data_1IRA
# 
_entry.id   1IRA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IRA         
WWPDB D_1000174235 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IRA 
_pdbx_database_status.recvd_initial_deposition_date   1998-04-09 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Schreuder, H.A.'    1 
'Tardif, C.'         2 
'Tramp-Kalmeyer, S.' 3 
'Soffientini, A.'    4 
'Sarubbi, E.'        5 
'Akeson, A.'         6 
'Bowlin, T.'         7 
'Yanofsky, S.'       8 
'Barrett, R.W.'      9 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'A new cytokine-receptor binding mode revealed by the crystal structure of the IL-1 receptor with an antagonist.'       
Nature         386 194 200 1997 NATUAS UK 0028-0836 0006 ? 9062194 10.1038/386194a0 
1       'Crystals of Soluble Interleukin-1 Receptor Complexed with its Natural Antagonist Reveal a 1:1 Receptor-Ligand Complex' 
'FEBS Lett.'   373 39  ?   1995 FEBLAL NE 0014-5793 0165 ? ?       ?                
2       'Refined Crystal Structure of the Interleukin-1 Receptor Antagonist. Presence of a Disulfide Link and a Cis-Proline'    
Eur.J.Biochem. 227 838 ?   1995 EJBCAI IX 0014-2956 0262 ? ?       ?                
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Schreuder, H.'       1  ? 
primary 'Tardif, C.'          2  ? 
primary 'Trump-Kallmeyer, S.' 3  ? 
primary 'Soffientini, A.'     4  ? 
primary 'Sarubbi, E.'         5  ? 
primary 'Akeson, A.'          6  ? 
primary 'Bowlin, T.'          7  ? 
primary 'Yanofsky, S.'        8  ? 
primary 'Barrett, R.W.'       9  ? 
1       'Schreuder, H.'       10 ? 
1       'Tardif, C.'          11 ? 
1       'Soffientini, A.'     12 ? 
1       'Sarubbi, E.'         13 ? 
1       'Akeson, A.'          14 ? 
1       'Bowlin, T.'          15 ? 
1       'Yanofsky, S.'        16 ? 
1       'Barrett, R.W.'       17 ? 
2       'Schreuder, H.A.'     18 ? 
2       'Rondeau, J.M.'       19 ? 
2       'Tardif, C.'          20 ? 
2       'Soffientini, A.'     21 ? 
2       'Sarubbi, E.'         22 ? 
2       'Akeson, A.'          23 ? 
2       'Bowlin, T.L.'        24 ? 
2       'Yanofsky, S.'        25 ? 
2       'Barrett, R.W.'       26 ? 
# 
_cell.entry_id           1IRA 
_cell.length_a           47.200 
_cell.length_b           84.600 
_cell.length_c           140.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IRA 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'INTERLEUKIN-1 RECEPTOR ANTAGONIST'      17145.406 1  ? ? ?                                        ? 
2 polymer     man 'INTERLEUKIN-1 RECEPTOR'                 36741.734 1  ? ? 'TYPE I RECEPTOR, EXTRACELLULAR DOMAINS' ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   4  ? ? ?                                        ? 
4 water       nat water                                    18.015    86 ? ? ?                                        ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        IL1RA 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQL
EAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
;
;RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQL
EAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
;
X ? 
2 'polypeptide(L)' no no 
;LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCV
VRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGV
KDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDI
AYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQK
;
;LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCV
VRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGV
KDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDI
AYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQK
;
Y ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   PRO n 
1 3   SER n 
1 4   GLY n 
1 5   ARG n 
1 6   LYS n 
1 7   SER n 
1 8   SER n 
1 9   LYS n 
1 10  MET n 
1 11  GLN n 
1 12  ALA n 
1 13  PHE n 
1 14  ARG n 
1 15  ILE n 
1 16  TRP n 
1 17  ASP n 
1 18  VAL n 
1 19  ASN n 
1 20  GLN n 
1 21  LYS n 
1 22  THR n 
1 23  PHE n 
1 24  TYR n 
1 25  LEU n 
1 26  ARG n 
1 27  ASN n 
1 28  ASN n 
1 29  GLN n 
1 30  LEU n 
1 31  VAL n 
1 32  ALA n 
1 33  GLY n 
1 34  TYR n 
1 35  LEU n 
1 36  GLN n 
1 37  GLY n 
1 38  PRO n 
1 39  ASN n 
1 40  VAL n 
1 41  ASN n 
1 42  LEU n 
1 43  GLU n 
1 44  GLU n 
1 45  LYS n 
1 46  ILE n 
1 47  ASP n 
1 48  VAL n 
1 49  VAL n 
1 50  PRO n 
1 51  ILE n 
1 52  GLU n 
1 53  PRO n 
1 54  HIS n 
1 55  ALA n 
1 56  LEU n 
1 57  PHE n 
1 58  LEU n 
1 59  GLY n 
1 60  ILE n 
1 61  HIS n 
1 62  GLY n 
1 63  GLY n 
1 64  LYS n 
1 65  MET n 
1 66  CYS n 
1 67  LEU n 
1 68  SER n 
1 69  CYS n 
1 70  VAL n 
1 71  LYS n 
1 72  SER n 
1 73  GLY n 
1 74  ASP n 
1 75  GLU n 
1 76  THR n 
1 77  ARG n 
1 78  LEU n 
1 79  GLN n 
1 80  LEU n 
1 81  GLU n 
1 82  ALA n 
1 83  VAL n 
1 84  ASN n 
1 85  ILE n 
1 86  THR n 
1 87  ASP n 
1 88  LEU n 
1 89  SER n 
1 90  GLU n 
1 91  ASN n 
1 92  ARG n 
1 93  LYS n 
1 94  GLN n 
1 95  ASP n 
1 96  LYS n 
1 97  ARG n 
1 98  PHE n 
1 99  ALA n 
1 100 PHE n 
1 101 ILE n 
1 102 ARG n 
1 103 SER n 
1 104 ASP n 
1 105 SER n 
1 106 GLY n 
1 107 PRO n 
1 108 THR n 
1 109 THR n 
1 110 SER n 
1 111 PHE n 
1 112 GLU n 
1 113 SER n 
1 114 ALA n 
1 115 ALA n 
1 116 CYS n 
1 117 PRO n 
1 118 GLY n 
1 119 TRP n 
1 120 PHE n 
1 121 LEU n 
1 122 CYS n 
1 123 THR n 
1 124 ALA n 
1 125 MET n 
1 126 GLU n 
1 127 ALA n 
1 128 ASP n 
1 129 GLN n 
1 130 PRO n 
1 131 VAL n 
1 132 SER n 
1 133 LEU n 
1 134 THR n 
1 135 ASN n 
1 136 MET n 
1 137 PRO n 
1 138 ASP n 
1 139 GLU n 
1 140 GLY n 
1 141 VAL n 
1 142 MET n 
1 143 VAL n 
1 144 THR n 
1 145 LYS n 
1 146 PHE n 
1 147 TYR n 
1 148 PHE n 
1 149 GLN n 
1 150 GLU n 
1 151 ASP n 
1 152 GLU n 
2 1   LEU n 
2 2   GLU n 
2 3   ALA n 
2 4   ASP n 
2 5   LYS n 
2 6   CYS n 
2 7   LYS n 
2 8   GLU n 
2 9   ARG n 
2 10  GLU n 
2 11  GLU n 
2 12  LYS n 
2 13  ILE n 
2 14  ILE n 
2 15  LEU n 
2 16  VAL n 
2 17  SER n 
2 18  SER n 
2 19  ALA n 
2 20  ASN n 
2 21  GLU n 
2 22  ILE n 
2 23  ASP n 
2 24  VAL n 
2 25  ARG n 
2 26  PRO n 
2 27  CYS n 
2 28  PRO n 
2 29  LEU n 
2 30  ASN n 
2 31  PRO n 
2 32  ASN n 
2 33  GLU n 
2 34  HIS n 
2 35  LYS n 
2 36  GLY n 
2 37  THR n 
2 38  ILE n 
2 39  THR n 
2 40  TRP n 
2 41  TYR n 
2 42  LYS n 
2 43  ASP n 
2 44  ASP n 
2 45  SER n 
2 46  LYS n 
2 47  THR n 
2 48  PRO n 
2 49  VAL n 
2 50  SER n 
2 51  THR n 
2 52  GLU n 
2 53  GLN n 
2 54  ALA n 
2 55  SER n 
2 56  ARG n 
2 57  ILE n 
2 58  HIS n 
2 59  GLN n 
2 60  HIS n 
2 61  LYS n 
2 62  GLU n 
2 63  LYS n 
2 64  LEU n 
2 65  TRP n 
2 66  PHE n 
2 67  VAL n 
2 68  PRO n 
2 69  ALA n 
2 70  LYS n 
2 71  VAL n 
2 72  GLU n 
2 73  ASP n 
2 74  SER n 
2 75  GLY n 
2 76  HIS n 
2 77  TYR n 
2 78  TYR n 
2 79  CYS n 
2 80  VAL n 
2 81  VAL n 
2 82  ARG n 
2 83  ASN n 
2 84  SER n 
2 85  SER n 
2 86  TYR n 
2 87  CYS n 
2 88  LEU n 
2 89  ARG n 
2 90  ILE n 
2 91  LYS n 
2 92  ILE n 
2 93  SER n 
2 94  ALA n 
2 95  LYS n 
2 96  PHE n 
2 97  VAL n 
2 98  GLU n 
2 99  ASN n 
2 100 GLU n 
2 101 PRO n 
2 102 ASN n 
2 103 LEU n 
2 104 CYS n 
2 105 TYR n 
2 106 ASN n 
2 107 ALA n 
2 108 GLN n 
2 109 ALA n 
2 110 ILE n 
2 111 PHE n 
2 112 LYS n 
2 113 GLN n 
2 114 LYS n 
2 115 LEU n 
2 116 PRO n 
2 117 VAL n 
2 118 ALA n 
2 119 GLY n 
2 120 ASP n 
2 121 GLY n 
2 122 GLY n 
2 123 LEU n 
2 124 VAL n 
2 125 CYS n 
2 126 PRO n 
2 127 TYR n 
2 128 MET n 
2 129 GLU n 
2 130 PHE n 
2 131 PHE n 
2 132 LYS n 
2 133 ASN n 
2 134 GLU n 
2 135 ASN n 
2 136 ASN n 
2 137 GLU n 
2 138 LEU n 
2 139 PRO n 
2 140 LYS n 
2 141 LEU n 
2 142 GLN n 
2 143 TRP n 
2 144 TYR n 
2 145 LYS n 
2 146 ASP n 
2 147 CYS n 
2 148 LYS n 
2 149 PRO n 
2 150 LEU n 
2 151 LEU n 
2 152 LEU n 
2 153 ASP n 
2 154 ASN n 
2 155 ILE n 
2 156 HIS n 
2 157 PHE n 
2 158 SER n 
2 159 GLY n 
2 160 VAL n 
2 161 LYS n 
2 162 ASP n 
2 163 ARG n 
2 164 LEU n 
2 165 ILE n 
2 166 VAL n 
2 167 MET n 
2 168 ASN n 
2 169 VAL n 
2 170 ALA n 
2 171 GLU n 
2 172 LYS n 
2 173 HIS n 
2 174 ARG n 
2 175 GLY n 
2 176 ASN n 
2 177 TYR n 
2 178 THR n 
2 179 CYS n 
2 180 HIS n 
2 181 ALA n 
2 182 SER n 
2 183 TYR n 
2 184 THR n 
2 185 TYR n 
2 186 LEU n 
2 187 GLY n 
2 188 LYS n 
2 189 GLN n 
2 190 TYR n 
2 191 PRO n 
2 192 ILE n 
2 193 THR n 
2 194 ARG n 
2 195 VAL n 
2 196 ILE n 
2 197 GLU n 
2 198 PHE n 
2 199 ILE n 
2 200 THR n 
2 201 LEU n 
2 202 GLU n 
2 203 GLU n 
2 204 ASN n 
2 205 LYS n 
2 206 PRO n 
2 207 THR n 
2 208 ARG n 
2 209 PRO n 
2 210 VAL n 
2 211 ILE n 
2 212 VAL n 
2 213 SER n 
2 214 PRO n 
2 215 ALA n 
2 216 ASN n 
2 217 GLU n 
2 218 THR n 
2 219 MET n 
2 220 GLU n 
2 221 VAL n 
2 222 ASP n 
2 223 LEU n 
2 224 GLY n 
2 225 SER n 
2 226 GLN n 
2 227 ILE n 
2 228 GLN n 
2 229 LEU n 
2 230 ILE n 
2 231 CYS n 
2 232 ASN n 
2 233 VAL n 
2 234 THR n 
2 235 GLY n 
2 236 GLN n 
2 237 LEU n 
2 238 SER n 
2 239 ASP n 
2 240 ILE n 
2 241 ALA n 
2 242 TYR n 
2 243 TRP n 
2 244 LYS n 
2 245 TRP n 
2 246 ASN n 
2 247 GLY n 
2 248 SER n 
2 249 VAL n 
2 250 ILE n 
2 251 ASP n 
2 252 GLU n 
2 253 ASP n 
2 254 ASP n 
2 255 PRO n 
2 256 VAL n 
2 257 LEU n 
2 258 GLY n 
2 259 GLU n 
2 260 ASP n 
2 261 TYR n 
2 262 TYR n 
2 263 SER n 
2 264 VAL n 
2 265 GLU n 
2 266 ASN n 
2 267 PRO n 
2 268 ALA n 
2 269 ASN n 
2 270 LYS n 
2 271 ARG n 
2 272 ARG n 
2 273 SER n 
2 274 THR n 
2 275 LEU n 
2 276 ILE n 
2 277 THR n 
2 278 VAL n 
2 279 LEU n 
2 280 ASN n 
2 281 ILE n 
2 282 SER n 
2 283 GLU n 
2 284 ILE n 
2 285 GLU n 
2 286 SER n 
2 287 ARG n 
2 288 PHE n 
2 289 TYR n 
2 290 LYS n 
2 291 HIS n 
2 292 PRO n 
2 293 PHE n 
2 294 THR n 
2 295 CYS n 
2 296 PHE n 
2 297 ALA n 
2 298 LYS n 
2 299 ASN n 
2 300 THR n 
2 301 HIS n 
2 302 GLY n 
2 303 ILE n 
2 304 ASP n 
2 305 ALA n 
2 306 ALA n 
2 307 TYR n 
2 308 ILE n 
2 309 GLN n 
2 310 LEU n 
2 311 ILE n 
2 312 TYR n 
2 313 PRO n 
2 314 VAL n 
2 315 THR n 
2 316 ASN n 
2 317 PHE n 
2 318 GLN n 
2 319 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? SF9 ? ? ? ? ? ?               'Escherichia coli'      562  
Escherichia ? ? ? ? ? ? ? ?   ? ? ? ? ? ? ?           ? ? TAC-BSP ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? SF9 ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 
Spodoptera  ? ? ? ? ? ? ? SF9 ? ? ? ? ? ? BACULOVIRUS ? ? PVL1392 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP IL1RA_HUMAN 1 P18510 1 
;MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHA
LFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTN
MPDEGVMVTKFYFQEDE
;
? 
2 UNP IL1R1_HUMAN 2 P14778 1 
;MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEK
LWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQW
YKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDL
GSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGI
DAAYIQLIYPVTNFQKHMIGICVTLTVIIVCSVFIYKIFKIDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGST
SDCDIFVFKVLPEVLEKQCGYKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQ
DGIKVVLLELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPVQRRSPSSKHQLLSPATKEKL
QREAHVPLG
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1IRA X 1 ? 152 ? P18510 26 ? 177 ? 1  152 
2 2 1IRA Y 1 ? 319 ? P14778 18 ? 336 ? -2 316 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1IRA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.7 
_exptl_crystal.density_percent_sol   54. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;THE COMPLEX OF THE IL-1 RECEPTOR WITH THE ANTAGONIST WAS PREPARED BY MIXING A SOLUTION OF IL-1 RECEPTOR IN 50 MM TRIS (PH 7.5) AND 150 MM NACL WITH A SOLUTION OF IL1RA IN THE SAME BUFFER. THE COMPLEX WAS CRYSTALLIZED USING THE HANGING DROP METHOD. THE DROPS WERE PREPARED BY MIXING 4 UL OF THE PROTEIN SOLUTION WITH 1 UL OF RESERVOIR SOLUTION, CONTAINING 30% (W/V) PEG 3350, 400 MM MGCL2 IN 100 MM MOPS BUFFER (PH 7.0)., vapor diffusion - hanging drop
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           296 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   SIEMENS 
_diffrn_detector.pdbx_collection_date   1994-09 
_diffrn_detector.details                COLLIMATOR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'MACSCIENCE M18X' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1IRA 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             60.0 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   15631 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.2 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.06 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.7 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.7 
_reflns_shell.d_res_low              2.8 
_reflns_shell.percent_possible_all   85.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.325 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        3.1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1IRA 
_refine.ls_number_reflns_obs                     15012 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            2.7 
_refine.ls_percent_reflns_obs                    97.6 
_refine.ls_R_factor_obs                          0.213 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.213 
_refine.ls_R_factor_R_free                       0.314 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.9 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               45.2 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'IL1RA STRUCTURE (PDB ENTRY 1ILR) AND TRUNCATED CD4 DOMAIN (PDB ENTRY 2CD4)' 
_refine.pdbx_method_to_determine_struct          'MIR + MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3638 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         56 
_refine_hist.number_atoms_solvent             86 
_refine_hist.number_atoms_total               3780 
_refine_hist.d_res_high                       2.7 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.004 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.2   ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      26.5  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.0   ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             5.4   2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            11.5  4.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             8.3   4.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            17.7  8.0 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.70 
_refine_ls_shell.d_res_low                        2.82 
_refine_ls_shell.number_reflns_R_work             1463 
_refine_ls_shell.R_factor_R_work                  0.393 
_refine_ls_shell.percent_reflns_obs               86.1 
_refine_ls_shell.R_factor_R_free                  0.466 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            9.1 
_refine_ls_shell.number_reflns_R_free             172 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO   TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM3_MOD.PRO TOPH3.CHO    'X-RAY DIFFRACTION' 
3 WAT.PAR        WAT.TOP      'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1IRA 
_struct.title                     'COMPLEX OF THE INTERLEUKIN-1 RECEPTOR WITH THE INTERLEUKIN-1 RECEPTOR ANTAGONIST (IL1RA)' 
_struct.pdbx_descriptor           'INTERLEUKIN-1 RECEPTOR ANTAGONIST' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IRA 
_struct_keywords.pdbx_keywords   'COMPLEX (CYTOKINE RECEPTOR/ANTAGONIST)' 
_struct_keywords.text            
;CYTOKINE RECEPTOR, RECEPTOR ANTAGONIST, IMMUNOGLOBULIN FOLD, COMPLEX (CYTOKINE RECEPTOR-ANTAGONIST), COMPLEX (CYTOKINE RECEPTOR-ANTAGONIST) complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 37  ? LEU A 42  ? GLY X 37  LEU X 42  5 ? 6 
HELX_P HELX_P2  2  ILE A 85  ? ASP A 87  ? ILE X 85  ASP X 87  5 ? 3 
HELX_P HELX_P3  3  LYS A 93  ? PHE A 98  ? LYS X 93  PHE X 98  5 ? 6 
HELX_P HELX_P4  4  PRO A 137 ? GLU A 139 ? PRO X 137 GLU X 139 5 ? 3 
HELX_P HELX_P5  5  PRO B 31  ? GLU B 33  ? PRO Y 28  GLU Y 30  5 ? 3 
HELX_P HELX_P6  6  VAL B 71  ? ASP B 73  ? VAL Y 68  ASP Y 70  5 ? 3 
HELX_P HELX_P7  7  ALA B 107 ? ALA B 109 ? ALA Y 104 ALA Y 106 5 ? 3 
HELX_P HELX_P8  8  MET B 128 ? PHE B 131 ? MET Y 125 PHE Y 128 5 ? 4 
HELX_P HELX_P9  9  GLU B 171 ? HIS B 173 ? GLU Y 168 HIS Y 170 5 ? 3 
HELX_P HELX_P10 10 LYS B 270 ? ARG B 272 ? LYS Y 267 ARG Y 269 5 ? 3 
HELX_P HELX_P11 11 SER B 286 ? TYR B 289 ? SER Y 283 TYR Y 286 5 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 69  SG  ? ? ? 1_555 A CYS 116 SG ? ? X CYS 69  X CYS 116 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf2 disulf ?   ? B CYS 6   SG  ? ? ? 1_555 B CYS 87  SG ? ? Y CYS 3   Y CYS 84  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf3 disulf ?   ? B CYS 27  SG  ? ? ? 1_555 B CYS 79  SG ? ? Y CYS 24  Y CYS 76  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf4 disulf ?   ? B CYS 104 SG  ? ? ? 1_555 B CYS 147 SG ? ? Y CYS 101 Y CYS 144 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf5 disulf ?   ? B CYS 125 SG  ? ? ? 1_555 B CYS 179 SG ? ? Y CYS 122 Y CYS 176 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf6 disulf ?   ? B CYS 231 SG  ? ? ? 1_555 B CYS 295 SG ? ? Y CYS 228 Y CYS 292 1_555 ? ? ? ? ? ? ? 2.021 ? ?               
covale1 covale one ? B ASN 176 ND2 ? ? ? 1_555 C NAG .   C1 ? ? Y ASN 173 Y NAG 401 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale2 covale one ? B ASN 216 ND2 ? ? ? 1_555 D NAG .   C1 ? ? Y ASN 213 Y NAG 402 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale3 covale one ? B ASN 232 ND2 ? ? ? 1_555 E NAG .   C1 ? ? Y ASN 229 Y NAG 403 1_555 ? ? ? ? ? ? ? 1.451 ? N-Glycosylation 
covale4 covale one ? B ASN 246 ND2 ? ? ? 1_555 F NAG .   C1 ? ? Y ASN 243 Y NAG 404 1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 67  B . ? VAL 64  Y PRO 68  B ? PRO 65  Y 1 -0.29 
2 SER 213 B . ? SER 210 Y PRO 214 B ? PRO 211 Y 1 -0.02 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 4 ? 
F ? 3 ? 
G ? 4 ? 
H ? 3 ? 
I ? 4 ? 
J ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 146 ? GLU A 150 ? PHE X 146 GLU X 150 
A 2 GLN A 11  ? ASP A 17  ? GLN X 11  ASP X 17  
A 3 ILE A 46  ? GLU A 52  ? ILE X 46  GLU X 52  
A 4 ALA A 55  ? GLY A 59  ? ALA X 55  GLY X 59  
A 5 ALA A 99  ? SER A 105 ? ALA X 99  SER X 105 
A 6 THR A 108 ? SER A 113 ? THR X 108 SER X 113 
B 1 THR A 22  ? ARG A 26  ? THR X 22  ARG X 26  
B 2 GLN A 29  ? GLY A 33  ? GLN X 29  GLY X 33  
C 1 CYS A 66  ? SER A 72  ? CYS X 66  SER X 72  
C 2 GLU A 75  ? GLU A 81  ? GLU X 75  GLU X 81  
D 1 PHE A 120 ? CYS A 122 ? PHE X 120 CYS X 122 
D 2 SER A 132 ? THR A 134 ? SER X 132 THR X 134 
E 1 LEU B 15  ? SER B 18  ? LEU Y 12  SER Y 15  
E 2 TYR B 86  ? VAL B 97  ? TYR Y 83  VAL Y 94  
E 3 GLY B 75  ? ASN B 83  ? GLY Y 72  ASN Y 80  
E 4 THR B 37  ? TYR B 41  ? THR Y 34  TYR Y 38  
F 1 ASP B 23  ? ARG B 25  ? ASP Y 20  ARG Y 22  
F 2 LYS B 63  ? PHE B 66  ? LYS Y 60  PHE Y 63  
F 3 ILE B 57  ? HIS B 60  ? ILE Y 54  HIS Y 57  
G 1 PHE B 111 ? PRO B 116 ? PHE Y 108 PRO Y 113 
G 2 LYS B 188 ? LEU B 201 ? LYS Y 185 LEU Y 198 
G 3 GLY B 175 ? TYR B 185 ? GLY Y 172 TYR Y 182 
G 4 GLN B 142 ? LYS B 145 ? GLN Y 139 LYS Y 142 
H 1 GLY B 121 ? VAL B 124 ? GLY Y 118 VAL Y 121 
H 2 ARG B 163 ? VAL B 166 ? ARG Y 160 VAL Y 163 
H 3 PHE B 157 ? VAL B 160 ? PHE Y 154 VAL Y 157 
I 1 GLU B 217 ? GLU B 220 ? GLU Y 214 GLU Y 217 
I 2 ILE B 303 ? ILE B 311 ? ILE Y 300 ILE Y 308 
I 3 PHE B 293 ? LYS B 298 ? PHE Y 290 LYS Y 295 
I 4 ILE B 240 ? TRP B 245 ? ILE Y 237 TRP Y 242 
J 1 LEU B 257 ? VAL B 264 ? LEU Y 254 VAL Y 261 
J 2 SER B 273 ? ILE B 281 ? SER Y 270 ILE Y 278 
J 3 ILE B 227 ? GLY B 235 ? ILE Y 224 GLY Y 232 
J 4 VAL B 210 ? SER B 213 ? VAL Y 207 SER Y 210 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 147 ? O TYR X 147 N TRP A 16  ? N TRP X 16  
A 2 3 O GLN A 11  ? O GLN X 11  N VAL A 48  ? N VAL X 48  
A 3 4 O ASP A 47  ? O ASP X 47  N GLY A 59  ? N GLY X 59  
A 4 5 O LEU A 56  ? O LEU X 56  N PHE A 100 ? N PHE X 100 
A 5 6 O ILE A 101 ? O ILE X 101 N GLU A 112 ? N GLU X 112 
B 1 2 O THR A 22  ? O THR X 22  N GLY A 33  ? N GLY X 33  
C 1 2 O CYS A 66  ? O CYS X 66  N GLU A 81  ? N GLU X 81  
D 1 2 O PHE A 120 ? O PHE X 120 N THR A 134 ? N THR X 134 
E 1 2 O LEU B 15  ? O LEU Y 12  N LYS B 95  ? N LYS Y 92  
E 2 3 O TYR B 86  ? O TYR Y 83  N ASN B 83  ? N ASN Y 80  
E 3 4 O TYR B 78  ? O TYR Y 75  N TYR B 41  ? N TYR Y 38  
F 1 2 O ASP B 23  ? O ASP Y 20  N PHE B 66  ? N PHE Y 63  
F 2 3 O LYS B 63  ? O LYS Y 60  N HIS B 60  ? N HIS Y 57  
G 1 2 O PHE B 111 ? O PHE Y 108 N GLU B 197 ? N GLU Y 194 
G 2 3 O LYS B 188 ? O LYS Y 185 N TYR B 185 ? N TYR Y 182 
G 3 4 O THR B 178 ? O THR Y 175 N TYR B 144 ? N TYR Y 141 
H 1 2 O GLY B 121 ? O GLY Y 118 N VAL B 166 ? N VAL Y 163 
H 2 3 O ARG B 163 ? O ARG Y 160 N VAL B 160 ? N VAL Y 157 
I 1 2 O GLU B 217 ? O GLU Y 214 N GLN B 309 ? N GLN Y 306 
I 2 3 O ASP B 304 ? O ASP Y 301 N ALA B 297 ? N ALA Y 294 
I 3 4 O THR B 294 ? O THR Y 291 N LYS B 244 ? N LYS Y 241 
J 1 2 O GLY B 258 ? O GLY Y 255 N ASN B 280 ? N ASN Y 277 
J 2 3 O SER B 273 ? O SER Y 270 N GLY B 235 ? N GLY Y 232 
J 3 4 O ASN B 232 ? O ASN Y 229 N SER B 213 ? N SER Y 210 
# 
_database_PDB_matrix.entry_id          1IRA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IRA 
_atom_sites.fract_transf_matrix[1][1]   0.021186 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011820 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007133 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 7   ? 38.403 41.807  49.183 1.00 126.71 ? 7   SER X N   1 
ATOM   2    C CA  . SER A 1 7   ? 38.650 43.230  49.551 1.00 125.08 ? 7   SER X CA  1 
ATOM   3    C C   . SER A 1 7   ? 40.130 43.567  49.384 1.00 121.43 ? 7   SER X C   1 
ATOM   4    O O   . SER A 1 7   ? 40.515 44.237  48.426 1.00 121.89 ? 7   SER X O   1 
ATOM   5    C CB  . SER A 1 7   ? 38.199 43.490  50.986 1.00 127.47 ? 7   SER X CB  1 
ATOM   6    N N   . SER A 1 8   ? 40.954 43.109  50.322 1.00 116.79 ? 8   SER X N   1 
ATOM   7    C CA  . SER A 1 8   ? 42.388 43.354  50.264 1.00 112.54 ? 8   SER X CA  1 
ATOM   8    C C   . SER A 1 8   ? 43.078 42.152  49.624 1.00 105.05 ? 8   SER X C   1 
ATOM   9    O O   . SER A 1 8   ? 43.415 42.171  48.438 1.00 107.89 ? 8   SER X O   1 
ATOM   10   C CB  . SER A 1 8   ? 42.945 43.612  51.669 1.00 117.34 ? 8   SER X CB  1 
ATOM   11   O OG  . SER A 1 8   ? 42.532 42.602  52.576 1.00 122.36 ? 8   SER X OG  1 
ATOM   12   N N   . LYS A 1 9   ? 43.240 41.090  50.403 1.00 90.78  ? 9   LYS X N   1 
ATOM   13   C CA  . LYS A 1 9   ? 43.880 39.878  49.924 1.00 76.00  ? 9   LYS X CA  1 
ATOM   14   C C   . LYS A 1 9   ? 43.096 38.663  50.400 1.00 69.76  ? 9   LYS X C   1 
ATOM   15   O O   . LYS A 1 9   ? 42.187 38.779  51.225 1.00 70.24  ? 9   LYS X O   1 
ATOM   16   C CB  . LYS A 1 9   ? 45.324 39.802  50.421 1.00 67.78  ? 9   LYS X CB  1 
ATOM   17   C CG  . LYS A 1 9   ? 46.367 39.785  49.313 1.00 56.91  ? 9   LYS X CG  1 
ATOM   18   C CD  . LYS A 1 9   ? 46.140 38.622  48.365 1.00 58.29  ? 9   LYS X CD  1 
ATOM   19   C CE  . LYS A 1 9   ? 47.191 38.577  47.271 1.00 76.01  ? 9   LYS X CE  1 
ATOM   20   N NZ  . LYS A 1 9   ? 46.883 37.515  46.270 1.00 77.91  ? 9   LYS X NZ  1 
ATOM   21   N N   . MET A 1 10  ? 43.451 37.503  49.866 1.00 60.59  ? 10  MET X N   1 
ATOM   22   C CA  . MET A 1 10  ? 42.792 36.256  50.216 1.00 50.71  ? 10  MET X CA  1 
ATOM   23   C C   . MET A 1 10  ? 43.822 35.272  50.753 1.00 43.82  ? 10  MET X C   1 
ATOM   24   O O   . MET A 1 10  ? 45.027 35.442  50.541 1.00 34.84  ? 10  MET X O   1 
ATOM   25   C CB  . MET A 1 10  ? 42.115 35.656  48.978 1.00 46.33  ? 10  MET X CB  1 
ATOM   26   C CG  . MET A 1 10  ? 43.089 35.239  47.887 1.00 48.99  ? 10  MET X CG  1 
ATOM   27   S SD  . MET A 1 10  ? 42.306 34.398  46.512 1.00 51.66  ? 10  MET X SD  1 
ATOM   28   C CE  . MET A 1 10  ? 42.286 35.697  45.296 1.00 74.01  ? 10  MET X CE  1 
ATOM   29   N N   . GLN A 1 11  ? 43.344 34.244  51.446 1.00 41.52  ? 11  GLN X N   1 
ATOM   30   C CA  . GLN A 1 11  ? 44.218 33.216  51.995 1.00 40.63  ? 11  GLN X CA  1 
ATOM   31   C C   . GLN A 1 11  ? 43.589 31.838  51.827 1.00 40.39  ? 11  GLN X C   1 
ATOM   32   O O   . GLN A 1 11  ? 42.378 31.669  51.991 1.00 39.86  ? 11  GLN X O   1 
ATOM   33   C CB  . GLN A 1 11  ? 44.552 33.498  53.463 1.00 44.33  ? 11  GLN X CB  1 
ATOM   34   C CG  . GLN A 1 11  ? 43.362 33.788  54.360 1.00 57.42  ? 11  GLN X CG  1 
ATOM   35   C CD  . GLN A 1 11  ? 43.776 34.033  55.800 1.00 68.24  ? 11  GLN X CD  1 
ATOM   36   O OE1 . GLN A 1 11  ? 44.964 34.064  56.121 1.00 69.99  ? 11  GLN X OE1 1 
ATOM   37   N NE2 . GLN A 1 11  ? 42.796 34.205  56.674 1.00 81.27  ? 11  GLN X NE2 1 
ATOM   38   N N   . ALA A 1 12  ? 44.415 30.870  51.443 1.00 38.45  ? 12  ALA X N   1 
ATOM   39   C CA  . ALA A 1 12  ? 43.968 29.502  51.227 1.00 36.43  ? 12  ALA X CA  1 
ATOM   40   C C   . ALA A 1 12  ? 43.809 28.740  52.533 1.00 34.06  ? 12  ALA X C   1 
ATOM   41   O O   . ALA A 1 12  ? 44.681 28.781  53.406 1.00 35.46  ? 12  ALA X O   1 
ATOM   42   C CB  . ALA A 1 12  ? 44.938 28.770  50.309 1.00 39.03  ? 12  ALA X CB  1 
ATOM   43   N N   . PHE A 1 13  ? 42.698 28.025  52.642 1.00 33.25  ? 13  PHE X N   1 
ATOM   44   C CA  . PHE A 1 13  ? 42.384 27.231  53.818 1.00 35.62  ? 13  PHE X CA  1 
ATOM   45   C C   . PHE A 1 13  ? 42.121 25.794  53.405 1.00 36.00  ? 13  PHE X C   1 
ATOM   46   O O   . PHE A 1 13  ? 41.769 25.515  52.256 1.00 37.69  ? 13  PHE X O   1 
ATOM   47   C CB  . PHE A 1 13  ? 41.125 27.758  54.508 1.00 31.67  ? 13  PHE X CB  1 
ATOM   48   C CG  . PHE A 1 13  ? 41.377 28.840  55.516 1.00 46.05  ? 13  PHE X CG  1 
ATOM   49   C CD1 . PHE A 1 13  ? 41.753 30.116  55.115 1.00 41.03  ? 13  PHE X CD1 1 
ATOM   50   C CD2 . PHE A 1 13  ? 41.196 28.593  56.874 1.00 52.29  ? 13  PHE X CD2 1 
ATOM   51   C CE1 . PHE A 1 13  ? 41.942 31.129  56.051 1.00 44.21  ? 13  PHE X CE1 1 
ATOM   52   C CE2 . PHE A 1 13  ? 41.382 29.599  57.817 1.00 36.65  ? 13  PHE X CE2 1 
ATOM   53   C CZ  . PHE A 1 13  ? 41.755 30.870  57.403 1.00 42.09  ? 13  PHE X CZ  1 
ATOM   54   N N   . ARG A 1 14  ? 42.309 24.885  54.350 1.00 33.18  ? 14  ARG X N   1 
ATOM   55   C CA  . ARG A 1 14  ? 42.053 23.476  54.123 1.00 26.49  ? 14  ARG X CA  1 
ATOM   56   C C   . ARG A 1 14  ? 40.764 23.203  54.878 1.00 22.15  ? 14  ARG X C   1 
ATOM   57   O O   . ARG A 1 14  ? 40.518 23.791  55.935 1.00 21.15  ? 14  ARG X O   1 
ATOM   58   C CB  . ARG A 1 14  ? 43.184 22.614  54.677 1.00 17.52  ? 14  ARG X CB  1 
ATOM   59   C CG  . ARG A 1 14  ? 44.550 22.979  54.128 1.00 43.02  ? 14  ARG X CG  1 
ATOM   60   C CD  . ARG A 1 14  ? 45.523 21.824  54.239 1.00 68.35  ? 14  ARG X CD  1 
ATOM   61   N NE  . ARG A 1 14  ? 45.201 20.751  53.301 1.00 88.25  ? 14  ARG X NE  1 
ATOM   62   C CZ  . ARG A 1 14  ? 45.672 19.511  53.387 1.00 101.51 ? 14  ARG X CZ  1 
ATOM   63   N NH1 . ARG A 1 14  ? 46.491 19.169  54.374 1.00 108.85 ? 14  ARG X NH1 1 
ATOM   64   N NH2 . ARG A 1 14  ? 45.328 18.610  52.478 1.00 101.49 ? 14  ARG X NH2 1 
ATOM   65   N N   . ILE A 1 15  ? 39.916 22.353  54.323 1.00 17.97  ? 15  ILE X N   1 
ATOM   66   C CA  . ILE A 1 15  ? 38.661 22.056  54.978 1.00 14.72  ? 15  ILE X CA  1 
ATOM   67   C C   . ILE A 1 15  ? 38.281 20.590  54.831 1.00 22.33  ? 15  ILE X C   1 
ATOM   68   O O   . ILE A 1 15  ? 38.591 19.952  53.824 1.00 19.80  ? 15  ILE X O   1 
ATOM   69   C CB  . ILE A 1 15  ? 37.532 22.956  54.439 1.00 2.00   ? 15  ILE X CB  1 
ATOM   70   C CG1 . ILE A 1 15  ? 36.284 22.828  55.311 1.00 16.05  ? 15  ILE X CG1 1 
ATOM   71   C CG2 . ILE A 1 15  ? 37.199 22.591  53.002 1.00 20.59  ? 15  ILE X CG2 1 
ATOM   72   C CD1 . ILE A 1 15  ? 35.222 23.846  54.997 1.00 9.95   ? 15  ILE X CD1 1 
ATOM   73   N N   . TRP A 1 16  ? 37.679 20.051  55.885 1.00 29.59  ? 16  TRP X N   1 
ATOM   74   C CA  . TRP A 1 16  ? 37.215 18.673  55.927 1.00 22.64  ? 16  TRP X CA  1 
ATOM   75   C C   . TRP A 1 16  ? 36.299 18.571  57.137 1.00 20.75  ? 16  TRP X C   1 
ATOM   76   O O   . TRP A 1 16  ? 36.600 19.127  58.194 1.00 25.25  ? 16  TRP X O   1 
ATOM   77   C CB  . TRP A 1 16  ? 38.395 17.696  56.030 1.00 24.38  ? 16  TRP X CB  1 
ATOM   78   C CG  . TRP A 1 16  ? 39.127 17.657  57.347 1.00 19.12  ? 16  TRP X CG  1 
ATOM   79   C CD1 . TRP A 1 16  ? 38.938 16.757  58.356 1.00 26.47  ? 16  TRP X CD1 1 
ATOM   80   C CD2 . TRP A 1 16  ? 40.226 18.487  57.756 1.00 15.39  ? 16  TRP X CD2 1 
ATOM   81   N NE1 . TRP A 1 16  ? 39.856 16.962  59.356 1.00 32.19  ? 16  TRP X NE1 1 
ATOM   82   C CE2 . TRP A 1 16  ? 40.660 18.016  59.014 1.00 13.14  ? 16  TRP X CE2 1 
ATOM   83   C CE3 . TRP A 1 16  ? 40.887 19.579  57.178 1.00 29.76  ? 16  TRP X CE3 1 
ATOM   84   C CZ2 . TRP A 1 16  ? 41.726 18.598  59.706 1.00 18.55  ? 16  TRP X CZ2 1 
ATOM   85   C CZ3 . TRP A 1 16  ? 41.950 20.158  57.868 1.00 26.91  ? 16  TRP X CZ3 1 
ATOM   86   C CH2 . TRP A 1 16  ? 42.356 19.665  59.118 1.00 30.14  ? 16  TRP X CH2 1 
ATOM   87   N N   . ASP A 1 17  ? 35.149 17.934  56.973 1.00 16.23  ? 17  ASP X N   1 
ATOM   88   C CA  . ASP A 1 17  ? 34.227 17.820  58.088 1.00 17.23  ? 17  ASP X CA  1 
ATOM   89   C C   . ASP A 1 17  ? 34.745 16.885  59.177 1.00 23.49  ? 17  ASP X C   1 
ATOM   90   O O   . ASP A 1 17  ? 35.810 16.273  59.033 1.00 19.38  ? 17  ASP X O   1 
ATOM   91   C CB  . ASP A 1 17  ? 32.820 17.413  57.614 1.00 19.18  ? 17  ASP X CB  1 
ATOM   92   C CG  . ASP A 1 17  ? 32.798 16.100  56.846 1.00 20.70  ? 17  ASP X CG  1 
ATOM   93   O OD1 . ASP A 1 17  ? 33.635 15.213  57.106 1.00 33.78  ? 17  ASP X OD1 1 
ATOM   94   O OD2 . ASP A 1 17  ? 31.916 15.948  55.981 1.00 19.86  ? 17  ASP X OD2 1 
ATOM   95   N N   . VAL A 1 18  ? 33.979 16.774  60.259 1.00 26.14  ? 18  VAL X N   1 
ATOM   96   C CA  . VAL A 1 18  ? 34.335 15.914  61.384 1.00 26.68  ? 18  VAL X CA  1 
ATOM   97   C C   . VAL A 1 18  ? 34.403 14.428  61.011 1.00 29.91  ? 18  VAL X C   1 
ATOM   98   O O   . VAL A 1 18  ? 35.027 13.635  61.716 1.00 38.27  ? 18  VAL X O   1 
ATOM   99   C CB  . VAL A 1 18  ? 33.372 16.121  62.580 1.00 22.01  ? 18  VAL X CB  1 
ATOM   100  C CG1 . VAL A 1 18  ? 33.609 17.485  63.208 1.00 6.42   ? 18  VAL X CG1 1 
ATOM   101  C CG2 . VAL A 1 18  ? 31.926 16.005  62.130 1.00 10.40  ? 18  VAL X CG2 1 
ATOM   102  N N   . ASN A 1 19  ? 33.773 14.063  59.896 1.00 21.70  ? 19  ASN X N   1 
ATOM   103  C CA  . ASN A 1 19  ? 33.773 12.684  59.411 1.00 8.26   ? 19  ASN X CA  1 
ATOM   104  C C   . ASN A 1 19  ? 34.877 12.464  58.370 1.00 11.81  ? 19  ASN X C   1 
ATOM   105  O O   . ASN A 1 19  ? 34.799 11.557  57.539 1.00 15.77  ? 19  ASN X O   1 
ATOM   106  C CB  . ASN A 1 19  ? 32.406 12.322  58.825 1.00 7.80   ? 19  ASN X CB  1 
ATOM   107  C CG  . ASN A 1 19  ? 31.296 12.368  59.860 1.00 13.17  ? 19  ASN X CG  1 
ATOM   108  O OD1 . ASN A 1 19  ? 31.553 12.543  61.048 1.00 26.13  ? 19  ASN X OD1 1 
ATOM   109  N ND2 . ASN A 1 19  ? 30.056 12.219  59.412 1.00 20.40  ? 19  ASN X ND2 1 
ATOM   110  N N   . GLN A 1 20  ? 35.872 13.348  58.386 1.00 11.99  ? 20  GLN X N   1 
ATOM   111  C CA  . GLN A 1 20  ? 37.028 13.282  57.491 1.00 16.87  ? 20  GLN X CA  1 
ATOM   112  C C   . GLN A 1 20  ? 36.803 13.419  55.971 1.00 15.33  ? 20  GLN X C   1 
ATOM   113  O O   . GLN A 1 20  ? 37.732 13.211  55.182 1.00 17.53  ? 20  GLN X O   1 
ATOM   114  C CB  . GLN A 1 20  ? 37.850 12.029  57.805 1.00 17.98  ? 20  GLN X CB  1 
ATOM   115  C CG  . GLN A 1 20  ? 38.341 11.945  59.254 1.00 15.46  ? 20  GLN X CG  1 
ATOM   116  C CD  . GLN A 1 20  ? 39.444 12.938  59.577 1.00 14.69  ? 20  GLN X CD  1 
ATOM   117  O OE1 . GLN A 1 20  ? 40.287 13.246  58.735 1.00 25.21  ? 20  GLN X OE1 1 
ATOM   118  N NE2 . GLN A 1 20  ? 39.452 13.431  60.805 1.00 29.15  ? 20  GLN X NE2 1 
ATOM   119  N N   . LYS A 1 21  ? 35.590 13.776  55.558 1.00 6.78   ? 21  LYS X N   1 
ATOM   120  C CA  . LYS A 1 21  ? 35.298 13.964  54.136 1.00 6.80   ? 21  LYS X CA  1 
ATOM   121  C C   . LYS A 1 21  ? 35.944 15.265  53.661 1.00 16.35  ? 21  LYS X C   1 
ATOM   122  O O   . LYS A 1 21  ? 35.987 16.249  54.404 1.00 25.77  ? 21  LYS X O   1 
ATOM   123  C CB  . LYS A 1 21  ? 33.791 14.067  53.888 1.00 2.00   ? 21  LYS X CB  1 
ATOM   124  C CG  . LYS A 1 21  ? 32.959 12.877  54.343 1.00 7.85   ? 21  LYS X CG  1 
ATOM   125  C CD  . LYS A 1 21  ? 31.495 13.087  53.967 1.00 2.00   ? 21  LYS X CD  1 
ATOM   126  C CE  . LYS A 1 21  ? 30.603 11.977  54.500 1.00 33.76  ? 21  LYS X CE  1 
ATOM   127  N NZ  . LYS A 1 21  ? 30.415 12.024  55.978 1.00 38.48  ? 21  LYS X NZ  1 
ATOM   128  N N   . THR A 1 22  ? 36.427 15.278  52.424 1.00 16.44  ? 22  THR X N   1 
ATOM   129  C CA  . THR A 1 22  ? 37.044 16.469  51.855 1.00 15.89  ? 22  THR X CA  1 
ATOM   130  C C   . THR A 1 22  ? 36.201 16.931  50.669 1.00 19.25  ? 22  THR X C   1 
ATOM   131  O O   . THR A 1 22  ? 35.269 16.230  50.259 1.00 25.97  ? 22  THR X O   1 
ATOM   132  C CB  . THR A 1 22  ? 38.502 16.212  51.413 1.00 16.33  ? 22  THR X CB  1 
ATOM   133  O OG1 . THR A 1 22  ? 38.553 15.084  50.528 1.00 35.48  ? 22  THR X OG1 1 
ATOM   134  C CG2 . THR A 1 22  ? 39.392 15.945  52.622 1.00 17.74  ? 22  THR X CG2 1 
ATOM   135  N N   . PHE A 1 23  ? 36.508 18.108  50.134 1.00 15.83  ? 23  PHE X N   1 
ATOM   136  C CA  . PHE A 1 23  ? 35.758 18.656  49.010 1.00 10.58  ? 23  PHE X CA  1 
ATOM   137  C C   . PHE A 1 23  ? 36.496 18.490  47.692 1.00 14.50  ? 23  PHE X C   1 
ATOM   138  O O   . PHE A 1 23  ? 37.722 18.614  47.640 1.00 23.41  ? 23  PHE X O   1 
ATOM   139  C CB  . PHE A 1 23  ? 35.486 20.152  49.218 1.00 15.06  ? 23  PHE X CB  1 
ATOM   140  C CG  . PHE A 1 23  ? 34.554 20.468  50.363 1.00 18.39  ? 23  PHE X CG  1 
ATOM   141  C CD1 . PHE A 1 23  ? 33.950 19.463  51.108 1.00 12.38  ? 23  PHE X CD1 1 
ATOM   142  C CD2 . PHE A 1 23  ? 34.285 21.791  50.694 1.00 22.64  ? 23  PHE X CD2 1 
ATOM   143  C CE1 . PHE A 1 23  ? 33.095 19.775  52.164 1.00 29.02  ? 23  PHE X CE1 1 
ATOM   144  C CE2 . PHE A 1 23  ? 33.433 22.108  51.745 1.00 20.25  ? 23  PHE X CE2 1 
ATOM   145  C CZ  . PHE A 1 23  ? 32.837 21.098  52.481 1.00 25.01  ? 23  PHE X CZ  1 
ATOM   146  N N   . TYR A 1 24  ? 35.744 18.215  46.631 1.00 13.19  ? 24  TYR X N   1 
ATOM   147  C CA  . TYR A 1 24  ? 36.298 18.076  45.284 1.00 17.94  ? 24  TYR X CA  1 
ATOM   148  C C   . TYR A 1 24  ? 35.156 18.287  44.303 1.00 23.55  ? 24  TYR X C   1 
ATOM   149  O O   . TYR A 1 24  ? 33.989 18.226  44.693 1.00 24.90  ? 24  TYR X O   1 
ATOM   150  C CB  . TYR A 1 24  ? 36.984 16.714  45.063 1.00 20.67  ? 24  TYR X CB  1 
ATOM   151  C CG  . TYR A 1 24  ? 36.078 15.502  45.129 1.00 29.43  ? 24  TYR X CG  1 
ATOM   152  C CD1 . TYR A 1 24  ? 35.432 15.025  43.989 1.00 20.87  ? 24  TYR X CD1 1 
ATOM   153  C CD2 . TYR A 1 24  ? 35.867 14.835  46.334 1.00 30.93  ? 24  TYR X CD2 1 
ATOM   154  C CE1 . TYR A 1 24  ? 34.597 13.919  44.048 1.00 20.19  ? 24  TYR X CE1 1 
ATOM   155  C CE2 . TYR A 1 24  ? 35.033 13.728  46.404 1.00 26.21  ? 24  TYR X CE2 1 
ATOM   156  C CZ  . TYR A 1 24  ? 34.401 13.277  45.260 1.00 27.11  ? 24  TYR X CZ  1 
ATOM   157  O OH  . TYR A 1 24  ? 33.563 12.190  45.325 1.00 47.54  ? 24  TYR X OH  1 
ATOM   158  N N   . LEU A 1 25  ? 35.490 18.553  43.044 1.00 29.51  ? 25  LEU X N   1 
ATOM   159  C CA  . LEU A 1 25  ? 34.491 18.801  42.007 1.00 30.19  ? 25  LEU X CA  1 
ATOM   160  C C   . LEU A 1 25  ? 34.048 17.593  41.187 1.00 31.06  ? 25  LEU X C   1 
ATOM   161  O O   . LEU A 1 25  ? 34.869 16.834  40.665 1.00 35.62  ? 25  LEU X O   1 
ATOM   162  C CB  . LEU A 1 25  ? 34.987 19.883  41.048 1.00 23.04  ? 25  LEU X CB  1 
ATOM   163  C CG  . LEU A 1 25  ? 35.003 21.325  41.539 1.00 18.95  ? 25  LEU X CG  1 
ATOM   164  C CD1 . LEU A 1 25  ? 35.684 22.190  40.501 1.00 22.45  ? 25  LEU X CD1 1 
ATOM   165  C CD2 . LEU A 1 25  ? 33.581 21.803  41.793 1.00 25.45  ? 25  LEU X CD2 1 
ATOM   166  N N   . ARG A 1 26  ? 32.736 17.430  41.078 1.00 28.78  ? 26  ARG X N   1 
ATOM   167  C CA  . ARG A 1 26  ? 32.147 16.360  40.289 1.00 36.06  ? 26  ARG X CA  1 
ATOM   168  C C   . ARG A 1 26  ? 31.153 17.045  39.365 1.00 41.41  ? 26  ARG X C   1 
ATOM   169  O O   . ARG A 1 26  ? 30.145 17.583  39.821 1.00 40.40  ? 26  ARG X O   1 
ATOM   170  C CB  . ARG A 1 26  ? 31.426 15.341  41.175 1.00 44.31  ? 26  ARG X CB  1 
ATOM   171  C CG  . ARG A 1 26  ? 30.517 14.396  40.396 1.00 38.37  ? 26  ARG X CG  1 
ATOM   172  C CD  . ARG A 1 26  ? 29.891 13.337  41.283 1.00 56.85  ? 26  ARG X CD  1 
ATOM   173  N NE  . ARG A 1 26  ? 30.840 12.282  41.629 1.00 86.17  ? 26  ARG X NE  1 
ATOM   174  C CZ  . ARG A 1 26  ? 31.204 11.972  42.869 1.00 99.81  ? 26  ARG X CZ  1 
ATOM   175  N NH1 . ARG A 1 26  ? 30.702 12.635  43.903 1.00 107.89 ? 26  ARG X NH1 1 
ATOM   176  N NH2 . ARG A 1 26  ? 32.074 10.994  43.077 1.00 95.51  ? 26  ARG X NH2 1 
ATOM   177  N N   . ASN A 1 27  ? 31.482 17.086  38.078 1.00 46.00  ? 27  ASN X N   1 
ATOM   178  C CA  . ASN A 1 27  ? 30.633 17.717  37.072 1.00 49.60  ? 27  ASN X CA  1 
ATOM   179  C C   . ASN A 1 27  ? 30.409 19.183  37.460 1.00 48.31  ? 27  ASN X C   1 
