 VAL A O   1 
ATOM   2639  C  CB  . VAL A 1 346 ? -38.939 53.341  31.667  1.00 11.62 ? 346 VAL A CB  1 
ATOM   2640  C  CG1 . VAL A 1 346 ? -37.940 53.769  30.600  1.00 11.94 ? 346 VAL A CG1 1 
ATOM   2641  C  CG2 . VAL A 1 346 ? -39.193 51.848  31.541  1.00 11.98 ? 346 VAL A CG2 1 
ATOM   2642  N  N   . ASP A 1 347 ? -38.616 56.083  33.312  1.00 9.88  ? 347 ASP A N   1 
ATOM   2643  C  CA  . ASP A 1 347 ? -38.112 57.450  33.399  1.00 8.73  ? 347 ASP A CA  1 
ATOM   2644  C  C   . ASP A 1 347 ? -37.282 57.583  34.675  1.00 8.25  ? 347 ASP A C   1 
ATOM   2645  O  O   . ASP A 1 347 ? -36.268 58.282  34.697  1.00 7.60  ? 347 ASP A O   1 
ATOM   2646  C  CB  . ASP A 1 347 ? -39.253 58.477  33.426  1.00 10.52 ? 347 ASP A CB  1 
ATOM   2647  C  CG  . ASP A 1 347 ? -39.863 58.724  32.050  1.00 12.56 ? 347 ASP A CG  1 
ATOM   2648  O  OD1 . ASP A 1 347 ? -39.278 58.281  31.039  1.00 11.74 ? 347 ASP A OD1 1 
ATOM   2649  O  OD2 . ASP A 1 347 ? -40.931 59.370  31.983  1.00 12.90 ? 347 ASP A OD2 1 
ATOM   2650  N  N   . LEU A 1 348 ? -37.714 56.909  35.738  1.00 8.00  ? 348 LEU A N   1 
ATOM   2651  C  CA  . LEU A 1 348 ? -36.992 56.956  37.006  1.00 8.33  ? 348 LEU A CA  1 
ATOM   2652  C  C   . LEU A 1 348 ? -35.610 56.318  36.871  1.00 8.37  ? 348 LEU A C   1 
ATOM   2653  O  O   . LEU A 1 348 ? -34.700 56.628  37.637  1.00 8.64  ? 348 LEU A O   1 
ATOM   2654  C  CB  . LEU A 1 348 ? -37.785 56.239  38.104  1.00 5.73  ? 348 LEU A CB  1 
ATOM   2655  C  CG  . LEU A 1 348 ? -39.077 56.914  38.577  1.00 8.27  ? 348 LEU A CG  1 
ATOM   2656  C  CD1 . LEU A 1 348 ? -39.827 55.972  39.515  1.00 8.38  ? 348 LEU A CD1 1 
ATOM   2657  C  CD2 . LEU A 1 348 ? -38.755 58.229  39.287  1.00 6.93  ? 348 LEU A CD2 1 
ATOM   2658  N  N   . LEU A 1 349 ? -35.461 55.434  35.889  1.00 7.95  ? 349 LEU A N   1 
ATOM   2659  C  CA  . LEU A 1 349 ? -34.195 54.743  35.653  1.00 8.02  ? 349 LEU A CA  1 
ATOM   2660  C  C   . LEU A 1 349 ? -33.236 55.468  34.709  1.00 8.50  ? 349 LEU A C   1 
ATOM   2661  O  O   . LEU A 1 349 ? -32.020 55.393  34.878  1.00 10.00 ? 349 LEU A O   1 
ATOM   2662  C  CB  . LEU A 1 349 ? -34.457 53.343  35.085  1.00 6.88  ? 349 LEU A CB  1 
ATOM   2663  C  CG  . LEU A 1 349 ? -34.997 52.235  35.994  1.00 9.40  ? 349 LEU A CG  1 
ATOM   2664  C  CD1 . LEU A 1 349 ? -35.326 51.015  35.148  1.00 6.34  ? 349 LEU A CD1 1 
ATOM   2665  C  CD2 . LEU A 1 349 ? -33.967 51.874  37.056  1.00 8.15  ? 349 LEU A CD2 1 
ATOM   2666  N  N   . ARG A 1 350 ? -33.778 56.168  33.718  1.00 9.01  ? 350 ARG A N   1 
ATOM   2667  C  CA  . ARG A 1 350 ? -32.944 56.845  32.730  1.00 9.35  ? 350 ARG A CA  1 
ATOM   2668  C  C   . ARG A 1 350 ? -32.701 58.341  32.901  1.00 9.47  ? 350 ARG A C   1 
ATOM   2669  O  O   . ARG A 1 350 ? -31.603 58.827  32.619  1.00 8.91  ? 350 ARG A O   1 
ATOM   2670  C  CB  . ARG A 1 350 ? -33.513 56.602  31.327  1.00 9.26  ? 350 ARG A CB  1 
ATOM   2671  C  CG  . ARG A 1 350 ? -33.622 55.139  30.946  1.00 9.24  ? 350 ARG A CG  1 
ATOM   2672  C  CD  . ARG A 1 350 ? -33.998 54.946  29.474  1.00 11.06 ? 350 ARG A CD  1 
ATOM   2673  N  NE  . ARG A 1 350 ? -35.199 55.691  29.097  1.00 10.40 ? 350 ARG A NE  1 
ATOM   2674  C  CZ  . ARG A 1 350 ? -36.023 55.339  28.114  1.00 10.79 ? 350 ARG A CZ  1 
ATOM   2675  N  NH1 . ARG A 1 350 ? -35.786 54.244  27.403  1.00 7.89  ? 350 ARG A NH1 1 
ATOM   2676  N  NH2 . ARG A 1 350 ? -37.089 56.083  27.842  1.00 11.66 ? 350 ARG A NH2 1 
ATOM   2677  N  N   . ASP A 1 351 ? -33.710 59.074  33.361  1.00 8.18  ? 351 ASP A N   1 
ATOM   2678  C  CA  . ASP A 1 351 ? -33.577 60.520  33.502  1.00 9.24  ? 351 ASP A CA  1 
ATOM   2679  C  C   . ASP A 1 351 ? -32.888 61.017  34.769  1.00 8.74  ? 351 ASP A C   1 
ATOM   2680  O  O   . ASP A 1 351 ? -32.649 60.265  35.710  1.00 11.07 ? 351 ASP A O   1 
ATOM   2681  C  CB  . ASP A 1 351 ? -34.952 61.188  33.364  1.00 9.52  ? 351 ASP A CB  1 
ATOM   2682  C  CG  . ASP A 1 351 ? -35.657 60.807  32.072  1.00 11.64 ? 351 ASP A CG  1 
ATOM   2683  O  OD1 . ASP A 1 351 ? -34.978 60.335  31.136  1.00 10.98 ? 351 ASP A OD1 1 
ATOM   2684  O  OD2 . ASP A 1 351 ? -36.891 60.985  31.991  1.00 12.79 ? 351 ASP A OD2 1 
ATOM   2685  N  N   . ASP A 1 352 ? -32.564 62.304  34.766  1.00 8.58  ? 352 ASP A N   1 
ATOM   2686  C  CA  . ASP A 1 352 ? -31.905 62.953  35.889  1.00 9.63  ? 352 ASP A CA  1 
ATOM   2687  C  C   . ASP A 1 352 ? -32.944 63.607  36.786  1.00 10.95 ? 352 ASP A C   1 
ATOM   2688  O  O   . ASP A 1 352 ? -32.657 63.961  37.929  1.00 10.56 ? 352 ASP A O   1 
ATOM   2689  C  CB  . ASP A 1 352 ? -30.942 64.035  35.381  1.00 10.99 ? 352 ASP A CB  1 
ATOM   2690  C  CG  . ASP A 1 352 ? -30.086 64.621  36.489  1.00 10.43 ? 352 ASP A CG  1 
ATOM   2691  O  OD1 . ASP A 1 352 ? -29.359 63.841  37.137  1.00 11.31 ? 352 ASP A OD1 1 
ATOM   2692  O  OD2 . ASP A 1 352 ? -30.135 65.851  36.713  1.00 10.14 ? 352 ASP A OD2 1 
ATOM   2693  N  N   . TYR A 1 353 ? -34.157 63.752  36.259  1.00 11.38 ? 353 TYR A N   1 
ATOM   2694  C  CA  . TYR A 1 353 ? -35.239 64.401  36.987  1.00 12.95 ? 353 TYR A CA  1 
ATOM   2695  C  C   . TYR A 1 353 ? -36.597 63.898  36.501  1.00 13.85 ? 353 TYR A C   1 
ATOM   2696  O  O   . TYR A 1 353 ? -36.842 63.834  35.296  1.00 13.41 ? 353 TYR A O   1 
ATOM   2697  C  CB  . TYR A 1 353 ? -35.149 65.913  36.762  1.00 12.84 ? 353 TYR A CB  1 
ATOM   2698  C  CG  . TYR A 1 353 ? -36.168 66.742  37.516  1.00 17.68 ? 353 TYR A CG  1 
ATOM   2699  C  CD1 . TYR A 1 353 ? -35.979 67.065  38.860  1.00 16.69 ? 353 TYR A CD1 1 
ATOM   2700  C  CD2 . TYR A 1 353 ? -37.312 67.222  36.879  1.00 19.10 ? 353 TYR A CD2 1 
ATOM   2701  C  CE1 . TYR A 1 353 ? -36.901 67.846  39.550  1.00 20.12 ? 353 TYR A CE1 1 
ATOM   2702  C  CE2 . TYR A 1 353 ? -38.245 68.003  37.560  1.00 20.89 ? 353 TYR A CE2 1 
ATOM   2703  C  CZ  . TYR A 1 353 ? -38.031 68.312  38.895  1.00 21.95 ? 353 TYR A CZ  1 
ATOM   2704  O  OH  . TYR A 1 353 ? -38.942 69.088  39.574  1.00 26.16 ? 353 TYR A OH  1 
ATOM   2705  N  N   . THR A 1 354 ? -37.466 63.538  37.442  1.00 13.70 ? 354 THR A N   1 
ATOM   2706  C  CA  . THR A 1 354 ? -38.813 63.062  37.125  1.00 14.02 ? 354 THR A CA  1 
ATOM   2707  C  C   . THR A 1 354 ? -39.784 63.686  38.127  1.00 16.25 ? 354 THR A C   1 
ATOM   2708  O  O   . THR A 1 354 ? -39.654 63.488  39.337  1.00 14.88 ? 354 THR A O   1 
ATOM   2709  C  CB  . THR A 1 354 ? -38.930 61.521  37.228  1.00 13.80 ? 354 THR A CB  1 
ATOM   2710  O  OG1 . THR A 1 354 ? -37.985 60.903  36.348  1.00 11.94 ? 354 THR A OG1 1 
ATOM   2711  C  CG2 . THR A 1 354 ? -40.330 61.065  36.836  1.00 12.79 ? 354 THR A CG2 1 
ATOM   2712  N  N   . GLU A 1 355 ? -40.752 64.448  37.630  1.00 16.98 ? 355 GLU A N   1 
ATOM   2713  C  CA  . GLU A 1 355 ? -41.712 65.083  38.520  1.00 18.49 ? 355 GLU A CA  1 
ATOM   2714  C  C   . GLU A 1 355 ? -42.844 64.160  38.934  1.00 16.49 ? 355 GLU A C   1 
ATOM   2715  O  O   . GLU A 1 355 ? -43.180 63.206  38.233  1.00 14.61 ? 355 GLU A O   1 
ATOM   2716  C  CB  . GLU A 1 355 ? -42.294 66.351  37.881  1.00 22.21 ? 355 GLU A CB  1 
ATOM   2717  C  CG  . GLU A 1 355 ? -41.735 67.632  38.498  1.00 30.51 ? 355 GLU A CG  1 
ATOM   2718  C  CD  . GLU A 1 355 ? -42.338 68.896  37.911  1.00 34.95 ? 355 GLU A CD  1 
ATOM   2719  O  OE1 . GLU A 1 355 ? -43.568 69.090  38.028  1.00 36.83 ? 355 GLU A OE1 1 
ATOM   2720  O  OE2 . GLU A 1 355 ? -41.574 69.702  37.333  1.00 37.43 ? 355 GLU A OE2 1 
ATOM   2721  N  N   . LYS A 1 356 ? -43.409 64.457  40.099  1.00 15.14 ? 356 LYS A N   1 
ATOM   2722  C  CA  . LYS A 1 356 ? -44.529 63.717  40.667  1.00 16.14 ? 356 LYS A CA  1 
ATOM   2723  C  C   . LYS A 1 356 ? -45.620 63.545  39.604  1.00 15.34 ? 356 LYS A C   1 
ATOM   2724  O  O   . LYS A 1 356 ? -45.951 64.491  38.896  1.00 15.88 ? 356 LYS A O   1 
ATOM   2725  C  CB  . LYS A 1 356 ? -45.070 64.504  41.865  1.00 17.26 ? 356 LYS A CB  1 
ATOM   2726  C  CG  . LYS A 1 356 ? -46.283 63.919  42.553  1.00 23.69 ? 356 LYS A CG  1 
ATOM   2727  C  CD  . LYS A 1 356 ? -46.756 64.870  43.648  1.00 27.24 ? 356 LYS A CD  1 
ATOM   2728  C  CE  . LYS A 1 356 ? -47.919 64.292  44.433  1.00 31.58 ? 356 LYS A CE  1 
ATOM   2729  N  NZ  . LYS A 1 356 ? -48.453 65.268  45.427  1.00 34.35 ? 356 LYS A NZ  1 
ATOM   2730  N  N   . ASP A 1 357 ? -46.177 62.340  39.499  1.00 15.23 ? 357 ASP A N   1 
ATOM   2731  C  CA  . ASP A 1 357 ? -47.221 62.054  38.517  1.00 15.98 ? 357 ASP A CA  1 
ATOM   2732  C  C   . ASP A 1 357 ? -48.021 60.836  38.962  1.00 16.08 ? 357 ASP A C   1 
ATOM   2733  O  O   . ASP A 1 357 ? -47.688 59.703  38.615  1.00 16.29 ? 357 ASP A O   1 
ATOM   2734  C  CB  . ASP A 1 357 ? -46.591 61.795  37.144  1.00 16.65 ? 357 ASP A CB  1 
ATOM   2735  C  CG  . ASP A 1 357 ? -47.626 61.541  36.060  1.00 18.36 ? 357 ASP A CG  1 
ATOM   2736  O  OD1 . ASP A 1 357 ? -48.838 61.592  36.358  1.00 16.72 ? 357 ASP A OD1 1 
ATOM   2737  O  OD2 . ASP A 1 357 ? -47.221 61.288  34.906  1.00 18.57 ? 357 ASP A OD2 1 
ATOM   2738  N  N   . ARG A 1 358 ? -49.082 61.077  39.724  1.00 15.48 ? 358 ARG A N   1 
ATOM   2739  C  CA  . ARG A 1 358 ? -49.912 59.993  40.241  1.00 16.08 ? 358 ARG A CA  1 
ATOM   2740  C  C   . ARG A 1 358 ? -50.611 59.124  39.194  1.00 16.14 ? 358 ARG A C   1 
ATOM   2741  O  O   . ARG A 1 358 ? -51.031 58.011  39.502  1.00 15.46 ? 358 ARG A O   1 
ATOM   2742  C  CB  . ARG A 1 358 ? -50.942 60.553  41.228  1.00 16.94 ? 358 ARG A CB  1 
ATOM   2743  C  CG  . ARG A 1 358 ? -50.335 61.032  42.543  1.00 17.93 ? 358 ARG A CG  1 
ATOM   2744  C  CD  . ARG A 1 358 ? -49.743 59.870  43.336  1.00 19.19 ? 358 ARG A CD  1 
ATOM   2745  N  NE  . ARG A 1 358 ? -50.769 59.006  43.921  1.00 19.29 ? 358 ARG A NE  1 
ATOM   2746  C  CZ  . ARG A 1 358 ? -51.487 59.315  44.999  1.00 21.49 ? 358 ARG A CZ  1 
ATOM   2747  N  NH1 . ARG A 1 358 ? -51.298 60.469  45.621  1.00 21.15 ? 358 ARG A NH1 1 
ATOM   2748  N  NH2 . ARG A 1 358 ? -52.399 58.465  45.460  1.00 22.91 ? 358 ARG A NH2 1 
ATOM   2749  N  N   . SER A 1 359 ? -50.737 59.615  37.963  1.00 15.35 ? 359 SER A N   1 
ATOM   2750  C  CA  . SER A 1 359 ? -51.386 58.823  36.923  1.00 16.00 ? 359 SER A CA  1 
ATOM   2751  C  C   . SER A 1 359 ? -50.443 57.719  36.453  1.00 17.34 ? 359 SER A C   1 
ATOM   2752  O  O   . SER A 1 359 ? -50.859 56.791  35.760  1.00 18.02 ? 359 SER A O   1 
ATOM   2753  C  CB  . SER A 1 359 ? -51.785 59.703  35.734  1.00 16.26 ? 359 SER A CB  1 
ATOM   2754  O  OG  . SER A 1 359 ? -50.647 60.159  35.026  1.00 18.05 ? 359 SER A OG  1 
ATOM   2755  N  N   . ARG A 1 360 ? -49.170 57.826  36.829  1.00 16.74 ? 360 ARG A N   1 
ATOM   2756  C  CA  . ARG A 1 360 ? -48.175 56.827  36.452  1.00 16.47 ? 360 ARG A CA  1 
ATOM   2757  C  C   . ARG A 1 360 ? -47.561 56.169  37.682  1.00 15.44 ? 360 ARG A C   1 
ATOM   2758  O  O   . ARG A 1 360 ? -46.564 55.457  37.580  1.00 16.34 ? 360 ARG A O   1 
ATOM   2759  C  CB  . ARG A 1 360 ? -47.064 57.452  35.596  1.00 16.40 ? 360 ARG A CB  1 
ATOM   2760  C  CG  . ARG A 1 360 ? -47.502 57.850  34.192  1.00 19.06 ? 360 ARG A CG  1 
ATOM   2761  C  CD  . ARG A 1 360 ? -46.296 58.114  33.291  1.00 21.73 ? 360 ARG A CD  1 
ATOM   2762  N  NE  . ARG A 1 360 ? -45.406 59.137  33.838  1.00 22.89 ? 360 ARG A NE  1 
ATOM   2763  C  CZ  . ARG A 1 360 ? -44.180 59.383  33.381  1.00 24.76 ? 360 ARG A CZ  1 
ATOM   2764  N  NH1 . ARG A 1 360 ? -43.693 58.681  32.365  1.00 23.01 ? 360 ARG A NH1 1 
ATOM   2765  N  NH2 . ARG A 1 360 ? -43.437 60.328  33.946  1.00 25.26 ? 360 ARG A NH2 1 
ATOM   2766  N  N   . GLY A 1 361 ? -48.154 56.418  38.845  1.00 15.17 ? 361 GLY A N   1 
ATOM   2767  C  CA  . GLY A 1 361 ? -47.654 55.822  40.071  1.00 13.25 ? 361 GLY A CA  1 
ATOM   2768  C  C   . GLY A 1 361 ? -46.413 56.464  40.662  1.00 13.48 ? 361 GLY A C   1 
ATOM   2769  O  O   . GLY A 1 361 ? -45.714 55.843  41.467  1.00 14.08 ? 361 GLY A O   1 
ATOM   2770  N  N   . ILE A 1 362 ? -46.130 57.702  40.270  1.00 11.11 ? 362 ILE A N   1 
ATOM   2771  C  CA  . ILE A 1 362 ? -44.967 58.421  40.788  1.00 11.19 ? 362 ILE A CA  1 
ATOM   2772  C  C   . ILE A 1 362 ? -45.460 59.382  41.868  1.00 11.43 ? 362 ILE A C   1 
ATOM   2773  O  O   . ILE A 1 362 ? -46.008 60.447  41.572  1.00 9.53  ? 362 ILE A O   1 
ATOM   2774  C  CB  . ILE A 1 362 ? -44.261 59.196  39.659  1.00 10.83 ? 362 ILE A CB  1 
ATOM   2775  C  CG1 . ILE A 1 362 ? -43.841 58.217  38.557  1.00 12.45 ? 362 ILE A CG1 1 
ATOM   2776  C  CG2 . ILE A 1 362 ? -43.035 59.926  40.207  1.00 11.11 ? 362 ILE A CG2 1 
ATOM   2777  C  CD1 . ILE A 1 362 ? -43.271 58.876  37.315  1.00 14.08 ? 362 ILE A CD1 1 
ATOM   2778  N  N   . TYR A 1 363 ? -45.261 58.988  43.122  1.00 10.44 ? 363 TYR A N   1 
ATOM   2779  C  CA  . TYR A 1 363 ? -45.718 59.761  44.272  1.00 10.57 ? 363 TYR A CA  1 
ATOM   2780  C  C   . TYR A 1 363 ? -44.863 60.953  44.669  1.00 10.31 ? 363 TYR A C   1 
ATOM   2781  O  O   . TYR A 1 363 ? -45.351 61.864  45.339  1.00 10.15 ? 363 TYR A O   1 
ATOM   2782  C  CB  . TYR A 1 363 ? -45.859 58.845  45.492  1.00 11.57 ? 363 TYR A CB  1 
ATOM   2783  C  CG  . TYR A 1 363 ? -46.959 57.813  45.382  1.00 11.50 ? 363 TYR A CG  1 
ATOM   2784  C  CD1 . TYR A 1 363 ? -46.863 56.750  44.485  1.00 11.60 ? 363 TYR A CD1 1 
ATOM   2785  C  CD2 . TYR A 1 363 ? -48.109 57.910  46.169  1.00 12.74 ? 363 TYR A CD2 1 
ATOM   2786  C  CE1 . TYR A 1 363 ? -47.888 55.810  44.368  1.00 11.57 ? 363 TYR A CE1 1 
ATOM   2787  C  CE2 . TYR A 1 363 ? -49.137 56.974  46.063  1.00 11.28 ? 363 TYR A CE2 1 
ATOM   2788  C  CZ  . TYR A 1 363 ? -49.019 55.928  45.161  1.00 12.62 ? 363 TYR A CZ  1 
ATOM   2789  O  OH  . TYR A 1 363 ? -50.029 54.999  45.050  1.00 13.78 ? 363 TYR A OH  1 
ATOM   2790  N  N   . PHE A 1 364 ? -43.595 60.949  44.271  1.00 8.19  ? 364 PHE A N   1 
ATOM   2791  C  CA  . PHE A 1 364 ? -42.689 62.038  44.634  1.00 9.56  ? 364 PHE A CA  1 
ATOM   2792  C  C   . PHE A 1 364 ? -41.832 62.480  43.463  1.00 10.02 ? 364 PHE A C   1 
ATOM   2793  O  O   . PHE A 1 364 ? -41.514 61.687  42.580  1.00 8.99  ? 364 PHE A O   1 
ATOM   2794  C  CB  . PHE A 1 364 ? -41.716 61.598  45.738  1.00 9.24  ? 364 PHE A CB  1 
ATOM   2795  C  CG  . PHE A 1 364 ? -42.372 61.057  46.975  1.00 8.99  ? 364 PHE A CG  1 
ATOM   2796  C  CD1 . PHE A 1 364 ? -43.014 61.903  47.874  1.00 10.34 ? 364 PHE A CD1 1 
ATOM   2797  C  CD2 . PHE A 1 364 ? -42.293 59.698  47.270  1.00 9.95  ? 364 PHE A CD2 1 
ATOM   2798  C  CE1 . PHE A 1 364 ? -43.570 61.404  49.056  1.00 8.70  ? 364 PHE A CE1 1 
ATOM   2799  C  CE2 . PHE A 1 364 ? -42.844 59.186  48.446  1.00 9.77  ? 364 PHE A CE2 1 
ATOM   2800  C  CZ  . PHE A 1 364 ? -43.482 60.043  49.342  1.00 9.76  ? 364 PHE A CZ  1 
ATOM   2801  N  N   . THR A 1 365 ? -41.446 63.750  43.471  1.00 9.75  ? 365 THR A N   1 
ATOM   2802  C  CA  . THR A 1 365 ? -40.556 64.256  42.440  1.00 9.18  ? 365 THR A CA  1 
ATOM   2803  C  C   . THR A 1 365 ? -39.192 63.703  42.859  1.00 9.19  ? 365 THR A C   1 
ATOM   2804  O  O   . THR A 1 365 ? -38.849 63.730  44.040  1.00 8.59  ? 365 THR A O   1 
ATOM   2805  C  CB  . THR A 1 365 ? -40.523 65.790  42.443  1.00 9.47  ? 365 THR A CB  1 
ATOM   2806  O  OG1 . THR A 1 365 ? -41.759 66.286  41.912  1.00 9.39  ? 365 THR A OG1 1 
ATOM   2807  C  CG2 . THR A 1 365 ? -39.350 66.307  41.611  1.00 8.84  ? 365 THR A CG2 1 
ATOM   2808  N  N   . GLN A 1 366 ? -38.428 63.194  41.899  1.00 7.10  ? 366 GLN A N   1 
ATOM   2809  C  CA  . GLN A 1 366 ? -37.124 62.604  42.186  1.00 7.40  ? 366 GLN A CA  1 
ATOM   2810  C  C   . GLN A 1 366 ? -36.006 63.186  41.327  1.00 8.39  ? 366 GLN A C   1 
ATOM   2811  O  O   . GLN A 1 366 ? -36.126 63.238  40.101  1.00 10.01 ? 366 GLN A O   1 
ATOM   2812  C  CB  . GLN A 1 366 ? -37.199 61.092  41.953  1.00 5.73  ? 366 GLN A CB  1 
ATOM   2813  C  CG  . GLN A 1 366 ? -35.906 60.332  42.212  1.00 6.98  ? 366 GLN A CG  1 
ATOM   2814  C  CD  . GLN A 1 366 ? -35.535 60.291  43.680  1.00 6.54  ? 366 GLN A CD  1 
ATOM   2815  O  OE1 . GLN A 1 366 ? -36.280 59.765  44.508  1.00 7.93  ? 366 GLN A OE1 1 
ATOM   2816  N  NE2 . GLN A 1 366 ? -34.375 60.849  44.011  1.00 10.14 ? 366 GLN A NE2 1 
ATOM   2817  N  N   . SER A 1 367 ? -34.925 63.623  41.975  1.00 8.98  ? 367 SER A N   1 
ATOM   2818  C  CA  . SER A 1 367 ? -33.755 64.173  41.279  1.00 9.28  ? 367 SER A CA  1 
ATOM   2819  C  C   . SER A 1 367 ? -32.576 63.225  41.496  1.00 8.86  ? 367 SER A C   1 
ATOM   2820  O  O   . SER A 1 367 ? -32.465 62.600  42.552  1.00 7.30  ? 367 SER A O   1 
ATOM   2821  C  CB  . SER A 1 367 ? -33.385 65.561  41.822  1.00 12.41 ? 367 SER A CB  1 
ATOM   2822  O  OG  . SER A 1 367 ? -34.363 66.527  41.479  1.00 18.32 ? 367 SER A OG  1 
ATOM   2823  N  N   . TRP A 1 368 ? -31.686 63.134  40.508  1.00 7.66  ? 368 TRP A N   1 
ATOM   2824  C  CA  . TRP A 1 368 ? -30.539 62.233  40.608  1.00 7.80  ? 368 TRP A CA  1 
ATOM   2825  C  C   . TRP A 1 368 ? -29.154 62.881  40.618  1.00 7.93  ? 368 TRP A C   1 
ATOM   2826  O  O   . TRP A 1 368 ? -28.145 62.178  40.725  1.00 8.83  ? 368 TRP A O   1 
ATOM   2827  C  CB  . TRP A 1 368 ? -30.596 61.202  39.478  1.00 6.91  ? 368 TRP A CB  1 
ATOM   2828  C  CG  . TRP A 1 368 ? -31.771 60.284  39.575  1.00 8.91  ? 368 TRP A CG  1 
ATOM   2829  C  CD1 . TRP A 1 368 ? -32.980 60.422  38.955  1.00 8.66  ? 368 TRP A CD1 1 
ATOM   2830  C  CD2 . TRP A 1 368 ? -31.862 59.099  40.371  1.00 10.04 ? 368 TRP A CD2 1 
ATOM   2831  N  NE1 . TRP A 1 368 ? -33.818 59.393  39.315  1.00 9.34  ? 368 TRP A NE1 1 
ATOM   2832  C  CE2 . TRP A 1 368 ? -33.156 58.567  40.184  1.00 9.82  ? 368 TRP A CE2 1 
ATOM   2833  C  CE3 . TRP A 1 368 ? -30.972 58.436  41.227  1.00 10.56 ? 368 TRP A CE3 1 
ATOM   2834  C  CZ2 . TRP A 1 368 ? -33.585 57.397  40.822  1.00 9.54  ? 368 TRP A CZ2 1 
ATOM   2835  C  CZ3 . TRP A 1 368 ? -31.397 57.274  41.862  1.00 10.12 ? 368 TRP A CZ3 1 
ATOM   2836  C  CH2 . TRP A 1 368 ? -32.693 56.768  41.654  1.00 12.08 ? 368 TRP A CH2 1 
ATOM   2837  N  N   . VAL A 1 369 ? -29.102 64.206  40.520  1.00 7.80  ? 369 VAL A N   1 
ATOM   2838  C  CA  . VAL A 1 369 ? -27.836 64.941  40.504  1.00 8.90  ? 369 VAL A CA  1 
ATOM   2839  C  C   . VAL A 1 369 ? -26.738 64.261  39.678  1.00 9.88  ? 369 VAL A C   1 
ATOM   2840  O  O   . VAL A 1 369 ? -25.644 63.968  40.166  1.00 11.27 ? 369 VAL A O   1 
ATOM   2841  C  CB  . VAL A 1 369 ? -27.310 65.233  41.949  1.00 9.70  ? 369 VAL A CB  1 
ATOM   2842  C  CG1 . VAL A 1 369 ? -28.137 66.350  42.579  1.00 7.94  ? 369 VAL A CG1 1 
ATOM   2843  C  CG2 . VAL A 1 369 ? -27.376 63.983  42.815  1.00 10.03 ? 369 VAL A CG2 1 
ATOM   2844  N  N   . SER A 1 370 ? -27.061 64.010  38.414  1.00 10.48 ? 370 SER A N   1 
ATOM   2845  C  CA  . SER A 1 370 ? -26.147 63.404  37.449  1.00 10.28 ? 370 SER A CA  1 
ATOM   2846  C  C   . SER A 1 370 ? -25.677 61.974  37.672  1.00 10.52 ? 370 SER A C   1 
ATOM   2847  O  O   . SER A 1 370 ? -24.643 61.574  37.134  1.00 10.68 ? 370 SER A O   1 
ATOM   2848  C  CB  . SER A 1 370 ? -24.937 64.318  37.248  1.00 9.66  ? 370 SER A CB  1 
ATOM   2849  O  OG  . SER A 1 370 ? -25.359 65.531  36.649  1.00 11.34 ? 370 SER A OG  1 
ATOM   2850  N  N   . THR A 1 371 ? -26.427 61.211  38.460  1.00 10.95 ? 371 THR A N   1 
ATOM   2851  C  CA  . THR A 1 371 ? -26.089 59.814  38.663  1.00 10.78 ? 371 THR A CA  1 
ATOM   2852  C  C   . THR A 1 371 ? -26.425 59.247  37.282  1.00 10.36 ? 371 THR A C   1 
ATOM   2853  O  O   . THR A 1 371 ? -27.483 59.564  36.720  1.00 11.02 ? 371 THR A O   1 
ATOM   2854  C  CB  . THR A 1 371 ? -26.989 59.149  39.724  1.00 12.19 ? 371 THR A CB  1 
ATOM   2855  O  OG1 . THR A 1 371 ? -26.770 59.801  40.975  1.00 12.95 ? 371 THR A OG1 1 
ATOM   2856  C  CG2 . THR A 1 371 ? -26.670 57.655  39.866  1.00 10.62 ? 371 THR A CG2 1 
ATOM   2857  N  N   . PRO A 1 372 ? -25.530 58.421  36.696  1.00 10.39 ? 372 PRO A N   1 
ATOM   2858  C  CA  . PRO A 1 372 ? -25.808 57.855  35.366  1.00 10.48 ? 372 PRO A CA  1 
ATOM   2859  C  C   . PRO A 1 372 ? -27.138 57.105  35.259  1.00 9.74  ? 372 PRO A C   1 
ATOM   2860  O  O   . PRO A 1 372 ? -27.637 56.558  36.244  1.00 11.12 ? 372 PRO A O   1 
ATOM   2861  C  CB  . PRO A 1 372 ? -24.648 56.888  35.142  1.00 10.19 ? 372 PRO A CB  1 
ATOM   2862  C  CG  . PRO A 1 372 ? -23.484 57.488  35.947  1.00 11.36 ? 372 PRO A CG  1 
ATOM   2863  C  CD  . PRO A 1 372 ? -24.265 57.868  37.226  1.00 11.49 ? 372 PRO A CD  1 
ATOM   2864  N  N   . GLY A 1 373 ? -27.713 57.109  34.058  1.00 10.64 ? 373 GLY A N   1 
ATOM   2865  C  CA  . GLY A 1 373 ? -28.964 56.406  33.832  1.00 8.47  ? 373 GLY A CA  1 
ATOM   2866  C  C   . GLY A 1 373 ? -28.686 54.924  33.614  1.00 9.18  ? 373 GLY A C   1 
ATOM   2867  O  O   . GLY A 1 373 ? -27.557 54.519  33.302  1.00 9.50  ? 373 GLY A O   1 
ATOM   2868  N  N   . VAL A 1 374 ? -29.718 54.106  33.796  1.00 8.60  ? 374 VAL A N   1 
ATOM   2869  C  CA  . VAL A 1 374 ? -29.620 52.658  33.624  1.00 9.59  ? 374 VAL A CA  1 
ATOM   2870  C  C   . VAL A 1 374 ? -30.444 52.250  32.401  1.00 9.52  ? 374 VAL A C   1 
ATOM   2871  O  O   . VAL A 1 374 ? -31.555 52.747  32.213  1.00 11.13 ? 374 VAL A O   1 
ATOM   2872  C  CB  . VAL A 1 374 ? -30.184 51.926  34.869  1.00 11.46 ? 374 VAL A CB  1 
ATOM   2873  C  CG1 . VAL A 1 374 ? -30.087 50.420  34.694  1.00 10.78 ? 374 VAL A CG1 1 
ATOM   2874  C  CG2 . VAL A 1 374 ? -29.430 52.372  36.109  1.00 11.61 ? 374 VAL A CG2 1 
ATOM   2875  N  N   . LEU A 1 375 ? -29.897 51.366  31.569  1.00 8.79  ? 375 LEU A N   1 
ATOM   2876  C  CA  . LEU A 1 375 ? -30.610 50.890  30.382  1.00 8.76  ? 375 LEU A CA  1 
ATOM   2877  C  C   . LEU A 1 375 ? -31.699 49.876  30.738  1.00 8.45  ? 375 LEU A C   1 
ATOM   2878  O  O   . LEU A 1 375 ? -31.416 48.839  31.337  1.00 8.36  ? 375 LEU A O   1 
ATOM   2879  C  CB  . LEU A 1 375 ? -29.651 50.210  29.398  1.00 9.36  ? 375 LEU A CB  1 
ATOM   2880  C  CG  . LEU A 1 375 ? -28.900 51.017  28.341  1.00 13.21 ? 375 LEU A CG  1 
ATOM   2881  C  CD1 . LEU A 1 375 ? -28.027 50.071  27.528  1.00 11.80 ? 375 LEU A CD1 1 
ATOM   2882  C  CD2 . LEU A 1 375 ? -29.896 51.745  27.434  1.00 11.94 ? 375 LEU A CD2 1 
ATOM   2883  N  N   . PRO A 1 376 ? -32.962 50.167  30.383  1.00 6.86  ? 376 PRO A N   1 
ATOM   2884  C  CA  . PRO A 1 376 ? -34.041 49.221  30.689  1.00 7.41  ? 376 PRO A CA  1 
ATOM   2885  C  C   . PRO A 1 376 ? -33.981 48.072  29.688  1.00 8.30  ? 376 PRO A C   1 
ATOM   2886  O  O   . PRO A 1 376 ? -33.670 48.278  28.511  1.00 9.33  ? 376 PRO A O   1 
ATOM   2887  C  CB  . PRO A 1 376 ? -35.303 50.071  30.535  1.00 6.87  ? 376 PRO A CB  1 
ATOM   2888  C  CG  . PRO A 1 376 ? -34.921 51.041  29.462  1.00 8.30  ? 376 PRO A CG  1 
ATOM   2889  C  CD  . PRO A 1 376 ? -33.508 51.434  29.867  1.00 7.74  ? 376 PRO A CD  1 
ATOM   2890  N  N   . VAL A 1 377 ? -34.266 46.862  30.155  1.00 9.27  ? 377 VAL A N   1 
ATOM   2891  C  CA  . VAL A 1 377 ? -34.220 45.687  29.297  1.00 7.98  ? 377 VAL A CA  1 
ATOM   2892  C  C   . VAL A 1 377 ? -35.581 45.002  29.237  1.00 9.23  ? 377 VAL A C   1 
ATOM   2893  O  O   . VAL A 1 377 ? -36.098 44.538  30.253  1.00 9.03  ? 377 VAL A O   1 
ATOM   2894  C  CB  . VAL A 1 377 ? -33.161 44.684  29.812  1.00 10.22 ? 377 VAL A CB  1 
ATOM   2895  C  CG1 . VAL A 1 377 ? -33.141 43.435  28.941  1.00 9.78  ? 377 VAL A CG1 1 
ATOM   2896  C  CG2 . VAL A 1 377 ? -31.790 45.347  29.824  1.00 9.45  ? 377 VAL A CG2 1 
ATOM   2897  N  N   . ALA A 1 378 ? -36.164 44.968  28.042  1.00 7.22  ? 378 ALA A N   1 
ATOM   2898  C  CA  . ALA A 1 378 ? -37.462 44.336  27.831  1.00 7.76  ? 378 ALA A CA  1 
ATOM   2899  C  C   . ALA A 1 378 ? -37.197 42.899  27.396  1.00 8.12  ? 378 ALA A C   1 
ATOM   2900  O  O   . ALA A 1 378 ? -36.553 42.660  26.374  1.00 9.44  ? 378 ALA A O   1 
ATOM   2901  C  CB  . ALA A 1 378 ? -38.247 45.092  26.753  1.00 8.08  ? 378 ALA A CB  1 
ATOM   2902  N  N   . SER A 1 379 ? -37.699 41.942  28.167  1.00 7.90  ? 379 SER A N   1 
ATOM   2903  C  CA  . SER A 1 379 ? -37.460 40.540  27.861  1.00 6.79  ? 379 SER A CA  1 
ATOM   2904  C  C   . SER A 1 379 ? -38.555 39.622  28.388  1.00 6.05  ? 379 SER A C   1 
ATOM   2905  O  O   . SER A 1 379 ? -39.143 39.885  29.435  1.00 4.93  ? 379 SER A O   1 
ATOM   2906  C  CB  . SER A 1 379 ? -36.106 40.132  28.461  1.00 5.91  ? 379 SER A CB  1 
ATOM   2907  O  OG  . SER A 1 379 ? -35.865 38.739  28.350  1.00 8.48  ? 379 SER A OG  1 
ATOM   2908  N  N   . GLY A 1 380 ? -38.837 38.552  27.652  1.00 6.39  ? 380 GLY A N   1 
ATOM   2909  C  CA  . GLY A 1 380 ? -39.837 37.603  28.105  1.00 6.31  ? 380 GLY A CA  1 
ATOM   2910  C  C   . GLY A 1 380 ? -41.069 37.386  27.251  1.00 8.54  ? 380 GLY A C   1 
ATOM   2911  O  O   . GLY A 1 380 ? -42.037 38.136  27.344  1.00 7.32  ? 380 GLY A O   1 
ATOM   2912  N  N   . GLY A 1 381 ? -41.037 36.346  26.425  1.00 8.51  ? 381 GLY A N   1 
ATOM   2913  C  CA  . GLY A 1 381 ? -42.179 36.030  25.588  1.00 8.93  ? 381 GLY A CA  1 
ATOM   2914  C  C   . GLY A 1 381 ? -42.516 37.015  24.484  1.00 10.69 ? 381 GLY A C   1 
ATOM   2915  O  O   . GLY A 1 381 ? -43.683 37.146  24.112  1.00 11.35 ? 381 GLY A O   1 
ATOM   2916  N  N   . ILE A 1 382 ? -41.513 37.711  23.956  1.00 9.93  ? 382 ILE A N   1 
ATOM   2917  C  CA  . ILE A 1 382 ? -41.759 38.654  22.872  1.00 8.37  ? 382 ILE A CA  1 
ATOM   2918  C  C   . ILE A 1 382 ? -41.195 38.110  21.565  1.00 9.10  ? 382 ILE A C   1 
ATOM   2919  O  O   . ILE A 1 382 ? -40.285 37.281  21.566  1.00 8.74  ? 382 ILE A O   1 
ATOM   2920  C  CB  . ILE A 1 382 ? -41.146 40.039  23.168  1.00 8.90  ? 382 ILE A CB  1 
ATOM   2921  C  CG1 . ILE A 1 382 ? -39.683 39.890  23.605  1.00 7.84  ? 382 ILE A CG1 1 
ATOM   2922  C  CG2 . ILE A 1 382 ? -41.986 40.747  24.220  1.00 8.56  ? 382 ILE A CG2 1 
ATOM   2923  C  CD1 . ILE A 1 382 ? -38.960 41.211  23.815  1.00 8.27  ? 382 ILE A CD1 1 
ATOM   2924  N  N   . HIS A 1 383 ? -41.754 38.567  20.451  1.00 9.34  ? 383 HIS A N   1 
ATOM   2925  C  CA  . HIS A 1 383 ? -41.313 38.119  19.138  1.00 9.74  ? 383 HIS A CA  1 
ATOM   2926  C  C   . HIS A 1 383 ? -41.417 39.245  18.118  1.00 9.72  ? 383 HIS A C   1 
ATOM   2927  O  O   . HIS A 1 383 ? -41.855 40.346  18.443  1.00 8.79  ? 383 HIS A O   1 
ATOM   2928  C  CB  . HIS A 1 383 ? -42.123 36.888  18.690  1.00 9.27  ? 383 HIS A CB  1 
ATOM   2929  C  CG  . HIS A 1 383 ? -43.608 37.064  18.778  1.00 11.63 ? 383 HIS A CG  1 
ATOM   2930  N  ND1 . HIS A 1 383 ? -44.313 37.883  17.923  1.00 12.75 ? 383 HIS A ND1 1 
ATOM   2931  C  CD2 . HIS A 1 383 ? -44.521 36.523  19.619  1.00 10.35 ? 383 HIS A CD2 1 
ATOM   2932  C  CE1 . HIS A 1 383 ? -45.599 37.840  18.234  1.00 12.88 ? 383 HIS A CE1 1 
ATOM   2933  N  NE2 . HIS A 1 383 ? -45.750 37.022  19.262  1.00 11.35 ? 383 HIS A NE2 1 
ATOM   2934  N  N   . VAL A 1 384 ? -41.016 38.961  16.884  1.00 9.02  ? 384 VAL A N   1 
ATOM   2935  C  CA  . VAL A 1 384 ? -41.019 39.961  15.825  1.00 8.90  ? 384 VAL A CA  1 
ATOM   2936  C  C   . VAL A 1 384 ? -42.253 40.855  15.695  1.00 8.77  ? 384 VAL A C   1 
ATOM   2937  O  O   . VAL A 1 384 ? -42.109 42.052  15.457  1.00 7.75  ? 384 VAL A O   1 
ATOM   2938  C  CB  . VAL A 1 384 ? -40.734 39.311  14.457  1.00 8.83  ? 384 VAL A CB  1 
ATOM   2939  C  CG1 . VAL A 1 384 ? -39.265 38.907  14.373  1.00 9.61  ? 384 VAL A CG1 1 
ATOM   2940  C  CG2 . VAL A 1 384 ? -41.636 38.103  14.256  1.00 7.72  ? 384 VAL A CG2 1 
ATOM   2941  N  N   . TRP A 1 385 ? -43.455 40.298  15.850  1.00 9.45  ? 385 TRP A N   1 
ATOM   2942  C  CA  . TRP A 1 385 ? -44.665 41.110  15.720  1.00 9.97  ? 385 TRP A CA  1 
ATOM   2943  C  C   . TRP A 1 385 ? -44.798 42.162  16.823  1.00 11.06 ? 385 TRP A C   1 
ATOM   2944  O  O   . TRP A 1 385 ? -45.559 43.123  16.682  1.00 11.70 ? 385 TRP A O   1 
ATOM   2945  C  CB  . TRP A 1 385 ? -45.921 40.224  15.699  1.00 10.13 ? 385 TRP A CB  1 
ATOM   2946  C  CG  . TRP A 1 385 ? -46.064 39.366  14.458  1.00 10.61 ? 385 TRP A CG  1 
ATOM   2947  C  CD1 . TRP A 1 385 ? -45.849 38.018  14.360  1.00 12.07 ? 385 TRP A CD1 1 
ATOM   2948  C  CD2 . TRP A 1 385 ? -46.446 39.806  13.147  1.00 12.15 ? 385 TRP A CD2 1 
ATOM   2949  N  NE1 . TRP A 1 385 ? -46.073 37.592  13.071  1.00 12.37 ? 385 TRP A NE1 1 
ATOM   2950  C  CE2 . TRP A 1 385 ? -46.437 38.667  12.306  1.00 12.89 ? 385 TRP A CE2 1 
ATOM   2951  C  CE3 . TRP A 1 385 ? -46.789 41.049  12.599  1.00 12.09 ? 385 TRP A CE3 1 
ATOM   2952  C  CZ2 . TRP A 1 385 ? -46.764 38.738  10.945  1.00 12.30 ? 385 TRP A CZ2 1 
ATOM   2953  C  CZ3 . TRP A 1 385 ? -47.114 41.118  11.242  1.00 13.22 ? 385 TRP A CZ3 1 
ATOM   2954  C  CH2 . TRP A 1 385 ? -47.096 39.967  10.434  1.00 12.52 ? 385 TRP A CH2 1 
ATOM   2955  N  N   . HIS A 1 386 ? -44.062 41.983  17.917  1.00 10.21 ? 386 HIS A N   1 
ATOM   2956  C  CA  . HIS A 1 386 ? -44.097 42.929  19.033  1.00 9.83  ? 386 HIS A CA  1 
ATOM   2957  C  C   . HIS A 1 386 ? -43.110 44.081  18.823  1.00 9.33  ? 386 HIS A C   1 
ATOM   2958  O  O   . HIS A 1 386 ? -43.167 45.086  19.527  1.00 8.74  ? 386 HIS A O   1 
ATOM   2959  C  CB  . HIS A 1 386 ? -43.717 42.230  20.344  1.00 9.39  ? 386 HIS A CB  1 
ATOM   2960  C  CG  . HIS A 1 386 ? -44.714 41.219  20.817  1.00 10.70 ? 386 HIS A CG  1 
ATOM   2961  N  ND1 . HIS A 1 386 ? -44.337 40.002  21.348  1.00 10.36 ? 386 HIS A ND1 1 
ATOM   2962  C  CD2 . HIS A 1 386 ? -46.065 41.262  20.900  1.00 10.71 ? 386 HIS A CD2 1 
ATOM   2963  C  CE1 . HIS A 1 386 ? -45.415 39.342  21.737  1.00 11.87 ? 386 HIS A CE1 1 
ATOM   2964  N  NE2 . HIS A 1 386 ? -46.474 40.084  21.477  1.00 11.65 ? 386 HIS A NE2 1 
ATOM   2965  N  N   . MET A 1 387 ? -42.213 43.938  17.853  1.00 9.04  ? 387 MET A N   1 
ATOM   2966  C  CA  . MET A 1 387 ? -41.184 44.948  17.612  1.00 10.86 ? 387 MET A CA  1 
ATOM   2967  C  C   . MET A 1 387 ? -41.642 46.406  17.527  1.00 10.53 ? 387 MET A C   1 
ATOM   2968  O  O   . MET A 1 387 ? -41.041 47.275  18.160  1.00 12.26 ? 387 MET A O   1 
ATOM   2969  C  CB  . MET A 1 387 ? -40.363 44.587  16.367  1.00 10.68 ? 387 MET A CB  1 
ATOM   2970  C  CG  . MET A 1 387 ? -38.926 45.113  16.394  1.00 10.25 ? 387 MET A CG  1 
ATOM   2971  S  SD  . MET A 1 387 ? -37.906 44.409  17.732  1.00 12.36 ? 387 MET A SD  1 
ATOM   2972  C  CE  . MET A 1 387 ? -37.519 42.797  17.058  1.00 12.34 ? 387 MET A CE  1 
ATOM   2973  N  N   . PRO A 1 388 ? -42.694 46.703  16.741  1.00 11.73 ? 388 PRO A N   1 
ATOM   2974  C  CA  . PRO A 1 388 ? -43.150 48.096  16.645  1.00 10.86 ? 388 PRO A CA  1 
ATOM   2975  C  C   . PRO A 1 388 ? -43.588 48.667  17.995  1.00 10.56 ? 388 PRO A C   1 
ATOM   2976  O  O   . PRO A 1 388 ? -43.207 49.779  18.363  1.00 11.13 ? 388 PRO A O   1 
ATOM   2977  C  CB  . PRO A 1 388 ? -44.310 48.013  15.652  1.00 12.95 ? 388 PRO A CB  1 
ATOM   2978  C  CG  . PRO A 1 388 ? -43.932 46.855  14.787  1.00 12.27 ? 388 PRO A CG  1 
ATOM   2979  C  CD  . PRO A 1 388 ? -43.435 45.848  15.798  1.00 12.54 ? 388 PRO A CD  1 
ATOM   2980  N  N   . ALA A 1 389 ? -44.393 47.904  18.727  1.00 9.86  ? 389 ALA A N   1 
ATOM   2981  C  CA  . ALA A 1 389 ? -44.871 48.334  20.038  1.00 10.21 ? 389 ALA A CA  1 
ATOM   2982  C  C   . ALA A 1 389 ? -43.711 48.553  21.012  1.00 9.68  ? 389 ALA A C   1 
ATOM   2983  O  O   . ALA A 1 389 ? -43.678 49.547  21.734  1.00 10.31 ? 389 ALA A O   1 
ATOM   2984  C  CB  . ALA A 1 389 ? -45.847 47.300  20.607  1.00 8.12  ? 389 ALA A CB  1 
ATOM   2985  N  N   . LEU A 1 390 ? -42.757 47.624  21.028  1.00 9.47  ? 390 LEU A N   1 
ATOM   2986  C  CA  . LEU A 1 390 ? -41.606 47.734  21.919  1.00 9.82  ? 390 LEU A CA  1 
ATOM   2987  C  C   . LEU A 1 390 ? -40.781 48.978  21.613  1.00 10.07 ? 390 LEU A C   1 
ATOM   2988  O  O   . LEU A 1 390 ? -40.377 49.706  22.518  1.00 10.37 ? 390 LEU A O   1 
ATOM   2989  C  CB  . LEU A 1 390 ? -40.720 46.495  21.790  1.00 8.72  ? 390 LEU A CB  1 
ATOM   2990  C  CG  . LEU A 1 390 ? -41.330 45.180  22.276  1.00 9.92  ? 390 LEU A CG  1 
ATOM   2991  C  CD1 . LEU A 1 390 ? -40.459 44.007  21.831  1.00 9.57  ? 390 LEU A CD1 1 
ATOM   2992  C  CD2 . LEU A 1 390 ? -41.471 45.221  23.791  1.00 8.32  ? 390 LEU A CD2 1 
ATOM   2993  N  N   . THR A 1 391 ? -40.529 49.215  20.331  1.00 10.76 ? 391 THR A N   1 
ATOM   2994  C  CA  . THR A 1 391 ? -39.749 50.371  19.905  1.00 11.69 ? 391 THR A CA  1 
ATOM   2995  C  C   . THR A 1 391 ? -40.474 51.661  20.283  1.00 12.74 ? 391 THR A C   1 
ATOM   2996  O  O   . THR A 1 391 ? -39.863 52.635  20.724  1.00 11.41 ? 391 THR A O   1 
ATOM   2997  C  CB  . THR A 1 391 ? -39.522 50.339  18.376  1.00 12.12 ? 391 THR A CB  1 
ATOM   2998  O  OG1 . THR A 1 391 ? -38.831 49.135  18.030  1.00 15.04 ? 391 THR A OG1 1 
ATOM   2999  C  CG2 . THR A 1 391 ? -38.702 51.539  17.918  1.00 10.97 ? 391 THR A CG2 1 
ATOM   3000  N  N   . GLU A 1 392 ? -41.790 51.647  20.125  1.00 13.67 ? 392 GLU A N   1 
ATOM   3001  C  CA  . GLU A 1 392 ? -42.615 52.806  20.434  1.00 15.69 ? 392 GLU A CA  1 
ATOM   3002  C  C   . GLU A 1 392 ? -42.633 53.102  21.933  1.00 14.45 ? 392 GLU A C   1 
ATOM   3003  O  O   . GLU A 1 392 ? -42.524 54.253  22.347  1.00 13.41 ? 392 GLU A O   1 
ATOM   3004  C  CB  . GLU A 1 392 ? -44.036 52.561  19.911  1.00 19.51 ? 392 GLU A CB  1 
ATOM   3005  C  CG  . GLU A 1 392 ? -44.942 53.775  19.912  1.00 26.41 ? 392 GLU A CG  1 
ATOM   3006  C  CD  . GLU A 1 392 ? -45.796 53.861  21.155  1.00 30.48 ? 392 GLU A CD  1 
ATOM   3007  O  OE1 . GLU A 1 392 ? -46.461 52.855  21.484  1.00 32.27 ? 392 GLU A OE1 1 
ATOM   3008  O  OE2 . GLU A 1 392 ? -45.810 54.933  21.795  1.00 34.68 ? 392 GLU A OE2 1 
ATOM   3009  N  N   . ILE A 1 393 ? -42.755 52.057  22.744  1.00 13.24 ? 393 ILE A N   1 
ATOM   3010  C  CA  . ILE A 1 393 ? -42.796 52.212  24.198  1.00 13.18 ? 393 ILE A CA  1 
ATOM   3011  C  C   . ILE A 1 393 ? -41.467 52.631  24.830  1.00 12.84 ? 393 ILE A C   1 
ATOM   3012  O  O   . ILE A 1 393 ? -41.404 53.606  25.586  1.00 12.19 ? 393 ILE A O   1 
ATOM   3013  C  CB  . ILE A 1 393 ? -43.244 50.892  24.884  1.00 12.41 ? 393 ILE A CB  1 
ATOM   3014  C  CG1 . ILE A 1 393 ? -44.708 50.598  24.553  1.00 13.84 ? 393 ILE A CG1 1 
ATOM   3015  C  CG2 . ILE A 1 393 ? -43.054 50.987  26.397  1.00 15.02 ? 393 ILE A CG2 1 
ATOM   3016  C  CD1 . ILE A 1 393 ? -45.180 49.237  25.033  1.00 14.72 ? 393 ILE A CD1 1 
ATOM   3017  N  N   . PHE A 1 394 ? -40.408 51.892  24.514  1.00 11.93 ? 394 PHE A N   1 
ATOM   3018  C  CA  . PHE A 1 394 ? -39.101 52.144  25.105  1.00 11.47 ? 394 PHE A CA  1 
ATOM   3019  C  C   . PHE A 1 394 ? -38.163 53.143  24.431  1.00 11.23 ? 394 PHE A C   1 
ATOM   3020  O  O   . PHE A 1 394 ? -37.329 53.755  25.100  1.00 12.54 ? 394 PHE A O   1 
ATOM   3021  C  CB  . PHE A 1 394 ? -38.386 50.804  25.287  1.00 10.79 ? 394 PHE A CB  1 
ATOM   3022  C  CG  . PHE A 1 394 ? -39.100 49.865  26.220  1.00 8.62  ? 394 PHE A CG  1 
ATOM   3023  C  CD1 . PHE A 1 394 ? -39.022 50.039  27.598  1.00 10.88 ? 394 PHE A CD1 1 
ATOM   3024  C  CD2 . PHE A 1 394 ? -39.877 48.824  25.721  1.00 8.92  ? 394 PHE A CD2 1 
ATOM   3025  C  CE1 . PHE A 1 394 ? -39.712 49.191  28.468  1.00 11.67 ? 394 PHE A CE1 1 
ATOM   3026  C  CE2 . PHE A 1 394 ? -40.571 47.972  26.578  1.00 8.89  ? 394 PHE A CE2 1 
ATOM   3027  C  CZ  . PHE A 1 394 ? -40.488 48.155  27.958  1.00 11.56 ? 394 PHE A CZ  1 
ATOM   3028  N  N   . GLY A 1 395 ? -38.283 53.321  23.121  1.00 11.82 ? 395 GLY A N   1 
ATOM   3029  C  CA  . GLY A 1 395 ? -37.389 54.249  22.448  1.00 10.55 ? 395 GLY A CA  1 
ATOM   3030  C  C   . GLY A 1 395 ? -36.024 53.617  22.215  1.00 10.46 ? 395 GLY A C   1 
ATOM   3031  O  O   . GLY A 1 395 ? -35.852 52.419  22.447  1.00 11.62 ? 395 GLY A O   1 
ATOM   3032  N  N   . ASP A 1 396 ? -35.051 54.411  21.767  1.00 9.89  ? 396 ASP A N   1 
ATOM   3033  C  CA  . ASP A 1 396 ? -33.707 53.898  21.482  1.00 10.37 ? 396 ASP A CA  1 
ATOM   3034  C  C   . ASP A 1 396 ? -32.917 53.369  22.669  1.00 10.26 ? 396 ASP A C   1 
ATOM   3035  O  O   . ASP A 1 396 ? -32.183 52.392  22.537  1.00 10.94 ? 396 ASP A O   1 
ATOM   3036  C  CB  . ASP A 1 396 ? -32.845 54.963  20.800  1.00 11.62 ? 396 ASP A CB  1 
ATOM   3037  C  CG  . ASP A 1 396 ? -33.268 55.234  19.377  1.00 13.41 ? 396 ASP A CG  1 
ATOM   3038  O  OD1 . ASP A 1 396 ? -33.872 54.343  18.749  1.00 12.70 ? 396 ASP A OD1 1 
ATOM   3039  O  OD2 . ASP A 1 396 ? -32.977 56.340  18.882  1.00 16.76 ? 396 ASP A OD2 1 
ATOM   3040  N  N   . ASP A 1 397 ? -33.046 54.015  23.821  1.00 10.07 ? 397 ASP A N   1 
ATOM   3041  C  CA  . ASP A 1 397 ? -32.288 53.580  24.985  1.00 9.89  ? 397 ASP A CA  1 
ATOM   3042  C  C   . ASP A 1 397 ? -32.934 52.432  25.740  1.00 9.69  ? 397 ASP A C   1 
ATOM   3043  O  O   . ASP A 1 397 ? -33.576 52.621  26.775  1.00 8.94  ? 397 ASP A O   1 
ATOM   3044  C  CB  . ASP A 1 397 ? -32.021 54.761  25.921  1.00 9.67  ? 397 ASP A CB  1 
ATOM   3045  C  CG  . ASP A 1 397 ? -31.111 55.802  25.291  1.00 12.32 ? 397 ASP A CG  1 
ATOM   3046  O  OD1 . ASP A 1 397 ? -30.314 55.429  24.407  1.00 11.52 ? 397 ASP A OD1 1 
ATOM   3047  O  OD2 . ASP A 1 397 ? -31.178 56.987  25.683  1.00 14.82 ? 397 ASP A OD2 1 
ATOM   3048  N  N   . SER A 1 398 ? -32.737 51.234  25.204  1.00 7.58  ? 398 SER A N   1 
ATOM   3049  C  CA  . SER A 1 398 ? -33.262 50.022  25.803  1.00 8.36  ? 398 SER A CA  1 
ATOM   3050  C  C   . SER A 1 398 ? -32.593 48.823  25.144  1.00 8.32  ? 398 SER A C   1 
ATOM   3051  O  O   . SER A 1 398 ? -31.892 48.959  24.138  1.00 7.75  ? 398 SER A O   1 
ATOM   3052  C  CB  . SER A 1 398 ? -34.776 49.935  25.598  1.00 8.65  ? 398 SER A CB  1 
ATOM   3053  O  OG  . SER A 1 398 ? -35.099 49.875  24.219  1.00 10.04 ? 398 SER A OG  1 
ATOM   3054  N  N   . VAL A 1 399 ? -32.801 47.654  25.734  1.00 8.12  ? 399 VAL A N   1 
ATOM   3055  C  CA  . VAL A 1 399 ? -32.263 46.418  25.198  1.00 8.24  ? 399 VAL A CA  1 
ATOM   3056  C  C   . VAL A 1 399 ? -33.471 45.502  25.059  1.00 7.93  ? 399 VAL A C   1 
ATOM   3057  O  O   . VAL A 1 399 ? -34.188 45.276  26.029  1.00 10.41 ? 399 VAL A O   1 
ATOM   3058  C  CB  . VAL A 1 399 ? -31.241 45.765  26.161  1.00 9.05  ? 399 VAL A CB  1 
ATOM   3059  C  CG1 . VAL A 1 399 ? -30.639 44.529  25.513  1.00 9.88  ? 399 VAL A CG1 1 
ATOM   3060  C  CG2 . VAL A 1 399 ? -30.144 46.758  26.512  1.00 8.47  ? 399 VAL A CG2 1 
ATOM   3061  N  N   . LEU A 1 400 ? -33.713 45.005  23.852  1.00 6.12  ? 400 LEU A N   1 
ATOM   3062  C  CA  . LEU A 1 400 ? -34.835 44.103  23.614  1.00 7.11  ? 400 LEU A CA  1 
ATOM   3063  C  C   . LEU A 1 400 ? -34.239 42.701  23.486  1.00 7.98  ? 400 LEU A C   1 
ATOM   3064  O  O   . LEU A 1 400 ? -33.368 42.471  22.647  1.00 8.36  ? 400 LEU A O   1 
ATOM   3065  C  CB  . LEU A 1 400 ? -35.560 44.503  22.328  1.00 8.74  ? 400 LEU A CB  1 
ATOM   3066  C  CG  . LEU A 1 400 ? -35.902 45.998  22.232  1.00 10.35 ? 400 LEU A CG  1 
ATOM   3067  C  CD1 . LEU A 1 400 ? -36.590 46.299  20.904  1.00 11.70 ? 400 LEU A CD1 1 
ATOM   3068  C  CD2 . LEU A 1 400 ? -36.797 46.397  23.396  1.00 9.88  ? 400 LEU A CD2 1 
ATOM   3069  N  N   . GLN A 1 401 ? -34.701 41.769  24.317  1.00 7.50  ? 401 GLN A N   1 
ATOM   3070  C  CA  . GLN A 1 401 ? -34.159 40.412  24.290  1.00 8.77  ? 401 GLN A CA  1 
ATOM   3071  C  C   . GLN A 1 401 ? -35.136 39.336  23.842  1.00 7.68  ? 401 GLN A C   1 
ATOM   3072  O  O   . GLN A 1 401 ? -36.270 39.265  24.319  1.00 8.25  ? 401 GLN A O   1 
ATOM   3073  C  CB  . GLN A 1 401 ? -33.598 40.046  25.666  1.00 8.03  ? 401 GLN A CB  1 
ATOM   3074  C  CG  . GLN A 1 401 ? -32.583 41.052  26.186  1.00 10.83 ? 401 GLN A CG  1 
ATOM   3075  C  CD  . GLN A 1 401 ? -31.915 40.606  27.470  1.00 11.06 ? 401 GLN A CD  1 
ATOM   3076  O  OE1 . GLN A 1 401 ? -32.494 39.858  28.262  1.00 13.33 ? 401 GLN A OE1 1 
ATOM   3077  N  NE2 . GLN A 1 401 ? -30.700 41.079  27.694  1.00 10.43 ? 401 GLN A NE2 1 
ATOM   3078  N  N   . PHE A 1 402 ? -34.669 38.490  22.928  1.00 8.37  ? 402 PHE A N   1 
ATOM   3079  C  CA  . PHE A 1 402 ? -35.470 37.402  22.388  1.00 7.93  ? 402 PHE A CA  1 
ATOM   3080  C  C   . PHE A 1 402 ? -34.768 36.053  22.555  1.00 9.80  ? 402 PHE A C   1 
ATOM   3081  O  O   . PHE A 1 402 ? -33.849 35.728  21.800  1.00 10.53 ? 402 PHE A O   1 
ATOM   3082  C  CB  . PHE A 1 402 ? -35.751 37.647  20.900  1.00 8.78  ? 402 PHE A CB  1 
ATOM   3083  C  CG  . PHE A 1 402 ? -36.389 38.977  20.618  1.00 9.10  ? 402 PHE A CG  1 
ATOM   3084  C  CD1 . PHE A 1 402 ? -35.615 40.130  20.523  1.00 9.74  ? 402 PHE A CD1 1 
ATOM   3085  C  CD2 . PHE A 1 402 ? -37.769 39.082  20.487  1.00 8.01  ? 402 PHE A CD2 1 
ATOM   3086  C  CE1 . PHE A 1 402 ? -36.207 41.374  20.307  1.00 9.07  ? 402 PHE A CE1 1 
ATOM   3087  C  CE2 . PHE A 1 402 ? -38.376 40.315  20.273  1.00 8.29  ? 402 PHE A CE2 1 
ATOM   3088  C  CZ  . PHE A 1 402 ? -37.594 41.467  20.181  1.00 9.16  ? 402 PHE A CZ  1 
ATOM   3089  N  N   . GLY A 1 403 ? -35.205 35.275  23.545  1.00 9.61  ? 403 GLY A N   1 
ATOM   3090  C  CA  . GLY A 1 403 ? -34.620 33.964  23.778  1.00 8.56  ? 403 GLY A CA  1 
ATOM   3091  C  C   . GLY A 1 403 ? -35.347 32.947  22.917  1.00 9.68  ? 403 GLY A C   1 
ATOM   3092  O  O   . GLY A 1 403 ? -34.831 32.508  21.883  1.00 8.87  ? 403 GLY A O   1 
ATOM   3093  N  N   . GLY A 1 404 ? -36.549 32.561  23.336  1.00 9.99  ? 404 GLY A N   1 
ATOM   3094  C  CA  . GLY A 1 404 ? -37.316 31.623  22.538  1.00 9.39  ? 404 GLY A CA  1 
ATOM   3095  C  C   . GLY A 1 404 ? -37.577 32.260  21.182  1.00 10.08 ? 404 GLY A C   1 
ATOM   3096  O  O   . GLY A 1 404 ? -37.732 31.568  20.177  1.00 10.07 ? 404 GLY A O   1 
ATOM   3097  N  N   . GLY A 1 405 ? -37.606 33.593  21.163  1.00 10.49 ? 405 GLY A N   1 
ATOM   3098  C  CA  . GLY A 1 405 ? -37.846 34.333  19.935  1.00 11.13 ? 405 GLY A CA  1 
ATOM   3099  C  C   . GLY A 1 405 ? -36.712 34.269  18.925  1.00 10.94 ? 405 GLY A C   1 
ATOM   3100  O  O   . GLY A 1 405 ? -36.845 34.778  17.812  1.00 11.25 ? 405 GLY A O   1 
ATOM   3101  N  N   . THR A 1 406 ? -35.592 33.663  19.312  1.00 9.26  ? 406 THR A N   1 
ATOM   3102  C  CA  . THR A 1 406 ? -34.452 33.519  18.413  1.00 8.42  ? 406 THR A CA  1 
ATOM   3103  C  C   . THR A 1 406 ? -34.148 32.034  18.198  1.00 9.32  ? 406 THR A C   1 
ATOM   3104  O  O   . THR A 1 406 ? -34.038 31.580  17.062  1.00 9.09  ? 406 THR A O   1 
ATOM   3105  C  CB  . THR A 1 406 ? -33.188 34.214  18.970  1.00 8.37  ? 406 THR A CB  1 
ATOM   3106  O  OG1 . THR A 1 406 ? -33.421 35.624  19.073  1.00 8.61  ? 406 THR A OG1 1 
ATOM   3107  C  CG2 . THR A 1 406 ? -32.003 33.973  18.050  1.00 6.73  ? 406 THR A CG2 1 
ATOM   3108  N  N   . LEU A 1 407 ? -34.025 31.279  19.288  1.00 8.18  ? 407 LEU A N   1 
ATOM   3109  C  CA  . LEU A 1 407 ? -33.736 29.851  19.187  1.00 8.99  ? 407 LEU A CA  1 
ATOM   3110  C  C   . LEU A 1 407 ? -34.974 29.053  18.778  1.00 10.06 ? 407 LEU A C   1 
ATOM   3111  O  O   . LEU A 1 407 ? -34.902 27.840  18.575  1.00 10.08 ? 407 LEU A O   1 
ATOM   3112  C  CB  . LEU A 1 407 ? -33.184 29.308  20.512  1.00 7.43  ? 407 LEU A CB  1 
ATOM   3113  C  CG  . LEU A 1 407 ? -31.772 29.770  20.897  1.00 10.67 ? 407 LEU A CG  1 
ATOM   3114  C  CD1 . LEU A 1 407 ? -31.852 31.079  21.658  1.00 10.40 ? 407 LEU A CD1 1 
ATOM   3115  C  CD2 . LEU A 1 407 ? -31.092 28.717  21.757  1.00 10.16 ? 407 LEU A CD2 1 
ATOM   3116  N  N   . GLY A 1 408 ? -36.105 29.743  18.660  1.00 9.64  ? 408 GLY A N   1 
ATOM   3117  C  CA  . GLY A 1 408 ? -37.337 29.081  18.268  1.00 9.85  ? 408 GLY A CA  1 
ATOM   3118  C  C   . GLY A 1 408 ? -37.623 29.250  16.786  1.00 9.97  ? 408 GLY A C   1 
ATOM   3119  O  O   . GLY A 1 408 ? -38.643 28.770  16.289  1.00 11.34 ? 408 GLY A O   1 
ATOM   3120  N  N   . HIS A 1 409 ? -36.725 29.940  16.085  1.00 8.65  ? 409 HIS A N   1 
ATOM   3121  C  CA  . HIS A 1 409 ? -36.867 30.182  14.653  1.00 8.02  ? 409 HIS A CA  1 
ATOM   3122  C  C   . HIS A 1 409 ? -36.692 28.847  13.940  1.00 9.02  ? 409 HIS A C   1 
ATOM   3123  O  O   . HIS A 1 409 ? -35.807 28.068  14.282  1.00 10.25 ? 409 HIS A O   1 
ATOM   3124  C  CB  . HIS A 1 409 ? -35.810 31.193  14.186  1.00 7.92  ? 409 HIS A CB  1 
ATOM   3125  C  CG  . HIS A 1 409 ? -36.021 31.698  12.791  1.00 8.14  ? 409 HIS A CG  1 
ATOM   3126  N  ND1 . HIS A 1 409 ? -35.771 30.926  11.673  1.00 8.91  ? 409 HIS A ND1 1 
ATOM   3127  C  CD2 . HIS A 1 409 ? -36.467 32.890  12.331  1.00 7.77  ? 409 HIS A CD2 1 
ATOM   3128  C  CE1 . HIS A 1 409 ? -36.055 31.626  10.587  1.00 6.79  ? 409 HIS A CE1 1 
ATOM   3129  N  NE2 . HIS A 1 409 ? -36.479 32.820  10.959  1.00 6.95  ? 409 HIS A NE2 1 
ATOM   3130  N  N   . PRO A 1 410 ? -37.534 28.562  12.933  1.00 10.13 ? 410 PRO A N   1 
ATOM   3131  C  CA  . PRO A 1 410 ? -37.440 27.294  12.202  1.00 10.31 ? 410 PRO A CA  1 
ATOM   3132  C  C   . PRO A 1 410 ? -36.125 26.975  11.491  1.00 10.52 ? 410 PRO A C   1 
ATOM   3133  O  O   . PRO A 1 410 ? -35.846 25.809  11.212  1.00 10.83 ? 410 PRO A O   1 
ATOM   3134  C  CB  . PRO A 1 410 ? -38.628 27.363  11.238  1.00 10.75 ? 410 PRO A CB  1 
ATOM   3135  C  CG  . PRO A 1 410 ? -38.806 28.827  11.013  1.00 12.46 ? 410 PRO A CG  1 
ATOM   3136  C  CD  . PRO A 1 410 ? -38.616 29.403  12.391  1.00 10.61 ? 410 PRO A CD  1 
ATOM   3137  N  N   . TRP A 1 411 ? -35.317 27.991  11.201  1.00 9.98  ? 411 TRP A N   1 
ATOM   3138  C  CA  . TRP A 1 411 ? -34.050 27.762  10.507  1.00 10.48 ? 411 TRP A CA  1 
ATOM   3139  C  C   . TRP A 1 411 ? -32.817 27.829  11.407  1.00 10.21 ? 411 TRP A C   1 
ATOM   3140  O  O   . TRP A 1 411 ? -31.690 27.727  10.923  1.00 9.82  ? 411 TRP A O   1 
ATOM   3141  C  CB  . TRP A 1 411 ? -33.870 28.765  9.364   1.00 9.92  ? 411 TRP A CB  1 
ATOM   3142  C  CG  . TRP A 1 411 ? -34.980 28.778  8.348   1.00 10.06 ? 411 TRP A CG  1 
ATOM   3143  C  CD1 . TRP A 1 411 ? -36.028 27.900  8.248   1.00 10.72 ? 411 TRP A CD1 1 
ATOM   3144  C  CD2 . TRP A 1 411 ? -35.136 29.712  7.273   1.00 9.88  ? 411 TRP A CD2 1 
ATOM   3145  N  NE1 . TRP A 1 411 ? -36.825 28.233  7.175   1.00 10.07 ? 411 TRP A NE1 1 
ATOM   3146  C  CE2 . TRP A 1 411 ? -36.301 29.340  6.559   1.00 11.20 ? 411 TRP A CE2 1 
ATOM   3147  C  CE3 . TRP A 1 411 ? -34.404 30.827  6.841   1.00 10.66 ? 411 TRP A CE3 1 
ATOM   3148  C  CZ2 . TRP A 1 411 ? -36.751 30.048  5.435   1.00 11.40 ? 411 TRP A CZ2 1 
ATOM   3149  C  CZ3 . TRP A 1 411 ? -34.851 31.532  5.724   1.00 12.66 ? 411 TRP A CZ3 1 
ATOM   3150  C  CH2 . TRP A 1 411 ? -36.015 31.136  5.035   1.00 11.69 ? 411 TRP A CH2 1 
ATOM   3151  N  N   . GLY A 1 412 ? -33.018 28.001  12.710  1.00 11.12 ? 412 GLY A N   1 
ATOM   3152  C  CA  . GLY A 1 412 ? -31.875 28.069  13.606  1.00 9.45  ? 412 GLY A CA  1 
ATOM   3153  C  C   . GLY A 1 412 ? -31.562 29.456  14.148  1.00 9.08  ? 412 GLY A C   1 
ATOM   3154  O  O   . GLY A 1 412 ? -32.237 30.432  13.825  1.00 9.13  ? 412 GLY A O   1 
ATOM   3155  N  N   . ASN A 1 413 ? -30.511 29.534  14.960  1.00 9.50  ? 413 ASN A N   1 
ATOM   3156  C  CA  . ASN A 1 413 ? -30.089 30.775  15.613  1.00 10.72 ? 413 ASN A CA  1 
ATOM   3157  C  C   . ASN A 1 413 ? -29.679 31.964  14.740  1.00 10.98 ? 413 ASN A C   1 
ATOM   3158  O  O   . ASN A 1 413 ? -30.160 33.079  14.956  1.00 11.59 ? 413 ASN A O   1 
ATOM   3159  C  CB  . ASN A 1 413 ? -28.961 30.466  16.599  1.00 9.40  ? 413 ASN A CB  1 
ATOM   3160  C  CG  . ASN A 1 413 ? -29.411 29.572  17.740  1.00 10.57 ? 413 ASN A CG  1 
ATOM   3161  O  OD1 . ASN A 1 413 ? -30.530 29.056  17.739  1.00 9.22  ? 413 ASN A OD1 1 
ATOM   3162  N  ND2 . ASN A 1 413 ? -28.530 29.374  18.720  1.00 10.27 ? 413 ASN A ND2 1 
ATOM   3163  N  N   . ALA A 1 414 ? -28.788 31.753  13.773  1.00 9.79  ? 414 ALA A N   1 
ATOM   3164  C  CA  . ALA A 1 414 ? -28.361 32.856  12.912  1.00 9.64  ? 414 ALA A CA  1 
ATOM   3165  C  C   . ALA A 1 414 ? -29.564 33.472  12.196  1.00 9.08  ? 414 ALA A C   1 
ATOM   3166  O  O   . ALA A 1 414 ? -29.739 34.689  12.206  1.00 9.84  ? 414 ALA A O   1 
ATOM   3167  C  CB  . ALA A 1 414 ? -27.314 32.382  11.901  1.00 9.15  ? 414 ALA A CB  1 
ATOM   3168  N  N   . PRO A 1 415 ? -30.405 32.642  11.548  1.00 9.80  ? 415 PRO A N   1 
ATOM   3169  C  CA  . PRO A 1 415 ? -31.575 33.204  10.862  1.00 9.74  ? 415 PRO A CA  1 
ATOM   3170  C  C   . PRO A 1 415 ? -32.532 33.853  11.858  1.00 8.91  ? 415 PRO A C   1 
ATOM   3171  O  O   . PRO A 1 415 ? -33.194 34.838  11.542  1.00 9.29  ? 415 PRO A O   1 
ATOM   3172  C  CB  . PRO A 1 415 ? -32.196 31.984  10.186  1.00 10.10 ? 415 PRO A CB  1 
ATOM   3173  C  CG  . PRO A 1 415 ? -30.991 31.161  9.846   1.00 10.33 ? 415 PRO A CG  1 
ATOM   3174  C  CD  . PRO A 1 415 ? -30.196 31.240  11.141  1.00 10.09 ? 415 PRO A CD  1 
ATOM   3175  N  N   . GLY A 1 416 ? -32.609 33.285  13.059  1.00 8.30  ? 416 GLY A N   1 
ATOM   3176  C  CA  . GLY A 1 416 ? -33.484 33.841  14.079  1.00 7.55  ? 416 GLY A CA  1 
ATOM   3177  C  C   . GLY A 1 416 ? -33.009 35.219  14.501  1.00 7.07  ? 416 GLY A C   1 
ATOM   3178  O  O   . GLY A 1 416 ? -33.811 36.124  14.750  1.00 7.57  ? 416 GLY A O   1 
ATOM   3179  N  N   . ALA A 1 417 ? -31.692 35.377  14.580  1.00 7.26  ? 417 ALA A N   1 
ATOM   3180  C  CA  . ALA A 1 417 ? -31.095 36.652  14.959  1.00 7.17  ? 417 ALA A CA  1 
ATOM   3181  C  C   . ALA A 1 417 ? -31.349 37.685  13.862  1.00 7.70  ? 417 ALA A C   1 
ATOM   3182  O  O   . ALA A 1 417 ? -31.723 38.824  14.144  1.00 9.01  ? 417 ALA A O   1 
ATOM   3183  C  CB  . ALA A 1 417 ? -29.596 36.482  15.183  1.00 4.93  ? 417 ALA A CB  1 
ATOM   3184  N  N   . VAL A 1 418 ? -31.143 37.278  12.612  1.00 7.00  ? 418 VAL A N   1 
ATOM   3185  C  CA  . VAL A 1 418 ? -31.350 38.168  11.474  1.00 6.88  ? 418 VAL A CA  1 
ATOM   3186  C  C   . VAL A 1 418 ? -32.778 38.709  11.473  1.00 7.93  ? 418 VAL A C   1 
ATOM   3187  O  O   . VAL A 1 418 ? -32.996 39.909  11.298  1.00 8.72  ? 418 VAL A O   1 
ATOM   3188  C  CB  . VAL A 1 418 ? -31.091 37.435  10.138  1.00 7.81  ? 418 VAL A CB  1 
ATOM   3189  C  CG1 . VAL A 1 418 ? -31.411 38.353  8.972   1.00 7.61  ? 418 VAL A CG1 1 
ATOM   3190  C  CG2 . VAL A 1 418 ? -29.635 36.975  10.064  1.00 8.44  ? 418 VAL A CG2 1 
ATOM   3191  N  N   . ALA A 1 419 ? -33.746 37.821  11.678  1.00 7.40  ? 419 ALA A N   1 
ATOM   3192  C  CA  . ALA A 1 419 ? -35.153 38.212  11.705  1.00 7.61  ? 419 ALA A CA  1 
ATOM   3193  C  C   . ALA A 1 419 ? -35.411 39.338  12.713  1.00 9.66  ? 419 ALA A C   1 
ATOM   3194  O  O   . ALA A 1 419 ? -36.101 40.314  12.405  1.00 9.08  ? 419 ALA A O   1 
ATOM   3195  C  CB  . ALA A 1 419 ? -36.020 36.998  12.034  1.00 7.49  ? 419 ALA A CB  1 
ATOM   3196  N  N   . ASN A 1 420 ? -34.852 39.206  13.915  1.00 8.07  ? 420 ASN A N   1 
ATOM   3197  C  CA  . ASN A 1 420 ? -35.037 40.227  14.939  1.00 7.57  ? 420 ASN A CA  1 
ATOM   3198  C  C   . ASN A 1 420 ? -34.295 41.522  14.606  1.00 6.77  ? 420 ASN A C   1 
ATOM   3199  O  O   . ASN A 1 420 ? -34.832 42.613  14.813  1.00 8.29  ? 420 ASN A O   1 
ATOM   3200  C  CB  . ASN A 1 420 ? -34.597 39.707  16.319  1.00 9.52  ? 420 ASN A CB  1 
ATOM   3201  C  CG  . ASN A 1 420 ? -35.526 38.624  16.861  1.00 12.62 ? 420 ASN A CG  1 
ATOM   3202  O  OD1 . ASN A 1 420 ? -36.748 38.761  16.814  1.00 9.92  ? 420 ASN A OD1 1 
ATOM   3203  N  ND2 . ASN A 1 420 ? -34.946 37.549  17.388  1.00 13.13 ? 420 ASN A ND2 1 
ATOM   3204  N  N   . ARG A 1 421 ? -33.076 41.407  14.083  1.00 6.71  ? 421 ARG A N   1 
ATOM   3205  C  CA  . ARG A 1 421 ? -32.290 42.589  13.720  1.00 7.71  ? 421 ARG A CA  1 
ATOM   3206  C  C   . ARG A 1 421 ? -32.975 43.348  12.582  1.00 9.27  ? 421 ARG A C   1 
ATOM   3207  O  O   . ARG A 1 421 ? -33.078 44.575  12.617  1.00 10.17 ? 421 ARG A O   1 
ATOM   3208  C  CB  . ARG A 1 421 ? -30.871 42.181  13.303  1.00 7.75  ? 421 ARG A CB  1 
ATOM   3209  C  CG  . ARG A 1 421 ? -29.932 43.342  12.921  1.00 7.04  ? 421 ARG A CG  1 
ATOM   3210  C  CD  . ARG A 1 421 ? -29.687 44.341  14.061  1.00 7.07  ? 421 ARG A CD  1 
ATOM   3211  N  NE  . ARG A 1 421 ? -28.793 45.420  13.628  1.00 8.19  ? 421 ARG A NE  1 
ATOM   3212  C  CZ  . ARG A 1 421 ? -27.466 45.382  13.706  1.00 7.34  ? 421 ARG A CZ  1 
ATOM   3213  N  NH1 . ARG A 1 421 ? -26.851 44.325  14.223  1.00 8.50  ? 421 ARG A NH1 1 
ATOM   3214  N  NH2 . ARG A 1 421 ? -26.744 46.384  13.223  1.00 8.86  ? 421 ARG A NH2 1 
ATOM   3215  N  N   . VAL A 1 422 ? -33.442 42.615  11.576  1.00 9.34  ? 422 VAL A N   1 
ATOM   3216  C  CA  . VAL A 1 422 ? -34.135 43.226  10.443  1.00 10.84 ? 422 VAL A CA  1 
ATOM   3217  C  C   . VAL A 1 422 ? -35.423 43.905  10.905  1.00 10.69 ? 422 VAL A C   1 
ATOM   3218  O  O   . VAL A 1 422 ? -35.706 45.039  10.523  1.00 11.19 ? 422 VAL A O   1 
ATOM   3219  C  CB  . VAL A 1 422 ? -34.490 42.172  9.363   1.00 11.41 ? 422 VAL A CB  1 
ATOM   3220  C  CG1 . VAL A 1 422 ? -35.469 42.766  8.354   1.00 9.76  ? 422 VAL A CG1 1 
ATOM   3221  C  CG2 . VAL A 1 422 ? -33.214 41.704  8.656   1.00 11.26 ? 422 VAL A CG2 1 
ATOM   3222  N  N   . ALA A 1 423 ? -36.203 43.204  11.723  1.00 9.93  ? 423 ALA A N   1 
ATOM   3223  C  CA  . ALA A 1 423 ? -37.455 43.751  12.233  1.00 10.16 ? 423 ALA A CA  1 
ATOM   3224  C  C   . ALA A 1 423 ? -37.213 45.060  12.984  1.00 10.05 ? 423 ALA A C   1 
ATOM   3225  O  O   . ALA A 1 423 ? -37.941 46.032  12.790  1.00 10.77 ? 423 ALA A O   1 
ATOM   3226  C  CB  . ALA A 1 423 ? -38.136 42.739  13.142  1.00 9.76  ? 423 ALA A CB  1 
ATOM   3227  N  N   . LEU A 1 424 ? -36.189 45.089  13.835  1.00 8.67  ? 424 LEU A N   1 
ATOM   3228  C  CA  . LEU A 1 424 ? -35.872 46.294  14.594  1.00 9.47  ? 424 LEU A CA  1 
ATOM   3229  C  C   . LEU A 1 424 ? -35.477 47.459  13.693  1.00 10.19 ? 424 LEU A C   1 
ATOM   3230  O  O   . LEU A 1 424 ? -36.028 48.554  13.819  1.00 11.60 ? 424 LEU A O   1 
ATOM   3231  C  CB  . LEU A 1 424 ? -34.733 46.036  15.590  1.00 10.46 ? 424 LEU A CB  1 
ATOM   3232  C  CG  . LEU A 1 424 ? -34.247 47.288  16.340  1.00 12.42 ? 424 LEU A CG  1 
ATOM   3233  C  CD1 . LEU A 1 424 ? -35.351 47.784  17.265  1.00 13.43 ? 424 LEU A CD1 1 
ATOM   3234  C  CD2 . LEU A 1 424 ? -32.990 46.980  17.134  1.00 11.65 ? 424 LEU A CD2 1 
ATOM   3235  N  N   . GLU A 1 425 ? -34.522 47.231  12.794  1.00 9.61  ? 425 GLU A N   1 
ATOM   3236  C  CA  . GLU A 1 425 ? -34.066 48.298  11.905  1.00 11.67 ? 425 GLU A CA  1 
ATOM   3237  C  C   . GLU A 1 425 ? -35.172 48.820  10.990  1.00 10.66 ? 425 GLU A C   1 
ATOM   3238  O  O   . GLU A 1 425 ? -35.191 50.002  10.649  1.00 12.58 ? 425 GLU A O   1 
ATOM   3239  C  CB  . GLU A 1 425 ? -32.860 47.838  11.075  1.00 10.60 ? 425 GLU A CB  1 
ATOM   3240  C  CG  . GLU A 1 425 ? -31.669 47.392  11.925  1.00 11.63 ? 425 GLU A CG  1 
ATOM   3241  C  CD  . GLU A 1 425 ? -30.339 47.479  11.194  1.00 12.50 ? 425 GLU A CD  1 
ATOM   3242  O  OE1 . GLU A 1 425 ? -30.305 47.241  9.970   1.00 15.17 ? 425 GLU A OE1 1 
ATOM   3243  O  OE2 . GLU A 1 425 ? -29.320 47.777  11.853  1.00 13.27 ? 425 GLU A OE2 1 
ATOM   3244  N  N   . ALA A 1 426 ? -36.096 47.948  10.600  1.00 10.52 ? 426 ALA A N   1 
ATOM   3245  C  CA  . ALA A 1 426 ? -37.207 48.366  9.747   1.00 10.12 ? 426 ALA A CA  1 
ATOM   3246  C  C   . ALA A 1 426 ? -38.082 49.346  10.526  1.00 10.34 ? 426 ALA A C   1 
ATOM   3247  O  O   . ALA A 1 426 ? -38.559 50.344  9.975   1.00 8.74  ? 426 ALA A O   1 
ATOM   3248  C  CB  . ALA A 1 426 ? -38.032 47.153  9.312   1.00 8.14  ? 426 ALA A CB  1 
ATOM   3249  N  N   . CYS A 1 427 ? -38.290 49.059  11.811  1.00 8.69  ? 427 CYS A N   1 
ATOM   3250  C  CA  . CYS A 1 427 ? -39.102 49.922  12.667  1.00 9.41  ? 427 CYS A CA  1 
ATOM   3251  C  C   . CYS A 1 427 ? -38.406 51.257  12.917  1.00 9.06  ? 427 CYS A C   1 
ATOM   3252  O  O   . CYS A 1 427 ? -39.047 52.309  12.929  1.00 8.08  ? 427 CYS A O   1 
ATOM   3253  C  CB  . CYS A 1 427 ? -39.382 49.239  14.011  1.00 8.65  ? 427 CYS A CB  1 
ATOM   3254  S  SG  . CYS A 1 427 ? -40.546 47.856  13.926  1.00 10.51 ? 427 CYS A SG  1 
ATOM   3255  N  N   . VAL A 1 428 ? -37.094 51.207  13.126  1.00 8.81  ? 428 VAL A N   1 
ATOM   3256  C  CA  . VAL A 1 428 ? -36.316 52.417  13.368  1.00 9.26  ? 428 VAL A CA  1 
ATOM   3257  C  C   . VAL A 1 428 ? -36.342 53.322  12.140  1.00 10.45 ? 428 VAL A C   1 
ATOM   3258  O  O   . VAL A 1 428 ? -36.550 54.532  12.254  1.00 11.66 ? 428 VAL A O   1 
ATOM   3259  C  CB  . VAL A 1 428 ? -34.856 52.071  13.722  1.00 10.17 ? 428 VAL A CB  1 
ATOM   3260  C  CG1 . VAL A 1 428 ? -33.998 53.330  13.727  1.00 9.89  ? 428 VAL A CG1 1 
ATOM   3261  C  CG2 . VAL A 1 428 ? -34.815 51.395  15.085  1.00 9.02  ? 428 VAL A CG2 1 
ATOM   3262  N  N   . GLN A 1 429 ? -36.131 52.737  10.965  1.00 10.10 ? 429 GLN A N   1 
ATOM   3263  C  CA  . GLN A 1 429 ? -36.152 53.516  9.737   1.00 10.83 ? 429 GLN A CA  1 
ATOM   3264  C  C   . GLN A 1 429 ? -37.528 54.144  9.539   1.00 11.29 ? 429 GLN A C   1 
ATOM   3265  O  O   . GLN A 1 429 ? -37.633 55.330  9.242   1.00 10.59 ? 429 GLN A O   1 
ATOM   3266  C  CB  . GLN A 1 429 ? -35.808 52.639  8.533   1.00 11.99 ? 429 GLN A CB  1 
ATOM   3267  C  CG  . GLN A 1 429 ? -35.816 53.391  7.212   1.00 14.49 ? 429 GLN A CG  1 
ATOM   3268  C  CD  . GLN A 1 429 ? -35.591 52.480  6.022   1.00 16.80 ? 429 GLN A CD  1 
ATOM   3269  O  OE1 . GLN A 1 429 ? -36.317 51.505  5.828   1.00 17.22 ? 429 GLN A OE1 1 
ATOM   3270  N  NE2 . GLN A 1 429 ? -34.584 52.796  5.215   1.00 17.05 ? 429 GLN A NE2 1 
ATOM   3271  N  N   . ALA A 1 430 ? -38.578 53.343  9.711   1.00 11.99 ? 430 ALA A N   1 
ATOM   3272  C  CA  . ALA A 1 430 ? -39.950 53.827  9.548   1.00 13.77 ? 430 ALA A CA  1 
ATOM   3273  C  C   . ALA A 1 430 ? -40.238 54.985  10.500  1.00 13.94 ? 430 ALA A C   1 
ATOM   3274  O  O   . ALA A 1 430 ? -40.809 56.002  10.104  1.00 14.42 ? 430 ALA A O   1 
ATOM   3275  C  CB  . ALA A 1 430 ? -40.943 52.686  9.788   1.00 13.56 ? 430 ALA A CB  1 
ATOM   3276  N  N   . ARG A 1 431 ? -39.843 54.826  11.759  1.00 13.71 ? 431 ARG A N   1 
ATOM   3277  C  CA  . ARG A 1 431 ? -40.044 55.868  12.760  1.00 12.40 ? 431 ARG A CA  1 
ATOM   3278  C  C   . ARG A 1 431 ? -39.326 57.161  12.362  1.00 12.75 ? 431 ARG A C   1 
ATOM   3279  O  O   . ARG A 1 431 ? -39.902 58.252  12.411  1.00 13.95 ? 431 ARG A O   1 
ATOM   3280  C  CB  . ARG A 1 431 ? -39.511 55.401  14.110  1.00 13.25 ? 431 ARG A CB  1 
ATOM   3281  C  CG  . ARG A 1 431 ? -39.567 56.455  15.192  1.00 13.67 ? 431 ARG A CG  1 
ATOM   3282  C  CD  . ARG A 1 431 ? -38.664 56.071  16.338  1.00 16.31 ? 431 ARG A CD  1 
ATOM   3283  N  NE  . ARG A 1 431 ? -37.252 56.100  15.955  1.00 15.07 ? 431 ARG A NE  1 
ATOM   3284  C  CZ  . ARG A 1 431 ? -36.275 55.607  16.709  1.00 14.33 ? 431 ARG A CZ  1 
ATOM   3285  N  NH1 . ARG A 1 431 ? -36.567 55.046  17.875  1.00 12.15 ? 431 ARG A NH1 1 
ATOM   3286  N  NH2 . ARG A 1 431 ? -35.012 55.686  16.311  1.00 11.48 ? 431 ARG A NH2 1 
ATOM   3287  N  N   . ASN A 1 432 ? -38.061 57.027  11.976  1.00 10.96 ? 432 ASN A N   1 
ATOM   3288  C  CA  . ASN A 1 432 ? -37.253 58.173  11.579  1.00 11.63 ? 432 ASN A CA  1 
ATOM   3289  C  C   . ASN A 1 432 ? -37.815 58.899  10.361  1.00 13.07 ? 432 ASN A C   1 
ATOM   3290  O  O   . ASN A 1 432 ? -37.573 60.096  10.181  1.00 13.43 ? 432 ASN A O   1 
ATOM   3291  C  CB  . ASN A 1 432 ? -35.814 57.730  11.304  1.00 10.06 ? 432 ASN A CB  1 
ATOM   3292  C  CG  . ASN A 1 432 ? -35.102 57.257  12.556  1.00 9.51  ? 432 ASN A CG  1 
ATOM   3293  O  OD1 . ASN A 1 432 ? -35.694 57.199  13.632  1.00 10.79 ? 432 ASN A OD1 1 
ATOM   3294  N  ND2 . ASN A 1 432 ? -33.823 56.915  12.422  1.00 9.61  ? 432 ASN A ND2 1 
ATOM   3295  N  N   . GLU A 1 433 ? -38.562 58.181  9.526   1.00 13.91 ? 433 GLU A N   1 
ATOM   3296  C  CA  . GLU A 1 433 ? -39.160 58.793  8.345   1.00 16.73 ? 433 GLU A CA  1 
ATOM   3297  C  C   . GLU A 1 433 ? -40.481 59.477  8.692   1.00 16.82 ? 433 GLU A C   1 
ATOM   3298  O  O   . GLU A 1 433 ? -41.096 60.114  7.840   1.00 18.15 ? 433 GLU A O   1 
ATOM   3299  C  CB  . GLU A 1 433 ? -39.388 57.754  7.245   1.00 17.11 ? 433 GLU A CB  1 
ATOM   3300  C  CG  . GLU A 1 433 ? -38.110 57.119  6.728   1.00 20.49 ? 433 GLU A CG  1 
ATOM   3301  C  CD  . GLU A 1 433 ? -38.331 56.313  5.467   1.00 21.80 ? 433 GLU A CD  1 
ATOM   3302  O  OE1 . GLU A 1 433 ? -39.364 55.617  5.384   1.00 23.59 ? 433 GLU A OE1 1 
ATOM   3303  O  OE2 . GLU A 1 433 ? -37.468 56.366  4.567   1.00 23.65 ? 433 GLU A OE2 1 
ATOM   3304  N  N   . GLY A 1 434 ? -40.918 59.335  9.941   1.00 16.72 ? 434 GLY A N   1 
ATOM   3305  C  CA  . GLY A 1 434 ? -42.149 59.979  10.371  1.00 16.43 ? 434 GLY A CA  1 
ATOM   3306  C  C   . GLY A 1 434 ? -43.406 59.132  10.430  1.00 17.53 ? 434 GLY A C   1 
ATOM   3307  O  O   . GLY A 1 434 ? -44.496 59.656  10.673  1.00 18.23 ? 434 GLY A O   1 
ATOM   3308  N  N   . ARG A 1 435 ? -43.275 57.828  10.220  1.00 15.48 ? 435 ARG A N   1 
ATOM   3309  C  CA  . ARG A 1 435 ? -44.436 56.948  10.255  1.00 16.49 ? 435 ARG A CA  1 
ATOM   3310  C  C   . ARG A 1 435 ? -44.818 56.596  11.691  1.00 17.22 ? 435 ARG A C   1 
ATOM   3311  O  O   . ARG A 1 435 ? -43.968 56.543  12.579  1.00 18.97 ? 435 ARG A O   1 
ATOM   3312  C  CB  . ARG A 1 435 ? -44.154 55.688  9.434   1.00 14.75 ? 435 ARG A CB  1 
ATOM   3313  C  CG  . ARG A 1 435 ? -43.841 56.004  7.971   1.00 15.53 ? 435 ARG A CG  1 
ATOM   3314  C  CD  . ARG A 1 435 ? -43.400 54.772  7.200   1.00 16.06 ? 435 ARG A CD  1 
ATOM   3315  N  NE  . ARG A 1 435 ? -44.479 53.805  7.035   1.00 15.65 ? 435 ARG A NE  1 
ATOM   3316  C  CZ  . ARG A 1 435 ? -44.328 52.612  6.471   1.00 18.45 ? 435 ARG A CZ  1 
ATOM   3317  N  NH1 . ARG A 1 435 ? -43.135 52.237  6.020   1.00 16.72 ? 435 ARG A NH1 1 
ATOM   3318  N  NH2 . ARG A 1 435 ? -45.369 51.799  6.348   1.00 18.22 ? 435 ARG A NH2 1 
ATOM   3319  N  N   . ASP A 1 436 ? -46.108 56.367  11.913  1.00 17.52 ? 436 ASP A N   1 
ATOM   3320  C  CA  . ASP A 1 436 ? -46.613 56.048  13.240  1.00 19.41 ? 436 ASP A CA  1 
ATOM   3321  C  C   . ASP A 1 436 ? -46.539 54.553  13.538  1.00 19.32 ? 436 ASP A C   1 
ATOM   3322  O  O   . ASP A 1 436 ? -47.302 53.761  12.987  1.00 18.50 ? 436 ASP A O   1 
ATOM   3323  C  CB  . ASP A 1 436 ? -48.051 56.554  13.366  1.00 21.10 ? 436 ASP A CB  1 
ATOM   3324  C  CG  . ASP A 1 436 ? -48.648 56.279  14.724  1.00 24.59 ? 436 ASP A CG  1 
ATOM   3325  O  OD1 . ASP A 1 436 ? -47.881 56.180  15.704  1.00 27.75 ? 436 ASP A OD1 1 
ATOM   3326  O  OD2 . ASP A 1 436 ? -49.890 56.176  14.812  1.00 28.40 ? 436 ASP A OD2 1 
ATOM   3327  N  N   . LEU A 1 437 ? -45.612 54.180  14.415  1.00 19.29 ? 437 LEU A N   1 
ATOM   3328  C  CA  . LEU A 1 437 ? -45.411 52.784  14.790  1.00 20.42 ? 437 LEU A CA  1 
ATOM   3329  C  C   . LEU A 1 437 ? -46.644 52.112  15.393  1.00 21.55 ? 437 LEU A C   1 
ATOM   3330  O  O   . LEU A 1 437 ? -46.879 50.926  15.172  1.00 21.58 ? 437 LEU A O   1 
ATOM   3331  C  CB  . LEU A 1 437 ? -44.231 52.676  15.764  1.00 20.25 ? 437 LEU A CB  1 
ATOM   3332  C  CG  . LEU A 1 437 ? -42.861 52.274  15.195  1.00 21.10 ? 437 LEU A CG  1 
ATOM   3333  C  CD1 . LEU A 1 437 ? -42.617 52.946  13.861  1.00 21.50 ? 437 LEU A CD1 1 
ATOM   3334  C  CD2 . LEU A 1 437 ? -41.771 52.640  16.196  1.00 20.98 ? 437 LEU A CD2 1 
ATOM   3335  N  N   . ALA A 1 438 ? -47.429 52.869  16.149  1.00 23.29 ? 438 ALA A N   1 
ATOM   3336  C  CA  . ALA A 1 438 ? -48.624 52.321  16.781  1.00 25.38 ? 438 ALA A CA  1 
ATOM   3337  C  C   . ALA A 1 438 ? -49.708 51.974  15.767  1.00 26.33 ? 438 ALA A C   1 
ATOM   3338  O  O   . ALA A 1 438 ? -50.382 50.954  15.890  1.00 27.46 ? 438 ALA A O   1 
ATOM   3339  C  CB  . ALA A 1 438 ? -49.171 53.311  17.807  1.00 24.93 ? 438 ALA A CB  1 
ATOM   3340  N  N   . ARG A 1 439 ? -49.863 52.821  14.757  1.00 27.15 ? 439 ARG A N   1 
ATOM   3341  C  CA  . ARG A 1 439 ? -50.883 52.616  13.738  1.00 27.73 ? 439 ARG A CA  1 
ATOM   3342  C  C   . ARG A 1 439 ? -50.425 51.757  12.563  1.00 26.27 ? 439 ARG A C   1 
ATOM   3343  O  O   . ARG A 1 439 ? -51.190 50.939  12.053  1.00 26.94 ? 439 ARG A O   1 
ATOM   3344  C  CB  . ARG A 1 439 ? -51.350 53.969  13.202  1.00 32.16 ? 439 ARG A CB  1 
ATOM   3345  C  CG  . ARG A 1 439 ? -52.827 54.043  12.866  1.00 39.15 ? 439 ARG A CG  1 
ATOM   3346  C  CD  . ARG A 1 439 ? -53.639 54.312  14.122  1.00 45.25 ? 439 ARG A CD  1 
ATOM   3347  N  NE  . ARG A 1 439 ? -55.036 54.620  13.826  1.00 50.40 ? 439 ARG A NE  1 
ATOM   3348  C  CZ  . ARG A 1 439 ? -55.808 55.383  14.594  1.00 52.40 ? 439 ARG A CZ  1 
ATOM   3349  N  NH1 . ARG A 1 439 ? -55.317 55.920  15.703  1.00 53.67 ? 439 ARG A NH1 1 
ATOM   3350  N  NH2 . ARG A 1 439 ? -57.069 55.614  14.253  1.00 54.03 ? 439 ARG A NH2 1 
ATOM   3351  N  N   . GLU A 1 440 ? -49.180 51.946  12.135  1.00 23.13 ? 440 GLU A N   1 
ATOM   3352  C  CA  . GLU A 1 440 ? -48.640 51.221  10.988  1.00 22.12 ? 440 GLU A CA  1 
ATOM   3353  C  C   . GLU A 1 440 ? -47.723 50.041  11.316  1.00 19.50 ? 440 GLU A C   1 
ATOM   3354  O  O   . GLU A 1 440 ? -47.100 49.475  10.419  1.00 18.49 ? 440 GLU A O   1 
ATOM   3355  C  CB  . GLU A 1 440 ? -47.891 52.203  10.081  1.00 22.86 ? 440 GLU A CB  1 
ATOM   3356  C  CG  . GLU A 1 440 ? -48.723 53.398  9.633   1.00 25.02 ? 440 GLU A CG  1 
ATOM   3357  C  CD  . GLU A 1 440 ? -47.902 54.431  8.881   1.00 27.39 ? 440 GLU A CD  1 
ATOM   3358  O  OE1 . GLU A 1 440 ? -47.339 54.086  7.822   1.00 28.12 ? 440 GLU A OE1 1 
ATOM   3359  O  OE2 . GLU A 1 440 ? -47.814 55.590  9.349   1.00 28.58 ? 440 GLU A OE2 1 
ATOM   3360  N  N   . GLY A 1 441 ? -47.649 49.668  12.589  1.00 18.35 ? 441 GLY A N   1 
ATOM   3361  C  CA  . GLY A 1 441 ? -46.791 48.567  13.002  1.00 16.35 ? 441 GLY A CA  1 
ATOM   3362  C  C   . GLY A 1 441 ? -46.857 47.288  12.183  1.00 16.75 ? 441 GLY A C   1 
ATOM   3363  O  O   . GLY A 1 441 ? -45.835 46.821  11.678  1.00 14.09 ? 441 GLY A O   1 
ATOM   3364  N  N   . ASN A 1 442 ? -48.045 46.706  12.048  1.00 16.73 ? 442 ASN A N   1 
ATOM   3365  C  CA  . ASN A 1 442 ? -48.176 45.468  11.286  1.00 18.19 ? 442 ASN A CA  1 
ATOM   3366  C  C   . ASN A 1 442 ? -47.785 45.628  9.825   1.00 16.73 ? 442 ASN A C   1 
ATOM   3367  O  O   . ASN A 1 442 ? -47.229 44.711  9.222   1.00 17.93 ? 442 ASN A O   1 
ATOM   3368  C  CB  . ASN A 1 442 ? -49.603 44.924  11.370  1.00 20.67 ? 442 ASN A CB  1 
ATOM   3369  C  CG  . ASN A 1 442 ? -49.925 44.348  12.734  1.00 23.80 ? 442 ASN A CG  1 
ATOM   3370  O  OD1 . ASN A 1 442 ? -49.119 43.620  13.318  1.00 25.33 ? 442 ASN A OD1 1 
ATOM   3371  N  ND2 . ASN A 1 442 ? -51.111 44.659  13.244  1.00 25.70 ? 442 ASN A ND2 1 
ATOM   3372  N  N   . THR A 1 443 ? -48.081 46.792  9.261   1.00 15.97 ? 443 THR A N   1 
ATOM   3373  C  CA  . THR A 1 443 ? -47.766 47.074  7.864   1.00 16.56 ? 443 THR A CA  1 
ATOM   3374  C  C   . THR A 1 443 ? -46.257 47.100  7.650   1.00 15.84 ? 443 THR A C   1 
ATOM   3375  O  O   . THR A 1 443 ? -45.739 46.511  6.699   1.00 16.05 ? 443 THR A O   1 
ATOM   3376  C  CB  . THR A 1 443 ? -48.347 48.434  7.436   1.00 17.48 ? 443 THR A CB  1 
ATOM   3377  O  OG1 . THR A 1 443 ? -49.754 48.451  7.700   1.00 19.69 ? 443 THR A OG1 1 
ATOM   3378  C  CG2 . THR A 1 443 ? -48.108 48.678  5.947   1.00 17.02 ? 443 THR A CG2 1 
ATOM   3379  N  N   . ILE A 1 444 ? -45.565 47.789  8.551   1.00 15.53 ? 444 ILE A N   1 
ATOM   3380  C  CA  . ILE A 1 444 ? -44.117 47.922  8.500   1.00 15.46 ? 444 ILE A CA  1 
ATOM   3381  C  C   . ILE A 1 444 ? -43.421 46.565  8.533   1.00 13.99 ? 444 ILE A C   1 
ATOM   3382  O  O   . ILE A 1 444 ? -42.474 46.331  7.787   1.00 14.07 ? 444 ILE A O   1 
ATOM   3383  C  CB  . ILE A 1 444 ? -43.622 48.792  9.672   1.00 17.29 ? 444 ILE A CB  1 
ATOM   3384  C  CG1 . ILE A 1 444 ? -44.152 50.217  9.495   1.00 18.01 ? 444 ILE A CG1 1 
ATOM   3385  C  CG2 . ILE A 1 444 ? -42.099 48.770  9.743   1.00 16.05 ? 444 ILE A CG2 1 
ATOM   3386  C  CD1 . ILE A 1 444 ? -43.966 51.115  10.701  1.00 20.32 ? 444 ILE A CD1 1 
ATOM   3387  N  N   . ILE A 1 445 ? -43.891 45.669  9.393   1.00 15.04 ? 445 ILE A N   1 
ATOM   3388  C  CA  . ILE A 1 445 ? -43.296 44.341  9.484   1.00 14.64 ? 445 ILE A CA  1 
ATOM   3389  C  C   . ILE A 1 445 ? -43.592 43.537  8.218   1.00 16.45 ? 445 ILE A C   1 
ATOM   3390  O  O   . ILE A 1 445 ? -42.720 42.827  7.711   1.00 15.09 ? 445 ILE A O   1 
ATOM   3391  C  CB  . ILE A 1 445 ? -43.819 43.573  10.721  1.00 14.51 ? 445 ILE A CB  1 
ATOM   3392  C  CG1 . ILE A 1 445 ? -43.277 44.220  12.002  1.00 13.72 ? 445 ILE A CG1 1 
ATOM   3393  C  CG2 . ILE A 1 445 ? -43.399 42.111  10.650  1.00 16.54 ? 445 ILE A CG2 1 
ATOM   3394  C  CD1 . ILE A 1 445 ? -41.758 44.199  12.114  1.00 14.31 ? 445 ILE A CD1 1 
ATOM   3395  N  N   . ARG A 1 446 ? -44.814 43.649  7.702   1.00 16.28 ? 446 ARG A N   1 
ATOM   3396  C  CA  . ARG A 1 446 ? -45.180 42.923  6.489   1.00 18.71 ? 446 ARG A CA  1 
ATOM   3397  C  C   . ARG A 1 446 ? -44.350 43.388  5.299   1.00 17.88 ? 446 ARG A C   1 
ATOM   3398  O  O   . ARG A 1 446 ? -43.968 42.579  4.455   1.00 17.70 ? 446 ARG A O   1 
ATOM   3399  C  CB  . ARG A 1 446 ? -46.666 43.093  6.164   1.00 21.66 ? 446 ARG A CB  1 
ATOM   3400  C  CG  . ARG A 1 446 ? -47.608 42.457  7.165   1.00 27.92 ? 446 ARG A CG  1 
ATOM   3401  C  CD  . ARG A 1 446 ? -48.974 42.207  6.536   1.00 34.39 ? 446 ARG A CD  1 
ATOM   3402  N  NE  . ARG A 1 446 ? -49.980 41.825  7.524   1.00 40.21 ? 446 ARG A NE  1 
ATOM   3403  C  CZ  . ARG A 1 446 ? -50.652 42.689  8.280   1.00 43.32 ? 446 ARG A CZ  1 
ATOM   3404  N  NH1 . ARG A 1 446 ? -50.432 43.993  8.160   1.00 44.69 ? 446 ARG A NH1 1 
ATOM   3405  N  NH2 . ARG A 1 446 ? -51.546 42.250  9.158   1.00 45.05 ? 446 ARG A NH2 1 
ATOM   3406  N  N   . GLU A 1 447 ? -44.081 44.690  5.224   1.00 17.28 ? 447 GLU A N   1 
ATOM   3407  C  CA  . GLU A 1 447 ? -43.275 45.232  4.131   1.00 17.91 ? 447 GLU A CA  1 
ATOM   3408  C  C   . GLU A 1 447 ? -41.894 44.576  4.140   1.00 17.54 ? 447 GLU A C   1 
ATOM   3409  O  O   . GLU A 1 447 ? -41.355 44.218  3.092   1.00 17.64 ? 447 GLU A O   1 
ATOM   3410  C  CB  . GLU A 1 447 ? -43.098 46.748  4.278   1.00 18.48 ? 447 GLU A CB  1 
ATOM   3411  C  CG  . GLU A 1 447 ? -44.388 47.552  4.257   1.00 22.71 ? 447 GLU A CG  1 
ATOM   3412  C  CD  . GLU A 1 447 ? -44.167 49.035  4.524   1.00 24.60 ? 447 GLU A CD  1 
ATOM   3413  O  OE1 . GLU A 1 447 ? -43.120 49.397  5.106   1.00 25.90 ? 447 GLU A OE1 1 
ATOM   3414  O  OE2 . GLU A 1 447 ? -45.051 49.841  4.166   1.00 25.11 ? 447 GLU A OE2 1 
ATOM   3415  N  N   . ALA A 1 448 ? -41.331 44.414  5.334   1.00 15.90 ? 448 ALA A N   1 
ATOM   3416  C  CA  . ALA A 1 448 ? -40.003 43.830  5.487   1.00 14.43 ? 448 ALA A CA  1 
ATOM   3417  C  C   . ALA A 1 448 ? -39.926 42.354  5.104   1.00 13.44 ? 448 ALA A C   1 
ATOM   3418  O  O   . ALA A 1 448 ? -38.890 41.885  4.633   1.00 13.75 ? 448 ALA A O   1 
ATOM   3419  C  CB  . ALA A 1 448 ? -39.513 44.030  6.923   1.00 13.32 ? 448 ALA A CB  1 
ATOM   3420  N  N   . THR A 1 449 ? -41.016 41.623  5.306   1.00 13.39 ? 449 THR A N   1 
ATOM   3421  C  CA  . THR A 1 449 ? -41.047 40.201  4.977   1.00 15.68 ? 449 THR A CA  1 
ATOM   3422  C  C   . THR A 1 449 ? -40.885 39.967  3.476   1.00 17.75 ? 449 THR A C   1 
ATOM   3423  O  O   . THR A 1 449 ? -40.513 38.874  3.046   1.00 18.58 ? 449 THR A O   1 
ATOM   3424  C  CB  . THR A 1 449 ? -42.375 39.557  5.409   1.00 16.11 ? 449 THR A CB  1 
ATOM   3425  O  OG1 . THR A 1 449 ? -43.448 40.135  4.655   1.00 11.99 ? 449 THR A OG1 1 
ATOM   3426  C  CG2 . THR A 1 449 ? -42.624 39.787  6.897   1.00 13.37 ? 449 THR A CG2 1 
ATOM   3427  N  N   . LYS A 1 450 ? -41.167 40.997  2.686   1.00 18.86 ? 450 LYS A N   1 
ATOM   3428  C  CA  . LYS A 1 450 ? -41.070 40.905  1.233   1.00 21.27 ? 450 LYS A CA  1 
ATOM   3429  C  C   . LYS A 1 450 ? -39.654 40.647  0.736   1.00 21.27 ? 450 LYS A C   1 
ATOM   3430  O  O   . LYS A 1 450 ? -39.450 39.905  -0.225  1.00 22.13 ? 450 LYS A O   1 
ATOM   3431  C  CB  . LYS A 1 450 ? -41.603 42.190  0.593   1.00 23.51 ? 450 LYS A CB  1 
ATOM   3432  C  CG  . LYS A 1 450 ? -42.722 41.971  -0.412  1.00 27.92 ? 450 LYS A CG  1 
ATOM   3433  C  CD  . LYS A 1 450 ? -43.970 41.417  0.255   1.00 31.78 ? 450 LYS A CD  1 
ATOM   3434  C  CE  . LYS A 1 450 ? -44.585 42.431  1.203   1.00 34.38 ? 450 LYS A CE  1 
ATOM   3435  N  NZ  . LYS A 1 450 ? -45.826 41.906  1.834   1.00 36.18 ? 450 LYS A NZ  1 
ATOM   3436  N  N   . TRP A 1 451 ? -38.676 41.260  1.391   1.00 20.24 ? 451 TRP A N   1 
ATOM   3437  C  CA  . TRP A 1 451 ? -37.291 41.092  0.985   1.00 18.76 ? 451 TRP A CA  1 
ATOM   3438  C  C   . TRP A 1 451 ? -36.428 40.309  1.973   1.00 17.49 ? 451 TRP A C   1 
ATOM   3439  O  O   . TRP A 1 451 ? -35.256 40.025  1.694   1.00 15.90 ? 451 TRP A O   1 
ATOM   3440  C  CB  . TRP A 1 451 ? -36.660 42.466  0.709   1.00 19.49 ? 451 TRP A CB  1 
ATOM   3441  C  CG  . TRP A 1 451 ? -36.801 43.448  1.825   1.00 21.90 ? 451 TRP A CG  1 
ATOM   3442  C  CD1 . TRP A 1 451 ? -37.769 44.402  1.961   1.00 21.00 ? 451 TRP A CD1 1 
ATOM   3443  C  CD2 . TRP A 1 451 ? -35.960 43.559  2.979   1.00 22.44 ? 451 TRP A CD2 1 
ATOM   3444  N  NE1 . TRP A 1 451 ? -37.582 45.100  3.129   1.00 22.47 ? 451 TRP A NE1 1 
ATOM   3445  C  CE2 . TRP A 1 451 ? -36.479 44.603  3.774   1.00 23.66 ? 451 TRP A CE2 1 
ATOM   3446  C  CE3 . TRP A 1 451 ? -34.816 42.873  3.419   1.00 24.39 ? 451 TRP A CE3 1 
ATOM   3447  C  CZ2 . TRP A 1 451 ? -35.894 44.984  4.989   1.00 23.20 ? 451 TRP A CZ2 1 
ATOM   3448  C  CZ3 . TRP A 1 451 ? -34.233 43.254  4.632   1.00 23.67 ? 451 TRP A CZ3 1 
ATOM   3449  C  CH2 . TRP A 1 451 ? -34.777 44.300  5.400   1.00 22.32 ? 451 TRP A CH2 1 
ATOM   3450  N  N   . SER A 1 452 ? -37.009 39.955  3.114   1.00 16.37 ? 452 SER A N   1 
ATOM   3451  C  CA  . SER A 1 452 ? -36.279 39.216  4.129   1.00 14.88 ? 452 SER A CA  1 
ATOM   3452  C  C   . SER A 1 452 ? -36.926 37.863  4.412   1.00 13.97 ? 452 SER A C   1 
ATOM   3453  O  O   . SER A 1 452 ? -37.904 37.772  5.178   1.00 12.76 ? 452 SER A O   1 
ATOM   3454  C  CB  . SER A 1 452 ? -36.208 40.021  5.428   1.00 14.82 ? 452 SER A CB  1 
ATOM   3455  O  OG  . SER A 1 452 ? -35.526 39.288  6.439   1.00 17.33 ? 452 SER A OG  1 
ATOM   3456  N  N   . PRO A 1 453 ? -36.392 36.778  3.795   1.00 14.50 ? 453 PRO A N   1 
ATOM   3457  C  CA  . PRO A 1 453 ? -36.929 35.419  3.993   1.00 13.31 ? 453 PRO A CA  1 
ATOM   3458  C  C   . PRO A 1 453 ? -36.834 34.983  5.454   1.00 13.16 ? 453 PRO A C   1 
ATOM   3459  O  O   . PRO A 1 453 ? -37.684 34.251  5.964   1.00 12.84 ? 453 PRO A O   1 
ATOM   3460  C  CB  . PRO A 1 453 ? -36.035 34.542  3.100   1.00 15.21 ? 453 PRO A CB  1 
ATOM   3461  C  CG  . PRO A 1 453 ? -35.498 35.514  2.008   1.00 15.85 ? 453 PRO A CG  1 
ATOM   3462  C  CD  . PRO A 1 453 ? -35.212 36.734  2.902   1.00 14.05 ? 453 PRO A CD  1 
ATOM   3463  N  N   . GLU A 1 454 ? -35.792 35.454  6.127   1.00 13.07 ? 454 GLU A N   1 
ATOM   3464  C  CA  . GLU A 1 454 ? -35.587 35.115  7.529   1.00 13.32 ? 454 GLU A CA  1 
ATOM   3465  C  C   . GLU A 1 454 ? -36.716 35.670  8.384   1.00 13.32 ? 454 GLU A C   1 
ATOM   3466  O  O   . GLU A 1 454 ? -37.245 34.974  9.249   1.00 13.26 ? 454 GLU A O   1 
ATOM   3467  C  CB  . GLU A 1 454 ? -34.254 35.666  8.031   1.00 14.08 ? 454 GLU A CB  1 
ATOM   3468  C  CG  . GLU A 1 454 ? -33.014 34.981  7.472   1.00 14.54 ? 454 GLU A CG  1 
ATOM   3469  C  CD  . GLU A 1 454 ? -32.767 35.275  6.009   1.00 15.89 ? 454 GLU A CD  1 
ATOM   3470  O  OE1 . GLU A 1 454 ? -33.063 36.403  5.559   1.00 17.03 ? 454 GLU A OE1 1 
ATOM   3471  O  OE2 . GLU A 1 454 ? -32.254 34.376  5.315   1.00 16.40 ? 454 GLU A OE2 1 
ATOM   3472  N  N   . LEU A 1 455 ? -37.089 36.921  8.134   1.00 11.31 ? 455 LEU A N   1 
ATOM   3473  C  CA  . LEU A 1 455 ? -38.168 37.536  8.887   1.00 11.50 ? 455 LEU A CA  1 
ATOM   3474  C  C   . LEU A 1 455 ? -39.511 36.901  8.523   1.00 12.14 ? 455 LEU A C   1 
ATOM   3475  O  O   . LEU A 1 455 ? -40.352 36.662  9.392   1.00 11.10 ? 455 LEU A O   1 
ATOM   3476  C  CB  . LEU A 1 455 ? -38.222 39.045  8.624   1.00 11.25 ? 455 LEU A CB  1 
ATOM   3477  C  CG  . LEU A 1 455 ? -39.409 39.775  9.271   1.00 11.17 ? 455 LEU A CG  1 
ATOM   3478  C  CD1 . LEU A 1 455 ? -39.345 39.600  10.785  1.00 10.32 ? 455 LEU A CD1 1 
ATOM   3479  C  CD2 . LEU A 1 455 ? -39.391 41.254  8.894   1.00 10.63 ? 455 LEU A CD2 1 
ATOM   3480  N  N   . ALA A 1 456 ? -39.708 36.631  7.234   1.00 12.69 ? 456 ALA A N   1 
ATOM   3481  C  CA  . ALA A 1 456 ? -40.950 36.022  6.765   1.00 11.90 ? 456 ALA A CA  1 
ATOM   3482  C  C   . ALA A 1 456 ? -41.224 34.703  7.487   1.00 11.23 ? 456 ALA A C   1 
ATOM   3483  O  O   . ALA A 1 456 ? -42.348 34.449  7.925   1.00 13.58 ? 456 ALA A O   1 
ATOM   3484  C  CB  . ALA A 1 456 ? -40.889 35.794  5.254   1.00 9.01  ? 456 ALA A CB  1 
ATOM   3485  N  N   . ALA A 1 457 ? -40.195 33.870  7.616   1.00 9.80  ? 457 ALA A N   1 
ATOM   3486  C  CA  . ALA A 1 457 ? -40.332 32.580  8.283   1.00 9.52  ? 457 ALA A CA  1 
ATOM   3487  C  C   . ALA A 1 457 ? -40.718 32.752  9.751   1.00 12.24 ? 457 ALA A C   1 
ATOM   3488  O  O   . ALA A 1 457 ? -41.531 31.989  10.282  1.00 13.44 ? 457 ALA A O   1 
ATOM   3489  C  CB  . ALA A 1 457 ? -39.022 31.790  8.175   1.00 9.59  ? 457 ALA A CB  1 
ATOM   3490  N  N   . ALA A 1 458 ? -40.140 33.758  10.402  1.00 11.69 ? 458 ALA A N   1 
ATOM   3491  C  CA  . ALA A 1 458 ? -40.424 34.030  11.809  1.00 12.35 ? 458 ALA A CA  1 
ATOM   3492  C  C   . ALA A 1 458 ? -41.859 34.511  12.011  1.00 13.35 ? 458 ALA A C   1 
ATOM   3493  O  O   . ALA A 1 458 ? -42.547 34.077  12.938  1.00 14.77 ? 458 ALA A O   1 
ATOM   3494  C  CB  . ALA A 1 458 ? -39.447 35.073  12.342  1.00 11.42 ? 458 ALA A CB  1 
ATOM   3495  N  N   . CYS A 1 459 ? -42.305 35.411  11.143  1.00 13.03 ? 459 CYS A N   1 
ATOM   3496  C  CA  . CYS A 1 459 ? -43.656 35.955  11.233  1.00 14.45 ? 459 CYS A CA  1 
ATOM   3497  C  C   . CYS A 1 459 ? -44.735 34.892  11.126  1.00 15.08 ? 459 CYS A C   1 
ATOM   3498  O  O   . CYS A 1 459 ? -45.734 34.942  11.836  1.00 14.45 ? 459 CYS A O   1 
ATOM   3499  C  CB  . CYS A 1 459 ? -43.881 36.995  10.140  1.00 12.51 ? 459 CYS A CB  1 
ATOM   3500  S  SG  . CYS A 1 459 ? -42.994 38.519  10.421  1.00 13.03 ? 459 CYS A SG  1 
ATOM   3501  N  N   . GLU A 1 460 ? -44.526 33.938  10.228  1.00 17.69 ? 460 GLU A N   1 
ATOM   3502  C  CA  . GLU A 1 460 ? -45.472 32.852  9.998   1.00 19.55 ? 460 GLU A CA  1 
ATOM   3503  C  C   . GLU A 1 460 ? -45.683 31.979  11.235  1.00 19.32 ? 460 GLU A C   1 
ATOM   3504  O  O   . GLU A 1 460 ? -46.791 31.516  11.499  1.00 19.14 ? 460 GLU A O   1 
ATOM   3505  C  CB  . GLU A 1 460 ? -44.969 31.977  8.851   1.00 23.90 ? 460 GLU A CB  1 
ATOM   3506  C  CG  . GLU A 1 460 ? -45.913 30.864  8.445   1.00 32.76 ? 460 GLU A CG  1 
ATOM   3507  C  CD  . GLU A 1 460 ? -45.173 29.596  8.053   1.00 37.72 ? 460 GLU A CD  1 
ATOM   3508  O  OE1 . GLU A 1 460 ? -44.747 28.843  8.961   1.00 41.65 ? 460 GLU A OE1 1 
ATOM   3509  O  OE2 . GLU A 1 460 ? -45.004 29.359  6.837   1.00 40.87 ? 460 GLU A OE2 1 
ATOM   3510  N  N   . VAL A 1 461 ? -44.613 31.754  11.989  1.00 17.14 ? 461 VAL A N   1 
ATOM   3511  C  CA  . VAL A 1 461 ? -44.680 30.913  13.176  1.00 16.26 ? 461 VAL A CA  1 
ATOM   3512  C  C   . VAL A 1 461 ? -45.396 31.534  14.373  1.00 15.72 ? 461 VAL A C   1 
ATOM   3513  O  O   . VAL A 1 461 ? -46.159 30.856  15.058  1.00 15.63 ? 461 VAL A O   1 
ATOM   3514  C  CB  . VAL A 1 461 ? -43.259 30.494  13.633  1.00 16.29 ? 461 VAL A CB  1 
ATOM   3515  C  CG1 . VAL A 1 461 ? -43.348 29.611  14.868  1.00 16.02 ? 461 VAL A CG1 1 
ATOM   3516  C  CG2 . VAL A 1 461 ? -42.542 29.762  12.508  1.00 15.21 ? 461 VAL A CG2 1 
ATOM   3517  N  N   . TRP A 1 462 ? -45.169 32.823  14.610  1.00 14.39 ? 462 TRP A N   1 
ATOM   3518  C  CA  . TRP A 1 462 ? -45.752 33.496  15.769  1.00 14.89 ? 462 TRP A CA  1 
ATOM   3519  C  C   . TRP A 1 462 ? -46.845 34.542  15.533  1.00 17.04 ? 462 TRP A C   1 
ATOM   3520  O  O   . TRP A 1 462 ? -47.158 35.305  16.441  1.00 16.64 ? 462 TRP A O   1 
ATOM   3521  C  CB  . TRP A 1 462 ? -44.623 34.148  16.586  1.00 13.05 ? 462 TRP A CB  1 
ATOM   3522  C  CG  . TRP A 1 462 ? -43.605 33.169  17.115  1.00 11.36 ? 462 TRP A CG  1 
ATOM   3523  C  CD1 . TRP A 1 462 ? -43.845 32.106  17.937  1.00 11.95 ? 462 TRP A CD1 1 
ATOM   3524  C  CD2 . TRP A 1 462 ? -42.192 33.163  16.852  1.00 11.35 ? 462 TRP A CD2 1 
ATOM   3525  N  NE1 . TRP A 1 462 ? -42.674 31.436  18.199  1.00 11.28 ? 462 TRP A NE1 1 
ATOM   3526  C  CE2 . TRP A 1 462 ? -41.645 32.062  17.548  1.00 9.42  ? 462 TRP A CE2 1 
ATOM   3527  C  CE3 . TRP A 1 462 ? -41.336 33.977  16.097  1.00 10.92 ? 462 TRP A CE3 1 
ATOM   3528  C  CZ2 . TRP A 1 462 ? -40.278 31.754  17.512  1.00 11.17 ? 462 TRP A CZ2 1 
ATOM   3529  C  CZ3 . TRP A 1 462 ? -39.971 33.669  16.061  1.00 12.04 ? 462 TRP A CZ3 1 
ATOM   3530  C  CH2 . TRP A 1 462 ? -39.460 32.565  16.765  1.00 10.10 ? 462 TRP A CH2 1 
ATOM   3531  N  N   . LYS A 1 463 ? -47.444 34.578  14.348  1.00 20.42 ? 463 LYS A N   1 
ATOM   3532  C  CA  . LYS A 1 463 ? -48.463 35.590  14.072  1.00 24.73 ? 463 LYS A CA  1 
ATOM   3533  C  C   . LYS A 1 463 ? -49.732 35.569  14.932  1.00 25.95 ? 463 LYS A C   1 
ATOM   3534  O  O   . LYS A 1 463 ? -50.376 36.603  15.105  1.00 26.84 ? 463 LYS A O   1 
ATOM   3535  C  CB  . LYS A 1 463 ? -48.855 35.558  12.591  1.00 27.40 ? 463 LYS A CB  1 
ATOM   3536  C  CG  . LYS A 1 463 ? -49.568 34.303  12.134  1.00 31.88 ? 463 LYS A CG  1 
ATOM   3537  C  CD  . LYS A 1 463 ? -49.898 34.378  10.639  1.00 35.55 ? 463 LYS A CD  1 
ATOM   3538  C  CE  . LYS A 1 463 ? -50.946 35.443  10.300  1.00 37.71 ? 463 LYS A CE  1 
ATOM   3539  N  NZ  . LYS A 1 463 ? -50.536 36.826  10.684  1.00 38.64 ? 463 LYS A NZ  1 
ATOM   3540  N  N   . GLU A 1 464 ? -50.101 34.416  15.477  1.00 27.51 ? 464 GLU A N   1 
ATOM   3541  C  CA  . GLU A 1 464 ? -51.315 34.348  16.293  1.00 29.63 ? 464 GLU A CA  1 
ATOM   3542  C  C   . GLU A 1 464 ? -51.026 34.396  17.794  1.00 27.98 ? 464 GLU A C   1 
ATOM   3543  O  O   . GLU A 1 464 ? -51.949 34.393  18.613  1.00 27.64 ? 464 GLU A O   1 
ATOM   3544  C  CB  . GLU A 1 464 ? -52.087 33.064  15.972  1.00 33.27 ? 464 GLU A CB  1 
ATOM   3545  C  CG  . GLU A 1 464 ? -52.241 32.786  14.482  1.00 38.87 ? 464 GLU A CG  1 
ATOM   3546  C  CD  . GLU A 1 464 ? -53.173 33.760  13.783  1.00 42.23 ? 464 GLU A CD  1 
ATOM   3547  O  OE1 . GLU A 1 464 ? -53.454 34.836  14.351  1.00 44.08 ? 464 GLU A OE1 1 
ATOM   3548  O  OE2 . GLU A 1 464 ? -53.617 33.453  12.653  1.00 45.42 ? 464 GLU A OE2 1 
ATOM   3549  N  N   . ILE A 1 465 ? -49.746 34.458  18.148  1.00 24.81 ? 465 ILE A N   1 
ATOM   3550  C  CA  . ILE A 1 465 ? -49.342 34.470  19.548  1.00 22.11 ? 465 ILE A CA  1 
ATOM   3551  C  C   . ILE A 1 465 ? -49.416 35.834  20.224  1.00 21.35 ? 465 ILE A C   1 
ATOM   3552  O  O   . ILE A 1 465 ? -48.744 36.785  19.823  1.00 19.78 ? 465 ILE A O   1 
ATOM   3553  C  CB  . ILE A 1 465 ? -47.917 33.906  19.696  1.00 20.85 ? 465 ILE A CB  1 
ATOM   3554  C  CG1 . ILE A 1 465 ? -47.837 32.535  19.019  1.00 21.35 ? 465 ILE A CG1 1 
ATOM   3555  C  CG2 . ILE A 1 465 ? -47.556 33.778  21.170  1.00 21.30 ? 465 ILE A CG2 1 
ATOM   3556  C  CD1 . ILE A 1 465 ? -48.854 31.522  19.548  1.00 19.49 ? 465 ILE A CD1 1 
ATOM   3557  N  N   . LYS A 1 466 ? -50.238 35.910  21.264  1.00 19.91 ? 466 LYS A N   1 
ATOM   3558  C  CA  . LYS A 1 466 ? -50.431 37.142  22.022  1.00 21.21 ? 466 LYS A CA  1 
ATOM   3559  C  C   . LYS A 1 466 ? -50.638 36.764  23.493  1.00 20.39 ? 466 LYS A C   1 
ATOM   3560  O  O   . LYS A 1 466 ? -51.116 35.671  23.793  1.00 19.33 ? 466 LYS A O   1 
ATOM   3561  C  CB  . LYS A 1 466 ? -51.664 37.879  21.481  1.00 23.67 ? 466 LYS A CB  1 
ATOM   3562  C  CG  . LYS A 1 466 ? -51.916 39.258  22.065  1.00 29.32 ? 466 LYS A CG  1 
ATOM   3563  C  CD  . LYS A 1 466 ? -50.959 40.308  21.509  1.00 33.83 ? 466 LYS A CD  1 
ATOM   3564  C  CE  . LYS A 1 466 ? -51.218 41.671  22.153  1.00 35.38 ? 466 LYS A CE  1 
ATOM   3565  N  NZ  . LYS A 1 466 ? -50.183 42.686  21.806  1.00 35.95 ? 466 LYS A NZ  1 
ATOM   3566  N  N   . PHE A 1 467 ? -50.267 37.659  24.404  1.00 20.13 ? 467 PHE A N   1 
ATOM   3567  C  CA  . PHE A 1 467 ? -50.424 37.410  25.837  1.00 21.43 ? 467 PHE A CA  1 
ATOM   3568  C  C   . PHE A 1 467 ? -51.303 38.488  26.455  1.00 23.94 ? 467 PHE A C   1 
ATOM   3569  O  O   . PHE A 1 467 ? -50.827 39.577  26.774  1.00 24.64 ? 467 PHE A O   1 
ATOM   3570  C  CB  . PHE A 1 467 ? -49.059 37.411  26.530  1.00 19.59 ? 467 PHE A CB  1 
ATOM   3571  C  CG  . PHE A 1 467 ? -48.139 36.320  26.060  1.00 17.17 ? 467 PHE A CG  1 
ATOM   3572  C  CD1 . PHE A 1 467 ? -48.286 35.016  26.527  1.00 16.99 ? 467 PHE A CD1 1 
ATOM   3573  C  CD2 . PHE A 1 467 ? -47.136 36.592  25.138  1.00 15.81 ? 467 PHE A CD2 1 
ATOM   3574  C  CE1 . PHE A 1 467 ? -47.441 33.998  26.081  1.00 14.68 ? 467 PHE A CE1 1 
ATOM   3575  C  CE2 . PHE A 1 467 ? -46.289 35.584  24.686  1.00 16.41 ? 467 PHE A CE2 1 
ATOM   3576  C  CZ  . PHE A 1 467 ? -46.441 34.285  25.157  1.00 15.05 ? 467 PHE A CZ  1 
ATOM   3577  N  N   . GLU A 1 468 ? -52.586 38.185  26.621  1.00 26.59 ? 468 GLU A N   1 
ATOM   3578  C  CA  . GLU A 1 468 ? -53.514 39.147  27.197  1.00 29.62 ? 468 GLU A CA  1 
ATOM   3579  C  C   . GLU A 1 468 ? -54.289 38.570  28.372  1.00 29.84 ? 468 GLU A C   1 
ATOM   3580  O  O   . GLU A 1 468 ? -55.124 37.681  28.207  1.00 29.04 ? 468 GLU A O   1 
ATOM   3581  C  CB  . GLU A 1 468 ? -54.485 39.654  26.130  1.00 32.57 ? 468 GLU A CB  1 
ATOM   3582  C  CG  . GLU A 1 468 ? -53.802 40.384  24.979  1.00 37.74 ? 468 GLU A CG  1 
ATOM   3583  C  CD  . GLU A 1 468 ? -54.792 41.053  24.045  1.00 41.28 ? 468 GLU A CD  1 
ATOM   3584  O  OE1 . GLU A 1 468 ? -55.477 42.004  24.484  1.00 44.51 ? 468 GLU A OE1 1 
ATOM   3585  O  OE2 . GLU A 1 468 ? -54.887 40.626  22.875  1.00 42.61 ? 468 GLU A OE2 1 
ATOM   3586  N  N   . PHE A 1 469 ? -53.993 39.094  29.557  1.00 30.53 ? 469 PHE A N   1 
ATOM   3587  C  CA  . PHE A 1 469 ? -54.627 38.675  30.805  1.00 31.69 ? 469 PHE A CA  1 
ATOM   3588  C  C   . PHE A 1 469 ? -54.803 39.905  31.693  1.00 33.32 ? 469 PHE A C   1 
ATOM   3589  O  O   . PHE A 1 469 ? -54.107 40.906  31.522  1.00 33.52 ? 469 PHE A O   1 
ATOM   3590  C  CB  . PHE A 1 469 ? -53.738 37.676  31.547  1.00 29.81 ? 469 PHE A CB  1 
ATOM   3591  C  CG  . PHE A 1 469 ? -53.655 36.323  30.901  1.00 28.73 ? 469 PHE A CG  1 
ATOM   3592  C  CD1 . PHE A 1 469 ? -54.669 35.387  31.084  1.00 27.62 ? 469 PHE A CD1 1 
ATOM   3593  C  CD2 . PHE A 1 469 ? -52.542 35.969  30.145  1.00 27.72 ? 469 PHE A CD2 1 
ATOM   3594  C  CE1 . PHE A 1 469 ? -54.572 34.113  30.526  1.00 27.34 ? 469 PHE A CE1 1 
ATOM   3595  C  CE2 . PHE A 1 469 ? -52.436 34.695  29.580  1.00 28.28 ? 469 PHE A CE2 1 
ATOM   3596  C  CZ  . PHE A 1 469 ? -53.454 33.767  29.774  1.00 27.39 ? 469 PHE A CZ  1 
ATOM   3597  N  N   . PRO A 1 470 ? -55.741 39.846  32.653  1.00 34.97 ? 470 PRO A N   1 
ATOM   3598  C  CA  . PRO A 1 470 ? -55.971 40.979  33.556  1.00 35.28 ? 470 PRO A CA  1 
ATOM   3599  C  C   . PRO A 1 470 ? -54.746 41.196  34.448  1.00 36.02 ? 470 PRO A C   1 
ATOM   3600  O  O   . PRO A 1 470 ? -54.135 40.234  34.912  1.00 35.23 ? 470 PRO A O   1 
ATOM   3601  C  CB  . PRO A 1 470 ? -57.196 40.539  34.354  1.00 35.83 ? 470 PRO A CB  1 
ATOM   3602  C  CG  . PRO A 1 470 ? -57.937 39.671  33.374  1.00 35.78 ? 470 PRO A CG  1 
ATOM   3603  C  CD  . PRO A 1 470 ? -56.817 38.848  32.785  1.00 35.44 ? 470 PRO A CD  1 
ATOM   3604  N  N   . ALA A 1 471 ? -54.395 42.457  34.686  1.00 36.51 ? 471 ALA A N   1 
ATOM   3605  C  CA  . ALA A 1 471 ? -53.235 42.796  35.507  1.00 36.96 ? 471 ALA A CA  1 
ATOM   3606  C  C   . ALA A 1 471 ? -53.563 42.939  36.994  1.00 37.86 ? 471 ALA A C   1 
ATOM   3607  O  O   . ALA A 1 471 ? -54.612 43.474  37.361  1.00 37.68 ? 471 ALA A O   1 
ATOM   3608  C  CB  . ALA A 1 471 ? -52.605 44.080  34.993  1.00 36.25 ? 471 ALA A CB  1 
ATOM   3609  N  N   . MET A 1 472 ? -52.653 42.456  37.840  1.00 38.13 ? 472 MET A N   1 
ATOM   3610  C  CA  . MET A 1 472 ? -52.817 42.526  39.289  1.00 39.08 ? 472 MET A CA  1 
ATOM   3611  C  C   . MET A 1 472 ? -52.299 43.867  39.802  1.00 40.06 ? 472 MET A C   1 
ATOM   3612  O  O   . MET A 1 472 ? -52.954 44.533  40.599  1.00 39.84 ? 472 MET A O   1 
ATOM   3613  C  CB  . MET A 1 472 ? -52.043 41.393  39.973  1.00 38.52 ? 472 MET A CB  1 
ATOM   3614  C  CG  . MET A 1 472 ? -52.423 39.989  39.524  1.00 38.33 ? 472 MET A CG  1 
ATOM   3615  S  SD  . MET A 1 472 ? -54.162 39.578  39.797  1.00 40.61 ? 472 MET A SD  1 
ATOM   3616  C  CE  . MET A 1 472 ? -54.766 39.557  38.109  1.00 37.38 ? 472 MET A CE  1 
ATOM   3617  N  N   . ASP A 1 473 ? -51.115 44.254  39.340  1.00 41.11 ? 473 ASP A N   1 
ATOM   3618  C  CA  . ASP A 1 473 ? -50.502 45.514  39.744  1.00 42.47 ? 473 ASP A CA  1 
ATOM   3619  C  C   . ASP A 1 473 ? -51.043 46.637  38.860  1.00 44.28 ? 473 ASP A C   1 
ATOM   3620  O  O   . ASP A 1 473 ? -50.670 46.754  37.691  1.00 43.77 ? 473 ASP A O   1 
ATOM   3621  C  CB  . ASP A 1 473 ? -48.979 45.412  39.609  1.00 41.90 ? 473 ASP A CB  1 
ATOM   3622  C  CG  . ASP A 1 473 ? -48.267 46.702  39.973  1.00 40.86 ? 473 ASP A CG  1 
ATOM   3623  O  OD1 . ASP A 1 473 ? -48.517 47.223  41.079  1.00 38.63 ? 473 ASP A OD1 1 
ATOM   3624  O  OD2 . ASP A 1 473 ? -47.453 47.188  39.157  1.00 39.40 ? 473 ASP A OD2 1 
ATOM   3625  N  N   . THR A 1 474 ? -51.917 47.464  39.425  1.00 46.08 ? 474 THR A N   1 
ATOM   3626  C  CA  . THR A 1 474 ? -52.521 48.553  38.671  1.00 48.38 ? 474 THR A CA  1 
ATOM   3627  C  C   . THR A 1 474 ? -52.527 49.870  39.447  1.00 49.97 ? 474 THR A C   1 
ATOM   3628  O  O   . THR A 1 474 ? -52.393 49.873  40.667  1.00 49.82 ? 474 THR A O   1 
ATOM   3629  C  CB  . THR A 1 474 ? -53.965 48.179  38.272  1.00 48.23 ? 474 THR A CB  1 
ATOM   3630  O  OG1 . THR A 1 474 ? -54.306 48.862  37.064  1.00 48.75 ? 474 THR A OG1 1 
ATOM   3631  C  CG2 . THR A 1 474 ? -54.961 48.572  39.364  1.00 47.17 ? 474 THR A CG2 1 
ATOM   3632  N  N   . VAL A 1 475 ? -52.670 50.982  38.731  1.00 52.03 ? 475 VAL A N   1 
ATOM   3633  C  CA  . VAL A 1 475 ? -52.705 52.307  39.343  1.00 54.77 ? 475 VAL A CA  1 
ATOM   3634  C  C   . VAL A 1 475 ? -54.158 52.617  39.731  1.00 56.28 ? 475 VAL A C   1 
ATOM   3635  O  O   . VAL A 1 475 ? -54.504 53.790  39.982  1.00 57.67 ? 475 VAL A O   1 
ATOM   3636  C  CB  . VAL A 1 475 ? -52.110 53.362  38.341  1.00 54.78 ? 475 VAL A CB  1 
ATOM   3637  C  CG1 . VAL A 1 475 ? -52.862 54.676  38.378  1.00 55.25 ? 475 VAL A CG1 1 
ATOM   3638  C  CG2 . VAL A 1 475 ? -50.659 53.613  38.682  1.00 56.13 ? 475 VAL A CG2 1 
ATOM   3639  O  OXT . VAL A 1 475 ? -54.946 51.651  39.813  1.00 57.27 ? 475 VAL A OXT 1 
HETATM 3640  N  N   . MME B 2 1   ? -35.076 26.090  4.006   1.00 27.74 ? 1   MME S N   1 
HETATM 3641  C  CA  . MME B 2 1   ? -34.136 26.455  5.065   1.00 26.26 ? 1   MME S CA  1 
HETATM 3642  C  C   . MME B 2 1   ? -32.866 27.024  4.437   1.00 25.34 ? 1   MME S C   1 
HETATM 3643  O  O   . MME B 2 1   ? -32.164 26.333  3.700   1.00 25.39 ? 1   MME S O   1 
HETATM 3644  C  CB  . MME B 2 1   ? -33.798 25.222  5.910   1.00 28.03 ? 1   MME S CB  1 
HETATM 3645  C  CG  . MME B 2 1   ? -33.251 25.529  7.295   1.00 30.52 ? 1   MME S CG  1 
HETATM 3646  S  SD  . MME B 2 1   ? -33.058 24.034  8.303   1.00 33.84 ? 1   MME S SD  1 
HETATM 3647  C  CE  . MME B 2 1   ? -34.740 23.713  8.769   1.00 32.52 ? 1   MME S CE  1 
HETATM 3648  C  CM  . MME B 2 1   ? -35.550 26.988  3.146   1.00 27.67 ? 1   MME S CM  1 
ATOM   3649  N  N   . LYS B 2 2   ? -32.584 28.289  4.725   1.00 22.86 ? 2   LYS S N   1 
ATOM   3650  C  CA  . LYS B 2 2   ? -31.405 28.948  4.180   1.00 21.96 ? 2   LYS S CA  1 
ATOM   3651  C  C   . LYS B 2 2   ? -30.347 29.161  5.251   1.00 19.42 ? 2   LYS S C   1 
ATOM   3652  O  O   . LYS B 2 2   ? -30.671 29.438  6.402   1.00 18.44 ? 2   LYS S O   1 
ATOM   3653  C  CB  . LYS B 2 2   ? -31.791 30.298  3.578   1.00 24.18 ? 2   LYS S CB  1 
ATOM   3654  C  CG  . LYS B 2 2   ? -32.747 30.203  2.403   1.00 28.91 ? 2   LYS S CG  1 
ATOM   3655  C  CD  . LYS B 2 2   ? -33.017 31.580  1.818   1.00 31.99 ? 2   LYS S CD  1 
ATOM   3656  C  CE  . LYS B 2 2   ? -31.724 32.266  1.389   1.00 35.00 ? 2   LYS S CE  1 
ATOM   3657  N  NZ  . LYS B 2 2   ? -31.956 33.671  0.933   1.00 38.62 ? 2   LYS S NZ  1 
ATOM   3658  N  N   . VAL B 2 3   ? -29.084 29.029  4.859   1.00 17.16 ? 3   VAL S N   1 
ATOM   3659  C  CA  . VAL B 2 3   ? -27.962 29.203  5.771   1.00 15.70 ? 3   VAL S CA  1 
ATOM   3660  C  C   . VAL B 2 3   ? -27.410 30.617  5.620   1.00 14.76 ? 3   VAL S C   1 
ATOM   3661  O  O   . VAL B 2 3   ? -27.087 31.040  4.512   1.00 14.35 ? 3   VAL S O   1 
ATOM   3662  C  CB  . VAL B 2 3   ? -26.836 28.190  5.460   1.00 14.57 ? 3   VAL S CB  1 
ATOM   3663  C  CG1 . VAL B 2 3   ? -25.687 28.369  6.440   1.00 12.58 ? 3   VAL S CG1 1 
ATOM   3664  C  CG2 . VAL B 2 3   ? -27.382 26.772  5.528   1.00 14.69 ? 3   VAL S CG2 1 
ATOM   3665  N  N   . TRP B 2 4   ? -27.310 31.344  6.731   1.00 12.62 ? 4   TRP S N   1 
ATOM   3666  C  CA  . TRP B 2 4   ? -26.795 32.710  6.708   1.00 12.71 ? 4   TRP S CA  1 