ATOM   180  O O   . ASN A 1 27  ? 29.282 19.687  37.452 1.00 47.22  ? 27  ASN X O   1 
ATOM   181  C CB  . ASN A 1 27  ? 29.298 16.967  36.946 1.00 59.91  ? 27  ASN X CB  1 
ATOM   182  C CG  . ASN A 1 27  ? 28.664 17.126  35.573 1.00 74.51  ? 27  ASN X CG  1 
ATOM   183  O OD1 . ASN A 1 27  ? 29.316 16.912  34.547 1.00 76.07  ? 27  ASN X OD1 1 
ATOM   184  N ND2 . ASN A 1 27  ? 27.390 17.493  35.545 1.00 75.28  ? 27  ASN X ND2 1 
ATOM   185  N N   . ASN A 1 28  ? 31.508 19.848  37.812 1.00 45.93  ? 28  ASN X N   1 
ATOM   186  C CA  . ASN A 1 28  ? 31.502 21.254  38.224 1.00 53.40  ? 28  ASN X CA  1 
ATOM   187  C C   . ASN A 1 28  ? 30.536 21.528  39.380 1.00 51.38  ? 28  ASN X C   1 
ATOM   188  O O   . ASN A 1 28  ? 29.935 22.602  39.481 1.00 48.38  ? 28  ASN X O   1 
ATOM   189  C CB  . ASN A 1 28  ? 31.203 22.178  37.039 1.00 71.94  ? 28  ASN X CB  1 
ATOM   190  C CG  . ASN A 1 28  ? 31.555 23.627  37.331 1.00 93.76  ? 28  ASN X CG  1 
ATOM   191  O OD1 . ASN A 1 28  ? 32.727 23.972  37.490 1.00 101.71 ? 28  ASN X OD1 1 
ATOM   192  N ND2 . ASN A 1 28  ? 30.541 24.478  37.420 1.00 104.46 ? 28  ASN X ND2 1 
ATOM   193  N N   . GLN A 1 29  ? 30.394 20.541  40.254 1.00 49.67  ? 29  GLN X N   1 
ATOM   194  C CA  . GLN A 1 29  ? 29.528 20.657  41.414 1.00 41.17  ? 29  GLN X CA  1 
ATOM   195  C C   . GLN A 1 29  ? 30.347 20.154  42.598 1.00 36.79  ? 29  GLN X C   1 
ATOM   196  O O   . GLN A 1 29  ? 30.912 19.061  42.558 1.00 41.69  ? 29  GLN X O   1 
ATOM   197  C CB  . GLN A 1 29  ? 28.262 19.818  41.215 1.00 36.90  ? 29  GLN X CB  1 
ATOM   198  C CG  . GLN A 1 29  ? 27.168 20.087  42.230 1.00 56.93  ? 29  GLN X CG  1 
ATOM   199  C CD  . GLN A 1 29  ? 25.847 19.447  41.844 1.00 78.22  ? 29  GLN X CD  1 
ATOM   200  O OE1 . GLN A 1 29  ? 25.271 18.675  42.611 1.00 101.69 ? 29  GLN X OE1 1 
ATOM   201  N NE2 . GLN A 1 29  ? 25.351 19.778  40.659 1.00 76.19  ? 29  GLN X NE2 1 
ATOM   202  N N   . LEU A 1 30  ? 30.484 21.002  43.608 1.00 32.39  ? 30  LEU X N   1 
ATOM   203  C CA  . LEU A 1 30  ? 31.250 20.680  44.803 1.00 25.12  ? 30  LEU X CA  1 
ATOM   204  C C   . LEU A 1 30  ? 30.595 19.541  45.577 1.00 21.32  ? 30  LEU X C   1 
ATOM   205  O O   . LEU A 1 30  ? 29.403 19.594  45.899 1.00 23.05  ? 30  LEU X O   1 
ATOM   206  C CB  . LEU A 1 30  ? 31.372 21.929  45.676 1.00 18.38  ? 30  LEU X CB  1 
ATOM   207  C CG  . LEU A 1 30  ? 32.596 22.099  46.573 1.00 15.64  ? 30  LEU X CG  1 
ATOM   208  C CD1 . LEU A 1 30  ? 33.877 21.877  45.788 1.00 3.12   ? 30  LEU X CD1 1 
ATOM   209  C CD2 . LEU A 1 30  ? 32.570 23.496  47.165 1.00 6.24   ? 30  LEU X CD2 1 
ATOM   210  N N   . VAL A 1 31  ? 31.364 18.489  45.829 1.00 17.33  ? 31  VAL X N   1 
ATOM   211  C CA  . VAL A 1 31  ? 30.866 17.330  46.561 1.00 17.94  ? 31  VAL X CA  1 
ATOM   212  C C   . VAL A 1 31  ? 31.873 16.949  47.643 1.00 17.32  ? 31  VAL X C   1 
ATOM   213  O O   . VAL A 1 31  ? 33.040 17.357  47.589 1.00 22.86  ? 31  VAL X O   1 
ATOM   214  C CB  . VAL A 1 31  ? 30.628 16.103  45.624 1.00 22.28  ? 31  VAL X CB  1 
ATOM   215  C CG1 . VAL A 1 31  ? 29.565 16.409  44.576 1.00 18.48  ? 31  VAL X CG1 1 
ATOM   216  C CG2 . VAL A 1 31  ? 31.910 15.696  44.947 1.00 25.40  ? 31  VAL X CG2 1 
ATOM   217  N N   . ALA A 1 32  ? 31.417 16.176  48.622 1.00 16.90  ? 32  ALA X N   1 
ATOM   218  C CA  . ALA A 1 32  ? 32.268 15.727  49.718 1.00 15.61  ? 32  ALA X CA  1 
ATOM   219  C C   . ALA A 1 32  ? 32.415 14.206  49.672 1.00 17.18  ? 32  ALA X C   1 
ATOM   220  O O   . ALA A 1 32  ? 31.430 13.481  49.497 1.00 18.85  ? 32  ALA X O   1 
ATOM   221  C CB  . ALA A 1 32  ? 31.677 16.164  51.055 1.00 11.11  ? 32  ALA X CB  1 
ATOM   222  N N   . GLY A 1 33  ? 33.644 13.726  49.827 1.00 10.68  ? 33  GLY X N   1 
ATOM   223  C CA  . GLY A 1 33  ? 33.893 12.297  49.803 1.00 11.51  ? 33  GLY X CA  1 
ATOM   224  C C   . GLY A 1 33  ? 35.265 11.969  50.353 1.00 18.93  ? 33  GLY X C   1 
ATOM   225  O O   . GLY A 1 33  ? 35.926 12.837  50.920 1.00 21.50  ? 33  GLY X O   1 
ATOM   226  N N   . TYR A 1 34  ? 35.693 10.721  50.191 1.00 21.87  ? 34  TYR X N   1 
ATOM   227  C CA  . TYR A 1 34  ? 36.999 10.278  50.674 1.00 20.90  ? 34  TYR X CA  1 
ATOM   228  C C   . TYR A 1 34  ? 37.923 10.095  49.480 1.00 26.03  ? 34  TYR X C   1 
ATOM   229  O O   . TYR A 1 34  ? 37.575 9.403   48.523 1.00 32.53  ? 34  TYR X O   1 
ATOM   230  C CB  . TYR A 1 34  ? 36.860 8.964   51.452 1.00 8.14   ? 34  TYR X CB  1 
ATOM   231  C CG  . TYR A 1 34  ? 35.952 9.079   52.653 1.00 2.00   ? 34  TYR X CG  1 
ATOM   232  C CD1 . TYR A 1 34  ? 36.404 9.669   53.834 1.00 11.99  ? 34  TYR X CD1 1 
ATOM   233  C CD2 . TYR A 1 34  ? 34.629 8.638   52.599 1.00 2.00   ? 34  TYR X CD2 1 
ATOM   234  C CE1 . TYR A 1 34  ? 35.562 9.823   54.933 1.00 14.08  ? 34  TYR X CE1 1 
ATOM   235  C CE2 . TYR A 1 34  ? 33.775 8.787   53.693 1.00 7.09   ? 34  TYR X CE2 1 
ATOM   236  C CZ  . TYR A 1 34  ? 34.250 9.380   54.857 1.00 19.82  ? 34  TYR X CZ  1 
ATOM   237  O OH  . TYR A 1 34  ? 33.414 9.536   55.940 1.00 21.86  ? 34  TYR X OH  1 
ATOM   238  N N   . LEU A 1 35  ? 39.081 10.743  49.522 1.00 24.80  ? 35  LEU X N   1 
ATOM   239  C CA  . LEU A 1 35  ? 40.040 10.654  48.427 1.00 30.21  ? 35  LEU X CA  1 
ATOM   240  C C   . LEU A 1 35  ? 41.242 9.808   48.817 1.00 38.28  ? 35  LEU X C   1 
ATOM   241  O O   . LEU A 1 35  ? 41.761 9.927   49.930 1.00 45.20  ? 35  LEU X O   1 
ATOM   242  C CB  . LEU A 1 35  ? 40.506 12.053  48.012 1.00 27.95  ? 35  LEU X CB  1 
ATOM   243  C CG  . LEU A 1 35  ? 39.420 13.043  47.577 1.00 29.61  ? 35  LEU X CG  1 
ATOM   244  C CD1 . LEU A 1 35  ? 40.045 14.393  47.275 1.00 25.43  ? 35  LEU X CD1 1 
ATOM   245  C CD2 . LEU A 1 35  ? 38.677 12.505  46.366 1.00 27.11  ? 35  LEU X CD2 1 
ATOM   246  N N   . GLN A 1 36  ? 41.664 8.938   47.905 1.00 37.92  ? 36  GLN X N   1 
ATOM   247  C CA  . GLN A 1 36  ? 42.811 8.070   48.144 1.00 41.69  ? 36  GLN X CA  1 
ATOM   248  C C   . GLN A 1 36  ? 44.063 8.638   47.499 1.00 46.29  ? 36  GLN X C   1 
ATOM   249  O O   . GLN A 1 36  ? 43.982 9.503   46.623 1.00 46.90  ? 36  GLN X O   1 
ATOM   250  C CB  . GLN A 1 36  ? 42.544 6.663   47.611 1.00 37.44  ? 36  GLN X CB  1 
ATOM   251  C CG  . GLN A 1 36  ? 41.467 5.924   48.375 1.00 39.90  ? 36  GLN X CG  1 
ATOM   252  C CD  . GLN A 1 36  ? 41.098 4.614   47.732 1.00 32.81  ? 36  GLN X CD  1 
ATOM   253  O OE1 . GLN A 1 36  ? 40.604 4.584   46.608 1.00 40.41  ? 36  GLN X OE1 1 
ATOM   254  N NE2 . GLN A 1 36  ? 41.326 3.519   48.443 1.00 47.49  ? 36  GLN X NE2 1 
ATOM   255  N N   . GLY A 1 37  ? 45.209 8.101   47.914 1.00 51.32  ? 37  GLY X N   1 
ATOM   256  C CA  . GLY A 1 37  ? 46.511 8.522   47.418 1.00 58.32  ? 37  GLY X CA  1 
ATOM   257  C C   . GLY A 1 37  ? 46.570 9.234   46.078 1.00 61.73  ? 37  GLY X C   1 
ATOM   258  O O   . GLY A 1 37  ? 46.877 10.421  46.039 1.00 64.26  ? 37  GLY X O   1 
ATOM   259  N N   . PRO A 1 38  ? 46.260 8.551   44.967 1.00 64.13  ? 38  PRO X N   1 
ATOM   260  C CA  . PRO A 1 38  ? 46.299 9.168   43.637 1.00 67.24  ? 38  PRO X CA  1 
ATOM   261  C C   . PRO A 1 38  ? 45.359 10.364  43.451 1.00 67.44  ? 38  PRO X C   1 
ATOM   262  O O   . PRO A 1 38  ? 45.743 11.385  42.872 1.00 73.55  ? 38  PRO X O   1 
ATOM   263  C CB  . PRO A 1 38  ? 45.919 8.007   42.713 1.00 75.84  ? 38  PRO X CB  1 
ATOM   264  C CG  . PRO A 1 38  ? 45.057 7.137   43.588 1.00 71.05  ? 38  PRO X CG  1 
ATOM   265  C CD  . PRO A 1 38  ? 45.828 7.143   44.877 1.00 62.96  ? 38  PRO X CD  1 
ATOM   266  N N   . ASN A 1 39  ? 44.142 10.248  43.973 1.00 59.87  ? 39  ASN X N   1 
ATOM   267  C CA  . ASN A 1 39  ? 43.143 11.302  43.842 1.00 50.64  ? 39  ASN X CA  1 
ATOM   268  C C   . ASN A 1 39  ? 43.325 12.457  44.828 1.00 42.22  ? 39  ASN X C   1 
ATOM   269  O O   . ASN A 1 39  ? 42.578 13.435  44.782 1.00 41.88  ? 39  ASN X O   1 
ATOM   270  C CB  . ASN A 1 39  ? 41.737 10.717  44.010 1.00 54.70  ? 39  ASN X CB  1 
ATOM   271  C CG  . ASN A 1 39  ? 41.511 9.493   43.149 1.00 60.76  ? 39  ASN X CG  1 
ATOM   272  O OD1 . ASN A 1 39  ? 41.487 9.574   41.921 1.00 57.08  ? 39  ASN X OD1 1 
ATOM   273  N ND2 . ASN A 1 39  ? 41.336 8.345   43.794 1.00 69.06  ? 39  ASN X ND2 1 
ATOM   274  N N   . VAL A 1 40  ? 44.337 12.367  45.687 1.00 31.63  ? 40  VAL X N   1 
ATOM   275  C CA  . VAL A 1 40  ? 44.590 13.398  46.690 1.00 28.77  ? 40  VAL X CA  1 
ATOM   276  C C   . VAL A 1 40  ? 44.761 14.797  46.091 1.00 34.69  ? 40  VAL X C   1 
ATOM   277  O O   . VAL A 1 40  ? 44.455 15.799  46.739 1.00 45.49  ? 40  VAL X O   1 
ATOM   278  C CB  . VAL A 1 40  ? 45.811 13.036  47.571 1.00 19.34  ? 40  VAL X CB  1 
ATOM   279  C CG1 . VAL A 1 40  ? 47.110 13.297  46.830 1.00 22.61  ? 40  VAL X CG1 1 
ATOM   280  C CG2 . VAL A 1 40  ? 45.756 13.796  48.882 1.00 22.93  ? 40  VAL X CG2 1 
ATOM   281  N N   . ASN A 1 41  ? 45.213 14.861  44.844 1.00 36.81  ? 41  ASN X N   1 
ATOM   282  C CA  . ASN A 1 41  ? 45.413 16.137  44.161 1.00 32.08  ? 41  ASN X CA  1 
ATOM   283  C C   . ASN A 1 41  ? 44.103 16.829  43.797 1.00 29.22  ? 41  ASN X C   1 
ATOM   284  O O   . ASN A 1 41  ? 44.103 17.998  43.427 1.00 35.93  ? 41  ASN X O   1 
ATOM   285  C CB  . ASN A 1 41  ? 46.253 15.945  42.894 1.00 58.55  ? 41  ASN X CB  1 
ATOM   286  C CG  . ASN A 1 41  ? 47.726 15.714  43.192 1.00 92.90  ? 41  ASN X CG  1 
ATOM   287  O OD1 . ASN A 1 41  ? 48.092 15.242  44.267 1.00 108.64 ? 41  ASN X OD1 1 
ATOM   288  N ND2 . ASN A 1 41  ? 48.582 16.053  42.235 1.00 103.02 ? 41  ASN X ND2 1 
ATOM   289  N N   . LEU A 1 42  ? 42.992 16.103  43.877 1.00 28.84  ? 42  LEU X N   1 
ATOM   290  C CA  . LEU A 1 42  ? 41.682 16.664  43.546 1.00 25.62  ? 42  LEU X CA  1 
ATOM   291  C C   . LEU A 1 42  ? 41.022 17.423  44.693 1.00 25.82  ? 42  LEU X C   1 
ATOM   292  O O   . LEU A 1 42  ? 39.909 17.925  44.546 1.00 23.04  ? 42  LEU X O   1 
ATOM   293  C CB  . LEU A 1 42  ? 40.734 15.570  43.048 1.00 29.63  ? 42  LEU X CB  1 
ATOM   294  C CG  . LEU A 1 42  ? 40.736 15.251  41.548 1.00 39.07  ? 42  LEU X CG  1 
ATOM   295  C CD1 . LEU A 1 42  ? 42.095 14.741  41.104 1.00 46.70  ? 42  LEU X CD1 1 
ATOM   296  C CD2 . LEU A 1 42  ? 39.658 14.227  41.249 1.00 26.40  ? 42  LEU X CD2 1 
ATOM   297  N N   . GLU A 1 43  ? 41.698 17.499  45.834 1.00 27.71  ? 43  GLU X N   1 
ATOM   298  C CA  . GLU A 1 43  ? 41.158 18.202  46.989 1.00 18.98  ? 43  GLU X CA  1 
ATOM   299  C C   . GLU A 1 43  ? 41.104 19.696  46.710 1.00 23.59  ? 43  GLU X C   1 
ATOM   300  O O   . GLU A 1 43  ? 42.066 20.288  46.225 1.00 25.66  ? 43  GLU X O   1 
ATOM   301  C CB  . GLU A 1 43  ? 42.024 17.953  48.227 1.00 15.29  ? 43  GLU X CB  1 
ATOM   302  C CG  . GLU A 1 43  ? 41.455 18.569  49.506 1.00 34.47  ? 43  GLU X CG  1 
ATOM   303  C CD  . GLU A 1 43  ? 42.468 18.657  50.636 1.00 34.59  ? 43  GLU X CD  1 
ATOM   304  O OE1 . GLU A 1 43  ? 43.294 17.732  50.783 1.00 43.55  ? 43  GLU X OE1 1 
ATOM   305  O OE2 . GLU A 1 43  ? 42.430 19.658  51.383 1.00 38.01  ? 43  GLU X OE2 1 
ATOM   306  N N   . GLU A 1 44  ? 39.971 20.303  47.026 1.00 20.72  ? 44  GLU X N   1 
ATOM   307  C CA  . GLU A 1 44  ? 39.796 21.729  46.830 1.00 17.25  ? 44  GLU X CA  1 
ATOM   308  C C   . GLU A 1 44  ? 40.070 22.481  48.130 1.00 22.03  ? 44  GLU X C   1 
ATOM   309  O O   . GLU A 1 44  ? 39.563 22.109  49.189 1.00 25.69  ? 44  GLU X O   1 
ATOM   310  C CB  . GLU A 1 44  ? 38.368 22.032  46.365 1.00 20.35  ? 44  GLU X CB  1 
ATOM   311  C CG  . GLU A 1 44  ? 38.025 21.518  44.974 1.00 29.96  ? 44  GLU X CG  1 
ATOM   312  C CD  . GLU A 1 44  ? 38.875 22.142  43.876 1.00 32.29  ? 44  GLU X CD  1 
ATOM   313  O OE1 . GLU A 1 44  ? 39.345 23.289  44.036 1.00 30.68  ? 44  GLU X OE1 1 
ATOM   314  O OE2 . GLU A 1 44  ? 39.080 21.476  42.843 1.00 41.13  ? 44  GLU X OE2 1 
ATOM   315  N N   . LYS A 1 45  ? 40.916 23.502  48.060 1.00 25.70  ? 45  LYS X N   1 
ATOM   316  C CA  . LYS A 1 45  ? 41.209 24.323  49.229 1.00 27.12  ? 45  LYS X CA  1 
ATOM   317  C C   . LYS A 1 45  ? 40.244 25.505  49.158 1.00 27.79  ? 45  LYS X C   1 
ATOM   318  O O   . LYS A 1 45  ? 39.763 25.849  48.075 1.00 26.69  ? 45  LYS X O   1 
ATOM   319  C CB  . LYS A 1 45  ? 42.660 24.810  49.210 1.00 32.66  ? 45  LYS X CB  1 
ATOM   320  C CG  . LYS A 1 45  ? 43.688 23.695  49.331 1.00 42.22  ? 45  LYS X CG  1 
ATOM   321  C CD  . LYS A 1 45  ? 45.095 24.248  49.499 1.00 35.27  ? 45  LYS X CD  1 
ATOM   322  C CE  . LYS A 1 45  ? 46.141 23.143  49.434 1.00 59.46  ? 45  LYS X CE  1 
ATOM   323  N NZ  . LYS A 1 45  ? 45.941 22.088  50.465 1.00 71.30  ? 45  LYS X NZ  1 
ATOM   324  N N   . ILE A 1 46  ? 39.930 26.096  50.304 1.00 27.95  ? 46  ILE X N   1 
ATOM   325  C CA  . ILE A 1 46  ? 39.010 27.226  50.346 1.00 29.84  ? 46  ILE X CA  1 
ATOM   326  C C   . ILE A 1 46  ? 39.757 28.552  50.469 1.00 39.43  ? 46  ILE X C   1 
ATOM   327  O O   . ILE A 1 46  ? 40.513 28.761  51.417 1.00 42.37  ? 46  ILE X O   1 
ATOM   328  C CB  . ILE A 1 46  ? 37.998 27.085  51.518 1.00 19.11  ? 46  ILE X CB  1 
ATOM   329  C CG1 . ILE A 1 46  ? 37.136 25.834  51.331 1.00 22.90  ? 46  ILE X CG1 1 
ATOM   330  C CG2 . ILE A 1 46  ? 37.094 28.303  51.597 1.00 18.57  ? 46  ILE X CG2 1 
ATOM   331  C CD1 . ILE A 1 46  ? 36.258 25.859  50.094 1.00 33.39  ? 46  ILE X CD1 1 
ATOM   332  N N   . ASP A 1 47  ? 39.584 29.419  49.475 1.00 40.41  ? 47  ASP X N   1 
ATOM   333  C CA  . ASP A 1 47  ? 40.212 30.737  49.478 1.00 26.34  ? 47  ASP X CA  1 
ATOM   334  C C   . ASP A 1 47  ? 39.232 31.657  50.175 1.00 22.59  ? 47  ASP X C   1 
ATOM   335  O O   . ASP A 1 47  ? 38.053 31.694  49.812 1.00 26.67  ? 47  ASP X O   1 
ATOM   336  C CB  . ASP A 1 47  ? 40.431 31.238  48.052 1.00 2.00   ? 47  ASP X CB  1 
ATOM   337  C CG  . ASP A 1 47  ? 41.418 30.392  47.281 1.00 26.95  ? 47  ASP X CG  1 
ATOM   338  O OD1 . ASP A 1 47  ? 42.635 30.487  47.560 1.00 23.52  ? 47  ASP X OD1 1 
ATOM   339  O OD2 . ASP A 1 47  ? 40.977 29.635  46.390 1.00 30.88  ? 47  ASP X OD2 1 
ATOM   340  N N   . VAL A 1 48  ? 39.701 32.381  51.185 1.00 20.81  ? 48  VAL X N   1 
ATOM   341  C CA  . VAL A 1 48  ? 38.824 33.290  51.915 1.00 25.11  ? 48  VAL X CA  1 
ATOM   342  C C   . VAL A 1 48  ? 39.333 34.721  51.937 1.00 29.09  ? 48  VAL X C   1 
ATOM   343  O O   . VAL A 1 48  ? 40.542 34.971  51.893 1.00 31.56  ? 48  VAL X O   1 
ATOM   344  C CB  . VAL A 1 48  ? 38.610 32.845  53.386 1.00 20.85  ? 48  VAL X CB  1 
ATOM   345  C CG1 . VAL A 1 48  ? 38.199 31.388  53.448 1.00 41.36  ? 48  VAL X CG1 1 
ATOM   346  C CG2 . VAL A 1 48  ? 39.863 33.079  54.202 1.00 25.06  ? 48  VAL X CG2 1 
ATOM   347  N N   . VAL A 1 49  ? 38.392 35.654  51.990 1.00 25.56  ? 49  VAL X N   1 
ATOM   348  C CA  . VAL A 1 49  ? 38.704 37.071  52.075 1.00 26.21  ? 49  VAL X CA  1 
ATOM   349  C C   . VAL A 1 49  ? 37.897 37.545  53.271 1.00 21.90  ? 49  VAL X C   1 
ATOM   350  O O   . VAL A 1 49  ? 36.670 37.418  53.284 1.00 18.33  ? 49  VAL X O   1 
ATOM   351  C CB  . VAL A 1 49  ? 38.271 37.848  50.813 1.00 44.66  ? 49  VAL X CB  1 
ATOM   352  C CG1 . VAL A 1 49  ? 38.290 39.344  51.090 1.00 52.21  ? 49  VAL X CG1 1 
ATOM   353  C CG2 . VAL A 1 49  ? 39.207 37.537  49.655 1.00 34.23  ? 49  VAL X CG2 1 
ATOM   354  N N   . PRO A 1 50  ? 38.581 37.993  54.336 1.00 24.15  ? 50  PRO X N   1 
ATOM   355  C CA  . PRO A 1 50  ? 37.901 38.472  55.544 1.00 21.01  ? 50  PRO X CA  1 
ATOM   356  C C   . PRO A 1 50  ? 37.222 39.826  55.375 1.00 24.97  ? 50  PRO X C   1 
ATOM   357  O O   . PRO A 1 50  ? 37.838 40.792  54.931 1.00 28.58  ? 50  PRO X O   1 
ATOM   358  C CB  . PRO A 1 50  ? 39.034 38.526  56.569 1.00 18.45  ? 50  PRO X CB  1 
ATOM   359  C CG  . PRO A 1 50  ? 40.230 38.859  55.735 1.00 33.64  ? 50  PRO X CG  1 
ATOM   360  C CD  . PRO A 1 50  ? 40.046 37.980  54.521 1.00 27.95  ? 50  PRO X CD  1 
ATOM   361  N N   . ILE A 1 51  ? 35.933 39.870  55.686 1.00 25.80  ? 51  ILE X N   1 
ATOM   362  C CA  . ILE A 1 51  ? 35.161 41.101  55.601 1.00 29.53  ? 51  ILE X CA  1 
ATOM   363  C C   . ILE A 1 51  ? 35.433 41.812  56.918 1.00 41.40  ? 51  ILE X C   1 
ATOM   364  O O   . ILE A 1 51  ? 36.074 42.859  56.967 1.00 49.36  ? 51  ILE X O   1 
ATOM   365  C CB  . ILE A 1 51  ? 33.645 40.801  55.502 1.00 25.90  ? 51  ILE X CB  1 
ATOM   366  C CG1 . ILE A 1 51  ? 33.345 39.981  54.247 1.00 25.50  ? 51  ILE X CG1 1 
ATOM   367  C CG2 . ILE A 1 51  ? 32.847 42.092  55.491 1.00 30.93  ? 51  ILE X CG2 1 
ATOM   368  C CD1 . ILE A 1 51  ? 31.908 39.520  54.155 1.00 23.95  ? 51  ILE X CD1 1 
ATOM   369  N N   . GLU A 1 52  ? 34.957 41.194  57.989 1.00 49.61  ? 52  GLU X N   1 
ATOM   370  C CA  . GLU A 1 52  ? 35.117 41.691  59.345 1.00 55.66  ? 52  GLU X CA  1 
ATOM   371  C C   . GLU A 1 52  ? 35.436 40.430  60.133 1.00 60.98  ? 52  GLU X C   1 
ATOM   372  O O   . GLU A 1 52  ? 35.321 39.319  59.600 1.00 62.39  ? 52  GLU X O   1 
ATOM   373  C CB  . GLU A 1 52  ? 33.793 42.261  59.861 1.00 61.34  ? 52  GLU X CB  1 
ATOM   374  C CG  . GLU A 1 52  ? 33.133 43.293  58.966 1.00 89.27  ? 52  GLU X CG  1 
ATOM   375  C CD  . GLU A 1 52  ? 31.716 43.616  59.408 1.00 113.04 ? 52  GLU X CD  1 
ATOM   376  O OE1 . GLU A 1 52  ? 30.928 42.671  59.628 1.00 121.05 ? 52  GLU X OE1 1 
ATOM   377  O OE2 . GLU A 1 52  ? 31.389 44.815  59.537 1.00 129.02 ? 52  GLU X OE2 1 
ATOM   378  N N   . PRO A 1 53  ? 35.878 40.569  61.391 1.00 62.89  ? 53  PRO X N   1 
ATOM   379  C CA  . PRO A 1 53  ? 36.165 39.335  62.124 1.00 60.39  ? 53  PRO X CA  1 
ATOM   380  C C   . PRO A 1 53  ? 34.899 38.474  62.225 1.00 58.17  ? 53  PRO X C   1 
ATOM   381  O O   . PRO A 1 53  ? 33.812 38.980  62.526 1.00 58.28  ? 53  PRO X O   1 
ATOM   382  C CB  . PRO A 1 53  ? 36.645 39.848  63.488 1.00 58.81  ? 53  PRO X CB  1 
ATOM   383  C CG  . PRO A 1 53  ? 36.046 41.229  63.591 1.00 61.22  ? 53  PRO X CG  1 
ATOM   384  C CD  . PRO A 1 53  ? 36.214 41.754  62.197 1.00 60.36  ? 53  PRO X CD  1 
ATOM   385  N N   . HIS A 1 54  ? 35.042 37.190  61.903 1.00 51.75  ? 54  HIS X N   1 
ATOM   386  C CA  . HIS A 1 54  ? 33.941 36.221  61.930 1.00 48.46  ? 54  HIS X CA  1 
ATOM   387  C C   . HIS A 1 54  ? 33.016 36.284  60.709 1.00 39.06  ? 54  HIS X C   1 
ATOM   388  O O   . HIS A 1 54  ? 32.006 35.582  60.654 1.00 35.03  ? 54  HIS X O   1 
ATOM   389  C CB  . HIS A 1 54  ? 33.120 36.333  63.225 1.00 59.09  ? 54  HIS X CB  1 
ATOM   390  C CG  . HIS A 1 54  ? 33.904 36.038  64.465 1.00 80.29  ? 54  HIS X CG  1 
ATOM   391  N ND1 . HIS A 1 54  ? 34.103 36.972  65.458 1.00 92.38  ? 54  HIS X ND1 1 
ATOM   392  C CD2 . HIS A 1 54  ? 34.556 34.920  64.863 1.00 96.59  ? 54  HIS X CD2 1 
ATOM   393  C CE1 . HIS A 1 54  ? 34.846 36.444  66.414 1.00 101.55 ? 54  HIS X CE1 1 
ATOM   394  N NE2 . HIS A 1 54  ? 35.134 35.200  66.077 1.00 107.09 ? 54  HIS X NE2 1 
ATOM   395  N N   . ALA A 1 55  ? 33.370 37.112  59.731 1.00 34.81  ? 55  ALA X N   1 
ATOM   396  C CA  . ALA A 1 55  ? 32.581 37.248  58.508 1.00 27.23  ? 55  ALA X CA  1 
ATOM   397  C C   . ALA A 1 55  ? 33.557 37.151  57.352 1.00 23.11  ? 55  ALA X C   1 
ATOM   398  O O   . ALA A 1 55  ? 34.610 37.796  57.369 1.00 24.04  ? 55  ALA X O   1 
ATOM   399  C CB  . ALA A 1 55  ? 31.861 38.588  58.478 1.00 21.27  ? 55  ALA X CB  1 
ATOM   400  N N   . LEU A 1 56  ? 33.230 36.339  56.353 1.00 23.58  ? 56  LEU X N   1 
ATOM   401  C CA  . LEU A 1 56  ? 34.123 36.171  55.211 1.00 26.80  ? 56  LEU X CA  1 
ATOM   402  C C   . LEU A 1 56  ? 33.479 35.643  53.932 1.00 23.92  ? 56  LEU X C   1 
ATOM   403  O O   . LEU A 1 56  ? 32.340 35.166  53.940 1.00 23.06  ? 56  LEU X O   1 
ATOM   404  C CB  . LEU A 1 56  ? 35.316 35.286  55.602 1.00 33.50  ? 56  LEU X CB  1 
ATOM   405  C CG  . LEU A 1 56  ? 35.140 34.175  56.647 1.00 33.58  ? 56  LEU X CG  1 
ATOM   406  C CD1 . LEU A 1 56  ? 34.118 33.141  56.203 1.00 16.57  ? 56  LEU X CD1 1 
ATOM   407  C CD2 . LEU A 1 56  ? 36.481 33.515  56.906 1.00 38.70  ? 56  LEU X CD2 1 
ATOM   408  N N   . PHE A 1 57  ? 34.201 35.806  52.827 1.00 23.12  ? 57  PHE X N   1 
ATOM   409  C CA  . PHE A 1 57  ? 33.764 35.339  51.518 1.00 27.96  ? 57  PHE X CA  1 
ATOM   410  C C   . PHE A 1 57  ? 34.485 34.016  51.272 1.00 34.37  ? 57  PHE X C   1 
ATOM   411  O O   . PHE A 1 57  ? 35.686 33.899  51.549 1.00 33.12  ? 57  PHE X O   1 
ATOM   412  C CB  . PHE A 1 57  ? 34.161 36.338  50.421 1.00 29.60  ? 57  PHE X CB  1 
ATOM   413  C CG  . PHE A 1 57  ? 33.402 37.641  50.457 1.00 22.12  ? 57  PHE X CG  1 
ATOM   414  C CD1 . PHE A 1 57  ? 32.015 37.664  50.367 1.00 23.83  ? 57  PHE X CD1 1 
ATOM   415  C CD2 . PHE A 1 57  ? 34.083 38.850  50.540 1.00 7.39   ? 57  PHE X CD2 1 
ATOM   416  C CE1 . PHE A 1 57  ? 31.319 38.867  50.357 1.00 9.27   ? 57  PHE X CE1 1 
ATOM   417  C CE2 . PHE A 1 57  ? 33.391 40.060  50.532 1.00 13.29  ? 57  PHE X CE2 1 
ATOM   418  C CZ  . PHE A 1 57  ? 32.006 40.064  50.439 1.00 14.55  ? 57  PHE X CZ  1 
ATOM   419  N N   . LEU A 1 58  ? 33.761 33.025  50.761 1.00 34.57  ? 58  LEU X N   1 
ATOM   420  C CA  . LEU A 1 58  ? 34.348 31.715  50.485 1.00 30.75  ? 58  LEU X CA  1 
ATOM   421  C C   . LEU A 1 58  ? 34.399 31.437  48.991 1.00 30.89  ? 58  LEU X C   1 
ATOM   422  O O   . LEU A 1 58  ? 33.427 31.677  48.275 1.00 34.42  ? 58  LEU X O   1 
ATOM   423  C CB  . LEU A 1 58  ? 33.545 30.607  51.170 1.00 23.60  ? 58  LEU X CB  1 
ATOM   424  C CG  . LEU A 1 58  ? 33.451 30.601  52.695 1.00 15.77  ? 58  LEU X CG  1 
ATOM   425  C CD1 . LEU A 1 58  ? 32.660 29.388  53.143 1.00 29.12  ? 58  LEU X CD1 1 
ATOM   426  C CD2 . LEU A 1 58  ? 34.837 30.576  53.303 1.00 14.59  ? 58  LEU X CD2 1 
ATOM   427  N N   . GLY A 1 59  ? 35.523 30.896  48.533 1.00 26.27  ? 59  GLY X N   1 
ATOM   428  C CA  . GLY A 1 59  ? 35.676 30.579  47.126 1.00 25.87  ? 59  GLY X CA  1 
ATOM   429  C C   . GLY A 1 59  ? 36.700 29.491  46.881 1.00 31.84  ? 59  GLY X C   1 
ATOM   430  O O   . GLY A 1 59  ? 37.364 29.037  47.813 1.00 36.74  ? 59  GLY X O   1 
ATOM   431  N N   . ILE A 1 60  ? 36.823 29.064  45.627 1.00 35.24  ? 60  ILE X N   1 
ATOM   432  C CA  . ILE A 1 60  ? 37.778 28.027  45.245 1.00 35.46  ? 60  ILE X CA  1 
ATOM   433  C C   . ILE A 1 60  ? 38.502 28.431  43.961 1.00 36.95  ? 60  ILE X C   1 
ATOM   434  O O   . ILE A 1 60  ? 38.115 29.399  43.302 1.00 41.65  ? 60  ILE X O   1 
ATOM   435  C CB  . ILE A 1 60  ? 37.084 26.659  45.030 1.00 29.24  ? 60  ILE X CB  1 
ATOM   436  C CG1 . ILE A 1 60  ? 35.980 26.781  43.978 1.00 20.00  ? 60  ILE X CG1 1 
ATOM   437  C CG2 . ILE A 1 60  ? 36.532 26.127  46.350 1.00 26.65  ? 60  ILE X CG2 1 
ATOM   438  C CD1 . ILE A 1 60  ? 35.276 25.481  43.671 1.00 24.68  ? 60  ILE X CD1 1 
ATOM   439  N N   . HIS A 1 61  ? 39.562 27.701  43.624 1.00 37.91  ? 61  HIS X N   1 
ATOM   440  C CA  . HIS A 1 61  ? 40.358 27.962  42.424 1.00 43.65  ? 61  HIS X CA  1 
ATOM   441  C C   . HIS A 1 61  ? 40.896 29.392  42.368 1.00 45.32  ? 61  HIS X C   1 
ATOM   442  O O   . HIS A 1 61  ? 40.542 30.162  41.476 1.00 43.42  ? 61  HIS X O   1 
ATOM   443  C CB  . HIS A 1 61  ? 39.552 27.662  41.151 1.00 42.14  ? 61  HIS X CB  1 
ATOM   444  C CG  . HIS A 1 61  ? 39.323 26.203  40.901 1.00 34.77  ? 61  HIS X CG  1 
ATOM   445  N ND1 . HIS A 1 61  ? 38.326 25.738  40.069 1.00 42.94  ? 61  HIS X ND1 1 
ATOM   446  C CD2 . HIS A 1 61  ? 39.967 25.106  41.365 1.00 49.34  ? 61  HIS X CD2 1 
ATOM   447  C CE1 . HIS A 1 61  ? 38.362 24.418  40.035 1.00 36.82  ? 61  HIS X CE1 1 
ATOM   448  N NE2 . HIS A 1 61  ? 39.350 24.010  40.812 1.00 50.35  ? 61  HIS X NE2 1 
ATOM   449  N N   . GLY A 1 62  ? 41.739 29.744  43.335 1.00 45.88  ? 62  GLY X N   1 
ATOM   450  C CA  . GLY A 1 62  ? 42.315 31.079  43.372 1.00 43.72  ? 62  GLY X CA  1 
ATOM   451  C C   . GLY A 1 62  ? 41.280 32.186  43.447 1.00 44.29  ? 62  GLY X C   1 
ATOM   452  O O   . GLY A 1 62  ? 41.531 33.309  43.007 1.00 51.68  ? 62  GLY X O   1 
ATOM   453  N N   . GLY A 1 63  ? 40.113 31.868  43.997 1.00 34.01  ? 63  GLY X N   1 
ATOM   454  C CA  . GLY A 1 63  ? 39.060 32.858  44.118 1.00 30.24  ? 63  GLY X CA  1 
ATOM   455  C C   . GLY A 1 63  ? 38.387 33.206  42.807 1.00 32.52  ? 63  GLY X C   1 
ATOM   456  O O   . GLY A 1 63  ? 37.794 34.276  42.683 1.00 33.46  ? 63  GLY X O   1 
ATOM   457  N N   . LYS A 1 64  ? 38.483 32.315  41.824 1.00 36.96  ? 64  LYS X N   1 
ATOM   458  C CA  . LYS A 1 64  ? 37.860 32.541  40.525 1.00 33.34  ? 64  LYS X CA  1 
ATOM   459  C C   . LYS A 1 64  ? 36.372 32.226  40.583 1.00 33.01  ? 64  LYS X C   1 
ATOM   460  O O   . LYS A 1 64  ? 35.582 32.794  39.825 1.00 44.72  ? 64  LYS X O   1 
ATOM   461  C CB  . LYS A 1 64  ? 38.537 31.699  39.442 1.00 44.62  ? 64  LYS X CB  1 
ATOM   462  C CG  . LYS A 1 64  ? 39.974 32.110  39.142 1.00 66.89  ? 64  LYS X CG  1 
ATOM   463  C CD  . LYS A 1 64  ? 40.048 33.560  38.684 1.00 91.54  ? 64  LYS X CD  1 
ATOM   464  C CE  . LYS A 1 64  ? 41.486 33.997  38.455 1.00 102.32 ? 64  LYS X CE  1 
ATOM   465  N NZ  . LYS A 1 64  ? 41.564 35.426  38.042 1.00 111.75 ? 64  LYS X NZ  1 
ATOM   466  N N   . MET A 1 65  ? 36.002 31.305  41.469 1.00 31.09  ? 65  MET X N   1 
ATOM   467  C CA  . MET A 1 65  ? 34.608 30.918  41.655 1.00 29.46  ? 65  MET X CA  1 
ATOM   468  C C   . MET A 1 65  ? 34.263 31.023  43.135 1.00 30.44  ? 65  MET X C   1 
ATOM   469  O O   . MET A 1 65  ? 35.018 30.543  43.986 1.00 33.14  ? 65  MET X O   1 
ATOM   470  C CB  . MET A 1 65  ? 34.366 29.492  41.164 1.00 34.57  ? 65  MET X CB  1 
ATOM   471  C CG  . MET A 1 65  ? 34.453 29.335  39.662 1.00 52.22  ? 65  MET X CG  1 
ATOM   472  S SD  . MET A 1 65  ? 33.805 27.754  39.125 1.00 64.65  ? 65  MET X SD  1 
ATOM   473  C CE  . MET A 1 65  ? 35.189 26.705  39.471 1.00 68.35  ? 65  MET X CE  1 
ATOM   474  N N   . CYS A 1 66  ? 33.120 31.629  43.439 1.00 27.37  ? 66  CYS X N   1 
ATOM   475  C CA  . CYS A 1 66  ? 32.698 31.812  44.821 1.00 23.69  ? 66  CYS X CA  1 
ATOM   476  C C   . CYS A 1 66  ? 31.409 31.079  45.172 1.00 21.29  ? 66  CYS X C   1 
ATOM   477  O O   . CYS A 1 66  ? 30.506 30.958  44.341 1.00 28.28  ? 66  CYS X O   1 
ATOM   478  C CB  . CYS A 1 66  ? 32.554 33.306  45.122 1.00 18.47  ? 66  CYS X CB  1 
ATOM   479  S SG  . CYS A 1 66  ? 34.089 34.233  44.902 1.00 23.31  ? 66  CYS X SG  1 
ATOM   480  N N   . LEU A 1 67  ? 31.332 30.602  46.411 1.00 19.08  ? 67  LEU X N   1 
ATOM   481  C CA  . LEU A 1 67  ? 30.168 29.880  46.915 1.00 14.67  ? 67  LEU X CA  1 
ATOM   482  C C   . LEU A 1 67  ? 29.104 30.896  47.302 1.00 12.13  ? 67  LEU X C   1 
ATOM   483  O O   . LEU A 1 67  ? 29.431 31.955  47.836 1.00 15.92  ? 67  LEU X O   1 
ATOM   484  C CB  . LEU A 1 67  ? 30.543 29.054  48.154 1.00 26.50  ? 67  LEU X CB  1 
ATOM   485  C CG  . LEU A 1 67  ? 31.439 27.811  48.061 1.00 28.26  ? 67  LEU X CG  1 
ATOM   486  C CD1 . LEU A 1 67  ? 32.771 28.127  47.402 1.00 31.78  ? 67  LEU X CD1 1 
ATOM   487  C CD2 . LEU A 1 67  ? 31.668 27.260  49.462 1.00 22.26  ? 67  LEU X CD2 1 
ATOM   488  N N   . SER A 1 68  ? 27.839 30.573  47.053 1.00 8.35   ? 68  SER X N   1 
ATOM   489  C CA  . SER A 1 68  ? 26.756 31.481  47.393 1.00 6.28   ? 68  SER X CA  1 
ATOM   490  C C   . SER A 1 68  ? 25.460 30.740  47.677 1.00 14.31  ? 68  SER X C   1 
ATOM   491  O O   . SER A 1 68  ? 25.308 29.576  47.309 1.00 20.84  ? 68  SER X O   1 
ATOM   492  C CB  . SER A 1 68  ? 26.529 32.482  46.259 1.00 20.29  ? 68  SER X CB  1 
ATOM   493  O OG  . SER A 1 68  ? 25.990 31.849  45.114 1.00 25.48  ? 68  SER X OG  1 
ATOM   494  N N   . CYS A 1 69  ? 24.528 31.428  48.329 1.00 16.94  ? 69  CYS X N   1 
ATOM   495  C CA  . CYS A 1 69  ? 23.226 30.866  48.655 1.00 18.58  ? 69  CYS X CA  1 
ATOM   496  C C   . CYS A 1 69  ? 22.164 31.615  47.866 1.00 29.74  ? 69  CYS X C   1 
ATOM   497  O O   . CYS A 1 69  ? 22.072 32.843  47.948 1.00 38.88  ? 69  CYS X O   1 
ATOM   498  C CB  . CYS A 1 69  ? 22.928 31.011  50.149 1.00 12.78  ? 69  CYS X CB  1 
ATOM   499  S SG  . CYS A 1 69  ? 21.243 30.485  50.602 1.00 40.78  ? 69  CYS X SG  1 
ATOM   500  N N   . VAL A 1 70  ? 21.387 30.888  47.074 1.00 31.42  ? 70  VAL X N   1 
ATOM   501  C CA  . VAL A 1 70  ? 20.323 31.495  46.280 1.00 33.29  ? 70  VAL X CA  1 
ATOM   502  C C   . VAL A 1 70  ? 19.041 30.719  46.540 1.00 35.70  ? 70  VAL X C   1 
ATOM   503  O O   . VAL A 1 70  ? 19.082 29.514  46.796 1.00 32.41  ? 70  VAL X O   1 
ATOM   504  C CB  . VAL A 1 70  ? 20.639 31.474  44.760 1.00 34.56  ? 70  VAL X CB  1 
ATOM   505  C CG1 . VAL A 1 70  ? 21.903 32.275  44.468 1.00 25.33  ? 70  VAL X CG1 1 
ATOM   506  C CG2 . VAL A 1 70  ? 20.794 30.049  44.269 1.00 37.55  ? 70  VAL X CG2 1 
ATOM   507  N N   . LYS A 1 71  ? 17.908 31.410  46.500 1.00 44.22  ? 71  LYS X N   1 
ATOM   508  C CA  . LYS A 1 71  ? 16.624 30.767  46.736 1.00 56.54  ? 71  LYS X CA  1 
ATOM   509  C C   . LYS A 1 71  ? 15.701 30.896  45.534 1.00 68.19  ? 71  LYS X C   1 
ATOM   510  O O   . LYS A 1 71  ? 15.393 32.005  45.092 1.00 73.41  ? 71  LYS X O   1 
ATOM   511  C CB  . LYS A 1 71  ? 15.935 31.361  47.974 1.00 50.39  ? 71  LYS X CB  1 
ATOM   512  C CG  . LYS A 1 71  ? 16.733 31.245  49.266 1.00 63.75  ? 71  LYS X CG  1 
ATOM   513  C CD  . LYS A 1 71  ? 15.899 31.658  50.475 1.00 75.65  ? 71  LYS X CD  1 
ATOM   514  C CE  . LYS A 1 71  ? 16.696 31.538  51.768 1.00 85.95  ? 71  LYS X CE  1 
ATOM   515  N NZ  . LYS A 1 71  ? 15.857 31.785  52.975 1.00 75.30  ? 71  LYS X NZ  1 
ATOM   516  N N   . SER A 1 72  ? 15.290 29.761  44.979 1.00 74.57  ? 72  SER X N   1 
ATOM   517  C CA  . SER A 1 72  ? 14.373 29.766  43.850 1.00 82.51  ? 72  SER X CA  1 
ATOM   518  C C   . SER A 1 72  ? 12.981 29.573  44.443 1.00 85.62  ? 72  SER X C   1 
ATOM   519  O O   . SER A 1 72  ? 12.559 28.446  44.715 1.00 84.24  ? 72  SER X O   1 
ATOM   520  C CB  . SER A 1 72  ? 14.708 28.639  42.871 1.00 88.32  ? 72  SER X CB  1 
ATOM   521  O OG  . SER A 1 72  ? 13.955 28.759  41.676 1.00 95.01  ? 72  SER X OG  1 
ATOM   522  N N   . GLY A 1 73  ? 12.294 30.684  44.691 1.00 89.42  ? 73  GLY X N   1 
ATOM   523  C CA  . GLY A 1 73  ? 10.967 30.629  45.276 1.00 92.27  ? 73  GLY X CA  1 
ATOM   524  C C   . GLY A 1 73  ? 11.084 30.364  46.764 1.00 95.50  ? 73  GLY X C   1 
ATOM   525  O O   . GLY A 1 73  ? 10.926 31.269  47.582 1.00 97.37  ? 73  GLY X O   1 
ATOM   526  N N   . ASP A 1 74  ? 11.392 29.118  47.107 1.00 98.37  ? 74  ASP X N   1 
ATOM   527  C CA  . ASP A 1 74  ? 11.555 28.703  48.497 1.00 98.88  ? 74  ASP X CA  1 
ATOM   528  C C   . ASP A 1 74  ? 12.715 27.712  48.604 1.00 96.39  ? 74  ASP X C   1 
ATOM   529  O O   . ASP A 1 74  ? 13.173 27.386  49.701 1.00 98.52  ? 74  ASP X O   1 
ATOM   530  C CB  . ASP A 1 74  ? 10.267 28.068  49.010 1.00 101.96 ? 74  ASP X CB  1 
ATOM   531  N N   . GLU A 1 75  ? 13.194 27.250  47.453 1.00 90.20  ? 75  GLU X N   1 
ATOM   532  C CA  . GLU A 1 75  ? 14.294 26.298  47.401 1.00 81.65  ? 75  GLU X CA  1 
ATOM   533  C C   . GLU A 1 75  ? 15.631 26.997  47.628 1.00 69.34  ? 75  GLU X C   1 
ATOM   534  O O   . GLU A 1 75  ? 16.153 27.663  46.731 1.00 72.29  ? 75  GLU X O   1 
ATOM   535  C CB  . GLU A 1 75  ? 14.302 25.573  46.050 1.00 90.33  ? 75  GLU X CB  1 
ATOM   536  C CG  . GLU A 1 75  ? 15.275 24.401  45.975 1.00 104.48 ? 75  GLU X CG  1 
ATOM   537  C CD  . GLU A 1 75  ? 15.248 23.680  44.634 1.00 112.00 ? 75  GLU X CD  1 
ATOM   538  O OE1 . GLU A 1 75  ? 14.203 23.709  43.947 1.00 118.35 ? 75  GLU X OE1 1 
ATOM   539  O OE2 . GLU A 1 75  ? 16.280 23.078  44.266 1.00 105.45 ? 75  GLU X OE2 1 
ATOM   540  N N   . THR A 1 76  ? 16.141 26.891  48.850 1.00 51.31  ? 76  THR X N   1 
ATOM   541  C CA  . THR A 1 76  ? 17.422 27.486  49.208 1.00 33.10  ? 76  THR X CA  1 
ATOM   542  C C   . THR A 1 76  ? 18.498 26.506  48.775 1.00 29.71  ? 76  THR X C   1 
ATOM   543  O O   . THR A 1 76  ? 18.457 25.335  49.153 1.00 30.05  ? 76  THR X O   1 
ATOM   544  C CB  . THR A 1 76  ? 17.521 27.694  50.723 1.00 28.95  ? 76  THR X CB  1 
ATOM   545  O OG1 . THR A 1 76  ? 16.406 28.473  51.174 1.00 46.99  ? 76  THR X OG1 1 
ATOM   546  C CG2 . THR A 1 76  ? 18.805 28.412  51.080 1.00 32.43  ? 76  THR X CG2 1 
ATOM   547  N N   . ARG A 1 77  ? 19.453 26.973  47.978 1.00 27.51  ? 77  ARG X N   1 
ATOM   548  C CA  . ARG A 1 77  ? 20.514 26.100  47.500 1.00 25.63  ? 77  ARG X CA  1 
ATOM   549  C C   . ARG A 1 77  ? 21.872 26.780  47.446 1.00 19.05  ? 77  ARG X C   1 
ATOM   550  O O   . ARG A 1 77  ? 21.970 28.001  47.344 1.00 30.72  ? 77  ARG X O   1 
ATOM   551  C CB  . ARG A 1 77  ? 20.173 25.554  46.109 1.00 44.54  ? 77  ARG X CB  1 
ATOM   552  C CG  . ARG A 1 77  ? 20.214 26.599  45.006 1.00 65.76  ? 77  ARG X CG  1 
ATOM   553  C CD  . ARG A 1 77  ? 20.152 25.972  43.620 1.00 84.69  ? 77  ARG X CD  1 
ATOM   554  N NE  . ARG A 1 77  ? 18.834 25.431  43.294 1.00 89.68  ? 77  ARG X NE  1 
ATOM   555  C CZ  . ARG A 1 77  ? 17.756 26.173  43.058 1.00 92.10  ? 77  ARG X CZ  1 
ATOM   556  N NH1 . ARG A 1 77  ? 17.822 27.498  43.115 1.00 92.34  ? 77  ARG X NH1 1 
ATOM   557  N NH2 . ARG A 1 77  ? 16.613 25.593  42.727 1.00 91.65  ? 77  ARG X NH2 1 
ATOM   558  N N   . LEU A 1 78  ? 22.917 25.969  47.531 1.00 15.26  ? 78  LEU X N   1 
ATOM   559  C CA  . LEU A 1 78  ? 24.290 26.440  47.464 1.00 18.97  ? 78  LEU X CA  1 
ATOM   560  C C   . LEU A 1 78  ? 24.700 26.332  45.999 1.00 25.07  ? 78  LEU X C   1 
ATOM   561  O O   . LEU A 1 78  ? 24.200 25.469  45.280 1.00 31.54  ? 78  LEU X O   1 
ATOM   562  C CB  . LEU A 1 78  ? 25.196 25.540  48.312 1.00 6.97   ? 78  LEU X CB  1 
ATOM   563  C CG  . LEU A 1 78  ? 26.666 25.953  48.423 1.00 16.61  ? 78  LEU X CG  1 
ATOM   564  C CD1 . LEU A 1 78  ? 26.814 27.109  49.404 1.00 30.12  ? 78  LEU X CD1 1 
ATOM   565  C CD2 . LEU A 1 78  ? 27.493 24.774  48.879 1.00 21.95  ? 78  LEU X CD2 1 
ATOM   566  N N   . GLN A 1 79  ? 25.578 27.218  45.544 1.00 29.18  ? 79  GLN X N   1 
ATOM   567  C CA  . GLN A 1 79  ? 26.043 27.169  44.164 1.00 23.69  ? 79  GLN X CA  1 
ATOM   568  C C   . GLN A 1 79  ? 27.334 27.935  43.948 1.00 28.33  ? 79  GLN X C   1 
ATOM   569  O O   . GLN A 1 79  ? 27.653 28.867  44.688 1.00 38.81  ? 79  GLN X O   1 
ATOM   570  C CB  . GLN A 1 79  ? 24.971 27.675  43.192 1.00 20.25  ? 79  GLN X CB  1 
ATOM   571  C CG  . GLN A 1 79  ? 24.678 29.165  43.253 1.00 31.67  ? 79  GLN X CG  1 
ATOM   572  C CD  . GLN A 1 79  ? 23.833 29.637  42.078 1.00 43.23  ? 79  GLN X CD  1 
ATOM   573  O OE1 . GLN A 1 79  ? 24.261 30.478  41.287 1.00 48.38  ? 79  GLN X OE1 1 
ATOM   574  N NE2 . GLN A 1 79  ? 22.634 29.088  41.951 1.00 39.91  ? 79  GLN X NE2 1 
ATOM   575  N N   . LEU A 1 80  ? 28.097 27.490  42.957 1.00 36.29  ? 80  LEU X N   1 
ATOM   576  C CA  . LEU A 1 80  ? 29.357 28.118  42.598 1.00 35.56  ? 80  LEU X CA  1 
ATOM   577  C C   . LEU A 1 80  ? 29.094 29.086  41.458 1.00 35.73  ? 80  LEU X C   1 
ATOM   578  O O   . LEU A 1 80  ? 28.355 28.769  40.518 1.00 34.98  ? 80  LEU X O   1 
ATOM   579  C CB  . LEU A 1 80  ? 30.373 27.072  42.134 1.00 41.60  ? 80  LEU X CB  1 
ATOM   580  C CG  . LEU A 1 80  ? 30.964 26.112  43.166 1.00 46.13  ? 80  LEU X CG  1 
ATOM   581  C CD1 . LEU A 1 80  ? 31.804 25.055  42.459 1.00 39.47  ? 80  LEU X CD1 1 
ATOM   582  C CD2 . LEU A 1 80  ? 31.803 26.890  44.165 1.00 50.26  ? 80  LEU X CD2 1 
ATOM   583  N N   . GLU A 1 81  ? 29.671 30.275  41.560 1.00 30.72  ? 81  GLU X N   1 
ATOM   584  C CA  . GLU A 1 81  ? 29.512 31.282  40.530 1.00 22.57  ? 81  GLU X CA  1 
ATOM   585  C C   . GLU A 1 81  ? 30.888 31.755  40.107 1.00 23.85  ? 81  GLU X C   1 
ATOM   586  O O   . GLU A 1 81  ? 31.827 31.758  40.909 1.00 18.77  ? 81  GLU X O   1 
ATOM   587  C CB  . GLU A 1 81  ? 28.679 32.455  41.045 1.00 20.44  ? 81  GLU X CB  1 
ATOM   588  C CG  . GLU A 1 81  ? 27.233 32.098  41.344 1.00 22.78  ? 81  GLU X CG  1 
ATOM   589  C CD  . GLU A 1 81  ? 26.423 33.284  41.831 1.00 33.18  ? 81  GLU X CD  1 
ATOM   590  O OE1 . GLU A 1 81  ? 26.619 34.399  41.307 1.00 41.39  ? 81  GLU X OE1 1 
ATOM   591  O OE2 . GLU A 1 81  ? 25.587 33.103  42.740 1.00 40.15  ? 81  GLU X OE2 1 
ATOM   592  N N   . ALA A 1 82  ? 31.015 32.090  38.830 1.00 28.78  ? 82  ALA X N   1 
ATOM   593  C CA  . ALA A 1 82  ? 32.276 32.565  38.285 1.00 36.30  ? 82  ALA X CA  1 
ATOM   594  C C   . ALA A 1 82  ? 32.422 34.061  38.552 1.00 36.84  ? 82  ALA X C   1 
ATOM   595  O O   . ALA A 1 82  ? 32.058 34.891  37.719 1.00 37.64  ? 82  ALA X O   1 
ATOM   596  C CB  . ALA A 1 82  ? 32.347 32.271  36.794 1.00 34.78  ? 82  ALA X CB  1 
ATOM   597  N N   . VAL A 1 83  ? 32.911 34.390  39.744 1.00 38.86  ? 83  VAL X N   1 
ATOM   598  C CA  . VAL A 1 83  ? 33.120 35.773  40.161 1.00 37.86  ? 83  VAL X CA  1 
ATOM   599  C C   . VAL A 1 83  ? 34.407 35.821  40.971 1.00 41.59  ? 83  VAL X C   1 
ATOM   600  O O   . VAL A 1 83  ? 34.625 34.978  41.843 1.00 47.62  ? 83  VAL X O   1 
ATOM   601  C CB  . VAL A 1 83  ? 31.957 36.302  41.045 1.00 32.51  ? 83  VAL X CB  1 
ATOM   602  C CG1 . VAL A 1 83  ? 30.665 36.376  40.249 1.00 33.64  ? 83  VAL X CG1 1 
ATOM   603  C CG2 . VAL A 1 83  ? 31.765 35.421  42.265 1.00 47.41  ? 83  VAL X CG2 1 
ATOM   604  N N   . ASN A 1 84  ? 35.276 36.777  40.668 1.00 44.47  ? 84  ASN X N   1 
ATOM   605  C CA  . ASN A 1 84  ? 36.527 36.881  41.402 1.00 43.35  ? 84  ASN X CA  1 
ATOM   606  C C   . ASN A 1 84  ? 36.233 37.379  42.809 1.00 42.45  ? 84  ASN X C   1 
ATOM   607  O O   . ASN A 1 84  ? 35.610 38.426  42.993 1.00 42.10  ? 84  ASN X O   1 
ATOM   608  C CB  . ASN A 1 84  ? 37.524 37.800  40.696 1.00 45.02  ? 84  ASN X CB  1 
ATOM   609  C CG  . ASN A 1 84  ? 38.933 37.660  41.249 1.00 67.56  ? 84  ASN X CG  1 
ATOM   610  O OD1 . ASN A 1 84  ? 39.143 37.697  42.462 1.00 83.22  ? 84  ASN X OD1 1 
ATOM   611  N ND2 . ASN A 1 84  ? 39.902 37.477  40.363 1.00 77.20  ? 84  ASN X ND2 1 
ATOM   612  N N   . ILE A 1 85  ? 36.693 36.615  43.792 1.00 41.90  ? 85  ILE X N   1 
ATOM   613  C CA  . ILE A 1 85  ? 36.485 36.914  45.200 1.00 43.39  ? 85  ILE X CA  1 
ATOM   614  C C   . ILE A 1 85  ? 36.891 38.329  45.628 1.00 45.97  ? 85  ILE X C   1 
ATOM   615  O O   . ILE A 1 85  ? 36.235 38.930  46.481 1.00 48.92  ? 85  ILE X O   1 
ATOM   616  C CB  . ILE A 1 85  ? 37.200 35.860  46.079 1.00 32.45  ? 85  ILE X CB  1 
ATOM   617  C CG1 . ILE A 1 85  ? 36.694 35.927  47.517 1.00 23.23  ? 85  ILE X CG1 1 