ATOM   3667  C  C   . TRP B 2 4   ? -25.313 32.679  6.326   1.00 13.05 ? 4   TRP S C   1 
ATOM   3668  O  O   . TRP B 2 4   ? -24.515 31.983  6.953   1.00 11.98 ? 4   TRP S O   1 
ATOM   3669  C  CB  . TRP B 2 4   ? -26.985 33.370  8.079   1.00 11.60 ? 4   TRP S CB  1 
ATOM   3670  C  CG  . TRP B 2 4   ? -26.733 34.848  8.075   1.00 12.10 ? 4   TRP S CG  1 
ATOM   3671  C  CD1 . TRP B 2 4   ? -25.700 35.503  8.679   1.00 11.64 ? 4   TRP S CD1 1 
ATOM   3672  C  CD2 . TRP B 2 4   ? -27.510 35.854  7.410   1.00 10.91 ? 4   TRP S CD2 1 
ATOM   3673  N  NE1 . TRP B 2 4   ? -25.783 36.853  8.433   1.00 12.40 ? 4   TRP S NE1 1 
ATOM   3674  C  CE2 . TRP B 2 4   ? -26.884 37.097  7.651   1.00 11.23 ? 4   TRP S CE2 1 
ATOM   3675  C  CE3 . TRP B 2 4   ? -28.675 35.826  6.625   1.00 11.48 ? 4   TRP S CE3 1 
ATOM   3676  C  CZ2 . TRP B 2 4   ? -27.381 38.305  7.143   1.00 9.83  ? 4   TRP S CZ2 1 
ATOM   3677  C  CZ3 . TRP B 2 4   ? -29.172 37.032  6.117   1.00 11.08 ? 4   TRP S CZ3 1 
ATOM   3678  C  CH2 . TRP B 2 4   ? -28.521 38.252  6.378   1.00 10.48 ? 4   TRP S CH2 1 
ATOM   3679  N  N   . PRO B 2 5   ? -24.928 33.445  5.291   1.00 13.59 ? 5   PRO S N   1 
ATOM   3680  C  CA  . PRO B 2 5   ? -23.554 33.532  4.780   1.00 13.27 ? 5   PRO S CA  1 
ATOM   3681  C  C   . PRO B 2 5   ? -22.489 33.938  5.797   1.00 13.22 ? 5   PRO S C   1 
ATOM   3682  O  O   . PRO B 2 5   ? -22.767 34.678  6.741   1.00 12.85 ? 5   PRO S O   1 
ATOM   3683  C  CB  . PRO B 2 5   ? -23.673 34.548  3.642   1.00 13.02 ? 5   PRO S CB  1 
ATOM   3684  C  CG  . PRO B 2 5   ? -25.095 34.397  3.190   1.00 14.65 ? 5   PRO S CG  1 
ATOM   3685  C  CD  . PRO B 2 5   ? -25.826 34.309  4.502   1.00 14.05 ? 5   PRO S CD  1 
ATOM   3686  N  N   . THR B 2 6   ? -21.267 33.452  5.587   1.00 14.42 ? 6   THR S N   1 
ATOM   3687  C  CA  . THR B 2 6   ? -20.136 33.766  6.463   1.00 15.91 ? 6   THR S CA  1 
ATOM   3688  C  C   . THR B 2 6   ? -19.095 34.642  5.762   1.00 17.65 ? 6   THR S C   1 
ATOM   3689  O  O   . THR B 2 6   ? -18.364 35.390  6.412   1.00 18.09 ? 6   THR S O   1 
ATOM   3690  C  CB  . THR B 2 6   ? -19.407 32.490  6.940   1.00 16.77 ? 6   THR S CB  1 
ATOM   3691  O  OG1 . THR B 2 6   ? -18.962 31.740  5.802   1.00 15.88 ? 6   THR S OG1 1 
ATOM   3692  C  CG2 . THR B 2 6   ? -20.325 31.629  7.801   1.00 15.18 ? 6   THR S CG2 1 
ATOM   3693  N  N   . GLN B 2 7   ? -19.038 34.546  4.437   1.00 20.16 ? 7   GLN S N   1 
ATOM   3694  C  CA  . GLN B 2 7   ? -18.070 35.298  3.632   1.00 22.99 ? 7   GLN S CA  1 
ATOM   3695  C  C   . GLN B 2 7   ? -18.484 36.725  3.296   1.00 22.47 ? 7   GLN S C   1 
ATOM   3696  O  O   . GLN B 2 7   ? -19.637 36.985  2.962   1.00 23.77 ? 7   GLN S O   1 
ATOM   3697  C  CB  . GLN B 2 7   ? -17.797 34.548  2.325   1.00 25.48 ? 7   GLN S CB  1 
ATOM   3698  C  CG  . GLN B 2 7   ? -17.141 33.195  2.509   1.00 30.14 ? 7   GLN S CG  1 
ATOM   3699  C  CD  . GLN B 2 7   ? -17.146 32.360  1.245   1.00 33.94 ? 7   GLN S CD  1 
ATOM   3700  O  OE1 . GLN B 2 7   ? -18.179 31.806  0.857   1.00 33.06 ? 7   GLN S OE1 1 
ATOM   3701  N  NE2 . GLN B 2 7   ? -15.994 32.273  0.587   1.00 34.48 ? 7   GLN S NE2 1 
ATOM   3702  N  N   . ASN B 2 8   ? -17.521 37.638  3.378   1.00 23.70 ? 8   ASN S N   1 
ATOM   3703  C  CA  . ASN B 2 8   ? -17.738 39.048  3.072   1.00 25.17 ? 8   ASN S CA  1 
ATOM   3704  C  C   . ASN B 2 8   ? -19.110 39.528  3.526   1.00 23.87 ? 8   ASN S C   1 
ATOM   3705  O  O   . ASN B 2 8   ? -19.879 40.066  2.734   1.00 24.15 ? 8   ASN S O   1 
ATOM   3706  C  CB  . ASN B 2 8   ? -17.586 39.275  1.567   1.00 29.06 ? 8   ASN S CB  1 
ATOM   3707  C  CG  . ASN B 2 8   ? -16.321 38.645  1.011   1.00 32.93 ? 8   ASN S CG  1 
ATOM   3708  O  OD1 . ASN B 2 8   ? -16.376 37.778  0.137   1.00 35.85 ? 8   ASN S OD1 1 
ATOM   3709  N  ND2 . ASN B 2 8   ? -15.172 39.073  1.523   1.00 34.67 ? 8   ASN S ND2 1 
ATOM   3710  N  N   . MET B 2 9   ? -19.410 39.328  4.806   1.00 23.23 ? 9   MET S N   1 
ATOM   3711  C  CA  . MET B 2 9   ? -20.690 39.733  5.373   1.00 22.16 ? 9   MET S CA  1 
ATOM   3712  C  C   . MET B 2 9   ? -20.520 40.766  6.482   1.00 20.63 ? 9   MET S C   1 
ATOM   3713  O  O   . MET B 2 9   ? -21.334 40.838  7.404   1.00 20.62 ? 9   MET S O   1 
ATOM   3714  C  CB  . MET B 2 9   ? -21.424 38.508  5.921   1.00 23.42 ? 9   MET S CB  1 
ATOM   3715  C  CG  . MET B 2 9   ? -22.050 37.630  4.854   1.00 24.48 ? 9   MET S CG  1 
ATOM   3716  S  SD  . MET B 2 9   ? -23.418 38.473  4.046   1.00 26.69 ? 9   MET S SD  1 
ATOM   3717  C  CE  . MET B 2 9   ? -24.625 38.426  5.348   1.00 28.06 ? 9   MET S CE  1 
ATOM   3718  N  N   . LYS B 2 10  ? -19.457 41.560  6.393   1.00 18.28 ? 10  LYS S N   1 
ATOM   3719  C  CA  . LYS B 2 10  ? -19.186 42.595  7.385   1.00 16.76 ? 10  LYS S CA  1 
ATOM   3720  C  C   . LYS B 2 10  ? -20.367 43.546  7.477   1.00 15.12 ? 10  LYS S C   1 
ATOM   3721  O  O   . LYS B 2 10  ? -20.956 43.911  6.462   1.00 13.80 ? 10  LYS S O   1 
ATOM   3722  C  CB  . LYS B 2 10  ? -17.932 43.384  7.005   1.00 17.71 ? 10  LYS S CB  1 
ATOM   3723  C  CG  . LYS B 2 10  ? -16.631 42.618  7.188   1.00 19.52 ? 10  LYS S CG  1 
ATOM   3724  C  CD  . LYS B 2 10  ? -16.331 42.406  8.659   1.00 21.98 ? 10  LYS S CD  1 
ATOM   3725  C  CE  . LYS B 2 10  ? -15.072 41.580  8.856   1.00 24.90 ? 10  LYS S CE  1 
ATOM   3726  N  NZ  . LYS B 2 10  ? -15.238 40.196  8.336   1.00 28.31 ? 10  LYS S NZ  1 
ATOM   3727  N  N   . ARG B 2 11  ? -20.719 43.941  8.694   1.00 13.00 ? 11  ARG S N   1 
ATOM   3728  C  CA  . ARG B 2 11  ? -21.834 44.859  8.884   1.00 12.87 ? 11  ARG S CA  1 
ATOM   3729  C  C   . ARG B 2 11  ? -21.353 46.209  9.415   1.00 11.93 ? 11  ARG S C   1 
ATOM   3730  O  O   . ARG B 2 11  ? -20.198 46.342  9.815   1.00 12.42 ? 11  ARG S O   1 
ATOM   3731  C  CB  . ARG B 2 11  ? -22.885 44.218  9.793   1.00 14.98 ? 11  ARG S CB  1 
ATOM   3732  C  CG  . ARG B 2 11  ? -23.695 43.137  9.072   1.00 16.14 ? 11  ARG S CG  1 
ATOM   3733  C  CD  . ARG B 2 11  ? -24.479 43.745  7.904   1.00 18.86 ? 11  ARG S CD  1 
ATOM   3734  N  NE  . ARG B 2 11  ? -25.258 42.767  7.143   1.00 23.34 ? 11  ARG S NE  1 
ATOM   3735  C  CZ  . ARG B 2 11  ? -24.883 42.258  5.972   1.00 25.48 ? 11  ARG S CZ  1 
ATOM   3736  N  NH1 . ARG B 2 11  ? -23.739 42.629  5.414   1.00 26.44 ? 11  ARG S NH1 1 
ATOM   3737  N  NH2 . ARG B 2 11  ? -25.653 41.374  5.352   1.00 27.60 ? 11  ARG S NH2 1 
ATOM   3738  N  N   . TYR B 2 12  ? -22.233 47.207  9.413   1.00 11.75 ? 12  TYR S N   1 
ATOM   3739  C  CA  . TYR B 2 12  ? -21.850 48.555  9.826   1.00 12.43 ? 12  TYR S CA  1 
ATOM   3740  C  C   . TYR B 2 12  ? -22.788 49.207  10.835  1.00 13.09 ? 12  TYR S C   1 
ATOM   3741  O  O   . TYR B 2 12  ? -23.050 50.412  10.773  1.00 13.66 ? 12  TYR S O   1 
ATOM   3742  C  CB  . TYR B 2 12  ? -21.746 49.429  8.572   1.00 13.02 ? 12  TYR S CB  1 
ATOM   3743  C  CG  . TYR B 2 12  ? -20.863 48.811  7.511   1.00 12.34 ? 12  TYR S CG  1 
ATOM   3744  C  CD1 . TYR B 2 12  ? -19.489 49.041  7.502   1.00 11.56 ? 12  TYR S CD1 1 
ATOM   3745  C  CD2 . TYR B 2 12  ? -21.394 47.936  6.558   1.00 13.31 ? 12  TYR S CD2 1 
ATOM   3746  C  CE1 . TYR B 2 12  ? -18.660 48.417  6.576   1.00 13.66 ? 12  TYR S CE1 1 
ATOM   3747  C  CE2 . TYR B 2 12  ? -20.571 47.299  5.625   1.00 14.53 ? 12  TYR S CE2 1 
ATOM   3748  C  CZ  . TYR B 2 12  ? -19.202 47.547  5.644   1.00 15.56 ? 12  TYR S CZ  1 
ATOM   3749  O  OH  . TYR B 2 12  ? -18.370 46.930  4.737   1.00 16.43 ? 12  TYR S OH  1 
ATOM   3750  N  N   . GLU B 2 13  ? -23.276 48.403  11.771  1.00 12.93 ? 13  GLU S N   1 
ATOM   3751  C  CA  . GLU B 2 13  ? -24.187 48.873  12.803  1.00 12.70 ? 13  GLU S CA  1 
ATOM   3752  C  C   . GLU B 2 13  ? -25.553 49.333  12.266  1.00 12.38 ? 13  GLU S C   1 
ATOM   3753  O  O   . GLU B 2 13  ? -26.048 48.787  11.282  1.00 13.65 ? 13  GLU S O   1 
ATOM   3754  C  CB  . GLU B 2 13  ? -23.517 49.967  13.638  1.00 11.54 ? 13  GLU S CB  1 
ATOM   3755  C  CG  . GLU B 2 13  ? -22.497 49.422  14.641  1.00 11.49 ? 13  GLU S CG  1 
ATOM   3756  C  CD  . GLU B 2 13  ? -23.114 48.431  15.631  1.00 14.08 ? 13  GLU S CD  1 
ATOM   3757  O  OE1 . GLU B 2 13  ? -24.334 48.522  15.885  1.00 13.14 ? 13  GLU S OE1 1 
ATOM   3758  O  OE2 . GLU B 2 13  ? -22.380 47.571  16.167  1.00 10.88 ? 13  GLU S OE2 1 
ATOM   3759  N  N   . THR B 2 14  ? -26.146 50.338  12.901  1.00 10.86 ? 14  THR S N   1 
ATOM   3760  C  CA  . THR B 2 14  ? -27.486 50.809  12.538  1.00 11.48 ? 14  THR S CA  1 
ATOM   3761  C  C   . THR B 2 14  ? -27.843 51.036  11.067  1.00 10.32 ? 14  THR S C   1 
ATOM   3762  O  O   . THR B 2 14  ? -27.226 51.841  10.369  1.00 9.83  ? 14  THR S O   1 
ATOM   3763  C  CB  . THR B 2 14  ? -27.850 52.077  13.341  1.00 11.79 ? 14  THR S CB  1 
ATOM   3764  O  OG1 . THR B 2 14  ? -27.662 51.815  14.737  1.00 14.24 ? 14  THR S OG1 1 
ATOM   3765  C  CG2 . THR B 2 14  ? -29.320 52.458  13.111  1.00 11.13 ? 14  THR S CG2 1 
ATOM   3766  N  N   . LEU B 2 15  ? -28.866 50.303  10.631  1.00 10.99 ? 15  LEU S N   1 
ATOM   3767  C  CA  . LEU B 2 15  ? -29.414 50.345  9.274   1.00 12.02 ? 15  LEU S CA  1 
ATOM   3768  C  C   . LEU B 2 15  ? -28.694 49.463  8.257   1.00 12.69 ? 15  LEU S C   1 
ATOM   3769  O  O   . LEU B 2 15  ? -29.145 49.352  7.118   1.00 13.91 ? 15  LEU S O   1 
ATOM   3770  C  CB  . LEU B 2 15  ? -29.460 51.788  8.746   1.00 12.74 ? 15  LEU S CB  1 
ATOM   3771  C  CG  . LEU B 2 15  ? -30.271 52.816  9.543   1.00 12.22 ? 15  LEU S CG  1 
ATOM   3772  C  CD1 . LEU B 2 15  ? -30.301 54.144  8.788   1.00 13.66 ? 15  LEU S CD1 1 
ATOM   3773  C  CD2 . LEU B 2 15  ? -31.683 52.305  9.758   1.00 12.89 ? 15  LEU S CD2 1 
ATOM   3774  N  N   . SER B 2 16  ? -27.602 48.818  8.664   1.00 11.98 ? 16  SER S N   1 
ATOM   3775  C  CA  . SER B 2 16  ? -26.833 47.975  7.746   1.00 12.16 ? 16  SER S CA  1 
ATOM   3776  C  C   . SER B 2 16  ? -27.458 46.626  7.375   1.00 12.29 ? 16  SER S C   1 
ATOM   3777  O  O   . SER B 2 16  ? -26.920 45.909  6.529   1.00 12.56 ? 16  SER S O   1 
ATOM   3778  C  CB  . SER B 2 16  ? -25.406 47.754  8.285   1.00 10.89 ? 16  SER S CB  1 
ATOM   3779  O  OG  . SER B 2 16  ? -25.406 47.068  9.525   1.00 12.51 ? 16  SER S OG  1 
ATOM   3780  N  N   . TYR B 2 17  ? -28.579 46.272  7.999   1.00 12.91 ? 17  TYR S N   1 
ATOM   3781  C  CA  . TYR B 2 17  ? -29.247 45.015  7.671   1.00 12.54 ? 17  TYR S CA  1 
ATOM   3782  C  C   . TYR B 2 17  ? -30.428 45.244  6.738   1.00 13.69 ? 17  TYR S C   1 
ATOM   3783  O  O   . TYR B 2 17  ? -31.139 44.306  6.373   1.00 14.47 ? 17  TYR S O   1 
ATOM   3784  C  CB  . TYR B 2 17  ? -29.725 44.296  8.934   1.00 12.00 ? 17  TYR S CB  1 
ATOM   3785  C  CG  . TYR B 2 17  ? -28.635 43.491  9.599   1.00 11.25 ? 17  TYR S CG  1 
ATOM   3786  C  CD1 . TYR B 2 17  ? -27.608 44.118  10.307  1.00 10.35 ? 17  TYR S CD1 1 
ATOM   3787  C  CD2 . TYR B 2 17  ? -28.606 42.101  9.486   1.00 11.15 ? 17  TYR S CD2 1 
ATOM   3788  C  CE1 . TYR B 2 17  ? -26.581 43.381  10.887  1.00 8.93  ? 17  TYR S CE1 1 
ATOM   3789  C  CE2 . TYR B 2 17  ? -27.580 41.353  10.062  1.00 12.09 ? 17  TYR S CE2 1 
ATOM   3790  C  CZ  . TYR B 2 17  ? -26.571 42.001  10.759  1.00 10.91 ? 17  TYR S CZ  1 
ATOM   3791  O  OH  . TYR B 2 17  ? -25.545 41.273  11.318  1.00 10.90 ? 17  TYR S OH  1 
ATOM   3792  N  N   . LEU B 2 18  ? -30.634 46.498  6.356   1.00 12.93 ? 18  LEU S N   1 
ATOM   3793  C  CA  . LEU B 2 18  ? -31.721 46.852  5.455   1.00 12.06 ? 18  LEU S CA  1 
ATOM   3794  C  C   . LEU B 2 18  ? -31.147 47.019  4.054   1.00 13.61 ? 18  LEU S C   1 
ATOM   3795  O  O   . LEU B 2 18  ? -29.927 47.093  3.877   1.00 11.80 ? 18  LEU S O   1 
ATOM   3796  C  CB  . LEU B 2 18  ? -32.359 48.173  5.884   1.00 11.29 ? 18  LEU S CB  1 
ATOM   3797  C  CG  . LEU B 2 18  ? -33.017 48.258  7.259   1.00 12.06 ? 18  LEU S CG  1 
ATOM   3798  C  CD1 . LEU B 2 18  ? -33.494 49.677  7.499   1.00 10.21 ? 18  LEU S CD1 1 
ATOM   3799  C  CD2 . LEU B 2 18  ? -34.187 47.288  7.330   1.00 12.09 ? 18  LEU S CD2 1 
ATOM   3800  N  N   . PRO B 2 19  ? -32.017 47.063  3.034   1.00 14.02 ? 19  PRO S N   1 
ATOM   3801  C  CA  . PRO B 2 19  ? -31.482 47.236  1.682   1.00 14.17 ? 19  PRO S CA  1 
ATOM   3802  C  C   . PRO B 2 19  ? -30.771 48.588  1.625   1.00 15.03 ? 19  PRO S C   1 
ATOM   3803  O  O   . PRO B 2 19  ? -31.050 49.474  2.431   1.00 14.54 ? 19  PRO S O   1 
ATOM   3804  C  CB  . PRO B 2 19  ? -32.737 47.209  0.814   1.00 13.47 ? 19  PRO S CB  1 
ATOM   3805  C  CG  . PRO B 2 19  ? -33.649 46.294  1.575   1.00 14.19 ? 19  PRO S CG  1 
ATOM   3806  C  CD  . PRO B 2 19  ? -33.462 46.772  2.997   1.00 13.01 ? 19  PRO S CD  1 
ATOM   3807  N  N   . PRO B 2 20  ? -29.831 48.759  0.684   1.00 16.78 ? 20  PRO S N   1 
ATOM   3808  C  CA  . PRO B 2 20  ? -29.108 50.028  0.563   1.00 17.05 ? 20  PRO S CA  1 
ATOM   3809  C  C   . PRO B 2 20  ? -30.063 51.220  0.544   1.00 17.82 ? 20  PRO S C   1 
ATOM   3810  O  O   . PRO B 2 20  ? -31.146 51.146  -0.038  1.00 17.93 ? 20  PRO S O   1 
ATOM   3811  C  CB  . PRO B 2 20  ? -28.365 49.864  -0.755  1.00 17.09 ? 20  PRO S CB  1 
ATOM   3812  C  CG  . PRO B 2 20  ? -28.034 48.402  -0.750  1.00 18.18 ? 20  PRO S CG  1 
ATOM   3813  C  CD  . PRO B 2 20  ? -29.334 47.775  -0.294  1.00 17.10 ? 20  PRO S CD  1 
ATOM   3814  N  N   . LEU B 2 21  ? -29.664 52.313  1.186   1.00 17.78 ? 21  LEU S N   1 
ATOM   3815  C  CA  . LEU B 2 21  ? -30.497 53.508  1.231   1.00 18.34 ? 21  LEU S CA  1 
ATOM   3816  C  C   . LEU B 2 21  ? -30.498 54.239  -0.104  1.00 18.50 ? 21  LEU S C   1 
ATOM   3817  O  O   . LEU B 2 21  ? -29.447 54.435  -0.712  1.00 18.40 ? 21  LEU S O   1 
ATOM   3818  C  CB  . LEU B 2 21  ? -29.995 54.473  2.304   1.00 18.64 ? 21  LEU S CB  1 
ATOM   3819  C  CG  . LEU B 2 21  ? -29.986 54.042  3.770   1.00 19.72 ? 21  LEU S CG  1 
ATOM   3820  C  CD1 . LEU B 2 21  ? -29.266 55.102  4.597   1.00 19.47 ? 21  LEU S CD1 1 
ATOM   3821  C  CD2 . LEU B 2 21  ? -31.409 53.842  4.261   1.00 18.10 ? 21  LEU S CD2 1 
ATOM   3822  N  N   . THR B 2 22  ? -31.681 54.637  -0.559  1.00 19.61 ? 22  THR S N   1 
ATOM   3823  C  CA  . THR B 2 22  ? -31.797 55.393  -1.798  1.00 20.13 ? 22  THR S CA  1 
ATOM   3824  C  C   . THR B 2 22  ? -31.481 56.827  -1.384  1.00 20.62 ? 22  THR S C   1 
ATOM   3825  O  O   . THR B 2 22  ? -31.417 57.124  -0.190  1.00 20.53 ? 22  THR S O   1 
ATOM   3826  C  CB  . THR B 2 22  ? -33.228 55.336  -2.364  1.00 20.72 ? 22  THR S CB  1 
ATOM   3827  O  OG1 . THR B 2 22  ? -34.143 55.883  -1.405  1.00 19.70 ? 22  THR S OG1 1 
ATOM   3828  C  CG2 . THR B 2 22  ? -33.623 53.899  -2.674  1.00 20.51 ? 22  THR S CG2 1 
ATOM   3829  N  N   . THR B 2 23  ? -31.279 57.718  -2.346  1.00 20.19 ? 23  THR S N   1 
ATOM   3830  C  CA  . THR B 2 23  ? -30.971 59.096  -1.992  1.00 22.56 ? 23  THR S CA  1 
ATOM   3831  C  C   . THR B 2 23  ? -32.100 59.736  -1.185  1.00 21.00 ? 23  THR S C   1 
ATOM   3832  O  O   . THR B 2 23  ? -31.850 60.601  -0.349  1.00 21.71 ? 23  THR S O   1 
ATOM   3833  C  CB  . THR B 2 23  ? -30.663 59.944  -3.243  1.00 23.76 ? 23  THR S CB  1 
ATOM   3834  O  OG1 . THR B 2 23  ? -31.749 59.850  -4.171  1.00 29.41 ? 23  THR S OG1 1 
ATOM   3835  C  CG2 . THR B 2 23  ? -29.388 59.449  -3.909  1.00 25.06 ? 23  THR S CG2 1 
ATOM   3836  N  N   . ASP B 2 24  ? -33.337 59.306  -1.421  1.00 19.78 ? 24  ASP S N   1 
ATOM   3837  C  CA  . ASP B 2 24  ? -34.468 59.853  -0.675  1.00 18.65 ? 24  ASP S CA  1 
ATOM   3838  C  C   . ASP B 2 24  ? -34.486 59.348  0.764   1.00 18.00 ? 24  ASP S C   1 
ATOM   3839  O  O   . ASP B 2 24  ? -34.820 60.096  1.682   1.00 18.48 ? 24  ASP S O   1 
ATOM   3840  C  CB  . ASP B 2 24  ? -35.801 59.496  -1.341  1.00 20.71 ? 24  ASP S CB  1 
ATOM   3841  C  CG  . ASP B 2 24  ? -36.063 60.300  -2.601  1.00 20.80 ? 24  ASP S CG  1 
ATOM   3842  O  OD1 . ASP B 2 24  ? -35.654 61.478  -2.661  1.00 18.30 ? 24  ASP S OD1 1 
ATOM   3843  O  OD2 . ASP B 2 24  ? -36.701 59.755  -3.525  1.00 24.20 ? 24  ASP S OD2 1 
ATOM   3844  N  N   . GLN B 2 25  ? -34.131 58.080  0.956   1.00 17.07 ? 25  GLN S N   1 
ATOM   3845  C  CA  . GLN B 2 25  ? -34.108 57.493  2.293   1.00 17.26 ? 25  GLN S CA  1 
ATOM   3846  C  C   . GLN B 2 25  ? -32.964 58.083  3.109   1.00 16.38 ? 25  GLN S C   1 
ATOM   3847  O  O   . GLN B 2 25  ? -33.087 58.261  4.320   1.00 17.39 ? 25  GLN S O   1 
ATOM   3848  C  CB  . GLN B 2 25  ? -33.963 55.969  2.212   1.00 16.95 ? 25  GLN S CB  1 
ATOM   3849  C  CG  . GLN B 2 25  ? -35.127 55.282  1.510   1.00 16.09 ? 25  GLN S CG  1 
ATOM   3850  C  CD  . GLN B 2 25  ? -34.973 53.771  1.442   1.00 16.08 ? 25  GLN S CD  1 
ATOM   3851  O  OE1 . GLN B 2 25  ? -33.896 53.258  1.140   1.00 15.16 ? 25  GLN S OE1 1 
ATOM   3852  N  NE2 . GLN B 2 25  ? -36.059 53.053  1.708   1.00 14.85 ? 25  GLN S NE2 1 
ATOM   3853  N  N   . LEU B 2 26  ? -31.857 58.383  2.436   1.00 16.43 ? 26  LEU S N   1 
ATOM   3854  C  CA  . LEU B 2 26  ? -30.691 58.973  3.086   1.00 16.48 ? 26  LEU S CA  1 
ATOM   3855  C  C   . LEU B 2 26  ? -31.113 60.360  3.557   1.00 15.84 ? 26  LEU S C   1 
ATOM   3856  O  O   . LEU B 2 26  ? -30.835 60.761  4.687   1.00 15.89 ? 26  LEU S O   1 
ATOM   3857  C  CB  . LEU B 2 26  ? -29.542 59.106  2.083   1.00 18.31 ? 26  LEU S CB  1 
ATOM   3858  C  CG  . LEU B 2 26  ? -28.083 59.153  2.556   1.00 20.46 ? 26  LEU S CG  1 
ATOM   3859  C  CD1 . LEU B 2 26  ? -27.248 59.803  1.461   1.00 21.26 ? 26  LEU S CD1 1 
ATOM   3860  C  CD2 . LEU B 2 26  ? -27.946 59.938  3.841   1.00 20.98 ? 26  LEU S CD2 1 
ATOM   3861  N  N   . ALA B 2 27  ? -31.793 61.088  2.674   1.00 15.29 ? 27  ALA S N   1 
ATOM   3862  C  CA  . ALA B 2 27  ? -32.265 62.432  2.979   1.00 14.70 ? 27  ALA S CA  1 
ATOM   3863  C  C   . ALA B 2 27  ? -33.202 62.428  4.183   1.00 14.24 ? 27  ALA S C   1 
ATOM   3864  O  O   . ALA B 2 27  ? -33.112 63.301  5.043   1.00 13.58 ? 27  ALA S O   1 
ATOM   3865  C  CB  . ALA B 2 27  ? -32.974 63.028  1.767   1.00 14.50 ? 27  ALA S CB  1 
ATOM   3866  N  N   . ARG B 2 28  ? -34.107 61.453  4.240   1.00 13.44 ? 28  ARG S N   1 
ATOM   3867  C  CA  . ARG B 2 28  ? -35.036 61.369  5.362   1.00 14.18 ? 28  ARG S CA  1 
ATOM   3868  C  C   . ARG B 2 28  ? -34.310 61.150  6.684   1.00 12.61 ? 28  ARG S C   1 
ATOM   3869  O  O   . ARG B 2 28  ? -34.733 61.667  7.716   1.00 9.82  ? 28  ARG S O   1 
ATOM   3870  C  CB  . ARG B 2 28  ? -36.066 60.255  5.139   1.00 15.94 ? 28  ARG S CB  1 
ATOM   3871  C  CG  . ARG B 2 28  ? -37.179 60.659  4.187   1.00 23.56 ? 28  ARG S CG  1 
ATOM   3872  C  CD  . ARG B 2 28  ? -37.770 61.990  4.654   1.00 29.35 ? 28  ARG S CD  1 
ATOM   3873  N  NE  . ARG B 2 28  ? -38.914 62.486  3.887   1.00 36.51 ? 28  ARG S NE  1 
ATOM   3874  C  CZ  . ARG B 2 28  ? -39.740 61.741  3.155   1.00 40.61 ? 28  ARG S CZ  1 
ATOM   3875  N  NH1 . ARG B 2 28  ? -39.565 60.429  3.053   1.00 42.95 ? 28  ARG S NH1 1 
ATOM   3876  N  NH2 . ARG B 2 28  ? -40.771 62.314  2.542   1.00 41.54 ? 28  ARG S NH2 1 
ATOM   3877  N  N   . GLN B 2 29  ? -33.218 60.391  6.661   1.00 11.52 ? 29  GLN S N   1 
ATOM   3878  C  CA  . GLN B 2 29  ? -32.473 60.161  7.895   1.00 13.53 ? 29  GLN S CA  1 
ATOM   3879  C  C   . GLN B 2 29  ? -31.832 61.463  8.375   1.00 12.75 ? 29  GLN S C   1 
ATOM   3880  O  O   . GLN B 2 29  ? -31.800 61.738  9.574   1.00 14.39 ? 29  GLN S O   1 
ATOM   3881  C  CB  . GLN B 2 29  ? -31.404 59.075  7.697   1.00 11.83 ? 29  GLN S CB  1 
ATOM   3882  C  CG  . GLN B 2 29  ? -31.984 57.698  7.411   1.00 13.27 ? 29  GLN S CG  1 
ATOM   3883  C  CD  . GLN B 2 29  ? -32.950 57.227  8.490   1.00 14.38 ? 29  GLN S CD  1 
ATOM   3884  O  OE1 . GLN B 2 29  ? -34.028 56.706  8.189   1.00 16.76 ? 29  GLN S OE1 1 
ATOM   3885  N  NE2 . GLN B 2 29  ? -32.565 57.395  9.751   1.00 12.84 ? 29  GLN S NE2 1 
ATOM   3886  N  N   . VAL B 2 30  ? -31.335 62.268  7.440   1.00 13.63 ? 30  VAL S N   1 
ATOM   3887  C  CA  . VAL B 2 30  ? -30.718 63.544  7.793   1.00 14.59 ? 30  VAL S CA  1 
ATOM   3888  C  C   . VAL B 2 30  ? -31.777 64.524  8.320   1.00 15.28 ? 30  VAL S C   1 
ATOM   3889  O  O   . VAL B 2 30  ? -31.495 65.311  9.225   1.00 15.12 ? 30  VAL S O   1 
ATOM   3890  C  CB  . VAL B 2 30  ? -29.995 64.180  6.584   1.00 15.26 ? 30  VAL S CB  1 
ATOM   3891  C  CG1 . VAL B 2 30  ? -29.423 65.541  6.965   1.00 17.56 ? 30  VAL S CG1 1 
ATOM   3892  C  CG2 . VAL B 2 30  ? -28.880 63.264  6.109   1.00 16.50 ? 30  VAL S CG2 1 
ATOM   3893  N  N   . ASP B 2 31  ? -32.984 64.480  7.747   1.00 15.87 ? 31  ASP S N   1 
ATOM   3894  C  CA  . ASP B 2 31  ? -34.065 65.352  8.215   1.00 16.49 ? 31  ASP S CA  1 
ATOM   3895  C  C   . ASP B 2 31  ? -34.457 64.979  9.625   1.00 15.30 ? 31  ASP S C   1 
ATOM   3896  O  O   . ASP B 2 31  ? -34.742 65.844  10.447  1.00 15.66 ? 31  ASP S O   1 
ATOM   3897  C  CB  . ASP B 2 31  ? -35.275 65.246  7.315   1.00 20.85 ? 31  ASP S CB  1 
ATOM   3898  C  CG  . ASP B 2 31  ? -35.181 66.196  6.124   1.00 27.38 ? 31  ASP S CG  1 
ATOM   3899  O  OD1 . ASP B 2 31  ? -35.027 67.426  6.370   1.00 33.60 ? 31  ASP S OD1 1 
ATOM   3900  O  OD2 . ASP B 2 31  ? -35.240 65.718  4.964   1.00 32.06 ? 31  ASP S OD2 1 
ATOM   3901  N  N   . TYR B 2 32  ? -34.446 63.685  9.919   1.00 14.54 ? 32  TYR S N   1 
ATOM   3902  C  CA  . TYR B 2 32  ? -34.775 63.201  11.256  1.00 16.75 ? 32  TYR S CA  1 
ATOM   3903  C  C   . TYR B 2 32  ? -33.773 63.779  12.260  1.00 17.43 ? 32  TYR S C   1 
ATOM   3904  O  O   . TYR B 2 32  ? -34.149 64.261  13.333  1.00 17.08 ? 32  TYR S O   1 
ATOM   3905  C  CB  . TYR B 2 32  ? -34.712 61.672  11.283  1.00 17.88 ? 32  TYR S CB  1 
ATOM   3906  C  CG  . TYR B 2 32  ? -34.820 61.060  12.660  1.00 19.47 ? 32  TYR S CG  1 
ATOM   3907  C  CD1 . TYR B 2 32  ? -36.026 61.063  13.358  1.00 19.98 ? 32  TYR S CD1 1 
ATOM   3908  C  CD2 . TYR B 2 32  ? -33.710 60.475  13.266  1.00 20.48 ? 32  TYR S CD2 1 
ATOM   3909  C  CE1 . TYR B 2 32  ? -36.124 60.492  14.630  1.00 21.93 ? 32  TYR S CE1 1 
ATOM   3910  C  CE2 . TYR B 2 32  ? -33.794 59.905  14.527  1.00 23.07 ? 32  TYR S CE2 1 
ATOM   3911  C  CZ  . TYR B 2 32  ? -35.001 59.916  15.203  1.00 23.11 ? 32  TYR S CZ  1 
ATOM   3912  O  OH  . TYR B 2 32  ? -35.074 59.334  16.445  1.00 27.53 ? 32  TYR S OH  1 
ATOM   3913  N  N   . LEU B 2 33  ? -32.496 63.728  11.894  1.00 16.88 ? 33  LEU S N   1 
ATOM   3914  C  CA  . LEU B 2 33  ? -31.414 64.231  12.734  1.00 16.35 ? 33  LEU S CA  1 
ATOM   3915  C  C   . LEU B 2 33  ? -31.609 65.719  13.028  1.00 16.56 ? 33  LEU S C   1 
ATOM   3916  O  O   . LEU B 2 33  ? -31.556 66.149  14.183  1.00 14.90 ? 33  LEU S O   1 
ATOM   3917  C  CB  . LEU B 2 33  ? -30.071 63.993  12.029  1.00 15.62 ? 33  LEU S CB  1 
ATOM   3918  C  CG  . LEU B 2 33  ? -28.742 64.242  12.755  1.00 14.96 ? 33  LEU S CG  1 
ATOM   3919  C  CD1 . LEU B 2 33  ? -27.619 63.577  11.978  1.00 14.70 ? 33  LEU S CD1 1 
ATOM   3920  C  CD2 . LEU B 2 33  ? -28.487 65.729  12.909  1.00 14.94 ? 33  LEU S CD2 1 
ATOM   3921  N  N   . LEU B 2 34  ? -31.854 66.498  11.977  1.00 16.89 ? 34  LEU S N   1 
ATOM   3922  C  CA  . LEU B 2 34  ? -32.046 67.940  12.114  1.00 17.78 ? 34  LEU S CA  1 
ATOM   3923  C  C   . LEU B 2 34  ? -33.351 68.352  12.804  1.00 18.29 ? 34  LEU S C   1 
ATOM   3924  O  O   . LEU B 2 34  ? -33.382 69.351  13.522  1.00 17.77 ? 34  LEU S O   1 
ATOM   3925  C  CB  . LEU B 2 34  ? -31.947 68.608  10.737  1.00 17.86 ? 34  LEU S CB  1 
ATOM   3926  C  CG  . LEU B 2 34  ? -30.579 68.516  10.045  1.00 18.02 ? 34  LEU S CG  1 
ATOM   3927  C  CD1 . LEU B 2 34  ? -30.685 69.021  8.612   1.00 16.20 ? 34  LEU S CD1 1 
ATOM   3928  C  CD2 . LEU B 2 34  ? -29.556 69.333  10.823  1.00 17.75 ? 34  LEU S CD2 1 
ATOM   3929  N  N   . ASN B 2 35  ? -34.426 67.597  12.597  1.00 18.80 ? 35  ASN S N   1 
ATOM   3930  C  CA  . ASN B 2 35  ? -35.693 67.946  13.233  1.00 19.70 ? 35  ASN S CA  1 
ATOM   3931  C  C   . ASN B 2 35  ? -35.641 67.726  14.743  1.00 19.29 ? 35  ASN S C   1 
ATOM   3932  O  O   . ASN B 2 35  ? -36.404 68.336  15.491  1.00 18.82 ? 35  ASN S O   1 
ATOM   3933  C  CB  . ASN B 2 35  ? -36.851 67.148  12.626  1.00 23.85 ? 35  ASN S CB  1 
ATOM   3934  C  CG  . ASN B 2 35  ? -37.137 67.543  11.185  1.00 27.59 ? 35  ASN S CG  1 
ATOM   3935  O  OD1 . ASN B 2 35  ? -37.108 68.726  10.833  1.00 30.33 ? 35  ASN S OD1 1 
ATOM   3936  N  ND2 . ASN B 2 35  ? -37.431 66.553  10.347  1.00 28.34 ? 35  ASN S ND2 1 
ATOM   3937  N  N   . ASN B 2 36  ? -34.740 66.857  15.191  1.00 17.53 ? 36  ASN S N   1 
ATOM   3938  C  CA  . ASN B 2 36  ? -34.590 66.600  16.618  1.00 16.44 ? 36  ASN S CA  1 
ATOM   3939  C  C   . ASN B 2 36  ? -33.557 67.561  17.192  1.00 16.65 ? 36  ASN S C   1 
ATOM   3940  O  O   . ASN B 2 36  ? -33.185 67.477  18.363  1.00 17.53 ? 36  ASN S O   1 
ATOM   3941  C  CB  . ASN B 2 36  ? -34.177 65.148  16.859  1.00 17.22 ? 36  ASN S CB  1 
ATOM   3942  C  CG  . ASN B 2 36  ? -35.358 64.196  16.797  1.00 17.66 ? 36  ASN S CG  1 
ATOM   3943  O  OD1 . ASN B 2 36  ? -36.236 64.231  17.658  1.00 21.73 ? 36  ASN S OD1 1 
ATOM   3944  N  ND2 . ASN B 2 36  ? -35.392 63.352  15.775  1.00 17.44 ? 36  ASN S ND2 1 
ATOM   3945  N  N   . LYS B 2 37  ? -33.106 68.480  16.345  1.00 16.31 ? 37  LYS S N   1 
ATOM   3946  C  CA  . LYS B 2 37  ? -32.132 69.500  16.720  1.00 17.50 ? 37  LYS S CA  1 
ATOM   3947  C  C   . LYS B 2 37  ? -30.770 68.968  17.146  1.00 16.56 ? 37  LYS S C   1 
ATOM   3948  O  O   . LYS B 2 37  ? -30.116 69.545  18.014  1.00 16.48 ? 37  LYS S O   1 
ATOM   3949  C  CB  . LYS B 2 37  ? -32.705 70.395  17.825  1.00 20.42 ? 37  LYS S CB  1 
ATOM   3950  C  CG  . LYS B 2 37  ? -34.036 71.047  17.464  1.00 24.60 ? 37  LYS S CG  1 
ATOM   3951  C  CD  . LYS B 2 37  ? -34.006 71.619  16.048  1.00 29.34 ? 37  LYS S CD  1 
ATOM   3952  C  CE  . LYS B 2 37  ? -35.331 72.270  15.669  1.00 33.41 ? 37  LYS S CE  1 
ATOM   3953  N  NZ  . LYS B 2 37  ? -36.485 71.325  15.771  1.00 35.81 ? 37  LYS S NZ  1 
ATOM   3954  N  N   . TRP B 2 38  ? -30.337 67.869  16.541  1.00 14.99 ? 38  TRP S N   1 
ATOM   3955  C  CA  . TRP B 2 38  ? -29.030 67.324  16.870  1.00 14.64 ? 38  TRP S CA  1 
ATOM   3956  C  C   . TRP B 2 38  ? -28.005 67.932  15.914  1.00 14.77 ? 38  TRP S C   1 
ATOM   3957  O  O   . TRP B 2 38  ? -28.364 68.430  14.846  1.00 15.85 ? 38  TRP S O   1 
ATOM   3958  C  CB  . TRP B 2 38  ? -29.041 65.797  16.769  1.00 13.60 ? 38  TRP S CB  1 
ATOM   3959  C  CG  . TRP B 2 38  ? -29.977 65.156  17.764  1.00 13.94 ? 38  TRP S CG  1 
ATOM   3960  C  CD1 . TRP B 2 38  ? -30.201 65.557  19.050  1.00 12.40 ? 38  TRP S CD1 1 
ATOM   3961  C  CD2 . TRP B 2 38  ? -30.785 63.990  17.560  1.00 12.35 ? 38  TRP S CD2 1 
ATOM   3962  N  NE1 . TRP B 2 38  ? -31.103 64.718  19.660  1.00 13.21 ? 38  TRP S NE1 1 
ATOM   3963  C  CE2 . TRP B 2 38  ? -31.483 63.751  18.768  1.00 13.36 ? 38  TRP S CE2 1 
ATOM   3964  C  CE3 . TRP B 2 38  ? -31.001 63.131  16.474  1.00 13.05 ? 38  TRP S CE3 1 
ATOM   3965  C  CZ2 . TRP B 2 38  ? -32.368 62.678  18.924  1.00 12.06 ? 38  TRP S CZ2 1 
ATOM   3966  C  CZ3 . TRP B 2 38  ? -31.883 62.064  16.630  1.00 12.87 ? 38  TRP S CZ3 1 
ATOM   3967  C  CH2 . TRP B 2 38  ? -32.560 61.853  17.846  1.00 12.43 ? 38  TRP S CH2 1 
ATOM   3968  N  N   . VAL B 2 39  ? -26.736 67.910  16.302  1.00 14.33 ? 39  VAL S N   1 
ATOM   3969  C  CA  . VAL B 2 39  ? -25.685 68.482  15.470  1.00 13.60 ? 39  VAL S CA  1 
ATOM   3970  C  C   . VAL B 2 39  ? -25.042 67.426  14.583  1.00 13.12 ? 39  VAL S C   1 
ATOM   3971  O  O   . VAL B 2 39  ? -24.497 66.435  15.073  1.00 11.89 ? 39  VAL S O   1 
ATOM   3972  C  CB  . VAL B 2 39  ? -24.596 69.147  16.337  1.00 14.62 ? 39  VAL S CB  1 
ATOM   3973  C  CG1 . VAL B 2 39  ? -23.571 69.839  15.452  1.00 12.70 ? 39  VAL S CG1 1 
ATOM   3974  C  CG2 . VAL B 2 39  ? -25.238 70.138  17.300  1.00 12.85 ? 39  VAL S CG2 1 
ATOM   3975  N  N   . PRO B 2 40  ? -25.100 67.623  13.257  1.00 12.00 ? 40  PRO S N   1 
ATOM   3976  C  CA  . PRO B 2 40  ? -24.508 66.653  12.335  1.00 13.78 ? 40  PRO S CA  1 
ATOM   3977  C  C   . PRO B 2 40  ? -22.992 66.781  12.222  1.00 12.85 ? 40  PRO S C   1 
ATOM   3978  O  O   . PRO B 2 40  ? -22.433 67.866  12.370  1.00 14.66 ? 40  PRO S O   1 
ATOM   3979  C  CB  . PRO B 2 40  ? -25.213 66.963  11.017  1.00 13.85 ? 40  PRO S CB  1 
ATOM   3980  C  CG  . PRO B 2 40  ? -25.371 68.450  11.084  1.00 14.08 ? 40  PRO S CG  1 
ATOM   3981  C  CD  . PRO B 2 40  ? -25.820 68.680  12.519  1.00 13.35 ? 40  PRO S CD  1 
ATOM   3982  N  N   . CYS B 2 41  ? -22.334 65.660  11.964  1.00 11.97 ? 41  CYS S N   1 
ATOM   3983  C  CA  . CYS B 2 41  ? -20.888 65.643  11.806  1.00 12.28 ? 41  CYS S CA  1 
ATOM   3984  C  C   . CYS B 2 41  ? -20.521 64.440  10.956  1.00 12.11 ? 41  CYS S C   1 
ATOM   3985  O  O   . CYS B 2 41  ? -21.170 63.397  11.037  1.00 13.24 ? 41  CYS S O   1 
ATOM   3986  C  CB  . CYS B 2 41  ? -20.197 65.545  13.171  1.00 12.60 ? 41  CYS S CB  1 
ATOM   3987  S  SG  . CYS B 2 41  ? -18.385 65.705  13.113  1.00 15.65 ? 41  CYS S SG  1 
ATOM   3988  N  N   . LEU B 2 42  ? -19.499 64.590  10.123  1.00 12.09 ? 42  LEU S N   1 
ATOM   3989  C  CA  . LEU B 2 42  ? -19.052 63.489  9.287   1.00 12.50 ? 42  LEU S CA  1 
ATOM   3990  C  C   . LEU B 2 42  ? -17.702 62.989  9.774   1.00 11.69 ? 42  LEU S C   1 
ATOM   3991  O  O   . LEU B 2 42  ? -16.887 63.769  10.270  1.00 10.58 ? 42  LEU S O   1 
ATOM   3992  C  CB  . LEU B 2 42  ? -18.930 63.922  7.822   1.00 14.01 ? 42  LEU S CB  1 
ATOM   3993  C  CG  . LEU B 2 42  ? -20.193 64.066  6.966   1.00 17.57 ? 42  LEU S CG  1 
ATOM   3994  C  CD1 . LEU B 2 42  ? -20.999 65.279  7.396   1.00 18.12 ? 42  LEU S CD1 1 
ATOM   3995  C  CD2 . LEU B 2 42  ? -19.778 64.211  5.510   1.00 18.29 ? 42  LEU S CD2 1 
ATOM   3996  N  N   . GLU B 2 43  ? -17.484 61.684  9.639   1.00 11.66 ? 43  GLU S N   1 
ATOM   3997  C  CA  . GLU B 2 43  ? -16.231 61.044  10.027  1.00 12.31 ? 43  GLU S CA  1 
ATOM   3998  C  C   . GLU B 2 43  ? -15.855 60.079  8.907   1.00 12.56 ? 43  GLU S C   1 
ATOM   3999  O  O   . GLU B 2 43  ? -16.732 59.482  8.273   1.00 11.78 ? 43  GLU S O   1 
ATOM   4000  C  CB  . GLU B 2 43  ? -16.392 60.252  11.327  1.00 12.66 ? 43  GLU S CB  1 
ATOM   4001  C  CG  . GLU B 2 43  ? -16.825 61.067  12.533  1.00 15.21 ? 43  GLU S CG  1 
ATOM   4002  C  CD  . GLU B 2 43  ? -16.804 60.252  13.820  1.00 14.60 ? 43  GLU S CD  1 
ATOM   4003  O  OE1 . GLU B 2 43  ? -17.388 59.149  13.841  1.00 13.61 ? 43  GLU S OE1 1 
ATOM   4004  O  OE2 . GLU B 2 43  ? -16.207 60.718  14.813  1.00 15.77 ? 43  GLU S OE2 1 
ATOM   4005  N  N   . PHE B 2 44  ? -14.557 59.925  8.660   1.00 11.51 ? 44  PHE S N   1 
ATOM   4006  C  CA  . PHE B 2 44  ? -14.099 59.019  7.613   1.00 11.66 ? 44  PHE S CA  1 
ATOM   4007  C  C   . PHE B 2 44  ? -12.904 58.192  8.079   1.00 12.15 ? 44  PHE S C   1 
ATOM   4008  O  O   . PHE B 2 44  ? -12.175 58.593  8.984   1.00 12.51 ? 44  PHE S O   1 
ATOM   4009  C  CB  . PHE B 2 44  ? -13.731 59.805  6.349   1.00 11.37 ? 44  PHE S CB  1 
ATOM   4010  C  CG  . PHE B 2 44  ? -12.589 60.763  6.541   1.00 10.39 ? 44  PHE S CG  1 
ATOM   4011  C  CD1 . PHE B 2 44  ? -12.793 62.005  7.136   1.00 10.59 ? 44  PHE S CD1 1 
ATOM   4012  C  CD2 . PHE B 2 44  ? -11.302 60.410  6.152   1.00 11.12 ? 44  PHE S CD2 1 
ATOM   4013  C  CE1 . PHE B 2 44  ? -11.727 62.881  7.339   1.00 10.37 ? 44  PHE S CE1 1 
ATOM   4014  C  CE2 . PHE B 2 44  ? -10.232 61.277  6.352   1.00 11.74 ? 44  PHE S CE2 1 
ATOM   4015  C  CZ  . PHE B 2 44  ? -10.446 62.514  6.947   1.00 12.15 ? 44  PHE S CZ  1 
ATOM   4016  N  N   . GLU B 2 45  ? -12.710 57.034  7.457   1.00 13.26 ? 45  GLU S N   1 
ATOM   4017  C  CA  . GLU B 2 45  ? -11.608 56.146  7.814   1.00 14.22 ? 45  GLU S CA  1 
ATOM   4018  C  C   . GLU B 2 45  ? -11.125 55.399  6.577   1.00 16.14 ? 45  GLU S C   1 
ATOM   4019  O  O   . GLU B 2 45  ? -11.930 54.881  5.808   1.00 14.96 ? 45  GLU S O   1 
ATOM   4020  C  CB  . GLU B 2 45  ? -12.077 55.155  8.886   1.00 13.86 ? 45  GLU S CB  1 
ATOM   4021  C  CG  . GLU B 2 45  ? -11.058 54.098  9.307   1.00 16.45 ? 45  GLU S CG  1 
ATOM   4022  C  CD  . GLU B 2 45  ? -9.793  54.687  9.911   1.00 17.64 ? 45  GLU S CD  1 
ATOM   4023  O  OE1 . GLU B 2 45  ? -9.895  55.634  10.724  1.00 17.55 ? 45  GLU S OE1 1 
ATOM   4024  O  OE2 . GLU B 2 45  ? -8.697  54.189  9.579   1.00 18.10 ? 45  GLU S OE2 1 
ATOM   4025  N  N   . THR B 2 46  ? -9.809  55.348  6.385   1.00 18.52 ? 46  THR S N   1 
ATOM   4026  C  CA  . THR B 2 46  ? -9.232  54.662  5.230   1.00 22.32 ? 46  THR S CA  1 
ATOM   4027  C  C   . THR B 2 46  ? -8.478  53.380  5.576   1.00 23.36 ? 46  THR S C   1 
ATOM   4028  O  O   . THR B 2 46  ? -8.449  52.444  4.779   1.00 23.54 ? 46  THR S O   1 
ATOM   4029  C  CB  . THR B 2 46  ? -8.252  55.574  4.457   1.00 23.08 ? 46  THR S CB  1 
ATOM   4030  O  OG1 . THR B 2 46  ? -7.176  55.965  5.321   1.00 25.51 ? 46  THR S OG1 1 
ATOM   4031  C  CG2 . THR B 2 46  ? -8.964  56.812  3.940   1.00 22.39 ? 46  THR S CG2 1 
ATOM   4032  N  N   . ASP B 2 47  ? -7.879  53.325  6.761   1.00 25.38 ? 47  ASP S N   1 
ATOM   4033  C  CA  . ASP B 2 47  ? -7.100  52.151  7.151   1.00 28.07 ? 47  ASP S CA  1 
ATOM   4034  C  C   . ASP B 2 47  ? -7.838  51.025  7.866   1.00 27.95 ? 47  ASP S C   1 
ATOM   4035  O  O   . ASP B 2 47  ? -7.928  49.917  7.344   1.00 29.26 ? 47  ASP S O   1 
ATOM   4036  C  CB  . ASP B 2 47  ? -5.900  52.577  7.996   1.00 32.01 ? 47  ASP S CB  1 
ATOM   4037  C  CG  . ASP B 2 47  ? -5.029  53.594  7.290   1.00 38.23 ? 47  ASP S CG  1 
ATOM   4038  O  OD1 . ASP B 2 47  ? -4.833  53.461  6.061   1.00 40.76 ? 47  ASP S OD1 1 
ATOM   4039  O  OD2 . ASP B 2 47  ? -4.532  54.520  7.963   1.00 43.02 ? 47  ASP S OD2 1 
ATOM   4040  N  N   . HIS B 2 48  ? -8.357  51.294  9.057   1.00 26.78 ? 48  HIS S N   1 
ATOM   4041  C  CA  . HIS B 2 48  ? -9.053  50.263  9.811   1.00 26.86 ? 48  HIS S CA  1 
ATOM   4042  C  C   . HIS B 2 48  ? -10.558 50.484  9.857   1.00 25.68 ? 48  HIS S C   1 
ATOM   4043  O  O   . HIS B 2 48  ? -11.072 51.161  10.752  1.00 26.97 ? 48  HIS S O   1 
ATOM   4044  C  CB  . HIS B 2 48  ? -8.475  50.185  11.228  1.00 28.00 ? 48  HIS S CB  1 
ATOM   4045  C  CG  . HIS B 2 48  ? -6.997  49.953  11.257  1.00 29.60 ? 48  HIS S CG  1 
ATOM   4046  N  ND1 . HIS B 2 48  ? -6.081  50.986  11.256  1.00 29.92 ? 48  HIS S ND1 1 
ATOM   4047  C  CD2 . HIS B 2 48  ? -6.273  48.809  11.249  1.00 29.26 ? 48  HIS S CD2 1 
ATOM   4048  C  CE1 . HIS B 2 48  ? -4.857  50.483  11.247  1.00 30.28 ? 48  HIS S CE1 1 
ATOM   4049  N  NE2 . HIS B 2 48  ? -4.949  49.165  11.242  1.00 30.69 ? 48  HIS S NE2 1 
ATOM   4050  N  N   . GLY B 2 49  ? -11.257 49.895  8.890   1.00 23.34 ? 49  GLY S N   1 
ATOM   4051  C  CA  . GLY B 2 49  ? -12.700 50.030  8.826   1.00 21.75 ? 49  GLY S CA  1 
ATOM   4052  C  C   . GLY B 2 49  ? -13.481 49.267  9.881   1.00 20.14 ? 49  GLY S C   1 
ATOM   4053  O  O   . GLY B 2 49  ? -14.690 49.483  10.012  1.00 19.83 ? 49  GLY S O   1 
ATOM   4054  N  N   . PHE B 2 50  ? -12.814 48.377  10.617  1.00 19.24 ? 50  PHE S N   1 
ATOM   4055  C  CA  . PHE B 2 50  ? -13.477 47.594  11.653  1.00 18.31 ? 50  PHE S CA  1 
ATOM   4056  C  C   . PHE B 2 50  ? -12.633 47.525  12.911  1.00 17.59 ? 50  PHE S C   1 
ATOM   4057  O  O   . PHE B 2 50  ? -11.419 47.751  12.873  1.00 15.85 ? 50  PHE S O   1 
ATOM   4058  C  CB  . PHE B 2 50  ? -13.742 46.202  11.139  1.00 18.82 ? 50  PHE S CB  1 
ATOM   4059  C  CG  . PHE B 2 50  ? -14.572 46.177  9.886   1.00 20.28 ? 50  PHE S CG  1 
ATOM   4060  C  CD1 . PHE B 2 50  ? -15.931 46.470  9.938   1.00 20.10 ? 50  PHE S CD1 1 
ATOM   4061  C  CD2 . PHE B 2 50  ? -13.988 45.929  8.640   1.00 20.19 ? 50  PHE S CD2 1 
ATOM   4062  C  CE1 . PHE B 2 50  ? -16.705 46.517  8.782   1.00 20.51 ? 50  PHE S CE1 1 
ATOM   4063  C  CE2 . PHE B 2 50  ? -14.765 45.974  7.457   1.00 21.19 ? 50  PHE S CE2 1 
ATOM   4064  C  CZ  . PHE B 2 50  ? -16.134 46.277  7.543   1.00 20.38 ? 50  PHE S CZ  1 
ATOM   4065  N  N   . VAL B 2 51  ? -13.288 47.290  14.040  1.00 16.72 ? 51  VAL S N   1 
ATOM   4066  C  CA  . VAL B 2 51  ? -12.578 47.234  15.297  1.00 16.65 ? 51  VAL S CA  1 
ATOM   4067  C  C   . VAL B 2 51  ? -11.617 46.065  15.357  1.00 15.66 ? 51  VAL S C   1 
ATOM   4068  O  O   . VAL B 2 51  ? -11.882 44.984  14.841  1.00 15.78 ? 51  VAL S O   1 
ATOM   4069  C  CB  . VAL B 2 51  ? -13.560 47.158  16.496  1.00 17.14 ? 51  VAL S CB  1 
ATOM   4070  C  CG1 . VAL B 2 51  ? -14.328 48.449  16.626  1.00 17.80 ? 51  VAL S CG1 1 
ATOM   4071  C  CG2 . VAL B 2 51  ? -14.497 45.977  16.316  1.00 17.76 ? 51  VAL S CG2 1 
ATOM   4072  N  N   . TYR B 2 52  ? -10.492 46.305  16.014  1.00 15.37 ? 52  TYR S N   1 
ATOM   4073  C  CA  . TYR B 2 52  ? -9.460  45.294  16.194  1.00 14.64 ? 52  TYR S CA  1 
ATOM   4074  C  C   . TYR B 2 52  ? -8.839  45.545  17.563  1.00 14.65 ? 52  TYR S C   1 
ATOM   4075  O  O   . TYR B 2 52  ? -9.238  46.480  18.255  1.00 15.54 ? 52  TYR S O   1 
ATOM   4076  C  CB  . TYR B 2 52  ? -8.389  45.398  15.089  1.00 14.09 ? 52  TYR S CB  1 
ATOM   4077  C  CG  . TYR B 2 52  ? -7.712  46.755  14.974  1.00 12.16 ? 52  TYR S CG  1 
ATOM   4078  C  CD1 . TYR B 2 52  ? -8.405  47.872  14.501  1.00 14.63 ? 52  TYR S CD1 1 
ATOM   4079  C  CD2 . TYR B 2 52  ? -6.376  46.919  15.339  1.00 13.74 ? 52  TYR S CD2 1 
ATOM   4080  C  CE1 . TYR B 2 52  ? -7.778  49.126  14.396  1.00 14.49 ? 52  TYR S CE1 1 
ATOM   4081  C  CE2 . TYR B 2 52  ? -5.739  48.166  15.238  1.00 13.55 ? 52  TYR S CE2 1 
ATOM   4082  C  CZ  . TYR B 2 52  ? -6.445  49.262  14.766  1.00 15.94 ? 52  TYR S CZ  1 
ATOM   4083  O  OH  . TYR B 2 52  ? -5.821  50.493  14.671  1.00 16.79 ? 52  TYR S OH  1 
ATOM   4084  N  N   . ARG B 2 53  ? -7.881  44.717  17.962  1.00 13.63 ? 53  ARG S N   1 
ATOM   4085  C  CA  . ARG B 2 53  ? -7.226  44.895  19.252  1.00 15.74 ? 53  ARG S CA  1 
ATOM   4086  C  C   . ARG B 2 53  ? -5.735  44.721  19.077  1.00 17.79 ? 53  ARG S C   1 
ATOM   4087  O  O   . ARG B 2 53  ? -5.239  43.600  18.965  1.00 20.38 ? 53  ARG S O   1 
ATOM   4088  C  CB  . ARG B 2 53  ? -7.748  43.883  20.269  1.00 15.62 ? 53  ARG S CB  1 
ATOM   4089  C  CG  . ARG B 2 53  ? -9.131  44.199  20.776  1.00 15.57 ? 53  ARG S CG  1 
ATOM   4090  C  CD  . ARG B 2 53  ? -9.562  43.188  21.802  1.00 15.66 ? 53  ARG S CD  1 
ATOM   4091  N  NE  . ARG B 2 53  ? -10.159 43.835  22.959  1.00 12.97 ? 53  ARG S NE  1 
ATOM   4092  C  CZ  . ARG B 2 53  ? -10.664 43.176  23.994  1.00 13.73 ? 53  ARG S CZ  1 
ATOM   4093  N  NH1 . ARG B 2 53  ? -10.638 41.851  24.005  1.00 12.56 ? 53  ARG S NH1 1 
ATOM   4094  N  NH2 . ARG B 2 53  ? -11.193 43.840  25.011  1.00 9.91  ? 53  ARG S NH2 1 
ATOM   4095  N  N   . GLU B 2 54  ? -5.024  45.840  19.058  1.00 17.53 ? 54  GLU S N   1 
ATOM   4096  C  CA  . GLU B 2 54  ? -3.589  45.811  18.876  1.00 19.54 ? 54  GLU S CA  1 
ATOM   4097  C  C   . GLU B 2 54  ? -2.820  46.287  20.096  1.00 19.41 ? 54  GLU S C   1 
ATOM   4098  O  O   . GLU B 2 54  ? -1.867  45.640  20.518  1.00 20.71 ? 54  GLU S O   1 
ATOM   4099  C  CB  . GLU B 2 54  ? -3.199  46.677  17.680  1.00 20.87 ? 54  GLU S CB  1 
ATOM   4100  C  CG  . GLU B 2 54  ? -1.756  46.501  17.249  1.00 25.96 ? 54  GLU S CG  1 
ATOM   4101  C  CD  . GLU B 2 54  ? -1.324  47.534  16.233  1.00 29.24 ? 54  GLU S CD  1 
ATOM   4102  O  OE1 . GLU B 2 54  ? -2.090  47.795  15.280  1.00 29.97 ? 54  GLU S OE1 1 
ATOM   4103  O  OE2 . GLU B 2 54  ? -0.212  48.078  16.384  1.00 31.91 ? 54  GLU S OE2 1 
ATOM   4104  N  N   . HIS B 2 55  ? -3.243  47.408  20.674  1.00 18.45 ? 55  HIS S N   1 
ATOM   4105  C  CA  . HIS B 2 55  ? -2.526  47.975  21.812  1.00 18.31 ? 55  HIS S CA  1 
ATOM   4106  C  C   . HIS B 2 55  ? -2.926  47.552  23.218  1.00 19.34 ? 55  HIS S C   1 
ATOM   4107  O  O   . HIS B 2 55  ? -2.198  47.820  24.168  1.00 20.83 ? 55  HIS S O   1 
ATOM   4108  C  CB  . HIS B 2 55  ? -2.554  49.497  21.711  1.00 18.60 ? 55  HIS S CB  1 
ATOM   4109  C  CG  . HIS B 2 55  ? -2.038  50.014  20.408  1.00 19.87 ? 55  HIS S CG  1 
ATOM   4110  N  ND1 . HIS B 2 55  ? -2.869  50.379  19.370  1.00 20.81 ? 55  HIS S ND1 1 
ATOM   4111  C  CD2 . HIS B 2 55  ? -0.773  50.180  19.953  1.00 19.80 ? 55  HIS S CD2 1 
ATOM   4112  C  CE1 . HIS B 2 55  ? -2.138  50.748  18.333  1.00 20.39 ? 55  HIS S CE1 1 
ATOM   4113  N  NE2 . HIS B 2 55  ? -0.864  50.636  18.662  1.00 21.20 ? 55  HIS S NE2 1 
ATOM   4114  N  N   . HIS B 2 56  ? -4.072  46.898  23.364  1.00 18.20 ? 56  HIS S N   1 
ATOM   4115  C  CA  . HIS B 2 56  ? -4.510  46.457  24.681  1.00 18.82 ? 56  HIS S CA  1 
ATOM   4116  C  C   . HIS B 2 56  ? -5.676  45.498  24.515  1.00 19.85 ? 56  HIS S C   1 
ATOM   4117  O  O   . HIS B 2 56  ? -6.336  45.508  23.463  1.00 19.75 ? 56  HIS S O   1 
ATOM   4118  C  CB  . HIS B 2 56  ? -4.898  47.685  25.524  1.00 19.60 ? 56  HIS S CB  1 
ATOM   4119  C  CG  . HIS B 2 56  ? -4.609  47.543  26.987  1.00 21.03 ? 56  HIS S CG  1 
ATOM   4120  N  ND1 . HIS B 2 56  ? -5.597  47.349  27.931  1.00 21.48 ? 56  HIS S ND1 1 
ATOM   4121  C  CD2 . HIS B 2 56  ? -3.439  47.572  27.671  1.00 19.53 ? 56  HIS S CD2 1 
ATOM   4122  C  CE1 . HIS B 2 56  ? -5.047  47.265  29.130  1.00 22.05 ? 56  HIS S CE1 1 
ATOM   4123  N  NE2 . HIS B 2 56  ? -3.741  47.396  29.000  1.00 22.44 ? 56  HIS S NE2 1 
ATOM   4124  N  N   . ASN B 2 57  ? -5.909  44.669  25.539  1.00 20.47 ? 57  ASN S N   1 
ATOM   4125  C  CA  . ASN B 2 57  ? -6.999  43.686  25.490  1.00 21.68 ? 57  ASN S CA  1 
ATOM   4126  C  C   . ASN B 2 57  ? -7.911  43.695  26.691  1.00 19.38 ? 57  ASN S C   1 
ATOM   4127  O  O   . ASN B 2 57  ? -8.669  42.775  26.883  1.00 18.86 ? 57  ASN S O   1 
ATOM   4128  C  CB  . ASN B 2 57  ? -6.453  42.245  25.290  1.00 26.05 ? 57  ASN S CB  1 
ATOM   4129  C  CG  . ASN B 2 57  ? -5.534  42.139  24.117  1.00 32.08 ? 57  ASN S CG  1 
ATOM   4130  O  OD1 . ASN B 2 57  ? -5.754  41.348  23.205  1.00 34.10 ? 57  ASN S OD1 1 
ATOM   4131  N  ND2 . ASN B 2 57  ? -4.458  42.912  24.152  1.00 34.52 ? 57  ASN S ND2 1 
ATOM   4132  N  N   . SER B 2 58  ? -7.760  44.694  27.547  1.00 16.04 ? 58  SER S N   1 
ATOM   4133  C  CA  . SER B 2 58  ? -8.587  44.746  28.750  1.00 13.54 ? 58  SER S CA  1 
ATOM   4134  C  C   . SER B 2 58  ? -10.064 45.044  28.436  1.00 11.93 ? 58  SER S C   1 
ATOM   4135  O  O   . SER B 2 58  ? -10.408 45.568  27.373  1.00 10.27 ? 58  SER S O   1 
ATOM   4136  C  CB  . SER B 2 58  ? -8.031  45.776  29.764  1.00 10.16 ? 58  SER S CB  1 
ATOM   4137  O  OG  . SER B 2 58  ? -7.958  47.070  29.196  1.00 12.48 ? 58  SER S OG  1 
ATOM   4138  N  N   . PRO B 2 59  ? -10.966 44.693  29.369  1.00 12.01 ? 59  PRO S N   1 
ATOM   4139  C  CA  . PRO B 2 59  ? -12.405 44.922  29.193  1.00 11.33 ? 59  PRO S CA  1 
ATOM   4140  C  C   . PRO B 2 59  ? -12.763 46.315  28.684  1.00 10.65 ? 59  PRO S C   1 
ATOM   4141  O  O   . PRO B 2 59  ? -12.310 47.322  29.229  1.00 11.89 ? 59  PRO S O   1 
ATOM   4142  C  CB  . PRO B 2 59  ? -12.966 44.659  30.588  1.00 11.79 ? 59  PRO S CB  1 
ATOM   4143  C  CG  . PRO B 2 59  ? -12.066 43.588  31.108  1.00 11.78 ? 59  PRO S CG  1 
ATOM   4144  C  CD  . PRO B 2 59  ? -10.696 44.088  30.688  1.00 11.14 ? 59  PRO S CD  1 
ATOM   4145  N  N   . GLY B 2 60  ? -13.568 46.361  27.629  1.00 10.25 ? 60  GLY S N   1 
ATOM   4146  C  CA  . GLY B 2 60  ? -13.984 47.639  27.084  1.00 7.65  ? 60  GLY S CA  1 
ATOM   4147  C  C   . GLY B 2 60  ? -12.985 48.375  26.210  1.00 8.67  ? 60  GLY S C   1 
ATOM   4148  O  O   . GLY B 2 60  ? -13.279 49.472  25.745  1.00 6.90  ? 60  GLY S O   1 
ATOM   4149  N  N   . TYR B 2 61  ? -11.805 47.799  25.991  1.00 9.22  ? 61  TYR S N   1 
ATOM   4150  C  CA  . TYR B 2 61  ? -10.812 48.452  25.138  1.00 10.46 ? 61  TYR S CA  1 
ATOM   4151  C  C   . TYR B 2 61  ? -10.754 47.833  23.744  1.00 11.46 ? 61  TYR S C   1 
ATOM   4152  O  O   . TYR B 2 61  ? -10.545 46.628  23.591  1.00 12.31 ? 61  TYR S O   1 
ATOM   4153  C  CB  . TYR B 2 61  ? -9.404  48.404  25.756  1.00 10.94 ? 61  TYR S CB  1 
ATOM   4154  C  CG  . TYR B 2 61  ? -8.373  49.092  24.881  1.00 9.99  ? 61  TYR S CG  1 
ATOM   4155  C  CD1 . TYR B 2 61  ? -7.857  48.466  23.740  1.00 10.64 ? 61  TYR S CD1 1 
ATOM   4156  C  CD2 . TYR B 2 61  ? -8.005  50.412  25.123  1.00 10.50 ? 61  TYR S CD2 1 
ATOM   4157  C  CE1 . TYR B 2 61  ? -7.012  49.150  22.859  1.00 9.81  ? 61  TYR S CE1 1 
ATOM   4158  C  CE2 . TYR B 2 61  ? -7.165  51.099  24.250  1.00 8.57  ? 61  TYR S CE2 1 
ATOM   4159  C  CZ  . TYR B 2 61  ? -6.676  50.474  23.125  1.00 10.98 ? 61  TYR S CZ  1 
ATOM   4160  O  OH  . TYR B 2 61  ? -5.873  51.194  22.270  1.00 10.59 ? 61  TYR S OH  1 
ATOM   4161  N  N   . TYR B 2 62  ? -10.931 48.674  22.731  1.00 10.49 ? 62  TYR S N   1 
ATOM   4162  C  CA  . TYR B 2 62  ? -10.885 48.238  21.341  1.00 11.31 ? 62  TYR S CA  1 
ATOM   4163  C  C   . TYR B 2 62  ? -10.243 49.349  20.519  1.00 11.47 ? 62  TYR S C   1 
ATOM   4164  O  O   . TYR B 2 62  ? -10.440 50.527  20.808  1.00 13.47 ? 62  TYR S O   1 
ATOM   4165  C  CB  . TYR B 2 62  ? -12.298 48.008  20.798  1.00 12.00 ? 62  TYR S CB  1 
ATOM   4166  C  CG  . TYR B 2 62  ? -13.120 46.978  21.541  1.00 10.97 ? 62  TYR S CG  1 
ATOM   4167  C  CD1 . TYR B 2 62  ? -12.985 45.618  21.269  1.00 10.69 ? 62  TYR S CD1 1 
ATOM   4168  C  CD2 . TYR B 2 62  ? -14.042 47.369  22.511  1.00 11.32 ? 62  TYR S CD2 1 
ATOM   4169  C  CE1 . TYR B 2 62  ? -13.754 44.668  21.940  1.00 12.06 ? 62  TYR S CE1 1 
ATOM   4170  C  CE2 . TYR B 2 62  ? -14.815 46.428  23.191  1.00 10.52 ? 62  TYR S CE2 1 
ATOM   4171  C  CZ  . TYR B 2 62  ? -14.667 45.082  22.901  1.00 11.86 ? 62  TYR S CZ  1 
ATOM   4172  O  OH  . TYR B 2 62  ? -15.443 44.157  23.562  1.00 13.07 ? 62  TYR S OH  1 
ATOM   4173  N  N   . ASP B 2 63  ? -9.471  48.975  19.506  1.00 10.86 ? 63  ASP S N   1 
ATOM   4174  C  CA  . ASP B 2 63  ? -8.864  49.962  18.622  1.00 11.21 ? 63  ASP S CA  1 
ATOM   4175  C  C   . ASP B 2 63  ? -9.826  50.055  17.444  1.00 11.44 ? 63  ASP S C   1 
ATOM   4176  O  O   . ASP B 2 63  ? -10.612 49.132  17.209  1.00 10.79 ? 63  ASP S O   1 
ATOM   4177  C  CB  . ASP B 2 63  ? -7.492  49.495  18.119  1.00 10.16 ? 63  ASP S CB  1 
ATOM   4178  C  CG  . ASP B 2 63  ? -6.438  49.482  19.208  1.00 10.63 ? 63  ASP S CG  1 
ATOM   4179  O  OD1 . ASP B 2 63  ? -6.151  50.556  19.780  1.00 8.92  ? 63  ASP S OD1 1 
ATOM   4180  O  OD2 . ASP B 2 63  ? -5.890  48.394  19.485  1.00 11.82 ? 63  ASP S OD2 1 
ATOM   4181  N  N   . GLY B 2 64  ? -9.779  51.164  16.715  1.00 10.05 ? 64  GLY S N   1 
ATOM   4182  C  CA  . GLY B 2 64  ? -10.651 51.315  15.565  1.00 10.81 ? 64  GLY S CA  1 
ATOM   4183  C  C   . GLY B 2 64  ? -12.003 51.980  15.772  1.00 11.49 ? 64  GLY S C   1 
ATOM   4184  O  O   . GLY B 2 64  ? -12.766 52.100  14.815  1.00 12.16 ? 64  GLY S O   1 
ATOM   4185  N  N   . ARG B 2 65  ? -12.327 52.403  16.992  1.00 10.16 ? 65  ARG S N   1 
ATOM   4186  C  CA  . ARG B 2 65  ? -13.612 53.064  17.212  1.00 10.76 ? 65  ARG S CA  1 
ATOM   4187  C  C   . ARG B 2 65  ? -13.532 54.496  16.719  1.00 11.39 ? 65  ARG S C   1 
ATOM   4188  O  O   . ARG B 2 65  ? -14.467 55.001  16.102  1.00 11.57 ? 65  ARG S O   1 
ATOM   4189  C  CB  . ARG B 2 65  ? -13.986 53.085  18.688  1.00 11.56 ? 65  ARG S CB  1 
ATOM   4190  C  CG  . ARG B 2 65  ? -14.137 51.735  19.320  1.00 12.35 ? 65  ARG S CG  1 
ATOM   4191  C  CD  . ARG B 2 65  ? -13.262 51.715  20.549  1.00 17.31 ? 65  ARG S CD  1 
ATOM   4192  N  NE  . ARG B 2 65  ? -13.998 51.339  21.739  1.00 16.82 ? 65  ARG S NE  1 
ATOM   4193  C  CZ  . ARG B 2 65  ? -13.501 51.402  22.966  1.00 14.79 ? 65  ARG S CZ  1 
ATOM   4194  N  NH1 . ARG B 2 65  ? -12.261 51.834  23.163  1.00 12.93 ? 65  ARG S NH1 1 
ATOM   4195  N  NH2 . ARG B 2 65  ? -14.245 51.022  23.991  1.00 11.95 ? 65  ARG S NH2 1 
ATOM   4196  N  N   . TYR B 2 66  ? -12.414 55.152  17.012  1.00 9.87  ? 66  TYR S N   1 
ATOM   4197  C  CA  . TYR B 2 66  ? -12.223 56.524  16.584  1.00 9.14  ? 66  TYR S CA  1 
ATOM   4198  C  C   . TYR B 2 66  ? -11.879 56.579  15.110  1.00 9.11  ? 66  TYR S C   1 
ATOM   4199  O  O   . TYR B 2 66  ? -10.975 55.884  14.650  1.00 8.10  ? 66  TYR S O   1 
ATOM   4200  C  CB  . TYR B 2 66  ? -11.096 57.195  17.373  1.00 9.42  ? 66  TYR S CB  1 
ATOM   4201  C  CG  . TYR B 2 66  ? -11.475 57.629  18.767  1.00 8.57  ? 66  TYR S CG  1 
ATOM   4202  C  CD1 . TYR B 2 66  ? -12.578 58.455  18.981  1.00 6.66  ? 66  TYR S CD1 1 
ATOM   4203  C  CD2 . TYR B 2 66  ? -10.717 57.235  19.869  1.00 5.90  ? 66  TYR S CD2 1 
ATOM   4204  C  CE1 . TYR B 2 66  ? -12.916 58.881  20.257  1.00 8.71  ? 66  TYR S CE1 1 
ATOM   4205  C  CE2 . TYR B 2 66  ? -11.046 57.651  21.151  1.00 5.13  ? 66  TYR S CE2 1 
ATOM   4206  C  CZ  . TYR B 2 66  ? -12.147 58.472  21.339  1.00 4.59  ? 66  TYR S CZ  1 
ATOM   4207  O  OH  . TYR B 2 66  ? -12.491 58.880  22.601  1.00 6.01  ? 66  TYR S OH  1 
ATOM   4208  N  N   . TRP B 2 67  ? -12.626 57.393  14.375  1.00 9.02  ? 67  TRP S N   1 
ATOM   4209  C  CA  . TRP B 2 67  ? -12.384 57.601  12.957  1.00 8.60  ? 67  TRP S CA  1 
ATOM   4210  C  C   . TRP B 2 67  ? -11.915 59.050  12.887  1.00 10.05 ? 67  TRP S C   1 
ATOM   4211  O  O   . TRP B 2 67  ? -11.734 59.680  13.927  1.00 10.99 ? 67  TRP S O   1 
ATOM   4212  C  CB  . TRP B 2 67  ? -13.673 57.384  12.154  1.00 10.12 ? 67  TRP S CB  1 
ATOM   4213  C  CG  . TRP B 2 67  ? -13.952 55.926  11.855  1.00 10.55 ? 67  TRP S CG  1 
ATOM   4214  C  CD1 . TRP B 2 67  ? -13.358 54.837  12.437  1.00 10.04 ? 67  TRP S CD1 1 
ATOM   4215  C  CD2 . TRP B 2 67  ? -14.891 55.407  10.902  1.00 9.70  ? 67  TRP S CD2 1 
ATOM   4216  N  NE1 . TRP B 2 67  ? -13.869 53.677  11.905  1.00 9.87  ? 67  TRP S NE1 1 
ATOM   4217  C  CE2 . TRP B 2 67  ? -14.811 53.995  10.965  1.00 10.01 ? 67  TRP S CE2 1 
ATOM   4218  C  CE3 . TRP B 2 67  ? -15.793 55.995  10.005  1.00 11.09 ? 67  TRP S CE3 1 
ATOM   4219  C  CZ2 . TRP B 2 67  ? -15.600 53.162  10.159  1.00 11.00 ? 67  TRP S CZ2 1 
ATOM   4220  C  CZ3 . TRP B 2 67  ? -16.578 55.166  9.204   1.00 10.76 ? 67  TRP S CZ3 1 
ATOM   4221  C  CH2 . TRP B 2 67  ? -16.475 53.763  9.291   1.00 9.99  ? 67  TRP S CH2 1 
ATOM   4222  N  N   . THR B 2 68  ? -11.712 59.585  11.689  1.00 9.01  ? 68  THR S N   1 
ATOM   4223  C  CA  . THR B 2 68  ? -11.243 60.963  11.566  1.00 10.58 ? 68  THR S CA  1 
ATOM   4224  C  C   . THR B 2 68  ? -12.381 61.930  11.269  1.00 11.65 ? 68  THR S C   1 
ATOM   4225  O  O   . THR B 2 68  ? -13.268 61.637  10.469  1.00 11.89 ? 68  THR S O   1 
ATOM   4226  C  CB  . THR B 2 68  ? -10.176 61.086  10.465  1.00 10.15 ? 68  THR S CB  1 
ATOM   4227  O  OG1 . THR B 2 68  ? -9.156  60.111  10.693  1.00 12.92 ? 68  THR S OG1 1 
ATOM   4228  C  CG2 . THR B 2 68  ? -9.538  62.475  10.481  1.00 10.26 ? 68  THR S CG2 1 
ATOM   4229  N  N   . MET B 2 69  ? -12.343 63.085  11.923  1.00 10.24 ? 69  MET S N   1 
ATOM   4230  C  CA  . MET B 2 69  ? -13.372 64.097  11.749  1.00 12.43 ? 69  MET S CA  1 
ATOM   4231  C  C   . MET B 2 69  ? -13.224 64.889  10.452  1.00 12.34 ? 69  MET S C   1 
ATOM   4232  O  O   . MET B 2 69  ? -12.133 65.349  10.114  1.00 10.81 ? 69  MET S O   1 
ATOM   4233  C  CB  . MET B 2 69  ? -13.350 65.063  12.937  1.00 12.36 ? 69  MET S CB  1 
ATOM   4234  C  CG  . MET B 2 69  ? -14.391 66.165  12.869  1.00 15.44 ? 69  MET S CG  1 
ATOM   4235  S  SD  . MET B 2 69  ? -14.286 67.271  14.290  1.00 17.82 ? 69  MET S SD  1 
ATOM   4236  C  CE  . MET B 2 69  ? -15.097 66.287  15.538  1.00 17.34 ? 69  MET S CE  1 
ATOM   4237  N  N   . TRP B 2 70  ? -14.325 65.031  9.723   1.00 11.72 ? 70  TRP S N   1 
ATOM   4238  C  CA  . TRP B 2 70  ? -14.323 65.807  8.490   1.00 12.46 ? 70  TRP S CA  1 
ATOM   4239  C  C   . TRP B 2 70  ? -14.684 67.229  8.906   1.00 12.08 ? 70  TRP S C   1 
ATOM   4240  O  O   . TRP B 2 70  ? -15.813 67.496  9.317   1.00 11.64 ? 70  TRP S O   1 
ATOM   4241  C  CB  . TRP B 2 70  ? -15.354 65.256  7.499   1.00 13.83 ? 70  TRP S CB  1 
ATOM   4242  C  CG  . TRP B 2 70  ? -15.530 66.112  6.283   1.00 15.23 ? 70  TRP S CG  1 
ATOM   4243  C  CD1 . TRP B 2 70  ? -16.559 66.973  6.026   1.00 14.94 ? 70  TRP S CD1 1 
ATOM   4244  C  CD2 . TRP B 2 70  ? -14.632 66.215  5.171   1.00 15.17 ? 70  TRP S CD2 1 
ATOM   4245  N  NE1 . TRP B 2 70  ? -16.360 67.604  4.821   1.00 14.54 ? 70  TRP S NE1 1 
ATOM   4246  C  CE2 . TRP B 2 70  ? -15.189 67.155  4.272   1.00 15.11 ? 70  TRP S CE2 1 
ATOM   4247  C  CE3 . TRP B 2 70  ? -13.419 65.596  4.840   1.00 15.63 ? 70  TRP S CE3 1 
ATOM   4248  C  CZ2 . TRP B 2 70  ? -14.564 67.503  3.068   1.00 14.53 ? 70  TRP S CZ2 1 
ATOM   4249  C  CZ3 . TRP B 2 70  ? -12.797 65.941  3.641   1.00 16.95 ? 70  TRP S CZ3 1 
ATOM   4250  C  CH2 . TRP B 2 70  ? -13.376 66.883  2.767   1.00 16.08 ? 70  TRP S CH2 1 
ATOM   4251  N  N   . LYS B 2 71  ? -13.709 68.129  8.817   1.00 12.22 ? 71  LYS S N   1 
ATOM   4252  C  CA  . LYS B 2 71  ? -13.893 69.523  9.207   1.00 12.04 ? 71  LYS S CA  1 
ATOM   4253  C  C   . LYS B 2 71  ? -14.351 69.598  10.669  1.00 12.82 ? 71  LYS S C   1 
ATOM   4254  O  O   . LYS B 2 71  ? -13.662 69.094  11.557  1.00 13.33 ? 71  LYS S O   1 
ATOM   4255  C  CB  . LYS B 2 71  ? -14.895 70.210  8.269   1.00 12.73 ? 71  LYS S CB  1 
ATOM   4256  C  CG  . LYS B 2 71  ? -14.385 70.310  6.834   1.00 13.19 ? 71  LYS S CG  1 
ATOM   4257  C  CD  . LYS B 2 71  ? -15.338 71.059  5.920   1.00 13.35 ? 71  LYS S CD  1 
ATOM   4258  C  CE  . LYS B 2 71  ? -14.832 71.040  4.480   1.00 14.92 ? 71  LYS S CE  1 
ATOM   4259  N  NZ  . LYS B 2 71  ? -15.781 71.715  3.546   1.00 16.11 ? 71  LYS S NZ  1 
ATOM   4260  N  N   . LEU B 2 72  ? -15.498 70.221  10.925  1.00 11.74 ? 72  LEU S N   1 
ATOM   4261  C  CA  . LEU B 2 72  ? -16.011 70.336  12.292  1.00 11.70 ? 72  LEU S CA  1 
ATOM   4262  C  C   . LEU B 2 72  ? -17.504 70.032  12.355  1.00 11.95 ? 72  LEU S C   1 
ATOM   4263  O  O   . LEU B 2 72  ? -18.180 70.004  11.330  1.00 12.16 ? 72  LEU S O   1 
ATOM   4264  C  CB  . LEU B 2 72  ? -15.783 71.754  12.836  1.00 10.46 ? 72  LEU S CB  1 
ATOM   4265  C  CG  . LEU B 2 72  ? -14.380 72.207  13.245  1.00 11.74 ? 72  LEU S CG  1 
ATOM   4266  C  CD1 . LEU B 2 72  ? -14.452 73.633  13.772  1.00 12.57 ? 72  LEU S CD1 1 
ATOM   4267  C  CD2 . LEU B 2 72  ? -13.832 71.281  14.317  1.00 9.66  ? 72  LEU S CD2 1 
ATOM   4268  N  N   . PRO B 2 73  ? -18.035 69.782  13.565  1.00 13.03 ? 73  PRO S N   1 
ATOM   4269  C  CA  . PRO B 2 73  ? -19.468 69.500  13.671  1.00 12.86 ? 73  PRO S CA  1 
ATOM   4270  C  C   . PRO B 2 73  ? -20.171 70.728  13.097  1.00 15.58 ? 73  PRO S C   1 
ATOM   4271  O  O   . PRO B 2 73  ? -19.678 71.847  13.244  1.00 14.05 ? 73  PRO S O   1 
ATOM   4272  C  CB  . PRO B 2 73  ? -19.681 69.359  15.174  1.00 13.07 ? 73  PRO S CB  1 
ATOM   4273  C  CG  . PRO B 2 73  ? -18.359 68.800  15.643  1.00 14.13 ? 73  PRO S CG  1 
ATOM   4274  C  CD  . PRO B 2 73  ? -17.371 69.646  14.874  1.00 12.25 ? 73  PRO S CD  1 
ATOM   4275  N  N   . MET B 2 74  ? -21.307 70.525  12.440  1.00 15.48 ? 74  MET S N   1 
ATOM   4276  C  CA  . MET B 2 74  ? -22.030 71.632  11.829  1.00 16.78 ? 74  MET S CA  1 
ATOM   4277  C  C   . MET B 2 74  ? -23.006 72.313  12.787  1.00 16.87 ? 74  MET S C   1 
ATOM   4278  O  O   . MET B 2 74  ? -24.225 72.189  12.649  1.00 17.33 ? 74  MET S O   1 
ATOM   4279  C  CB  . MET B 2 74  ? -22.737 71.115  10.575  1.00 16.66 ? 74  MET S CB  1 
ATOM   4280  C  CG  . MET B 2 74  ? -21.742 70.483  9.597   1.00 18.68 ? 74  MET S CG  1 
ATOM   4281  S  SD  . MET B 2 74  ? -22.446 69.588  8.201   1.00 20.81 ? 74  MET S SD  1 
ATOM   4282  C  CE  . MET B 2 74  ? -22.660 70.915  7.049   1.00 21.85 ? 74  MET S CE  1 
ATOM   4283  N  N   . PHE B 2 75  ? -22.449 73.045  13.751  1.00 17.14 ? 75  PHE S N   1 
ATOM   4284  C  CA  . PHE B 2 75  ? -23.227 73.756  14.761  1.00 18.04 ? 75  PHE S CA  1 
ATOM   4285  C  C   . PHE B 2 75  ? -24.189 74.771  14.145  1.00 20.64 ? 75  PHE S C   1 
ATOM   4286  O  O   . PHE B 2 75  ? -23.788 75.605  13.332  1.00 19.46 ? 75  PHE S O   1 
ATOM   4287  C  CB  . PHE B 2 75  ? -22.291 74.491  15.729  1.00 17.65 ? 75  PHE S CB  1 
ATOM   4288  C  CG  . PHE B 2 75  ? -21.330 73.590  16.458  1.00 16.19 ? 75  PHE S CG  1 
ATOM   4289  C  CD1 . PHE B 2 75  ? -21.788 72.668  17.395  1.00 16.56 ? 75  PHE S CD1 1 
ATOM   4290  C  CD2 . PHE B 2 75  ? -19.961 73.673  16.213  1.00 17.07 ? 75  PHE S CD2 1 
ATOM   4291  C  CE1 . PHE B 2 75  ? -20.893 71.842  18.079  1.00 15.80 ? 75  PHE S CE1 1 
ATOM   4292  C  CE2 . PHE B 2 75  ? -19.059 72.852  16.892  1.00 15.05 ? 75  PHE S CE2 1 
ATOM   4293  C  CZ  . PHE B 2 75  ? -19.527 71.934  17.827  1.00 15.62 ? 75  PHE S CZ  1 
ATOM   4294  N  N   . GLY B 2 76  ? -25.456 74.696  14.544  1.00 22.81 ? 76  GLY S N   1 
ATOM   4295  C  CA  . GLY B 2 76  ? -26.451 75.625  14.039  1.00 25.53 ? 76  GLY S CA  1 
ATOM   4296  C  C   . GLY B 2 76  ? -27.020 75.305  12.668  1.00 28.09 ? 76  GLY S C   1 
ATOM   4297  O  O   . GLY B 2 76  ? -27.797 76.088  12.123  1.00 28.67 ? 76  GLY S O   1 
ATOM   4298  N  N   . CYS B 2 77  ? -26.638 74.164  12.103  1.00 28.75 ? 77  CYS S N   1 
ATOM   4299  C  CA  . CYS B 2 77  ? -27.133 73.766  10.789  1.00 29.96 ? 77  CYS S CA  1 
ATOM   4300  C  C   . CYS B 2 77  ? -28.627 73.432  10.826  1.00 30.94 ? 77  CYS S C   1 
ATOM   4301  O  O   . CYS B 2 77  ? -29.091 72.715  11.716  1.00 31.28 ? 77  CYS S O   1 
ATOM   4302  C  CB  . CYS B 2 77  ? -26.351 72.553  10.286  1.00 29.55 ? 77  CYS S CB  1 
ATOM   4303  S  SG  . CYS B 2 77  ? -26.994 71.846  8.759   1.00 31.09 ? 77  CYS S SG  1 
ATOM   4304  N  N   . THR B 2 78  ? -29.376 73.952  9.857   1.00 30.64 ? 78  THR S N   1 
ATOM   4305  C  CA  . THR B 2 78  ? -30.814 73.701  9.782   1.00 31.43 ? 78  THR S CA  1 
ATOM   4306  C  C   . THR B 2 78  ? -31.225 73.237  8.388   1.00 30.92 ? 78  THR S C   1 
ATOM   4307  O  O   . THR B 2 78  ? -32.384 72.902  8.153   1.00 31.85 ? 78  THR S O   1 
ATOM   4308  C  CB  . THR B 2 78  ? -31.634 74.970  10.130  1.00 32.82 ? 78  THR S CB  1 
ATOM   4309  O  OG1 . THR B 2 78  ? -31.299 76.025  9.220   1.00 33.17 ? 78  THR S OG1 1 
ATOM   4310  C  CG2 . THR B 2 78  ? -31.351 75.423  11.556  1.00 32.93 ? 78  THR S CG2 1 
ATOM   4311  N  N   . ASP B 2 79  ? -30.265 73.211  7.471   1.00 30.24 ? 79  ASP S N   1 
ATOM   4312  C  CA  . ASP B 2 79  ? -30.521 72.806  6.092   1.00 29.46 ? 79  ASP S CA  1 
ATOM   4313  C  C   . ASP B 2 79  ? -29.864 71.469  5.745   1.00 27.48 ? 79  ASP S C   1 
ATOM   4314  O  O   . ASP B 2 79  ? -28.640 71.361  5.703   1.00 26.48 ? 79  ASP S O   1 
ATOM   4315  C  CB  . ASP B 2 79  ? -30.029 73.914  5.150   1.00 31.75 ? 79  ASP S CB  1 
ATOM   4316  C  CG  . ASP B 2 79  ? -30.148 73.542  3.685   1.00 33.59 ? 79  ASP S CG  1 
ATOM   4317  O  OD1 . ASP B 2 79  ? -31.060 72.767  3.326   1.00 34.02 ? 79  ASP S OD1 1 
ATOM   4318  O  OD2 . ASP B 2 79  ? -29.330 74.044  2.886   1.00 37.12 ? 79  ASP S OD2 1 
ATOM   4319  N  N   . PRO B 2 80  ? -30.679 70.428  5.488   1.00 26.23 ? 80  PRO S N   1 
ATOM   4320  C  CA  . PRO B 2 80  ? -30.156 69.101  5.147   1.00 25.05 ? 80  PRO S CA  1 
ATOM   4321  C  C   . PRO B 2 80  ? -29.261 69.079  3.911   1.00 24.71 ? 80  PRO S C   1 
ATOM   4322  O  O   . PRO B 2 80  ? -28.350 68.259  3.814   1.00 22.85 ? 80  PRO S O   1 
ATOM   4323  C  CB  . PRO B 2 80  ? -31.422 68.259  4.977   1.00 24.42 ? 80  PRO S CB  1 
ATOM   4324  C  CG  . PRO B 2 80  ? -32.440 69.253  4.551   1.00 25.52 ? 80  PRO S CG  1 
ATOM   4325  C  CD  . PRO B 2 80  ? -32.151 70.426  5.455   1.00 26.01 ? 80  PRO S CD  1 
ATOM   4326  N  N   . ALA B 2 81  ? -29.522 69.978  2.967   1.00 24.69 ? 81  ALA S N   1 
ATOM   4327  C  CA  . ALA B 2 81  ? -28.718 70.049  1.750   1.00 24.29 ? 81  ALA S CA  1 
ATOM   4328  C  C   . ALA B 2 81  ? -27.267 70.365  2.110   1.00 23.49 ? 81  ALA S C   1 
ATOM   4329  O  O   . ALA B 2 81  ? -26.337 69.972  1.406   1.00 21.03 ? 81  ALA S O   1 
ATOM   4330  C  CB  . ALA B 2 81  ? -29.270 71.121  0.823   1.00 24.20 ? 81  ALA S CB  1 
ATOM   4331  N  N   . GLN B 2 82  ? -27.091 71.077  3.216   1.00 23.95 ? 82  GLN S N   1 
ATOM   4332  C  CA  . GLN B 2 82  ? -25.772 71.462  3.705   1.00 25.47 ? 82  GLN S CA  1 
ATOM   4333  C  C   . GLN B 2 82  ? -24.947 70.232  4.107   1.00 23.84 ? 82  GLN S C   1 
ATOM   4334  O  O   . GLN B 2 82  ? -23.752 70.164  3.830   1.00 22.60 ? 82  GLN S O   1 
ATOM   4335  C  CB  . GLN B 2 82  ? -25.937 72.397  4.905   1.00 29.97 ? 82  GLN S CB  1 
ATOM   4336  C  CG  . GLN B 2 82  ? -24.648 72.915  5.511   1.00 37.06 ? 82  GLN S CG  1 
ATOM   4337  C  CD  . GLN B 2 82  ? -23.990 73.998  4.678   1.00 42.26 ? 82  GLN S CD  1 
ATOM   4338  O  OE1 . GLN B 2 82  ? -22.938 73.782  4.072   1.00 45.47 ? 82  GLN S OE1 1 
ATOM   4339  N  NE2 . GLN B 2 82  ? -24.611 75.174  4.643   1.00 44.35 ? 82  GLN S NE2 1 
ATOM   4340  N  N   . VAL B 2 83  ? -25.594 69.266  4.758   1.00 22.27 ? 83  VAL S N   1 
ATOM   4341  C  CA  . VAL B 2 83  ? -24.931 68.039  5.197   1.00 19.91 ? 83  VAL S CA  1 
ATOM   4342  C  C   . VAL B 2 83  ? -24.612 67.132  4.006   1.00 21.15 ? 83  VAL S C   1 
ATOM   4343  O  O   . VAL B 2 83  ? -23.520 66.571  3.906   1.00 19.35 ? 83  VAL S O   1 
ATOM   4344  C  CB  . VAL B 2 83  ? -25.821 67.247  6.191   1.00 19.87 ? 83  VAL S CB  1 
ATOM   4345  C  CG1 . VAL B 2 83  ? -25.114 65.977  6.641   1.00 18.03 ? 83  VAL S CG1 1 
ATOM   4346  C  CG2 . VAL B 2 83  ? -26.163 68.113  7.390   1.00 18.66 ? 83  VAL S CG2 1 
ATOM   4347  N  N   . LEU B 2 84  ? -25.577 66.988  3.104   1.00 21.89 ? 84  LEU S N   1 
ATOM   4348  C  CA  . LEU B 2 84  ? -25.393 66.150  1.929   1.00 22.36 ? 84  LEU S CA  1 
ATOM   4349  C  C   . LEU B 2 84  ? -24.289 66.721  1.046   1.00 22.02 ? 84  LEU S C   1 
ATOM   4350  O  O   . LEU B 2 84  ? -23.586 65.980  0.362   1.00 20.31 ? 84  LEU S O   1 
ATOM   4351  C  CB  . LEU B 2 84  ? -26.710 66.046  1.151   1.00 23.25 ? 84  LEU S CB  1 
ATOM   4352  C  CG  . LEU B 2 84  ? -27.831 65.291  1.876   1.00 23.70 ? 84  LEU S CG  1 
ATOM   4353  C  CD1 . LEU B 2 84  ? -29.139 65.424  1.113   1.00 23.98 ? 84  LEU S CD1 1 
ATOM   4354  C  CD2 . LEU B 2 84  ? -27.438 63.828  2.023   1.00 24.45 ? 84  LEU S CD2 1 
ATOM   4355  N  N   . ASN B 2 85  ? -24.136 68.041  1.078   1.00 22.31 ? 85  ASN S N   1 
ATOM   4356  C  CA  . ASN B 2 85  ? -23.109 68.716  0.291   1.00 23.91 ? 85  ASN S CA  1 
ATOM   4357  C  C   . ASN B 2 85  ? -21.726 68.304  0.798   1.00 21.90 ? 85  ASN S C   1 
ATOM   4358  O  O   . ASN B 2 85  ? -20.837 67.975  0.009   1.00 21.15 ? 85  ASN S O   1 
ATOM   4359  C  CB  . ASN B 2 85  ? -23.258 70.231  0.410   1.00 27.75 ? 85  ASN S CB  1 
ATOM   4360  C  CG  . ASN B 2 85  ? -22.982 70.943  -0.895  1.00 33.63 ? 85  ASN S CG  1 
ATOM   4361  O  OD1 . ASN B 2 85  ? -23.906 71.268  -1.643  1.00 37.44 ? 85  ASN S OD1 1 
ATOM   4362  N  ND2 . ASN B 2 85  ? -21.705 71.174  -1.189  1.00 35.22 ? 85  ASN S ND2 1 
ATOM   4363  N  N   . GLU B 2 86  ? -21.551 68.326  2.118   1.00 19.30 ? 86  GLU S N   1 
ATOM   4364  C  CA  . GLU B 2 86  ? -20.281 67.941  2.726   1.00 18.75 ? 86  GLU S CA  1 
ATOM   4365  C  C   . GLU B 2 86  ? -19.974 66.474  2.438   1.00 17.74 ? 86  GLU S C   1 
ATOM   4366  O  O   . GLU B 2 86  ? -18.810 66.092  2.290   1.00 16.91 ? 86  GLU S O   1 
ATOM   4367  C  CB  . GLU B 2 86  ? -20.317 68.166  4.240   1.00 19.00 ? 86  GLU S CB  1 
ATOM   4368  C  CG  . GLU B 2 86  ? -20.299 69.625  4.677   1.00 19.13 ? 86  GLU S CG  1 
ATOM   4369  C  CD  . GLU B 2 86  ? -19.088 70.389  4.159   1.00 21.57 ? 86  GLU S CD  1 
ATOM   4370  O  OE1 . GLU B 2 86  ? -18.012 69.780  3.988   1.00 19.97 ? 86  GLU S OE1 1 
ATOM   4371  O  OE2 . GLU B 2 86  ? -19.211 71.609  3.935   1.00 24.54 ? 86  GLU S OE2 1 
ATOM   4372  N  N   . LEU B 2 87  ? -21.020 65.655  2.370   1.00 15.51 ? 87  LEU S N   1 
ATOM   4373  C  CA  . LEU B 2 87  ? -20.858 64.237  2.078   1.00 15.83 ? 87  LEU S CA  1 
ATOM   4374  C  C   . LEU B 2 87  ? -20.202 64.079  0.707   1.00 15.24 ? 87  LEU S C   1 
ATOM   4375  O  O   . LEU B 2 87  ? -19.255 63.310  0.546   1.00 13.68 ? 87  LEU S O   1 
ATOM   4376  C  CB  . LEU B 2 87  ? -22.223 63.535  2.100   1.00 15.21 ? 87  LEU S CB  1 
ATOM   4377  C  CG  . LEU B 2 87  ? -22.276 62.049  1.724   1.00 17.89 ? 87  LEU S CG  1 
ATOM   4378  C  CD1 . LEU B 2 87  ? -21.328 61.239  2.603   1.00 17.45 ? 87  LEU S CD1 1 
ATOM   4379  C  CD2 . LEU B 2 87  ? -23.698 61.546  1.873   1.00 15.44 ? 87  LEU S CD2 1 
ATOM   4380  N  N   . GLU B 2 88  ? -20.704 64.812  -0.281  1.00 17.01 ? 88  GLU S N   1 
ATOM   4381  C  CA  . GLU B 2 88  ? -20.141 64.744  -1.626  1.00 20.09 ? 88  GLU S CA  1 
ATOM   4382  C  C   . GLU B 2 88  ? -18.691 65.232  -1.645  1.00 20.49 ? 88  GLU S C   1 
ATOM   4383  O  O   . GLU B 2 88  ? -17.841 64.647  -2.317  1.00 19.84 ? 88  GLU S O   1 
ATOM   4384  C  CB  . GLU B 2 88  ? -20.984 65.570  -2.605  1.00 22.35 ? 88  GLU S CB  1 
ATOM   4385  C  CG  . GLU B 2 88  ? -22.359 64.979  -2.888  1.00 27.01 ? 88  GLU S CG  1 
ATOM   4386  C  CD  . GLU B 2 88  ? -22.285 63.530  -3.335  1.00 28.94 ? 88  GLU S CD  1 
ATOM   4387  O  OE1 . GLU B 2 88  ? -21.550 63.238  -4.302  1.00 31.00 ? 88  GLU S OE1 1 
ATOM   4388  O  OE2 . GLU B 2 88  ? -22.964 62.682  -2.719  1.00 32.13 ? 88  GLU S OE2 1 
ATOM   4389  N  N   . GLU B 2 89  ? -18.411 66.304  -0.909  1.00 21.06 ? 89  GLU S N   1 
ATOM   4390  C  CA  . GLU B 2 89  ? -17.052 66.837  -0.850  1.00 22.23 ? 89  GLU S CA  1 
ATOM   4391  C  C   . GLU B 2 89  ? -16.093 65.830  -0.233  1.00 21.78 ? 89  GLU S C   1 
ATOM   4392  O  O   . GLU B 2 89  ? -14.980 65.638  -0.726  1.00 19.70 ? 89  GLU S O   1 
ATOM   4393  C  CB  . GLU B 2 89  ? -16.999 68.122  -0.028  1.00 25.01 ? 89  GLU S CB  1 
ATOM   4394  C  CG  . GLU B 2 89  ? -17.013 69.398  -0.846  1.00 31.91 ? 89  GLU S CG  1 
ATOM   4395  C  CD  . GLU B 2 89  ? -16.258 70.522  -0.155  1.00 36.08 ? 89  GLU S CD  1 
ATOM   4396  O  OE1 . GLU B 2 89  ? -16.686 71.691  -0.279  1.00 38.29 ? 89  GLU S OE1 1 
ATOM   4397  O  OE2 . GLU B 2 89  ? -15.230 70.237  0.504   1.00 37.02 ? 89  GLU S OE2 1 
ATOM   4398  N  N   . CYS B 2 90  ? -16.527 65.195  0.855   1.00 21.09 ? 90  CYS S N   1 
ATOM   4399  C  CA  . CYS B 2 90  ? -15.703 64.204  1.538   1.00 19.92 ? 90  CYS S CA  1 
ATOM   4400  C  C   . CYS B 2 90  ? -15.430 63.017  0.613   1.00 20.76 ? 90  CYS S C   1 
ATOM   4401  O  O   . CYS B 2 90  ? -14.303 62.526  0.543   1.00 19.51 ? 90  CYS S O   1 
ATOM   4402  C  CB  . CYS B 2 90  ? -16.397 63.730  2.820   1.00 20.69 ? 90  CYS S CB  1 
ATOM   4403  S  SG  . CYS B 2 90  ? -15.386 62.657  3.875   1.00 18.25 ? 90  CYS S SG  1 
ATOM   4404  N  N   . LYS B 2 91  ? -16.462 62.568  -0.101  1.00 21.30 ? 91  LYS S N   1 
ATOM   4405  C  CA  . LYS B 2 91  ? -16.331 61.444  -1.029  1.00 23.52 ? 91  LYS S CA  1 
ATOM   4406  C  C   . LYS B 2 91  ? -15.354 61.777  -2.144  1.00 23.95 ? 91  LYS S C   1 
ATOM   4407  O  O   . LYS B 2 91  ? -14.595 60.922  -2.601  1.00 24.78 ? 91  LYS S O   1 
ATOM   4408  C  CB  . LYS B 2 91  ? -17.689 61.094  -1.641  1.00 25.36 ? 91  LYS S CB  1 
ATOM   4409  C  CG  . LYS B 2 91  ? -18.606 60.320  -0.716  1.00 28.50 ? 91  LYS S CG  1 
ATOM   4410  C  CD  . LYS B 2 91  ? -20.052 60.337  -1.201  1.00 30.62 ? 91  LYS S CD  1 
ATOM   4411  C  CE  . LYS B 2 91  ? -20.211 59.732  -2.588  1.00 31.45 ? 91  LYS S CE  1 
ATOM   4412  N  NZ  . LYS B 2 91  ? -21.652 59.691  -2.978  1.00 32.40 ? 91  LYS S NZ  1 
ATOM   4413  N  N   . LYS B 2 92  ? -15.385 63.030  -2.577  1.00 24.86 ? 92  LYS S N   1 
ATOM   4414  C  CA  . LYS B 2 92  ? -14.512 63.500  -3.639  1.00 26.34 ? 92  LYS S CA  1 
ATOM   4415  C  C   . LYS B 2 92  ? -13.050 63.430  -3.208  1.00 25.73 ? 92  LYS S C   1 
ATOM   4416  O  O   . LYS B 2 92  ? -12.195 62.983  -3.968  1.00 24.87 ? 92  LYS S O   1 
ATOM   4417  C  CB  . LYS B 2 92  ? -14.881 64.939  -4.005  1.00 29.18 ? 92  LYS S CB  1 
ATOM   4418  C  CG  . LYS B 2 92  ? -15.024 65.183  -5.497  1.00 34.33 ? 92  LYS S CG  1 
ATOM   4419  C  CD  . LYS B 2 92  ? -15.765 66.485  -5.785  1.00 38.49 ? 92  LYS S CD  1 
ATOM   4420  C  CE  . LYS B 2 92  ? -15.016 67.695  -5.248  1.00 41.15 ? 92  LYS S CE  1 
ATOM   4421  N  NZ  . LYS B 2 92  ? -15.714 68.971  -5.590  1.00 43.96 ? 92  LYS S NZ  1 
ATOM   4422  N  N   . GLU B 2 93  ? -12.771 63.854  -1.978  1.00 24.88 ? 93  GLU S N   1 
ATOM   4423  C  CA  . GLU B 2 93  ? -11.404 63.849  -1.465  1.00 24.74 ? 93  GLU S CA  1 
ATOM   4424  C  C   . GLU B 2 93  ? -10.948 62.471  -0.984  1.00 22.79 ? 93  GLU S C   1 
ATOM   4425  O  O   . GLU B 2 93  ? -9.768  62.136  -1.082  1.00 20.34 ? 93  GLU S O   1 
ATOM   4426  C  CB  . GLU B 2 93  ? -11.274 64.863  -0.324  1.00 27.57 ? 93  GLU S CB  1 
ATOM   4427  C  CG  . GLU B 2 93  ? -10.049 65.756  -0.429  1.00 34.47 ? 93  GLU S CG  1 
ATOM   4428  C  CD  . GLU B 2 93  ? -9.857  66.621  0.802   1.00 38.91 ? 93  GLU S CD  1 
ATOM   4429  O  OE1 . GLU B 2 93  ? -9.744  66.053  1.908   1.00 41.97 ? 93  GLU S OE1 1 
ATOM   4430  O  OE2 . GLU B 2 93  ? -9.816  67.863  0.668   1.00 41.77 ? 93  GLU S OE2 1 
ATOM   4431  N  N   . TYR B 2 94  ? -11.889 61.674  -0.481  1.00 21.26 ? 94  TYR S N   1 
ATOM   4432  C  CA  . TYR B 2 94  ? -11.592 60.337  0.032   1.00 20.80 ? 94  TYR S CA  1 
ATOM   4433  C  C   . TYR B 2 94  ? -12.516 59.251  -0.516  1.00 20.81 ? 94  TYR S C   1 
ATOM   4434  O  O   . TYR B 2 94  ? -13.370 58.733  0.207   1.00 20.28 ? 94  TYR S O   1 
ATOM   4435  C  CB  . TYR B 2 94  ? -11.690 60.338  1.560   1.00 20.21 ? 94  TYR S CB  1 
ATOM   4436  C  CG  . TYR B 2 94  ? -10.584 61.099  2.246   1.00 20.11 ? 94  TYR S CG  1 
ATOM   4437  C  CD1 . TYR B 2 94  ? -9.340  60.512  2.465   1.00 20.59 ? 94  TYR S CD1 1 
ATOM   4438  C  CD2 . TYR B 2 94  ? -10.776 62.416  2.667   1.00 20.10 ? 94  TYR S CD2 1 
ATOM   4439  C  CE1 . TYR B 2 94  ? -8.310  61.213  3.087   1.00 20.47 ? 94  TYR S CE1 1 
ATOM   4440  C  CE2 . TYR B 2 94  ? -9.754  63.129  3.291   1.00 21.48 ? 94  TYR S CE2 1 
ATOM   4441  C  CZ  . TYR B 2 94  ? -8.524  62.521  3.497   1.00 22.52 ? 94  TYR S CZ  1 
ATOM   4442  O  OH  . TYR B 2 94  ? -7.511  63.222  4.112   1.00 22.20 ? 94  TYR S OH  1 
ATOM   4443  N  N   . PRO B 2 95  ? -12.352 58.879  -1.795  1.00 21.87 ? 95  PRO S N   1 
ATOM   4444  C  CA  . PRO B 2 95  ? -13.200 57.842  -2.395  1.00 21.42 ? 95  PRO S CA  1 
ATOM   4445  C  C   . PRO B 2 95  ? -12.892 56.440  -1.871  1.00 21.21 ? 95  PRO S C   1 
ATOM   4446  O  O   . PRO B 2 95  ? -13.687 55.514  -2.035  1.00 20.00 ? 95  PRO S O   1 
ATOM   4447  C  CB  . PRO B 2 95  ? -12.900 57.979  -3.884  1.00 22.09 ? 95  PRO S CB  1 
ATOM   4448  C  CG  . PRO B 2 95  ? -11.453 58.382  -3.885  1.00 22.29 ? 95  PRO S CG  1 
ATOM   4449  C  CD  . PRO B 2 95  ? -11.413 59.430  -2.790  1.00 21.80 ? 95  PRO S CD  1 
ATOM   4450  N  N   . ASN B 2 96  ? -11.737 56.302  -1.230  1.00 20.49 ? 96  ASN S N   1 
ATOM   4451  C  CA  . ASN B 2 96  ? -11.279 55.026  -0.686  1.00 20.70 ? 96  ASN S CA  1 
ATOM   4452  C  C   . ASN B 2 96  ? -11.615 54.860  0.795   1.00 19.79 ? 96  ASN S C   1 
ATOM   4453  O  O   . ASN B 2 96  ? -11.196 53.894  1.432   1.00 20.50 ? 96  ASN S O   1 
ATOM   4454  C  CB  . ASN B 2 96  ? -9.767  54.935  -0.865  1.00 21.72 ? 96  ASN S CB  1 
ATOM   4455  C  CG  . ASN B 2 96  ? -9.041  56.096  -0.206  1.00 25.20 ? 96  ASN S CG  1 
ATOM   4456  O  OD1 . ASN B 2 96  ? -9.481  57.245  -0.284  1.00 25.12 ? 96  ASN S OD1 1 
ATOM   4457  N  ND2 . ASN B 2 96  ? -7.923  55.803  0.441   1.00 27.48 ? 96  ASN S ND2 1 
ATOM   4458  N  N   . ALA B 2 97  ? -12.378 55.797  1.341   1.00 17.32 ? 97  ALA S N   1 
ATOM   4459  C  CA  . ALA B 2 97  ? -12.721 55.744  2.751   1.00 15.99 ? 97  ALA S CA  1 
ATOM   4460  C  C   . ALA B 2 97  ? -14.170 55.387  3.055   1.00 16.25 ? 97  ALA S C   1 
ATOM   4461  O  O   . ALA B 2 97  ? -15.054 55.508  2.202   1.00 15.35 ? 97  ALA S O   1 
ATOM   4462  C  CB  . ALA B 2 97  ? -12.386 57.079  3.390   1.00 16.67 ? 97  ALA S CB  1 
ATOM   4463  N  N   . PHE B 2 98  ? -14.397 54.916  4.278   1.00 16.13 ? 98  PHE S N   1 
ATOM   4464  C  CA  . PHE B 2 98  ? -15.740 54.612  4.744   1.00 16.16 ? 98  PHE S CA  1 
ATOM   4465  C  C   . PHE B 2 98  ? -16.143 55.957  5.327   1.00 16.53 ? 98  PHE S C   1 
ATOM   4466  O  O   . PHE B 2 98  ? -15.326 56.624  5.964   1.00 16.83 ? 98  PHE S O   1 
ATOM   4467  C  CB  . PHE B 2 98  ? -15.733 53.566  5.862   1.00 16.56 ? 98  PHE S CB  1 
ATOM   4468  C  CG  . PHE B 2 98  ? -15.385 52.179  5.407   1.00 17.15 ? 98  PHE S CG  1 
ATOM   4469  C  CD1 . PHE B 2 98  ? -14.061 51.767  5.323   1.00 16.59 ? 98  PHE S CD1 1 
ATOM   4470  C  CD2 . PHE B 2 98  ? -16.389 51.276  5.076   1.00 18.23 ? 98  PHE S CD2 1 
ATOM   4471  C  CE1 . PHE B 2 98  ? -13.743 50.473  4.922   1.00 17.83 ? 98  PHE S CE1 1 
ATOM   4472  C  CE2 . PHE B 2 98  ? -16.081 49.978  4.674   1.00 16.53 ? 98  PHE S CE2 1 
ATOM   4473  C  CZ  . PHE B 2 98  ? -14.758 49.577  4.598   1.00 16.92 ? 98  PHE S CZ  1 
ATOM   4474  N  N   . ILE B 2 99  ? -17.382 56.370  5.102   1.00 15.98 ? 99  ILE S N   1 
ATOM   4475  C  CA  . ILE B 2 99  ? -17.844 57.647  5.618   1.00 14.80 ? 99  ILE S CA  1 
ATOM   4476  C  C   . ILE B 2 99  ? -19.159 57.462  6.359   1.00 15.13 ? 99  ILE S C   1 
ATOM   4477  O  O   . ILE B 2 99  ? -20.091 56.855  5.837   1.00 15.84 ? 99  ILE S O   1 
ATOM   4478  C  CB  . ILE B 2 99  ? -18.053 58.666  4.470   1.00 14.84 ? 99  ILE S CB  1 
ATOM   4479  C  CG1 . ILE B 2 99  ? -16.756 58.829  3.674   1.00 14.27 ? 99  ILE S CG1 1 
ATOM   4480  C  CG2 . ILE B 2 99  ? -18.504 60.009  5.040   1.00 11.55 ? 99  ILE S CG2 1 
ATOM   4481  C  CD1 . ILE B 2 99  ? -16.922 59.602  2.378   1.00 15.05 ? 99  ILE S CD1 1 
ATOM   4482  N  N   . ARG B 2 100 ? -19.234 57.971  7.584   1.00 14.13 ? 100 ARG S N   1 
ATOM   4483  C  CA  . ARG B 2 100 ? -20.466 57.858  8.343   1.00 15.01 ? 100 ARG S CA  1 
ATOM   4484  C  C   . ARG B 2 100 ? -20.938 59.221  8.815   1.00 14.25 ? 100 ARG S C   1 
ATOM   4485  O  O   . ARG B 2 100 ? -20.143 60.149  8.996   1.00 14.68 ? 100 ARG S O   1 
ATOM   4486  C  CB  . ARG B 2 100 ? -20.295 56.920  9.545   1.00 15.90 ? 100 ARG S CB  1 
ATOM   4487  C  CG  . ARG B 2 100 ? -19.384 57.427  10.645  1.00 16.28 ? 100 ARG S CG  1 
ATOM   4488  C  CD  . ARG B 2 100 ? -19.114 56.322  11.665  1.00 15.01 ? 100 ARG S CD  1 
ATOM   4489  N  NE  . ARG B 2 100 ? -18.065 56.696  12.610  1.00 14.35 ? 100 ARG S NE  1 
ATOM   4490  C  CZ  . ARG B 2 100 ? -17.327 55.827  13.295  1.00 13.14 ? 100 ARG S CZ  1 
ATOM   4491  N  NH1 . ARG B 2 100 ? -17.523 54.524  13.144  1.00 10.95 ? 100 ARG S NH1 1 
ATOM   4492  N  NH2 . ARG B 2 100 ? -16.386 56.260  14.123  1.00 10.54 ? 100 ARG S NH2 1 
ATOM   4493  N  N   . ILE B 2 101 ? -22.250 59.336  8.983   1.00 13.97 ? 101 ILE S N   1 
ATOM   4494  C  CA  . ILE B 2 101 ? -22.861 60.565  9.459   1.00 12.90 ? 101 ILE S CA  1 
ATOM   4495  C  C   . ILE B 2 101 ? -23.303 60.330  10.897  1.00 12.68 ? 101 ILE S C   1 
ATOM   4496  O  O   . ILE B 2 101 ? -23.934 59.316  11.202  1.00 11.74 ? 101 ILE S O   1 
ATOM   4497  C  CB  . ILE B 2 101 ? -24.098 60.937  8.617   1.00 14.17 ? 101 ILE S CB  1 
ATOM   4498  C  CG1 . ILE B 2 101 ? -23.679 61.228  7.173   1.00 14.73 ? 101 ILE S CG1 1 
ATOM   4499  C  CG2 . ILE B 2 101 ? -24.792 62.144  9.223   1.00 14.45 ? 101 ILE S CG2 1 
ATOM   4500  C  CD1 . ILE B 2 101 ? -24.846 61.558  6.244   1.00 15.50 ? 101 ILE S CD1 1 
ATOM   4501  N  N   . ILE B 2 102 ? -22.954 61.249  11.787  1.00 11.02 ? 102 ILE S N   1 
ATOM   4502  C  CA  . ILE B 2 102 ? -23.357 61.113  13.177  1.00 11.83 ? 102 ILE S CA  1 
ATOM   4503  C  C   . ILE B 2 102 ? -24.099 62.371  13.603  1.00 11.44 ? 102 ILE S C   1 
ATOM   4504  O  O   . ILE B 2 102 ? -23.992 63.412  12.956  1.00 10.90 ? 102 ILE S O   1 
ATOM   4505  C  CB  . ILE B 2 102 ? -22.140 60.877  14.114  1.00 12.23 ? 102 ILE S CB  1 
ATOM   4506  C  CG1 . ILE B 2 102 ? -21.207 62.093  14.104  1.00 14.37 ? 102 ILE S CG1 1 
ATOM   4507  C  CG2 . ILE B 2 102 ? -21.380 59.627  13.673  1.00 10.39 ? 102 ILE S CG2 1 
ATOM   4508  C  CD1 . ILE B 2 102 ? -19.975 61.920  14.994  1.00 13.79 ? 102 ILE S CD1 1 
ATOM   4509  N  N   . GLY B 2 103 ? -24.872 62.262  14.679  1.00 12.57 ? 103 GLY S N   1 
ATOM   4510  C  CA  . GLY B 2 103 ? -25.622 63.400  15.179  1.00 12.66 ? 103 GLY S CA  1 
ATOM   4511  C  C   . GLY B 2 103 ? -25.438 63.492  16.679  1.00 12.61 ? 103 GLY S C   1 
ATOM   4512  O  O   . GLY B 2 103 ? -25.668 62.516  17.391  1.00 15.24 ? 103 GLY S O   1 
ATOM   4513  N  N   . PHE B 2 104 ? -25.028 64.661  17.157  1.00 11.39 ? 104 PHE S N   1 
ATOM   4514  C  CA  . PHE B 2 104 ? -24.786 64.877  18.581  1.00 12.65 ? 104 PHE S CA  1 
ATOM   4515  C  C   . PHE B 2 104 ? -25.945 65.521  19.328  1.00 12.84 ? 104 PHE S C   1 
ATOM   4516  O  O   . PHE B 2 104 ? -26.578 66.451  18.832  1.00 11.10 ? 104 PHE S O   1 
ATOM   4517  C  CB  . PHE B 2 104 ? -23.576 65.797  18.795  1.00 12.86 ? 104 PHE S CB  1 
ATOM   4518  C  CG  . PHE B 2 104 ? -22.255 65.213  18.377  1.00 15.35 ? 104 PHE S CG  1 
ATOM   4519  C  CD1 . PHE B 2 104 ? -21.643 64.209  19.128  1.00 16.54 ? 104 PHE S CD1 1 
ATOM   4520  C  CD2 . PHE B 2 104 ? -21.586 65.719  17.264  1.00 15.87 ? 104 PHE S CD2 1 
ATOM   4521  C  CE1 . PHE B 2 104 ? -20.376 63.723  18.780  1.00 15.63 ? 104 PHE S CE1 1 
ATOM   4522  C  CE2 . PHE B 2 104 ? -20.323 65.243  16.905  1.00 16.30 ? 104 PHE S CE2 1 
ATOM   4523  C  CZ  . PHE B 2 104 ? -19.715 64.242  17.667  1.00 16.68 ? 104 PHE S CZ  1 
ATOM   4524  N  N   . ASP B 2 105 ? -26.199 65.021  20.532  1.00 13.91 ? 105 ASP S N   1 
ATOM   4525  C  CA  . ASP B 2 105 ? -27.208 65.586  21.418  1.00 16.32 ? 105 ASP S CA  1 
ATOM   4526  C  C   . ASP B 2 105 ? -26.289 66.233  22.455  1.00 16.56 ? 105 ASP S C   1 
ATOM   4527  O  O   . ASP B 2 105 ? -25.708 65.534  23.285  1.00 17.08 ? 105 ASP S O   1 
ATOM   4528  C  CB  . ASP B 2 105 ? -28.035 64.488  22.085  1.00 18.84 ? 105 ASP S CB  1 
ATOM   4529  C  CG  . ASP B 2 105 ? -29.011 65.036  23.112  1.00 22.81 ? 105 ASP S CG  1 
ATOM   4530  O  OD1 . ASP B 2 105 ? -28.650 65.987  23.841  1.00 22.46 ? 105 ASP S OD1 1 
ATOM   4531  O  OD2 . ASP B 2 105 ? -30.136 64.508  23.203  1.00 25.53 ? 105 ASP S OD2 1 
ATOM   4532  N  N   . SER B 2 106 ? -26.138 67.552  22.404  1.00 16.84 ? 106 SER S N   1 
ATOM   4533  C  CA  . SER B 2 106 ? -25.237 68.234  23.331  1.00 19.58 ? 106 SER S CA  1 
ATOM   4534  C  C   . SER B 2 106 ? -25.738 68.271  24.767  1.00 20.64 ? 106 SER S C   1 
ATOM   4535  O  O   . SER B 2 106 ? -24.967 68.525  25.688  1.00 20.38 ? 106 SER S O   1 
ATOM   4536  C  CB  . SER B 2 106 ? -24.950 69.656  22.844  1.00 18.81 ? 106 SER S CB  1 
ATOM   4537  O  OG  . SER B 2 106 ? -26.130 70.431  22.812  1.00 22.41 ? 106 SER S OG  1 
ATOM   4538  N  N   . ASN B 2 107 ? -27.029 68.019  24.955  1.00 22.02 ? 107 ASN S N   1 
ATOM   4539  C  CA  . ASN B 2 107 ? -27.621 68.017  26.286  1.00 23.97 ? 107 ASN S CA  1 
ATOM   4540  C  C   . ASN B 2 107 ? -27.152 66.801  27.063  1.00 23.26 ? 107 ASN S C   1 
ATOM   4541  O  O   . ASN B 2 107 ? -26.709 66.922  28.199  1.00 23.71 ? 107 ASN S O   1 
ATOM   4542  C  CB  . ASN B 2 107 ? -29.159 68.015  26.209  1.00 29.90 ? 107 ASN S CB  1 
ATOM   4543  C  CG  . ASN B 2 107 ? -29.785 68.854  27.297  1.00 36.71 ? 107 ASN S CG  1 
ATOM   4544  O  OD1 . ASN B 2 107 ? -29.439 68.721  28.479  1.00 40.08 ? 107 ASN S OD1 1 
ATOM   4545  N  ND2 . ASN B 2 107 ? -30.700 69.738  26.908  1.00 39.46 ? 107 ASN S ND2 1 
ATOM   4546  N  N   . ARG B 2 108 ? -27.289 65.630  26.452  1.00 21.56 ? 108 ARG S N   1 
ATOM   4547  C  CA  . ARG B 2 108 ? -26.886 64.383  27.082  1.00 21.24 ? 108 ARG S CA  1 
ATOM   4548  C  C   . ARG B 2 108 ? -25.464 64.021  26.690  1.00 19.96 ? 108 ARG S C   1 
ATOM   4549  O  O   . ARG B 2 108 ? -24.844 63.139  27.287  1.00 20.08 ? 108 ARG S O   1 
ATOM   4550  C  CB  . ARG B 2 108 ? -27.824 63.248  26.664  1.00 21.51 ? 108 ARG S CB  1 
ATOM   4551  C  CG  . ARG B 2 108 ? -29.266 63.436  27.090  1.00 24.29 ? 108 ARG S CG  1 
ATOM   4552  C  CD  . ARG B 2 108 ? -30.005 62.107  27.088  1.00 24.97 ? 108 ARG S CD  1 
ATOM   4553  N  NE  . ARG B 2 108 ? -30.149 61.548  25.748  1.00 26.69 ? 108 ARG S NE  1 
ATOM   4554  C  CZ  . ARG B 2 108 ? -29.939 60.270  25.448  1.00 28.24 ? 108 ARG S CZ  1 
ATOM   4555  N  NH1 . ARG B 2 108 ? -29.569 59.418  26.395  1.00 28.02 ? 108 ARG S NH1 1 
ATOM   4556  N  NH2 . ARG B 2 108 ? -30.104 59.840  24.203  1.00 27.95 ? 108 ARG S NH2 1 
ATOM   4557  N  N   . GLN B 2 109 ? -24.959 64.711  25.676  1.00 18.72 ? 109 GLN S N   1 
ATOM   4558  C  CA  . GLN B 2 109 ? -23.621 64.479  25.164  1.00 18.77 ? 109 GLN S CA  1 
ATOM   4559  C  C   . GLN B 2 109 ? -23.461 63.017  24.754  1.00 19.72 ? 109 GLN S C   1 
ATOM   4560  O  O   . GLN B 2 109 ? -22.560 62.311  25.211  1.00 21.73 ? 109 GLN S O   1 
ATOM   4561  C  CB  . GLN B 2 109 ? -22.568 64.878  26.206  1.00 20.21 ? 109 GLN S CB  1 
ATOM   4562  C  CG  . GLN B 2 109 ? -21.190 65.083  25.605  1.00 18.58 ? 109 GLN S CG  1 
ATOM   4563  C  CD  . GLN B 2 109 ? -20.214 65.787  26.538  1.00 19.04 ? 109 GLN S CD  1 
ATOM   4564  O  OE1 . GLN B 2 109 ? -19.064 66.018  26.172  1.00 17.60 ? 109 GLN S OE1 1 
ATOM   4565  N  NE2 . GLN B 2 109 ? -20.666 66.131  27.741  1.00 17.74 ? 109 GLN S NE2 1 
ATOM   4566  N  N   . VAL B 2 110 ? -24.367 62.573  23.890  1.00 18.91 ? 110 VAL S N   1 
ATOM   4567  C  CA  . VAL B 2 110 ? -24.355 61.215  23.362  1.00 17.62 ? 110 VAL S CA  1 
ATOM   4568  C  C   . VAL B 2 110 ? -24.723 61.333  21.886  1.00 15.59 ? 110 VAL S C   1 
ATOM   4569  O  O   . VAL B 2 110 ? -25.460 62.240  21.501  1.00 13.80 ? 110 VAL S O   1 
ATOM   4570  C  CB  . VAL B 2 110 ? -25.420 60.303  24.050  1.00 19.34 ? 110 VAL S CB  1 
ATOM   4571  C  CG1 . VAL B 2 110 ? -25.413 60.523  25.551  1.00 21.47 ? 110 VAL S CG1 1 
ATOM   4572  C  CG2 . VAL B 2 110 ? -26.803 60.571  23.472  1.00 20.74 ? 110 VAL S CG2 1 
ATOM   4573  N  N   . GLN B 2 111 ? -24.196 60.440  21.057  1.00 13.66 ? 111 GLN S N   1 
ATOM   4574  C  CA  . GLN B 2 111 ? -24.539 60.456  19.640  1.00 12.96 ? 111 GLN S CA  1 
ATOM   4575  C  C   . GLN B 2 111 ? -25.864 59.705  19.524  1.00 12.68 ? 111 GLN S C   1 
ATOM   4576  O  O   . GLN B 2 111 ? -25.961 58.543  19.908  1.00 12.34 ? 111 GLN S O   1 
ATOM   4577  C  CB  . GLN B 2 111 ? -23.451 59.760  18.812  1.00 13.08 ? 111 GLN S CB  1 
ATOM   4578  C  CG  . GLN B 2 111 ? -22.090 60.422  18.948  1.00 15.53 ? 111 GLN S CG  1 
ATOM   4579  C  CD  . GLN B 2 111 ? -20.990 59.701  18.192  1.00 17.72 ? 111 GLN S CD  1 
ATOM   4580  O  OE1 . GLN B 2 111 ? -19.807 59.928  18.443  1.00 22.13 ? 111 GLN S OE1 1 
ATOM   4581  N  NE2 . GLN B 2 111 ? -21.369 58.838  17.256  1.00 17.95 ? 111 GLN S NE2 1 
ATOM   4582  N  N   . CYS B 2 112 ? -26.890 60.372  19.011  1.00 13.68 ? 112 CYS S N   1 
ATOM   4583  C  CA  . CYS B 2 112 ? -28.200 59.744  18.874  1.00 15.26 ? 112 CYS S CA  1 
ATOM   4584  C  C   . CYS B 2 112 ? -28.410 59.177  17.483  1.00 15.00 ? 112 CYS S C   1 
ATOM   4585  O  O   . CYS B 2 112 ? -29.393 58.482  17.225  1.00 15.66 ? 112 CYS S O   1 
ATOM   4586  C  CB  . CYS B 2 112 ? -29.301 60.754  19.195  1.00 15.16 ? 112 CYS S CB  1 
ATOM   4587  S  SG  . CYS B 2 112 ? -29.248 61.325  20.900  1.00 17.28 ? 112 CYS S SG  1 
ATOM   4588  N  N   . VAL B 2 113 ? -27.477 59.480  16.590  1.00 15.06 ? 113 VAL S N   1 
ATOM   4589  C  CA  . VAL B 2 113 ? -27.547 58.999  15.219  1.00 15.22 ? 113 VAL S CA  1 
ATOM   4590  C  C   . VAL B 2 113 ? -26.158 58.640  14.732  1.00 14.58 ? 113 VAL S C   1 
ATOM   4591  O  O   . VAL B 2 113 ? -25.192 59.352  15.008  1.00 14.55 ? 113 VAL S O   1 
ATOM   4592  C  CB  . VAL B 2 113 ? -28.132 60.072  14.273  1.00 14.52 ? 113 VAL S CB  1 
ATOM   4593  C  CG1 . VAL B 2 113 ? -27.961 59.644  12.821  1.00 17.55 ? 113 VAL S CG1 1 
ATOM   4594  C  CG2 . VAL B 2 113 ? -29.604 60.288  14.584  1.00 16.92 ? 113 VAL S CG2 1 
ATOM   4595  N  N   . SER B 2 114 ? -26.062 57.525  14.018  1.00 13.92 ? 114 SER S N   1 
ATOM   4596  C  CA  . SER B 2 114 ? -24.794 57.085  13.460  1.00 12.86 ? 114 SER S CA  1 
ATOM   4597  C  C   . SER B 2 114 ? -25.030 55.985  12.444  1.00 13.80 ? 114 SER S C   1 
ATOM   4598  O  O   . SER B 2 114 ? -25.490 54.895  12.793  1.00 15.85 ? 114 SER S O   1 
ATOM   4599  C  CB  . SER B 2 114 ? -23.861 56.571  14.554  1.00 14.46 ? 114 SER S CB  1 
ATOM   4600  O  OG  . SER B 2 114 ? -22.620 56.165  13.997  1.00 17.17 ? 114 SER S OG  1 
ATOM   4601  N  N   . PHE B 2 115 ? -24.738 56.275  11.182  1.00 12.04 ? 115 PHE S N   1 
ATOM   4602  C  CA  . PHE B 2 115 ? -24.901 55.285  10.129  1.00 13.13 ? 115 PHE S CA  1 
ATOM   4603  C  C   . PHE B 2 115 ? -23.923 55.541  8.993   1.00 14.53 ? 115 PHE S C   1 
ATOM   4604  O  O   . PHE B 2 115 ? -23.545 56.685  8.728   1.00 14.17 ? 115 PHE S O   1 
ATOM   4605  C  CB  . PHE B 2 115 ? -26.342 55.275  9.598   1.00 14.13 ? 115 PHE S CB  1 
ATOM   4606  C  CG  . PHE B 2 115 ? -26.780 56.569  8.979   1.00 13.57 ? 115 PHE S CG  1 
ATOM   4607  C  CD1 . PHE B 2 115 ? -27.276 57.604  9.768   1.00 16.32 ? 115 PHE S CD1 1 
ATOM   4608  C  CD2 . PHE B 2 115 ? -26.709 56.751  7.601   1.00 15.63 ? 115 PHE S CD2 1 
ATOM   4609  C  CE1 . PHE B 2 115 ? -27.699 58.804  9.189   1.00 17.04 ? 115 PHE S CE1 1 
ATOM   4610  C  CE2 . PHE B 2 115 ? -27.130 57.948  7.014   1.00 16.60 ? 115 PHE S CE2 1 
ATOM   4611  C  CZ  . PHE B 2 115 ? -27.624 58.973  7.809   1.00 16.33 ? 115 PHE S CZ  1 
ATOM   4612  N  N   . ILE B 2 116 ? -23.508 54.470  8.328   1.00 15.94 ? 116 ILE S N   1 
ATOM   4613  C  CA  . ILE B 2 116 ? -22.564 54.585  7.228   1.00 18.43 ? 116 ILE S CA  1 
ATOM   4614  C  C   . ILE B 2 116 ? -23.298 55.143  6.006   1.00 18.70 ? 116 ILE S C   1 
ATOM   4615  O  O   . ILE B 2 116 ? -24.362 54.653  5.627   1.00 18.94 ? 116 ILE S O   1 
ATOM   4616  C  CB  . ILE B 2 116 ? -21.918 53.208  6.921   1.00 20.16 ? 116 ILE S CB  1 
ATOM   4617  C  CG1 . ILE B 2 116 ? -20.558 53.404  6.250   1.00 23.95 ? 116 ILE S CG1 1 
ATOM   4618  C  CG2 . ILE B 2 116 ? -22.831 52.368  6.052   1.00 24.31 ? 116 ILE S CG2 1 
ATOM   4619  C  CD1 . ILE B 2 116 ? -19.470 53.867  7.215   1.00 25.42 ? 116 ILE S CD1 1 
ATOM   4620  N  N   . ALA B 2 117 ? -22.738 56.188  5.407   1.00 18.85 ? 117 ALA S N   1 
ATOM   4621  C  CA  . ALA B 2 117 ? -23.361 56.823  4.251   1.00 18.67 ? 117 ALA S CA  1 
ATOM   4622  C  C   . ALA B 2 117 ? -22.616 56.537  2.958   1.00 18.91 ? 117 ALA S C   1 
ATOM   4623  O  O   . ALA B 2 117 ? -23.137 56.771  1.870   1.00 20.17 ? 117 ALA S O   1 
ATOM   4624  C  CB  . ALA B 2 117 ? -23.451 58.328  4.474   1.00 18.26 ? 117 ALA S CB  1 
ATOM   4625  N  N   . TYR B 2 118 ? -21.393 56.036  3.078   1.00 18.70 ? 118 TYR S N   1 
ATOM   4626  C  CA  . TYR B 2 118 ? -20.584 55.724  1.910   1.00 19.24 ? 118 TYR S CA  1 
ATOM   4627  C  C   . TYR B 2 118 ? -19.562 54.643  2.229   1.00 19.62 ? 118 TYR S C   1 
ATOM   4628  O  O   . TYR B 2 118 ? -18.932 54.670  3.285   1.00 19.00 ? 118 TYR S O   1 
ATOM   4629  C  CB  . TYR B 2 118 ? -19.852 56.978  1.418   1.00 18.47 ? 118 TYR S CB  1 
ATOM   4630  C  CG  . TYR B 2 118 ? -18.904 56.714  0.267   1.00 19.35 ? 118 TYR S CG  1 
ATOM   4631  C  CD1 . TYR B 2 118 ? -19.378 56.545  -1.034  1.00 20.24 ? 118 TYR S CD1 1 
ATOM   4632  C  CD2 . TYR B 2 118 ? -17.531 56.605  0.486   1.00 19.31 ? 118 TYR S CD2 1 
ATOM   4633  C  CE1 . TYR B 2 118 ? -18.507 56.275  -2.092  1.00 21.81 ? 118 TYR S CE1 1 
ATOM   4634  C  CE2 . TYR B 2 118 ? -16.650 56.334  -0.560  1.00 21.85 ? 118 TYR S CE2 1 
ATOM   4635  C  CZ  . TYR B 2 118 ? -17.143 56.171  -1.845  1.00 22.81 ? 118 TYR S CZ  1 
ATOM   4636  O  OH  . TYR B 2 118 ? -16.272 55.908  -2.877  1.00 22.53 ? 118 TYR S OH  1 
ATOM   4637  N  N   . LYS B 2 119 ? -19.408 53.694  1.313   1.00 21.72 ? 119 LYS S N   1 
ATOM   4638  C  CA  . LYS B 2 119 ? -18.445 52.610  1.470   1.00 24.64 ? 119 LYS S CA  1 
ATOM   4639  C  C   . LYS B 2 119 ? -17.588 52.517  0.212   1.00 25.86 ? 119 LYS S C   1 
ATOM   4640  O  O   . LYS B 2 119 ? -18.088 52.672  -0.900  1.00 25.97 ? 119 LYS S O   1 
ATOM   4641  C  CB  . LYS B 2 119 ? -19.163 51.276  1.704   1.00 26.43 ? 119 LYS S CB  1 
ATOM   4642  C  CG  . LYS B 2 119 ? -19.748 51.108  3.103   1.00 29.65 ? 119 LYS S CG  1 
ATOM   4643  C  CD  . LYS B 2 119 ? -20.439 49.773  3.243   1.00 31.67 ? 119 LYS S CD  1 
ATOM   4644  C  CE  . LYS B 2 119 ? -21.785 49.830  2.568   1.00 34.01 ? 119 LYS S CE  1 
ATOM   4645  N  NZ  . LYS B 2 119 ? -22.872 50.397  3.414   1.00 38.01 ? 119 LYS S NZ  1 
ATOM   4646  N  N   . PRO B 2 120 ? -16.279 52.278  0.374   1.00 28.62 ? 120 PRO S N   1 
ATOM   4647  C  CA  . PRO B 2 120 ? -15.386 52.171  -0.784  1.00 30.84 ? 120 PRO S CA  1 
ATOM   4648  C  C   . PRO B 2 120 ? -15.658 50.919  -1.619  1.00 33.60 ? 120 PRO S C   1 
ATOM   4649  O  O   . PRO B 2 120 ? -16.476 50.072  -1.246  1.00 33.56 ? 120 PRO S O   1 
ATOM   4650  C  CB  . PRO B 2 120 ? -13.999 52.167  -0.145  1.00 30.16 ? 120 PRO S CB  1 
ATOM   4651  C  CG  . PRO B 2 120 ? -14.242 51.498  1.168   1.00 28.75 ? 120 PRO S CG  1 
ATOM   4652  C  CD  . PRO B 2 120 ? -15.524 52.150  1.632   1.00 28.68 ? 120 PRO S CD  1 
ATOM   4653  N  N   . ALA B 2 121 ? -14.964 50.812  -2.748  1.00 36.25 ? 121 ALA S N   1 
ATOM   4654  C  CA  . ALA B 2 121 ? -15.123 49.686  -3.664  1.00 39.07 ? 121 ALA S CA  1 
ATOM   4655  C  C   . ALA B 2 121 ? -14.888 48.318  -3.026  1.00 41.03 ? 121 ALA S C   1 
ATOM   4656  O  O   . ALA B 2 121 ? -13.891 48.104  -2.335  1.00 40.85 ? 121 ALA S O   1 
ATOM   4657  C  CB  . ALA B 2 121 ? -14.190 49.863  -4.860  1.00 39.50 ? 121 ALA S CB  1 
ATOM   4658  N  N   . GLY B 2 122 ? -15.817 47.396  -3.268  1.00 43.37 ? 122 GLY S N   1 
ATOM   4659  C  CA  . GLY B 2 122 ? -15.694 46.047  -2.741  1.00 46.42 ? 122 GLY S CA  1 
ATOM   4660  C  C   . GLY B 2 122 ? -16.386 45.784  -1.416  1.00 48.15 ? 122 GLY S C   1 
ATOM   4661  O  O   . GLY B 2 122 ? -16.229 44.707  -0.834  1.00 48.07 ? 122 GLY S O   1 
ATOM   4662  N  N   . TYR B 2 123 ? -17.166 46.750  -0.940  1.00 48.98 ? 123 TYR S N   1 
ATOM   4663  C  CA  . TYR B 2 123 ? -17.858 46.600  0.335   1.00 49.53 ? 123 TYR S CA  1 
ATOM   4664  C  C   . TYR B 2 123 ? -19.373 46.713  0.245   1.00 49.98 ? 123 TYR S C   1 
ATOM   4665  O  O   . TYR B 2 123 ? -20.049 46.106  1.102   1.00 50.69 ? 123 TYR S O   1 
ATOM   4666  C  CB  . TYR B 2 123 ? -17.313 47.620  1.331   1.00 49.79 ? 123 TYR S CB  1 
ATOM   4667  C  CG  . TYR B 2 123 ? -15.896 47.314  1.745   1.00 49.54 ? 123 TYR S CG  1 
ATOM   4668  C  CD1 . TYR B 2 123 ? -15.629 46.350  2.715   1.00 49.96 ? 123 TYR S CD1 1 
ATOM   4669  C  CD2 . TYR B 2 123 ? -14.819 47.951  1.133   1.00 50.00 ? 123 TYR S CD2 1 
ATOM   4670  C  CE1 . TYR B 2 123 ? -14.324 46.024  3.065   1.00 49.76 ? 123 TYR S CE1 1 
ATOM   4671  C  CE2 . TYR B 2 123 ? -13.509 47.633  1.474   1.00 49.94 ? 123 TYR S CE2 1 
ATOM   4672  C  CZ  . TYR B 2 123 ? -13.270 46.669  2.441   1.00 50.06 ? 123 TYR S CZ  1 
ATOM   4673  O  OH  . TYR B 2 123 ? -11.977 46.342  2.782   1.00 51.27 ? 123 TYR S OH  1 
ATOM   4674  O  OXT . TYR B 2 123 ? -19.865 47.414  -0.662  1.00 50.48 ? 123 TYR S OXT 1 
ATOM   4675  N  N   . GLU C 1 12  ? 23.200  79.018  85.556  1.00 44.69 ? 12  GLU B N   1 
ATOM   4676  C  CA  . GLU C 1 12  ? 21.828  79.355  86.025  1.00 44.93 ? 12  GLU B CA  1 
ATOM   4677  C  C   . GLU C 1 12  ? 20.748  79.215  84.963  1.00 41.49 ? 12  GLU B C   1 
ATOM   4678  O  O   . GLU C 1 12  ? 20.911  79.672  83.829  1.00 41.49 ? 12  GLU B O   1 
ATOM   4679  C  CB  . GLU C 1 12  ? 21.773  80.801  86.536  1.00 48.21 ? 12  GLU B CB  1 
ATOM   4680  C  CG  . GLU C 1 12  ? 20.347  81.316  86.786  1.00 52.84 ? 12  GLU B CG  1 
ATOM   4681  C  CD  . GLU C 1 12  ? 20.278  82.828  86.936  1.00 56.24 ? 12  GLU B CD  1 
ATOM   4682  O  OE1 . GLU C 1 12  ? 21.291  83.439  87.340  1.00 57.49 ? 12  GLU B OE1 1 
ATOM   4683  O  OE2 . GLU C 1 12  ? 19.205  83.405  86.662  1.00 57.85 ? 12  GLU B OE2 1 
ATOM   4684  N  N   . PHE C 1 13  ? 19.654  78.560  85.331  1.00 36.56 ? 13  PHE B N   1 
ATOM   4685  C  CA  . PHE C 1 13  ? 18.516  78.480  84.437  1.00 30.34 ? 13  PHE B CA  1 
ATOM   4686  C  C   . PHE C 1 13  ? 17.751  79.662  84.998  1.00 28.22 ? 13  PHE B C   1 
ATOM   4687  O  O   . PHE C 1 13  ? 17.353  79.649  86.164  1.00 27.48 ? 13  PHE B O   1 
ATOM   4688  C  CB  . PHE C 1 13  ? 17.686  77.205  84.631  1.00 25.85 ? 13  PHE B CB  1 
ATOM   4689  C  CG  . PHE C 1 13  ? 16.236  77.369  84.235  1.00 21.45 ? 13  PHE B CG  1 
ATOM   4690  C  CD1 . PHE C 1 13  ? 15.894  77.905  82.994  1.00 19.23 ? 13  PHE B CD1 1 
ATOM   4691  C  CD2 . PHE C 1 13  ? 15.215  77.021  85.115  1.00 19.36 ? 13  PHE B CD2 1 
ATOM   4692  C  CE1 . PHE C 1 13  ? 14.554  78.098  82.636  1.00 16.87 ? 13  PHE B CE1 1 
ATOM   4693  C  CE2 . PHE C 1 13  ? 13.873  77.207  84.770  1.00 17.94 ? 13  PHE B CE2 1 
ATOM   4694  C  CZ  . PHE C 1 13  ? 13.542  77.748  83.524  1.00 17.69 ? 13  PHE B CZ  1 