ATOM   618  C CG2 . ILE A 1 85  ? 38.707 36.053  46.027 1.00 19.87  ? 85  ILE X CG2 1 
ATOM   619  C CD1 . ILE A 1 85  ? 37.201 34.797  48.379 1.00 21.04  ? 85  ILE X CD1 1 
ATOM   620  N N   . THR A 1 86  ? 37.937 38.873  45.011 1.00 46.39  ? 86  THR X N   1 
ATOM   621  C CA  . THR A 1 86  ? 38.419 40.211  45.352 1.00 47.77  ? 86  THR X CA  1 
ATOM   622  C C   . THR A 1 86  ? 37.482 41.338  44.922 1.00 49.32  ? 86  THR X C   1 
ATOM   623  O O   . THR A 1 86  ? 37.455 42.397  45.550 1.00 51.89  ? 86  THR X O   1 
ATOM   624  C CB  . THR A 1 86  ? 39.805 40.481  44.746 1.00 38.10  ? 86  THR X CB  1 
ATOM   625  O OG1 . THR A 1 86  ? 39.763 40.233  43.337 1.00 44.49  ? 86  THR X OG1 1 
ATOM   626  C CG2 . THR A 1 86  ? 40.860 39.591  45.391 1.00 22.05  ? 86  THR X CG2 1 
ATOM   627  N N   . ASP A 1 87  ? 36.728 41.113  43.849 1.00 48.84  ? 87  ASP X N   1 
ATOM   628  C CA  . ASP A 1 87  ? 35.795 42.117  43.332 1.00 48.09  ? 87  ASP X CA  1 
ATOM   629  C C   . ASP A 1 87  ? 34.503 42.204  44.148 1.00 44.53  ? 87  ASP X C   1 
ATOM   630  O O   . ASP A 1 87  ? 33.603 42.985  43.826 1.00 42.79  ? 87  ASP X O   1 
ATOM   631  C CB  . ASP A 1 87  ? 35.470 41.843  41.854 1.00 45.58  ? 87  ASP X CB  1 
ATOM   632  C CG  . ASP A 1 87  ? 36.701 41.907  40.954 1.00 53.44  ? 87  ASP X CG  1 
ATOM   633  O OD1 . ASP A 1 87  ? 37.716 42.528  41.344 1.00 55.49  ? 87  ASP X OD1 1 
ATOM   634  O OD2 . ASP A 1 87  ? 36.650 41.335  39.845 1.00 55.64  ? 87  ASP X OD2 1 
ATOM   635  N N   . LEU A 1 88  ? 34.402 41.386  45.188 1.00 49.14  ? 88  LEU X N   1 
ATOM   636  C CA  . LEU A 1 88  ? 33.223 41.383  46.042 1.00 51.83  ? 88  LEU X CA  1 
ATOM   637  C C   . LEU A 1 88  ? 33.333 42.496  47.075 1.00 49.94  ? 88  LEU X C   1 
ATOM   638  O O   . LEU A 1 88  ? 34.414 42.754  47.606 1.00 54.58  ? 88  LEU X O   1 
ATOM   639  C CB  . LEU A 1 88  ? 33.068 40.023  46.730 1.00 55.38  ? 88  LEU X CB  1 
ATOM   640  C CG  . LEU A 1 88  ? 32.341 38.903  45.976 1.00 40.59  ? 88  LEU X CG  1 
ATOM   641  C CD1 . LEU A 1 88  ? 32.752 38.850  44.516 1.00 46.75  ? 88  LEU X CD1 1 
ATOM   642  C CD2 . LEU A 1 88  ? 32.619 37.580  46.664 1.00 36.01  ? 88  LEU X CD2 1 
ATOM   643  N N   . SER A 1 89  ? 32.214 43.157  47.348 1.00 45.69  ? 89  SER X N   1 
ATOM   644  C CA  . SER A 1 89  ? 32.179 44.248  48.308 1.00 46.73  ? 89  SER X CA  1 
ATOM   645  C C   . SER A 1 89  ? 31.045 44.047  49.296 1.00 46.71  ? 89  SER X C   1 
ATOM   646  O O   . SER A 1 89  ? 29.936 43.675  48.915 1.00 42.56  ? 89  SER X O   1 
ATOM   647  C CB  . SER A 1 89  ? 32.007 45.589  47.590 1.00 55.24  ? 89  SER X CB  1 
ATOM   648  O OG  . SER A 1 89  ? 31.722 46.634  48.506 1.00 62.65  ? 89  SER X OG  1 
ATOM   649  N N   . GLU A 1 90  ? 31.332 44.318  50.565 1.00 48.06  ? 90  GLU X N   1 
ATOM   650  C CA  . GLU A 1 90  ? 30.352 44.185  51.635 1.00 45.45  ? 90  GLU X CA  1 
ATOM   651  C C   . GLU A 1 90  ? 29.278 45.259  51.537 1.00 45.14  ? 90  GLU X C   1 
ATOM   652  O O   . GLU A 1 90  ? 28.228 45.155  52.169 1.00 45.35  ? 90  GLU X O   1 
ATOM   653  C CB  . GLU A 1 90  ? 31.034 44.264  53.008 1.00 50.07  ? 90  GLU X CB  1 
ATOM   654  C CG  . GLU A 1 90  ? 31.869 45.521  53.254 1.00 66.49  ? 90  GLU X CG  1 
ATOM   655  C CD  . GLU A 1 90  ? 33.322 45.368  52.831 1.00 78.60  ? 90  GLU X CD  1 
ATOM   656  O OE1 . GLU A 1 90  ? 34.129 44.874  53.648 1.00 85.15  ? 90  GLU X OE1 1 
ATOM   657  O OE2 . GLU A 1 90  ? 33.659 45.746  51.688 1.00 72.69  ? 90  GLU X OE2 1 
ATOM   658  N N   . ASN A 1 91  ? 29.553 46.293  50.749 1.00 47.48  ? 91  ASN X N   1 
ATOM   659  C CA  . ASN A 1 91  ? 28.616 47.393  50.581 1.00 48.35  ? 91  ASN X CA  1 
ATOM   660  C C   . ASN A 1 91  ? 27.592 47.138  49.485 1.00 53.90  ? 91  ASN X C   1 
ATOM   661  O O   . ASN A 1 91  ? 26.560 47.811  49.425 1.00 61.15  ? 91  ASN X O   1 
ATOM   662  C CB  . ASN A 1 91  ? 29.376 48.689  50.306 1.00 48.64  ? 91  ASN X CB  1 
ATOM   663  C CG  . ASN A 1 91  ? 30.363 49.025  51.409 1.00 65.06  ? 91  ASN X CG  1 
ATOM   664  O OD1 . ASN A 1 91  ? 31.545 48.693  51.318 1.00 61.45  ? 91  ASN X OD1 1 
ATOM   665  N ND2 . ASN A 1 91  ? 29.880 49.666  52.466 1.00 73.76  ? 91  ASN X ND2 1 
ATOM   666  N N   . ARG A 1 92  ? 27.874 46.172  48.615 1.00 55.51  ? 92  ARG X N   1 
ATOM   667  C CA  . ARG A 1 92  ? 26.968 45.834  47.521 1.00 47.28  ? 92  ARG X CA  1 
ATOM   668  C C   . ARG A 1 92  ? 26.002 44.755  48.008 1.00 46.23  ? 92  ARG X C   1 
ATOM   669  O O   . ARG A 1 92  ? 26.423 43.660  48.383 1.00 49.61  ? 92  ARG X O   1 
ATOM   670  C CB  . ARG A 1 92  ? 27.757 45.328  46.307 1.00 47.63  ? 92  ARG X CB  1 
ATOM   671  C CG  . ARG A 1 92  ? 28.894 46.242  45.849 1.00 44.91  ? 92  ARG X CG  1 
ATOM   672  C CD  . ARG A 1 92  ? 28.397 47.520  45.187 1.00 55.37  ? 92  ARG X CD  1 
ATOM   673  N NE  . ARG A 1 92  ? 29.499 48.429  44.864 1.00 64.53  ? 92  ARG X NE  1 
ATOM   674  C CZ  . ARG A 1 92  ? 30.183 48.418  43.722 1.00 55.08  ? 92  ARG X CZ  1 
ATOM   675  N NH1 . ARG A 1 92  ? 29.884 47.548  42.769 1.00 71.41  ? 92  ARG X NH1 1 
ATOM   676  N NH2 . ARG A 1 92  ? 31.181 49.273  43.535 1.00 35.86  ? 92  ARG X NH2 1 
ATOM   677  N N   . LYS A 1 93  ? 24.710 45.062  47.959 1.00 50.69  ? 93  LYS X N   1 
ATOM   678  C CA  . LYS A 1 93  ? 23.648 44.159  48.403 1.00 54.70  ? 93  LYS X CA  1 
ATOM   679  C C   . LYS A 1 93  ? 23.730 42.740  47.824 1.00 57.00  ? 93  LYS X C   1 
ATOM   680  O O   . LYS A 1 93  ? 23.681 41.754  48.564 1.00 57.08  ? 93  LYS X O   1 
ATOM   681  C CB  . LYS A 1 93  ? 22.286 44.783  48.067 1.00 56.75  ? 93  LYS X CB  1 
ATOM   682  C CG  . LYS A 1 93  ? 21.074 43.916  48.394 1.00 82.56  ? 93  LYS X CG  1 
ATOM   683  C CD  . LYS A 1 93  ? 20.871 43.759  49.893 1.00 105.03 ? 93  LYS X CD  1 
ATOM   684  C CE  . LYS A 1 93  ? 20.428 45.061  50.539 1.00 115.68 ? 93  LYS X CE  1 
ATOM   685  N NZ  . LYS A 1 93  ? 20.213 44.895  52.002 1.00 117.32 ? 93  LYS X NZ  1 
ATOM   686  N N   . GLN A 1 94  ? 23.863 42.645  46.504 1.00 53.33  ? 94  GLN X N   1 
ATOM   687  C CA  . GLN A 1 94  ? 23.932 41.357  45.818 1.00 50.35  ? 94  GLN X CA  1 
ATOM   688  C C   . GLN A 1 94  ? 25.042 40.456  46.355 1.00 48.31  ? 94  GLN X C   1 
ATOM   689  O O   . GLN A 1 94  ? 24.847 39.253  46.530 1.00 55.59  ? 94  GLN X O   1 
ATOM   690  C CB  . GLN A 1 94  ? 24.141 41.538  44.308 1.00 56.02  ? 94  GLN X CB  1 
ATOM   691  C CG  . GLN A 1 94  ? 23.571 42.814  43.696 1.00 50.51  ? 94  GLN X CG  1 
ATOM   692  C CD  . GLN A 1 94  ? 24.546 43.970  43.777 1.00 42.31  ? 94  GLN X CD  1 
ATOM   693  O OE1 . GLN A 1 94  ? 24.516 44.753  44.725 1.00 49.28  ? 94  GLN X OE1 1 
ATOM   694  N NE2 . GLN A 1 94  ? 25.444 44.058  42.805 1.00 36.73  ? 94  GLN X NE2 1 
ATOM   695  N N   . ASP A 1 95  ? 26.193 41.050  46.650 1.00 35.88  ? 95  ASP X N   1 
ATOM   696  C CA  . ASP A 1 95  ? 27.351 40.304  47.134 1.00 33.51  ? 95  ASP X CA  1 
ATOM   697  C C   . ASP A 1 95  ? 27.184 39.608  48.480 1.00 35.48  ? 95  ASP X C   1 
ATOM   698  O O   . ASP A 1 95  ? 28.012 38.777  48.859 1.00 35.63  ? 95  ASP X O   1 
ATOM   699  C CB  . ASP A 1 95  ? 28.586 41.210  47.153 1.00 33.00  ? 95  ASP X CB  1 
ATOM   700  C CG  . ASP A 1 95  ? 28.988 41.681  45.764 1.00 37.01  ? 95  ASP X CG  1 
ATOM   701  O OD1 . ASP A 1 95  ? 28.227 41.450  44.799 1.00 34.46  ? 95  ASP X OD1 1 
ATOM   702  O OD2 . ASP A 1 95  ? 30.072 42.283  45.635 1.00 35.56  ? 95  ASP X OD2 1 
ATOM   703  N N   . LYS A 1 96  ? 26.109 39.921  49.194 1.00 37.77  ? 96  LYS X N   1 
ATOM   704  C CA  . LYS A 1 96  ? 25.858 39.303  50.490 1.00 40.08  ? 96  LYS X CA  1 
ATOM   705  C C   . LYS A 1 96  ? 25.712 37.789  50.372 1.00 37.63  ? 96  LYS X C   1 
ATOM   706  O O   . LYS A 1 96  ? 26.054 37.049  51.299 1.00 38.55  ? 96  LYS X O   1 
ATOM   707  C CB  . LYS A 1 96  ? 24.607 39.905  51.139 1.00 51.80  ? 96  LYS X CB  1 
ATOM   708  C CG  . LYS A 1 96  ? 24.729 41.377  51.528 1.00 68.60  ? 96  LYS X CG  1 
ATOM   709  C CD  . LYS A 1 96  ? 25.498 41.595  52.837 1.00 90.26  ? 96  LYS X CD  1 
ATOM   710  C CE  . LYS A 1 96  ? 26.994 41.298  52.721 1.00 98.29  ? 96  LYS X CE  1 
ATOM   711  N NZ  . LYS A 1 96  ? 27.668 42.129  51.685 1.00 102.13 ? 96  LYS X NZ  1 
ATOM   712  N N   . ARG A 1 97  ? 25.241 37.330  49.215 1.00 30.89  ? 97  ARG X N   1 
ATOM   713  C CA  . ARG A 1 97  ? 25.050 35.904  48.982 1.00 27.46  ? 97  ARG X CA  1 
ATOM   714  C C   . ARG A 1 97  ? 26.347 35.092  49.007 1.00 23.72  ? 97  ARG X C   1 
ATOM   715  O O   . ARG A 1 97  ? 26.300 33.875  49.176 1.00 32.39  ? 97  ARG X O   1 
ATOM   716  C CB  . ARG A 1 97  ? 24.291 35.659  47.672 1.00 21.96  ? 97  ARG X CB  1 
ATOM   717  C CG  . ARG A 1 97  ? 25.065 36.001  46.407 1.00 24.51  ? 97  ARG X CG  1 
ATOM   718  C CD  . ARG A 1 97  ? 24.263 35.668  45.153 1.00 28.60  ? 97  ARG X CD  1 
ATOM   719  N NE  . ARG A 1 97  ? 25.036 35.892  43.934 1.00 28.85  ? 97  ARG X NE  1 
ATOM   720  C CZ  . ARG A 1 97  ? 25.098 37.050  43.285 1.00 30.09  ? 97  ARG X CZ  1 
ATOM   721  N NH1 . ARG A 1 97  ? 24.427 38.104  43.729 1.00 40.77  ? 97  ARG X NH1 1 
ATOM   722  N NH2 . ARG A 1 97  ? 25.852 37.163  42.203 1.00 23.97  ? 97  ARG X NH2 1 
ATOM   723  N N   . PHE A 1 98  ? 27.492 35.758  48.855 1.00 19.42  ? 98  PHE X N   1 
ATOM   724  C CA  . PHE A 1 98  ? 28.796 35.086  48.861 1.00 16.65  ? 98  PHE X CA  1 
ATOM   725  C C   . PHE A 1 98  ? 29.482 35.135  50.226 1.00 22.30  ? 98  PHE X C   1 
ATOM   726  O O   . PHE A 1 98  ? 30.617 34.664  50.377 1.00 22.98  ? 98  PHE X O   1 
ATOM   727  C CB  . PHE A 1 98  ? 29.744 35.727  47.838 1.00 12.16  ? 98  PHE X CB  1 
ATOM   728  C CG  . PHE A 1 98  ? 29.274 35.630  46.414 1.00 30.70  ? 98  PHE X CG  1 
ATOM   729  C CD1 . PHE A 1 98  ? 29.288 34.418  45.742 1.00 27.24  ? 98  PHE X CD1 1 
ATOM   730  C CD2 . PHE A 1 98  ? 28.845 36.765  45.736 1.00 41.67  ? 98  PHE X CD2 1 
ATOM   731  C CE1 . PHE A 1 98  ? 28.885 34.333  44.416 1.00 30.46  ? 98  PHE X CE1 1 
ATOM   732  C CE2 . PHE A 1 98  ? 28.440 36.691  44.408 1.00 49.02  ? 98  PHE X CE2 1 
ATOM   733  C CZ  . PHE A 1 98  ? 28.461 35.471  43.748 1.00 36.95  ? 98  PHE X CZ  1 
ATOM   734  N N   . ALA A 1 99  ? 28.816 35.735  51.207 1.00 28.44  ? 99  ALA X N   1 
ATOM   735  C CA  . ALA A 1 99  ? 29.378 35.866  52.545 1.00 31.39  ? 99  ALA X CA  1 
ATOM   736  C C   . ALA A 1 99  ? 28.798 34.871  53.543 1.00 26.57  ? 99  ALA X C   1 
ATOM   737  O O   . ALA A 1 99  ? 27.605 34.547  53.506 1.00 21.36  ? 99  ALA X O   1 
ATOM   738  C CB  . ALA A 1 99  ? 29.190 37.290  53.053 1.00 33.69  ? 99  ALA X CB  1 
ATOM   739  N N   . PHE A 1 100 ? 29.650 34.408  54.448 1.00 19.68  ? 100 PHE X N   1 
ATOM   740  C CA  . PHE A 1 100 ? 29.258 33.456  55.472 1.00 22.42  ? 100 PHE X CA  1 
ATOM   741  C C   . PHE A 1 100 ? 29.768 33.931  56.829 1.00 27.96  ? 100 PHE X C   1 
ATOM   742  O O   . PHE A 1 100 ? 30.795 34.612  56.916 1.00 33.67  ? 100 PHE X O   1 
ATOM   743  C CB  . PHE A 1 100 ? 29.830 32.065  55.155 1.00 25.38  ? 100 PHE X CB  1 
ATOM   744  C CG  . PHE A 1 100 ? 29.246 31.432  53.917 1.00 21.92  ? 100 PHE X CG  1 
ATOM   745  C CD1 . PHE A 1 100 ? 29.795 31.680  52.663 1.00 26.71  ? 100 PHE X CD1 1 
ATOM   746  C CD2 . PHE A 1 100 ? 28.125 30.613  54.005 1.00 15.82  ? 100 PHE X CD2 1 
ATOM   747  C CE1 . PHE A 1 100 ? 29.230 31.127  51.515 1.00 24.05  ? 100 PHE X CE1 1 
ATOM   748  C CE2 . PHE A 1 100 ? 27.551 30.053  52.863 1.00 12.60  ? 100 PHE X CE2 1 
ATOM   749  C CZ  . PHE A 1 100 ? 28.103 30.312  51.616 1.00 15.12  ? 100 PHE X CZ  1 
ATOM   750  N N   . ILE A 1 101 ? 29.030 33.591  57.880 1.00 24.40  ? 101 ILE X N   1 
ATOM   751  C CA  . ILE A 1 101 ? 29.391 33.961  59.241 1.00 25.90  ? 101 ILE X CA  1 
ATOM   752  C C   . ILE A 1 101 ? 30.083 32.763  59.892 1.00 28.38  ? 101 ILE X C   1 
ATOM   753  O O   . ILE A 1 101 ? 29.489 31.687  60.017 1.00 28.93  ? 101 ILE X O   1 
ATOM   754  C CB  . ILE A 1 101 ? 28.141 34.331  60.064 1.00 26.34  ? 101 ILE X CB  1 
ATOM   755  C CG1 . ILE A 1 101 ? 27.308 35.374  59.314 1.00 16.73  ? 101 ILE X CG1 1 
ATOM   756  C CG2 . ILE A 1 101 ? 28.552 34.862  61.431 1.00 18.03  ? 101 ILE X CG2 1 
ATOM   757  C CD1 . ILE A 1 101 ? 25.958 35.644  59.933 1.00 33.92  ? 101 ILE X CD1 1 
ATOM   758  N N   . ARG A 1 102 ? 31.339 32.947  60.285 1.00 24.51  ? 102 ARG X N   1 
ATOM   759  C CA  . ARG A 1 102 ? 32.117 31.886  60.911 1.00 27.90  ? 102 ARG X CA  1 
ATOM   760  C C   . ARG A 1 102 ? 31.899 31.755  62.414 1.00 38.83  ? 102 ARG X C   1 
ATOM   761  O O   . ARG A 1 102 ? 32.232 32.659  63.185 1.00 44.54  ? 102 ARG X O   1 
ATOM   762  C CB  . ARG A 1 102 ? 33.607 32.082  60.638 1.00 23.20  ? 102 ARG X CB  1 
ATOM   763  C CG  . ARG A 1 102 ? 34.481 31.068  61.348 1.00 17.85  ? 102 ARG X CG  1 
ATOM   764  C CD  . ARG A 1 102 ? 35.949 31.358  61.153 1.00 28.22  ? 102 ARG X CD  1 
ATOM   765  N NE  . ARG A 1 102 ? 36.783 30.352  61.802 1.00 22.54  ? 102 ARG X NE  1 
ATOM   766  C CZ  . ARG A 1 102 ? 38.098 30.249  61.632 1.00 46.53  ? 102 ARG X CZ  1 
ATOM   767  N NH1 . ARG A 1 102 ? 38.739 31.092  60.833 1.00 62.52  ? 102 ARG X NH1 1 
ATOM   768  N NH2 . ARG A 1 102 ? 38.774 29.293  62.251 1.00 50.93  ? 102 ARG X NH2 1 
ATOM   769  N N   . SER A 1 103 ? 31.352 30.616  62.820 1.00 50.66  ? 103 SER X N   1 
ATOM   770  C CA  . SER A 1 103 ? 31.104 30.317  64.227 1.00 56.49  ? 103 SER X CA  1 
ATOM   771  C C   . SER A 1 103 ? 32.072 29.194  64.607 1.00 58.42  ? 103 SER X C   1 
ATOM   772  O O   . SER A 1 103 ? 32.263 28.247  63.837 1.00 64.95  ? 103 SER X O   1 
ATOM   773  C CB  . SER A 1 103 ? 29.655 29.857  64.421 1.00 60.96  ? 103 SER X CB  1 
ATOM   774  O OG  . SER A 1 103 ? 29.368 29.601  65.784 1.00 78.23  ? 103 SER X OG  1 
ATOM   775  N N   . ASP A 1 104 ? 32.706 29.306  65.769 1.00 54.83  ? 104 ASP X N   1 
ATOM   776  C CA  . ASP A 1 104 ? 33.653 28.284  66.200 1.00 53.88  ? 104 ASP X CA  1 
ATOM   777  C C   . ASP A 1 104 ? 33.252 27.560  67.479 1.00 55.91  ? 104 ASP X C   1 
ATOM   778  O O   . ASP A 1 104 ? 32.957 28.188  68.495 1.00 59.18  ? 104 ASP X O   1 
ATOM   779  C CB  . ASP A 1 104 ? 35.049 28.884  66.355 1.00 48.36  ? 104 ASP X CB  1 
ATOM   780  C CG  . ASP A 1 104 ? 35.639 29.325  65.033 1.00 63.46  ? 104 ASP X CG  1 
ATOM   781  O OD1 . ASP A 1 104 ? 35.387 30.479  64.628 1.00 75.33  ? 104 ASP X OD1 1 
ATOM   782  O OD2 . ASP A 1 104 ? 36.347 28.515  64.396 1.00 65.15  ? 104 ASP X OD2 1 
ATOM   783  N N   . SER A 1 105 ? 33.212 26.234  67.405 1.00 59.86  ? 105 SER X N   1 
ATOM   784  C CA  . SER A 1 105 ? 32.865 25.394  68.544 1.00 55.54  ? 105 SER X CA  1 
ATOM   785  C C   . SER A 1 105 ? 34.093 24.566  68.900 1.00 50.64  ? 105 SER X C   1 
ATOM   786  O O   . SER A 1 105 ? 34.287 23.455  68.394 1.00 56.79  ? 105 SER X O   1 
ATOM   787  C CB  . SER A 1 105 ? 31.691 24.473  68.199 1.00 62.59  ? 105 SER X CB  1 
ATOM   788  O OG  . SER A 1 105 ? 31.317 23.676  69.310 1.00 74.82  ? 105 SER X OG  1 
ATOM   789  N N   . GLY A 1 106 ? 34.944 25.132  69.744 1.00 45.68  ? 106 GLY X N   1 
ATOM   790  C CA  . GLY A 1 106 ? 36.147 24.436  70.148 1.00 43.77  ? 106 GLY X CA  1 
ATOM   791  C C   . GLY A 1 106 ? 37.101 24.263  68.983 1.00 42.38  ? 106 GLY X C   1 
ATOM   792  O O   . GLY A 1 106 ? 37.608 25.249  68.445 1.00 52.71  ? 106 GLY X O   1 
ATOM   793  N N   . PRO A 1 107 ? 37.355 23.018  68.558 1.00 33.96  ? 107 PRO X N   1 
ATOM   794  C CA  . PRO A 1 107 ? 38.262 22.742  67.442 1.00 32.09  ? 107 PRO X CA  1 
ATOM   795  C C   . PRO A 1 107 ? 37.579 22.769  66.068 1.00 30.07  ? 107 PRO X C   1 
ATOM   796  O O   . PRO A 1 107 ? 38.254 22.736  65.035 1.00 34.16  ? 107 PRO X O   1 
ATOM   797  C CB  . PRO A 1 107 ? 38.784 21.352  67.790 1.00 26.68  ? 107 PRO X CB  1 
ATOM   798  C CG  . PRO A 1 107 ? 37.557 20.690  68.338 1.00 26.83  ? 107 PRO X CG  1 
ATOM   799  C CD  . PRO A 1 107 ? 36.926 21.765  69.209 1.00 29.74  ? 107 PRO X CD  1 
ATOM   800  N N   . THR A 1 108 ? 36.250 22.838  66.061 1.00 22.59  ? 108 THR X N   1 
ATOM   801  C CA  . THR A 1 108 ? 35.495 22.850  64.816 1.00 23.49  ? 108 THR X CA  1 
ATOM   802  C C   . THR A 1 108 ? 34.894 24.215  64.474 1.00 37.06  ? 108 THR X C   1 
ATOM   803  O O   . THR A 1 108 ? 34.782 25.099  65.328 1.00 38.97  ? 108 THR X O   1 
ATOM   804  C CB  . THR A 1 108 ? 34.373 21.800  64.838 1.00 17.53  ? 108 THR X CB  1 
ATOM   805  O OG1 . THR A 1 108 ? 33.452 22.095  65.894 1.00 24.49  ? 108 THR X OG1 1 
ATOM   806  C CG2 . THR A 1 108 ? 34.955 20.420  65.042 1.00 23.07  ? 108 THR X CG2 1 
ATOM   807  N N   . THR A 1 109 ? 34.479 24.362  63.222 1.00 35.93  ? 109 THR X N   1 
ATOM   808  C CA  . THR A 1 109 ? 33.898 25.599  62.729 1.00 29.01  ? 109 THR X CA  1 
ATOM   809  C C   . THR A 1 109 ? 32.564 25.286  62.065 1.00 26.82  ? 109 THR X C   1 
ATOM   810  O O   . THR A 1 109 ? 32.284 24.134  61.733 1.00 29.83  ? 109 THR X O   1 
ATOM   811  C CB  . THR A 1 109 ? 34.822 26.251  61.682 1.00 22.49  ? 109 THR X CB  1 
ATOM   812  O OG1 . THR A 1 109 ? 36.171 26.256  62.172 1.00 27.74  ? 109 THR X OG1 1 
ATOM   813  C CG2 . THR A 1 109 ? 34.393 27.670  61.398 1.00 34.81  ? 109 THR X CG2 1 
ATOM   814  N N   . SER A 1 110 ? 31.744 26.314  61.885 1.00 21.66  ? 110 SER X N   1 
ATOM   815  C CA  . SER A 1 110 ? 30.446 26.182  61.245 1.00 21.78  ? 110 SER X CA  1 
ATOM   816  C C   . SER A 1 110 ? 30.238 27.483  60.467 1.00 25.64  ? 110 SER X C   1 
ATOM   817  O O   . SER A 1 110 ? 30.692 28.543  60.905 1.00 30.97  ? 110 SER X O   1 
ATOM   818  C CB  . SER A 1 110 ? 29.355 25.982  62.299 1.00 19.35  ? 110 SER X CB  1 
ATOM   819  O OG  . SER A 1 110 ? 28.117 25.625  61.706 1.00 42.89  ? 110 SER X OG  1 
ATOM   820  N N   . PHE A 1 111 ? 29.610 27.398  59.296 1.00 24.36  ? 111 PHE X N   1 
ATOM   821  C CA  . PHE A 1 111 ? 29.389 28.576  58.458 1.00 10.95  ? 111 PHE X CA  1 
ATOM   822  C C   . PHE A 1 111 ? 27.917 28.824  58.182 1.00 14.03  ? 111 PHE X C   1 
ATOM   823  O O   . PHE A 1 111 ? 27.225 27.958  57.653 1.00 23.65  ? 111 PHE X O   1 
ATOM   824  C CB  . PHE A 1 111 ? 30.123 28.423  57.125 1.00 2.00   ? 111 PHE X CB  1 
ATOM   825  C CG  . PHE A 1 111 ? 31.607 28.207  57.264 1.00 2.00   ? 111 PHE X CG  1 
ATOM   826  C CD1 . PHE A 1 111 ? 32.127 26.922  57.377 1.00 4.26   ? 111 PHE X CD1 1 
ATOM   827  C CD2 . PHE A 1 111 ? 32.485 29.285  57.264 1.00 2.00   ? 111 PHE X CD2 1 
ATOM   828  C CE1 . PHE A 1 111 ? 33.501 26.713  57.487 1.00 9.32   ? 111 PHE X CE1 1 
ATOM   829  C CE2 . PHE A 1 111 ? 33.858 29.089  57.373 1.00 4.15   ? 111 PHE X CE2 1 
ATOM   830  C CZ  . PHE A 1 111 ? 34.368 27.799  57.484 1.00 6.51   ? 111 PHE X CZ  1 
ATOM   831  N N   . GLU A 1 112 ? 27.441 30.012  58.534 1.00 12.10  ? 112 GLU X N   1 
ATOM   832  C CA  . GLU A 1 112 ? 26.050 30.371  58.304 1.00 11.98  ? 112 GLU X CA  1 
ATOM   833  C C   . GLU A 1 112 ? 25.979 31.332  57.125 1.00 21.44  ? 112 GLU X C   1 
ATOM   834  O O   . GLU A 1 112 ? 26.832 32.206  56.977 1.00 28.73  ? 112 GLU X O   1 
ATOM   835  C CB  . GLU A 1 112 ? 25.454 31.034  59.546 1.00 14.32  ? 112 GLU X CB  1 
ATOM   836  C CG  . GLU A 1 112 ? 23.958 31.310  59.446 1.00 18.87  ? 112 GLU X CG  1 
ATOM   837  C CD  . GLU A 1 112 ? 23.395 32.041  60.654 1.00 29.72  ? 112 GLU X CD  1 
ATOM   838  O OE1 . GLU A 1 112 ? 24.154 32.296  61.619 1.00 34.58  ? 112 GLU X OE1 1 
ATOM   839  O OE2 . GLU A 1 112 ? 22.187 32.366  60.633 1.00 28.94  ? 112 GLU X OE2 1 
ATOM   840  N N   . SER A 1 113 ? 24.978 31.154  56.275 1.00 15.58  ? 113 SER X N   1 
ATOM   841  C CA  . SER A 1 113 ? 24.806 32.011  55.117 1.00 14.22  ? 113 SER X CA  1 
ATOM   842  C C   . SER A 1 113 ? 24.362 33.393  55.561 1.00 21.74  ? 113 SER X C   1 
ATOM   843  O O   . SER A 1 113 ? 23.362 33.534  56.267 1.00 27.50  ? 113 SER X O   1 
ATOM   844  C CB  . SER A 1 113 ? 23.767 31.413  54.174 1.00 14.97  ? 113 SER X CB  1 
ATOM   845  O OG  . SER A 1 113 ? 23.461 32.306  53.118 1.00 28.07  ? 113 SER X OG  1 
ATOM   846  N N   . ALA A 1 114 ? 25.116 34.411  55.159 1.00 24.08  ? 114 ALA X N   1 
ATOM   847  C CA  . ALA A 1 114 ? 24.783 35.789  55.506 1.00 26.56  ? 114 ALA X CA  1 
ATOM   848  C C   . ALA A 1 114 ? 23.507 36.205  54.786 1.00 31.45  ? 114 ALA X C   1 
ATOM   849  O O   . ALA A 1 114 ? 22.642 36.852  55.370 1.00 34.60  ? 114 ALA X O   1 
ATOM   850  C CB  . ALA A 1 114 ? 25.923 36.720  55.130 1.00 28.56  ? 114 ALA X CB  1 
ATOM   851  N N   . ALA A 1 115 ? 23.388 35.809  53.521 1.00 36.88  ? 115 ALA X N   1 
ATOM   852  C CA  . ALA A 1 115 ? 22.217 36.136  52.713 1.00 39.38  ? 115 ALA X CA  1 
ATOM   853  C C   . ALA A 1 115 ? 21.006 35.265  53.056 1.00 42.80  ? 115 ALA X C   1 
ATOM   854  O O   . ALA A 1 115 ? 19.861 35.670  52.842 1.00 44.04  ? 115 ALA X O   1 
ATOM   855  C CB  . ALA A 1 115 ? 22.551 36.022  51.235 1.00 31.07  ? 115 ALA X CB  1 
ATOM   856  N N   . CYS A 1 116 ? 21.259 34.067  53.572 1.00 47.59  ? 116 CYS X N   1 
ATOM   857  C CA  . CYS A 1 116 ? 20.188 33.151  53.950 1.00 50.78  ? 116 CYS X CA  1 
ATOM   858  C C   . CYS A 1 116 ? 20.352 32.775  55.418 1.00 55.78  ? 116 CYS X C   1 
ATOM   859  O O   . CYS A 1 116 ? 20.892 31.715  55.740 1.00 62.14  ? 116 CYS X O   1 
ATOM   860  C CB  . CYS A 1 116 ? 20.240 31.883  53.095 1.00 44.75  ? 116 CYS X CB  1 
ATOM   861  S SG  . CYS A 1 116 ? 20.314 32.152  51.295 1.00 39.49  ? 116 CYS X SG  1 
ATOM   862  N N   . PRO A 1 117 ? 19.903 33.650  56.334 1.00 54.66  ? 117 PRO X N   1 
ATOM   863  C CA  . PRO A 1 117 ? 20.005 33.401  57.774 1.00 48.95  ? 117 PRO X CA  1 
ATOM   864  C C   . PRO A 1 117 ? 19.314 32.107  58.183 1.00 43.98  ? 117 PRO X C   1 
ATOM   865  O O   . PRO A 1 117 ? 18.185 31.839  57.774 1.00 40.10  ? 117 PRO X O   1 
ATOM   866  C CB  . PRO A 1 117 ? 19.294 34.608  58.378 1.00 50.29  ? 117 PRO X CB  1 
ATOM   867  C CG  . PRO A 1 117 ? 19.542 35.681  57.377 1.00 53.76  ? 117 PRO X CG  1 
ATOM   868  C CD  . PRO A 1 117 ? 19.284 34.962  56.081 1.00 58.91  ? 117 PRO X CD  1 
ATOM   869  N N   . GLY A 1 118 ? 20.004 31.310  58.989 1.00 40.81  ? 118 GLY X N   1 
ATOM   870  C CA  . GLY A 1 118 ? 19.441 30.055  59.448 1.00 35.90  ? 118 GLY X CA  1 
ATOM   871  C C   . GLY A 1 118 ? 19.989 28.861  58.699 1.00 30.05  ? 118 GLY X C   1 
ATOM   872  O O   . GLY A 1 118 ? 19.948 27.742  59.203 1.00 31.75  ? 118 GLY X O   1 
ATOM   873  N N   . TRP A 1 119 ? 20.530 29.101  57.510 1.00 27.88  ? 119 TRP X N   1 
ATOM   874  C CA  . TRP A 1 119 ? 21.084 28.029  56.696 1.00 20.75  ? 119 TRP X CA  1 
ATOM   875  C C   . TRP A 1 119 ? 22.583 27.917  56.870 1.00 23.11  ? 119 TRP X C   1 
ATOM   876  O O   . TRP A 1 119 ? 23.317 28.882  56.652 1.00 21.40  ? 119 TRP X O   1 
ATOM   877  C CB  . TRP A 1 119 ? 20.729 28.239  55.226 1.00 13.47  ? 119 TRP X CB  1 
ATOM   878  C CG  . TRP A 1 119 ? 19.260 28.171  54.983 1.00 15.95  ? 119 TRP X CG  1 
ATOM   879  C CD1 . TRP A 1 119 ? 18.336 29.134  55.267 1.00 22.44  ? 119 TRP X CD1 1 
ATOM   880  C CD2 . TRP A 1 119 ? 18.532 27.065  54.442 1.00 28.65  ? 119 TRP X CD2 1 
ATOM   881  N NE1 . TRP A 1 119 ? 17.078 28.695  54.942 1.00 28.79  ? 119 TRP X NE1 1 
ATOM   882  C CE2 . TRP A 1 119 ? 17.168 27.428  54.431 1.00 25.93  ? 119 TRP X CE2 1 
ATOM   883  C CE3 . TRP A 1 119 ? 18.900 25.799  53.967 1.00 31.41  ? 119 TRP X CE3 1 
ATOM   884  C CZ2 . TRP A 1 119 ? 16.168 26.571  53.963 1.00 35.64  ? 119 TRP X CZ2 1 
ATOM   885  C CZ3 . TRP A 1 119 ? 17.906 24.946  53.502 1.00 40.24  ? 119 TRP X CZ3 1 
ATOM   886  C CH2 . TRP A 1 119 ? 16.555 25.338  53.503 1.00 44.11  ? 119 TRP X CH2 1 
ATOM   887  N N   . PHE A 1 120 ? 23.028 26.733  57.276 1.00 26.24  ? 120 PHE X N   1 
ATOM   888  C CA  . PHE A 1 120 ? 24.443 26.478  57.499 1.00 24.06  ? 120 PHE X CA  1 
ATOM   889  C C   . PHE A 1 120 ? 24.999 25.543  56.436 1.00 22.84  ? 120 PHE X C   1 
ATOM   890  O O   . PHE A 1 120 ? 24.269 24.730  55.868 1.00 24.82  ? 120 PHE X O   1 
ATOM   891  C CB  . PHE A 1 120 ? 24.654 25.858  58.885 1.00 25.52  ? 120 PHE X CB  1 
ATOM   892  C CG  . PHE A 1 120 ? 24.085 26.677  60.004 1.00 17.48  ? 120 PHE X CG  1 
ATOM   893  C CD1 . PHE A 1 120 ? 22.711 26.738  60.214 1.00 23.01  ? 120 PHE X CD1 1 
ATOM   894  C CD2 . PHE A 1 120 ? 24.922 27.413  60.832 1.00 14.34  ? 120 PHE X CD2 1 
ATOM   895  C CE1 . PHE A 1 120 ? 22.175 27.523  61.226 1.00 8.96   ? 120 PHE X CE1 1 
ATOM   896  C CE2 . PHE A 1 120 ? 24.397 28.202  61.848 1.00 2.86   ? 120 PHE X CE2 1 
ATOM   897  C CZ  . PHE A 1 120 ? 23.018 28.257  62.044 1.00 15.15  ? 120 PHE X CZ  1 
ATOM   898  N N   . LEU A 1 121 ? 26.295 25.662  56.177 1.00 21.28  ? 121 LEU X N   1 
ATOM   899  C CA  . LEU A 1 121 ? 26.982 24.826  55.201 1.00 20.94  ? 121 LEU X CA  1 
ATOM   900  C C   . LEU A 1 121 ? 26.991 23.411  55.781 1.00 29.48  ? 121 LEU X C   1 
ATOM   901  O O   . LEU A 1 121 ? 27.195 23.235  56.987 1.00 32.57  ? 121 LEU X O   1 
ATOM   902  C CB  . LEU A 1 121 ? 28.418 25.329  55.017 1.00 11.04  ? 121 LEU X CB  1 
ATOM   903  C CG  . LEU A 1 121 ? 29.193 24.903  53.770 1.00 18.64  ? 121 LEU X CG  1 
ATOM   904  C CD1 . LEU A 1 121 ? 28.539 25.499  52.534 1.00 19.86  ? 121 LEU X CD1 1 
ATOM   905  C CD2 . LEU A 1 121 ? 30.629 25.377  53.884 1.00 14.12  ? 121 LEU X CD2 1 
ATOM   906  N N   . CYS A 1 122 ? 26.752 22.406  54.945 1.00 30.98  ? 122 CYS X N   1 
ATOM   907  C CA  . CYS A 1 122 ? 26.730 21.037  55.437 1.00 28.46  ? 122 CYS X CA  1 
ATOM   908  C C   . CYS A 1 122 ? 27.041 19.994  54.380 1.00 27.71  ? 122 CYS X C   1 
ATOM   909  O O   . CYS A 1 122 ? 26.951 20.247  53.180 1.00 33.17  ? 122 CYS X O   1 
ATOM   910  C CB  . CYS A 1 122 ? 25.365 20.716  56.045 1.00 15.33  ? 122 CYS X CB  1 
ATOM   911  S SG  . CYS A 1 122 ? 24.090 20.426  54.803 1.00 23.74  ? 122 CYS X SG  1 
ATOM   912  N N   . THR A 1 123 ? 27.410 18.813  54.856 1.00 25.79  ? 123 THR X N   1 
ATOM   913  C CA  . THR A 1 123 ? 27.714 17.674  54.010 1.00 19.99  ? 123 THR X CA  1 
ATOM   914  C C   . THR A 1 123 ? 26.757 16.578  54.460 1.00 23.07  ? 123 THR X C   1 
ATOM   915  O O   . THR A 1 123 ? 26.110 16.705  55.504 1.00 26.18  ? 123 THR X O   1 
ATOM   916  C CB  . THR A 1 123 ? 29.154 17.195  54.221 1.00 4.78   ? 123 THR X CB  1 
ATOM   917  O OG1 . THR A 1 123 ? 29.411 17.066  55.623 1.00 31.41  ? 123 THR X OG1 1 
ATOM   918  C CG2 . THR A 1 123 ? 30.139 18.186  53.623 1.00 22.21  ? 123 THR X CG2 1 
ATOM   919  N N   . ALA A 1 124 ? 26.626 15.527  53.665 1.00 22.21  ? 124 ALA X N   1 
ATOM   920  C CA  . ALA A 1 124 ? 25.743 14.431  54.024 1.00 17.61  ? 124 ALA X CA  1 
ATOM   921  C C   . ALA A 1 124 ? 26.543 13.340  54.727 1.00 19.76  ? 124 ALA X C   1 
ATOM   922  O O   . ALA A 1 124 ? 27.777 13.363  54.736 1.00 17.30  ? 124 ALA X O   1 
ATOM   923  C CB  . ALA A 1 124 ? 25.068 13.876  52.782 1.00 20.02  ? 124 ALA X CB  1 
ATOM   924  N N   . MET A 1 125 ? 25.837 12.408  55.355 1.00 21.10  ? 125 MET X N   1 
ATOM   925  C CA  . MET A 1 125 ? 26.494 11.299  56.028 1.00 20.12  ? 125 MET X CA  1 
ATOM   926  C C   . MET A 1 125 ? 27.081 10.379  54.960 1.00 22.00  ? 125 MET X C   1 
ATOM   927  O O   . MET A 1 125 ? 28.215 9.918   55.085 1.00 21.65  ? 125 MET X O   1 
ATOM   928  C CB  . MET A 1 125 ? 25.494 10.529  56.896 1.00 26.48  ? 125 MET X CB  1 
ATOM   929  C CG  . MET A 1 125 ? 25.036 11.269  58.144 1.00 32.55  ? 125 MET X CG  1 
ATOM   930  S SD  . MET A 1 125 ? 26.417 11.782  59.183 1.00 48.75  ? 125 MET X SD  1 
ATOM   931  C CE  . MET A 1 125 ? 27.202 10.213  59.522 1.00 33.34  ? 125 MET X CE  1 
ATOM   932  N N   . GLU A 1 126 ? 26.307 10.142  53.900 1.00 28.60  ? 126 GLU X N   1 
ATOM   933  C CA  . GLU A 1 126 ? 26.729 9.283   52.792 1.00 31.85  ? 126 GLU X CA  1 
ATOM   934  C C   . GLU A 1 126 ? 27.810 10.002  51.995 1.00 24.08  ? 126 GLU X C   1 
ATOM   935  O O   . GLU A 1 126 ? 27.691 11.195  51.714 1.00 33.48  ? 126 GLU X O   1 
ATOM   936  C CB  . GLU A 1 126 ? 25.554 8.954   51.857 1.00 47.12  ? 126 GLU X CB  1 
ATOM   937  C CG  . GLU A 1 126 ? 24.242 8.588   52.546 1.00 67.61  ? 126 GLU X CG  1 
ATOM   938  C CD  . GLU A 1 126 ? 23.408 9.808   52.901 1.00 87.47  ? 126 GLU X CD  1 
ATOM   939  O OE1 . GLU A 1 126 ? 22.908 10.477  51.970 1.00 99.45  ? 126 GLU X OE1 1 
ATOM   940  O OE2 . GLU A 1 126 ? 23.259 10.102  54.107 1.00 85.36  ? 126 GLU X OE2 1 
ATOM   941  N N   . ALA A 1 127 ? 28.844 9.271   51.603 1.00 15.01  ? 127 ALA X N   1 
ATOM   942  C CA  . ALA A 1 127 ? 29.945 9.857   50.855 1.00 13.44  ? 127 ALA X CA  1 
ATOM   943  C C   . ALA A 1 127 ? 29.595 10.228  49.413 1.00 22.74  ? 127 ALA X C   1 
ATOM   944  O O   . ALA A 1 127 ? 28.546 9.843   48.887 1.00 16.93  ? 127 ALA X O   1 
ATOM   945  C CB  . ALA A 1 127 ? 31.146 8.924   50.885 1.00 13.37  ? 127 ALA X CB  1 
ATOM   946  N N   . ASP A 1 128 ? 30.461 11.043  48.818 1.00 31.07  ? 128 ASP X N   1 
ATOM   947  C CA  . ASP A 1 128 ? 30.334 11.500  47.438 1.00 28.78  ? 128 ASP X CA  1 
ATOM   948  C C   . ASP A 1 128 ? 29.033 12.227  47.118 1.00 28.70  ? 128 ASP X C   1 
ATOM   949  O O   . ASP A 1 128 ? 28.508 12.127  46.007 1.00 34.84  ? 128 ASP X O   1 
ATOM   950  C CB  . ASP A 1 128 ? 30.565 10.330  46.472 1.00 44.16  ? 128 ASP X CB  1 
ATOM   951  C CG  . ASP A 1 128 ? 31.999 9.803   46.509 1.00 51.73  ? 128 ASP X CG  1 
ATOM   952  O OD1 . ASP A 1 128 ? 32.728 10.063  47.492 1.00 50.95  ? 128 ASP X OD1 1 
ATOM   953  O OD2 . ASP A 1 128 ? 32.401 9.120   45.544 1.00 79.00  ? 128 ASP X OD2 1 
ATOM   954  N N   . GLN A 1 129 ? 28.524 12.979  48.085 1.00 30.19  ? 129 GLN X N   1 
ATOM   955  C CA  . GLN A 1 129 ? 27.296 13.741  47.894 1.00 28.53  ? 129 GLN X CA  1 
ATOM   956  C C   . GLN A 1 129 ? 27.665 15.212  47.774 1.00 23.97  ? 129 GLN X C   1 
ATOM   957  O O   . GLN A 1 129 ? 28.699 15.644  48.284 1.00 24.99  ? 129 GLN X O   1 
ATOM   958  C CB  . GLN A 1 129 ? 26.348 13.545  49.080 1.00 39.52  ? 129 GLN X CB  1 
ATOM   959  C CG  . GLN A 1 129 ? 25.951 12.110  49.332 1.00 45.23  ? 129 GLN X CG  1 
ATOM   960  C CD  . GLN A 1 129 ? 25.355 11.457  48.115 1.00 36.03  ? 129 GLN X CD  1 
ATOM   961  O OE1 . GLN A 1 129 ? 24.188 11.668  47.793 1.00 40.76  ? 129 GLN X OE1 1 
ATOM   962  N NE2 . GLN A 1 129 ? 26.158 10.672  47.418 1.00 42.51  ? 129 GLN X NE2 1 
ATOM   963  N N   . PRO A 1 130 ? 26.837 16.005  47.081 1.00 26.10  ? 130 PRO X N   1 
ATOM   964  C CA  . PRO A 1 130 ? 27.147 17.430  46.939 1.00 29.49  ? 130 PRO X CA  1 
ATOM   965  C C   . PRO A 1 130 ? 27.042 18.182  48.268 1.00 34.36  ? 130 PRO X C   1 
ATOM   966  O O   . PRO A 1 130 ? 26.280 17.795  49.159 1.00 34.61  ? 130 PRO X O   1 
ATOM   967  C CB  . PRO A 1 130 ? 26.100 17.904  45.934 1.00 25.01  ? 130 PRO X CB  1 
ATOM   968  C CG  . PRO A 1 130 ? 24.933 17.016  46.220 1.00 20.75  ? 130 PRO X CG  1 
ATOM   969  C CD  . PRO A 1 130 ? 25.587 15.666  46.379 1.00 27.01  ? 130 PRO X CD  1 
ATOM   970  N N   . VAL A 1 131 ? 27.860 19.217  48.416 1.00 32.71  ? 131 VAL X N   1 
ATOM   971  C CA  . VAL A 1 131 ? 27.855 20.039  49.618 1.00 18.55  ? 131 VAL X CA  1 
ATOM   972  C C   . VAL A 1 131 ? 26.626 20.937  49.487 1.00 25.77  ? 131 VAL X C   1 
ATOM   973  O O   . VAL A 1 131 ? 26.419 21.547  48.439 1.00 36.37  ? 131 VAL X O   1 
ATOM   974  C CB  . VAL A 1 131 ? 29.123 20.904  49.679 1.00 8.75   ? 131 VAL X CB  1 
ATOM   975  C CG1 . VAL A 1 131 ? 29.140 21.738  50.947 1.00 23.21  ? 131 VAL X CG1 1 
ATOM   976  C CG2 . VAL A 1 131 ? 30.354 20.022  49.595 1.00 3.97   ? 131 VAL X CG2 1 
ATOM   977  N N   . SER A 1 132 ? 25.806 21.010  50.528 1.00 27.50  ? 132 SER X N   1 
ATOM   978  C CA  . SER A 1 132 ? 24.601 21.829  50.471 1.00 28.91  ? 132 SER X CA  1 
ATOM   979  C C   . SER A 1 132 ? 24.425 22.708  51.711 1.00 25.27  ? 132 SER X C   1 
ATOM   980  O O   . SER A 1 132 ? 25.373 22.936  52.469 1.00 22.91  ? 132 SER X O   1 
ATOM   981  C CB  . SER A 1 132 ? 23.375 20.927  50.280 1.00 29.35  ? 132 SER X CB  1 
ATOM   982  O OG  . SER A 1 132 ? 22.225 21.684  49.934 1.00 51.09  ? 132 SER X OG  1 
ATOM   983  N N   . LEU A 1 133 ? 23.215 23.231  51.882 1.00 19.39  ? 133 LEU X N   1 
ATOM   984  C CA  . LEU A 1 133 ? 22.867 24.077  53.014 1.00 21.01  ? 133 LEU X CA  1 
ATOM   985  C C   . LEU A 1 133 ? 21.744 23.399  53.782 1.00 26.47  ? 133 LEU X C   1 
ATOM   986  O O   . LEU A 1 133 ? 20.820 22.846  53.181 1.00 28.70  ? 133 LEU X O   1 
ATOM   987  C CB  . LEU A 1 133 ? 22.380 25.444  52.532 1.00 15.02  ? 133 LEU X CB  1 
ATOM   988  C CG  . LEU A 1 133 ? 23.371 26.379  51.840 1.00 20.00  ? 133 LEU X CG  1 
ATOM   989  C CD1 . LEU A 1 133 ? 22.624 27.595  51.337 1.00 12.18  ? 133 LEU X CD1 1 
ATOM   990  C CD2 . LEU A 1 133 ? 24.472 26.791  52.804 1.00 10.78  ? 133 LEU X CD2 1 
ATOM   991  N N   . THR A 1 134 ? 21.815 23.442  55.106 1.00 25.86  ? 134 THR X N   1 
ATOM   992  C CA  . THR A 1 134 ? 20.783 22.832  55.923 1.00 26.31  ? 134 THR X CA  1 
ATOM   993  C C   . THR A 1 134 ? 20.036 23.868  56.746 1.00 35.69  ? 134 THR X C   1 
ATOM   994  O O   . THR A 1 134 ? 20.630 24.771  57.338 1.00 38.25  ? 134 THR X O   1 
ATOM   995  C CB  . THR A 1 134 ? 21.346 21.734  56.848 1.00 26.35  ? 134 THR X CB  1 
ATOM   996  O OG1 . THR A 1 134 ? 20.290 21.212  57.667 1.00 26.40  ? 134 THR X OG1 1 
ATOM   997  C CG2 . THR A 1 134 ? 22.445 22.284  57.738 1.00 13.47  ? 134 THR X CG2 1 
ATOM   998  N N   . ASN A 1 135 ? 18.717 23.734  56.743 1.00 42.69  ? 135 ASN X N   1 
ATOM   999  C CA  . ASN A 1 135 ? 17.813 24.615  57.468 1.00 43.28  ? 135 ASN X CA  1 
ATOM   1000 C C   . ASN A 1 135 ? 17.693 24.165  58.922 1.00 43.41  ? 135 ASN X C   1 
ATOM   1001 O O   . ASN A 1 135 ? 17.196 24.898  59.772 1.00 44.21  ? 135 ASN X O   1 
ATOM   1002 C CB  . ASN A 1 135 ? 16.435 24.553  56.801 1.00 44.76  ? 135 ASN X CB  1 
ATOM   1003 C CG  . ASN A 1 135 ? 15.381 25.353  57.535 1.00 54.37  ? 135 ASN X CG  1 
ATOM   1004 O OD1 . ASN A 1 135 ? 15.282 26.568  57.376 1.00 78.88  ? 135 ASN X OD1 1 
ATOM   1005 N ND2 . ASN A 1 135 ? 14.553 24.664  58.306 1.00 68.12  ? 135 ASN X ND2 1 
ATOM   1006 N N   . MET A 1 136 ? 18.155 22.952  59.203 1.00 47.69  ? 136 MET X N   1 
ATOM   1007 C CA  . MET A 1 136 ? 18.049 22.399  60.544 1.00 43.34  ? 136 MET X CA  1 
ATOM   1008 C C   . MET A 1 136 ? 19.348 21.802  61.068 1.00 44.03  ? 136 MET X C   1 
ATOM   1009 O O   . MET A 1 136 ? 19.546 20.585  61.016 1.00 43.05  ? 136 MET X O   1 
ATOM   1010 C CB  . MET A 1 136 ? 16.959 21.325  60.560 1.00 48.57  ? 136 MET X CB  1 
ATOM   1011 C CG  . MET A 1 136 ? 15.615 21.790  60.030 1.00 68.28  ? 136 MET X CG  1 
ATOM   1012 S SD  . MET A 1 136 ? 14.585 20.423  59.485 1.00 82.07  ? 136 MET X SD  1 
ATOM   1013 C CE  . MET A 1 136 ? 15.178 20.199  57.796 1.00 79.54  ? 136 MET X CE  1 
ATOM   1014 N N   . PRO A 1 137 ? 20.249 22.646  61.594 1.00 46.09  ? 137 PRO X N   1 
ATOM   1015 C CA  . PRO A 1 137 ? 21.519 22.138  62.124 1.00 53.76  ? 137 PRO X CA  1 
ATOM   1016 C C   . PRO A 1 137 ? 21.283 21.258  63.364 1.00 62.84  ? 137 PRO X C   1 
ATOM   1017 O O   . PRO A 1 137 ? 22.095 20.394  63.691 1.00 59.62  ? 137 PRO X O   1 
ATOM   1018 C CB  . PRO A 1 137 ? 22.283 23.421  62.458 1.00 34.94  ? 137 PRO X CB  1 
ATOM   1019 C CG  . PRO A 1 137 ? 21.191 24.390  62.791 1.00 40.60  ? 137 PRO X CG  1 
ATOM   1020 C CD  . PRO A 1 137 ? 20.184 24.113  61.706 1.00 39.08  ? 137 PRO X CD  1 
ATOM   1021 N N   . ASP A 1 138 ? 20.142 21.468  64.020 1.00 74.08  ? 138 ASP X N   1 
ATOM   1022 C CA  . ASP A 1 138 ? 19.750 20.713  65.207 1.00 82.51  ? 138 ASP X CA  1 
ATOM   1023 C C   . ASP A 1 138 ? 19.489 19.241  64.887 1.00 84.69  ? 138 ASP X C   1 
ATOM   1024 O O   . ASP A 1 138 ? 19.804 18.362  65.688 1.00 86.20  ? 138 ASP X O   1 
ATOM   1025 C CB  . ASP A 1 138 ? 18.493 21.338  65.826 1.00 94.75  ? 138 ASP X CB  1 
ATOM   1026 C CG  . ASP A 1 138 ? 17.961 20.548  67.009 1.00 113.52 ? 138 ASP X CG  1 
ATOM   1027 O OD1 . ASP A 1 138 ? 18.539 20.657  68.113 1.00 126.38 ? 138 ASP X OD1 1 
ATOM   1028 O OD2 . ASP A 1 138 ? 16.957 19.822  66.837 1.00 116.53 ? 138 ASP X OD2 1 
ATOM   1029 N N   . GLU A 1 139 ? 18.911 18.987  63.717 1.00 83.80  ? 139 GLU X N   1 
ATOM   1030 C CA  . GLU A 1 139 ? 18.590 17.629  63.287 1.00 83.92  ? 139 GLU X CA  1 
ATOM   1031 C C   . GLU A 1 139 ? 19.744 16.635  63.360 1.00 86.29  ? 139 GLU X C   1 
ATOM   1032 O O   . GLU A 1 139 ? 19.533 15.456  63.646 1.00 87.06  ? 139 GLU X O   1 
ATOM   1033 C CB  . GLU A 1 139 ? 18.009 17.641  61.872 1.00 82.77  ? 139 GLU X CB  1 
ATOM   1034 C CG  . GLU A 1 139 ? 16.538 18.004  61.816 1.00 95.75  ? 139 GLU X CG  1 
ATOM   1035 C CD  . GLU A 1 139 ? 15.672 17.021  62.581 1.00 104.43 ? 139 GLU X CD  1 
ATOM   1036 O OE1 . GLU A 1 139 ? 15.501 15.879  62.101 1.00 110.32 ? 139 GLU X OE1 1 
ATOM   1037 O OE2 . GLU A 1 139 ? 15.167 17.388  63.664 1.00 104.26 ? 139 GLU X OE2 1 
ATOM   1038 N N   . GLY A 1 140 ? 20.951 17.097  63.055 1.00 86.01  ? 140 GLY X N   1 
ATOM   1039 C CA  . GLY A 1 140 ? 22.106 16.218  63.098 1.00 81.85  ? 140 GLY X CA  1 
ATOM   1040 C C   . GLY A 1 140 ? 22.148 15.175  61.993 1.00 79.23  ? 140 GLY X C   1 
ATOM   1041 O O   . GLY A 1 140 ? 23.032 14.322  61.985 1.00 85.35  ? 140 GLY X O   1 
ATOM   1042 N N   . VAL A 1 141 ? 21.189 15.224  61.072 1.00 70.65  ? 141 VAL X N   1 
ATOM   1043 C CA  . VAL A 1 141 ? 21.146 14.281  59.956 1.00 61.51  ? 141 VAL X CA  1 
ATOM   1044 C C   . VAL A 1 141 ? 22.227 14.640  58.927 1.00 56.86  ? 141 VAL X C   1 
ATOM   1045 O O   . VAL A 1 141 ? 22.734 13.774  58.209 1.00 55.31  ? 141 VAL X O   1 
ATOM   1046 C CB  . VAL A 1 141 ? 19.741 14.257  59.290 1.00 63.78  ? 141 VAL X CB  1 
ATOM   1047 C CG1 . VAL A 1 141 ? 19.360 15.640  58.776 1.00 78.73  ? 141 VAL X CG1 1 
ATOM   1048 C CG2 . VAL A 1 141 ? 19.700 13.229  58.171 1.00 64.61  ? 141 VAL X CG2 1 
ATOM   1049 N N   . MET A 1 142 ? 22.562 15.928  58.868 1.00 51.21  ? 142 MET X N   1 
ATOM   1050 C CA  . MET A 1 142 ? 23.592 16.444  57.969 1.00 38.75  ? 142 MET X CA  1 
ATOM   1051 C C   . MET A 1 142 ? 24.739 16.912  58.863 1.00 34.21  ? 142 MET X C   1 
ATOM   1052 O O   . MET A 1 142 ? 24.514 17.267  60.022 1.00 38.05  ? 142 MET X O   1 
ATOM   1053 C CB  . MET A 1 142 ? 23.062 17.633  57.161 1.00 32.09  ? 142 MET X CB  1 
ATOM   1054 C CG  . MET A 1 142 ? 21.879 17.326  56.243 1.00 45.42  ? 142 MET X CG  1 
ATOM   1055 S SD  . MET A 1 142 ? 22.259 16.261  54.828 1.00 46.15  ? 142 MET X SD  1 