ATOM   4695  N  N   . LYS C 1 14  ? 17.590  80.699  84.190  1.00 25.81 ? 14  LYS B N   1 
ATOM   4696  C  CA  . LYS C 1 14  ? 16.879  81.890  84.620  1.00 25.10 ? 14  LYS B CA  1 
ATOM   4697  C  C   . LYS C 1 14  ? 15.543  81.955  83.894  1.00 22.75 ? 14  LYS B C   1 
ATOM   4698  O  O   . LYS C 1 14  ? 15.498  82.207  82.692  1.00 21.03 ? 14  LYS B O   1 
ATOM   4699  C  CB  . LYS C 1 14  ? 17.717  83.130  84.297  1.00 28.23 ? 14  LYS B CB  1 
ATOM   4700  C  CG  . LYS C 1 14  ? 17.060  84.471  84.618  1.00 32.82 ? 14  LYS B CG  1 
ATOM   4701  C  CD  . LYS C 1 14  ? 16.889  84.691  86.112  1.00 36.14 ? 14  LYS B CD  1 
ATOM   4702  C  CE  . LYS C 1 14  ? 17.368  86.081  86.517  1.00 38.58 ? 14  LYS B CE  1 
ATOM   4703  N  NZ  . LYS C 1 14  ? 16.610  87.163  85.827  1.00 39.80 ? 14  LYS B NZ  1 
ATOM   4704  N  N   . ALA C 1 15  ? 14.459  81.702  84.619  1.00 21.16 ? 15  ALA B N   1 
ATOM   4705  C  CA  . ALA C 1 15  ? 13.131  81.753  84.023  1.00 20.99 ? 15  ALA B CA  1 
ATOM   4706  C  C   . ALA C 1 15  ? 12.852  83.197  83.627  1.00 20.90 ? 15  ALA B C   1 
ATOM   4707  O  O   . ALA C 1 15  ? 13.370  84.126  84.249  1.00 21.85 ? 15  ALA B O   1 
ATOM   4708  C  CB  . ALA C 1 15  ? 12.085  81.273  85.017  1.00 20.25 ? 15  ALA B CB  1 
ATOM   4709  N  N   . GLY C 1 16  ? 12.043  83.386  82.592  1.00 18.93 ? 16  GLY B N   1 
ATOM   4710  C  CA  . GLY C 1 16  ? 11.725  84.731  82.150  1.00 16.98 ? 16  GLY B CA  1 
ATOM   4711  C  C   . GLY C 1 16  ? 11.910  84.939  80.659  1.00 15.90 ? 16  GLY B C   1 
ATOM   4712  O  O   . GLY C 1 16  ? 12.515  84.111  79.977  1.00 14.61 ? 16  GLY B O   1 
ATOM   4713  N  N   . VAL C 1 17  ? 11.390  86.056  80.159  1.00 14.76 ? 17  VAL B N   1 
ATOM   4714  C  CA  . VAL C 1 17  ? 11.477  86.396  78.744  1.00 15.36 ? 17  VAL B CA  1 
ATOM   4715  C  C   . VAL C 1 17  ? 12.689  87.269  78.417  1.00 17.25 ? 17  VAL B C   1 
ATOM   4716  O  O   . VAL C 1 17  ? 12.955  88.259  79.095  1.00 18.83 ? 17  VAL B O   1 
ATOM   4717  C  CB  . VAL C 1 17  ? 10.204  87.142  78.285  1.00 15.53 ? 17  VAL B CB  1 
ATOM   4718  C  CG1 . VAL C 1 17  ? 10.343  87.587  76.835  1.00 14.90 ? 17  VAL B CG1 1 
ATOM   4719  C  CG2 . VAL C 1 17  ? 8.990   86.246  78.452  1.00 13.20 ? 17  VAL B CG2 1 
ATOM   4720  N  N   . LYS C 1 18  ? 13.420  86.892  77.373  1.00 18.30 ? 18  LYS B N   1 
ATOM   4721  C  CA  . LYS C 1 18  ? 14.585  87.651  76.922  1.00 17.95 ? 18  LYS B CA  1 
ATOM   4722  C  C   . LYS C 1 18  ? 14.385  87.953  75.444  1.00 17.47 ? 18  LYS B C   1 
ATOM   4723  O  O   . LYS C 1 18  ? 13.615  87.268  74.770  1.00 16.99 ? 18  LYS B O   1 
ATOM   4724  C  CB  . LYS C 1 18  ? 15.868  86.835  77.067  1.00 20.05 ? 18  LYS B CB  1 
ATOM   4725  C  CG  . LYS C 1 18  ? 16.228  86.424  78.480  1.00 23.45 ? 18  LYS B CG  1 
ATOM   4726  C  CD  . LYS C 1 18  ? 17.572  85.714  78.478  1.00 27.29 ? 18  LYS B CD  1 
ATOM   4727  C  CE  . LYS C 1 18  ? 17.564  84.537  77.507  1.00 29.30 ? 18  LYS B CE  1 
ATOM   4728  N  NZ  . LYS C 1 18  ? 18.930  84.009  77.270  1.00 31.59 ? 18  LYS B NZ  1 
ATOM   4729  N  N   . ASP C 1 19  ? 15.075  88.970  74.935  1.00 15.82 ? 19  ASP B N   1 
ATOM   4730  C  CA  . ASP C 1 19  ? 14.957  89.296  73.520  1.00 15.36 ? 19  ASP B CA  1 
ATOM   4731  C  C   . ASP C 1 19  ? 15.556  88.147  72.722  1.00 13.88 ? 19  ASP B C   1 
ATOM   4732  O  O   . ASP C 1 19  ? 16.513  87.511  73.164  1.00 13.37 ? 19  ASP B O   1 
ATOM   4733  C  CB  . ASP C 1 19  ? 15.712  90.584  73.179  1.00 17.05 ? 19  ASP B CB  1 
ATOM   4734  C  CG  . ASP C 1 19  ? 15.078  91.817  73.788  1.00 21.01 ? 19  ASP B CG  1 
ATOM   4735  O  OD1 . ASP C 1 19  ? 13.866  91.786  74.093  1.00 22.14 ? 19  ASP B OD1 1 
ATOM   4736  O  OD2 . ASP C 1 19  ? 15.793  92.828  73.942  1.00 24.65 ? 19  ASP B OD2 1 
ATOM   4737  N  N   . TYR C 1 20  ? 14.992  87.884  71.549  1.00 12.65 ? 20  TYR B N   1 
ATOM   4738  C  CA  . TYR C 1 20  ? 15.486  86.818  70.686  1.00 12.18 ? 20  TYR B CA  1 
ATOM   4739  C  C   . TYR C 1 20  ? 16.909  87.098  70.195  1.00 12.78 ? 20  TYR B C   1 
ATOM   4740  O  O   . TYR C 1 20  ? 17.724  86.182  70.065  1.00 12.28 ? 20  TYR B O   1 
ATOM   4741  C  CB  . TYR C 1 20  ? 14.572  86.661  69.465  1.00 10.00 ? 20  TYR B CB  1 
ATOM   4742  C  CG  . TYR C 1 20  ? 13.221  86.029  69.733  1.00 10.43 ? 20  TYR B CG  1 
ATOM   4743  C  CD1 . TYR C 1 20  ? 13.113  84.675  70.049  1.00 8.01  ? 20  TYR B CD1 1 
ATOM   4744  C  CD2 . TYR C 1 20  ? 12.043  86.773  69.615  1.00 9.23  ? 20  TYR B CD2 1 
ATOM   4745  C  CE1 . TYR C 1 20  ? 11.866  84.072  70.232  1.00 8.95  ? 20  TYR B CE1 1 
ATOM   4746  C  CE2 . TYR C 1 20  ? 10.787  86.179  69.801  1.00 8.57  ? 20  TYR B CE2 1 
ATOM   4747  C  CZ  . TYR C 1 20  ? 10.709  84.827  70.104  1.00 8.02  ? 20  TYR B CZ  1 
ATOM   4748  O  OH  . TYR C 1 20  ? 9.481   84.224  70.265  1.00 8.59  ? 20  TYR B OH  1 
ATOM   4749  N  N   . LYS C 1 21  ? 17.208  88.364  69.921  1.00 13.41 ? 21  LYS B N   1 
ATOM   4750  C  CA  . LYS C 1 21  ? 18.522  88.724  69.403  1.00 16.17 ? 21  LYS B CA  1 
ATOM   4751  C  C   . LYS C 1 21  ? 19.704  88.384  70.301  1.00 16.01 ? 21  LYS B C   1 
ATOM   4752  O  O   . LYS C 1 21  ? 20.835  88.324  69.830  1.00 15.39 ? 21  LYS B O   1 
ATOM   4753  C  CB  . LYS C 1 21  ? 18.571  90.207  69.042  1.00 18.07 ? 21  LYS B CB  1 
ATOM   4754  C  CG  . LYS C 1 21  ? 18.400  91.152  70.207  1.00 21.95 ? 21  LYS B CG  1 
ATOM   4755  C  CD  . LYS C 1 21  ? 18.553  92.576  69.722  1.00 26.29 ? 21  LYS B CD  1 
ATOM   4756  C  CE  . LYS C 1 21  ? 17.860  93.549  70.648  1.00 29.91 ? 21  LYS B CE  1 
ATOM   4757  N  NZ  . LYS C 1 21  ? 18.491  93.615  71.991  1.00 33.93 ? 21  LYS B NZ  1 
ATOM   4758  N  N   . LEU C 1 22  ? 19.447  88.167  71.586  1.00 15.70 ? 22  LEU B N   1 
ATOM   4759  C  CA  . LEU C 1 22  ? 20.516  87.825  72.518  1.00 17.01 ? 22  LEU B CA  1 
ATOM   4760  C  C   . LEU C 1 22  ? 21.135  86.482  72.154  1.00 16.79 ? 22  LEU B C   1 
ATOM   4761  O  O   . LEU C 1 22  ? 22.328  86.256  72.367  1.00 18.07 ? 22  LEU B O   1 
ATOM   4762  C  CB  . LEU C 1 22  ? 19.970  87.761  73.950  1.00 18.75 ? 22  LEU B CB  1 
ATOM   4763  C  CG  . LEU C 1 22  ? 19.973  89.041  74.796  1.00 22.50 ? 22  LEU B CG  1 
ATOM   4764  C  CD1 . LEU C 1 22  ? 19.586  90.246  73.958  1.00 24.65 ? 22  LEU B CD1 1 
ATOM   4765  C  CD2 . LEU C 1 22  ? 19.016  88.866  75.965  1.00 23.97 ? 22  LEU B CD2 1 
ATOM   4766  N  N   . THR C 1 23  ? 20.319  85.597  71.591  1.00 14.72 ? 23  THR B N   1 
ATOM   4767  C  CA  . THR C 1 23  ? 20.774  84.265  71.223  1.00 13.26 ? 23  THR B CA  1 
ATOM   4768  C  C   . THR C 1 23  ? 20.726  83.970  69.724  1.00 11.83 ? 23  THR B C   1 
ATOM   4769  O  O   . THR C 1 23  ? 21.534  83.197  69.216  1.00 12.59 ? 23  THR B O   1 
ATOM   4770  C  CB  . THR C 1 23  ? 19.910  83.191  71.928  1.00 14.05 ? 23  THR B CB  1 
ATOM   4771  O  OG1 . THR C 1 23  ? 19.847  83.468  73.331  1.00 17.65 ? 23  THR B OG1 1 
ATOM   4772  C  CG2 . THR C 1 23  ? 20.495  81.804  71.713  1.00 14.21 ? 23  THR B CG2 1 
ATOM   4773  N  N   . TYR C 1 24  ? 19.793  84.597  69.015  1.00 12.29 ? 24  TYR B N   1 
ATOM   4774  C  CA  . TYR C 1 24  ? 19.617  84.311  67.596  1.00 12.39 ? 24  TYR B CA  1 
ATOM   4775  C  C   . TYR C 1 24  ? 20.118  85.289  66.537  1.00 12.21 ? 24  TYR B C   1 
ATOM   4776  O  O   . TYR C 1 24  ? 19.887  85.080  65.345  1.00 13.05 ? 24  TYR B O   1 
ATOM   4777  C  CB  . TYR C 1 24  ? 18.142  83.978  67.369  1.00 11.29 ? 24  TYR B CB  1 
ATOM   4778  C  CG  . TYR C 1 24  ? 17.729  82.748  68.152  1.00 11.34 ? 24  TYR B CG  1 
ATOM   4779  C  CD1 . TYR C 1 24  ? 17.886  81.470  67.615  1.00 9.16  ? 24  TYR B CD1 1 
ATOM   4780  C  CD2 . TYR C 1 24  ? 17.246  82.859  69.454  1.00 10.84 ? 24  TYR B CD2 1 
ATOM   4781  C  CE1 . TYR C 1 24  ? 17.573  80.334  68.352  1.00 9.41  ? 24  TYR B CE1 1 
ATOM   4782  C  CE2 . TYR C 1 24  ? 16.930  81.725  70.206  1.00 10.69 ? 24  TYR B CE2 1 
ATOM   4783  C  CZ  . TYR C 1 24  ? 17.097  80.468  69.648  1.00 10.59 ? 24  TYR B CZ  1 
ATOM   4784  O  OH  . TYR C 1 24  ? 16.786  79.345  70.382  1.00 11.42 ? 24  TYR B OH  1 
ATOM   4785  N  N   . TYR C 1 25  ? 20.796  86.349  66.958  1.00 12.61 ? 25  TYR B N   1 
ATOM   4786  C  CA  . TYR C 1 25  ? 21.363  87.304  66.013  1.00 13.21 ? 25  TYR B CA  1 
ATOM   4787  C  C   . TYR C 1 25  ? 22.876  87.202  66.181  1.00 12.61 ? 25  TYR B C   1 
ATOM   4788  O  O   . TYR C 1 25  ? 23.424  87.674  67.173  1.00 11.34 ? 25  TYR B O   1 
ATOM   4789  C  CB  . TYR C 1 25  ? 20.908  88.735  66.314  1.00 13.13 ? 25  TYR B CB  1 
ATOM   4790  C  CG  . TYR C 1 25  ? 21.535  89.764  65.389  1.00 16.19 ? 25  TYR B CG  1 
ATOM   4791  C  CD1 . TYR C 1 25  ? 21.437  89.637  64.003  1.00 15.69 ? 25  TYR B CD1 1 
ATOM   4792  C  CD2 . TYR C 1 25  ? 22.248  90.848  65.898  1.00 17.42 ? 25  TYR B CD2 1 
ATOM   4793  C  CE1 . TYR C 1 25  ? 22.035  90.558  63.152  1.00 16.89 ? 25  TYR B CE1 1 
ATOM   4794  C  CE2 . TYR C 1 25  ? 22.852  91.777  65.050  1.00 17.61 ? 25  TYR B CE2 1 
ATOM   4795  C  CZ  . TYR C 1 25  ? 22.743  91.623  63.681  1.00 16.36 ? 25  TYR B CZ  1 
ATOM   4796  O  OH  . TYR C 1 25  ? 23.352  92.531  62.840  1.00 18.77 ? 25  TYR B OH  1 
ATOM   4797  N  N   . THR C 1 26  ? 23.536  86.568  65.217  1.00 12.82 ? 26  THR B N   1 
ATOM   4798  C  CA  . THR C 1 26  ? 24.983  86.373  65.261  1.00 13.16 ? 26  THR B CA  1 
ATOM   4799  C  C   . THR C 1 26  ? 25.640  86.890  63.981  1.00 12.14 ? 26  THR B C   1 
ATOM   4800  O  O   . THR C 1 26  ? 25.997  86.113  63.101  1.00 11.40 ? 26  THR B O   1 
ATOM   4801  C  CB  . THR C 1 26  ? 25.319  84.873  65.421  1.00 14.27 ? 26  THR B CB  1 
ATOM   4802  O  OG1 . THR C 1 26  ? 24.810  84.141  64.295  1.00 15.34 ? 26  THR B OG1 1 
ATOM   4803  C  CG2 . THR C 1 26  ? 24.684  84.321  66.689  1.00 14.27 ? 26  THR B CG2 1 
ATOM   4804  N  N   . PRO C 1 27  ? 25.826  88.215  63.874  1.00 14.21 ? 27  PRO B N   1 
ATOM   4805  C  CA  . PRO C 1 27  ? 26.439  88.826  62.690  1.00 15.25 ? 27  PRO B CA  1 
ATOM   4806  C  C   . PRO C 1 27  ? 27.885  88.408  62.407  1.00 17.19 ? 27  PRO B C   1 
ATOM   4807  O  O   . PRO C 1 27  ? 28.408  88.666  61.326  1.00 18.23 ? 27  PRO B O   1 
ATOM   4808  C  CB  . PRO C 1 27  ? 26.302  90.322  62.974  1.00 15.30 ? 27  PRO B CB  1 
ATOM   4809  C  CG  . PRO C 1 27  ? 26.441  90.382  64.466  1.00 14.01 ? 27  PRO B CG  1 
ATOM   4810  C  CD  . PRO C 1 27  ? 25.571  89.227  64.917  1.00 14.22 ? 27  PRO B CD  1 
ATOM   4811  N  N   . GLU C 1 28  ? 28.529  87.754  63.365  1.00 18.15 ? 28  GLU B N   1 
ATOM   4812  C  CA  . GLU C 1 28  ? 29.911  87.335  63.167  1.00 19.93 ? 28  GLU B CA  1 
ATOM   4813  C  C   . GLU C 1 28  ? 30.003  85.896  62.674  1.00 19.60 ? 28  GLU B C   1 
ATOM   4814  O  O   . GLU C 1 28  ? 31.093  85.380  62.436  1.00 19.20 ? 28  GLU B O   1 
ATOM   4815  C  CB  . GLU C 1 28  ? 30.707  87.491  64.470  1.00 22.42 ? 28  GLU B CB  1 
ATOM   4816  C  CG  . GLU C 1 28  ? 30.455  86.430  65.548  1.00 27.56 ? 28  GLU B CG  1 
ATOM   4817  C  CD  . GLU C 1 28  ? 29.029  86.423  66.081  1.00 30.64 ? 28  GLU B CD  1 
ATOM   4818  O  OE1 . GLU C 1 28  ? 28.383  87.492  66.095  1.00 31.70 ? 28  GLU B OE1 1 
ATOM   4819  O  OE2 . GLU C 1 28  ? 28.560  85.346  66.509  1.00 34.31 ? 28  GLU B OE2 1 
ATOM   4820  N  N   . TYR C 1 29  ? 28.850  85.258  62.509  1.00 18.06 ? 29  TYR B N   1 
ATOM   4821  C  CA  . TYR C 1 29  ? 28.799  83.873  62.063  1.00 17.47 ? 29  TYR B CA  1 
ATOM   4822  C  C   . TYR C 1 29  ? 29.239  83.669  60.618  1.00 17.04 ? 29  TYR B C   1 
ATOM   4823  O  O   . TYR C 1 29  ? 28.830  84.403  59.721  1.00 17.52 ? 29  TYR B O   1 
ATOM   4824  C  CB  . TYR C 1 29  ? 27.377  83.320  62.223  1.00 15.54 ? 29  TYR B CB  1 
ATOM   4825  C  CG  . TYR C 1 29  ? 27.233  81.865  61.830  1.00 15.68 ? 29  TYR B CG  1 
ATOM   4826  C  CD1 . TYR C 1 29  ? 27.813  80.856  62.600  1.00 15.99 ? 29  TYR B CD1 1 
ATOM   4827  C  CD2 . TYR C 1 29  ? 26.507  81.494  60.697  1.00 15.56 ? 29  TYR B CD2 1 
ATOM   4828  C  CE1 . TYR C 1 29  ? 27.673  79.513  62.255  1.00 14.84 ? 29  TYR B CE1 1 
ATOM   4829  C  CE2 . TYR C 1 29  ? 26.361  80.152  60.343  1.00 15.10 ? 29  TYR B CE2 1 
ATOM   4830  C  CZ  . TYR C 1 29  ? 26.946  79.168  61.130  1.00 15.35 ? 29  TYR B CZ  1 
ATOM   4831  O  OH  . TYR C 1 29  ? 26.801  77.840  60.802  1.00 12.43 ? 29  TYR B OH  1 
ATOM   4832  N  N   . GLU C 1 30  ? 30.082  82.665  60.408  1.00 18.08 ? 30  GLU B N   1 
ATOM   4833  C  CA  . GLU C 1 30  ? 30.542  82.314  59.071  1.00 20.08 ? 30  GLU B CA  1 
ATOM   4834  C  C   . GLU C 1 30  ? 29.796  81.023  58.739  1.00 18.09 ? 30  GLU B C   1 
ATOM   4835  O  O   . GLU C 1 30  ? 29.929  80.022  59.441  1.00 17.25 ? 30  GLU B O   1 
ATOM   4836  C  CB  . GLU C 1 30  ? 32.057  82.092  59.056  1.00 24.99 ? 30  GLU B CB  1 
ATOM   4837  C  CG  . GLU C 1 30  ? 32.854  83.366  59.324  1.00 33.69 ? 30  GLU B CG  1 
ATOM   4838  C  CD  . GLU C 1 30  ? 34.357  83.140  59.304  1.00 39.02 ? 30  GLU B CD  1 
ATOM   4839  O  OE1 . GLU C 1 30  ? 34.846  82.306  60.098  1.00 40.56 ? 30  GLU B OE1 1 
ATOM   4840  O  OE2 . GLU C 1 30  ? 35.050  83.800  58.497  1.00 42.02 ? 30  GLU B OE2 1 
ATOM   4841  N  N   . THR C 1 31  ? 28.995  81.060  57.681  1.00 16.32 ? 31  THR B N   1 
ATOM   4842  C  CA  . THR C 1 31  ? 28.200  79.902  57.292  1.00 15.90 ? 31  THR B CA  1 
ATOM   4843  C  C   . THR C 1 31  ? 29.032  78.688  56.900  1.00 16.00 ? 31  THR B C   1 
ATOM   4844  O  O   . THR C 1 31  ? 30.155  78.816  56.415  1.00 16.19 ? 31  THR B O   1 
ATOM   4845  C  CB  . THR C 1 31  ? 27.268  80.247  56.123  1.00 15.85 ? 31  THR B CB  1 
ATOM   4846  O  OG1 . THR C 1 31  ? 28.052  80.556  54.966  1.00 15.12 ? 31  THR B OG1 1 
ATOM   4847  C  CG2 . THR C 1 31  ? 26.398  81.451  56.477  1.00 12.10 ? 31  THR B CG2 1 
ATOM   4848  N  N   . LEU C 1 32  ? 28.468  77.507  57.128  1.00 15.09 ? 32  LEU B N   1 
ATOM   4849  C  CA  . LEU C 1 32  ? 29.131  76.254  56.788  1.00 14.42 ? 32  LEU B CA  1 
ATOM   4850  C  C   . LEU C 1 32  ? 28.561  75.807  55.448  1.00 13.89 ? 32  LEU B C   1 
ATOM   4851  O  O   . LEU C 1 32  ? 27.460  76.215  55.075  1.00 13.04 ? 32  LEU B O   1 
ATOM   4852  C  CB  . LEU C 1 32  ? 28.838  75.188  57.848  1.00 14.69 ? 32  LEU B CB  1 
ATOM   4853  C  CG  . LEU C 1 32  ? 29.204  75.492  59.304  1.00 16.41 ? 32  LEU B CG  1 
ATOM   4854  C  CD1 . LEU C 1 32  ? 28.752  74.333  60.183  1.00 16.38 ? 32  LEU B CD1 1 
ATOM   4855  C  CD2 . LEU C 1 32  ? 30.704  75.709  59.436  1.00 14.06 ? 32  LEU B CD2 1 
ATOM   4856  N  N   . ASP C 1 33  ? 29.302  74.973  54.728  1.00 12.16 ? 33  ASP B N   1 
ATOM   4857  C  CA  . ASP C 1 33  ? 28.835  74.493  53.435  1.00 14.30 ? 33  ASP B CA  1 
ATOM   4858  C  C   . ASP C 1 33  ? 27.731  73.450  53.573  1.00 12.32 ? 33  ASP B C   1 
ATOM   4859  O  O   . ASP C 1 33  ? 27.172  72.998  52.573  1.00 11.91 ? 33  ASP B O   1 
ATOM   4860  C  CB  . ASP C 1 33  ? 29.995  73.910  52.624  1.00 18.16 ? 33  ASP B CB  1 
ATOM   4861  C  CG  . ASP C 1 33  ? 31.020  74.962  52.237  1.00 24.22 ? 33  ASP B CG  1 
ATOM   4862  O  OD1 . ASP C 1 33  ? 30.613  76.103  51.927  1.00 26.17 ? 33  ASP B OD1 1 
ATOM   4863  O  OD2 . ASP C 1 33  ? 32.230  74.648  52.232  1.00 27.34 ? 33  ASP B OD2 1 
ATOM   4864  N  N   . THR C 1 34  ? 27.422  73.066  54.808  1.00 10.51 ? 34  THR B N   1 
ATOM   4865  C  CA  . THR C 1 34  ? 26.367  72.085  55.054  1.00 8.69  ? 34  THR B CA  1 
ATOM   4866  C  C   . THR C 1 34  ? 25.083  72.750  55.576  1.00 8.12  ? 34  THR B C   1 
ATOM   4867  O  O   . THR C 1 34  ? 24.063  72.082  55.749  1.00 7.59  ? 34  THR B O   1 
ATOM   4868  C  CB  . THR C 1 34  ? 26.819  71.007  56.064  1.00 9.95  ? 34  THR B CB  1 
ATOM   4869  O  OG1 . THR C 1 34  ? 27.313  71.641  57.248  1.00 7.38  ? 34  THR B OG1 1 
ATOM   4870  C  CG2 . THR C 1 34  ? 27.916  70.117  55.455  1.00 8.30  ? 34  THR B CG2 1 
ATOM   4871  N  N   . ASP C 1 35  ? 25.139  74.060  55.816  1.00 7.64  ? 35  ASP B N   1 
ATOM   4872  C  CA  . ASP C 1 35  ? 23.971  74.810  56.301  1.00 7.38  ? 35  ASP B CA  1 
ATOM   4873  C  C   . ASP C 1 35  ? 22.953  75.128  55.203  1.00 7.60  ? 35  ASP B C   1 
ATOM   4874  O  O   . ASP C 1 35  ? 23.314  75.321  54.041  1.00 7.36  ? 35  ASP B O   1 
ATOM   4875  C  CB  . ASP C 1 35  ? 24.371  76.171  56.884  1.00 7.65  ? 35  ASP B CB  1 
ATOM   4876  C  CG  . ASP C 1 35  ? 25.156  76.073  58.174  1.00 10.70 ? 35  ASP B CG  1 
ATOM   4877  O  OD1 . ASP C 1 35  ? 25.025  75.067  58.903  1.00 10.81 ? 35  ASP B OD1 1 
ATOM   4878  O  OD2 . ASP C 1 35  ? 25.897  77.036  58.463  1.00 10.78 ? 35  ASP B OD2 1 
ATOM   4879  N  N   . ILE C 1 36  ? 21.683  75.201  55.588  1.00 7.66  ? 36  ILE B N   1 
ATOM   4880  C  CA  . ILE C 1 36  ? 20.628  75.602  54.662  1.00 8.70  ? 36  ILE B CA  1 
ATOM   4881  C  C   . ILE C 1 36  ? 20.531  77.102  54.938  1.00 8.73  ? 36  ILE B C   1 
ATOM   4882  O  O   . ILE C 1 36  ? 20.358  77.510  56.092  1.00 9.60  ? 36  ILE B O   1 
ATOM   4883  C  CB  . ILE C 1 36  ? 19.256  74.963  54.993  1.00 8.93  ? 36  ILE B CB  1 
ATOM   4884  C  CG1 . ILE C 1 36  ? 19.223  73.497  54.551  1.00 10.83 ? 36  ILE B CG1 1 
ATOM   4885  C  CG2 . ILE C 1 36  ? 18.144  75.732  54.288  1.00 9.08  ? 36  ILE B CG2 1 
ATOM   4886  C  CD1 . ILE C 1 36  ? 20.140  72.586  55.338  1.00 12.78 ? 36  ILE B CD1 1 
ATOM   4887  N  N   . LEU C 1 37  ? 20.666  77.920  53.899  1.00 7.61  ? 37  LEU B N   1 
ATOM   4888  C  CA  . LEU C 1 37  ? 20.600  79.368  54.065  1.00 8.86  ? 37  LEU B CA  1 
ATOM   4889  C  C   . LEU C 1 37  ? 19.283  79.889  53.507  1.00 11.00 ? 37  LEU B C   1 
ATOM   4890  O  O   . LEU C 1 37  ? 18.816  79.428  52.468  1.00 12.17 ? 37  LEU B O   1 
ATOM   4891  C  CB  . LEU C 1 37  ? 21.770  80.046  53.338  1.00 7.78  ? 37  LEU B CB  1 
ATOM   4892  C  CG  . LEU C 1 37  ? 23.179  79.505  53.620  1.00 7.43  ? 37  LEU B CG  1 
ATOM   4893  C  CD1 . LEU C 1 37  ? 24.203  80.356  52.878  1.00 6.63  ? 37  LEU B CD1 1 
ATOM   4894  C  CD2 . LEU C 1 37  ? 23.457  79.518  55.125  1.00 6.60  ? 37  LEU B CD2 1 
ATOM   4895  N  N   . ALA C 1 38  ? 18.684  80.850  54.202  1.00 11.92 ? 38  ALA B N   1 
ATOM   4896  C  CA  . ALA C 1 38  ? 17.417  81.425  53.756  1.00 11.07 ? 38  ALA B CA  1 
ATOM   4897  C  C   . ALA C 1 38  ? 17.479  82.944  53.695  1.00 10.60 ? 38  ALA B C   1 
ATOM   4898  O  O   . ALA C 1 38  ? 18.078  83.582  54.559  1.00 11.75 ? 38  ALA B O   1 
ATOM   4899  C  CB  . ALA C 1 38  ? 16.292  80.995  54.692  1.00 11.05 ? 38  ALA B CB  1 
ATOM   4900  N  N   . ALA C 1 39  ? 16.865  83.513  52.663  1.00 9.79  ? 39  ALA B N   1 
ATOM   4901  C  CA  . ALA C 1 39  ? 16.812  84.962  52.501  1.00 10.87 ? 39  ALA B CA  1 
ATOM   4902  C  C   . ALA C 1 39  ? 15.361  85.401  52.697  1.00 9.52  ? 39  ALA B C   1 
ATOM   4903  O  O   . ALA C 1 39  ? 14.517  85.151  51.841  1.00 10.05 ? 39  ALA B O   1 
ATOM   4904  C  CB  . ALA C 1 39  ? 17.295  85.360  51.107  1.00 7.38  ? 39  ALA B CB  1 
ATOM   4905  N  N   . PHE C 1 40  ? 15.083  86.047  53.828  1.00 9.91  ? 40  PHE B N   1 
ATOM   4906  C  CA  . PHE C 1 40  ? 13.736  86.520  54.154  1.00 9.21  ? 40  PHE B CA  1 
ATOM   4907  C  C   . PHE C 1 40  ? 13.559  88.019  53.932  1.00 10.08 ? 40  PHE B C   1 
ATOM   4908  O  O   . PHE C 1 40  ? 14.414  88.813  54.329  1.00 9.91  ? 40  PHE B O   1 
ATOM   4909  C  CB  . PHE C 1 40  ? 13.417  86.255  55.629  1.00 9.70  ? 40  PHE B CB  1 
ATOM   4910  C  CG  . PHE C 1 40  ? 13.140  84.817  55.965  1.00 11.04 ? 40  PHE B CG  1 
ATOM   4911  C  CD1 . PHE C 1 40  ? 11.883  84.264  55.740  1.00 10.91 ? 40  PHE B CD1 1 
ATOM   4912  C  CD2 . PHE C 1 40  ? 14.118  84.034  56.579  1.00 9.08  ? 40  PHE B CD2 1 
ATOM   4913  C  CE1 . PHE C 1 40  ? 11.601  82.954  56.131  1.00 11.03 ? 40  PHE B CE1 1 
ATOM   4914  C  CE2 . PHE C 1 40  ? 13.846  82.729  56.968  1.00 8.65  ? 40  PHE B CE2 1 
ATOM   4915  C  CZ  . PHE C 1 40  ? 12.586  82.189  56.747  1.00 11.15 ? 40  PHE B CZ  1 
ATOM   4916  N  N   . ARG C 1 41  ? 12.447  88.402  53.306  1.00 9.63  ? 41  ARG B N   1 
ATOM   4917  C  CA  . ARG C 1 41  ? 12.127  89.815  53.111  1.00 9.41  ? 41  ARG B CA  1 
ATOM   4918  C  C   . ARG C 1 41  ? 11.243  90.113  54.322  1.00 9.02  ? 41  ARG B C   1 
ATOM   4919  O  O   . ARG C 1 41  ? 10.086  89.682  54.385  1.00 8.85  ? 41  ARG B O   1 
ATOM   4920  C  CB  . ARG C 1 41  ? 11.346  90.033  51.812  1.00 9.95  ? 41  ARG B CB  1 
ATOM   4921  C  CG  . ARG C 1 41  ? 11.070  91.504  51.496  1.00 8.27  ? 41  ARG B CG  1 
ATOM   4922  C  CD  . ARG C 1 41  ? 10.222  91.648  50.235  1.00 10.03 ? 41  ARG B CD  1 
ATOM   4923  N  NE  . ARG C 1 41  ? 10.908  91.142  49.051  1.00 12.33 ? 41  ARG B NE  1 
ATOM   4924  C  CZ  . ARG C 1 41  ? 11.691  91.875  48.266  1.00 14.25 ? 41  ARG B CZ  1 
ATOM   4925  N  NH1 . ARG C 1 41  ? 11.888  93.159  48.534  1.00 14.64 ? 41  ARG B NH1 1 
ATOM   4926  N  NH2 . ARG C 1 41  ? 12.285  91.322  47.216  1.00 14.68 ? 41  ARG B NH2 1 
ATOM   4927  N  N   . VAL C 1 42  ? 11.803  90.833  55.291  1.00 10.19 ? 42  VAL B N   1 
ATOM   4928  C  CA  . VAL C 1 42  ? 11.106  91.135  56.540  1.00 9.38  ? 42  VAL B CA  1 
ATOM   4929  C  C   . VAL C 1 42  ? 10.589  92.562  56.693  1.00 10.58 ? 42  VAL B C   1 
ATOM   4930  O  O   . VAL C 1 42  ? 11.326  93.528  56.500  1.00 10.47 ? 42  VAL B O   1 
ATOM   4931  C  CB  . VAL C 1 42  ? 12.031  90.838  57.757  1.00 10.53 ? 42  VAL B CB  1 
ATOM   4932  C  CG1 . VAL C 1 42  ? 11.253  90.956  59.059  1.00 9.01  ? 42  VAL B CG1 1 
ATOM   4933  C  CG2 . VAL C 1 42  ? 12.656  89.457  57.622  1.00 10.30 ? 42  VAL B CG2 1 
ATOM   4934  N  N   . SER C 1 43  ? 9.315   92.678  57.055  1.00 11.15 ? 43  SER B N   1 
ATOM   4935  C  CA  . SER C 1 43  ? 8.679   93.968  57.289  1.00 10.31 ? 43  SER B CA  1 
ATOM   4936  C  C   . SER C 1 43  ? 8.189   93.964  58.737  1.00 11.45 ? 43  SER B C   1 
ATOM   4937  O  O   . SER C 1 43  ? 7.109   93.451  59.037  1.00 10.02 ? 43  SER B O   1 
ATOM   4938  C  CB  . SER C 1 43  ? 7.500   94.163  56.337  1.00 11.18 ? 43  SER B CB  1 
ATOM   4939  O  OG  . SER C 1 43  ? 7.947   94.177  54.992  1.00 12.76 ? 43  SER B OG  1 
ATOM   4940  N  N   . PRO C 1 44  ? 8.984   94.541  59.658  1.00 12.29 ? 44  PRO B N   1 
ATOM   4941  C  CA  . PRO C 1 44  ? 8.643   94.599  61.083  1.00 11.93 ? 44  PRO B CA  1 
ATOM   4942  C  C   . PRO C 1 44  ? 7.544   95.603  61.412  1.00 12.98 ? 44  PRO B C   1 
ATOM   4943  O  O   . PRO C 1 44  ? 7.279   96.524  60.639  1.00 12.34 ? 44  PRO B O   1 
ATOM   4944  C  CB  . PRO C 1 44  ? 9.966   95.000  61.750  1.00 12.75 ? 44  PRO B CB  1 
ATOM   4945  C  CG  . PRO C 1 44  ? 11.022  94.812  60.667  1.00 11.48 ? 44  PRO B CG  1 
ATOM   4946  C  CD  . PRO C 1 44  ? 10.291  95.174  59.419  1.00 11.58 ? 44  PRO B CD  1 
ATOM   4947  N  N   . GLN C 1 45  ? 6.907   95.408  62.565  1.00 13.42 ? 45  GLN B N   1 
ATOM   4948  C  CA  . GLN C 1 45  ? 5.873   96.321  63.033  1.00 15.01 ? 45  GLN B CA  1 
ATOM   4949  C  C   . GLN C 1 45  ? 6.642   97.532  63.541  1.00 16.81 ? 45  GLN B C   1 
ATOM   4950  O  O   . GLN C 1 45  ? 7.812   97.412  63.907  1.00 15.66 ? 45  GLN B O   1 
ATOM   4951  C  CB  . GLN C 1 45  ? 5.095   95.710  64.202  1.00 15.12 ? 45  GLN B CB  1 
ATOM   4952  C  CG  . GLN C 1 45  ? 4.131   94.604  63.830  1.00 15.11 ? 45  GLN B CG  1 
ATOM   4953  C  CD  . GLN C 1 45  ? 2.838   95.137  63.244  1.00 18.20 ? 45  GLN B CD  1 
ATOM   4954  O  OE1 . GLN C 1 45  ? 2.656   96.349  63.108  1.00 18.65 ? 45  GLN B OE1 1 
ATOM   4955  N  NE2 . GLN C 1 45  ? 1.928   94.231  62.900  1.00 17.14 ? 45  GLN B NE2 1 
ATOM   4956  N  N   . PRO C 1 46  ? 6.004   98.712  63.565  1.00 18.02 ? 46  PRO B N   1 
ATOM   4957  C  CA  . PRO C 1 46  ? 6.687   99.914  64.049  1.00 19.46 ? 46  PRO B CA  1 
ATOM   4958  C  C   . PRO C 1 46  ? 7.245   99.669  65.449  1.00 19.83 ? 46  PRO B C   1 
ATOM   4959  O  O   . PRO C 1 46  ? 6.570   99.083  66.296  1.00 21.27 ? 46  PRO B O   1 
ATOM   4960  C  CB  . PRO C 1 46  ? 5.574   100.962 64.049  1.00 19.77 ? 46  PRO B CB  1 
ATOM   4961  C  CG  . PRO C 1 46  ? 4.701   100.521 62.915  1.00 20.41 ? 46  PRO B CG  1 
ATOM   4962  C  CD  . PRO C 1 46  ? 4.637   99.026  63.113  1.00 19.26 ? 46  PRO B CD  1 
ATOM   4963  N  N   . GLY C 1 47  ? 8.480   100.095 65.686  1.00 19.99 ? 47  GLY B N   1 
ATOM   4964  C  CA  . GLY C 1 47  ? 9.073   99.915  66.999  1.00 20.20 ? 47  GLY B CA  1 
ATOM   4965  C  C   . GLY C 1 47  ? 9.849   98.626  67.209  1.00 20.56 ? 47  GLY B C   1 
ATOM   4966  O  O   . GLY C 1 47  ? 10.487  98.449  68.247  1.00 21.71 ? 47  GLY B O   1 
ATOM   4967  N  N   . VAL C 1 48  ? 9.791   97.715  66.246  1.00 19.65 ? 48  VAL B N   1 
ATOM   4968  C  CA  . VAL C 1 48  ? 10.522  96.459  66.370  1.00 17.49 ? 48  VAL B CA  1 
ATOM   4969  C  C   . VAL C 1 48  ? 11.805  96.580  65.556  1.00 17.90 ? 48  VAL B C   1 
ATOM   4970  O  O   . VAL C 1 48  ? 11.760  96.746  64.339  1.00 18.38 ? 48  VAL B O   1 
ATOM   4971  C  CB  . VAL C 1 48  ? 9.690   95.265  65.844  1.00 17.16 ? 48  VAL B CB  1 
ATOM   4972  C  CG1 . VAL C 1 48  ? 10.504  93.983  65.928  1.00 14.88 ? 48  VAL B CG1 1 
ATOM   4973  C  CG2 . VAL C 1 48  ? 8.402   95.125  66.658  1.00 16.74 ? 48  VAL B CG2 1 
ATOM   4974  N  N   . PRO C 1 49  ? 12.970  96.510  66.224  1.00 18.06 ? 49  PRO B N   1 
ATOM   4975  C  CA  . PRO C 1 49  ? 14.261  96.616  65.536  1.00 17.51 ? 49  PRO B CA  1 
ATOM   4976  C  C   . PRO C 1 49  ? 14.454  95.465  64.555  1.00 17.02 ? 49  PRO B C   1 
ATOM   4977  O  O   . PRO C 1 49  ? 14.016  94.341  64.810  1.00 17.07 ? 49  PRO B O   1 
ATOM   4978  C  CB  . PRO C 1 49  ? 15.274  96.556  66.680  1.00 17.79 ? 49  PRO B CB  1 
ATOM   4979  C  CG  . PRO C 1 49  ? 14.496  97.035  67.870  1.00 19.37 ? 49  PRO B CG  1 
ATOM   4980  C  CD  . PRO C 1 49  ? 13.168  96.363  67.675  1.00 17.65 ? 49  PRO B CD  1 
ATOM   4981  N  N   . PRO C 1 50  ? 15.112  95.727  63.418  1.00 15.22 ? 50  PRO B N   1 
ATOM   4982  C  CA  . PRO C 1 50  ? 15.320  94.646  62.451  1.00 14.60 ? 50  PRO B CA  1 
ATOM   4983  C  C   . PRO C 1 50  ? 16.105  93.465  63.020  1.00 14.70 ? 50  PRO B C   1 
ATOM   4984  O  O   . PRO C 1 50  ? 15.876  92.322  62.627  1.00 13.86 ? 50  PRO B O   1 
ATOM   4985  C  CB  . PRO C 1 50  ? 16.032  95.346  61.289  1.00 14.51 ? 50  PRO B CB  1 
ATOM   4986  C  CG  . PRO C 1 50  ? 16.700  96.534  61.941  1.00 14.65 ? 50  PRO B CG  1 
ATOM   4987  C  CD  . PRO C 1 50  ? 15.653  97.003  62.916  1.00 15.07 ? 50  PRO B CD  1 
ATOM   4988  N  N   . GLU C 1 51  ? 17.014  93.734  63.957  1.00 14.67 ? 51  GLU B N   1 
ATOM   4989  C  CA  . GLU C 1 51  ? 17.809  92.663  64.563  1.00 14.34 ? 51  GLU B CA  1 
ATOM   4990  C  C   . GLU C 1 51  ? 16.928  91.730  65.391  1.00 13.40 ? 51  GLU B C   1 
ATOM   4991  O  O   . GLU C 1 51  ? 17.159  90.521  65.433  1.00 14.40 ? 51  GLU B O   1 
ATOM   4992  C  CB  . GLU C 1 51  ? 18.910  93.225  65.472  1.00 15.95 ? 51  GLU B CB  1 
ATOM   4993  C  CG  . GLU C 1 51  ? 19.936  94.123  64.798  1.00 19.61 ? 51  GLU B CG  1 
ATOM   4994  C  CD  . GLU C 1 51  ? 19.387  95.500  64.479  1.00 22.84 ? 51  GLU B CD  1 
ATOM   4995  O  OE1 . GLU C 1 51  ? 18.365  95.888  65.089  1.00 20.69 ? 51  GLU B OE1 1 
ATOM   4996  O  OE2 . GLU C 1 51  ? 19.987  96.197  63.629  1.00 24.98 ? 51  GLU B OE2 1 
ATOM   4997  N  N   . GLU C 1 52  ? 15.923  92.290  66.060  1.00 12.43 ? 52  GLU B N   1 
ATOM   4998  C  CA  . GLU C 1 52  ? 15.027  91.484  66.879  1.00 11.24 ? 52  GLU B CA  1 
ATOM   4999  C  C   . GLU C 1 52  ? 14.038  90.734  65.996  1.00 11.05 ? 52  GLU B C   1 
ATOM   5000  O  O   . GLU C 1 52  ? 13.687  89.590  66.279  1.00 11.43 ? 52  GLU B O   1 
ATOM   5001  C  CB  . GLU C 1 52  ? 14.273  92.364  67.883  1.00 10.86 ? 52  GLU B CB  1 
ATOM   5002  C  CG  . GLU C 1 52  ? 13.317  91.602  68.805  1.00 10.78 ? 52  GLU B CG  1 
ATOM   5003  C  CD  . GLU C 1 52  ? 14.022  90.608  69.725  1.00 10.48 ? 52  GLU B CD  1 
ATOM   5004  O  OE1 . GLU C 1 52  ? 15.270  90.553  69.728  1.00 10.20 ? 52  GLU B OE1 1 
ATOM   5005  O  OE2 . GLU C 1 52  ? 13.322  89.875  70.454  1.00 11.72 ? 52  GLU B OE2 1 
ATOM   5006  N  N   . ALA C 1 53  ? 13.597  91.381  64.921  1.00 10.58 ? 53  ALA B N   1 
ATOM   5007  C  CA  . ALA C 1 53  ? 12.654  90.760  63.998  1.00 11.07 ? 53  ALA B CA  1 
ATOM   5008  C  C   . ALA C 1 53  ? 13.328  89.592  63.274  1.00 11.55 ? 53  ALA B C   1 
ATOM   5009  O  O   . ALA C 1 53  ? 12.733  88.525  63.108  1.00 10.21 ? 53  ALA B O   1 
ATOM   5010  C  CB  . ALA C 1 53  ? 12.149  91.790  62.986  1.00 10.85 ? 53  ALA B CB  1 
ATOM   5011  N  N   . GLY C 1 54  ? 14.569  89.802  62.845  1.00 10.84 ? 54  GLY B N   1 
ATOM   5012  C  CA  . GLY C 1 54  ? 15.298  88.752  62.157  1.00 11.65 ? 54  GLY B CA  1 
ATOM   5013  C  C   . GLY C 1 54  ? 15.602  87.603  63.101  1.00 11.50 ? 54  GLY B C   1 
ATOM   5014  O  O   . GLY C 1 54  ? 15.545  86.436  62.710  1.00 12.08 ? 54  GLY B O   1 
ATOM   5015  N  N   . ALA C 1 55  ? 15.923  87.935  64.350  1.00 10.35 ? 55  ALA B N   1 
ATOM   5016  C  CA  . ALA C 1 55  ? 16.230  86.929  65.362  1.00 8.55  ? 55  ALA B CA  1 
ATOM   5017  C  C   . ALA C 1 55  ? 14.989  86.108  65.718  1.00 8.64  ? 55  ALA B C   1 
ATOM   5018  O  O   . ALA C 1 55  ? 15.083  84.908  65.966  1.00 8.39  ? 55  ALA B O   1 
ATOM   5019  C  CB  . ALA C 1 55  ? 16.785  87.601  66.613  1.00 9.46  ? 55  ALA B CB  1 
ATOM   5020  N  N   . ALA C 1 56  ? 13.831  86.761  65.754  1.00 7.92  ? 56  ALA B N   1 
ATOM   5021  C  CA  . ALA C 1 56  ? 12.583  86.069  66.074  1.00 8.30  ? 56  ALA B CA  1 
ATOM   5022  C  C   . ALA C 1 56  ? 12.303  85.012  65.008  1.00 8.02  ? 56  ALA B C   1 
ATOM   5023  O  O   . ALA C 1 56  ? 11.940  83.879  65.317  1.00 8.75  ? 56  ALA B O   1 
ATOM   5024  C  CB  . ALA C 1 56  ? 11.431  87.067  66.139  1.00 9.02  ? 56  ALA B CB  1 
ATOM   5025  N  N   . VAL C 1 57  ? 12.474  85.400  63.747  1.00 7.77  ? 57  VAL B N   1 
ATOM   5026  C  CA  . VAL C 1 57  ? 12.256  84.496  62.628  1.00 7.65  ? 57  VAL B CA  1 
ATOM   5027  C  C   . VAL C 1 57  ? 13.185  83.288  62.736  1.00 8.85  ? 57  VAL B C   1 
ATOM   5028  O  O   . VAL C 1 57  ? 12.745  82.147  62.614  1.00 10.10 ? 57  VAL B O   1 
ATOM   5029  C  CB  . VAL C 1 57  ? 12.497  85.222  61.284  1.00 8.62  ? 57  VAL B CB  1 
ATOM   5030  C  CG1 . VAL C 1 57  ? 12.552  84.215  60.140  1.00 6.57  ? 57  VAL B CG1 1 
ATOM   5031  C  CG2 . VAL C 1 57  ? 11.382  86.238  61.044  1.00 6.99  ? 57  VAL B CG2 1 
ATOM   5032  N  N   . ALA C 1 58  ? 14.467  83.544  62.980  1.00 8.33  ? 58  ALA B N   1 
ATOM   5033  C  CA  . ALA C 1 58  ? 15.456  82.479  63.112  1.00 8.12  ? 58  ALA B CA  1 
ATOM   5034  C  C   . ALA C 1 58  ? 15.139  81.546  64.284  1.00 9.04  ? 58  ALA B C   1 
ATOM   5035  O  O   . ALA C 1 58  ? 15.232  80.322  64.169  1.00 10.74 ? 58  ALA B O   1 
ATOM   5036  C  CB  . ALA C 1 58  ? 16.842  83.084  63.298  1.00 7.79  ? 58  ALA B CB  1 
ATOM   5037  N  N   . ALA C 1 59  ? 14.752  82.133  65.407  1.00 9.26  ? 59  ALA B N   1 
ATOM   5038  C  CA  . ALA C 1 59  ? 14.448  81.367  66.608  1.00 9.30  ? 59  ALA B CA  1 
ATOM   5039  C  C   . ALA C 1 59  ? 13.241  80.443  66.493  1.00 8.93  ? 59  ALA B C   1 
ATOM   5040  O  O   . ALA C 1 59  ? 13.350  79.237  66.709  1.00 7.75  ? 59  ALA B O   1 
ATOM   5041  C  CB  . ALA C 1 59  ? 14.250  82.316  67.780  1.00 9.90  ? 59  ALA B CB  1 
ATOM   5042  N  N   . GLU C 1 60  ? 12.093  81.015  66.154  1.00 9.22  ? 60  GLU B N   1 
ATOM   5043  C  CA  . GLU C 1 60  ? 10.856  80.249  66.056  1.00 9.94  ? 60  GLU B CA  1 
ATOM   5044  C  C   . GLU C 1 60  ? 10.755  79.325  64.841  1.00 9.19  ? 60  GLU B C   1 
ATOM   5045  O  O   . GLU C 1 60  ? 9.738   78.663  64.646  1.00 10.89 ? 60  GLU B O   1 
ATOM   5046  C  CB  . GLU C 1 60  ? 9.660   81.205  66.101  1.00 9.76  ? 60  GLU B CB  1 
ATOM   5047  C  CG  . GLU C 1 60  ? 9.517   81.967  67.423  1.00 9.57  ? 60  GLU B CG  1 
ATOM   5048  C  CD  . GLU C 1 60  ? 8.709   81.215  68.482  1.00 12.41 ? 60  GLU B CD  1 
ATOM   5049  O  OE1 . GLU C 1 60  ? 8.135   80.148  68.170  1.00 11.23 ? 60  GLU B OE1 1 
ATOM   5050  O  OE2 . GLU C 1 60  ? 8.637   81.701  69.634  1.00 11.63 ? 60  GLU B OE2 1 
ATOM   5051  N  N   . SER C 1 61  ? 11.799  79.280  64.020  1.00 9.80  ? 61  SER B N   1 
ATOM   5052  C  CA  . SER C 1 61  ? 11.795  78.391  62.860  1.00 8.70  ? 61  SER B CA  1 
ATOM   5053  C  C   . SER C 1 61  ? 12.892  77.347  63.037  1.00 10.22 ? 61  SER B C   1 
ATOM   5054  O  O   . SER C 1 61  ? 13.209  76.595  62.110  1.00 10.34 ? 61  SER B O   1 
ATOM   5055  C  CB  . SER C 1 61  ? 12.025  79.173  61.561  1.00 8.75  ? 61  SER B CB  1 
ATOM   5056  O  OG  . SER C 1 61  ? 13.297  79.796  61.547  1.00 9.51  ? 61  SER B OG  1 
ATOM   5057  N  N   . SER C 1 62  ? 13.471  77.299  64.234  1.00 7.54  ? 62  SER B N   1 
ATOM   5058  C  CA  . SER C 1 62  ? 14.525  76.331  64.500  1.00 7.98  ? 62  SER B CA  1 
ATOM   5059  C  C   . SER C 1 62  ? 14.453  75.668  65.872  1.00 8.59  ? 62  SER B C   1 
ATOM   5060  O  O   . SER C 1 62  ? 14.024  74.518  65.983  1.00 10.56 ? 62  SER B O   1 
ATOM   5061  C  CB  . SER C 1 62  ? 15.910  76.974  64.308  1.00 6.01  ? 62  SER B CB  1 
ATOM   5062  O  OG  . SER C 1 62  ? 16.130  78.049  65.206  1.00 6.50  ? 62  SER B OG  1 
ATOM   5063  N  N   . THR C 1 63  ? 14.836  76.396  66.918  1.00 8.06  ? 63  THR B N   1 
ATOM   5064  C  CA  . THR C 1 63  ? 14.868  75.821  68.262  1.00 8.30  ? 63  THR B CA  1 
ATOM   5065  C  C   . THR C 1 63  ? 14.205  76.575  69.415  1.00 8.42  ? 63  THR B C   1 
ATOM   5066  O  O   . THR C 1 63  ? 13.946  75.988  70.463  1.00 10.53 ? 63  THR B O   1 
ATOM   5067  C  CB  . THR C 1 63  ? 16.327  75.590  68.699  1.00 7.61  ? 63  THR B CB  1 
ATOM   5068  O  OG1 . THR C 1 63  ? 17.046  76.828  68.593  1.00 9.87  ? 63  THR B OG1 1 
ATOM   5069  C  CG2 . THR C 1 63  ? 17.001  74.534  67.828  1.00 5.61  ? 63  THR B CG2 1 
ATOM   5070  N  N   . GLY C 1 64  ? 13.932  77.862  69.250  1.00 9.06  ? 64  GLY B N   1 
ATOM   5071  C  CA  . GLY C 1 64  ? 13.376  78.598  70.368  1.00 6.26  ? 64  GLY B CA  1 
ATOM   5072  C  C   . GLY C 1 64  ? 11.891  78.875  70.443  1.00 7.73  ? 64  GLY B C   1 
ATOM   5073  O  O   . GLY C 1 64  ? 11.121  78.596  69.518  1.00 6.95  ? 64  GLY B O   1 
ATOM   5074  N  N   . THR C 1 65  ? 11.494  79.416  71.591  1.00 6.56  ? 65  THR B N   1 
ATOM   5075  C  CA  . THR C 1 65  ? 10.120  79.809  71.825  1.00 8.51  ? 65  THR B CA  1 
ATOM   5076  C  C   . THR C 1 65  ? 10.134  81.168  72.534  1.00 8.32  ? 65  THR B C   1 
ATOM   5077  O  O   . THR C 1 65  ? 11.197  81.764  72.704  1.00 7.70  ? 65  THR B O   1 
ATOM   5078  C  CB  . THR C 1 65  ? 9.335   78.750  72.636  1.00 9.08  ? 65  THR B CB  1 
ATOM   5079  O  OG1 . THR C 1 65  ? 7.962   79.149  72.708  1.00 10.66 ? 65  THR B OG1 1 
ATOM   5080  C  CG2 . THR C 1 65  ? 9.897   78.593  74.034  1.00 8.68  ? 65  THR B CG2 1 
ATOM   5081  N  N   . TRP C 1 66  ? 8.963   81.645  72.946  1.00 9.96  ? 66  TRP B N   1 
ATOM   5082  C  CA  . TRP C 1 66  ? 8.809   82.966  73.559  1.00 9.50  ? 66  TRP B CA  1 
ATOM   5083  C  C   . TRP C 1 66  ? 9.373   83.242  74.952  1.00 10.63 ? 66  TRP B C   1 
ATOM   5084  O  O   . TRP C 1 66  ? 9.459   84.403  75.360  1.00 10.31 ? 66  TRP B O   1 
ATOM   5085  C  CB  . TRP C 1 66  ? 7.328   83.354  73.551  1.00 10.11 ? 66  TRP B CB  1 
ATOM   5086  C  CG  . TRP C 1 66  ? 6.505   82.549  74.496  1.00 9.75  ? 66  TRP B CG  1 
ATOM   5087  C  CD1 . TRP C 1 66  ? 6.024   81.286  74.301  1.00 10.67 ? 66  TRP B CD1 1 
ATOM   5088  C  CD2 . TRP C 1 66  ? 6.120   82.927  75.820  1.00 9.12  ? 66  TRP B CD2 1 
ATOM   5089  N  NE1 . TRP C 1 66  ? 5.361   80.854  75.426  1.00 11.02 ? 66  TRP B NE1 1 
ATOM   5090  C  CE2 . TRP C 1 66  ? 5.403   81.844  76.373  1.00 9.50  ? 66  TRP B CE2 1 
ATOM   5091  C  CE3 . TRP C 1 66  ? 6.305   84.084  76.593  1.00 8.57  ? 66  TRP B CE3 1 
ATOM   5092  C  CZ2 . TRP C 1 66  ? 4.881   81.874  77.670  1.00 10.00 ? 66  TRP B CZ2 1 
ATOM   5093  C  CZ3 . TRP C 1 66  ? 5.785   84.117  77.881  1.00 8.88  ? 66  TRP B CZ3 1 
ATOM   5094  C  CH2 . TRP C 1 66  ? 5.076   83.018  78.406  1.00 10.20 ? 66  TRP B CH2 1 
ATOM   5095  N  N   . THR C 1 67  ? 9.744   82.200  75.687  1.00 11.07 ? 67  THR B N   1 
ATOM   5096  C  CA  . THR C 1 67  ? 10.296  82.389  77.026  1.00 10.28 ? 67  THR B CA  1 
ATOM   5097  C  C   . THR C 1 67  ? 11.410  81.363  77.245  1.00 10.98 ? 67  THR B C   1 
ATOM   5098  O  O   . THR C 1 67  ? 11.503  80.382  76.509  1.00 11.35 ? 67  THR B O   1 
ATOM   5099  C  CB  . THR C 1 67  ? 9.176   82.260  78.110  1.00 10.90 ? 67  THR B CB  1 
ATOM   5100  O  OG1 . THR C 1 67  ? 9.688   82.644  79.393  1.00 9.32  ? 67  THR B OG1 1 
ATOM   5101  C  CG2 . THR C 1 67  ? 8.639   80.836  78.171  1.00 8.11  ? 67  THR B CG2 1 
ATOM   5102  N  N   . THR C 1 68  ? 12.261  81.594  78.239  1.00 11.46 ? 68  THR B N   1 
ATOM   5103  C  CA  . THR C 1 68  ? 13.374  80.685  78.511  1.00 10.18 ? 68  THR B CA  1 
ATOM   5104  C  C   . THR C 1 68  ? 12.925  79.347  79.087  1.00 10.47 ? 68  THR B C   1 
ATOM   5105  O  O   . THR C 1 68  ? 12.130  79.302  80.027  1.00 11.70 ? 68  THR B O   1 
ATOM   5106  C  CB  . THR C 1 68  ? 14.386  81.326  79.488  1.00 9.70  ? 68  THR B CB  1 
ATOM   5107  O  OG1 . THR C 1 68  ? 14.808  82.593  78.971  1.00 12.79 ? 68  THR B OG1 1 
ATOM   5108  C  CG2 . THR C 1 68  ? 15.613  80.436  79.653  1.00 11.34 ? 68  THR B CG2 1 
ATOM   5109  N  N   . VAL C 1 69  ? 13.434  78.260  78.515  1.00 10.12 ? 69  VAL B N   1 
ATOM   5110  C  CA  . VAL C 1 69  ? 13.106  76.915  78.987  1.00 10.95 ? 69  VAL B CA  1 
ATOM   5111  C  C   . VAL C 1 69  ? 14.385  76.246  79.501  1.00 11.18 ? 69  VAL B C   1 
ATOM   5112  O  O   . VAL C 1 69  ? 15.450  76.381  78.894  1.00 9.58  ? 69  VAL B O   1 
ATOM   5113  C  CB  . VAL C 1 69  ? 12.466  76.056  77.857  1.00 12.57 ? 69  VAL B CB  1 
ATOM   5114  C  CG1 . VAL C 1 69  ? 11.178  76.725  77.369  1.00 10.57 ? 69  VAL B CG1 1 
ATOM   5115  C  CG2 . VAL C 1 69  ? 13.445  75.876  76.697  1.00 11.00 ? 69  VAL B CG2 1 
ATOM   5116  N  N   . TRP C 1 70  ? 14.286  75.538  80.624  1.00 10.72 ? 70  TRP B N   1 
ATOM   5117  C  CA  . TRP C 1 70  ? 15.457  74.886  81.213  1.00 9.76  ? 70  TRP B CA  1 
ATOM   5118  C  C   . TRP C 1 70  ? 16.050  73.763  80.366  1.00 10.92 ? 70  TRP B C   1 
ATOM   5119  O  O   . TRP C 1 70  ? 17.252  73.493  80.430  1.00 9.72  ? 70  TRP B O   1 
ATOM   5120  C  CB  . TRP C 1 70  ? 15.124  74.332  82.604  1.00 9.52  ? 70  TRP B CB  1 
ATOM   5121  C  CG  . TRP C 1 70  ? 14.111  73.220  82.607  1.00 8.62  ? 70  TRP B CG  1 
ATOM   5122  C  CD1 . TRP C 1 70  ? 12.758  73.344  82.730  1.00 8.81  ? 70  TRP B CD1 1 
ATOM   5123  C  CD2 . TRP C 1 70  ? 14.374  71.814  82.487  1.00 8.18  ? 70  TRP B CD2 1 
ATOM   5124  N  NE1 . TRP C 1 70  ? 12.160  72.106  82.697  1.00 9.71  ? 70  TRP B NE1 1 
ATOM   5125  C  CE2 . TRP C 1 70  ? 13.131  71.149  82.545  1.00 9.03  ? 70  TRP B CE2 1 
ATOM   5126  C  CE3 . TRP C 1 70  ? 15.543  71.055  82.331  1.00 10.18 ? 70  TRP B CE3 1 
ATOM   5127  C  CZ2 . TRP C 1 70  ? 13.018  69.756  82.460  1.00 10.02 ? 70  TRP B CZ2 1 
ATOM   5128  C  CZ3 . TRP C 1 70  ? 15.431  69.666  82.246  1.00 10.94 ? 70  TRP B CZ3 1 
ATOM   5129  C  CH2 . TRP C 1 70  ? 14.175  69.033  82.309  1.00 10.64 ? 70  TRP B CH2 1 
ATOM   5130  N  N   . THR C 1 71  ? 15.209  73.105  79.579  1.00 10.78 ? 71  THR B N   1 
ATOM   5131  C  CA  . THR C 1 71  ? 15.660  72.002  78.739  1.00 11.31 ? 71  THR B CA  1 
ATOM   5132  C  C   . THR C 1 71  ? 16.748  72.355  77.720  1.00 11.52 ? 71  THR B C   1 
ATOM   5133  O  O   . THR C 1 71  ? 17.393  71.458  77.172  1.00 10.95 ? 71  THR B O   1 
ATOM   5134  C  CB  . THR C 1 71  ? 14.472  71.364  78.001  1.00 10.48 ? 71  THR B CB  1 
ATOM   5135  O  OG1 . THR C 1 71  ? 13.649  72.396  77.447  1.00 9.00  ? 71  THR B OG1 1 
ATOM   5136  C  CG2 . THR C 1 71  ? 13.649  70.513  78.957  1.00 10.77 ? 71  THR B CG2 1 
ATOM   5137  N  N   . ASP C 1 72  ? 16.953  73.645  77.456  1.00 11.94 ? 72  ASP B N   1 
ATOM   5138  C  CA  . ASP C 1 72  ? 17.998  74.051  76.516  1.00 13.26 ? 72  ASP B CA  1 
ATOM   5139  C  C   . ASP C 1 72  ? 19.344  73.544  77.032  1.00 14.28 ? 72  ASP B C   1 
ATOM   5140  O  O   . ASP C 1 72  ? 20.243  73.226  76.250  1.00 14.78 ? 72  ASP B O   1 
ATOM   5141  C  CB  . ASP C 1 72  ? 18.071  75.582  76.388  1.00 13.40 ? 72  ASP B CB  1 
ATOM   5142  C  CG  . ASP C 1 72  ? 17.021  76.158  75.443  1.00 15.30 ? 72  ASP B CG  1 
ATOM   5143  O  OD1 . ASP C 1 72  ? 16.216  75.394  74.867  1.00 14.18 ? 72  ASP B OD1 1 
ATOM   5144  O  OD2 . ASP C 1 72  ? 17.007  77.395  75.277  1.00 14.90 ? 72  ASP B OD2 1 
ATOM   5145  N  N   . GLY C 1 73  ? 19.469  73.474  78.355  1.00 12.47 ? 73  GLY B N   1 
ATOM   5146  C  CA  . GLY C 1 73  ? 20.708  73.033  78.970  1.00 12.74 ? 73  GLY B CA  1 
ATOM   5147  C  C   . GLY C 1 73  ? 21.029  71.560  78.827  1.00 13.27 ? 73  GLY B C   1 
ATOM   5148  O  O   . GLY C 1 73  ? 22.146  71.144  79.121  1.00 12.65 ? 73  GLY B O   1 
ATOM   5149  N  N   . LEU C 1 74  ? 20.059  70.764  78.385  1.00 13.83 ? 74  LEU B N   1 
ATOM   5150  C  CA  . LEU C 1 74  ? 20.282  69.333  78.212  1.00 14.64 ? 74  LEU B CA  1 
ATOM   5151  C  C   . LEU C 1 74  ? 21.001  69.044  76.898  1.00 15.12 ? 74  LEU B C   1 
ATOM   5152  O  O   . LEU C 1 74  ? 21.562  67.965  76.713  1.00 15.39 ? 74  LEU B O   1 
ATOM   5153  C  CB  . LEU C 1 74  ? 18.950  68.575  78.232  1.00 14.39 ? 74  LEU B CB  1 
ATOM   5154  C  CG  . LEU C 1 74  ? 18.131  68.593  79.526  1.00 15.71 ? 74  LEU B CG  1 
ATOM   5155  C  CD1 . LEU C 1 74  ? 16.868  67.750  79.337  1.00 14.33 ? 74  LEU B CD1 1 
ATOM   5156  C  CD2 . LEU C 1 74  ? 18.967  68.054  80.677  1.00 16.46 ? 74  LEU B CD2 1 
ATOM   5157  N  N   . THR C 1 75  ? 20.978  70.014  75.989  1.00 14.76 ? 75  THR B N   1 
ATOM   5158  C  CA  . THR C 1 75  ? 21.608  69.852  74.684  1.00 14.24 ? 75  THR B CA  1 
ATOM   5159  C  C   . THR C 1 75  ? 22.573  71.007  74.414  1.00 15.00 ? 75  THR B C   1 
ATOM   5160  O  O   . THR C 1 75  ? 22.805  71.845  75.283  1.00 16.11 ? 75  THR B O   1 
ATOM   5161  C  CB  . THR C 1 75  ? 20.519  69.782  73.573  1.00 14.25 ? 75  THR B CB  1 
ATOM   5162  O  OG1 . THR C 1 75  ? 21.122  69.475  72.310  1.00 12.06 ? 75  THR B OG1 1 
ATOM   5163  C  CG2 . THR C 1 75  ? 19.775  71.106  73.469  1.00 12.88 ? 75  THR B CG2 1 
ATOM   5164  N  N   . ASN C 1 76  ? 23.145  71.040  73.215  1.00 14.88 ? 76  ASN B N   1 
ATOM   5165  C  CA  . ASN C 1 76  ? 24.081  72.096  72.834  1.00 15.26 ? 76  ASN B CA  1 
ATOM   5166  C  C   . ASN C 1 76  ? 23.388  72.976  71.800  1.00 15.41 ? 76  ASN B C   1 
ATOM   5167  O  O   . ASN C 1 76  ? 23.455  72.709  70.601  1.00 13.96 ? 76  ASN B O   1 
ATOM   5168  C  CB  . ASN C 1 76  ? 25.344  71.484  72.225  1.00 16.64 ? 76  ASN B CB  1 
ATOM   5169  C  CG  . ASN C 1 76  ? 26.410  72.521  71.923  1.00 18.84 ? 76  ASN B CG  1 
ATOM   5170  O  OD1 . ASN C 1 76  ? 26.122  73.714  71.817  1.00 20.61 ? 76  ASN B OD1 1 
ATOM   5171  N  ND2 . ASN C 1 76  ? 27.650  72.068  71.772  1.00 21.01 ? 76  ASN B ND2 1 
ATOM   5172  N  N   . LEU C 1 77  ? 22.731  74.032  72.265  1.00 16.51 ? 77  LEU B N   1 
ATOM   5173  C  CA  . LEU C 1 77  ? 21.998  74.916  71.369  1.00 18.40 ? 77  LEU B CA  1 
ATOM   5174  C  C   . LEU C 1 77  ? 22.847  75.616  70.308  1.00 19.47 ? 77  LEU B C   1 
ATOM   5175  O  O   . LEU C 1 77  ? 22.355  75.909  69.220  1.00 20.05 ? 77  LEU B O   1 
ATOM   5176  C  CB  . LEU C 1 77  ? 21.220  75.955  72.183  1.00 20.20 ? 77  LEU B CB  1 
ATOM   5177  C  CG  . LEU C 1 77  ? 19.805  76.240  71.671  1.00 23.04 ? 77  LEU B CG  1 
ATOM   5178  C  CD1 . LEU C 1 77  ? 18.948  74.989  71.819  1.00 23.20 ? 77  LEU B CD1 1 
ATOM   5179  C  CD2 . LEU C 1 77  ? 19.197  77.392  72.451  1.00 24.25 ? 77  LEU B CD2 1 
ATOM   5180  N  N   . ASP C 1 78  ? 24.114  75.884  70.607  1.00 19.40 ? 78  ASP B N   1 
ATOM   5181  C  CA  . ASP C 1 78  ? 24.981  76.556  69.639  1.00 21.36 ? 78  ASP B CA  1 
ATOM   5182  C  C   . ASP C 1 78  ? 25.122  75.735  68.366  1.00 20.04 ? 78  ASP B C   1 
ATOM   5183  O  O   . ASP C 1 78  ? 25.318  76.268  67.277  1.00 21.11 ? 78  ASP B O   1 
ATOM   5184  C  CB  . ASP C 1 78  ? 26.371  76.797  70.234  1.00 24.47 ? 78  ASP B CB  1 
ATOM   5185  C  CG  . ASP C 1 78  ? 26.362  77.845  71.325  1.00 27.72 ? 78  ASP B CG  1 
ATOM   5186  O  OD1 . ASP C 1 78  ? 25.856  78.954  71.071  1.00 29.89 ? 78  ASP B OD1 1 
ATOM   5187  O  OD2 . ASP C 1 78  ? 26.862  77.564  72.434  1.00 32.55 ? 78  ASP B OD2 1 
ATOM   5188  N  N   . ARG C 1 79  ? 24.997  74.430  68.532  1.00 18.52 ? 79  ARG B N   1 
ATOM   5189  C  CA  . ARG C 1 79  ? 25.128  73.452  67.463  1.00 19.48 ? 79  ARG B CA  1 
ATOM   5190  C  C   . ARG C 1 79  ? 23.843  73.241  66.652  1.00 17.38 ? 79  ARG B C   1 
ATOM   5191  O  O   . ARG C 1 79  ? 23.889  72.772  65.511  1.00 17.48 ? 79  ARG B O   1 
ATOM   5192  C  CB  . ARG C 1 79  ? 25.574  72.157  68.132  1.00 22.00 ? 79  ARG B CB  1 
ATOM   5193  C  CG  . ARG C 1 79  ? 25.720  70.906  67.314  1.00 27.52 ? 79  ARG B CG  1 
ATOM   5194  C  CD  . ARG C 1 79  ? 25.617  69.791  68.340  1.00 33.02 ? 79  ARG B CD  1 
ATOM   5195  N  NE  . ARG C 1 79  ? 26.108  68.481  67.943  1.00 36.27 ? 79  ARG B NE  1 
ATOM   5196  C  CZ  . ARG C 1 79  ? 25.904  67.389  68.674  1.00 39.75 ? 79  ARG B CZ  1 
ATOM   5197  N  NH1 . ARG C 1 79  ? 25.220  67.480  69.810  1.00 41.33 ? 79  ARG B NH1 1 
ATOM   5198  N  NH2 . ARG C 1 79  ? 26.384  66.215  68.290  1.00 41.41 ? 79  ARG B NH2 1 
ATOM   5199  N  N   . TYR C 1 80  ? 22.704  73.614  67.233  1.00 13.95 ? 80  TYR B N   1 
ATOM   5200  C  CA  . TYR C 1 80  ? 21.413  73.412  66.580  1.00 12.12 ? 80  TYR B CA  1 
ATOM   5201  C  C   . TYR C 1 80  ? 20.619  74.653  66.182  1.00 12.36 ? 80  TYR B C   1 
ATOM   5202  O  O   . TYR C 1 80  ? 19.811  74.597  65.258  1.00 11.30 ? 80  TYR B O   1 
ATOM   5203  C  CB  . TYR C 1 80  ? 20.522  72.549  67.483  1.00 10.35 ? 80  TYR B CB  1 
ATOM   5204  C  CG  . TYR C 1 80  ? 21.032  71.143  67.685  1.00 11.48 ? 80  TYR B CG  1 
ATOM   5205  C  CD1 . TYR C 1 80  ? 21.095  70.250  66.618  1.00 10.28 ? 80  TYR B CD1 1 
ATOM   5206  C  CD2 . TYR C 1 80  ? 21.470  70.708  68.937  1.00 10.94 ? 80  TYR B CD2 1 
ATOM   5207  C  CE1 . TYR C 1 80  ? 21.581  68.959  66.787  1.00 11.40 ? 80  TYR B CE1 1 
ATOM   5208  C  CE2 . TYR C 1 80  ? 21.960  69.416  69.118  1.00 10.53 ? 80  TYR B CE2 1 
ATOM   5209  C  CZ  . TYR C 1 80  ? 22.012  68.547  68.035  1.00 10.93 ? 80  TYR B CZ  1 
ATOM   5210  O  OH  . TYR C 1 80  ? 22.490  67.266  68.187  1.00 11.12 ? 80  TYR B OH  1 
ATOM   5211  N  N   . LYS C 1 81  ? 20.842  75.768  66.868  1.00 10.53 ? 81  LYS B N   1 
ATOM   5212  C  CA  . LYS C 1 81  ? 20.076  76.978  66.591  1.00 12.56 ? 81  LYS B CA  1 
ATOM   5213  C  C   . LYS C 1 81  ? 20.185  77.587  65.194  1.00 13.70 ? 81  LYS B C   1 
ATOM   5214  O  O   . LYS C 1 81  ? 21.233  77.527  64.546  1.00 13.92 ? 81  LYS B O   1 
ATOM   5215  C  CB  . LYS C 1 81  ? 20.408  78.055  67.633  1.00 12.28 ? 81  LYS B CB  1 
ATOM   5216  C  CG  . LYS C 1 81  ? 21.809  78.658  67.512  1.00 13.17 ? 81  LYS B CG  1 
ATOM   5217  C  CD  . LYS C 1 81  ? 22.041  79.707  68.592  1.00 13.05 ? 81  LYS B CD  1 
ATOM   5218  C  CE  . LYS C 1 81  ? 23.408  80.369  68.456  1.00 13.52 ? 81  LYS B CE  1 
ATOM   5219  N  NZ  . LYS C 1 81  ? 23.667  81.320  69.579  1.00 12.59 ? 81  LYS B NZ  1 
ATOM   5220  N  N   . GLY C 1 82  ? 19.073  78.160  64.735  1.00 13.35 ? 82  GLY B N   1 
ATOM   5221  C  CA  . GLY C 1 82  ? 19.057  78.837  63.452  1.00 13.18 ? 82  GLY B CA  1 
ATOM   5222  C  C   . GLY C 1 82  ? 19.664  80.185  63.797  1.00 14.61 ? 82  GLY B C   1 
ATOM   5223  O  O   . GLY C 1 82  ? 19.515  80.642  64.930  1.00 14.55 ? 82  GLY B O   1 
ATOM   5224  N  N   . ARG C 1 83  ? 20.338  80.832  62.856  1.00 14.26 ? 83  ARG B N   1 
ATOM   5225  C  CA  . ARG C 1 83  ? 20.975  82.108  63.166  1.00 14.01 ? 83  ARG B CA  1 
ATOM   5226  C  C   . ARG C 1 83  ? 20.780  83.179  62.114  1.00 13.10 ? 83  ARG B C   1 
ATOM   5227  O  O   . ARG C 1 83  ? 20.955  82.917  60.927  1.00 12.44 ? 83  ARG B O   1 
ATOM   5228  C  CB  . ARG C 1 83  ? 22.482  81.922  63.307  1.00 15.22 ? 83  ARG B CB  1 
ATOM   5229  C  CG  . ARG C 1 83  ? 22.936  80.693  64.044  1.00 18.24 ? 83  ARG B CG  1 
ATOM   5230  C  CD  . ARG C 1 83  ? 24.304  80.320  63.521  1.00 18.29 ? 83  ARG B CD  1 
ATOM   5231  N  NE  . ARG C 1 83  ? 25.228  79.925  64.573  1.00 22.36 ? 83  ARG B NE  1 
ATOM   5232  C  CZ  . ARG C 1 83  ? 25.168  78.781  65.243  1.00 23.94 ? 83  ARG B CZ  1 
ATOM   5233  N  NH1 . ARG C 1 83  ? 24.214  77.891  64.975  1.00 23.33 ? 83  ARG B NH1 1 
ATOM   5234  N  NH2 . ARG C 1 83  ? 26.075  78.526  66.178  1.00 25.06 ? 83  ARG B NH2 1 
ATOM   5235  N  N   . CYS C 1 84  ? 20.431  84.386  62.549  1.00 11.57 ? 84  CYS B N   1 
ATOM   5236  C  CA  . CYS C 1 84  ? 20.302  85.499  61.621  1.00 11.81 ? 84  CYS B CA  1 
ATOM   5237  C  C   . CYS C 1 84  ? 21.713  86.078  61.634  1.00 11.74 ? 84  CYS B C   1 
ATOM   5238  O  O   . CYS C 1 84  ? 22.144  86.657  62.635  1.00 12.09 ? 84  CYS B O   1 
ATOM   5239  C  CB  . CYS C 1 84  ? 19.305  86.546  62.121  1.00 11.05 ? 84  CYS B CB  1 
ATOM   5240  S  SG  . CYS C 1 84  ? 19.130  87.936  60.972  1.00 14.42 ? 84  CYS B SG  1 
ATOM   5241  N  N   . TYR C 1 85  ? 22.432  85.912  60.529  1.00 10.59 ? 85  TYR B N   1 
ATOM   5242  C  CA  . TYR C 1 85  ? 23.813  86.378  60.457  1.00 11.49 ? 85  TYR B CA  1 
ATOM   5243  C  C   . TYR C 1 85  ? 24.057  87.637  59.627  1.00 11.54 ? 85  TYR B C   1 
ATOM   5244  O  O   . TYR C 1 85  ? 25.174  88.160  59.608  1.00 11.92 ? 85  TYR B O   1 
ATOM   5245  C  CB  . TYR C 1 85  ? 24.700  85.231  59.955  1.00 10.21 ? 85  TYR B CB  1 
ATOM   5246  C  CG  . TYR C 1 85  ? 24.377  84.763  58.551  1.00 10.90 ? 85  TYR B CG  1 
ATOM   5247  C  CD1 . TYR C 1 85  ? 24.965  85.370  57.443  1.00 12.56 ? 85  TYR B CD1 1 
ATOM   5248  C  CD2 . TYR C 1 85  ? 23.472  83.722  58.328  1.00 11.51 ? 85  TYR B CD2 1 
ATOM   5249  C  CE1 . TYR C 1 85  ? 24.663  84.954  56.145  1.00 12.36 ? 85  TYR B CE1 1 
ATOM   5250  C  CE2 . TYR C 1 85  ? 23.160  83.298  57.032  1.00 9.88  ? 85  TYR B CE2 1 
ATOM   5251  C  CZ  . TYR C 1 85  ? 23.761  83.918  55.949  1.00 12.84 ? 85  TYR B CZ  1 
ATOM   5252  O  OH  . TYR C 1 85  ? 23.478  83.498  54.671  1.00 13.30 ? 85  TYR B OH  1 
ATOM   5253  N  N   . HIS C 1 86  ? 23.027  88.127  58.946  1.00 11.59 ? 86  HIS B N   1 
ATOM   5254  C  CA  . HIS C 1 86  ? 23.176  89.331  58.139  1.00 12.65 ? 86  HIS B CA  1 
ATOM   5255  C  C   . HIS C 1 86  ? 21.855  90.040  57.861  1.00 11.34 ? 86  HIS B C   1 
ATOM   5256  O  O   . HIS C 1 86  ? 20.829  89.408  57.609  1.00 10.19 ? 86  HIS B O   1 
ATOM   5257  C  CB  . HIS C 1 86  ? 23.867  89.006  56.813  1.00 15.80 ? 86  HIS B CB  1 
ATOM   5258  C  CG  . HIS C 1 86  ? 24.262  90.223  56.032  1.00 21.06 ? 86  HIS B CG  1 
ATOM   5259  N  ND1 . HIS C 1 86  ? 23.675  90.560  54.831  1.00 22.76 ? 86  HIS B ND1 1 
ATOM   5260  C  CD2 . HIS C 1 86  ? 25.154  91.202  56.304  1.00 21.29 ? 86  HIS B CD2 1 
ATOM   5261  C  CE1 . HIS C 1 86  ? 24.190  91.697  54.398  1.00 23.47 ? 86  HIS B CE1 1 
ATOM   5262  N  NE2 . HIS C 1 86  ? 25.089  92.109  55.273  1.00 24.37 ? 86  HIS B NE2 1 
ATOM   5263  N  N   . ILE C 1 87  ? 21.891  91.365  57.920  1.00 12.35 ? 87  ILE B N   1 
ATOM   5264  C  CA  . ILE C 1 87  ? 20.707  92.173  57.666  1.00 12.51 ? 87  ILE B CA  1 
ATOM   5265  C  C   . ILE C 1 87  ? 21.058  93.272  56.680  1.00 14.22 ? 87  ILE B C   1 
ATOM   5266  O  O   . ILE C 1 87  ? 22.095  93.923  56.792  1.00 14.82 ? 87  ILE B O   1 
ATOM   5267  C  CB  . ILE C 1 87  ? 20.157  92.785  58.959  1.00 11.94 ? 87  ILE B CB  1 
ATOM   5268  C  CG1 . ILE C 1 87  ? 19.768  91.665  59.927  1.00 12.17 ? 87  ILE B CG1 1 
ATOM   5269  C  CG2 . ILE C 1 87  ? 18.946  93.643  58.647  1.00 11.63 ? 87  ILE B CG2 1 
ATOM   5270  C  CD1 . ILE C 1 87  ? 19.262  92.148  61.265  1.00 13.18 ? 87  ILE B CD1 1 
ATOM   5271  N  N   . GLU C 1 88  ? 20.171  93.473  55.718  1.00 15.94 ? 88  GLU B N   1 
ATOM   5272  C  CA  . GLU C 1 88  ? 20.372  94.445  54.659  1.00 16.82 ? 88  GLU B CA  1 
ATOM   5273  C  C   . GLU C 1 88  ? 19.074  95.215  54.400  1.00 16.21 ? 88  GLU B C   1 
ATOM   5274  O  O   . GLU C 1 88  ? 18.010  94.611  54.251  1.00 13.37 ? 88  GLU B O   1 
ATOM   5275  C  CB  . GLU C 1 88  ? 20.795  93.663  53.417  1.00 20.14 ? 88  GLU B CB  1 
ATOM   5276  C  CG  . GLU C 1 88  ? 20.892  94.409  52.120  1.00 24.71 ? 88  GLU B CG  1 
ATOM   5277  C  CD  . GLU C 1 88  ? 20.961  93.443  50.958  1.00 26.88 ? 88  GLU B CD  1 
ATOM   5278  O  OE1 . GLU C 1 88  ? 21.458  92.315  51.163  1.00 29.50 ? 88  GLU B OE1 1 
ATOM   5279  O  OE2 . GLU C 1 88  ? 20.526  93.803  49.846  1.00 30.15 ? 88  GLU B OE2 1 
ATOM   5280  N  N   . PRO C 1 89  ? 19.143  96.559  54.354  1.00 14.58 ? 89  PRO B N   1 
ATOM   5281  C  CA  . PRO C 1 89  ? 17.945  97.367  54.104  1.00 14.79 ? 89  PRO B CA  1 
ATOM   5282  C  C   . PRO C 1 89  ? 17.546  97.214  52.642  1.00 13.99 ? 89  PRO B C   1 
ATOM   5283  O  O   . PRO C 1 89  ? 18.412  97.115  51.774  1.00 14.31 ? 89  PRO B O   1 
ATOM   5284  C  CB  . PRO C 1 89  ? 18.410  98.800  54.399  1.00 16.11 ? 89  PRO B CB  1 
ATOM   5285  C  CG  . PRO C 1 89  ? 19.694  98.631  55.168  1.00 15.50 ? 89  PRO B CG  1 
ATOM   5286  C  CD  . PRO C 1 89  ? 20.316  97.425  54.557  1.00 16.57 ? 89  PRO B CD  1 
ATOM   5287  N  N   . VAL C 1 90  ? 16.245  97.195  52.370  1.00 14.53 ? 90  VAL B N   1 
ATOM   5288  C  CA  . VAL C 1 90  ? 15.756  97.075  51.002  1.00 14.23 ? 90  VAL B CA  1 
ATOM   5289  C  C   . VAL C 1 90  ? 15.554  98.475  50.433  1.00 15.53 ? 90  VAL B C   1 
ATOM   5290  O  O   . VAL C 1 90  ? 14.841  99.292  51.011  1.00 15.46 ? 90  VAL B O   1 
ATOM   5291  C  CB  . VAL C 1 90  ? 14.413  96.316  50.942  1.00 14.11 ? 90  VAL B CB  1 
ATOM   5292  C  CG1 . VAL C 1 90  ? 13.877  96.311  49.516  1.00 13.90 ? 90  VAL B CG1 1 
ATOM   5293  C  CG2 . VAL C 1 90  ? 14.603  94.889  51.436  1.00 12.21 ? 90  VAL B CG2 1 
ATOM   5294  N  N   . ALA C 1 91  ? 16.192  98.753  49.303  1.00 15.34 ? 91  ALA B N   1 
ATOM   5295  C  CA  . ALA C 1 91  ? 16.070  100.058 48.672  1.00 15.79 ? 91  ALA B CA  1 
ATOM   5296  C  C   . ALA C 1 91  ? 14.733  100.162 47.946  1.00 16.98 ? 91  ALA B C   1 
ATOM   5297  O  O   . ALA C 1 91  ? 14.297  99.215  47.295  1.00 15.09 ? 91  ALA B O   1 
ATOM   5298  C  CB  . ALA C 1 91  ? 17.219  100.270 47.688  1.00 15.70 ? 91  ALA B CB  1 
ATOM   5299  N  N   . GLY C 1 92  ? 14.083  101.314 48.068  1.00 19.15 ? 92  GLY B N   1 
ATOM   5300  C  CA  . GLY C 1 92  ? 12.808  101.516 47.400  1.00 22.69 ? 92  GLY B CA  1 
ATOM   5301  C  C   . GLY C 1 92  ? 11.593  101.227 48.257  1.00 25.03 ? 92  GLY B C   1 
ATOM   5302  O  O   . GLY C 1 92  ? 10.476  101.609 47.910  1.00 26.94 ? 92  GLY B O   1 
ATOM   5303  N  N   . GLU C 1 93  ? 11.803  100.540 49.374  1.00 26.99 ? 93  GLU B N   1 
ATOM   5304  C  CA  . GLU C 1 93  ? 10.717  100.203 50.285  1.00 28.23 ? 93  GLU B CA  1 
ATOM   5305  C  C   . GLU C 1 93  ? 10.995  100.893 51.606  1.00 28.74 ? 93  GLU B C   1 
ATOM   5306  O  O   . GLU C 1 93  ? 12.102  101.374 51.838  1.00 29.31 ? 93  GLU B O   1 
ATOM   5307  C  CB  . GLU C 1 93  ? 10.657  98.694  50.518  1.00 29.11 ? 93  GLU B CB  1 
ATOM   5308  C  CG  . GLU C 1 93  ? 10.400  97.846  49.280  1.00 31.07 ? 93  GLU B CG  1 
ATOM   5309  C  CD  . GLU C 1 93  ? 9.018   98.057  48.697  1.00 32.17 ? 93  GLU B CD  1 
ATOM   5310  O  OE1 . GLU C 1 93  ? 8.079   98.327  49.475  1.00 33.30 ? 93  GLU B OE1 1 
ATOM   5311  O  OE2 . GLU C 1 93  ? 8.869   97.936  47.463  1.00 32.56 ? 93  GLU B OE2 1 
ATOM   5312  N  N   . GLU C 1 94  ? 9.994   100.946 52.474  1.00 30.12 ? 94  GLU B N   1 
ATOM   5313  C  CA  . GLU C 1 94  ? 10.189  101.572 53.771  1.00 30.55 ? 94  GLU B CA  1 
ATOM   5314  C  C   . GLU C 1 94  ? 10.094  100.528 54.876  1.00 27.19 ? 94  GLU B C   1 
ATOM   5315  O  O   . GLU C 1 94  ? 9.195   99.692  54.874  1.00 26.46 ? 94  GLU B O   1 
ATOM   5316  C  CB  . GLU C 1 94  ? 9.155   102.674 54.007  1.00 35.05 ? 94  GLU B CB  1 
ATOM   5317  C  CG  . GLU C 1 94  ? 9.535   103.571 55.172  1.00 42.30 ? 94  GLU B CG  1 
ATOM   5318  C  CD  . GLU C 1 94  ? 10.951  104.125 55.031  1.00 46.18 ? 94  GLU B CD  1 
ATOM   5319  O  OE1 . GLU C 1 94  ? 11.136  105.104 54.274  1.00 48.54 ? 94  GLU B OE1 1 
ATOM   5320  O  OE2 . GLU C 1 94  ? 11.880  103.571 55.663  1.00 47.76 ? 94  GLU B OE2 1 
ATOM   5321  N  N   . ASN C 1 95  ? 11.034  100.579 55.812  1.00 25.44 ? 95  ASN B N   1 
ATOM   5322  C  CA  . ASN C 1 95  ? 11.076  99.641  56.931  1.00 23.40 ? 95  ASN B CA  1 
ATOM   5323  C  C   . ASN C 1 95  ? 10.970  98.187  56.458  1.00 21.24 ? 95  ASN B C   1 
ATOM   5324  O  O   . ASN C 1 95  ? 10.155  97.409  56.955  1.00 19.79 ? 95  ASN B O   1 
ATOM   5325  C  CB  . ASN C 1 95  ? 9.960   99.969  57.932  1.00 24.21 ? 95  ASN B CB  1 
ATOM   5326  C  CG  . ASN C 1 95  ? 10.193  99.338  59.299  1.00 27.79 ? 95  ASN B CG  1 
ATOM   5327  O  OD1 . ASN C 1 95  ? 11.328  99.270  59.780  1.00 29.86 ? 95  ASN B OD1 1 
ATOM   5328  N  ND2 . ASN C 1 95  ? 9.116   98.891  59.939  1.00 27.28 ? 95  ASN B ND2 1 
ATOM   5329  N  N   . GLN C 1 96  ? 11.806  97.835  55.484  1.00 19.51 ? 96  GLN B N   1 
ATOM   5330  C  CA  . GLN C 1 96  ? 11.840  96.482  54.938  1.00 17.22 ? 96  GLN B CA  1 
ATOM   5331  C  C   . GLN C 1 96  ? 13.302  96.053  54.826  1.00 15.60 ? 96  GLN B C   1 
ATOM   5332  O  O   . GLN C 1 96  ? 14.154  96.819  54.368  1.00 14.40 ? 96  GLN B O   1 
ATOM   5333  C  CB  . GLN C 1 96  ? 11.177  96.444  53.562  1.00 17.36 ? 96  GLN B CB  1 
ATOM   5334  C  CG  . GLN C 1 96  ? 10.747  95.053  53.126  1.00 18.91 ? 96  GLN B CG  1 
ATOM   5335  C  CD  . GLN C 1 96  ? 10.055  95.051  51.776  1.00 19.05 ? 96  GLN B CD  1 
ATOM   5336  O  OE1 . GLN C 1 96  ? 10.703  95.025  50.728  1.00 17.60 ? 96  GLN B OE1 1 
ATOM   5337  N  NE2 . GLN C 1 96  ? 8.728   95.092  51.798  1.00 16.13 ? 96  GLN B NE2 1 
ATOM   5338  N  N   . TYR C 1 97  ? 13.590  94.829  55.247  1.00 13.78 ? 97  TYR B N   1 
ATOM   5339  C  CA  . TYR C 1 97  ? 14.955  94.327  55.221  1.00 13.39 ? 97  TYR B CA  1 
ATOM   5340  C  C   . TYR C 1 97  ? 15.052  92.897  54.721  1.00 14.13 ? 97  TYR B C   1 
ATOM   5341  O  O   . TYR C 1 97  ? 14.092  92.130  54.795  1.00 14.82 ? 97  TYR B O   1 
ATOM   5342  C  CB  . TYR C 1 97  ? 15.560  94.364  56.629  1.00 13.76 ? 97  TYR B CB  1 
ATOM   5343  C  CG  . TYR C 1 97  ? 15.355  95.657  57.373  1.00 15.08 ? 97  TYR B CG  1 
ATOM   5344  C  CD1 . TYR C 1 97  ? 14.112  95.987  57.910  1.00 16.74 ? 97  TYR B CD1 1 
ATOM   5345  C  CD2 . TYR C 1 97  ? 16.394  96.577  57.500  1.00 14.86 ? 97  TYR B CD2 1 
ATOM   5346  C  CE1 . TYR C 1 97  ? 13.908  97.203  58.555  1.00 18.74 ? 97  TYR B CE1 1 
ATOM   5347  C  CE2 . TYR C 1 97  ? 16.202  97.793  58.141  1.00 16.78 ? 97  TYR B CE2 1 
ATOM   5348  C  CZ  . TYR C 1 97  ? 14.959  98.101  58.660  1.00 18.04 ? 97  TYR B CZ  1 
ATOM   5349  O  OH  . TYR C 1 97  ? 14.758  99.311  59.272  1.00 23.37 ? 97  TYR B OH  1 
ATOM   5350  N  N   . ILE C 1 98  ? 16.223  92.547  54.202  1.00 12.54 ? 98  ILE B N   1 
ATOM   5351  C  CA  . ILE C 1 98  ? 16.469  91.183  53.771  1.00 11.82 ? 98  ILE B CA  1 
ATOM   5352  C  C   . ILE C 1 98  ? 17.283  90.619  54.930  1.00 11.82 ? 98  ILE B C   1 
ATOM   5353  O  O   . ILE C 1 98  ? 18.353  91.137  55.250  1.00 13.01 ? 98  ILE B O   1 
ATOM   5354  C  CB  . ILE C 1 98  ? 17.324  91.103  52.482  1.00 11.46 ? 98  ILE B CB  1 
ATOM   5355  C  CG1 . ILE C 1 98  ? 16.557  91.693  51.294  1.00 9.94  ? 98  ILE B CG1 1 
ATOM   5356  C  CG2 . ILE C 1 98  ? 17.700  89.652  52.207  1.00 10.00 ? 98  ILE B CG2 1 
ATOM   5357  C  CD1 . ILE C 1 98  ? 15.216  91.007  51.008  1.00 9.49  ? 98  ILE B CD1 1 
ATOM   5358  N  N   . CYS C 1 99  ? 16.757  89.592  55.584  1.00 10.76 ? 99  CYS B N   1 
ATOM   5359  C  CA  . CYS C 1 99  ? 17.461  88.968  56.696  1.00 11.82 ? 99  CYS B CA  1 
ATOM   5360  C  C   . CYS C 1 99  ? 17.893  87.574  56.265  1.00 11.63 ? 99  CYS B C   1 
ATOM   5361  O  O   . CYS C 1 99  ? 17.074  86.785  55.784  1.00 10.77 ? 99  CYS B O   1 
ATOM   5362  C  CB  . CYS C 1 99  ? 16.552  88.871  57.925  1.00 12.01 ? 99  CYS B CB  1 
ATOM   5363  S  SG  . CYS C 1 99  ? 16.116  90.462  58.678  1.00 17.36 ? 99  CYS B SG  1 
ATOM   5364  N  N   . TYR C 1 100 ? 19.179  87.278  56.422  1.00 10.85 ? 100 TYR B N   1 
ATOM   5365  C  CA  . TYR C 1 100 ? 19.708  85.973  56.047  1.00 11.90 ? 100 TYR B CA  1 
ATOM   5366  C  C   . TYR C 1 100 ? 19.805  85.086  57.272  1.00 10.52 ? 100 TYR B C   1 
ATOM   5367  O  O   . TYR C 1 100 ? 20.375  85.478  58.288  1.00 11.84 ? 100 TYR B O   1 
ATOM   5368  C  CB  . TYR C 1 100 ? 21.087  86.108  55.399  1.00 12.64 ? 100 TYR B CB  1 
ATOM   5369  C  CG  . TYR C 1 100 ? 21.086  86.931  54.133  1.00 14.92 ? 100 TYR B CG  1 
ATOM   5370  C  CD1 . TYR C 1 100 ? 21.128  88.326  54.182  1.00 15.98 ? 100 TYR B CD1 1 
ATOM   5371  C  CD2 . TYR C 1 100 ? 21.028  86.317  52.884  1.00 16.08 ? 100 TYR B CD2 1 
ATOM   5372  C  CE1 . TYR C 1 100 ? 21.114  89.088  53.012  1.00 17.18 ? 100 TYR B CE1 1 
ATOM   5373  C  CE2 . TYR C 1 100 ? 21.013  87.067  51.711  1.00 17.43 ? 100 TYR B CE2 1 
ATOM   5374  C  CZ  . TYR C 1 100 ? 21.056  88.449  51.782  1.00 17.11 ? 100 TYR B CZ  1 
ATOM   5375  O  OH  . TYR C 1 100 ? 21.042  89.191  50.624  1.00 20.74 ? 100 TYR B OH  1 
ATOM   5376  N  N   . VAL C 1 101 ? 19.243  83.888  57.163  1.00 10.09 ? 101 VAL B N   1 
ATOM   5377  C  CA  . VAL C 1 101 ? 19.237  82.931  58.258  1.00 9.17  ? 101 VAL B CA  1 
ATOM   5378  C  C   . VAL C 1 101 ? 19.926  81.633  57.861  1.00 8.97  ? 101 VAL B C   1 
ATOM   5379  O  O   . VAL C 1 101 ? 19.728  81.127  56.756  1.00 9.56  ? 101 VAL B O   1 
ATOM   5380  C  CB  . VAL C 1 101 ? 17.788  82.603  58.691  1.00 10.02 ? 101 VAL B CB  1 
ATOM   5381  C  CG1 . VAL C 1 101 ? 17.796  81.633  59.872  1.00 8.37  ? 101 VAL B CG1 1 
ATOM   5382  C  CG2 . VAL C 1 101 ? 17.052  83.887  59.043  1.00 8.71  ? 101 VAL B CG2 1 
ATOM   5383  N  N   . ALA C 1 102 ? 20.735  81.101  58.772  1.00 9.11  ? 102 ALA B N   1 
ATOM   5384  C  CA  . ALA C 1 102 ? 21.443  79.849  58.535  1.00 8.07  ? 102 ALA B CA  1 
ATOM   5385  C  C   . ALA C 1 102 ? 20.849  78.757  59.430  1.00 9.22  ? 102 ALA B C   1 
ATOM   5386  O  O   . ALA C 1 102 ? 20.597  78.987  60.615  1.00 10.14 ? 102 ALA B O   1 
ATOM   5387  C  CB  . ALA C 1 102 ? 22.930  80.023  58.830  1.00 6.59  ? 102 ALA B CB  1 
ATOM   5388  N  N   . TYR C 1 103 ? 20.626  77.578  58.854  1.00 9.66  ? 103 TYR B N   1 
ATOM   5389  C  CA  . TYR C 1 103 ? 20.062  76.437  59.577  1.00 9.37  ? 103 TYR B CA  1 
ATOM   5390  C  C   . TYR C 1 103 ? 21.007  75.238  59.479  1.00 9.84  ? 103 TYR B C   1 
ATOM   5391  O  O   . TYR C 1 103 ? 21.388  74.832  58.379  1.00 11.00 ? 103 TYR B O   1 
ATOM   5392  C  CB  . TYR C 1 103 ? 18.716  76.026  58.965  1.00 10.00 ? 103 TYR B CB  1 
ATOM   5393  C  CG  . TYR C 1 103 ? 17.632  77.068  59.030  1.00 9.90  ? 103 TYR B CG  1 
ATOM   5394  C  CD1 . TYR C 1 103 ? 16.836  77.205  60.167  1.00 10.26 ? 103 TYR B CD1 1 
ATOM   5395  C  CD2 . TYR C 1 103 ? 17.387  77.911  57.948  1.00 10.82 ? 103 TYR B CD2 1 
ATOM   5396  C  CE1 . TYR C 1 103 ? 15.820  78.152  60.222  1.00 10.58 ? 103 TYR B CE1 1 
ATOM   5397  C  CE2 . TYR C 1 103 ? 16.376  78.861  57.992  1.00 10.99 ? 103 TYR B CE2 1 
ATOM   5398  C  CZ  . TYR C 1 103 ? 15.595  78.976  59.131  1.00 11.09 ? 103 TYR B CZ  1 
ATOM   5399  O  OH  . TYR C 1 103 ? 14.582  79.906  59.172  1.00 10.30 ? 103 TYR B OH  1 
ATOM   5400  N  N   . PRO C 1 104 ? 21.388  74.650  60.622  1.00 9.15  ? 104 PRO B N   1 
ATOM   5401  C  CA  . PRO C 1 104 ? 22.291  73.490  60.598  1.00 9.33  ? 104 PRO B CA  1 
ATOM   5402  C  C   . PRO C 1 104 ? 21.669  72.292  59.870  1.00 9.57  ? 104 PRO B C   1 
ATOM   5403  O  O   . PRO C 1 104 ? 20.458  72.075  59.929  1.00 8.93  ? 104 PRO B O   1 
ATOM   5404  C  CB  . PRO C 1 104 ? 22.524  73.205  62.082  1.00 9.79  ? 104 PRO B CB  1 
ATOM   5405  C  CG  . PRO C 1 104 ? 22.410  74.566  62.708  1.00 9.16  ? 104 PRO B CG  1 
ATOM   5406  C  CD  . PRO C 1 104 ? 21.207  75.148  61.998  1.00 9.40  ? 104 PRO B CD  1 
ATOM   5407  N  N   . LEU C 1 105 ? 22.505  71.511  59.192  1.00 9.40  ? 105 LEU B N   1 
ATOM   5408  C  CA  . LEU C 1 105 ? 22.043  70.342  58.445  1.00 9.11  ? 105 LEU B CA  1 
ATOM   5409  C  C   . LEU C 1 105 ? 21.240  69.347  59.288  1.00 8.82  ? 105 LEU B C   1 
ATOM   5410  O  O   . LEU C 1 105 ? 20.302  68.721  58.789  1.00 8.63  ? 105 LEU B O   1 
ATOM   5411  C  CB  . LEU C 1 105 ? 23.242  69.620  57.818  1.00 9.84  ? 105 LEU B CB  1 
ATOM   5412  C  CG  . LEU C 1 105 ? 22.944  68.364  56.992  1.00 11.14 ? 105 LEU B CG  1 
ATOM   5413  C  CD1 . LEU C 1 105 ? 22.067  68.720  55.803  1.00 11.68 ? 105 LEU B CD1 1 
ATOM   5414  C  CD2 . LEU C 1 105 ? 24.252  67.745  56.528  1.00 9.70  ? 105 LEU B CD2 1 
ATOM   5415  N  N   . ASP C 1 106 ? 21.615  69.206  60.557  1.00 9.47  ? 106 ASP B N   1 
ATOM   5416  C  CA  . ASP C 1 106 ? 20.959  68.277  61.481  1.00 9.08  ? 106 ASP B CA  1 
ATOM   5417  C  C   . ASP C 1 106 ? 19.476  68.532  61.748  1.00 9.14  ? 106 ASP B C   1 
ATOM   5418  O  O   . ASP C 1 106 ? 18.759  67.628  62.184  1.00 10.41 ? 106 ASP B O   1 
ATOM   5419  C  CB  . ASP C 1 106 ? 21.699  68.267  62.829  1.00 11.99 ? 106 ASP B CB  1 
ATOM   5420  C  CG  . ASP C 1 106 ? 23.023  67.521  62.772  1.00 14.10 ? 106 ASP B CG  1 
ATOM   5421  O  OD1 . ASP C 1 106 ? 23.395  67.030  61.686  1.00 13.73 ? 106 ASP B OD1 1 
ATOM   5422  O  OD2 . ASP C 1 106 ? 23.691  67.421  63.821  1.00 13.26 ? 106 ASP B OD2 1 
ATOM   5423  N  N   . LEU C 1 107 ? 19.012  69.749  61.495  1.00 8.86  ? 107 LEU B N   1 
ATOM   5424  C  CA  . LEU C 1 107 ? 17.611  70.085  61.747  1.00 9.23  ? 107 LEU B CA  1 
ATOM   5425  C  C   . LEU C 1 107 ? 16.609  69.494  60.759  1.00 9.18  ? 107 LEU B C   1 
ATOM   5426  O  O   . LEU C 1 107 ? 15.401  69.552  60.991  1.00 9.82  ? 107 LEU B O   1 
ATOM   5427  C  CB  . LEU C 1 107 ? 17.420  71.606  61.748  1.00 8.60  ? 107 LEU B CB  1 
ATOM   5428  C  CG  . LEU C 1 107 ? 18.234  72.485  62.699  1.00 8.86  ? 107 LEU B CG  1 
ATOM   5429  C  CD1 . LEU C 1 107 ? 17.690  73.897  62.647  1.00 8.62  ? 107 LEU B CD1 1 
ATOM   5430  C  CD2 . LEU C 1 107 ? 18.158  71.949  64.121  1.00 9.22  ? 107 LEU B CD2 1 
ATOM   5431  N  N   . PHE C 1 108 ? 17.095  68.913  59.669  1.00 7.29  ? 108 PHE B N   1 
ATOM   5432  C  CA  . PHE C 1 108 ? 16.194  68.405  58.640  1.00 6.19  ? 108 PHE B CA  1 
ATOM   5433  C  C   . PHE C 1 108 ? 16.152  66.901  58.404  1.00 6.10  ? 108 PHE B C   1 
ATOM   5434  O  O   . PHE C 1 108 ? 17.170  66.213  58.500  1.00 6.14  ? 108 PHE B O   1 
ATOM   5435  C  CB  . PHE C 1 108 ? 16.522  69.123  57.329  1.00 8.59  ? 108 PHE B CB  1 
ATOM   5436  C  CG  . PHE C 1 108 ? 16.502  70.624  57.446  1.00 8.78  ? 108 PHE B CG  1 
ATOM   5437  C  CD1 . PHE C 1 108 ? 15.316  71.332  57.304  1.00 10.36 ? 108 PHE B CD1 1 
ATOM   5438  C  CD2 . PHE C 1 108 ? 17.668  71.324  57.752  1.00 10.16 ? 108 PHE B CD2 1 
ATOM   5439  C  CE1 . PHE C 1 108 ? 15.287  72.719  57.465  1.00 10.01 ? 108 PHE B CE1 1 
ATOM   5440  C  CE2 . PHE C 1 108 ? 17.652  72.707  57.917  1.00 8.58  ? 108 PHE B CE2 1 
ATOM   5441  C  CZ  . PHE C 1 108 ? 16.460  73.408  57.774  1.00 9.54  ? 108 PHE B CZ  1 
ATOM   5442  N  N   . GLU C 1 109 ? 14.961  66.392  58.095  1.00 5.84  ? 109 GLU B N   1 
ATOM   5443  C  CA  . GLU C 1 109 ? 14.810  64.972  57.812  1.00 5.35  ? 109 GLU B CA  1 
ATOM   5444  C  C   . GLU C 1 109 ? 15.242  64.727  56.378  1.00 6.55  ? 109 GLU B C   1 
ATOM   5445  O  O   . GLU C 1 109 ? 14.829  65.436  55.465  1.00 6.28  ? 109 GLU B O   1 
ATOM   5446  C  CB  . GLU C 1 109 ? 13.360  64.502  57.986  1.00 4.79  ? 109 GLU B CB  1 
ATOM   5447  C  CG  . GLU C 1 109 ? 13.161  63.067  57.487  1.00 6.33  ? 109 GLU B CG  1 
ATOM   5448  C  CD  . GLU C 1 109 ? 11.889  62.396  57.985  1.00 8.93  ? 109 GLU B CD  1 
ATOM   5449  O  OE1 . GLU C 1 109 ? 11.070  63.048  58.669  1.00 8.46  ? 109 GLU B OE1 1 
ATOM   5450  O  OE2 . GLU C 1 109 ? 11.713  61.197  57.682  1.00 10.14 ? 109 GLU B OE2 1 
ATOM   5451  N  N   . GLU C 1 110 ? 16.082  63.717  56.190  1.00 7.05  ? 110 GLU B N   1 
ATOM   5452  C  CA  . GLU C 1 110 ? 16.587  63.375  54.874  1.00 6.87  ? 110 GLU B CA  1 
ATOM   5453  C  C   . GLU C 1 110 ? 15.468  63.057  53.878  1.00 6.43  ? 110 GLU B C   1 
ATOM   5454  O  O   . GLU C 1 110 ? 14.539  62.310  54.187  1.00 6.53  ? 110 GLU B O   1 
ATOM   5455  C  CB  . GLU C 1 110 ? 17.541  62.177  54.988  1.00 8.23  ? 110 GLU B CB  1 
ATOM   5456  C  CG  . GLU C 1 110 ? 18.769  62.434  55.863  1.00 8.25  ? 110 GLU B CG  1 
ATOM   5457  C  CD  . GLU C 1 110 ? 18.522  62.226  57.354  1.00 11.60 ? 110 GLU B CD  1 
ATOM   5458  O  OE1 . GLU C 1 110 ? 17.355  62.037  57.771  1.00 8.76  ? 110 GLU B OE1 1 
ATOM   5459  O  OE2 . GLU C 1 110 ? 19.513  62.256  58.114  1.00 10.27 ? 110 GLU B OE2 1 
ATOM   5460  N  N   . GLY C 1 111 ? 15.556  63.645  52.688  1.00 5.07  ? 111 GLY B N   1 
ATOM   5461  C  CA  . GLY C 1 111 ? 14.570  63.391  51.649  1.00 5.38  ? 111 GLY B CA  1 
ATOM   5462  C  C   . GLY C 1 111 ? 13.151  63.889  51.856  1.00 6.62  ? 111 GLY B C   1 
ATOM   5463  O  O   . GLY C 1 111 ? 12.235  63.446  51.157  1.00 6.31  ? 111 GLY B O   1 
ATOM   5464  N  N   . SER C 1 112 ? 12.946  64.809  52.792  1.00 6.25  ? 112 SER B N   1 
ATOM   5465  C  CA  . SER C 1 112 ? 11.601  65.319  53.033  1.00 6.73  ? 112 SER B CA  1 
ATOM   5466  C  C   . SER C 1 112 ? 11.447  66.825  52.854  1.00 8.18  ? 112 SER B C   1 
ATOM   5467  O  O   . SER C 1 112 ? 11.859  67.609  53.711  1.00 6.32  ? 112 SER B O   1 
ATOM   5468  C  CB  . SER C 1 112 ? 11.128  64.930  54.438  1.00 6.19  ? 112 SER B CB  1 
ATOM   5469  O  OG  . SER C 1 112 ? 9.851   65.491  54.723  1.00 6.21  ? 112 SER B OG  1 
ATOM   5470  N  N   . VAL C 1 113 ? 10.848  67.224  51.733  1.00 7.52  ? 113 VAL B N   1 
ATOM   5471  C  CA  . VAL C 1 113 ? 10.603  68.636  51.469  1.00 7.79  ? 113 VAL B CA  1 
ATOM   5472  C  C   . VAL C 1 113 ? 9.573   69.098  52.494  1.00 7.64  ? 113 VAL B C   1 
ATOM   5473  O  O   . VAL C 1 113 ? 9.606   70.238  52.952  1.00 8.15  ? 113 VAL B O   1 
ATOM   5474  C  CB  . VAL C 1 113 ? 10.030  68.860  50.053  1.00 9.08  ? 113 VAL B CB  1 
ATOM   5475  C  CG1 . VAL C 1 113 ? 9.520   70.291  49.913  1.00 13.01 ? 113 VAL B CG1 1 
ATOM   5476  C  CG2 . VAL C 1 113 ? 11.107  68.580  49.011  1.00 10.57 ? 113 VAL B CG2 1 
ATOM   5477  N  N   . THR C 1 114 ? 8.655   68.198  52.840  1.00 6.46  ? 114 THR B N   1 
ATOM   5478  C  CA  . THR C 1 114 ? 7.617   68.489  53.822  1.00 6.55  ? 114 THR B CA  1 
ATOM   5479  C  C   . THR C 1 114 ? 8.239   68.975  55.137  1.00 6.55  ? 114 THR B C   1 
ATOM   5480  O  O   . THR C 1 114 ? 7.800   69.975  55.713  1.00 6.32  ? 114 THR B O   1 
ATOM   5481  C  CB  . THR C 1 114 ? 6.761   67.234  54.091  1.00 8.42  ? 114 THR B CB  1 
ATOM   5482  O  OG1 . THR C 1 114 ? 5.985   66.928  52.922  1.00 8.19  ? 114 THR B OG1 1 
ATOM   5483  C  CG2 . THR C 1 114 ? 5.839   67.455  55.281  1.00 7.49  ? 114 THR B CG2 1 
ATOM   5484  N  N   . ASN C 1 115 ? 9.267   68.274  55.605  1.00 6.03  ? 115 ASN B N   1 
ATOM   5485  C  CA  . ASN C 1 115 ? 9.933   68.657  56.845  1.00 6.16  ? 115 ASN B CA  1 
ATOM   5486  C  C   . ASN C 1 115 ? 10.700  69.965  56.690  1.00 6.51  ? 115 ASN B C   1 
ATOM   5487  O  O   . ASN C 1 115 ? 10.684  70.802  57.589  1.00 6.16  ? 115 ASN B O   1 
ATOM   5488  C  CB  . ASN C 1 115 ? 10.888  67.554  57.311  1.00 6.34  ? 115 ASN B CB  1 
ATOM   5489  C  CG  . ASN C 1 115 ? 11.638  67.929  58.585  1.00 9.86  ? 115 ASN B CG  1 
ATOM   5490  O  OD1 . ASN C 1 115 ? 12.819  68.276  58.547  1.00 10.19 ? 115 ASN B OD1 1 
ATOM   5491  N  ND2 . ASN C 1 115 ? 10.945  67.870  59.723  1.00 11.07 ? 115 ASN B ND2 1 
ATOM   5492  N  N   . MET C 1 116 ? 11.356  70.146  55.546  1.00 7.22  ? 116 MET B N   1 
ATOM   5493  C  CA  . MET C 1 116 ? 12.134  71.360  55.302  1.00 9.17  ? 116 MET B CA  1 
ATOM   5494  C  C   . MET C 1 116 ? 11.279  72.621  55.401  1.00 9.69  ? 116 MET B C   1 
ATOM   5495  O  O   . MET C 1 116 ? 11.687  73.601  56.024  1.00 10.01 ? 116 MET B O   1 
ATOM   5496  C  CB  . MET C 1 116 ? 12.817  71.306  53.928  1.00 9.61  ? 116 MET B CB  1 
ATOM   5497  C  CG  . MET C 1 116 ? 13.631  72.560  53.605  1.00 12.64 ? 116 MET B CG  1 
ATOM   5498  S  SD  . MET C 1 116 ? 14.491  72.517  52.010  1.00 16.21 ? 116 MET B SD  1 
ATOM   5499  C  CE  . MET C 1 116 ? 13.114  72.459  50.870  1.00 13.25 ? 116 MET B CE  1 
ATOM   5500  N  N   . PHE C 1 117 ? 10.093  72.597  54.794  1.00 9.22  ? 117 PHE B N   1 
ATOM   5501  C  CA  . PHE C 1 117 ? 9.208   73.753  54.841  1.00 9.73  ? 117 PHE B CA  1 
ATOM   5502  C  C   . PHE C 1 117 ? 8.532   73.933  56.197  1.00 10.09 ? 117 PHE B C   1 
ATOM   5503  O  O   . PHE C 1 117 ? 8.272   75.059  56.618  1.00 9.46  ? 117 PHE B O   1 
ATOM   5504  C  CB  . PHE C 1 117 ? 8.136   73.670  53.752  1.00 11.89 ? 117 PHE B CB  1 
ATOM   5505  C  CG  . PHE C 1 117 ? 8.622   74.067  52.381  1.00 14.96 ? 117 PHE B CG  1 
ATOM   5506  C  CD1 . PHE C 1 117 ? 9.603   75.043  52.227  1.00 17.73 ? 117 PHE B CD1 1 
ATOM   5507  C  CD2 . PHE C 1 117 ? 8.066   73.498  51.244  1.00 16.97 ? 117 PHE B CD2 1 
ATOM   5508  C  CE1 . PHE C 1 117 ? 10.021  75.445  50.953  1.00 19.82 ? 117 PHE B CE1 1 
ATOM   5509  C  CE2 . PHE C 1 117 ? 8.475   73.894  49.968  1.00 20.50 ? 117 PHE B CE2 1 
ATOM   5510  C  CZ  . PHE C 1 117 ? 9.455   74.870  49.823  1.00 18.00 ? 117 PHE B CZ  1 
ATOM   5511  N  N   . THR C 1 118 ? 8.243   72.828  56.879  1.00 9.72  ? 118 THR B N   1 
ATOM   5512  C  CA  . THR C 1 118 ? 7.588   72.917  58.179  1.00 9.06  ? 118 THR B CA  1 
ATOM   5513  C  C   . THR C 1 118 ? 8.413   73.761  59.148  1.00 9.10  ? 118 THR B C   1 
ATOM   5514  O  O   . THR C 1 118 ? 7.861   74.515  59.950  1.00 8.69  ? 118 THR B O   1 
ATOM   5515  C  CB  . THR C 1 118 ? 7.329   71.514  58.778  1.00 8.93  ? 118 THR B CB  1 
ATOM   5516  O  OG1 . THR C 1 118 ? 6.452   70.785  57.909  1.00 7.46  ? 118 THR B OG1 1 
ATOM   5517  C  CG2 . THR C 1 118 ? 6.670   71.625  60.142  1.00 7.35  ? 118 THR B CG2 1 
ATOM   5518  N  N   . SER C 1 119 ? 9.735   73.639  59.078  1.00 7.67  ? 119 SER B N   1 
ATOM   5519  C  CA  . SER C 1 119 ? 10.596  74.431  59.946  1.00 9.34  ? 119 SER B CA  1 
ATOM   5520  C  C   . SER C 1 119 ? 10.709  75.871  59.465  1.00 8.76  ? 119 SER B C   1 
ATOM   5521  O  O   . SER C 1 119 ? 10.363  76.805  60.183  1.00 9.98  ? 119 SER B O   1 
ATOM   5522  C  CB  . SER C 1 119 ? 12.007  73.833  60.017  1.00 8.71  ? 119 SER B CB  1 
ATOM   5523  O  OG  . SER C 1 119 ? 12.082  72.779  60.958  1.00 12.16 ? 119 SER B OG  1 
ATOM   5524  N  N   . ILE C 1 120 ? 11.177  76.036  58.233  1.00 8.32  ? 120 ILE B N   1 
ATOM   5525  C  CA  . ILE C 1 120 ? 11.411  77.353  57.654  1.00 8.23  ? 120 ILE B CA  1 
ATOM   5526  C  C   . ILE C 1 120 ? 10.200  78.274  57.456  1.00 9.42  ? 120 ILE B C   1 
ATOM   5527  O  O   . ILE C 1 120 ? 10.314  79.481  57.651  1.00 8.79  ? 120 ILE B O   1 
ATOM   5528  C  CB  . ILE C 1 120 ? 12.203  77.204  56.329  1.00 8.37  ? 120 ILE B CB  1 
ATOM   5529  C  CG1 . ILE C 1 120 ? 13.491  76.411  56.608  1.00 6.71  ? 120 ILE B CG1 1 
ATOM   5530  C  CG2 . ILE C 1 120 ? 12.552  78.574  55.754  1.00 6.44  ? 120 ILE B CG2 1 
ATOM   5531  C  CD1 . ILE C 1 120 ? 14.361  76.135  55.397  1.00 9.91  ? 120 ILE B CD1 1 
ATOM   5532  N  N   . VAL C 1 121 ? 9.044   77.735  57.083  1.00 9.63  ? 121 VAL B N   1 
ATOM   5533  C  CA  . VAL C 1 121 ? 7.871   78.596  56.904  1.00 8.64  ? 121 VAL B CA  1 
ATOM   5534  C  C   . VAL C 1 121 ? 6.689   78.167  57.766  1.00 9.62  ? 121 VAL B C   1 
ATOM   5535  O  O   . VAL C 1 121 ? 5.562   78.627  57.559  1.00 10.52 ? 121 VAL B O   1 
ATOM   5536  C  CB  . VAL C 1 121 ? 7.403   78.642  55.424  1.00 8.33  ? 121 VAL B CB  1 
ATOM   5537  C  CG1 . VAL C 1 121 ? 8.511   79.191  54.541  1.00 9.68  ? 121 VAL B CG1 1 
ATOM   5538  C  CG2 . VAL C 1 121 ? 6.979   77.257  54.961  1.00 9.01  ? 121 VAL B CG2 1 
ATOM   5539  N  N   . GLY C 1 122 ? 6.957   77.310  58.749  1.00 9.38  ? 122 GLY B N   1 
ATOM   5540  C  CA  . GLY C 1 122 ? 5.908   76.802  59.620  1.00 8.93  ? 122 GLY B CA  1 
ATOM   5541  C  C   . GLY C 1 122 ? 5.027   77.762  60.410  1.00 8.48  ? 122 GLY B C   1 
ATOM   5542  O  O   . GLY C 1 122 ? 3.806   77.777  60.226  1.00 9.03  ? 122 GLY B O   1 
ATOM   5543  N  N   . ASN C 1 123 ? 5.622   78.553  61.299  1.00 8.43  ? 123 ASN B N   1 
ATOM   5544  C  CA  . ASN C 1 123 ? 4.838   79.470  62.127  1.00 7.78  ? 123 ASN B CA  1 
ATOM   5545  C  C   . ASN C 1 123 ? 5.228   80.944  62.079  1.00 7.80  ? 123 ASN B C   1 
ATOM   5546  O  O   . ASN C 1 123 ? 4.421   81.805  62.440  1.00 8.11  ? 123 ASN B O   1 
ATOM   5547  C  CB  . ASN C 1 123 ? 4.892   79.034  63.602  1.00 9.43  ? 123 ASN B CB  1 
ATOM   5548  C  CG  . ASN C 1 123 ? 4.488   77.588  63.813  1.00 10.39 ? 123 ASN B CG  1 
ATOM   5549  O  OD1 . ASN C 1 123 ? 3.558   77.086  63.181  1.00 11.83 ? 123 ASN B OD1 1 
ATOM   5550  N  ND2 . ASN C 1 123 ? 5.173   76.916  64.732  1.00 12.85 ? 123 ASN B ND2 1 
ATOM   5551  N  N   . VAL C 1 124 ? 6.445   81.242  61.637  1.00 7.61  ? 124 VAL B N   1 
ATOM   5552  C  CA  . VAL C 1 124 ? 6.923   82.625  61.631  1.00 7.26  ? 124 VAL B CA  1 
ATOM   5553  C  C   . VAL C 1 124 ? 6.152   83.672  60.830  1.00 8.60  ? 124 VAL B C   1 
ATOM   5554  O  O   . VAL C 1 124 ? 6.217   84.856  61.158  1.00 8.54  ? 124 VAL B O   1 
ATOM   5555  C  CB  . VAL C 1 124 ? 8.431   82.699  61.239  1.00 7.09  ? 124 VAL B CB  1 
ATOM   5556  C  CG1 . VAL C 1 124 ? 9.272   82.045  62.325  1.00 6.94  ? 124 VAL B CG1 1 
ATOM   5557  C  CG2 . VAL C 1 124 ? 8.676   81.997  59.917  1.00 6.79  ? 124 VAL B CG2 1 
ATOM   5558  N  N   . PHE C 1 125 ? 5.409   83.265  59.803  1.00 6.56  ? 125 PHE B N   1 
ATOM   5559  C  CA  . PHE C 1 125 ? 4.674   84.248  59.013  1.00 7.63  ? 125 PHE B CA  1 
ATOM   5560  C  C   . PHE C 1 125 ? 3.483   84.874  59.735  1.00 8.81  ? 125 PHE B C   1 
ATOM   5561  O  O   . PHE C 1 125 ? 2.945   85.885  59.282  1.00 8.45  ? 125 PHE B O   1 
ATOM   5562  C  CB  . PHE C 1 125 ? 4.216   83.636  57.683  1.00 7.67  ? 125 PHE B CB  1 
ATOM   5563  C  CG  . PHE C 1 125 ? 5.342   83.382  56.720  1.00 7.84  ? 125 PHE B CG  1 
ATOM   5564  C  CD1 . PHE C 1 125 ? 6.324   82.436  57.008  1.00 8.23  ? 125 PHE B CD1 1 
ATOM   5565  C  CD2 . PHE C 1 125 ? 5.439   84.107  55.536  1.00 7.92  ? 125 PHE B CD2 1 
ATOM   5566  C  CE1 . PHE C 1 125 ? 7.388   82.222  56.135  1.00 8.23  ? 125 PHE B CE1 1 
ATOM   5567  C  CE2 . PHE C 1 125 ? 6.500   83.901  54.657  1.00 7.18  ? 125 PHE B CE2 1 
ATOM   5568  C  CZ  . PHE C 1 125 ? 7.477   82.957  54.956  1.00 6.06  ? 125 PHE B CZ  1 
ATOM   5569  N  N   . GLY C 1 126 ? 3.080   84.291  60.859  1.00 8.14  ? 126 GLY B N   1 
ATOM   5570  C  CA  . GLY C 1 126 ? 1.948   84.829  61.595  1.00 10.73 ? 126 GLY B CA  1 
ATOM   5571  C  C   . GLY C 1 126 ? 2.297   85.654  62.824  1.00 10.44 ? 126 GLY B C   1 
ATOM   5572  O  O   . GLY C 1 126 ? 1.405   86.130  63.528  1.00 9.75  ? 126 GLY B O   1 
ATOM   5573  N  N   . PHE C 1 127 ? 3.586   85.841  63.089  1.00 9.83  ? 127 PHE B N   1 
ATOM   5574  C  CA  . PHE C 1 127 ? 3.998   86.616  64.256  1.00 10.97 ? 127 PHE B CA  1 
ATOM   5575  C  C   . PHE C 1 127 ? 3.427   88.028  64.294  1.00 11.28 ? 127 PHE B C   1 
ATOM   5576  O  O   . PHE C 1 127 ? 3.520   88.777  63.324  1.00 11.29 ? 127 PHE B O   1 
ATOM   5577  C  CB  . PHE C 1 127 ? 5.525   86.681  64.343  1.00 14.81 ? 127 PHE B CB  1 
ATOM   5578  C  CG  . PHE C 1 127 ? 6.103   85.774  65.384  1.00 16.85 ? 127 PHE B CG  1 
ATOM   5579  C  CD1 . PHE C 1 127 ? 6.055   84.392  65.228  1.00 20.14 ? 127 PHE B CD1 1 
ATOM   5580  C  CD2 . PHE C 1 127 ? 6.654   86.298  66.547  1.00 20.56 ? 127 PHE B CD2 1 
ATOM   5581  C  CE1 . PHE C 1 127 ? 6.553   83.544  66.220  1.00 21.40 ? 127 PHE B CE1 1 
ATOM   5582  C  CE2 . PHE C 1 127 ? 7.153   85.463  67.542  1.00 20.71 ? 127 PHE B CE2 1 
ATOM   5583  C  CZ  . PHE C 1 127 ? 7.099   84.084  67.379  1.00 20.38 ? 127 PHE B CZ  1 
ATOM   5584  N  N   . LYS C 1 128 ? 2.850   88.392  65.434  1.00 11.60 ? 128 LYS B N   1 
ATOM   5585  C  CA  . LYS C 1 128 ? 2.270   89.721  65.605  1.00 12.29 ? 128 LYS B CA  1 
ATOM   5586  C  C   . LYS C 1 128 ? 3.303   90.824  65.399  1.00 12.92 ? 128 LYS B C   1 
ATOM   5587  O  O   . LYS C 1 128 ? 2.983   91.896  64.885  1.00 13.07 ? 128 LYS B O   1 
ATOM   5588  C  CB  . LYS C 1 128 ? 1.668   89.866  67.008  1.00 12.56 ? 128 LYS B CB  1 
ATOM   5589  C  CG  . LYS C 1 128 ? 0.324   89.176  67.211  1.00 12.70 ? 128 LYS B CG  1 
ATOM   5590  C  CD  . LYS C 1 128 ? -0.168  89.402  68.641  1.00 12.95 ? 128 LYS B CD  1 
ATOM   5591  C  CE  . LYS C 1 128 ? -1.566  88.844  68.862  1.00 12.29 ? 128 LYS B CE  1 
ATOM   5592  N  NZ  . LYS C 1 128 ? -1.971  88.945  70.298  1.00 12.35 ? 128 LYS B NZ  1 
ATOM   5593  N  N   . ALA C 1 129 ? 4.540   90.550  65.802  1.00 11.82 ? 129 ALA B N   1 
ATOM   5594  C  CA  . ALA C 1 129 ? 5.632   91.514  65.698  1.00 12.11 ? 129 ALA B CA  1 
ATOM   5595  C  C   . ALA C 1 129 ? 6.041   91.863  64.270  1.00 11.43 ? 129 ALA B C   1 
ATOM   5596  O  O   . ALA C 1 129 ? 6.852   92.763  64.060  1.00 10.93 ? 129 ALA B O   1 
ATOM   5597  C  CB  . ALA C 1 129 ? 6.851   91.004  66.478  1.00 11.51 ? 129 ALA B CB  1 
ATOM   5598  N  N   . LEU C 1 130 ? 5.485   91.152  63.294  1.00 11.38 ? 130 LEU B N   1 
ATOM   5599  C  CA  . LEU C 1 130 ? 5.794   91.401  61.889  1.00 12.08 ? 130 LEU B CA  1 
ATOM   5600  C  C   . LEU C 1 130 ? 4.540   91.835  61.140  1.00 12.61 ? 130 LEU B C   1 
ATOM   5601  O  O   . LEU C 1 130 ? 3.436   91.384  61.452  1.00 12.88 ? 130 LEU B O   1 
ATOM   5602  C  CB  . LEU C 1 130 ? 6.326   90.132  61.222  1.00 13.14 ? 130 LEU B CB  1 
ATOM   5603  C  CG  . LEU C 1 130 ? 7.515   89.385  61.825  1.00 12.61 ? 130 LEU B CG  1 
ATOM   5604  C  CD1 . LEU C 1 130 ? 7.759   88.123  61.014  1.00 11.54 ? 130 LEU B CD1 1 
ATOM   5605  C  CD2 . LEU C 1 130 ? 8.749   90.266  61.831  1.00 14.15 ? 130 LEU B CD2 1 
ATOM   5606  N  N   . ARG C 1 131 ? 4.707   92.712  60.157  1.00 14.48 ? 131 ARG B N   1 
ATOM   5607  C  CA  . ARG C 1 131 ? 3.581   93.165  59.345  1.00 15.82 ? 131 ARG B CA  1 
ATOM   5608  C  C   . ARG C 1 131 ? 3.455   92.209  58.165  1.00 15.04 ? 131 ARG B C   1 
ATOM   5609  O  O   . ARG C 1 131 ? 2.356   91.845  57.754  1.00 15.37 ? 131 ARG B O   1 
ATOM   5610  C  CB  . ARG C 1 131 ? 3.823   94.577  58.809  1.00 19.53 ? 131 ARG B CB  1 
ATOM   5611  C  CG  . ARG C 1 131 ? 3.639   95.693  59.817  1.00 26.08 ? 131 ARG B CG  1 
ATOM   5612  C  CD  . ARG C 1 131 ? 4.017   97.027  59.192  1.00 29.94 ? 131 ARG B CD  1 
ATOM   5613  N  NE  . ARG C 1 131 ? 3.342   97.245  57.913  1.00 35.88 ? 131 ARG B NE  1 
ATOM   5614  C  CZ  . ARG C 1 131 ? 3.972   97.470  56.762  1.00 37.68 ? 131 ARG B CZ  1 
ATOM   5615  N  NH1 . ARG C 1 131 ? 5.299   97.508  56.724  1.00 36.59 ? 131 ARG B NH1 1 
ATOM   5616  N  NH2 . ARG C 1 131 ? 3.275   97.664  55.648  1.00 38.61 ? 131 ARG B NH2 1 
ATOM   5617  N  N   . ALA C 1 132 ? 4.599   91.804  57.625  1.00 12.73 ? 132 ALA B N   1 
ATOM   5618  C  CA  . ALA C 1 132 ? 4.628   90.897  56.489  1.00 11.13 ? 132 ALA B CA  1 
ATOM   5619  C  C   . ALA C 1 132 ? 5.962   90.176  56.438  1.00 10.79 ? 132 ALA B C   1 
ATOM   5620  O  O   . ALA C 1 132 ? 6.956   90.649  56.985  1.00 9.98  ? 132 ALA B O   1 
ATOM   5621  C  CB  . ALA C 1 132 ? 4.400   91.670  55.191  1.00 12.06 ? 132 ALA B CB  1 
ATOM   5622  N  N   . LEU C 1 133 ? 5.979   89.027  55.775  1.00 8.72  ? 133 LEU B N   1 
ATOM   5623  C  CA  . LEU C 1 133 ? 7.200   88.241  55.655  1.00 8.60  ? 133 LEU B CA  1 
ATOM   5624  C  C   . LEU C 1 133 ? 7.171   87.459  54.355  1.00 8.71  ? 133 LEU B C   1 
ATOM   5625  O  O   . LEU C 1 133 ? 6.134   86.901  53.983  1.00 8.04  ? 133 LEU B O   1 
ATOM   5626  C  CB  . LEU C 1 133 ? 7.318   87.268  56.830  1.00 7.47  ? 133 LEU B CB  1 
ATOM   5627  C  CG  . LEU C 1 133 ? 8.548   86.352  56.860  1.00 7.50  ? 133 LEU B CG  1 
ATOM   5628  C  CD1 . LEU C 1 133 ? 9.821   87.197  57.032  1.00 3.46  ? 133 LEU B CD1 1 
ATOM   5629  C  CD2 . LEU C 1 133 ? 8.411   85.358  58.004  1.00 5.58  ? 133 LEU B CD2 1 
ATOM   5630  N  N   . ARG C 1 134 ? 8.301   87.426  53.655  1.00 7.72  ? 134 ARG B N   1 
ATOM   5631  C  CA  . ARG C 1 134 ? 8.375   86.678  52.410  1.00 7.76  ? 134 ARG B CA  1 
ATOM   5632  C  C   . ARG C 1 134 ? 9.700   85.943  52.294  1.00 7.47  ? 134 ARG B C   1 
ATOM   5633  O  O   . ARG C 1 134 ? 10.760  86.519  52.540  1.00 10.46 ? 134 ARG B O   1 
ATOM   5634  C  CB  . ARG C 1 134 ? 8.220   87.599  51.193  1.00 7.32  ? 134 ARG B CB  1 
ATOM   5635  C  CG  . ARG C 1 134 ? 7.919   86.827  49.915  1.00 9.67  ? 134 ARG B CG  1 
ATOM   5636  C  CD  . ARG C 1 134 ? 8.296   87.601  48.678  1.00 11.75 ? 134 ARG B CD  1 
ATOM   5637  N  NE  . ARG C 1 134 ? 7.628   87.081  47.488  1.00 10.64 ? 134 ARG B NE  1 
ATOM   5638  C  CZ  . ARG C 1 134 ? 7.857   87.517  46.254  1.00 8.98  ? 134 ARG B CZ  1 
ATOM   5639  N  NH1 . ARG C 1 134 ? 8.749   88.478  46.045  1.00 8.99  ? 134 ARG B NH1 1 
ATOM   5640  N  NH2 . ARG C 1 134 ? 7.174   87.018  45.235  1.00 6.55  ? 134 ARG B NH2 1 
ATOM   5641  N  N   . LEU C 1 135 ? 9.635   84.667  51.920  1.00 7.56  ? 135 LEU B N   1 
ATOM   5642  C  CA  . LEU C 1 135 ? 10.841  83.871  51.731  1.00 6.18  ? 135 LEU B CA  1 
ATOM   5643  C  C   . LEU C 1 135 ? 11.210  84.008  50.258  1.00 6.42  ? 135 LEU B C   1 
ATOM   5644  O  O   . LEU C 1 135 ? 10.465  83.571  49.382  1.00 7.84  ? 135 LEU B O   1 
ATOM   5645  C  CB  . LEU C 1 135 ? 10.587  82.401  52.073  1.00 4.68  ? 135 LEU B CB  1 
ATOM   5646  C  CG  . LEU C 1 135 ? 11.764  81.451  51.798  1.00 7.11  ? 135 LEU B CG  1 
ATOM   5647  C  CD1 . LEU C 1 135 ? 12.970  81.842  52.654  1.00 5.93  ? 135 LEU B CD1 1 
ATOM   5648  C  CD2 . LEU C 1 135 ? 11.343  80.012  52.086  1.00 8.32  ? 135 LEU B CD2 1 
ATOM   5649  N  N   . GLU C 1 136 ? 12.358  84.622  49.994  1.00 6.49  ? 136 GLU B N   1 
ATOM   5650  C  CA  . GLU C 1 136 ? 12.822  84.848  48.629  1.00 6.98  ? 136 GLU B CA  1 
ATOM   5651  C  C   . GLU C 1 136 ? 13.664  83.719  48.038  1.00 7.63  ? 136 GLU B C   1 
ATOM   5652  O  O   . GLU C 1 136 ? 13.493  83.355  46.870  1.00 8.57  ? 136 GLU B O   1 
ATOM   5653  C  CB  . GLU C 1 136 ? 13.632  86.149  48.570  1.00 8.59  ? 136 GLU B CB  1 
ATOM   5654  C  CG  . GLU C 1 136 ? 12.821  87.424  48.790  1.00 9.06  ? 136 GLU B CG  1 
ATOM   5655  C  CD  . GLU C 1 136 ? 11.962  87.791  47.596  1.00 8.99  ? 136 GLU B CD  1 
ATOM   5656  O  OE1 . GLU C 1 136 ? 12.095  87.139  46.537  1.00 9.60  ? 136 GLU B OE1 1 
ATOM   5657  O  OE2 . GLU C 1 136 ? 11.157  88.739  47.716  1.00 10.57 ? 136 GLU B OE2 1 
ATOM   5658  N  N   . ASP C 1 137 ? 14.569  83.158  48.831  1.00 6.90  ? 137 ASP B N   1 
ATOM   5659  C  CA  . ASP C 1 137 ? 15.443  82.112  48.307  1.00 8.04  ? 137 ASP B CA  1 
ATOM   5660  C  C   . ASP C 1 137 ? 15.962  81.186  49.399  1.00 7.86  ? 137 ASP B C   1 
ATOM   5661  O  O   . ASP C 1 137 ? 15.891  81.497  50.592  1.00 8.33  ? 137 ASP B O   1 
ATOM   5662  C  CB  . ASP C 1 137 ? 16.625  82.777  47.583  1.00 8.95  ? 137 ASP B CB  1 
ATOM   5663  C  CG  . ASP C 1 137 ? 17.299  81.865  46.569  1.00 8.03  ? 137 ASP B CG  1 
ATOM   5664  O  OD1 . ASP C 1 137 ? 16.881  80.702  46.404  1.00 7.27  ? 137 ASP B OD1 1 
ATOM   5665  O  OD2 . ASP C 1 137 ? 18.262  82.327  45.925  1.00 10.38 ? 137 ASP B OD2 1 
ATOM   5666  N  N   . LEU C 1 138 ? 16.488  80.043  48.971  1.00 7.59  ? 138 LEU B N   1 
ATOM   5667  C  CA  . LEU C 1 138 ? 17.046  79.047  49.871  1.00 9.49  ? 138 LEU B CA  1 
ATOM   5668  C  C   . LEU C 1 138 ? 18.304  78.466  49.247  1.00 9.58  ? 138 LEU B C   1 
ATOM   5669  O  O   . LEU C 1 138 ? 18.317  78.156  48.054  1.00 10.66 ? 138 LEU B O   1 
ATOM   5670  C  CB  . LEU C 1 138 ? 16.061  77.892  50.097  1.00 12.28 ? 138 LEU B CB  1 
ATOM   5671  C  CG  . LEU C 1 138 ? 14.854  78.001  51.029  1.00 14.76 ? 138 LEU B CG  1 
ATOM   5672  C  CD1 . LEU C 1 138 ? 14.042  76.707  50.940  1.00 13.87 ? 138 LEU B CD1 1 
ATOM   5673  C  CD2 . LEU C 1 138 ? 15.317  78.234  52.460  1.00 14.06 ? 138 LEU B CD2 1 
ATOM   5674  N  N   . ARG C 1 139 ? 19.360  78.332  50.044  1.00 7.70  ? 139 ARG B N   1 
ATOM   5675  C  CA  . ARG C 1 139 ? 20.595  77.725  49.557  1.00 7.30  ? 139 ARG B CA  1 
ATOM   5676  C  C   . ARG C 1 139 ? 20.554  76.302  50.106  1.00 8.23  ? 139 ARG B C   1 
ATOM   5677  O  O   . ARG C 1 139 ? 20.748  76.080  51.304  1.00 7.89  ? 139 ARG B O   1 
ATOM   5678  C  CB  . ARG C 1 139 ? 21.831  78.459  50.095  1.00 5.68  ? 139 ARG B CB  1 
ATOM   5679  C  CG  . ARG C 1 139 ? 23.165  78.051  49.433  1.00 8.53  ? 139 ARG B CG  1 
ATOM   5680  C  CD  . ARG C 1 139 ? 23.608  76.630  49.782  1.00 7.57  ? 139 ARG B CD  1 
ATOM   5681  N  NE  . ARG C 1 139 ? 24.007  76.486  51.181  1.00 9.08  ? 139 ARG B NE  1 
ATOM   5682  C  CZ  . ARG C 1 139 ? 25.193  76.840  51.666  1.00 9.44  ? 139 ARG B CZ  1 
ATOM   5683  N  NH1 . ARG C 1 139 ? 26.113  77.361  50.865  1.00 9.46  ? 139 ARG B NH1 1 
ATOM   5684  N  NH2 . ARG C 1 139 ? 25.461  76.678  52.955  1.00 7.55  ? 139 ARG B NH2 1 
ATOM   5685  N  N   . ILE C 1 140 ? 20.277  75.340  49.235  1.00 9.56  ? 140 ILE B N   1 
ATOM   5686  C  CA  . ILE C 1 140 ? 20.213  73.948  49.657  1.00 10.54 ? 140 ILE B CA  1 
ATOM   5687  C  C   . ILE C 1 140 ? 21.597  73.324  49.477  1.00 10.71 ? 140 ILE B C   1 
ATOM   5688  O  O   . ILE C 1 140 ? 22.065  73.143  48.354  1.00 12.47 ? 140 ILE B O   1 
ATOM   5689  C  CB  . ILE C 1 140 ? 19.171  73.179  48.830  1.00 11.63 ? 140 ILE B CB  1 
ATOM   5690  C  CG1 . ILE C 1 140 ? 17.822  73.902  48.924  1.00 14.25 ? 140 ILE B CG1 1 
ATOM   5691  C  CG2 . ILE C 1 140 ? 19.032  71.755  49.356  1.00 9.62  ? 140 ILE B CG2 1 
ATOM   5692  C  CD1 . ILE C 1 140 ? 16.790  73.405  47.952  1.00 18.05 ? 140 ILE B CD1 1 
ATOM   5693  N  N   . PRO C 1 141 ? 22.269  72.993  50.591  1.00 10.30 ? 141 PRO B N   1 
ATOM   5694  C  CA  . PRO C 1 141 ? 23.609  72.393  50.555  1.00 8.93  ? 141 PRO B CA  1 
ATOM   5695  C  C   . PRO C 1 141 ? 23.622  71.064  49.811  1.00 8.45  ? 141 PRO B C   1 
ATOM   5696  O  O   . PRO C 1 141 ? 22.651  70.308  49.868  1.00 7.13  ? 141 PRO B O   1 
ATOM   5697  C  CB  . PRO C 1 141 ? 23.958  72.248  52.035  1.00 9.55  ? 141 PRO B CB  1 
ATOM   5698  C  CG  . PRO C 1 141 ? 22.626  71.987  52.660  1.00 9.75  ? 141 PRO B CG  1 
ATOM   5699  C  CD  . PRO C 1 141 ? 21.729  72.987  51.963  1.00 10.86 ? 141 PRO B CD  1 
ATOM   5700  N  N   . VAL C 1 142 ? 24.721  70.777  49.116  1.00 8.34  ? 142 VAL B N   1 
ATOM   5701  C  CA  . VAL C 1 142 ? 24.812  69.537  48.353  1.00 9.43  ? 142 VAL B CA  1 
ATOM   5702  C  C   . VAL C 1 142 ? 24.647  68.284  49.209  1.00 9.57  ? 142 VAL B C   1 
ATOM   5703  O  O   . VAL C 1 142 ? 24.158  67.263  48.724  1.00 9.07  ? 142 VAL B O   1 
ATOM   5704  C  CB  . VAL C 1 142 ? 26.141  69.454  47.543  1.00 10.11 ? 142 VAL B CB  1 
ATOM   5705  C  CG1 . VAL C 1 142 ? 26.205  70.604  46.549  1.00 10.07 ? 142 VAL B CG1 1 
ATOM   5706  C  CG2 . VAL C 1 142 ? 27.347  69.493  48.468  1.00 9.05  ? 142 VAL B CG2 1 
ATOM   5707  N  N   . ALA C 1 143 ? 25.033  68.362  50.480  1.00 8.71  ? 143 ALA B N   1 
ATOM   5708  C  CA  . ALA C 1 143 ? 24.905  67.211  51.370  1.00 8.68  ? 143 ALA B CA  1 
ATOM   5709  C  C   . ALA C 1 143 ? 23.437  66.848  51.563  1.00 9.33  ? 143 ALA B C   1 
ATOM   5710  O  O   . ALA C 1 143 ? 23.101  65.677  51.731  1.00 9.77  ? 143 ALA B O   1 
ATOM   5711  C  CB  . ALA C 1 143 ? 25.551  67.506  52.723  1.00 8.09  ? 143 ALA B CB  1 
ATOM   5712  N  N   . TYR C 1 144 ? 22.568  67.856  51.548  1.00 7.50  ? 144 TYR B N   1 
ATOM   5713  C  CA  . TYR C 1 144 ? 21.137  67.620  51.713  1.00 7.65  ? 144 TYR B CA  1 
ATOM   5714  C  C   . TYR C 1 144 ? 20.512  67.230  50.375  1.00 5.75  ? 144 TYR B C   1 
ATOM   5715  O  O   . TYR C 1 144 ? 19.600  66.407  50.324  1.00 6.76  ? 144 TYR B O   1 
ATOM   5716  C  CB  . TYR C 1 144 ? 20.447  68.872  52.278  1.00 6.98  ? 144 TYR B CB  1 
ATOM   5717  C  CG  . TYR C 1 144 ? 19.045  68.622  52.807  1.00 7.87  ? 144 TYR B CG  1 
ATOM   5718  C  CD1 . TYR C 1 144 ? 18.787  67.569  53.689  1.00 8.48  ? 144 TYR B CD1 1 
ATOM   5719  C  CD2 . TYR C 1 144 ? 17.980  69.442  52.437  1.00 8.09  ? 144 TYR B CD2 1 
ATOM   5720  C  CE1 . TYR C 1 144 ? 17.500  67.339  54.186  1.00 8.12  ? 144 TYR B CE1 1 
ATOM   5721  C  CE2 . TYR C 1 144 ? 16.688  69.220  52.929  1.00 8.59  ? 144 TYR B CE2 1 
ATOM   5722  C  CZ  . TYR C 1 144 ? 16.459  68.168  53.799  1.00 7.33  ? 144 TYR B CZ  1 