ATOM   1056 C CE  . MET A 1 142 ? 22.770 17.457  53.623 1.00 39.05  ? 142 MET X CE  1 
ATOM   1057 N N   . VAL A 1 143 ? 25.958 16.911  58.334 1.00 30.78  ? 143 VAL X N   1 
ATOM   1058 C CA  . VAL A 1 143 ? 27.130 17.331  59.100 1.00 24.27  ? 143 VAL X CA  1 
ATOM   1059 C C   . VAL A 1 143 ? 27.413 18.817  58.896 1.00 25.35  ? 143 VAL X C   1 
ATOM   1060 O O   . VAL A 1 143 ? 27.671 19.259  57.778 1.00 28.25  ? 143 VAL X O   1 
ATOM   1061 C CB  . VAL A 1 143 ? 28.371 16.510  58.709 1.00 14.73  ? 143 VAL X CB  1 
ATOM   1062 C CG1 . VAL A 1 143 ? 29.562 16.922  59.552 1.00 6.57   ? 143 VAL X CG1 1 
ATOM   1063 C CG2 . VAL A 1 143 ? 28.085 15.023  58.877 1.00 8.02   ? 143 VAL X CG2 1 
ATOM   1064 N N   . THR A 1 144 ? 27.389 19.576  59.988 1.00 24.98  ? 144 THR X N   1 
ATOM   1065 C CA  . THR A 1 144 ? 27.614 21.018  59.949 1.00 12.43  ? 144 THR X CA  1 
ATOM   1066 C C   . THR A 1 144 ? 28.938 21.482  60.541 1.00 12.79  ? 144 THR X C   1 
ATOM   1067 O O   . THR A 1 144 ? 29.279 22.660  60.446 1.00 20.01  ? 144 THR X O   1 
ATOM   1068 C CB  . THR A 1 144 ? 26.484 21.758  60.673 1.00 10.58  ? 144 THR X CB  1 
ATOM   1069 O OG1 . THR A 1 144 ? 26.236 21.127  61.938 1.00 53.09  ? 144 THR X OG1 1 
ATOM   1070 C CG2 . THR A 1 144 ? 25.215 21.723  59.846 1.00 17.48  ? 144 THR X CG2 1 
ATOM   1071 N N   . LYS A 1 145 ? 29.674 20.574  61.172 1.00 8.90   ? 145 LYS X N   1 
ATOM   1072 C CA  . LYS A 1 145 ? 30.954 20.930  61.770 1.00 11.00  ? 145 LYS X CA  1 
ATOM   1073 C C   . LYS A 1 145 ? 32.139 20.536  60.894 1.00 14.31  ? 145 LYS X C   1 
ATOM   1074 O O   . LYS A 1 145 ? 32.219 19.402  60.406 1.00 21.08  ? 145 LYS X O   1 
ATOM   1075 C CB  . LYS A 1 145 ? 31.083 20.329  63.175 1.00 14.93  ? 145 LYS X CB  1 
ATOM   1076 C CG  . LYS A 1 145 ? 30.193 21.013  64.207 1.00 41.23  ? 145 LYS X CG  1 
ATOM   1077 C CD  . LYS A 1 145 ? 30.429 20.492  65.620 1.00 73.31  ? 145 LYS X CD  1 
ATOM   1078 C CE  . LYS A 1 145 ? 29.928 19.065  65.794 1.00 88.88  ? 145 LYS X CE  1 
ATOM   1079 N NZ  . LYS A 1 145 ? 28.466 18.958  65.526 1.00 96.31  ? 145 LYS X NZ  1 
ATOM   1080 N N   . PHE A 1 146 ? 33.064 21.475  60.713 1.00 9.27   ? 146 PHE X N   1 
ATOM   1081 C CA  . PHE A 1 146 ? 34.245 21.266  59.886 1.00 3.40   ? 146 PHE X CA  1 
ATOM   1082 C C   . PHE A 1 146 ? 35.505 21.680  60.624 1.00 7.41   ? 146 PHE X C   1 
ATOM   1083 O O   . PHE A 1 146 ? 35.437 22.262  61.703 1.00 13.23  ? 146 PHE X O   1 
ATOM   1084 C CB  . PHE A 1 146 ? 34.145 22.113  58.608 1.00 10.14  ? 146 PHE X CB  1 
ATOM   1085 C CG  . PHE A 1 146 ? 32.914 21.842  57.784 1.00 17.39  ? 146 PHE X CG  1 
ATOM   1086 C CD1 . PHE A 1 146 ? 31.707 22.465  58.086 1.00 11.12  ? 146 PHE X CD1 1 
ATOM   1087 C CD2 . PHE A 1 146 ? 32.958 20.959  56.714 1.00 15.05  ? 146 PHE X CD2 1 
ATOM   1088 C CE1 . PHE A 1 146 ? 30.562 22.214  57.336 1.00 12.24  ? 146 PHE X CE1 1 
ATOM   1089 C CE2 . PHE A 1 146 ? 31.821 20.701  55.961 1.00 11.39  ? 146 PHE X CE2 1 
ATOM   1090 C CZ  . PHE A 1 146 ? 30.619 21.332  56.273 1.00 12.70  ? 146 PHE X CZ  1 
ATOM   1091 N N   . TYR A 1 147 ? 36.653 21.356  60.042 1.00 8.57   ? 147 TYR X N   1 
ATOM   1092 C CA  . TYR A 1 147 ? 37.947 21.727  60.598 1.00 18.26  ? 147 TYR X CA  1 
ATOM   1093 C C   . TYR A 1 147 ? 38.533 22.718  59.596 1.00 28.70  ? 147 TYR X C   1 
ATOM   1094 O O   . TYR A 1 147 ? 39.049 22.317  58.554 1.00 38.01  ? 147 TYR X O   1 
ATOM   1095 C CB  . TYR A 1 147 ? 38.868 20.509  60.712 1.00 21.52  ? 147 TYR X CB  1 
ATOM   1096 C CG  . TYR A 1 147 ? 38.574 19.591  61.873 1.00 15.03  ? 147 TYR X CG  1 
ATOM   1097 C CD1 . TYR A 1 147 ? 37.655 18.550  61.751 1.00 30.80  ? 147 TYR X CD1 1 
ATOM   1098 C CD2 . TYR A 1 147 ? 39.230 19.750  63.091 1.00 22.89  ? 147 TYR X CD2 1 
ATOM   1099 C CE1 . TYR A 1 147 ? 37.395 17.689  62.818 1.00 30.49  ? 147 TYR X CE1 1 
ATOM   1100 C CE2 . TYR A 1 147 ? 38.978 18.896  64.162 1.00 21.74  ? 147 TYR X CE2 1 
ATOM   1101 C CZ  . TYR A 1 147 ? 38.062 17.869  64.018 1.00 29.26  ? 147 TYR X CZ  1 
ATOM   1102 O OH  . TYR A 1 147 ? 37.810 17.023  65.070 1.00 39.56  ? 147 TYR X OH  1 
ATOM   1103 N N   . PHE A 1 148 ? 38.425 24.007  59.897 1.00 32.58  ? 148 PHE X N   1 
ATOM   1104 C CA  . PHE A 1 148 ? 38.912 25.054  59.004 1.00 29.73  ? 148 PHE X CA  1 
ATOM   1105 C C   . PHE A 1 148 ? 40.304 25.533  59.402 1.00 30.45  ? 148 PHE X C   1 
ATOM   1106 O O   . PHE A 1 148 ? 40.449 26.343  60.318 1.00 37.85  ? 148 PHE X O   1 
ATOM   1107 C CB  . PHE A 1 148 ? 37.928 26.225  59.028 1.00 32.42  ? 148 PHE X CB  1 
ATOM   1108 C CG  . PHE A 1 148 ? 37.857 26.988  57.743 1.00 39.06  ? 148 PHE X CG  1 
ATOM   1109 C CD1 . PHE A 1 148 ? 37.885 26.326  56.522 1.00 48.10  ? 148 PHE X CD1 1 
ATOM   1110 C CD2 . PHE A 1 148 ? 37.724 28.372  57.754 1.00 37.63  ? 148 PHE X CD2 1 
ATOM   1111 C CE1 . PHE A 1 148 ? 37.778 27.031  55.330 1.00 47.61  ? 148 PHE X CE1 1 
ATOM   1112 C CE2 . PHE A 1 148 ? 37.616 29.083  56.568 1.00 49.83  ? 148 PHE X CE2 1 
ATOM   1113 C CZ  . PHE A 1 148 ? 37.643 28.411  55.354 1.00 55.40  ? 148 PHE X CZ  1 
ATOM   1114 N N   . GLN A 1 149 ? 41.326 25.057  58.700 1.00 26.52  ? 149 GLN X N   1 
ATOM   1115 C CA  . GLN A 1 149 ? 42.698 25.447  59.012 1.00 27.28  ? 149 GLN X CA  1 
ATOM   1116 C C   . GLN A 1 149 ? 43.437 26.097  57.853 1.00 31.10  ? 149 GLN X C   1 
ATOM   1117 O O   . GLN A 1 149 ? 43.491 25.556  56.752 1.00 38.65  ? 149 GLN X O   1 
ATOM   1118 C CB  . GLN A 1 149 ? 43.500 24.247  59.525 1.00 32.61  ? 149 GLN X CB  1 
ATOM   1119 C CG  . GLN A 1 149 ? 43.127 23.814  60.935 1.00 50.34  ? 149 GLN X CG  1 
ATOM   1120 C CD  . GLN A 1 149 ? 44.048 22.747  61.493 1.00 60.73  ? 149 GLN X CD  1 
ATOM   1121 O OE1 . GLN A 1 149 ? 43.605 21.843  62.201 1.00 83.92  ? 149 GLN X OE1 1 
ATOM   1122 N NE2 . GLN A 1 149 ? 45.336 22.850  61.186 1.00 37.64  ? 149 GLN X NE2 1 
ATOM   1123 N N   . GLU A 1 150 ? 44.012 27.264  58.116 1.00 30.58  ? 150 GLU X N   1 
ATOM   1124 C CA  . GLU A 1 150 ? 44.765 28.002  57.112 1.00 33.43  ? 150 GLU X CA  1 
ATOM   1125 C C   . GLU A 1 150 ? 46.056 27.275  56.761 1.00 35.08  ? 150 GLU X C   1 
ATOM   1126 O O   . GLU A 1 150 ? 46.733 26.748  57.641 1.00 44.77  ? 150 GLU X O   1 
ATOM   1127 C CB  . GLU A 1 150 ? 45.050 29.427  57.606 1.00 38.17  ? 150 GLU X CB  1 
ATOM   1128 C CG  . GLU A 1 150 ? 45.458 29.532  59.074 1.00 58.19  ? 150 GLU X CG  1 
ATOM   1129 C CD  . GLU A 1 150 ? 45.307 30.942  59.628 1.00 81.97  ? 150 GLU X CD  1 
ATOM   1130 O OE1 . GLU A 1 150 ? 44.161 31.439  59.698 1.00 83.95  ? 150 GLU X OE1 1 
ATOM   1131 O OE2 . GLU A 1 150 ? 46.331 31.551  60.005 1.00 97.39  ? 150 GLU X OE2 1 
ATOM   1132 N N   . ASP A 1 151 ? 46.372 27.216  55.469 1.00 39.74  ? 151 ASP X N   1 
ATOM   1133 C CA  . ASP A 1 151 ? 47.586 26.548  55.001 1.00 48.33  ? 151 ASP X CA  1 
ATOM   1134 C C   . ASP A 1 151 ? 48.834 27.065  55.709 1.00 58.19  ? 151 ASP X C   1 
ATOM   1135 O O   . ASP A 1 151 ? 49.954 26.722  55.333 1.00 66.44  ? 151 ASP X O   1 
ATOM   1136 C CB  . ASP A 1 151 ? 47.751 26.725  53.489 1.00 52.80  ? 151 ASP X CB  1 
ATOM   1137 C CG  . ASP A 1 151 ? 46.940 25.729  52.693 1.00 73.29  ? 151 ASP X CG  1 
ATOM   1138 O OD1 . ASP A 1 151 ? 45.701 25.874  52.641 1.00 97.54  ? 151 ASP X OD1 1 
ATOM   1139 O OD2 . ASP A 1 151 ? 47.544 24.799  52.117 1.00 67.31  ? 151 ASP X OD2 1 
ATOM   1140 N N   . ASP B 2 4   ? 25.132 8.862   20.543 1.00 103.03 ? 1   ASP Y N   1 
ATOM   1141 C CA  . ASP B 2 4   ? 24.144 8.032   21.288 1.00 99.73  ? 1   ASP Y CA  1 
ATOM   1142 C C   . ASP B 2 4   ? 23.179 8.917   22.076 1.00 96.81  ? 1   ASP Y C   1 
ATOM   1143 O O   . ASP B 2 4   ? 23.526 10.028  22.480 1.00 101.54 ? 1   ASP Y O   1 
ATOM   1144 C CB  . ASP B 2 4   ? 24.874 7.069   22.236 1.00 96.81  ? 1   ASP Y CB  1 
ATOM   1145 C CG  . ASP B 2 4   ? 23.938 6.071   22.895 1.00 81.18  ? 1   ASP Y CG  1 
ATOM   1146 O OD1 . ASP B 2 4   ? 23.057 5.529   22.200 1.00 87.17  ? 1   ASP Y OD1 1 
ATOM   1147 O OD2 . ASP B 2 4   ? 24.080 5.834   24.109 1.00 71.51  ? 1   ASP Y OD2 1 
ATOM   1148 N N   . LYS B 2 5   ? 21.973 8.409   22.306 1.00 89.13  ? 2   LYS Y N   1 
ATOM   1149 C CA  . LYS B 2 5   ? 20.944 9.138   23.039 1.00 79.00  ? 2   LYS Y CA  1 
ATOM   1150 C C   . LYS B 2 5   ? 21.199 9.064   24.549 1.00 72.99  ? 2   LYS Y C   1 
ATOM   1151 O O   . LYS B 2 5   ? 20.277 8.862   25.337 1.00 74.94  ? 2   LYS Y O   1 
ATOM   1152 C CB  . LYS B 2 5   ? 19.567 8.555   22.694 1.00 80.48  ? 2   LYS Y CB  1 
ATOM   1153 C CG  . LYS B 2 5   ? 18.386 9.460   23.004 1.00 89.50  ? 2   LYS Y CG  1 
ATOM   1154 C CD  . LYS B 2 5   ? 17.078 8.771   22.649 1.00 101.71 ? 2   LYS Y CD  1 
ATOM   1155 C CE  . LYS B 2 5   ? 15.883 9.681   22.878 1.00 118.84 ? 2   LYS Y CE  1 
ATOM   1156 N NZ  . LYS B 2 5   ? 14.597 8.984   22.589 1.00 128.14 ? 2   LYS Y NZ  1 
ATOM   1157 N N   . CYS B 2 6   ? 22.456 9.237   24.945 1.00 66.84  ? 3   CYS Y N   1 
ATOM   1158 C CA  . CYS B 2 6   ? 22.841 9.188   26.349 1.00 65.12  ? 3   CYS Y CA  1 
ATOM   1159 C C   . CYS B 2 6   ? 23.964 10.191  26.581 1.00 67.43  ? 3   CYS Y C   1 
ATOM   1160 O O   . CYS B 2 6   ? 24.940 10.223  25.832 1.00 68.82  ? 3   CYS Y O   1 
ATOM   1161 C CB  . CYS B 2 6   ? 23.295 7.778   26.739 1.00 55.98  ? 3   CYS Y CB  1 
ATOM   1162 S SG  . CYS B 2 6   ? 22.080 6.474   26.365 1.00 42.99  ? 3   CYS Y SG  1 
ATOM   1163 N N   . LYS B 2 7   ? 23.820 10.993  27.634 1.00 66.61  ? 4   LYS Y N   1 
ATOM   1164 C CA  . LYS B 2 7   ? 24.782 12.035  27.986 1.00 66.92  ? 4   LYS Y CA  1 
ATOM   1165 C C   . LYS B 2 7   ? 26.258 11.640  27.963 1.00 66.67  ? 4   LYS Y C   1 
ATOM   1166 O O   . LYS B 2 7   ? 27.068 12.349  27.371 1.00 74.25  ? 4   LYS Y O   1 
ATOM   1167 C CB  . LYS B 2 7   ? 24.420 12.644  29.334 1.00 75.22  ? 4   LYS Y CB  1 
ATOM   1168 N N   . GLU B 2 8   ? 26.601 10.535  28.623 1.00 59.98  ? 5   GLU Y N   1 
ATOM   1169 C CA  . GLU B 2 8   ? 27.983 10.043  28.683 1.00 59.53  ? 5   GLU Y CA  1 
ATOM   1170 C C   . GLU B 2 8   ? 28.873 10.952  29.543 1.00 65.41  ? 5   GLU Y C   1 
ATOM   1171 O O   . GLU B 2 8   ? 28.948 12.164  29.321 1.00 65.47  ? 5   GLU Y O   1 
ATOM   1172 C CB  . GLU B 2 8   ? 28.570 9.912   27.269 1.00 45.30  ? 5   GLU Y CB  1 
ATOM   1173 C CG  . GLU B 2 8   ? 29.954 9.274   27.191 1.00 61.72  ? 5   GLU Y CG  1 
ATOM   1174 C CD  . GLU B 2 8   ? 29.905 7.781   26.906 1.00 77.05  ? 5   GLU Y CD  1 
ATOM   1175 O OE1 . GLU B 2 8   ? 29.223 7.379   25.938 1.00 68.03  ? 5   GLU Y OE1 1 
ATOM   1176 O OE2 . GLU B 2 8   ? 30.558 7.009   27.641 1.00 86.10  ? 5   GLU Y OE2 1 
ATOM   1177 N N   . ARG B 2 9   ? 29.526 10.363  30.540 1.00 68.60  ? 6   ARG Y N   1 
ATOM   1178 C CA  . ARG B 2 9   ? 30.408 11.106  31.436 1.00 66.91  ? 6   ARG Y CA  1 
ATOM   1179 C C   . ARG B 2 9   ? 31.458 10.164  32.015 1.00 66.57  ? 6   ARG Y C   1 
ATOM   1180 O O   . ARG B 2 9   ? 31.197 8.978   32.209 1.00 67.86  ? 6   ARG Y O   1 
ATOM   1181 C CB  . ARG B 2 9   ? 29.606 11.756  32.571 1.00 63.88  ? 6   ARG Y CB  1 
ATOM   1182 C CG  . ARG B 2 9   ? 30.406 12.749  33.407 1.00 65.40  ? 6   ARG Y CG  1 
ATOM   1183 C CD  . ARG B 2 9   ? 29.545 13.434  34.457 1.00 70.58  ? 6   ARG Y CD  1 
ATOM   1184 N NE  . ARG B 2 9   ? 29.118 12.521  35.515 1.00 84.81  ? 6   ARG Y NE  1 
ATOM   1185 C CZ  . ARG B 2 9   ? 27.896 12.501  36.040 1.00 84.48  ? 6   ARG Y CZ  1 
ATOM   1186 N NH1 . ARG B 2 9   ? 26.969 13.343  35.604 1.00 66.29  ? 6   ARG Y NH1 1 
ATOM   1187 N NH2 . ARG B 2 9   ? 27.602 11.646  37.010 1.00 86.39  ? 6   ARG Y NH2 1 
ATOM   1188 N N   . GLU B 2 10  ? 32.644 10.694  32.287 1.00 67.18  ? 7   GLU Y N   1 
ATOM   1189 C CA  . GLU B 2 10  ? 33.738 9.898   32.833 1.00 68.86  ? 7   GLU Y CA  1 
ATOM   1190 C C   . GLU B 2 10  ? 34.110 10.374  34.239 1.00 66.24  ? 7   GLU Y C   1 
ATOM   1191 O O   . GLU B 2 10  ? 34.272 11.577  34.471 1.00 69.03  ? 7   GLU Y O   1 
ATOM   1192 C CB  . GLU B 2 10  ? 34.951 9.995   31.904 1.00 79.46  ? 7   GLU Y CB  1 
ATOM   1193 C CG  . GLU B 2 10  ? 36.173 9.227   32.367 1.00 98.49  ? 7   GLU Y CG  1 
ATOM   1194 C CD  . GLU B 2 10  ? 37.357 9.420   31.441 1.00 114.56 ? 7   GLU Y CD  1 
ATOM   1195 O OE1 . GLU B 2 10  ? 38.007 10.487  31.515 1.00 120.33 ? 7   GLU Y OE1 1 
ATOM   1196 O OE2 . GLU B 2 10  ? 37.635 8.509   30.634 1.00 121.84 ? 7   GLU Y OE2 1 
ATOM   1197 N N   . GLU B 2 11  ? 34.228 9.435   35.173 1.00 59.99  ? 8   GLU Y N   1 
ATOM   1198 C CA  . GLU B 2 11  ? 34.581 9.769   36.549 1.00 52.93  ? 8   GLU Y CA  1 
ATOM   1199 C C   . GLU B 2 11  ? 36.079 9.901   36.729 1.00 48.38  ? 8   GLU Y C   1 
ATOM   1200 O O   . GLU B 2 11  ? 36.834 9.012   36.340 1.00 50.00  ? 8   GLU Y O   1 
ATOM   1201 C CB  . GLU B 2 11  ? 34.050 8.720   37.525 1.00 53.61  ? 8   GLU Y CB  1 
ATOM   1202 C CG  . GLU B 2 11  ? 32.766 9.121   38.234 1.00 68.75  ? 8   GLU Y CG  1 
ATOM   1203 C CD  . GLU B 2 11  ? 32.893 10.421  39.015 1.00 77.34  ? 8   GLU Y CD  1 
ATOM   1204 O OE1 . GLU B 2 11  ? 33.935 10.641  39.675 1.00 67.19  ? 8   GLU Y OE1 1 
ATOM   1205 O OE2 . GLU B 2 11  ? 31.939 11.227  38.968 1.00 86.22  ? 8   GLU Y OE2 1 
ATOM   1206 N N   . LYS B 2 12  ? 36.503 11.006  37.334 1.00 43.72  ? 9   LYS Y N   1 
ATOM   1207 C CA  . LYS B 2 12  ? 37.921 11.246  37.569 1.00 46.02  ? 9   LYS Y CA  1 
ATOM   1208 C C   . LYS B 2 12  ? 38.428 10.417  38.743 1.00 48.76  ? 9   LYS Y C   1 
ATOM   1209 O O   . LYS B 2 12  ? 39.584 9.995   38.763 1.00 47.81  ? 9   LYS Y O   1 
ATOM   1210 C CB  . LYS B 2 12  ? 38.172 12.728  37.859 1.00 60.20  ? 9   LYS Y CB  1 
ATOM   1211 C CG  . LYS B 2 12  ? 37.816 13.683  36.730 1.00 76.32  ? 9   LYS Y CG  1 
ATOM   1212 C CD  . LYS B 2 12  ? 38.096 15.129  37.135 1.00 89.21  ? 9   LYS Y CD  1 
ATOM   1213 C CE  . LYS B 2 12  ? 37.265 15.535  38.349 1.00 99.50  ? 9   LYS Y CE  1 
ATOM   1214 N NZ  . LYS B 2 12  ? 37.609 16.888  38.871 1.00 97.53  ? 9   LYS Y NZ  1 
ATOM   1215 N N   . ILE B 2 13  ? 37.557 10.204  39.725 1.00 50.68  ? 10  ILE Y N   1 
ATOM   1216 C CA  . ILE B 2 13  ? 37.908 9.449   40.924 1.00 54.00  ? 10  ILE Y CA  1 
ATOM   1217 C C   . ILE B 2 13  ? 38.068 7.951   40.661 1.00 53.22  ? 10  ILE Y C   1 
ATOM   1218 O O   . ILE B 2 13  ? 37.118 7.274   40.254 1.00 57.65  ? 10  ILE Y O   1 
ATOM   1219 C CB  . ILE B 2 13  ? 36.852 9.653   42.043 1.00 55.57  ? 10  ILE Y CB  1 
ATOM   1220 C CG1 . ILE B 2 13  ? 36.690 11.143  42.358 1.00 63.55  ? 10  ILE Y CG1 1 
ATOM   1221 C CG2 . ILE B 2 13  ? 37.251 8.890   43.304 1.00 46.36  ? 10  ILE Y CG2 1 
ATOM   1222 C CD1 . ILE B 2 13  ? 37.943 11.802  42.895 1.00 56.83  ? 10  ILE Y CD1 1 
ATOM   1223 N N   . ILE B 2 14  ? 39.275 7.445   40.894 1.00 47.64  ? 11  ILE Y N   1 
ATOM   1224 C CA  . ILE B 2 14  ? 39.567 6.028   40.716 1.00 43.03  ? 11  ILE Y CA  1 
ATOM   1225 C C   . ILE B 2 14  ? 39.742 5.382   42.096 1.00 36.45  ? 11  ILE Y C   1 
ATOM   1226 O O   . ILE B 2 14  ? 40.720 5.642   42.804 1.00 36.74  ? 11  ILE Y O   1 
ATOM   1227 C CB  . ILE B 2 14  ? 40.822 5.812   39.821 1.00 44.67  ? 11  ILE Y CB  1 
ATOM   1228 C CG1 . ILE B 2 14  ? 41.125 4.318   39.687 1.00 55.87  ? 11  ILE Y CG1 1 
ATOM   1229 C CG2 . ILE B 2 14  ? 42.020 6.585   40.362 1.00 44.72  ? 11  ILE Y CG2 1 
ATOM   1230 C CD1 . ILE B 2 14  ? 42.224 4.000   38.694 1.00 70.22  ? 11  ILE Y CD1 1 
ATOM   1231 N N   . LEU B 2 15  ? 38.760 4.580   42.493 1.00 31.31  ? 12  LEU Y N   1 
ATOM   1232 C CA  . LEU B 2 15  ? 38.778 3.915   43.791 1.00 26.14  ? 12  LEU Y CA  1 
ATOM   1233 C C   . LEU B 2 15  ? 39.593 2.617   43.778 1.00 26.98  ? 12  LEU Y C   1 
ATOM   1234 O O   . LEU B 2 15  ? 39.305 1.703   43.003 1.00 27.48  ? 12  LEU Y O   1 
ATOM   1235 C CB  . LEU B 2 15  ? 37.337 3.639   44.243 1.00 29.26  ? 12  LEU Y CB  1 
ATOM   1236 C CG  . LEU B 2 15  ? 37.098 3.118   45.665 1.00 39.46  ? 12  LEU Y CG  1 
ATOM   1237 C CD1 . LEU B 2 15  ? 37.573 4.140   46.683 1.00 46.43  ? 12  LEU Y CD1 1 
ATOM   1238 C CD2 . LEU B 2 15  ? 35.620 2.825   45.868 1.00 40.76  ? 12  LEU Y CD2 1 
ATOM   1239 N N   . VAL B 2 16  ? 40.619 2.554   44.623 1.00 25.03  ? 13  VAL Y N   1 
ATOM   1240 C CA  . VAL B 2 16  ? 41.482 1.379   44.731 1.00 23.37  ? 13  VAL Y CA  1 
ATOM   1241 C C   . VAL B 2 16  ? 41.019 0.495   45.893 1.00 30.56  ? 13  VAL Y C   1 
ATOM   1242 O O   . VAL B 2 16  ? 40.897 0.964   47.028 1.00 36.19  ? 13  VAL Y O   1 
ATOM   1243 C CB  . VAL B 2 16  ? 42.958 1.793   44.968 1.00 17.74  ? 13  VAL Y CB  1 
ATOM   1244 C CG1 . VAL B 2 16  ? 43.851 0.567   45.105 1.00 8.42   ? 13  VAL Y CG1 1 
ATOM   1245 C CG2 . VAL B 2 16  ? 43.445 2.673   43.834 1.00 25.76  ? 13  VAL Y CG2 1 
ATOM   1246 N N   . SER B 2 17  ? 40.748 -0.776  45.609 1.00 31.46  ? 14  SER Y N   1 
ATOM   1247 C CA  . SER B 2 17  ? 40.305 -1.716  46.637 1.00 33.84  ? 14  SER Y CA  1 
ATOM   1248 C C   . SER B 2 17  ? 41.278 -2.885  46.797 1.00 33.36  ? 14  SER Y C   1 
ATOM   1249 O O   . SER B 2 17  ? 42.191 -3.058  45.989 1.00 30.00  ? 14  SER Y O   1 
ATOM   1250 C CB  . SER B 2 17  ? 38.904 -2.240  46.313 1.00 37.00  ? 14  SER Y CB  1 
ATOM   1251 O OG  . SER B 2 17  ? 37.989 -1.173  46.139 1.00 47.26  ? 14  SER Y OG  1 
ATOM   1252 N N   . SER B 2 18  ? 41.105 -3.659  47.864 1.00 38.32  ? 15  SER Y N   1 
ATOM   1253 C CA  . SER B 2 18  ? 41.966 -4.808  48.126 1.00 36.10  ? 15  SER Y CA  1 
ATOM   1254 C C   . SER B 2 18  ? 41.413 -6.061  47.456 1.00 33.39  ? 15  SER Y C   1 
ATOM   1255 O O   . SER B 2 18  ? 40.197 -6.227  47.333 1.00 31.81  ? 15  SER Y O   1 
ATOM   1256 C CB  . SER B 2 18  ? 42.098 -5.047  49.634 1.00 32.68  ? 15  SER Y CB  1 
ATOM   1257 O OG  . SER B 2 18  ? 42.691 -3.936  50.292 1.00 47.27  ? 15  SER Y OG  1 
ATOM   1258 N N   . ALA B 2 19  ? 42.313 -6.924  46.997 1.00 33.04  ? 16  ALA Y N   1 
ATOM   1259 C CA  . ALA B 2 19  ? 41.929 -8.175  46.353 1.00 35.72  ? 16  ALA Y CA  1 
ATOM   1260 C C   . ALA B 2 19  ? 41.536 -9.196  47.424 1.00 33.78  ? 16  ALA Y C   1 
ATOM   1261 O O   . ALA B 2 19  ? 41.857 -9.028  48.601 1.00 31.75  ? 16  ALA Y O   1 
ATOM   1262 C CB  . ALA B 2 19  ? 43.083 -8.709  45.505 1.00 20.05  ? 16  ALA Y CB  1 
ATOM   1263 N N   . ASN B 2 20  ? 40.842 -10.250 47.008 1.00 35.69  ? 17  ASN Y N   1 
ATOM   1264 C CA  . ASN B 2 20  ? 40.401 -11.315 47.911 1.00 40.35  ? 17  ASN Y CA  1 
ATOM   1265 C C   . ASN B 2 20  ? 39.397 -10.850 48.966 1.00 32.42  ? 17  ASN Y C   1 
ATOM   1266 O O   . ASN B 2 20  ? 39.176 -11.530 49.969 1.00 33.29  ? 17  ASN Y O   1 
ATOM   1267 C CB  . ASN B 2 20  ? 41.603 -11.978 48.600 1.00 52.99  ? 17  ASN Y CB  1 
ATOM   1268 C CG  . ASN B 2 20  ? 42.577 -12.605 47.617 1.00 57.22  ? 17  ASN Y CG  1 
ATOM   1269 O OD1 . ASN B 2 20  ? 42.354 -12.598 46.405 1.00 55.92  ? 17  ASN Y OD1 1 
ATOM   1270 N ND2 . ASN B 2 20  ? 43.670 -13.147 48.137 1.00 71.58  ? 17  ASN Y ND2 1 
ATOM   1271 N N   . GLU B 2 21  ? 38.771 -9.706  48.727 1.00 23.59  ? 18  GLU Y N   1 
ATOM   1272 C CA  . GLU B 2 21  ? 37.787 -9.167  49.658 1.00 16.32  ? 18  GLU Y CA  1 
ATOM   1273 C C   . GLU B 2 21  ? 36.553 -8.759  48.878 1.00 16.55  ? 18  GLU Y C   1 
ATOM   1274 O O   . GLU B 2 21  ? 36.625 -8.546  47.670 1.00 22.01  ? 18  GLU Y O   1 