ATOM   5723  O  OH  . TYR C 1 144 ? 15.185  67.936  54.265  1.00 9.51  ? 144 TYR B OH  1 
ATOM   5724  N  N   . VAL C 1 145 ? 21.011  67.821  49.294  1.00 6.71  ? 145 VAL B N   1 
ATOM   5725  C  CA  . VAL C 1 145 ? 20.503  67.519  47.953  1.00 7.44  ? 145 VAL B CA  1 
ATOM   5726  C  C   . VAL C 1 145 ? 20.630  66.027  47.654  1.00 8.13  ? 145 VAL B C   1 
ATOM   5727  O  O   . VAL C 1 145 ? 19.746  65.436  47.030  1.00 9.42  ? 145 VAL B O   1 
ATOM   5728  C  CB  . VAL C 1 145 ? 21.276  68.306  46.852  1.00 6.39  ? 145 VAL B CB  1 
ATOM   5729  C  CG1 . VAL C 1 145 ? 20.906  67.780  45.462  1.00 6.48  ? 145 VAL B CG1 1 
ATOM   5730  C  CG2 . VAL C 1 145 ? 20.949  69.786  46.941  1.00 7.83  ? 145 VAL B CG2 1 
ATOM   5731  N  N   . LYS C 1 146 ? 21.724  65.420  48.109  1.00 8.37  ? 146 LYS B N   1 
ATOM   5732  C  CA  . LYS C 1 146 ? 21.961  63.998  47.865  1.00 8.00  ? 146 LYS B CA  1 
ATOM   5733  C  C   . LYS C 1 146 ? 21.021  63.049  48.602  1.00 8.34  ? 146 LYS B C   1 
ATOM   5734  O  O   . LYS C 1 146 ? 21.043  61.845  48.348  1.00 7.78  ? 146 LYS B O   1 
ATOM   5735  C  CB  . LYS C 1 146 ? 23.413  63.632  48.194  1.00 7.45  ? 146 LYS B CB  1 
ATOM   5736  C  CG  . LYS C 1 146 ? 24.439  64.214  47.229  1.00 9.07  ? 146 LYS B CG  1 
ATOM   5737  C  CD  . LYS C 1 146 ? 24.286  63.656  45.809  1.00 8.37  ? 146 LYS B CD  1 
ATOM   5738  C  CE  . LYS C 1 146 ? 24.521  62.153  45.764  1.00 10.62 ? 146 LYS B CE  1 
ATOM   5739  N  NZ  . LYS C 1 146 ? 24.459  61.617  44.372  1.00 10.09 ? 146 LYS B NZ  1 
ATOM   5740  N  N   . THR C 1 147 ? 20.201  63.570  49.513  1.00 8.30  ? 147 THR B N   1 
ATOM   5741  C  CA  . THR C 1 147 ? 19.269  62.704  50.233  1.00 6.32  ? 147 THR B CA  1 
ATOM   5742  C  C   . THR C 1 147 ? 17.940  62.567  49.482  1.00 6.69  ? 147 THR B C   1 
ATOM   5743  O  O   . THR C 1 147 ? 17.057  61.824  49.910  1.00 4.87  ? 147 THR B O   1 
ATOM   5744  C  CB  . THR C 1 147 ? 18.976  63.218  51.670  1.00 6.00  ? 147 THR B CB  1 
ATOM   5745  O  OG1 . THR C 1 147 ? 18.163  64.398  51.613  1.00 7.58  ? 147 THR B OG1 1 
ATOM   5746  C  CG2 . THR C 1 147 ? 20.268  63.536  52.393  1.00 3.41  ? 147 THR B CG2 1 
ATOM   5747  N  N   . PHE C 1 148 ? 17.809  63.273  48.361  1.00 7.42  ? 148 PHE B N   1 
ATOM   5748  C  CA  . PHE C 1 148 ? 16.586  63.224  47.555  1.00 7.63  ? 148 PHE B CA  1 
ATOM   5749  C  C   . PHE C 1 148 ? 16.805  62.465  46.253  1.00 9.18  ? 148 PHE B C   1 
ATOM   5750  O  O   . PHE C 1 148 ? 17.921  62.399  45.746  1.00 9.54  ? 148 PHE B O   1 
ATOM   5751  C  CB  . PHE C 1 148 ? 16.107  64.633  47.190  1.00 5.54  ? 148 PHE B CB  1 
ATOM   5752  C  CG  . PHE C 1 148 ? 15.668  65.458  48.360  1.00 6.43  ? 148 PHE B CG  1 
ATOM   5753  C  CD1 . PHE C 1 148 ? 16.600  66.122  49.153  1.00 5.45  ? 148 PHE B CD1 1 
ATOM   5754  C  CD2 . PHE C 1 148 ? 14.317  65.571  48.672  1.00 6.41  ? 148 PHE B CD2 1 
ATOM   5755  C  CE1 . PHE C 1 148 ? 16.185  66.898  50.243  1.00 6.37  ? 148 PHE B CE1 1 
ATOM   5756  C  CE2 . PHE C 1 148 ? 13.893  66.342  49.760  1.00 9.24  ? 148 PHE B CE2 1 
ATOM   5757  C  CZ  . PHE C 1 148 ? 14.832  67.004  50.547  1.00 7.61  ? 148 PHE B CZ  1 
ATOM   5758  N  N   . GLN C 1 149 ? 15.731  61.906  45.704  1.00 9.67  ? 149 GLN B N   1 
ATOM   5759  C  CA  . GLN C 1 149 ? 15.830  61.188  44.438  1.00 10.06 ? 149 GLN B CA  1 
ATOM   5760  C  C   . GLN C 1 149 ? 15.904  62.186  43.287  1.00 9.88  ? 149 GLN B C   1 
ATOM   5761  O  O   . GLN C 1 149 ? 16.631  61.970  42.315  1.00 10.08 ? 149 GLN B O   1 
ATOM   5762  C  CB  . GLN C 1 149 ? 14.612  60.283  44.220  1.00 11.39 ? 149 GLN B CB  1 
ATOM   5763  C  CG  . GLN C 1 149 ? 14.516  59.749  42.788  1.00 12.49 ? 149 GLN B CG  1 
ATOM   5764  C  CD  . GLN C 1 149 ? 13.142  59.201  42.440  1.00 12.69 ? 149 GLN B CD  1 
ATOM   5765  O  OE1 . GLN C 1 149 ? 12.777  58.101  42.847  1.00 11.63 ? 149 GLN B OE1 1 
ATOM   5766  N  NE2 . GLN C 1 149 ? 12.368  59.979  41.688  1.00 10.90 ? 149 GLN B NE2 1 
ATOM   5767  N  N   . GLY C 1 150 ? 15.147  63.274  43.402  1.00 8.51  ? 150 GLY B N   1 
ATOM   5768  C  CA  . GLY C 1 150 ? 15.113  64.272  42.350  1.00 8.45  ? 150 GLY B CA  1 
ATOM   5769  C  C   . GLY C 1 150 ? 14.159  63.822  41.257  1.00 7.73  ? 150 GLY B C   1 
ATOM   5770  O  O   . GLY C 1 150 ? 13.347  62.927  41.487  1.00 8.12  ? 150 GLY B O   1 
ATOM   5771  N  N   . PRO C 1 151 ? 14.225  64.418  40.056  1.00 7.24  ? 151 PRO B N   1 
ATOM   5772  C  CA  . PRO C 1 151 ? 13.335  64.025  38.959  1.00 6.63  ? 151 PRO B CA  1 
ATOM   5773  C  C   . PRO C 1 151 ? 13.412  62.523  38.668  1.00 7.94  ? 151 PRO B C   1 
ATOM   5774  O  O   . PRO C 1 151 ? 14.485  61.922  38.741  1.00 7.90  ? 151 PRO B O   1 
ATOM   5775  C  CB  . PRO C 1 151 ? 13.850  64.859  37.791  1.00 7.01  ? 151 PRO B CB  1 
ATOM   5776  C  CG  . PRO C 1 151 ? 14.318  66.111  38.464  1.00 6.45  ? 151 PRO B CG  1 
ATOM   5777  C  CD  . PRO C 1 151 ? 15.057  65.572  39.671  1.00 6.07  ? 151 PRO B CD  1 
ATOM   5778  N  N   . PRO C 1 152 ? 12.271  61.895  38.343  1.00 8.00  ? 152 PRO B N   1 
ATOM   5779  C  CA  . PRO C 1 152 ? 12.288  60.460  38.048  1.00 8.02  ? 152 PRO B CA  1 
ATOM   5780  C  C   . PRO C 1 152 ? 13.201  60.169  36.859  1.00 9.92  ? 152 PRO B C   1 
ATOM   5781  O  O   . PRO C 1 152 ? 13.829  59.110  36.779  1.00 9.96  ? 152 PRO B O   1 
ATOM   5782  C  CB  . PRO C 1 152 ? 10.824  60.157  37.725  1.00 9.44  ? 152 PRO B CB  1 
ATOM   5783  C  CG  . PRO C 1 152 ? 10.078  61.156  38.558  1.00 9.30  ? 152 PRO B CG  1 
ATOM   5784  C  CD  . PRO C 1 152 ? 10.891  62.414  38.348  1.00 8.04  ? 152 PRO B CD  1 
ATOM   5785  N  N   . HIS C 1 153 ? 13.273  61.120  35.932  1.00 8.19  ? 153 HIS B N   1 
ATOM   5786  C  CA  . HIS C 1 153 ? 14.103  60.943  34.750  1.00 8.50  ? 153 HIS B CA  1 
ATOM   5787  C  C   . HIS C 1 153 ? 14.969  62.146  34.387  1.00 8.30  ? 153 HIS B C   1 
ATOM   5788  O  O   . HIS C 1 153 ? 16.191  62.024  34.317  1.00 9.41  ? 153 HIS B O   1 
ATOM   5789  C  CB  . HIS C 1 153 ? 13.224  60.525  33.566  1.00 7.25  ? 153 HIS B CB  1 
ATOM   5790  C  CG  . HIS C 1 153 ? 12.474  59.250  33.809  1.00 7.27  ? 153 HIS B CG  1 
ATOM   5791  N  ND1 . HIS C 1 153 ? 11.187  59.225  34.305  1.00 7.06  ? 153 HIS B ND1 1 
ATOM   5792  C  CD2 . HIS C 1 153 ? 12.868  57.958  33.720  1.00 6.37  ? 153 HIS B CD2 1 
ATOM   5793  C  CE1 . HIS C 1 153 ? 10.823  57.974  34.514  1.00 6.86  ? 153 HIS B CE1 1 
ATOM   5794  N  NE2 . HIS C 1 153 ? 11.824  57.183  34.169  1.00 8.50  ? 153 HIS B NE2 1 
ATOM   5795  N  N   . GLY C 1 154 ? 14.350  63.303  34.168  1.00 8.28  ? 154 GLY B N   1 
ATOM   5796  C  CA  . GLY C 1 154 ? 15.121  64.483  33.812  1.00 6.66  ? 154 GLY B CA  1 
ATOM   5797  C  C   . GLY C 1 154 ? 15.219  64.699  32.311  1.00 8.06  ? 154 GLY B C   1 
ATOM   5798  O  O   . GLY C 1 154 ? 14.955  63.787  31.530  1.00 7.88  ? 154 GLY B O   1 
ATOM   5799  N  N   . ILE C 1 155 ? 15.623  65.905  31.916  1.00 7.60  ? 155 ILE B N   1 
ATOM   5800  C  CA  . ILE C 1 155 ? 15.740  66.299  30.510  1.00 7.79  ? 155 ILE B CA  1 
ATOM   5801  C  C   . ILE C 1 155 ? 16.407  65.307  29.562  1.00 9.31  ? 155 ILE B C   1 
ATOM   5802  O  O   . ILE C 1 155 ? 15.811  64.901  28.560  1.00 8.80  ? 155 ILE B O   1 
ATOM   5803  C  CB  . ILE C 1 155 ? 16.474  67.659  30.384  1.00 9.82  ? 155 ILE B CB  1 
ATOM   5804  C  CG1 . ILE C 1 155 ? 15.698  68.741  31.138  1.00 7.90  ? 155 ILE B CG1 1 
ATOM   5805  C  CG2 . ILE C 1 155 ? 16.614  68.051  28.916  1.00 7.89  ? 155 ILE B CG2 1 
ATOM   5806  C  CD1 . ILE C 1 155 ? 16.412  70.084  31.192  1.00 9.03  ? 155 ILE B CD1 1 
ATOM   5807  N  N   . GLN C 1 156 ? 17.648  64.930  29.854  1.00 8.60  ? 156 GLN B N   1 
ATOM   5808  C  CA  . GLN C 1 156 ? 18.371  63.995  28.996  1.00 8.08  ? 156 GLN B CA  1 
ATOM   5809  C  C   . GLN C 1 156 ? 17.607  62.689  28.740  1.00 6.97  ? 156 GLN B C   1 
ATOM   5810  O  O   . GLN C 1 156 ? 17.378  62.302  27.593  1.00 6.67  ? 156 GLN B O   1 
ATOM   5811  C  CB  . GLN C 1 156 ? 19.728  63.661  29.616  1.00 9.30  ? 156 GLN B CB  1 
ATOM   5812  C  CG  . GLN C 1 156 ? 20.572  62.702  28.790  1.00 12.04 ? 156 GLN B CG  1 
ATOM   5813  C  CD  . GLN C 1 156 ? 21.532  61.900  29.646  1.00 13.32 ? 156 GLN B CD  1 
ATOM   5814  O  OE1 . GLN C 1 156 ? 21.142  60.914  30.275  1.00 16.28 ? 156 GLN B OE1 1 
ATOM   5815  N  NE2 . GLN C 1 156 ? 22.790  62.328  29.690  1.00 11.55 ? 156 GLN B NE2 1 
ATOM   5816  N  N   . VAL C 1 157 ? 17.230  62.012  29.818  1.00 6.67  ? 157 VAL B N   1 
ATOM   5817  C  CA  . VAL C 1 157 ? 16.520  60.740  29.726  1.00 5.85  ? 157 VAL B CA  1 
ATOM   5818  C  C   . VAL C 1 157 ? 15.178  60.866  29.009  1.00 7.06  ? 157 VAL B C   1 
ATOM   5819  O  O   . VAL C 1 157 ? 14.803  59.993  28.222  1.00 7.74  ? 157 VAL B O   1 
ATOM   5820  C  CB  . VAL C 1 157 ? 16.305  60.131  31.139  1.00 6.85  ? 157 VAL B CB  1 
ATOM   5821  C  CG1 . VAL C 1 157 ? 15.483  58.848  31.047  1.00 7.37  ? 157 VAL B CG1 1 
ATOM   5822  C  CG2 . VAL C 1 157 ? 17.660  59.842  31.782  1.00 6.61  ? 157 VAL B CG2 1 
ATOM   5823  N  N   . GLU C 1 158 ? 14.456  61.951  29.269  1.00 6.60  ? 158 GLU B N   1 
ATOM   5824  C  CA  . GLU C 1 158 ? 13.165  62.143  28.621  1.00 5.66  ? 158 GLU B CA  1 
ATOM   5825  C  C   . GLU C 1 158 ? 13.319  62.251  27.114  1.00 5.39  ? 158 GLU B C   1 
ATOM   5826  O  O   . GLU C 1 158 ? 12.606  61.585  26.362  1.00 6.30  ? 158 GLU B O   1 
ATOM   5827  C  CB  . GLU C 1 158 ? 12.458  63.394  29.149  1.00 4.61  ? 158 GLU B CB  1 
ATOM   5828  C  CG  . GLU C 1 158 ? 11.147  63.669  28.427  1.00 4.71  ? 158 GLU B CG  1 
ATOM   5829  C  CD  . GLU C 1 158 ? 10.245  64.639  29.161  1.00 8.02  ? 158 GLU B CD  1 
ATOM   5830  O  OE1 . GLU C 1 158 ? 10.569  65.021  30.304  1.00 9.76  ? 158 GLU B OE1 1 
ATOM   5831  O  OE2 . GLU C 1 158 ? 9.201   65.015  28.592  1.00 9.97  ? 158 GLU B OE2 1 
ATOM   5832  N  N   . ARG C 1 159 ? 14.245  63.096  26.672  1.00 5.57  ? 159 ARG B N   1 
ATOM   5833  C  CA  . ARG C 1 159 ? 14.480  63.255  25.241  1.00 6.33  ? 159 ARG B CA  1 
ATOM   5834  C  C   . ARG C 1 159 ? 14.892  61.921  24.621  1.00 7.53  ? 159 ARG B C   1 
ATOM   5835  O  O   . ARG C 1 159 ? 14.487  61.604  23.501  1.00 7.78  ? 159 ARG B O   1 
ATOM   5836  C  CB  . ARG C 1 159 ? 15.566  64.309  24.983  1.00 7.38  ? 159 ARG B CB  1 
ATOM   5837  C  CG  . ARG C 1 159 ? 15.087  65.747  25.131  1.00 5.99  ? 159 ARG B CG  1 
ATOM   5838  C  CD  . ARG C 1 159 ? 16.170  66.720  24.702  1.00 7.36  ? 159 ARG B CD  1 
ATOM   5839  N  NE  . ARG C 1 159 ? 15.696  68.099  24.676  1.00 10.12 ? 159 ARG B NE  1 
ATOM   5840  C  CZ  . ARG C 1 159 ? 14.851  68.583  23.771  1.00 9.11  ? 159 ARG B CZ  1 
ATOM   5841  N  NH1 . ARG C 1 159 ? 14.383  67.799  22.809  1.00 8.28  ? 159 ARG B NH1 1 
ATOM   5842  N  NH2 . ARG C 1 159 ? 14.478  69.853  23.821  1.00 10.15 ? 159 ARG B NH2 1 
ATOM   5843  N  N   . ASP C 1 160 ? 15.696  61.144  25.350  1.00 7.70  ? 160 ASP B N   1 
ATOM   5844  C  CA  . ASP C 1 160 ? 16.156  59.845  24.864  1.00 7.77  ? 160 ASP B CA  1 
ATOM   5845  C  C   . ASP C 1 160 ? 15.032  58.807  24.782  1.00 9.16  ? 160 ASP B C   1 
ATOM   5846  O  O   . ASP C 1 160 ? 15.011  57.983  23.869  1.00 8.03  ? 160 ASP B O   1 
ATOM   5847  C  CB  . ASP C 1 160 ? 17.289  59.292  25.745  1.00 7.31  ? 160 ASP B CB  1 
ATOM   5848  C  CG  . ASP C 1 160 ? 18.598  60.046  25.563  1.00 9.03  ? 160 ASP B CG  1 
ATOM   5849  O  OD1 . ASP C 1 160 ? 18.764  60.705  24.514  1.00 7.75  ? 160 ASP B OD1 1 
ATOM   5850  O  OD2 . ASP C 1 160 ? 19.466  59.966  26.463  1.00 9.21  ? 160 ASP B OD2 1 
ATOM   5851  N  N   . LYS C 1 161 ? 14.109  58.838  25.737  1.00 8.19  ? 161 LYS B N   1 
ATOM   5852  C  CA  . LYS C 1 161 ? 12.992  57.891  25.736  1.00 10.23 ? 161 LYS B CA  1 
ATOM   5853  C  C   . LYS C 1 161 ? 12.007  58.207  24.609  1.00 9.68  ? 161 LYS B C   1 
ATOM   5854  O  O   . LYS C 1 161 ? 11.508  57.305  23.937  1.00 9.51  ? 161 LYS B O   1 
ATOM   5855  C  CB  . LYS C 1 161 ? 12.243  57.942  27.073  1.00 10.71 ? 161 LYS B CB  1 
ATOM   5856  C  CG  . LYS C 1 161 ? 13.005  57.408  28.286  1.00 13.04 ? 161 LYS B CG  1 
ATOM   5857  C  CD  . LYS C 1 161 ? 12.973  55.891  28.358  1.00 14.75 ? 161 LYS B CD  1 
ATOM   5858  C  CE  . LYS C 1 161 ? 13.613  55.372  29.648  1.00 15.70 ? 161 LYS B CE  1 
ATOM   5859  N  NZ  . LYS C 1 161 ? 12.869  55.782  30.880  1.00 12.72 ? 161 LYS B NZ  1 
ATOM   5860  N  N   . LEU C 1 162 ? 11.735  59.494  24.410  1.00 9.74  ? 162 LEU B N   1 
ATOM   5861  C  CA  . LEU C 1 162 ? 10.789  59.936  23.389  1.00 9.51  ? 162 LEU B CA  1 
ATOM   5862  C  C   . LEU C 1 162 ? 11.415  60.128  22.015  1.00 10.61 ? 162 LEU B C   1 
ATOM   5863  O  O   . LEU C 1 162 ? 10.703  60.310  21.025  1.00 9.02  ? 162 LEU B O   1 
ATOM   5864  C  CB  . LEU C 1 162 ? 10.124  61.242  23.827  1.00 10.16 ? 162 LEU B CB  1 
ATOM   5865  C  CG  . LEU C 1 162 ? 9.402   61.195  25.174  1.00 12.83 ? 162 LEU B CG  1 
ATOM   5866  C  CD1 . LEU C 1 162 ? 8.808   62.565  25.481  1.00 12.22 ? 162 LEU B CD1 1 
ATOM   5867  C  CD2 . LEU C 1 162 ? 8.315   60.123  25.136  1.00 13.31 ? 162 LEU B CD2 1 
ATOM   5868  N  N   . ASN C 1 163 ? 12.745  60.098  21.967  1.00 10.07 ? 163 ASN B N   1 
ATOM   5869  C  CA  . ASN C 1 163 ? 13.484  60.254  20.719  1.00 11.96 ? 163 ASN B CA  1 
ATOM   5870  C  C   . ASN C 1 163 ? 13.208  61.615  20.070  1.00 11.61 ? 163 ASN B C   1 
ATOM   5871  O  O   . ASN C 1 163 ? 13.069  61.715  18.852  1.00 14.54 ? 163 ASN B O   1 
ATOM   5872  C  CB  . ASN C 1 163 ? 13.109  59.115  19.763  1.00 12.46 ? 163 ASN B CB  1 
ATOM   5873  C  CG  . ASN C 1 163 ? 14.198  58.819  18.744  1.00 14.91 ? 163 ASN B CG  1 
ATOM   5874  O  OD1 . ASN C 1 163 ? 15.390  58.909  19.045  1.00 16.61 ? 163 ASN B OD1 1 
ATOM   5875  N  ND2 . ASN C 1 163 ? 13.791  58.439  17.537  1.00 15.61 ? 163 ASN B ND2 1 
ATOM   5876  N  N   . LYS C 1 164 ? 13.132  62.657  20.892  1.00 9.96  ? 164 LYS B N   1 
ATOM   5877  C  CA  . LYS C 1 164 ? 12.880  64.010  20.412  1.00 9.58  ? 164 LYS B CA  1 
ATOM   5878  C  C   . LYS C 1 164 ? 14.059  64.933  20.733  1.00 9.63  ? 164 LYS B C   1 
ATOM   5879  O  O   . LYS C 1 164 ? 14.449  65.071  21.895  1.00 9.86  ? 164 LYS B O   1 
ATOM   5880  C  CB  . LYS C 1 164 ? 11.586  64.543  21.037  1.00 8.95  ? 164 LYS B CB  1 
ATOM   5881  C  CG  . LYS C 1 164 ? 10.367  63.715  20.640  1.00 9.50  ? 164 LYS B CG  1 
ATOM   5882  C  CD  . LYS C 1 164 ? 9.096   64.217  21.281  1.00 7.65  ? 164 LYS B CD  1 
ATOM   5883  C  CE  . LYS C 1 164 ? 7.921   63.295  20.965  1.00 7.63  ? 164 LYS B CE  1 
ATOM   5884  N  NZ  . LYS C 1 164 ? 7.538   63.299  19.517  1.00 5.79  ? 164 LYS B NZ  1 
ATOM   5885  N  N   . TYR C 1 165 ? 14.615  65.566  19.697  1.00 8.47  ? 165 TYR B N   1 
ATOM   5886  C  CA  . TYR C 1 165 ? 15.766  66.461  19.850  1.00 9.29  ? 165 TYR B CA  1 
ATOM   5887  C  C   . TYR C 1 165 ? 15.734  67.669  18.916  1.00 9.33  ? 165 TYR B C   1 
ATOM   5888  O  O   . TYR C 1 165 ? 15.063  67.654  17.884  1.00 9.29  ? 165 TYR B O   1 
ATOM   5889  C  CB  . TYR C 1 165 ? 17.066  65.710  19.544  1.00 10.13 ? 165 TYR B CB  1 
ATOM   5890  C  CG  . TYR C 1 165 ? 17.226  64.374  20.225  1.00 10.42 ? 165 TYR B CG  1 
ATOM   5891  C  CD1 . TYR C 1 165 ? 17.617  64.290  21.560  1.00 8.93  ? 165 TYR B CD1 1 
ATOM   5892  C  CD2 . TYR C 1 165 ? 17.012  63.185  19.522  1.00 9.90  ? 165 TYR B CD2 1 
ATOM   5893  C  CE1 . TYR C 1 165 ? 17.804  63.050  22.182  1.00 10.34 ? 165 TYR B CE1 1 
ATOM   5894  C  CE2 . TYR C 1 165 ? 17.195  61.943  20.132  1.00 10.41 ? 165 TYR B CE2 1 
ATOM   5895  C  CZ  . TYR C 1 165 ? 17.591  61.884  21.459  1.00 9.75  ? 165 TYR B CZ  1 
ATOM   5896  O  OH  . TYR C 1 165 ? 17.798  60.662  22.050  1.00 11.24 ? 165 TYR B OH  1 
ATOM   5897  N  N   . GLY C 1 166 ? 16.486  68.704  19.286  1.00 10.69 ? 166 GLY B N   1 
ATOM   5898  C  CA  . GLY C 1 166 ? 16.614  69.892  18.457  1.00 9.84  ? 166 GLY B CA  1 
ATOM   5899  C  C   . GLY C 1 166 ? 15.521  70.943  18.405  1.00 11.13 ? 166 GLY B C   1 
ATOM   5900  O  O   . GLY C 1 166 ? 15.541  71.798  17.517  1.00 10.25 ? 166 GLY B O   1 
ATOM   5901  N  N   . ARG C 1 167 ? 14.574  70.901  19.336  1.00 10.40 ? 167 ARG B N   1 
ATOM   5902  C  CA  . ARG C 1 167 ? 13.490  71.885  19.343  1.00 9.74  ? 167 ARG B CA  1 
ATOM   5903  C  C   . ARG C 1 167 ? 12.678  71.774  20.616  1.00 8.22  ? 167 ARG B C   1 
ATOM   5904  O  O   . ARG C 1 167 ? 12.729  70.758  21.307  1.00 7.68  ? 167 ARG B O   1 
ATOM   5905  C  CB  . ARG C 1 167 ? 12.540  71.654  18.160  1.00 9.29  ? 167 ARG B CB  1 
ATOM   5906  C  CG  . ARG C 1 167 ? 11.663  70.402  18.318  1.00 11.13 ? 167 ARG B CG  1 
ATOM   5907  C  CD  . ARG C 1 167 ? 10.663  70.229  17.172  1.00 9.24  ? 167 ARG B CD  1 
ATOM   5908  N  NE  . ARG C 1 167 ? 10.033  68.907  17.194  1.00 9.46  ? 167 ARG B NE  1 
ATOM   5909  C  CZ  . ARG C 1 167 ? 8.995   68.563  17.956  1.00 11.45 ? 167 ARG B CZ  1 
ATOM   5910  N  NH1 . ARG C 1 167 ? 8.435   69.443  18.775  1.00 7.53  ? 167 ARG B NH1 1 
ATOM   5911  N  NH2 . ARG C 1 167 ? 8.522   67.321  17.911  1.00 7.61  ? 167 ARG B NH2 1 
ATOM   5912  N  N   . PRO C 1 168 ? 11.930  72.832  20.958  1.00 8.94  ? 168 PRO B N   1 
ATOM   5913  C  CA  . PRO C 1 168 ? 11.116  72.756  22.171  1.00 7.37  ? 168 PRO B CA  1 
ATOM   5914  C  C   . PRO C 1 168 ? 10.032  71.713  21.890  1.00 7.76  ? 168 PRO B C   1 
ATOM   5915  O  O   . PRO C 1 168 ? 9.729   71.433  20.728  1.00 8.68  ? 168 PRO B O   1 
ATOM   5916  C  CB  . PRO C 1 168 ? 10.527  74.161  22.277  1.00 5.89  ? 168 PRO B CB  1 
ATOM   5917  C  CG  . PRO C 1 168 ? 11.595  75.023  21.652  1.00 7.57  ? 168 PRO B CG  1 
ATOM   5918  C  CD  . PRO C 1 168 ? 11.979  74.211  20.438  1.00 7.75  ? 168 PRO B CD  1 
ATOM   5919  N  N   . LEU C 1 169 ? 9.472   71.124  22.939  1.00 8.19  ? 169 LEU B N   1 
ATOM   5920  C  CA  . LEU C 1 169 ? 8.402   70.146  22.778  1.00 8.30  ? 169 LEU B CA  1 
ATOM   5921  C  C   . LEU C 1 169 ? 7.083   70.930  22.719  1.00 9.09  ? 169 LEU B C   1 
ATOM   5922  O  O   . LEU C 1 169 ? 7.023   72.070  23.181  1.00 8.97  ? 169 LEU B O   1 
ATOM   5923  C  CB  . LEU C 1 169 ? 8.410   69.169  23.954  1.00 9.73  ? 169 LEU B CB  1 
ATOM   5924  C  CG  . LEU C 1 169 ? 9.325   67.936  23.850  1.00 14.66 ? 169 LEU B CG  1 
ATOM   5925  C  CD1 . LEU C 1 169 ? 10.679  68.319  23.226  1.00 18.28 ? 169 LEU B CD1 1 
ATOM   5926  C  CD2 . LEU C 1 169 ? 9.455   67.285  25.251  1.00 17.06 ? 169 LEU B CD2 1 
ATOM   5927  N  N   . LEU C 1 170 ? 6.040   70.337  22.141  1.00 8.46  ? 170 LEU B N   1 
ATOM   5928  C  CA  . LEU C 1 170 ? 4.746   71.015  22.011  1.00 9.44  ? 170 LEU B CA  1 
ATOM   5929  C  C   . LEU C 1 170 ? 3.612   70.276  22.701  1.00 9.43  ? 170 LEU B C   1 
ATOM   5930  O  O   . LEU C 1 170 ? 3.436   69.073  22.502  1.00 10.17 ? 170 LEU B O   1 
ATOM   5931  C  CB  . LEU C 1 170 ? 4.393   71.204  20.533  1.00 10.07 ? 170 LEU B CB  1 
ATOM   5932  C  CG  . LEU C 1 170 ? 5.156   72.278  19.756  1.00 11.40 ? 170 LEU B CG  1 
ATOM   5933  C  CD1 . LEU C 1 170 ? 4.807   72.197  18.273  1.00 11.90 ? 170 LEU B CD1 1 
ATOM   5934  C  CD2 . LEU C 1 170 ? 4.801   73.651  20.311  1.00 12.32 ? 170 LEU B CD2 1 
ATOM   5935  N  N   . GLY C 1 171 ? 2.843   71.013  23.502  1.00 9.07  ? 171 GLY B N   1 
ATOM   5936  C  CA  . GLY C 1 171 ? 1.727   70.431  24.227  1.00 8.79  ? 171 GLY B CA  1 
ATOM   5937  C  C   . GLY C 1 171 ? 0.431   71.201  24.038  1.00 9.64  ? 171 GLY B C   1 
ATOM   5938  O  O   . GLY C 1 171 ? 0.392   72.199  23.310  1.00 9.56  ? 171 GLY B O   1 
ATOM   5939  N  N   . CYS C 1 172 ? -0.626  70.747  24.707  1.00 10.01 ? 172 CYS B N   1 
ATOM   5940  C  CA  . CYS C 1 172 ? -1.939  71.374  24.593  1.00 9.99  ? 172 CYS B CA  1 
ATOM   5941  C  C   . CYS C 1 172 ? -2.929  70.876  25.640  1.00 9.22  ? 172 CYS B C   1 
ATOM   5942  O  O   . CYS C 1 172 ? -3.086  69.674  25.834  1.00 9.15  ? 172 CYS B O   1 
ATOM   5943  C  CB  . CYS C 1 172 ? -2.515  71.101  23.197  1.00 12.15 ? 172 CYS B CB  1 
ATOM   5944  S  SG  . CYS C 1 172 ? -4.323  71.287  23.041  1.00 13.27 ? 172 CYS B SG  1 
ATOM   5945  N  N   . THR C 1 173 ? -3.602  71.803  26.314  1.00 8.96  ? 173 THR B N   1 
ATOM   5946  C  CA  . THR C 1 173 ? -4.600  71.426  27.309  1.00 7.75  ? 173 THR B CA  1 
ATOM   5947  C  C   . THR C 1 173 ? -5.949  71.352  26.607  1.00 7.89  ? 173 THR B C   1 
ATOM   5948  O  O   . THR C 1 173 ? -6.311  72.253  25.854  1.00 8.80  ? 173 THR B O   1 
ATOM   5949  C  CB  . THR C 1 173 ? -4.726  72.470  28.446  1.00 6.94  ? 173 THR B CB  1 
ATOM   5950  O  OG1 . THR C 1 173 ? -3.437  72.725  29.013  1.00 8.62  ? 173 THR B OG1 1 
ATOM   5951  C  CG2 . THR C 1 173 ? -5.669  71.953  29.537  1.00 5.90  ? 173 THR B CG2 1 
ATOM   5952  N  N   . ILE C 1 174 ? -6.690  70.280  26.859  1.00 8.78  ? 174 ILE B N   1 
ATOM   5953  C  CA  . ILE C 1 174 ? -8.007  70.098  26.263  1.00 9.08  ? 174 ILE B CA  1 
ATOM   5954  C  C   . ILE C 1 174 ? -9.001  71.064  26.916  1.00 8.86  ? 174 ILE B C   1 
ATOM   5955  O  O   . ILE C 1 174 ? -8.923  71.327  28.117  1.00 9.16  ? 174 ILE B O   1 
ATOM   5956  C  CB  . ILE C 1 174 ? -8.494  68.635  26.458  1.00 8.73  ? 174 ILE B CB  1 
ATOM   5957  C  CG1 . ILE C 1 174 ? -7.488  67.670  25.822  1.00 9.29  ? 174 ILE B CG1 1 
ATOM   5958  C  CG2 . ILE C 1 174 ? -9.875  68.441  25.843  1.00 6.75  ? 174 ILE B CG2 1 
ATOM   5959  C  CD1 . ILE C 1 174 ? -7.229  67.918  24.329  1.00 10.66 ? 174 ILE B CD1 1 
ATOM   5960  N  N   . LYS C 1 175 ? -9.919  71.601  26.117  1.00 8.55  ? 175 LYS B N   1 
ATOM   5961  C  CA  . LYS C 1 175 ? -10.939 72.530  26.609  1.00 8.81  ? 175 LYS B CA  1 
ATOM   5962  C  C   . LYS C 1 175 ? -12.300 72.117  26.036  1.00 9.39  ? 175 LYS B C   1 
ATOM   5963  O  O   . LYS C 1 175 ? -12.367 71.455  24.998  1.00 9.52  ? 175 LYS B O   1 
ATOM   5964  C  CB  . LYS C 1 175 ? -10.618 73.966  26.175  1.00 8.51  ? 175 LYS B CB  1 
ATOM   5965  C  CG  . LYS C 1 175 ? -9.237  74.480  26.591  1.00 6.18  ? 175 LYS B CG  1 
ATOM   5966  C  CD  . LYS C 1 175 ? -9.106  74.662  28.108  1.00 7.71  ? 175 LYS B CD  1 
ATOM   5967  C  CE  . LYS C 1 175 ? -7.649  74.932  28.490  1.00 7.13  ? 175 LYS B CE  1 
ATOM   5968  N  NZ  . LYS C 1 175 ? -7.452  75.243  29.929  1.00 5.94  ? 175 LYS B NZ  1 
ATOM   5969  N  N   . PRO C 1 176 ? -13.405 72.497  26.704  1.00 9.04  ? 176 PRO B N   1 
ATOM   5970  C  CA  . PRO C 1 176 ? -13.480 73.274  27.949  1.00 8.21  ? 176 PRO B CA  1 
ATOM   5971  C  C   . PRO C 1 176 ? -12.828 72.556  29.131  1.00 8.61  ? 176 PRO B C   1 
ATOM   5972  O  O   . PRO C 1 176 ? -12.716 71.331  29.129  1.00 10.06 ? 176 PRO B O   1 
ATOM   5973  C  CB  . PRO C 1 176 ? -14.984 73.481  28.139  1.00 9.12  ? 176 PRO B CB  1 
ATOM   5974  C  CG  . PRO C 1 176 ? -15.582 72.263  27.492  1.00 9.62  ? 176 PRO B CG  1 
ATOM   5975  C  CD  . PRO C 1 176 ? -14.753 72.127  26.235  1.00 9.17  ? 176 PRO B CD  1 
ATOM   5976  N  N   . LYS C 1 177 ? -12.400 73.321  30.135  1.00 8.61  ? 177 LYS B N   1 
ATOM   5977  C  CA  . LYS C 1 177 ? -11.748 72.740  31.311  1.00 8.93  ? 177 LYS B CA  1 
ATOM   5978  C  C   . LYS C 1 177 ? -12.516 71.521  31.815  1.00 8.94  ? 177 LYS B C   1 
ATOM   5979  O  O   . LYS C 1 177 ? -11.952 70.430  31.951  1.00 7.38  ? 177 LYS B O   1 
ATOM   5980  C  CB  . LYS C 1 177 ? -11.631 73.779  32.437  1.00 6.29  ? 177 LYS B CB  1 
ATOM   5981  C  CG  . LYS C 1 177 ? -10.833 75.027  32.065  1.00 7.53  ? 177 LYS B CG  1 
ATOM   5982  C  CD  . LYS C 1 177 ? -10.786 76.036  33.212  1.00 7.43  ? 177 LYS B CD  1 
ATOM   5983  C  CE  . LYS C 1 177 ? -9.928  75.547  34.381  1.00 9.39  ? 177 LYS B CE  1 
ATOM   5984  N  NZ  . LYS C 1 177 ? -8.474  75.507  34.039  1.00 8.87  ? 177 LYS B NZ  1 
ATOM   5985  N  N   . LEU C 1 178 ? -13.806 71.712  32.082  1.00 7.50  ? 178 LEU B N   1 
ATOM   5986  C  CA  . LEU C 1 178 ? -14.667 70.642  32.578  1.00 7.37  ? 178 LEU B CA  1 
ATOM   5987  C  C   . LEU C 1 178 ? -15.943 70.576  31.745  1.00 7.70  ? 178 LEU B C   1 
ATOM   5988  O  O   . LEU C 1 178 ? -16.317 71.552  31.096  1.00 9.42  ? 178 LEU B O   1 
ATOM   5989  C  CB  . LEU C 1 178 ? -15.043 70.909  34.041  1.00 6.00  ? 178 LEU B CB  1 
ATOM   5990  C  CG  . LEU C 1 178 ? -13.901 71.075  35.045  1.00 9.06  ? 178 LEU B CG  1 
ATOM   5991  C  CD1 . LEU C 1 178 ? -14.445 71.565  36.380  1.00 6.50  ? 178 LEU B CD1 1 
ATOM   5992  C  CD2 . LEU C 1 178 ? -13.170 69.747  35.210  1.00 6.14  ? 178 LEU B CD2 1 
ATOM   5993  N  N   . GLY C 1 179 ? -16.609 69.427  31.756  1.00 8.36  ? 179 GLY B N   1 
ATOM   5994  C  CA  . GLY C 1 179 ? -17.847 69.306  31.010  1.00 9.08  ? 179 GLY B CA  1 
ATOM   5995  C  C   . GLY C 1 179 ? -17.862 68.338  29.844  1.00 9.89  ? 179 GLY B C   1 
ATOM   5996  O  O   . GLY C 1 179 ? -18.937 67.995  29.348  1.00 9.75  ? 179 GLY B O   1 
ATOM   5997  N  N   . LEU C 1 180 ? -16.690 67.893  29.401  1.00 8.22  ? 180 LEU B N   1 
ATOM   5998  C  CA  . LEU C 1 180 ? -16.616 66.951  28.284  1.00 8.64  ? 180 LEU B CA  1 
ATOM   5999  C  C   . LEU C 1 180 ? -16.697 65.504  28.759  1.00 8.66  ? 180 LEU B C   1 
ATOM   6000  O  O   . LEU C 1 180 ? -16.253 65.179  29.858  1.00 8.19  ? 180 LEU B O   1 
ATOM   6001  C  CB  . LEU C 1 180 ? -15.315 67.145  27.493  1.00 9.32  ? 180 LEU B CB  1 
ATOM   6002  C  CG  . LEU C 1 180 ? -15.179 68.390  26.610  1.00 11.55 ? 180 LEU B CG  1 
ATOM   6003  C  CD1 . LEU C 1 180 ? -13.799 68.404  25.945  1.00 10.81 ? 180 LEU B CD1 1 
ATOM   6004  C  CD2 . LEU C 1 180 ? -16.276 68.397  25.554  1.00 11.45 ? 180 LEU B CD2 1 
ATOM   6005  N  N   . SER C 1 181 ? -17.269 64.640  27.927  1.00 7.45  ? 181 SER B N   1 
ATOM   6006  C  CA  . SER C 1 181 ? -17.383 63.224  28.262  1.00 8.64  ? 181 SER B CA  1 
ATOM   6007  C  C   . SER C 1 181 ? -16.058 62.537  27.931  1.00 8.45  ? 181 SER B C   1 
ATOM   6008  O  O   . SER C 1 181 ? -15.226 63.097  27.212  1.00 8.00  ? 181 SER B O   1 
ATOM   6009  C  CB  . SER C 1 181 ? -18.503 62.572  27.449  1.00 9.16  ? 181 SER B CB  1 
ATOM   6010  O  OG  . SER C 1 181 ? -18.160 62.502  26.073  1.00 8.51  ? 181 SER B OG  1 
ATOM   6011  N  N   . ALA C 1 182 ? -15.869 61.327  28.448  1.00 7.65  ? 182 ALA B N   1 
ATOM   6012  C  CA  . ALA C 1 182 ? -14.644 60.571  28.192  1.00 7.72  ? 182 ALA B CA  1 
ATOM   6013  C  C   . ALA C 1 182 ? -14.392 60.365  26.698  1.00 8.74  ? 182 ALA B C   1 
ATOM   6014  O  O   . ALA C 1 182 ? -13.271 60.563  26.220  1.00 9.68  ? 182 ALA B O   1 
ATOM   6015  C  CB  . ALA C 1 182 ? -14.706 59.222  28.894  1.00 8.05  ? 182 ALA B CB  1 
ATOM   6016  N  N   . LYS C 1 183 ? -15.423 59.971  25.953  1.00 8.22  ? 183 LYS B N   1 
ATOM   6017  C  CA  . LYS C 1 183 ? -15.236 59.745  24.524  1.00 9.99  ? 183 LYS B CA  1 
ATOM   6018  C  C   . LYS C 1 183 ? -14.903 61.022  23.750  1.00 8.47  ? 183 LYS B C   1 
ATOM   6019  O  O   . LYS C 1 183 ? -14.065 61.001  22.851  1.00 8.89  ? 183 LYS B O   1 
ATOM   6020  C  CB  . LYS C 1 183 ? -16.457 59.067  23.892  1.00 9.91  ? 183 LYS B CB  1 
ATOM   6021  C  CG  . LYS C 1 183 ? -16.179 58.701  22.439  1.00 15.87 ? 183 LYS B CG  1 
ATOM   6022  C  CD  . LYS C 1 183 ? -17.267 57.893  21.770  1.00 17.82 ? 183 LYS B CD  1 
ATOM   6023  C  CE  . LYS C 1 183 ? -16.887 57.654  20.308  1.00 17.80 ? 183 LYS B CE  1 
ATOM   6024  N  NZ  . LYS C 1 183 ? -17.888 56.838  19.575  1.00 23.22 ? 183 LYS B NZ  1 
ATOM   6025  N  N   . ASN C 1 184 ? -15.549 62.133  24.086  1.00 8.81  ? 184 ASN B N   1 
ATOM   6026  C  CA  . ASN C 1 184 ? -15.250 63.379  23.390  1.00 10.12 ? 184 ASN B CA  1 
ATOM   6027  C  C   . ASN C 1 184 ? -13.848 63.872  23.740  1.00 10.51 ? 184 ASN B C   1 
ATOM   6028  O  O   . ASN C 1 184 ? -13.220 64.574  22.947  1.00 11.74 ? 184 ASN B O   1 
ATOM   6029  C  CB  . ASN C 1 184 ? -16.285 64.461  23.718  1.00 9.65  ? 184 ASN B CB  1 
ATOM   6030  C  CG  . ASN C 1 184 ? -17.596 64.263  22.965  1.00 10.34 ? 184 ASN B CG  1 
ATOM   6031  O  OD1 . ASN C 1 184 ? -17.614 63.707  21.863  1.00 10.87 ? 184 ASN B OD1 1 
ATOM   6032  N  ND2 . ASN C 1 184 ? -18.692 64.736  23.546  1.00 11.19 ? 184 ASN B ND2 1 
ATOM   6033  N  N   . TYR C 1 185 ? -13.357 63.502  24.921  1.00 8.17  ? 185 TYR B N   1 
ATOM   6034  C  CA  . TYR C 1 185 ? -12.016 63.903  25.343  1.00 8.29  ? 185 TYR B CA  1 
ATOM   6035  C  C   . TYR C 1 185 ? -10.999 63.195  24.442  1.00 7.12  ? 185 TYR B C   1 
ATOM   6036  O  O   . TYR C 1 185 ? -10.061 63.813  23.944  1.00 7.59  ? 185 TYR B O   1 
ATOM   6037  C  CB  . TYR C 1 185 ? -11.763 63.504  26.801  1.00 7.12  ? 185 TYR B CB  1 
ATOM   6038  C  CG  . TYR C 1 185 ? -10.990 64.533  27.597  1.00 6.78  ? 185 TYR B CG  1 
ATOM   6039  C  CD1 . TYR C 1 185 ? -11.608 65.703  28.041  1.00 7.72  ? 185 TYR B CD1 1 
ATOM   6040  C  CD2 . TYR C 1 185 ? -9.643  64.343  27.905  1.00 7.52  ? 185 TYR B CD2 1 
ATOM   6041  C  CE1 . TYR C 1 185 ? -10.906 66.660  28.778  1.00 6.60  ? 185 TYR B CE1 1 
ATOM   6042  C  CE2 . TYR C 1 185 ? -8.927  65.297  28.640  1.00 7.90  ? 185 TYR B CE2 1 
ATOM   6043  C  CZ  . TYR C 1 185 ? -9.566  66.449  29.073  1.00 7.41  ? 185 TYR B CZ  1 
ATOM   6044  O  OH  . TYR C 1 185 ? -8.874  67.389  29.801  1.00 8.26  ? 185 TYR B OH  1 
ATOM   6045  N  N   . GLY C 1 186 ? -11.190 61.894  24.240  1.00 5.94  ? 186 GLY B N   1 
ATOM   6046  C  CA  . GLY C 1 186 ? -10.284 61.142  23.387  1.00 7.53  ? 186 GLY B CA  1 
ATOM   6047  C  C   . GLY C 1 186 ? -10.362 61.624  21.946  1.00 8.94  ? 186 GLY B C   1 
ATOM   6048  O  O   . GLY C 1 186 ? -9.367  61.635  21.222  1.00 8.24  ? 186 GLY B O   1 
ATOM   6049  N  N   . ARG C 1 187 ? -11.560 62.026  21.534  1.00 8.71  ? 187 ARG B N   1 
ATOM   6050  C  CA  . ARG C 1 187 ? -11.796 62.534  20.186  1.00 10.10 ? 187 ARG B CA  1 
ATOM   6051  C  C   . ARG C 1 187 ? -10.952 63.796  19.968  1.00 10.14 ? 187 ARG B C   1 
ATOM   6052  O  O   . ARG C 1 187 ? -10.268 63.937  18.951  1.00 9.68  ? 187 ARG B O   1 
ATOM   6053  C  CB  . ARG C 1 187 ? -13.296 62.822  20.017  1.00 10.37 ? 187 ARG B CB  1 
ATOM   6054  C  CG  . ARG C 1 187 ? -13.681 63.721  18.863  1.00 12.97 ? 187 ARG B CG  1 
ATOM   6055  C  CD  . ARG C 1 187 ? -15.204 63.810  18.750  1.00 13.33 ? 187 ARG B CD  1 
ATOM   6056  N  NE  . ARG C 1 187 ? -15.747 62.696  17.978  1.00 14.83 ? 187 ARG B NE  1 
ATOM   6057  C  CZ  . ARG C 1 187 ? -16.669 61.842  18.416  1.00 15.76 ? 187 ARG B CZ  1 
ATOM   6058  N  NH1 . ARG C 1 187 ? -17.171 61.956  19.639  1.00 14.84 ? 187 ARG B NH1 1 
ATOM   6059  N  NH2 . ARG C 1 187 ? -17.096 60.874  17.618  1.00 15.08 ? 187 ARG B NH2 1 
ATOM   6060  N  N   . ALA C 1 188 ? -10.981 64.700  20.941  1.00 8.45  ? 188 ALA B N   1 
ATOM   6061  C  CA  . ALA C 1 188 ? -10.208 65.933  20.849  1.00 9.33  ? 188 ALA B CA  1 
ATOM   6062  C  C   . ALA C 1 188 ? -8.705  65.644  20.904  1.00 8.90  ? 188 ALA B C   1 
ATOM   6063  O  O   . ALA C 1 188 ? -7.916  66.291  20.217  1.00 8.53  ? 188 ALA B O   1 
ATOM   6064  C  CB  . ALA C 1 188 ? -10.599 66.881  21.982  1.00 10.32 ? 188 ALA B CB  1 
ATOM   6065  N  N   . VAL C 1 189 ? -8.319  64.673  21.728  1.00 8.67  ? 189 VAL B N   1 
ATOM   6066  C  CA  . VAL C 1 189 ? -6.918  64.295  21.877  1.00 7.85  ? 189 VAL B CA  1 
ATOM   6067  C  C   . VAL C 1 189 ? -6.348  63.761  20.567  1.00 8.08  ? 189 VAL B C   1 
ATOM   6068  O  O   . VAL C 1 189 ? -5.273  64.170  20.143  1.00 8.62  ? 189 VAL B O   1 
ATOM   6069  C  CB  . VAL C 1 189 ? -6.742  63.227  22.985  1.00 8.05  ? 189 VAL B CB  1 
ATOM   6070  C  CG1 . VAL C 1 189 ? -5.318  62.673  22.966  1.00 7.62  ? 189 VAL B CG1 1 
ATOM   6071  C  CG2 . VAL C 1 189 ? -7.039  63.842  24.343  1.00 7.58  ? 189 VAL B CG2 1 
ATOM   6072  N  N   . TYR C 1 190 ? -7.068  62.846  19.926  1.00 8.39  ? 190 TYR B N   1 
ATOM   6073  C  CA  . TYR C 1 190 ? -6.604  62.286  18.665  1.00 8.28  ? 190 TYR B CA  1 
ATOM   6074  C  C   . TYR C 1 190 ? -6.373  63.363  17.601  1.00 9.60  ? 190 TYR B C   1 
ATOM   6075  O  O   . TYR C 1 190 ? -5.322  63.398  16.958  1.00 8.92  ? 190 TYR B O   1 
ATOM   6076  C  CB  . TYR C 1 190 ? -7.606  61.249  18.143  1.00 8.46  ? 190 TYR B CB  1 
ATOM   6077  C  CG  . TYR C 1 190 ? -7.425  60.929  16.674  1.00 9.66  ? 190 TYR B CG  1 
ATOM   6078  C  CD1 . TYR C 1 190 ? -6.224  60.399  16.192  1.00 8.31  ? 190 TYR B CD1 1 
ATOM   6079  C  CD2 . TYR C 1 190 ? -8.437  61.212  15.757  1.00 9.40  ? 190 TYR B CD2 1 
ATOM   6080  C  CE1 . TYR C 1 190 ? -6.037  60.168  14.826  1.00 10.35 ? 190 TYR B CE1 1 
ATOM   6081  C  CE2 . TYR C 1 190 ? -8.264  60.983  14.398  1.00 10.47 ? 190 TYR B CE2 1 
ATOM   6082  C  CZ  . TYR C 1 190 ? -7.066  60.465  13.934  1.00 11.45 ? 190 TYR B CZ  1 
ATOM   6083  O  OH  . TYR C 1 190 ? -6.904  60.260  12.576  1.00 9.55  ? 190 TYR B OH  1 
ATOM   6084  N  N   . GLU C 1 191 ? -7.351  64.247  17.423  1.00 7.75  ? 191 GLU B N   1 
ATOM   6085  C  CA  . GLU C 1 191 ? -7.238  65.294  16.423  1.00 7.91  ? 191 GLU B CA  1 
ATOM   6086  C  C   . GLU C 1 191 ? -6.088  66.257  16.717  1.00 9.64  ? 191 GLU B C   1 
ATOM   6087  O  O   . GLU C 1 191 ? -5.422  66.720  15.789  1.00 10.44 ? 191 GLU B O   1 
ATOM   6088  C  CB  . GLU C 1 191 ? -8.558  66.058  16.304  1.00 7.55  ? 191 GLU B CB  1 
ATOM   6089  C  CG  . GLU C 1 191 ? -9.731  65.225  15.768  1.00 7.34  ? 191 GLU B CG  1 
ATOM   6090  C  CD  . GLU C 1 191 ? -9.578  64.837  14.303  1.00 9.01  ? 191 GLU B CD  1 
ATOM   6091  O  OE1 . GLU C 1 191 ? -8.929  65.593  13.554  1.00 11.41 ? 191 GLU B OE1 1 
ATOM   6092  O  OE2 . GLU C 1 191 ? -10.122 63.787  13.892  1.00 8.60  ? 191 GLU B OE2 1 
ATOM   6093  N  N   . CYS C 1 192 ? -5.854  66.558  17.995  1.00 7.78  ? 192 CYS B N   1 
ATOM   6094  C  CA  . CYS C 1 192 ? -4.760  67.457  18.380  1.00 8.64  ? 192 CYS B CA  1 
ATOM   6095  C  C   . CYS C 1 192 ? -3.386  66.841  18.095  1.00 9.50  ? 192 CYS B C   1 
ATOM   6096  O  O   . CYS C 1 192 ? -2.512  67.479  17.501  1.00 10.37 ? 192 CYS B O   1 
ATOM   6097  C  CB  . CYS C 1 192 ? -4.831  67.796  19.876  1.00 9.64  ? 192 CYS B CB  1 
ATOM   6098  S  SG  . CYS C 1 192 ? -6.071  69.017  20.354  1.00 10.04 ? 192 CYS B SG  1 
ATOM   6099  N  N   . LEU C 1 193 ? -3.199  65.599  18.527  1.00 7.02  ? 193 LEU B N   1 
ATOM   6100  C  CA  . LEU C 1 193 ? -1.925  64.915  18.343  1.00 8.30  ? 193 LEU B CA  1 
ATOM   6101  C  C   . LEU C 1 193 ? -1.556  64.600  16.896  1.00 8.96  ? 193 LEU B C   1 
ATOM   6102  O  O   . LEU C 1 193 ? -0.383  64.688  16.519  1.00 11.24 ? 193 LEU B O   1 
ATOM   6103  C  CB  . LEU C 1 193 ? -1.904  63.618  19.160  1.00 5.69  ? 193 LEU B CB  1 
ATOM   6104  C  CG  . LEU C 1 193 ? -1.941  63.744  20.688  1.00 5.27  ? 193 LEU B CG  1 
ATOM   6105  C  CD1 . LEU C 1 193 ? -2.100  62.361  21.298  1.00 8.38  ? 193 LEU B CD1 1 
ATOM   6106  C  CD2 . LEU C 1 193 ? -0.667  64.410  21.198  1.00 5.28  ? 193 LEU B CD2 1 
ATOM   6107  N  N   . ARG C 1 194 ? -2.540  64.228  16.084  1.00 8.40  ? 194 ARG B N   1 
ATOM   6108  C  CA  . ARG C 1 194 ? -2.252  63.883  14.698  1.00 9.67  ? 194 ARG B CA  1 
ATOM   6109  C  C   . ARG C 1 194 ? -1.779  65.090  13.888  1.00 10.87 ? 194 ARG B C   1 
ATOM   6110  O  O   . ARG C 1 194 ? -1.194  64.930  12.817  1.00 12.01 ? 194 ARG B O   1 
ATOM   6111  C  CB  . ARG C 1 194 ? -3.487  63.242  14.041  1.00 7.98  ? 194 ARG B CB  1 
ATOM   6112  C  CG  . ARG C 1 194 ? -4.519  64.212  13.474  1.00 6.77  ? 194 ARG B CG  1 
ATOM   6113  C  CD  . ARG C 1 194 ? -5.757  63.447  13.005  1.00 7.79  ? 194 ARG B CD  1 
ATOM   6114  N  NE  . ARG C 1 194 ? -6.632  64.242  12.146  1.00 10.43 ? 194 ARG B NE  1 
ATOM   6115  C  CZ  . ARG C 1 194 ? -6.401  64.496  10.860  1.00 11.89 ? 194 ARG B CZ  1 
ATOM   6116  N  NH1 . ARG C 1 194 ? -5.316  64.014  10.263  1.00 10.72 ? 194 ARG B NH1 1 
ATOM   6117  N  NH2 . ARG C 1 194 ? -7.254  65.238  10.169  1.00 10.57 ? 194 ARG B NH2 1 
ATOM   6118  N  N   . GLY C 1 195 ? -2.019  66.288  14.417  1.00 12.03 ? 195 GLY B N   1 
ATOM   6119  C  CA  . GLY C 1 195 ? -1.620  67.510  13.736  1.00 11.03 ? 195 GLY B CA  1 
ATOM   6120  C  C   . GLY C 1 195 ? -0.191  67.977  13.963  1.00 11.57 ? 195 GLY B C   1 
ATOM   6121  O  O   . GLY C 1 195 ? 0.242   68.958  13.356  1.00 12.63 ? 195 GLY B O   1 
ATOM   6122  N  N   . GLY C 1 196 ? 0.551   67.304  14.839  1.00 11.58 ? 196 GLY B N   1 
ATOM   6123  C  CA  . GLY C 1 196 ? 1.930   67.711  15.058  1.00 12.65 ? 196 GLY B CA  1 
ATOM   6124  C  C   . GLY C 1 196 ? 2.345   68.047  16.476  1.00 11.88 ? 196 GLY B C   1 
ATOM   6125  O  O   . GLY C 1 196 ? 3.503   68.386  16.717  1.00 12.27 ? 196 GLY B O   1 
ATOM   6126  N  N   . LEU C 1 197 ? 1.412   67.978  17.417  1.00 11.53 ? 197 LEU B N   1 
ATOM   6127  C  CA  . LEU C 1 197 ? 1.746   68.257  18.807  1.00 11.26 ? 197 LEU B CA  1 
ATOM   6128  C  C   . LEU C 1 197 ? 2.350   66.975  19.380  1.00 11.18 ? 197 LEU B C   1 
ATOM   6129  O  O   . LEU C 1 197 ? 2.007   65.876  18.944  1.00 12.21 ? 197 LEU B O   1 
ATOM   6130  C  CB  . LEU C 1 197 ? 0.494   68.641  19.601  1.00 12.15 ? 197 LEU B CB  1 
ATOM   6131  C  CG  . LEU C 1 197 ? -0.238  69.914  19.173  1.00 10.64 ? 197 LEU B CG  1 
ATOM   6132  C  CD1 . LEU C 1 197 ? -1.472  70.121  20.032  1.00 11.22 ? 197 LEU B CD1 1 
ATOM   6133  C  CD2 . LEU C 1 197 ? 0.696   71.101  19.304  1.00 12.94 ? 197 LEU B CD2 1 
ATOM   6134  N  N   . ASP C 1 198 ? 3.259   67.118  20.338  1.00 10.55 ? 198 ASP B N   1 
ATOM   6135  C  CA  . ASP C 1 198 ? 3.889   65.963  20.964  1.00 8.26  ? 198 ASP B CA  1 
ATOM   6136  C  C   . ASP C 1 198 ? 3.009   65.461  22.107  1.00 9.02  ? 198 ASP B C   1 
ATOM   6137  O  O   . ASP C 1 198 ? 2.910   64.255  22.340  1.00 6.99  ? 198 ASP B O   1 
ATOM   6138  C  CB  . ASP C 1 198 ? 5.263   66.342  21.523  1.00 8.21  ? 198 ASP B CB  1 
ATOM   6139  C  CG  . ASP C 1 198 ? 6.201   66.866  20.462  1.00 9.32  ? 198 ASP B CG  1 
ATOM   6140  O  OD1 . ASP C 1 198 ? 6.546   66.090  19.546  1.00 8.52  ? 198 ASP B OD1 1 
ATOM   6141  O  OD2 . ASP C 1 198 ? 6.589   68.052  20.545  1.00 10.23 ? 198 ASP B OD2 1 
ATOM   6142  N  N   . PHE C 1 199 ? 2.368   66.396  22.810  1.00 7.25  ? 199 PHE B N   1 
ATOM   6143  C  CA  . PHE C 1 199 ? 1.522   66.052  23.948  1.00 7.95  ? 199 PHE B CA  1 
ATOM   6144  C  C   . PHE C 1 199 ? 0.209   66.823  24.003  1.00 6.40  ? 199 PHE B C   1 
ATOM   6145  O  O   . PHE C 1 199 ? 0.067   67.898  23.431  1.00 5.44  ? 199 PHE B O   1 
ATOM   6146  C  CB  . PHE C 1 199 ? 2.209   66.382  25.284  1.00 9.80  ? 199 PHE B CB  1 
ATOM   6147  C  CG  . PHE C 1 199 ? 3.637   65.925  25.409  1.00 10.03 ? 199 PHE B CG  1 
ATOM   6148  C  CD1 . PHE C 1 199 ? 3.954   64.574  25.499  1.00 10.93 ? 199 PHE B CD1 1 
ATOM   6149  C  CD2 . PHE C 1 199 ? 4.660   66.865  25.548  1.00 9.53  ? 199 PHE B CD2 1 
ATOM   6150  C  CE1 . PHE C 1 199 ? 5.271   64.163  25.734  1.00 9.58  ? 199 PHE B CE1 1 
ATOM   6151  C  CE2 . PHE C 1 199 ? 5.975   66.468  25.782  1.00 8.83  ? 199 PHE B CE2 1 
ATOM   6152  C  CZ  . PHE C 1 199 ? 6.280   65.112  25.878  1.00 10.46 ? 199 PHE B CZ  1 
ATOM   6153  N  N   . THR C 1 200 ? -0.736  66.251  24.738  1.00 7.47  ? 200 THR B N   1 
ATOM   6154  C  CA  . THR C 1 200 ? -2.015  66.882  25.036  1.00 7.62  ? 200 THR B CA  1 
ATOM   6155  C  C   . THR C 1 200 ? -2.065  66.602  26.537  1.00 6.67  ? 200 THR B C   1 
ATOM   6156  O  O   . THR C 1 200 ? -1.193  65.894  27.053  1.00 7.23  ? 200 THR B O   1 
ATOM   6157  C  CB  . THR C 1 200 ? -3.220  66.213  24.331  1.00 7.68  ? 200 THR B CB  1 
ATOM   6158  O  OG1 . THR C 1 200 ? -3.111  64.792  24.435  1.00 11.49 ? 200 THR B OG1 1 
ATOM   6159  C  CG2 . THR C 1 200 ? -3.285  66.630  22.872  1.00 9.26  ? 200 THR B CG2 1 
HETATM 6160  N  N   . KCX C 1 201 ? -3.050  67.142  27.244  1.00 5.60  ? 201 KCX B N   1 
HETATM 6161  C  CA  . KCX C 1 201 ? -3.123  66.902  28.685  1.00 7.43  ? 201 KCX B CA  1 
HETATM 6162  C  CB  . KCX C 1 201 ? -2.100  67.802  29.423  1.00 6.32  ? 201 KCX B CB  1 
HETATM 6163  C  CG  . KCX C 1 201 ? -2.284  69.317  29.234  1.00 6.10  ? 201 KCX B CG  1 
HETATM 6164  C  CD  . KCX C 1 201 ? -1.230  70.141  29.994  1.00 7.72  ? 201 KCX B CD  1 
HETATM 6165  C  CE  . KCX C 1 201 ? -1.360  70.099  31.518  1.00 8.17  ? 201 KCX B CE  1 
HETATM 6166  N  NZ  . KCX C 1 201 ? -2.640  70.604  32.030  1.00 7.30  ? 201 KCX B NZ  1 
HETATM 6167  C  C   . KCX C 1 201 ? -4.467  67.187  29.302  1.00 6.95  ? 201 KCX B C   1 
HETATM 6168  O  O   . KCX C 1 201 ? -5.283  67.944  28.755  1.00 7.59  ? 201 KCX B O   1 
HETATM 6169  C  CX  . KCX C 1 201 ? -2.903  71.881  32.347  1.00 6.88  ? 201 KCX B CX  1 
HETATM 6170  O  OQ1 . KCX C 1 201 ? -2.049  72.804  32.207  1.00 5.13  ? 201 KCX B OQ1 1 
HETATM 6171  O  OQ2 . KCX C 1 201 ? -4.017  72.200  32.800  1.00 6.17  ? 201 KCX B OQ2 1 
ATOM   6172  N  N   . ASP C 1 202 ? -4.693  66.564  30.455  1.00 6.65  ? 202 ASP B N   1 
ATOM   6173  C  CA  . ASP C 1 202 ? -5.908  66.769  31.226  1.00 6.29  ? 202 ASP B CA  1 
ATOM   6174  C  C   . ASP C 1 202 ? -5.741  68.160  31.828  1.00 7.73  ? 202 ASP B C   1 
ATOM   6175  O  O   . ASP C 1 202 ? -4.620  68.560  32.156  1.00 7.76  ? 202 ASP B O   1 
ATOM   6176  C  CB  . ASP C 1 202 ? -6.004  65.768  32.390  1.00 7.28  ? 202 ASP B CB  1 
ATOM   6177  C  CG  . ASP C 1 202 ? -6.301  64.343  31.943  1.00 8.43  ? 202 ASP B CG  1 
ATOM   6178  O  OD1 . ASP C 1 202 ? -6.604  64.124  30.753  1.00 7.82  ? 202 ASP B OD1 1 
ATOM   6179  O  OD2 . ASP C 1 202 ? -6.243  63.438  32.806  1.00 10.18 ? 202 ASP B OD2 1 
ATOM   6180  N  N   . ASP C 1 203 ? -6.829  68.910  31.967  1.00 6.56  ? 203 ASP B N   1 
ATOM   6181  C  CA  . ASP C 1 203 ? -6.709  70.216  32.590  1.00 6.61  ? 203 ASP B CA  1 
ATOM   6182  C  C   . ASP C 1 203 ? -6.399  69.878  34.055  1.00 7.01  ? 203 ASP B C   1 
ATOM   6183  O  O   . ASP C 1 203 ? -6.728  68.783  34.512  1.00 8.28  ? 203 ASP B O   1 
ATOM   6184  C  CB  . ASP C 1 203 ? -8.016  70.999  32.481  1.00 5.74  ? 203 ASP B CB  1 
ATOM   6185  C  CG  . ASP C 1 203 ? -7.782  72.465  32.192  1.00 7.26  ? 203 ASP B CG  1 
ATOM   6186  O  OD1 . ASP C 1 203 ? -6.842  73.035  32.780  1.00 9.29  ? 203 ASP B OD1 1 
ATOM   6187  O  OD2 . ASP C 1 203 ? -8.530  73.052  31.388  1.00 9.49  ? 203 ASP B OD2 1 
ATOM   6188  N  N   . GLU C 1 204 ? -5.772  70.795  34.789  1.00 5.53  ? 204 GLU B N   1 
ATOM   6189  C  CA  . GLU C 1 204 ? -5.411  70.520  36.177  1.00 6.23  ? 204 GLU B CA  1 
ATOM   6190  C  C   . GLU C 1 204 ? -6.551  70.078  37.089  1.00 7.57  ? 204 GLU B C   1 
ATOM   6191  O  O   . GLU C 1 204 ? -6.319  69.309  38.025  1.00 9.30  ? 204 GLU B O   1 
ATOM   6192  C  CB  . GLU C 1 204 ? -4.697  71.723  36.813  1.00 7.20  ? 204 GLU B CB  1 
ATOM   6193  C  CG  . GLU C 1 204 ? -5.575  72.922  37.155  1.00 6.44  ? 204 GLU B CG  1 
ATOM   6194  C  CD  . GLU C 1 204 ? -5.972  73.729  35.937  1.00 8.51  ? 204 GLU B CD  1 
ATOM   6195  O  OE1 . GLU C 1 204 ? -5.118  73.922  35.042  1.00 6.65  ? 204 GLU B OE1 1 
ATOM   6196  O  OE2 . GLU C 1 204 ? -7.131  74.190  35.885  1.00 8.70  ? 204 GLU B OE2 1 
ATOM   6197  N  N   . ASN C 1 205 ? -7.770  70.550  36.831  1.00 6.06  ? 205 ASN B N   1 
ATOM   6198  C  CA  . ASN C 1 205 ? -8.901  70.179  37.674  1.00 7.68  ? 205 ASN B CA  1 
ATOM   6199  C  C   . ASN C 1 205 ? -9.681  68.966  37.175  1.00 8.03  ? 205 ASN B C   1 
ATOM   6200  O  O   . ASN C 1 205 ? -10.685 68.574  37.769  1.00 8.54  ? 205 ASN B O   1 
ATOM   6201  C  CB  . ASN C 1 205 ? -9.842  71.378  37.881  1.00 4.71  ? 205 ASN B CB  1 
ATOM   6202  C  CG  . ASN C 1 205 ? -10.303 72.012  36.579  1.00 7.95  ? 205 ASN B CG  1 
ATOM   6203  O  OD1 . ASN C 1 205 ? -9.807  71.700  35.494  1.00 8.64  ? 205 ASN B OD1 1 
ATOM   6204  N  ND2 . ASN C 1 205 ? -11.258 72.926  36.689  1.00 5.37  ? 205 ASN B ND2 1 
ATOM   6205  N  N   . VAL C 1 206 ? -9.211  68.374  36.083  1.00 7.89  ? 206 VAL B N   1 
ATOM   6206  C  CA  . VAL C 1 206 ? -9.844  67.182  35.535  1.00 6.98  ? 206 VAL B CA  1 
ATOM   6207  C  C   . VAL C 1 206 ? -9.239  65.980  36.270  1.00 8.14  ? 206 VAL B C   1 
ATOM   6208  O  O   . VAL C 1 206 ? -8.091  65.601  36.023  1.00 7.39  ? 206 VAL B O   1 
ATOM   6209  C  CB  . VAL C 1 206 ? -9.584  67.058  34.007  1.00 6.54  ? 206 VAL B CB  1 
ATOM   6210  C  CG1 . VAL C 1 206 ? -9.980  65.674  33.504  1.00 4.48  ? 206 VAL B CG1 1 
ATOM   6211  C  CG2 . VAL C 1 206 ? -10.389 68.123  33.262  1.00 6.73  ? 206 VAL B CG2 1 
ATOM   6212  N  N   . ASN C 1 207 ? -10.008 65.410  37.194  1.00 6.91  ? 207 ASN B N   1 
ATOM   6213  C  CA  . ASN C 1 207 ? -9.573  64.252  37.971  1.00 7.42  ? 207 ASN B CA  1 
ATOM   6214  C  C   . ASN C 1 207 ? -10.595 63.137  37.692  1.00 8.85  ? 207 ASN B C   1 
ATOM   6215  O  O   . ASN C 1 207 ? -10.414 62.332  36.777  1.00 10.23 ? 207 ASN B O   1 
ATOM   6216  C  CB  . ASN C 1 207 ? -9.549  64.601  39.466  1.00 6.96  ? 207 ASN B CB  1 
ATOM   6217  C  CG  . ASN C 1 207 ? -8.538  65.706  39.810  1.00 10.26 ? 207 ASN B CG  1 
ATOM   6218  O  OD1 . ASN C 1 207 ? -8.501  66.187  40.942  1.00 12.80 ? 207 ASN B OD1 1 
ATOM   6219  N  ND2 . ASN C 1 207 ? -7.718  66.100  38.841  1.00 6.10  ? 207 ASN B ND2 1 
ATOM   6220  N  N   . SER C 1 208 ? -11.664 63.094  38.479  1.00 7.82  ? 208 SER B N   1 
ATOM   6221  C  CA  . SER C 1 208 ? -12.730 62.116  38.266  1.00 8.69  ? 208 SER B CA  1 
ATOM   6222  C  C   . SER C 1 208 ? -14.028 62.796  38.700  1.00 8.93  ? 208 SER B C   1 
ATOM   6223  O  O   . SER C 1 208 ? -14.180 63.162  39.860  1.00 10.96 ? 208 SER B O   1 
ATOM   6224  C  CB  . SER C 1 208 ? -12.492 60.851  39.089  1.00 8.96  ? 208 SER B CB  1 
ATOM   6225  O  OG  . SER C 1 208 ? -13.409 59.840  38.710  1.00 9.02  ? 208 SER B OG  1 
ATOM   6226  N  N   . GLN C 1 209 ? -14.957 62.969  37.767  1.00 9.14  ? 209 GLN B N   1 
ATOM   6227  C  CA  . GLN C 1 209 ? -16.218 63.643  38.065  1.00 8.87  ? 209 GLN B CA  1 
ATOM   6228  C  C   . GLN C 1 209 ? -17.440 62.983  37.410  1.00 8.96  ? 209 GLN B C   1 
ATOM   6229  O  O   . GLN C 1 209 ? -17.304 62.083  36.587  1.00 9.09  ? 209 GLN B O   1 
ATOM   6230  C  CB  . GLN C 1 209 ? -16.113 65.117  37.642  1.00 9.80  ? 209 GLN B CB  1 
ATOM   6231  C  CG  . GLN C 1 209 ? -15.215 65.961  38.556  1.00 9.98  ? 209 GLN B CG  1 
ATOM   6232  C  CD  . GLN C 1 209 ? -13.887 66.369  37.918  1.00 12.07 ? 209 GLN B CD  1 
ATOM   6233  O  OE1 . GLN C 1 209 ? -13.195 65.554  37.302  1.00 10.86 ? 209 GLN B OE1 1 
ATOM   6234  N  NE2 . GLN C 1 209 ? -13.521 67.639  38.083  1.00 10.46 ? 209 GLN B NE2 1 
ATOM   6235  N  N   . PRO C 1 210 ? -18.655 63.420  37.785  1.00 8.30  ? 210 PRO B N   1 
ATOM   6236  C  CA  . PRO C 1 210 ? -19.884 62.854  37.218  1.00 9.01  ? 210 PRO B CA  1 
ATOM   6237  C  C   . PRO C 1 210 ? -19.930 62.825  35.689  1.00 8.57  ? 210 PRO B C   1 
ATOM   6238  O  O   . PRO C 1 210 ? -20.356 61.831  35.100  1.00 10.93 ? 210 PRO B O   1 
ATOM   6239  C  CB  . PRO C 1 210 ? -20.974 63.746  37.813  1.00 8.05  ? 210 PRO B CB  1 
ATOM   6240  C  CG  . PRO C 1 210 ? -20.431 64.050  39.173  1.00 7.47  ? 210 PRO B CG  1 
ATOM   6241  C  CD  . PRO C 1 210 ? -18.969 64.348  38.889  1.00 8.37  ? 210 PRO B CD  1 
ATOM   6242  N  N   . PHE C 1 211 ? -19.489 63.904  35.049  1.00 7.77  ? 211 PHE B N   1 
ATOM   6243  C  CA  . PHE C 1 211 ? -19.509 63.986  33.591  1.00 8.41  ? 211 PHE B CA  1 
ATOM   6244  C  C   . PHE C 1 211 ? -18.437 63.135  32.913  1.00 8.36  ? 211 PHE B C   1 
ATOM   6245  O  O   . PHE C 1 211 ? -18.527 62.847  31.720  1.00 9.05  ? 211 PHE B O   1 
ATOM   6246  C  CB  . PHE C 1 211 ? -19.377 65.452  33.144  1.00 8.47  ? 211 PHE B CB  1 
ATOM   6247  C  CG  . PHE C 1 211 ? -18.122 66.132  33.629  1.00 9.56  ? 211 PHE B CG  1 
ATOM   6248  C  CD1 . PHE C 1 211 ? -16.917 65.972  32.951  1.00 7.48  ? 211 PHE B CD1 1 
ATOM   6249  C  CD2 . PHE C 1 211 ? -18.145 66.925  34.778  1.00 9.20  ? 211 PHE B CD2 1 
ATOM   6250  C  CE1 . PHE C 1 211 ? -15.751 66.588  33.405  1.00 8.80  ? 211 PHE B CE1 1 
ATOM   6251  C  CE2 . PHE C 1 211 ? -16.985 67.547  35.246  1.00 8.57  ? 211 PHE B CE2 1 
ATOM   6252  C  CZ  . PHE C 1 211 ? -15.786 67.379  34.559  1.00 9.08  ? 211 PHE B CZ  1 
ATOM   6253  N  N   . MET C 1 212 ? -17.423 62.734  33.673  1.00 9.31  ? 212 MET B N   1 
ATOM   6254  C  CA  . MET C 1 212 ? -16.338 61.924  33.125  1.00 8.40  ? 212 MET B CA  1 
ATOM   6255  C  C   . MET C 1 212 ? -15.492 61.313  34.235  1.00 9.50  ? 212 MET B C   1 
ATOM   6256  O  O   . MET C 1 212 ? -14.769 62.019  34.947  1.00 9.93  ? 212 MET B O   1 
ATOM   6257  C  CB  . MET C 1 212 ? -15.454 62.779  32.200  1.00 6.41  ? 212 MET B CB  1 
ATOM   6258  C  CG  . MET C 1 212 ? -14.130 62.110  31.780  1.00 8.13  ? 212 MET B CG  1 
ATOM   6259  S  SD  . MET C 1 212 ? -13.195 63.007  30.503  1.00 9.38  ? 212 MET B SD  1 
ATOM   6260  C  CE  . MET C 1 212 ? -13.034 64.634  31.288  1.00 5.60  ? 212 MET B CE  1 
ATOM   6261  N  N   . ARG C 1 213 ? -15.592 59.995  34.380  1.00 9.06  ? 213 ARG B N   1 
ATOM   6262  C  CA  . ARG C 1 213 ? -14.828 59.274  35.392  1.00 7.65  ? 213 ARG B CA  1 
ATOM   6263  C  C   . ARG C 1 213 ? -13.426 58.988  34.848  1.00 7.90  ? 213 ARG B C   1 
ATOM   6264  O  O   . ARG C 1 213 ? -13.252 58.787  33.648  1.00 7.60  ? 213 ARG B O   1 
ATOM   6265  C  CB  . ARG C 1 213 ? -15.569 57.992  35.777  1.00 6.27  ? 213 ARG B CB  1 
ATOM   6266  C  CG  . ARG C 1 213 ? -16.923 58.269  36.444  1.00 6.71  ? 213 ARG B CG  1 
ATOM   6267  C  CD  . ARG C 1 213 ? -16.746 59.054  37.747  1.00 5.50  ? 213 ARG B CD  1 
ATOM   6268  N  NE  . ARG C 1 213 ? -18.017 59.394  38.384  1.00 6.49  ? 213 ARG B NE  1 
ATOM   6269  C  CZ  . ARG C 1 213 ? -18.130 60.167  39.462  1.00 6.90  ? 213 ARG B CZ  1 
ATOM   6270  N  NH1 . ARG C 1 213 ? -17.046 60.680  40.025  1.00 6.17  ? 213 ARG B NH1 1 
ATOM   6271  N  NH2 . ARG C 1 213 ? -19.326 60.435  39.971  1.00 6.10  ? 213 ARG B NH2 1 
ATOM   6272  N  N   . TRP C 1 214 ? -12.431 58.968  35.732  1.00 8.26  ? 214 TRP B N   1 
ATOM   6273  C  CA  . TRP C 1 214 ? -11.044 58.785  35.323  1.00 7.85  ? 214 TRP B CA  1 
ATOM   6274  C  C   . TRP C 1 214 ? -10.666 57.553  34.511  1.00 8.24  ? 214 TRP B C   1 
ATOM   6275  O  O   . TRP C 1 214 ? -9.912  57.670  33.544  1.00 8.64  ? 214 TRP B O   1 
ATOM   6276  C  CB  . TRP C 1 214 ? -10.103 58.887  36.539  1.00 7.68  ? 214 TRP B CB  1 
ATOM   6277  C  CG  . TRP C 1 214 ? -10.118 57.700  37.457  1.00 8.88  ? 214 TRP B CG  1 
ATOM   6278  C  CD1 . TRP C 1 214 ? -10.947 57.494  38.523  1.00 7.28  ? 214 TRP B CD1 1 
ATOM   6279  C  CD2 . TRP C 1 214 ? -9.271  56.544  37.375  1.00 8.93  ? 214 TRP B CD2 1 
ATOM   6280  N  NE1 . TRP C 1 214 ? -10.670 56.282  39.109  1.00 8.40  ? 214 TRP B NE1 1 
ATOM   6281  C  CE2 . TRP C 1 214 ? -9.646  55.677  38.425  1.00 8.20  ? 214 TRP B CE2 1 
ATOM   6282  C  CE3 . TRP C 1 214 ? -8.229  56.158  36.516  1.00 5.34  ? 214 TRP B CE3 1 
ATOM   6283  C  CZ2 . TRP C 1 214 ? -9.022  54.440  38.640  1.00 8.47  ? 214 TRP B CZ2 1 
ATOM   6284  C  CZ3 . TRP C 1 214 ? -7.607  54.928  36.729  1.00 9.25  ? 214 TRP B CZ3 1 
ATOM   6285  C  CH2 . TRP C 1 214 ? -8.008  54.084  37.785  1.00 7.45  ? 214 TRP B CH2 1 
ATOM   6286  N  N   . ARG C 1 215 ? -11.165 56.379  34.881  1.00 7.93  ? 215 ARG B N   1 
ATOM   6287  C  CA  . ARG C 1 215 ? -10.792 55.174  34.143  1.00 8.63  ? 215 ARG B CA  1 
ATOM   6288  C  C   . ARG C 1 215 ? -11.310 55.209  32.706  1.00 8.76  ? 215 ARG B C   1 
ATOM   6289  O  O   . ARG C 1 215 ? -10.611 54.785  31.785  1.00 8.40  ? 215 ARG B O   1 
ATOM   6290  C  CB  . ARG C 1 215 ? -11.293 53.915  34.856  1.00 9.91  ? 215 ARG B CB  1 
ATOM   6291  C  CG  . ARG C 1 215 ? -10.571 52.639  34.403  1.00 9.87  ? 215 ARG B CG  1 
ATOM   6292  C  CD  . ARG C 1 215 ? -11.070 51.417  35.166  1.00 10.01 ? 215 ARG B CD  1 
ATOM   6293  N  NE  . ARG C 1 215 ? -10.253 50.231  34.921  1.00 9.68  ? 215 ARG B NE  1 
ATOM   6294  C  CZ  . ARG C 1 215 ? -10.192 49.577  33.763  1.00 9.87  ? 215 ARG B CZ  1 
ATOM   6295  N  NH1 . ARG C 1 215 ? -10.904 49.991  32.724  1.00 8.85  ? 215 ARG B NH1 1 
ATOM   6296  N  NH2 . ARG C 1 215 ? -9.417  48.505  33.645  1.00 8.89  ? 215 ARG B NH2 1 
ATOM   6297  N  N   . ASP C 1 216 ? -12.527 55.710  32.509  1.00 6.07  ? 216 ASP B N   1 
ATOM   6298  C  CA  . ASP C 1 216 ? -13.078 55.807  31.159  1.00 7.10  ? 216 ASP B CA  1 
ATOM   6299  C  C   . ASP C 1 216 ? -12.205 56.776  30.351  1.00 7.20  ? 216 ASP B C   1 
ATOM   6300  O  O   . ASP C 1 216 ? -11.904 56.528  29.181  1.00 8.01  ? 216 ASP B O   1 
ATOM   6301  C  CB  . ASP C 1 216 ? -14.526 56.325  31.185  1.00 6.51  ? 216 ASP B CB  1 
ATOM   6302  C  CG  . ASP C 1 216 ? -15.501 55.338  31.822  1.00 9.58  ? 216 ASP B CG  1 
ATOM   6303  O  OD1 . ASP C 1 216 ? -15.348 54.114  31.609  1.00 10.96 ? 216 ASP B OD1 1 
ATOM   6304  O  OD2 . ASP C 1 216 ? -16.437 55.788  32.518  1.00 9.55  ? 216 ASP B OD2 1 
ATOM   6305  N  N   . ARG C 1 217 ? -11.801 57.881  30.973  1.00 5.59  ? 217 ARG B N   1 
ATOM   6306  C  CA  . ARG C 1 217 ? -10.957 58.849  30.279  1.00 7.33  ? 217 ARG B CA  1 
ATOM   6307  C  C   . ARG C 1 217 ? -9.607  58.253  29.868  1.00 7.65  ? 217 ARG B C   1 
ATOM   6308  O  O   . ARG C 1 217 ? -9.194  58.385  28.716  1.00 8.53  ? 217 ARG B O   1 
ATOM   6309  C  CB  . ARG C 1 217 ? -10.705 60.090  31.142  1.00 6.83  ? 217 ARG B CB  1 
ATOM   6310  C  CG  . ARG C 1 217 ? -9.760  61.066  30.456  1.00 6.53  ? 217 ARG B CG  1 
ATOM   6311  C  CD  . ARG C 1 217 ? -9.610  62.386  31.182  1.00 6.01  ? 217 ARG B CD  1 
ATOM   6312  N  NE  . ARG C 1 217 ? -8.796  62.309  32.390  1.00 6.74  ? 217 ARG B NE  1 
ATOM   6313  C  CZ  . ARG C 1 217 ? -9.293  62.221  33.618  1.00 7.77  ? 217 ARG B CZ  1 
ATOM   6314  N  NH1 . ARG C 1 217 ? -10.609 62.187  33.802  1.00 9.39  ? 217 ARG B NH1 1 
ATOM   6315  N  NH2 . ARG C 1 217 ? -8.478  62.220  34.663  1.00 8.46  ? 217 ARG B NH2 1 
ATOM   6316  N  N   . PHE C 1 218 ? -8.917  57.626  30.820  1.00 7.09  ? 218 PHE B N   1 
ATOM   6317  C  CA  . PHE C 1 218 ? -7.612  57.004  30.573  1.00 7.75  ? 218 PHE B CA  1 
ATOM   6318  C  C   . PHE C 1 218 ? -7.701  56.020  29.407  1.00 7.64  ? 218 PHE B C   1 
ATOM   6319  O  O   . PHE C 1 218 ? -6.837  55.986  28.523  1.00 8.50  ? 218 PHE B O   1 
ATOM   6320  C  CB  . PHE C 1 218 ? -7.140  56.244  31.824  1.00 8.64  ? 218 PHE B CB  1 
ATOM   6321  C  CG  . PHE C 1 218 ? -6.530  57.119  32.896  1.00 9.37  ? 218 PHE B CG  1 
ATOM   6322  C  CD1 . PHE C 1 218 ? -7.039  58.385  33.172  1.00 8.78  ? 218 PHE B CD1 1 
ATOM   6323  C  CD2 . PHE C 1 218 ? -5.468  56.647  33.663  1.00 8.98  ? 218 PHE B CD2 1 
ATOM   6324  C  CE1 . PHE C 1 218 ? -6.498  59.167  34.200  1.00 8.46  ? 218 PHE B CE1 1 
ATOM   6325  C  CE2 . PHE C 1 218 ? -4.924  57.420  34.690  1.00 8.55  ? 218 PHE B CE2 1 
ATOM   6326  C  CZ  . PHE C 1 218 ? -5.440  58.683  34.959  1.00 8.22  ? 218 PHE B CZ  1 
ATOM   6327  N  N   . LEU C 1 219 ? -8.753  55.212  29.420  1.00 7.17  ? 219 LEU B N   1 
ATOM   6328  C  CA  . LEU C 1 219 ? -8.974  54.215  28.389  1.00 8.07  ? 219 LEU B CA  1 
ATOM   6329  C  C   . LEU C 1 219 ? -9.149  54.832  26.997  1.00 7.60  ? 219 LEU B C   1 
ATOM   6330  O  O   . LEU C 1 219 ? -8.488  54.415  26.044  1.00 7.69  ? 219 LEU B O   1 
ATOM   6331  C  CB  . LEU C 1 219 ? -10.194 53.366  28.769  1.00 11.13 ? 219 LEU B CB  1 
ATOM   6332  C  CG  . LEU C 1 219 ? -10.523 52.125  27.936  1.00 16.18 ? 219 LEU B CG  1 
ATOM   6333  C  CD1 . LEU C 1 219 ? -11.175 51.073  28.823  1.00 16.59 ? 219 LEU B CD1 1 
ATOM   6334  C  CD2 . LEU C 1 219 ? -11.433 52.511  26.773  1.00 16.27 ? 219 LEU B CD2 1 
ATOM   6335  N  N   . PHE C 1 220 ? -10.023 55.831  26.879  1.00 6.10  ? 220 PHE B N   1 
ATOM   6336  C  CA  . PHE C 1 220 ? -10.268 56.475  25.588  1.00 5.91  ? 220 PHE B CA  1 
ATOM   6337  C  C   . PHE C 1 220 ? -9.090  57.313  25.096  1.00 7.06  ? 220 PHE B C   1 
ATOM   6338  O  O   . PHE C 1 220 ? -8.856  57.413  23.889  1.00 7.07  ? 220 PHE B O   1 
ATOM   6339  C  CB  . PHE C 1 220 ? -11.530 57.353  25.645  1.00 4.69  ? 220 PHE B CB  1 
ATOM   6340  C  CG  . PHE C 1 220 ? -12.824 56.576  25.532  1.00 7.08  ? 220 PHE B CG  1 
ATOM   6341  C  CD1 . PHE C 1 220 ? -13.108 55.835  24.388  1.00 8.67  ? 220 PHE B CD1 1 
ATOM   6342  C  CD2 . PHE C 1 220 ? -13.757 56.595  26.561  1.00 8.55  ? 220 PHE B CD2 1 
ATOM   6343  C  CE1 . PHE C 1 220 ? -14.306 55.124  24.270  1.00 10.11 ? 220 PHE B CE1 1 
ATOM   6344  C  CE2 . PHE C 1 220 ? -14.962 55.886  26.455  1.00 10.18 ? 220 PHE B CE2 1 
ATOM   6345  C  CZ  . PHE C 1 220 ? -15.235 55.151  25.310  1.00 8.70  ? 220 PHE B CZ  1 
ATOM   6346  N  N   . CYS C 1 221 ? -8.356  57.925  26.018  1.00 6.25  ? 221 CYS B N   1 
ATOM   6347  C  CA  . CYS C 1 221 ? -7.212  58.740  25.616  1.00 7.90  ? 221 CYS B CA  1 
ATOM   6348  C  C   . CYS C 1 221 ? -6.076  57.871  25.104  1.00 8.22  ? 221 CYS B C   1 
ATOM   6349  O  O   . CYS C 1 221 ? -5.316  58.284  24.224  1.00 8.72  ? 221 CYS B O   1 
ATOM   6350  C  CB  . CYS C 1 221 ? -6.727  59.606  26.779  1.00 6.86  ? 221 CYS B CB  1 
ATOM   6351  S  SG  . CYS C 1 221 ? -7.785  61.031  27.077  1.00 10.98 ? 221 CYS B SG  1 
ATOM   6352  N  N   . ALA C 1 222 ? -5.952  56.667  25.653  1.00 7.75  ? 222 ALA B N   1 
ATOM   6353  C  CA  . ALA C 1 222 ? -4.899  55.772  25.194  1.00 8.98  ? 222 ALA B CA  1 
ATOM   6354  C  C   . ALA C 1 222 ? -5.227  55.318  23.775  1.00 8.19  ? 222 ALA B C   1 
ATOM   6355  O  O   . ALA C 1 222 ? -4.326  55.198  22.950  1.00 9.02  ? 222 ALA B O   1 
ATOM   6356  C  CB  . ALA C 1 222 ? -4.756  54.568  26.119  1.00 7.20  ? 222 ALA B CB  1 
ATOM   6357  N  N   . GLU C 1 223 ? -6.505  55.080  23.481  1.00 8.11  ? 223 GLU B N   1 
ATOM   6358  C  CA  . GLU C 1 223 ? -6.877  54.650  22.132  1.00 9.23  ? 223 GLU B CA  1 
ATOM   6359  C  C   . GLU C 1 223 ? -6.517  55.749  21.137  1.00 9.77  ? 223 GLU B C   1 
ATOM   6360  O  O   . GLU C 1 223 ? -5.918  55.484  20.098  1.00 10.20 ? 223 GLU B O   1 
ATOM   6361  C  CB  . GLU C 1 223 ? -8.384  54.357  22.016  1.00 10.18 ? 223 GLU B CB  1 
ATOM   6362  C  CG  . GLU C 1 223 ? -8.741  53.615  20.716  1.00 10.00 ? 223 GLU B CG  1 
ATOM   6363  C  CD  . GLU C 1 223 ? -10.215 53.686  20.332  1.00 10.66 ? 223 GLU B CD  1 
ATOM   6364  O  OE1 . GLU C 1 223 ? -11.087 53.722  21.230  1.00 8.46  ? 223 GLU B OE1 1 
ATOM   6365  O  OE2 . GLU C 1 223 ? -10.501 53.691  19.114  1.00 10.12 ? 223 GLU B OE2 1 
ATOM   6366  N  N   . ALA C 1 224 ? -6.888  56.982  21.468  1.00 8.16  ? 224 ALA B N   1 
ATOM   6367  C  CA  . ALA C 1 224 ? -6.626  58.131  20.608  1.00 11.18 ? 224 ALA B CA  1 
ATOM   6368  C  C   . ALA C 1 224 ? -5.132  58.382  20.441  1.00 11.02 ? 224 ALA B C   1 
ATOM   6369  O  O   . ALA C 1 224 ? -4.648  58.633  19.335  1.00 12.22 ? 224 ALA B O   1 
ATOM   6370  C  CB  . ALA C 1 224 ? -7.301  59.373  21.188  1.00 10.22 ? 224 ALA B CB  1 
ATOM   6371  N  N   . LEU C 1 225 ? -4.417  58.318  21.558  1.00 11.27 ? 225 LEU B N   1 
ATOM   6372  C  CA  . LEU C 1 225 ? -2.977  58.532  21.605  1.00 11.97 ? 225 LEU B CA  1 
ATOM   6373  C  C   . LEU C 1 225 ? -2.239  57.555  20.691  1.00 11.41 ? 225 LEU B C   1 
ATOM   6374  O  O   . LEU C 1 225 ? -1.358  57.954  19.925  1.00 11.62 ? 225 LEU B O   1 
ATOM   6375  C  CB  . LEU C 1 225 ? -2.520  58.383  23.061  1.00 14.92 ? 225 LEU B CB  1 
ATOM   6376  C  CG  . LEU C 1 225 ? -1.069  58.415  23.533  1.00 19.07 ? 225 LEU B CG  1 
ATOM   6377  C  CD1 . LEU C 1 225 ? -1.082  58.541  25.055  1.00 20.66 ? 225 LEU B CD1 1 
ATOM   6378  C  CD2 . LEU C 1 225 ? -0.321  57.158  23.109  1.00 15.53 ? 225 LEU B CD2 1 
ATOM   6379  N  N   . TYR C 1 226 ? -2.603  56.278  20.769  1.00 10.58 ? 226 TYR B N   1 
ATOM   6380  C  CA  . TYR C 1 226 ? -1.968  55.259  19.943  1.00 11.09 ? 226 TYR B CA  1 
ATOM   6381  C  C   . TYR C 1 226 ? -2.340  55.374  18.464  1.00 10.37 ? 226 TYR B C   1 
ATOM   6382  O  O   . TYR C 1 226 ? -1.541  55.024  17.596  1.00 9.79  ? 226 TYR B O   1 
ATOM   6383  C  CB  . TYR C 1 226 ? -2.306  53.856  20.466  1.00 9.33  ? 226 TYR B CB  1 
ATOM   6384  C  CG  . TYR C 1 226 ? -1.583  53.495  21.748  1.00 10.33 ? 226 TYR B CG  1 
ATOM   6385  C  CD1 . TYR C 1 226 ? -0.202  53.672  21.862  1.00 11.15 ? 226 TYR B CD1 1 
ATOM   6386  C  CD2 . TYR C 1 226 ? -2.266  52.935  22.831  1.00 10.73 ? 226 TYR B CD2 1 
ATOM   6387  C  CE1 . TYR C 1 226 ? 0.486   53.302  23.019  1.00 11.27 ? 226 TYR B CE1 1 
ATOM   6388  C  CE2 . TYR C 1 226 ? -1.585  52.554  23.998  1.00 10.94 ? 226 TYR B CE2 1 
ATOM   6389  C  CZ  . TYR C 1 226 ? -0.209  52.742  24.079  1.00 12.55 ? 226 TYR B CZ  1 
ATOM   6390  O  OH  . TYR C 1 226 ? 0.484   52.370  25.207  1.00 9.36  ? 226 TYR B OH  1 
ATOM   6391  N  N   . LYS C 1 227 ? -3.544  55.868  18.178  1.00 9.45  ? 227 LYS B N   1 
ATOM   6392  C  CA  . LYS C 1 227 ? -3.979  56.034  16.791  1.00 9.57  ? 227 LYS B CA  1 
ATOM   6393  C  C   . LYS C 1 227 ? -3.184  57.164  16.129  1.00 8.88  ? 227 LYS B C   1 
ATOM   6394  O  O   . LYS C 1 227 ? -2.794  57.065  14.964  1.00 6.65  ? 227 LYS B O   1 
ATOM   6395  C  CB  . LYS C 1 227 ? -5.477  56.360  16.726  1.00 7.83  ? 227 LYS B CB  1 
ATOM   6396  C  CG  . LYS C 1 227 ? -6.020  56.525  15.306  1.00 7.97  ? 227 LYS B CG  1 
ATOM   6397  C  CD  . LYS C 1 227 ? -7.480  56.983  15.320  1.00 9.29  ? 227 LYS B CD  1 
ATOM   6398  C  CE  . LYS C 1 227 ? -8.039  57.187  13.913  1.00 10.85 ? 227 LYS B CE  1 
ATOM   6399  N  NZ  . LYS C 1 227 ? -8.313  55.910  13.197  1.00 9.44  ? 227 LYS B NZ  1 
ATOM   6400  N  N   . ALA C 1 228 ? -2.945  58.235  16.882  1.00 8.39  ? 228 ALA B N   1 
ATOM   6401  C  CA  . ALA C 1 228 ? -2.198  59.382  16.376  1.00 8.33  ? 228 ALA B CA  1 
ATOM   6402  C  C   . ALA C 1 228 ? -0.728  59.026  16.164  1.00 8.50  ? 228 ALA B C   1 
ATOM   6403  O  O   . ALA C 1 228 ? -0.100  59.503  15.219  1.00 10.06 ? 228 ALA B O   1 
ATOM   6404  C  CB  . ALA C 1 228 ? -2.315  60.562  17.345  1.00 6.03  ? 228 ALA B CB  1 
ATOM   6405  N  N   . GLN C 1 229 ? -0.181  58.197  17.047  1.00 8.15  ? 229 GLN B N   1 
ATOM   6406  C  CA  . GLN C 1 229 ? 1.213   57.786  16.925  1.00 8.88  ? 229 GLN B CA  1 
ATOM   6407  C  C   . GLN C 1 229 ? 1.400   56.945  15.662  1.00 9.86  ? 229 GLN B C   1 
ATOM   6408  O  O   . GLN C 1 229 ? 2.367   57.127  14.924  1.00 10.74 ? 229 GLN B O   1 
ATOM   6409  C  CB  . GLN C 1 229 ? 1.650   56.987  18.156  1.00 8.88  ? 229 GLN B CB  1 
ATOM   6410  C  CG  . GLN C 1 229 ? 3.109   56.528  18.092  1.00 10.70 ? 229 GLN B CG  1 
ATOM   6411  C  CD  . GLN C 1 229 ? 3.623   55.996  19.418  1.00 14.57 ? 229 GLN B CD  1 
ATOM   6412  O  OE1 . GLN C 1 229 ? 3.558   56.675  20.446  1.00 11.16 ? 229 GLN B OE1 1 
ATOM   6413  N  NE2 . GLN C 1 229 ? 4.150   54.779  19.398  1.00 18.15 ? 229 GLN B NE2 1 
ATOM   6414  N  N   . ALA C 1 230 ? 0.469   56.028  15.413  1.00 8.94  ? 230 ALA B N   1 
ATOM   6415  C  CA  . ALA C 1 230 ? 0.534   55.172  14.230  1.00 10.06 ? 230 ALA B CA  1 
ATOM   6416  C  C   . ALA C 1 230 ? 0.407   56.006  12.957  1.00 10.99 ? 230 ALA B C   1 
ATOM   6417  O  O   . ALA C 1 230 ? 1.100   55.766  11.966  1.00 11.60 ? 230 ALA B O   1 
ATOM   6418  C  CB  . ALA C 1 230 ? -0.585  54.132  14.276  1.00 9.53  ? 230 ALA B CB  1 
ATOM   6419  N  N   . GLU C 1 231 ? -0.480  56.994  12.996  1.00 10.58 ? 231 GLU B N   1 
ATOM   6420  C  CA  . GLU C 1 231 ? -0.717  57.856  11.848  1.00 10.39 ? 231 GLU B CA  1 
ATOM   6421  C  C   . GLU C 1 231 ? 0.462   58.754  11.479  1.00 11.76 ? 231 GLU B C   1 
ATOM   6422  O  O   . GLU C 1 231 ? 0.785   58.902  10.300  1.00 11.96 ? 231 GLU B O   1 
ATOM   6423  C  CB  . GLU C 1 231 ? -1.956  58.726  12.097  1.00 10.68 ? 231 GLU B CB  1 
ATOM   6424  C  CG  . GLU C 1 231 ? -2.354  59.591  10.904  1.00 12.15 ? 231 GLU B CG  1 
ATOM   6425  C  CD  . GLU C 1 231 ? -3.612  60.413  11.162  1.00 12.78 ? 231 GLU B CD  1 
ATOM   6426  O  OE1 . GLU C 1 231 ? -4.602  59.835  11.652  1.00 11.55 ? 231 GLU B OE1 1 
ATOM   6427  O  OE2 . GLU C 1 231 ? -3.616  61.628  10.866  1.00 10.14 ? 231 GLU B OE2 1 
ATOM   6428  N  N   . THR C 1 232 ? 1.108   59.344  12.481  1.00 10.64 ? 232 THR B N   1 
ATOM   6429  C  CA  . THR C 1 232 ? 2.217   60.264  12.230  1.00 10.34 ? 232 THR B CA  1 
ATOM   6430  C  C   . THR C 1 232 ? 3.617   59.662  12.220  1.00 10.94 ? 232 THR B C   1 
ATOM   6431  O  O   . THR C 1 232 ? 4.509   60.168  11.538  1.00 12.94 ? 232 THR B O   1 
ATOM   6432  C  CB  . THR C 1 232 ? 2.227   61.402  13.263  1.00 11.11 ? 232 THR B CB  1 
ATOM   6433  O  OG1 . THR C 1 232 ? 2.478   60.855  14.564  1.00 9.73  ? 232 THR B OG1 1 
ATOM   6434  C  CG2 . THR C 1 232 ? 0.887   62.137  13.260  1.00 8.83  ? 232 THR B CG2 1 
ATOM   6435  N  N   . GLY C 1 233 ? 3.823   58.602  12.986  1.00 9.85  ? 233 GLY B N   1 
ATOM   6436  C  CA  . GLY C 1 233 ? 5.146   58.006  13.033  1.00 10.65 ? 233 GLY B CA  1 
ATOM   6437  C  C   . GLY C 1 233 ? 6.026   58.657  14.092  1.00 11.17 ? 233 GLY B C   1 
ATOM   6438  O  O   . GLY C 1 233 ? 7.210   58.337  14.201  1.00 10.76 ? 233 GLY B O   1 
ATOM   6439  N  N   . GLU C 1 234 ? 5.455   59.586  14.861  1.00 10.73 ? 234 GLU B N   1 
ATOM   6440  C  CA  . GLU C 1 234 ? 6.191   60.261  15.933  1.00 9.88  ? 234 GLU B CA  1 
ATOM   6441  C  C   . GLU C 1 234 ? 5.592   59.833  17.270  1.00 9.70  ? 234 GLU B C   1 
ATOM   6442  O  O   . GLU C 1 234 ? 4.378   59.654  17.386  1.00 9.44  ? 234 GLU B O   1 
ATOM   6443  C  CB  . GLU C 1 234 ? 6.097   61.787  15.800  1.00 10.09 ? 234 GLU B CB  1 
ATOM   6444  C  CG  . GLU C 1 234 ? 6.738   62.367  14.542  1.00 9.05  ? 234 GLU B CG  1 
ATOM   6445  C  CD  . GLU C 1 234 ? 6.726   63.893  14.525  1.00 12.15 ? 234 GLU B CD  1 
ATOM   6446  O  OE1 . GLU C 1 234 ? 5.892   64.499  15.235  1.00 9.41  ? 234 GLU B OE1 1 
ATOM   6447  O  OE2 . GLU C 1 234 ? 7.541   64.492  13.791  1.00 12.73 ? 234 GLU B OE2 1 
ATOM   6448  N  N   . ILE C 1 235 ? 6.443   59.661  18.277  1.00 8.46  ? 235 ILE B N   1 
ATOM   6449  C  CA  . ILE C 1 235 ? 5.981   59.243  19.596  1.00 8.33  ? 235 ILE B CA  1 
ATOM   6450  C  C   . ILE C 1 235 ? 5.109   60.320  20.247  1.00 8.34  ? 235 ILE B C   1 
ATOM   6451  O  O   . ILE C 1 235 ? 5.467   61.502  20.264  1.00 7.43  ? 235 ILE B O   1 
ATOM   6452  C  CB  . ILE C 1 235 ? 7.184   58.876  20.495  1.00 8.37  ? 235 ILE B CB  1 
ATOM   6453  C  CG1 . ILE C 1 235 ? 7.855   57.613  19.935  1.00 8.36  ? 235 ILE B CG1 1 
ATOM   6454  C  CG2 . ILE C 1 235 ? 6.730   58.657  21.940  1.00 8.12  ? 235 ILE B CG2 1 
ATOM   6455  C  CD1 . ILE C 1 235 ? 9.147   57.225  20.630  1.00 8.88  ? 235 ILE B CD1 1 
ATOM   6456  N  N   . LYS C 1 236 ? 3.961   59.889  20.770  1.00 8.19  ? 236 LYS B N   1 
ATOM   6457  C  CA  . LYS C 1 236 ? 2.984   60.778  21.397  1.00 8.99  ? 236 LYS B CA  1 
ATOM   6458  C  C   . LYS C 1 236 ? 2.709   60.454  22.859  1.00 9.31  ? 236 LYS B C   1 
ATOM   6459  O  O   . LYS C 1 236 ? 2.952   59.339  23.328  1.00 9.00  ? 236 LYS B O   1 
ATOM   6460  C  CB  . LYS C 1 236 ? 1.647   60.704  20.647  1.00 8.18  ? 236 LYS B CB  1 
ATOM   6461  C  CG  . LYS C 1 236 ? 1.743   60.895  19.145  1.00 7.58  ? 236 LYS B CG  1 
ATOM   6462  C  CD  . LYS C 1 236 ? 2.187   62.308  18.787  1.00 6.85  ? 236 LYS B CD  1 
ATOM   6463  C  CE  . LYS C 1 236 ? 2.195   62.508  17.281  1.00 6.83  ? 236 LYS B CE  1 
ATOM   6464  N  NZ  . LYS C 1 236 ? 2.405   63.940  16.920  1.00 8.02  ? 236 LYS B NZ  1 
ATOM   6465  N  N   . GLY C 1 237 ? 2.173   61.446  23.562  1.00 7.93  ? 237 GLY B N   1 
ATOM   6466  C  CA  . GLY C 1 237 ? 1.832   61.271  24.957  1.00 10.02 ? 237 GLY B CA  1 
ATOM   6467  C  C   . GLY C 1 237 ? 0.677   62.180  25.338  1.00 10.41 ? 237 GLY B C   1 
ATOM   6468  O  O   . GLY C 1 237 ? 0.418   63.180  24.669  1.00 10.30 ? 237 GLY B O   1 
ATOM   6469  N  N   . HIS C 1 238 ? -0.029  61.812  26.401  1.00 10.44 ? 238 HIS B N   1 
ATOM   6470  C  CA  . HIS C 1 238 ? -1.140  62.601  26.927  1.00 9.75  ? 238 HIS B CA  1 
ATOM   6471  C  C   . HIS C 1 238 ? -0.991  62.541  28.444  1.00 9.64  ? 238 HIS B C   1 
ATOM   6472  O  O   . HIS C 1 238 ? -1.075  61.457  29.019  1.00 10.63 ? 238 HIS B O   1 
ATOM   6473  C  CB  . HIS C 1 238 ? -2.495  61.994  26.537  1.00 9.67  ? 238 HIS B CB  1 
ATOM   6474  C  CG  . HIS C 1 238 ? -3.662  62.677  27.187  1.00 8.42  ? 238 HIS B CG  1 
ATOM   6475  N  ND1 . HIS C 1 238 ? -4.256  63.802  26.658  1.00 7.63  ? 238 HIS B ND1 1 
ATOM   6476  C  CD2 . HIS C 1 238 ? -4.285  62.439  28.364  1.00 8.09  ? 238 HIS B CD2 1 
ATOM   6477  C  CE1 . HIS C 1 238 ? -5.194  64.230  27.482  1.00 7.23  ? 238 HIS B CE1 1 
ATOM   6478  N  NE2 . HIS C 1 238 ? -5.233  63.423  28.527  1.00 7.54  ? 238 HIS B NE2 1 
ATOM   6479  N  N   . TYR C 1 239 ? -0.763  63.681  29.096  1.00 9.47  ? 239 TYR B N   1 
ATOM   6480  C  CA  . TYR C 1 239 ? -0.609  63.663  30.551  1.00 8.80  ? 239 TYR B CA  1 
ATOM   6481  C  C   . TYR C 1 239 ? -1.909  63.235  31.241  1.00 8.58  ? 239 TYR B C   1 
ATOM   6482  O  O   . TYR C 1 239 ? -2.870  64.005  31.310  1.00 7.95  ? 239 TYR B O   1 
ATOM   6483  C  CB  . TYR C 1 239 ? -0.229  65.036  31.131  1.00 7.82  ? 239 TYR B CB  1 
ATOM   6484  C  CG  . TYR C 1 239 ? 0.808   65.878  30.403  1.00 6.96  ? 239 TYR B CG  1 
ATOM   6485  C  CD1 . TYR C 1 239 ? 1.725   65.325  29.508  1.00 8.13  ? 239 TYR B CD1 1 
ATOM   6486  C  CD2 . TYR C 1 239 ? 0.868   67.254  30.633  1.00 9.96  ? 239 TYR B CD2 1 
ATOM   6487  C  CE1 . TYR C 1 239 ? 2.671   66.139  28.855  1.00 7.30  ? 239 TYR B CE1 1 
ATOM   6488  C  CE2 . TYR C 1 239 ? 1.795   68.064  29.992  1.00 7.00  ? 239 TYR B CE2 1 
ATOM   6489  C  CZ  . TYR C 1 239 ? 2.690   67.511  29.106  1.00 8.91  ? 239 TYR B CZ  1 
ATOM   6490  O  OH  . TYR C 1 239 ? 3.577   68.353  28.465  1.00 9.21  ? 239 TYR B OH  1 
ATOM   6491  N  N   . LEU C 1 240 ? -1.935  62.009  31.750  1.00 7.80  ? 240 LEU B N   1 
ATOM   6492  C  CA  . LEU C 1 240 ? -3.099  61.511  32.468  1.00 5.93  ? 240 LEU B CA  1 
ATOM   6493  C  C   . LEU C 1 240 ? -2.954  61.977  33.921  1.00 6.27  ? 240 LEU B C   1 
ATOM   6494  O  O   . LEU C 1 240 ? -1.969  61.664  34.591  1.00 7.09  ? 240 LEU B O   1 
ATOM   6495  C  CB  . LEU C 1 240 ? -3.152  59.986  32.372  1.00 6.04  ? 240 LEU B CB  1 
ATOM   6496  C  CG  . LEU C 1 240 ? -3.461  59.487  30.955  1.00 8.53  ? 240 LEU B CG  1 
ATOM   6497  C  CD1 . LEU C 1 240 ? -3.240  57.982  30.866  1.00 10.06 ? 240 LEU B CD1 1 
ATOM   6498  C  CD2 . LEU C 1 240 ? -4.898  59.845  30.591  1.00 8.00  ? 240 LEU B CD2 1 
ATOM   6499  N  N   . ASN C 1 241 ? -3.934  62.742  34.392  1.00 5.85  ? 241 ASN B N   1 
ATOM   6500  C  CA  . ASN C 1 241 ? -3.921  63.299  35.745  1.00 6.55  ? 241 ASN B CA  1 
ATOM   6501  C  C   . ASN C 1 241 ? -4.178  62.258  36.838  1.00 8.01  ? 241 ASN B C   1 
ATOM   6502  O  O   . ASN C 1 241 ? -5.255  61.654  36.900  1.00 8.27  ? 241 ASN B O   1 
ATOM   6503  C  CB  . ASN C 1 241 ? -4.973  64.415  35.849  1.00 6.73  ? 241 ASN B CB  1 
ATOM   6504  C  CG  . ASN C 1 241 ? -4.585  65.504  36.833  1.00 8.74  ? 241 ASN B CG  1 
ATOM   6505  O  OD1 . ASN C 1 241 ? -3.828  65.270  37.777  1.00 7.88  ? 241 ASN B OD1 1 
ATOM   6506  N  ND2 . ASN C 1 241 ? -5.120  66.704  36.624  1.00 8.43  ? 241 ASN B ND2 1 
ATOM   6507  N  N   . ALA C 1 242 ? -3.189  62.069  37.707  1.00 7.36  ? 242 ALA B N   1 
ATOM   6508  C  CA  . ALA C 1 242 ? -3.288  61.114  38.802  1.00 7.66  ? 242 ALA B CA  1 
ATOM   6509  C  C   . ALA C 1 242 ? -3.686  61.798  40.104  1.00 8.57  ? 242 ALA B C   1 
ATOM   6510  O  O   . ALA C 1 242 ? -3.874  61.139  41.122  1.00 10.67 ? 242 ALA B O   1 
ATOM   6511  C  CB  . ALA C 1 242 ? -1.962  60.383  38.979  1.00 10.16 ? 242 ALA B CB  1 
ATOM   6512  N  N   . THR C 1 243 ? -3.806  63.122  40.065  1.00 7.79  ? 243 THR B N   1 
ATOM   6513  C  CA  . THR C 1 243 ? -4.198  63.898  41.237  1.00 8.63  ? 243 THR B CA  1 
ATOM   6514  C  C   . THR C 1 243 ? -5.509  63.340  41.809  1.00 8.72  ? 243 THR B C   1 
ATOM   6515  O  O   . THR C 1 243 ? -6.490  63.181  41.081  1.00 6.65  ? 243 THR B O   1 
ATOM   6516  C  CB  . THR C 1 243 ? -4.397  65.380  40.858  1.00 9.25  ? 243 THR B CB  1 
ATOM   6517  O  OG1 . THR C 1 243 ? -3.178  65.900  40.311  1.00 8.46  ? 243 THR B OG1 1 
ATOM   6518  C  CG2 . THR C 1 243 ? -4.788  66.202  42.084  1.00 10.01 ? 243 THR B CG2 1 
ATOM   6519  N  N   . ALA C 1 244 ? -5.527  63.049  43.109  1.00 7.77  ? 244 ALA B N   1 
ATOM   6520  C  CA  . ALA C 1 244 ? -6.724  62.488  43.736  1.00 6.96  ? 244 ALA B CA  1 
ATOM   6521  C  C   . ALA C 1 244 ? -6.878  62.924  45.192  1.00 7.16  ? 244 ALA B C   1 
ATOM   6522  O  O   . ALA C 1 244 ? -6.056  63.673  45.712  1.00 5.94  ? 244 ALA B O   1 
ATOM   6523  C  CB  . ALA C 1 244 ? -6.685  60.970  43.646  1.00 6.94  ? 244 ALA B CB  1 
ATOM   6524  N  N   . GLY C 1 245 ? -7.932  62.444  45.847  1.00 7.33  ? 245 GLY B N   1 
ATOM   6525  C  CA  . GLY C 1 245 ? -8.180  62.814  47.232  1.00 6.14  ? 245 GLY B CA  1 
ATOM   6526  C  C   . GLY C 1 245 ? -7.379  62.066  48.286  1.00 7.44  ? 245 GLY B C   1 
ATOM   6527  O  O   . GLY C 1 245 ? -7.229  62.547  49.409  1.00 7.71  ? 245 GLY B O   1 
ATOM   6528  N  N   . THR C 1 246 ? -6.862  60.892  47.933  1.00 8.83  ? 246 THR B N   1 
ATOM   6529  C  CA  . THR C 1 246 ? -6.077  60.085  48.870  1.00 8.13  ? 246 THR B CA  1 
ATOM   6530  C  C   . THR C 1 246 ? -4.876  59.470  48.164  1.00 7.37  ? 246 THR B C   1 
ATOM   6531  O  O   . THR C 1 246 ? -4.831  59.432  46.935  1.00 8.49  ? 246 THR B O   1 
ATOM   6532  C  CB  . THR C 1 246 ? -6.911  58.921  49.446  1.00 7.82  ? 246 THR B CB  1 
ATOM   6533  O  OG1 . THR C 1 246 ? -7.334  58.069  48.375  1.00 7.62  ? 246 THR B OG1 1 
ATOM   6534  C  CG2 . THR C 1 246 ? -8.137  59.442  50.183  1.00 9.18  ? 246 THR B CG2 1 
ATOM   6535  N  N   . CYS C 1 247 ? -3.910  58.988  48.941  1.00 7.04  ? 247 CYS B N   1 
ATOM   6536  C  CA  . CYS C 1 247 ? -2.722  58.351  48.378  1.00 7.98  ? 247 CYS B CA  1 
ATOM   6537  C  C   . CYS C 1 247 ? -3.139  57.117  47.589  1.00 8.18  ? 247 CYS B C   1 
ATOM   6538  O  O   . CYS C 1 247 ? -2.618  56.853  46.503  1.00 8.69  ? 247 CYS B O   1 
ATOM   6539  C  CB  . CYS C 1 247 ? -1.756  57.926  49.493  1.00 7.21  ? 247 CYS B CB  1 
ATOM   6540  S  SG  . CYS C 1 247 ? -1.010  59.289  50.428  1.00 12.33 ? 247 CYS B SG  1 
ATOM   6541  N  N   . GLU C 1 248 ? -4.084  56.366  48.150  1.00 7.26  ? 248 GLU B N   1 
ATOM   6542  C  CA  . GLU C 1 248 ? -4.587  55.147  47.530  1.00 9.15  ? 248 GLU B CA  1 
ATOM   6543  C  C   . GLU C 1 248 ? -5.206  55.374  46.150  1.00 9.61  ? 248 GLU B C   1 
ATOM   6544  O  O   . GLU C 1 248 ? -4.955  54.606  45.219  1.00 7.13  ? 248 GLU B O   1 
ATOM   6545  C  CB  . GLU C 1 248 ? -5.616  54.475  48.450  1.00 11.54 ? 248 GLU B CB  1 
ATOM   6546  C  CG  . GLU C 1 248 ? -5.045  53.978  49.778  1.00 14.15 ? 248 GLU B CG  1 
ATOM   6547  C  CD  . GLU C 1 248 ? -4.934  55.065  50.843  1.00 16.73 ? 248 GLU B CD  1 
ATOM   6548  O  OE1 . GLU C 1 248 ? -5.224  56.246  50.552  1.00 16.50 ? 248 GLU B OE1 1 
ATOM   6549  O  OE2 . GLU C 1 248 ? -4.555  54.730  51.985  1.00 18.27 ? 248 GLU B OE2 1 
ATOM   6550  N  N   . ASP C 1 249 ? -6.023  56.418  46.021  1.00 9.40  ? 249 ASP B N   1 
ATOM   6551  C  CA  . ASP C 1 249 ? -6.660  56.726  44.746  1.00 9.31  ? 249 ASP B CA  1 
ATOM   6552  C  C   . ASP C 1 249 ? -5.633  57.197  43.728  1.00 10.00 ? 249 ASP B C   1 
ATOM   6553  O  O   . ASP C 1 249 ? -5.700  56.833  42.556  1.00 9.42  ? 249 ASP B O   1 
ATOM   6554  C  CB  . ASP C 1 249 ? -7.745  57.797  44.914  1.00 11.85 ? 249 ASP B CB  1 
ATOM   6555  C  CG  . ASP C 1 249 ? -9.045  57.231  45.456  1.00 14.63 ? 249 ASP B CG  1 
ATOM   6556  O  OD1 . ASP C 1 249 ? -9.231  55.999  45.397  1.00 16.88 ? 249 ASP B OD1 1 
ATOM   6557  O  OD2 . ASP C 1 249 ? -9.889  58.019  45.925  1.00 17.52 ? 249 ASP B OD2 1 
ATOM   6558  N  N   . MET C 1 250 ? -4.689  58.020  44.176  1.00 9.52  ? 250 MET B N   1 
ATOM   6559  C  CA  . MET C 1 250 ? -3.638  58.519  43.299  1.00 8.58  ? 250 MET B CA  1 
ATOM   6560  C  C   . MET C 1 250 ? -2.855  57.337  42.717  1.00 9.51  ? 250 MET B C   1 
ATOM   6561  O  O   . MET C 1 250 ? -2.613  57.275  41.514  1.00 7.78  ? 250 MET B O   1 
ATOM   6562  C  CB  . MET C 1 250 ? -2.694  59.442  44.080  1.00 8.33  ? 250 MET B CB  1 
ATOM   6563  C  CG  . MET C 1 250 ? -1.430  59.839  43.328  1.00 6.16  ? 250 MET B CG  1 
ATOM   6564  S  SD  . MET C 1 250 ? -0.285  60.794  44.353  1.00 10.25 ? 250 MET B SD  1 
ATOM   6565  C  CE  . MET C 1 250 ? 0.321   59.499  45.429  1.00 7.08  ? 250 MET B CE  1 
ATOM   6566  N  N   . MET C 1 251 ? -2.470  56.397  43.579  1.00 9.38  ? 251 MET B N   1 
ATOM   6567  C  CA  . MET C 1 251 ? -1.714  55.222  43.143  1.00 11.35 ? 251 MET B CA  1 
ATOM   6568  C  C   . MET C 1 251 ? -2.505  54.343  42.173  1.00 10.60 ? 251 MET B C   1 
ATOM   6569  O  O   . MET C 1 251 ? -1.953  53.801  41.212  1.00 11.57 ? 251 MET B O   1 
ATOM   6570  C  CB  . MET C 1 251 ? -1.284  54.391  44.359  1.00 12.60 ? 251 MET B CB  1 
ATOM   6571  C  CG  . MET C 1 251 ? -0.177  55.027  45.184  1.00 17.83 ? 251 MET B CG  1 
ATOM   6572  S  SD  . MET C 1 251 ? 1.324   55.332  44.206  1.00 25.07 ? 251 MET B SD  1 
ATOM   6573  C  CE  . MET C 1 251 ? 1.626   53.700  43.564  1.00 17.90 ? 251 MET B CE  1 
ATOM   6574  N  N   . LYS C 1 252 ? -3.800  54.214  42.435  1.00 9.92  ? 252 LYS B N   1 
ATOM   6575  C  CA  . LYS C 1 252 ? -4.698  53.414  41.612  1.00 11.82 ? 252 LYS B CA  1 
ATOM   6576  C  C   . LYS C 1 252 ? -4.697  53.909  40.167  1.00 11.31 ? 252 LYS B C   1 
ATOM   6577  O  O   . LYS C 1 252 ? -4.718  53.117  39.223  1.00 10.59 ? 252 LYS B O   1 
ATOM   6578  C  CB  . LYS C 1 252 ? -6.112  53.506  42.185  1.00 15.08 ? 252 LYS B CB  1 
ATOM   6579  C  CG  . LYS C 1 252 ? -6.872  52.205  42.227  1.00 20.52 ? 252 LYS B CG  1 
ATOM   6580  C  CD  . LYS C 1 252 ? -8.130  52.365  43.066  1.00 23.31 ? 252 LYS B CD  1 
ATOM   6581  C  CE  . LYS C 1 252 ? -8.839  51.038  43.253  1.00 27.62 ? 252 LYS B CE  1 
ATOM   6582  N  NZ  . LYS C 1 252 ? -10.008 51.161  44.169  1.00 29.29 ? 252 LYS B NZ  1 
ATOM   6583  N  N   . ARG C 1 253 ? -4.665  55.227  40.002  1.00 10.77 ? 253 ARG B N   1 
ATOM   6584  C  CA  . ARG C 1 253 ? -4.667  55.837  38.678  1.00 9.35  ? 253 ARG B CA  1 
ATOM   6585  C  C   . ARG C 1 253 ? -3.307  55.678  37.996  1.00 10.51 ? 253 ARG B C   1 
ATOM   6586  O  O   . ARG C 1 253 ? -3.234  55.382  36.802  1.00 8.46  ? 253 ARG B O   1 
ATOM   6587  C  CB  . ARG C 1 253 ? -5.081  57.311  38.809  1.00 8.91  ? 253 ARG B CB  1 
ATOM   6588  C  CG  . ARG C 1 253 ? -6.466  57.410  39.454  1.00 9.38  ? 253 ARG B CG  1 
ATOM   6589  C  CD  . ARG C 1 253 ? -7.021  58.809  39.720  1.00 7.76  ? 253 ARG B CD  1 
ATOM   6590  N  NE  . ARG C 1 253 ? -8.228  58.656  40.537  1.00 6.56  ? 253 ARG B NE  1 
ATOM   6591  C  CZ  . ARG C 1 253 ? -9.072  59.627  40.879  1.00 9.01  ? 253 ARG B CZ  1 
ATOM   6592  N  NH1 . ARG C 1 253 ? -8.877  60.878  40.483  1.00 7.85  ? 253 ARG B NH1 1 
ATOM   6593  N  NH2 . ARG C 1 253 ? -10.124 59.330  41.635  1.00 8.89  ? 253 ARG B NH2 1 
ATOM   6594  N  N   . ALA C 1 254 ? -2.233  55.857  38.756  1.00 9.49  ? 254 ALA B N   1 
ATOM   6595  C  CA  . ALA C 1 254 ? -0.889  55.701  38.212  1.00 10.44 ? 254 ALA B CA  1 
ATOM   6596  C  C   . ALA C 1 254 ? -0.699  54.259  37.756  1.00 9.85  ? 254 ALA B C   1 
ATOM   6597  O  O   . ALA C 1 254 ? -0.087  54.001  36.722  1.00 11.54 ? 254 ALA B O   1 
ATOM   6598  C  CB  . ALA C 1 254 ? 0.152   56.051  39.270  1.00 8.85  ? 254 ALA B CB  1 
ATOM   6599  N  N   . VAL C 1 255 ? -1.230  53.321  38.534  1.00 9.12  ? 255 VAL B N   1 
ATOM   6600  C  CA  . VAL C 1 255 ? -1.112  51.902  38.213  1.00 9.97  ? 255 VAL B CA  1 
ATOM   6601  C  C   . VAL C 1 255 ? -1.773  51.540  36.884  1.00 9.71  ? 255 VAL B C   1 
ATOM   6602  O  O   . VAL C 1 255 ? -1.219  50.767  36.101  1.00 7.69  ? 255 VAL B O   1 
ATOM   6603  C  CB  . VAL C 1 255 ? -1.709  51.023  39.345  1.00 10.78 ? 255 VAL B CB  1 
ATOM   6604  C  CG1 . VAL C 1 255 ? -1.834  49.574  38.888  1.00 11.32 ? 255 VAL B CG1 1 
ATOM   6605  C  CG2 . VAL C 1 255 ? -0.814  51.099  40.575  1.00 11.73 ? 255 VAL B CG2 1 
ATOM   6606  N  N   . PHE C 1 256 ? -2.952  52.095  36.624  1.00 8.81  ? 256 PHE B N   1 
ATOM   6607  C  CA  . PHE C 1 256 ? -3.644  51.797  35.376  1.00 9.63  ? 256 PHE B CA  1 
ATOM   6608  C  C   . PHE C 1 256 ? -2.887  52.390  34.190  1.00 9.90  ? 256 PHE B C   1 
ATOM   6609  O  O   . PHE C 1 256 ? -2.861  51.804  33.108  1.00 10.42 ? 256 PHE B O   1 
ATOM   6610  C  CB  . PHE C 1 256 ? -5.084  52.325  35.407  1.00 8.84  ? 256 PHE B CB  1 
ATOM   6611  C  CG  . PHE C 1 256 ? -5.918  51.879  34.232  1.00 11.04 ? 256 PHE B CG  1 
ATOM   6612  C  CD1 . PHE C 1 256 ? -5.900  50.550  33.819  1.00 9.49  ? 256 PHE B CD1 1 
ATOM   6613  C  CD2 . PHE C 1 256 ? -6.714  52.786  33.537  1.00 10.99 ? 256 PHE B CD2 1 
ATOM   6614  C  CE1 . PHE C 1 256 ? -6.662  50.127  32.728  1.00 10.94 ? 256 PHE B CE1 1 
ATOM   6615  C  CE2 . PHE C 1 256 ? -7.481  52.376  32.445  1.00 10.03 ? 256 PHE B CE2 1 
ATOM   6616  C  CZ  . PHE C 1 256 ? -7.452  51.041  32.039  1.00 11.86 ? 256 PHE B CZ  1 
ATOM   6617  N  N   . ALA C 1 257 ? -2.268  53.550  34.392  1.00 9.90  ? 257 ALA B N   1 
ATOM   6618  C  CA  . ALA C 1 257 ? -1.504  54.184  33.322  1.00 9.89  ? 257 ALA B CA  1 
ATOM   6619  C  C   . ALA C 1 257 ? -0.342  53.259  32.953  1.00 10.25 ? 257 ALA B C   1 
ATOM   6620  O  O   . ALA C 1 257 ? -0.007  53.099  31.782  1.00 8.63  ? 257 ALA B O   1 
ATOM   6621  C  CB  . ALA C 1 257 ? -0.979  55.541  33.779  1.00 10.85 ? 257 ALA B CB  1 
ATOM   6622  N  N   . ARG C 1 258 ? 0.254   52.648  33.973  1.00 9.47  ? 258 ARG B N   1 
ATOM   6623  C  CA  . ARG C 1 258 ? 1.369   51.719  33.802  1.00 11.03 ? 258 ARG B CA  1 
ATOM   6624  C  C   . ARG C 1 258 ? 0.876   50.515  32.991  1.00 11.85 ? 258 ARG B C   1 
ATOM   6625  O  O   . ARG C 1 258 ? 1.572   50.030  32.101  1.00 11.98 ? 258 ARG B O   1 
ATOM   6626  C  CB  . ARG C 1 258 ? 1.863   51.261  35.183  1.00 12.95 ? 258 ARG B CB  1 
ATOM   6627  C  CG  . ARG C 1 258 ? 3.333   50.844  35.286  1.00 17.90 ? 258 ARG B CG  1 
ATOM   6628  C  CD  . ARG C 1 258 ? 3.641   49.490  34.668  1.00 21.14 ? 258 ARG B CD  1 
ATOM   6629  N  NE  . ARG C 1 258 ? 4.941   48.986  35.121  1.00 22.70 ? 258 ARG B NE  1 
ATOM   6630  C  CZ  . ARG C 1 258 ? 5.582   47.952  34.580  1.00 23.80 ? 258 ARG B CZ  1 
ATOM   6631  N  NH1 . ARG C 1 258 ? 5.053   47.300  33.553  1.00 22.11 ? 258 ARG B NH1 1 
ATOM   6632  N  NH2 . ARG C 1 258 ? 6.756   47.567  35.072  1.00 22.23 ? 258 ARG B NH2 1 
ATOM   6633  N  N   . GLU C 1 259 ? -0.329  50.044  33.302  1.00 11.01 ? 259 GLU B N   1 
ATOM   6634  C  CA  . GLU C 1 259 ? -0.904  48.897  32.602  1.00 11.08 ? 259 GLU B CA  1 
ATOM   6635  C  C   . GLU C 1 259 ? -1.146  49.201  31.126  1.00 9.38  ? 259 GLU B C   1 
ATOM   6636  O  O   . GLU C 1 259 ? -0.963  48.334  30.274  1.00 9.14  ? 259 GLU B O   1 
ATOM   6637  C  CB  . GLU C 1 259 ? -2.228  48.471  33.253  1.00 12.77 ? 259 GLU B CB  1 
ATOM   6638  C  CG  . GLU C 1 259 ? -2.769  47.141  32.728  1.00 17.88 ? 259 GLU B CG  1 
ATOM   6639  C  CD  . GLU C 1 259 ? -4.198  46.852  33.168  1.00 21.42 ? 259 GLU B CD  1 
ATOM   6640  O  OE1 . GLU C 1 259 ? -4.510  47.027  34.367  1.00 21.03 ? 259 GLU B OE1 1 
ATOM   6641  O  OE2 . GLU C 1 259 ? -5.010  46.438  32.312  1.00 22.11 ? 259 GLU B OE2 1 
ATOM   6642  N  N   . LEU C 1 260 ? -1.566  50.429  30.832  1.00 7.91  ? 260 LEU B N   1 
ATOM   6643  C  CA  . LEU C 1 260 ? -1.835  50.850  29.461  1.00 9.15  ? 260 LEU B CA  1 
ATOM   6644  C  C   . LEU C 1 260 ? -0.557  51.030  28.637  1.00 9.77  ? 260 LEU B C   1 
ATOM   6645  O  O   . LEU C 1 260 ? -0.608  51.112  27.408  1.00 9.52  ? 260 LEU B O   1 
ATOM   6646  C  CB  . LEU C 1 260 ? -2.638  52.153  29.467  1.00 9.71  ? 260 LEU B CB  1 
ATOM   6647  C  CG  . LEU C 1 260 ? -4.082  52.034  29.966  1.00 12.97 ? 260 LEU B CG  1 
ATOM   6648  C  CD1 . LEU C 1 260 ? -4.639  53.417  30.272  1.00 12.50 ? 260 LEU B CD1 1 
ATOM   6649  C  CD2 . LEU C 1 260 ? -4.929  51.314  28.920  1.00 11.59 ? 260 LEU B CD2 1 
ATOM   6650  N  N   . GLY C 1 261 ? 0.584   51.094  29.318  1.00 8.97  ? 261 GLY B N   1 
ATOM   6651  C  CA  . GLY C 1 261 ? 1.857   51.252  28.634  1.00 10.17 ? 261 GLY B CA  1 
ATOM   6652  C  C   . GLY C 1 261 ? 2.149   52.645  28.096  1.00 9.65  ? 261 GLY B C   1 
ATOM   6653  O  O   . GLY C 1 261 ? 3.052   52.813  27.271  1.00 9.21  ? 261 GLY B O   1 
ATOM   6654  N  N   . VAL C 1 262 ? 1.392   53.640  28.554  1.00 8.36  ? 262 VAL B N   1 
ATOM   6655  C  CA  . VAL C 1 262 ? 1.585   55.017  28.107  1.00 8.93  ? 262 VAL B CA  1 
ATOM   6656  C  C   . VAL C 1 262 ? 2.834   55.631  28.754  1.00 8.68  ? 262 VAL B C   1 
ATOM   6657  O  O   . VAL C 1 262 ? 3.243   55.231  29.841  1.00 9.21  ? 262 VAL B O   1 
ATOM   6658  C  CB  . VAL C 1 262 ? 0.333   55.876  28.401  1.00 9.77  ? 262 VAL B CB  1 
ATOM   6659  C  CG1 . VAL C 1 262 ? -0.838  55.358  27.582  1.00 11.27 ? 262 VAL B CG1 1 
ATOM   6660  C  CG2 . VAL C 1 262 ? -0.008  55.834  29.887  1.00 10.80 ? 262 VAL B CG2 1 
ATOM   6661  N  N   . PRO C 1 263 ? 3.441   56.633  28.096  1.00 8.37  ? 263 PRO B N   1 
ATOM   6662  C  CA  . PRO C 1 263 ? 4.654   57.293  28.592  1.00 8.57  ? 263 PRO B CA  1 
ATOM   6663  C  C   . PRO C 1 263 ? 4.628   58.333  29.712  1.00 9.68  ? 263 PRO B C   1 
ATOM   6664  O  O   . PRO C 1 263 ? 5.646   58.532  30.381  1.00 9.47  ? 263 PRO B O   1 
ATOM   6665  C  CB  . PRO C 1 263 ? 5.248   57.885  27.320  1.00 8.31  ? 263 PRO B CB  1 
ATOM   6666  C  CG  . PRO C 1 263 ? 4.009   58.345  26.588  1.00 9.24  ? 263 PRO B CG  1 
ATOM   6667  C  CD  . PRO C 1 263 ? 3.043   57.180  26.782  1.00 7.09  ? 263 PRO B CD  1 
ATOM   6668  N  N   . ILE C 1 264 ? 3.494   58.986  29.943  1.00 10.14 ? 264 ILE B N   1 
ATOM   6669  C  CA  . ILE C 1 264 ? 3.487   60.048  30.940  1.00 9.64  ? 264 ILE B CA  1 
ATOM   6670  C  C   . ILE C 1 264 ? 2.193   60.290  31.717  1.00 9.15  ? 264 ILE B C   1 
ATOM   6671  O  O   . ILE C 1 264 ? 1.093   60.094  31.201  1.00 10.94 ? 264 ILE B O   1 
ATOM   6672  C  CB  . ILE C 1 264 ? 3.915   61.367  30.237  1.00 10.82 ? 264 ILE B CB  1 
ATOM   6673  C  CG1 . ILE C 1 264 ? 3.999   62.522  31.226  1.00 10.15 ? 264 ILE B CG1 1 
ATOM   6674  C  CG2 . ILE C 1 264 ? 2.920   61.702  29.130  1.00 12.66 ? 264 ILE B CG2 1 
ATOM   6675  C  CD1 . ILE C 1 264 ? 4.772   63.713  30.677  1.00 11.69 ? 264 ILE B CD1 1 
ATOM   6676  N  N   . VAL C 1 265 ? 2.347   60.708  32.972  1.00 8.21  ? 265 VAL B N   1 
ATOM   6677  C  CA  . VAL C 1 265 ? 1.224   61.041  33.851  1.00 8.03  ? 265 VAL B CA  1 
ATOM   6678  C  C   . VAL C 1 265 ? 1.507   62.418  34.460  1.00 8.08  ? 265 VAL B C   1 
ATOM   6679  O  O   . VAL C 1 265 ? 2.626   62.922  34.355  1.00 8.61  ? 265 VAL B O   1 
ATOM   6680  C  CB  . VAL C 1 265 ? 1.058   60.005  34.997  1.00 9.60  ? 265 VAL B CB  1 
ATOM   6681  C  CG1 . VAL C 1 265 ? 0.610   58.668  34.429  1.00 7.38  ? 265 VAL B CG1 1 
ATOM   6682  C  CG2 . VAL C 1 265 ? 2.369   59.844  35.761  1.00 7.08  ? 265 VAL B CG2 1 
ATOM   6683  N  N   . MET C 1 266 ? 0.502   63.038  35.074  1.00 7.90  ? 266 MET B N   1 
ATOM   6684  C  CA  . MET C 1 266 ? 0.705   64.347  35.688  1.00 8.64  ? 266 MET B CA  1 
ATOM   6685  C  C   . MET C 1 266 ? 0.162   64.419  37.116  1.00 8.23  ? 266 MET B C   1 
ATOM   6686  O  O   . MET C 1 266 ? -0.653  63.595  37.530  1.00 8.04  ? 266 MET B O   1 
ATOM   6687  C  CB  . MET C 1 266 ? 0.077   65.458  34.833  1.00 9.57  ? 266 MET B CB  1 
ATOM   6688  C  CG  . MET C 1 266 ? -1.439  65.524  34.862  1.00 10.63 ? 266 MET B CG  1 
ATOM   6689  S  SD  . MET C 1 266 ? -2.099  66.881  33.842  1.00 10.58 ? 266 MET B SD  1 
ATOM   6690  C  CE  . MET C 1 266 ? -2.198  68.198  35.023  1.00 8.22  ? 266 MET B CE  1 
ATOM   6691  N  N   . HIS C 1 267 ? 0.628   65.411  37.864  1.00 6.33  ? 267 HIS B N   1 
ATOM   6692  C  CA  . HIS C 1 267 ? 0.196   65.598  39.241  1.00 8.61  ? 267 HIS B CA  1 
ATOM   6693  C  C   . HIS C 1 267 ? 0.221   67.078  39.622  1.00 7.83  ? 267 HIS B C   1 
ATOM   6694  O  O   . HIS C 1 267 ? 1.135   67.809  39.233  1.00 6.95  ? 267 HIS B O   1 
ATOM   6695  C  CB  . HIS C 1 267 ? 1.113   64.805  40.187  1.00 8.05  ? 267 HIS B CB  1 
ATOM   6696  C  CG  . HIS C 1 267 ? 0.634   64.763  41.607  1.00 10.33 ? 267 HIS B CG  1 
ATOM   6697  N  ND1 . HIS C 1 267 ? 1.417   65.151  42.671  1.00 8.43  ? 267 HIS B ND1 1 
ATOM   6698  C  CD2 . HIS C 1 267 ? -0.549  64.365  42.139  1.00 9.58  ? 267 HIS B CD2 1 
ATOM   6699  C  CE1 . HIS C 1 267 ? 0.742   64.997  43.797  1.00 10.14 ? 267 HIS B CE1 1 
ATOM   6700  N  NE2 . HIS C 1 267 ? -0.455  64.521  43.499  1.00 10.67 ? 267 HIS B NE2 1 
ATOM   6701  N  N   . ASP C 1 268 ? -0.793  67.522  40.361  1.00 8.29  ? 268 ASP B N   1 
ATOM   6702  C  CA  . ASP C 1 268 ? -0.839  68.907  40.827  1.00 6.90  ? 268 ASP B CA  1 
ATOM   6703  C  C   . ASP C 1 268 ? -0.128  68.803  42.173  1.00 8.24  ? 268 ASP B C   1 
ATOM   6704  O  O   . ASP C 1 268 ? -0.750  68.453  43.178  1.00 8.21  ? 268 ASP B O   1 
ATOM   6705  C  CB  . ASP C 1 268 ? -2.286  69.376  41.033  1.00 5.69  ? 268 ASP B CB  1 
ATOM   6706  C  CG  . ASP C 1 268 ? -3.161  69.177  39.800  1.00 7.98  ? 268 ASP B CG  1 
ATOM   6707  O  OD1 . ASP C 1 268 ? -2.619  69.052  38.681  1.00 7.90  ? 268 ASP B OD1 1 
ATOM   6708  O  OD2 . ASP C 1 268 ? -4.405  69.164  39.952  1.00 7.57  ? 268 ASP B OD2 1 
ATOM   6709  N  N   . TYR C 1 269 ? 1.166   69.115  42.203  1.00 7.85  ? 269 TYR B N   1 
ATOM   6710  C  CA  . TYR C 1 269 ? 1.927   68.952  43.433  1.00 7.53  ? 269 TYR B CA  1 
ATOM   6711  C  C   . TYR C 1 269 ? 1.596   69.798  44.652  1.00 7.55  ? 269 TYR B C   1 
ATOM   6712  O  O   . TYR C 1 269 ? 1.856   69.364  45.773  1.00 8.68  ? 269 TYR B O   1 
ATOM   6713  C  CB  . TYR C 1 269 ? 3.440   69.005  43.138  1.00 7.33  ? 269 TYR B CB  1 
ATOM   6714  C  CG  . TYR C 1 269 ? 4.102   70.370  43.115  1.00 7.24  ? 269 TYR B CG  1 
ATOM   6715  C  CD1 . TYR C 1 269 ? 3.707   71.358  42.210  1.00 6.87  ? 269 TYR B CD1 1 
ATOM   6716  C  CD2 . TYR C 1 269 ? 5.193   70.638  43.945  1.00 7.45  ? 269 TYR B CD2 1 
ATOM   6717  C  CE1 . TYR C 1 269 ? 4.394   72.576  42.129  1.00 7.86  ? 269 TYR B CE1 1 
ATOM   6718  C  CE2 . TYR C 1 269 ? 5.880   71.845  43.875  1.00 6.26  ? 269 TYR B CE2 1 
ATOM   6719  C  CZ  . TYR C 1 269 ? 5.482   72.808  42.966  1.00 7.65  ? 269 TYR B CZ  1 
ATOM   6720  O  OH  . TYR C 1 269 ? 6.187   73.990  42.888  1.00 9.17  ? 269 TYR B OH  1 
ATOM   6721  N  N   . LEU C 1 270 ? 1.013   70.978  44.467  1.00 7.23  ? 270 LEU B N   1 
ATOM   6722  C  CA  . LEU C 1 270 ? 0.691   71.808  45.621  1.00 7.45  ? 270 LEU B CA  1 
ATOM   6723  C  C   . LEU C 1 270 ? -0.689  71.508  46.207  1.00 8.72  ? 270 LEU B C   1 
ATOM   6724  O  O   . LEU C 1 270 ? -0.858  71.501  47.429  1.00 9.52  ? 270 LEU B O   1 
ATOM   6725  C  CB  . LEU C 1 270 ? 0.808   73.294  45.266  1.00 8.08  ? 270 LEU B CB  1 
ATOM   6726  C  CG  . LEU C 1 270 ? 2.218   73.754  44.866  1.00 10.04 ? 270 LEU B CG  1 
ATOM   6727  C  CD1 . LEU C 1 270 ? 2.194   75.226  44.486  1.00 6.60  ? 270 LEU B CD1 1 
ATOM   6728  C  CD2 . LEU C 1 270 ? 3.191   73.513  46.018  1.00 10.39 ? 270 LEU B CD2 1 
ATOM   6729  N  N   . THR C 1 271 ? -1.675  71.252  45.354  1.00 8.60  ? 271 THR B N   1 
ATOM   6730  C  CA  . THR C 1 271 ? -3.016  70.945  45.850  1.00 7.78  ? 271 THR B CA  1 
ATOM   6731  C  C   . THR C 1 271 ? -3.053  69.500  46.350  1.00 8.39  ? 271 THR B C   1 
ATOM   6732  O  O   . THR C 1 271 ? -3.813  69.164  47.259  1.00 9.62  ? 271 THR B O   1 
ATOM   6733  C  CB  . THR C 1 271 ? -4.095  71.159  44.760  1.00 8.21  ? 271 THR B CB  1 
ATOM   6734  O  OG1 . THR C 1 271 ? -3.821  70.327  43.627  1.00 4.70  ? 271 THR B OG1 1 
ATOM   6735  C  CG2 . THR C 1 271 ? -4.120  72.619  44.327  1.00 7.36  ? 271 THR B CG2 1 
ATOM   6736  N  N   . GLY C 1 272 ? -2.229  68.649  45.742  1.00 8.60  ? 272 GLY B N   1 
ATOM   6737  C  CA  . GLY C 1 272 ? -2.141  67.263  46.166  1.00 7.34  ? 272 GLY B CA  1 
ATOM   6738  C  C   . GLY C 1 272 ? -1.254  67.190  47.401  1.00 8.23  ? 272 GLY B C   1 
ATOM   6739  O  O   . GLY C 1 272 ? -1.569  66.487  48.363  1.00 8.44  ? 272 GLY B O   1 
ATOM   6740  N  N   . GLY C 1 273 ? -0.140  67.922  47.381  1.00 6.64  ? 273 GLY B N   1 
ATOM   6741  C  CA  . GLY C 1 273 ? 0.751   67.934  48.528  1.00 6.13  ? 273 GLY B CA  1 
ATOM   6742  C  C   . GLY C 1 273 ? 2.098   67.279  48.286  1.00 5.67  ? 273 GLY B C   1 
ATOM   6743  O  O   . GLY C 1 273 ? 2.208   66.342  47.498  1.00 7.03  ? 273 GLY B O   1 
ATOM   6744  N  N   . PHE C 1 274 ? 3.121   67.769  48.979  1.00 6.55  ? 274 PHE B N   1 
ATOM   6745  C  CA  . PHE C 1 274 ? 4.476   67.248  48.834  1.00 7.52  ? 274 PHE B CA  1 
ATOM   6746  C  C   . PHE C 1 274 ? 4.631   65.788  49.234  1.00 6.81  ? 274 PHE B C   1 
ATOM   6747  O  O   . PHE C 1 274 ? 5.343   65.037  48.576  1.00 4.92  ? 274 PHE B O   1 
ATOM   6748  C  CB  . PHE C 1 274 ? 5.456   68.113  49.631  1.00 11.16 ? 274 PHE B CB  1 
ATOM   6749  C  CG  . PHE C 1 274 ? 5.789   69.416  48.962  1.00 14.09 ? 274 PHE B CG  1 
ATOM   6750  C  CD1 . PHE C 1 274 ? 6.474   69.428  47.750  1.00 17.30 ? 274 PHE B CD1 1 
ATOM   6751  C  CD2 . PHE C 1 274 ? 5.402   70.626  49.525  1.00 17.47 ? 274 PHE B CD2 1 
ATOM   6752  C  CE1 . PHE C 1 274 ? 6.772   70.626  47.112  1.00 18.12 ? 274 PHE B CE1 1 
ATOM   6753  C  CE2 . PHE C 1 274 ? 5.696   71.832  48.892  1.00 17.22 ? 274 PHE B CE2 1 
ATOM   6754  C  CZ  . PHE C 1 274 ? 6.379   71.831  47.685  1.00 16.50 ? 274 PHE B CZ  1 
ATOM   6755  N  N   . THR C 1 275 ? 3.962   65.378  50.305  1.00 7.87  ? 275 THR B N   1 
ATOM   6756  C  CA  . THR C 1 275 ? 4.060   63.995  50.743  1.00 8.73  ? 275 THR B CA  1 
ATOM   6757  C  C   . THR C 1 275 ? 3.581   63.041  49.641  1.00 9.71  ? 275 THR B C   1 
ATOM   6758  O  O   . THR C 1 275 ? 4.274   62.082  49.293  1.00 8.55  ? 275 THR B O   1 
ATOM   6759  C  CB  . THR C 1 275 ? 3.241   63.775  52.031  1.00 10.88 ? 275 THR B CB  1 
ATOM   6760  O  OG1 . THR C 1 275 ? 3.800   64.572  53.083  1.00 7.61  ? 275 THR B OG1 1 
ATOM   6761  C  CG2 . THR C 1 275 ? 3.257   62.308  52.442  1.00 8.46  ? 275 THR B CG2 1 
ATOM   6762  N  N   . ALA C 1 276 ? 2.402   63.312  49.087  1.00 7.85  ? 276 ALA B N   1 
ATOM   6763  C  CA  . ALA C 1 276 ? 1.851   62.476  48.025  1.00 6.64  ? 276 ALA B CA  1 
ATOM   6764  C  C   . ALA C 1 276 ? 2.680   62.610  46.744  1.00 6.46  ? 276 ALA B C   1 
ATOM   6765  O  O   . ALA C 1 276 ? 2.847   61.645  45.999  1.00 6.73  ? 276 ALA B O   1 
ATOM   6766  C  CB  . ALA C 1 276 ? 0.393   62.862  47.751  1.00 7.26  ? 276 ALA B CB  1 
ATOM   6767  N  N   . ASN C 1 277 ? 3.208   63.802  46.485  1.00 5.94  ? 277 ASN B N   1 
ATOM   6768  C  CA  . ASN C 1 277 ? 3.998   63.992  45.279  1.00 7.06  ? 277 ASN B CA  1 
ATOM   6769  C  C   . ASN C 1 277 ? 5.278   63.167  45.317  1.00 5.29  ? 277 ASN B C   1 
ATOM   6770  O  O   . ASN C 1 277 ? 5.665   62.576  44.314  1.00 5.81  ? 277 ASN B O   1 
ATOM   6771  C  CB  . ASN C 1 277 ? 4.366   65.458  45.074  1.00 6.70  ? 277 ASN B CB  1 
ATOM   6772  C  CG  . ASN C 1 277 ? 5.001   65.702  43.718  1.00 9.75  ? 277 ASN B CG  1 
ATOM   6773  O  OD1 . ASN C 1 277 ? 4.320   65.686  42.691  1.00 10.09 ? 277 ASN B OD1 1 
ATOM   6774  N  ND2 . ASN C 1 277 ? 6.317   65.905  43.704  1.00 8.35  ? 277 ASN B ND2 1 
ATOM   6775  N  N   . THR C 1 278 ? 5.933   63.131  46.474  1.00 6.89  ? 278 THR B N   1 
ATOM   6776  C  CA  . THR C 1 278 ? 7.171   62.372  46.610  1.00 5.66  ? 278 THR B CA  1 
ATOM   6777  C  C   . THR C 1 278 ? 6.889   60.888  46.407  1.00 7.26  ? 278 THR B C   1 
ATOM   6778  O  O   . THR C 1 278 ? 7.697   60.176  45.814  1.00 6.56  ? 278 THR B O   1 
ATOM   6779  C  CB  . THR C 1 278 ? 7.832   62.606  47.989  1.00 7.62  ? 278 THR B CB  1 
ATOM   6780  O  OG1 . THR C 1 278 ? 8.026   64.014  48.186  1.00 4.63  ? 278 THR B OG1 1 
ATOM   6781  C  CG2 . THR C 1 278 ? 9.196   61.916  48.054  1.00 4.88  ? 278 THR B CG2 1 
ATOM   6782  N  N   . THR C 1 279 ? 5.742   60.423  46.895  1.00 6.42  ? 279 THR B N   1 
ATOM   6783  C  CA  . THR C 1 279 ? 5.362   59.023  46.713  1.00 7.58  ? 279 THR B CA  1 
ATOM   6784  C  C   . THR C 1 279 ? 5.235   58.709  45.216  1.00 7.79  ? 279 THR B C   1 
ATOM   6785  O  O   . THR C 1 279 ? 5.758   57.703  44.730  1.00 7.58  ? 279 THR B O   1 
ATOM   6786  C  CB  . THR C 1 279 ? 4.005   58.712  47.401  1.00 8.43  ? 279 THR B CB  1 
ATOM   6787  O  OG1 . THR C 1 279 ? 4.189   58.656  48.820  1.00 7.66  ? 279 THR B OG1 1 
ATOM   6788  C  CG2 . THR C 1 279 ? 3.434   57.388  46.907  1.00 8.72  ? 279 THR B CG2 1 
ATOM   6789  N  N   . LEU C 1 280 ? 4.540   59.578  44.488  1.00 6.50  ? 280 LEU B N   1 
ATOM   6790  C  CA  . LEU C 1 280 ? 4.339   59.384  43.055  1.00 5.95  ? 280 LEU B CA  1 
ATOM   6791  C  C   . LEU C 1 280 ? 5.661   59.467  42.300  1.00 6.43  ? 280 LEU B C   1 
ATOM   6792  O  O   . LEU C 1 280 ? 5.910   58.696  41.372  1.00 6.39  ? 280 LEU B O   1 
ATOM   6793  C  CB  . LEU C 1 280 ? 3.352   60.428  42.516  1.00 6.71  ? 280 LEU B CB  1 
ATOM   6794  C  CG  . LEU C 1 280 ? 2.915   60.305  41.052  1.00 8.61  ? 280 LEU B CG  1 
ATOM   6795  C  CD1 . LEU C 1 280 ? 2.406   58.896  40.757  1.00 7.43  ? 280 LEU B CD1 1 
ATOM   6796  C  CD2 . LEU C 1 280 ? 1.823   61.325  40.778  1.00 8.94  ? 280 LEU B CD2 1 
ATOM   6797  N  N   . SER C 1 281 ? 6.514   60.398  42.710  1.00 6.30  ? 281 SER B N   1 
ATOM   6798  C  CA  . SER C 1 281 ? 7.812   60.564  42.077  1.00 7.39  ? 281 SER B CA  1 
ATOM   6799  C  C   . SER C 1 281 ? 8.613   59.263  42.141  1.00 6.98  ? 281 SER B C   1 
ATOM   6800  O  O   . SER C 1 281 ? 9.211   58.844  41.151  1.00 7.28  ? 281 SER B O   1 
ATOM   6801  C  CB  . SER C 1 281 ? 8.586   61.690  42.767  1.00 8.15  ? 281 SER B CB  1 
ATOM   6802  O  OG  . SER C 1 281 ? 9.848   61.886  42.160  1.00 11.63 ? 281 SER B OG  1 
ATOM   6803  N  N   . HIS C 1 282 ? 8.623   58.624  43.307  1.00 5.41  ? 282 HIS B N   1 
ATOM   6804  C  CA  . HIS C 1 282 ? 9.347   57.372  43.476  1.00 6.14  ? 282 HIS B CA  1 
ATOM   6805  C  C   . HIS C 1 282 ? 8.724   56.259  42.633  1.00 6.12  ? 282 HIS B C   1 
ATOM   6806  O  O   . HIS C 1 282 ? 9.433   55.447  42.040  1.00 5.39  ? 282 HIS B O   1 
ATOM   6807  C  CB  . HIS C 1 282 ? 9.362   56.969  44.951  1.00 6.86  ? 282 HIS B CB  1 
ATOM   6808  C  CG  . HIS C 1 282 ? 10.186  57.876  45.810  1.00 11.13 ? 282 HIS B CG  1 
ATOM   6809  N  ND1 . HIS C 1 282 ? 10.884  58.948  45.301  1.00 12.26 ? 282 HIS B ND1 1 
ATOM   6810  C  CD2 . HIS C 1 282 ? 10.433  57.862  47.140  1.00 10.68 ? 282 HIS B CD2 1 
ATOM   6811  C  CE1 . HIS C 1 282 ? 11.529  59.557  46.279  1.00 12.50 ? 282 HIS B CE1 1 
ATOM   6812  N  NE2 . HIS C 1 282 ? 11.272  58.916  47.408  1.00 13.85 ? 282 HIS B NE2 1 
ATOM   6813  N  N   . TYR C 1 283 ? 7.397   56.231  42.571  1.00 5.49  ? 283 TYR B N   1 
ATOM   6814  C  CA  . TYR C 1 283 ? 6.706   55.217  41.783  1.00 5.95  ? 283 TYR B CA  1 
ATOM   6815  C  C   . TYR C 1 283 ? 7.047   55.373  40.295  1.00 7.37  ? 283 TYR B C   1 
ATOM   6816  O  O   . TYR C 1 283 ? 7.286   54.386  39.595  1.00 6.62  ? 283 TYR B O   1 
ATOM   6817  C  CB  . TYR C 1 283 ? 5.191   55.335  41.967  1.00 7.29  ? 283 TYR B CB  1 
ATOM   6818  C  CG  . TYR C 1 283 ? 4.413   54.345  41.131  1.00 9.51  ? 283 TYR B CG  1 
ATOM   6819  C  CD1 . TYR C 1 283 ? 4.273   53.019  41.536  1.00 9.72  ? 283 TYR B CD1 1 
ATOM   6820  C  CD2 . TYR C 1 283 ? 3.872   54.719  39.901  1.00 10.85 ? 283 TYR B CD2 1 
ATOM   6821  C  CE1 . TYR C 1 283 ? 3.618   52.087  40.735  1.00 10.96 ? 283 TYR B CE1 1 
ATOM   6822  C  CE2 . TYR C 1 283 ? 3.219   53.798  39.091  1.00 9.72  ? 283 TYR B CE2 1 
ATOM   6823  C  CZ  . TYR C 1 283 ? 3.096   52.485  39.511  1.00 12.14 ? 283 TYR B CZ  1 
ATOM   6824  O  OH  . TYR C 1 283 ? 2.472   51.563  38.702  1.00 11.92 ? 283 TYR B OH  1 
ATOM   6825  N  N   . CYS C 1 284 ? 7.072   56.613  39.815  1.00 6.81  ? 284 CYS B N   1 
ATOM   6826  C  CA  . CYS C 1 284 ? 7.374   56.865  38.408  1.00 8.26  ? 284 CYS B CA  1 
ATOM   6827  C  C   . CYS C 1 284 ? 8.792   56.425  38.053  1.00 8.69  ? 284 CYS B C   1 
ATOM   6828  O  O   . CYS C 1 284 ? 9.038   55.936  36.948  1.00 8.25  ? 284 CYS B O   1 
ATOM   6829  C  CB  . CYS C 1 284 ? 7.166   58.348  38.072  1.00 7.30  ? 284 CYS B CB  1 
ATOM   6830  S  SG  . CYS C 1 284 ? 5.415   58.847  38.025  1.00 10.34 ? 284 CYS B SG  1 
ATOM   6831  N  N   . ARG C 1 285 ? 9.719   56.602  38.993  1.00 8.86  ? 285 ARG B N   1 
ATOM   6832  C  CA  . ARG C 1 285 ? 11.108  56.197  38.798  1.00 8.90  ? 285 ARG B CA  1 
ATOM   6833  C  C   . ARG C 1 285 ? 11.171  54.676  38.677  1.00 9.15  ? 285 ARG B C   1 
ATOM   6834  O  O   . ARG C 1 285 ? 11.846  54.148  37.799  1.00 12.15 ? 285 ARG B O   1 
ATOM   6835  C  CB  . ARG C 1 285 ? 11.974  56.669  39.981  1.00 7.54  ? 285 ARG B CB  1 
ATOM   6836  C  CG  . ARG C 1 285 ? 13.372  56.029  40.085  1.00 9.16  ? 285 ARG B CG  1 
ATOM   6837  C  CD  . ARG C 1 285 ? 14.313  56.416  38.945  1.00 7.10  ? 285 ARG B CD  1 
ATOM   6838  N  NE  . ARG C 1 285 ? 14.763  57.811  38.986  1.00 7.59  ? 285 ARG B NE  1 
ATOM   6839  C  CZ  . ARG C 1 285 ? 15.787  58.273  39.705  1.00 9.96  ? 285 ARG B CZ  1 
ATOM   6840  N  NH1 . ARG C 1 285 ? 16.502  57.460  40.475  1.00 9.51  ? 285 ARG B NH1 1 
ATOM   6841  N  NH2 . ARG C 1 285 ? 16.111  59.558  39.639  1.00 8.31  ? 285 ARG B NH2 1 
ATOM   6842  N  N   . ASP C 1 286 ? 10.453  53.974  39.546  1.00 9.39  ? 286 ASP B N   1 
ATOM   6843  C  CA  . ASP C 1 286 ? 10.459  52.514  39.524  1.00 11.40 ? 286 ASP B CA  1 
ATOM   6844  C  C   . ASP C 1 286 ? 9.653   51.871  38.407  1.00 10.31 ? 286 ASP B C   1 
ATOM   6845  O  O   . ASP C 1 286 ? 9.780   50.668  38.171  1.00 9.41  ? 286 ASP B O   1 
ATOM   6846  C  CB  . ASP C 1 286 ? 9.960   51.948  40.858  1.00 14.63 ? 286 ASP B CB  1 
ATOM   6847  C  CG  . ASP C 1 286 ? 10.972  52.100  41.971  1.00 20.26 ? 286 ASP B CG  1 
ATOM   6848  O  OD1 . ASP C 1 286 ? 12.184  51.965  41.692  1.00 22.13 ? 286 ASP B OD1 1 
ATOM   6849  O  OD2 . ASP C 1 286 ? 10.557  52.337  43.125  1.00 25.12 ? 286 ASP B OD2 1 
ATOM   6850  N  N   . ASN C 1 287 ? 8.824   52.652  37.722  1.00 8.95  ? 287 ASN B N   1 
ATOM   6851  C  CA  . ASN C 1 287 ? 8.000   52.093  36.659  1.00 9.04  ? 287 ASN B CA  1 
ATOM   6852  C  C   . ASN C 1 287 ? 8.143   52.742  35.294  1.00 8.23  ? 287 ASN B C   1 
ATOM   6853  O  O   . ASN C 1 287 ? 7.336   52.496  34.396  1.00 10.42 ? 287 ASN B O   1 
ATOM   6854  C  CB  . ASN C 1 287 ? 6.540   52.091  37.103  1.00 8.72  ? 287 ASN B CB  1 
ATOM   6855  C  CG  . ASN C 1 287 ? 6.270   51.048  38.163  1.00 9.95  ? 287 ASN B CG  1 
ATOM   6856  O  OD1 . ASN C 1 287 ? 6.092   49.875  37.854  1.00 13.90 ? 287 ASN B OD1 1 
ATOM   6857  N  ND2 . ASN C 1 287 ? 6.270   51.465  39.425  1.00 9.29  ? 287 ASN B ND2 1 
ATOM   6858  N  N   . GLY C 1 288 ? 9.169   53.571  35.143  1.00 7.71  ? 288 GLY B N   1 
ATOM   6859  C  CA  . GLY C 1 288 ? 9.432   54.208  33.865  1.00 7.89  ? 288 GLY B CA  1 
ATOM   6860  C  C   . GLY C 1 288 ? 8.440   55.228  33.341  1.00 8.01  ? 288 GLY B C   1 
ATOM   6861  O  O   . GLY C 1 288 ? 8.351   55.425  32.126  1.00 9.79  ? 288 GLY B O   1 
ATOM   6862  N  N   . LEU C 1 289 ? 7.708   55.891  34.230  1.00 6.88  ? 289 LEU B N   1 
ATOM   6863  C  CA  . LEU C 1 289 ? 6.735   56.892  33.799  1.00 7.42  ? 289 LEU B CA  1 
ATOM   6864  C  C   . LEU C 1 289 ? 7.257   58.315  33.951  1.00 7.34  ? 289 LEU B C   1 
ATOM   6865  O  O   . LEU C 1 289 ? 7.804   58.676  34.988  1.00 7.99  ? 289 LEU B O   1 
ATOM   6866  C  CB  . LEU C 1 289 ? 5.434   56.755  34.599  1.00 8.13  ? 289 LEU B CB  1 
ATOM   6867  C  CG  . LEU C 1 289 ? 4.515   55.571  34.286  1.00 10.47 ? 289 LEU B CG  1 
ATOM   6868  C  CD1 . LEU C 1 289 ? 3.464   55.432  35.376  1.00 10.58 ? 289 LEU B CD1 1 
ATOM   6869  C  CD2 . LEU C 1 289 ? 3.864   55.783  32.930  1.00 10.42 ? 289 LEU B CD2 1 
ATOM   6870  N  N   . LEU C 1 290 ? 7.093   59.117  32.904  1.00 8.13  ? 290 LEU B N   1 
ATOM   6871  C  CA  . LEU C 1 290 ? 7.504   60.513  32.953  1.00 7.65  ? 290 LEU B CA  1 
ATOM   6872  C  C   . LEU C 1 290 ? 6.462   61.192  33.836  1.00 7.99  ? 290 LEU B C   1 
ATOM   6873  O  O   . LEU C 1 290 ? 5.300   60.790  33.839  1.00 6.78  ? 290 LEU B O   1 
ATOM   6874  C  CB  . LEU C 1 290 ? 7.496   61.122  31.548  1.00 7.73  ? 290 LEU B CB  1 
ATOM   6875  C  CG  . LEU C 1 290 ? 8.629   60.668  30.618  1.00 7.98  ? 290 LEU B CG  1 
ATOM   6876  C  CD1 . LEU C 1 290 ? 8.378   61.194  29.216  1.00 10.31 ? 290 LEU B CD1 1 
ATOM   6877  C  CD2 . LEU C 1 290 ? 9.968   61.169  31.144  1.00 7.07  ? 290 LEU B CD2 1 
ATOM   6878  N  N   . LEU C 1 291 ? 6.869   62.214  34.580  1.00 6.99  ? 291 LEU B N   1 
ATOM   6879  C  CA  . LEU C 1 291 ? 5.952   62.902  35.482  1.00 7.48  ? 291 LEU B CA  1 
ATOM   6880  C  C   . LEU C 1 291 ? 5.856   64.401  35.246  1.00 7.43  ? 291 LEU B C   1 
ATOM   6881  O  O   . LEU C 1 291 ? 6.798   65.147  35.519  1.00 8.31  ? 291 LEU B O   1 
ATOM   6882  C  CB  . LEU C 1 291 ? 6.370   62.648  36.935  1.00 5.73  ? 291 LEU B CB  1 
ATOM   6883  C  CG  . LEU C 1 291 ? 5.529   63.282  38.046  1.00 8.57  ? 291 LEU B CG  1 
ATOM   6884  C  CD1 . LEU C 1 291 ? 4.067   62.856  37.913  1.00 5.65  ? 291 LEU B CD1 1 
ATOM   6885  C  CD2 . LEU C 1 291 ? 6.092   62.852  39.398  1.00 7.02  ? 291 LEU B CD2 1 
ATOM   6886  N  N   . HIS C 1 292 ? 4.711   64.837  34.734  1.00 7.30  ? 292 HIS B N   1 
ATOM   6887  C  CA  . HIS C 1 292 ? 4.480   66.252  34.479  1.00 7.90  ? 292 HIS B CA  1 
ATOM   6888  C  C   . HIS C 1 292 ? 3.891   66.873  35.739  1.00 6.44  ? 292 HIS B C   1 
ATOM   6889  O  O   . HIS C 1 292 ? 2.921   66.359  36.295  1.00 6.35  ? 292 HIS B O   1 
ATOM   6890  C  CB  . HIS C 1 292 ? 3.492   66.452  33.328  1.00 4.41  ? 292 HIS B CB  1 
ATOM   6891  C  CG  . HIS C 1 292 ? 3.080   67.876  33.141  1.00 4.30  ? 292 HIS B CG  1 
ATOM   6892  N  ND1 . HIS C 1 292 ? 3.865   68.801  32.485  1.00 4.86  ? 292 HIS B ND1 1 
ATOM   6893  C  CD2 . HIS C 1 292 ? 1.978   68.548  33.557  1.00 7.40  ? 292 HIS B CD2 1 
ATOM   6894  C  CE1 . HIS C 1 292 ? 3.263   69.976  32.502  1.00 6.04  ? 292 HIS B CE1 1 
ATOM   6895  N  NE2 . HIS C 1 292 ? 2.119   69.852  33.145  1.00 4.55  ? 292 HIS B NE2 1 
ATOM   6896  N  N   . ILE C 1 293 ? 4.467   67.988  36.174  1.00 6.60  ? 293 ILE B N   1 
ATOM   6897  C  CA  . ILE C 1 293 ? 3.987   68.653  37.373  1.00 5.58  ? 293 ILE B CA  1 
ATOM   6898  C  C   . ILE C 1 293 ? 3.304   69.980  37.072  1.00 6.12  ? 293 ILE B C   1 
ATOM   6899  O  O   . ILE C 1 293 ? 3.867   70.845  36.396  1.00 7.61  ? 293 ILE B O   1 
ATOM   6900  C  CB  . ILE C 1 293 ? 5.145   68.908  38.368  1.00 7.75  ? 293 ILE B CB  1 
ATOM   6901  C  CG1 . ILE C 1 293 ? 5.795   67.578  38.767  1.00 7.00  ? 293 ILE B CG1 1 
ATOM   6902  C  CG2 . ILE C 1 293 ? 4.626   69.659  39.592  1.00 6.57  ? 293 ILE B CG2 1 
ATOM   6903  C  CD1 . ILE C 1 293 ? 4.891   66.658  39.562  1.00 6.16  ? 293 ILE B CD1 1 
ATOM   6904  N  N   . HIS C 1 294 ? 2.083   70.127  37.578  1.00 6.17  ? 294 HIS B N   1 
ATOM   6905  C  CA  . HIS C 1 294 ? 1.303   71.350  37.407  1.00 5.70  ? 294 HIS B CA  1 
ATOM   6906  C  C   . HIS C 1 294 ? 1.393   72.101  38.737  1.00 6.95  ? 294 HIS B C   1 
ATOM   6907  O  O   . HIS C 1 294 ? 1.295   71.496  39.806  1.00 6.52  ? 294 HIS B O   1 
ATOM   6908  C  CB  . HIS C 1 294 ? -0.152  71.003  37.072  1.00 5.37  ? 294 HIS B CB  1 
ATOM   6909  C  CG  . HIS C 1 294 ? -0.981  72.182  36.665  1.00 6.62  ? 294 HIS B CG  1 
ATOM   6910  N  ND1 . HIS C 1 294 ? -1.518  73.067  37.574  1.00 7.43  ? 294 HIS B ND1 1 
ATOM   6911  C  CD2 . HIS C 1 294 ? -1.345  72.635  35.441  1.00 7.33  ? 294 HIS B CD2 1 
ATOM   6912  C  CE1 . HIS C 1 294 ? -2.176  74.014  36.930  1.00 8.73  ? 294 HIS B CE1 1 
ATOM   6913  N  NE2 . HIS C 1 294 ? -2.086  73.776  35.634  1.00 8.33  ? 294 HIS B NE2 1 
ATOM   6914  N  N   . ARG C 1 295 ? 1.582   73.414  38.675  1.00 6.85  ? 295 ARG B N   1 
ATOM   6915  C  CA  . ARG C 1 295 ? 1.730   74.210  39.889  1.00 6.89  ? 295 ARG B CA  1 
ATOM   6916  C  C   . ARG C 1 295 ? 0.466   74.904  40.386  1.00 7.65  ? 295 ARG B C   1 
ATOM   6917  O  O   . ARG C 1 295 ? 0.543   75.977  40.977  1.00 7.44  ? 295 ARG B O   1 
ATOM   6918  C  CB  . ARG C 1 295 ? 2.837   75.249  39.687  1.00 8.13  ? 295 ARG B CB  1 
ATOM   6919  C  CG  . ARG C 1 295 ? 2.613   76.150  38.485  1.00 7.16  ? 295 ARG B CG  1 
ATOM   6920  C  CD  . ARG C 1 295 ? 3.728   77.177  38.349  1.00 7.61  ? 295 ARG B CD  1 
ATOM   6921  N  NE  . ARG C 1 295 ? 3.383   78.201  37.367  1.00 8.56  ? 295 ARG B NE  1 
ATOM   6922  C  CZ  . ARG C 1 295 ? 4.098   79.300  37.147  1.00 9.32  ? 295 ARG B CZ  1 
ATOM   6923  N  NH1 . ARG C 1 295 ? 5.209   79.519  37.839  1.00 6.42  ? 295 ARG B NH1 1 
ATOM   6924  N  NH2 . ARG C 1 295 ? 3.693   80.185  36.246  1.00 9.44  ? 295 ARG B NH2 1 
ATOM   6925  N  N   . ALA C 1 296 ? -0.692  74.287  40.162  1.00 7.13  ? 296 ALA B N   1 
ATOM   6926  C  CA  . ALA C 1 296 ? -1.960  74.861  40.610  1.00 7.19  ? 296 ALA B CA  1 
ATOM   6927  C  C   . ALA C 1 296 ? -1.858  75.372  42.045  1.00 6.43  ? 296 ALA B C   1 
ATOM   6928  O  O   . ALA C 1 296 ? -1.320  74.681  42.908  1.00 4.88  ? 296 ALA B O   1 
ATOM   6929  C  CB  . ALA C 1 296 ? -3.062  73.819  40.517  1.00 5.98  ? 296 ALA B CB  1 
ATOM   6930  N  N   . MET C 1 297 ? -2.371  76.582  42.278  1.00 6.43  ? 297 MET B N   1 
ATOM   6931  C  CA  . MET C 1 297 ? -2.382  77.235  43.593  1.00 8.04  ? 297 MET B CA  1 
ATOM   6932  C  C   . MET C 1 297 ? -1.137  78.059  43.938  1.00 8.61  ? 297 MET B C   1 
ATOM   6933  O  O   . MET C 1 297 ? -1.141  78.825  44.899  1.00 8.47  ? 297 MET B O   1 
ATOM   6934  C  CB  . MET C 1 297 ? -2.616  76.205  44.706  1.00 10.09 ? 297 MET B CB  1 
ATOM   6935  C  CG  . MET C 1 297 ? -3.030  76.821  46.037  1.00 16.25 ? 297 MET B CG  1 
ATOM   6936  S  SD  . MET C 1 297 ? -3.349  75.591  47.332  1.00 21.44 ? 297 MET B SD  1 
ATOM   6937  C  CE  . MET C 1 297 ? -2.823  76.496  48.792  1.00 22.81 ? 297 MET B CE  1 
ATOM   6938  N  N   . HIS C 1 298 ? -0.076  77.919  43.155  1.00 9.61  ? 298 HIS B N   1 
ATOM   6939  C  CA  . HIS C 1 298 ? 1.157   78.650  43.444  1.00 9.80  ? 298 HIS B CA  1 
ATOM   6940  C  C   . HIS C 1 298 ? 0.994   80.168  43.593  1.00 10.38 ? 298 HIS B C   1 
ATOM   6941  O  O   . HIS C 1 298 ? 1.613   80.774  44.472  1.00 8.74  ? 298 HIS B O   1 
ATOM   6942  C  CB  . HIS C 1 298 ? 2.213   78.336  42.377  1.00 8.65  ? 298 HIS B CB  1 
ATOM   6943  C  CG  . HIS C 1 298 ? 2.037   79.102  41.102  1.00 8.38  ? 298 HIS B CG  1 
ATOM   6944  N  ND1 . HIS C 1 298 ? 2.710   80.278  40.846  1.00 7.64  ? 298 HIS B ND1 1 
ATOM   6945  C  CD2 . HIS C 1 298 ? 1.250   78.874  40.027  1.00 5.69  ? 298 HIS B CD2 1 
ATOM   6946  C  CE1 . HIS C 1 298 ? 2.343   80.741  39.665  1.00 6.22  ? 298 HIS B CE1 1 
ATOM   6947  N  NE2 . HIS C 1 298 ? 1.456   79.908  39.145  1.00 7.03  ? 298 HIS B NE2 1 
ATOM   6948  N  N   . ALA C 1 299 ? 0.160   80.781  42.753  1.00 10.51 ? 299 ALA B N   1 
ATOM   6949  C  CA  . ALA C 1 299 ? -0.040  82.231  42.807  1.00 10.88 ? 299 ALA B CA  1 
ATOM   6950  C  C   . ALA C 1 299 ? -0.695  82.711  44.098  1.00 11.13 ? 299 ALA B C   1 
ATOM   6951  O  O   . ALA C 1 299 ? -0.612  83.893  44.438  1.00 12.07 ? 299 ALA B O   1 
ATOM   6952  C  CB  . ALA C 1 299 ? -0.851  82.699  41.603  1.00 12.03 ? 299 ALA B CB  1 
ATOM   6953  N  N   . VAL C 1 300 ? -1.363  81.803  44.805  1.00 10.07 ? 300 VAL B N   1 
ATOM   6954  C  CA  . VAL C 1 300 ? -1.991  82.145  46.075  1.00 8.46  ? 300 VAL B CA  1 
ATOM   6955  C  C   . VAL C 1 300 ? -0.869  82.485  47.060  1.00 10.87 ? 300 VAL B C   1 
ATOM   6956  O  O   . VAL C 1 300 ? -1.043  83.290  47.974  1.00 11.24 ? 300 VAL B O   1 
ATOM   6957  C  CB  . VAL C 1 300 ? -2.793  80.943  46.644  1.00 7.62  ? 300 VAL B CB  1 
ATOM   6958  C  CG1 . VAL C 1 300 ? -3.228  81.229  48.078  1.00 7.13  ? 300 VAL B CG1 1 
ATOM   6959  C  CG2 . VAL C 1 300 ? -4.003  80.655  45.766  1.00 7.19  ? 300 VAL B CG2 1 
ATOM   6960  N  N   . ILE C 1 301 ? 0.287   81.864  46.834  1.00 11.93 ? 301 ILE B N   1 
ATOM   6961  C  CA  . ILE C 1 301 ? 1.474   82.002  47.675  1.00 11.74 ? 301 ILE B CA  1 
ATOM   6962  C  C   . ILE C 1 301 ? 2.574   82.951  47.189  1.00 11.31 ? 301 ILE B C   1 
ATOM   6963  O  O   . ILE C 1 301 ? 3.166   83.675  47.992  1.00 8.10  ? 301 ILE B O   1 
ATOM   6964  C  CB  . ILE C 1 301 ? 2.154   80.614  47.867  1.00 14.02 ? 301 ILE B CB  1 
ATOM   6965  C  CG1 . ILE C 1 301 ? 1.238   79.677  48.646  1.00 17.30 ? 301 ILE B CG1 1 
ATOM   6966  C  CG2 . ILE C 1 301 ? 3.495   80.768  48.569  1.00 16.27 ? 301 ILE B CG2 1 
ATOM   6967  C  CD1 . ILE C 1 301 ? 1.763   78.258  48.712  1.00 19.92 ? 301 ILE B CD1 1 
ATOM   6968  N  N   . ASP C 1 302 ? 2.845   82.950  45.885  1.00 11.61 ? 302 ASP B N   1 
ATOM   6969  C  CA  . ASP C 1 302 ? 3.948   83.744  45.345  1.00 11.59 ? 302 ASP B CA  1 
ATOM   6970  C  C   . ASP C 1 302 ? 3.700   85.013  44.537  1.00 11.91 ? 302 ASP B C   1 
ATOM   6971  O  O   . ASP C 1 302 ? 4.649   85.559  43.972  1.00 10.84 ? 302 ASP B O   1 
ATOM   6972  C  CB  . ASP C 1 302 ? 4.847   82.833  44.503  1.00 10.74 ? 302 ASP B CB  1 
ATOM   6973  C  CG  . ASP C 1 302 ? 4.149   82.313  43.250  1.00 10.14 ? 302 ASP B CG  1 
ATOM   6974  O  OD1 . ASP C 1 302 ? 3.298   83.035  42.689  1.00 9.28  ? 302 ASP B OD1 1 
ATOM   6975  O  OD2 . ASP C 1 302 ? 4.469   81.189  42.809  1.00 9.43  ? 302 ASP B OD2 1 
ATOM   6976  N  N   . ARG C 1 303 ? 2.465   85.499  44.477  1.00 11.61 ? 303 ARG B N   1 
ATOM   6977  C  CA  . ARG C 1 303 ? 2.176   86.694  43.685  1.00 13.22 ? 303 ARG B CA  1 
ATOM   6978  C  C   . ARG C 1 303 ? 2.713   88.018  44.252  1.00 13.89 ? 303 ARG B C   1 
ATOM   6979  O  O   . ARG C 1 303 ? 3.379   88.771  43.539  1.00 14.77 ? 303 ARG B O   1 
ATOM   6980  C  CB  . ARG C 1 303 ? 0.660   86.824  43.463  1.00 13.28 ? 303 ARG B CB  1 
ATOM   6981  C  CG  . ARG C 1 303 ? 0.232   87.967  42.529  1.00 14.80 ? 303 ARG B CG  1 
ATOM   6982  C  CD  . ARG C 1 303 ? 0.335   87.572  41.060  1.00 14.35 ? 303 ARG B CD  1 
ATOM   6983  N  NE  . ARG C 1 303 ? 0.140   88.691  40.133  1.00 13.33 ? 303 ARG B NE  1 
ATOM   6984  C  CZ  . ARG C 1 303 ? -1.009  89.006  39.537  1.00 15.65 ? 303 ARG B CZ  1 
ATOM   6985  N  NH1 . ARG C 1 303 ? -2.110  88.295  39.758  1.00 10.78 ? 303 ARG B NH1 1 
ATOM   6986  N  NH2 . ARG C 1 303 ? -1.054  90.034  38.698  1.00 13.06 ? 303 ARG B NH2 1 
ATOM   6987  N  N   . GLN C 1 304 ? 2.437   88.294  45.526  1.00 13.10 ? 304 GLN B N   1 
ATOM   6988  C  CA  . GLN C 1 304 ? 2.849   89.556  46.141  1.00 13.02 ? 304 GLN B CA  1 
ATOM   6989  C  C   . GLN C 1 304 ? 4.296   89.638  46.630  1.00 12.47 ? 304 GLN B C   1 
ATOM   6990  O  O   . GLN C 1 304 ? 4.841   88.693  47.195  1.00 13.25 ? 304 GLN B O   1 
ATOM   6991  C  CB  . GLN C 1 304 ? 1.887   89.910  47.283  1.00 11.25 ? 304 GLN B CB  1 
ATOM   6992  C  CG  . GLN C 1 304 ? 0.408   89.786  46.906  1.00 12.05 ? 304 GLN B CG  1 
ATOM   6993  C  CD  . GLN C 1 304 ? -0.021  90.724  45.781  1.00 13.58 ? 304 GLN B CD  1 
ATOM   6994  O  OE1 . GLN C 1 304 ? -1.023  90.479  45.098  1.00 14.87 ? 304 GLN B OE1 1 
ATOM   6995  N  NE2 . GLN C 1 304 ? 0.725   91.804  45.592  1.00 12.47 ? 304 GLN B NE2 1 
ATOM   6996  N  N   . LYS C 1 305 ? 4.897   90.801  46.412  1.00 12.39 ? 305 LYS B N   1 
ATOM   6997  C  CA  . LYS C 1 305 ? 6.278   91.062  46.790  1.00 13.34 ? 305 LYS B CA  1 
ATOM   6998  C  C   . LYS C 1 305 ? 6.537   91.118  48.295  1.00 13.15 ? 305 LYS B C   1 
ATOM   6999  O  O   . LYS C 1 305 ? 7.609   90.733  48.759  1.00 12.87 ? 305 LYS B O   1 
ATOM   7000  C  CB  . LYS C 1 305 ? 6.719   92.384  46.160  1.00 16.76 ? 305 LYS B CB  1 
ATOM   7001  C  CG  . LYS C 1 305 ? 8.180   92.734  46.364  1.00 21.52 ? 305 LYS B CG  1 
ATOM   7002  C  CD  . LYS C 1 305 ? 8.514   94.041  45.659  1.00 25.03 ? 305 LYS B CD  1 
ATOM   7003  C  CE  . LYS C 1 305 ? 9.944   94.039  45.140  1.00 27.78 ? 305 LYS B CE  1 
ATOM   7004  N  NZ  . LYS C 1 305 ? 10.241  95.251  44.319  1.00 31.37 ? 305 LYS B NZ  1 
ATOM   7005  N  N   . ASN C 1 306 ? 5.554   91.593  49.054  1.00 13.03 ? 306 ASN B N   1 
ATOM   7006  C  CA  . ASN C 1 306 ? 5.705   91.745  50.500  1.00 13.33 ? 306 ASN B CA  1 
ATOM   7007  C  C   . ASN C 1 306 ? 5.429   90.526  51.376  1.00 13.04 ? 306 ASN B C   1 
ATOM   7008  O  O   . ASN C 1 306 ? 5.932   90.446  52.499  1.00 11.63 ? 306 ASN B O   1 
ATOM   7009  C  CB  . ASN C 1 306 ? 4.820   92.899  50.981  1.00 17.13 ? 306 ASN B CB  1 
ATOM   7010  C  CG  . ASN C 1 306 ? 3.342   92.538  50.987  1.00 21.23 ? 306 ASN B CG  1 
ATOM   7011  O  OD1 . ASN C 1 306 ? 2.841   91.893  50.062  1.00 23.65 ? 306 ASN B OD1 1 
ATOM   7012  N  ND2 . ASN C 1 306 ? 2.632   92.964  52.029  1.00 23.78 ? 306 ASN B ND2 1 
ATOM   7013  N  N   . HIS C 1 307 ? 4.649   89.573  50.877  1.00 10.58 ? 307 HIS B N   1 
ATOM   7014  C  CA  . HIS C 1 307 ? 4.303   88.419  51.697  1.00 11.27 ? 307 HIS B CA  1 
ATOM   7015  C  C   . HIS C 1 307 ? 4.141   87.112  50.926  1.00 11.06 ? 307 HIS B C   1 
ATOM   7016  O  O   . HIS C 1 307 ? 3.571   87.091  49.835  1.00 11.67 ? 307 HIS B O   1 
ATOM   7017  C  CB  . HIS C 1 307 ? 3.004   88.724  52.450  1.00 8.92  ? 307 HIS B CB  1 
ATOM   7018  C  CG  . HIS C 1 307 ? 2.698   87.758  53.548  1.00 9.06  ? 307 HIS B CG  1 
ATOM   7019  N  ND1 . HIS C 1 307 ? 3.179   87.912  54.830  1.00 7.57  ? 307 HIS B ND1 1 
ATOM   7020  C  CD2 . HIS C 1 307 ? 1.980   86.608  53.552  1.00 5.57  ? 307 HIS B CD2 1 
ATOM   7021  C  CE1 . HIS C 1 307 ? 2.772   86.900  55.575  1.00 8.36  ? 307 HIS B CE1 1 
ATOM   7022  N  NE2 . HIS C 1 307 ? 2.044   86.096  54.824  1.00 7.99  ? 307 HIS B NE2 1 
ATOM   7023  N  N   . GLY C 1 308 ? 4.641   86.022  51.504  1.00 11.03 ? 308 GLY B N   1 
ATOM   7024  C  CA  . GLY C 1 308 ? 4.521   84.723  50.866  1.00 9.93  ? 308 GLY B CA  1 
ATOM   7025  C  C   . GLY C 1 308 ? 5.847   84.021  50.634  1.00 10.19 ? 308 GLY B C   1 
ATOM   7026  O  O   . GLY C 1 308 ? 6.765   84.122  51.447  1.00 12.14 ? 308 GLY B O   1 
ATOM   7027  N  N   . MET C 1 309 ? 5.936   83.302  49.518  1.00 9.17  ? 309 MET B N   1 
ATOM   7028  C  CA  . MET C 1 309 ? 7.146   82.575  49.145  1.00 10.16 ? 309 MET B CA  1 
ATOM   7029  C  C   . MET C 1 309 ? 7.315   82.762  47.646  1.00 8.85  ? 309 MET B C   1 
ATOM   7030  O  O   . MET C 1 309 ? 6.363   82.562  46.895  1.00 7.84  ? 309 MET B O   1 
ATOM   7031  C  CB  . MET C 1 309 ? 6.997   81.078  49.436  1.00 10.99 ? 309 MET B CB  1 
ATOM   7032  C  CG  . MET C 1 309 ? 6.868   80.699  50.900  1.00 16.47 ? 309 MET B CG  1 
ATOM   7033  S  SD  . MET C 1 309 ? 6.457   78.932  51.084  1.00 22.69 ? 309 MET B SD  1 
ATOM   7034  C  CE  . MET C 1 309 ? 7.951   78.172  50.496  1.00 15.44 ? 309 MET B CE  1 
ATOM   7035  N  N   . HIS C 1 310 ? 8.510   83.141  47.203  1.00 8.30  ? 310 HIS B N   1 
ATOM   7036  C  CA  . HIS C 1 310 ? 8.718   83.331  45.770  1.00 7.80  ? 310 HIS B CA  1 
ATOM   7037  C  C   . HIS C 1 310 ? 8.688   81.980  45.063  1.00 7.86  ? 310 HIS B C   1 
ATOM   7038  O  O   . HIS C 1 310 ? 9.005   80.954  45.670  1.00 6.89  ? 310 HIS B O   1 
ATOM   7039  C  CB  . HIS C 1 310 ? 10.043  84.039  45.495  1.00 7.33  ? 310 HIS B CB  1 
ATOM   7040  C  CG  . HIS C 1 310 ? 10.147  84.565  44.101  1.00 8.96  ? 310 HIS B CG  1 
ATOM   7041  N  ND1 . HIS C 1 310 ? 10.467  83.767  43.025  1.00 8.39  ? 310 HIS B ND1 1 
ATOM   7042  C  CD2 . HIS C 1 310 ? 9.867   85.791  43.590  1.00 8.34  ? 310 HIS B CD2 1 
ATOM   7043  C  CE1 . HIS C 1 310 ? 10.376  84.472  41.912  1.00 9.32  ? 310 HIS B CE1 1 
ATOM   7044  N  NE2 . HIS C 1 310 ? 10.012  85.703  42.228  1.00 9.17  ? 310 HIS B NE2 1 
ATOM   7045  N  N   . PHE C 1 311 ? 8.312   81.973  43.785  1.00 6.50  ? 311 PHE B N   1 
ATOM   7046  C  CA  . PHE C 1 311 ? 8.229   80.715  43.048  1.00 6.48  ? 311 PHE B CA  1 
ATOM   7047  C  C   . PHE C 1 311 ? 9.554   79.959  42.947  1.00 6.99  ? 311 PHE B C   1 
ATOM   7048  O  O   . PHE C 1 311 ? 9.566   78.725  42.922  1.00 7.18  ? 311 PHE B O   1 
ATOM   7049  C  CB  . PHE C 1 311 ? 7.673   80.934  41.635  1.00 6.38  ? 311 PHE B CB  1 
ATOM   7050  C  CG  . PHE C 1 311 ? 7.479   79.656  40.868  1.00 7.10  ? 311 PHE B CG  1 
ATOM   7051  C  CD1 . PHE C 1 311 ? 6.529   78.726  41.277  1.00 6.46  ? 311 PHE B CD1 1 
ATOM   7052  C  CD2 . PHE C 1 311 ? 8.293   79.345  39.785  1.00 6.28  ? 311 PHE B CD2 1 
ATOM   7053  C  CE1 . PHE C 1 311 ? 6.395   77.503  40.621  1.00 8.77  ? 311 PHE B CE1 1 
ATOM   7054  C  CE2 . PHE C 1 311 ? 8.166   78.125  39.124  1.00 6.80  ? 311 PHE B CE2 1 
ATOM   7055  C  CZ  . PHE C 1 311 ? 7.217   77.203  39.544  1.00 5.92  ? 311 PHE B CZ  1 
ATOM   7056  N  N   . ARG C 1 312 ? 10.671  80.679  42.877  1.00 6.15  ? 312 ARG B N   1 
ATOM   7057  C  CA  . ARG C 1 312 ? 11.954  79.996  42.774  1.00 7.36  ? 312 ARG B CA  1 
ATOM   7058  C  C   . ARG C 1 312 ? 12.148  79.013  43.932  1.00 7.62  ? 312 ARG B C   1 
ATOM   7059  O  O   . ARG C 1 312 ? 12.822  77.995  43.785  1.00 8.88  ? 312 ARG B O   1 
ATOM   7060  C  CB  . ARG C 1 312 ? 13.113  81.004  42.715  1.00 7.84  ? 312 ARG B CB  1 
ATOM   7061  C  CG  . ARG C 1 312 ? 13.404  81.755  43.997  1.00 7.60  ? 312 ARG B CG  1 
ATOM   7062  C  CD  . ARG C 1 312 ? 14.582  82.698  43.777  1.00 9.93  ? 312 ARG B CD  1 
ATOM   7063  N  NE  . ARG C 1 312 ? 14.234  83.841  42.935  1.00 8.08  ? 312 ARG B NE  1 
ATOM   7064  C  CZ  . ARG C 1 312 ? 13.633  84.940  43.384  1.00 9.87  ? 312 ARG B CZ  1 
ATOM   7065  N  NH1 . ARG C 1 312 ? 13.316  85.045  44.669  1.00 8.86  ? 312 ARG B NH1 1 
ATOM   7066  N  NH2 . ARG C 1 312 ? 13.358  85.939  42.554  1.00 10.47 ? 312 ARG B NH2 1 
ATOM   7067  N  N   . VAL C 1 313 ? 11.552  79.309  45.081  1.00 8.16  ? 313 VAL B N   1 
ATOM   7068  C  CA  . VAL C 1 313 ? 11.668  78.415  46.231  1.00 9.56  ? 313 VAL B CA  1 
ATOM   7069  C  C   . VAL C 1 313 ? 10.789  77.177  46.014  1.00 9.14  ? 313 VAL B C   1 
ATOM   7070  O  O   . VAL C 1 313 ? 11.174  76.059  46.353  1.00 9.77  ? 313 VAL B O   1 
ATOM   7071  C  CB  . VAL C 1 313 ? 11.257  79.137  47.537  1.00 11.00 ? 313 VAL B CB  1 
ATOM   7072  C  CG1 . VAL C 1 313 ? 11.245  78.162  48.701  1.00 12.49 ? 313 VAL B CG1 1 
ATOM   7073  C  CG2 . VAL C 1 313 ? 12.237  80.264  47.820  1.00 13.02 ? 313 VAL B CG2 1 
ATOM   7074  N  N   . LEU C 1 314 ? 9.611   77.385  45.434  1.00 8.02  ? 314 LEU B N   1 
ATOM   7075  C  CA  . LEU C 1 314 ? 8.693   76.285  45.157  1.00 9.26  ? 314 LEU B CA  1 
ATOM   7076  C  C   . LEU C 1 314 ? 9.277   75.431  44.038  1.00 9.39  ? 314 LEU B C   1 
ATOM   7077  O  O   . LEU C 1 314 ? 9.042   74.223  43.980  1.00 10.99 ? 314 LEU B O   1 
ATOM   7078  C  CB  . LEU C 1 314 ? 7.317   76.825  44.741  1.00 7.62  ? 314 LEU B CB  1 
ATOM   7079  C  CG  . LEU C 1 314 ? 6.527   77.567  45.826  1.00 9.96  ? 314 LEU B CG  1 
ATOM   7080  C  CD1 . LEU C 1 314 ? 5.232   78.124  45.252  1.00 9.99  ? 314 LEU B CD1 1 
ATOM   7081  C  CD2 . LEU C 1 314 ? 6.233   76.615  46.970  1.00 11.50 ? 314 LEU B CD2 1 
ATOM   7082  N  N   . ALA C 1 315 ? 10.047  76.069  43.158  1.00 9.44  ? 315 ALA B N   1 
ATOM   7083  C  CA  . ALA C 1 315 ? 10.681  75.380  42.037  1.00 9.63  ? 315 ALA B CA  1 
ATOM   7084  C  C   . ALA C 1 315 ? 11.797  74.452  42.525  1.00 8.86  ? 315 ALA B C   1 
ATOM   7085  O  O   . ALA C 1 315 ? 11.881  73.303  42.099  1.00 8.54  ? 315 ALA B O   1 
ATOM   7086  C  CB  . ALA C 1 315 ? 11.238  76.395  41.044  1.00 10.44 ? 315 ALA B CB  1 
ATOM   7087  N  N   . LYS C 1 316 ? 12.658  74.952  43.407  1.00 8.59  ? 316 LYS B N   1 
ATOM   7088  C  CA  . LYS C 1 316 ? 13.740  74.128  43.943  1.00 8.68  ? 316 LYS B CA  1 
ATOM   7089  C  C   . LYS C 1 316 ? 13.159  72.942  44.704  1.00 9.53  ? 316 LYS B C   1 
ATOM   7090  O  O   . LYS C 1 316 ? 13.694  71.836  44.651  1.00 9.57  ? 316 LYS B O   1 
ATOM   7091  C  CB  . LYS C 1 316 ? 14.632  74.939  44.891  1.00 8.14  ? 316 LYS B CB  1 
ATOM   7092  C  CG  . LYS C 1 316 ? 15.499  75.981  44.206  1.00 9.50  ? 316 LYS B CG  1 
ATOM   7093  C  CD  . LYS C 1 316 ? 16.478  76.609  45.183  1.00 11.16 ? 316 LYS B CD  1 
ATOM   7094  C  CE  . LYS C 1 316 ? 17.369  77.631  44.492  1.00 7.45  ? 316 LYS B CE  1 
ATOM   7095  N  NZ  . LYS C 1 316 ? 18.379  78.191  45.433  1.00 7.78  ? 316 LYS B NZ  1 
ATOM   7096  N  N   . ALA C 1 317 ? 12.062  73.184  45.416  1.00 9.60  ? 317 ALA B N   1 
ATOM   7097  C  CA  . ALA C 1 317 ? 11.411  72.141  46.197  1.00 9.74  ? 317 ALA B CA  1 
ATOM   7098  C  C   . ALA C 1 317 ? 10.912  71.016  45.296  1.00 10.37 ? 317 ALA B C   1 
ATOM   7099  O  O   . ALA C 1 317 ? 10.995  69.837  45.651  1.00 10.39 ? 317 ALA B O   1 
ATOM   7100  C  CB  . ALA C 1 317 ? 10.248  72.734  46.993  1.00 10.32 ? 317 ALA B CB  1 
ATOM   7101  N  N   . LEU C 1 318 ? 10.396  71.381  44.126  1.00 8.53  ? 318 LEU B N   1 
ATOM   7102  C  CA  . LEU C 1 318 ? 9.901   70.387  43.190  1.00 7.33  ? 318 LEU B CA  1 
ATOM   7103  C  C   . LEU C 1 318 ? 11.051  69.571  42.595  1.00 7.45  ? 318 LEU B C   1 
ATOM   7104  O  O   . LEU C 1 318 ? 10.934  68.358  42.428  1.00 6.07  ? 318 LEU B O   1 
ATOM   7105  C  CB  . LEU C 1 318 ? 9.092   71.061  42.072  1.00 8.72  ? 318 LEU B CB  1 
ATOM   7106  C  CG  . LEU C 1 318 ? 8.362   70.144  41.079  1.00 11.92 ? 318 LEU B CG  1 
ATOM   7107  C  CD1 . LEU C 1 318 ? 9.302   69.687  39.979  1.00 11.66 ? 318 LEU B CD1 1 
ATOM   7108  C  CD2 . LEU C 1 318 ? 7.774   68.948  41.829  1.00 11.14 ? 318 LEU B CD2 1 
ATOM   7109  N  N   . ARG C 1 319 ? 12.170  70.223  42.289  1.00 6.34  ? 319 ARG B N   1 
ATOM   7110  C  CA  . ARG C 1 319 ? 13.301  69.497  41.710  1.00 7.27  ? 319 ARG B CA  1 
ATOM   7111  C  C   . ARG C 1 319 ? 13.826  68.445  42.683  1.00 7.88  ? 319 ARG B C   1 
ATOM   7112  O  O   . ARG C 1 319 ? 14.351  67.408  42.271  1.00 9.35  ? 319 ARG B O   1 
ATOM   7113  C  CB  . ARG C 1 319 ? 14.428  70.462  41.321  1.00 6.73  ? 319 ARG B CB  1 
ATOM   7114  C  CG  . ARG C 1 319 ? 15.532  69.804  40.498  1.00 7.00  ? 319 ARG B CG  1 
ATOM   7115  C  CD  . ARG C 1 319 ? 16.483  70.831  39.903  1.00 8.17  ? 319 ARG B CD  1 
ATOM   7116  N  NE  . ARG C 1 319 ? 17.535  70.198  39.116  1.00 9.32  ? 319 ARG B NE  1 
ATOM   7117  C  CZ  . ARG C 1 319 ? 18.547  70.852  38.554  1.00 12.73 ? 319 ARG B CZ  1 
ATOM   7118  N  NH1 . ARG C 1 319 ? 18.644  72.168  38.691  1.00 9.31  ? 319 ARG B NH1 1 
ATOM   7119  N  NH2 . ARG C 1 319 ? 19.476  70.189  37.875  1.00 10.87 ? 319 ARG B NH2 1 
ATOM   7120  N  N   . LEU C 1 320 ? 13.680  68.714  43.976  1.00 7.32  ? 320 LEU B N   1 
ATOM   7121  C  CA  . LEU C 1 320 ? 14.123  67.777  45.004  1.00 8.01  ? 320 LEU B CA  1 
ATOM   7122  C  C   . LEU C 1 320 ? 13.117  66.636  45.166  1.00 9.34  ? 320 LEU B C   1 
ATOM   7123  O  O   . LEU C 1 320 ? 13.486  65.459  45.106  1.00 8.52  ? 320 LEU B O   1 
ATOM   7124  C  CB  . LEU C 1 320 ? 14.291  68.501  46.339  1.00 7.97  ? 320 LEU B CB  1 
ATOM   7125  C  CG  . LEU C 1 320 ? 15.448  69.498  46.430  1.00 10.54 ? 320 LEU B CG  1 
ATOM   7126  C  CD1 . LEU C 1 320 ? 15.393  70.212  47.769  1.00 9.64  ? 320 LEU B CD1 1 
ATOM   7127  C  CD2 . LEU C 1 320 ? 16.780  68.765  46.264  1.00 8.09  ? 320 LEU B CD2 1 
ATOM   7128  N  N   . SER C 1 321 ? 11.851  66.989  45.378  1.00 6.65  ? 321 SER B N   1 
ATOM   7129  C  CA  . SER C 1 321 ? 10.790  65.992  45.545  1.00 9.29  ? 321 SER B CA  1 
ATOM   7130  C  C   . SER C 1 321 ? 10.709  65.113  44.301  1.00 8.96  ? 321 SER B C   1 
ATOM   7131  O  O   . SER C 1 321 ? 10.651  63.886  44.395  1.00 9.63  ? 321 SER B O   1 
ATOM   7132  C  CB  . SER C 1 321 ? 9.444   66.682  45.784  1.00 7.26  ? 321 SER B CB  1 
ATOM   7133  O  OG  . SER C 1 321 ? 8.392   65.736  45.872  1.00 6.05  ? 321 SER B OG  1 
ATOM   7134  N  N   . GLY C 1 322 ? 10.697  65.744  43.132  1.00 9.67  ? 322 GLY B N   1 
ATOM   7135  C  CA  . GLY C 1 322 ? 10.654  64.971  41.908  1.00 9.66  ? 322 GLY B CA  1 
ATOM   7136  C  C   . GLY C 1 322 ? 9.578   65.321  40.899  1.00 9.32  ? 322 GLY B C   1 
ATOM   7137  O  O   . GLY C 1 322 ? 8.386   65.313  41.200  1.00 9.60  ? 322 GLY B O   1 
ATOM   7138  N  N   . GLY C 1 323 ? 10.024  65.615  39.682  1.00 9.83  ? 323 GLY B N   1 
ATOM   7139  C  CA  . GLY C 1 323 ? 9.125   65.943  38.592  1.00 7.82  ? 323 GLY B CA  1 
ATOM   7140  C  C   . GLY C 1 323 ? 9.967   66.097  37.338  1.00 9.38  ? 323 GLY B C   1 
ATOM   7141  O  O   . GLY C 1 323 ? 11.088  66.593  37.413  1.00 7.91  ? 323 GLY B O   1 
ATOM   7142  N  N   . ASP C 1 324 ? 9.454   65.663  36.191  1.00 6.92  ? 324 ASP B N   1 
ATOM   7143  C  CA  . ASP C 1 324 ? 10.207  65.788  34.949  1.00 7.39  ? 324 ASP B CA  1 
ATOM   7144  C  C   . ASP C 1 324 ? 9.921   67.112  34.235  1.00 8.02  ? 324 ASP B C   1 
ATOM   7145  O  O   . ASP C 1 324 ? 10.782  67.634  33.524  1.00 8.01  ? 324 ASP B O   1 
ATOM   7146  C  CB  . ASP C 1 324 ? 9.925   64.582  34.042  1.00 8.17  ? 324 ASP B CB  1 
ATOM   7147  C  CG  . ASP C 1 324 ? 10.473  63.286  34.625  1.00 7.79  ? 324 ASP B CG  1 
ATOM   7148  O  OD1 . ASP C 1 324 ? 11.636  63.301  35.072  1.00 5.46  ? 324 ASP B OD1 1 
ATOM   7149  O  OD2 . ASP C 1 324 ? 9.755   62.261  34.641  1.00 9.06  ? 324 ASP B OD2 1 
ATOM   7150  N  N   . HIS C 1 325 ? 8.716   67.646  34.440  1.00 8.46  ? 325 HIS B N   1 
ATOM   7151  C  CA  . HIS C 1 325 ? 8.296   68.932  33.872  1.00 9.17  ? 325 HIS B CA  1 
ATOM   7152  C  C   . HIS C 1 325 ? 7.711   69.756  35.016  1.00 10.53 ? 325 HIS B C   1 
ATOM   7153  O  O   . HIS C 1 325 ? 7.270   69.208  36.024  1.00 9.87  ? 325 HIS B O   1 
ATOM   7154  C  CB  . HIS C 1 325 ? 7.107   68.823  32.905  1.00 8.32  ? 325 HIS B CB  1 
ATOM   7155  C  CG  . HIS C 1 325 ? 7.328   67.984  31.686  1.00 9.42  ? 325 HIS B CG  1 
ATOM   7156  N  ND1 . HIS C 1 325 ? 6.322   67.773  30.763  1.00 8.60  ? 325 HIS B ND1 1 
ATOM   7157  C  CD2 . HIS C 1 325 ? 8.405   67.306  31.232  1.00 10.67 ? 325 HIS B CD2 1 
ATOM   7158  C  CE1 . HIS C 1 325 ? 6.774   66.997  29.795  1.00 8.79  ? 325 HIS B CE1 1 
ATOM   7159  N  NE2 . HIS C 1 325 ? 8.033   66.699  30.053  1.00 10.48 ? 325 HIS B NE2 1 
ATOM   7160  N  N   . ILE C 1 326 ? 7.678   71.071  34.832  1.00 10.51 ? 326 ILE B N   1 
ATOM   7161  C  CA  . ILE C 1 326 ? 7.027   71.963  35.781  1.00 8.45  ? 326 ILE B CA  1 
ATOM   7162  C  C   . ILE C 1 326 ? 6.745   73.265  35.051  1.00 9.24  ? 326 ILE B C   1 
ATOM   7163  O  O   . ILE C 1 326 ? 7.577   73.742  34.276  1.00 8.71  ? 326 ILE B O   1 
ATOM   7164  C  CB  . ILE C 1 326 ? 7.854   72.258  37.050  1.00 8.22  ? 326 ILE B CB  1 
ATOM   7165  C  CG1 . ILE C 1 326 ? 6.936   72.961  38.065  1.00 7.06  ? 326 ILE B CG1 1 
ATOM   7166  C  CG2 . ILE C 1 326 ? 9.062   73.144  36.720  1.00 6.48  ? 326 ILE B CG2 1 
ATOM   7167  C  CD1 . ILE C 1 326 ? 7.587   73.300  39.392  1.00 9.71  ? 326 ILE B CD1 1 
ATOM   7168  N  N   . HIS C 1 327 ? 5.561   73.826  35.270  1.00 8.66  ? 327 HIS B N   1 
ATOM   7169  C  CA  . HIS C 1 327 ? 5.205   75.071  34.612  1.00 9.93  ? 327 HIS B CA  1 
ATOM   7170  C  C   . HIS C 1 327 ? 6.088   76.183  35.149  1.00 9.28  ? 327 HIS B C   1 
ATOM   7171  O  O   . HIS C 1 327 ? 6.370   76.244  36.345  1.00 10.33 ? 327 HIS B O   1 
ATOM   7172  C  CB  . HIS C 1 327 ? 3.721   75.384  34.822  1.00 8.56  ? 327 HIS B CB  1 
ATOM   7173  C  CG  . HIS C 1 327 ? 2.802   74.463  34.076  1.00 9.29  ? 327 HIS B CG  1 
ATOM   7174  N  ND1 . HIS C 1 327 ? 1.777   74.917  33.275  1.00 11.40 ? 327 HIS B ND1 1 
ATOM   7175  C  CD2 . HIS C 1 327 ? 2.758   73.110  34.009  1.00 9.63  ? 327 HIS B CD2 1 
ATOM   7176  C  CE1 . HIS C 1 327 ? 1.141   73.888  32.746  1.00 10.74 ? 327 HIS B CE1 1 
ATOM   7177  N  NE2 . HIS C 1 327 ? 1.716   72.778  33.175  1.00 10.53 ? 327 HIS B NE2 1 
ATOM   7178  N  N   . SER C 1 328 ? 6.521   77.060  34.251  1.00 10.33 ? 328 SER B N   1 
ATOM   7179  C  CA  . SER C 1 328 ? 7.421   78.149  34.606  1.00 10.03 ? 328 SER B CA  1 
ATOM   7180  C  C   . SER C 1 328 ? 6.894   79.536  34.258  1.00 10.65 ? 328 SER B C   1 
ATOM   7181  O  O   . SER C 1 328 ? 7.519   80.540  34.611  1.00 10.51 ? 328 SER B O   1 
ATOM   7182  C  CB  . SER C 1 328 ? 8.743   77.948  33.878  1.00 12.40 ? 328 SER B CB  1 
ATOM   7183  O  OG  . SER C 1 328 ? 8.532   78.067  32.477  1.00 15.41 ? 328 SER B OG  1 
ATOM   7184  N  N   . GLY C 1 329 ? 5.760   79.588  33.565  1.00 7.29  ? 329 GLY B N   1 
ATOM   7185  C  CA  . GLY C 1 329 ? 5.204   80.865  33.157  1.00 7.96  ? 329 GLY B CA  1 
ATOM   7186  C  C   . GLY C 1 329 ? 5.550   81.097  31.693  1.00 8.33  ? 329 GLY B C   1 
ATOM   7187  O  O   . GLY C 1 329 ? 6.311   80.322  31.107  1.00 8.17  ? 329 GLY B O   1 
ATOM   7188  N  N   . THR C 1 330 ? 5.015   82.162  31.106  1.00 8.42  ? 330 THR B N   1 
ATOM   7189  C  CA  . THR C 1 330 ? 5.258   82.467  29.696  1.00 9.31  ? 330 THR B CA  1 
ATOM   7190  C  C   . THR C 1 330 ? 5.843   83.860  29.489  1.00 11.73 ? 330 THR B C   1 
ATOM   7191  O  O   . THR C 1 330 ? 6.405   84.150  28.431  1.00 11.52 ? 330 THR B O   1 
ATOM   7192  C  CB  . THR C 1 330 ? 3.952   82.456  28.901  1.00 9.05  ? 330 THR B CB  1 
ATOM   7193  O  OG1 . THR C 1 330 ? 3.109   83.508  29.395  1.00 7.64  ? 330 THR B OG1 1 
ATOM   7194  C  CG2 . THR C 1 330 ? 3.232   81.115  29.036  1.00 9.50  ? 330 THR B CG2 1 
ATOM   7195  N  N   . VAL C 1 331 ? 5.682   84.716  30.494  1.00 11.70 ? 331 VAL B N   1 
ATOM   7196  C  CA  . VAL C 1 331 ? 6.123   86.107  30.437  1.00 12.35 ? 331 VAL B CA  1 
ATOM   7197  C  C   . VAL C 1 331 ? 5.156   86.915  29.567  1.00 12.60 ? 331 VAL B C   1 
ATOM   7198  O  O   . VAL C 1 331 ? 4.640   87.947  29.995  1.00 14.00 ? 331 VAL B O   1 
ATOM   7199  C  CB  . VAL C 1 331 ? 7.547   86.261  29.846  1.00 14.46 ? 331 VAL B CB  1 
ATOM   7200  C  CG1 . VAL C 1 331 ? 7.910   87.739  29.760  1.00 12.87 ? 331 VAL B CG1 1 
ATOM   7201  C  CG2 . VAL C 1 331 ? 8.560   85.516  30.711  1.00 15.06 ? 331 VAL B CG2 1 
ATOM   7202  N  N   . VAL C 1 332 ? 4.889   86.426  28.358  1.00 11.85 ? 332 VAL B N   1 
ATOM   7203  C  CA  . VAL C 1 332 ? 4.004   87.123  27.423  1.00 10.28 ? 332 VAL B CA  1 
ATOM   7204  C  C   . VAL C 1 332 ? 2.529   86.694  27.429  1.00 10.60 ? 332 VAL B C   1 
ATOM   7205  O  O   . VAL C 1 332 ? 1.706   87.305  26.742  1.00 9.87  ? 332 VAL B O   1 
ATOM   7206  C  CB  . VAL C 1 332 ? 4.540   86.990  25.974  1.00 10.77 ? 332 VAL B CB  1 
ATOM   7207  C  CG1 . VAL C 1 332 ? 5.940   87.602  25.875  1.00 12.17 ? 332 VAL B CG1 1 
ATOM   7208  C  CG2 . VAL C 1 332 ? 4.580   85.523  25.564  1.00 8.91  ? 332 VAL B CG2 1 
ATOM   7209  N  N   . GLY C 1 333 ? 2.195   85.670  28.213  1.00 10.78 ? 333 GLY B N   1 
ATOM   7210  C  CA  . GLY C 1 333 ? 0.827   85.167  28.259  1.00 10.50 ? 333 GLY B CA  1 
ATOM   7211  C  C   . GLY C 1 333 ? -0.169  85.867  29.169  1.00 10.47 ? 333 GLY B C   1 
ATOM   7212  O  O   . GLY C 1 333 ? 0.046   87.000  29.594  1.00 11.66 ? 333 GLY B O   1 
ATOM   7213  N  N   . LYS C 1 334 ? -1.267  85.177  29.476  1.00 8.78  ? 334 LYS B N   1 
ATOM   7214  C  CA  . LYS C 1 334 ? -2.327  85.729  30.317  1.00 7.73  ? 334 LYS B CA  1 
ATOM   7215  C  C   . LYS C 1 334 ? -2.007  85.752  31.810  1.00 9.48  ? 334 LYS B C   1 
ATOM   7216  O  O   . LYS C 1 334 ? -2.680  86.442  32.576  1.00 9.14  ? 334 LYS B O   1 
ATOM   7217  C  CB  . LYS C 1 334 ? -3.637  84.951  30.096  1.00 9.89  ? 334 LYS B CB  1 
ATOM   7218  C  CG  . LYS C 1 334 ? -3.628  83.529  30.660  1.00 7.35  ? 334 LYS B CG  1 
ATOM   7219  C  CD  . LYS C 1 334 ? -4.866  82.735  30.242  1.00 9.40  ? 334 LYS B CD  1 
ATOM   7220  C  CE  . LYS C 1 334 ? -4.818  81.326  30.823  1.00 10.17 ? 334 LYS B CE  1 
ATOM   7221  N  NZ  . LYS C 1 334 ? -5.911  80.458  30.313  1.00 10.32 ? 334 LYS B NZ  1 
ATOM   7222  N  N   . LEU C 1 335 ? -0.988  85.002  32.224  1.00 9.80  ? 335 LEU B N   1 
ATOM   7223  C  CA  . LEU C 1 335 ? -0.605  84.944  33.633  1.00 10.17 ? 335 LEU B CA  1 
ATOM   7224  C  C   . LEU C 1 335 ? 0.701   85.705  33.860  1.00 11.22 ? 335 LEU B C   1 
ATOM   7225  O  O   . LEU C 1 335 ? 1.561   85.747  32.982  1.00 11.63 ? 335 LEU B O   1 
ATOM   7226  C  CB  . LEU C 1 335 ? -0.481  83.481  34.066  1.00 10.52 ? 335 LEU B CB  1 
ATOM   7227  C  CG  . LEU C 1 335 ? -1.804  82.720  33.876  1.00 11.64 ? 335 LEU B CG  1 
ATOM   7228  C  CD1 . LEU C 1 335 ? -1.538  81.267  33.541  1.00 11.81 ? 335 LEU B CD1 1 
ATOM   7229  C  CD2 . LEU C 1 335 ? -2.658  82.849  35.130  1.00 12.70 ? 335 LEU B CD2 1 
ATOM   7230  N  N   . GLU C 1 336 ? 0.842   86.306  35.039  1.00 12.42 ? 336 GLU B N   1 
ATOM   7231  C  CA  . GLU C 1 336 ? 2.022   87.108  35.359  1.00 13.65 ? 336 GLU B CA  1 
ATOM   7232  C  C   . GLU C 1 336 ? 3.353   86.369  35.384  1.00 14.00 ? 336 GLU B C   1 
ATOM   7233  O  O   . GLU C 1 336 ? 3.424   85.193  35.736  1.00 13.46 ? 336 GLU B O   1 
ATOM   7234  C  CB  . GLU C 1 336 ? 1.828   87.829  36.697  1.00 18.31 ? 336 GLU B CB  1 
ATOM   7235  C  CG  . GLU C 1 336 ? 3.051   88.635  37.139  1.00 22.58 ? 336 GLU B CG  1 
ATOM   7236  C  CD  . GLU C 1 336 ? 2.793   89.475  38.377  1.00 25.21 ? 336 GLU B CD  1 
ATOM   7237  O  OE1 . GLU C 1 336 ? 1.979   90.422  38.302  1.00 26.33 ? 336 GLU B OE1 1 
ATOM   7238  O  OE2 . GLU C 1 336 ? 3.407   89.186  39.427  1.00 28.50 ? 336 GLU B OE2 1 
ATOM   7239  N  N   . GLY C 1 337 ? 4.407   87.091  35.010  1.00 12.91 ? 337 GLY B N   1 
ATOM   7240  C  CA  . GLY C 1 337 ? 5.747   86.537  34.988  1.00 15.86 ? 337 GLY B CA  1 
ATOM   7241  C  C   . GLY C 1 337 ? 6.739   87.497  34.346  1.00 16.64 ? 337 GLY B C   1 
ATOM   7242  O  O   . GLY C 1 337 ? 6.655   87.765  33.149  1.00 18.07 ? 337 GLY B O   1 
ATOM   7243  N  N   . GLU C 1 338 ? 7.667   88.026  35.138  1.00 18.43 ? 338 GLU B N   1 
ATOM   7244  C  CA  . GLU C 1 338 ? 8.681   88.955  34.634  1.00 19.20 ? 338 GLU B CA  1 
ATOM   7245  C  C   . GLU C 1 338 ? 9.819   88.186  33.962  1.00 17.62 ? 338 GLU B C   1 
ATOM   7246  O  O   . GLU C 1 338 ? 10.234  87.136  34.448  1.00 16.89 ? 338 GLU B O   1 
ATOM   7247  C  CB  . GLU C 1 338 ? 9.241   89.801  35.781  1.00 23.75 ? 338 GLU B CB  1 
ATOM   7248  C  CG  . GLU C 1 338 ? 8.339   90.932  36.246  1.00 31.13 ? 338 GLU B CG  1 
ATOM   7249  C  CD  . GLU C 1 338 ? 8.094   91.964  35.160  1.00 36.17 ? 338 GLU B CD  1 
ATOM   7250  O  OE1 . GLU C 1 338 ? 7.236   91.720  34.282  1.00 38.90 ? 338 GLU B OE1 1 
ATOM   7251  O  OE2 . GLU C 1 338 ? 8.771   93.016  35.178  1.00 38.77 ? 338 GLU B OE2 1 
ATOM   7252  N  N   . ARG C 1 339 ? 10.332  88.725  32.858  1.00 17.61 ? 339 ARG B N   1 
ATOM   7253  C  CA  . ARG C 1 339 ? 11.400  88.075  32.095  1.00 18.24 ? 339 ARG B CA  1 
ATOM   7254  C  C   . ARG C 1 339 ? 12.673  87.699  32.866  1.00 17.13 ? 339 ARG B C   1 
ATOM   7255  O  O   . ARG C 1 339 ? 13.056  86.528  32.906  1.00 16.08 ? 339 ARG B O   1 
ATOM   7256  C  CB  . ARG C 1 339 ? 11.786  88.940  30.889  1.00 19.57 ? 339 ARG B CB  1 
ATOM   7257  C  CG  . ARG C 1 339 ? 12.804  88.280  29.963  1.00 23.17 ? 339 ARG B CG  1 
ATOM   7258  C  CD  . ARG C 1 339 ? 13.357  89.251  28.927  1.00 26.42 ? 339 ARG B CD  1 
ATOM   7259  N  NE  . ARG C 1 339 ? 14.391  88.630  28.099  1.00 31.67 ? 339 ARG B NE  1 
ATOM   7260  C  CZ  . ARG C 1 339 ? 14.175  88.079  26.907  1.00 34.15 ? 339 ARG B CZ  1 
ATOM   7261  N  NH1 . ARG C 1 339 ? 12.957  88.073  26.383  1.00 34.49 ? 339 ARG B NH1 1 
ATOM   7262  N  NH2 . ARG C 1 339 ? 15.180  87.524  26.241  1.00 36.53 ? 339 ARG B NH2 1 
ATOM   7263  N  N   . ASP C 1 340 ? 13.334  88.681  33.469  1.00 16.62 ? 340 ASP B N   1 
ATOM   7264  C  CA  . ASP C 1 340 ? 14.568  88.406  34.201  1.00 17.57 ? 340 ASP B CA  1 
ATOM   7265  C  C   . ASP C 1 340 ? 14.388  87.413  35.342  1.00 16.56 ? 340 ASP B C   1 
ATOM   7266  O  O   . ASP C 1 340 ? 15.188  86.490  35.504  1.00 15.23 ? 340 ASP B O   1 
ATOM   7267  C  CB  . ASP C 1 340 ? 15.177  89.701  34.746  1.00 21.65 ? 340 ASP B CB  1 
ATOM   7268  C  CG  . ASP C 1 340 ? 15.761  90.575  33.652  1.00 26.25 ? 340 ASP B CG  1 
ATOM   7269  O  OD1 . ASP C 1 340 ? 16.390  90.024  32.723  1.00 29.98 ? 340 ASP B OD1 1 
ATOM   7270  O  OD2 . ASP C 1 340 ? 15.602  91.811  33.727  1.00 29.60 ? 340 ASP B OD2 1 
ATOM   7271  N  N   . ILE C 1 341 ? 13.343  87.608  36.138  1.00 14.84 ? 341 ILE B N   1 
ATOM   7272  C  CA  . ILE C 1 341 ? 13.069  86.716  37.256  1.00 15.57 ? 341 ILE B CA  1 
ATOM   7273  C  C   . ILE C 1 341 ? 12.774  85.299  36.766  1.00 14.70 ? 341 ILE B C   1 
ATOM   7274  O  O   . ILE C 1 341 ? 13.187  84.322  37.393  1.00 15.09 ? 341 ILE B O   1 
ATOM   7275  C  CB  . ILE C 1 341 ? 11.881  87.238  38.096  1.00 17.57 ? 341 ILE B CB  1 
ATOM   7276  C  CG1 . ILE C 1 341 ? 12.336  88.445  38.919  1.00 18.72 ? 341 ILE B CG1 1 
ATOM   7277  C  CG2 . ILE C 1 341 ? 11.336  86.135  38.995  1.00 17.46 ? 341 ILE B CG2 1 
ATOM   7278  C  CD1 . ILE C 1 341 ? 11.253  89.048  39.788  1.00 22.04 ? 341 ILE B CD1 1 
ATOM   7279  N  N   . THR C 1 342 ? 12.069  85.190  35.643  1.00 12.76 ? 342 THR B N   1 
ATOM   7280  C  CA  . THR C 1 342 ? 11.731  83.886  35.082  1.00 11.54 ? 342 THR B CA  1 
ATOM   7281  C  C   . THR C 1 342 ? 12.980  83.152  34.592  1.00 11.01 ? 342 THR B C   1 
ATOM   7282  O  O   . THR C 1 342 ? 13.150  81.961  34.855  1.00 10.13 ? 342 THR B O   1 
ATOM   7283  C  CB  . THR C 1 342 ? 10.728  84.024  33.915  1.00 10.96 ? 342 THR B CB  1 
ATOM   7284  O  OG1 . THR C 1 342 ? 9.504   84.581  34.411  1.00 11.24 ? 342 THR B OG1 1 
ATOM   7285  C  CG2 . THR C 1 342 ? 10.440  82.667  33.289  1.00 10.64 ? 342 THR B CG2 1 
ATOM   7286  N  N   . LEU C 1 343 ? 13.845  83.865  33.878  1.00 9.28  ? 343 LEU B N   1 
ATOM   7287  C  CA  . LEU C 1 343 ? 15.083  83.281  33.375  1.00 10.53 ? 343 LEU B CA  1 
ATOM   7288  C  C   . LEU C 1 343 ? 15.914  82.814  34.561  1.00 10.41 ? 343 LEU B C   1 
ATOM   7289  O  O   . LEU C 1 343 ? 16.673  81.857  34.459  1.00 11.88 ? 343 LEU B O   1 
ATOM   7290  C  CB  . LEU C 1 343 ? 15.875  84.317  32.567  1.00 11.86 ? 343 LEU B CB  1 
ATOM   7291  C  CG  . LEU C 1 343 ? 15.270  84.735  31.221  1.00 13.78 ? 343 LEU B CG  1 
ATOM   7292  C  CD1 . LEU C 1 343 ? 15.992  85.963  30.666  1.00 16.19 ? 343 LEU B CD1 1 
ATOM   7293  C  CD2 . LEU C 1 343 ? 15.368  83.575  30.250  1.00 14.42 ? 343 LEU B CD2 1 
ATOM   7294  N  N   . GLY C 1 344 ? 15.756  83.502  35.687  1.00 10.94 ? 344 GLY B N   1 
ATOM   7295  C  CA  . GLY C 1 344 ? 16.488  83.148  36.886  1.00 11.02 ? 344 GLY B CA  1 
ATOM   7296  C  C   . GLY C 1 344 ? 16.135  81.767  37.408  1.00 11.99 ? 344 GLY B C   1 
ATOM   7297  O  O   . GLY C 1 344 ? 17.028  80.937  37.611  1.00 12.12 ? 344 GLY B O   1 
ATOM   7298  N  N   . PHE C 1 345 ? 14.848  81.498  37.626  1.00 10.92 ? 345 PHE B N   1 
ATOM   7299  C  CA  . PHE C 1 345 ? 14.481  80.185  38.139  1.00 11.22 ? 345 PHE B CA  1 
ATOM   7300  C  C   . PHE C 1 345 ? 14.423  79.083  37.088  1.00 10.60 ? 345 PHE B C   1 
ATOM   7301  O  O   . PHE C 1 345 ? 14.315  77.905  37.425  1.00 12.40 ? 345 PHE B O   1 
ATOM   7302  C  CB  . PHE C 1 345 ? 13.195  80.242  38.990  1.00 10.71 ? 345 PHE B CB  1 
ATOM   7303  C  CG  . PHE C 1 345 ? 11.984  80.790  38.288  1.00 11.36 ? 345 PHE B CG  1 
ATOM   7304  C  CD1 . PHE C 1 345 ? 11.360  80.076  37.269  1.00 12.02 ? 345 PHE B CD1 1 
ATOM   7305  C  CD2 . PHE C 1 345 ? 11.405  81.978  38.722  1.00 10.48 ? 345 PHE B CD2 1 
ATOM   7306  C  CE1 . PHE C 1 345 ? 10.169  80.536  36.701  1.00 13.50 ? 345 PHE B CE1 1 
ATOM   7307  C  CE2 . PHE C 1 345 ? 10.215  82.447  38.162  1.00 12.47 ? 345 PHE B CE2 1 
ATOM   7308  C  CZ  . PHE C 1 345 ? 9.596   81.722  37.150  1.00 11.59 ? 345 PHE B CZ  1 
ATOM   7309  N  N   . VAL C 1 346 ? 14.516  79.457  35.815  1.00 9.35  ? 346 VAL B N   1 
ATOM   7310  C  CA  . VAL C 1 346 ? 14.552  78.456  34.757  1.00 9.25  ? 346 VAL B CA  1 
ATOM   7311  C  C   . VAL C 1 346 ? 15.957  77.832  34.796  1.00 9.00  ? 346 VAL B C   1 
ATOM   7312  O  O   . VAL C 1 346 ? 16.119  76.629  34.598  1.00 9.67  ? 346 VAL B O   1 
ATOM   7313  C  CB  . VAL C 1 346 ? 14.291  79.079  33.365  1.00 9.92  ? 346 VAL B CB  1 
ATOM   7314  C  CG1 . VAL C 1 346 ? 14.788  78.145  32.269  1.00 8.29  ? 346 VAL B CG1 1 
ATOM   7315  C  CG2 . VAL C 1 346 ? 12.793  79.317  33.183  1.00 9.12  ? 346 VAL B CG2 1 
ATOM   7316  N  N   . ASP C 1 347 ? 16.972  78.652  35.063  1.00 8.88  ? 347 ASP B N   1 
ATOM   7317  C  CA  . ASP C 1 347 ? 18.340  78.147  35.160  1.00 9.48  ? 347 ASP B CA  1 
ATOM   7318  C  C   . ASP C 1 347 ? 18.458  77.261  36.399  1.00 9.18  ? 347 ASP B C   1 
ATOM   7319  O  O   . ASP C 1 347 ? 19.158  76.249  36.388  1.00 9.48  ? 347 ASP B O   1 
ATOM   7320  C  CB  . ASP C 1 347 ? 19.351  79.295  35.260  1.00 10.46 ? 347 ASP B CB  1 
ATOM   7321  C  CG  . ASP C 1 347 ? 19.617  79.967  33.923  1.00 13.19 ? 347 ASP B CG  1 
ATOM   7322  O  OD1 . ASP C 1 347 ? 19.243  79.401  32.873  1.00 12.33 ? 347 ASP B OD1 1 
ATOM   7323  O  OD2 . ASP C 1 347 ? 20.220  81.063  33.925  1.00 16.18 ? 347 ASP B OD2 1 
ATOM   7324  N  N   . LEU C 1 348 ? 17.766  77.649  37.468  1.00 10.24 ? 348 LEU B N   1 
ATOM   7325  C  CA  . LEU C 1 348 ? 17.781  76.890  38.713  1.00 9.59  ? 348 LEU B CA  1 
ATOM   7326  C  C   . LEU C 1 348 ? 17.126  75.524  38.527  1.00 9.51  ? 348 LEU B C   1 
ATOM   7327  O  O   . LEU C 1 348 ? 17.406  74.584  39.271  1.00 7.87  ? 348 LEU B O   1 
ATOM   7328  C  CB  . LEU C 1 348 ? 17.050  77.662  39.818  1.00 10.04 ? 348 LEU B CB  1 
ATOM   7329  C  CG  . LEU C 1 348 ? 17.721  78.938  40.335  1.00 9.19  ? 348 LEU B CG  1 
ATOM   7330  C  CD1 . LEU C 1 348 ? 16.796  79.655  41.308  1.00 11.00 ? 348 LEU B CD1 1 
ATOM   7331  C  CD2 . LEU C 1 348 ? 19.027  78.582  41.016  1.00 6.99  ? 348 LEU B CD2 1 
ATOM   7332  N  N   . LEU C 1 349 ? 16.251  75.421  37.531  1.00 7.45  ? 349 LEU B N   1 
ATOM   7333  C  CA  . LEU C 1 349 ? 15.552  74.172  37.251  1.00 7.40  ? 349 LEU B CA  1 
ATOM   7334  C  C   . LEU C 1 349 ? 16.302  73.240  36.297  1.00 7.64  ? 349 LEU B C   1 
ATOM   7335  O  O   . LEU C 1 349 ? 16.213  72.019  36.426  1.00 7.99  ? 349 LEU B O   1 
ATOM   7336  C  CB  . LEU C 1 349 ? 14.166  74.469  36.668  1.00 9.75  ? 349 LEU B CB  1 
ATOM   7337  C  CG  . LEU C 1 349 ? 13.066  74.952  37.621  1.00 12.16 ? 349 LEU B CG  1 
ATOM   7338  C  CD1 . LEU C 1 349 ? 11.910  75.545  36.828  1.00 11.98 ? 349 LEU B CD1 1 
ATOM   7339  C  CD2 . LEU C 1 349 ? 12.595  73.783  38.483  1.00 9.44  ? 349 LEU B CD2 1 
ATOM   7340  N  N   . ARG C 1 350 ? 17.051  73.811  35.352  1.00 6.69  ? 350 ARG B N   1 
ATOM   7341  C  CA  . ARG C 1 350 ? 17.765  73.006  34.354  1.00 7.04  ? 350 ARG B CA  1 
ATOM   7342  C  C   . ARG C 1 350 ? 19.261  72.758  34.552  1.00 8.21  ? 350 ARG B C   1 
ATOM   7343  O  O   . ARG C 1 350 ? 19.753  71.659  34.280  1.00 8.69  ? 350 ARG B O   1 
ATOM   7344  C  CB  . ARG C 1 350 ? 17.571  73.620  32.959  1.00 6.97  ? 350 ARG B CB  1 
ATOM   7345  C  CG  . ARG C 1 350 ? 16.118  73.809  32.540  1.00 8.23  ? 350 ARG B CG  1 
ATOM   7346  C  CD  . ARG C 1 350 ? 15.996  74.214  31.067  1.00 9.68  ? 350 ARG B CD  1 
ATOM   7347  N  NE  . ARG C 1 350 ? 16.721  75.447  30.764  1.00 10.98 ? 350 ARG B NE  1 
ATOM   7348  C  CZ  . ARG C 1 350 ? 16.421  76.269  29.760  1.00 10.92 ? 350 ARG B CZ  1 
ATOM   7349  N  NH1 . ARG C 1 350 ? 15.404  75.995  28.952  1.00 11.74 ? 350 ARG B NH1 1 
ATOM   7350  N  NH2 . ARG C 1 350 ? 17.136  77.371  29.566  1.00 9.59  ? 350 ARG B NH2 1 
ATOM   7351  N  N   . ASP C 1 351 ? 19.983  73.775  35.010  1.00 8.81  ? 351 ASP B N   1 
ATOM   7352  C  CA  . ASP C 1 351 ? 21.427  73.668  35.178  1.00 9.22  ? 351 ASP B CA  1 
ATOM   7353  C  C   . ASP C 1 351 ? 21.906  72.942  36.428  1.00 8.11  ? 351 ASP B C   1 
ATOM   7354  O  O   . ASP C 1 351 ? 21.123  72.625  37.322  1.00 8.89  ? 351 ASP B O   1 
ATOM   7355  C  CB  . ASP C 1 351 ? 22.054  75.064  35.124  1.00 9.24  ? 351 ASP B CB  1 
ATOM   7356  C  CG  . ASP C 1 351 ? 21.692  75.816  33.858  1.00 12.16 ? 351 ASP B CG  1 
ATOM   7357  O  OD1 . ASP C 1 351 ? 21.223  75.177  32.893  1.00 13.31 ? 351 ASP B OD1 1 
ATOM   7358  O  OD2 . ASP C 1 351 ? 21.888  77.047  33.823  1.00 12.59 ? 351 ASP B OD2 1 
ATOM   7359  N  N   . ASP C 1 352 ? 23.210  72.688  36.478  1.00 6.94  ? 352 ASP B N   1 
ATOM   7360  C  CA  . ASP C 1 352 ? 23.816  71.995  37.605  1.00 7.96  ? 352 ASP B CA  1 
ATOM   7361  C  C   . ASP C 1 352 ? 24.427  72.992  38.575  1.00 9.72  ? 352 ASP B C   1 
ATOM   7362  O  O   . ASP C 1 352 ? 24.704  72.665  39.731  1.00 8.88  ? 352 ASP B O   1 
ATOM   7363  C  CB  . ASP C 1 352 ? 24.912  71.048  37.110  1.00 9.93  ? 352 ASP B CB  1 
ATOM   7364  C  CG  . ASP C 1 352 ? 25.429  70.136  38.204  1.00 11.83 ? 352 ASP B CG  1 
ATOM   7365  O  OD1 . ASP C 1 352 ? 24.618  69.354  38.740  1.00 13.87 ? 352 ASP B OD1 1 
ATOM   7366  O  OD2 . ASP C 1 352 ? 26.635  70.199  38.529  1.00 13.73 ? 352 ASP B OD2 1 
ATOM   7367  N  N   . TYR C 1 353 ? 24.618  74.217  38.099  1.00 10.58 ? 353 TYR B N   1 
ATOM   7368  C  CA  . TYR C 1 353 ? 25.245  75.259  38.897  1.00 11.50 ? 353 TYR B CA  1 
ATOM   7369  C  C   . TYR C 1 353 ? 24.742  76.634  38.481  1.00 12.23 ? 353 TYR B C   1 
ATOM   7370  O  O   . TYR C 1 353 ? 24.759  76.964  37.297  1.00 11.16 ? 353 TYR B O   1 
ATOM   7371  C  CB  . TYR C 1 353 ? 26.759  75.189  38.683  1.00 12.66 ? 353 TYR B CB  1 
ATOM   7372  C  CG  . TYR C 1 353 ? 27.567  76.168  39.492  1.00 15.43 ? 353 TYR B CG  1 
ATOM   7373  C  CD1 . TYR C 1 353 ? 27.875  75.910  40.826  1.00 16.61 ? 353 TYR B CD1 1 
ATOM   7374  C  CD2 . TYR C 1 353 ? 28.036  77.352  38.920  1.00 16.55 ? 353 TYR B CD2 1 
ATOM   7375  C  CE1 . TYR C 1 353 ? 28.644  76.806  41.575  1.00 20.25 ? 353 TYR B CE1 1 
ATOM   7376  C  CE2 . TYR C 1 353 ? 28.802  78.254  39.658  1.00 19.51 ? 353 TYR B CE2 1 
ATOM   7377  C  CZ  . TYR C 1 353 ? 29.101  77.975  40.984  1.00 20.57 ? 353 TYR B CZ  1 
ATOM   7378  O  OH  . TYR C 1 353 ? 29.871  78.852  41.715  1.00 25.34 ? 353 TYR B OH  1 
ATOM   7379  N  N   . THR C 1 354 ? 24.292  77.426  39.450  1.00 10.73 ? 354 THR B N   1 
ATOM   7380  C  CA  . THR C 1 354 ? 23.816  78.782  39.178  1.00 12.16 ? 354 THR B CA  1 
ATOM   7381  C  C   . THR C 1 354 ? 24.415  79.725  40.207  1.00 14.18 ? 354 THR B C   1 
ATOM   7382  O  O   . THR C 1 354 ? 24.213  79.556  41.411  1.00 13.58 ? 354 THR B O   1 
ATOM   7383  C  CB  . THR C 1 354 ? 22.284  78.907  39.272  1.00 12.08 ? 354 THR B CB  1 
ATOM   7384  O  OG1 . THR C 1 354 ? 21.668  78.004  38.353  1.00 11.11 ? 354 THR B OG1 1 
ATOM   7385  C  CG2 . THR C 1 354 ? 21.850  80.337  38.936  1.00 12.54 ? 354 THR B CG2 1 
ATOM   7386  N  N   . GLU C 1 355 ? 25.153  80.717  39.729  1.00 16.88 ? 355 GLU B N   1 
ATOM   7387  C  CA  . GLU C 1 355 ? 25.780  81.682  40.613  1.00 18.61 ? 355 GLU B CA  1 
ATOM   7388  C  C   . GLU C 1 355 ? 24.836  82.783  41.062  1.00 18.84 ? 355 GLU B C   1 
ATOM   7389  O  O   . GLU C 1 355 ? 23.896  83.156  40.358  1.00 18.82 ? 355 GLU B O   1 
ATOM   7390  C  CB  . GLU C 1 355 ? 26.998  82.310  39.937  1.00 23.70 ? 355 GLU B CB  1 
ATOM   7391  C  CG  . GLU C 1 355 ? 28.323  81.739  40.410  1.00 32.52 ? 355 GLU B CG  1 
ATOM   7392  C  CD  . GLU C 1 355 ? 29.487  82.207  39.567  1.00 38.25 ? 355 GLU B CD  1 
ATOM   7393  O  OE1 . GLU C 1 355 ? 29.652  83.438  39.409  1.00 40.77 ? 355 GLU B OE1 1 
ATOM   7394  O  OE2 . GLU C 1 355 ? 30.237  81.342  39.061  1.00 41.61 ? 355 GLU B OE2 1 
ATOM   7395  N  N   . LYS C 1 356 ? 25.107  83.289  42.257  1.00 18.36 ? 356 LYS B N   1 
ATOM   7396  C  CA  . LYS C 1 356 ? 24.346  84.370  42.855  1.00 16.97 ? 356 LYS B CA  1 
ATOM   7397  C  C   . LYS C 1 356 ? 24.225  85.517  41.841  1.00 15.88 ? 356 LYS B C   1 
ATOM   7398  O  O   . LYS C 1 356 ? 25.206  85.893  41.201  1.00 14.35 ? 356 LYS B O   1 
ATOM   7399  C  CB  . LYS C 1 356 ? 25.088  84.833  44.108  1.00 18.59 ? 356 LYS B CB  1 
ATOM   7400  C  CG  . LYS C 1 356 ? 24.467  85.988  44.843  1.00 24.53 ? 356 LYS B CG  1 
ATOM   7401  C  CD  . LYS C 1 356 ? 25.331  86.385  46.027  1.00 27.67 ? 356 LYS B CD  1 
ATOM   7402  C  CE  . LYS C 1 356 ? 24.729  87.572  46.755  1.00 32.96 ? 356 LYS B CE  1 
ATOM   7403  N  NZ  . LYS C 1 356 ? 24.465  88.708  45.821  1.00 36.79 ? 356 LYS B NZ  1 
ATOM   7404  N  N   . ASP C 1 357 ? 23.021  86.062  41.690  1.00 14.43 ? 357 ASP B N   1 
ATOM   7405  C  CA  . ASP C 1 357 ? 22.781  87.159  40.753  1.00 15.98 ? 357 ASP B CA  1 
ATOM   7406  C  C   . ASP C 1 357 ? 21.538  87.924  41.194  1.00 16.60 ? 357 ASP B C   1 
ATOM   7407  O  O   . ASP C 1 357 ? 20.414  87.549  40.861  1.00 15.95 ? 357 ASP B O   1 
ATOM   7408  C  CB  . ASP C 1 357 ? 22.583  86.616  39.335  1.00 14.37 ? 357 ASP B CB  1 
ATOM   7409  C  CG  . ASP C 1 357 ? 22.334  87.715  38.309  1.00 16.83 ? 357 ASP B CG  1 
ATOM   7410  O  OD1 . ASP C 1 357 ? 22.379  88.909  38.675  1.00 16.25 ? 357 ASP B OD1 1 
ATOM   7411  O  OD2 . ASP C 1 357 ? 22.093  87.385  37.128  1.00 16.04 ? 357 ASP B OD2 1 
ATOM   7412  N  N   . ARG C 1 358 ? 21.751  89.002  41.940  1.00 17.95 ? 358 ARG B N   1 
ATOM   7413  C  CA  . ARG C 1 358 ? 20.649  89.802  42.456  1.00 19.77 ? 358 ARG B CA  1 
ATOM   7414  C  C   . ARG C 1 358 ? 19.764  90.457  41.399  1.00 20.54 ? 358 ARG B C   1 
ATOM   7415  O  O   . ARG C 1 358 ? 18.603  90.769  41.673  1.00 20.14 ? 358 ARG B O   1 
ATOM   7416  C  CB  . ARG C 1 358 ? 21.192  90.854  43.425  1.00 21.21 ? 358 ARG B CB  1 
ATOM   7417  C  CG  . ARG C 1 358 ? 21.807  90.242  44.686  1.00 24.51 ? 358 ARG B CG  1 
ATOM   7418  C  CD  . ARG C 1 358 ? 20.761  89.476  45.489  1.00 27.60 ? 358 ARG B CD  1 
ATOM   7419  N  NE  . ARG C 1 358 ? 19.742  90.370  46.036  1.00 29.64 ? 358 ARG B NE  1 
ATOM   7420  C  CZ  . ARG C 1 358 ? 19.921  91.142  47.105  1.00 31.18 ? 358 ARG B CZ  1 
ATOM   7421  N  NH1 . ARG C 1 358 ? 21.080  91.124  47.752  1.00 31.82 ? 358 ARG B NH1 1 
ATOM   7422  N  NH2 . ARG C 1 358 ? 18.947  91.943  47.521  1.00 31.61 ? 358 ARG B NH2 1 
ATOM   7423  N  N   . SER C 1 359 ? 20.292  90.655  40.194  1.00 20.14 ? 359 SER B N   1 
ATOM   7424  C  CA  . SER C 1 359 ? 19.499  91.270  39.133  1.00 21.06 ? 359 SER B CA  1 
ATOM   7425  C  C   . SER C 1 359 ? 18.395  90.318  38.664  1.00 20.48 ? 359 SER B C   1 
ATOM   7426  O  O   . SER C 1 359 ? 17.425  90.742  38.038  1.00 20.39 ? 359 SER B O   1 
ATOM   7427  C  CB  . SER C 1 359 ? 20.386  91.664  37.945  1.00 21.84 ? 359 SER B CB  1 
ATOM   7428  O  OG  . SER C 1 359 ? 20.892  90.525  37.270  1.00 23.87 ? 359 SER B OG  1 
ATOM   7429  N  N   . ARG C 1 360 ? 18.545  89.032  38.972  1.00 19.06 ? 360 ARG B N   1 
ATOM   7430  C  CA  . ARG C 1 360 ? 17.546  88.044  38.580  1.00 18.67 ? 360 ARG B CA  1 
ATOM   7431  C  C   . ARG C 1 360 ? 16.881  87.409  39.797  1.00 17.26 ? 360 ARG B C   1 
ATOM   7432  O  O   . ARG C 1 360 ? 16.201  86.388  39.691  1.00 18.99 ? 360 ARG B O   1 
ATOM   7433  C  CB  . ARG C 1 360 ? 18.175  86.962  37.692  1.00 19.86 ? 360 ARG B CB  1 
ATOM   7434  C  CG  . ARG C 1 360 ? 18.693  87.478  36.352  1.00 20.97 ? 360 ARG B CG  1 
ATOM   7435  C  CD  . ARG C 1 360 ? 18.953  86.333  35.378  1.00 23.48 ? 360 ARG B CD  1 
ATOM   7436  N  NE  . ARG C 1 360 ? 19.920  85.372  35.900  1.00 26.19 ? 360 ARG B NE  1 
ATOM   7437  C  CZ  . ARG C 1 360 ? 20.109  84.154  35.399  1.00 26.97 ? 360 ARG B CZ  1 
ATOM   7438  N  NH1 . ARG C 1 360 ? 19.395  83.741  34.359  1.00 28.86 ? 360 ARG B NH1 1 
ATOM   7439  N  NH2 . ARG C 1 360 ? 21.009  83.345  35.941  1.00 27.38 ? 360 ARG B NH2 1 
ATOM   7440  N  N   . GLY C 1 361 ? 17.081  88.022  40.958  1.00 16.08 ? 361 GLY B N   1 
ATOM   7441  C  CA  . GLY C 1 361 ? 16.472  87.516  42.174  1.00 14.45 ? 361 GLY B CA  1 
ATOM   7442  C  C   . GLY C 1 361 ? 17.095  86.256  42.739  1.00 13.42 ? 361 GLY B C   1 
ATOM   7443  O  O   . GLY C 1 361 ? 16.452  85.536  43.509  1.00 11.92 ? 361 GLY B O   1 
ATOM   7444  N  N   . ILE C 1 362 ? 18.337  85.980  42.356  1.00 11.47 ? 362 ILE B N   1 
ATOM   7445  C  CA  . ILE C 1 362 ? 19.048  84.801  42.846  1.00 12.60 ? 362 ILE B CA  1 
ATOM   7446  C  C   . ILE C 1 362 ? 19.974  85.257  43.965  1.00 12.16 ? 362 ILE B C   1 
ATOM   7447  O  O   . ILE C 1 362 ? 21.036  85.838  43.716  1.00 12.22 ? 362 ILE B O   1 
ATOM   7448  C  CB  . ILE C 1 362 ? 19.855  84.140  41.713  1.00 13.96 ? 362 ILE B CB  1 
ATOM   7449  C  CG1 . ILE C 1 362 ? 18.891  83.704  40.603  1.00 16.11 ? 362 ILE B CG1 1 
ATOM   7450  C  CG2 . ILE C 1 362 ? 20.640  82.945  42.246  1.00 12.96 ? 362 ILE B CG2 1 
ATOM   7451  C  CD1 . ILE C 1 362 ? 19.569  83.207  39.350  1.00 18.36 ? 362 ILE B CD1 1 
ATOM   7452  N  N   . TYR C 1 363 ? 19.555  84.989  45.198  1.00 11.89 ? 363 TYR B N   1 
ATOM   7453  C  CA  . TYR C 1 363 ? 20.298  85.399  46.384  1.00 9.80  ? 363 TYR B CA  1 
ATOM   7454  C  C   . TYR C 1 363 ? 21.494  84.539  46.766  1.00 10.37 ? 363 TYR B C   1 
ATOM   7455  O  O   . TYR C 1 363 ? 22.431  85.029  47.398  1.00 9.71  ? 363 TYR B O   1 
ATOM   7456  C  CB  . TYR C 1 363 ? 19.353  85.481  47.583  1.00 9.89  ? 363 TYR B CB  1 
ATOM   7457  C  CG  . TYR C 1 363 ? 18.346  86.604  47.496  1.00 10.00 ? 363 TYR B CG  1 
ATOM   7458  C  CD1 . TYR C 1 363 ? 17.290  86.554  46.590  1.00 8.69  ? 363 TYR B CD1 1 
ATOM   7459  C  CD2 . TYR C 1 363 ? 18.475  87.740  48.298  1.00 11.94 ? 363 TYR B CD2 1 
ATOM   7460  C  CE1 . TYR C 1 363 ? 16.383  87.612  46.481  1.00 10.00 ? 363 TYR B CE1 1 
ATOM   7461  C  CE2 . TYR C 1 363 ? 17.578  88.801  48.200  1.00 10.84 ? 363 TYR B CE2 1 
ATOM   7462  C  CZ  . TYR C 1 363 ? 16.537  88.731  47.290  1.00 12.15 ? 363 TYR B CZ  1 
ATOM   7463  O  OH  . TYR C 1 363 ? 15.653  89.782  47.191  1.00 13.48 ? 363 TYR B OH  1 
ATOM   7464  N  N   . PHE C 1 364 ? 21.463  83.265  46.391  1.00 9.26  ? 364 PHE B N   1 
ATOM   7465  C  CA  . PHE C 1 364 ? 22.547  82.349  46.728  1.00 9.83  ? 364 PHE B CA  1 
ATOM   7466  C  C   . PHE C 1 364 ? 23.019  81.542  45.531  1.00 10.87 ? 364 PHE B C   1 
ATOM   7467  O  O   . PHE C 1 364 ? 22.252  81.274  44.606  1.00 12.53 ? 364 PHE B O   1 
ATOM   7468  C  CB  . PHE C 1 364 ? 22.089  81.339  47.783  1.00 11.14 ? 364 PHE B CB  1 
ATOM   7469  C  CG  . PHE C 1 364 ? 21.521  81.954  49.026  1.00 11.60 ? 364 PHE B CG  1 
ATOM   7470  C  CD1 . PHE C 1 364 ? 22.354  82.525  49.984  1.00 10.96 ? 364 PHE B CD1 1 
ATOM   7471  C  CD2 . PHE C 1 364 ? 20.148  81.927  49.255  1.00 10.44 ? 364 PHE B CD2 1 
ATOM   7472  C  CE1 . PHE C 1 364 ? 21.828  83.058  51.156  1.00 10.68 ? 364 PHE B CE1 1 
ATOM   7473  C  CE2 . PHE C 1 364 ? 19.609  82.457  50.423  1.00 10.76 ? 364 PHE B CE2 1 
ATOM   7474  C  CZ  . PHE C 1 364 ? 20.449  83.022  51.376  1.00 11.69 ? 364 PHE B CZ  1 
ATOM   7475  N  N   . THR C 1 365 ? 24.287  81.146  45.567  1.00 10.31 ? 365 THR B N   1 
ATOM   7476  C  CA  . THR C 1 365 ? 24.853  80.303  44.530  1.00 9.49  ? 365 THR B CA  1 
ATOM   7477  C  C   . THR C 1 365 ? 24.303  78.915  44.870  1.00 9.72  ? 365 THR B C   1 
ATOM   7478  O  O   . THR C 1 365 ? 24.362  78.480  46.022  1.00 10.65 ? 365 THR B O   1 
ATOM   7479  C  CB  . THR C 1 365 ? 26.393  80.304  44.604  1.00 10.82 ? 365 THR B CB  1 
ATOM   7480  O  OG1 . THR C 1 365 ? 26.885  81.569  44.143  1.00 10.51 ? 365 THR B OG1 1 
ATOM   7481  C  CG2 . THR C 1 365 ? 26.981  79.195  43.755  1.00 10.42 ? 365 THR B CG2 1 
ATOM   7482  N  N   . GLN C 1 366 ? 23.747  78.232  43.877  1.00 9.71  ? 366 GLN B N   1 
ATOM   7483  C  CA  . GLN C 1 366 ? 23.163  76.915  44.099  1.00 9.24  ? 366 GLN B CA  1 
ATOM   7484  C  C   . GLN C 1 366 ? 23.813  75.862  43.218  1.00 9.73  ? 366 GLN B C   1 
ATOM   7485  O  O   . GLN C 1 366 ? 23.946  76.052  42.011  1.00 11.42 ? 366 GLN B O   1 
ATOM   7486  C  CB  . GLN C 1 366 ? 21.657  76.969  43.816  1.00 8.53  ? 366 GLN B CB  1 
ATOM   7487  C  CG  . GLN C 1 366 ? 20.914  75.648  44.004  1.00 9.18  ? 366 GLN B CG  1 
ATOM   7488  C  CD  . GLN C 1 366 ? 20.872  75.202  45.453  1.00 6.90  ? 366 GLN B CD  1 
ATOM   7489  O  OE1 . GLN C 1 366 ? 20.362  75.912  46.317  1.00 9.63  ? 366 GLN B OE1 1 
ATOM   7490  N  NE2 . GLN C 1 366 ? 21.410  74.021  45.725  1.00 6.17  ? 366 GLN B NE2 1 
ATOM   7491  N  N   . SER C 1 367 ? 24.221  74.756  43.834  1.00 10.63 ? 367 SER B N   1 
ATOM   7492  C  CA  . SER C 1 367 ? 24.847  73.646  43.120  1.00 10.82 ? 367 SER B CA  1 
ATOM   7493  C  C   . SER C 1 367 ? 23.930  72.431  43.285  1.00 10.03 ? 367 SER B C   1 
ATOM   7494  O  O   . SER C 1 367 ? 23.302  72.272  44.330  1.00 11.18 ? 367 SER B O   1 
ATOM   7495  C  CB  . SER C 1 367 ? 26.226  73.358  43.710  1.00 12.40 ? 367 SER B CB  1 
ATOM   7496  O  OG  . SER C 1 367 ? 26.863  72.307  43.008  1.00 21.38 ? 367 SER B OG  1 
ATOM   7497  N  N   . TRP C 1 368 ? 23.851  71.576  42.266  1.00 9.71  ? 368 TRP B N   1 
ATOM   7498  C  CA  . TRP C 1 368 ? 22.962  70.410  42.321  1.00 9.55  ? 368 TRP B CA  1 
ATOM   7499  C  C   . TRP C 1 368 ? 23.611  69.031  42.280  1.00 10.35 ? 368 TRP B C   1 
ATOM   7500  O  O   . TRP C 1 368 ? 22.909  68.017  42.263  1.00 11.51 ? 368 TRP B O   1 
ATOM   7501  C  CB  . TRP C 1 368 ? 21.934  70.485  41.190  1.00 8.12  ? 368 TRP B CB  1 
ATOM   7502  C  CG  . TRP C 1 368 ? 21.010  71.648  41.297  1.00 8.65  ? 368 TRP B CG  1 
ATOM   7503  C  CD1 . TRP C 1 368 ? 21.181  72.886  40.751  1.00 8.59  ? 368 TRP B CD1 1 
ATOM   7504  C  CD2 . TRP C 1 368 ? 19.785  71.699  42.037  1.00 9.28  ? 368 TRP B CD2 1 
ATOM   7505  N  NE1 . TRP C 1 368 ? 20.135  73.710  41.105  1.00 8.46  ? 368 TRP B NE1 1 
ATOM   7506  C  CE2 . TRP C 1 368 ? 19.266  73.008  41.899  1.00 8.59  ? 368 TRP B CE2 1 
ATOM   7507  C  CE3 . TRP C 1 368 ? 19.077  70.770  42.811  1.00 8.33  ? 368 TRP B CE3 1 
ATOM   7508  C  CZ2 . TRP C 1 368 ? 18.069  73.409  42.500  1.00 8.58  ? 368 TRP B CZ2 1 
ATOM   7509  C  CZ3 . TRP C 1 368 ? 17.885  71.169  43.410  1.00 8.44  ? 368 TRP B CZ3 1 
ATOM   7510  C  CH2 . TRP C 1 368 ? 17.396  72.478  43.252  1.00 7.02  ? 368 TRP B CH2 1 
ATOM   7511  N  N   . VAL C 1 369 ? 24.938  68.988  42.266  1.00 9.70  ? 369 VAL B N   1 
ATOM   7512  C  CA  . VAL C 1 369 ? 25.666  67.727  42.212  1.00 8.76  ? 369 VAL B CA  1 
ATOM   7513  C  C   . VAL C 1 369 ? 24.996  66.642  41.359  1.00 10.13 ? 369 VAL B C   1 
ATOM   7514  O  O   . VAL C 1 369 ? 24.694  65.542  41.825  1.00 9.03  ? 369 VAL B O   1 
ATOM   7515  C  CB  . VAL C 1 369 ? 25.967  67.176  43.637  1.00 10.14 ? 369 VAL B CB  1 
ATOM   7516  C  CG1 . VAL C 1 369 ? 27.063  68.017  44.286  1.00 9.62  ? 369 VAL B CG1 1 
ATOM   7517  C  CG2 . VAL C 1 369 ? 24.718  67.198  44.498  1.00 7.47  ? 369 VAL B CG2 1 
ATOM   7518  N  N   . SER C 1 370 ? 24.769  66.990  40.096  1.00 10.17 ? 370 SER B N   1 
ATOM   7519  C  CA  . SER C 1 370 ? 24.192  66.104  39.091  1.00 10.37 ? 370 SER B CA  1 
ATOM   7520  C  C   . SER C 1 370 ? 22.737  65.662  39.231  1.00 11.63 ? 370 SER B C   1 
ATOM   7521  O  O   . SER C 1 370 ? 22.337  64.680  38.615  1.00 11.61 ? 370 SER B O   1 
ATOM   7522  C  CB  . SER C 1 370 ? 25.088  64.868  38.918  1.00 12.20 ? 370 SER B CB  1 
ATOM   7523  O  OG  . SER C 1 370 ? 26.348  65.244  38.384  1.00 15.53 ? 370 SER B OG  1 
ATOM   7524  N  N   . THR C 1 371 ? 21.956  66.370  40.038  1.00 10.20 ? 371 THR B N   1 
ATOM   7525  C  CA  . THR C 1 371 ? 20.552  66.036  40.151  1.00 11.08 ? 371 THR B CA  1 
ATOM   7526  C  C   . THR C 1 371 ? 20.031  66.431  38.765  1.00 9.63  ? 371 THR B C   1 
ATOM   7527  O  O   . THR C 1 371 ? 20.323  67.522  38.278  1.00 10.48 ? 371 THR B O   1 
ATOM   7528  C  CB  . THR C 1 371 ? 19.823  66.891  41.208  1.00 9.63  ? 371 THR B CB  1 
ATOM   7529  O  OG1 . THR C 1 371 ? 20.415  66.660  42.481  1.00 12.74 ? 371 THR B OG1 1 
ATOM   7530  C  CG2 . THR C 1 371 ? 18.341  66.535  41.275  1.00 11.43 ? 371 THR B CG2 1 
ATOM   7531  N  N   . PRO C 1 372 ? 19.275  65.539  38.094  1.00 10.91 ? 372 PRO B N   1 
ATOM   7532  C  CA  . PRO C 1 372 ? 18.738  65.850  36.757  1.00 9.73  ? 372 PRO B CA  1 
ATOM   7533  C  C   . PRO C 1 372 ? 17.997  67.184  36.682  1.00 8.66  ? 372 PRO B C   1 
ATOM   7534  O  O   . PRO C 1 372 ? 17.430  67.650  37.669  1.00 8.33  ? 372 PRO B O   1 
ATOM   7535  C  CB  . PRO C 1 372 ? 17.781  64.678  36.473  1.00 10.59 ? 372 PRO B CB  1 
ATOM   7536  C  CG  . PRO C 1 372 ? 18.410  63.497  37.277  1.00 11.37 ? 372 PRO B CG  1 
ATOM   7537  C  CD  . PRO C 1 372 ? 18.775  64.227  38.563  1.00 10.79 ? 372 PRO B CD  1 
ATOM   7538  N  N   . GLY C 1 373 ? 18.017  67.786  35.496  1.00 7.98  ? 373 GLY B N   1 
ATOM   7539  C  CA  . GLY C 1 373 ? 17.325  69.046  35.294  1.00 8.43  ? 373 GLY B CA  1 
ATOM   7540  C  C   . GLY C 1 373 ? 15.852  68.792  35.010  1.00 9.18  ? 373 GLY B C   1 
ATOM   7541  O  O   . GLY C 1 373 ? 15.465  67.676  34.641  1.00 9.16  ? 373 GLY B O   1 
ATOM   7542  N  N   . VAL C 1 374 ? 15.028  69.825  35.179  1.00 8.80  ? 374 VAL B N   1 
ATOM   7543  C  CA  . VAL C 1 374 ? 13.585  69.721  34.955  1.00 8.53  ? 374 VAL B CA  1 
ATOM   7544  C  C   . VAL C 1 374 ? 13.192  70.583  33.756  1.00 8.29  ? 374 VAL B C   1 
ATOM   7545  O  O   . VAL C 1 374 ? 13.636  71.726  33.645  1.00 8.53  ? 374 VAL B O   1 
ATOM   7546  C  CB  . VAL C 1 374 ? 12.796  70.227  36.192  1.00 8.15  ? 374 VAL B CB  1 
ATOM   7547  C  CG1 . VAL C 1 374 ? 11.301  69.967  36.016  1.00 9.46  ? 374 VAL B CG1 1 
ATOM   7548  C  CG2 . VAL C 1 374 ? 13.311  69.545  37.450  1.00 9.89  ? 374 VAL B CG2 1 
ATOM   7549  N  N   . LEU C 1 375 ? 12.372  70.041  32.859  1.00 7.88  ? 375 LEU B N   1 
ATOM   7550  C  CA  . LEU C 1 375 ? 11.929  70.802  31.692  1.00 8.96  ? 375 LEU B CA  1 
ATOM   7551  C  C   . LEU C 1 375 ? 10.896  71.862  32.061  1.00 8.40  ? 375 LEU B C   1 
ATOM   7552  O  O   . LEU C 1 375 ? 9.845   71.547  32.613  1.00 8.91  ? 375 LEU B O   1 
ATOM   7553  C  CB  . LEU C 1 375 ? 11.298  69.884  30.640  1.00 10.79 ? 375 LEU B CB  1 
ATOM   7554  C  CG  . LEU C 1 375 ? 12.162  69.180  29.597  1.00 14.26 ? 375 LEU B CG  1 
ATOM   7555  C  CD1 . LEU C 1 375 ? 11.248  68.359  28.689  1.00 14.93 ? 375 LEU B CD1 1 
ATOM   7556  C  CD2 . LEU C 1 375 ? 12.952  70.204  28.783  1.00 11.21 ? 375 LEU B CD2 1 
ATOM   7557  N  N   . PRO C 1 376 ? 11.186  73.139  31.767  1.00 8.70  ? 376 PRO B N   1 
ATOM   7558  C  CA  . PRO C 1 376 ? 10.225  74.200  32.087  1.00 6.96  ? 376 PRO B CA  1 
ATOM   7559  C  C   . PRO C 1 376 ? 9.096   74.187  31.055  1.00 7.96  ? 376 PRO B C   1 
ATOM   7560  O  O   . PRO C 1 376 ? 9.347   73.993  29.862  1.00 5.66  ? 376 PRO B O   1 
ATOM   7561  C  CB  . PRO C 1 376 ? 11.073  75.467  32.007  1.00 8.84  ? 376 PRO B CB  1 
ATOM   7562  C  CG  . PRO C 1 376 ? 12.073  75.131  30.939  1.00 9.25  ? 376 PRO B CG  1 
ATOM   7563  C  CD  . PRO C 1 376 ? 12.460  73.705  31.284  1.00 8.24  ? 376 PRO B CD  1 
ATOM   7564  N  N   . VAL C 1 377 ? 7.861   74.391  31.513  1.00 6.79  ? 377 VAL B N   1 
ATOM   7565  C  CA  . VAL C 1 377 ? 6.704   74.394  30.627  1.00 7.03  ? 377 VAL B CA  1 
ATOM   7566  C  C   . VAL C 1 377 ? 6.045   75.770  30.545  1.00 6.69  ? 377 VAL B C   1 
ATOM   7567  O  O   . VAL C 1 377 ? 5.573   76.304  31.548  1.00 8.10  ? 377 VAL B O   1 
ATOM   7568  C  CB  . VAL C 1 377 ? 5.650   73.365  31.098  1.00 7.86  ? 377 VAL B CB  1 
ATOM   7569  C  CG1 . VAL C 1 377 ? 4.459   73.355  30.139  1.00 7.24  ? 377 VAL B CG1 1 
ATOM   7570  C  CG2 . VAL C 1 377 ? 6.286   71.981  31.200  1.00 8.45  ? 377 VAL B CG2 1 
ATOM   7571  N  N   . ALA C 1 378 ? 6.025   76.341  29.345  1.00 6.62  ? 378 ALA B N   1 
ATOM   7572  C  CA  . ALA C 1 378 ? 5.416   77.651  29.132  1.00 7.99  ? 378 ALA B CA  1 
ATOM   7573  C  C   . ALA C 1 378 ? 3.989   77.410  28.658  1.00 8.65  ? 378 ALA B C   1 
ATOM   7574  O  O   . ALA C 1 378 ? 3.772   76.802  27.608  1.00 8.36  ? 378 ALA B O   1 
ATOM   7575  C  CB  . ALA C 1 378 ? 6.199   78.429  28.086  1.00 8.07  ? 378 ALA B CB  1 
ATOM   7576  N  N   . SER C 1 379 ? 3.017   77.894  29.426  1.00 7.28  ? 379 SER B N   1 
ATOM   7577  C  CA  . SER C 1 379 ? 1.615   77.678  29.089  1.00 7.52  ? 379 SER B CA  1 
ATOM   7578  C  C   . SER C 1 379 ? 0.691   78.779  29.607  1.00 6.85  ? 379 SER B C   1 
ATOM   7579  O  O   . SER C 1 379 ? 0.953   79.379  30.649  1.00 7.49  ? 379 SER B O   1 
ATOM   7580  C  CB  . SER C 1 379 ? 1.178   76.323  29.668  1.00 7.86  ? 379 SER B CB  1 
ATOM   7581  O  OG  . SER C 1 379 ? -0.215  76.105  29.538  1.00 10.72 ? 379 SER B OG  1 
ATOM   7582  N  N   . GLY C 1 380 ? -0.386  79.043  28.870  1.00 6.86  ? 380 GLY B N   1 
ATOM   7583  C  CA  . GLY C 1 380 ? -1.349  80.038  29.307  1.00 7.18  ? 380 GLY B CA  1 
ATOM   7584  C  C   . GLY C 1 380 ? -1.530  81.302  28.490  1.00 8.87  ? 380 GLY B C   1 
ATOM   7585  O  O   . GLY C 1 380 ? -0.769  82.260  28.639  1.00 8.90  ? 380 GLY B O   1 
ATOM   7586  N  N   . GLY C 1 381 ? -2.545  81.307  27.629  1.00 8.43  ? 381 GLY B N   1 
ATOM   7587  C  CA  . GLY C 1 381 ? -2.835  82.481  26.821  1.00 9.57  ? 381 GLY B CA  1 
ATOM   7588  C  C   . GLY C 1 381 ? -1.831  82.847  25.747  1.00 10.61 ? 381 GLY B C   1 
ATOM   7589  O  O   . GLY C 1 381 ? -1.689  84.023  25.398  1.00 11.96 ? 381 GLY B O   1 
ATOM   7590  N  N   . ILE C 1 382 ? -1.120  81.856  25.221  1.00 10.34 ? 382 ILE B N   1 
ATOM   7591  C  CA  . ILE C 1 382 ? -0.149  82.128  24.171  1.00 9.80  ? 382 ILE B CA  1 
ATOM   7592  C  C   . ILE C 1 382 ? -0.647  81.609  22.828  1.00 11.00 ? 382 ILE B C   1 
ATOM   7593  O  O   . ILE C 1 382 ? -1.483  80.706  22.771  1.00 10.58 ? 382 ILE B O   1 
ATOM   7594  C  CB  . ILE C 1 382 ? 1.224   81.495  24.487  1.00 9.57  ? 382 ILE B CB  1 
ATOM   7595  C  CG1 . ILE C 1 382 ? 1.044   80.053  24.974  1.00 8.57  ? 382 ILE B CG1 1 
ATOM   7596  C  CG2 . ILE C 1 382 ? 1.954   82.344  25.519  1.00 10.38 ? 382 ILE B CG2 1 
ATOM   7597  C  CD1 . ILE C 1 382 ? 2.361   79.303  25.197  1.00 10.52 ? 382 ILE B CD1 1 
ATOM   7598  N  N   . HIS C 1 383 ? -0.135  82.192  21.749  1.00 10.19 ? 383 HIS B N   1 
ATOM   7599  C  CA  . HIS C 1 383 ? -0.530  81.787  20.408  1.00 10.36 ? 383 HIS B CA  1 
ATOM   7600  C  C   . HIS C 1 383 ? 0.625   81.942  19.430  1.00 10.52 ? 383 HIS B C   1 
ATOM   7601  O  O   . HIS C 1 383 ? 1.708   82.408  19.799  1.00 10.62 ? 383 HIS B O   1 
ATOM   7602  C  CB  . HIS C 1 383 ? -1.750  82.594  19.947  1.00 9.79  ? 383 HIS B CB  1 
ATOM   7603  C  CG  . HIS C 1 383 ? -1.594  84.076  20.105  1.00 12.48 ? 383 HIS B CG  1 
ATOM   7604  N  ND1 . HIS C 1 383 ? -0.773  84.830  19.293  1.00 11.70 ? 383 HIS B ND1 1 
ATOM   7605  C  CD2 . HIS C 1 383 ? -2.157  84.940  20.981  1.00 9.99  ? 383 HIS B CD2 1 
ATOM   7606  C  CE1 . HIS C 1 383 ? -0.838  86.096  19.663  1.00 11.88 ? 383 HIS B CE1 1 
ATOM   7607  N  NE2 . HIS C 1 383 ? -1.670  86.192  20.685  1.00 10.75 ? 383 HIS B NE2 1 
ATOM   7608  N  N   . VAL C 1 384 ? 0.389   81.555  18.181  1.00 9.87  ? 384 VAL B N   1 
ATOM   7609  C  CA  . VAL C 1 384 ? 1.417   81.605  17.146  1.00 9.69  ? 384 VAL B CA  1 
ATOM   7610  C  C   . VAL C 1 384 ? 2.300   82.851  17.060  1.00 9.68  ? 384 VAL B C   1 
ATOM   7611  O  O   . VAL C 1 384 ? 3.487   82.733  16.771  1.00 10.77 ? 384 VAL B O   1 
ATOM   7612  C  CB  . VAL C 1 384 ? 0.805   81.339  15.752  1.00 9.96  ? 384 VAL B CB  1 
ATOM   7613  C  CG1 . VAL C 1 384 ? 0.295   79.912  15.689  1.00 9.07  ? 384 VAL B CG1 1 
ATOM   7614  C  CG2 . VAL C 1 384 ? -0.328  82.322  15.469  1.00 8.36  ? 384 VAL B CG2 1 
ATOM   7615  N  N   . TRP C 1 385 ? 1.753   84.038  17.304  1.00 9.17  ? 385 TRP B N   1 
ATOM   7616  C  CA  . TRP C 1 385 ? 2.592   85.230  17.210  1.00 10.45 ? 385 TRP B CA  1 
ATOM   7617  C  C   . TRP C 1 385 ? 3.621   85.332  18.340  1.00 10.63 ? 385 TRP B C   1 
ATOM   7618  O  O   . TRP C 1 385 ? 4.587   86.083  18.234  1.00 10.11 ? 385 TRP B O   1 
ATOM   7619  C  CB  . TRP C 1 385 ? 1.742   86.506  17.166  1.00 10.95 ? 385 TRP B CB  1 
ATOM   7620  C  CG  . TRP C 1 385 ? 0.937   86.685  15.900  1.00 11.57 ? 385 TRP B CG  1 
ATOM   7621  C  CD1 . TRP C 1 385 ? -0.409  86.507  15.754  1.00 11.50 ? 385 TRP B CD1 1 
ATOM   7622  C  CD2 . TRP C 1 385 ? 1.427   87.107  14.617  1.00 12.24 ? 385 TRP B CD2 1 
ATOM   7623  N  NE1 . TRP C 1 385 ? -0.792  86.798  14.463  1.00 12.31 ? 385 TRP B NE1 1 
ATOM   7624  C  CE2 . TRP C 1 385 ? 0.314   87.169  13.744  1.00 12.47 ? 385 TRP B CE2 1 
ATOM   7625  C  CE3 . TRP C 1 385 ? 2.696   87.444  14.120  1.00 14.25 ? 385 TRP B CE3 1 
ATOM   7626  C  CZ2 . TRP C 1 385 ? 0.431   87.551  12.398  1.00 13.75 ? 385 TRP B CZ2 1 
ATOM   7627  C  CZ3 . TRP C 1 385 ? 2.814   87.826  12.771  1.00 15.62 ? 385 TRP B CZ3 1 
ATOM   7628  C  CH2 . TRP C 1 385 ? 1.683   87.876  11.931  1.00 15.07 ? 385 TRP B CH2 1 
ATOM   7629  N  N   . HIS C 1 386 ? 3.415   84.572  19.413  1.00 10.11 ? 386 HIS B N   1 
ATOM   7630  C  CA  . HIS C 1 386 ? 4.330   84.575  20.551  1.00 10.19 ? 386 HIS B CA  1 
ATOM   7631  C  C   . HIS C 1 386 ? 5.477   83.585  20.348  1.00 10.43 ? 386 HIS B C   1 
ATOM   7632  O  O   . HIS C 1 386 ? 6.440   83.589  21.113  1.00 11.07 ? 386 HIS B O   1 
ATOM   7633  C  CB  . HIS C 1 386 ? 3.602   84.166  21.839  1.00 8.97  ? 386 HIS B CB  1 
ATOM   7634  C  CG  . HIS C 1 386 ? 2.565   85.141  22.305  1.00 11.10 ? 386 HIS B CG  1 
ATOM   7635  N  ND1 . HIS C 1 386 ? 1.305   84.744  22.705  1.00 10.60 ? 386 HIS B ND1 1 
ATOM   7636  C  CD2 . HIS C 1 386 ? 2.610   86.481  22.488  1.00 10.00 ? 386 HIS B CD2 1 
ATOM   7637  C  CE1 . HIS C 1 386 ? 0.622   85.799  23.114  1.00 10.94 ? 386 HIS B CE1 1 
ATOM   7638  N  NE2 . HIS C 1 386 ? 1.391   86.865  22.993  1.00 10.86 ? 386 HIS B NE2 1 
ATOM   7639  N  N   . MET C 1 387 ? 5.369   82.734  19.330  1.00 8.90  ? 387 MET B N   1 
ATOM   7640  C  CA  . MET C 1 387 ? 6.377   81.703  19.086  1.00 9.54  ? 387 MET B CA  1 
ATOM   7641  C  C   . MET C 1 387 ? 7.831   82.169  19.046  1.00 9.96  ? 387 MET B C   1 
ATOM   7642  O  O   . MET C 1 387 ? 8.696   81.550  19.669  1.00 10.90 ? 387 MET B O   1 
ATOM   7643  C  CB  . MET C 1 387 ? 6.058   80.927  17.805  1.00 8.89  ? 387 MET B CB  1 
ATOM   7644  C  CG  . MET C 1 387 ? 6.587   79.493  17.825  1.00 10.49 ? 387 MET B CG  1 
ATOM   7645  S  SD  . MET C 1 387 ? 5.785   78.478  19.113  1.00 12.15 ? 387 MET B SD  1 
ATOM   7646  C  CE  . MET C 1 387 ? 4.347   77.870  18.212  1.00 11.14 ? 387 MET B CE  1 
ATOM   7647  N  N   . PRO C 1 388 ? 8.129   83.249  18.304  1.00 9.08  ? 388 PRO B N   1 
ATOM   7648  C  CA  . PRO C 1 388 ? 9.519   83.715  18.252  1.00 10.67 ? 388 PRO B CA  1 
ATOM   7649  C  C   . PRO C 1 388 ? 10.059  84.075  19.638  1.00 11.29 ? 388 PRO B C   1 
ATOM   7650  O  O   . PRO C 1 388 ? 11.166  83.677  20.008  1.00 12.38 ? 388 PRO B O   1 
ATOM   7651  C  CB  . PRO C 1 388 ? 9.441   84.935  17.338  1.00 9.34  ? 388 PRO B CB  1 
ATOM   7652  C  CG  . PRO C 1 388 ? 8.311   84.600  16.427  1.00 10.65 ? 388 PRO B CG  1 
ATOM   7653  C  CD  . PRO C 1 388 ? 7.287   84.017  17.369  1.00 9.86  ? 388 PRO B CD  1 
ATOM   7654  N  N   . ALA C 1 389 ? 9.268   84.833  20.394  1.00 10.35 ? 389 ALA B N   1 
ATOM   7655  C  CA  . ALA C 1 389 ? 9.652   85.268  21.736  1.00 11.07 ? 389 ALA B CA  1 
ATOM   7656  C  C   . ALA C 1 389 ? 9.819   84.103  22.711  1.00 10.41 ? 389 ALA B C   1 
ATOM   7657  O  O   . ALA C 1 389 ? 10.739  84.094  23.526  1.00 11.00 ? 389 ALA B O   1 
ATOM   7658  C  CB  . ALA C 1 389 ? 8.619   86.259  22.274  1.00 12.40 ? 389 ALA B CB  1 
ATOM   7659  N  N   . LEU C 1 390 ? 8.927   83.121  22.630  1.00 10.43 ? 390 LEU B N   1 
ATOM   7660  C  CA  . LEU C 1 390 ? 9.003   81.963  23.510  1.00 10.32 ? 390 LEU B CA  1 
ATOM   7661  C  C   . LEU C 1 390 ? 10.268  81.165  23.223  1.00 11.14 ? 390 LEU B C   1 
ATOM   7662  O  O   . LEU C 1 390 ? 10.964  80.734  24.145  1.00 12.04 ? 390 LEU B O   1 
ATOM   7663  C  CB  . LEU C 1 390 ? 7.777   81.068  23.321  1.00 7.51  ? 390 LEU B CB  1 
ATOM   7664  C  CG  . LEU C 1 390 ? 6.441   81.645  23.794  1.00 9.92  ? 390 LEU B CG  1 
ATOM   7665  C  CD1 . LEU C 1 390 ? 5.310   80.767  23.283  1.00 9.96  ? 390 LEU B CD1 1 
ATOM   7666  C  CD2 . LEU C 1 390 ? 6.415   81.735  25.317  1.00 8.22  ? 390 LEU B CD2 1 
ATOM   7667  N  N   . THR C 1 391 ? 10.561  80.976  21.939  1.00 9.53  ? 391 THR B N   1 
ATOM   7668  C  CA  . THR C 1 391 ? 11.739  80.224  21.521  1.00 11.68 ? 391 THR B CA  1 
ATOM   7669  C  C   . THR C 1 391 ? 13.026  80.917  21.960  1.00 12.60 ? 391 THR B C   1 
ATOM   7670  O  O   . THR C 1 391 ? 13.992  80.268  22.361  1.00 14.33 ? 391 THR B O   1 
ATOM   7671  C  CB  . THR C 1 391 ? 11.766  80.053  19.986  1.00 12.81 ? 391 THR B CB  1 
ATOM   7672  O  OG1 . THR C 1 391 ? 10.559  79.413  19.554  1.00 12.66 ? 391 THR B OG1 1 
ATOM   7673  C  CG2 . THR C 1 391 ? 12.954  79.211  19.562  1.00 12.41 ? 391 THR B CG2 1 
ATOM   7674  N  N   . GLU C 1 392 ? 13.023  82.240  21.887  1.00 12.74 ? 392 GLU B N   1 
ATOM   7675  C  CA  . GLU C 1 392 ? 14.179  83.040  22.261  1.00 15.47 ? 392 GLU B CA  1 
ATOM   7676  C  C   . GLU C 1 392 ? 14.412  83.017  23.773  1.00 15.72 ? 392 GLU B C   1 
ATOM   7677  O  O   . GLU C 1 392 ? 15.543  82.883  24.236  1.00 15.97 ? 392 GLU B O   1 
ATOM   7678  C  CB  . GLU C 1 392 ? 13.967  84.476  21.770  1.00 17.95 ? 392 GLU B CB  1 
ATOM   7679  C  CG  . GLU C 1 392 ? 15.196  85.367  21.805  1.00 25.26 ? 392 GLU B CG  1 
ATOM   7680  C  CD  . GLU C 1 392 ? 15.260  86.222  23.050  1.00 29.72 ? 392 GLU B CD  1 
ATOM   7681  O  OE1 . GLU C 1 392 ? 14.257  86.900  23.356  1.00 32.66 ? 392 GLU B OE1 1 
ATOM   7682  O  OE2 . GLU C 1 392 ? 16.315  86.226  23.718  1.00 34.28 ? 392 GLU B OE2 1 
ATOM   7683  N  N   . ILE C 1 393 ? 13.335  83.136  24.540  1.00 14.02 ? 393 ILE B N   1 
ATOM   7684  C  CA  . ILE C 1 393 ? 13.427  83.141  25.996  1.00 12.72 ? 393 ILE B CA  1 
ATOM   7685  C  C   . ILE C 1 393 ? 13.828  81.797  26.603  1.00 12.65 ? 393 ILE B C   1 
ATOM   7686  O  O   . ILE C 1 393 ? 14.778  81.720  27.380  1.00 11.58 ? 393 ILE B O   1 
ATOM   7687  C  CB  . ILE C 1 393 ? 12.076  83.570  26.632  1.00 13.38 ? 393 ILE B CB  1 
ATOM   7688  C  CG1 . ILE C 1 393 ? 11.792  85.039  26.317  1.00 14.49 ? 393 ILE B CG1 1 
ATOM   7689  C  CG2 . ILE C 1 393 ? 12.101  83.335  28.137  1.00 13.39 ? 393 ILE B CG2 1 
ATOM   7690  C  CD1 . ILE C 1 393 ? 10.394  85.504  26.724  1.00 16.15 ? 393 ILE B CD1 1 
ATOM   7691  N  N   . PHE C 1 394 ? 13.109  80.740  26.235  1.00 11.13 ? 394 PHE B N   1 
ATOM   7692  C  CA  . PHE C 1 394 ? 13.346  79.417  26.798  1.00 12.07 ? 394 PHE B CA  1 
ATOM   7693  C  C   . PHE C 1 394 ? 14.356  78.493  26.118  1.00 12.46 ? 394 PHE B C   1 
ATOM   7694  O  O   . PHE C 1 394 ? 14.912  77.611  26.767  1.00 14.18 ? 394 PHE B O   1 
ATOM   7695  C  CB  . PHE C 1 394 ? 12.000  78.691  26.924  1.00 11.62 ? 394 PHE B CB  1 
ATOM   7696  C  CG  . PHE C 1 394 ? 11.008  79.409  27.802  1.00 11.66 ? 394 PHE B CG  1 
ATOM   7697  C  CD1 . PHE C 1 394 ? 11.089  79.315  29.188  1.00 10.17 ? 394 PHE B CD1 1 
ATOM   7698  C  CD2 . PHE C 1 394 ? 10.024  80.221  27.242  1.00 10.97 ? 394 PHE B CD2 1 
ATOM   7699  C  CE1 . PHE C 1 394 ? 10.204  80.018  30.006  1.00 12.79 ? 394 PHE B CE1 1 
ATOM   7700  C  CE2 . PHE C 1 394 ? 9.137   80.928  28.046  1.00 12.98 ? 394 PHE B CE2 1 
ATOM   7701  C  CZ  . PHE C 1 394 ? 9.226   80.829  29.434  1.00 13.18 ? 394 PHE B CZ  1 
ATOM   7702  N  N   . GLY C 1 395 ? 14.593  78.673  24.825  1.00 12.26 ? 395 GLY B N   1 
ATOM   7703  C  CA  . GLY C 1 395 ? 15.529  77.798  24.143  1.00 10.54 ? 395 GLY B CA  1 
ATOM   7704  C  C   . GLY C 1 395 ? 14.912  76.442  23.834  1.00 11.51 ? 395 GLY B C   1 
ATOM   7705  O  O   . GLY C 1 395 ? 13.711  76.245  24.034  1.00 12.72 ? 395 GLY B O   1 
ATOM   7706  N  N   . ASP C 1 396 ? 15.726  75.499  23.362  1.00 9.63  ? 396 ASP B N   1 
ATOM   7707  C  CA  . ASP C 1 396 ? 15.231  74.166  23.014  1.00 10.03 ? 396 ASP B CA  1 
ATOM   7708  C  C   . ASP C 1 396 ? 14.660  73.331  24.153  1.00 10.94 ? 396 ASP B C   1 
ATOM   7709  O  O   . ASP C 1 396 ? 13.674  72.613  23.967  1.00 8.61  ? 396 ASP B O   1 
ATOM   7710  C  CB  . ASP C 1 396 ? 16.323  73.337  22.337  1.00 11.33 ? 396 ASP B CB  1 
ATOM   7711  C  CG  . ASP C 1 396 ? 16.624  73.800  20.926  1.00 12.22 ? 396 ASP B CG  1 
ATOM   7712  O  OD1 . ASP C 1 396 ? 15.746  74.429  20.301  1.00 14.65 ? 396 ASP B OD1 1 
ATOM   7713  O  OD2 . ASP C 1 396 ? 17.736  73.514  20.438  1.00 15.73 ? 396 ASP B OD2 1 
ATOM   7714  N  N   . ASP C 1 397 ? 15.277  73.403  25.327  1.00 9.63  ? 397 ASP B N   1 
ATOM   7715  C  CA  . ASP C 1 397 ? 14.796  72.602  26.439  1.00 9.27  ? 397 ASP B CA  1 
ATOM   7716  C  C   . ASP C 1 397 ? 13.624  73.229  27.175  1.00 9.78  ? 397 ASP B C   1 
ATOM   7717  O  O   . ASP C 1 397 ? 13.778  73.841  28.234  1.00 9.75  ? 397 ASP B O   1 
ATOM   7718  C  CB  . ASP C 1 397 ? 15.942  72.279  27.403  1.00 10.37 ? 397 ASP B CB  1 
ATOM   7719  C  CG  . ASP C 1 397 ? 17.011  71.406  26.757  1.00 12.41 ? 397 ASP B CG  1 
ATOM   7720  O  OD1 . ASP C 1 397 ? 16.661  70.607  25.863  1.00 13.03 ? 397 ASP B OD1 1 
ATOM   7721  O  OD2 . ASP C 1 397 ? 18.193  71.506  27.142  1.00 12.42 ? 397 ASP B OD2 1 
ATOM   7722  N  N   . SER C 1 398 ? 12.446  73.059  26.588  1.00 8.12  ? 398 SER B N   1 
ATOM   7723  C  CA  . SER C 1 398 ? 11.213  73.572  27.156  1.00 9.03  ? 398 SER B CA  1 
ATOM   7724  C  C   . SER C 1 398 ? 10.029  72.900  26.479  1.00 8.75  ? 398 SER B C   1 
ATOM   7725  O  O   . SER C 1 398 ? 10.177  72.207  25.472  1.00 7.83  ? 398 SER B O   1 
ATOM   7726  C  CB  . SER C 1 398 ? 11.120  75.087  26.953  1.00 9.59  ? 398 SER B CB  1 
ATOM   7727  O  OG  . SER C 1 398 ? 11.041  75.412  25.576  1.00 9.95  ? 398 SER B OG  1 
ATOM   7728  N  N   . VAL C 1 399 ? 8.852   73.101  27.053  1.00 8.51  ? 399 VAL B N   1 
ATOM   7729  C  CA  . VAL C 1 399 ? 7.623   72.556  26.498  1.00 8.21  ? 399 VAL B CA  1 
ATOM   7730  C  C   . VAL C 1 399 ? 6.695   73.753  26.376  1.00 8.09  ? 399 VAL B C   1 
ATOM   7731  O  O   . VAL C 1 399 ? 6.456   74.449  27.356  1.00 9.94  ? 399 VAL B O   1 
ATOM   7732  C  CB  . VAL C 1 399 ? 6.975   71.519  27.441  1.00 7.97  ? 399 VAL B CB  1 
ATOM   7733  C  CG1 . VAL C 1 399 ? 5.680   71.007  26.828  1.00 6.77  ? 399 VAL B CG1 1 
ATOM   7734  C  CG2 . VAL C 1 399 ? 7.943   70.363  27.700  1.00 7.04  ? 399 VAL B CG2 1 
ATOM   7735  N  N   . LEU C 1 400 ? 6.200   74.007  25.169  1.00 7.37  ? 400 LEU B N   1 
ATOM   7736  C  CA  . LEU C 1 400 ? 5.298   75.130  24.928  1.00 6.92  ? 400 LEU B CA  1 
ATOM   7737  C  C   . LEU C 1 400 ? 3.898   74.546  24.734  1.00 7.49  ? 400 LEU B C   1 
ATOM   7738  O  O   . LEU C 1 400 ? 3.695   73.692  23.876  1.00 8.28  ? 400 LEU B O   1 
ATOM   7739  C  CB  . LEU C 1 400 ? 5.753   75.895  23.680  1.00 6.51  ? 400 LEU B CB  1 
ATOM   7740  C  CG  . LEU C 1 400 ? 7.247   76.267  23.645  1.00 6.95  ? 400 LEU B CG  1 
ATOM   7741  C  CD1 . LEU C 1 400 ? 7.591   76.897  22.305  1.00 7.89  ? 400 LEU B CD1 1 
ATOM   7742  C  CD2 . LEU C 1 400 ? 7.584   77.226  24.774  1.00 5.92  ? 400 LEU B CD2 1 
ATOM   7743  N  N   . GLN C 1 401 ? 2.933   74.999  25.529  1.00 7.46  ? 401 GLN B N   1 
ATOM   7744  C  CA  . GLN C 1 401 ? 1.585   74.450  25.432  1.00 8.53  ? 401 GLN B CA  1 
ATOM   7745  C  C   . GLN C 1 401 ? 0.528   75.446  24.983  1.00 8.34  ? 401 GLN B C   1 
ATOM   7746  O  O   . GLN C 1 401 ? 0.444   76.568  25.493  1.00 10.25 ? 401 GLN B O   1 
ATOM   7747  C  CB  . GLN C 1 401 ? 1.182   73.830  26.773  1.00 7.43  ? 401 GLN B CB  1 
ATOM   7748  C  CG  . GLN C 1 401 ? 2.221   72.865  27.325  1.00 10.13 ? 401 GLN B CG  1 
ATOM   7749  C  CD  . GLN C 1 401 ? 1.750   72.138  28.572  1.00 9.67  ? 401 GLN B CD  1 
ATOM   7750  O  OE1 . GLN C 1 401 ? 0.976   72.674  29.367  1.00 12.61 ? 401 GLN B OE1 1 
ATOM   7751  N  NE2 . GLN C 1 401 ? 2.234   70.922  28.758  1.00 9.89  ? 401 GLN B NE2 1 
ATOM   7752  N  N   . PHE C 1 402 ? -0.285  75.009  24.026  1.00 7.40  ? 402 PHE B N   1 
ATOM   7753  C  CA  . PHE C 1 402 ? -1.344  75.835  23.467  1.00 7.52  ? 402 PHE B CA  1 
ATOM   7754  C  C   . PHE C 1 402 ? -2.705  75.145  23.560  1.00 8.33  ? 402 PHE B C   1 
ATOM   7755  O  O   . PHE C 1 402 ? -3.042  74.305  22.729  1.00 9.43  ? 402 PHE B O   1 
ATOM   7756  C  CB  . PHE C 1 402 ? -1.024  76.164  22.002  1.00 7.42  ? 402 PHE B CB  1 
ATOM   7757  C  CG  . PHE C 1 402 ? 0.326   76.818  21.801  1.00 8.77  ? 402 PHE B CG  1 
ATOM   7758  C  CD1 . PHE C 1 402 ? 1.494   76.056  21.783  1.00 7.31  ? 402 PHE B CD1 1 
ATOM   7759  C  CD2 . PHE C 1 402 ? 0.428   78.196  21.651  1.00 9.69  ? 402 PHE B CD2 1 
ATOM   7760  C  CE1 . PHE C 1 402 ? 2.744   76.659  21.619  1.00 7.05  ? 402 PHE B CE1 1 
ATOM   7761  C  CE2 . PHE C 1 402 ? 1.673   78.810  21.487  1.00 8.92  ? 402 PHE B CE2 1 
ATOM   7762  C  CZ  . PHE C 1 402 ? 2.834   78.040  21.471  1.00 7.97  ? 402 PHE B CZ  1 
ATOM   7763  N  N   . GLY C 1 403 ? -3.478  75.507  24.582  1.00 9.51  ? 403 GLY B N   1 
ATOM   7764  C  CA  . GLY C 1 403 ? -4.799  74.932  24.766  1.00 8.09  ? 403 GLY B CA  1 
ATOM   7765  C  C   . GLY C 1 403 ? -5.781  75.655  23.869  1.00 8.08  ? 403 GLY B C   1 
ATOM   7766  O  O   . GLY C 1 403 ? -6.161  75.147  22.813  1.00 8.74  ? 403 GLY B O   1 
ATOM   7767  N  N   . GLY C 1 404 ? -6.193  76.847  24.284  1.00 8.07  ? 404 GLY B N   1 
ATOM   7768  C  CA  . GLY C 1 404 ? -7.108  77.623  23.468  1.00 8.40  ? 404 GLY B CA  1 
ATOM   7769  C  C   . GLY C 1 404 ? -6.440  77.948  22.142  1.00 9.16  ? 404 GLY B C   1 
ATOM   7770  O  O   . GLY C 1 404 ? -7.110  78.131  21.127  1.00 7.91  ? 404 GLY B O   1 
ATOM   7771  N  N   . GLY C 1 405 ? -5.109  78.012  22.157  1.00 9.45  ? 405 GLY B N   1 
ATOM   7772  C  CA  . GLY C 1 405 ? -4.354  78.309  20.950  1.00 9.68  ? 405 GLY B CA  1 
ATOM   7773  C  C   . GLY C 1 405 ? -4.391  77.204  19.906  1.00 10.24 ? 405 GLY B C   1 
ATOM   7774  O  O   . GLY C 1 405 ? -3.881  77.376  18.794  1.00 10.50 ? 405 GLY B O   1 
ATOM   7775  N  N   . THR C 1 406 ? -4.977  76.062  20.263  1.00 9.16  ? 406 THR B N   1 
ATOM   7776  C  CA  . THR C 1 406 ? -5.104  74.937  19.340  1.00 8.48  ? 406 THR B CA  1 
ATOM   7777  C  C   . THR C 1 406 ? -6.586  74.662  19.076  1.00 9.73  ? 406 THR B C   1 
ATOM   7778  O  O   . THR C 1 406 ? -7.010  74.574  17.924  1.00 10.29 ? 406 THR B O   1 
ATOM   7779  C  CB  . THR C 1 406 ? -4.477  73.641  19.902  1.00 8.69  ? 406 THR B CB  1 
ATOM   7780  O  OG1 . THR C 1 406 ? -3.069  73.824  20.090  1.00 7.78  ? 406 THR B OG1 1 
ATOM   7781  C  CG2 . THR C 1 406 ? -4.710  72.476  18.940  1.00 7.30  ? 406 THR B CG2 1 
ATOM   7782  N  N   . LEU C 1 407 ? -7.365  74.525  20.149  1.00 9.00  ? 407 LEU B N   1 
ATOM   7783  C  CA  . LEU C 1 407 ? -8.797  74.253  20.025  1.00 9.19  ? 407 LEU B CA  1 
ATOM   7784  C  C   . LEU C 1 407 ? -9.595  75.494  19.627  1.00 10.45 ? 407 LEU B C   1 
ATOM   7785  O  O   . LEU C 1 407 ? -10.805 75.417  19.406  1.00 10.70 ? 407 LEU B O   1 
ATOM   7786  C  CB  . LEU C 1 407 ? -9.356  73.679  21.334  1.00 10.20 ? 407 LEU B CB  1 
ATOM   7787  C  CG  . LEU C 1 407 ? -9.004  72.220  21.651  1.00 12.16 ? 407 LEU B CG  1 
ATOM   7788  C  CD1 . LEU C 1 407 ? -7.619  72.150  22.263  1.00 14.11 ? 407 LEU B CD1 1 
ATOM   7789  C  CD2 . LEU C 1 407 ? -10.033 71.632  22.613  1.00 15.02 ? 407 LEU B CD2 1 
ATOM   7790  N  N   . GLY C 1 408 ? -8.909  76.631  19.539  1.00 8.88  ? 408 GLY B N   1 
ATOM   7791  C  CA  . GLY C 1 408 ? -9.555  77.871  19.150  1.00 10.15 ? 408 GLY B CA  1 
ATOM   7792  C  C   . GLY C 1 408 ? -9.330  78.203  17.682  1.00 10.53 ? 408 GLY B C   1 
ATOM   7793  O  O   . GLY C 1 408 ? -9.769  79.247  17.205  1.00 10.51 ? 408 GLY B O   1 
ATOM   7794  N  N   . HIS C 1 409 ? -8.636  77.317  16.970  1.00 10.00 ? 409 HIS B N   1 
ATOM   7795  C  CA  . HIS C 1 409 ? -8.356  77.507  15.545  1.00 10.39 ? 409 HIS B CA  1 
ATOM   7796  C  C   . HIS C 1 409 ? -9.662  77.329  14.758  1.00 10.94 ? 409 HIS B C   1 
ATOM   7797  O  O   . HIS C 1 409 ? -10.426 76.400  15.017  1.00 10.74 ? 409 HIS B O   1 
ATOM   7798  C  CB  . HIS C 1 409 ? -7.303  76.488  15.091  1.00 11.08 ? 409 HIS B CB  1 
ATOM   7799  C  CG  . HIS C 1 409 ? -6.804  76.704  13.697  1.00 12.07 ? 409 HIS B CG  1 
ATOM   7800  N  ND1 . HIS C 1 409 ? -7.549  76.392  12.580  1.00 11.75 ? 409 HIS B ND1 1 
ATOM   7801  C  CD2 . HIS C 1 409 ? -5.629  77.202  13.240  1.00 10.89 ? 409 HIS B CD2 1 
ATOM   7802  C  CE1 . HIS C 1 409 ? -6.856  76.687  11.495  1.00 12.84 ? 409 HIS B CE1 1 
ATOM   7803  N  NE2 . HIS C 1 409 ? -5.688  77.180  11.868  1.00 12.28 ? 409 HIS B NE2 1 
ATOM   7804  N  N   . PRO C 1 410 ? -9.929  78.212  13.780  1.00 10.93 ? 410 PRO B N   1 
ATOM   7805  C  CA  . PRO C 1 410 ? -11.161 78.128  12.979  1.00 11.28 ? 410 PRO B CA  1 
ATOM   7806  C  C   . PRO C 1 410 ? -11.423 76.831  12.211  1.00 12.14 ? 410 PRO B C   1 
ATOM   7807  O  O   . PRO C 1 410 ? -12.575 76.530  11.887  1.00 13.19 ? 410 PRO B O   1 
ATOM   7808  C  CB  . PRO C 1 410 ? -11.057 79.341  12.053  1.00 11.95 ? 410 PRO B CB  1 
ATOM   7809  C  CG  . PRO C 1 410 ? -9.569  79.539  11.909  1.00 12.05 ? 410 PRO B CG  1 
ATOM   7810  C  CD  . PRO C 1 410 ? -9.081  79.328  13.324  1.00 10.52 ? 410 PRO B CD  1 
ATOM   7811  N  N   . TRP C 1 411 ? -10.376 76.058  11.930  1.00 10.71 ? 411 TRP B N   1 
ATOM   7812  C  CA  . TRP C 1 411 ? -10.546 74.808  11.185  1.00 11.80 ? 411 TRP B CA  1 
ATOM   7813  C  C   . TRP C 1 411 ? -10.518 73.537  12.038  1.00 11.46 ? 411 TRP B C   1 
ATOM   7814  O  O   . TRP C 1 411 ? -10.623 72.433  11.508  1.00 10.76 ? 411 TRP B O   1 
ATOM   7815  C  CB  . TRP C 1 411 ? -9.476  74.676  10.099  1.00 12.00 ? 411 TRP B CB  1 
ATOM   7816  C  CG  . TRP C 1 411 ? -9.420  75.806  9.109   1.00 13.03 ? 411 TRP B CG  1 
ATOM   7817  C  CD1 . TRP C 1 411 ? -10.259 76.882  9.028   1.00 13.57 ? 411 TRP B CD1 1 
ATOM   7818  C  CD2 . TRP C 1 411 ? -8.449  75.976  8.071   1.00 13.92 ? 411 TRP B CD2 1 
ATOM   7819  N  NE1 . TRP C 1 411 ? -9.867  77.712  8.001   1.00 14.78 ? 411 TRP B NE1 1 
ATOM   7820  C  CE2 . TRP C 1 411 ? -8.759  77.176  7.397   1.00 14.43 ? 411 TRP B CE2 1 
ATOM   7821  C  CE3 . TRP C 1 411 ? -7.345  75.223  7.643   1.00 15.54 ? 411 TRP B CE3 1 
ATOM   7822  C  CZ2 . TRP C 1 411 ? -8.000  77.649  6.320   1.00 14.47 ? 411 TRP B CZ2 1 
ATOM   7823  C  CZ3 . TRP C 1 411 ? -6.592  75.691  6.572   1.00 15.93 ? 411 TRP B CZ3 1 
ATOM   7824  C  CH2 . TRP C 1 411 ? -6.925  76.893  5.922   1.00 16.64 ? 411 TRP B CH2 1 
ATOM   7825  N  N   . GLY C 1 412 ? -10.366 73.677  13.350  1.00 10.86 ? 412 GLY B N   1 
ATOM   7826  C  CA  . GLY C 1 412 ? -10.351 72.491  14.189  1.00 11.03 ? 412 GLY B CA  1 
ATOM   7827  C  C   . GLY C 1 412 ? -9.012  72.166  14.824  1.00 9.88  ? 412 GLY B C   1 
ATOM   7828  O  O   . GLY C 1 412 ? -8.024  72.870  14.615  1.00 7.05  ? 412 GLY B O   1 
ATOM   7829  N  N   . ASN C 1 413 ? -8.987  71.077  15.586  1.00 8.12  ? 413 ASN B N   1 
ATOM   7830  C  CA  . ASN C 1 413 ? -7.790  70.650  16.304  1.00 9.49  ? 413 ASN B CA  1 
ATOM   7831  C  C   . ASN C 1 413 ? -6.557  70.302  15.472  1.00 9.85  ? 413 ASN B C   1 
ATOM   7832  O  O   . ASN C 1 413 ? -5.458  70.778  15.768  1.00 10.93 ? 413 ASN B O   1 
ATOM   7833  C  CB  . ASN C 1 413 ? -8.136  69.473  17.218  1.00 8.89  ? 413 ASN B CB  1 
ATOM   7834  C  CG  . ASN C 1 413 ? -9.048  69.874  18.366  1.00 8.36  ? 413 ASN B CG  1 
ATOM   7835  O  OD1 . ASN C 1 413 ? -9.533  71.006  18.428  1.00 9.08  ? 413 ASN B OD1 1 
ATOM   7836  N  ND2 . ASN C 1 413 ? -9.283  68.943  19.284  1.00 7.66  ? 413 ASN B ND2 1 
ATOM   7837  N  N   . ALA C 1 414 ? -6.718  69.473  14.447  1.00 9.53  ? 414 ALA B N   1 
ATOM   7838  C  CA  . ALA C 1 414 ? -5.573  69.093  13.627  1.00 9.40  ? 414 ALA B CA  1 
ATOM   7839  C  C   . ALA C 1 414 ? -4.930  70.316  12.976  1.00 9.52  ? 414 ALA B C   1 
ATOM   7840  O  O   . ALA C 1 414 ? -3.716  70.505  13.070  1.00 11.23 ? 414 ALA B O   1 
ATOM   7841  C  CB  . ALA C 1 414 ? -5.989  68.074  12.572  1.00 9.19  ? 414 ALA B CB  1 
ATOM   7842  N  N   . PRO C 1 415 ? -5.728  71.158  12.294  1.00 9.38  ? 415 PRO B N   1 
ATOM   7843  C  CA  . PRO C 1 415 ? -5.150  72.349  11.662  1.00 10.26 ? 415 PRO B CA  1 
ATOM   7844  C  C   . PRO C 1 415 ? -4.550  73.293  12.707  1.00 10.83 ? 415 PRO B C   1 
ATOM   7845  O  O   . PRO C 1 415 ? -3.577  73.997  12.442  1.00 11.05 ? 415 PRO B O   1 
ATOM   7846  C  CB  . PRO C 1 415 ? -6.345  72.968  10.941  1.00 10.77 ? 415 PRO B CB  1 
ATOM   7847  C  CG  . PRO C 1 415 ? -7.164  71.768  10.576  1.00 9.66  ? 415 PRO B CG  1 
ATOM   7848  C  CD  . PRO C 1 415 ? -7.117  70.954  11.845  1.00 8.62  ? 415 PRO B CD  1 
ATOM   7849  N  N   . GLY C 1 416 ? -5.141  73.306  13.897  1.00 9.75  ? 416 GLY B N   1 
ATOM   7850  C  CA  . GLY C 1 416 ? -4.627  74.151  14.958  1.00 8.42  ? 416 GLY B CA  1 
ATOM   7851  C  C   . GLY C 1 416 ? -3.260  73.657  15.404  1.00 9.92  ? 416 GLY B C   1 
ATOM   7852  O  O   . GLY C 1 416 ? -2.357  74.452  15.682  1.00 9.02  ? 416 GLY B O   1 
ATOM   7853  N  N   . ALA C 1 417 ? -3.106  72.338  15.473  1.00 9.19  ? 417 ALA B N   1 
ATOM   7854  C  CA  . ALA C 1 417 ? -1.841  71.732  15.877  1.00 10.00 ? 417 ALA B CA  1 
ATOM   7855  C  C   . ALA C 1 417 ? -0.773  72.003  14.811  1.00 11.32 ? 417 ALA B C   1 
ATOM   7856  O  O   . ALA C 1 417 ? 0.373   72.337  15.129  1.00 11.17 ? 417 ALA B O   1 
ATOM   7857  C  CB  . ALA C 1 417 ? -2.026  70.227  16.072  1.00 9.93  ? 417 ALA B CB  1 
ATOM   7858  N  N   . VAL C 1 418 ? -1.155  71.853  13.546  1.00 10.17 ? 418 VAL B N   1 
ATOM   7859  C  CA  . VAL C 1 418 ? -0.236  72.092  12.438  1.00 10.20 ? 418 VAL B CA  1 
ATOM   7860  C  C   . VAL C 1 418 ? 0.313   73.518  12.489  1.00 10.13 ? 418 VAL B C   1 
ATOM   7861  O  O   . VAL C 1 418 ? 1.519   73.734  12.349  1.00 11.09 ? 418 VAL B O   1 
ATOM   7862  C  CB  . VAL C 1 418 ? -0.934  71.871  11.071  1.00 10.38 ? 418 VAL B CB  1 
ATOM   7863  C  CG1 . VAL C 1 418 ? 0.013   72.231  9.938   1.00 11.41 ? 418 VAL B CG1 1 
ATOM   7864  C  CG2 . VAL C 1 418 ? -1.384  70.423  10.940  1.00 10.17 ? 418 VAL B CG2 1 
ATOM   7865  N  N   . ALA C 1 419 ? -0.573  74.489  12.700  1.00 9.47  ? 419 ALA B N   1 
ATOM   7866  C  CA  . ALA C 1 419 ? -0.169  75.891  12.770  1.00 8.54  ? 419 ALA B CA  1 
ATOM   7867  C  C   . ALA C 1 419 ? 0.911   76.132  13.830  1.00 9.53  ? 419 ALA B C   1 
ATOM   7868  O  O   . ALA C 1 419 ? 1.866   76.884  13.597  1.00 7.19  ? 419 ALA B O   1 
ATOM   7869  C  CB  . ALA C 1 419 ? -1.388  76.772  13.052  1.00 7.68  ? 419 ALA B CB  1 
ATOM   7870  N  N   . ASN C 1 420 ? 0.764   75.504  14.995  1.00 6.94  ? 420 ASN B N   1 
ATOM   7871  C  CA  . ASN C 1 420 ? 1.752   75.681  16.053  1.00 8.49  ? 420 ASN B CA  1 
ATOM   7872  C  C   . ASN C 1 420 ? 3.061   74.954  15.737  1.00 7.28  ? 420 ASN B C   1 
ATOM   7873  O  O   . ASN C 1 420 ? 4.145   75.489  15.969  1.00 7.78  ? 420 ASN B O   1 
ATOM   7874  C  CB  . ASN C 1 420 ? 1.188   75.211  17.398  1.00 8.34  ? 420 ASN B CB  1 
ATOM   7875  C  CG  . ASN C 1 420 ? 0.083   76.127  17.915  1.00 11.85 ? 420 ASN B CG  1 
ATOM   7876  O  OD1 . ASN C 1 420 ? 0.245   77.349  17.958  1.00 11.87 ? 420 ASN B OD1 1 
ATOM   7877  N  ND2 . ASN C 1 420 ? -1.042  75.541  18.313  1.00 9.90  ? 420 ASN B ND2 1 
ATOM   7878  N  N   . ARG C 1 421 ? 2.959   73.743  15.202  1.00 7.39  ? 421 ARG B N   1 
ATOM   7879  C  CA  . ARG C 1 421 ? 4.148   72.970  14.853  1.00 7.34  ? 421 ARG B CA  1 
ATOM   7880  C  C   . ARG C 1 421 ? 4.941   73.702  13.765  1.00 8.42  ? 421 ARG B C   1 
ATOM   7881  O  O   . ARG C 1 421 ? 6.161   73.830  13.860  1.00 7.55  ? 421 ARG B O   1 
ATOM   7882  C  CB  . ARG C 1 421 ? 3.739   71.565  14.389  1.00 5.68  ? 421 ARG B CB  1 
ATOM   7883  C  CG  . ARG C 1 421 ? 4.887   70.631  14.016  1.00 5.76  ? 421 ARG B CG  1 
ATOM   7884  C  CD  . ARG C 1 421 ? 5.897   70.414  15.146  1.00 6.37  ? 421 ARG B CD  1 
ATOM   7885  N  NE  . ARG C 1 421 ? 6.972   69.520  14.710  1.00 8.14  ? 421 ARG B NE  1 
ATOM   7886  C  CZ  . ARG C 1 421 ? 6.909   68.191  14.743  1.00 7.56  ? 421 ARG B CZ  1 
ATOM   7887  N  NH1 . ARG C 1 421 ? 5.826   67.581  15.210  1.00 6.52  ? 421 ARG B NH1 1 
ATOM   7888  N  NH2 . ARG C 1 421 ? 7.916   67.464  14.268  1.00 6.86  ? 421 ARG B NH2 1 
ATOM   7889  N  N   . VAL C 1 422 ? 4.245   74.192  12.740  1.00 9.12  ? 422 VAL B N   1 
ATOM   7890  C  CA  . VAL C 1 422 ? 4.895   74.927  11.655  1.00 9.70  ? 422 VAL B CA  1 
ATOM   7891  C  C   . VAL C 1 422 ? 5.554   76.209  12.179  1.00 10.94 ? 422 VAL B C   1 
ATOM   7892  O  O   . VAL C 1 422 ? 6.709   76.500  11.860  1.00 12.76 ? 422 VAL B O   1 
ATOM   7893  C  CB  . VAL C 1 422 ? 3.881   75.304  10.550  1.00 11.21 ? 422 VAL B CB  1 
ATOM   7894  C  CG1 . VAL C 1 422 ? 4.493   76.315  9.599   1.00 9.76  ? 422 VAL B CG1 1 
ATOM   7895  C  CG2 . VAL C 1 422 ? 3.456   74.056  9.784   1.00 9.81  ? 422 VAL B CG2 1 
ATOM   7896  N  N   . ALA C 1 423 ? 4.817   76.974  12.979  1.00 9.45  ? 423 ALA B N   1 
ATOM   7897  C  CA  . ALA C 1 423 ? 5.348   78.214  13.539  1.00 9.28  ? 423 ALA B CA  1 
ATOM   7898  C  C   . ALA C 1 423 ? 6.628   77.948  14.329  1.00 8.97  ? 423 ALA B C   1 
ATOM   7899  O  O   . ALA C 1 423 ? 7.602   78.695  14.224  1.00 10.50 ? 423 ALA B O   1 
ATOM   7900  C  CB  . ALA C 1 423 ? 4.309   78.872  14.440  1.00 8.71  ? 423 ALA B CB  1 
ATOM   7901  N  N   . LEU C 1 424 ? 6.621   76.878  15.118  1.00 9.48  ? 424 LEU B N   1 
ATOM   7902  C  CA  . LEU C 1 424 ? 7.774   76.521  15.929  1.00 10.80 ? 424 LEU B CA  1 
ATOM   7903  C  C   . LEU C 1 424 ? 8.987   76.153  15.085  1.00 10.70 ? 424 LEU B C   1 
ATOM   7904  O  O   . LEU C 1 424 ? 10.074  76.692  15.282  1.00 10.08 ? 424 LEU B O   1 
ATOM   7905  C  CB  . LEU C 1 424 ? 7.431   75.355  16.859  1.00 11.90 ? 424 LEU B CB  1 
ATOM   7906  C  CG  . LEU C 1 424 ? 8.595   74.811  17.699  1.00 13.32 ? 424 LEU B CG  1 
ATOM   7907  C  CD1 . LEU C 1 424 ? 9.116   75.898  18.626  1.00 11.85 ? 424 LEU B CD1 1 
ATOM   7908  C  CD2 . LEU C 1 424 ? 8.129   73.608  18.498  1.00 15.40 ? 424 LEU B CD2 1 
ATOM   7909  N  N   . GLU C 1 425 ? 8.805   75.237  14.140  1.00 11.39 ? 425 GLU B N   1 
ATOM   7910  C  CA  . GLU C 1 425 ? 9.925   74.819  13.305  1.00 11.92 ? 425 GLU B CA  1 
ATOM   7911  C  C   . GLU C 1 425 ? 10.470  75.961  12.449  1.00 12.27 ? 425 GLU B C   1 
ATOM   7912  O  O   . GLU C 1 425 ? 11.664  76.009  12.172  1.00 13.06 ? 425 GLU B O   1 
ATOM   7913  C  CB  . GLU C 1 425 ? 9.527   73.630  12.430  1.00 11.65 ? 425 GLU B CB  1 
ATOM   7914  C  CG  . GLU C 1 425 ? 9.013   72.437  13.230  1.00 13.88 ? 425 GLU B CG  1 
ATOM   7915  C  CD  . GLU C 1 425 ? 9.120   71.126  12.473  1.00 13.16 ? 425 GLU B CD  1 
ATOM   7916  O  OE1 . GLU C 1 425 ? 8.998   71.138  11.228  1.00 14.51 ? 425 GLU B OE1 1 
ATOM   7917  O  OE2 . GLU C 1 425 ? 9.319   70.080  13.126  1.00 13.48 ? 425 GLU B OE2 1 
ATOM   7918  N  N   . ALA C 1 426 ? 9.604   76.882  12.037  1.00 10.86 ? 426 ALA B N   1 
ATOM   7919  C  CA  . ALA C 1 426 ? 10.046  78.020  11.236  1.00 11.81 ? 426 ALA B CA  1 
ATOM   7920  C  C   . ALA C 1 426 ? 11.006  78.858  12.074  1.00 12.00 ? 426 ALA B C   1 
ATOM   7921  O  O   . ALA C 1 426 ? 12.009  79.361  11.570  1.00 12.10 ? 426 ALA B O   1 
ATOM   7922  C  CB  . ALA C 1 426 ? 8.850   78.863  10.803  1.00 11.51 ? 426 ALA B CB  1 
ATOM   7923  N  N   . CYS C 1 427 ? 10.693  79.004  13.359  1.00 11.27 ? 427 CYS B N   1 
ATOM   7924  C  CA  . CYS C 1 427 ? 11.539  79.768  14.265  1.00 11.60 ? 427 CYS B CA  1 
ATOM   7925  C  C   . CYS C 1 427 ? 12.853  79.044  14.519  1.00 10.57 ? 427 CYS B C   1 
ATOM   7926  O  O   . CYS C 1 427 ? 13.916  79.661  14.533  1.00 9.69  ? 427 CYS B O   1 
ATOM   7927  C  CB  . CYS C 1 427 ? 10.819  80.012  15.591  1.00 11.10 ? 427 CYS B CB  1 
ATOM   7928  S  SG  . CYS C 1 427 ? 9.456   81.173  15.454  1.00 13.67 ? 427 CYS B SG  1 
ATOM   7929  N  N   . VAL C 1 428 ? 12.777  77.734  14.725  1.00 10.11 ? 428 VAL B N   1 
ATOM   7930  C  CA  . VAL C 1 428 ? 13.978  76.945  14.965  1.00 12.93 ? 428 VAL B CA  1 
ATOM   7931  C  C   . VAL C 1 428 ? 14.914  77.022  13.762  1.00 13.40 ? 428 VAL B C   1 
ATOM   7932  O  O   . VAL C 1 428 ? 16.121  77.196  13.916  1.00 14.75 ? 428 VAL B O   1 
ATOM   7933  C  CB  . VAL C 1 428 ? 13.632  75.466  15.239  1.00 13.84 ? 428 VAL B CB  1 
ATOM   7934  C  CG1 . VAL C 1 428 ? 14.889  74.608  15.155  1.00 12.44 ? 428 VAL B CG1 1 
ATOM   7935  C  CG2 . VAL C 1 428 ? 13.005  75.336  16.617  1.00 12.83 ? 428 VAL B CG2 1 
ATOM   7936  N  N   . GLN C 1 429 ? 14.355  76.890  12.564  1.00 12.59 ? 429 GLN B N   1 
ATOM   7937  C  CA  . GLN C 1 429 ? 15.162  76.954  11.352  1.00 13.92 ? 429 GLN B CA  1 
ATOM   7938  C  C   . GLN C 1 429 ? 15.827  78.322  11.214  1.00 13.70 ? 429 GLN B C   1 
ATOM   7939  O  O   . GLN C 1 429 ? 17.025  78.408  10.946  1.00 13.48 ? 429 GLN B O   1 
ATOM   7940  C  CB  . GLN C 1 429 ? 14.302  76.686  10.120  1.00 15.28 ? 429 GLN B CB  1 
ATOM   7941  C  CG  . GLN C 1 429 ? 15.049  76.834  8.798   1.00 14.86 ? 429 GLN B CG  1 
ATOM   7942  C  CD  . GLN C 1 429 ? 14.159  76.555  7.605   1.00 15.48 ? 429 GLN B CD  1 
ATOM   7943  O  OE1 . GLN C 1 429 ? 13.116  77.184  7.439   1.00 18.26 ? 429 GLN B OE1 1 
ATOM   7944  N  NE2 . GLN C 1 429 ? 14.567  75.606  6.766   1.00 15.52 ? 429 GLN B NE2 1 
ATOM   7945  N  N   . ALA C 1 430 ? 15.044  79.383  11.397  1.00 12.89 ? 430 ALA B N   1 
ATOM   7946  C  CA  . ALA C 1 430 ? 15.555  80.748  11.286  1.00 13.39 ? 430 ALA B CA  1 
ATOM   7947  C  C   . ALA C 1 430 ? 16.665  81.015  12.301  1.00 13.87 ? 430 ALA B C   1 
ATOM   7948  O  O   . ALA C 1 430 ? 17.681  81.634  11.979  1.00 15.22 ? 430 ALA B O   1 
ATOM   7949  C  CB  . ALA C 1 430 ? 14.415  81.747  11.480  1.00 13.09 ? 430 ALA B CB  1 
ATOM   7950  N  N   . ARG C 1 431 ? 16.464  80.553  13.529  1.00 13.39 ? 431 ARG B N   1 
ATOM   7951  C  CA  . ARG C 1 431 ? 17.455  80.740  14.580  1.00 13.06 ? 431 ARG B CA  1 
ATOM   7952  C  C   . ARG C 1 431 ? 18.743  80.028  14.195  1.00 14.31 ? 431 ARG B C   1 
ATOM   7953  O  O   . ARG C 1 431 ? 19.835  80.605  14.259  1.00 13.65 ? 431 ARG B O   1 
ATOM   7954  C  CB  . ARG C 1 431 ? 16.947  80.163  15.900  1.00 14.22 ? 431 ARG B CB  1 
ATOM   7955  C  CG  . ARG C 1 431 ? 17.968  80.231  17.026  1.00 13.56 ? 431 ARG B CG  1 
ATOM   7956  C  CD  . ARG C 1 431 ? 17.592  79.296  18.148  1.00 14.42 ? 431 ARG B CD  1 
ATOM   7957  N  NE  . ARG C 1 431 ? 17.647  77.901  17.721  1.00 15.15 ? 431 ARG B NE  1 
ATOM   7958  C  CZ  . ARG C 1 431 ? 17.148  76.891  18.425  1.00 14.50 ? 431 ARG B CZ  1 
ATOM   7959  N  NH1 . ARG C 1 431 ? 16.554  77.129  19.585  1.00 14.28 ? 431 ARG B NH1 1 
ATOM   7960  N  NH2 . ARG C 1 431 ? 17.263  75.647  17.978  1.00 14.12 ? 431 ARG B NH2 1 
ATOM   7961  N  N   . ASN C 1 432 ? 18.606  78.768  13.795  1.00 13.18 ? 432 ASN B N   1 
ATOM   7962  C  CA  . ASN C 1 432 ? 19.753  77.960  13.403  1.00 13.96 ? 432 ASN B CA  1 
ATOM   7963  C  C   . ASN C 1 432 ? 20.539  78.590  12.253  1.00 15.43 ? 432 ASN B C   1 
ATOM   7964  O  O   . ASN C 1 432 ? 21.758  78.429  12.171  1.00 15.94 ? 432 ASN B O   1 
ATOM   7965  C  CB  . ASN C 1 432 ? 19.290  76.552  13.019  1.00 12.84 ? 432 ASN B CB  1 
ATOM   7966  C  CG  . ASN C 1 432 ? 18.745  75.774  14.204  1.00 12.32 ? 432 ASN B CG  1 
ATOM   7967  O  OD1 . ASN C 1 432 ? 18.682  76.285  15.324  1.00 11.17 ? 432 ASN B OD1 1 
ATOM   7968  N  ND2 . ASN C 1 432 ? 18.353  74.527  13.962  1.00 11.23 ? 432 ASN B ND2 1 
ATOM   7969  N  N   . GLU C 1 433 ? 19.846  79.312  11.374  1.00 16.14 ? 433 GLU B N   1 
ATOM   7970  C  CA  . GLU C 1 433 ? 20.501  79.956  10.239  1.00 18.22 ? 433 GLU B CA  1 
ATOM   7971  C  C   . GLU C 1 433 ? 21.189  81.260  10.639  1.00 18.76 ? 433 GLU B C   1 
ATOM   7972  O  O   . GLU C 1 433 ? 21.896  81.862  9.833   1.00 19.94 ? 433 GLU B O   1 
ATOM   7973  C  CB  . GLU C 1 433 ? 19.496  80.224  9.114   1.00 17.97 ? 433 GLU B CB  1 
ATOM   7974  C  CG  . GLU C 1 433 ? 18.798  78.972  8.595   1.00 20.09 ? 433 GLU B CG  1 
ATOM   7975  C  CD  . GLU C 1 433 ? 17.929  79.243  7.378   1.00 21.74 ? 433 GLU B CD  1 
ATOM   7976  O  OE1 . GLU C 1 433 ? 17.241  80.284  7.357   1.00 23.35 ? 433 GLU B OE1 1 
ATOM   7977  O  OE2 . GLU C 1 433 ? 17.922  78.408  6.448   1.00 23.54 ? 433 GLU B OE2 1 
ATOM   7978  N  N   . GLY C 1 434 ? 20.975  81.696  11.877  1.00 19.80 ? 434 GLY B N   1 
ATOM   7979  C  CA  . GLY C 1 434 ? 21.614  82.914  12.349  1.00 19.97 ? 434 GLY B CA  1 
ATOM   7980  C  C   . GLY C 1 434 ? 20.750  84.161  12.438  1.00 21.67 ? 434 GLY B C   1 
ATOM   7981  O  O   . GLY C 1 434 ? 21.260  85.242  12.733  1.00 20.46 ? 434 GLY B O   1 
ATOM   7982  N  N   . ARG C 1 435 ? 19.450  84.026  12.191  1.00 19.91 ? 435 ARG B N   1 
ATOM   7983  C  CA  . ARG C 1 435 ? 18.550  85.174  12.251  1.00 19.91 ? 435 ARG B CA  1 
ATOM   7984  C  C   . ARG C 1 435 ? 18.200  85.541  13.691  1.00 21.37 ? 435 ARG B C   1 
ATOM   7985  O  O   . ARG C 1 435 ? 18.193  84.690  14.580  1.00 21.50 ? 435 ARG B O   1 
ATOM   7986  C  CB  . ARG C 1 435 ? 17.279  84.881  11.448  1.00 18.65 ? 435 ARG B CB  1 
ATOM   7987  C  CG  . ARG C 1 435 ? 17.575  84.511  10.003  1.00 19.96 ? 435 ARG B CG  1 
ATOM   7988  C  CD  . ARG C 1 435 ? 16.322  84.210  9.205   1.00 20.19 ? 435 ARG B CD  1 
ATOM   7989  N  NE  . ARG C 1 435 ? 15.476  85.385  9.010   1.00 18.83 ? 435 ARG B NE  1 
ATOM   7990  C  CZ  . ARG C 1 435 ? 14.348  85.375  8.306   1.00 18.37 ? 435 ARG B CZ  1 
ATOM   7991  N  NH1 . ARG C 1 435 ? 13.940  84.251  7.734   1.00 16.73 ? 435 ARG B NH1 1 
ATOM   7992  N  NH2 . ARG C 1 435 ? 13.630  86.482  8.174   1.00 17.23 ? 435 ARG B NH2 1 
ATOM   7993  N  N   . ASP C 1 436 ? 17.918  86.820  13.912  1.00 23.09 ? 436 ASP B N   1 
ATOM   7994  C  CA  . ASP C 1 436 ? 17.574  87.328  15.236  1.00 24.97 ? 436 ASP B CA  1 
ATOM   7995  C  C   . ASP C 1 436 ? 16.066  87.208  15.482  1.00 24.50 ? 436 ASP B C   1 
ATOM   7996  O  O   . ASP C 1 436 ? 15.279  87.963  14.914  1.00 25.01 ? 436 ASP B O   1 
ATOM   7997  C  CB  . ASP C 1 436 ? 18.005  88.794  15.348  1.00 27.58 ? 436 ASP B CB  1 
ATOM   7998  C  CG  . ASP C 1 436 ? 17.913  89.329  16.763  1.00 31.47 ? 436 ASP B CG  1 
ATOM   7999  O  OD1 . ASP C 1 436 ? 17.329  88.647  17.632  1.00 32.66 ? 436 ASP B OD1 1 
ATOM   8000  O  OD2 . ASP C 1 436 ? 18.421  90.444  17.004  1.00 34.61 ? 436 ASP B OD2 1 
ATOM   8001  N  N   . LEU C 1 437 ? 15.674  86.255  16.325  1.00 24.25 ? 437 LEU B N   1 
ATOM   8002  C  CA  . LEU C 1 437 ? 14.264  86.029  16.649  1.00 23.50 ? 437 LEU B CA  1 
ATOM   8003  C  C   . LEU C 1 437 ? 13.587  87.244  17.281  1.00 23.82 ? 437 LEU B C   1 
ATOM   8004  O  O   . LEU C 1 437 ? 12.411  87.508  17.033  1.00 23.46 ? 437 LEU B O   1 
ATOM   8005  C  CB  . LEU C 1 437 ? 14.130  84.827  17.592  1.00 23.69 ? 437 LEU B CB  1 
ATOM   8006  C  CG  . LEU C 1 437 ? 13.778  83.465  16.986  1.00 24.14 ? 437 LEU B CG  1 
ATOM   8007  C  CD1 . LEU C 1 437 ? 14.515  83.250  15.684  1.00 24.82 ? 437 LEU B CD1 1 
ATOM   8008  C  CD2 . LEU C 1 437 ? 14.116  82.376  17.988  1.00 24.34 ? 437 LEU B CD2 1 
ATOM   8009  N  N   . ALA C 1 438 ? 14.328  87.979  18.101  1.00 24.61 ? 438 ALA B N   1 
ATOM   8010  C  CA  . ALA C 1 438 ? 13.780  89.156  18.765  1.00 26.70 ? 438 ALA B CA  1 
ATOM   8011  C  C   . ALA C 1 438 ? 13.445  90.277  17.782  1.00 27.74 ? 438 ALA B C   1 
ATOM   8012  O  O   . ALA C 1 438 ? 12.402  90.920  17.897  1.00 29.24 ? 438 ALA B O   1 
ATOM   8013  C  CB  . ALA C 1 438 ? 14.762  89.663  19.819  1.00 25.86 ? 438 ALA B CB  1 
ATOM   8014  N  N   . ARG C 1 439 ? 14.324  90.494  16.810  1.00 28.21 ? 439 ARG B N   1 
ATOM   8015  C  CA  . ARG C 1 439 ? 14.137  91.553  15.822  1.00 29.92 ? 439 ARG B CA  1 
ATOM   8016  C  C   . ARG C 1 439 ? 13.346  91.116  14.589  1.00 28.13 ? 439 ARG B C   1 
ATOM   8017  O  O   . ARG C 1 439 ? 12.551  91.887  14.053  1.00 28.13 ? 439 ARG B O   1 
ATOM   8018  C  CB  . ARG C 1 439 ? 15.504  92.088  15.374  1.00 32.99 ? 439 ARG B CB  1 
ATOM   8019  C  CG  . ARG C 1 439 ? 15.467  93.426  14.639  1.00 41.11 ? 439 ARG B CG  1 
ATOM   8020  C  CD  . ARG C 1 439 ? 15.395  94.594  15.622  1.00 46.30 ? 439 ARG B CD  1 
ATOM   8021  N  NE  . ARG C 1 439 ? 14.149  95.353  15.523  1.00 51.31 ? 439 ARG B NE  1 
ATOM   8022  C  CZ  . ARG C 1 439 ? 14.049  96.569  14.991  1.00 53.48 ? 439 ARG B CZ  1 
ATOM   8023  N  NH1 . ARG C 1 439 ? 15.123  97.176  14.502  1.00 54.85 ? 439 ARG B NH1 1 
ATOM   8024  N  NH2 . ARG C 1 439 ? 12.872  97.183  14.953  1.00 54.92 ? 439 ARG B NH2 1 
ATOM   8025  N  N   . GLU C 1 440 ? 13.558  89.881  14.146  1.00 25.68 ? 440 GLU B N   1 
ATOM   8026  C  CA  . GLU C 1 440 ? 12.891  89.375  12.950  1.00 23.91 ? 440 GLU B CA  1 
ATOM   8027  C  C   . GLU C 1 440 ? 11.701  88.452  13.202  1.00 22.06 ? 440 GLU B C   1 
ATOM   8028  O  O   . GLU C 1 440 ? 11.137  87.904  12.256  1.00 20.97 ? 440 GLU B O   1 
ATOM   8029  C  CB  . GLU C 1 440 ? 13.900  88.636  12.068  1.00 24.77 ? 440 GLU B CB  1 
ATOM   8030  C  CG  . GLU C 1 440 ? 15.160  89.417  11.747  1.00 27.22 ? 440 GLU B CG  1 
ATOM   8031  C  CD  . GLU C 1 440 ? 16.126  88.618  10.889  1.00 29.29 ? 440 GLU B CD  1 
ATOM   8032  O  OE1 . GLU C 1 440 ? 15.778  88.315  9.728   1.00 29.61 ? 440 GLU B OE1 1 
ATOM   8033  O  OE2 . GLU C 1 440 ? 17.230  88.287  11.376  1.00 30.45 ? 440 GLU B OE2 1 
ATOM   8034  N  N   . GLY C 1 441 ? 11.324  88.285  14.466  1.00 21.00 ? 441 GLY B N   1 
ATOM   8035  C  CA  . GLY C 1 441 ? 10.212  87.412  14.815  1.00 20.32 ? 441 GLY B CA  1 
ATOM   8036  C  C   . GLY C 1 441 ? 8.973   87.489  13.938  1.00 20.06 ? 441 GLY B C   1 
ATOM   8037  O  O   . GLY C 1 441 ? 8.564   86.487  13.349  1.00 19.92 ? 441 GLY B O   1 
ATOM   8038  N  N   . ASN C 1 442 ? 8.370   88.671  13.854  1.00 19.88 ? 442 ASN B N   1 
ATOM   8039  C  CA  . ASN C 1 442 ? 7.163   88.870  13.055  1.00 21.07 ? 442 ASN B CA  1 
ATOM   8040  C  C   . ASN C 1 442 ? 7.312   88.532  11.582  1.00 20.49 ? 442 ASN B C   1 
ATOM   8041  O  O   . ASN C 1 442 ? 6.414   87.941  10.979  1.00 19.31 ? 442 ASN B O   1 
ATOM   8042  C  CB  . ASN C 1 442 ? 6.675   90.312  13.184  1.00 23.99 ? 442 ASN B CB  1 
ATOM   8043  C  CG  . ASN C 1 442 ? 5.569   90.457  14.200  1.00 27.91 ? 442 ASN B CG  1 
ATOM   8044  O  OD1 . ASN C 1 442 ? 5.766   90.206  15.385  1.00 30.55 ? 442 ASN B OD1 1 
ATOM   8045  N  ND2 . ASN C 1 442 ? 4.388   90.856  13.737  1.00 32.35 ? 442 ASN B ND2 1 
ATOM   8046  N  N   . THR C 1 443 ? 8.442   88.910  10.998  1.00 19.47 ? 443 THR B N   1 
ATOM   8047  C  CA  . THR C 1 443 ? 8.668   88.642  9.587   1.00 20.24 ? 443 THR B CA  1 
ATOM   8048  C  C   . THR C 1 443 ? 8.823   87.143  9.344   1.00 18.68 ? 443 THR B C   1 
ATOM   8049  O  O   . THR C 1 443 ? 8.380   86.625  8.321   1.00 17.51 ? 443 THR B O   1 
ATOM   8050  C  CB  . THR C 1 443 ? 9.914   89.394  9.074   1.00 21.74 ? 443 THR B CB  1 
ATOM   8051  O  OG1 . THR C 1 443 ? 11.091  88.842  9.674   1.00 28.03 ? 443 THR B OG1 1 
ATOM   8052  C  CG2 . THR C 1 443 ? 9.820   90.874  9.426   1.00 22.62 ? 443 THR B CG2 1 
ATOM   8053  N  N   . ILE C 1 444 ? 9.442   86.449  10.295  1.00 17.47 ? 444 ILE B N   1 
ATOM   8054  C  CA  . ILE C 1 444 ? 9.641   85.008  10.184  1.00 16.37 ? 444 ILE B CA  1 
ATOM   8055  C  C   . ILE C 1 444 ? 8.300   84.280  10.129  1.00 17.19 ? 444 ILE B C   1 
ATOM   8056  O  O   . ILE C 1 444 ? 8.119   83.354  9.334   1.00 18.00 ? 444 ILE B O   1 
ATOM   8057  C  CB  . ILE C 1 444 ? 10.475  84.471  11.376  1.00 15.58 ? 444 ILE B CB  1 
ATOM   8058  C  CG1 . ILE C 1 444 ? 11.928  84.941  11.237  1.00 15.65 ? 444 ILE B CG1 1 
ATOM   8059  C  CG2 . ILE C 1 444 ? 10.395  82.955  11.431  1.00 11.74 ? 444 ILE B CG2 1 
ATOM   8060  C  CD1 . ILE C 1 444 ? 12.790  84.698  12.465  1.00 14.02 ? 444 ILE B CD1 1 
ATOM   8061  N  N   . ILE C 1 445 ? 7.361   84.704  10.973  1.00 16.65 ? 445 ILE B N   1 
ATOM   8062  C  CA  . ILE C 1 445 ? 6.034   84.096  11.002  1.00 14.42 ? 445 ILE B CA  1 
ATOM   8063  C  C   . ILE C 1 445 ? 5.299   84.406  9.697   1.00 16.81 ? 445 ILE B C   1 
ATOM   8064  O  O   . ILE C 1 445 ? 4.667   83.527  9.111   1.00 16.91 ? 445 ILE B O   1 
ATOM   8065  C  CB  . ILE C 1 445 ? 5.189   84.624  12.197  1.00 13.73 ? 445 ILE B CB  1 
ATOM   8066  C  CG1 . ILE C 1 445 ? 5.793   84.147  13.523  1.00 12.82 ? 445 ILE B CG1 1 
ATOM   8067  C  CG2 . ILE C 1 445 ? 3.743   84.167  12.062  1.00 11.65 ? 445 ILE B CG2 1 
ATOM   8068  C  CD1 . ILE C 1 445 ? 5.846   82.630  13.691  1.00 14.51 ? 445 ILE B CD1 1 
ATOM   8069  N  N   . ARG C 1 446 ? 5.387   85.655  9.243   1.00 17.30 ? 446 ARG B N   1 
ATOM   8070  C  CA  . ARG C 1 446 ? 4.730   86.060  8.001   1.00 18.97 ? 446 ARG B CA  1 
ATOM   8071  C  C   . ARG C 1 446 ? 5.225   85.239  6.817   1.00 19.56 ? 446 ARG B C   1 
ATOM   8072  O  O   . ARG C 1 446 ? 4.432   84.813  5.978   1.00 18.95 ? 446 ARG B O   1 
ATOM   8073  C  CB  . ARG C 1 446 ? 4.970   87.545  7.710   1.00 22.24 ? 446 ARG B CB  1 
ATOM   8074  C  CG  . ARG C 1 446 ? 4.376   88.505  8.730   1.00 27.61 ? 446 ARG B CG  1 
ATOM   8075  C  CD  . ARG C 1 446 ? 4.276   89.910  8.145   1.00 33.98 ? 446 ARG B CD  1 
ATOM   8076  N  NE  . ARG C 1 446 ? 3.791   90.892  9.111   1.00 39.14 ? 446 ARG B NE  1 
ATOM   8077  C  CZ  . ARG C 1 446 ? 4.575   91.595  9.925   1.00 42.31 ? 446 ARG B CZ  1 
ATOM   8078  N  NH1 . ARG C 1 446 ? 5.893   91.431  9.891   1.00 43.71 ? 446 ARG B NH1 1 
ATOM   8079  N  NH2 . ARG C 1 446 ? 4.040   92.466  10.771  1.00 43.96 ? 446 ARG B NH2 1 
ATOM   8080  N  N   . GLU C 1 447 ? 6.538   85.018  6.745   1.00 18.43 ? 447 GLU B N   1 
ATOM   8081  C  CA  . GLU C 1 447 ? 7.113   84.240  5.652   1.00 18.25 ? 447 GLU B CA  1 
ATOM   8082  C  C   . GLU C 1 447 ? 6.506   82.842  5.595   1.00 17.55 ? 447 GLU B C   1 
ATOM   8083  O  O   . GLU C 1 447 ? 6.250   82.315  4.515   1.00 17.71 ? 447 GLU B O   1 
ATOM   8084  C  CB  . GLU C 1 447 ? 8.632   84.113  5.809   1.00 19.41 ? 447 GLU B CB  1 
ATOM   8085  C  CG  . GLU C 1 447 ? 9.392   85.431  5.776   1.00 22.40 ? 447 GLU B CG  1 
ATOM   8086  C  CD  . GLU C 1 447 ? 10.889  85.245  5.976   1.00 23.18 ? 447 GLU B CD  1 
ATOM   8087  O  OE1 . GLU C 1 447 ? 11.296  84.189  6.510   1.00 24.52 ? 447 GLU B OE1 1 
ATOM   8088  O  OE2 . GLU C 1 447 ? 11.657  86.159  5.613   1.00 22.81 ? 447 GLU B OE2 1 
ATOM   8089  N  N   . ALA C 1 448 ? 6.282   82.245  6.761   1.00 17.48 ? 448 ALA B N   1 
ATOM   8090  C  CA  . ALA C 1 448 ? 5.720   80.901  6.828   1.00 16.95 ? 448 ALA B CA  1 
ATOM   8091  C  C   . ALA C 1 448 ? 4.247   80.840  6.423   1.00 16.72 ? 448 ALA B C   1 
ATOM   8092  O  O   . ALA C 1 448 ? 3.792   79.821  5.904   1.00 16.90 ? 448 ALA B O   1 
ATOM   8093  C  CB  . ALA C 1 448 ? 5.903   80.328  8.232   1.00 14.45 ? 448 ALA B CB  1 
ATOM   8094  N  N   . THR C 1 449 ? 3.503   81.920  6.653   1.00 16.69 ? 449 THR B N   1 
ATOM   8095  C  CA  . THR C 1 449 ? 2.085   81.931  6.291   1.00 18.14 ? 449 THR B CA  1 
ATOM   8096  C  C   . THR C 1 449 ? 1.888   81.845  4.782   1.00 18.85 ? 449 THR B C   1 
ATOM   8097  O  O   . THR C 1 449 ? 0.802   81.515  4.314   1.00 18.65 ? 449 THR B O   1 
ATOM   8098  C  CB  . THR C 1 449 ? 1.361   83.204  6.783   1.00 17.95 ? 449 THR B CB  1 
ATOM   8099  O  OG1 . THR C 1 449 ? 1.892   84.351  6.109   1.00 18.10 ? 449 THR B OG1 1 
ATOM   8100  C  CG2 . THR C 1 449 ? 1.523   83.365  8.289   1.00 17.24 ? 449 THR B CG2 1 
ATOM   8101  N  N   . LYS C 1 450 ? 2.938   82.140  4.022   1.00 19.87 ? 450 LYS B N   1 
ATOM   8102  C  CA  . LYS C 1 450 ? 2.854   82.092  2.568   1.00 21.68 ? 450 LYS B CA  1 
ATOM   8103  C  C   . LYS C 1 450 ? 2.648   80.681  2.029   1.00 21.17 ? 450 LYS B C   1 
ATOM   8104  O  O   . LYS C 1 450 ? 1.959   80.490  1.028   1.00 21.60 ? 450 LYS B O   1 
ATOM   8105  C  CB  . LYS C 1 450 ? 4.107   82.711  1.941   1.00 24.53 ? 450 LYS B CB  1 
ATOM   8106  C  CG  . LYS C 1 450 ? 4.267   84.183  2.263   1.00 28.83 ? 450 LYS B CG  1 
ATOM   8107  C  CD  . LYS C 1 450 ? 2.984   84.922  1.923   1.00 34.13 ? 450 LYS B CD  1 
ATOM   8108  C  CE  . LYS C 1 450 ? 2.755   86.092  2.857   1.00 36.77 ? 450 LYS B CE  1 
ATOM   8109  N  NZ  . LYS C 1 450 ? 1.309   86.465  2.906   1.00 38.83 ? 450 LYS B NZ  1 
ATOM   8110  N  N   . TRP C 1 451 ? 3.240   79.693  2.691   1.00 19.44 ? 451 TRP B N   1 
ATOM   8111  C  CA  . TRP C 1 451 ? 3.098   78.314  2.244   1.00 18.59 ? 451 TRP B CA  1 
ATOM   8112  C  C   . TRP C 1 451 ? 2.259   77.447  3.175   1.00 17.89 ? 451 TRP B C   1 
ATOM   8113  O  O   . TRP C 1 451 ? 1.971   76.292  2.857   1.00 19.30 ? 451 TRP B O   1 
ATOM   8114  C  CB  . TRP C 1 451 ? 4.475   77.665  2.050   1.00 21.28 ? 451 TRP B CB  1 
ATOM   8115  C  CG  . TRP C 1 451 ? 5.379   77.767  3.239   1.00 23.17 ? 451 TRP B CG  1 
ATOM   8116  C  CD1 . TRP C 1 451 ? 6.284   78.756  3.499   1.00 23.45 ? 451 TRP B CD1 1 
ATOM   8117  C  CD2 . TRP C 1 451 ? 5.463   76.846  4.332   1.00 23.73 ? 451 TRP B CD2 1 
ATOM   8118  N  NE1 . TRP C 1 451 ? 6.931   78.505  4.687   1.00 24.99 ? 451 TRP B NE1 1 
ATOM   8119  C  CE2 . TRP C 1 451 ? 6.447   77.338  5.220   1.00 24.53 ? 451 TRP B CE2 1 
ATOM   8120  C  CE3 . TRP C 1 451 ? 4.805   75.649  4.650   1.00 25.03 ? 451 TRP B CE3 1 
ATOM   8121  C  CZ2 . TRP C 1 451 ? 6.789   76.677  6.405   1.00 24.94 ? 451 TRP B CZ2 1 
ATOM   8122  C  CZ3 . TRP C 1 451 ? 5.146   74.989  5.828   1.00 24.11 ? 451 TRP B CZ3 1 
ATOM   8123  C  CH2 . TRP C 1 451 ? 6.131   75.507  6.690   1.00 25.30 ? 451 TRP B CH2 1 
ATOM   8124  N  N   . SER C 1 452 ? 1.859   77.993  4.318   1.00 14.95 ? 452 SER B N   1 
ATOM   8125  C  CA  . SER C 1 452 ? 1.060   77.226  5.265   1.00 13.23 ? 452 SER B CA  1 
ATOM   8126  C  C   . SER C 1 452 ? -0.289  77.877  5.529   1.00 14.19 ? 452 SER B C   1 
ATOM   8127  O  O   . SER C 1 452 ? -0.399  78.801  6.328   1.00 13.23 ? 452 SER B O   1 
ATOM   8128  C  CB  . SER C 1 452 ? 1.802   77.071  6.591   1.00 14.24 ? 452 SER B CB  1 
ATOM   8129  O  OG  . SER C 1 452 ? 1.023   76.341  7.529   1.00 11.80 ? 452 SER B OG  1 
ATOM   8130  N  N   . PRO C 1 453 ? -1.341  77.417  4.842   1.00 13.13 ? 453 PRO B N   1 
ATOM   8131  C  CA  . PRO C 1 453 ? -2.668  78.001  5.057   1.00 12.13 ? 453 PRO B CA  1 
ATOM   8132  C  C   . PRO C 1 453 ? -3.181  77.809  6.483   1.00 12.39 ? 453 PRO B C   1 
ATOM   8133  O  O   . PRO C 1 453 ? -3.952  78.629  6.978   1.00 11.56 ? 453 PRO B O   1 
ATOM   8134  C  CB  . PRO C 1 453 ? -3.539  77.301  4.004   1.00 12.89 ? 453 PRO B CB  1 
ATOM   8135  C  CG  . PRO C 1 453 ? -2.803  76.063  3.707   1.00 14.40 ? 453 PRO B CG  1 
ATOM   8136  C  CD  . PRO C 1 453 ? -1.367  76.476  3.717   1.00 12.64 ? 453 PRO B CD  1 
ATOM   8137  N  N   . GLU C 1 454 ? -2.746  76.737  7.143   1.00 12.92 ? 454 GLU B N   1 
ATOM   8138  C  CA  . GLU C 1 454 ? -3.159  76.480  8.524   1.00 13.88 ? 454 GLU B CA  1 
ATOM   8139  C  C   . GLU C 1 454 ? -2.635  77.589  9.441   1.00 13.73 ? 454 GLU B C   1 
ATOM   8140  O  O   . GLU C 1 454 ? -3.356  78.087  10.313  1.00 13.93 ? 454 GLU B O   1 
ATOM   8141  C  CB  . GLU C 1 454 ? -2.622  75.130  9.014   1.00 14.75 ? 454 GLU B CB  1 
ATOM   8142  C  CG  . GLU C 1 454 ? -3.266  73.890  8.399   1.00 16.92 ? 454 GLU B CG  1 
ATOM   8143  C  CD  . GLU C 1 454 ? -2.911  73.680  6.936   1.00 19.75 ? 454 GLU B CD  1 
ATOM   8144  O  OE1 . GLU C 1 454 ? -1.802  74.082  6.515   1.00 18.86 ? 454 GLU B OE1 1 
ATOM   8145  O  OE2 . GLU C 1 454 ? -3.741  73.090  6.212   1.00 18.86 ? 454 GLU B OE2 1 
ATOM   8146  N  N   . LEU C 1 455 ? -1.376  77.970  9.239   1.00 13.01 ? 455 LEU B N   1 
ATOM   8147  C  CA  . LEU C 1 455 ? -0.756  79.025  10.036  1.00 12.39 ? 455 LEU B CA  1 
ATOM   8148  C  C   . LEU C 1 455 ? -1.361  80.387  9.698   1.00 11.72 ? 455 LEU B C   1 
ATOM   8149  O  O   . LEU C 1 455 ? -1.573  81.219  10.580  1.00 10.87 ? 455 LEU B O   1 
ATOM   8150  C  CB  . LEU C 1 455 ? 0.757   79.064  9.787   1.00 12.32 ? 455 LEU B CB  1 
ATOM   8151  C  CG  . LEU C 1 455 ? 1.527   80.164  10.524  1.00 13.63 ? 455 LEU B CG  1 
ATOM   8152  C  CD1 . LEU C 1 455 ? 1.363   79.985  12.031  1.00 12.63 ? 455 LEU B CD1 1 
ATOM   8153  C  CD2 . LEU C 1 455 ? 3.001   80.115  10.136  1.00 13.46 ? 455 LEU B CD2 1 
ATOM   8154  N  N   . ALA C 1 456 ? -1.636  80.610  8.416   1.00 12.21 ? 456 ALA B N   1 
ATOM   8155  C  CA  . ALA C 1 456 ? -2.215  81.873  7.975   1.00 10.95 ? 456 ALA B CA  1 
ATOM   8156  C  C   . ALA C 1 456 ? -3.560  82.097  8.653   1.00 11.19 ? 456 ALA B C   1 
ATOM   8157  O  O   . ALA C 1 456 ? -3.860  83.200  9.104   1.00 11.93 ? 456 ALA B O   1 
ATOM   8158  C  CB  . ALA C 1 456 ? -2.382  81.872  6.460   1.00 13.13 ? 456 ALA B CB  1 
ATOM   8159  N  N   . ALA C 1 457 ? -4.370  81.047  8.730   1.00 10.13 ? 457 ALA B N   1 
ATOM   8160  C  CA  . ALA C 1 457 ? -5.678  81.153  9.360   1.00 11.13 ? 457 ALA B CA  1 
ATOM   8161  C  C   . ALA C 1 457 ? -5.538  81.508  10.838  1.00 12.30 ? 457 ALA B C   1 
ATOM   8162  O  O   . ALA C 1 457 ? -6.309  82.305  11.369  1.00 12.36 ? 457 ALA B O   1 
ATOM   8163  C  CB  . ALA C 1 457 ? -6.434  79.848  9.200   1.00 9.78  ? 457 ALA B CB  1 
ATOM   8164  N  N   . ALA C 1 458 ? -4.547  80.922  11.500  1.00 13.25 ? 458 ALA B N   1 
ATOM   8165  C  CA  . ALA C 1 458 ? -4.319  81.184  12.918  1.00 13.72 ? 458 ALA B CA  1 
ATOM   8166  C  C   . ALA C 1 458 ? -3.843  82.616  13.169  1.00 13.89 ? 458 ALA B C   1 
ATOM   8167  O  O   . ALA C 1 458 ? -4.341  83.290  14.065  1.00 13.80 ? 458 ALA B O   1 
ATOM   8168  C  CB  . ALA C 1 458 ? -3.304  80.191  13.476  1.00 12.97 ? 458 ALA B CB  1 
ATOM   8169  N  N   . CYS C 1 459 ? -2.882  83.076  12.374  1.00 14.08 ? 459 CYS B N   1 
ATOM   8170  C  CA  . CYS C 1 459 ? -2.347  84.429  12.526  1.00 15.74 ? 459 CYS B CA  1 
ATOM   8171  C  C   . CYS C 1 459 ? -3.425  85.498  12.400  1.00 17.09 ? 459 CYS B C   1 
ATOM   8172  O  O   . CYS C 1 459 ? -3.400  86.510  13.104  1.00 16.54 ? 459 CYS B O   1 
ATOM   8173  C  CB  . CYS C 1 459 ? -1.266  84.693  11.477  1.00 14.33 ? 459 CYS B CB  1 
ATOM   8174  S  SG  . CYS C 1 459 ? 0.237   83.753  11.731  1.00 15.38 ? 459 CYS B SG  1 
ATOM   8175  N  N   . GLU C 1 460 ? -4.365  85.260  11.493  1.00 19.16 ? 460 GLU B N   1 
ATOM   8176  C  CA  . GLU C 1 460 ? -5.458  86.184  11.229  1.00 21.47 ? 460 GLU B CA  1 
ATOM   8177  C  C   . GLU C 1 460 ? -6.349  86.392  12.449  1.00 20.68 ? 460 GLU B C   1 
ATOM   8178  O  O   . GLU C 1 460 ? -6.759  87.514  12.749  1.00 21.95 ? 460 GLU B O   1 
ATOM   8179  C  CB  . GLU C 1 460 ? -6.293  85.639  10.074  1.00 25.85 ? 460 GLU B CB  1 
ATOM   8180  C  CG  . GLU C 1 460 ? -7.234  86.631  9.429   1.00 34.92 ? 460 GLU B CG  1 
ATOM   8181  C  CD  . GLU C 1 460 ? -8.116  85.973  8.380   1.00 39.69 ? 460 GLU B CD  1 
ATOM   8182  O  OE1 . GLU C 1 460 ? -7.611  85.102  7.634   1.00 43.35 ? 460 GLU B OE1 1 
ATOM   8183  O  OE2 . GLU C 1 460 ? -9.309  86.331  8.297   1.00 42.69 ? 460 GLU B OE2 1 
ATOM   8184  N  N   . VAL C 1 461 ? -6.646  85.301  13.146  1.00 17.78 ? 461 VAL B N   1 
ATOM   8185  C  CA  . VAL C 1 461 ? -7.510  85.340  14.318  1.00 16.62 ? 461 VAL B CA  1 
ATOM   8186  C  C   . VAL C 1 461 ? -6.929  86.028  15.552  1.00 16.60 ? 461 VAL B C   1 
ATOM   8187  O  O   . VAL C 1 461 ? -7.626  86.799  16.215  1.00 16.60 ? 461 VAL B O   1 
ATOM   8188  C  CB  . VAL C 1 461 ? -7.939  83.906  14.726  1.00 16.55 ? 461 VAL B CB  1 
ATOM   8189  C  CG1 . VAL C 1 461 ? -8.751  83.943  16.022  1.00 16.94 ? 461 VAL B CG1 1 
ATOM   8190  C  CG2 . VAL C 1 461 ? -8.749  83.268  13.608  1.00 15.16 ? 461 VAL B CG2 1 
ATOM   8191  N  N   . TRP C 1 462 ? -5.660  85.770  15.857  1.00 14.63 ? 462 TRP B N   1 
ATOM   8192  C  CA  . TRP C 1 462 ? -5.054  86.336  17.058  1.00 14.51 ? 462 TRP B CA  1 
ATOM   8193  C  C   . TRP C 1 462 ? -4.052  87.468  16.864  1.00 17.32 ? 462 TRP B C   1 
ATOM   8194  O  O   . TRP C 1 462 ? -3.322  87.827  17.790  1.00 15.39 ? 462 TRP B O   1 
ATOM   8195  C  CB  . TRP C 1 462 ? -4.412  85.204  17.866  1.00 12.67 ? 462 TRP B CB  1 
ATOM   8196  C  CG  . TRP C 1 462 ? -5.420  84.183  18.324  1.00 11.97 ? 462 TRP B CG  1 
ATOM   8197  C  CD1 . TRP C 1 462 ? -6.530  84.414  19.091  1.00 12.41 ? 462 TRP B CD1 1 
ATOM   8198  C  CD2 . TRP C 1 462 ? -5.421  82.778  18.032  1.00 11.53 ? 462 TRP B CD2 1 
ATOM   8199  N  NE1 . TRP C 1 462 ? -7.223  83.241  19.292  1.00 13.03 ? 462 TRP B NE1 1 
ATOM   8200  C  CE2 . TRP C 1 462 ? -6.565  82.221  18.654  1.00 11.78 ? 462 TRP B CE2 1 
ATOM   8201  C  CE3 . TRP C 1 462 ? -4.567  81.933  17.304  1.00 9.85  ? 462 TRP B CE3 1 
ATOM   8202  C  CZ2 . TRP C 1 462 ? -6.877  80.857  18.573  1.00 10.55 ? 462 TRP B CZ2 1 
ATOM   8203  C  CZ3 . TRP C 1 462 ? -4.877  80.573  17.222  1.00 9.10  ? 462 TRP B CZ3 1 
ATOM   8204  C  CH2 . TRP C 1 462 ? -6.023  80.051  17.855  1.00 9.65  ? 462 TRP B CH2 1 
ATOM   8205  N  N   . LYS C 1 463 ? -4.042  88.037  15.667  1.00 19.94 ? 463 LYS B N   1 
ATOM   8206  C  CA  . LYS C 1 463 ? -3.143  89.127  15.305  1.00 25.90 ? 463 LYS B CA  1 
ATOM   8207  C  C   . LYS C 1 463 ? -3.021  90.275  16.313  1.00 27.97 ? 463 LYS B C   1 
ATOM   8208  O  O   . LYS C 1 463 ? -1.916  90.733  16.604  1.00 29.76 ? 463 LYS B O   1 
ATOM   8209  C  CB  . LYS C 1 463 ? -3.580  89.698  13.956  1.00 28.20 ? 463 LYS B CB  1 
ATOM   8210  C  CG  . LYS C 1 463 ? -2.691  90.794  13.396  1.00 32.74 ? 463 LYS B CG  1 
ATOM   8211  C  CD  . LYS C 1 463 ? -3.350  91.434  12.179  1.00 37.98 ? 463 LYS B CD  1 
ATOM   8212  C  CE  . LYS C 1 463 ? -3.730  90.384  11.137  1.00 40.47 ? 463 LYS B CE  1 
ATOM   8213  N  NZ  . LYS C 1 463 ? -4.499  90.965  10.001  1.00 43.31 ? 463 LYS B NZ  1 
ATOM   8214  N  N   . GLU C 1 464 ? -4.148  90.738  16.842  1.00 30.02 ? 464 GLU B N   1 
ATOM   8215  C  CA  . GLU C 1 464 ? -4.152  91.863  17.780  1.00 32.74 ? 464 GLU B CA  1 
ATOM   8216  C  C   . GLU C 1 464 ? -4.137  91.516  19.264  1.00 31.92 ? 464 GLU B C   1 
ATOM   8217  O  O   . GLU C 1 464 ? -4.165  92.412  20.108  1.00 32.20 ? 464 GLU B O   1 
ATOM   8218  C  CB  . GLU C 1 464 ? -5.374  92.737  17.511  1.00 35.80 ? 464 GLU B CB  1 
ATOM   8219  C  CG  . GLU C 1 464 ? -5.469  93.227  16.089  1.00 40.21 ? 464 GLU B CG  1 
ATOM   8220  C  CD  . GLU C 1 464 ? -4.437  94.287  15.766  1.00 43.09 ? 464 GLU B CD  1 
ATOM   8221  O  OE1 . GLU C 1 464 ? -4.397  95.323  16.467  1.00 45.02 ? 464 GLU B OE1 1 
ATOM   8222  O  OE2 . GLU C 1 464 ? -3.670  94.085  14.802  1.00 45.54 ? 464 GLU B OE2 1 
ATOM   8223  N  N   . ILE C 1 465 ? -4.079  90.230  19.587  1.00 30.38 ? 465 ILE B N   1 
ATOM   8224  C  CA  . ILE C 1 465 ? -4.115  89.804  20.982  1.00 28.93 ? 465 ILE B CA  1 
ATOM   8225  C  C   . ILE C 1 465 ? -2.795  89.786  21.758  1.00 27.62 ? 465 ILE B C   1 
ATOM   8226  O  O   . ILE C 1 465 ? -1.890  89.010  21.454  1.00 26.69 ? 465 ILE B O   1 
ATOM   8227  C  CB  . ILE C 1 465 ? -4.762  88.401  21.096  1.00 29.07 ? 465 ILE B CB  1 
ATOM   8228  C  CG1 . ILE C 1 465 ? -6.117  88.396  20.378  1.00 28.54 ? 465 ILE B CG1 1 
ATOM   8229  C  CG2 . ILE C 1 465 ? -4.918  88.012  22.565  1.00 28.41 ? 465 ILE B CG2 1 
ATOM   8230  C  CD1 . ILE C 1 465 ? -7.103  89.433  20.891  1.00 26.36 ? 465 ILE B CD1 1 
ATOM   8231  N  N   . LYS C 1 466 ? -2.705  90.647  22.770  1.00 27.84 ? 466 LYS B N   1 
ATOM   8232  C  CA  . LYS C 1 466 ? -1.529  90.714  23.640  1.00 28.01 ? 466 LYS B CA  1 
ATOM   8233  C  C   . LYS C 1 466 ? -2.006  90.893  25.078  1.00 26.30 ? 466 LYS B C   1 
ATOM   8234  O  O   . LYS C 1 466 ? -3.124  91.348  25.319  1.00 25.89 ? 466 LYS B O   1 
ATOM   8235  C  CB  . LYS C 1 466 ? -0.612  91.891  23.296  1.00 29.93 ? 466 LYS B CB  1 
ATOM   8236  C  CG  . LYS C 1 466 ? -0.870  92.583  21.976  1.00 34.27 ? 466 LYS B CG  1 
ATOM   8237  C  CD  . LYS C 1 466 ? 0.169   93.682  21.755  1.00 37.12 ? 466 LYS B CD  1 
ATOM   8238  C  CE  . LYS C 1 466 ? 0.151   94.724  22.874  1.00 39.81 ? 466 LYS B CE  1 
ATOM   8239  N  NZ  . LYS C 1 466 ? -1.077  95.575  22.856  1.00 42.75 ? 466 LYS B NZ  1 
ATOM   8240  N  N   . PHE C 1 467 ? -1.148  90.542  26.027  1.00 23.77 ? 467 PHE B N   1 
ATOM   8241  C  CA  . PHE C 1 467 ? -1.465  90.663  27.442  1.00 24.45 ? 467 PHE B CA  1 
ATOM   8242  C  C   . PHE C 1 467 ? -0.405  91.525  28.100  1.00 25.25 ? 467 PHE B C   1 
ATOM   8243  O  O   . PHE C 1 467 ? 0.663   91.037  28.465  1.00 24.93 ? 467 PHE B O   1 
ATOM   8244  C  CB  . PHE C 1 467 ? -1.489  89.280  28.090  1.00 22.46 ? 467 PHE B CB  1 
ATOM   8245  C  CG  . PHE C 1 467 ? -2.580  88.397  27.573  1.00 20.51 ? 467 PHE B CG  1 
ATOM   8246  C  CD1 . PHE C 1 467 ? -3.880  88.522  28.056  1.00 19.66 ? 467 PHE B CD1 1 
ATOM   8247  C  CD2 . PHE C 1 467 ? -2.320  87.469  26.568  1.00 19.75 ? 467 PHE B CD2 1 
ATOM   8248  C  CE1 . PHE C 1 467 ? -4.909  87.732  27.545  1.00 20.12 ? 467 PHE B CE1 1 
ATOM   8249  C  CE2 . PHE C 1 467 ? -3.341  86.672  26.048  1.00 21.80 ? 467 PHE B CE2 1 
ATOM   8250  C  CZ  . PHE C 1 467 ? -4.642  86.806  26.536  1.00 20.05 ? 467 PHE B CZ  1 
ATOM   8251  N  N   . GLU C 1 468 ? -0.704  92.810  28.243  1.00 27.23 ? 468 GLU B N   1 
ATOM   8252  C  CA  . GLU C 1 468 ? 0.237   93.741  28.840  1.00 29.71 ? 468 GLU B CA  1 
ATOM   8253  C  C   . GLU C 1 468 ? -0.348  94.506  30.021  1.00 30.24 ? 468 GLU B C   1 
ATOM   8254  O  O   . GLU C 1 468 ? -1.180  95.400  29.860  1.00 30.36 ? 468 GLU B O   1 
ATOM   8255  C  CB  . GLU C 1 468 ? 0.756   94.697  27.764  1.00 32.16 ? 468 GLU B CB  1 
ATOM   8256  C  CG  . GLU C 1 468 ? 1.802   94.045  26.865  1.00 36.79 ? 468 GLU B CG  1 
ATOM   8257  C  CD  . GLU C 1 468 ? 2.153   94.873  25.641  1.00 40.42 ? 468 GLU B CD  1 
ATOM   8258  O  OE1 . GLU C 1 468 ? 1.979   96.111  25.683  1.00 41.86 ? 468 GLU B OE1 1 
ATOM   8259  O  OE2 . GLU C 1 468 ? 2.616   94.281  24.640  1.00 41.33 ? 468 GLU B OE2 1 
ATOM   8260  N  N   . PHE C 1 469 ? 0.105   94.128  31.212  1.00 30.67 ? 469 PHE B N   1 
ATOM   8261  C  CA  . PHE C 1 469 ? -0.330  94.726  32.469  1.00 31.04 ? 469 PHE B CA  1 
ATOM   8262  C  C   . PHE C 1 469 ? 0.883   94.884  33.385  1.00 32.27 ? 469 PHE B C   1 
ATOM   8263  O  O   . PHE C 1 469 ? 1.903   94.220  33.193  1.00 32.59 ? 469 PHE B O   1 
ATOM   8264  C  CB  . PHE C 1 469 ? -1.345  93.812  33.162  1.00 29.98 ? 469 PHE B CB  1 
ATOM   8265  C  CG  . PHE C 1 469 ? -2.672  93.729  32.471  1.00 27.49 ? 469 PHE B CG  1 
ATOM   8266  C  CD1 . PHE C 1 469 ? -3.635  94.713  32.666  1.00 26.43 ? 469 PHE B CD1 1 
ATOM   8267  C  CD2 . PHE C 1 469 ? -2.973  92.650  31.647  1.00 27.94 ? 469 PHE B CD2 1 
ATOM   8268  C  CE1 . PHE C 1 469 ? -4.880  94.622  32.055  1.00 25.35 ? 469 PHE B CE1 1 
ATOM   8269  C  CE2 . PHE C 1 469 ? -4.217  92.548  31.029  1.00 27.61 ? 469 PHE B CE2 1 
ATOM   8270  C  CZ  . PHE C 1 469 ? -5.173  93.537  31.235  1.00 26.29 ? 469 PHE B CZ  1 
ATOM   8271  N  N   . PRO C 1 470 ? 0.788   95.771  34.391  1.00 32.93 ? 470 PRO B N   1 
ATOM   8272  C  CA  . PRO C 1 470 ? 1.896   95.985  35.330  1.00 33.13 ? 470 PRO B CA  1 
ATOM   8273  C  C   . PRO C 1 470 ? 2.064   94.744  36.207  1.00 34.31 ? 470 PRO B C   1 
ATOM   8274  O  O   . PRO C 1 470 ? 1.077   94.155  36.649  1.00 34.59 ? 470 PRO B O   1 
ATOM   8275  C  CB  . PRO C 1 470 ? 1.436   97.200  36.131  1.00 33.43 ? 470 PRO B CB  1 
ATOM   8276  C  CG  . PRO C 1 470 ? 0.590   97.951  35.146  1.00 33.19 ? 470 PRO B CG  1 
ATOM   8277  C  CD  . PRO C 1 470 ? -0.217  96.840  34.521  1.00 33.56 ? 470 PRO B CD  1 
ATOM   8278  N  N   . ALA C 1 471 ? 3.308   94.348  36.460  1.00 34.84 ? 471 ALA B N   1 
ATOM   8279  C  CA  . ALA C 1 471 ? 3.576   93.165  37.275  1.00 35.51 ? 471 ALA B CA  1 
ATOM   8280  C  C   . ALA C 1 471 ? 3.655   93.465  38.769  1.00 36.12 ? 471 ALA B C   1 
ATOM   8281  O  O   . ALA C 1 471 ? 4.127   94.524  39.175  1.00 36.13 ? 471 ALA B O   1 
ATOM   8282  C  CB  . ALA C 1 471 ? 4.862   92.503  36.816  1.00 34.79 ? 471 ALA B CB  1 
ATOM   8283  N  N   . MET C 1 472 ? 3.198   92.516  39.582  1.00 36.87 ? 472 MET B N   1 
ATOM   8284  C  CA  . MET C 1 472 ? 3.210   92.661  41.038  1.00 38.52 ? 472 MET B CA  1 
ATOM   8285  C  C   . MET C 1 472 ? 4.527   92.138  41.581  1.00 39.93 ? 472 MET B C   1 
ATOM   8286  O  O   . MET C 1 472 ? 5.150   92.764  42.457  1.00 39.98 ? 472 MET B O   1 
ATOM   8287  C  CB  . MET C 1 472 ? 2.073   91.864  41.668  1.00 37.86 ? 472 MET B CB  1 
ATOM   8288  C  CG  . MET C 1 472 ? 0.673   92.250  41.229  1.00 37.22 ? 472 MET B CG  1 
ATOM   8289  S  SD  . MET C 1 472 ? 0.235   93.964  41.578  1.00 37.21 ? 472 MET B SD  1 
ATOM   8290  C  CE  . MET C 1 472 ? 0.347   94.668  39.931  1.00 35.25 ? 472 MET B CE  1 
ATOM   8291  N  N   . ASP C 1 473 ? 4.908   90.960  41.079  1.00 41.73 ? 473 ASP B N   1 
ATOM   8292  C  CA  . ASP C 1 473 ? 6.171   90.318  41.443  1.00 43.26 ? 473 ASP B CA  1 
ATOM   8293  C  C   . ASP C 1 473 ? 7.422   90.875  40.702  1.00 44.65 ? 473 ASP B C   1 
ATOM   8294  O  O   . ASP C 1 473 ? 7.749   90.482  39.569  1.00 44.79 ? 473 ASP B O   1 
ATOM   8295  C  CB  . ASP C 1 473 ? 6.040   88.789  41.287  1.00 43.19 ? 473 ASP B CB  1 
ATOM   8296  C  CG  . ASP C 1 473 ? 7.278   88.060  41.764  1.00 43.11 ? 473 ASP B CG  1 
ATOM   8297  O  OD1 . ASP C 1 473 ? 7.739   88.338  42.896  1.00 41.92 ? 473 ASP B OD1 1 
ATOM   8298  O  OD2 . ASP C 1 473 ? 7.805   87.228  40.998  1.00 42.60 ? 473 ASP B OD2 1 
ATOM   8299  N  N   . THR C 1 474 ? 8.096   91.820  41.350  1.00 46.11 ? 474 THR B N   1 
ATOM   8300  C  CA  . THR C 1 474 ? 9.257   92.430  40.746  1.00 47.33 ? 474 THR B CA  1 
ATOM   8301  C  C   . THR C 1 474 ? 10.441  92.294  41.702  1.00 47.83 ? 474 THR B C   1 
ATOM   8302  O  O   . THR C 1 474 ? 10.261  92.339  42.914  1.00 47.53 ? 474 THR B O   1 
ATOM   8303  C  CB  . THR C 1 474 ? 8.947   93.931  40.406  1.00 47.72 ? 474 THR B CB  1 
ATOM   8304  O  OG1 . THR C 1 474 ? 8.949   94.130  38.979  1.00 48.52 ? 474 THR B OG1 1 
ATOM   8305  C  CG2 . THR C 1 474 ? 9.982   94.850  41.051  1.00 48.27 ? 474 THR B CG2 1 
ATOM   8306  N  N   . VAL C 1 475 ? 11.651  92.164  41.161  1.00 48.31 ? 475 VAL B N   1 
ATOM   8307  C  CA  . VAL C 1 475 ? 12.846  92.013  41.996  1.00 49.26 ? 475 VAL B CA  1 
ATOM   8308  C  C   . VAL C 1 475 ? 13.054  93.150  42.996  1.00 49.66 ? 475 VAL B C   1 
ATOM   8309  O  O   . VAL C 1 475 ? 12.749  94.309  42.644  1.00 50.19 ? 475 VAL B O   1 
ATOM   8310  C  CB  . VAL C 1 475 ? 14.129  91.852  41.120  1.00 49.60 ? 475 VAL B CB  1 
ATOM   8311  C  CG1 . VAL C 1 475 ? 13.812  92.188  39.669  1.00 49.97 ? 475 VAL B CG1 1 
ATOM   8312  C  CG2 . VAL C 1 475 ? 15.253  92.743  41.631  1.00 49.59 ? 475 VAL B CG2 1 
ATOM   8313  O  OXT . VAL C 1 475 ? 13.530  92.861  44.118  1.00 48.80 ? 475 VAL B OXT 1 
HETATM 8314  N  N   . MME D 2 1   ? -11.998 76.014  4.624   1.00 23.41 ? 1   MME T N   1 
HETATM 8315  C  CA  . MME D 2 1   ? -11.631 75.127  5.722   1.00 23.10 ? 1   MME T CA  1 
HETATM 8316  C  C   . MME D 2 1   ? -11.009 73.844  5.168   1.00 22.64 ? 1   MME T C   1 
HETATM 8317  O  O   . MME D 2 1   ? -11.693 73.040  4.547   1.00 23.03 ? 1   MME T O   1 
HETATM 8318  C  CB  . MME D 2 1   ? -12.872 74.786  6.553   1.00 24.45 ? 1   MME T CB  1 
HETATM 8319  C  CG  . MME D 2 1   ? -12.575 74.164  7.904   1.00 26.71 ? 1   MME T CG  1 
HETATM 8320  S  SD  . MME D 2 1   ? -14.067 73.756  8.839   1.00 31.41 ? 1   MME T SD  1 
HETATM 8321  C  CE  . MME D 2 1   ? -14.488 75.317  9.558   1.00 30.11 ? 1   MME T CE  1 
HETATM 8322  C  CM  . MME D 2 1   ? -11.077 76.595  3.862   1.00 22.81 ? 1   MME T CM  1 
ATOM   8323  N  N   . LYS D 2 2   ? -9.709  73.667  5.390   1.00 22.06 ? 2   LYS T N   1 
ATOM   8324  C  CA  . LYS D 2 2   ? -8.987  72.479  4.925   1.00 20.32 ? 2   LYS T CA  1 
ATOM   8325  C  C   . LYS D 2 2   ? -8.927  71.355  5.953   1.00 19.12 ? 2   LYS T C   1 
ATOM   8326  O  O   . LYS D 2 2   ? -8.745  71.602  7.147   1.00 16.60 ? 2   LYS T O   1 
ATOM   8327  C  CB  . LYS D 2 2   ? -7.546  72.827  4.550   1.00 24.10 ? 2   LYS T CB  1 
ATOM   8328  C  CG  . LYS D 2 2   ? -7.385  73.450  3.190   1.00 29.59 ? 2   LYS T CG  1 
ATOM   8329  C  CD  . LYS D 2 2   ? -5.916  73.377  2.773   1.00 34.50 ? 2   LYS T CD  1 
ATOM   8330  C  CE  . LYS D 2 2   ? -5.679  73.758  1.307   1.00 38.26 ? 2   LYS T CE  1 
ATOM   8331  N  NZ  . LYS D 2 2   ? -4.242  73.542  0.907   1.00 41.37 ? 2   LYS T NZ  1 
ATOM   8332  N  N   . VAL D 2 3   ? -9.063  70.120  5.479   1.00 17.21 ? 3   VAL T N   1 
ATOM   8333  C  CA  . VAL D 2 3   ? -8.986  68.946  6.347   1.00 16.42 ? 3   VAL T CA  1 
ATOM   8334  C  C   . VAL D 2 3   ? -7.568  68.380  6.223   1.00 15.42 ? 3   VAL T C   1 
ATOM   8335  O  O   . VAL D 2 3   ? -7.094  68.121  5.117   1.00 15.74 ? 3   VAL T O   1 
ATOM   8336  C  CB  . VAL D 2 3   ? -9.997  67.860  5.920   1.00 16.06 ? 3   VAL T CB  1 
ATOM   8337  C  CG1 . VAL D 2 3   ? -9.916  66.664  6.856   1.00 15.24 ? 3   VAL T CG1 1 
ATOM   8338  C  CG2 . VAL D 2 3   ? -11.401 68.439  5.922   1.00 16.64 ? 3   VAL T CG2 1 
ATOM   8339  N  N   . TRP D 2 4   ? -6.892  68.203  7.354   1.00 15.61 ? 4   TRP T N   1 
ATOM   8340  C  CA  . TRP D 2 4   ? -5.525  67.686  7.361   1.00 15.27 ? 4   TRP T CA  1 
ATOM   8341  C  C   . TRP D 2 4   ? -5.523  66.220  6.925   1.00 15.56 ? 4   TRP T C   1 
ATOM   8342  O  O   . TRP D 2 4   ? -6.211  65.389  7.513   1.00 16.56 ? 4   TRP T O   1 
ATOM   8343  C  CB  . TRP D 2 4   ? -4.921  67.838  8.764   1.00 15.14 ? 4   TRP T CB  1 
ATOM   8344  C  CG  . TRP D 2 4   ? -3.445  67.569  8.838   1.00 14.40 ? 4   TRP T CG  1 
ATOM   8345  C  CD1 . TRP D 2 4   ? -2.828  66.540  9.493   1.00 14.23 ? 4   TRP T CD1 1 
ATOM   8346  C  CD2 . TRP D 2 4   ? -2.401  68.347  8.237   1.00 14.28 ? 4   TRP T CD2 1 
ATOM   8347  N  NE1 . TRP D 2 4   ? -1.463  66.631  9.338   1.00 14.54 ? 4   TRP T NE1 1 
ATOM   8348  C  CE2 . TRP D 2 4   ? -1.175  67.729  8.570   1.00 14.76 ? 4   TRP T CE2 1 
ATOM   8349  C  CE3 . TRP D 2 4   ? -2.384  69.506  7.447   1.00 14.25 ? 4   TRP T CE3 1 
ATOM   8350  C  CZ2 . TRP D 2 4   ? 0.061   68.235  8.144   1.00 16.23 ? 4   TRP T CZ2 1 
ATOM   8351  C  CZ3 . TRP D 2 4   ? -1.156  70.011  7.023   1.00 15.66 ? 4   TRP T CZ3 1 
ATOM   8352  C  CH2 . TRP D 2 4   ? 0.051   69.371  7.372   1.00 15.30 ? 4   TRP T CH2 1 
ATOM   8353  N  N   . PRO D 2 5   ? -4.742  65.888  5.883   1.00 16.64 ? 5   PRO T N   1 
ATOM   8354  C  CA  . PRO D 2 5   ? -4.629  64.530  5.332   1.00 16.25 ? 5   PRO T CA  1 
ATOM   8355  C  C   . PRO D 2 5   ? -4.259  63.459  6.357   1.00 16.49 ? 5   PRO T C   1 
ATOM   8356  O  O   . PRO D 2 5   ? -3.571  63.739  7.338   1.00 15.84 ? 5   PRO T O   1 
ATOM   8357  C  CB  . PRO D 2 5   ? -3.552  64.682  4.256   1.00 15.75 ? 5   PRO T CB  1 
ATOM   8358  C  CG  . PRO D 2 5   ? -3.682  66.110  3.839   1.00 15.35 ? 5   PRO T CG  1 
ATOM   8359  C  CD  . PRO D 2 5   ? -3.858  66.816  5.155   1.00 16.29 ? 5   PRO T CD  1 
ATOM   8360  N  N   . THR D 2 6   ? -4.710  62.230  6.108   1.00 18.26 ? 6   THR T N   1 
ATOM   8361  C  CA  . THR D 2 6   ? -4.432  61.099  6.995   1.00 17.37 ? 6   THR T CA  1 
ATOM   8362  C  C   . THR D 2 6   ? -3.578  60.032  6.320   1.00 18.74 ? 6   THR T C   1 
ATOM   8363  O  O   . THR D 2 6   ? -2.958  59.209  6.993   1.00 19.17 ? 6   THR T O   1 
ATOM   8364  C  CB  . THR D 2 6   ? -5.727  60.391  7.452   1.00 16.52 ? 6   THR T CB  1 
ATOM   8365  O  OG1 . THR D 2 6   ? -6.476  59.992  6.298   1.00 15.64 ? 6   THR T OG1 1 
ATOM   8366  C  CG2 . THR D 2 6   ? -6.567  61.302  8.339   1.00 14.18 ? 6   THR T CG2 1 
ATOM   8367  N  N   . GLN D 2 7   ? -3.555  60.040  4.992   1.00 20.31 ? 7   GLN T N   1 
ATOM   8368  C  CA  . GLN D 2 7   ? -2.804  59.044  4.238   1.00 22.86 ? 7   GLN T CA  1 
ATOM   8369  C  C   . GLN D 2 7   ? -1.404  59.467  3.828   1.00 21.93 ? 7   GLN T C   1 
ATOM   8370  O  O   . GLN D 2 7   ? -1.201  60.557  3.297   1.00 20.92 ? 7   GLN T O   1 
ATOM   8371  C  CB  . GLN D 2 7   ? -3.587  58.645  2.994   1.00 26.49 ? 7   GLN T CB  1 
ATOM   8372  C  CG  . GLN D 2 7   ? -4.896  57.957  3.300   1.00 30.16 ? 7   GLN T CG  1 
ATOM   8373  C  CD  . GLN D 2 7   ? -5.720  57.733  2.057   1.00 33.69 ? 7   GLN T CD  1 
ATOM   8374  O  OE1 . GLN D 2 7   ? -6.169  58.686  1.413   1.00 35.72 ? 7   GLN T OE1 1 
ATOM   8375  N  NE2 . GLN D 2 7   ? -5.918  56.471  1.702   1.00 34.50 ? 7   GLN T NE2 1 
ATOM   8376  N  N   . ASN D 2 8   ? -0.448  58.576  4.069   1.00 23.48 ? 8   ASN T N   1 
ATOM   8377  C  CA  . ASN D 2 8   ? 0.952   58.806  3.741   1.00 25.06 ? 8   ASN T CA  1 
ATOM   8378  C  C   . ASN D 2 8   ? 1.403   60.177  4.208   1.00 24.06 ? 8   ASN T C   1 
ATOM   8379  O  O   . ASN D 2 8   ? 1.909   60.981  3.427   1.00 23.73 ? 8   ASN T O   1 
ATOM   8380  C  CB  . ASN D 2 8   ? 1.176   58.641  2.232   1.00 28.14 ? 8   ASN T CB  1 
ATOM   8381  C  CG  . ASN D 2 8   ? 0.825   57.241  1.750   1.00 31.96 ? 8   ASN T CG  1 
ATOM   8382  O  OD1 . ASN D 2 8   ? 1.091   56.256  2.443   1.00 34.28 ? 8   ASN T OD1 1 
ATOM   8383  N  ND2 . ASN D 2 8   ? 0.233   57.144  0.562   1.00 33.02 ? 8   ASN T ND2 1 
ATOM   8384  N  N   . MET D 2 9   ? 1.210   60.423  5.500   1.00 23.51 ? 9   MET T N   1 
ATOM   8385  C  CA  . MET D 2 9   ? 1.577   61.682  6.129   1.00 23.04 ? 9   MET T CA  1 
ATOM   8386  C  C   . MET D 2 9   ? 2.591   61.460  7.249   1.00 21.17 ? 9   MET T C   1 
ATOM   8387  O  O   . MET D 2 9   ? 2.655   62.237  8.197   1.00 20.59 ? 9   MET T O   1 
ATOM   8388  C  CB  . MET D 2 9   ? 0.328   62.355  6.694   1.00 24.52 ? 9   MET T CB  1 
ATOM   8389  C  CG  . MET D 2 9   ? -0.595  62.920  5.629   1.00 26.34 ? 9   MET T CG  1 
ATOM   8390  S  SD  . MET D 2 9   ? 0.194   64.273  4.748   1.00 27.54 ? 9   MET T SD  1 
ATOM   8391  C  CE  . MET D 2 9   ? 0.384   65.453  6.083   1.00 28.17 ? 9   MET T CE  1 
ATOM   8392  N  N   . LYS D 2 10  ? 3.375   60.392  7.143   1.00 19.98 ? 10  LYS T N   1 
ATOM   8393  C  CA  . LYS D 2 10  ? 4.379   60.092  8.156   1.00 18.92 ? 10  LYS T CA  1 
ATOM   8394  C  C   . LYS D 2 10  ? 5.315   61.287  8.320   1.00 17.18 ? 10  LYS T C   1 
ATOM   8395  O  O   . LYS D 2 10  ? 5.606   61.990  7.355   1.00 16.85 ? 10  LYS T O   1 
ATOM   8396  C  CB  . LYS D 2 10  ? 5.178   58.848  7.754   1.00 20.62 ? 10  LYS T CB  1 
ATOM   8397  C  CG  . LYS D 2 10  ? 4.390   57.549  7.823   1.00 23.02 ? 10  LYS T CG  1 
ATOM   8398  C  CD  . LYS D 2 10  ? 4.168   57.115  9.261   1.00 24.45 ? 10  LYS T CD  1 
ATOM   8399  C  CE  . LYS D 2 10  ? 3.357   55.826  9.344   1.00 27.95 ? 10  LYS T CE  1 
ATOM   8400  N  NZ  . LYS D 2 10  ? 1.941   56.031  8.928   1.00 26.72 ? 10  LYS T NZ  1 
ATOM   8401  N  N   . ARG D 2 11  ? 5.772   61.522  9.544   1.00 15.29 ? 11  ARG T N   1 
ATOM   8402  C  CA  . ARG D 2 11  ? 6.666   62.639  9.813   1.00 14.36 ? 11  ARG T CA  1 
ATOM   8403  C  C   . ARG D 2 11  ? 7.998   62.151  10.366  1.00 14.92 ? 11  ARG T C   1 
ATOM   8404  O  O   . ARG D 2 11  ? 8.134   60.982  10.729  1.00 16.40 ? 11  ARG T O   1 
ATOM   8405  C  CB  . ARG D 2 11  ? 5.993   63.628  10.764  1.00 15.68 ? 11  ARG T CB  1 
ATOM   8406  C  CG  . ARG D 2 11  ? 4.900   64.456  10.084  1.00 16.85 ? 11  ARG T CG  1 
ATOM   8407  C  CD  . ARG D 2 11  ? 5.491   65.258  8.927   1.00 20.44 ? 11  ARG T CD  1 
ATOM   8408  N  NE  . ARG D 2 11  ? 4.534   66.162  8.296   1.00 24.52 ? 11  ARG T NE  1 
ATOM   8409  C  CZ  . ARG D 2 11  ? 4.092   66.035  7.048   1.00 25.61 ? 11  ARG T CZ  1 
ATOM   8410  N  NH1 . ARG D 2 11  ? 4.518   65.036  6.290   1.00 26.40 ? 11  ARG T NH1 1 
ATOM   8411  N  NH2 . ARG D 2 11  ? 3.233   66.916  6.553   1.00 27.64 ? 11  ARG T NH2 1 
ATOM   8412  N  N   . TYR D 2 12  ? 8.978   63.047  10.440  1.00 13.93 ? 12  TYR T N   1 
ATOM   8413  C  CA  . TYR D 2 12  ? 10.310  62.660  10.887  1.00 13.14 ? 12  TYR T CA  1 
ATOM   8414  C  C   . TYR D 2 12  ? 10.903  63.574  11.956  1.00 12.24 ? 12  TYR T C   1 
ATOM   8415  O  O   . TYR D 2 12  ? 12.103  63.843  11.959  1.00 11.75 ? 12  TYR T O   1 
ATOM   8416  C  CB  . TYR D 2 12  ? 11.223  62.617  9.660   1.00 15.07 ? 12  TYR T CB  1 
ATOM   8417  C  CG  . TYR D 2 12  ? 10.639  61.788  8.537   1.00 14.72 ? 12  TYR T CG  1 
ATOM   8418  C  CD1 . TYR D 2 12  ? 10.872  60.419  8.466   1.00 15.79 ? 12  TYR T CD1 1 
ATOM   8419  C  CD2 . TYR D 2 12  ? 9.797   62.364  7.581   1.00 16.49 ? 12  TYR T CD2 1 
ATOM   8420  C  CE1 . TYR D 2 12  ? 10.283  59.636  7.474   1.00 16.50 ? 12  TYR T CE1 1 
ATOM   8421  C  CE2 . TYR D 2 12  ? 9.199   61.588  6.584   1.00 16.95 ? 12  TYR T CE2 1 
ATOM   8422  C  CZ  . TYR D 2 12  ? 9.450   60.225  6.540   1.00 17.58 ? 12  TYR T CZ  1 
ATOM   8423  O  OH  . TYR D 2 12  ? 8.867   59.447  5.567   1.00 20.15 ? 12  TYR T OH  1 
ATOM   8424  N  N   . GLU D 2 13  ? 10.057  64.038  12.866  1.00 11.87 ? 13  GLU T N   1 
ATOM   8425  C  CA  . GLU D 2 13  ? 10.488  64.924  13.937  1.00 11.76 ? 13  GLU T CA  1 
ATOM   8426  C  C   . GLU D 2 13  ? 10.980  66.287  13.437  1.00 12.29 ? 13  GLU T C   1 
ATOM   8427  O  O   . GLU D 2 13  ? 10.564  66.748  12.377  1.00 11.88 ? 13  GLU T O   1 
ATOM   8428  C  CB  . GLU D 2 13  ? 11.551  64.236  14.804  1.00 11.93 ? 13  GLU T CB  1 
ATOM   8429  C  CG  . GLU D 2 13  ? 10.988  63.150  15.738  1.00 9.98  ? 13  GLU T CG  1 
ATOM   8430  C  CD  . GLU D 2 13  ? 9.924   63.682  16.703  1.00 12.23 ? 13  GLU T CD  1 
ATOM   8431  O  OE1 . GLU D 2 13  ? 9.915   64.900  16.978  1.00 11.69 ? 13  GLU T OE1 1 
ATOM   8432  O  OE2 . GLU D 2 13  ? 9.100   62.880  17.202  1.00 11.53 ? 13  GLU T OE2 1 
ATOM   8433  N  N   . THR D 2 14  ? 11.867  66.921  14.199  1.00 12.90 ? 14  THR T N   1 
ATOM   8434  C  CA  . THR D 2 14  ? 12.358  68.263  13.882  1.00 13.10 ? 14  THR T CA  1 
ATOM   8435  C  C   . THR D 2 14  ? 12.650  68.622  12.426  1.00 12.77 ? 14  THR T C   1 
ATOM   8436  O  O   . THR D 2 14  ? 13.490  68.001  11.773  1.00 11.71 ? 14  THR T O   1 
ATOM   8437  C  CB  . THR D 2 14  ? 13.598  68.604  14.720  1.00 13.71 ? 14  THR T CB  1 
ATOM   8438  O  OG1 . THR D 2 14  ? 13.320  68.346  16.102  1.00 14.27 ? 14  THR T OG1 1 
ATOM   8439  C  CG2 . THR D 2 14  ? 13.957  70.084  14.560  1.00 13.83 ? 14  THR T CG2 1 
ATOM   8440  N  N   . LEU D 2 15  ? 11.942  69.653  11.958  1.00 11.63 ? 15  LEU T N   1 
ATOM   8441  C  CA  . LEU D 2 15  ? 12.046  70.210  10.604  1.00 13.73 ? 15  LEU T CA  1 
ATOM   8442  C  C   . LEU D 2 15  ? 11.187  69.534  9.535   1.00 14.66 ? 15  LEU T C   1 
ATOM   8443  O  O   . LEU D 2 15  ? 11.069  70.051  8.419   1.00 13.91 ? 15  LEU T O   1 
ATOM   8444  C  CB  . LEU D 2 15  ? 13.508  70.225  10.127  1.00 14.33 ? 15  LEU T CB  1 
ATOM   8445  C  CG  . LEU D 2 15  ? 14.523  71.042  10.935  1.00 15.58 ? 15  LEU T CG  1 
ATOM   8446  C  CD1 . LEU D 2 15  ? 15.864  71.063  10.198  1.00 13.79 ? 15  LEU T CD1 1 
ATOM   8447  C  CD2 . LEU D 2 15  ? 14.006  72.462  11.137  1.00 14.68 ? 15  LEU T CD2 1 
ATOM   8448  N  N   . SER D 2 16  ? 10.569  68.402  9.869   1.00 13.67 ? 16  SER T N   1 
ATOM   8449  C  CA  . SER D 2 16  ? 9.760   67.676  8.891   1.00 13.84 ? 16  SER T CA  1 
ATOM   8450  C  C   . SER D 2 16  ? 8.414   68.298  8.505   1.00 13.66 ? 16  SER T C   1 
ATOM   8451  O  O   . SER D 2 16  ? 7.732   67.779  7.623   1.00 14.63 ? 16  SER T O   1 
ATOM   8452  C  CB  . SER D 2 16  ? 9.544   66.229  9.353   1.00 13.31 ? 16  SER T CB  1 
ATOM   8453  O  OG  . SER D 2 16  ? 8.833   66.173  10.574  1.00 14.37 ? 16  SER T OG  1 
ATOM   8454  N  N   . TYR D 2 17  ? 8.019   69.393  9.152   1.00 13.06 ? 17  TYR T N   1 
ATOM   8455  C  CA  . TYR D 2 17  ? 6.756   70.043  8.801   1.00 12.62 ? 17  TYR T CA  1 
ATOM   8456  C  C   . TYR D 2 17  ? 7.000   71.256  7.922   1.00 13.13 ? 17  TYR T C   1 
ATOM   8457  O  O   . TYR D 2 17  ? 6.065   71.956  7.537   1.00 14.50 ? 17  TYR T O   1 
ATOM   8458  C  CB  . TYR D 2 17  ? 5.979   70.469  10.047  1.00 12.74 ? 17  TYR T CB  1 
ATOM   8459  C  CG  . TYR D 2 17  ? 5.162   69.352  10.651  1.00 13.03 ? 17  TYR T CG  1 
ATOM   8460  C  CD1 . TYR D 2 17  ? 5.777   68.297  11.322  1.00 13.37 ? 17  TYR T CD1 1 
ATOM   8461  C  CD2 . TYR D 2 17  ? 3.771   69.344  10.539  1.00 12.89 ? 17  TYR T CD2 1 
ATOM   8462  C  CE1 . TYR D 2 17  ? 5.030   67.262  11.874  1.00 13.96 ? 17  TYR T CE1 1 
ATOM   8463  C  CE2 . TYR D 2 17  ? 3.011   68.307  11.086  1.00 14.39 ? 17  TYR T CE2 1 
ATOM   8464  C  CZ  . TYR D 2 17  ? 3.650   67.273  11.753  1.00 14.06 ? 17  TYR T CZ  1 
ATOM   8465  O  OH  . TYR D 2 17  ? 2.914   66.257  12.318  1.00 14.49 ? 17  TYR T OH  1 
ATOM   8466  N  N   . LEU D 2 18  ? 8.268   71.510  7.626   1.00 13.25 ? 18  LEU T N   1 
ATOM   8467  C  CA  . LEU D 2 18  ? 8.646   72.626  6.776   1.00 13.89 ? 18  LEU T CA  1 
ATOM   8468  C  C   . LEU D 2 18  ? 8.844   72.069  5.375   1.00 14.69 ? 18  LEU T C   1 
ATOM   8469  O  O   . LEU D 2 18  ? 8.871   70.852  5.185   1.00 15.91 ? 18  LEU T O   1 
ATOM   8470  C  CB  . LEU D 2 18  ? 9.964   73.238  7.255   1.00 12.96 ? 18  LEU T CB  1 
ATOM   8471  C  CG  . LEU D 2 18  ? 10.047  73.794  8.676   1.00 12.17 ? 18  LEU T CG  1 
ATOM   8472  C  CD1 . LEU D 2 18  ? 11.470  74.260  8.942   1.00 11.31 ? 18  LEU T CD1 1 
ATOM   8473  C  CD2 . LEU D 2 18  ? 9.061   74.937  8.845   1.00 11.89 ? 18  LEU T CD2 1 
ATOM   8474  N  N   . PRO D 2 19  ? 8.966   72.949  4.371   1.00 14.55 ? 19  PRO T N   1 
ATOM   8475  C  CA  . PRO D 2 19  ? 9.171   72.468  3.001   1.00 16.19 ? 19  PRO T CA  1 
ATOM   8476  C  C   . PRO D 2 19  ? 10.525  71.753  2.941   1.00 17.53 ? 19  PRO T C   1 
ATOM   8477  O  O   . PRO D 2 19  ? 11.419  72.051  3.733   1.00 18.52 ? 19  PRO T O   1 
ATOM   8478  C  CB  . PRO D 2 19  ? 9.157   73.756  2.181   1.00 16.21 ? 19  PRO T CB  1 
ATOM   8479  C  CG  . PRO D 2 19  ? 8.236   74.653  2.976   1.00 15.95 ? 19  PRO T CG  1 
ATOM   8480  C  CD  . PRO D 2 19  ? 8.701   74.399  4.390   1.00 15.17 ? 19  PRO T CD  1 
ATOM   8481  N  N   . PRO D 2 20  ? 10.695  70.805  2.007   1.00 19.39 ? 20  PRO T N   1 
ATOM   8482  C  CA  . PRO D 2 20  ? 11.967  70.081  1.896   1.00 19.68 ? 20  PRO T CA  1 
ATOM   8483  C  C   . PRO D 2 20  ? 13.172  71.025  1.893   1.00 20.85 ? 20  PRO T C   1 
ATOM   8484  O  O   . PRO D 2 20  ? 13.154  72.064  1.234   1.00 20.53 ? 20  PRO T O   1 
ATOM   8485  C  CB  . PRO D 2 20  ? 11.818  69.328  0.577   1.00 20.29 ? 20  PRO T CB  1 
ATOM   8486  C  CG  . PRO D 2 20  ? 10.349  69.051  0.523   1.00 21.11 ? 20  PRO T CG  1 
ATOM   8487  C  CD  . PRO D 2 20  ? 9.752   70.375  0.960   1.00 20.21 ? 20  PRO T CD  1 
ATOM   8488  N  N   . LEU D 2 21  ? 14.216  70.662  2.633   1.00 20.92 ? 21  LEU T N   1 
ATOM   8489  C  CA  . LEU D 2 21  ? 15.417  71.486  2.709   1.00 22.50 ? 21  LEU T CA  1 
ATOM   8490  C  C   . LEU D 2 21  ? 16.185  71.498  1.400   1.00 22.92 ? 21  LEU T C   1 
ATOM   8491  O  O   . LEU D 2 21  ? 16.407  70.453  0.791   1.00 23.35 ? 21  LEU T O   1 
ATOM   8492  C  CB  . LEU D 2 21  ? 16.354  70.977  3.803   1.00 23.09 ? 21  LEU T CB  1 
ATOM   8493  C  CG  . LEU D 2 21  ? 15.892  71.014  5.257   1.00 23.41 ? 21  LEU T CG  1 
ATOM   8494  C  CD1 . LEU D 2 21  ? 17.010  70.486  6.139   1.00 24.51 ? 21  LEU T CD1 1 
ATOM   8495  C  CD2 . LEU D 2 21  ? 15.525  72.432  5.651   1.00 24.14 ? 21  LEU T CD2 1 
ATOM   8496  N  N   . THR D 2 22  ? 16.588  72.685  0.964   1.00 23.45 ? 22  THR T N   1 
ATOM   8497  C  CA  . THR D 2 22  ? 17.367  72.796  -0.257  1.00 24.30 ? 22  THR T CA  1 
ATOM   8498  C  C   . THR D 2 22  ? 18.800  72.474  0.133   1.00 24.78 ? 22  THR T C   1 
ATOM   8499  O  O   . THR D 2 22  ? 19.104  72.292  1.314   1.00 25.05 ? 22  THR T O   1 
ATOM   8500  C  CB  . THR D 2 22  ? 17.339  74.219  -0.831  1.00 24.82 ? 22  THR T CB  1 
ATOM   8501  O  OG1 . THR D 2 22  ? 17.914  75.123  0.119   1.00 23.25 ? 22  THR T OG1 1 
ATOM   8502  C  CG2 . THR D 2 22  ? 15.908  74.642  -1.142  1.00 25.87 ? 22  THR T CG2 1 
ATOM   8503  N  N   . THR D 2 23  ? 19.678  72.407  -0.857  1.00 25.47 ? 23  THR T N   1 
ATOM   8504  C  CA  . THR D 2 23  ? 21.081  72.111  -0.618  1.00 26.16 ? 23  THR T CA  1 
ATOM   8505  C  C   . THR D 2 23  ? 21.748  73.142  0.291   1.00 24.64 ? 23  THR T C   1 
ATOM   8506  O  O   . THR D 2 23  ? 22.574  72.789  1.133   1.00 24.66 ? 23  THR T O   1 
ATOM   8507  C  CB  . THR D 2 23  ? 21.842  72.013  -1.963  1.00 28.05 ? 23  THR T CB  1 
ATOM   8508  O  OG1 . THR D 2 23  ? 21.716  70.681  -2.475  1.00 30.80 ? 23  THR T OG1 1 
ATOM   8509  C  CG2 . THR D 2 23  ? 23.317  72.366  -1.795  1.00 31.07 ? 23  THR T CG2 1 
ATOM   8510  N  N   . ASP D 2 24  ? 21.387  74.411  0.131   1.00 23.65 ? 24  ASP T N   1 
ATOM   8511  C  CA  . ASP D 2 24  ? 21.976  75.461  0.954   1.00 23.22 ? 24  ASP T CA  1 
ATOM   8512  C  C   . ASP D 2 24  ? 21.411  75.485  2.376   1.00 23.11 ? 24  ASP T C   1 
ATOM   8513  O  O   . ASP D 2 24  ? 22.126  75.803  3.325   1.00 22.69 ? 24  ASP T O   1 
ATOM   8514  C  CB  . ASP D 2 24  ? 21.782  76.832  0.302   1.00 24.33 ? 24  ASP T CB  1 
ATOM   8515  C  CG  . ASP D 2 24  ? 22.533  76.972  -1.011  1.00 25.74 ? 24  ASP T CG  1 
ATOM   8516  O  OD1 . ASP D 2 24  ? 23.656  76.439  -1.115  1.00 26.95 ? 24  ASP T OD1 1 
ATOM   8517  O  OD2 . ASP D 2 24  ? 22.010  77.631  -1.934  1.00 25.93 ? 24  ASP T OD2 1 
ATOM   8518  N  N   . GLN D 2 25  ? 20.132  75.155  2.523   1.00 22.98 ? 25  GLN T N   1 
ATOM   8519  C  CA  . GLN D 2 25  ? 19.506  75.141  3.840   1.00 21.46 ? 25  GLN T CA  1 
ATOM   8520  C  C   . GLN D 2 25  ? 20.093  74.001  4.660   1.00 20.63 ? 25  GLN T C   1 
ATOM   8521  O  O   . GLN D 2 25  ? 20.309  74.135  5.864   1.00 21.77 ? 25  GLN T O   1 
ATOM   8522  C  CB  . GLN D 2 25  ? 17.989  74.968  3.709   1.00 20.95 ? 25  GLN T CB  1 
ATOM   8523  C  CG  . GLN D 2 25  ? 17.306  76.100  2.962   1.00 21.26 ? 25  GLN T CG  1 
ATOM   8524  C  CD  . GLN D 2 25  ? 15.804  75.914  2.855   1.00 23.12 ? 25  GLN T CD  1 
ATOM   8525  O  OE1 . GLN D 2 25  ? 15.325  74.879  2.389   1.00 23.26 ? 25  GLN T OE1 1 
ATOM   8526  N  NE2 . GLN D 2 25  ? 15.052  76.925  3.278   1.00 23.55 ? 25  GLN T NE2 1 
ATOM   8527  N  N   . LEU D 2 26  ? 20.350  72.878  3.997   1.00 19.20 ? 26  LEU T N   1 
ATOM   8528  C  CA  . LEU D 2 26  ? 20.929  71.717  4.658   1.00 19.81 ? 26  LEU T CA  1 
ATOM   8529  C  C   . LEU D 2 26  ? 22.314  72.085  5.182   1.00 19.19 ? 26  LEU T C   1 
ATOM   8530  O  O   . LEU D 2 26  ? 22.661  71.780  6.321   1.00 18.48 ? 26  LEU T O   1 
ATOM   8531  C  CB  . LEU D 2 26  ? 21.043  70.552  3.672   1.00 21.43 ? 26  LEU T CB  1 
ATOM   8532  C  CG  . LEU D 2 26  ? 21.726  69.278  4.175   1.00 23.26 ? 26  LEU T CG  1 
ATOM   8533  C  CD1 . LEU D 2 26  ? 20.854  68.604  5.219   1.00 24.77 ? 26  LEU T CD1 1 
ATOM   8534  C  CD2 . LEU D 2 26  ? 21.971  68.340  3.005   1.00 24.83 ? 26  LEU T CD2 1 
ATOM   8535  N  N   . ALA D 2 27  ? 23.101  72.747  4.338   1.00 19.56 ? 27  ALA T N   1 
ATOM   8536  C  CA  . ALA D 2 27  ? 24.451  73.164  4.701   1.00 19.06 ? 27  ALA T CA  1 
ATOM   8537  C  C   . ALA D 2 27  ? 24.434  74.121  5.892   1.00 19.11 ? 27  ALA T C   1 
ATOM   8538  O  O   . ALA D 2 27  ? 25.329  74.089  6.739   1.00 17.82 ? 27  ALA T O   1 
ATOM   8539  C  CB  . ALA D 2 27  ? 25.131  73.831  3.504   1.00 19.06 ? 27  ALA T CB  1 
ATOM   8540  N  N   . ARG D 2 28  ? 23.417  74.976  5.955   1.00 18.44 ? 28  ARG T N   1 
ATOM   8541  C  CA  . ARG D 2 28  ? 23.307  75.929  7.052   1.00 19.79 ? 28  ARG T CA  1 
ATOM   8542  C  C   . ARG D 2 28  ? 23.009  75.237  8.377   1.00 18.07 ? 28  ARG T C   1 
ATOM   8543  O  O   . ARG D 2 28  ? 23.444  75.696  9.432   1.00 17.27 ? 28  ARG T O   1 
ATOM   8544  C  CB  . ARG D 2 28  ? 22.232  76.979  6.744   1.00 23.96 ? 28  ARG T CB  1 
ATOM   8545  C  CG  . ARG D 2 28  ? 22.798  78.280  6.186   1.00 30.09 ? 28  ARG T CG  1 
ATOM   8546  C  CD  . ARG D 2 28  ? 22.095  78.702  4.906   1.00 36.14 ? 28  ARG T CD  1 
ATOM   8547  N  NE  . ARG D 2 28  ? 22.540  80.013  4.433   1.00 41.22 ? 28  ARG T NE  1 
ATOM   8548  C  CZ  . ARG D 2 28  ? 23.800  80.321  4.139   1.00 44.44 ? 28  ARG T CZ  1 
ATOM   8549  N  NH1 . ARG D 2 28  ? 24.757  79.410  4.268   1.00 46.44 ? 28  ARG T NH1 1 
ATOM   8550  N  NH2 . ARG D 2 28  ? 24.108  81.541  3.714   1.00 44.70 ? 28  ARG T NH2 1 
ATOM   8551  N  N   . GLN D 2 29  ? 22.266  74.135  8.326   1.00 16.18 ? 29  GLN T N   1 
ATOM   8552  C  CA  . GLN D 2 29  ? 21.948  73.397  9.541   1.00 15.46 ? 29  GLN T CA  1 
ATOM   8553  C  C   . GLN D 2 29  ? 23.211  72.714  10.058  1.00 15.72 ? 29  GLN T C   1 
ATOM   8554  O  O   . GLN D 2 29  ? 23.430  72.635  11.266  1.00 14.86 ? 29  GLN T O   1 
ATOM   8555  C  CB  . GLN D 2 29  ? 20.865  72.347  9.274   1.00 15.25 ? 29  GLN T CB  1 
ATOM   8556  C  CG  . GLN D 2 29  ? 19.476  72.918  8.995   1.00 15.14 ? 29  GLN T CG  1 
ATOM   8557  C  CD  . GLN D 2 29  ? 18.966  73.803  10.123  1.00 15.31 ? 29  GLN T CD  1 
ATOM   8558  O  OE1 . GLN D 2 29  ? 19.068  73.450  11.296  1.00 14.68 ? 29  GLN T OE1 1 
ATOM   8559  N  NE2 . GLN D 2 29  ? 18.404  74.953  9.768   1.00 12.97 ? 29  GLN T NE2 1 
ATOM   8560  N  N   . VAL D 2 30  ? 24.040  72.225  9.137   1.00 15.27 ? 30  VAL T N   1 
ATOM   8561  C  CA  . VAL D 2 30  ? 25.286  71.561  9.509   1.00 16.08 ? 30  VAL T CA  1 
ATOM   8562  C  C   . VAL D 2 30  ? 26.253  72.574  10.116  1.00 17.46 ? 30  VAL T C   1 
ATOM   8563  O  O   . VAL D 2 30  ? 26.955  72.265  11.078  1.00 17.40 ? 30  VAL T O   1 
ATOM   8564  C  CB  . VAL D 2 30  ? 25.957  70.893  8.289   1.00 15.37 ? 30  VAL T CB  1 
ATOM   8565  C  CG1 . VAL D 2 30  ? 27.291  70.276  8.697   1.00 12.84 ? 30  VAL T CG1 1 
ATOM   8566  C  CG2 . VAL D 2 30  ? 25.036  69.827  7.714   1.00 14.57 ? 30  VAL T CG2 1 
ATOM   8567  N  N   . ASP D 2 31  ? 26.287  73.780  9.551   1.00 19.51 ? 31  ASP T N   1 
ATOM   8568  C  CA  . ASP D 2 31  ? 27.163  74.837  10.056  1.00 19.64 ? 31  ASP T CA  1 
ATOM   8569  C  C   . ASP D 2 31  ? 26.750  75.213  11.467  1.00 18.99 ? 31  ASP T C   1 
ATOM   8570  O  O   . ASP D 2 31  ? 27.590  75.515  12.313  1.00 16.79 ? 31  ASP T O   1 
ATOM   8571  C  CB  . ASP D 2 31  ? 27.091  76.085  9.171   1.00 24.71 ? 31  ASP T CB  1 
ATOM   8572  C  CG  . ASP D 2 31  ? 27.837  75.916  7.866   1.00 30.16 ? 31  ASP T CG  1 
ATOM   8573  O  OD1 . ASP D 2 31  ? 28.875  75.220  7.867   1.00 33.31 ? 31  ASP T OD1 1 
ATOM   8574  O  OD2 . ASP D 2 31  ? 27.398  76.491  6.845   1.00 33.89 ? 31  ASP T OD2 1 
ATOM   8575  N  N   . TYR D 2 32  ? 25.444  75.202  11.707  1.00 18.23 ? 32  TYR T N   1 
ATOM   8576  C  CA  . TYR D 2 32  ? 24.894  75.526  13.014  1.00 17.80 ? 32  TYR T CA  1 
ATOM   8577  C  C   . TYR D 2 32  ? 25.396  74.534  14.056  1.00 17.34 ? 32  TYR T C   1 
ATOM   8578  O  O   . TYR D 2 32  ? 25.831  74.922  15.140  1.00 17.82 ? 32  TYR T O   1 
ATOM   8579  C  CB  . TYR D 2 32  ? 23.365  75.484  12.951  1.00 18.95 ? 32  TYR T CB  1 
ATOM   8580  C  CG  . TYR D 2 32  ? 22.684  75.496  14.302  1.00 20.57 ? 32  TYR T CG  1 
ATOM   8581  C  CD1 . TYR D 2 32  ? 22.663  76.648  15.087  1.00 19.41 ? 32  TYR T CD1 1 
ATOM   8582  C  CD2 . TYR D 2 32  ? 22.061  74.348  14.794  1.00 20.77 ? 32  TYR T CD2 1 
ATOM   8583  C  CE1 . TYR D 2 32  ? 22.038  76.654  16.334  1.00 22.88 ? 32  TYR T CE1 1 
ATOM   8584  C  CE2 . TYR D 2 32  ? 21.436  74.342  16.037  1.00 21.64 ? 32  TYR T CE2 1 
ATOM   8585  C  CZ  . TYR D 2 32  ? 21.425  75.496  16.799  1.00 22.66 ? 32  TYR T CZ  1 
ATOM   8586  O  OH  . TYR D 2 32  ? 20.799  75.492  18.022  1.00 25.43 ? 32  TYR T OH  1 
ATOM   8587  N  N   . LEU D 2 33  ? 25.341  73.249  13.723  1.00 17.25 ? 33  LEU T N   1 
ATOM   8588  C  CA  . LEU D 2 33  ? 25.783  72.226  14.657  1.00 17.43 ? 33  LEU T CA  1 
ATOM   8589  C  C   . LEU D 2 33  ? 27.296  72.272  14.881  1.00 18.17 ? 33  LEU T C   1 
ATOM   8590  O  O   . LEU D 2 33  ? 27.776  71.966  15.974  1.00 18.21 ? 33  LEU T O   1 
ATOM   8591  C  CB  . LEU D 2 33  ? 25.314  70.844  14.170  1.00 17.42 ? 33  LEU T CB  1 
ATOM   8592  C  CG  . LEU D 2 33  ? 26.226  69.694  13.737  1.00 17.90 ? 33  LEU T CG  1 
ATOM   8593  C  CD1 . LEU D 2 33  ? 27.134  69.256  14.869  1.00 18.20 ? 33  LEU T CD1 1 
ATOM   8594  C  CD2 . LEU D 2 33  ? 25.346  68.525  13.305  1.00 18.01 ? 33  LEU T CD2 1 
ATOM   8595  N  N   . LEU D 2 34  ? 28.052  72.669  13.861  1.00 18.60 ? 34  LEU T N   1 
ATOM   8596  C  CA  . LEU D 2 34  ? 29.501  72.753  14.009  1.00 21.07 ? 34  LEU T CA  1 
ATOM   8597  C  C   . LEU D 2 34  ? 29.913  74.002  14.789  1.00 21.71 ? 34  LEU T C   1 
ATOM   8598  O  O   . LEU D 2 34  ? 30.833  73.952  15.604  1.00 21.63 ? 34  LEU T O   1 
ATOM   8599  C  CB  . LEU D 2 34  ? 30.196  72.746  12.643  1.00 22.08 ? 34  LEU T CB  1 
ATOM   8600  C  CG  . LEU D 2 34  ? 30.247  71.411  11.893  1.00 23.18 ? 34  LEU T CG  1 
ATOM   8601  C  CD1 . LEU D 2 34  ? 31.037  71.584  10.604  1.00 23.40 ? 34  LEU T CD1 1 
ATOM   8602  C  CD2 . LEU D 2 34  ? 30.897  70.347  12.769  1.00 23.38 ? 34  LEU T CD2 1 
ATOM   8603  N  N   . ASN D 2 35  ? 29.228  75.117  14.553  1.00 22.25 ? 35  ASN T N   1 
ATOM   8604  C  CA  . ASN D 2 35  ? 29.562  76.348  15.259  1.00 22.84 ? 35  ASN T CA  1 
ATOM   8605  C  C   . ASN D 2 35  ? 29.298  76.242  16.752  1.00 22.05 ? 35  ASN T C   1 
ATOM   8606  O  O   . ASN D 2 35  ? 29.855  76.999  17.542  1.00 21.65 ? 35  ASN T O   1 
ATOM   8607  C  CB  . ASN D 2 35  ? 28.788  77.535  14.682  1.00 25.84 ? 35  ASN T CB  1 
ATOM   8608  C  CG  . ASN D 2 35  ? 29.274  77.922  13.300  1.00 28.99 ? 35  ASN T CG  1 
ATOM   8609  O  OD1 . ASN D 2 35  ? 30.449  77.738  12.971  1.00 29.51 ? 35  ASN T OD1 1 
ATOM   8610  N  ND2 . ASN D 2 35  ? 28.378  78.475  12.487  1.00 31.90 ? 35  ASN T ND2 1 
ATOM   8611  N  N   . ASN D 2 36  ? 28.443  75.301  17.138  1.00 20.65 ? 36  ASN T N   1 
ATOM   8612  C  CA  . ASN D 2 36  ? 28.129  75.096  18.543  1.00 20.67 ? 36  ASN T CA  1 
ATOM   8613  C  C   . ASN D 2 36  ? 29.046  74.040  19.149  1.00 21.29 ? 36  ASN T C   1 
ATOM   8614  O  O   . ASN D 2 36  ? 28.850  73.605  20.285  1.00 21.84 ? 36  ASN T O   1 
ATOM   8615  C  CB  . ASN D 2 36  ? 26.664  74.688  18.695  1.00 21.35 ? 36  ASN T CB  1 
ATOM   8616  C  CG  . ASN D 2 36  ? 25.731  75.877  18.636  1.00 21.21 ? 36  ASN T CG  1 
ATOM   8617  O  OD1 . ASN D 2 36  ? 25.567  76.595  19.620  1.00 23.04 ? 36  ASN T OD1 1 
ATOM   8618  N  ND2 . ASN D 2 36  ? 25.130  76.105  17.475  1.00 20.95 ? 36  ASN T ND2 1 
ATOM   8619  N  N   . LYS D 2 37  ? 30.047  73.637  18.373  1.00 21.14 ? 37  LYS T N   1 
ATOM   8620  C  CA  . LYS D 2 37  ? 31.026  72.642  18.799  1.00 22.14 ? 37  LYS T CA  1 
ATOM   8621  C  C   . LYS D 2 37  ? 30.447  71.279  19.138  1.00 21.02 ? 37  LYS T C   1 
ATOM   8622  O  O   . LYS D 2 37  ? 30.989  70.555  19.976  1.00 21.01 ? 37  LYS T O   1 
ATOM   8623  C  CB  . LYS D 2 37  ? 31.830  73.160  19.994  1.00 24.84 ? 37  LYS T CB  1 
ATOM   8624  C  CG  . LYS D 2 37  ? 32.642  74.407  19.685  1.00 29.84 ? 37  LYS T CG  1 
ATOM   8625  C  CD  . LYS D 2 37  ? 33.470  74.222  18.423  1.00 34.77 ? 37  LYS T CD  1 
ATOM   8626  C  CE  . LYS D 2 37  ? 34.263  75.479  18.101  1.00 37.50 ? 37  LYS T CE  1 
ATOM   8627  N  NZ  . LYS D 2 37  ? 33.386  76.685  18.110  1.00 38.94 ? 37  LYS T NZ  1 
ATOM   8628  N  N   . TRP D 2 38  ? 29.342  70.923  18.496  1.00 18.41 ? 38  TRP T N   1 
ATOM   8629  C  CA  . TRP D 2 38  ? 28.757  69.617  18.740  1.00 16.27 ? 38  TRP T CA  1 
ATOM   8630  C  C   . TRP D 2 38  ? 29.398  68.647  17.761  1.00 15.51 ? 38  TRP T C   1 
ATOM   8631  O  O   . TRP D 2 38  ? 29.904  69.053  16.714  1.00 16.55 ? 38  TRP T O   1 
ATOM   8632  C  CB  . TRP D 2 38  ? 27.236  69.662  18.568  1.00 14.35 ? 38  TRP T CB  1 
ATOM   8633  C  CG  . TRP D 2 38  ? 26.584  70.551  19.579  1.00 13.77 ? 38  TRP T CG  1 
ATOM   8634  C  CD1 . TRP D 2 38  ? 26.960  70.718  20.882  1.00 13.82 ? 38  TRP T CD1 1 
ATOM   8635  C  CD2 . TRP D 2 38  ? 25.441  71.391  19.382  1.00 14.08 ? 38  TRP T CD2 1 
ATOM   8636  N  NE1 . TRP D 2 38  ? 26.125  71.612  21.508  1.00 13.22 ? 38  TRP T NE1 1 
ATOM   8637  C  CE2 . TRP D 2 38  ? 25.182  72.041  20.611  1.00 13.44 ? 38  TRP T CE2 1 
ATOM   8638  C  CE3 . TRP D 2 38  ? 24.609  71.661  18.287  1.00 14.35 ? 38  TRP T CE3 1 
ATOM   8639  C  CZ2 . TRP D 2 38  ? 24.125  72.942  20.777  1.00 14.81 ? 38  TRP T CZ2 1 
ATOM   8640  C  CZ3 . TRP D 2 38  ? 23.554  72.560  18.452  1.00 13.64 ? 38  TRP T CZ3 1 
ATOM   8641  C  CH2 . TRP D 2 38  ? 23.324  73.188  19.689  1.00 14.99 ? 38  TRP T CH2 1 
ATOM   8642  N  N   . VAL D 2 39  ? 29.399  67.368  18.115  1.00 15.93 ? 39  VAL T N   1 
ATOM   8643  C  CA  . VAL D 2 39  ? 30.001  66.348  17.271  1.00 14.41 ? 39  VAL T CA  1 
ATOM   8644  C  C   . VAL D 2 39  ? 28.996  65.722  16.313  1.00 14.07 ? 39  VAL T C   1 
ATOM   8645  O  O   . VAL D 2 39  ? 28.005  65.125  16.737  1.00 13.83 ? 39  VAL T O   1 
ATOM   8646  C  CB  . VAL D 2 39  ? 30.633  65.231  18.125  1.00 14.64 ? 39  VAL T CB  1 
ATOM   8647  C  CG1 . VAL D 2 39  ? 31.320  64.213  17.229  1.00 13.74 ? 39  VAL T CG1 1 
ATOM   8648  C  CG2 . VAL D 2 39  ? 31.623  65.832  19.105  1.00 13.11 ? 39  VAL T CG2 1 
ATOM   8649  N  N   . PRO D 2 40  ? 29.245  65.850  15.000  1.00 13.38 ? 40  PRO T N   1 
ATOM   8650  C  CA  . PRO D 2 40  ? 28.361  65.293  13.972  1.00 11.84 ? 40  PRO T CA  1 
ATOM   8651  C  C   . PRO D 2 40  ? 28.462  63.774  13.833  1.00 12.00 ? 40  PRO T C   1 
ATOM   8652  O  O   . PRO D 2 40  ? 29.519  63.180  14.054  1.00 11.95 ? 40  PRO T O   1 
ATOM   8653  C  CB  . PRO D 2 40  ? 28.809  66.022  12.709  1.00 12.59 ? 40  PRO T CB  1 
ATOM   8654  C  CG  . PRO D 2 40  ? 30.282  66.197  12.942  1.00 13.19 ? 40  PRO T CG  1 
ATOM   8655  C  CD  . PRO D 2 40  ? 30.337  66.632  14.389  1.00 11.97 ? 40  PRO T CD  1 
ATOM   8656  N  N   . CYS D 2 41  ? 27.348  63.147  13.476  1.00 11.24 ? 41  CYS T N   1 
ATOM   8657  C  CA  . CYS D 2 41  ? 27.315  61.703  13.289  1.00 13.54 ? 41  CYS T CA  1 
ATOM   8658  C  C   . CYS D 2 41  ? 26.131  61.336  12.403  1.00 13.87 ? 41  CYS T C   1 
ATOM   8659  O  O   . CYS D 2 41  ? 25.067  61.955  12.490  1.00 14.79 ? 41  CYS T O   1 
ATOM   8660  C  CB  . CYS D 2 41  ? 27.194  60.986  14.637  1.00 13.90 ? 41  CYS T CB  1 
ATOM   8661  S  SG  . CYS D 2 41  ? 27.347  59.176  14.523  1.00 16.92 ? 41  CYS T SG  1 
ATOM   8662  N  N   . LEU D 2 42  ? 26.324  60.345  11.537  1.00 13.76 ? 42  LEU T N   1 
ATOM   8663  C  CA  . LEU D 2 42  ? 25.260  59.892  10.644  1.00 13.47 ? 42  LEU T CA  1 
ATOM   8664  C  C   . LEU D 2 42  ? 24.710  58.542  11.084  1.00 12.52 ? 42  LEU T C   1 
ATOM   8665  O  O   . LEU D 2 42  ? 25.456  57.688  11.571  1.00 12.75 ? 42  LEU T O   1 
ATOM   8666  C  CB  . LEU D 2 42  ? 25.770  59.771  9.202   1.00 14.21 ? 42  LEU T CB  1 
ATOM   8667  C  CG  . LEU D 2 42  ? 25.839  61.005  8.297   1.00 16.53 ? 42  LEU T CG  1 
ATOM   8668  C  CD1 . LEU D 2 42  ? 26.747  62.061  8.893   1.00 17.44 ? 42  LEU T CD1 1 
ATOM   8669  C  CD2 . LEU D 2 42  ? 26.347  60.576  6.930   1.00 17.94 ? 42  LEU T CD2 1 
ATOM   8670  N  N   . GLU D 2 43  ? 23.403  58.362  10.910  1.00 11.66 ? 43  GLU T N   1 
ATOM   8671  C  CA  . GLU D 2 43  ? 22.731  57.112  11.255  1.00 12.02 ? 43  GLU T CA  1 
ATOM   8672  C  C   . GLU D 2 43  ? 21.803  56.726  10.104  1.00 12.57 ? 43  GLU T C   1 
ATOM   8673  O  O   . GLU D 2 43  ? 21.227  57.594  9.445   1.00 13.44 ? 43  GLU T O   1 
ATOM   8674  C  CB  . GLU D 2 43  ? 21.902  57.265  12.534  1.00 11.60 ? 43  GLU T CB  1 
ATOM   8675  C  CG  . GLU D 2 43  ? 22.667  57.745  13.749  1.00 10.53 ? 43  GLU T CG  1 
ATOM   8676  C  CD  . GLU D 2 43  ? 21.840  57.634  15.013  1.00 11.91 ? 43  GLU T CD  1 
ATOM   8677  O  OE1 . GLU D 2 43  ? 20.684  58.111  15.012  1.00 12.52 ? 43  GLU T OE1 1 
ATOM   8678  O  OE2 . GLU D 2 43  ? 22.343  57.071  16.008  1.00 13.82 ? 43  GLU T OE2 1 
ATOM   8679  N  N   . PHE D 2 44  ? 21.660  55.428  9.857   1.00 13.07 ? 44  PHE T N   1 
ATOM   8680  C  CA  . PHE D 2 44  ? 20.794  54.964  8.781   1.00 13.67 ? 44  PHE T CA  1 
ATOM   8681  C  C   . PHE D 2 44  ? 19.970  53.752  9.191   1.00 13.46 ? 44  PHE T C   1 
ATOM   8682  O  O   . PHE D 2 44  ? 20.365  52.988  10.070  1.00 11.63 ? 44  PHE T O   1 
ATOM   8683  C  CB  . PHE D 2 44  ? 21.614  54.630  7.529   1.00 15.13 ? 44  PHE T CB  1 
ATOM   8684  C  CG  . PHE D 2 44  ? 22.610  53.524  7.730   1.00 15.50 ? 44  PHE T CG  1 
ATOM   8685  C  CD1 . PHE D 2 44  ? 23.817  53.763  8.374   1.00 15.84 ? 44  PHE T CD1 1 
ATOM   8686  C  CD2 . PHE D 2 44  ? 22.337  52.239  7.277   1.00 15.97 ? 44  PHE T CD2 1 
ATOM   8687  C  CE1 . PHE D 2 44  ? 24.739  52.738  8.564   1.00 14.75 ? 44  PHE T CE1 1 
ATOM   8688  C  CE2 . PHE D 2 44  ? 23.252  51.209  7.463   1.00 15.61 ? 44  PHE T CE2 1 
ATOM   8689  C  CZ  . PHE D 2 44  ? 24.457  51.462  8.108   1.00 13.93 ? 44  PHE T CZ  1 
ATOM   8690  N  N   . GLU D 2 45  ? 18.823  53.586  8.543   1.00 14.29 ? 45  GLU T N   1 
ATOM   8691  C  CA  . GLU D 2 45  ? 17.919  52.477  8.831   1.00 16.87 ? 45  GLU T CA  1 
ATOM   8692  C  C   . GLU D 2 45  ? 17.230  52.046  7.540   1.00 19.35 ? 45  GLU T C   1 
ATOM   8693  O  O   . GLU D 2 45  ? 16.755  52.885  6.771   1.00 18.63 ? 45  GLU T O   1 
ATOM   8694  C  CB  . GLU D 2 45  ? 16.879  52.919  9.870   1.00 16.22 ? 45  GLU T CB  1 
ATOM   8695  C  CG  . GLU D 2 45  ? 15.818  51.884  10.224  1.00 16.27 ? 45  GLU T CG  1 
ATOM   8696  C  CD  . GLU D 2 45  ? 16.395  50.599  10.800  1.00 17.36 ? 45  GLU T CD  1 
ATOM   8697  O  OE1 . GLU D 2 45  ? 17.295  50.670  11.664  1.00 17.48 ? 45  GLU T OE1 1 
ATOM   8698  O  OE2 . GLU D 2 45  ? 15.933  49.511  10.397  1.00 18.97 ? 45  GLU T OE2 1 
ATOM   8699  N  N   . THR D 2 46  ? 17.176  50.738  7.305   1.00 21.21 ? 46  THR T N   1 
ATOM   8700  C  CA  . THR D 2 46  ? 16.556  50.207  6.095   1.00 25.26 ? 46  THR T CA  1 
ATOM   8701  C  C   . THR D 2 46  ? 15.251  49.455  6.347   1.00 27.24 ? 46  THR T C   1 
ATOM   8702  O  O   . THR D 2 46  ? 14.347  49.480  5.514   1.00 28.39 ? 46  THR T O   1 
ATOM   8703  C  CB  . THR D 2 46  ? 17.512  49.248  5.359   1.00 25.81 ? 46  THR T CB  1 
ATOM   8704  O  OG1 . THR D 2 46  ? 17.850  48.157  6.226   1.00 30.11 ? 46  THR T OG1 1 
ATOM   8705  C  CG2 . THR D 2 46  ? 18.784  49.968  4.950   1.00 26.67 ? 46  THR T CG2 1 
ATOM   8706  N  N   . ASP D 2 47  ? 15.147  48.796  7.497   1.00 28.54 ? 47  ASP T N   1 
ATOM   8707  C  CA  . ASP D 2 47  ? 13.955  48.015  7.809   1.00 30.63 ? 47  ASP T CA  1 
ATOM   8708  C  C   . ASP D 2 47  ? 12.806  48.755  8.480   1.00 30.53 ? 47  ASP T C   1 
ATOM   8709  O  O   . ASP D 2 47  ? 11.720  48.859  7.915   1.00 31.10 ? 47  ASP T O   1 
ATOM   8710  C  CB  . ASP D 2 47  ? 14.327  46.806  8.672   1.00 34.48 ? 47  ASP T CB  1 
ATOM   8711  C  CG  . ASP D 2 47  ? 15.342  45.903  8.003   1.00 37.75 ? 47  ASP T CG  1 
ATOM   8712  O  OD1 . ASP D 2 47  ? 15.168  45.599  6.803   1.00 39.46 ? 47  ASP T OD1 1 
ATOM   8713  O  OD2 . ASP D 2 47  ? 16.308  45.490  8.680   1.00 41.17 ? 47  ASP T OD2 1 
ATOM   8714  N  N   . HIS D 2 48  ? 13.044  49.263  9.683   1.00 29.30 ? 48  HIS T N   1 
ATOM   8715  C  CA  . HIS D 2 48  ? 12.002  49.955  10.433  1.00 27.53 ? 48  HIS T CA  1 
ATOM   8716  C  C   . HIS D 2 48  ? 12.252  51.453  10.565  1.00 26.18 ? 48  HIS T C   1 
ATOM   8717  O  O   . HIS D 2 48  ? 12.930  51.899  11.492  1.00 25.69 ? 48  HIS T O   1 
ATOM   8718  C  CB  . HIS D 2 48  ? 11.880  49.316  11.817  1.00 29.02 ? 48  HIS T CB  1 
ATOM   8719  C  CG  . HIS D 2 48  ? 11.562  47.853  11.774  1.00 29.89 ? 48  HIS T CG  1 
ATOM   8720  N  ND1 . HIS D 2 48  ? 10.324  47.373  11.411  1.00 31.57 ? 48  HIS T ND1 1 
ATOM   8721  C  CD2 . HIS D 2 48  ? 12.333  46.765  12.013  1.00 30.32 ? 48  HIS T CD2 1 
ATOM   8722  C  CE1 . HIS D 2 48  ? 10.343  46.052  11.427  1.00 31.41 ? 48  HIS T CE1 1 
ATOM   8723  N  NE2 . HIS D 2 48  ? 11.553  45.658  11.789  1.00 31.28 ? 48  HIS T NE2 1 
ATOM   8724  N  N   . GLY D 2 49  ? 11.685  52.224  9.641   1.00 22.64 ? 49  GLY T N   1 
ATOM   8725  C  CA  . GLY D 2 49  ? 11.863  53.665  9.662   1.00 20.36 ? 49  GLY T CA  1 
ATOM   8726  C  C   . GLY D 2 49  ? 11.031  54.406  10.697  1.00 19.29 ? 49  GLY T C   1 
ATOM   8727  O  O   . GLY D 2 49  ? 11.239  55.598  10.926  1.00 17.57 ? 49  GLY T O   1 
ATOM   8728  N  N   . PHE D 2 50  ? 10.090  53.708  11.326  1.00 17.99 ? 50  PHE T N   1 
ATOM   8729  C  CA  . PHE D 2 50  ? 9.233   54.324  12.336  1.00 17.64 ? 50  PHE T CA  1 
ATOM   8730  C  C   . PHE D 2 50  ? 9.149   53.436  13.568  1.00 17.00 ? 50  PHE T C   1 
ATOM   8731  O  O   . PHE D 2 50  ? 9.283   52.216  13.474  1.00 17.23 ? 50  PHE T O   1 
ATOM   8732  C  CB  . PHE D 2 50  ? 7.836   54.555  11.752  1.00 17.25 ? 50  PHE T CB  1 
ATOM   8733  C  CG  . PHE D 2 50  ? 7.844   55.393  10.510  1.00 18.74 ? 50  PHE T CG  1 
ATOM   8734  C  CD1 . PHE D 2 50  ? 8.017   56.771  10.588  1.00 17.64 ? 50  PHE T CD1 1 
ATOM   8735  C  CD2 . PHE D 2 50  ? 7.750   54.799  9.254   1.00 18.66 ? 50  PHE T CD2 1 
ATOM   8736  C  CE1 . PHE D 2 50  ? 8.099   57.545  9.435   1.00 18.04 ? 50  PHE T CE1 1 
ATOM   8737  C  CE2 . PHE D 2 50  ? 7.832   55.569  8.093   1.00 18.08 ? 50  PHE T CE2 1 
ATOM   8738  C  CZ  . PHE D 2 50  ? 8.009   56.942  8.186   1.00 17.30 ? 50  PHE T CZ  1 
ATOM   8739  N  N   . VAL D 2 51  ? 8.930   54.045  14.727  1.00 16.63 ? 51  VAL T N   1 
ATOM   8740  C  CA  . VAL D 2 51  ? 8.845   53.275  15.957  1.00 15.88 ? 51  VAL T CA  1 
ATOM   8741  C  C   . VAL D 2 51  ? 7.649   52.343  15.960  1.00 15.15 ? 51  VAL T C   1 
ATOM   8742  O  O   . VAL D 2 51  ? 6.609   52.632  15.365  1.00 14.55 ? 51  VAL T O   1 
ATOM   8743  C  CB  . VAL D 2 51  ? 8.766   54.182  17.201  1.00 17.15 ? 51  VAL T CB  1 
ATOM   8744  C  CG1 . VAL D 2 51  ? 10.067  54.955  17.357  1.00 17.48 ? 51  VAL T CG1 1 
ATOM   8745  C  CG2 . VAL D 2 51  ? 7.579   55.131  17.083  1.00 17.53 ? 51  VAL T CG2 1 
ATOM   8746  N  N   . TYR D 2 52  ? 7.820   51.216  16.638  1.00 13.86 ? 52  TYR T N   1 
ATOM   8747  C  CA  . TYR D 2 52  ? 6.789   50.205  16.762  1.00 14.16 ? 52  TYR T CA  1 
ATOM   8748  C  C   . TYR D 2 52  ? 7.025   49.503  18.096  1.00 14.49 ? 52  TYR T C   1 
ATOM   8749  O  O   . TYR D 2 52  ? 7.942   49.859  18.839  1.00 14.64 ? 52  TYR T O   1 
ATOM   8750  C  CB  . TYR D 2 52  ? 6.887   49.198  15.604  1.00 13.16 ? 52  TYR T CB  1 
ATOM   8751  C  CG  . TYR D 2 52  ? 8.232   48.505  15.485  1.00 14.18 ? 52  TYR T CG  1 
ATOM   8752  C  CD1 . TYR D 2 52  ? 9.382   49.213  15.118  1.00 13.47 ? 52  TYR T CD1 1 
ATOM   8753  C  CD2 . TYR D 2 52  ? 8.359   47.142  15.756  1.00 13.39 ? 52  TYR T CD2 1 
ATOM   8754  C  CE1 . TYR D 2 52  ? 10.624  48.580  15.031  1.00 13.53 ? 52  TYR T CE1 1 
ATOM   8755  C  CE2 . TYR D 2 52  ? 9.590   46.500  15.672  1.00 14.60 ? 52  TYR T CE2 1 
ATOM   8756  C  CZ  . TYR D 2 52  ? 10.718  47.222  15.312  1.00 14.38 ? 52  TYR T CZ  1 
ATOM   8757  O  OH  . TYR D 2 52  ? 11.939  46.592  15.266  1.00 15.94 ? 52  TYR T OH  1 
ATOM   8758  N  N   . ARG D 2 53  ? 6.193   48.519  18.404  1.00 13.90 ? 53  ARG T N   1 
ATOM   8759  C  CA  . ARG D 2 53  ? 6.334   47.775  19.644  1.00 14.65 ? 53  ARG T CA  1 
ATOM   8760  C  C   . ARG D 2 53  ? 6.176   46.294  19.359  1.00 16.49 ? 53  ARG T C   1 
ATOM   8761  O  O   . ARG D 2 53  ? 5.073   45.815  19.098  1.00 18.40 ? 53  ARG T O   1 
ATOM   8762  C  CB  . ARG D 2 53  ? 5.287   48.223  20.662  1.00 15.00 ? 53  ARG T CB  1 
ATOM   8763  C  CG  . ARG D 2 53  ? 5.580   49.564  21.284  1.00 14.64 ? 53  ARG T CG  1 
ATOM   8764  C  CD  . ARG D 2 53  ? 4.545   49.914  22.331  1.00 14.24 ? 53  ARG T CD  1 
ATOM   8765  N  NE  . ARG D 2 53  ? 5.147   50.637  23.444  1.00 12.77 ? 53  ARG T NE  1 
ATOM   8766  C  CZ  . ARG D 2 53  ? 4.467   51.122  24.475  1.00 13.12 ? 53  ARG T CZ  1 
ATOM   8767  N  NH1 . ARG D 2 53  ? 3.149   50.964  24.535  1.00 13.75 ? 53  ARG T NH1 1 
ATOM   8768  N  NH2 . ARG D 2 53  ? 5.106   51.753  25.448  1.00 11.78 ? 53  ARG T NH2 1 
ATOM   8769  N  N   . GLU D 2 54  ? 7.290   45.576  19.398  1.00 16.29 ? 54  GLU T N   1 
ATOM   8770  C  CA  . GLU D 2 54  ? 7.284   44.147  19.140  1.00 17.56 ? 54  GLU T CA  1 
ATOM   8771  C  C   . GLU D 2 54  ? 7.725   43.341  20.355  1.00 18.04 ? 54  GLU T C   1 
ATOM   8772  O  O   . GLU D 2 54  ? 7.064   42.377  20.736  1.00 18.37 ? 54  GLU T O   1 
ATOM   8773  C  CB  . GLU D 2 54  ? 8.202   43.829  17.957  1.00 17.06 ? 54  GLU T CB  1 
ATOM   8774  C  CG  . GLU D 2 54  ? 8.479   42.349  17.781  1.00 22.60 ? 54  GLU T CG  1 
ATOM   8775  C  CD  . GLU D 2 54  ? 9.241   42.043  16.503  1.00 26.88 ? 54  GLU T CD  1 
ATOM   8776  O  OE1 . GLU D 2 54  ? 9.396   42.954  15.660  1.00 28.10 ? 54  GLU T OE1 1 
ATOM   8777  O  OE2 . GLU D 2 54  ? 9.680   40.885  16.339  1.00 28.34 ? 54  GLU T OE2 1 
ATOM   8778  N  N   . HIS D 2 55  ? 8.833   43.746  20.970  1.00 17.38 ? 55  HIS T N   1 
ATOM   8779  C  CA  . HIS D 2 55  ? 9.366   43.018  22.112  1.00 17.69 ? 55  HIS T CA  1 
ATOM   8780  C  C   . HIS D 2 55  ? 8.881   43.429  23.495  1.00 18.06 ? 55  HIS T C   1 
ATOM   8781  O  O   . HIS D 2 55  ? 9.029   42.662  24.446  1.00 19.69 ? 55  HIS T O   1 
ATOM   8782  C  CB  . HIS D 2 55  ? 10.893  43.041  22.052  1.00 17.69 ? 55  HIS T CB  1 
ATOM   8783  C  CG  . HIS D 2 55  ? 11.435  42.558  20.745  1.00 17.91 ? 55  HIS T CG  1 
ATOM   8784  N  ND1 . HIS D 2 55  ? 11.877  43.415  19.759  1.00 18.94 ? 55  HIS T ND1 1 
ATOM   8785  C  CD2 . HIS D 2 55  ? 11.511  41.312  20.223  1.00 19.48 ? 55  HIS T CD2 1 
ATOM   8786  C  CE1 . HIS D 2 55  ? 12.198  42.718  18.686  1.00 19.51 ? 55  HIS T CE1 1 
ATOM   8787  N  NE2 . HIS D 2 55  ? 11.985  41.439  18.938  1.00 19.42 ? 55  HIS T NE2 1 
ATOM   8788  N  N   . HIS D 2 56  ? 8.308   44.621  23.628  1.00 17.72 ? 56  HIS T N   1 
ATOM   8789  C  CA  . HIS D 2 56  ? 7.803   45.041  24.930  1.00 19.10 ? 56  HIS T CA  1 
ATOM   8790  C  C   . HIS D 2 56  ? 6.759   46.145  24.835  1.00 20.21 ? 56  HIS T C   1 
ATOM   8791  O  O   . HIS D 2 56  ? 6.682   46.864  23.839  1.00 19.96 ? 56  HIS T O   1 
ATOM   8792  C  CB  . HIS D 2 56  ? 8.949   45.469  25.852  1.00 19.94 ? 56  HIS T CB  1 
ATOM   8793  C  CG  . HIS D 2 56  ? 8.767   45.021  27.269  1.00 20.01 ? 56  HIS T CG  1 
ATOM   8794  N  ND1 . HIS D 2 56  ? 8.570   45.900  28.313  1.00 20.24 ? 56  HIS T ND1 1 
ATOM   8795  C  CD2 . HIS D 2 56  ? 8.712   43.780  27.808  1.00 18.98 ? 56  HIS T CD2 1 
ATOM   8796  C  CE1 . HIS D 2 56  ? 8.401   45.218  29.432  1.00 19.20 ? 56  HIS T CE1 1 
ATOM   8797  N  NE2 . HIS D 2 56  ? 8.482   43.932  29.154  1.00 18.59 ? 56  HIS T NE2 1 
ATOM   8798  N  N   . ASN D 2 57  ? 5.969   46.280  25.894  1.00 20.72 ? 57  ASN T N   1 
ATOM   8799  C  CA  . ASN D 2 57  ? 4.881   47.246  25.927  1.00 21.88 ? 57  ASN T CA  1 
ATOM   8800  C  C   . ASN D 2 57  ? 4.881   48.164  27.142  1.00 20.68 ? 57  ASN T C   1 
ATOM   8801  O  O   . ASN D 2 57  ? 3.998   49.015  27.271  1.00 22.22 ? 57  ASN T O   1 
ATOM   8802  C  CB  . ASN D 2 57  ? 3.555   46.485  25.891  1.00 26.68 ? 57  ASN T CB  1 
ATOM   8803  C  CG  . ASN D 2 57  ? 2.686   46.885  24.731  1.00 31.23 ? 57  ASN T CG  1 
ATOM   8804  O  OD1 . ASN D 2 57  ? 3.140   46.933  23.585  1.00 34.50 ? 57  ASN T OD1 1 
ATOM   8805  N  ND2 . ASN D 2 57  ? 1.418   47.164  25.014  1.00 34.67 ? 57  ASN T ND2 1 
ATOM   8806  N  N   . SER D 2 58  ? 5.856   48.000  28.031  1.00 16.58 ? 58  SER T N   1 
ATOM   8807  C  CA  . SER D 2 58  ? 5.912   48.820  29.232  1.00 13.06 ? 58  SER T CA  1 
ATOM   8808  C  C   . SER D 2 58  ? 6.155   50.297  28.910  1.00 11.50 ? 58  SER T C   1 
ATOM   8809  O  O   . SER D 2 58  ? 6.550   50.648  27.799  1.00 9.64  ? 58  SER T O   1 
ATOM   8810  C  CB  . SER D 2 58  ? 6.986   48.284  30.190  1.00 13.49 ? 58  SER T CB  1 
ATOM   8811  O  OG  . SER D 2 58  ? 8.271   48.290  29.593  1.00 12.61 ? 58  SER T OG  1 
ATOM   8812  N  N   . PRO D 2 59  ? 5.902   51.185  29.881  1.00 9.98  ? 59  PRO T N   1 
ATOM   8813  C  CA  . PRO D 2 59  ? 6.093   52.622  29.684  1.00 10.66 ? 59  PRO T CA  1 
ATOM   8814  C  C   . PRO D 2 59  ? 7.503   53.001  29.230  1.00 10.89 ? 59  PRO T C   1 
ATOM   8815  O  O   . PRO D 2 59  ? 8.496   52.517  29.776  1.00 10.64 ? 59  PRO T O   1 
ATOM   8816  C  CB  . PRO D 2 59  ? 5.757   53.200  31.057  1.00 8.87  ? 59  PRO T CB  1 
ATOM   8817  C  CG  . PRO D 2 59  ? 4.727   52.250  31.575  1.00 9.93  ? 59  PRO T CG  1 
ATOM   8818  C  CD  . PRO D 2 59  ? 5.322   50.911  31.209  1.00 11.42 ? 59  PRO T CD  1 
ATOM   8819  N  N   . GLY D 2 60  ? 7.580   53.869  28.226  1.00 11.03 ? 60  GLY T N   1 
ATOM   8820  C  CA  . GLY D 2 60  ? 8.872   54.315  27.737  1.00 8.69  ? 60  GLY T CA  1 
ATOM   8821  C  C   . GLY D 2 60  ? 9.620   53.347  26.842  1.00 9.27  ? 60  GLY T C   1 
ATOM   8822  O  O   . GLY D 2 60  ? 10.710  53.674  26.370  1.00 8.56  ? 60  GLY T O   1 
ATOM   8823  N  N   . TYR D 2 61  ? 9.063   52.159  26.614  1.00 7.86  ? 61  TYR T N   1 
ATOM   8824  C  CA  . TYR D 2 61  ? 9.722   51.195  25.739  1.00 9.40  ? 61  TYR T CA  1 
ATOM   8825  C  C   . TYR D 2 61  ? 9.108   51.194  24.341  1.00 9.04  ? 61  TYR T C   1 
ATOM   8826  O  O   . TYR D 2 61  ? 7.893   51.055  24.175  1.00 9.18  ? 61  TYR T O   1 
ATOM   8827  C  CB  . TYR D 2 61  ? 9.664   49.766  26.303  1.00 9.29  ? 61  TYR T CB  1 
ATOM   8828  C  CG  . TYR D 2 61  ? 10.404  48.764  25.427  1.00 12.28 ? 61  TYR T CG  1 
ATOM   8829  C  CD1 . TYR D 2 61  ? 9.862   48.334  24.212  1.00 10.65 ? 61  TYR T CD1 1 
ATOM   8830  C  CD2 . TYR D 2 61  ? 11.687  48.323  25.765  1.00 11.43 ? 61  TYR T CD2 1 
ATOM   8831  C  CE1 . TYR D 2 61  ? 10.576  47.505  23.354  1.00 10.43 ? 61  TYR T CE1 1 
ATOM   8832  C  CE2 . TYR D 2 61  ? 12.415  47.487  24.912  1.00 10.17 ? 61  TYR T CE2 1 
ATOM   8833  C  CZ  . TYR D 2 61  ? 11.854  47.088  23.704  1.00 11.35 ? 61  TYR T CZ  1 
ATOM   8834  O  OH  . TYR D 2 61  ? 12.574  46.299  22.831  1.00 9.40  ? 61  TYR T OH  1 
ATOM   8835  N  N   . TYR D 2 62  ? 9.970   51.339  23.343  1.00 8.66  ? 62  TYR T N   1 
ATOM   8836  C  CA  . TYR D 2 62  ? 9.567   51.337  21.945  1.00 9.32  ? 62  TYR T CA  1 
ATOM   8837  C  C   . TYR D 2 62  ? 10.724  50.744  21.159  1.00 10.02 ? 62  TYR T C   1 
ATOM   8838  O  O   . TYR D 2 62  ? 11.882  50.901  21.539  1.00 10.61 ? 62  TYR T O   1 
ATOM   8839  C  CB  . TYR D 2 62  ? 9.335   52.764  21.440  1.00 8.25  ? 62  TYR T CB  1 
ATOM   8840  C  CG  . TYR D 2 62  ? 8.335   53.573  22.228  1.00 8.51  ? 62  TYR T CG  1 
ATOM   8841  C  CD1 . TYR D 2 62  ? 6.966   53.449  21.995  1.00 9.34  ? 62  TYR T CD1 1 
ATOM   8842  C  CD2 . TYR D 2 62  ? 8.759   54.473  23.199  1.00 10.43 ? 62  TYR T CD2 1 
ATOM   8843  C  CE1 . TYR D 2 62  ? 6.045   54.210  22.708  1.00 10.25 ? 62  TYR T CE1 1 
ATOM   8844  C  CE2 . TYR D 2 62  ? 7.851   55.236  23.917  1.00 10.65 ? 62  TYR T CE2 1 
ATOM   8845  C  CZ  . TYR D 2 62  ? 6.498   55.100  23.669  1.00 10.65 ? 62  TYR T CZ  1 
ATOM   8846  O  OH  . TYR D 2 62  ? 5.605   55.867  24.377  1.00 9.89  ? 62  TYR T OH  1 
ATOM   8847  N  N   . ASP D 2 63  ? 10.412  50.054  20.072  1.00 11.37 ? 63  ASP T N   1 
ATOM   8848  C  CA  . ASP D 2 63  ? 11.451  49.495  19.220  1.00 10.93 ? 63  ASP T CA  1 
ATOM   8849  C  C   . ASP D 2 63  ? 11.582  50.477  18.064  1.00 10.67 ? 63  ASP T C   1 
ATOM   8850  O  O   . ASP D 2 63  ? 10.660  51.250  17.796  1.00 10.41 ? 63  ASP T O   1 
ATOM   8851  C  CB  . ASP D 2 63  ? 11.044  48.119  18.685  1.00 12.02 ? 63  ASP T CB  1 
ATOM   8852  C  CG  . ASP D 2 63  ? 11.007  47.055  19.766  1.00 13.36 ? 63  ASP T CG  1 
ATOM   8853  O  OD1 . ASP D 2 63  ? 12.067  46.784  20.376  1.00 11.02 ? 63  ASP T OD1 1 
ATOM   8854  O  OD2 . ASP D 2 63  ? 9.918   46.484  20.002  1.00 11.29 ? 63  ASP T OD2 1 
ATOM   8855  N  N   . GLY D 2 64  ? 12.727  50.468  17.393  1.00 12.09 ? 64  GLY T N   1 
ATOM   8856  C  CA  . GLY D 2 64  ? 12.909  51.364  16.264  1.00 12.37 ? 64  GLY T CA  1 
ATOM   8857  C  C   . GLY D 2 64  ? 13.509  52.720  16.575  1.00 10.75 ? 64  GLY T C   1 
ATOM   8858  O  O   . GLY D 2 64  ? 13.586  53.577  15.695  1.00 12.26 ? 64  GLY T O   1 
ATOM   8859  N  N   . ARG D 2 65  ? 13.921  52.937  17.818  1.00 10.80 ? 65  ARG T N   1 
ATOM   8860  C  CA  . ARG D 2 65  ? 14.533  54.209  18.180  1.00 9.72  ? 65  ARG T CA  1 
ATOM   8861  C  C   . ARG D 2 65  ? 15.996  54.176  17.749  1.00 10.76 ? 65  ARG T C   1 
ATOM   8862  O  O   . ARG D 2 65  ? 16.523  55.170  17.256  1.00 10.09 ? 65  ARG T O   1 
ATOM   8863  C  CB  . ARG D 2 65  ? 14.415  54.461  19.686  1.00 9.02  ? 65  ARG T CB  1 
ATOM   8864  C  CG  . ARG D 2 65  ? 13.020  54.897  20.112  1.00 8.20  ? 65  ARG T CG  1 
ATOM   8865  C  CD  . ARG D 2 65  ? 12.921  55.073  21.618  1.00 9.55  ? 65  ARG T CD  1 
ATOM   8866  N  NE  . ARG D 2 65  ? 13.189  53.827  22.332  1.00 9.28  ? 65  ARG T NE  1 
ATOM   8867  C  CZ  . ARG D 2 65  ? 12.891  53.628  23.612  1.00 8.34  ? 65  ARG T CZ  1 
ATOM   8868  N  NH1 . ARG D 2 65  ? 12.317  54.595  24.313  1.00 5.43  ? 65  ARG T NH1 1 
ATOM   8869  N  NH2 . ARG D 2 65  ? 13.163  52.463  24.188  1.00 8.94  ? 65  ARG T NH2 1 
ATOM   8870  N  N   . TYR D 2 66  ? 16.642  53.025  17.932  1.00 10.52 ? 66  TYR T N   1 
ATOM   8871  C  CA  . TYR D 2 66  ? 18.033  52.858  17.524  1.00 9.26  ? 66  TYR T CA  1 
ATOM   8872  C  C   . TYR D 2 66  ? 18.139  52.564  16.034  1.00 8.95  ? 66  TYR T C   1 
ATOM   8873  O  O   . TYR D 2 66  ? 17.466  51.672  15.513  1.00 8.68  ? 66  TYR T O   1 
ATOM   8874  C  CB  . TYR D 2 66  ? 18.707  51.700  18.272  1.00 8.91  ? 66  TYR T CB  1 
ATOM   8875  C  CG  . TYR D 2 66  ? 19.112  52.004  19.692  1.00 9.03  ? 66  TYR T CG  1 
ATOM   8876  C  CD1 . TYR D 2 66  ? 19.953  53.077  19.984  1.00 7.70  ? 66  TYR T CD1 1 
ATOM   8877  C  CD2 . TYR D 2 66  ? 18.662  51.210  20.747  1.00 7.83  ? 66  TYR T CD2 1 
ATOM   8878  C  CE1 . TYR D 2 66  ? 20.334  53.358  21.298  1.00 8.97  ? 66  TYR T CE1 1 
ATOM   8879  C  CE2 . TYR D 2 66  ? 19.035  51.482  22.062  1.00 7.01  ? 66  TYR T CE2 1 
ATOM   8880  C  CZ  . TYR D 2 66  ? 19.872  52.558  22.328  1.00 7.80  ? 66  TYR T CZ  1 
ATOM   8881  O  OH  . TYR D 2 66  ? 20.235  52.840  23.623  1.00 10.94 ? 66  TYR T OH  1 
ATOM   8882  N  N   . TRP D 2 67  ? 18.985  53.331  15.360  1.00 7.06  ? 67  TRP T N   1 
ATOM   8883  C  CA  . TRP D 2 67  ? 19.260  53.142  13.943  1.00 9.55  ? 67  TRP T CA  1 
ATOM   8884  C  C   . TRP D 2 67  ? 20.722  52.686  13.898  1.00 9.47  ? 67  TRP T C   1 
ATOM   8885  O  O   . TRP D 2 67  ? 21.343  52.530  14.946  1.00 11.97 ? 67  TRP T O   1 
ATOM   8886  C  CB  . TRP D 2 67  ? 19.057  54.456  13.181  1.00 8.53  ? 67  TRP T CB  1 
ATOM   8887  C  CG  . TRP D 2 67  ? 17.604  54.725  12.832  1.00 8.61  ? 67  TRP T CG  1 
ATOM   8888  C  CD1 . TRP D 2 67  ? 16.500  54.108  13.360  1.00 8.67  ? 67  TRP T CD1 1 
ATOM   8889  C  CD2 . TRP D 2 67  ? 17.109  55.685  11.888  1.00 9.19  ? 67  TRP T CD2 1 
ATOM   8890  N  NE1 . TRP D 2 67  ? 15.351  54.623  12.799  1.00 9.02  ? 67  TRP T NE1 1 
ATOM   8891  C  CE2 . TRP D 2 67  ? 15.697  55.592  11.895  1.00 9.26  ? 67  TRP T CE2 1 
ATOM   8892  C  CE3 . TRP D 2 67  ? 17.722  56.614  11.035  1.00 10.27 ? 67  TRP T CE3 1 
ATOM   8893  C  CZ2 . TRP D 2 67  ? 14.887  56.399  11.083  1.00 10.14 ? 67  TRP T CZ2 1 
ATOM   8894  C  CZ3 . TRP D 2 67  ? 16.914  57.415  10.226  1.00 9.39  ? 67  TRP T CZ3 1 
ATOM   8895  C  CH2 . TRP D 2 67  ? 15.513  57.300  10.257  1.00 9.46  ? 67  TRP T CH2 1 
ATOM   8896  N  N   . THR D 2 68  ? 21.276  52.469  12.711  1.00 10.47 ? 68  THR T N   1 
ATOM   8897  C  CA  . THR D 2 68  ? 22.660  52.010  12.611  1.00 8.94  ? 68  THR T CA  1 
ATOM   8898  C  C   . THR D 2 68  ? 23.627  53.171  12.407  1.00 9.90  ? 68  THR T C   1 
ATOM   8899  O  O   . THR D 2 68  ? 23.344  54.109  11.669  1.00 11.23 ? 68  THR T O   1 
ATOM   8900  C  CB  . THR D 2 68  ? 22.813  50.986  11.470  1.00 9.28  ? 68  THR T CB  1 
ATOM   8901  O  OG1 . THR D 2 68  ? 21.870  49.924  11.667  1.00 8.68  ? 68  THR T OG1 1 
ATOM   8902  C  CG2 . THR D 2 68  ? 24.221  50.389  11.458  1.00 8.35  ? 68  THR T CG2 1 
ATOM   8903  N  N   . MET D 2 69  ? 24.773  53.105  13.074  1.00 9.67  ? 69  MET T N   1 
ATOM   8904  C  CA  . MET D 2 69  ? 25.766  54.169  12.974  1.00 11.00 ? 69  MET T CA  1 
ATOM   8905  C  C   . MET D 2 69  ? 26.626  54.053  11.726  1.00 11.32 ? 69  MET T C   1 
ATOM   8906  O  O   . MET D 2 69  ? 27.145  52.982  11.416  1.00 11.67 ? 69  MET T O   1 
ATOM   8907  C  CB  . MET D 2 69  ? 26.672  54.164  14.210  1.00 13.23 ? 69  MET T CB  1 
ATOM   8908  C  CG  . MET D 2 69  ? 27.775  55.219  14.188  1.00 14.92 ? 69  MET T CG  1 
ATOM   8909  S  SD  . MET D 2 69  ? 28.894  55.076  15.603  1.00 16.29 ? 69  MET T SD  1 
ATOM   8910  C  CE  . MET D 2 69  ? 27.868  55.719  16.896  1.00 16.23 ? 69  MET T CE  1 
ATOM   8911  N  N   . TRP D 2 70  ? 26.769  55.162  11.009  1.00 11.58 ? 70  TRP T N   1 
ATOM   8912  C  CA  . TRP D 2 70  ? 27.601  55.194  9.814   1.00 11.28 ? 70  TRP T CA  1 
ATOM   8913  C  C   . TRP D 2 70  ? 29.008  55.556  10.275  1.00 11.16 ? 70  TRP T C   1 
ATOM   8914  O  O   . TRP D 2 70  ? 29.265  56.689  10.682  1.00 10.35 ? 70  TRP T O   1 
ATOM   8915  C  CB  . TRP D 2 70  ? 27.080  56.237  8.819   1.00 11.71 ? 70  TRP T CB  1 
ATOM   8916  C  CG  . TRP D 2 70  ? 28.005  56.479  7.654   1.00 12.81 ? 70  TRP T CG  1 
ATOM   8917  C  CD1 . TRP D 2 70  ? 28.899  57.504  7.512   1.00 13.66 ? 70  TRP T CD1 1 
ATOM   8918  C  CD2 . TRP D 2 70  ? 28.147  55.661  6.484   1.00 11.76 ? 70  TRP T CD2 1 
ATOM   8919  N  NE1 . TRP D 2 70  ? 29.586  57.376  6.324   1.00 12.39 ? 70  TRP T NE1 1 
ATOM   8920  C  CE2 . TRP D 2 70  ? 29.142  56.255  5.675   1.00 12.24 ? 70  TRP T CE2 1 
ATOM   8921  C  CE3 . TRP D 2 70  ? 27.523  54.488  6.040   1.00 12.31 ? 70  TRP T CE3 1 
ATOM   8922  C  CZ2 . TRP D 2 70  ? 29.535  55.708  4.446   1.00 12.93 ? 70  TRP T CZ2 1 
ATOM   8923  C  CZ3 . TRP D 2 70  ? 27.914  53.945  4.817   1.00 12.06 ? 70  TRP T CZ3 1 
ATOM   8924  C  CH2 . TRP D 2 70  ? 28.909  54.560  4.034   1.00 12.79 ? 70  TRP T CH2 1 
ATOM   8925  N  N   . LYS D 2 71  ? 29.908  54.580  10.223  1.00 11.61 ? 71  LYS T N   1 
ATOM   8926  C  CA  . LYS D 2 71  ? 31.288  54.767  10.654  1.00 12.17 ? 71  LYS T CA  1 
ATOM   8927  C  C   . LYS D 2 71  ? 31.331  55.190  12.124  1.00 12.72 ? 71  LYS T C   1 
ATOM   8928  O  O   . LYS D 2 71  ? 30.810  54.482  12.983  1.00 13.89 ? 71  LYS T O   1 
ATOM   8929  C  CB  . LYS D 2 71  ? 31.991  55.794  9.756   1.00 13.38 ? 71  LYS T CB  1 
ATOM   8930  C  CG  . LYS D 2 71  ? 32.155  55.303  8.323   1.00 14.07 ? 71  LYS T CG  1 
ATOM   8931  C  CD  . LYS D 2 71  ? 32.897  56.293  7.446   1.00 15.72 ? 71  LYS T CD  1 
ATOM   8932  C  CE  . LYS D 2 71  ? 33.061  55.747  6.032   1.00 15.31 ? 71  LYS T CE  1 
ATOM   8933  N  NZ  . LYS D 2 71  ? 33.693  56.750  5.128   1.00 16.57 ? 71  LYS T NZ  1 
ATOM   8934  N  N   . LEU D 2 72  ? 31.942  56.332  12.418  1.00 11.80 ? 72  LEU T N   1 
ATOM   8935  C  CA  . LEU D 2 72  ? 32.031  56.811  13.793  1.00 12.87 ? 72  LEU T CA  1 
ATOM   8936  C  C   . LEU D 2 72  ? 31.691  58.290  13.900  1.00 14.12 ? 72  LEU T C   1 
ATOM   8937  O  O   . LEU D 2 72  ? 31.654  59.003  12.894  1.00 13.93 ? 72  LEU T O   1 
ATOM   8938  C  CB  . LEU D 2 72  ? 33.450  56.605  14.343  1.00 12.94 ? 72  LEU T CB  1 
ATOM   8939  C  CG  . LEU D 2 72  ? 33.923  55.186  14.660  1.00 13.14 ? 72  LEU T CG  1 
ATOM   8940  C  CD1 . LEU D 2 72  ? 35.397  55.210  15.068  1.00 14.06 ? 72  LEU T CD1 1 
ATOM   8941  C  CD2 . LEU D 2 72  ? 33.065  54.603  15.777  1.00 12.25 ? 72  LEU T CD2 1 
ATOM   8942  N  N   . PRO D 2 73  ? 31.404  58.767  15.124  1.00 14.11 ? 73  PRO T N   1 
ATOM   8943  C  CA  . PRO D 2 73  ? 31.091  60.191  15.265  1.00 13.36 ? 73  PRO T CA  1 
ATOM   8944  C  C   . PRO D 2 73  ? 32.355  60.908  14.789  1.00 14.77 ? 73  PRO T C   1 
ATOM   8945  O  O   . PRO D 2 73  ? 33.469  60.455  15.063  1.00 13.14 ? 73  PRO T O   1 
ATOM   8946  C  CB  . PRO D 2 73  ? 30.866  60.349  16.766  1.00 13.58 ? 73  PRO T CB  1 
ATOM   8947  C  CG  . PRO D 2 73  ? 30.330  59.005  17.174  1.00 14.11 ? 73  PRO T CG  1 
ATOM   8948  C  CD  . PRO D 2 73  ? 31.222  58.056  16.404  1.00 13.67 ? 73  PRO T CD  1 
ATOM   8949  N  N   . MET D 2 74  ? 32.185  62.017  14.081  1.00 15.11 ? 74  MET T N   1 
ATOM   8950  C  CA  . MET D 2 74  ? 33.315  62.758  13.537  1.00 17.18 ? 74  MET T CA  1 
ATOM   8951  C  C   . MET D 2 74  ? 33.966  63.725  14.524  1.00 17.34 ? 74  MET T C   1 
ATOM   8952  O  O   . MET D 2 74  ? 33.884  64.943  14.366  1.00 16.05 ? 74  MET T O   1 
ATOM   8953  C  CB  . MET D 2 74  ? 32.850  63.493  12.282  1.00 17.49 ? 74  MET T CB  1 
ATOM   8954  C  CG  . MET D 2 74  ? 32.209  62.548  11.276  1.00 19.29 ? 74  MET T CG  1 
ATOM   8955  S  SD  . MET D 2 74  ? 31.440  63.362  9.865   1.00 20.94 ? 74  MET T SD  1 
ATOM   8956  C  CE  . MET D 2 74  ? 32.890  63.788  8.914   1.00 23.47 ? 74  MET T CE  1 
ATOM   8957  N  N   . PHE D 2 75  ? 34.623  63.166  15.536  1.00 18.09 ? 75  PHE T N   1 
ATOM   8958  C  CA  . PHE D 2 75  ? 35.298  63.959  16.560  1.00 19.78 ? 75  PHE T CA  1 
ATOM   8959  C  C   . PHE D 2 75  ? 36.332  64.890  15.932  1.00 22.12 ? 75  PHE T C   1 
ATOM   8960  O  O   . PHE D 2 75  ? 37.105  64.481  15.066  1.00 22.74 ? 75  PHE T O   1 
ATOM   8961  C  CB  . PHE D 2 75  ? 36.005  63.039  17.565  1.00 19.07 ? 75  PHE T CB  1 
ATOM   8962  C  CG  . PHE D 2 75  ? 35.104  62.014  18.202  1.00 18.31 ? 75  PHE T CG  1 
ATOM   8963  C  CD1 . PHE D 2 75  ? 34.093  62.394  19.082  1.00 17.38 ? 75  PHE T CD1 1 
ATOM   8964  C  CD2 . PHE D 2 75  ? 35.270  60.662  17.920  1.00 16.89 ? 75  PHE T CD2 1 
ATOM   8965  C  CE1 . PHE D 2 75  ? 33.263  61.437  19.674  1.00 18.72 ? 75  PHE T CE1 1 
ATOM   8966  C  CE2 . PHE D 2 75  ? 34.448  59.699  18.504  1.00 18.61 ? 75  PHE T CE2 1 
ATOM   8967  C  CZ  . PHE D 2 75  ? 33.442  60.087  19.382  1.00 16.95 ? 75  PHE T CZ  1 
ATOM   8968  N  N   . GLY D 2 76  ? 36.345  66.142  16.373  1.00 24.60 ? 76  GLY T N   1 
ATOM   8969  C  CA  . GLY D 2 76  ? 37.304  67.099  15.849  1.00 27.70 ? 76  GLY T CA  1 
ATOM   8970  C  C   . GLY D 2 76  ? 36.949  67.735  14.517  1.00 29.40 ? 76  GLY T C   1 
ATOM   8971  O  O   . GLY D 2 76  ? 37.654  68.634  14.054  1.00 30.12 ? 76  GLY T O   1 
ATOM   8972  N  N   . CYS D 2 77  ? 35.867  67.281  13.892  1.00 29.49 ? 77  CYS T N   1 
ATOM   8973  C  CA  . CYS D 2 77  ? 35.448  67.837  12.608  1.00 29.06 ? 77  CYS T CA  1 
ATOM   8974  C  C   . CYS D 2 77  ? 35.087  69.311  12.743  1.00 28.94 ? 77  CYS T C   1 
ATOM   8975  O  O   . CYS D 2 77  ? 34.336  69.693  13.637  1.00 29.18 ? 77  CYS T O   1 
ATOM   8976  C  CB  . CYS D 2 77  ? 34.241  67.070  12.065  1.00 29.16 ? 77  CYS T CB  1 
ATOM   8977  S  SG  . CYS D 2 77  ? 33.555  67.758  10.540  1.00 29.47 ? 77  CYS T SG  1 
ATOM   8978  N  N   . THR D 2 78  ? 35.623  70.137  11.850  1.00 29.36 ? 78  THR T N   1 
ATOM   8979  C  CA  . THR D 2 78  ? 35.341  71.569  11.874  1.00 29.88 ? 78  THR T CA  1 
ATOM   8980  C  C   . THR D 2 78  ? 34.917  72.064  10.500  1.00 30.19 ? 78  THR T C   1 
ATOM   8981  O  O   . THR D 2 78  ? 34.582  73.235  10.330  1.00 30.19 ? 78  THR T O   1 
ATOM   8982  C  CB  . THR D 2 78  ? 36.571  72.383  12.331  1.00 30.76 ? 78  THR T CB  1 
ATOM   8983  O  OG1 . THR D 2 78  ? 37.718  71.988  11.567  1.00 31.18 ? 78  THR T OG1 1 
ATOM   8984  C  CG2 . THR D 2 78  ? 36.839  72.158  13.811  1.00 30.35 ? 78  THR T CG2 1 
ATOM   8985  N  N   . ASP D 2 79  ? 34.933  71.162  9.523   1.00 30.50 ? 79  ASP T N   1 
ATOM   8986  C  CA  . ASP D 2 79  ? 34.553  71.501  8.158   1.00 31.00 ? 79  ASP T CA  1 
ATOM   8987  C  C   . ASP D 2 79  ? 33.242  70.818  7.759   1.00 29.71 ? 79  ASP T C   1 
ATOM   8988  O  O   . ASP D 2 79  ? 33.159  69.591  7.698   1.00 29.20 ? 79  ASP T O   1 
ATOM   8989  C  CB  . ASP D 2 79  ? 35.677  71.102  7.198   1.00 33.16 ? 79  ASP T CB  1 
ATOM   8990  C  CG  . ASP D 2 79  ? 35.323  71.350  5.745   1.00 36.72 ? 79  ASP T CG  1 
ATOM   8991  O  OD1 . ASP D 2 79  ? 34.745  72.416  5.443   1.00 36.78 ? 79  ASP T OD1 1 
ATOM   8992  O  OD2 . ASP D 2 79  ? 35.637  70.481  4.902   1.00 40.11 ? 79  ASP T OD2 1 
ATOM   8993  N  N   . PRO D 2 80  ? 32.197  71.614  7.480   1.00 29.35 ? 80  PRO T N   1 
ATOM   8994  C  CA  . PRO D 2 80  ? 30.886  71.088  7.088   1.00 28.03 ? 80  PRO T CA  1 
ATOM   8995  C  C   . PRO D 2 80  ? 30.913  70.259  5.808   1.00 27.24 ? 80  PRO T C   1 
ATOM   8996  O  O   . PRO D 2 80  ? 30.045  69.414  5.586   1.00 27.51 ? 80  PRO T O   1 
ATOM   8997  C  CB  . PRO D 2 80  ? 30.038  72.351  6.951   1.00 28.23 ? 80  PRO T CB  1 
ATOM   8998  C  CG  . PRO D 2 80  ? 31.039  73.385  6.540   1.00 28.87 ? 80  PRO T CG  1 
ATOM   8999  C  CD  . PRO D 2 80  ? 32.193  73.087  7.462   1.00 29.29 ? 80  PRO T CD  1 
ATOM   9000  N  N   . ALA D 2 81  ? 31.913  70.502  4.968   1.00 26.72 ? 81  ALA T N   1 
ATOM   9001  C  CA  . ALA D 2 81  ? 32.046  69.770  3.714   1.00 25.54 ? 81  ALA T CA  1 
ATOM   9002  C  C   . ALA D 2 81  ? 32.328  68.297  3.991   1.00 24.83 ? 81  ALA T C   1 
ATOM   9003  O  O   . ALA D 2 81  ? 31.928  67.426  3.220   1.00 24.15 ? 81  ALA T O   1 
ATOM   9004  C  CB  . ALA D 2 81  ? 33.167  70.369  2.874   1.00 26.21 ? 81  ALA T CB  1 
ATOM   9005  N  N   . GLN D 2 82  ? 33.018  68.027  5.095   1.00 24.54 ? 82  GLN T N   1 
ATOM   9006  C  CA  . GLN D 2 82  ? 33.351  66.662  5.476   1.00 25.34 ? 82  GLN T CA  1 
ATOM   9007  C  C   . GLN D 2 82  ? 32.100  65.884  5.858   1.00 24.61 ? 82  GLN T C   1 
ATOM   9008  O  O   . GLN D 2 82  ? 31.997  64.687  5.582   1.00 23.59 ? 82  GLN T O   1 
ATOM   9009  C  CB  . GLN D 2 82  ? 34.332  66.663  6.649   1.00 28.91 ? 82  GLN T CB  1 
ATOM   9010  C  CG  . GLN D 2 82  ? 35.675  67.286  6.326   1.00 36.45 ? 82  GLN T CG  1 
ATOM   9011  C  CD  . GLN D 2 82  ? 36.606  67.323  7.525   1.00 41.22 ? 82  GLN T CD  1 
ATOM   9012  O  OE1 . GLN D 2 82  ? 37.758  67.747  7.415   1.00 45.53 ? 82  GLN T OE1 1 
ATOM   9013  N  NE2 . GLN D 2 82  ? 36.112  66.878  8.677   1.00 42.59 ? 82  GLN T NE2 1 
ATOM   9014  N  N   . VAL D 2 83  ? 31.156  66.565  6.501   1.00 22.58 ? 83  VAL T N   1 
ATOM   9015  C  CA  . VAL D 2 83  ? 29.909  65.932  6.909   1.00 21.17 ? 83  VAL T CA  1 
ATOM   9016  C  C   . VAL D 2 83  ? 29.052  65.657  5.676   1.00 20.99 ? 83  VAL T C   1 
ATOM   9017  O  O   . VAL D 2 83  ? 28.489  64.571  5.527   1.00 21.27 ? 83  VAL T O   1 
ATOM   9018  C  CB  . VAL D 2 83  ? 29.115  66.831  7.883   1.00 20.71 ? 83  VAL T CB  1 
ATOM   9019  C  CG1 . VAL D 2 83  ? 27.814  66.146  8.279   1.00 19.28 ? 83  VAL T CG1 1 
ATOM   9020  C  CG2 . VAL D 2 83  ? 29.955  67.138  9.114   1.00 19.89 ? 83  VAL T CG2 1 
ATOM   9021  N  N   . LEU D 2 84  ? 28.958  66.649  4.795   1.00 21.42 ? 84  LEU T N   1 
ATOM   9022  C  CA  . LEU D 2 84  ? 28.176  66.518  3.568   1.00 21.13 ? 84  LEU T CA  1 
ATOM   9023  C  C   . LEU D 2 84  ? 28.729  65.414  2.675   1.00 20.45 ? 84  LEU T C   1 
ATOM   9024  O  O   . LEU D 2 84  ? 27.985  64.762  1.939   1.00 19.25 ? 84  LEU T O   1 
ATOM   9025  C  CB  . LEU D 2 84  ? 28.176  67.841  2.799   1.00 21.56 ? 84  LEU T CB  1 
ATOM   9026  C  CG  . LEU D 2 84  ? 27.036  68.830  3.060   1.00 23.72 ? 84  LEU T CG  1 
ATOM   9027  C  CD1 . LEU D 2 84  ? 26.765  68.955  4.544   1.00 24.92 ? 84  LEU T CD1 1 
ATOM   9028  C  CD2 . LEU D 2 84  ? 27.404  70.181  2.457   1.00 22.98 ? 84  LEU T CD2 1 
ATOM   9029  N  N   . ASN D 2 85  ? 30.039  65.211  2.744   1.00 20.76 ? 85  ASN T N   1 
ATOM   9030  C  CA  . ASN D 2 85  ? 30.691  64.186  1.945   1.00 21.71 ? 85  ASN T CA  1 
ATOM   9031  C  C   . ASN D 2 85  ? 30.287  62.792  2.409   1.00 20.73 ? 85  ASN T C   1 
ATOM   9032  O  O   . ASN D 2 85  ? 29.975  61.927  1.592   1.00 20.32 ? 85  ASN T O   1 
ATOM   9033  C  CB  . ASN D 2 85  ? 32.207  64.346  2.033   1.00 26.24 ? 85  ASN T CB  1 
ATOM   9034  C  CG  . ASN D 2 85  ? 32.849  64.492  0.673   1.00 32.03 ? 85  ASN T CG  1 
ATOM   9035  O  OD1 . ASN D 2 85  ? 32.877  63.543  -0.118  1.00 34.97 ? 85  ASN T OD1 1 
ATOM   9036  N  ND2 . ASN D 2 85  ? 33.360  65.688  0.384   1.00 32.48 ? 85  ASN T ND2 1 
ATOM   9037  N  N   . GLU D 2 86  ? 30.299  62.574  3.721   1.00 18.78 ? 86  GLU T N   1 
ATOM   9038  C  CA  . GLU D 2 86  ? 29.916  61.279  4.269   1.00 18.34 ? 86  GLU T CA  1 
ATOM   9039  C  C   . GLU D 2 86  ? 28.454  60.986  3.952   1.00 17.30 ? 86  GLU T C   1 
ATOM   9040  O  O   . GLU D 2 86  ? 28.075  59.835  3.739   1.00 17.50 ? 86  GLU T O   1 
ATOM   9041  C  CB  . GLU D 2 86  ? 30.137  61.246  5.783   1.00 17.15 ? 86  GLU T CB  1 
ATOM   9042  C  CG  . GLU D 2 86  ? 31.596  61.186  6.209   1.00 16.98 ? 86  GLU T CG  1 
ATOM   9043  C  CD  . GLU D 2 86  ? 32.334  59.983  5.636   1.00 19.07 ? 86  GLU T CD  1 
ATOM   9044  O  OE1 . GLU D 2 86  ? 31.681  58.965  5.322   1.00 16.72 ? 86  GLU T OE1 1 
ATOM   9045  O  OE2 . GLU D 2 86  ? 33.576  60.050  5.515   1.00 19.71 ? 86  GLU T OE2 1 
ATOM   9046  N  N   . LEU D 2 87  ? 27.633  62.032  3.920   1.00 17.64 ? 87  LEU T N   1 
ATOM   9047  C  CA  . LEU D 2 87  ? 26.220  61.868  3.602   1.00 18.34 ? 87  LEU T CA  1 
ATOM   9048  C  C   . LEU D 2 87  ? 26.100  61.262  2.210   1.00 18.43 ? 87  LEU T C   1 
ATOM   9049  O  O   . LEU D 2 87  ? 25.334  60.322  1.996   1.00 17.19 ? 87  LEU T O   1 
ATOM   9050  C  CB  . LEU D 2 87  ? 25.496  63.219  3.638   1.00 17.59 ? 87  LEU T CB  1 
ATOM   9051  C  CG  . LEU D 2 87  ? 24.019  63.211  3.225   1.00 19.37 ? 87  LEU T CG  1 
ATOM   9052  C  CD1 . LEU D 2 87  ? 23.243  62.205  4.064   1.00 17.58 ? 87  LEU T CD1 1 
ATOM   9053  C  CD2 . LEU D 2 87  ? 23.436  64.605  3.394   1.00 18.32 ? 87  LEU T CD2 1 
ATOM   9054  N  N   . GLU D 2 88  ? 26.862  61.805  1.262   1.00 18.60 ? 88  GLU T N   1 
ATOM   9055  C  CA  . GLU D 2 88  ? 26.837  61.304  -0.108  1.00 20.04 ? 88  GLU T CA  1 
ATOM   9056  C  C   . GLU D 2 88  ? 27.356  59.869  -0.174  1.00 19.54 ? 88  GLU T C   1 
ATOM   9057  O  O   . GLU D 2 88  ? 26.842  59.054  -0.935  1.00 19.37 ? 88  GLU T O   1 
ATOM   9058  C  CB  . GLU D 2 88  ? 27.664  62.212  -1.026  1.00 20.96 ? 88  GLU T CB  1 
ATOM   9059  C  CG  . GLU D 2 88  ? 27.044  63.585  -1.252  1.00 24.09 ? 88  GLU T CG  1 
ATOM   9060  C  CD  . GLU D 2 88  ? 25.641  63.496  -1.825  1.00 27.17 ? 88  GLU T CD  1 
ATOM   9061  O  OE1 . GLU D 2 88  ? 25.483  62.900  -2.911  1.00 29.64 ? 88  GLU T OE1 1 
ATOM   9062  O  OE2 . GLU D 2 88  ? 24.696  64.018  -1.191  1.00 29.36 ? 88  GLU T OE2 1 
ATOM   9063  N  N   . GLU D 2 89  ? 28.374  59.566  0.627   1.00 20.45 ? 89  GLU T N   1 
ATOM   9064  C  CA  . GLU D 2 89  ? 28.934  58.219  0.665   1.00 21.56 ? 89  GLU T CA  1 
ATOM   9065  C  C   . GLU D 2 89  ? 27.891  57.243  1.185   1.00 20.80 ? 89  GLU T C   1 
ATOM   9066  O  O   . GLU D 2 89  ? 27.707  56.161  0.628   1.00 21.66 ? 89  GLU T O   1 
ATOM   9067  C  CB  . GLU D 2 89  ? 30.152  58.153  1.587   1.00 26.08 ? 89  GLU T CB  1 
ATOM   9068  C  CG  . GLU D 2 89  ? 31.489  58.231  0.887   1.00 32.74 ? 89  GLU T CG  1 
ATOM   9069  C  CD  . GLU D 2 89  ? 32.597  57.577  1.695   1.00 37.38 ? 89  GLU T CD  1 
ATOM   9070  O  OE1 . GLU D 2 89  ? 32.517  56.349  1.935   1.00 38.27 ? 89  GLU T OE1 1 
ATOM   9071  O  OE2 . GLU D 2 89  ? 33.546  58.287  2.094   1.00 40.67 ? 89  GLU T OE2 1 
ATOM   9072  N  N   . CYS D 2 90  ? 27.218  57.630  2.266   1.00 20.21 ? 90  CYS T N   1 
ATOM   9073  C  CA  . CYS D 2 90  ? 26.194  56.785  2.869   1.00 18.77 ? 90  CYS T CA  1 
ATOM   9074  C  C   . CYS D 2 90  ? 25.041  56.559  1.897   1.00 19.54 ? 90  CYS T C   1 
ATOM   9075  O  O   . CYS D 2 90  ? 24.545  55.439  1.766   1.00 18.94 ? 90  CYS T O   1 
ATOM   9076  C  CB  . CYS D 2 90  ? 25.673  57.424  4.160   1.00 17.25 ? 90  CYS T CB  1 
ATOM   9077  S  SG  . CYS D 2 90  ? 24.526  56.377  5.079   1.00 15.88 ? 90  CYS T SG  1 
ATOM   9078  N  N   . LYS D 2 91  ? 24.619  57.625  1.220   1.00 19.64 ? 91  LYS T N   1 
ATOM   9079  C  CA  . LYS D 2 91  ? 23.533  57.546  0.249   1.00 22.21 ? 91  LYS T CA  1 
ATOM   9080  C  C   . LYS D 2 91  ? 23.871  56.585  -0.881  1.00 22.67 ? 91  LYS T C   1 
ATOM   9081  O  O   . LYS D 2 91  ? 23.005  55.866  -1.378  1.00 23.45 ? 91  LYS T O   1 
ATOM   9082  C  CB  . LYS D 2 91  ? 23.244  58.929  -0.345  1.00 23.37 ? 91  LYS T CB  1 
ATOM   9083  C  CG  . LYS D 2 91  ? 22.486  59.861  0.583   1.00 27.13 ? 91  LYS T CG  1 
ATOM   9084  C  CD  . LYS D 2 91  ? 22.490  61.296  0.073   1.00 28.68 ? 91  LYS T CD  1 
ATOM   9085  C  CE  . LYS D 2 91  ? 21.848  61.419  -1.297  1.00 30.60 ? 91  LYS T CE  1 
ATOM   9086  N  NZ  . LYS D 2 91  ? 21.866  62.837  -1.759  1.00 32.34 ? 91  LYS T NZ  1 
ATOM   9087  N  N   . LYS D 2 92  ? 25.133  56.578  -1.289  1.00 23.54 ? 92  LYS T N   1 
ATOM   9088  C  CA  . LYS D 2 92  ? 25.567  55.710  -2.372  1.00 26.33 ? 92  LYS T CA  1 
ATOM   9089  C  C   . LYS D 2 92  ? 25.547  54.237  -1.973  1.00 25.92 ? 92  LYS T C   1 
ATOM   9090  O  O   . LYS D 2 92  ? 25.204  53.376  -2.779  1.00 25.58 ? 92  LYS T O   1 
ATOM   9091  C  CB  . LYS D 2 92  ? 26.975  56.090  -2.829  1.00 29.67 ? 92  LYS T CB  1 
ATOM   9092  C  CG  . LYS D 2 92  ? 27.156  55.998  -4.335  1.00 35.09 ? 92  LYS T CG  1 
ATOM   9093  C  CD  . LYS D 2 92  ? 28.619  55.967  -4.759  1.00 38.82 ? 92  LYS T CD  1 
ATOM   9094  C  CE  . LYS D 2 92  ? 29.293  54.646  -4.390  1.00 41.27 ? 92  LYS T CE  1 
ATOM   9095  N  NZ  . LYS D 2 92  ? 30.008  54.709  -3.083  1.00 43.33 ? 92  LYS T NZ  1 
ATOM   9096  N  N   . GLU D 2 93  ? 25.912  53.948  -0.728  1.00 26.22 ? 93  GLU T N   1 
ATOM   9097  C  CA  . GLU D 2 93  ? 25.934  52.568  -0.254  1.00 26.51 ? 93  GLU T CA  1 
ATOM   9098  C  C   . GLU D 2 93  ? 24.551  52.108  0.201   1.00 24.40 ? 93  GLU T C   1 
ATOM   9099  O  O   . GLU D 2 93  ? 24.240  50.923  0.144   1.00 25.13 ? 93  GLU T O   1 
ATOM   9100  C  CB  . GLU D 2 93  ? 26.936  52.422  0.898   1.00 29.94 ? 93  GLU T CB  1 
ATOM   9101  C  CG  . GLU D 2 93  ? 27.444  50.998  1.108   1.00 36.39 ? 93  GLU T CG  1 
ATOM   9102  C  CD  . GLU D 2 93  ? 28.454  50.896  2.241   1.00 39.97 ? 93  GLU T CD  1 
ATOM   9103  O  OE1 . GLU D 2 93  ? 28.810  51.944  2.817   1.00 44.44 ? 93  GLU T OE1 1 
ATOM   9104  O  OE2 . GLU D 2 93  ? 28.892  49.770  2.557   1.00 41.72 ? 93  GLU T OE2 1 
ATOM   9105  N  N   . TYR D 2 94  ? 23.720  53.050  0.638   1.00 22.32 ? 94  TYR T N   1 
ATOM   9106  C  CA  . TYR D 2 94  ? 22.374  52.736  1.115   1.00 21.12 ? 94  TYR T CA  1 
ATOM   9107  C  C   . TYR D 2 94  ? 21.298  53.650  0.521   1.00 21.46 ? 94  TYR T C   1 
ATOM   9108  O  O   . TYR D 2 94  ? 20.678  54.433  1.236   1.00 20.16 ? 94  TYR T O   1 
ATOM   9109  C  CB  . TYR D 2 94  ? 22.338  52.837  2.643   1.00 19.90 ? 94  TYR T CB  1 
ATOM   9110  C  CG  . TYR D 2 94  ? 23.096  51.737  3.344   1.00 21.25 ? 94  TYR T CG  1 
ATOM   9111  C  CD1 . TYR D 2 94  ? 22.531  50.471  3.502   1.00 21.69 ? 94  TYR T CD1 1 
ATOM   9112  C  CD2 . TYR D 2 94  ? 24.389  51.948  3.823   1.00 20.08 ? 94  TYR T CD2 1 
ATOM   9113  C  CE1 . TYR D 2 94  ? 23.232  49.441  4.121   1.00 22.08 ? 94  TYR T CE1 1 
ATOM   9114  C  CE2 . TYR D 2 94  ? 25.104  50.920  4.441   1.00 21.18 ? 94  TYR T CE2 1 
ATOM   9115  C  CZ  . TYR D 2 94  ? 24.517  49.672  4.586   1.00 21.89 ? 94  TYR T CZ  1 
ATOM   9116  O  OH  . TYR D 2 94  ? 25.213  48.652  5.191   1.00 23.97 ? 94  TYR T OH  1 
ATOM   9117  N  N   . PRO D 2 95  ? 21.053  53.553  -0.795  1.00 21.74 ? 95  PRO T N   1 
ATOM   9118  C  CA  . PRO D 2 95  ? 20.035  54.402  -1.424  1.00 21.91 ? 95  PRO T CA  1 
ATOM   9119  C  C   . PRO D 2 95  ? 18.618  54.084  -0.951  1.00 22.01 ? 95  PRO T C   1 
ATOM   9120  O  O   . PRO D 2 95  ? 17.699  54.884  -1.131  1.00 22.83 ? 95  PRO T O   1 
ATOM   9121  C  CB  . PRO D 2 95  ? 20.220  54.113  -2.911  1.00 21.74 ? 95  PRO T CB  1 
ATOM   9122  C  CG  . PRO D 2 95  ? 20.641  52.666  -2.909  1.00 21.94 ? 95  PRO T CG  1 
ATOM   9123  C  CD  . PRO D 2 95  ? 21.649  52.629  -1.779  1.00 21.65 ? 95  PRO T CD  1 
ATOM   9124  N  N   . ASN D 2 96  ? 18.460  52.918  -0.334  1.00 21.25 ? 96  ASN T N   1 
ATOM   9125  C  CA  . ASN D 2 96  ? 17.165  52.453  0.156   1.00 22.31 ? 96  ASN T CA  1 
ATOM   9126  C  C   . ASN D 2 96  ? 16.930  52.712  1.643   1.00 21.23 ? 96  ASN T C   1 
ATOM   9127  O  O   . ASN D 2 96  ? 15.974  52.197  2.221   1.00 20.03 ? 96  ASN T O   1 
ATOM   9128  C  CB  . ASN D 2 96  ? 17.041  50.952  -0.098  1.00 25.24 ? 96  ASN T CB  1 
ATOM   9129  C  CG  . ASN D 2 96  ? 18.094  50.146  0.647   1.00 27.62 ? 96  ASN T CG  1 
ATOM   9130  O  OD1 . ASN D 2 96  ? 19.280  50.485  0.635   1.00 27.08 ? 96  ASN T OD1 1 
ATOM   9131  N  ND2 . ASN D 2 96  ? 17.663  49.067  1.288   1.00 28.15 ? 96  ASN T ND2 1 
ATOM   9132  N  N   . ALA D 2 97  ? 17.789  53.509  2.263   1.00 19.75 ? 97  ALA T N   1 
ATOM   9133  C  CA  . ALA D 2 97  ? 17.642  53.774  3.685   1.00 19.51 ? 97  ALA T CA  1 
ATOM   9134  C  C   . ALA D 2 97  ? 17.305  55.213  4.035   1.00 19.18 ? 97  ALA T C   1 
ATOM   9135  O  O   . ALA D 2 97  ? 17.485  56.130  3.227   1.00 18.06 ? 97  ALA T O   1 
ATOM   9136  C  CB  . ALA D 2 97  ? 18.918  53.367  4.413   1.00 19.13 ? 97  ALA T CB  1 
ATOM   9137  N  N   . PHE D 2 98  ? 16.792  55.395  5.249   1.00 16.98 ? 98  PHE T N   1 
ATOM   9138  C  CA  . PHE D 2 98  ? 16.499  56.724  5.756   1.00 15.59 ? 98  PHE T CA  1 
ATOM   9139  C  C   . PHE D 2 98  ? 17.827  57.123  6.385   1.00 15.46 ? 98  PHE T C   1 
ATOM   9140  O  O   . PHE D 2 98  ? 18.434  56.324  7.100   1.00 14.58 ? 98  PHE T O   1 
ATOM   9141  C  CB  . PHE D 2 98  ? 15.429  56.691  6.851   1.00 16.63 ? 98  PHE T CB  1 
ATOM   9142  C  CG  . PHE D 2 98  ? 14.045  56.387  6.354   1.00 18.40 ? 98  PHE T CG  1 
ATOM   9143  C  CD1 . PHE D 2 98  ? 13.593  55.076  6.262   1.00 18.51 ? 98  PHE T CD1 1 
ATOM   9144  C  CD2 . PHE D 2 98  ? 13.188  57.418  5.983   1.00 18.69 ? 98  PHE T CD2 1 
ATOM   9145  C  CE1 . PHE D 2 98  ? 12.304  54.794  5.814   1.00 19.19 ? 98  PHE T CE1 1 
ATOM   9146  C  CE2 . PHE D 2 98  ? 11.897  57.146  5.532   1.00 19.25 ? 98  PHE T CE2 1 
ATOM   9147  C  CZ  . PHE D 2 98  ? 11.455  55.831  5.446   1.00 18.44 ? 98  PHE T CZ  1 
ATOM   9148  N  N   . ILE D 2 99  ? 18.292  58.336  6.117   1.00 15.80 ? 99  ILE T N   1 
ATOM   9149  C  CA  . ILE D 2 99  ? 19.553  58.779  6.693   1.00 15.54 ? 99  ILE T CA  1 
ATOM   9150  C  C   . ILE D 2 99  ? 19.331  59.999  7.574   1.00 15.73 ? 99  ILE T C   1 
ATOM   9151  O  O   . ILE D 2 99  ? 18.706  60.983  7.169   1.00 16.39 ? 99  ILE T O   1 
ATOM   9152  C  CB  . ILE D 2 99  ? 20.590  59.082  5.605   1.00 17.24 ? 99  ILE T CB  1 
ATOM   9153  C  CG1 . ILE D 2 99  ? 20.780  57.839  4.729   1.00 17.18 ? 99  ILE T CG1 1 
ATOM   9154  C  CG2 . ILE D 2 99  ? 21.920  59.460  6.248   1.00 15.38 ? 99  ILE T CG2 1 
ATOM   9155  C  CD1 . ILE D 2 99  ? 21.624  58.069  3.499   1.00 18.71 ? 99  ILE T CD1 1 
ATOM   9156  N  N   . ARG D 2 100 ? 19.874  59.917  8.780   1.00 13.61 ? 100 ARG T N   1 
ATOM   9157  C  CA  . ARG D 2 100 ? 19.716  60.941  9.797   1.00 14.20 ? 100 ARG T CA  1 
ATOM   9158  C  C   . ARG D 2 100 ? 21.051  61.575  10.219  1.00 13.23 ? 100 ARG T C   1 
ATOM   9159  O  O   . ARG D 2 100 ? 22.060  60.884  10.358  1.00 11.88 ? 100 ARG T O   1 
ATOM   9160  C  CB  . ARG D 2 100 ? 19.024  60.262  10.991  1.00 15.11 ? 100 ARG T CB  1 
ATOM   9161  C  CG  . ARG D 2 100 ? 18.670  61.107  12.181  1.00 17.19 ? 100 ARG T CG  1 
ATOM   9162  C  CD  . ARG D 2 100 ? 17.648  60.356  13.059  1.00 15.32 ? 100 ARG T CD  1 
ATOM   9163  N  NE  . ARG D 2 100 ? 18.181  59.153  13.703  1.00 12.97 ? 100 ARG T NE  1 
ATOM   9164  C  CZ  . ARG D 2 100 ? 17.428  58.231  14.302  1.00 11.93 ? 100 ARG T CZ  1 
ATOM   9165  N  NH1 . ARG D 2 100 ? 16.110  58.363  14.333  1.00 10.33 ? 100 ARG T NH1 1 
ATOM   9166  N  NH2 . ARG D 2 100 ? 17.989  57.184  14.891  1.00 12.98 ? 100 ARG T NH2 1 
ATOM   9167  N  N   . ILE D 2 101 ? 21.053  62.892  10.405  1.00 10.68 ? 101 ILE T N   1 
ATOM   9168  C  CA  . ILE D 2 101 ? 22.253  63.591  10.858  1.00 11.94 ? 101 ILE T CA  1 
ATOM   9169  C  C   . ILE D 2 101 ? 22.004  64.039  12.293  1.00 12.52 ? 101 ILE T C   1 
ATOM   9170  O  O   . ILE D 2 101 ? 21.008  64.705  12.575  1.00 12.27 ? 101 ILE T O   1 
ATOM   9171  C  CB  . ILE D 2 101 ? 22.557  64.855  10.019  1.00 12.17 ? 101 ILE T CB  1 
ATOM   9172  C  CG1 . ILE D 2 101 ? 22.909  64.464  8.583   1.00 13.57 ? 101 ILE T CG1 1 
ATOM   9173  C  CG2 . ILE D 2 101 ? 23.709  65.633  10.652  1.00 11.22 ? 101 ILE T CG2 1 
ATOM   9174  C  CD1 . ILE D 2 101 ? 23.239  65.639  7.693   1.00 13.57 ? 101 ILE T CD1 1 
ATOM   9175  N  N   . ILE D 2 102 ? 22.899  63.672  13.204  1.00 12.61 ? 102 ILE T N   1 
ATOM   9176  C  CA  . ILE D 2 102 ? 22.737  64.076  14.591  1.00 13.86 ? 102 ILE T CA  1 
ATOM   9177  C  C   . ILE D 2 102 ? 23.982  64.802  15.083  1.00 15.50 ? 102 ILE T C   1 
ATOM   9178  O  O   . ILE D 2 102 ? 25.043  64.732  14.460  1.00 16.98 ? 102 ILE T O   1 
ATOM   9179  C  CB  . ILE D 2 102 ? 22.438  62.864  15.508  1.00 14.02 ? 102 ILE T CB  1 
ATOM   9180  C  CG1 . ILE D 2 102 ? 23.654  61.941  15.595  1.00 15.72 ? 102 ILE T CG1 1 
ATOM   9181  C  CG2 . ILE D 2 102 ? 21.231  62.094  14.970  1.00 12.94 ? 102 ILE T CG2 1 
ATOM   9182  C  CD1 . ILE D 2 102 ? 23.442  60.747  16.510  1.00 15.79 ? 102 ILE T CD1 1 
ATOM   9183  N  N   . GLY D 2 103 ? 23.837  65.517  16.192  1.00 15.22 ? 103 GLY T N   1 
ATOM   9184  C  CA  . GLY D 2 103 ? 24.953  66.248  16.756  1.00 14.49 ? 103 GLY T CA  1 
ATOM   9185  C  C   . GLY D 2 103 ? 24.985  66.048  18.256  1.00 15.30 ? 103 GLY T C   1 
ATOM   9186  O  O   . GLY D 2 103 ? 23.998  66.326  18.939  1.00 15.07 ? 103 GLY T O   1 
ATOM   9187  N  N   . PHE D 2 104 ? 26.116  65.568  18.765  1.00 14.00 ? 104 PHE T N   1 
ATOM   9188  C  CA  . PHE D 2 104 ? 26.286  65.308  20.194  1.00 14.40 ? 104 PHE T CA  1 
ATOM   9189  C  C   . PHE D 2 104 ? 26.892  66.465  20.979  1.00 15.47 ? 104 PHE T C   1 
ATOM   9190  O  O   . PHE D 2 104 ? 27.795  67.149  20.503  1.00 13.71 ? 104 PHE T O   1 
ATOM   9191  C  CB  . PHE D 2 104 ? 27.220  64.110  20.426  1.00 14.07 ? 104 PHE T CB  1 
ATOM   9192  C  CG  . PHE D 2 104 ? 26.700  62.800  19.922  1.00 15.43 ? 104 PHE T CG  1 
ATOM   9193  C  CD1 . PHE D 2 104 ? 25.655  62.150  20.572  1.00 15.29 ? 104 PHE T CD1 1 
ATOM   9194  C  CD2 . PHE D 2 104 ? 27.300  62.179  18.831  1.00 17.23 ? 104 PHE T CD2 1 
ATOM   9195  C  CE1 . PHE D 2 104 ? 25.222  60.899  20.146  1.00 16.21 ? 104 PHE T CE1 1 
ATOM   9196  C  CE2 . PHE D 2 104 ? 26.872  60.927  18.397  1.00 16.81 ? 104 PHE T CE2 1 
ATOM   9197  C  CZ  . PHE D 2 104 ? 25.833  60.286  19.056  1.00 17.51 ? 104 PHE T CZ  1 
ATOM   9198  N  N   . ASP D 2 105 ? 26.392  66.659  22.194  1.00 15.93 ? 105 ASP T N   1 
ATOM   9199  C  CA  . ASP D 2 105 ? 26.934  67.652  23.110  1.00 16.78 ? 105 ASP T CA  1 
ATOM   9200  C  C   . ASP D 2 105 ? 27.549  66.707  24.139  1.00 16.94 ? 105 ASP T C   1 
ATOM   9201  O  O   . ASP D 2 105 ? 26.828  66.101  24.934  1.00 16.45 ? 105 ASP T O   1 
ATOM   9202  C  CB  . ASP D 2 105 ? 25.828  68.477  23.764  1.00 19.42 ? 105 ASP T CB  1 
ATOM   9203  C  CG  . ASP D 2 105 ? 26.374  69.557  24.687  1.00 22.78 ? 105 ASP T CG  1 
ATOM   9204  O  OD1 . ASP D 2 105 ? 27.319  69.275  25.453  1.00 23.37 ? 105 ASP T OD1 1 
ATOM   9205  O  OD2 . ASP D 2 105 ? 25.851  70.689  24.654  1.00 27.61 ? 105 ASP T OD2 1 
ATOM   9206  N  N   . SER D 2 106 ? 28.869  66.556  24.107  1.00 15.85 ? 106 SER T N   1 
ATOM   9207  C  CA  . SER D 2 106 ? 29.545  65.639  25.015  1.00 17.68 ? 106 SER T CA  1 
ATOM   9208  C  C   . SER D 2 106 ? 29.553  66.041  26.490  1.00 18.69 ? 106 SER T C   1 
ATOM   9209  O  O   . SER D 2 106 ? 29.773  65.193  27.353  1.00 17.52 ? 106 SER T O   1 
ATOM   9210  C  CB  . SER D 2 106 ? 30.976  65.389  24.535  1.00 18.41 ? 106 SER T CB  1 
ATOM   9211  O  OG  . SER D 2 106 ? 31.718  66.596  24.489  1.00 22.78 ? 106 SER T OG  1 
ATOM   9212  N  N   . ASN D 2 107 ? 29.310  67.315  26.790  1.00 19.81 ? 107 ASN T N   1 
ATOM   9213  C  CA  . ASN D 2 107 ? 29.286  67.754  28.187  1.00 21.40 ? 107 ASN T CA  1 
ATOM   9214  C  C   . ASN D 2 107 ? 27.968  67.374  28.877  1.00 20.75 ? 107 ASN T C   1 
ATOM   9215  O  O   . ASN D 2 107 ? 27.969  66.930  30.023  1.00 20.57 ? 107 ASN T O   1 
ATOM   9216  C  CB  . ASN D 2 107 ? 29.512  69.264  28.286  1.00 24.80 ? 107 ASN T CB  1 
ATOM   9217  C  CG  . ASN D 2 107 ? 30.931  69.669  27.911  1.00 31.11 ? 107 ASN T CG  1 
ATOM   9218  O  OD1 . ASN D 2 107 ? 31.904  69.040  28.336  1.00 34.31 ? 107 ASN T OD1 1 
ATOM   9219  N  ND2 . ASN D 2 107 ? 31.057  70.734  27.124  1.00 31.49 ? 107 ASN T ND2 1 
ATOM   9220  N  N   . ARG D 2 108 ? 26.848  67.548  28.180  1.00 18.93 ? 108 ARG T N   1 
ATOM   9221  C  CA  . ARG D 2 108 ? 25.543  67.188  28.732  1.00 17.82 ? 108 ARG T CA  1 
ATOM   9222  C  C   . ARG D 2 108 ? 25.172  65.771  28.297  1.00 18.11 ? 108 ARG T C   1 
ATOM   9223  O  O   . ARG D 2 108 ? 24.261  65.150  28.847  1.00 18.16 ? 108 ARG T O   1 
ATOM   9224  C  CB  . ARG D 2 108 ? 24.458  68.143  28.233  1.00 19.85 ? 108 ARG T CB  1 
ATOM   9225  C  CG  . ARG D 2 108 ? 24.440  69.503  28.902  1.00 24.32 ? 108 ARG T CG  1 
ATOM   9226  C  CD  . ARG D 2 108 ? 23.038  70.088  28.841  1.00 26.90 ? 108 ARG T CD  1 
ATOM   9227  N  NE  . ARG D 2 108 ? 22.622  70.393  27.475  1.00 28.55 ? 108 ARG T NE  1 
ATOM   9228  C  CZ  . ARG D 2 108 ? 21.379  70.252  27.024  1.00 29.58 ? 108 ARG T CZ  1 
ATOM   9229  N  NH1 . ARG D 2 108 ? 20.425  69.801  27.830  1.00 28.96 ? 108 ARG T NH1 1 
ATOM   9230  N  NH2 . ARG D 2 108 ? 21.088  70.568  25.769  1.00 30.16 ? 108 ARG T NH2 1 
ATOM   9231  N  N   . GLN D 2 109 ? 25.891  65.276  27.298  1.00 16.19 ? 109 GLN T N   1 
ATOM   9232  C  CA  . GLN D 2 109 ? 25.660  63.957  26.733  1.00 16.83 ? 109 GLN T CA  1 
ATOM   9233  C  C   . GLN D 2 109 ? 24.218  63.812  26.240  1.00 17.74 ? 109 GLN T C   1 
ATOM   9234  O  O   . GLN D 2 109 ? 23.500  62.879  26.603  1.00 17.80 ? 109 GLN T O   1 
ATOM   9235  C  CB  . GLN D 2 109 ? 26.007  62.856  27.743  1.00 14.64 ? 109 GLN T CB  1 
ATOM   9236  C  CG  . GLN D 2 109 ? 26.237  61.518  27.065  1.00 12.96 ? 109 GLN T CG  1 
ATOM   9237  C  CD  . GLN D 2 109 ? 26.899  60.478  27.946  1.00 10.04 ? 109 GLN T CD  1 
ATOM   9238  O  OE1 . GLN D 2 109 ? 27.129  59.351  27.508  1.00 11.32 ? 109 GLN T OE1 1 
ATOM   9239  N  NE2 . GLN D 2 109 ? 27.210  60.843  29.187  1.00 10.50 ? 109 GLN T NE2 1 
ATOM   9240  N  N   . VAL D 2 110 ? 23.808  64.768  25.411  1.00 18.50 ? 110 VAL T N   1 
ATOM   9241  C  CA  . VAL D 2 110 ? 22.479  64.782  24.813  1.00 19.23 ? 110 VAL T CA  1 
ATOM   9242  C  C   . VAL D 2 110 ? 22.646  65.196  23.359  1.00 17.80 ? 110 VAL T C   1 
ATOM   9243  O  O   . VAL D 2 110 ? 23.544  65.975  23.029  1.00 18.00 ? 110 VAL T O   1 
ATOM   9244  C  CB  . VAL D 2 110 ? 21.535  65.814  25.486  1.00 20.54 ? 110 VAL T CB  1 
ATOM   9245  C  CG1 . VAL D 2 110 ? 21.295  65.449  26.935  1.00 24.50 ? 110 VAL T CG1 1 
ATOM   9246  C  CG2 . VAL D 2 110 ? 22.131  67.200  25.393  1.00 23.04 ? 110 VAL T CG2 1 
ATOM   9247  N  N   . GLN D 2 111 ? 21.799  64.665  22.488  1.00 16.51 ? 111 GLN T N   1 
ATOM   9248  C  CA  . GLN D 2 111 ? 21.855  65.034  21.083  1.00 15.53 ? 111 GLN T CA  1 
ATOM   9249  C  C   . GLN D 2 111 ? 21.117  66.364  20.991  1.00 15.01 ? 111 GLN T C   1 
ATOM   9250  O  O   . GLN D 2 111 ? 19.942  66.454  21.339  1.00 15.04 ? 111 GLN T O   1 
ATOM   9251  C  CB  . GLN D 2 111 ? 21.174  63.962  20.226  1.00 16.37 ? 111 GLN T CB  1 
ATOM   9252  C  CG  . GLN D 2 111 ? 21.841  62.602  20.356  1.00 17.17 ? 111 GLN T CG  1 
ATOM   9253  C  CD  . GLN D 2 111 ? 21.144  61.503  19.580  1.00 18.72 ? 111 GLN T CD  1 
ATOM   9254  O  OE1 . GLN D 2 111 ? 21.413  60.318  19.794  1.00 22.78 ? 111 GLN T OE1 1 
ATOM   9255  N  NE2 . GLN D 2 111 ? 20.259  61.883  18.668  1.00 17.02 ? 111 GLN T NE2 1 
ATOM   9256  N  N   . CYS D 2 112 ? 21.816  67.405  20.556  1.00 14.88 ? 112 CYS T N   1 
ATOM   9257  C  CA  . CYS D 2 112 ? 21.214  68.730  20.451  1.00 14.87 ? 112 CYS T CA  1 
ATOM   9258  C  C   . CYS D 2 112 ? 20.647  68.994  19.068  1.00 15.13 ? 112 CYS T C   1 
ATOM   9259  O  O   . CYS D 2 112 ? 19.944  69.977  18.857  1.00 15.06 ? 112 CYS T O   1 
ATOM   9260  C  CB  . CYS D 2 112 ? 22.243  69.805  20.802  1.00 16.26 ? 112 CYS T CB  1 
ATOM   9261  S  SG  . CYS D 2 112 ? 22.752  69.769  22.530  1.00 17.91 ? 112 CYS T SG  1 
ATOM   9262  N  N   . VAL D 2 113 ? 20.959  68.107  18.132  1.00 15.63 ? 113 VAL T N   1 
ATOM   9263  C  CA  . VAL D 2 113 ? 20.479  68.226  16.765  1.00 16.44 ? 113 VAL T CA  1 
ATOM   9264  C  C   . VAL D 2 113 ? 20.168  66.845  16.211  1.00 17.01 ? 113 VAL T C   1 
ATOM   9265  O  O   . VAL D 2 113 ? 20.879  65.880  16.487  1.00 16.44 ? 113 VAL T O   1 
ATOM   9266  C  CB  . VAL D 2 113 ? 21.532  68.906  15.853  1.00 17.31 ? 113 VAL T CB  1 
ATOM   9267  C  CG1 . VAL D 2 113 ? 21.151  68.735  14.385  1.00 18.78 ? 113 VAL T CG1 1 
ATOM   9268  C  CG2 . VAL D 2 113 ? 21.623  70.385  16.187  1.00 18.24 ? 113 VAL T CG2 1 
ATOM   9269  N  N   . SER D 2 114 ? 19.091  66.762  15.437  1.00 17.38 ? 114 SER T N   1 
ATOM   9270  C  CA  . SER D 2 114 ? 18.672  65.513  14.815  1.00 15.53 ? 114 SER T CA  1 
ATOM   9271  C  C   . SER D 2 114 ? 17.618  65.808  13.760  1.00 16.24 ? 114 SER T C   1 
ATOM   9272  O  O   . SER D 2 114 ? 16.568  66.376  14.063  1.00 15.30 ? 114 SER T O   1 
ATOM   9273  C  CB  . SER D 2 114 ? 18.099  64.556  15.858  1.00 16.82 ? 114 SER T CB  1 
ATOM   9274  O  OG  . SER D 2 114 ? 17.659  63.349  15.253  1.00 15.97 ? 114 SER T OG  1 
ATOM   9275  N  N   . PHE D 2 115 ? 17.903  65.429  12.518  1.00 15.67 ? 115 PHE T N   1 
ATOM   9276  C  CA  . PHE D 2 115 ? 16.963  65.656  11.428  1.00 15.62 ? 115 PHE T CA  1 
ATOM   9277  C  C   . PHE D 2 115 ? 17.274  64.753  10.241  1.00 15.80 ? 115 PHE T C   1 
ATOM   9278  O  O   . PHE D 2 115 ? 18.437  64.449  9.970   1.00 16.71 ? 115 PHE T O   1 
ATOM   9279  C  CB  . PHE D 2 115 ? 16.985  67.135  11.014  1.00 15.07 ? 115 PHE T CB  1 
ATOM   9280  C  CG  . PHE D 2 115 ? 18.296  67.598  10.438  1.00 16.82 ? 115 PHE T CG  1 
ATOM   9281  C  CD1 . PHE D 2 115 ? 18.579  67.423  9.087   1.00 17.79 ? 115 PHE T CD1 1 
ATOM   9282  C  CD2 . PHE D 2 115 ? 19.245  68.215  11.245  1.00 18.59 ? 115 PHE T CD2 1 
ATOM   9283  C  CE1 . PHE D 2 115 ? 19.791  67.858  8.550   1.00 20.51 ? 115 PHE T CE1 1 
ATOM   9284  C  CE2 . PHE D 2 115 ? 20.458  68.653  10.719  1.00 18.60 ? 115 PHE T CE2 1 
ATOM   9285  C  CZ  . PHE D 2 115 ? 20.731  68.474  9.368   1.00 20.02 ? 115 PHE T CZ  1 
ATOM   9286  N  N   . ILE D 2 116 ? 16.233  64.303  9.548   1.00 16.62 ? 116 ILE T N   1 
ATOM   9287  C  CA  . ILE D 2 116 ? 16.432  63.438  8.394   1.00 18.41 ? 116 ILE T CA  1 
ATOM   9288  C  C   . ILE D 2 116 ? 17.045  64.240  7.256   1.00 18.15 ? 116 ILE T C   1 
ATOM   9289  O  O   . ILE D 2 116 ? 16.583  65.333  6.939   1.00 16.80 ? 116 ILE T O   1 
ATOM   9290  C  CB  . ILE D 2 116 ? 15.100  62.789  7.923   1.00 20.33 ? 116 ILE T CB  1 
ATOM   9291  C  CG1 . ILE D 2 116 ? 14.859  61.468  8.667   1.00 23.80 ? 116 ILE T CG1 1 
ATOM   9292  C  CG2 . ILE D 2 116 ? 15.161  62.477  6.437   1.00 23.03 ? 116 ILE T CG2 1 
ATOM   9293  C  CD1 . ILE D 2 116 ? 14.723  61.602  10.171  1.00 26.43 ? 116 ILE T CD1 1 
ATOM   9294  N  N   . ALA D 2 117 ? 18.097  63.694  6.657   1.00 16.99 ? 117 ALA T N   1 
ATOM   9295  C  CA  . ALA D 2 117 ? 18.779  64.357  5.554   1.00 17.12 ? 117 ALA T CA  1 
ATOM   9296  C  C   . ALA D 2 117 ? 18.462  63.663  4.232   1.00 17.13 ? 117 ALA T C   1 
ATOM   9297  O  O   . ALA D 2 117 ? 18.622  64.244  3.159   1.00 18.17 ? 117 ALA T O   1 
ATOM   9298  C  CB  . ALA D 2 117 ? 20.288  64.356  5.799   1.00 15.06 ? 117 ALA T CB  1 
ATOM   9299  N  N   . TYR D 2 118 ? 18.009  62.418  4.317   1.00 17.13 ? 118 TYR T N   1 
ATOM   9300  C  CA  . TYR D 2 118 ? 17.690  61.649  3.124   1.00 17.31 ? 118 TYR T CA  1 
ATOM   9301  C  C   . TYR D 2 118 ? 16.588  60.630  3.384   1.00 18.08 ? 118 TYR T C   1 
ATOM   9302  O  O   . TYR D 2 118 ? 16.572  59.963  4.417   1.00 17.04 ? 118 TYR T O   1 
ATOM   9303  C  CB  . TYR D 2 118 ? 18.946  60.927  2.628   1.00 18.42 ? 118 TYR T CB  1 
ATOM   9304  C  CG  . TYR D 2 118 ? 18.718  60.026  1.441   1.00 18.30 ? 118 TYR T CG  1 
ATOM   9305  C  CD1 . TYR D 2 118 ? 18.621  60.548  0.150   1.00 19.03 ? 118 TYR T CD1 1 
ATOM   9306  C  CD2 . TYR D 2 118 ? 18.595  58.648  1.605   1.00 18.22 ? 118 TYR T CD2 1 
ATOM   9307  C  CE1 . TYR D 2 118 ? 18.413  59.714  -0.951  1.00 19.16 ? 118 TYR T CE1 1 
ATOM   9308  C  CE2 . TYR D 2 118 ? 18.382  57.807  0.516   1.00 19.60 ? 118 TYR T CE2 1 
ATOM   9309  C  CZ  . TYR D 2 118 ? 18.294  58.345  -0.758  1.00 19.91 ? 118 TYR T CZ  1 
ATOM   9310  O  OH  . TYR D 2 118 ? 18.098  57.504  -1.830  1.00 22.15 ? 118 TYR T OH  1 
ATOM   9311  N  N   . LYS D 2 119 ? 15.667  60.522  2.433   1.00 19.99 ? 119 LYS T N   1 
ATOM   9312  C  CA  . LYS D 2 119 ? 14.561  59.577  2.513   1.00 22.05 ? 119 LYS T CA  1 
ATOM   9313  C  C   . LYS D 2 119 ? 14.556  58.782  1.214   1.00 23.93 ? 119 LYS T C   1 
ATOM   9314  O  O   . LYS D 2 119 ? 14.784  59.338  0.142   1.00 22.79 ? 119 LYS T O   1 
ATOM   9315  C  CB  . LYS D 2 119 ? 13.227  60.313  2.666   1.00 22.96 ? 119 LYS T CB  1 
ATOM   9316  C  CG  . LYS D 2 119 ? 13.038  61.016  3.998   1.00 25.38 ? 119 LYS T CG  1 
ATOM   9317  C  CD  . LYS D 2 119 ? 11.651  61.640  4.097   1.00 26.92 ? 119 LYS T CD  1 
ATOM   9318  C  CE  . LYS D 2 119 ? 11.501  62.817  3.149   1.00 28.35 ? 119 LYS T CE  1 
ATOM   9319  N  NZ  . LYS D 2 119 ? 10.108  63.347  3.141   1.00 32.09 ? 119 LYS T NZ  1 
ATOM   9320  N  N   . PRO D 2 120 ? 14.307  57.465  1.291   1.00 26.36 ? 120 PRO T N   1 
ATOM   9321  C  CA  . PRO D 2 120 ? 14.286  56.645  0.075   1.00 29.23 ? 120 PRO T CA  1 
ATOM   9322  C  C   . PRO D 2 120 ? 13.104  56.997  -0.844  1.00 32.13 ? 120 PRO T C   1 
ATOM   9323  O  O   . PRO D 2 120 ? 12.376  57.957  -0.599  1.00 31.30 ? 120 PRO T O   1 
ATOM   9324  C  CB  . PRO D 2 120 ? 14.207  55.217  0.627   1.00 28.42 ? 120 PRO T CB  1 
ATOM   9325  C  CG  . PRO D 2 120 ? 13.482  55.389  1.923   1.00 27.99 ? 120 PRO T CG  1 
ATOM   9326  C  CD  . PRO D 2 120 ? 14.105  56.636  2.493   1.00 26.17 ? 120 PRO T CD  1 
ATOM   9327  N  N   . ALA D 2 121 ? 12.931  56.226  -1.912  1.00 35.57 ? 121 ALA T N   1 
ATOM   9328  C  CA  . ALA D 2 121 ? 11.828  56.423  -2.861  1.00 38.11 ? 121 ALA T CA  1 
ATOM   9329  C  C   . ALA D 2 121 ? 10.435  56.043  -2.336  1.00 39.60 ? 121 ALA T C   1 
ATOM   9330  O  O   . ALA D 2 121 ? 10.216  54.914  -1.861  1.00 40.34 ? 121 ALA T O   1 
ATOM   9331  C  CB  . ALA D 2 121 ? 12.122  55.652  -4.133  1.00 38.03 ? 121 ALA T CB  1 
ATOM   9332  N  N   . GLY D 2 122 ? 9.505   56.996  -2.415  1.00 41.52 ? 122 GLY T N   1 
ATOM   9333  C  CA  . GLY D 2 122 ? 8.156   56.744  -1.950  1.00 44.26 ? 122 GLY T CA  1 
ATOM   9334  C  C   . GLY D 2 122 ? 7.819   57.436  -0.644  1.00 46.22 ? 122 GLY T C   1 
ATOM   9335  O  O   . GLY D 2 122 ? 6.742   57.221  -0.095  1.00 46.91 ? 122 GLY T O   1 
ATOM   9336  N  N   . TYR D 2 123 ? 8.738   58.259  -0.147  1.00 47.37 ? 123 TYR T N   1 
ATOM   9337  C  CA  . TYR D 2 123 ? 8.545   58.995  1.099   1.00 48.21 ? 123 TYR T CA  1 
ATOM   9338  C  C   . TYR D 2 123 ? 8.846   60.468  0.904   1.00 49.13 ? 123 TYR T C   1 
ATOM   9339  O  O   . TYR D 2 123 ? 8.255   61.275  1.648   1.00 49.42 ? 123 TYR T O   1 
ATOM   9340  C  CB  . TYR D 2 123 ? 9.442   58.429  2.197   1.00 48.46 ? 123 TYR T CB  1 
ATOM   9341  C  CG  . TYR D 2 123 ? 9.042   57.045  2.654   1.00 47.98 ? 123 TYR T CG  1 
ATOM   9342  C  CD1 . TYR D 2 123 ? 7.972   56.855  3.525   1.00 48.22 ? 123 TYR T CD1 1 
ATOM   9343  C  CD2 . TYR D 2 123 ? 9.736   55.920  2.221   1.00 48.09 ? 123 TYR T CD2 1 
ATOM   9344  C  CE1 . TYR D 2 123 ? 7.611   55.572  3.957   1.00 48.07 ? 123 TYR T CE1 1 
ATOM   9345  C  CE2 . TYR D 2 123 ? 9.387   54.639  2.640   1.00 48.21 ? 123 TYR T CE2 1 
ATOM   9346  C  CZ  . TYR D 2 123 ? 8.322   54.467  3.509   1.00 48.56 ? 123 TYR T CZ  1 
ATOM   9347  O  OH  . TYR D 2 123 ? 7.965   53.198  3.926   1.00 48.98 ? 123 TYR T OH  1 
ATOM   9348  O  OXT . TYR D 2 123 ? 9.675   60.786  0.026   1.00 50.22 ? 123 TYR T OXT 1 
ATOM   9349  N  N   . GLU E 1 12  ? 37.748  15.197  84.495  1.00 38.30 ? 12  GLU C N   1 
ATOM   9350  C  CA  . GLU E 1 12  ? 37.823  16.223  85.578  1.00 38.54 ? 12  GLU C CA  1 
ATOM   9351  C  C   . GLU E 1 12  ? 38.151  17.588  84.989  1.00 35.76 ? 12  GLU C C   1 
ATOM   9352  O  O   . GLU E 1 12  ? 38.996  17.702  84.098  1.00 35.53 ? 12  GLU C O   1 
ATOM   9353  C  CB  . GLU E 1 12  ? 38.908  15.854  86.592  1.00 42.77 ? 12  GLU C CB  1 
ATOM   9354  C  CG  . GLU E 1 12  ? 38.771  14.462  87.178  1.00 48.59 ? 12  GLU C CG  1 
ATOM   9355  C  CD  . GLU E 1 12  ? 39.945  14.093  88.066  1.00 51.90 ? 12  GLU C CD  1 
ATOM   9356  O  OE1 . GLU E 1 12  ? 41.092  14.445  87.710  1.00 53.80 ? 12  GLU C OE1 1 
ATOM   9357  O  OE2 . GLU E 1 12  ? 39.722  13.442  89.111  1.00 54.70 ? 12  GLU C OE2 1 
ATOM   9358  N  N   . PHE E 1 13  ? 37.484  18.624  85.487  1.00 31.51 ? 13  PHE C N   1 
ATOM   9359  C  CA  . PHE E 1 13  ? 37.740  19.970  84.997  1.00 27.06 ? 13  PHE C CA  1 
ATOM   9360  C  C   . PHE E 1 13  ? 38.916  20.596  85.734  1.00 25.22 ? 13  PHE C C   1 
ATOM   9361  O  O   . PHE E 1 13  ? 38.905  20.725  86.958  1.00 25.08 ? 13  PHE C O   1 
ATOM   9362  C  CB  . PHE E 1 13  ? 36.502  20.854  85.158  1.00 22.60 ? 13  PHE C CB  1 
ATOM   9363  C  CG  . PHE E 1 13  ? 36.750  22.301  84.829  1.00 19.54 ? 13  PHE C CG  1 
ATOM   9364  C  CD1 . PHE E 1 13  ? 37.303  22.664  83.603  1.00 14.64 ? 13  PHE C CD1 1 
ATOM   9365  C  CD2 . PHE E 1 13  ? 36.439  23.300  85.748  1.00 17.15 ? 13  PHE C CD2 1 
ATOM   9366  C  CE1 . PHE E 1 13  ? 37.545  24.001  83.299  1.00 15.20 ? 13  PHE C CE1 1 
ATOM   9367  C  CE2 . PHE E 1 13  ? 36.676  24.640  85.451  1.00 17.42 ? 13  PHE C CE2 1 
ATOM   9368  C  CZ  . PHE E 1 13  ? 37.229  24.992  84.227  1.00 15.16 ? 13  PHE C CZ  1 
ATOM   9369  N  N   . LYS E 1 14  ? 39.925  20.985  84.964  1.00 24.36 ? 14  LYS C N   1 
ATOM   9370  C  CA  . LYS E 1 14  ? 41.133  21.604  85.497  1.00 22.91 ? 14  LYS C CA  1 
ATOM   9371  C  C   . LYS E 1 14  ? 41.320  22.944  84.796  1.00 19.94 ? 14  LYS C C   1 
ATOM   9372  O  O   . LYS E 1 14  ? 41.744  22.991  83.644  1.00 18.85 ? 14  LYS C O   1 
ATOM   9373  C  CB  . LYS E 1 14  ? 42.335  20.697  85.216  1.00 26.70 ? 14  LYS C CB  1 
ATOM   9374  C  CG  . LYS E 1 14  ? 43.683  21.209  85.709  1.00 30.37 ? 14  LYS C CG  1 
ATOM   9375  C  CD  . LYS E 1 14  ? 43.775  21.198  87.226  1.00 35.34 ? 14  LYS C CD  1 
ATOM   9376  C  CE  . LYS E 1 14  ? 45.180  20.812  87.681  1.00 38.05 ? 14  LYS C CE  1 
ATOM   9377  N  NZ  . LYS E 1 14  ? 46.242  21.626  87.022  1.00 39.53 ? 14  LYS C NZ  1 
ATOM   9378  N  N   . ALA E 1 15  ? 40.994  24.030  85.486  1.00 17.88 ? 15  ALA C N   1 
ATOM   9379  C  CA  . ALA E 1 15  ? 41.126  25.361  84.912  1.00 15.84 ? 15  ALA C CA  1 
ATOM   9380  C  C   . ALA E 1 15  ? 42.580  25.660  84.550  1.00 15.60 ? 15  ALA C C   1 
ATOM   9381  O  O   . ALA E 1 15  ? 43.508  25.134  85.166  1.00 15.10 ? 15  ALA C O   1 
ATOM   9382  C  CB  . ALA E 1 15  ? 40.606  26.406  85.893  1.00 16.80 ? 15  ALA C CB  1 
ATOM   9383  N  N   . GLY E 1 16  ? 42.779  26.501  83.543  1.00 13.40 ? 16  GLY C N   1 
ATOM   9384  C  CA  . GLY E 1 16  ? 44.132  26.839  83.153  1.00 13.66 ? 16  GLY C CA  1 
ATOM   9385  C  C   . GLY E 1 16  ? 44.411  26.686  81.673  1.00 13.38 ? 16  GLY C C   1 
ATOM   9386  O  O   . GLY E 1 16  ? 43.669  26.028  80.943  1.00 12.43 ? 16  GLY C O   1 
ATOM   9387  N  N   . VAL E 1 17  ? 45.506  27.296  81.239  1.00 13.54 ? 17  VAL C N   1 
ATOM   9388  C  CA  . VAL E 1 17  ? 45.913  27.267  79.845  1.00 14.12 ? 17  VAL C CA  1 
ATOM   9389  C  C   . VAL E 1 17  ? 46.863  26.114  79.547  1.00 15.80 ? 17  VAL C C   1 
ATOM   9390  O  O   . VAL E 1 17  ? 47.759  25.817  80.333  1.00 16.49 ? 17  VAL C O   1 
ATOM   9391  C  CB  . VAL E 1 17  ? 46.628  28.582  79.463  1.00 13.53 ? 17  VAL C CB  1 
ATOM   9392  C  CG1 . VAL E 1 17  ? 47.100  28.526  78.020  1.00 14.29 ? 17  VAL C CG1 1 
ATOM   9393  C  CG2 . VAL E 1 17  ? 45.696  29.765  79.686  1.00 14.69 ? 17  VAL C CG2 1 
ATOM   9394  N  N   . LYS E 1 18  ? 46.659  25.459  78.411  1.00 16.08 ? 18  LYS C N   1 
ATOM   9395  C  CA  . LYS E 1 18  ? 47.543  24.376  77.997  1.00 18.03 ? 18  LYS C CA  1 
ATOM   9396  C  C   . LYS E 1 18  ? 47.689  24.418  76.486  1.00 16.83 ? 18  LYS C C   1 
ATOM   9397  O  O   . LYS E 1 18  ? 46.844  24.985  75.795  1.00 17.52 ? 18  LYS C O   1 
ATOM   9398  C  CB  . LYS E 1 18  ? 47.015  23.014  78.459  1.00 21.82 ? 18  LYS C CB  1 
ATOM   9399  C  CG  . LYS E 1 18  ? 45.549  22.779  78.223  1.00 24.63 ? 18  LYS C CG  1 
ATOM   9400  C  CD  . LYS E 1 18  ? 45.348  21.436  77.563  1.00 29.70 ? 18  LYS C CD  1 
ATOM   9401  C  CE  . LYS E 1 18  ? 44.153  20.705  78.146  1.00 30.91 ? 18  LYS C CE  1 
ATOM   9402  N  NZ  . LYS E 1 18  ? 43.866  19.461  77.380  1.00 35.38 ? 18  LYS C NZ  1 
ATOM   9403  N  N   . ASP E 1 19  ? 48.770  23.841  75.973  1.00 15.47 ? 19  ASP C N   1 
ATOM   9404  C  CA  . ASP E 1 19  ? 49.016  23.854  74.537  1.00 15.46 ? 19  ASP C CA  1 
ATOM   9405  C  C   . ASP E 1 19  ? 47.877  23.280  73.711  1.00 14.11 ? 19  ASP C C   1 
ATOM   9406  O  O   . ASP E 1 19  ? 47.242  22.297  74.093  1.00 14.37 ? 19  ASP C O   1 
ATOM   9407  C  CB  . ASP E 1 19  ? 50.304  23.103  74.204  1.00 16.15 ? 19  ASP C CB  1 
ATOM   9408  C  CG  . ASP E 1 19  ? 51.516  23.704  74.881  1.00 20.47 ? 19  ASP C CG  1 
ATOM   9409  O  OD1 . ASP E 1 19  ? 51.485  24.910  75.214  1.00 20.68 ? 19  ASP C OD1 1 
ATOM   9410  O  OD2 . ASP E 1 19  ? 52.508  22.970  75.065  1.00 23.26 ? 19  ASP C OD2 1 
ATOM   9411  N  N   . TYR E 1 20  ? 47.627  23.909  72.568  1.00 14.39 ? 20  TYR C N   1 
ATOM   9412  C  CA  . TYR E 1 20  ? 46.574  23.467  71.664  1.00 12.81 ? 20  TYR C CA  1 
ATOM   9413  C  C   . TYR E 1 20  ? 46.892  22.069  71.135  1.00 12.03 ? 20  TYR C C   1 
ATOM   9414  O  O   . TYR E 1 20  ? 46.000  21.240  70.982  1.00 12.24 ? 20  TYR C O   1 
ATOM   9415  C  CB  . TYR E 1 20  ? 46.454  24.434  70.476  1.00 12.18 ? 20  TYR C CB  1 
ATOM   9416  C  CG  . TYR E 1 20  ? 45.827  25.789  70.778  1.00 12.04 ? 20  TYR C CG  1 
ATOM   9417  C  CD1 . TYR E 1 20  ? 44.458  25.912  71.000  1.00 10.77 ? 20  TYR C CD1 1 
ATOM   9418  C  CD2 . TYR E 1 20  ? 46.599  26.956  70.777  1.00 12.06 ? 20  TYR C CD2 1 
ATOM   9419  C  CE1 . TYR E 1 20  ? 43.864  27.165  71.205  1.00 12.26 ? 20  TYR C CE1 1 
ATOM   9420  C  CE2 . TYR E 1 20  ? 46.018  28.214  70.983  1.00 9.92  ? 20  TYR C CE2 1 
ATOM   9421  C  CZ  . TYR E 1 20  ? 44.649  28.309  71.192  1.00 10.88 ? 20  TYR C CZ  1 
ATOM   9422  O  OH  . TYR E 1 20  ? 44.057  29.541  71.364  1.00 9.33  ? 20  TYR C OH  1 
ATOM   9423  N  N   . LYS E 1 21  ? 48.172  21.806  70.878  1.00 13.34 ? 21  LYS C N   1 
ATOM   9424  C  CA  . LYS E 1 21  ? 48.591  20.522  70.323  1.00 13.60 ? 21  LYS C CA  1 
ATOM   9425  C  C   . LYS E 1 21  ? 48.217  19.297  71.154  1.00 13.20 ? 21  LYS C C   1 
ATOM   9426  O  O   . LYS E 1 21  ? 48.141  18.192  70.623  1.00 13.40 ? 21  LYS C O   1 
ATOM   9427  C  CB  . LYS E 1 21  ? 50.101  20.524  70.051  1.00 15.75 ? 21  LYS C CB  1 
ATOM   9428  C  CG  . LYS E 1 21  ? 50.986  20.370  71.273  1.00 19.17 ? 21  LYS C CG  1 
ATOM   9429  C  CD  . LYS E 1 21  ? 52.451  20.368  70.858  1.00 23.18 ? 21  LYS C CD  1 
ATOM   9430  C  CE  . LYS E 1 21  ? 53.334  19.711  71.906  1.00 26.58 ? 21  LYS C CE  1 
ATOM   9431  N  NZ  . LYS E 1 21  ? 53.278  20.403  73.222  1.00 31.86 ? 21  LYS C NZ  1 
ATOM   9432  N  N   . LEU E 1 22  ? 47.980  19.488  72.448  1.00 13.39 ? 22  LEU C N   1 
ATOM   9433  C  CA  . LEU E 1 22  ? 47.608  18.381  73.324  1.00 14.25 ? 22  LEU C CA  1 
ATOM   9434  C  C   . LEU E 1 22  ? 46.259  17.781  72.951  1.00 14.41 ? 22  LEU C C   1 
ATOM   9435  O  O   . LEU E 1 22  ? 45.996  16.609  73.218  1.00 14.90 ? 22  LEU C O   1 
ATOM   9436  C  CB  . LEU E 1 22  ? 47.553  18.851  74.779  1.00 16.18 ? 22  LEU C CB  1 
ATOM   9437  C  CG  . LEU E 1 22  ? 48.816  18.750  75.638  1.00 19.12 ? 22  LEU C CG  1 
ATOM   9438  C  CD1 . LEU E 1 22  ? 50.039  19.209  74.862  1.00 21.25 ? 22  LEU C CD1 1 
ATOM   9439  C  CD2 . LEU E 1 22  ? 48.623  19.592  76.893  1.00 20.30 ? 22  LEU C CD2 1 
ATOM   9440  N  N   . THR E 1 23  ? 45.406  18.587  72.329  1.00 12.95 ? 23  THR C N   1 
ATOM   9441  C  CA  . THR E 1 23  ? 44.077  18.136  71.949  1.00 13.15 ? 23  THR C CA  1 
ATOM   9442  C  C   . THR E 1 23  ? 43.808  18.213  70.452  1.00 12.23 ? 23  THR C C   1 
ATOM   9443  O  O   . THR E 1 23  ? 43.072  17.391  69.907  1.00 11.69 ? 23  THR C O   1 
ATOM   9444  C  CB  . THR E 1 23  ? 42.993  18.989  72.644  1.00 13.99 ? 23  THR C CB  1 
ATOM   9445  O  OG1 . THR E 1 23  ? 43.230  19.015  74.056  1.00 18.05 ? 23  THR C OG1 1 
ATOM   9446  C  CG2 . THR E 1 23  ? 41.608  18.419  72.368  1.00 15.24 ? 23  THR C CG2 1 
ATOM   9447  N  N   . TYR E 1 24  ? 44.416  19.194  69.790  1.00 12.01 ? 24  TYR C N   1 
ATOM   9448  C  CA  . TYR E 1 24  ? 44.174  19.414  68.371  1.00 11.82 ? 24  TYR C CA  1 
ATOM   9449  C  C   . TYR E 1 24  ? 45.201  18.943  67.343  1.00 12.50 ? 24  TYR C C   1 
ATOM   9450  O  O   . TYR E 1 24  ? 45.001  19.136  66.141  1.00 12.85 ? 24  TYR C O   1 
ATOM   9451  C  CB  . TYR E 1 24  ? 43.854  20.889  68.168  1.00 10.30 ? 24  TYR C CB  1 
ATOM   9452  C  CG  . TYR E 1 24  ? 42.593  21.305  68.899  1.00 11.26 ? 24  TYR C CG  1 
ATOM   9453  C  CD1 . TYR E 1 24  ? 41.340  21.167  68.299  1.00 8.99  ? 24  TYR C CD1 1 
ATOM   9454  C  CD2 . TYR E 1 24  ? 42.650  21.807  70.201  1.00 8.58  ? 24  TYR C CD2 1 
ATOM   9455  C  CE1 . TYR E 1 24  ? 40.173  21.515  68.976  1.00 10.21 ? 24  TYR C CE1 1 
ATOM   9456  C  CE2 . TYR E 1 24  ? 41.485  22.159  70.892  1.00 9.16  ? 24  TYR C CE2 1 
ATOM   9457  C  CZ  . TYR E 1 24  ? 40.250  22.011  70.271  1.00 10.62 ? 24  TYR C CZ  1 
ATOM   9458  O  OH  . TYR E 1 24  ? 39.091  22.355  70.934  1.00 9.62  ? 24  TYR C OH  1 
ATOM   9459  N  N   . TYR E 1 25  ? 46.295  18.338  67.797  1.00 12.13 ? 25  TYR C N   1 
ATOM   9460  C  CA  . TYR E 1 25  ? 47.286  17.801  66.868  1.00 12.59 ? 25  TYR C CA  1 
ATOM   9461  C  C   . TYR E 1 25  ? 47.156  16.285  66.970  1.00 12.59 ? 25  TYR C C   1 
ATOM   9462  O  O   . TYR E 1 25  ? 47.546  15.692  67.973  1.00 11.34 ? 25  TYR C O   1 
ATOM   9463  C  CB  . TYR E 1 25  ? 48.708  18.237  67.243  1.00 12.64 ? 25  TYR C CB  1 
ATOM   9464  C  CG  . TYR E 1 25  ? 49.769  17.627  66.349  1.00 14.58 ? 25  TYR C CG  1 
ATOM   9465  C  CD1 . TYR E 1 25  ? 49.717  17.786  64.964  1.00 13.99 ? 25  TYR C CD1 1 
ATOM   9466  C  CD2 . TYR E 1 25  ? 50.809  16.866  66.885  1.00 15.86 ? 25  TYR C CD2 1 
ATOM   9467  C  CE1 . TYR E 1 25  ? 50.671  17.198  64.133  1.00 15.22 ? 25  TYR C CE1 1 
ATOM   9468  C  CE2 . TYR E 1 25  ? 51.770  16.274  66.063  1.00 16.99 ? 25  TYR C CE2 1 
ATOM   9469  C  CZ  . TYR E 1 25  ? 51.694  16.442  64.690  1.00 16.35 ? 25  TYR C CZ  1 
ATOM   9470  O  OH  . TYR E 1 25  ? 52.625  15.835  63.876  1.00 18.19 ? 25  TYR C OH  1 
ATOM   9471  N  N   . THR E 1 26  ? 46.585  15.669  65.939  1.00 12.47 ? 26  THR C N   1 
ATOM   9472  C  CA  . THR E 1 26  ? 46.368  14.228  65.925  1.00 11.50 ? 26  THR C CA  1 
ATOM   9473  C  C   . THR E 1 26  ? 46.900  13.604  64.637  1.00 13.58 ? 26  THR C C   1 
ATOM   9474  O  O   . THR E 1 26  ? 46.139  13.296  63.718  1.00 12.58 ? 26  THR C O   1 
ATOM   9475  C  CB  . THR E 1 26  ? 44.861  13.909  66.064  1.00 12.14 ? 26  THR C CB  1 
ATOM   9476  O  OG1 . THR E 1 26  ? 44.141  14.489  64.969  1.00 12.03 ? 26  THR C OG1 1 
ATOM   9477  C  CG2 . THR E 1 26  ? 44.315  14.483  67.361  1.00 11.31 ? 26  THR C CG2 1 
ATOM   9478  N  N   . PRO E 1 27  ? 48.223  13.392  64.568  1.00 13.77 ? 27  PRO C N   1 
ATOM   9479  C  CA  . PRO E 1 27  ? 48.892  12.809  63.402  1.00 15.66 ? 27  PRO C CA  1 
ATOM   9480  C  C   . PRO E 1 27  ? 48.486  11.379  63.046  1.00 16.46 ? 27  PRO C C   1 
ATOM   9481  O  O   . PRO E 1 27  ? 48.798  10.904  61.959  1.00 19.60 ? 27  PRO C O   1 
ATOM   9482  C  CB  . PRO E 1 27  ? 50.372  12.923  63.770  1.00 15.70 ? 27  PRO C CB  1 
ATOM   9483  C  CG  . PRO E 1 27  ? 50.348  12.728  65.256  1.00 14.43 ? 27  PRO C CG  1 
ATOM   9484  C  CD  . PRO E 1 27  ? 49.184  13.606  65.666  1.00 12.94 ? 27  PRO C CD  1 
ATOM   9485  N  N   . GLU E 1 28  ? 47.787  10.689  63.940  1.00 17.42 ? 28  GLU C N   1 
ATOM   9486  C  CA  . GLU E 1 28  ? 47.383  9.318   63.642  1.00 19.49 ? 28  GLU C CA  1 
ATOM   9487  C  C   . GLU E 1 28  ? 45.947  9.229   63.126  1.00 18.13 ? 28  GLU C C   1 
ATOM   9488  O  O   . GLU E 1 28  ? 45.430  8.139   62.880  1.00 18.08 ? 28  GLU C O   1 
ATOM   9489  C  CB  . GLU E 1 28  ? 47.548  8.432   64.883  1.00 23.92 ? 28  GLU C CB  1 
ATOM   9490  C  CG  . GLU E 1 28  ? 46.541  8.681   66.006  1.00 30.48 ? 28  GLU C CG  1 
ATOM   9491  C  CD  . GLU E 1 28  ? 46.541  10.114  66.509  1.00 33.40 ? 28  GLU C CD  1 
ATOM   9492  O  OE1 . GLU E 1 28  ? 47.634  10.664  66.760  1.00 35.22 ? 28  GLU C OE1 1 
ATOM   9493  O  OE2 . GLU E 1 28  ? 45.442  10.688  66.665  1.00 37.46 ? 28  GLU C OE2 1 
ATOM   9494  N  N   . TYR E 1 29  ? 45.313  10.381  62.945  1.00 17.27 ? 29  TYR C N   1 
ATOM   9495  C  CA  . TYR E 1 29  ? 43.933  10.431  62.473  1.00 17.52 ? 29  TYR C CA  1 
ATOM   9496  C  C   . TYR E 1 29  ? 43.769  10.055  61.008  1.00 17.86 ? 29  TYR C C   1 
ATOM   9497  O  O   . TYR E 1 29  ? 44.491  10.556  60.146  1.00 18.47 ? 29  TYR C O   1 
ATOM   9498  C  CB  . TYR E 1 29  ? 43.360  11.838  62.682  1.00 16.01 ? 29  TYR C CB  1 
ATOM   9499  C  CG  . TYR E 1 29  ? 41.912  12.005  62.257  1.00 14.52 ? 29  TYR C CG  1 
ATOM   9500  C  CD1 . TYR E 1 29  ? 40.884  11.370  62.954  1.00 13.38 ? 29  TYR C CD1 1 
ATOM   9501  C  CD2 . TYR E 1 29  ? 41.570  12.823  61.177  1.00 13.62 ? 29  TYR C CD2 1 
ATOM   9502  C  CE1 . TYR E 1 29  ? 39.553  11.551  62.596  1.00 11.13 ? 29  TYR C CE1 1 
ATOM   9503  C  CE2 . TYR E 1 29  ? 40.238  13.012  60.811  1.00 11.79 ? 29  TYR C CE2 1 
ATOM   9504  C  CZ  . TYR E 1 29  ? 39.235  12.371  61.526  1.00 12.70 ? 29  TYR C CZ  1 
ATOM   9505  O  OH  . TYR E 1 29  ? 37.913  12.565  61.191  1.00 11.50 ? 29  TYR C OH  1 
ATOM   9506  N  N   . GLU E 1 30  ? 42.818  9.164   60.737  1.00 18.65 ? 30  GLU C N   1 
ATOM   9507  C  CA  . GLU E 1 30  ? 42.502  8.762   59.370  1.00 20.77 ? 30  GLU C CA  1 
ATOM   9508  C  C   . GLU E 1 30  ? 41.235  9.548   59.048  1.00 19.64 ? 30  GLU C C   1 
ATOM   9509  O  O   . GLU E 1 30  ? 40.228  9.423   59.749  1.00 19.26 ? 30  GLU C O   1 
ATOM   9510  C  CB  . GLU E 1 30  ? 42.211  7.262   59.279  1.00 25.00 ? 30  GLU C CB  1 
ATOM   9511  C  CG  . GLU E 1 30  ? 43.378  6.367   59.671  1.00 34.20 ? 30  GLU C CG  1 
ATOM   9512  C  CD  . GLU E 1 30  ? 43.086  4.895   59.431  1.00 38.91 ? 30  GLU C CD  1 
ATOM   9513  O  OE1 . GLU E 1 30  ? 43.021  4.482   58.250  1.00 41.76 ? 30  GLU C OE1 1 
ATOM   9514  O  OE2 . GLU E 1 30  ? 42.915  4.154   60.424  1.00 41.70 ? 30  GLU C OE2 1 
ATOM   9515  N  N   . THR E 1 31  ? 41.284  10.362  58.002  1.00 17.34 ? 31  THR C N   1 
ATOM   9516  C  CA  . THR E 1 31  ? 40.133  11.180  57.638  1.00 16.73 ? 31  THR C CA  1 
ATOM   9517  C  C   . THR E 1 31  ? 38.926  10.370  57.168  1.00 15.73 ? 31  THR C C   1 
ATOM   9518  O  O   . THR E 1 31  ? 39.072  9.282   56.611  1.00 16.05 ? 31  THR C O   1 
ATOM   9519  C  CB  . THR E 1 31  ? 40.507  12.196  56.545  1.00 17.04 ? 31  THR C CB  1 
ATOM   9520  O  OG1 . THR E 1 31  ? 40.919  11.501  55.363  1.00 17.62 ? 31  THR C OG1 1 
ATOM   9521  C  CG2 . THR E 1 31  ? 41.653  13.087  57.023  1.00 19.09 ? 31  THR C CG2 1 
ATOM   9522  N  N   . LEU E 1 32  ? 37.736  10.913  57.411  1.00 14.22 ? 32  LEU C N   1 
ATOM   9523  C  CA  . LEU E 1 32  ? 36.480  10.279  57.011  1.00 14.19 ? 32  LEU C CA  1 
ATOM   9524  C  C   . LEU E 1 32  ? 36.042  10.894  55.686  1.00 12.06 ? 32  LEU C C   1 
ATOM   9525  O  O   . LEU E 1 32  ? 36.371  12.039  55.402  1.00 11.23 ? 32  LEU C O   1 
ATOM   9526  C  CB  . LEU E 1 32  ? 35.396  10.537  58.059  1.00 14.70 ? 32  LEU C CB  1 
ATOM   9527  C  CG  . LEU E 1 32  ? 35.677  10.101  59.496  1.00 17.00 ? 32  LEU C CG  1 
ATOM   9528  C  CD1 . LEU E 1 32  ? 34.526  10.542  60.390  1.00 16.18 ? 32  LEU C CD1 1 
ATOM   9529  C  CD2 . LEU E 1 32  ? 35.855  8.591   59.546  1.00 16.53 ? 32  LEU C CD2 1 
ATOM   9530  N  N   . ASP E 1 33  ? 35.292  10.143  54.884  1.00 11.27 ? 33  ASP C N   1 
ATOM   9531  C  CA  . ASP E 1 33  ? 34.826  10.656  53.597  1.00 12.11 ? 33  ASP C CA  1 
ATOM   9532  C  C   . ASP E 1 33  ? 33.829  11.804  53.748  1.00 10.17 ? 33  ASP C C   1 
ATOM   9533  O  O   . ASP E 1 33  ? 33.487  12.468  52.771  1.00 11.07 ? 33  ASP C O   1 
ATOM   9534  C  CB  . ASP E 1 33  ? 34.179  9.542   52.770  1.00 16.01 ? 33  ASP C CB  1 
ATOM   9535  C  CG  . ASP E 1 33  ? 35.168  8.473   52.358  1.00 21.42 ? 33  ASP C CG  1 
ATOM   9536  O  OD1 . ASP E 1 33  ? 36.328  8.822   52.058  1.00 23.44 ? 33  ASP C OD1 1 
ATOM   9537  O  OD2 . ASP E 1 33  ? 34.782  7.285   52.323  1.00 26.06 ? 33  ASP C OD2 1 
ATOM   9538  N  N   . THR E 1 34  ? 33.367  12.033  54.973  1.00 9.38  ? 34  THR C N   1 
ATOM   9539  C  CA  . THR E 1 34  ? 32.410  13.103  55.243  1.00 8.23  ? 34  THR C CA  1 
ATOM   9540  C  C   . THR E 1 34  ? 33.071  14.357  55.827  1.00 9.48  ? 34  THR C C   1 
ATOM   9541  O  O   . THR E 1 34  ? 32.400  15.376  56.020  1.00 8.59  ? 34  THR C O   1 
ATOM   9542  C  CB  . THR E 1 34  ? 31.312  12.632  56.219  1.00 8.03  ? 34  THR C CB  1 
ATOM   9543  O  OG1 . THR E 1 34  ? 31.922  12.127  57.412  1.00 7.56  ? 34  THR C OG1 1 
ATOM   9544  C  CG2 . THR E 1 34  ? 30.458  11.533  55.586  1.00 5.58  ? 34  THR C CG2 1 
ATOM   9545  N  N   . ASP E 1 35  ? 34.374  14.284  56.109  1.00 9.29  ? 35  ASP C N   1 
ATOM   9546  C  CA  . ASP E 1 35  ? 35.096  15.429  56.670  1.00 9.42  ? 35  ASP C CA  1 
ATOM   9547  C  C   . ASP E 1 35  ? 35.405  16.467  55.602  1.00 10.41 ? 35  ASP C C   1 
ATOM   9548  O  O   . ASP E 1 35  ? 35.566  16.137  54.424  1.00 9.70  ? 35  ASP C O   1 
ATOM   9549  C  CB  . ASP E 1 35  ? 36.469  15.038  57.257  1.00 10.08 ? 35  ASP C CB  1 
ATOM   9550  C  CG  . ASP E 1 35  ? 36.386  14.190  58.517  1.00 11.43 ? 35  ASP C CG  1 
ATOM   9551  O  OD1 . ASP E 1 35  ? 35.367  14.228  59.235  1.00 12.54 ? 35  ASP C OD1 1 
ATOM   9552  O  OD2 . ASP E 1 35  ? 37.385  13.492  58.798  1.00 13.13 ? 35  ASP C OD2 1 
ATOM   9553  N  N   . ILE E 1 36  ? 35.491  17.724  56.024  1.00 9.06  ? 36  ILE C N   1 
ATOM   9554  C  CA  . ILE E 1 36  ? 35.894  18.796  55.130  1.00 9.07  ? 36  ILE C CA  1 
ATOM   9555  C  C   . ILE E 1 36  ? 37.384  18.916  55.468  1.00 8.62  ? 36  ILE C C   1 
ATOM   9556  O  O   . ILE E 1 36  ? 37.746  19.068  56.636  1.00 10.21 ? 36  ILE C O   1 
ATOM   9557  C  CB  . ILE E 1 36  ? 35.186  20.136  55.445  1.00 10.89 ? 36  ILE C CB  1 
ATOM   9558  C  CG1 . ILE E 1 36  ? 33.734  20.091  54.946  1.00 12.68 ? 36  ILE C CG1 1 
ATOM   9559  C  CG2 . ILE E 1 36  ? 35.947  21.289  54.802  1.00 9.36  ? 36  ILE C CG2 1 
ATOM   9560  C  CD1 . ILE E 1 36  ? 33.016  21.442  54.962  1.00 14.60 ? 36  ILE C CD1 1 
ATOM   9561  N  N   . LEU E 1 37  ? 38.250  18.806  54.465  1.00 8.07  ? 37  LEU C N   1 
ATOM   9562  C  CA  . LEU E 1 37  ? 39.688  18.890  54.707  1.00 8.25  ? 37  LEU C CA  1 
ATOM   9563  C  C   . LEU E 1 37  ? 40.232  20.215  54.192  1.00 8.93  ? 37  LEU C C   1 
ATOM   9564  O  O   . LEU E 1 37  ? 39.817  20.701  53.137  1.00 10.48 ? 37  LEU C O   1 
ATOM   9565  C  CB  . LEU E 1 37  ? 40.419  17.725  54.023  1.00 6.34  ? 37  LEU C CB  1 
ATOM   9566  C  CG  . LEU E 1 37  ? 39.881  16.305  54.253  1.00 6.59  ? 37  LEU C CG  1 
ATOM   9567  C  CD1 . LEU E 1 37  ? 40.713  15.311  53.446  1.00 6.40  ? 37  LEU C CD1 1 
ATOM   9568  C  CD2 . LEU E 1 37  ? 39.924  15.950  55.735  1.00 7.14  ? 37  LEU C CD2 1 
ATOM   9569  N  N   . ALA E 1 38  ? 41.159  20.799  54.943  1.00 7.69  ? 38  ALA C N   1 
ATOM   9570  C  CA  . ALA E 1 38  ? 41.754  22.075  54.564  1.00 7.80  ? 38  ALA C CA  1 
ATOM   9571  C  C   . ALA E 1 38  ? 43.279  22.013  54.557  1.00 8.07  ? 38  ALA C C   1 
ATOM   9572  O  O   . ALA E 1 38  ? 43.887  21.379  55.418  1.00 10.12 ? 38  ALA C O   1 
ATOM   9573  C  CB  . ALA E 1 38  ? 41.286  23.165  55.518  1.00 4.51  ? 38  ALA C CB  1 
ATOM   9574  N  N   . ALA E 1 39  ? 43.889  22.667  53.573  1.00 7.96  ? 39  ALA C N   1 
ATOM   9575  C  CA  . ALA E 1 39  ? 45.344  22.718  53.457  1.00 7.50  ? 39  ALA C CA  1 
ATOM   9576  C  C   . ALA E 1 39  ? 45.762  24.164  53.674  1.00 8.81  ? 39  ALA C C   1 
ATOM   9577  O  O   . ALA E 1 39  ? 45.529  25.015  52.817  1.00 9.57  ? 39  ALA C O   1 
ATOM   9578  C  CB  . ALA E 1 39  ? 45.786  22.246  52.076  1.00 5.41  ? 39  ALA C CB  1 
ATOM   9579  N  N   . PHE E 1 40  ? 46.369  24.432  54.829  1.00 9.28  ? 40  PHE C N   1 
ATOM   9580  C  CA  . PHE E 1 40  ? 46.822  25.774  55.197  1.00 7.87  ? 40  PHE C CA  1 
ATOM   9581  C  C   . PHE E 1 40  ? 48.327  25.938  55.034  1.00 8.18  ? 40  PHE C C   1 
ATOM   9582  O  O   . PHE E 1 40  ? 49.096  25.070  55.440  1.00 7.27  ? 40  PHE C O   1 
ATOM   9583  C  CB  . PHE E 1 40  ? 46.511  26.064  56.672  1.00 8.51  ? 40  PHE C CB  1 
ATOM   9584  C  CG  . PHE E 1 40  ? 45.069  26.374  56.963  1.00 8.33  ? 40  PHE C CG  1 
ATOM   9585  C  CD1 . PHE E 1 40  ? 44.555  27.647  56.737  1.00 7.90  ? 40  PHE C CD1 1 
ATOM   9586  C  CD2 . PHE E 1 40  ? 44.239  25.406  57.524  1.00 7.51  ? 40  PHE C CD2 1 
ATOM   9587  C  CE1 . PHE E 1 40  ? 43.231  27.953  57.073  1.00 8.77  ? 40  PHE C CE1 1 
ATOM   9588  C  CE2 . PHE E 1 40  ? 42.917  25.697  57.864  1.00 9.83  ? 40  PHE C CE2 1 
ATOM   9589  C  CZ  . PHE E 1 40  ? 42.411  26.976  57.640  1.00 7.30  ? 40  PHE C CZ  1 
ATOM   9590  N  N   . ARG E 1 41  ? 48.745  27.058  54.453  1.00 7.26  ? 41  ARG C N   1 
ATOM   9591  C  CA  . ARG E 1 41  ? 50.168  27.351  54.314  1.00 8.10  ? 41  ARG C CA  1 
ATOM   9592  C  C   . ARG E 1 41  ? 50.441  28.205  55.557  1.00 8.28  ? 41  ARG C C   1 
ATOM   9593  O  O   . ARG E 1 41  ? 50.039  29.368  55.623  1.00 8.61  ? 41  ARG C O   1 
ATOM   9594  C  CB  . ARG E 1 41  ? 50.439  28.152  53.041  1.00 7.27  ? 41  ARG C CB  1 
ATOM   9595  C  CG  . ARG E 1 41  ? 51.919  28.471  52.820  1.00 6.81  ? 41  ARG C CG  1 
ATOM   9596  C  CD  . ARG E 1 41  ? 52.104  29.416  51.641  1.00 9.37  ? 41  ARG C CD  1 
ATOM   9597  N  NE  . ARG E 1 41  ? 51.720  28.797  50.376  1.00 11.61 ? 41  ARG C NE  1 
ATOM   9598  C  CZ  . ARG E 1 41  ? 52.508  28.010  49.649  1.00 14.42 ? 41  ARG C CZ  1 
ATOM   9599  N  NH1 . ARG E 1 41  ? 53.743  27.739  50.053  1.00 14.28 ? 41  ARG C NH1 1 
ATOM   9600  N  NH2 . ARG E 1 41  ? 52.057  27.489  48.513  1.00 12.51 ? 41  ARG C NH2 1 
ATOM   9601  N  N   . VAL E 1 42  ? 51.116  27.614  56.538  1.00 8.18  ? 42  VAL C N   1 
ATOM   9602  C  CA  . VAL E 1 42  ? 51.393  28.268  57.817  1.00 8.45  ? 42  VAL C CA  1 
ATOM   9603  C  C   . VAL E 1 42  ? 52.816  28.797  58.022  1.00 9.06  ? 42  VAL C C   1 
ATOM   9604  O  O   . VAL E 1 42  ? 53.792  28.080  57.789  1.00 8.24  ? 42  VAL C O   1 
ATOM   9605  C  CB  . VAL E 1 42  ? 51.076  27.289  58.977  1.00 8.43  ? 42  VAL C CB  1 
ATOM   9606  C  CG1 . VAL E 1 42  ? 51.134  28.012  60.310  1.00 10.76 ? 42  VAL C CG1 1 
ATOM   9607  C  CG2 . VAL E 1 42  ? 49.709  26.654  58.759  1.00 8.68  ? 42  VAL C CG2 1 
ATOM   9608  N  N   . SER E 1 43  ? 52.919  30.044  58.485  1.00 7.64  ? 43  SER C N   1 
ATOM   9609  C  CA  . SER E 1 43  ? 54.209  30.686  58.763  1.00 9.43  ? 43  SER C CA  1 
ATOM   9610  C  C   . SER E 1 43  ? 54.192  31.117  60.227  1.00 9.77  ? 43  SER C C   1 
ATOM   9611  O  O   . SER E 1 43  ? 53.736  32.213  60.550  1.00 11.83 ? 43  SER C O   1 
ATOM   9612  C  CB  . SER E 1 43  ? 54.413  31.923  57.882  1.00 7.61  ? 43  SER C CB  1 
ATOM   9613  O  OG  . SER E 1 43  ? 54.379  31.599  56.506  1.00 10.21 ? 43  SER C OG  1 
ATOM   9614  N  N   . PRO E 1 44  ? 54.691  30.260  61.131  1.00 10.61 ? 44  PRO C N   1 
ATOM   9615  C  CA  . PRO E 1 44  ? 54.722  30.553  62.569  1.00 11.48 ? 44  PRO C CA  1 
ATOM   9616  C  C   . PRO E 1 44  ? 55.684  31.665  62.960  1.00 11.75 ? 44  PRO C C   1 
ATOM   9617  O  O   . PRO E 1 44  ? 56.615  31.981  62.221  1.00 11.71 ? 44  PRO C O   1 
ATOM   9618  C  CB  . PRO E 1 44  ? 55.155  29.218  63.194  1.00 11.25 ? 44  PRO C CB  1 
ATOM   9619  C  CG  . PRO E 1 44  ? 54.936  28.195  62.104  1.00 11.77 ? 44  PRO C CG  1 
ATOM   9620  C  CD  . PRO E 1 44  ? 55.297  28.948  60.862  1.00 10.33 ? 44  PRO C CD  1 
ATOM   9621  N  N   . GLN E 1 45  ? 55.452  32.258  64.128  1.00 12.12 ? 45  GLN C N   1 
ATOM   9622  C  CA  . GLN E 1 45  ? 56.341  33.293  64.646  1.00 12.82 ? 45  GLN C CA  1 
ATOM   9623  C  C   . GLN E 1 45  ? 57.573  32.535  65.140  1.00 13.45 ? 45  GLN C C   1 
ATOM   9624  O  O   . GLN E 1 45  ? 57.496  31.339  65.440  1.00 12.71 ? 45  GLN C O   1 
ATOM   9625  C  CB  . GLN E 1 45  ? 55.701  34.027  65.831  1.00 12.74 ? 45  GLN C CB  1 
ATOM   9626  C  CG  . GLN E 1 45  ? 54.594  35.009  65.472  1.00 14.59 ? 45  GLN C CG  1 
ATOM   9627  C  CD  . GLN E 1 45  ? 55.132  36.324  64.941  1.00 15.81 ? 45  GLN C CD  1 
ATOM   9628  O  OE1 . GLN E 1 45  ? 56.345  36.529  64.873  1.00 16.10 ? 45  GLN C OE1 1 
ATOM   9629  N  NE2 . GLN E 1 45  ? 54.230  37.229  64.572  1.00 16.18 ? 45  GLN C NE2 1 
ATOM   9630  N  N   . PRO E 1 46  ? 58.729  33.207  65.221  1.00 14.67 ? 46  PRO C N   1 
ATOM   9631  C  CA  . PRO E 1 46  ? 59.919  32.496  65.700  1.00 16.29 ? 46  PRO C CA  1 
ATOM   9632  C  C   . PRO E 1 46  ? 59.675  31.917  67.095  1.00 17.18 ? 46  PRO C C   1 
ATOM   9633  O  O   . PRO E 1 46  ? 59.171  32.611  67.981  1.00 16.69 ? 46  PRO C O   1 
ATOM   9634  C  CB  . PRO E 1 46  ? 60.988  33.585  65.705  1.00 15.87 ? 46  PRO C CB  1 
ATOM   9635  C  CG  . PRO E 1 46  ? 60.576  34.455  64.559  1.00 16.41 ? 46  PRO C CG  1 
ATOM   9636  C  CD  . PRO E 1 46  ? 59.074  34.562  64.756  1.00 15.35 ? 46  PRO C CD  1 
ATOM   9637  N  N   . GLY E 1 47  ? 60.014  30.645  67.285  1.00 17.31 ? 47  GLY C N   1 
ATOM   9638  C  CA  . GLY E 1 47  ? 59.821  30.031  68.587  1.00 17.41 ? 47  GLY C CA  1 
ATOM   9639  C  C   . GLY E 1 47  ? 58.523  29.263  68.762  1.00 18.45 ? 47  GLY C C   1 
ATOM   9640  O  O   . GLY E 1 47  ? 58.292  28.665  69.810  1.00 21.51 ? 47  GLY C O   1 
ATOM   9641  N  N   . VAL E 1 48  ? 57.659  29.284  67.755  1.00 17.32 ? 48  VAL C N   1 
ATOM   9642  C  CA  . VAL E 1 48  ? 56.399  28.550  67.838  1.00 16.28 ? 48  VAL C CA  1 
ATOM   9643  C  C   . VAL E 1 48  ? 56.539  27.299  66.978  1.00 16.09 ? 48  VAL C C   1 
ATOM   9644  O  O   . VAL E 1 48  ? 56.685  27.389  65.760  1.00 15.61 ? 48  VAL C O   1 
ATOM   9645  C  CB  . VAL E 1 48  ? 55.209  29.390  67.315  1.00 16.45 ? 48  VAL C CB  1 
ATOM   9646  C  CG1 . VAL E 1 48  ? 53.918  28.590  67.431  1.00 15.15 ? 48  VAL C CG1 1 
ATOM   9647  C  CG2 . VAL E 1 48  ? 55.099  30.687  68.108  1.00 17.28 ? 48  VAL C CG2 1 
ATOM   9648  N  N   . PRO E 1 49  ? 56.510  26.113  67.603  1.00 16.73 ? 49  PRO C N   1 
ATOM   9649  C  CA  . PRO E 1 49  ? 56.640  24.853  66.861  1.00 16.81 ? 49  PRO C CA  1 
ATOM   9650  C  C   . PRO E 1 49  ? 55.523  24.708  65.830  1.00 16.60 ? 49  PRO C C   1 
ATOM   9651  O  O   . PRO E 1 49  ? 54.401  25.169  66.052  1.00 15.25 ? 49  PRO C O   1 
ATOM   9652  C  CB  . PRO E 1 49  ? 56.537  23.787  67.955  1.00 17.90 ? 49  PRO C CB  1 
ATOM   9653  C  CG  . PRO E 1 49  ? 56.960  24.506  69.199  1.00 19.41 ? 49  PRO C CG  1 
ATOM   9654  C  CD  . PRO E 1 49  ? 56.317  25.855  69.040  1.00 17.94 ? 49  PRO C CD  1 
ATOM   9655  N  N   . PRO E 1 50  ? 55.816  24.073  64.685  1.00 16.92 ? 50  PRO C N   1 
ATOM   9656  C  CA  . PRO E 1 50  ? 54.762  23.914  63.679  1.00 16.66 ? 50  PRO C CA  1 
ATOM   9657  C  C   . PRO E 1 50  ? 53.562  23.104  64.180  1.00 16.86 ? 50  PRO C C   1 
ATOM   9658  O  O   . PRO E 1 50  ? 52.438  23.334  63.740  1.00 18.43 ? 50  PRO C O   1 
ATOM   9659  C  CB  . PRO E 1 50  ? 55.493  23.252  62.503  1.00 16.71 ? 50  PRO C CB  1 
ATOM   9660  C  CG  . PRO E 1 50  ? 56.661  22.565  63.146  1.00 16.61 ? 50  PRO C CG  1 
ATOM   9661  C  CD  . PRO E 1 50  ? 57.106  23.565  64.185  1.00 16.60 ? 50  PRO C CD  1 
ATOM   9662  N  N   . GLU E 1 51  ? 53.794  22.170  65.102  1.00 15.98 ? 51  GLU C N   1 
ATOM   9663  C  CA  . GLU E 1 51  ? 52.701  21.356  65.643  1.00 16.46 ? 51  GLU C CA  1 
ATOM   9664  C  C   . GLU E 1 51  ? 51.726  22.220  66.438  1.00 15.24 ? 51  GLU C C   1 
ATOM   9665  O  O   . GLU E 1 51  ? 50.510  22.012  66.392  1.00 14.61 ? 51  GLU C O   1 
ATOM   9666  C  CB  . GLU E 1 51  ? 53.225  20.254  66.575  1.00 17.99 ? 51  GLU C CB  1 
ATOM   9667  C  CG  . GLU E 1 51  ? 54.088  19.187  65.930  1.00 21.47 ? 51  GLU C CG  1 
ATOM   9668  C  CD  . GLU E 1 51  ? 55.492  19.671  65.625  1.00 25.20 ? 51  GLU C CD  1 
ATOM   9669  O  OE1 . GLU E 1 51  ? 55.957  20.619  66.296  1.00 22.80 ? 51  GLU C OE1 1 
ATOM   9670  O  OE2 . GLU E 1 51  ? 56.138  19.089  64.727  1.00 28.04 ? 51  GLU C OE2 1 
ATOM   9671  N  N   . GLU E 1 52  ? 52.268  23.177  67.185  1.00 13.52 ? 52  GLU C N   1 
ATOM   9672  C  CA  . GLU E 1 52  ? 51.447  24.064  67.997  1.00 13.28 ? 52  GLU C CA  1 
ATOM   9673  C  C   . GLU E 1 52  ? 50.706  25.057  67.107  1.00 12.45 ? 52  GLU C C   1 
ATOM   9674  O  O   . GLU E 1 52  ? 49.527  25.348  67.332  1.00 12.33 ? 52  GLU C O   1 
ATOM   9675  C  CB  . GLU E 1 52  ? 52.326  24.801  69.014  1.00 12.63 ? 52  GLU C CB  1 
ATOM   9676  C  CG  . GLU E 1 52  ? 51.579  25.716  69.991  1.00 12.84 ? 52  GLU C CG  1 
ATOM   9677  C  CD  . GLU E 1 52  ? 50.510  24.997  70.802  1.00 11.62 ? 52  GLU C CD  1 
ATOM   9678  O  OE1 . GLU E 1 52  ? 50.496  23.749  70.827  1.00 12.54 ? 52  GLU C OE1 1 
ATOM   9679  O  OE2 . GLU E 1 52  ? 49.681  25.689  71.429  1.00 13.92 ? 52  GLU C OE2 1 
ATOM   9680  N  N   . ALA E 1 53  ? 51.394  25.565  66.089  1.00 11.86 ? 53  ALA C N   1 
ATOM   9681  C  CA  . ALA E 1 53  ? 50.784  26.521  65.169  1.00 12.01 ? 53  ALA C CA  1 
ATOM   9682  C  C   . ALA E 1 53  ? 49.625  25.865  64.423  1.00 11.92 ? 53  ALA C C   1 
ATOM   9683  O  O   . ALA E 1 53  ? 48.550  26.453  64.284  1.00 11.47 ? 53  ALA C O   1 
ATOM   9684  C  CB  . ALA E 1 53  ? 51.825  27.039  64.181  1.00 10.69 ? 53  ALA C CB  1 
ATOM   9685  N  N   . GLY E 1 54  ? 49.850  24.647  63.941  1.00 11.16 ? 54  GLY C N   1 
ATOM   9686  C  CA  . GLY E 1 54  ? 48.809  23.932  63.225  1.00 10.45 ? 54  GLY C CA  1 
ATOM   9687  C  C   . GLY E 1 54  ? 47.644  23.583  64.132  1.00 12.20 ? 54  GLY C C   1 
ATOM   9688  O  O   . GLY E 1 54  ? 46.485  23.622  63.711  1.00 11.83 ? 54  GLY C O   1 
ATOM   9689  N  N   . ALA E 1 55  ? 47.945  23.239  65.381  1.00 10.65 ? 55  ALA C N   1 
ATOM   9690  C  CA  . ALA E 1 55  ? 46.904  22.890  66.342  1.00 10.89 ? 55  ALA C CA  1 
ATOM   9691  C  C   . ALA E 1 55  ? 46.076  24.121  66.712  1.00 11.48 ? 55  ALA C C   1 
ATOM   9692  O  O   . ALA E 1 55  ? 44.867  24.014  66.940  1.00 11.34 ? 55  ALA C O   1 
ATOM   9693  C  CB  . ALA E 1 55  ? 47.527  22.279  67.594  1.00 9.14  ? 55  ALA C CB  1 
ATOM   9694  N  N   . ALA E 1 56  ? 46.724  25.284  66.777  1.00 9.11  ? 56  ALA C N   1 
ATOM   9695  C  CA  . ALA E 1 56  ? 46.026  26.526  67.109  1.00 9.38  ? 56  ALA C CA  1 
ATOM   9696  C  C   . ALA E 1 56  ? 45.026  26.842  66.006  1.00 9.57  ? 56  ALA C C   1 
ATOM   9697  O  O   . ALA E 1 56  ? 43.890  27.245  66.272  1.00 10.25 ? 56  ALA C O   1 
ATOM   9698  C  CB  . ALA E 1 56  ? 47.019  27.679  67.258  1.00 7.57  ? 56  ALA C CB  1 
ATOM   9699  N  N   . VAL E 1 57  ? 45.452  26.660  64.762  1.00 8.04  ? 57  VAL C N   1 
ATOM   9700  C  CA  . VAL E 1 57  ? 44.572  26.923  63.633  1.00 8.61  ? 57  VAL C CA  1 
ATOM   9701  C  C   . VAL E 1 57  ? 43.364  25.991  63.696  1.00 9.31  ? 57  VAL C C   1 
ATOM   9702  O  O   . VAL E 1 57  ? 42.224  26.431  63.542  1.00 9.72  ? 57  VAL C O   1 
ATOM   9703  C  CB  . VAL E 1 57  ? 45.317  26.731  62.291  1.00 7.93  ? 57  VAL C CB  1 
ATOM   9704  C  CG1 . VAL E 1 57  ? 44.342  26.834  61.127  1.00 8.03  ? 57  VAL C CG1 1 
ATOM   9705  C  CG2 . VAL E 1 57  ? 46.399  27.793  62.151  1.00 6.83  ? 57  VAL C CG2 1 
ATOM   9706  N  N   . ALA E 1 58  ? 43.613  24.707  63.942  1.00 7.08  ? 58  ALA C N   1 
ATOM   9707  C  CA  . ALA E 1 58  ? 42.531  23.729  64.016  1.00 8.33  ? 58  ALA C CA  1 
ATOM   9708  C  C   . ALA E 1 58  ? 41.550  24.017  65.151  1.00 7.15  ? 58  ALA C C   1 
ATOM   9709  O  O   . ALA E 1 58  ? 40.336  23.941  64.967  1.00 8.75  ? 58  ALA C O   1 
ATOM   9710  C  CB  . ALA E 1 58  ? 43.107  22.320  64.173  1.00 7.04  ? 58  ALA C CB  1 
ATOM   9711  N  N   . ALA E 1 59  ? 42.076  24.349  66.325  1.00 6.74  ? 59  ALA C N   1 
ATOM   9712  C  CA  . ALA E 1 59  ? 41.235  24.624  67.483  1.00 5.53  ? 59  ALA C CA  1 
ATOM   9713  C  C   . ALA E 1 59  ? 40.347  25.853  67.342  1.00 6.77  ? 59  ALA C C   1 
ATOM   9714  O  O   . ALA E 1 59  ? 39.126  25.773  67.480  1.00 8.13  ? 59  ALA C O   1 
ATOM   9715  C  CB  . ALA E 1 59  ? 42.103  24.770  68.721  1.00 5.84  ? 59  ALA C CB  1 
ATOM   9716  N  N   . GLU E 1 60  ? 40.967  26.995  67.079  1.00 6.63  ? 60  GLU C N   1 
ATOM   9717  C  CA  . GLU E 1 60  ? 40.235  28.247  66.968  1.00 8.11  ? 60  GLU C CA  1 
ATOM   9718  C  C   . GLU E 1 60  ? 39.360  28.385  65.725  1.00 8.75  ? 60  GLU C C   1 
ATOM   9719  O  O   . GLU E 1 60  ? 38.724  29.419  65.524  1.00 10.00 ? 60  GLU C O   1 
ATOM   9720  C  CB  . GLU E 1 60  ? 41.219  29.414  67.073  1.00 9.12  ? 60  GLU C CB  1 
ATOM   9721  C  CG  . GLU E 1 60  ? 41.942  29.465  68.418  1.00 10.60 ? 60  GLU C CG  1 
ATOM   9722  C  CD  . GLU E 1 60  ? 41.213  30.300  69.470  1.00 11.78 ? 60  GLU C CD  1 
ATOM   9723  O  OE1 . GLU E 1 60  ? 40.167  30.897  69.144  1.00 9.32  ? 60  GLU C OE1 1 
ATOM   9724  O  OE2 . GLU E 1 60  ? 41.696  30.370  70.624  1.00 11.75 ? 60  GLU C OE2 1 
ATOM   9725  N  N   . SER E 1 61  ? 39.327  27.356  64.886  1.00 8.70  ? 61  SER C N   1 
ATOM   9726  C  CA  . SER E 1 61  ? 38.475  27.396  63.703  1.00 8.31  ? 61  SER C CA  1 
ATOM   9727  C  C   . SER E 1 61  ? 37.409  26.305  63.818  1.00 8.59  ? 61  SER C C   1 
ATOM   9728  O  O   . SER E 1 61  ? 36.681  26.029  62.864  1.00 9.00  ? 61  SER C O   1 
ATOM   9729  C  CB  . SER E 1 61  ? 39.295  27.203  62.419  1.00 8.06  ? 61  SER C CB  1 
ATOM   9730  O  OG  . SER E 1 61  ? 39.890  25.916  62.353  1.00 8.67  ? 61  SER C OG  1 
ATOM   9731  N  N   . SER E 1 62  ? 37.315  25.692  64.995  1.00 7.48  ? 62  SER C N   1 
ATOM   9732  C  CA  . SER E 1 62  ? 36.338  24.636  65.207  1.00 8.47  ? 62  SER C CA  1 
ATOM   9733  C  C   . SER E 1 62  ? 35.632  24.649  66.563  1.00 8.95  ? 62  SER C C   1 
ATOM   9734  O  O   . SER E 1 62  ? 34.470  25.041  66.651  1.00 10.27 ? 62  SER C O   1 
ATOM   9735  C  CB  . SER E 1 62  ? 36.982  23.260  64.976  1.00 7.84  ? 62  SER C CB  1 
ATOM   9736  O  OG  . SER E 1 62  ? 38.001  22.979  65.920  1.00 9.80  ? 62  SER C OG  1 
ATOM   9737  N  N   . THR E 1 63  ? 36.328  24.241  67.620  1.00 8.82  ? 63  THR C N   1 
ATOM   9738  C  CA  . THR E 1 63  ? 35.699  24.163  68.935  1.00 9.16  ? 63  THR C CA  1 
ATOM   9739  C  C   . THR E 1 63  ? 36.402  24.794  70.132  1.00 10.24 ? 63  THR C C   1 
ATOM   9740  O  O   . THR E 1 63  ? 35.765  25.044  71.154  1.00 9.93  ? 63  THR C O   1 
ATOM   9741  C  CB  . THR E 1 63  ? 35.450  22.694  69.320  1.00 10.20 ? 63  THR C CB  1 
ATOM   9742  O  OG1 . THR E 1 63  ? 36.696  21.985  69.294  1.00 11.34 ? 63  THR C OG1 1 
ATOM   9743  C  CG2 . THR E 1 63  ? 34.483  22.038  68.348  1.00 11.06 ? 63  THR C CG2 1 
ATOM   9744  N  N   . GLY E 1 64  ? 37.698  25.055  70.024  1.00 10.76 ? 64  GLY C N   1 
ATOM   9745  C  CA  . GLY E 1 64  ? 38.396  25.586  71.179  1.00 10.18 ? 64  GLY C CA  1 
ATOM   9746  C  C   . GLY E 1 64  ? 38.703  27.061  71.283  1.00 10.32 ? 64  GLY C C   1 
ATOM   9747  O  O   . GLY E 1 64  ? 38.477  27.839  70.358  1.00 11.54 ? 64  GLY C O   1 
ATOM   9748  N  N   . THR E 1 65  ? 39.201  27.442  72.456  1.00 9.45  ? 65  THR C N   1 
ATOM   9749  C  CA  . THR E 1 65  ? 39.606  28.811  72.716  1.00 8.96  ? 65  THR C CA  1 
ATOM   9750  C  C   . THR E 1 65  ? 40.932  28.786  73.486  1.00 8.56  ? 65  THR C C   1 
ATOM   9751  O  O   . THR E 1 65  ? 41.531  27.720  73.649  1.00 7.96  ? 65  THR C O   1 
ATOM   9752  C  CB  . THR E 1 65  ? 38.515  29.607  73.476  1.00 8.96  ? 65  THR C CB  1 
ATOM   9753  O  OG1 . THR E 1 65  ? 38.936  30.971  73.598  1.00 9.06  ? 65  THR C OG1 1 
ATOM   9754  C  CG2 . THR E 1 65  ? 38.245  29.009  74.857  1.00 8.28  ? 65  THR C CG2 1 
ATOM   9755  N  N   . TRP E 1 66  ? 41.379  29.945  73.962  1.00 8.11  ? 66  TRP C N   1 
ATOM   9756  C  CA  . TRP E 1 66  ? 42.673  30.071  74.637  1.00 7.14  ? 66  TRP C CA  1 
ATOM   9757  C  C   . TRP E 1 66  ? 42.909  29.444  76.008  1.00 8.30  ? 66  TRP C C   1 
ATOM   9758  O  O   . TRP E 1 66  ? 44.059  29.328  76.434  1.00 6.62  ? 66  TRP C O   1 
ATOM   9759  C  CB  . TRP E 1 66  ? 43.062  31.542  74.730  1.00 6.45  ? 66  TRP C CB  1 
ATOM   9760  C  CG  . TRP E 1 66  ? 42.216  32.310  75.690  1.00 6.88  ? 66  TRP C CG  1 
ATOM   9761  C  CD1 . TRP E 1 66  ? 40.959  32.785  75.472  1.00 6.84  ? 66  TRP C CD1 1 
ATOM   9762  C  CD2 . TRP E 1 66  ? 42.560  32.677  77.033  1.00 7.37  ? 66  TRP C CD2 1 
ATOM   9763  N  NE1 . TRP E 1 66  ? 40.494  33.428  76.594  1.00 9.19  ? 66  TRP C NE1 1 
ATOM   9764  C  CE2 . TRP E 1 66  ? 41.456  33.376  77.568  1.00 7.51  ? 66  TRP C CE2 1 
ATOM   9765  C  CE3 . TRP E 1 66  ? 43.693  32.482  77.835  1.00 7.53  ? 66  TRP C CE3 1 
ATOM   9766  C  CZ2 . TRP E 1 66  ? 41.451  33.884  78.875  1.00 7.36  ? 66  TRP C CZ2 1 
ATOM   9767  C  CZ3 . TRP E 1 66  ? 43.687  32.990  79.137  1.00 8.61  ? 66  TRP C CZ3 1 
ATOM   9768  C  CH2 . TRP E 1 66  ? 42.570  33.682  79.640  1.00 8.23  ? 66  TRP C CH2 1 
ATOM   9769  N  N   . THR E 1 67  ? 41.850  29.067  76.709  1.00 8.77  ? 67  THR C N   1 
ATOM   9770  C  CA  . THR E 1 67  ? 42.002  28.462  78.027  1.00 9.62  ? 67  THR C CA  1 
ATOM   9771  C  C   . THR E 1 67  ? 40.973  27.345  78.166  1.00 11.30 ? 67  THR C C   1 
ATOM   9772  O  O   . THR E 1 67  ? 40.007  27.295  77.411  1.00 10.91 ? 67  THR C O   1 
ATOM   9773  C  CB  . THR E 1 67  ? 41.817  29.515  79.158  1.00 11.04 ? 67  THR C CB  1 
ATOM   9774  O  OG1 . THR E 1 67  ? 42.204  28.950  80.419  1.00 9.09  ? 67  THR C OG1 1 
ATOM   9775  C  CG2 . THR E 1 67  ? 40.361  29.980  79.239  1.00 9.50  ? 67  THR C CG2 1 
ATOM   9776  N  N   . THR E 1 68  ? 41.188  26.447  79.119  1.00 12.06 ? 68  THR C N   1 
ATOM   9777  C  CA  . THR E 1 68  ? 40.278  25.324  79.323  1.00 11.45 ? 68  THR C CA  1 
ATOM   9778  C  C   . THR E 1 68  ? 38.927  25.762  79.885  1.00 11.73 ? 68  THR C C   1 
ATOM   9779  O  O   . THR E 1 68  ? 38.864  26.556  80.824  1.00 13.54 ? 68  THR C O   1 
ATOM   9780  C  CB  . THR E 1 68  ? 40.902  24.280  80.279  1.00 13.24 ? 68  THR C CB  1 
ATOM   9781  O  OG1 . THR E 1 68  ? 42.165  23.849  79.758  1.00 13.64 ? 68  THR C OG1 1 
ATOM   9782  C  CG2 . THR E 1 68  ? 39.993  23.070  80.421  1.00 13.71 ? 68  THR C CG2 1 
ATOM   9783  N  N   . VAL E 1 69  ? 37.847  25.245  79.301  1.00 12.14 ? 69  VAL C N   1 
ATOM   9784  C  CA  . VAL E 1 69  ? 36.497  25.565  79.755  1.00 10.30 ? 69  VAL C CA  1 
ATOM   9785  C  C   . VAL E 1 69  ? 35.810  24.275  80.203  1.00 11.16 ? 69  VAL C C   1 
ATOM   9786  O  O   . VAL E 1 69  ? 36.009  23.221  79.600  1.00 11.22 ? 69  VAL C O   1 
ATOM   9787  C  CB  . VAL E 1 69  ? 35.673  26.252  78.634  1.00 11.53 ? 69  VAL C CB  1 
ATOM   9788  C  CG1 . VAL E 1 69  ? 36.315  27.595  78.273  1.00 8.21  ? 69  VAL C CG1 1 
ATOM   9789  C  CG2 . VAL E 1 69  ? 35.596  25.351  77.403  1.00 10.39 ? 69  VAL C CG2 1 
ATOM   9790  N  N   . TRP E 1 70  ? 35.008  24.357  81.261  1.00 10.54 ? 70  TRP C N   1 
ATOM   9791  C  CA  . TRP E 1 70  ? 34.329  23.180  81.793  1.00 10.19 ? 70  TRP C CA  1 
ATOM   9792  C  C   . TRP E 1 70  ? 33.239  22.616  80.888  1.00 10.47 ? 70  TRP C C   1 
ATOM   9793  O  O   . TRP E 1 70  ? 32.937  21.422  80.939  1.00 12.77 ? 70  TRP C O   1 
ATOM   9794  C  CB  . TRP E 1 70  ? 33.729  23.484  83.173  1.00 8.35  ? 70  TRP C CB  1 
ATOM   9795  C  CG  . TRP E 1 70  ? 32.609  24.487  83.158  1.00 8.71  ? 70  TRP C CG  1 
ATOM   9796  C  CD1 . TRP E 1 70  ? 32.716  25.841  83.295  1.00 8.28  ? 70  TRP C CD1 1 
ATOM   9797  C  CD2 . TRP E 1 70  ? 31.213  24.213  82.977  1.00 8.78  ? 70  TRP C CD2 1 
ATOM   9798  N  NE1 . TRP E 1 70  ? 31.475  26.428  83.214  1.00 8.49  ? 70  TRP C NE1 1 
ATOM   9799  C  CE2 . TRP E 1 70  ? 30.534  25.450  83.018  1.00 9.50  ? 70  TRP C CE2 1 
ATOM   9800  C  CE3 . TRP E 1 70  ? 30.469  23.039  82.786  1.00 10.60 ? 70  TRP C CE3 1 
ATOM   9801  C  CZ2 . TRP E 1 70  ? 29.146  25.551  82.871  1.00 10.20 ? 70  TRP C CZ2 1 
ATOM   9802  C  CZ3 . TRP E 1 70  ? 29.084  23.139  82.641  1.00 10.46 ? 70  TRP C CZ3 1 
ATOM   9803  C  CH2 . TRP E 1 70  ? 28.440  24.387  82.686  1.00 10.90 ? 70  TRP C CH2 1 
ATOM   9804  N  N   . THR E 1 71  ? 32.655  23.470  80.058  1.00 10.53 ? 71  THR C N   1 
ATOM   9805  C  CA  . THR E 1 71  ? 31.584  23.058  79.164  1.00 9.40  ? 71  THR C CA  1 
ATOM   9806  C  C   . THR E 1 71  ? 31.959  21.991  78.133  1.00 10.99 ? 71  THR C C   1 
ATOM   9807  O  O   . THR E 1 71  ? 31.080  21.391  77.512  1.00 10.30 ? 71  THR C O   1 
ATOM   9808  C  CB  . THR E 1 71  ? 30.984  24.280  78.449  1.00 9.63  ? 71  THR C CB  1 
ATOM   9809  O  OG1 . THR E 1 71  ? 32.037  25.147  78.014  1.00 8.57  ? 71  THR C OG1 1 
ATOM   9810  C  CG2 . THR E 1 71  ? 30.072  25.046  79.395  1.00 7.89  ? 71  THR C CG2 1 
ATOM   9811  N  N   . ASP E 1 72  ? 33.254  21.746  77.950  1.00 10.04 ? 72  ASP C N   1 
ATOM   9812  C  CA  . ASP E 1 72  ? 33.687  20.718  77.005  1.00 10.43 ? 72  ASP C CA  1 
ATOM   9813  C  C   . ASP E 1 72  ? 33.128  19.363  77.455  1.00 11.40 ? 72  ASP C C   1 
ATOM   9814  O  O   . ASP E 1 72  ? 32.765  18.525  76.631  1.00 12.77 ? 72  ASP C O   1 
ATOM   9815  C  CB  . ASP E 1 72  ? 35.224  20.634  76.949  1.00 11.31 ? 72  ASP C CB  1 
ATOM   9816  C  CG  . ASP E 1 72  ? 35.848  21.685  76.034  1.00 10.97 ? 72  ASP C CG  1 
ATOM   9817  O  OD1 . ASP E 1 72  ? 35.127  22.571  75.534  1.00 12.74 ? 72  ASP C OD1 1 
ATOM   9818  O  OD2 . ASP E 1 72  ? 37.076  21.624  75.816  1.00 11.58 ? 72  ASP C OD2 1 
ATOM   9819  N  N   . GLY E 1 73  ? 33.054  19.166  78.770  1.00 10.76 ? 73  GLY C N   1 
ATOM   9820  C  CA  . GLY E 1 73  ? 32.562  17.912  79.323  1.00 12.74 ? 73  GLY C CA  1 
ATOM   9821  C  C   . GLY E 1 73  ? 31.080  17.630  79.138  1.00 12.84 ? 73  GLY C C   1 
ATOM   9822  O  O   . GLY E 1 73  ? 30.619  16.525  79.412  1.00 12.17 ? 73  GLY C O   1 
ATOM   9823  N  N   . LEU E 1 74  ? 30.333  18.627  78.678  1.00 13.43 ? 74  LEU C N   1 
ATOM   9824  C  CA  . LEU E 1 74  ? 28.898  18.479  78.448  1.00 13.56 ? 74  LEU C CA  1 
ATOM   9825  C  C   . LEU E 1 74  ? 28.636  17.784  77.110  1.00 14.73 ? 74  LEU C C   1 
ATOM   9826  O  O   . LEU E 1 74  ? 27.569  17.209  76.890  1.00 14.06 ? 74  LEU C O   1 
ATOM   9827  C  CB  . LEU E 1 74  ? 28.235  19.860  78.450  1.00 13.58 ? 74  LEU C CB  1 
ATOM   9828  C  CG  . LEU E 1 74  ? 27.332  20.277  79.614  1.00 15.51 ? 74  LEU C CG  1 
ATOM   9829  C  CD1 . LEU E 1 74  ? 27.823  19.715  80.934  1.00 13.71 ? 74  LEU C CD1 1 
ATOM   9830  C  CD2 . LEU E 1 74  ? 27.275  21.797  79.646  1.00 15.88 ? 74  LEU C CD2 1 
ATOM   9831  N  N   . THR E 1 75  ? 29.621  17.834  76.219  1.00 14.62 ? 75  THR C N   1 
ATOM   9832  C  CA  . THR E 1 75  ? 29.491  17.223  74.903  1.00 14.49 ? 75  THR C CA  1 
ATOM   9833  C  C   . THR E 1 75  ? 30.666  16.267  74.656  1.00 15.44 ? 75  THR C C   1 
ATOM   9834  O  O   . THR E 1 75  ? 31.461  16.012  75.561  1.00 13.82 ? 75  THR C O   1 
ATOM   9835  C  CB  . THR E 1 75  ? 29.431  18.338  73.811  1.00 15.80 ? 75  THR C CB  1 
ATOM   9836  O  OG1 . THR E 1 75  ? 29.207  17.753  72.522  1.00 14.92 ? 75  THR C OG1 1 
ATOM   9837  C  CG2 . THR E 1 75  ? 30.722  19.153  73.798  1.00 13.53 ? 75  THR C CG2 1 
ATOM   9838  N  N   . ASN E 1 76  ? 30.758  15.718  73.450  1.00 15.24 ? 76  ASN C N   1 
ATOM   9839  C  CA  . ASN E 1 76  ? 31.848  14.803  73.104  1.00 15.91 ? 76  ASN C CA  1 
ATOM   9840  C  C   . ASN E 1 76  ? 32.741  15.535  72.106  1.00 15.44 ? 76  ASN C C   1 
ATOM   9841  O  O   . ASN E 1 76  ? 32.479  15.533  70.902  1.00 15.03 ? 76  ASN C O   1 
ATOM   9842  C  CB  . ASN E 1 76  ? 31.290  13.521  72.479  1.00 17.58 ? 76  ASN C CB  1 
ATOM   9843  C  CG  . ASN E 1 76  ? 32.378  12.518  72.122  1.00 21.49 ? 76  ASN C CG  1 
ATOM   9844  O  OD1 . ASN E 1 76  ? 33.563  12.743  72.383  1.00 23.52 ? 76  ASN C OD1 1 
ATOM   9845  N  ND2 . ASN E 1 76  ? 31.977  11.400  71.528  1.00 21.14 ? 76  ASN C ND2 1 
ATOM   9846  N  N   . LEU E 1 77  ? 33.791  16.167  72.620  1.00 15.11 ? 77  LEU C N   1 
ATOM   9847  C  CA  . LEU E 1 77  ? 34.712  16.941  71.800  1.00 16.97 ? 77  LEU C CA  1 
ATOM   9848  C  C   . LEU E 1 77  ? 35.422  16.147  70.696  1.00 18.60 ? 77  LEU C C   1 
ATOM   9849  O  O   . LEU E 1 77  ? 35.715  16.692  69.632  1.00 19.27 ? 77  LEU C O   1 
ATOM   9850  C  CB  . LEU E 1 77  ? 35.743  17.624  72.704  1.00 19.21 ? 77  LEU C CB  1 
ATOM   9851  C  CG  . LEU E 1 77  ? 36.332  18.955  72.224  1.00 22.30 ? 77  LEU C CG  1 
ATOM   9852  C  CD1 . LEU E 1 77  ? 35.233  20.007  72.137  1.00 23.62 ? 77  LEU C CD1 1 
ATOM   9853  C  CD2 . LEU E 1 77  ? 37.416  19.411  73.191  1.00 24.51 ? 77  LEU C CD2 1 
ATOM   9854  N  N   . ASP E 1 78  ? 35.702  14.871  70.940  1.00 20.07 ? 78  ASP C N   1 
ATOM   9855  C  CA  . ASP E 1 78  ? 36.379  14.045  69.939  1.00 22.66 ? 78  ASP C CA  1 
ATOM   9856  C  C   . ASP E 1 78  ? 35.548  13.898  68.672  1.00 21.61 ? 78  ASP C C   1 
ATOM   9857  O  O   . ASP E 1 78  ? 36.071  13.644  67.589  1.00 21.60 ? 78  ASP C O   1 
ATOM   9858  C  CB  . ASP E 1 78  ? 36.684  12.653  70.502  1.00 26.33 ? 78  ASP C CB  1 
ATOM   9859  C  CG  . ASP E 1 78  ? 37.834  12.662  71.488  1.00 31.49 ? 78  ASP C CG  1 
ATOM   9860  O  OD1 . ASP E 1 78  ? 37.651  13.147  72.625  1.00 34.44 ? 78  ASP C OD1 1 
ATOM   9861  O  OD2 . ASP E 1 78  ? 38.929  12.189  71.119  1.00 35.61 ? 78  ASP C OD2 1 
ATOM   9862  N  N   . ARG E 1 79  ? 34.244  14.065  68.823  1.00 20.46 ? 79  ARG C N   1 
ATOM   9863  C  CA  . ARG E 1 79  ? 33.304  13.945  67.725  1.00 19.50 ? 79  ARG C CA  1 
ATOM   9864  C  C   . ARG E 1 79  ? 33.178  15.245  66.935  1.00 17.51 ? 79  ARG C C   1 
ATOM   9865  O  O   . ARG E 1 79  ? 32.864  15.230  65.744  1.00 17.95 ? 79  ARG C O   1 
ATOM   9866  C  CB  . ARG E 1 79  ? 31.945  13.543  68.303  1.00 21.87 ? 79  ARG C CB  1 
ATOM   9867  C  CG  . ARG E 1 79  ? 30.786  13.497  67.337  1.00 26.68 ? 79  ARG C CG  1 
ATOM   9868  C  CD  . ARG E 1 79  ? 29.499  13.212  68.110  1.00 29.35 ? 79  ARG C CD  1 
ATOM   9869  N  NE  . ARG E 1 79  ? 28.311  13.214  67.261  1.00 32.60 ? 79  ARG C NE  1 
ATOM   9870  C  CZ  . ARG E 1 79  ? 27.068  13.084  67.719  1.00 35.13 ? 79  ARG C CZ  1 
ATOM   9871  N  NH1 . ARG E 1 79  ? 26.850  12.943  69.022  1.00 35.53 ? 79  ARG C NH1 1 
ATOM   9872  N  NH2 . ARG E 1 79  ? 26.043  13.094  66.875  1.00 35.53 ? 79  ARG C NH2 1 
ATOM   9873  N  N   . TYR E 1 80  ? 33.451  16.366  67.593  1.00 14.33 ? 80  TYR C N   1 
ATOM   9874  C  CA  . TYR E 1 80  ? 33.309  17.672  66.960  1.00 12.73 ? 80  TYR C CA  1 
ATOM   9875  C  C   . TYR E 1 80  ? 34.571  18.473  66.644  1.00 11.91 ? 80  TYR C C   1 
ATOM   9876  O  O   . TYR E 1 80  ? 34.547  19.340  65.776  1.00 11.87 ? 80  TYR C O   1 
ATOM   9877  C  CB  . TYR E 1 80  ? 32.392  18.541  67.826  1.00 12.33 ? 80  TYR C CB  1 
ATOM   9878  C  CG  . TYR E 1 80  ? 30.985  18.005  67.962  1.00 11.72 ? 80  TYR C CG  1 
ATOM   9879  C  CD1 . TYR E 1 80  ? 30.117  17.999  66.871  1.00 11.81 ? 80  TYR C CD1 1 
ATOM   9880  C  CD2 . TYR E 1 80  ? 30.522  17.493  69.175  1.00 11.14 ? 80  TYR C CD2 1 
ATOM   9881  C  CE1 . TYR E 1 80  ? 28.823  17.499  66.981  1.00 12.04 ? 80  TYR C CE1 1 
ATOM   9882  C  CE2 . TYR E 1 80  ? 29.227  16.990  69.299  1.00 11.60 ? 80  TYR C CE2 1 
ATOM   9883  C  CZ  . TYR E 1 80  ? 28.384  16.996  68.196  1.00 12.79 ? 80  TYR C CZ  1 
ATOM   9884  O  OH  . TYR E 1 80  ? 27.102  16.503  68.304  1.00 11.26 ? 80  TYR C OH  1 
ATOM   9885  N  N   . LYS E 1 81  ? 35.673  18.195  67.325  1.00 11.54 ? 81  LYS C N   1 
ATOM   9886  C  CA  . LYS E 1 81  ? 36.885  18.979  67.104  1.00 11.10 ? 81  LYS C CA  1 
ATOM   9887  C  C   . LYS E 1 81  ? 37.537  18.901  65.725  1.00 10.37 ? 81  LYS C C   1 
ATOM   9888  O  O   . LYS E 1 81  ? 37.517  17.863  65.067  1.00 11.80 ? 81  LYS C O   1 
ATOM   9889  C  CB  . LYS E 1 81  ? 37.941  18.632  68.164  1.00 11.63 ? 81  LYS C CB  1 
ATOM   9890  C  CG  . LYS E 1 81  ? 38.530  17.229  68.066  1.00 10.44 ? 81  LYS C CG  1 
ATOM   9891  C  CD  . LYS E 1 81  ? 39.572  17.005  69.159  1.00 10.89 ? 81  LYS C CD  1 
ATOM   9892  C  CE  . LYS E 1 81  ? 40.180  15.608  69.084  1.00 9.20  ? 81  LYS C CE  1 
ATOM   9893  N  NZ  . LYS E 1 81  ? 41.159  15.370  70.189  1.00 10.18 ? 81  LYS C NZ  1 
ATOM   9894  N  N   . GLY E 1 82  ? 38.095  20.023  65.285  1.00 9.55  ? 82  GLY C N   1 
ATOM   9895  C  CA  . GLY E 1 82  ? 38.808  20.039  64.027  1.00 10.31 ? 82  GLY C CA  1 
ATOM   9896  C  C   . GLY E 1 82  ? 40.174  19.547  64.440  1.00 11.56 ? 82  GLY C C   1 
ATOM   9897  O  O   . GLY E 1 82  ? 40.544  19.652  65.621  1.00 11.91 ? 82  GLY C O   1 
ATOM   9898  N  N   . ARG E 1 83  ? 40.938  19.023  63.497  1.00 10.58 ? 83  ARG C N   1 
ATOM   9899  C  CA  . ARG E 1 83  ? 42.228  18.502  63.890  1.00 13.91 ? 83  ARG C CA  1 
ATOM   9900  C  C   . ARG E 1 83  ? 43.305  18.511  62.837  1.00 12.03 ? 83  ARG C C   1 
ATOM   9901  O  O   . ARG E 1 83  ? 43.060  18.199  61.683  1.00 12.76 ? 83  ARG C O   1 
ATOM   9902  C  CB  . ARG E 1 83  ? 42.048  17.092  64.459  1.00 14.86 ? 83  ARG C CB  1 
ATOM   9903  C  CG  . ARG E 1 83  ? 41.348  16.084  63.578  1.00 18.85 ? 83  ARG C CG  1 
ATOM   9904  C  CD  . ARG E 1 83  ? 40.770  15.046  64.519  1.00 19.83 ? 83  ARG C CD  1 
ATOM   9905  N  NE  . ARG E 1 83  ? 39.312  15.126  64.558  1.00 25.84 ? 83  ARG C NE  1 
ATOM   9906  C  CZ  . ARG E 1 83  ? 38.530  14.389  65.333  1.00 26.26 ? 83  ARG C CZ  1 
ATOM   9907  N  NH1 . ARG E 1 83  ? 39.092  13.465  66.106  1.00 25.33 ? 83  ARG C NH1 1 
ATOM   9908  N  NH2 . ARG E 1 83  ? 37.244  14.737  65.515  1.00 25.95 ? 83  ARG C NH2 1 
ATOM   9909  N  N   . CYS E 1 84  ? 44.500  18.906  63.256  1.00 11.75 ? 84  CYS C N   1 
ATOM   9910  C  CA  . CYS E 1 84  ? 45.657  18.957  62.375  1.00 12.54 ? 84  CYS C CA  1 
ATOM   9911  C  C   . CYS E 1 84  ? 46.212  17.544  62.364  1.00 10.98 ? 84  CYS C C   1 
ATOM   9912  O  O   . CYS E 1 84  ? 46.763  17.085  63.362  1.00 11.68 ? 84  CYS C O   1 
ATOM   9913  C  CB  . CYS E 1 84  ? 46.687  19.938  62.935  1.00 13.07 ? 84  CYS C CB  1 
ATOM   9914  S  SG  . CYS E 1 84  ? 48.085  20.203  61.853  1.00 14.82 ? 84  CYS C SG  1 
ATOM   9915  N  N   . TYR E 1 85  ? 46.050  16.849  61.243  1.00 11.48 ? 85  TYR C N   1 
ATOM   9916  C  CA  . TYR E 1 85  ? 46.502  15.466  61.146  1.00 11.71 ? 85  TYR C CA  1 
ATOM   9917  C  C   . TYR E 1 85  ? 47.784  15.249  60.349  1.00 12.98 ? 85  TYR C C   1 
ATOM   9918  O  O   . TYR E 1 85  ? 48.293  14.127  60.292  1.00 12.68 ? 85  TYR C O   1 
ATOM   9919  C  CB  . TYR E 1 85  ? 45.387  14.585  60.565  1.00 9.66  ? 85  TYR C CB  1 
ATOM   9920  C  CG  . TYR E 1 85  ? 44.968  14.956  59.161  1.00 8.77  ? 85  TYR C CG  1 
ATOM   9921  C  CD1 . TYR E 1 85  ? 44.055  15.985  58.930  1.00 9.01  ? 85  TYR C CD1 1 
ATOM   9922  C  CD2 . TYR E 1 85  ? 45.483  14.274  58.063  1.00 7.52  ? 85  TYR C CD2 1 
ATOM   9923  C  CE1 . TYR E 1 85  ? 43.663  16.321  57.634  1.00 6.90  ? 85  TYR C CE1 1 
ATOM   9924  C  CE2 . TYR E 1 85  ? 45.101  14.602  56.767  1.00 10.00 ? 85  TYR C CE2 1 
ATOM   9925  C  CZ  . TYR E 1 85  ? 44.191  15.625  56.558  1.00 8.84  ? 85  TYR C CZ  1 
ATOM   9926  O  OH  . TYR E 1 85  ? 43.814  15.943  55.273  1.00 11.83 ? 85  TYR C OH  1 
ATOM   9927  N  N   . HIS E 1 86  ? 48.302  16.303  59.726  1.00 11.83 ? 86  HIS C N   1 
ATOM   9928  C  CA  . HIS E 1 86  ? 49.538  16.174  58.964  1.00 13.29 ? 86  HIS C CA  1 
ATOM   9929  C  C   . HIS E 1 86  ? 50.248  17.504  58.776  1.00 12.54 ? 86  HIS C C   1 
ATOM   9930  O  O   . HIS E 1 86  ? 49.616  18.551  58.638  1.00 12.05 ? 86  HIS C O   1 
ATOM   9931  C  CB  . HIS E 1 86  ? 49.274  15.543  57.594  1.00 15.38 ? 86  HIS C CB  1 
ATOM   9932  C  CG  . HIS E 1 86  ? 50.520  15.105  56.890  1.00 20.29 ? 86  HIS C CG  1 
ATOM   9933  N  ND1 . HIS E 1 86  ? 50.911  15.613  55.669  1.00 21.12 ? 86  HIS C ND1 1 
ATOM   9934  C  CD2 . HIS E 1 86  ? 51.488  14.229  57.259  1.00 20.05 ? 86  HIS C CD2 1 
ATOM   9935  C  CE1 . HIS E 1 86  ? 52.064  15.074  55.319  1.00 21.26 ? 86  HIS C CE1 1 
ATOM   9936  N  NE2 . HIS E 1 86  ? 52.437  14.232  56.265  1.00 21.17 ? 86  HIS C NE2 1 
ATOM   9937  N  N   . ILE E 1 87  ? 51.574  17.451  58.771  1.00 12.57 ? 87  ILE C N   1 
ATOM   9938  C  CA  . ILE E 1 87  ? 52.391  18.644  58.599  1.00 13.12 ? 87  ILE C CA  1 
ATOM   9939  C  C   . ILE E 1 87  ? 53.590  18.331  57.716  1.00 14.46 ? 87  ILE C C   1 
ATOM   9940  O  O   . ILE E 1 87  ? 54.298  17.353  57.950  1.00 14.69 ? 87  ILE C O   1 
ATOM   9941  C  CB  . ILE E 1 87  ? 52.903  19.167  59.958  1.00 12.25 ? 87  ILE C CB  1 
ATOM   9942  C  CG1 . ILE E 1 87  ? 51.719  19.589  60.829  1.00 13.48 ? 87  ILE C CG1 1 
ATOM   9943  C  CG2 . ILE E 1 87  ? 53.854  20.344  59.747  1.00 13.30 ? 87  ILE C CG2 1 
ATOM   9944  C  CD1 . ILE E 1 87  ? 52.104  20.003  62.228  1.00 17.57 ? 87  ILE C CD1 1 
ATOM   9945  N  N   . GLU E 1 88  ? 53.806  19.147  56.690  1.00 15.06 ? 88  GLU C N   1 
ATOM   9946  C  CA  . GLU E 1 88  ? 54.949  18.947  55.806  1.00 16.96 ? 88  GLU C CA  1 
ATOM   9947  C  C   . GLU E 1 88  ? 55.644  20.273  55.531  1.00 15.57 ? 88  GLU C C   1 
ATOM   9948  O  O   . GLU E 1 88  ? 54.995  21.293  55.304  1.00 15.61 ? 88  GLU C O   1 
ATOM   9949  C  CB  . GLU E 1 88  ? 54.526  18.300  54.479  1.00 19.11 ? 88  GLU C CB  1 
ATOM   9950  C  CG  . GLU E 1 88  ? 53.763  19.205  53.537  1.00 25.99 ? 88  GLU C CG  1 
ATOM   9951  C  CD  . GLU E 1 88  ? 53.418  18.521  52.226  1.00 27.70 ? 88  GLU C CD  1 
ATOM   9952  O  OE1 . GLU E 1 88  ? 54.141  18.725  51.227  1.00 30.36 ? 88  GLU C OE1 1 
ATOM   9953  O  OE2 . GLU E 1 88  ? 52.423  17.769  52.201  1.00 29.52 ? 88  GLU C OE2 1 
ATOM   9954  N  N   . PRO E 1 89  ? 56.984  20.272  55.557  1.00 15.26 ? 89  PRO C N   1 
ATOM   9955  C  CA  . PRO E 1 89  ? 57.785  21.475  55.311  1.00 14.59 ? 89  PRO C CA  1 
ATOM   9956  C  C   . PRO E 1 89  ? 57.628  21.946  53.866  1.00 14.02 ? 89  PRO C C   1 
ATOM   9957  O  O   . PRO E 1 89  ? 57.478  21.130  52.962  1.00 13.52 ? 89  PRO C O   1 
ATOM   9958  C  CB  . PRO E 1 89  ? 59.216  21.008  55.594  1.00 14.59 ? 89  PRO C CB  1 
ATOM   9959  C  CG  . PRO E 1 89  ? 59.040  19.790  56.467  1.00 16.61 ? 89  PRO C CG  1 
ATOM   9960  C  CD  . PRO E 1 89  ? 57.849  19.122  55.865  1.00 14.59 ? 89  PRO C CD  1 
ATOM   9961  N  N   . VAL E 1 90  ? 57.663  23.257  53.655  1.00 13.71 ? 90  VAL C N   1 
ATOM   9962  C  CA  . VAL E 1 90  ? 57.545  23.811  52.311  1.00 14.43 ? 90  VAL C CA  1 
ATOM   9963  C  C   . VAL E 1 90  ? 58.936  24.041  51.724  1.00 16.63 ? 90  VAL C C   1 
ATOM   9964  O  O   . VAL E 1 90  ? 59.738  24.796  52.276  1.00 16.10 ? 90  VAL C O   1 
ATOM   9965  C  CB  . VAL E 1 90  ? 56.779  25.153  52.320  1.00 13.79 ? 90  VAL C CB  1 
ATOM   9966  C  CG1 . VAL E 1 90  ? 56.825  25.792  50.941  1.00 13.11 ? 90  VAL C CG1 1 
ATOM   9967  C  CG2 . VAL E 1 90  ? 55.334  24.921  52.741  1.00 13.77 ? 90  VAL C CG2 1 
ATOM   9968  N  N   . ALA E 1 91  ? 59.220  23.385  50.606  1.00 17.89 ? 91  ALA C N   1 
ATOM   9969  C  CA  . ALA E 1 91  ? 60.514  23.526  49.952  1.00 19.83 ? 91  ALA C CA  1 
ATOM   9970  C  C   . ALA E 1 91  ? 60.631  24.902  49.305  1.00 20.85 ? 91  ALA C C   1 
ATOM   9971  O  O   . ALA E 1 91  ? 59.696  25.374  48.656  1.00 20.02 ? 91  ALA C O   1 
ATOM   9972  C  CB  . ALA E 1 91  ? 60.688  22.433  48.897  1.00 18.98 ? 91  ALA C CB  1 
ATOM   9973  N  N   . GLY E 1 92  ? 61.780  25.544  49.495  1.00 22.92 ? 92  GLY C N   1 
ATOM   9974  C  CA  . GLY E 1 92  ? 62.003  26.858  48.918  1.00 24.59 ? 92  GLY C CA  1 
ATOM   9975  C  C   . GLY E 1 92  ? 61.587  28.012  49.812  1.00 26.57 ? 92  GLY C C   1 
ATOM   9976  O  O   . GLY E 1 92  ? 61.710  29.174  49.425  1.00 26.40 ? 92  GLY C O   1 
ATOM   9977  N  N   . GLU E 1 93  ? 61.096  27.701  51.008  1.00 26.44 ? 93  GLU C N   1 
ATOM   9978  C  CA  . GLU E 1 93  ? 60.667  28.733  51.946  1.00 27.81 ? 93  GLU C CA  1 
ATOM   9979  C  C   . GLU E 1 93  ? 61.328  28.549  53.304  1.00 28.14 ? 93  GLU C C   1 
ATOM   9980  O  O   . GLU E 1 93  ? 61.765  27.454  53.648  1.00 28.99 ? 93  GLU C O   1 
ATOM   9981  C  CB  . GLU E 1 93  ? 59.148  28.695  52.125  1.00 28.91 ? 93  GLU C CB  1 
ATOM   9982  C  CG  . GLU E 1 93  ? 58.339  29.081  50.898  1.00 31.45 ? 93  GLU C CG  1 
ATOM   9983  C  CD  . GLU E 1 93  ? 58.613  30.501  50.432  1.00 34.03 ? 93  GLU C CD  1 
ATOM   9984  O  OE1 . GLU E 1 93  ? 58.997  31.345  51.272  1.00 34.57 ? 93  GLU C OE1 1 
ATOM   9985  O  OE2 . GLU E 1 93  ? 58.427  30.776  49.226  1.00 34.44 ? 93  GLU C OE2 1 
ATOM   9986  N  N   . GLU E 1 94  ? 61.397  29.628  54.074  1.00 29.00 ? 94  GLU C N   1 
ATOM   9987  C  CA  . GLU E 1 94  ? 61.989  29.575  55.403  1.00 29.90 ? 94  GLU C CA  1 
ATOM   9988  C  C   . GLU E 1 94  ? 60.864  29.484  56.429  1.00 26.75 ? 94  GLU C C   1 
ATOM   9989  O  O   . GLU E 1 94  ? 59.908  30.257  56.377  1.00 27.73 ? 94  GLU C O   1 
ATOM   9990  C  CB  . GLU E 1 94  ? 62.821  30.834  55.676  1.00 34.35 ? 94  GLU C CB  1 
ATOM   9991  C  CG  . GLU E 1 94  ? 63.890  31.139  54.634  1.00 41.33 ? 94  GLU C CG  1 
ATOM   9992  C  CD  . GLU E 1 94  ? 64.657  32.418  54.940  1.00 44.56 ? 94  GLU C CD  1 
ATOM   9993  O  OE1 . GLU E 1 94  ? 65.492  32.411  55.869  1.00 47.02 ? 94  GLU C OE1 1 
ATOM   9994  O  OE2 . GLU E 1 94  ? 64.417  33.435  54.255  1.00 47.17 ? 94  GLU C OE2 1 
ATOM   9995  N  N   . ASN E 1 95  ? 60.976  28.525  57.340  1.00 23.87 ? 95  ASN C N   1 
ATOM   9996  C  CA  . ASN E 1 95  ? 59.991  28.333  58.403  1.00 21.76 ? 95  ASN C CA  1 
ATOM   9997  C  C   . ASN E 1 95  ? 58.536  28.384  57.921  1.00 19.87 ? 95  ASN C C   1 
ATOM   9998  O  O   . ASN E 1 95  ? 57.722  29.105  58.494  1.00 17.73 ? 95  ASN C O   1 
ATOM   9999  C  CB  . ASN E 1 95  ? 60.200  29.400  59.482  1.00 23.47 ? 95  ASN C CB  1 
ATOM   10000 C  CG  . ASN E 1 95  ? 59.616  29.002  60.824  1.00 25.95 ? 95  ASN C CG  1 
ATOM   10001 O  OD1 . ASN E 1 95  ? 59.210  29.859  61.613  1.00 27.50 ? 95  ASN C OD1 1 
ATOM   10002 N  ND2 . ASN E 1 95  ? 59.590  27.701  61.101  1.00 27.17 ? 95  ASN C ND2 1 
ATOM   10003 N  N   . GLN E 1 96  ? 58.210  27.629  56.875  1.00 17.03 ? 96  GLN C N   1 
ATOM   10004 C  CA  . GLN E 1 96  ? 56.843  27.600  56.352  1.00 15.09 ? 96  GLN C CA  1 
ATOM   10005 C  C   . GLN E 1 96  ? 56.396  26.147  56.220  1.00 14.68 ? 96  GLN C C   1 
ATOM   10006 O  O   . GLN E 1 96  ? 57.188  25.282  55.840  1.00 11.56 ? 96  GLN C O   1 
ATOM   10007 C  CB  . GLN E 1 96  ? 56.777  28.288  54.990  1.00 15.90 ? 96  GLN C CB  1 
ATOM   10008 C  CG  . GLN E 1 96  ? 55.400  28.800  54.629  1.00 15.28 ? 96  GLN C CG  1 
ATOM   10009 C  CD  . GLN E 1 96  ? 55.378  29.488  53.284  1.00 14.45 ? 96  GLN C CD  1 
ATOM   10010 O  OE1 . GLN E 1 96  ? 55.305  28.839  52.242  1.00 12.50 ? 96  GLN C OE1 1 
ATOM   10011 N  NE2 . GLN E 1 96  ? 55.460  30.813  53.300  1.00 15.56 ? 96  GLN C NE2 1 
ATOM   10012 N  N   . TYR E 1 97  ? 55.131  25.879  56.533  1.00 12.62 ? 97  TYR C N   1 
ATOM   10013 C  CA  . TYR E 1 97  ? 54.611  24.517  56.467  1.00 12.33 ? 97  TYR C CA  1 
ATOM   10014 C  C   . TYR E 1 97  ? 53.194  24.425  55.927  1.00 13.26 ? 97  TYR C C   1 
ATOM   10015 O  O   . TYR E 1 97  ? 52.427  25.385  55.985  1.00 11.20 ? 97  TYR C O   1 
ATOM   10016 C  CB  . TYR E 1 97  ? 54.596  23.878  57.859  1.00 13.66 ? 97  TYR C CB  1 
ATOM   10017 C  CG  . TYR E 1 97  ? 55.869  24.039  58.640  1.00 13.76 ? 97  TYR C CG  1 
ATOM   10018 C  CD1 . TYR E 1 97  ? 56.189  25.256  59.242  1.00 15.81 ? 97  TYR C CD1 1 
ATOM   10019 C  CD2 . TYR E 1 97  ? 56.768  22.984  58.763  1.00 13.00 ? 97  TYR C CD2 1 
ATOM   10020 C  CE1 . TYR E 1 97  ? 57.373  25.417  59.945  1.00 16.07 ? 97  TYR C CE1 1 
ATOM   10021 C  CE2 . TYR E 1 97  ? 57.956  23.135  59.464  1.00 15.93 ? 97  TYR C CE2 1 
ATOM   10022 C  CZ  . TYR E 1 97  ? 58.251  24.353  60.052  1.00 16.49 ? 97  TYR C CZ  1 
ATOM   10023 O  OH  . TYR E 1 97  ? 59.424  24.510  60.749  1.00 20.62 ? 97  TYR C OH  1 
ATOM   10024 N  N   . ILE E 1 98  ? 52.855  23.253  55.404  1.00 11.25 ? 98  ILE C N   1 
ATOM   10025 C  CA  . ILE E 1 98  ? 51.507  23.011  54.923  1.00 11.86 ? 98  ILE C CA  1 
ATOM   10026 C  C   . ILE E 1 98  ? 50.913  22.125  56.009  1.00 12.65 ? 98  ILE C C   1 
ATOM   10027 O  O   . ILE E 1 98  ? 51.398  21.016  56.253  1.00 13.64 ? 98  ILE C O   1 
ATOM   10028 C  CB  . ILE E 1 98  ? 51.472  22.239  53.578  1.00 12.53 ? 98  ILE C CB  1 
ATOM   10029 C  CG1 . ILE E 1 98  ? 52.154  23.055  52.475  1.00 11.17 ? 98  ILE C CG1 1 
ATOM   10030 C  CG2 . ILE E 1 98  ? 50.021  21.949  53.189  1.00 12.33 ? 98  ILE C CG2 1 
ATOM   10031 C  CD1 . ILE E 1 98  ? 51.480  24.381  52.169  1.00 13.97 ? 98  ILE C CD1 1 
ATOM   10032 N  N   . CYS E 1 99  ? 49.891  22.633  56.685  1.00 9.86  ? 99  CYS C N   1 
ATOM   10033 C  CA  . CYS E 1 99  ? 49.226  21.886  57.737  1.00 9.91  ? 99  CYS C CA  1 
ATOM   10034 C  C   . CYS E 1 99  ? 47.852  21.482  57.232  1.00 10.11 ? 99  CYS C C   1 
ATOM   10035 O  O   . CYS E 1 99  ? 47.105  22.318  56.727  1.00 9.52  ? 99  CYS C O   1 
ATOM   10036 C  CB  . CYS E 1 99  ? 49.080  22.747  58.997  1.00 11.07 ? 99  CYS C CB  1 
ATOM   10037 S  SG  . CYS E 1 99  ? 50.650  23.261  59.738  1.00 14.31 ? 99  CYS C SG  1 
ATOM   10038 N  N   . TYR E 1 100 ? 47.536  20.197  57.347  1.00 9.02  ? 100 TYR C N   1 
ATOM   10039 C  CA  . TYR E 1 100 ? 46.244  19.687  56.914  1.00 9.50  ? 100 TYR C CA  1 
ATOM   10040 C  C   . TYR E 1 100 ? 45.326  19.570  58.124  1.00 10.65 ? 100 TYR C C   1 
ATOM   10041 O  O   . TYR E 1 100 ? 45.710  19.016  59.157  1.00 11.65 ? 100 TYR C O   1 
ATOM   10042 C  CB  . TYR E 1 100 ? 46.407  18.322  56.239  1.00 10.87 ? 100 TYR C CB  1 
ATOM   10043 C  CG  . TYR E 1 100 ? 47.264  18.362  54.997  1.00 13.93 ? 100 TYR C CG  1 
ATOM   10044 C  CD1 . TYR E 1 100 ? 48.654  18.482  55.084  1.00 14.52 ? 100 TYR C CD1 1 
ATOM   10045 C  CD2 . TYR E 1 100 ? 46.685  18.312  53.729  1.00 14.21 ? 100 TYR C CD2 1 
ATOM   10046 C  CE1 . TYR E 1 100 ? 49.443  18.551  53.937  1.00 15.80 ? 100 TYR C CE1 1 
ATOM   10047 C  CE2 . TYR E 1 100 ? 47.461  18.379  52.580  1.00 15.09 ? 100 TYR C CE2 1 
ATOM   10048 C  CZ  . TYR E 1 100 ? 48.837  18.498  52.690  1.00 16.49 ? 100 TYR C CZ  1 
ATOM   10049 O  OH  . TYR E 1 100 ? 49.606  18.558  51.555  1.00 18.17 ? 100 TYR C OH  1 
ATOM   10050 N  N   . VAL E 1 101 ? 44.115  20.103  57.994  1.00 9.37  ? 101 VAL C N   1 
ATOM   10051 C  CA  . VAL E 1 101 ? 43.142  20.075  59.078  1.00 8.97  ? 101 VAL C CA  1 
ATOM   10052 C  C   . VAL E 1 101 ? 41.841  19.421  58.628  1.00 10.11 ? 101 VAL C C   1 
ATOM   10053 O  O   . VAL E 1 101 ? 41.364  19.668  57.518  1.00 10.18 ? 101 VAL C O   1 
ATOM   10054 C  CB  . VAL E 1 101 ? 42.839  21.512  59.586  1.00 8.64  ? 101 VAL C CB  1 
ATOM   10055 C  CG1 . VAL E 1 101 ? 41.749  21.478  60.650  1.00 7.64  ? 101 VAL C CG1 1 
ATOM   10056 C  CG2 . VAL E 1 101 ? 44.106  22.139  60.166  1.00 8.27  ? 101 VAL C CG2 1 
ATOM   10057 N  N   . ALA E 1 102 ? 41.277  18.577  59.488  1.00 9.34  ? 102 ALA C N   1 
ATOM   10058 C  CA  . ALA E 1 102 ? 40.017  17.912  59.173  1.00 9.53  ? 102 ALA C CA  1 
ATOM   10059 C  C   . ALA E 1 102 ? 38.892  18.463  60.050  1.00 8.44  ? 102 ALA C C   1 
ATOM   10060 O  O   . ALA E 1 102 ? 39.061  18.635  61.258  1.00 8.08  ? 102 ALA C O   1 
ATOM   10061 C  CB  . ALA E 1 102 ? 40.155  16.406  59.365  1.00 9.72  ? 102 ALA C CB  1 
ATOM   10062 N  N   . TYR E 1 103 ? 37.751  18.744  59.427  1.00 9.45  ? 103 TYR C N   1 
ATOM   10063 C  CA  . TYR E 1 103 ? 36.578  19.280  60.116  1.00 8.68  ? 103 TYR C CA  1 
ATOM   10064 C  C   . TYR E 1 103 ? 35.401  18.327  59.913  1.00 8.72  ? 103 TYR C C   1 
ATOM   10065 O  O   . TYR E 1 103 ? 35.054  18.001  58.776  1.00 9.58  ? 103 TYR C O   1 
ATOM   10066 C  CB  . TYR E 1 103 ? 36.190  20.642  59.528  1.00 8.32  ? 103 TYR C CB  1 
ATOM   10067 C  CG  . TYR E 1 103 ? 37.250  21.717  59.623  1.00 8.78  ? 103 TYR C CG  1 
ATOM   10068 C  CD1 . TYR E 1 103 ? 37.337  22.540  60.744  1.00 7.25  ? 103 TYR C CD1 1 
ATOM   10069 C  CD2 . TYR E 1 103 ? 38.152  21.926  58.580  1.00 6.55  ? 103 TYR C CD2 1 
ATOM   10070 C  CE1 . TYR E 1 103 ? 38.299  23.553  60.827  1.00 9.21  ? 103 TYR C CE1 1 
ATOM   10071 C  CE2 . TYR E 1 103 ? 39.124  22.937  58.653  1.00 8.31  ? 103 TYR C CE2 1 
ATOM   10072 C  CZ  . TYR E 1 103 ? 39.189  23.744  59.777  1.00 8.69  ? 103 TYR C CZ  1 
ATOM   10073 O  OH  . TYR E 1 103 ? 40.146  24.735  59.861  1.00 10.12 ? 103 TYR C OH  1 
ATOM   10074 N  N   . PRO E 1 104 ? 34.770  17.868  61.008  1.00 6.74  ? 104 PRO C N   1 
ATOM   10075 C  CA  . PRO E 1 104 ? 33.627  16.953  60.890  1.00 6.75  ? 104 PRO C CA  1 
ATOM   10076 C  C   . PRO E 1 104 ? 32.439  17.618  60.186  1.00 6.72  ? 104 PRO C C   1 
ATOM   10077 O  O   . PRO E 1 104 ? 32.221  18.824  60.319  1.00 5.46  ? 104 PRO C O   1 
ATOM   10078 C  CB  . PRO E 1 104 ? 33.307  16.605  62.344  1.00 6.82  ? 104 PRO C CB  1 
ATOM   10079 C  CG  . PRO E 1 104 ? 34.644  16.709  63.019  1.00 7.68  ? 104 PRO C CG  1 
ATOM   10080 C  CD  . PRO E 1 104 ? 35.210  17.976  62.410  1.00 6.14  ? 104 PRO C CD  1 
ATOM   10081 N  N   . LEU E 1 105 ? 31.670  16.814  59.457  1.00 7.00  ? 105 LEU C N   1 
ATOM   10082 C  CA  . LEU E 1 105 ? 30.506  17.291  58.714  1.00 8.58  ? 105 LEU C CA  1 
ATOM   10083 C  C   . LEU E 1 105 ? 29.503  18.070  59.570  1.00 8.83  ? 105 LEU C C   1 
ATOM   10084 O  O   . LEU E 1 105 ? 28.897  19.036  59.103  1.00 8.87  ? 105 LEU C O   1 
ATOM   10085 C  CB  . LEU E 1 105 ? 29.802  16.096  58.053  1.00 8.44  ? 105 LEU C CB  1 
ATOM   10086 C  CG  . LEU E 1 105 ? 28.573  16.365  57.179  1.00 9.17  ? 105 LEU C CG  1 
ATOM   10087 C  CD1 . LEU E 1 105 ? 28.963  17.220  55.985  1.00 8.76  ? 105 LEU C CD1 1 
ATOM   10088 C  CD2 . LEU E 1 105 ? 27.984  15.040  56.706  1.00 7.74  ? 105 LEU C CD2 1 
ATOM   10089 N  N   . ASP E 1 106 ? 29.341  17.648  60.822  1.00 9.16  ? 106 ASP C N   1 
ATOM   10090 C  CA  . ASP E 1 106 ? 28.400  18.275  61.756  1.00 10.13 ? 106 ASP C CA  1 
ATOM   10091 C  C   . ASP E 1 106 ? 28.634  19.748  62.090  1.00 9.88  ? 106 ASP C C   1 
ATOM   10092 O  O   . ASP E 1 106 ? 27.730  20.415  62.591  1.00 10.02 ? 106 ASP C O   1 
ATOM   10093 C  CB  . ASP E 1 106 ? 28.366  17.493  63.079  1.00 10.92 ? 106 ASP C CB  1 
ATOM   10094 C  CG  . ASP E 1 106 ? 27.538  16.225  62.994  1.00 13.71 ? 106 ASP C CG  1 
ATOM   10095 O  OD1 . ASP E 1 106 ? 27.027  15.910  61.900  1.00 14.77 ? 106 ASP C OD1 1 
ATOM   10096 O  OD2 . ASP E 1 106 ? 27.399  15.541  64.030  1.00 14.30 ? 106 ASP C OD2 1 
ATOM   10097 N  N   . LEU E 1 107 ? 29.831  20.260  61.830  1.00 7.76  ? 107 LEU C N   1 
ATOM   10098 C  CA  . LEU E 1 107 ? 30.128  21.653  62.158  1.00 7.75  ? 107 LEU C CA  1 
ATOM   10099 C  C   . LEU E 1 107 ? 29.549  22.682  61.190  1.00 8.15  ? 107 LEU C C   1 
ATOM   10100 O  O   . LEU E 1 107 ? 29.525  23.877  61.491  1.00 7.57  ? 107 LEU C O   1 
ATOM   10101 C  CB  . LEU E 1 107 ? 31.649  21.871  62.226  1.00 8.20  ? 107 LEU C CB  1 
ATOM   10102 C  CG  . LEU E 1 107 ? 32.513  20.970  63.116  1.00 7.38  ? 107 LEU C CG  1 
ATOM   10103 C  CD1 . LEU E 1 107 ? 33.934  21.520  63.149  1.00 7.41  ? 107 LEU C CD1 1 
ATOM   10104 C  CD2 . LEU E 1 107 ? 31.939  20.913  64.524  1.00 6.50  ? 107 LEU C CD2 1 
ATOM   10105 N  N   . PHE E 1 108 ? 29.062  22.223  60.044  1.00 6.81  ? 108 PHE C N   1 
ATOM   10106 C  CA  . PHE E 1 108 ? 28.580  23.141  59.019  1.00 6.98  ? 108 PHE C CA  1 
ATOM   10107 C  C   . PHE E 1 108 ? 27.076  23.227  58.752  1.00 7.95  ? 108 PHE C C   1 
ATOM   10108 O  O   . PHE E 1 108 ? 26.363  22.220  58.797  1.00 8.51  ? 108 PHE C O   1 
ATOM   10109 C  CB  . PHE E 1 108 ? 29.317  22.805  57.722  1.00 6.65  ? 108 PHE C CB  1 
ATOM   10110 C  CG  . PHE E 1 108 ? 30.815  22.808  57.873  1.00 7.28  ? 108 PHE C CG  1 
ATOM   10111 C  CD1 . PHE E 1 108 ? 31.531  23.998  57.795  1.00 7.39  ? 108 PHE C CD1 1 
ATOM   10112 C  CD2 . PHE E 1 108 ? 31.502  21.629  58.160  1.00 7.93  ? 108 PHE C CD2 1 
ATOM   10113 C  CE1 . PHE E 1 108 ? 32.908  24.022  58.006  1.00 7.46  ? 108 PHE C CE1 1 
ATOM   10114 C  CE2 . PHE E 1 108 ? 32.884  21.642  58.375  1.00 8.06  ? 108 PHE C CE2 1 
ATOM   10115 C  CZ  . PHE E 1 108 ? 33.586  22.840  58.298  1.00 8.68  ? 108 PHE C CZ  1 
ATOM   10116 N  N   . GLU E 1 109 ? 26.593  24.435  58.473  1.00 6.50  ? 109 GLU C N   1 
ATOM   10117 C  CA  . GLU E 1 109 ? 25.180  24.590  58.163  1.00 7.27  ? 109 GLU C CA  1 
ATOM   10118 C  C   . GLU E 1 109 ? 24.981  24.196  56.709  1.00 7.86  ? 109 GLU C C   1 
ATOM   10119 O  O   . GLU E 1 109 ? 25.728  24.627  55.835  1.00 9.65  ? 109 GLU C O   1 
ATOM   10120 C  CB  . GLU E 1 109 ? 24.688  26.029  58.364  1.00 7.71  ? 109 GLU C CB  1 
ATOM   10121 C  CG  . GLU E 1 109 ? 23.273  26.219  57.797  1.00 7.10  ? 109 GLU C CG  1 
ATOM   10122 C  CD  . GLU E 1 109 ? 22.565  27.482  58.263  1.00 9.42  ? 109 GLU C CD  1 
ATOM   10123 O  OE1 . GLU E 1 109 ? 23.157  28.283  59.015  1.00 10.13 ? 109 GLU C OE1 1 
ATOM   10124 O  OE2 . GLU E 1 109 ? 21.394  27.672  57.869  1.00 9.52  ? 109 GLU C OE2 1 
ATOM   10125 N  N   . GLU E 1 110 ? 23.973  23.373  56.454  1.00 7.06  ? 110 GLU C N   1 
ATOM   10126 C  CA  . GLU E 1 110 ? 23.690  22.924  55.102  1.00 6.62  ? 110 GLU C CA  1 
ATOM   10127 C  C   . GLU E 1 110 ? 23.404  24.078  54.133  1.00 7.47  ? 110 GLU C C   1 
ATOM   10128 O  O   . GLU E 1 110 ? 22.672  25.019  54.462  1.00 6.19  ? 110 GLU C O   1 
ATOM   10129 C  CB  . GLU E 1 110 ? 22.500  21.958  55.119  1.00 6.88  ? 110 GLU C CB  1 
ATOM   10130 C  CG  . GLU E 1 110 ? 22.722  20.692  55.951  1.00 8.16  ? 110 GLU C CG  1 
ATOM   10131 C  CD  . GLU E 1 110 ? 22.411  20.867  57.435  1.00 9.20  ? 110 GLU C CD  1 
ATOM   10132 O  OE1 . GLU E 1 110 ? 22.200  22.011  57.891  1.00 10.20 ? 110 GLU C OE1 1 
ATOM   10133 O  OE2 . GLU E 1 110 ? 22.381  19.846  58.151  1.00 8.43  ? 110 GLU C OE2 1 
ATOM   10134 N  N   . GLY E 1 111 ? 23.992  23.991  52.942  1.00 7.51  ? 111 GLY C N   1 
ATOM   10135 C  CA  . GLY E 1 111 ? 23.794  24.990  51.903  1.00 8.41  ? 111 GLY C CA  1 
ATOM   10136 C  C   . GLY E 1 111 ? 24.277  26.408  52.161  1.00 9.00  ? 111 GLY C C   1 
ATOM   10137 O  O   . GLY E 1 111 ? 23.870  27.332  51.446  1.00 9.19  ? 111 GLY C O   1 
ATOM   10138 N  N   . SER E 1 112 ? 25.146  26.595  53.151  1.00 7.32  ? 112 SER C N   1 
ATOM   10139 C  CA  . SER E 1 112 ? 25.643  27.931  53.476  1.00 6.47  ? 112 SER C CA  1 
ATOM   10140 C  C   . SER E 1 112 ? 27.157  28.114  53.339  1.00 7.70  ? 112 SER C C   1 
ATOM   10141 O  O   . SER E 1 112 ? 27.918  27.732  54.227  1.00 6.93  ? 112 SER C O   1 
ATOM   10142 C  CB  . SER E 1 112 ? 25.225  28.304  54.904  1.00 8.59  ? 112 SER C CB  1 
ATOM   10143 O  OG  . SER E 1 112 ? 25.767  29.555  55.292  1.00 7.06  ? 112 SER C OG  1 
ATOM   10144 N  N   . VAL E 1 113 ? 27.592  28.701  52.228  1.00 7.45  ? 113 VAL C N   1 
ATOM   10145 C  CA  . VAL E 1 113 ? 29.012  28.958  52.019  1.00 8.42  ? 113 VAL C CA  1 
ATOM   10146 C  C   . VAL E 1 113 ? 29.456  29.951  53.092  1.00 7.98  ? 113 VAL C C   1 
ATOM   10147 O  O   . VAL E 1 113 ? 30.581  29.894  53.583  1.00 8.24  ? 113 VAL C O   1 
ATOM   10148 C  CB  . VAL E 1 113 ? 29.271  29.560  50.609  1.00 9.17  ? 113 VAL C CB  1 
ATOM   10149 C  CG1 . VAL E 1 113 ? 30.675  30.138  50.523  1.00 12.20 ? 113 VAL C CG1 1 
ATOM   10150 C  CG2 . VAL E 1 113 ? 29.089  28.479  49.551  1.00 10.19 ? 113 VAL C CG2 1 
ATOM   10151 N  N   . THR E 1 114 ? 28.556  30.862  53.454  1.00 7.06  ? 114 THR C N   1 
ATOM   10152 C  CA  . THR E 1 114 ? 28.838  31.864  54.473  1.00 6.90  ? 114 THR C CA  1 
ATOM   10153 C  C   . THR E 1 114 ? 29.278  31.217  55.787  1.00 7.48  ? 114 THR C C   1 
ATOM   10154 O  O   . THR E 1 114 ? 30.235  31.663  56.421  1.00 8.94  ? 114 THR C O   1 
ATOM   10155 C  CB  . THR E 1 114 ? 27.593  32.741  54.733  1.00 6.32  ? 114 THR C CB  1 
ATOM   10156 O  OG1 . THR E 1 114 ? 27.384  33.610  53.612  1.00 9.03  ? 114 THR C OG1 1 
ATOM   10157 C  CG2 . THR E 1 114 ? 27.761  33.569  55.994  1.00 4.88  ? 114 THR C CG2 1 
ATOM   10158 N  N   . ASN E 1 115 ? 28.578  30.163  56.197  1.00 7.88  ? 115 ASN C N   1 
ATOM   10159 C  CA  . ASN E 1 115 ? 28.920  29.483  57.438  1.00 7.08  ? 115 ASN C CA  1 
ATOM   10160 C  C   . ASN E 1 115 ? 30.241  28.717  57.318  1.00 7.68  ? 115 ASN C C   1 
ATOM   10161 O  O   . ASN E 1 115 ? 31.048  28.711  58.251  1.00 7.50  ? 115 ASN C O   1 
ATOM   10162 C  CB  . ASN E 1 115 ? 27.789  28.533  57.853  1.00 8.80  ? 115 ASN C CB  1 
ATOM   10163 C  CG  . ASN E 1 115 ? 28.126  27.740  59.104  1.00 8.92  ? 115 ASN C CG  1 
ATOM   10164 O  OD1 . ASN E 1 115 ? 28.474  26.563  59.029  1.00 7.62  ? 115 ASN C OD1 1 
ATOM   10165 N  ND2 . ASN E 1 115 ? 28.046  28.391  60.261  1.00 9.73  ? 115 ASN C ND2 1 
ATOM   10166 N  N   . MET E 1 116 ? 30.467  28.085  56.171  1.00 5.22  ? 116 MET C N   1 
ATOM   10167 C  CA  . MET E 1 116 ? 31.703  27.328  55.961  1.00 6.64  ? 116 MET C CA  1 
ATOM   10168 C  C   . MET E 1 116 ? 32.944  28.217  56.111  1.00 8.04  ? 116 MET C C   1 
ATOM   10169 O  O   . MET E 1 116 ? 33.913  27.829  56.769  1.00 9.35  ? 116 MET C O   1 
ATOM   10170 C  CB  . MET E 1 116 ? 31.696  26.677  54.577  1.00 6.96  ? 116 MET C CB  1 
ATOM   10171 C  CG  . MET E 1 116 ? 32.923  25.818  54.283  1.00 10.92 ? 116 MET C CG  1 
ATOM   10172 S  SD  . MET E 1 116 ? 32.875  25.112  52.614  1.00 13.98 ? 116 MET C SD  1 
ATOM   10173 C  CE  . MET E 1 116 ? 33.168  26.571  51.636  1.00 12.94 ? 116 MET C CE  1 
ATOM   10174 N  N   . PHE E 1 117 ? 32.923  29.405  55.509  1.00 5.96  ? 117 PHE C N   1 
ATOM   10175 C  CA  . PHE E 1 117 ? 34.065  30.313  55.620  1.00 9.15  ? 117 PHE C CA  1 
ATOM   10176 C  C   . PHE E 1 117 ? 34.184  30.918  57.021  1.00 8.34  ? 117 PHE C C   1 
ATOM   10177 O  O   . PHE E 1 117 ? 35.287  31.167  57.513  1.00 8.04  ? 117 PHE C O   1 
ATOM   10178 C  CB  . PHE E 1 117 ? 33.972  31.444  54.585  1.00 10.39 ? 117 PHE C CB  1 
ATOM   10179 C  CG  . PHE E 1 117 ? 34.369  31.034  53.189  1.00 13.88 ? 117 PHE C CG  1 
ATOM   10180 C  CD1 . PHE E 1 117 ? 35.251  29.979  52.980  1.00 15.69 ? 117 PHE C CD1 1 
ATOM   10181 C  CD2 . PHE E 1 117 ? 33.903  31.741  52.087  1.00 16.24 ? 117 PHE C CD2 1 
ATOM   10182 C  CE1 . PHE E 1 117 ? 35.665  29.635  51.696  1.00 18.18 ? 117 PHE C CE1 1 
ATOM   10183 C  CE2 . PHE E 1 117 ? 34.311  31.405  50.797  1.00 18.74 ? 117 PHE C CE2 1 
ATOM   10184 C  CZ  . PHE E 1 117 ? 35.194  30.351  50.603  1.00 17.96 ? 117 PHE C CZ  1 
ATOM   10185 N  N   . THR E 1 118 ? 33.049  31.157  57.666  1.00 7.63  ? 118 THR C N   1 
ATOM   10186 C  CA  . THR E 1 118 ? 33.069  31.739  59.001  1.00 8.65  ? 118 THR C CA  1 
ATOM   10187 C  C   . THR E 1 118 ? 33.910  30.885  59.945  1.00 9.19  ? 118 THR C C   1 
ATOM   10188 O  O   . THR E 1 118 ? 34.643  31.414  60.779  1.00 9.95  ? 118 THR C O   1 
ATOM   10189 C  CB  . THR E 1 118 ? 31.644  31.892  59.559  1.00 8.15  ? 118 THR C CB  1 
ATOM   10190 O  OG1 . THR E 1 118 ? 30.902  32.769  58.703  1.00 9.30  ? 118 THR C OG1 1 
ATOM   10191 C  CG2 . THR E 1 118 ? 31.676  32.473  60.964  1.00 5.85  ? 118 THR C CG2 1 
ATOM   10192 N  N   . SER E 1 119 ? 33.810  29.567  59.813  1.00 8.42  ? 119 SER C N   1 
ATOM   10193 C  CA  . SER E 1 119 ? 34.604  28.685  60.657  1.00 9.73  ? 119 SER C CA  1 
ATOM   10194 C  C   . SER E 1 119 ? 36.057  28.622  60.206  1.00 9.94  ? 119 SER C C   1 
ATOM   10195 O  O   . SER E 1 119 ? 36.960  29.041  60.924  1.00 10.76 ? 119 SER C O   1 
ATOM   10196 C  CB  . SER E 1 119 ? 34.032  27.266  60.663  1.00 8.71  ? 119 SER C CB  1 
ATOM   10197 O  OG  . SER E 1 119 ? 32.941  27.150  61.555  1.00 10.79 ? 119 SER C OG  1 
ATOM   10198 N  N   . ILE E 1 120 ? 36.272  28.113  58.999  1.00 8.98  ? 120 ILE C N   1 
ATOM   10199 C  CA  . ILE E 1 120 ? 37.616  27.934  58.469  1.00 9.13  ? 120 ILE C CA  1 
ATOM   10200 C  C   . ILE E 1 120 ? 38.524  29.166  58.379  1.00 9.97  ? 120 ILE C C   1 
ATOM   10201 O  O   . ILE E 1 120 ? 39.713  29.065  58.687  1.00 9.48  ? 120 ILE C O   1 
ATOM   10202 C  CB  . ILE E 1 120 ? 37.543  27.220  57.104  1.00 8.71  ? 120 ILE C CB  1 
ATOM   10203 C  CG1 . ILE E 1 120 ? 36.721  25.935  57.266  1.00 8.63  ? 120 ILE C CG1 1 
ATOM   10204 C  CG2 . ILE E 1 120 ? 38.947  26.881  56.598  1.00 8.89  ? 120 ILE C CG2 1 
ATOM   10205 C  CD1 . ILE E 1 120 ? 36.554  25.135  55.994  1.00 8.58  ? 120 ILE C CD1 1 
ATOM   10206 N  N   . VAL E 1 121 ? 37.995  30.320  57.974  1.00 8.07  ? 121 VAL C N   1 
ATOM   10207 C  CA  . VAL E 1 121 ? 38.830  31.516  57.878  1.00 9.05  ? 121 VAL C CA  1 
ATOM   10208 C  C   . VAL E 1 121 ? 38.334  32.684  58.732  1.00 9.51  ? 121 VAL C C   1 
ATOM   10209 O  O   . VAL E 1 121 ? 38.701  33.834  58.490  1.00 12.58 ? 121 VAL C O   1 
ATOM   10210 C  CB  . VAL E 1 121 ? 38.956  32.009  56.406  1.00 7.32  ? 121 VAL C CB  1 
ATOM   10211 C  CG1 . VAL E 1 121 ? 39.522  30.905  55.530  1.00 9.02  ? 121 VAL C CG1 1 
ATOM   10212 C  CG2 . VAL E 1 121 ? 37.608  32.468  55.881  1.00 8.91  ? 121 VAL C CG2 1 
ATOM   10213 N  N   . GLY E 1 122 ? 37.526  32.383  59.743  1.00 9.22  ? 122 GLY C N   1 
ATOM   10214 C  CA  . GLY E 1 122 ? 36.965  33.422  60.594  1.00 8.98  ? 122 GLY C CA  1 
ATOM   10215 C  C   . GLY E 1 122 ? 37.887  34.275  61.455  1.00 8.95  ? 122 GLY C C   1 
ATOM   10216 O  O   . GLY E 1 122 ? 37.916  35.501  61.302  1.00 9.24  ? 122 GLY C O   1 
ATOM   10217 N  N   . ASN E 1 123 ? 38.630  33.648  62.363  1.00 6.69  ? 123 ASN C N   1 
ATOM   10218 C  CA  . ASN E 1 123 ? 39.521  34.390  63.253  1.00 7.42  ? 123 ASN C CA  1 
ATOM   10219 C  C   . ASN E 1 123 ? 41.003  33.993  63.215  1.00 7.58  ? 123 ASN C C   1 
ATOM   10220 O  O   . ASN E 1 123 ? 41.860  34.781  63.611  1.00 8.21  ? 123 ASN C O   1 
ATOM   10221 C  CB  . ASN E 1 123 ? 39.047  34.259  64.712  1.00 6.40  ? 123 ASN C CB  1 
ATOM   10222 C  CG  . ASN E 1 123 ? 37.591  34.663  64.910  1.00 6.66  ? 123 ASN C CG  1 
ATOM   10223 O  OD1 . ASN E 1 123 ? 37.120  35.645  64.340  1.00 11.68 ? 123 ASN C OD1 1 
ATOM   10224 N  ND2 . ASN E 1 123 ? 36.882  33.916  65.744  1.00 8.32  ? 123 ASN C ND2 1 
ATOM   10225 N  N   . VAL E 1 124 ? 41.311  32.791  62.741  1.00 7.53  ? 124 VAL C N   1 
ATOM   10226 C  CA  . VAL E 1 124 ? 42.692  32.308  62.747  1.00 7.73  ? 124 VAL C CA  1 
ATOM   10227 C  C   . VAL E 1 124 ? 43.775  33.084  61.998  1.00 9.40  ? 124 VAL C C   1 
ATOM   10228 O  O   . VAL E 1 124 ? 44.954  32.935  62.317  1.00 9.79  ? 124 VAL C O   1 
ATOM   10229 C  CB  . VAL E 1 124 ? 42.775  30.829  62.292  1.00 7.39  ? 124 VAL C CB  1 
ATOM   10230 C  CG1 . VAL E 1 124 ? 41.983  29.941  63.258  1.00 7.61  ? 124 VAL C CG1 1 
ATOM   10231 C  CG2 . VAL E 1 124 ? 42.267  30.689  60.878  1.00 7.42  ? 124 VAL C CG2 1 
ATOM   10232 N  N   . PHE E 1 125 ? 43.405  33.902  61.016  1.00 8.76  ? 125 PHE C N   1 
ATOM   10233 C  CA  . PHE E 1 125 ? 44.417  34.655  60.272  1.00 8.82  ? 125 PHE C CA  1 
ATOM   10234 C  C   . PHE E 1 125 ? 45.024  35.816  61.057  1.00 10.01 ? 125 PHE C C   1 
ATOM   10235 O  O   . PHE E 1 125 ? 46.066  36.356  60.669  1.00 8.35  ? 125 PHE C O   1 
ATOM   10236 C  CB  . PHE E 1 125 ? 43.842  35.168  58.944  1.00 6.92  ? 125 PHE C CB  1 
ATOM   10237 C  CG  . PHE E 1 125 ? 43.607  34.085  57.928  1.00 7.87  ? 125 PHE C CG  1 
ATOM   10238 C  CD1 . PHE E 1 125 ? 42.638  33.106  58.143  1.00 8.86  ? 125 PHE C CD1 1 
ATOM   10239 C  CD2 . PHE E 1 125 ? 44.375  34.026  56.766  1.00 5.75  ? 125 PHE C CD2 1 
ATOM   10240 C  CE1 . PHE E 1 125 ? 42.437  32.084  57.216  1.00 10.65 ? 125 PHE C CE1 1 
ATOM   10241 C  CE2 . PHE E 1 125 ? 44.184  33.010  55.834  1.00 7.13  ? 125 PHE C CE2 1 
ATOM   10242 C  CZ  . PHE E 1 125 ? 43.215  32.036  56.057  1.00 10.25 ? 125 PHE C CZ  1 
ATOM   10243 N  N   . GLY E 1 126 ? 44.389  36.189  62.166  1.00 10.17 ? 126 GLY C N   1 
ATOM   10244 C  CA  . GLY E 1 126 ? 44.900  37.286  62.973  1.00 10.44 ? 126 GLY C CA  1 
ATOM   10245 C  C   . GLY E 1 126 ? 45.681  36.892  64.222  1.00 12.48 ? 126 GLY C C   1 
ATOM   10246 O  O   . GLY E 1 126 ? 46.084  37.757  65.003  1.00 13.71 ? 126 GLY C O   1 
ATOM   10247 N  N   . PHE E 1 127 ? 45.910  35.599  64.424  1.00 12.39 ? 127 PHE C N   1 
ATOM   10248 C  CA  . PHE E 1 127 ? 46.637  35.155  65.611  1.00 13.25 ? 127 PHE C CA  1 
ATOM   10249 C  C   . PHE E 1 127 ? 48.048  35.715  65.699  1.00 12.53 ? 127 PHE C C   1 
ATOM   10250 O  O   . PHE E 1 127 ? 48.807  35.652  64.736  1.00 12.14 ? 127 PHE C O   1 
ATOM   10251 C  CB  . PHE E 1 127 ? 46.687  33.627  65.672  1.00 16.01 ? 127 PHE C CB  1 
ATOM   10252 C  CG  . PHE E 1 127 ? 45.651  33.035  66.575  1.00 21.04 ? 127 PHE C CG  1 
ATOM   10253 C  CD1 . PHE E 1 127 ? 44.301  33.077  66.233  1.00 23.47 ? 127 PHE C CD1 1 
ATOM   10254 C  CD2 . PHE E 1 127 ? 46.017  32.480  67.796  1.00 21.38 ? 127 PHE C CD2 1 
ATOM   10255 C  CE1 . PHE E 1 127 ? 43.330  32.583  67.104  1.00 24.27 ? 127 PHE C CE1 1 
ATOM   10256 C  CE2 . PHE E 1 127 ? 45.057  31.985  68.671  1.00 23.13 ? 127 PHE C CE2 1 
ATOM   10257 C  CZ  . PHE E 1 127 ? 43.713  32.036  68.324  1.00 24.50 ? 127 PHE C CZ  1 
ATOM   10258 N  N   . LYS E 1 128 ? 48.388  36.259  66.866  1.00 12.18 ? 128 LYS C N   1 
ATOM   10259 C  CA  . LYS E 1 128 ? 49.711  36.832  67.099  1.00 11.40 ? 128 LYS C CA  1 
ATOM   10260 C  C   . LYS E 1 128 ? 50.815  35.794  66.930  1.00 12.30 ? 128 LYS C C   1 
ATOM   10261 O  O   . LYS E 1 128 ? 51.922  36.125  66.503  1.00 14.58 ? 128 LYS C O   1 
ATOM   10262 C  CB  . LYS E 1 128 ? 49.808  37.419  68.512  1.00 11.10 ? 128 LYS C CB  1 
ATOM   10263 C  CG  . LYS E 1 128 ? 49.060  38.723  68.742  1.00 8.20  ? 128 LYS C CG  1 
ATOM   10264 C  CD  . LYS E 1 128 ? 49.300  39.204  70.166  1.00 7.07  ? 128 LYS C CD  1 
ATOM   10265 C  CE  . LYS E 1 128 ? 48.657  40.557  70.455  1.00 7.27  ? 128 LYS C CE  1 
ATOM   10266 N  NZ  . LYS E 1 128 ? 48.812  40.900  71.905  1.00 5.77  ? 128 LYS C NZ  1 
ATOM   10267 N  N   . ALA E 1 129 ? 50.515  34.543  67.267  1.00 11.40 ? 129 ALA C N   1 
ATOM   10268 C  CA  . ALA E 1 129 ? 51.495  33.463  67.168  1.00 12.41 ? 129 ALA C CA  1 
ATOM   10269 C  C   . ALA E 1 129 ? 51.883  33.108  65.731  1.00 11.75 ? 129 ALA C C   1 
ATOM   10270 O  O   . ALA E 1 129 ? 52.799  32.311  65.511  1.00 13.44 ? 129 ALA C O   1 
ATOM   10271 C  CB  . ALA E 1 129 ? 50.974  32.222  67.886  1.00 10.30 ? 129 ALA C CB  1 
ATOM   10272 N  N   . LEU E 1 130 ? 51.192  33.694  64.760  1.00 10.89 ? 130 LEU C N   1 
ATOM   10273 C  CA  . LEU E 1 130 ? 51.486  33.424  63.356  1.00 11.53 ? 130 LEU C CA  1 
ATOM   10274 C  C   . LEU E 1 130 ? 51.959  34.699  62.664  1.00 12.99 ? 130 LEU C C   1 
ATOM   10275 O  O   . LEU E 1 130 ? 51.525  35.800  63.011  1.00 14.37 ? 130 LEU C O   1 
ATOM   10276 C  CB  . LEU E 1 130 ? 50.232  32.902  62.633  1.00 10.57 ? 130 LEU C CB  1 
ATOM   10277 C  CG  . LEU E 1 130 ? 49.460  31.708  63.205  1.00 9.04  ? 130 LEU C CG  1 
ATOM   10278 C  CD1 . LEU E 1 130 ? 48.287  31.385  62.290  1.00 9.51  ? 130 LEU C CD1 1 
ATOM   10279 C  CD2 . LEU E 1 130 ? 50.363  30.496  63.329  1.00 11.08 ? 130 LEU C CD2 1 
ATOM   10280 N  N   . ARG E 1 131 ? 52.852  34.544  61.692  1.00 12.98 ? 131 ARG C N   1 
ATOM   10281 C  CA  . ARG E 1 131 ? 53.364  35.676  60.921  1.00 14.23 ? 131 ARG C CA  1 
ATOM   10282 C  C   . ARG E 1 131 ? 52.468  35.846  59.699  1.00 13.57 ? 131 ARG C C   1 
ATOM   10283 O  O   . ARG E 1 131 ? 52.202  36.965  59.252  1.00 12.94 ? 131 ARG C O   1 
ATOM   10284 C  CB  . ARG E 1 131 ? 54.792  35.403  60.435  1.00 16.99 ? 131 ARG C CB  1 
ATOM   10285 C  CG  . ARG E 1 131 ? 55.889  35.614  61.455  1.00 21.36 ? 131 ARG C CG  1 
ATOM   10286 C  CD  . ARG E 1 131 ? 57.105  34.772  61.090  1.00 25.04 ? 131 ARG C CD  1 
ATOM   10287 N  NE  . ARG E 1 131 ? 57.454  34.871  59.674  1.00 28.58 ? 131 ARG C NE  1 
ATOM   10288 C  CZ  . ARG E 1 131 ? 57.710  33.825  58.889  1.00 28.69 ? 131 ARG C CZ  1 
ATOM   10289 N  NH1 . ARG E 1 131 ? 57.654  32.586  59.373  1.00 25.69 ? 131 ARG C NH1 1 
ATOM   10290 N  NH2 . ARG E 1 131 ? 58.026  34.013  57.617  1.00 29.12 ? 131 ARG C NH2 1 
ATOM   10291 N  N   . ALA E 1 132 ? 52.024  34.714  59.157  1.00 11.01 ? 132 ALA C N   1 
ATOM   10292 C  CA  . ALA E 1 132 ? 51.171  34.700  57.980  1.00 9.89  ? 132 ALA C CA  1 
ATOM   10293 C  C   . ALA E 1 132 ? 50.420  33.378  57.883  1.00 9.43  ? 132 ALA C C   1 
ATOM   10294 O  O   . ALA E 1 132 ? 50.827  32.374  58.466  1.00 9.12  ? 132 ALA C O   1 
ATOM   10295 C  CB  . ALA E 1 132 ? 52.009  34.912  56.728  1.00 8.02  ? 132 ALA C CB  1 
ATOM   10296 N  N   . LEU E 1 133 ? 49.323  33.388  57.135  1.00 9.07  ? 133 LEU C N   1 
ATOM   10297 C  CA  . LEU E 1 133 ? 48.505  32.197  56.947  1.00 8.17  ? 133 LEU C CA  1 
ATOM   10298 C  C   . LEU E 1 133 ? 47.758  32.302  55.628  1.00 9.10  ? 133 LEU C C   1 
ATOM   10299 O  O   . LEU E 1 133 ? 47.240  33.364  55.284  1.00 8.63  ? 133 LEU C O   1 
ATOM   10300 C  CB  . LEU E 1 133 ? 47.491  32.056  58.082  1.00 7.17  ? 133 LEU C CB  1 
ATOM   10301 C  CG  . LEU E 1 133 ? 46.638  30.783  58.040  1.00 6.23  ? 133 LEU C CG  1 
ATOM   10302 C  CD1 . LEU E 1 133 ? 47.534  29.569  58.318  1.00 4.61  ? 133 LEU C CD1 1 
ATOM   10303 C  CD2 . LEU E 1 133 ? 45.514  30.871  59.066  1.00 6.42  ? 133 LEU C CD2 1 
ATOM   10304 N  N   . ARG E 1 134 ? 47.709  31.197  54.889  1.00 10.37 ? 134 ARG C N   1 
ATOM   10305 C  CA  . ARG E 1 134 ? 47.002  31.171  53.616  1.00 9.81  ? 134 ARG C CA  1 
ATOM   10306 C  C   . ARG E 1 134 ? 46.281  29.840  53.434  1.00 9.99  ? 134 ARG C C   1 
ATOM   10307 O  O   . ARG E 1 134 ? 46.860  28.779  53.659  1.00 11.20 ? 134 ARG C O   1 
ATOM   10308 C  CB  . ARG E 1 134 ? 47.975  31.372  52.448  1.00 10.26 ? 134 ARG C CB  1 
ATOM   10309 C  CG  . ARG E 1 134 ? 47.270  31.686  51.131  1.00 9.89  ? 134 ARG C CG  1 
ATOM   10310 C  CD  . ARG E 1 134 ? 48.147  31.427  49.921  1.00 9.23  ? 134 ARG C CD  1 
ATOM   10311 N  NE  . ARG E 1 134 ? 47.666  32.151  48.746  1.00 9.77  ? 134 ARG C NE  1 
ATOM   10312 C  CZ  . ARG E 1 134 ? 48.106  31.951  47.507  1.00 9.83  ? 134 ARG C CZ  1 
ATOM   10313 N  NH1 . ARG E 1 134 ? 49.034  31.035  47.268  1.00 9.92  ? 134 ARG C NH1 1 
ATOM   10314 N  NH2 . ARG E 1 134 ? 47.637  32.688  46.509  1.00 6.19  ? 134 ARG C NH2 1 
ATOM   10315 N  N   . LEU E 1 135 ? 45.013  29.898  53.043  1.00 9.33  ? 135 LEU C N   1 
ATOM   10316 C  CA  . LEU E 1 135 ? 44.239  28.683  52.795  1.00 8.29  ? 135 LEU C CA  1 
ATOM   10317 C  C   . LEU E 1 135 ? 44.423  28.355  51.315  1.00 7.14  ? 135 LEU C C   1 
ATOM   10318 O  O   . LEU E 1 135 ? 43.971  29.101  50.447  1.00 8.08  ? 135 LEU C O   1 
ATOM   10319 C  CB  . LEU E 1 135 ? 42.757  28.917  53.100  1.00 9.38  ? 135 LEU C CB  1 
ATOM   10320 C  CG  . LEU E 1 135 ? 41.811  27.741  52.837  1.00 8.73  ? 135 LEU C CG  1 
ATOM   10321 C  CD1 . LEU E 1 135 ? 42.227  26.544  53.680  1.00 10.48 ? 135 LEU C CD1 1 
ATOM   10322 C  CD2 . LEU E 1 135 ? 40.374  28.161  53.160  1.00 10.42 ? 135 LEU C CD2 1 
ATOM   10323 N  N   . GLU E 1 136 ? 45.093  27.243  51.029  1.00 5.86  ? 136 GLU C N   1 
ATOM   10324 C  CA  . GLU E 1 136 ? 45.359  26.850  49.649  1.00 6.00  ? 136 GLU C CA  1 
ATOM   10325 C  C   . GLU E 1 136 ? 44.244  26.046  48.983  1.00 7.50  ? 136 GLU C C   1 
ATOM   10326 O  O   . GLU E 1 136 ? 43.869  26.321  47.842  1.00 7.89  ? 136 GLU C O   1 
ATOM   10327 C  CB  . GLU E 1 136 ? 46.656  26.038  49.580  1.00 6.37  ? 136 GLU C CB  1 
ATOM   10328 C  CG  . GLU E 1 136 ? 47.928  26.826  49.862  1.00 9.50  ? 136 GLU C CG  1 
ATOM   10329 C  CD  . GLU E 1 136 ? 48.331  27.728  48.709  1.00 12.55 ? 136 GLU C CD  1 
ATOM   10330 O  OE1 . GLU E 1 136 ? 47.740  27.604  47.615  1.00 11.42 ? 136 GLU C OE1 1 
ATOM   10331 O  OE2 . GLU E 1 136 ? 49.250  28.556  48.894  1.00 14.80 ? 136 GLU C OE2 1 
ATOM   10332 N  N   . ASP E 1 137 ? 43.713  25.056  49.692  1.00 6.88  ? 137 ASP C N   1 
ATOM   10333 C  CA  . ASP E 1 137 ? 42.677  24.207  49.117  1.00 8.75  ? 137 ASP C CA  1 
ATOM   10334 C  C   . ASP E 1 137 ? 41.709  23.685  50.167  1.00 9.17  ? 137 ASP C C   1 
ATOM   10335 O  O   . ASP E 1 137 ? 41.971  23.751  51.366  1.00 8.94  ? 137 ASP C O   1 
ATOM   10336 C  CB  . ASP E 1 137 ? 43.337  23.031  48.388  1.00 8.47  ? 137 ASP C CB  1 
ATOM   10337 C  CG  . ASP E 1 137 ? 42.448  22.417  47.315  1.00 9.18  ? 137 ASP C CG  1 
ATOM   10338 O  OD1 . ASP E 1 137 ? 41.293  22.865  47.142  1.00 9.29  ? 137 ASP C OD1 1 
ATOM   10339 O  OD2 . ASP E 1 137 ? 42.919  21.480  46.636  1.00 7.82  ? 137 ASP C OD2 1 
ATOM   10340 N  N   . LEU E 1 138 ? 40.598  23.135  49.690  1.00 10.55 ? 138 LEU C N   1 
ATOM   10341 C  CA  . LEU E 1 138 ? 39.551  22.606  50.546  1.00 11.03 ? 138 LEU C CA  1 
ATOM   10342 C  C   . LEU E 1 138 ? 38.953  21.361  49.884  1.00 10.98 ? 138 LEU C C   1 
ATOM   10343 O  O   . LEU E 1 138 ? 38.616  21.392  48.701  1.00 12.08 ? 138 LEU C O   1 
ATOM   10344 C  CB  . LEU E 1 138 ? 38.466  23.675  50.694  1.00 13.17 ? 138 LEU C CB  1 
ATOM   10345 C  CG  . LEU E 1 138 ? 37.873  24.121  52.027  1.00 15.71 ? 138 LEU C CG  1 
ATOM   10346 C  CD1 . LEU E 1 138 ? 38.950  24.400  53.054  1.00 14.21 ? 138 LEU C CD1 1 
ATOM   10347 C  CD2 . LEU E 1 138 ? 37.041  25.375  51.766  1.00 14.80 ? 138 LEU C CD2 1 
ATOM   10348 N  N   . ARG E 1 139 ? 38.841  20.267  50.632  1.00 8.06  ? 139 ARG C N   1 
ATOM   10349 C  CA  . ARG E 1 139 ? 38.236  19.049  50.099  1.00 7.21  ? 139 ARG C CA  1 
ATOM   10350 C  C   . ARG E 1 139 ? 36.802  19.052  50.618  1.00 7.67  ? 139 ARG C C   1 
ATOM   10351 O  O   . ARG E 1 139 ? 36.558  18.777  51.788  1.00 7.53  ? 139 ARG C O   1 
ATOM   10352 C  CB  . ARG E 1 139 ? 38.964  17.796  50.602  1.00 6.77  ? 139 ARG C CB  1 
ATOM   10353 C  CG  . ARG E 1 139 ? 38.555  16.486  49.904  1.00 7.67  ? 139 ARG C CG  1 
ATOM   10354 C  CD  . ARG E 1 139 ? 37.105  16.075  50.197  1.00 8.13  ? 139 ARG C CD  1 
ATOM   10355 N  NE  . ARG E 1 139 ? 36.908  15.598  51.564  1.00 8.89  ? 139 ARG C NE  1 
ATOM   10356 C  CZ  . ARG E 1 139 ? 37.253  14.390  52.002  1.00 10.26 ? 139 ARG C CZ  1 
ATOM   10357 N  NH1 . ARG E 1 139 ? 37.815  13.514  51.180  1.00 9.35  ? 139 ARG C NH1 1 
ATOM   10358 N  NH2 . ARG E 1 139 ? 37.040  14.055  53.268  1.00 10.52 ? 139 ARG C NH2 1 
ATOM   10359 N  N   . ILE E 1 140 ? 35.857  19.380  49.748  1.00 8.47  ? 140 ILE C N   1 
ATOM   10360 C  CA  . ILE E 1 140 ? 34.462  19.418  50.152  1.00 9.21  ? 140 ILE C CA  1 
ATOM   10361 C  C   . ILE E 1 140 ? 33.837  18.048  49.900  1.00 8.82  ? 140 ILE C C   1 
ATOM   10362 O  O   . ILE E 1 140 ? 33.711  17.605  48.760  1.00 7.91  ? 140 ILE C O   1 
ATOM   10363 C  CB  . ILE E 1 140 ? 33.725  20.542  49.392  1.00 11.76 ? 140 ILE C CB  1 
ATOM   10364 C  CG1 . ILE E 1 140 ? 34.457  21.869  49.650  1.00 14.03 ? 140 ILE C CG1 1 
ATOM   10365 C  CG2 . ILE E 1 140 ? 32.277  20.646  49.868  1.00 12.65 ? 140 ILE C CG2 1 
ATOM   10366 C  CD1 . ILE E 1 140 ? 33.915  23.057  48.892  1.00 17.65 ? 140 ILE C CD1 1 
ATOM   10367 N  N   . PRO E 1 141 ? 33.446  17.350  50.980  1.00 8.36  ? 141 PRO C N   1 
ATOM   10368 C  CA  . PRO E 1 141 ? 32.843  16.020  50.855  1.00 6.82  ? 141 PRO C CA  1 
ATOM   10369 C  C   . PRO E 1 141 ? 31.531  16.037  50.067  1.00 7.94  ? 141 PRO C C   1 
ATOM   10370 O  O   . PRO E 1 141 ? 30.785  17.017  50.114  1.00 7.82  ? 141 PRO C O   1 
ATOM   10371 C  CB  . PRO E 1 141 ? 32.677  15.588  52.310  1.00 6.55  ? 141 PRO C CB  1 
ATOM   10372 C  CG  . PRO E 1 141 ? 32.393  16.880  53.008  1.00 7.79  ? 141 PRO C CG  1 
ATOM   10373 C  CD  . PRO E 1 141 ? 33.366  17.843  52.369  1.00 7.04  ? 141 PRO C CD  1 
ATOM   10374 N  N   . VAL E 1 142 ? 31.261  14.954  49.341  1.00 6.84  ? 142 VAL C N   1 
ATOM   10375 C  CA  . VAL E 1 142 ? 30.049  14.873  48.530  1.00 9.79  ? 142 VAL C CA  1 
ATOM   10376 C  C   . VAL E 1 142 ? 28.763  15.022  49.339  1.00 9.38  ? 142 VAL C C   1 
ATOM   10377 O  O   . VAL E 1 142 ? 27.776  15.572  48.848  1.00 10.48 ? 142 VAL C O   1 
ATOM   10378 C  CB  . VAL E 1 142 ? 29.998  13.555  47.713  1.00 11.26 ? 142 VAL C CB  1 
ATOM   10379 C  CG1 . VAL E 1 142 ? 31.208  13.479  46.794  1.00 12.27 ? 142 VAL C CG1 1 
ATOM   10380 C  CG2 . VAL E 1 142 ? 29.946  12.346  48.636  1.00 13.22 ? 142 VAL C CG2 1 
ATOM   10381 N  N   . ALA E 1 143 ? 28.772  14.547  50.581  1.00 6.99  ? 143 ALA C N   1 
ATOM   10382 C  CA  . ALA E 1 143 ? 27.590  14.666  51.426  1.00 7.50  ? 143 ALA C CA  1 
ATOM   10383 C  C   . ALA E 1 143 ? 27.249  16.137  51.686  1.00 6.78  ? 143 ALA C C   1 
ATOM   10384 O  O   . ALA E 1 143 ? 26.081  16.484  51.861  1.00 6.80  ? 143 ALA C O   1 
ATOM   10385 C  CB  . ALA E 1 143 ? 27.810  13.934  52.750  1.00 7.76  ? 143 ALA C CB  1 
ATOM   10386 N  N   . TYR E 1 144 ? 28.262  17.005  51.709  1.00 5.80  ? 144 TYR C N   1 
ATOM   10387 C  CA  . TYR E 1 144 ? 28.015  18.431  51.943  1.00 6.00  ? 144 TYR C CA  1 
ATOM   10388 C  C   . TYR E 1 144 ? 27.669  19.131  50.630  1.00 6.97  ? 144 TYR C C   1 
ATOM   10389 O  O   . TYR E 1 144 ? 26.845  20.050  50.603  1.00 7.89  ? 144 TYR C O   1 
ATOM   10390 C  CB  . TYR E 1 144 ? 29.237  19.096  52.587  1.00 6.31  ? 144 TYR C CB  1 
ATOM   10391 C  CG  . TYR E 1 144 ? 28.976  20.491  53.117  1.00 5.97  ? 144 TYR C CG  1 
ATOM   10392 C  CD1 . TYR E 1 144 ? 27.906  20.745  53.988  1.00 7.73  ? 144 TYR C CD1 1 
ATOM   10393 C  CD2 . TYR E 1 144 ? 29.802  21.557  52.765  1.00 7.98  ? 144 TYR C CD2 1 
ATOM   10394 C  CE1 . TYR E 1 144 ? 27.669  22.026  54.484  1.00 7.31  ? 144 TYR C CE1 1 
ATOM   10395 C  CE2 . TYR E 1 144 ? 29.571  22.844  53.255  1.00 5.76  ? 144 TYR C CE2 1 
ATOM   10396 C  CZ  . TYR E 1 144 ? 28.508  23.071  54.114  1.00 8.55  ? 144 TYR C CZ  1 
ATOM   10397 O  OH  . TYR E 1 144 ? 28.287  24.345  54.595  1.00 8.05  ? 144 TYR C OH  1 
ATOM   10398 N  N   . VAL E 1 145 ? 28.300  18.688  49.544  1.00 6.70  ? 145 VAL C N   1 
ATOM   10399 C  CA  . VAL E 1 145 ? 28.044  19.250  48.219  1.00 6.89  ? 145 VAL C CA  1 
ATOM   10400 C  C   . VAL E 1 145 ? 26.562  19.113  47.857  1.00 8.09  ? 145 VAL C C   1 
ATOM   10401 O  O   . VAL E 1 145 ? 25.977  20.006  47.239  1.00 8.70  ? 145 VAL C O   1 
ATOM   10402 C  CB  . VAL E 1 145 ? 28.873  18.520  47.134  1.00 7.49  ? 145 VAL C CB  1 
ATOM   10403 C  CG1 . VAL E 1 145 ? 28.397  18.930  45.739  1.00 6.29  ? 145 VAL C CG1 1 
ATOM   10404 C  CG2 . VAL E 1 145 ? 30.355  18.837  47.309  1.00 5.75  ? 145 VAL C CG2 1 
ATOM   10405 N  N   . LYS E 1 146 ? 25.962  17.987  48.234  1.00 7.56  ? 146 LYS C N   1 
ATOM   10406 C  CA  . LYS E 1 146 ? 24.556  17.738  47.931  1.00 7.30  ? 146 LYS C CA  1 
ATOM   10407 C  C   . LYS E 1 146 ? 23.579  18.650  48.669  1.00 7.89  ? 146 LYS C C   1 
ATOM   10408 O  O   . LYS E 1 146 ? 22.381  18.624  48.392  1.00 10.80 ? 146 LYS C O   1 
ATOM   10409 C  CB  . LYS E 1 146 ? 24.204  16.277  48.216  1.00 5.97  ? 146 LYS C CB  1 
ATOM   10410 C  CG  . LYS E 1 146 ? 24.799  15.279  47.233  1.00 9.62  ? 146 LYS C CG  1 
ATOM   10411 C  CD  . LYS E 1 146 ? 24.251  15.475  45.814  1.00 7.46  ? 146 LYS C CD  1 
ATOM   10412 C  CE  . LYS E 1 146 ? 22.744  15.248  45.759  1.00 9.10  ? 146 LYS C CE  1 
ATOM   10413 N  NZ  . LYS E 1 146 ? 22.201  15.335  44.367  1.00 9.13  ? 146 LYS C NZ  1 
ATOM   10414 N  N   . THR E 1 147 ? 24.067  19.459  49.604  1.00 7.20  ? 147 THR C N   1 
ATOM   10415 C  CA  . THR E 1 147 ? 23.163  20.352  50.326  1.00 6.81  ? 147 THR C CA  1 
ATOM   10416 C  C   . THR E 1 147 ? 23.036  21.700  49.620  1.00 8.26  ? 147 THR C C   1 
ATOM   10417 O  O   . THR E 1 147 ? 22.287  22.575  50.062  1.00 6.96  ? 147 THR C O   1 
ATOM   10418 C  CB  . THR E 1 147 ? 23.628  20.587  51.781  1.00 5.75  ? 147 THR C CB  1 
ATOM   10419 O  OG1 . THR E 1 147 ? 24.871  21.297  51.784  1.00 6.97  ? 147 THR C OG1 1 
ATOM   10420 C  CG2 . THR E 1 147 ? 23.807  19.259  52.500  1.00 6.00  ? 147 THR C CG2 1 
ATOM   10421 N  N   . PHE E 1 148 ? 23.763  21.859  48.514  1.00 7.56  ? 148 PHE C N   1 
ATOM   10422 C  CA  . PHE E 1 148 ? 23.729  23.100  47.748  1.00 9.41  ? 148 PHE C CA  1 
ATOM   10423 C  C   . PHE E 1 148 ? 23.011  22.925  46.408  1.00 10.38 ? 148 PHE C C   1 
ATOM   10424 O  O   . PHE E 1 148 ? 22.955  21.820  45.864  1.00 9.72  ? 148 PHE C O   1 
ATOM   10425 C  CB  . PHE E 1 148 ? 25.148  23.606  47.469  1.00 6.78  ? 148 PHE C CB  1 
ATOM   10426 C  CG  . PHE E 1 148 ? 25.917  24.007  48.701  1.00 7.54  ? 148 PHE C CG  1 
ATOM   10427 C  CD1 . PHE E 1 148 ? 26.557  23.049  49.485  1.00 6.18  ? 148 PHE C CD1 1 
ATOM   10428 C  CD2 . PHE E 1 148 ? 26.023  25.349  49.060  1.00 6.76  ? 148 PHE C CD2 1 
ATOM   10429 C  CE1 . PHE E 1 148 ? 27.295  23.424  50.610  1.00 8.60  ? 148 PHE C CE1 1 
ATOM   10430 C  CE2 . PHE E 1 148 ? 26.756  25.736  50.180  1.00 6.83  ? 148 PHE C CE2 1 
ATOM   10431 C  CZ  . PHE E 1 148 ? 27.396  24.771  50.958  1.00 7.07  ? 148 PHE C CZ  1 
ATOM   10432 N  N   . GLN E 1 149 ? 22.466  24.020  45.882  1.00 8.44  ? 149 GLN C N   1 
ATOM   10433 C  CA  . GLN E 1 149 ? 21.785  23.979  44.594  1.00 10.05 ? 149 GLN C CA  1 
ATOM   10434 C  C   . GLN E 1 149 ? 22.837  23.940  43.498  1.00 9.09  ? 149 GLN C C   1 
ATOM   10435 O  O   . GLN E 1 149 ? 22.710  23.202  42.525  1.00 9.56  ? 149 GLN C O   1 
ATOM   10436 C  CB  . GLN E 1 149 ? 20.918  25.225  44.381  1.00 11.62 ? 149 GLN C CB  1 
ATOM   10437 C  CG  . GLN E 1 149 ? 20.438  25.361  42.934  1.00 11.86 ? 149 GLN C CG  1 
ATOM   10438 C  CD  . GLN E 1 149 ? 19.831  26.717  42.621  1.00 12.99 ? 149 GLN C CD  1 
ATOM   10439 O  OE1 . GLN E 1 149 ? 18.702  27.010  43.009  1.00 13.01 ? 149 GLN C OE1 1 
ATOM   10440 N  NE2 . GLN E 1 149 ? 20.587  27.556  41.917  1.00 10.88 ? 149 GLN C NE2 1 
ATOM   10441 N  N   . GLY E 1 150 ? 23.878  24.748  43.668  1.00 9.16  ? 150 GLY C N   1 
ATOM   10442 C  CA  . GLY E 1 150 ? 24.933  24.818  42.680  1.00 7.91  ? 150 GLY C CA  1 
ATOM   10443 C  C   . GLY E 1 150 ? 24.522  25.794  41.595  1.00 7.37  ? 150 GLY C C   1 
ATOM   10444 O  O   . GLY E 1 150 ? 23.610  26.597  41.803  1.00 7.10  ? 150 GLY C O   1 
ATOM   10445 N  N   . PRO E 1 151 ? 25.168  25.749  40.421  1.00 6.99  ? 151 PRO C N   1 
ATOM   10446 C  CA  . PRO E 1 151 ? 24.845  26.652  39.312  1.00 6.15  ? 151 PRO C CA  1 
ATOM   10447 C  C   . PRO E 1 151 ? 23.359  26.605  38.950  1.00 8.06  ? 151 PRO C C   1 
ATOM   10448 O  O   . PRO E 1 151 ? 22.746  25.537  38.942  1.00 8.96  ? 151 PRO C O   1 
ATOM   10449 C  CB  . PRO E 1 151 ? 25.719  26.125  38.177  1.00 5.91  ? 151 PRO C CB  1 
ATOM   10450 C  CG  . PRO E 1 151 ? 26.917  25.580  38.909  1.00 6.36  ? 151 PRO C CG  1 
ATOM   10451 C  CD  . PRO E 1 151 ? 26.284  24.855  40.065  1.00 5.68  ? 151 PRO C CD  1 
ATOM   10452 N  N   . PRO E 1 152 ? 22.758  27.767  38.659  1.00 7.03  ? 152 PRO C N   1 
ATOM   10453 C  CA  . PRO E 1 152 ? 21.338  27.770  38.300  1.00 6.83  ? 152 PRO C CA  1 
ATOM   10454 C  C   . PRO E 1 152 ? 21.076  26.868  37.094  1.00 7.23  ? 152 PRO C C   1 
ATOM   10455 O  O   . PRO E 1 152 ? 20.033  26.221  37.003  1.00 7.60  ? 152 PRO C O   1 
ATOM   10456 C  CB  . PRO E 1 152 ? 21.066  29.236  37.982  1.00 8.18  ? 152 PRO C CB  1 
ATOM   10457 C  CG  . PRO E 1 152 ? 22.013  29.962  38.888  1.00 7.99  ? 152 PRO C CG  1 
ATOM   10458 C  CD  . PRO E 1 152 ? 23.280  29.141  38.778  1.00 7.77  ? 152 PRO C CD  1 
ATOM   10459 N  N   . HIS E 1 153 ? 22.036  26.825  36.171  1.00 6.78  ? 153 HIS C N   1 
ATOM   10460 C  CA  . HIS E 1 153 ? 21.893  26.011  34.969  1.00 5.61  ? 153 HIS C CA  1 
ATOM   10461 C  C   . HIS E 1 153 ? 23.122  25.172  34.621  1.00 5.70  ? 153 HIS C C   1 
ATOM   10462 O  O   . HIS E 1 153 ? 23.030  23.952  34.498  1.00 6.80  ? 153 HIS C O   1 
ATOM   10463 C  CB  . HIS E 1 153 ? 21.504  26.907  33.789  1.00 4.27  ? 153 HIS C CB  1 
ATOM   10464 C  CG  . HIS E 1 153 ? 20.256  27.696  34.037  1.00 5.93  ? 153 HIS C CG  1 
ATOM   10465 N  ND1 . HIS E 1 153 ? 20.273  28.984  34.517  1.00 5.95  ? 153 HIS C ND1 1 
ATOM   10466 C  CD2 . HIS E 1 153 ? 18.948  27.336  33.975  1.00 5.69  ? 153 HIS C CD2 1 
ATOM   10467 C  CE1 . HIS E 1 153 ? 19.036  29.388  34.746  1.00 6.60  ? 153 HIS C CE1 1 
ATOM   10468 N  NE2 . HIS E 1 153 ? 18.213  28.403  34.426  1.00 6.22  ? 153 HIS C NE2 1 
ATOM   10469 N  N   . GLY E 1 154 ? 24.271  25.818  34.464  1.00 6.00  ? 154 GLY C N   1 
ATOM   10470 C  CA  . GLY E 1 154 ? 25.469  25.066  34.132  1.00 4.81  ? 154 GLY C CA  1 
ATOM   10471 C  C   . GLY E 1 154 ? 25.736  25.008  32.642  1.00 5.66  ? 154 GLY C C   1 
ATOM   10472 O  O   . GLY E 1 154 ? 24.867  25.327  31.825  1.00 6.35  ? 154 GLY C O   1 
ATOM   10473 N  N   . ILE E 1 155 ? 26.941  24.571  32.295  1.00 5.09  ? 155 ILE C N   1 
ATOM   10474 C  CA  . ILE E 1 155 ? 27.395  24.490  30.911  1.00 7.21  ? 155 ILE C CA  1 
ATOM   10475 C  C   . ILE E 1 155 ? 26.453  23.840  29.897  1.00 6.33  ? 155 ILE C C   1 
ATOM   10476 O  O   . ILE E 1 155 ? 26.135  24.443  28.876  1.00 7.32  ? 155 ILE C O   1 
ATOM   10477 C  CB  . ILE E 1 155 ? 28.773  23.792  30.852  1.00 7.97  ? 155 ILE C CB  1 
ATOM   10478 C  CG1 . ILE E 1 155 ? 29.776  24.583  31.707  1.00 7.66  ? 155 ILE C CG1 1 
ATOM   10479 C  CG2 . ILE E 1 155 ? 29.257  23.702  29.414  1.00 8.12  ? 155 ILE C CG2 1 
ATOM   10480 C  CD1 . ILE E 1 155 ? 31.136  23.925  31.849  1.00 8.88  ? 155 ILE C CD1 1 
ATOM   10481 N  N   . GLN E 1 156 ? 26.016  22.616  30.164  1.00 7.17  ? 156 GLN C N   1 
ATOM   10482 C  CA  . GLN E 1 156 ? 25.122  21.917  29.246  1.00 7.07  ? 156 GLN C CA  1 
ATOM   10483 C  C   . GLN E 1 156 ? 23.839  22.699  28.971  1.00 7.13  ? 156 GLN C C   1 
ATOM   10484 O  O   . GLN E 1 156 ? 23.523  23.011  27.827  1.00 6.58  ? 156 GLN C O   1 
ATOM   10485 C  CB  . GLN E 1 156 ? 24.751  20.546  29.807  1.00 7.78  ? 156 GLN C CB  1 
ATOM   10486 C  CG  . GLN E 1 156 ? 23.809  19.740  28.919  1.00 8.93  ? 156 GLN C CG  1 
ATOM   10487 C  CD  . GLN E 1 156 ? 23.004  18.719  29.711  1.00 12.56 ? 156 GLN C CD  1 
ATOM   10488 O  OE1 . GLN E 1 156 ? 22.101  19.080  30.468  1.00 13.23 ? 156 GLN C OE1 1 
ATOM   10489 N  NE2 . GLN E 1 156 ? 23.332  17.442  29.548  1.00 11.47 ? 156 GLN C NE2 1 
ATOM   10490 N  N   . VAL E 1 157 ? 23.105  23.011  30.032  1.00 6.85  ? 157 VAL C N   1 
ATOM   10491 C  CA  . VAL E 1 157 ? 21.846  23.731  29.904  1.00 7.10  ? 157 VAL C CA  1 
ATOM   10492 C  C   . VAL E 1 157 ? 21.993  25.100  29.247  1.00 6.95  ? 157 VAL C C   1 
ATOM   10493 O  O   . VAL E 1 157 ? 21.131  25.510  28.466  1.00 7.89  ? 157 VAL C O   1 
ATOM   10494 C  CB  . VAL E 1 157 ? 21.156  23.874  31.287  1.00 6.22  ? 157 VAL C CB  1 
ATOM   10495 C  CG1 . VAL E 1 157 ? 19.900  24.726  31.168  1.00 6.95  ? 157 VAL C CG1 1 
ATOM   10496 C  CG2 . VAL E 1 157 ? 20.794  22.497  31.821  1.00 6.26  ? 157 VAL C CG2 1 
ATOM   10497 N  N   . GLU E 1 158 ? 23.077  25.808  29.552  1.00 6.05  ? 158 GLU C N   1 
ATOM   10498 C  CA  . GLU E 1 158 ? 23.291  27.120  28.956  1.00 5.69  ? 158 GLU C CA  1 
ATOM   10499 C  C   . GLU E 1 158 ? 23.449  27.010  27.440  1.00 5.46  ? 158 GLU C C   1 
ATOM   10500 O  O   . GLU E 1 158 ? 22.811  27.749  26.689  1.00 6.07  ? 158 GLU C O   1 
ATOM   10501 C  CB  . GLU E 1 158 ? 24.527  27.802  29.552  1.00 4.97  ? 158 GLU C CB  1 
ATOM   10502 C  CG  . GLU E 1 158 ? 24.822  29.129  28.873  1.00 7.28  ? 158 GLU C CG  1 
ATOM   10503 C  CD  . GLU E 1 158 ? 25.775  30.013  29.644  1.00 8.86  ? 158 GLU C CD  1 
ATOM   10504 O  OE1 . GLU E 1 158 ? 26.133  29.671  30.792  1.00 8.83  ? 158 GLU C OE1 1 
ATOM   10505 O  OE2 . GLU E 1 158 ? 26.157  31.064  29.092  1.00 8.33  ? 158 GLU C OE2 1 
ATOM   10506 N  N   . ARG E 1 159 ? 24.293  26.086  26.988  1.00 4.41  ? 159 ARG C N   1 
ATOM   10507 C  CA  . ARG E 1 159 ? 24.489  25.905  25.548  1.00 7.20  ? 159 ARG C CA  1 
ATOM   10508 C  C   . ARG E 1 159 ? 23.173  25.523  24.870  1.00 7.66  ? 159 ARG C C   1 
ATOM   10509 O  O   . ARG E 1 159 ? 22.887  25.969  23.759  1.00 9.36  ? 159 ARG C O   1 
ATOM   10510 C  CB  . ARG E 1 159 ? 25.547  24.828  25.263  1.00 6.93  ? 159 ARG C CB  1 
ATOM   10511 C  CG  . ARG E 1 159 ? 26.995  25.288  25.482  1.00 8.05  ? 159 ARG C CG  1 
ATOM   10512 C  CD  . ARG E 1 159 ? 28.002  24.245  24.985  1.00 7.56  ? 159 ARG C CD  1 
ATOM   10513 N  NE  . ARG E 1 159 ? 29.380  24.738  25.019  1.00 7.66  ? 159 ARG C NE  1 
ATOM   10514 C  CZ  . ARG E 1 159 ? 29.862  25.672  24.202  1.00 8.40  ? 159 ARG C CZ  1 
ATOM   10515 N  NH1 . ARG E 1 159 ? 29.077  26.217  23.284  1.00 6.01  ? 159 ARG C NH1 1 
ATOM   10516 N  NH2 . ARG E 1 159 ? 31.128  26.061  24.296  1.00 8.71  ? 159 ARG C NH2 1 
ATOM   10517 N  N   . ASP E 1 160 ? 22.367  24.708  25.545  1.00 7.28  ? 160 ASP C N   1 
ATOM   10518 C  CA  . ASP E 1 160 ? 21.083  24.275  24.993  1.00 7.45  ? 160 ASP C CA  1 
ATOM   10519 C  C   . ASP E 1 160 ? 20.060  25.411  24.930  1.00 7.36  ? 160 ASP C C   1 
ATOM   10520 O  O   . ASP E 1 160 ? 19.274  25.486  23.989  1.00 7.53  ? 160 ASP C O   1 
ATOM   10521 C  CB  . ASP E 1 160 ? 20.509  23.102  25.805  1.00 6.10  ? 160 ASP C CB  1 
ATOM   10522 C  CG  . ASP E 1 160 ? 21.319  21.821  25.643  1.00 10.76 ? 160 ASP C CG  1 
ATOM   10523 O  OD1 . ASP E 1 160 ? 21.936  21.632  24.568  1.00 9.01  ? 160 ASP C OD1 1 
ATOM   10524 O  OD2 . ASP E 1 160 ? 21.325  20.992  26.581  1.00 8.68  ? 160 ASP C OD2 1 
ATOM   10525 N  N   . LYS E 1 161 ? 20.069  26.298  25.921  1.00 8.47  ? 161 LYS C N   1 
ATOM   10526 C  CA  . LYS E 1 161 ? 19.125  27.418  25.925  1.00 9.64  ? 161 LYS C CA  1 
ATOM   10527 C  C   . LYS E 1 161 ? 19.482  28.433  24.836  1.00 9.18  ? 161 LYS C C   1 
ATOM   10528 O  O   . LYS E 1 161 ? 18.608  28.951  24.144  1.00 10.29 ? 161 LYS C O   1 
ATOM   10529 C  CB  . LYS E 1 161 ? 19.137  28.135  27.282  1.00 9.85  ? 161 LYS C CB  1 
ATOM   10530 C  CG  . LYS E 1 161 ? 18.575  27.345  28.456  1.00 11.38 ? 161 LYS C CG  1 
ATOM   10531 C  CD  . LYS E 1 161 ? 17.058  27.225  28.393  1.00 10.49 ? 161 LYS C CD  1 
ATOM   10532 C  CE  . LYS E 1 161 ? 16.506  26.528  29.640  1.00 11.81 ? 161 LYS C CE  1 
ATOM   10533 N  NZ  . LYS E 1 161 ? 16.761  27.284  30.904  1.00 9.40  ? 161 LYS C NZ  1 
ATOM   10534 N  N   . LEU E 1 162 ? 20.773  28.711  24.688  1.00 9.36  ? 162 LEU C N   1 
ATOM   10535 C  CA  . LEU E 1 162 ? 21.234  29.691  23.710  1.00 9.67  ? 162 LEU C CA  1 
ATOM   10536 C  C   . LEU E 1 162 ? 21.476  29.122  22.320  1.00 9.66  ? 162 LEU C C   1 
ATOM   10537 O  O   . LEU E 1 162 ? 21.706  29.875  21.378  1.00 11.52 ? 162 LEU C O   1 
ATOM   10538 C  CB  . LEU E 1 162 ? 22.520  30.353  24.208  1.00 9.19  ? 162 LEU C CB  1 
ATOM   10539 C  CG  . LEU E 1 162 ? 22.449  31.034  25.575  1.00 11.49 ? 162 LEU C CG  1 
ATOM   10540 C  CD1 . LEU E 1 162 ? 23.792  31.665  25.899  1.00 8.32  ? 162 LEU C CD1 1 
ATOM   10541 C  CD2 . LEU E 1 162 ? 21.342  32.078  25.571  1.00 10.76 ? 162 LEU C CD2 1 
ATOM   10542 N  N   . ASN E 1 163 ? 21.433  27.798  22.200  1.00 10.45 ? 163 ASN C N   1 
ATOM   10543 C  CA  . ASN E 1 163 ? 21.656  27.120  20.926  1.00 10.29 ? 163 ASN C CA  1 
ATOM   10544 C  C   . ASN E 1 163 ? 23.048  27.446  20.360  1.00 11.22 ? 163 ASN C C   1 
ATOM   10545 O  O   . ASN E 1 163 ? 23.198  27.752  19.175  1.00 11.85 ? 163 ASN C O   1 
ATOM   10546 C  CB  . ASN E 1 163 ? 20.563  27.522  19.931  1.00 13.04 ? 163 ASN C CB  1 
ATOM   10547 C  CG  . ASN E 1 163 ? 20.226  26.411  18.947  1.00 17.03 ? 163 ASN C CG  1 
ATOM   10548 O  OD1 . ASN E 1 163 ? 20.244  25.228  19.296  1.00 19.19 ? 163 ASN C OD1 1 
ATOM   10549 N  ND2 . ASN E 1 163 ? 19.894  26.790  17.719  1.00 18.48 ? 163 ASN C ND2 1 
ATOM   10550 N  N   . LYS E 1 164 ? 24.064  27.364  21.214  1.00 9.19  ? 164 LYS C N   1 
ATOM   10551 C  CA  . LYS E 1 164 ? 25.443  27.649  20.815  1.00 8.17  ? 164 LYS C CA  1 
ATOM   10552 C  C   . LYS E 1 164 ? 26.347  26.461  21.140  1.00 8.30  ? 164 LYS C C   1 
ATOM   10553 O  O   . LYS E 1 164 ? 26.402  26.000  22.282  1.00 7.93  ? 164 LYS C O   1 
ATOM   10554 C  CB  . LYS E 1 164 ? 25.924  28.921  21.516  1.00 10.50 ? 164 LYS C CB  1 
ATOM   10555 C  CG  . LYS E 1 164 ? 25.139  30.161  21.076  1.00 9.92  ? 164 LYS C CG  1 
ATOM   10556 C  CD  . LYS E 1 164 ? 25.584  31.415  21.808  1.00 10.84 ? 164 LYS C CD  1 
ATOM   10557 C  CE  . LYS E 1 164 ? 24.695  32.608  21.458  1.00 8.60  ? 164 LYS C CE  1 
ATOM   10558 N  NZ  . LYS E 1 164 ? 24.855  33.081  20.051  1.00 7.08  ? 164 LYS C NZ  1 
ATOM   10559 N  N   . TYR E 1 165 ? 27.049  25.968  20.125  1.00 7.27  ? 165 TYR C N   1 
ATOM   10560 C  CA  . TYR E 1 165 ? 27.914  24.801  20.276  1.00 8.75  ? 165 TYR C CA  1 
ATOM   10561 C  C   . TYR E 1 165 ? 29.146  24.856  19.377  1.00 8.51  ? 165 TYR C C   1 
ATOM   10562 O  O   . TYR E 1 165 ? 29.159  25.558  18.364  1.00 9.68  ? 165 TYR C O   1 
ATOM   10563 C  CB  . TYR E 1 165 ? 27.141  23.533  19.897  1.00 9.50  ? 165 TYR C CB  1 
ATOM   10564 C  CG  . TYR E 1 165 ? 25.769  23.373  20.523  1.00 10.99 ? 165 TYR C CG  1 
ATOM   10565 C  CD1 . TYR E 1 165 ? 25.627  22.893  21.823  1.00 9.87  ? 165 TYR C CD1 1 
ATOM   10566 C  CD2 . TYR E 1 165 ? 24.609  23.639  19.787  1.00 8.72  ? 165 TYR C CD2 1 
ATOM   10567 C  CE1 . TYR E 1 165 ? 24.364  22.669  22.374  1.00 9.28  ? 165 TYR C CE1 1 
ATOM   10568 C  CE2 . TYR E 1 165 ? 23.342  23.420  20.328  1.00 5.85  ? 165 TYR C CE2 1 
ATOM   10569 C  CZ  . TYR E 1 165 ? 23.229  22.932  21.620  1.00 8.02  ? 165 TYR C CZ  1 
ATOM   10570 O  OH  . TYR E 1 165 ? 21.986  22.685  22.153  1.00 8.58  ? 165 TYR C OH  1 
ATOM   10571 N  N   . GLY E 1 166 ? 30.167  24.092  19.754  1.00 8.50  ? 166 GLY C N   1 
ATOM   10572 C  CA  . GLY E 1 166 ? 31.382  23.991  18.963  1.00 9.72  ? 166 GLY C CA  1 
ATOM   10573 C  C   . GLY E 1 166 ? 32.436  25.081  19.006  1.00 9.42  ? 166 GLY C C   1 
ATOM   10574 O  O   . GLY E 1 166 ? 33.348  25.069  18.190  1.00 8.58  ? 166 GLY C O   1 
ATOM   10575 N  N   . ARG E 1 167 ? 32.337  26.015  19.941  1.00 9.98  ? 167 ARG C N   1 
ATOM   10576 C  CA  . ARG E 1 167 ? 33.328  27.086  20.016  1.00 9.96  ? 167 ARG C CA  1 
ATOM   10577 C  C   . ARG E 1 167 ? 33.181  27.888  21.298  1.00 9.80  ? 167 ARG C C   1 
ATOM   10578 O  O   . ARG E 1 167 ? 32.146  27.833  21.959  1.00 9.97  ? 167 ARG C O   1 
ATOM   10579 C  CB  . ARG E 1 167 ? 33.163  28.054  18.837  1.00 9.43  ? 167 ARG C CB  1 
ATOM   10580 C  CG  . ARG E 1 167 ? 31.887  28.906  18.922  1.00 8.81  ? 167 ARG C CG  1 
ATOM   10581 C  CD  . ARG E 1 167 ? 31.816  29.980  17.839  1.00 9.00  ? 167 ARG C CD  1 
ATOM   10582 N  NE  . ARG E 1 167 ? 30.509  30.648  17.810  1.00 11.47 ? 167 ARG C NE  1 
ATOM   10583 C  CZ  . ARG E 1 167 ? 30.115  31.596  18.660  1.00 12.71 ? 167 ARG C CZ  1 
ATOM   10584 N  NH1 . ARG E 1 167 ? 30.923  32.019  19.625  1.00 9.43  ? 167 ARG C NH1 1 
ATOM   10585 N  NH2 . ARG E 1 167 ? 28.893  32.111  18.558  1.00 11.20 ? 167 ARG C NH2 1 
ATOM   10586 N  N   . PRO E 1 168 ? 34.231  28.635  21.674  1.00 8.72  ? 168 PRO C N   1 
ATOM   10587 C  CA  . PRO E 1 168 ? 34.136  29.443  22.889  1.00 7.59  ? 168 PRO C CA  1 
ATOM   10588 C  C   . PRO E 1 168 ? 33.095  30.526  22.595  1.00 8.76  ? 168 PRO C C   1 
ATOM   10589 O  O   . PRO E 1 168 ? 32.853  30.855  21.431  1.00 6.84  ? 168 PRO C O   1 
ATOM   10590 C  CB  . PRO E 1 168 ? 35.537  30.038  23.019  1.00 7.87  ? 168 PRO C CB  1 
ATOM   10591 C  CG  . PRO E 1 168 ? 36.415  28.980  22.404  1.00 7.84  ? 168 PRO C CG  1 
ATOM   10592 C  CD  . PRO E 1 168 ? 35.619  28.586  21.178  1.00 9.56  ? 168 PRO C CD  1 
ATOM   10593 N  N   . LEU E 1 169 ? 32.470  31.068  23.633  1.00 9.70  ? 169 LEU C N   1 
ATOM   10594 C  CA  . LEU E 1 169 ? 31.491  32.129  23.439  1.00 9.74  ? 169 LEU C CA  1 
ATOM   10595 C  C   . LEU E 1 169 ? 32.275  33.440  23.492  1.00 11.03 ? 169 LEU C C   1 
ATOM   10596 O  O   . LEU E 1 169 ? 33.380  33.475  24.039  1.00 10.52 ? 169 LEU C O   1 
ATOM   10597 C  CB  . LEU E 1 169 ? 30.422  32.078  24.535  1.00 11.17 ? 169 LEU C CB  1 
ATOM   10598 C  CG  . LEU E 1 169 ? 29.594  30.787  24.558  1.00 13.63 ? 169 LEU C CG  1 
ATOM   10599 C  CD1 . LEU E 1 169 ? 28.561  30.857  25.671  1.00 15.07 ? 169 LEU C CD1 1 
ATOM   10600 C  CD2 . LEU E 1 169 ? 28.909  30.591  23.211  1.00 15.45 ? 169 LEU C CD2 1 
ATOM   10601 N  N   . LEU E 1 170 ? 31.719  34.508  22.921  1.00 11.06 ? 170 LEU C N   1 
ATOM   10602 C  CA  . LEU E 1 170 ? 32.401  35.803  22.889  1.00 10.70 ? 170 LEU C CA  1 
ATOM   10603 C  C   . LEU E 1 170 ? 31.655  36.930  23.591  1.00 11.83 ? 170 LEU C C   1 
ATOM   10604 O  O   . LEU E 1 170 ? 30.474  37.169  23.324  1.00 11.42 ? 170 LEU C O   1 
ATOM   10605 C  CB  . LEU E 1 170 ? 32.675  36.206  21.436  1.00 12.94 ? 170 LEU C CB  1 
ATOM   10606 C  CG  . LEU E 1 170 ? 33.729  35.380  20.696  1.00 12.68 ? 170 LEU C CG  1 
ATOM   10607 C  CD1 . LEU E 1 170 ? 33.682  35.679  19.203  1.00 12.86 ? 170 LEU C CD1 1 
ATOM   10608 C  CD2 . LEU E 1 170 ? 35.097  35.699  21.268  1.00 13.12 ? 170 LEU C CD2 1 
ATOM   10609 N  N   . GLY E 1 171 ? 32.362  37.627  24.478  1.00 9.56  ? 171 GLY C N   1 
ATOM   10610 C  CA  . GLY E 1 171 ? 31.767  38.725  25.218  1.00 8.45  ? 171 GLY C CA  1 
ATOM   10611 C  C   . GLY E 1 171 ? 32.543  40.024  25.077  1.00 8.94  ? 171 GLY C C   1 
ATOM   10612 O  O   . GLY E 1 171 ? 33.533  40.094  24.354  1.00 8.04  ? 171 GLY C O   1 
ATOM   10613 N  N   . CYS E 1 172 ? 32.097  41.057  25.783  1.00 8.94  ? 172 CYS C N   1 
ATOM   10614 C  CA  . CYS E 1 172 ? 32.740  42.364  25.708  1.00 9.50  ? 172 CYS C CA  1 
ATOM   10615 C  C   . CYS E 1 172 ? 32.186  43.325  26.754  1.00 9.05  ? 172 CYS C C   1 
ATOM   10616 O  O   . CYS E 1 172 ? 30.974  43.475  26.883  1.00 7.15  ? 172 CYS C O   1 
ATOM   10617 C  CB  . CYS E 1 172 ? 32.532  42.949  24.306  1.00 10.91 ? 172 CYS C CB  1 
ATOM   10618 S  SG  . CYS E 1 172 ? 32.598  44.755  24.195  1.00 12.65 ? 172 CYS C SG  1 
ATOM   10619 N  N   . THR E 1 173 ? 33.077  43.969  27.503  1.00 10.09 ? 173 THR C N   1 
ATOM   10620 C  CA  . THR E 1 173 ? 32.657  44.929  28.518  1.00 9.19  ? 173 THR C CA  1 
ATOM   10621 C  C   . THR E 1 173 ? 32.598  46.318  27.889  1.00 9.92  ? 173 THR C C   1 
ATOM   10622 O  O   . THR E 1 173 ? 33.558  46.756  27.258  1.00 10.64 ? 173 THR C O   1 
ATOM   10623 C  CB  . THR E 1 173 ? 33.649  44.990  29.697  1.00 8.57  ? 173 THR C CB  1 
ATOM   10624 O  OG1 . THR E 1 173 ? 33.888  43.671  30.202  1.00 9.78  ? 173 THR C OG1 1 
ATOM   10625 C  CG2 . THR E 1 173 ? 33.083  45.862  30.812  1.00 6.78  ? 173 THR C CG2 1 
ATOM   10626 N  N   . ILE E 1 174 ? 31.483  47.016  28.066  1.00 8.02  ? 174 ILE C N   1 
ATOM   10627 C  CA  . ILE E 1 174 ? 31.343  48.352  27.503  1.00 7.32  ? 174 ILE C CA  1 
ATOM   10628 C  C   . ILE E 1 174 ? 32.278  49.327  28.224  1.00 7.57  ? 174 ILE C C   1 
ATOM   10629 O  O   . ILE E 1 174 ? 32.485  49.222  29.432  1.00 8.15  ? 174 ILE C O   1 
ATOM   10630 C  CB  . ILE E 1 174 ? 29.879  48.844  27.614  1.00 6.85  ? 174 ILE C CB  1 
ATOM   10631 C  CG1 . ILE E 1 174 ? 28.948  47.850  26.906  1.00 8.42  ? 174 ILE C CG1 1 
ATOM   10632 C  CG2 . ILE E 1 174 ? 29.733  50.232  26.993  1.00 6.37  ? 174 ILE C CG2 1 
ATOM   10633 C  CD1 . ILE E 1 174 ? 29.243  47.654  25.416  1.00 7.39  ? 174 ILE C CD1 1 
ATOM   10634 N  N   . LYS E 1 175 ? 32.851  50.264  27.473  1.00 8.22  ? 175 LYS C N   1 
ATOM   10635 C  CA  . LYS E 1 175 ? 33.768  51.264  28.025  1.00 8.99  ? 175 LYS C CA  1 
ATOM   10636 C  C   . LYS E 1 175 ? 33.398  52.643  27.475  1.00 10.86 ? 175 LYS C C   1 
ATOM   10637 O  O   . LYS E 1 175 ? 32.787  52.744  26.411  1.00 10.90 ? 175 LYS C O   1 
ATOM   10638 C  CB  . LYS E 1 175 ? 35.215  50.936  27.629  1.00 8.57  ? 175 LYS C CB  1 
ATOM   10639 C  CG  . LYS E 1 175 ? 35.683  49.542  28.019  1.00 7.93  ? 175 LYS C CG  1 
ATOM   10640 C  CD  . LYS E 1 175 ? 35.786  49.373  29.531  1.00 7.71  ? 175 LYS C CD  1 
ATOM   10641 C  CE  . LYS E 1 175 ? 36.182  47.945  29.897  1.00 8.65  ? 175 LYS C CE  1 
ATOM   10642 N  NZ  . LYS E 1 175 ? 36.277  47.735  31.377  1.00 7.66  ? 175 LYS C NZ  1 
ATOM   10643 N  N   . PRO E 1 176 ? 33.762  53.723  28.189  1.00 10.39 ? 176 PRO C N   1 
ATOM   10644 C  CA  . PRO E 1 176 ? 34.492  53.733  29.463  1.00 9.37  ? 176 PRO C CA  1 
ATOM   10645 C  C   . PRO E 1 176 ? 33.695  53.076  30.593  1.00 9.82  ? 176 PRO C C   1 
ATOM   10646 O  O   . PRO E 1 176 ? 32.464  53.000  30.531  1.00 8.11  ? 176 PRO C O   1 
ATOM   10647 C  CB  . PRO E 1 176 ? 34.745  55.222  29.703  1.00 9.70  ? 176 PRO C CB  1 
ATOM   10648 C  CG  . PRO E 1 176 ? 33.575  55.885  29.005  1.00 11.00 ? 176 PRO C CG  1 
ATOM   10649 C  CD  . PRO E 1 176 ? 33.487  55.097  27.729  1.00 10.09 ? 176 PRO C CD  1 
ATOM   10650 N  N   . LYS E 1 177 ? 34.402  52.603  31.617  1.00 8.31  ? 177 LYS C N   1 
ATOM   10651 C  CA  . LYS E 1 177 ? 33.763  51.936  32.745  1.00 8.03  ? 177 LYS C CA  1 
ATOM   10652 C  C   . LYS E 1 177 ? 32.537  52.707  33.229  1.00 8.99  ? 177 LYS C C   1 
ATOM   10653 O  O   . LYS E 1 177 ? 31.432  52.166  33.272  1.00 8.67  ? 177 LYS C O   1 
ATOM   10654 C  CB  . LYS E 1 177 ? 34.755  51.774  33.897  1.00 6.33  ? 177 LYS C CB  1 
ATOM   10655 C  CG  . LYS E 1 177 ? 36.056  51.066  33.518  1.00 6.46  ? 177 LYS C CG  1 
ATOM   10656 C  CD  . LYS E 1 177 ? 36.999  50.972  34.714  1.00 6.38  ? 177 LYS C CD  1 
ATOM   10657 C  CE  . LYS E 1 177 ? 36.455  50.045  35.804  1.00 4.00  ? 177 LYS C CE  1 
ATOM   10658 N  NZ  . LYS E 1 177 ? 36.420  48.620  35.352  1.00 4.03  ? 177 LYS C NZ  1 
ATOM   10659 N  N   . LEU E 1 178 ? 32.739  53.973  33.581  1.00 8.37  ? 178 LEU C N   1 
ATOM   10660 C  CA  . LEU E 1 178 ? 31.656  54.820  34.067  1.00 9.11  ? 178 LEU C CA  1 
ATOM   10661 C  C   . LEU E 1 178 ? 31.584  56.097  33.230  1.00 10.56 ? 178 LEU C C   1 
ATOM   10662 O  O   . LEU E 1 178 ? 32.547  56.444  32.543  1.00 10.40 ? 178 LEU C O   1 
ATOM   10663 C  CB  . LEU E 1 178 ? 31.903  55.178  35.540  1.00 8.50  ? 178 LEU C CB  1 
ATOM   10664 C  CG  . LEU E 1 178 ? 32.047  54.021  36.533  1.00 9.20  ? 178 LEU C CG  1 
ATOM   10665 C  CD1 . LEU E 1 178 ? 32.491  54.563  37.888  1.00 10.40 ? 178 LEU C CD1 1 
ATOM   10666 C  CD2 . LEU E 1 178 ? 30.721  53.269  36.655  1.00 8.14  ? 178 LEU C CD2 1 
ATOM   10667 N  N   . GLY E 1 179 ? 30.445  56.789  33.274  1.00 10.08 ? 179 GLY C N   1 
ATOM   10668 C  CA  . GLY E 1 179 ? 30.327  58.031  32.528  1.00 11.43 ? 179 GLY C CA  1 
ATOM   10669 C  C   . GLY E 1 179 ? 29.383  58.095  31.337  1.00 12.55 ? 179 GLY C C   1 
ATOM   10670 O  O   . GLY E 1 179 ? 29.049  59.192  30.879  1.00 12.30 ? 179 GLY C O   1 
ATOM   10671 N  N   . LEU E 1 180 ? 28.954  56.943  30.827  1.00 10.48 ? 180 LEU C N   1 
ATOM   10672 C  CA  . LEU E 1 180 ? 28.047  56.903  29.681  1.00 9.84  ? 180 LEU C CA  1 
ATOM   10673 C  C   . LEU E 1 180 ? 26.582  56.937  30.103  1.00 8.27  ? 180 LEU C C   1 
ATOM   10674 O  O   . LEU E 1 180 ? 26.217  56.406  31.147  1.00 8.86  ? 180 LEU C O   1 
ATOM   10675 C  CB  . LEU E 1 180 ? 28.282  55.635  28.854  1.00 12.06 ? 180 LEU C CB  1 
ATOM   10676 C  CG  . LEU E 1 180 ? 29.563  55.514  28.034  1.00 13.05 ? 180 LEU C CG  1 
ATOM   10677 C  CD1 . LEU E 1 180 ? 29.535  54.199  27.259  1.00 14.12 ? 180 LEU C CD1 1 
ATOM   10678 C  CD2 . LEU E 1 180 ? 29.673  56.690  27.079  1.00 13.68 ? 180 LEU C CD2 1 
ATOM   10679 N  N   . SER E 1 181 ? 25.746  57.559  29.279  1.00 8.07  ? 181 SER C N   1 
ATOM   10680 C  CA  . SER E 1 181 ? 24.317  57.638  29.566  1.00 6.70  ? 181 SER C CA  1 
ATOM   10681 C  C   . SER E 1 181 ? 23.662  56.320  29.168  1.00 6.83  ? 181 SER C C   1 
ATOM   10682 O  O   . SER E 1 181 ? 24.249  55.516  28.439  1.00 7.22  ? 181 SER C O   1 
ATOM   10683 C  CB  . SER E 1 181 ? 23.677  58.780  28.773  1.00 7.12  ? 181 SER C CB  1 
ATOM   10684 O  OG  . SER E 1 181 ? 23.695  58.504  27.384  1.00 8.04  ? 181 SER C OG  1 
ATOM   10685 N  N   . ALA E 1 182 ? 22.445  56.096  29.649  1.00 5.86  ? 182 ALA C N   1 
ATOM   10686 C  CA  . ALA E 1 182 ? 21.714  54.880  29.329  1.00 5.48  ? 182 ALA C CA  1 
ATOM   10687 C  C   . ALA E 1 182 ? 21.527  54.707  27.821  1.00 6.62  ? 182 ALA C C   1 
ATOM   10688 O  O   . ALA E 1 182 ? 21.711  53.611  27.289  1.00 6.45  ? 182 ALA C O   1 
ATOM   10689 C  CB  . ALA E 1 182 ? 20.359  54.893  30.022  1.00 6.75  ? 182 ALA C CB  1 
ATOM   10690 N  N   . LYS E 1 183 ? 21.159  55.778  27.122  1.00 6.65  ? 183 LYS C N   1 
ATOM   10691 C  CA  . LYS E 1 183 ? 20.969  55.653  25.682  1.00 9.36  ? 183 LYS C CA  1 
ATOM   10692 C  C   . LYS E 1 183 ? 22.268  55.343  24.939  1.00 8.77  ? 183 LYS C C   1 
ATOM   10693 O  O   . LYS E 1 183 ? 22.267  54.525  24.017  1.00 8.96  ? 183 LYS C O   1 
ATOM   10694 C  CB  . LYS E 1 183 ? 20.314  56.903  25.084  1.00 11.33 ? 183 LYS C CB  1 
ATOM   10695 C  CG  . LYS E 1 183 ? 20.276  56.845  23.561  1.00 13.14 ? 183 LYS C CG  1 
ATOM   10696 C  CD  . LYS E 1 183 ? 19.084  57.553  22.967  1.00 16.71 ? 183 LYS C CD  1 
ATOM   10697 C  CE  . LYS E 1 183 ? 19.134  57.463  21.447  1.00 18.04 ? 183 LYS C CE  1 
ATOM   10698 N  NZ  . LYS E 1 183 ? 18.075  58.286  20.808  1.00 21.92 ? 183 LYS C NZ  1 
ATOM   10699 N  N   . ASN E 1 184 ? 23.372  55.980  25.326  1.00 8.56  ? 184 ASN C N   1 
ATOM   10700 C  CA  . ASN E 1 184 ? 24.645  55.705  24.659  1.00 9.15  ? 184 ASN C CA  1 
ATOM   10701 C  C   . ASN E 1 184 ? 25.121  54.289  24.964  1.00 8.25  ? 184 ASN C C   1 
ATOM   10702 O  O   . ASN E 1 184 ? 25.789  53.665  24.147  1.00 8.60  ? 184 ASN C O   1 
ATOM   10703 C  CB  . ASN E 1 184 ? 25.726  56.717  25.066  1.00 9.75  ? 184 ASN C CB  1 
ATOM   10704 C  CG  . ASN E 1 184 ? 25.618  58.027  24.299  1.00 9.47  ? 184 ASN C CG  1 
ATOM   10705 O  OD1 . ASN E 1 184 ? 25.207  58.042  23.139  1.00 12.00 ? 184 ASN C OD1 1 
ATOM   10706 N  ND2 . ASN E 1 184 ? 26.004  59.129  24.937  1.00 9.56  ? 184 ASN C ND2 1 
ATOM   10707 N  N   . TYR E 1 185 ? 24.760  53.780  26.137  1.00 8.61  ? 185 TYR C N   1 
ATOM   10708 C  CA  . TYR E 1 185 ? 25.148  52.431  26.528  1.00 7.97  ? 185 TYR C CA  1 
ATOM   10709 C  C   . TYR E 1 185 ? 24.481  51.430  25.581  1.00 8.24  ? 185 TYR C C   1 
ATOM   10710 O  O   . TYR E 1 185 ? 25.127  50.510  25.083  1.00 8.94  ? 185 TYR C O   1 
ATOM   10711 C  CB  . TYR E 1 185 ? 24.710  52.152  27.969  1.00 6.78  ? 185 TYR C CB  1 
ATOM   10712 C  CG  . TYR E 1 185 ? 25.707  51.344  28.773  1.00 7.94  ? 185 TYR C CG  1 
ATOM   10713 C  CD1 . TYR E 1 185 ? 26.864  51.937  29.282  1.00 7.16  ? 185 TYR C CD1 1 
ATOM   10714 C  CD2 . TYR E 1 185 ? 25.500  49.986  29.018  1.00 6.86  ? 185 TYR C CD2 1 
ATOM   10715 C  CE1 . TYR E 1 185 ? 27.795  51.193  30.024  1.00 10.25 ? 185 TYR C CE1 1 
ATOM   10716 C  CE2 . TYR E 1 185 ? 26.418  49.236  29.756  1.00 9.51  ? 185 TYR C CE2 1 
ATOM   10717 C  CZ  . TYR E 1 185 ? 27.564  49.844  30.257  1.00 9.59  ? 185 TYR C CZ  1 
ATOM   10718 O  OH  . TYR E 1 185 ? 28.465  49.105  30.991  1.00 8.42  ? 185 TYR C OH  1 
ATOM   10719 N  N   . GLY E 1 186 ? 23.184  51.619  25.338  1.00 7.91  ? 186 GLY C N   1 
ATOM   10720 C  CA  . GLY E 1 186 ? 22.455  50.726  24.450  1.00 8.23  ? 186 GLY C CA  1 
ATOM   10721 C  C   . GLY E 1 186 ? 22.937  50.834  23.011  1.00 9.13  ? 186 GLY C C   1 
ATOM   10722 O  O   . GLY E 1 186 ? 22.890  49.865  22.245  1.00 8.32  ? 186 GLY C O   1 
ATOM   10723 N  N   . ARG E 1 187 ? 23.393  52.027  22.643  1.00 8.02  ? 187 ARG C N   1 
ATOM   10724 C  CA  . ARG E 1 187 ? 23.909  52.283  21.304  1.00 8.14  ? 187 ARG C CA  1 
ATOM   10725 C  C   . ARG E 1 187 ? 25.175  51.442  21.125  1.00 7.75  ? 187 ARG C C   1 
ATOM   10726 O  O   . ARG E 1 187 ? 25.336  50.732  20.128  1.00 7.53  ? 187 ARG C O   1 
ATOM   10727 C  CB  . ARG E 1 187 ? 24.206  53.784  21.162  1.00 9.31  ? 187 ARG C CB  1 
ATOM   10728 C  CG  . ARG E 1 187 ? 25.078  54.179  19.988  1.00 11.23 ? 187 ARG C CG  1 
ATOM   10729 C  CD  . ARG E 1 187 ? 25.234  55.695  19.928  1.00 12.81 ? 187 ARG C CD  1 
ATOM   10730 N  NE  . ARG E 1 187 ? 24.157  56.333  19.171  1.00 14.49 ? 187 ARG C NE  1 
ATOM   10731 C  CZ  . ARG E 1 187 ? 23.354  57.283  19.641  1.00 14.72 ? 187 ARG C CZ  1 
ATOM   10732 N  NH1 . ARG E 1 187 ? 23.487  57.723  20.885  1.00 14.04 ? 187 ARG C NH1 1 
ATOM   10733 N  NH2 . ARG E 1 187 ? 22.419  57.803  18.854  1.00 15.87 ? 187 ARG C NH2 1 
ATOM   10734 N  N   . ALA E 1 188 ? 26.059  51.512  22.113  1.00 6.66  ? 188 ALA C N   1 
ATOM   10735 C  CA  . ALA E 1 188 ? 27.307  50.758  22.086  1.00 8.02  ? 188 ALA C CA  1 
ATOM   10736 C  C   . ALA E 1 188 ? 27.030  49.255  22.049  1.00 8.11  ? 188 ALA C C   1 
ATOM   10737 O  O   . ALA E 1 188 ? 27.705  48.503  21.342  1.00 11.14 ? 188 ALA C O   1 
ATOM   10738 C  CB  . ALA E 1 188 ? 28.144  51.102  23.315  1.00 5.29  ? 188 ALA C CB  1 
ATOM   10739 N  N   . VAL E 1 189 ? 26.037  48.824  22.819  1.00 6.82  ? 189 VAL C N   1 
ATOM   10740 C  CA  . VAL E 1 189 ? 25.673  47.413  22.887  1.00 6.27  ? 189 VAL C CA  1 
ATOM   10741 C  C   . VAL E 1 189 ? 25.181  46.859  21.545  1.00 8.64  ? 189 VAL C C   1 
ATOM   10742 O  O   . VAL E 1 189 ? 25.627  45.796  21.101  1.00 8.39  ? 189 VAL C O   1 
ATOM   10743 C  CB  . VAL E 1 189 ? 24.599  47.188  23.983  1.00 6.35  ? 189 VAL C CB  1 
ATOM   10744 C  CG1 . VAL E 1 189 ? 24.023  45.780  23.888  1.00 4.95  ? 189 VAL C CG1 1 
ATOM   10745 C  CG2 . VAL E 1 189 ? 25.226  47.403  25.359  1.00 3.65  ? 189 VAL C CG2 1 
ATOM   10746 N  N   . TYR E 1 190 ? 24.263  47.570  20.899  1.00 7.80  ? 190 TYR C N   1 
ATOM   10747 C  CA  . TYR E 1 190 ? 23.744  47.118  19.614  1.00 7.86  ? 190 TYR C CA  1 
ATOM   10748 C  C   . TYR E 1 190 ? 24.868  46.956  18.586  1.00 7.69  ? 190 TYR C C   1 
ATOM   10749 O  O   . TYR E 1 190 ? 24.938  45.944  17.890  1.00 6.96  ? 190 TYR C O   1 
ATOM   10750 C  CB  . TYR E 1 190 ? 22.686  48.102  19.090  1.00 8.40  ? 190 TYR C CB  1 
ATOM   10751 C  CG  . TYR E 1 190 ? 22.442  47.998  17.597  1.00 7.83  ? 190 TYR C CG  1 
ATOM   10752 C  CD1 . TYR E 1 190 ? 21.940  46.826  17.026  1.00 6.89  ? 190 TYR C CD1 1 
ATOM   10753 C  CD2 . TYR E 1 190 ? 22.756  49.057  16.753  1.00 7.34  ? 190 TYR C CD2 1 
ATOM   10754 C  CE1 . TYR E 1 190 ? 21.762  46.716  15.644  1.00 6.28  ? 190 TYR C CE1 1 
ATOM   10755 C  CE2 . TYR E 1 190 ? 22.584  48.959  15.379  1.00 6.75  ? 190 TYR C CE2 1 
ATOM   10756 C  CZ  . TYR E 1 190 ? 22.091  47.788  14.829  1.00 7.60  ? 190 TYR C CZ  1 
ATOM   10757 O  OH  . TYR E 1 190 ? 21.955  47.696  13.463  1.00 7.97  ? 190 TYR C OH  1 
ATOM   10758 N  N   . GLU E 1 191 ? 25.750  47.947  18.500  1.00 7.52  ? 191 GLU C N   1 
ATOM   10759 C  CA  . GLU E 1 191 ? 26.854  47.888  17.548  1.00 8.38  ? 191 GLU C CA  1 
ATOM   10760 C  C   . GLU E 1 191 ? 27.808  46.718  17.818  1.00 8.99  ? 191 GLU C C   1 
ATOM   10761 O  O   . GLU E 1 191 ? 28.324  46.109  16.880  1.00 9.98  ? 191 GLU C O   1 
ATOM   10762 C  CB  . GLU E 1 191 ? 27.632  49.209  17.544  1.00 7.15  ? 191 GLU C CB  1 
ATOM   10763 C  CG  . GLU E 1 191 ? 26.860  50.416  17.003  1.00 8.30  ? 191 GLU C CG  1 
ATOM   10764 C  CD  . GLU E 1 191 ? 26.453  50.263  15.538  1.00 11.02 ? 191 GLU C CD  1 
ATOM   10765 O  OE1 . GLU E 1 191 ? 27.124  49.516  14.797  1.00 10.22 ? 191 GLU C OE1 1 
ATOM   10766 O  OE2 . GLU E 1 191 ? 25.467  50.906  15.123  1.00 12.08 ? 191 GLU C OE2 1 
ATOM   10767 N  N   . CYS E 1 192 ? 28.040  46.400  19.090  1.00 7.11  ? 192 CYS C N   1 
ATOM   10768 C  CA  . CYS E 1 192 ? 28.929  45.282  19.442  1.00 8.92  ? 192 CYS C CA  1 
ATOM   10769 C  C   . CYS E 1 192 ? 28.310  43.932  19.086  1.00 7.88  ? 192 CYS C C   1 
ATOM   10770 O  O   . CYS E 1 192 ? 28.936  43.094  18.432  1.00 6.03  ? 192 CYS C O   1 
ATOM   10771 C  CB  . CYS E 1 192 ? 29.241  45.283  20.945  1.00 8.81  ? 192 CYS C CB  1 
ATOM   10772 S  SG  . CYS E 1 192 ? 30.399  46.546  21.489  1.00 11.39 ? 192 CYS C SG  1 
ATOM   10773 N  N   . LEU E 1 193 ? 27.075  43.728  19.531  1.00 6.80  ? 193 LEU C N   1 
ATOM   10774 C  CA  . LEU E 1 193 ? 26.369  42.480  19.285  1.00 6.21  ? 193 LEU C CA  1 
ATOM   10775 C  C   . LEU E 1 193 ? 26.126  42.178  17.809  1.00 7.33  ? 193 LEU C C   1 
ATOM   10776 O  O   . LEU E 1 193 ? 26.239  41.031  17.382  1.00 9.07  ? 193 LEU C O   1 
ATOM   10777 C  CB  . LEU E 1 193 ? 25.030  42.479  20.037  1.00 7.47  ? 193 LEU C CB  1 
ATOM   10778 C  CG  . LEU E 1 193 ? 25.112  42.502  21.570  1.00 6.05  ? 193 LEU C CG  1 
ATOM   10779 C  CD1 . LEU E 1 193 ? 23.716  42.637  22.168  1.00 7.99  ? 193 LEU C CD1 1 
ATOM   10780 C  CD2 . LEU E 1 193 ? 25.790  41.230  22.064  1.00 7.06  ? 193 LEU C CD2 1 
ATOM   10781 N  N   . ARG E 1 194 ? 25.801  43.199  17.022  1.00 6.78  ? 194 ARG C N   1 
ATOM   10782 C  CA  . ARG E 1 194 ? 25.522  42.973  15.606  1.00 8.33  ? 194 ARG C CA  1 
ATOM   10783 C  C   . ARG E 1 194 ? 26.748  42.522  14.818  1.00 9.50  ? 194 ARG C C   1 
ATOM   10784 O  O   . ARG E 1 194 ? 26.620  41.969  13.725  1.00 10.37 ? 194 ARG C O   1 
ATOM   10785 C  CB  . ARG E 1 194 ? 24.916  44.235  14.977  1.00 6.08  ? 194 ARG C CB  1 
ATOM   10786 C  CG  . ARG E 1 194 ? 25.897  45.239  14.386  1.00 7.07  ? 194 ARG C CG  1 
ATOM   10787 C  CD  . ARG E 1 194 ? 25.143  46.485  13.923  1.00 7.19  ? 194 ARG C CD  1 
ATOM   10788 N  NE  . ARG E 1 194 ? 25.965  47.388  13.121  1.00 11.51 ? 194 ARG C NE  1 
ATOM   10789 C  CZ  . ARG E 1 194 ? 26.213  47.223  11.825  1.00 11.15 ? 194 ARG C CZ  1 
ATOM   10790 N  NH1 . ARG E 1 194 ? 25.697  46.190  11.174  1.00 9.75  ? 194 ARG C NH1 1 
ATOM   10791 N  NH2 . ARG E 1 194 ? 26.990  48.085  11.182  1.00 12.06 ? 194 ARG C NH2 1 
ATOM   10792 N  N   . GLY E 1 195 ? 27.928  42.741  15.388  1.00 10.84 ? 195 GLY C N   1 
ATOM   10793 C  CA  . GLY E 1 195 ? 29.165  42.359  14.729  1.00 12.30 ? 195 GLY C CA  1 
ATOM   10794 C  C   . GLY E 1 195 ? 29.639  40.930  14.946  1.00 11.78 ? 195 GLY C C   1 
ATOM   10795 O  O   . GLY E 1 195 ? 30.688  40.547  14.430  1.00 12.76 ? 195 GLY C O   1 
ATOM   10796 N  N   . GLY E 1 196 ? 28.898  40.136  15.712  1.00 11.23 ? 196 GLY C N   1 
ATOM   10797 C  CA  . GLY E 1 196 ? 29.315  38.760  15.916  1.00 10.27 ? 196 GLY C CA  1 
ATOM   10798 C  C   . GLY E 1 196 ? 29.569  38.315  17.345  1.00 10.29 ? 196 GLY C C   1 
ATOM   10799 O  O   . GLY E 1 196 ? 29.840  37.136  17.581  1.00 10.44 ? 196 GLY C O   1 
ATOM   10800 N  N   . LEU E 1 197 ? 29.504  39.238  18.298  1.00 7.64  ? 197 LEU C N   1 
ATOM   10801 C  CA  . LEU E 1 197 ? 29.708  38.871  19.696  1.00 9.55  ? 197 LEU C CA  1 
ATOM   10802 C  C   . LEU E 1 197 ? 28.410  38.270  20.242  1.00 9.64  ? 197 LEU C C   1 
ATOM   10803 O  O   . LEU E 1 197 ? 27.318  38.708  19.881  1.00 10.42 ? 197 LEU C O   1 
ATOM   10804 C  CB  . LEU E 1 197 ? 30.090  40.096  20.524  1.00 9.14  ? 197 LEU C CB  1 
ATOM   10805 C  CG  . LEU E 1 197 ? 31.432  40.768  20.231  1.00 11.14 ? 197 LEU C CG  1 
ATOM   10806 C  CD1 . LEU E 1 197 ? 31.587  41.999  21.108  1.00 11.92 ? 197 LEU C CD1 1 
ATOM   10807 C  CD2 . LEU E 1 197 ? 32.564  39.789  20.484  1.00 11.06 ? 197 LEU C CD2 1 
ATOM   10808 N  N   . ASP E 1 198 ? 28.532  37.268  21.106  1.00 9.27  ? 198 ASP C N   1 
ATOM   10809 C  CA  . ASP E 1 198 ? 27.365  36.623  21.695  1.00 8.83  ? 198 ASP C CA  1 
ATOM   10810 C  C   . ASP E 1 198 ? 26.805  37.474  22.829  1.00 8.96  ? 198 ASP C C   1 
ATOM   10811 O  O   . ASP E 1 198 ? 25.589  37.576  22.997  1.00 7.72  ? 198 ASP C O   1 
ATOM   10812 C  CB  . ASP E 1 198 ? 27.737  35.247  22.257  1.00 8.29  ? 198 ASP C CB  1 
ATOM   10813 C  CG  . ASP E 1 198 ? 28.319  34.321  21.213  1.00 9.37  ? 198 ASP C CG  1 
ATOM   10814 O  OD1 . ASP E 1 198 ? 27.613  34.002  20.229  1.00 9.80  ? 198 ASP C OD1 1 
ATOM   10815 O  OD2 . ASP E 1 198 ? 29.485  33.903  21.384  1.00 10.00 ? 198 ASP C OD2 1 
ATOM   10816 N  N   . PHE E 1 199 ? 27.702  38.084  23.601  1.00 8.30  ? 199 PHE C N   1 
ATOM   10817 C  CA  . PHE E 1 199 ? 27.310  38.902  24.745  1.00 7.63  ? 199 PHE C CA  1 
ATOM   10818 C  C   . PHE E 1 199 ? 28.066  40.220  24.856  1.00 7.88  ? 199 PHE C C   1 
ATOM   10819 O  O   . PHE E 1 199 ? 29.137  40.392  24.283  1.00 7.78  ? 199 PHE C O   1 
ATOM   10820 C  CB  . PHE E 1 199 ? 27.609  38.188  26.068  1.00 9.08  ? 199 PHE C CB  1 
ATOM   10821 C  CG  . PHE E 1 199 ? 27.165  36.754  26.142  1.00 10.92 ? 199 PHE C CG  1 
ATOM   10822 C  CD1 . PHE E 1 199 ? 25.816  36.424  26.218  1.00 12.04 ? 199 PHE C CD1 1 
ATOM   10823 C  CD2 . PHE E 1 199 ? 28.111  35.737  26.258  1.00 10.45 ? 199 PHE C CD2 1 
ATOM   10824 C  CE1 . PHE E 1 199 ? 25.413  35.103  26.416  1.00 11.18 ? 199 PHE C CE1 1 
ATOM   10825 C  CE2 . PHE E 1 199 ? 27.722  34.414  26.455  1.00 12.70 ? 199 PHE C CE2 1 
ATOM   10826 C  CZ  . PHE E 1 199 ? 26.370  34.097  26.538  1.00 12.81 ? 199 PHE C CZ  1 
ATOM   10827 N  N   . THR E 1 200 ? 27.485  41.129  25.637  1.00 6.42  ? 200 THR C N   1 
ATOM   10828 C  CA  . THR E 1 200 ? 28.094  42.410  26.000  1.00 7.40  ? 200 THR C CA  1 
ATOM   10829 C  C   . THR E 1 200 ? 27.793  42.431  27.502  1.00 6.84  ? 200 THR C C   1 
ATOM   10830 O  O   . THR E 1 200 ? 27.046  41.571  27.981  1.00 4.73  ? 200 THR C O   1 
ATOM   10831 C  CB  . THR E 1 200 ? 27.450  43.648  25.294  1.00 7.23  ? 200 THR C CB  1 
ATOM   10832 O  OG1 . THR E 1 200 ? 26.022  43.559  25.321  1.00 7.62  ? 200 THR C OG1 1 
ATOM   10833 C  CG2 . THR E 1 200 ? 27.939  43.749  23.856  1.00 6.89  ? 200 THR C CG2 1 
HETATM 10834 N  N   . KCX E 1 201 ? 28.366  43.363  28.255  1.00 5.81  ? 201 KCX C N   1 
HETATM 10835 C  CA  . KCX E 1 201 ? 28.089  43.389  29.691  1.00 6.28  ? 201 KCX C CA  1 
HETATM 10836 C  CB  . KCX E 1 201 ? 28.986  42.356  30.417  1.00 5.06  ? 201 KCX C CB  1 
HETATM 10837 C  CG  . KCX E 1 201 ? 30.505  42.600  30.320  1.00 3.53  ? 201 KCX C CG  1 
HETATM 10838 C  CD  . KCX E 1 201 ? 31.330  41.526  31.049  1.00 6.14  ? 201 KCX C CD  1 
HETATM 10839 C  CE  . KCX E 1 201 ? 31.208  41.555  32.572  1.00 6.31  ? 201 KCX C CE  1 
HETATM 10840 N  NZ  . KCX E 1 201 ? 31.668  42.806  33.186  1.00 6.58  ? 201 KCX C NZ  1 
HETATM 10841 C  C   . KCX E 1 201 ? 28.324  44.728  30.353  1.00 6.87  ? 201 KCX C C   1 
HETATM 10842 O  O   . KCX E 1 201 ? 29.088  45.566  29.853  1.00 7.81  ? 201 KCX C O   1 
HETATM 10843 C  CX  . KCX E 1 201 ? 32.935  43.088  33.521  1.00 6.55  ? 201 KCX C CX  1 
HETATM 10844 O  OQ1 . KCX E 1 201 ? 33.867  42.247  33.405  1.00 7.07  ? 201 KCX C OQ1 1 
HETATM 10845 O  OQ2 . KCX E 1 201 ? 33.236  44.207  33.972  1.00 5.77  ? 201 KCX C OQ2 1 
ATOM   10846 N  N   . ASP E 1 202 ? 27.643  44.931  31.481  1.00 5.90  ? 202 ASP C N   1 
ATOM   10847 C  CA  . ASP E 1 202 ? 27.813  46.139  32.281  1.00 7.05  ? 202 ASP C CA  1 
ATOM   10848 C  C   . ASP E 1 202 ? 29.184  45.946  32.920  1.00 8.21  ? 202 ASP C C   1 
ATOM   10849 O  O   . ASP E 1 202 ? 29.560  44.810  33.228  1.00 8.78  ? 202 ASP C O   1 
ATOM   10850 C  CB  . ASP E 1 202 ? 26.797  46.205  33.430  1.00 6.51  ? 202 ASP C CB  1 
ATOM   10851 C  CG  . ASP E 1 202 ? 25.382  46.509  32.971  1.00 7.78  ? 202 ASP C CG  1 
ATOM   10852 O  OD1 . ASP E 1 202 ? 25.190  46.911  31.804  1.00 7.91  ? 202 ASP C OD1 1 
ATOM   10853 O  OD2 . ASP E 1 202 ? 24.461  46.357  33.807  1.00 7.21  ? 202 ASP C OD2 1 
ATOM   10854 N  N   . ASP E 1 203 ? 29.939  47.023  33.125  1.00 7.79  ? 203 ASP C N   1 
ATOM   10855 C  CA  . ASP E 1 203 ? 31.226  46.862  33.787  1.00 7.80  ? 203 ASP C CA  1 
ATOM   10856 C  C   . ASP E 1 203 ? 30.839  46.505  35.226  1.00 7.41  ? 203 ASP C C   1 
ATOM   10857 O  O   . ASP E 1 203 ? 29.741  46.844  35.669  1.00 6.70  ? 203 ASP C O   1 
ATOM   10858 C  CB  . ASP E 1 203 ? 32.039  48.160  33.756  1.00 6.64  ? 203 ASP C CB  1 
ATOM   10859 C  CG  . ASP E 1 203 ? 33.519  47.908  33.533  1.00 7.38  ? 203 ASP C CG  1 
ATOM   10860 O  OD1 . ASP E 1 203 ? 34.055  46.944  34.116  1.00 8.11  ? 203 ASP C OD1 1 
ATOM   10861 O  OD2 . ASP E 1 203 ? 34.150  48.674  32.778  1.00 8.23  ? 203 ASP C OD2 1 
ATOM   10862 N  N   . GLU E 1 204 ? 31.722  45.831  35.956  1.00