ATOM   1275 C CB  . GLU B 2 21  ? 38.357 -7.953  50.396 1.00 28.23  ? 18  GLU Y CB  1 
ATOM   1276 C CG  . GLU B 2 21  ? 39.554 -8.270  51.288 1.00 47.16  ? 18  GLU Y CG  1 
ATOM   1277 C CD  . GLU B 2 21  ? 40.117 -7.052  52.011 1.00 47.53  ? 18  GLU Y CD  1 
ATOM   1278 O OE1 . GLU B 2 21  ? 39.507 -5.961  51.945 1.00 37.68  ? 18  GLU Y OE1 1 
ATOM   1279 O OE2 . GLU B 2 21  ? 41.181 -7.193  52.655 1.00 45.16  ? 18  GLU Y OE2 1 
ATOM   1280 N N   . ILE B 2 22  ? 35.413 -8.686  49.554 1.00 26.75  ? 19  ILE Y N   1 
ATOM   1281 C CA  . ILE B 2 22  ? 34.177 -8.290  48.891 1.00 37.04  ? 19  ILE Y CA  1 
ATOM   1282 C C   . ILE B 2 22  ? 34.214 -6.774  48.699 1.00 41.10  ? 19  ILE Y C   1 
ATOM   1283 O O   . ILE B 2 22  ? 34.792 -6.053  49.518 1.00 43.35  ? 19  ILE Y O   1 
ATOM   1284 C CB  . ILE B 2 22  ? 32.926 -8.708  49.713 1.00 33.01  ? 19  ILE Y CB  1 
ATOM   1285 C CG1 . ILE B 2 22  ? 31.646 -8.433  48.918 1.00 26.56  ? 19  ILE Y CG1 1 
ATOM   1286 C CG2 . ILE B 2 22  ? 32.892 -7.977  51.048 1.00 46.54  ? 19  ILE Y CG2 1 
ATOM   1287 C CD1 . ILE B 2 22  ? 30.387 -8.916  49.598 1.00 22.93  ? 19  ILE Y CD1 1 
ATOM   1288 N N   . ASP B 2 23  ? 33.634 -6.292  47.607 1.00 44.72  ? 20  ASP Y N   1 
ATOM   1289 C CA  . ASP B 2 23  ? 33.620 -4.861  47.340 1.00 47.94  ? 20  ASP Y CA  1 
ATOM   1290 C C   . ASP B 2 23  ? 32.359 -4.462  46.588 1.00 40.03  ? 20  ASP Y C   1 
ATOM   1291 O O   . ASP B 2 23  ? 31.761 -5.279  45.882 1.00 42.27  ? 20  ASP Y O   1 
ATOM   1292 C CB  . ASP B 2 23  ? 34.867 -4.458  46.552 1.00 60.31  ? 20  ASP Y CB  1 
ATOM   1293 C CG  . ASP B 2 23  ? 35.103 -2.959  46.561 1.00 61.57  ? 20  ASP Y CG  1 
ATOM   1294 O OD1 . ASP B 2 23  ? 35.020 -2.340  47.645 1.00 45.60  ? 20  ASP Y OD1 1 
ATOM   1295 O OD2 . ASP B 2 23  ? 35.384 -2.403  45.481 1.00 72.39  ? 20  ASP Y OD2 1 
ATOM   1296 N N   . VAL B 2 24  ? 31.951 -3.210  46.761 1.00 32.12  ? 21  VAL Y N   1 
ATOM   1297 C CA  . VAL B 2 24  ? 30.753 -2.690  46.117 1.00 29.70  ? 21  VAL Y CA  1 
ATOM   1298 C C   . VAL B 2 24  ? 31.053 -1.333  45.490 1.00 31.70  ? 21  VAL Y C   1 
ATOM   1299 O O   . VAL B 2 24  ? 31.807 -0.536  46.049 1.00 42.69  ? 21  VAL Y O   1 
ATOM   1300 C CB  . VAL B 2 24  ? 29.605 -2.529  47.138 1.00 25.14  ? 21  VAL Y CB  1 
ATOM   1301 C CG1 . VAL B 2 24  ? 28.340 -2.038  46.454 1.00 31.70  ? 21  VAL Y CG1 1 
ATOM   1302 C CG2 . VAL B 2 24  ? 29.338 -3.844  47.844 1.00 38.85  ? 21  VAL Y CG2 1 
ATOM   1303 N N   . ARG B 2 25  ? 30.482 -1.088  44.317 1.00 29.47  ? 22  ARG Y N   1 
ATOM   1304 C CA  . ARG B 2 25  ? 30.672 0.173   43.612 1.00 25.48  ? 22  ARG Y CA  1 
ATOM   1305 C C   . ARG B 2 25  ? 29.311 0.697   43.164 1.00 30.23  ? 22  ARG Y C   1 
ATOM   1306 O O   . ARG B 2 25  ? 28.573 0.010   42.458 1.00 36.60  ? 22  ARG Y O   1 
ATOM   1307 C CB  . ARG B 2 25  ? 31.578 -0.016  42.389 1.00 17.31  ? 22  ARG Y CB  1 
ATOM   1308 C CG  . ARG B 2 25  ? 32.979 -0.515  42.699 1.00 17.94  ? 22  ARG Y CG  1 
ATOM   1309 C CD  . ARG B 2 25  ? 33.742 0.472   43.558 1.00 34.41  ? 22  ARG Y CD  1 
ATOM   1310 N NE  . ARG B 2 25  ? 35.060 -0.036  43.926 1.00 24.14  ? 22  ARG Y NE  1 
ATOM   1311 C CZ  . ARG B 2 25  ? 36.185 0.264   43.286 1.00 25.33  ? 22  ARG Y CZ  1 
ATOM   1312 N NH1 . ARG B 2 25  ? 36.164 1.080   42.241 1.00 50.51  ? 22  ARG Y NH1 1 
ATOM   1313 N NH2 . ARG B 2 25  ? 37.330 -0.270  43.679 1.00 19.31  ? 22  ARG Y NH2 1 
ATOM   1314 N N   . PRO B 2 26  ? 28.907 1.869   43.677 1.00 30.69  ? 23  PRO Y N   1 
ATOM   1315 C CA  . PRO B 2 26  ? 27.617 2.443   43.287 1.00 27.90  ? 23  PRO Y CA  1 
ATOM   1316 C C   . PRO B 2 26  ? 27.804 3.313   42.036 1.00 26.34  ? 23  PRO Y C   1 
ATOM   1317 O O   . PRO B 2 26  ? 28.934 3.630   41.659 1.00 22.31  ? 23  PRO Y O   1 
ATOM   1318 C CB  . PRO B 2 26  ? 27.251 3.279   44.511 1.00 15.66  ? 23  PRO Y CB  1 
ATOM   1319 C CG  . PRO B 2 26  ? 28.578 3.811   44.934 1.00 17.49  ? 23  PRO Y CG  1 
ATOM   1320 C CD  . PRO B 2 26  ? 29.485 2.598   44.821 1.00 22.78  ? 23  PRO Y CD  1 
ATOM   1321 N N   . CYS B 2 27  ? 26.710 3.675   41.376 1.00 25.69  ? 24  CYS Y N   1 
ATOM   1322 C CA  . CYS B 2 27  ? 26.800 4.514   40.187 1.00 24.75  ? 24  CYS Y CA  1 
ATOM   1323 C C   . CYS B 2 27  ? 26.947 5.968   40.657 1.00 23.28  ? 24  CYS Y C   1 
ATOM   1324 O O   . CYS B 2 27  ? 26.031 6.528   41.267 1.00 26.64  ? 24  CYS Y O   1 
ATOM   1325 C CB  . CYS B 2 27  ? 25.550 4.326   39.319 1.00 29.95  ? 24  CYS Y CB  1 
ATOM   1326 S SG  . CYS B 2 27  ? 25.627 5.065   37.653 1.00 31.45  ? 24  CYS Y SG  1 
ATOM   1327 N N   . PRO B 2 28  ? 28.124 6.575   40.429 1.00 15.52  ? 25  PRO Y N   1 
ATOM   1328 C CA  . PRO B 2 28  ? 28.429 7.958   40.820 1.00 16.80  ? 25  PRO Y CA  1 
ATOM   1329 C C   . PRO B 2 28  ? 27.587 9.035   40.136 1.00 24.65  ? 25  PRO Y C   1 
ATOM   1330 O O   . PRO B 2 28  ? 28.070 9.749   39.257 1.00 29.16  ? 25  PRO Y O   1 
ATOM   1331 C CB  . PRO B 2 28  ? 29.919 8.085   40.480 1.00 11.08  ? 25  PRO Y CB  1 
ATOM   1332 C CG  . PRO B 2 28  ? 30.092 7.136   39.345 1.00 11.15  ? 25  PRO Y CG  1 
ATOM   1333 C CD  . PRO B 2 28  ? 29.287 5.947   39.777 1.00 18.69  ? 25  PRO Y CD  1 
ATOM   1334 N N   . LEU B 2 29  ? 26.346 9.181   40.587 1.00 33.07  ? 26  LEU Y N   1 
ATOM   1335 C CA  . LEU B 2 29  ? 25.425 10.163  40.023 1.00 44.06  ? 26  LEU Y CA  1 
ATOM   1336 C C   . LEU B 2 29  ? 24.932 11.126  41.095 1.00 51.75  ? 26  LEU Y C   1 
ATOM   1337 O O   . LEU B 2 29  ? 24.631 10.711  42.217 1.00 55.67  ? 26  LEU Y O   1 
ATOM   1338 C CB  . LEU B 2 29  ? 24.204 9.457   39.443 1.00 45.10  ? 26  LEU Y CB  1 
ATOM   1339 C CG  . LEU B 2 29  ? 24.405 8.241   38.551 1.00 49.75  ? 26  LEU Y CG  1 
ATOM   1340 C CD1 . LEU B 2 29  ? 23.286 7.258   38.809 1.00 43.34  ? 26  LEU Y CD1 1 
ATOM   1341 C CD2 . LEU B 2 29  ? 24.454 8.665   37.101 1.00 59.06  ? 26  LEU Y CD2 1 
ATOM   1342 N N   . ASN B 2 30  ? 24.797 12.396  40.729 1.00 53.38  ? 27  ASN Y N   1 
ATOM   1343 C CA  . ASN B 2 30  ? 24.305 13.418  41.652 1.00 51.11  ? 27  ASN Y CA  1 
ATOM   1344 C C   . ASN B 2 30  ? 22.815 13.154  41.878 1.00 45.11  ? 27  ASN Y C   1 
ATOM   1345 O O   . ASN B 2 30  ? 22.179 12.459  41.082 1.00 38.31  ? 27  ASN Y O   1 
ATOM   1346 C CB  . ASN B 2 30  ? 24.501 14.826  41.063 1.00 52.68  ? 27  ASN Y CB  1 
ATOM   1347 C CG  . ASN B 2 30  ? 25.962 15.156  40.795 1.00 62.52  ? 27  ASN Y CG  1 
ATOM   1348 O OD1 . ASN B 2 30  ? 26.374 15.301  39.643 1.00 78.46  ? 27  ASN Y OD1 1 
ATOM   1349 N ND2 . ASN B 2 30  ? 26.750 15.276  41.855 1.00 55.96  ? 27  ASN Y ND2 1 
ATOM   1350 N N   . PRO B 2 31  ? 22.242 13.681  42.972 1.00 52.68  ? 28  PRO Y N   1 
ATOM   1351 C CA  . PRO B 2 31  ? 20.820 13.487  43.281 1.00 65.04  ? 28  PRO Y CA  1 
ATOM   1352 C C   . PRO B 2 31  ? 19.900 13.769  42.096 1.00 73.22  ? 28  PRO Y C   1 
ATOM   1353 O O   . PRO B 2 31  ? 18.926 13.052  41.869 1.00 71.58  ? 28  PRO Y O   1 
ATOM   1354 C CB  . PRO B 2 31  ? 20.592 14.479  44.417 1.00 71.07  ? 28  PRO Y CB  1 
ATOM   1355 C CG  . PRO B 2 31  ? 21.884 14.414  45.156 1.00 69.32  ? 28  PRO Y CG  1 
ATOM   1356 C CD  . PRO B 2 31  ? 22.901 14.463  44.034 1.00 59.18  ? 28  PRO Y CD  1 
ATOM   1357 N N   . ASN B 2 32  ? 20.249 14.788  41.316 1.00 80.71  ? 29  ASN Y N   1 
ATOM   1358 C CA  . ASN B 2 32  ? 19.472 15.180  40.143 1.00 87.05  ? 29  ASN Y CA  1 
ATOM   1359 C C   . ASN B 2 32  ? 19.587 14.199  38.973 1.00 92.38  ? 29  ASN Y C   1 
ATOM   1360 O O   . ASN B 2 32  ? 19.118 14.490  37.871 1.00 98.28  ? 29  ASN Y O   1 
ATOM   1361 C CB  . ASN B 2 32  ? 19.892 16.581  39.678 1.00 90.33  ? 29  ASN Y CB  1 
ATOM   1362 C CG  . ASN B 2 32  ? 21.328 16.630  39.175 1.00 95.90  ? 29  ASN Y CG  1 
ATOM   1363 O OD1 . ASN B 2 32  ? 22.258 16.890  39.940 1.00 93.24  ? 29  ASN Y OD1 1 
ATOM   1364 N ND2 . ASN B 2 32  ? 21.513 16.373  37.888 1.00 99.99  ? 29  ASN Y ND2 1 
ATOM   1365 N N   . GLU B 2 33  ? 20.215 13.050  39.204 1.00 90.49  ? 30  GLU Y N   1 
ATOM   1366 C CA  . GLU B 2 33  ? 20.393 12.042  38.163 1.00 87.48  ? 30  GLU Y CA  1 
ATOM   1367 C C   . GLU B 2 33  ? 19.990 10.663  38.681 1.00 90.08  ? 30  GLU Y C   1 
ATOM   1368 O O   . GLU B 2 33  ? 20.685 9.671   38.456 1.00 92.94  ? 30  GLU Y O   1 
ATOM   1369 C CB  . GLU B 2 33  ? 21.854 12.022  37.700 1.00 78.25  ? 30  GLU Y CB  1 
ATOM   1370 C CG  . GLU B 2 33  ? 22.370 13.367  37.207 1.00 78.78  ? 30  GLU Y CG  1 
ATOM   1371 C CD  . GLU B 2 33  ? 23.862 13.377  36.912 1.00 79.45  ? 30  GLU Y CD  1 
ATOM   1372 O OE1 . GLU B 2 33  ? 24.606 12.561  37.500 1.00 74.85  ? 30  GLU Y OE1 1 
ATOM   1373 O OE2 . GLU B 2 33  ? 24.293 14.216  36.093 1.00 72.07  ? 30  GLU Y OE2 1 
ATOM   1374 N N   . HIS B 2 34  ? 18.872 10.601  39.393 1.00 92.57  ? 31  HIS Y N   1 
ATOM   1375 C CA  . HIS B 2 34  ? 18.396 9.336   39.940 1.00 99.48  ? 31  HIS Y CA  1 
ATOM   1376 C C   . HIS B 2 34  ? 16.941 9.064   39.567 1.00 104.18 ? 31  HIS Y C   1 
ATOM   1377 O O   . HIS B 2 34  ? 16.153 8.620   40.400 1.00 106.76 ? 31  HIS Y O   1 
ATOM   1378 C CB  . HIS B 2 34  ? 18.550 9.322   41.466 1.00 109.33 ? 31  HIS Y CB  1 
ATOM   1379 C CG  . HIS B 2 34  ? 19.972 9.342   41.936 1.00 120.04 ? 31  HIS Y CG  1 
ATOM   1380 N ND1 . HIS B 2 34  ? 21.002 8.764   41.226 1.00 120.87 ? 31  HIS Y ND1 1 
ATOM   1381 C CD2 . HIS B 2 34  ? 20.532 9.855   43.059 1.00 123.97 ? 31  HIS Y CD2 1 
ATOM   1382 C CE1 . HIS B 2 34  ? 22.134 8.918   41.890 1.00 123.36 ? 31  HIS Y CE1 1 
ATOM   1383 N NE2 . HIS B 2 34  ? 21.876 9.578   43.005 1.00 124.60 ? 31  HIS Y NE2 1 
ATOM   1384 N N   . LYS B 2 35  ? 16.594 9.322   38.310 1.00 105.41 ? 32  LYS Y N   1 
ATOM   1385 C CA  . LYS B 2 35  ? 15.227 9.104   37.844 1.00 102.95 ? 32  LYS Y CA  1 
ATOM   1386 C C   . LYS B 2 35  ? 15.019 7.731   37.208 1.00 94.49  ? 32  LYS Y C   1 
ATOM   1387 O O   . LYS B 2 35  ? 13.957 7.126   37.355 1.00 92.30  ? 32  LYS Y O   1 
ATOM   1388 C CB  . LYS B 2 35  ? 14.815 10.199  36.853 1.00 112.90 ? 32  LYS Y CB  1 
ATOM   1389 C CG  . LYS B 2 35  ? 15.600 10.197  35.548 1.00 121.05 ? 32  LYS Y CG  1 
ATOM   1390 C CD  . LYS B 2 35  ? 15.030 11.188  34.544 1.00 129.00 ? 32  LYS Y CD  1 
ATOM   1391 C CE  . LYS B 2 35  ? 15.293 12.625  34.953 1.00 132.05 ? 32  LYS Y CE  1 
ATOM   1392 N NZ  . LYS B 2 35  ? 14.830 13.575  33.905 1.00 136.23 ? 32  LYS Y NZ  1 
ATOM   1393 N N   . GLY B 2 36  ? 16.033 7.244   36.501 1.00 87.31  ? 33  GLY Y N   1 
ATOM   1394 C CA  . GLY B 2 36  ? 15.912 5.959   35.842 1.00 82.38  ? 33  GLY Y CA  1 
ATOM   1395 C C   . GLY B 2 36  ? 16.684 4.828   36.484 1.00 77.94  ? 33  GLY Y C   1 
ATOM   1396 O O   . GLY B 2 36  ? 17.532 5.050   37.351 1.00 80.35  ? 33  GLY Y O   1 
ATOM   1397 N N   . THR B 2 37  ? 16.402 3.610   36.034 1.00 71.30  ? 34  THR Y N   1 
ATOM   1398 C CA  . THR B 2 37  ? 17.058 2.419   36.551 1.00 61.34  ? 34  THR Y CA  1 
ATOM   1399 C C   . THR B 2 37  ? 18.498 2.323   36.064 1.00 55.06  ? 34  THR Y C   1 
ATOM   1400 O O   . THR B 2 37  ? 18.798 2.619   34.903 1.00 54.45  ? 34  THR Y O   1 
ATOM   1401 C CB  . THR B 2 37  ? 16.293 1.146   36.152 1.00 64.33  ? 34  THR Y CB  1 
ATOM   1402 O OG1 . THR B 2 37  ? 16.101 1.125   34.731 1.00 58.43  ? 34  THR Y OG1 1 
ATOM   1403 C CG2 . THR B 2 37  ? 14.934 1.100   36.851 1.00 66.39  ? 34  THR Y CG2 1 
ATOM   1404 N N   . ILE B 2 38  ? 19.382 1.916   36.965 1.00 47.71  ? 35  ILE Y N   1 
ATOM   1405 C CA  . ILE B 2 38  ? 20.794 1.782   36.655 1.00 39.78  ? 35  ILE Y CA  1 
ATOM   1406 C C   . ILE B 2 38  ? 21.103 0.376   36.159 1.00 38.43  ? 35  ILE Y C   1 
ATOM   1407 O O   . ILE B 2 38  ? 20.552 -0.606  36.665 1.00 39.80  ? 35  ILE Y O   1 
ATOM   1408 C CB  . ILE B 2 38  ? 21.653 2.098   37.891 1.00 36.15  ? 35  ILE Y CB  1 
ATOM   1409 C CG1 . ILE B 2 38  ? 21.276 3.479   38.438 1.00 53.62  ? 35  ILE Y CG1 1 
ATOM   1410 C CG2 . ILE B 2 38  ? 23.132 2.054   37.529 1.00 28.84  ? 35  ILE Y CG2 1 
ATOM   1411 C CD1 . ILE B 2 38  ? 21.917 3.825   39.765 1.00 71.00  ? 35  ILE Y CD1 1 
ATOM   1412 N N   . THR B 2 39  ? 21.977 0.291   35.163 1.00 32.38  ? 36  THR Y N   1 
ATOM   1413 C CA  . THR B 2 39  ? 22.378 -0.984  34.584 1.00 28.34  ? 36  THR Y CA  1 
ATOM   1414 C C   . THR B 2 39  ? 23.880 -0.937  34.311 1.00 24.96  ? 36  THR Y C   1 
ATOM   1415 O O   . THR B 2 39  ? 24.368 -0.008  33.675 1.00 30.90  ? 36  THR Y O   1 
ATOM   1416 C CB  . THR B 2 39  ? 21.631 -1.250  33.256 1.00 39.38  ? 36  THR Y CB  1 
ATOM   1417 O OG1 . THR B 2 39  ? 20.219 -1.074  33.450 1.00 45.00  ? 36  THR Y OG1 1 
ATOM   1418 C CG2 . THR B 2 39  ? 21.901 -2.669  32.762 1.00 39.50  ? 36  THR Y CG2 1 
ATOM   1419 N N   . TRP B 2 40  ? 24.607 -1.931  34.805 1.00 22.58  ? 37  TRP Y N   1 
ATOM   1420 C CA  . TRP B 2 40  ? 26.051 -1.994  34.626 1.00 25.10  ? 37  TRP Y CA  1 
ATOM   1421 C C   . TRP B 2 40  ? 26.515 -2.764  33.390 1.00 27.92  ? 37  TRP Y C   1 
ATOM   1422 O O   . TRP B 2 40  ? 25.855 -3.698  32.937 1.00 33.22  ? 37  TRP Y O   1 
ATOM   1423 C CB  . TRP B 2 40  ? 26.696 -2.583  35.875 1.00 28.35  ? 37  TRP Y CB  1 
ATOM   1424 C CG  . TRP B 2 40  ? 26.572 -1.705  37.070 1.00 14.79  ? 37  TRP Y CG  1 
ATOM   1425 C CD1 . TRP B 2 40  ? 25.511 -1.623  37.929 1.00 5.88   ? 37  TRP Y CD1 1 
ATOM   1426 C CD2 . TRP B 2 40  ? 27.552 -0.786  37.550 1.00 6.31   ? 37  TRP Y CD2 1 
ATOM   1427 N NE1 . TRP B 2 40  ? 25.777 -0.708  38.917 1.00 7.30   ? 37  TRP Y NE1 1 
ATOM   1428 C CE2 . TRP B 2 40  ? 27.025 -0.180  38.709 1.00 11.74  ? 37  TRP Y CE2 1 
ATOM   1429 C CE3 . TRP B 2 40  ? 28.832 -0.417  37.111 1.00 21.19  ? 37  TRP Y CE3 1 
ATOM   1430 C CZ2 . TRP B 2 40  ? 27.734 0.778   39.440 1.00 13.04  ? 37  TRP Y CZ2 1 
ATOM   1431 C CZ3 . TRP B 2 40  ? 29.535 0.534   37.836 1.00 21.53  ? 37  TRP Y CZ3 1 
ATOM   1432 C CH2 . TRP B 2 40  ? 28.984 1.121   38.989 1.00 22.81  ? 37  TRP Y CH2 1 
ATOM   1433 N N   . TYR B 2 41  ? 27.668 -2.363  32.863 1.00 23.50  ? 38  TYR Y N   1 
ATOM   1434 C CA  . TYR B 2 41  ? 28.277 -2.973  31.684 1.00 25.90  ? 38  TYR Y CA  1 
ATOM   1435 C C   . TYR B 2 41  ? 29.776 -3.050  31.938 1.00 30.25  ? 38  TYR Y C   1 
ATOM   1436 O O   . TYR B 2 41  ? 30.311 -2.274  32.735 1.00 33.86  ? 38  TYR Y O   1 
ATOM   1437 C CB  . TYR B 2 41  ? 28.007 -2.122  30.432 1.00 28.43  ? 38  TYR Y CB  1 
ATOM   1438 C CG  . TYR B 2 41  ? 26.537 -1.975  30.103 1.00 19.37  ? 38  TYR Y CG  1 
ATOM   1439 C CD1 . TYR B 2 41  ? 25.749 -1.034  30.759 1.00 18.60  ? 38  TYR Y CD1 1 
ATOM   1440 C CD2 . TYR B 2 41  ? 25.924 -2.812  29.179 1.00 13.37  ? 38  TYR Y CD2 1 
ATOM   1441 C CE1 . TYR B 2 41  ? 24.390 -0.937  30.508 1.00 30.25  ? 38  TYR Y CE1 1 
ATOM   1442 C CE2 . TYR B 2 41  ? 24.564 -2.721  28.920 1.00 9.69   ? 38  TYR Y CE2 1 
ATOM   1443 C CZ  . TYR B 2 41  ? 23.803 -1.784  29.590 1.00 21.63  ? 38  TYR Y CZ  1 
ATOM   1444 O OH  . TYR B 2 41  ? 22.448 -1.699  29.358 1.00 32.73  ? 38  TYR Y OH  1 
ATOM   1445 N N   . LYS B 2 42  ? 30.448 -3.993  31.288 1.00 39.70  ? 39  LYS Y N   1 
ATOM   1446 C CA  . LYS B 2 42  ? 31.886 -4.151  31.469 1.00 50.05  ? 39  LYS Y CA  1 
ATOM   1447 C C   . LYS B 2 42  ? 32.682 -3.276  30.504 1.00 48.88  ? 39  LYS Y C   1 
ATOM   1448 O O   . LYS B 2 42  ? 32.130 -2.352  29.910 1.00 49.43  ? 39  LYS Y O   1 
ATOM   1449 C CB  . LYS B 2 42  ? 32.283 -5.624  31.342 1.00 70.21  ? 39  LYS Y CB  1 
ATOM   1450 C CG  . LYS B 2 42  ? 31.931 -6.266  30.011 1.00 101.04 ? 39  LYS Y CG  1 
ATOM   1451 C CD  . LYS B 2 42  ? 32.194 -7.769  30.030 1.00 124.14 ? 39  LYS Y CD  1 
ATOM   1452 C CE  . LYS B 2 42  ? 33.651 -8.099  30.327 1.00 133.20 ? 39  LYS Y CE  1 
ATOM   1453 N NZ  . LYS B 2 42  ? 33.910 -9.566  30.250 1.00 134.84 ? 39  LYS Y NZ  1 
ATOM   1454 N N   . ASP B 2 43  ? 33.969 -3.581  30.347 1.00 48.53  ? 40  ASP Y N   1 
ATOM   1455 C CA  . ASP B 2 43  ? 34.874 -2.830  29.473 1.00 54.06  ? 40  ASP Y CA  1 
ATOM   1456 C C   . ASP B 2 43  ? 34.268 -2.215  28.210 1.00 61.11  ? 40  ASP Y C   1 
ATOM   1457 O O   . ASP B 2 43  ? 34.686 -1.138  27.786 1.00 68.59  ? 40  ASP Y O   1 
ATOM   1458 C CB  . ASP B 2 43  ? 36.117 -3.661  29.123 1.00 57.44  ? 40  ASP Y CB  1 
ATOM   1459 C CG  . ASP B 2 43  ? 35.784 -5.073  28.650 1.00 86.19  ? 40  ASP Y CG  1 
ATOM   1460 O OD1 . ASP B 2 43  ? 34.636 -5.339  28.236 1.00 101.19 ? 40  ASP Y OD1 1 
ATOM   1461 O OD2 . ASP B 2 43  ? 36.693 -5.929  28.694 1.00 90.77  ? 40  ASP Y OD2 1 
ATOM   1462 N N   . ASP B 2 44  ? 33.308 -2.903  27.598 1.00 63.14  ? 41  ASP Y N   1 
ATOM   1463 C CA  . ASP B 2 44  ? 32.648 -2.387  26.402 1.00 61.75  ? 41  ASP Y CA  1 
ATOM   1464 C C   . ASP B 2 44  ? 31.196 -2.092  26.771 1.00 63.42  ? 41  ASP Y C   1 
ATOM   1465 O O   . ASP B 2 44  ? 30.519 -2.926  27.376 1.00 72.20  ? 41  ASP Y O   1 
ATOM   1466 C CB  . ASP B 2 44  ? 32.730 -3.391  25.243 1.00 51.89  ? 41  ASP Y CB  1 
ATOM   1467 C CG  . ASP B 2 44  ? 31.934 -4.658  25.500 1.00 60.94  ? 41  ASP Y CG  1 
ATOM   1468 O OD1 . ASP B 2 44  ? 30.741 -4.686  25.137 1.00 50.04  ? 41  ASP Y OD1 1 
ATOM   1469 O OD2 . ASP B 2 44  ? 32.501 -5.622  26.057 1.00 74.22  ? 41  ASP Y OD2 1 
ATOM   1470 N N   . SER B 2 45  ? 30.712 -0.925  26.365 1.00 62.42  ? 42  SER Y N   1 
ATOM   1471 C CA  . SER B 2 45  ? 29.354 -0.487  26.677 1.00 65.57  ? 42  SER Y CA  1 
ATOM   1472 C C   . SER B 2 45  ? 28.186 -1.374  26.221 1.00 65.67  ? 42  SER Y C   1 
ATOM   1473 O O   . SER B 2 45  ? 27.027 -1.049  26.483 1.00 68.05  ? 42  SER Y O   1 
ATOM   1474 C CB  . SER B 2 45  ? 29.144 0.939   26.171 1.00 66.37  ? 42  SER Y CB  1 
ATOM   1475 O OG  . SER B 2 45  ? 27.973 1.507   26.721 1.00 73.72  ? 42  SER Y OG  1 
ATOM   1476 N N   . LYS B 2 46  ? 28.471 -2.485  25.548 1.00 63.73  ? 43  LYS Y N   1 
ATOM   1477 C CA  . LYS B 2 46  ? 27.398 -3.367  25.090 1.00 61.15  ? 43  LYS Y CA  1 
ATOM   1478 C C   . LYS B 2 46  ? 27.202 -4.630  25.923 1.00 54.79  ? 43  LYS Y C   1 
ATOM   1479 O O   . LYS B 2 46  ? 26.090 -5.153  25.998 1.00 56.20  ? 43  LYS Y O   1 
ATOM   1480 C CB  . LYS B 2 46  ? 27.580 -3.739  23.617 1.00 65.74  ? 43  LYS Y CB  1 
ATOM   1481 C CG  . LYS B 2 46  ? 27.143 -2.654  22.655 1.00 81.27  ? 43  LYS Y CG  1 
ATOM   1482 C CD  . LYS B 2 46  ? 26.922 -3.222  21.265 1.00 95.91  ? 43  LYS Y CD  1 
ATOM   1483 C CE  . LYS B 2 46  ? 26.397 -2.159  20.316 1.00 109.38 ? 43  LYS Y CE  1 
ATOM   1484 N NZ  . LYS B 2 46  ? 26.082 -2.710  18.969 1.00 112.58 ? 43  LYS Y NZ  1 
ATOM   1485 N N   . THR B 2 47  ? 28.267 -5.107  26.559 1.00 42.62  ? 44  THR Y N   1 
ATOM   1486 C CA  . THR B 2 47  ? 28.178 -6.315  27.363 1.00 36.71  ? 44  THR Y CA  1 
ATOM   1487 C C   . THR B 2 47  ? 27.758 -6.003  28.791 1.00 34.69  ? 44  THR Y C   1 
ATOM   1488 O O   . THR B 2 47  ? 28.524 -5.412  29.555 1.00 39.34  ? 44  THR Y O   1 
ATOM   1489 C CB  . THR B 2 47  ? 29.512 -7.069  27.396 1.00 31.03  ? 44  THR Y CB  1 
ATOM   1490 O OG1 . THR B 2 47  ? 30.025 -7.193  26.064 1.00 56.89  ? 44  THR Y OG1 1 
ATOM   1491 C CG2 . THR B 2 47  ? 29.311 -8.457  27.973 1.00 42.54  ? 44  THR Y CG2 1 
ATOM   1492 N N   . PRO B 2 48  ? 26.529 -6.386  29.168 1.00 28.98  ? 45  PRO Y N   1 
ATOM   1493 C CA  . PRO B 2 48  ? 26.018 -6.142  30.518 1.00 36.93  ? 45  PRO Y CA  1 
ATOM   1494 C C   . PRO B 2 48  ? 26.665 -7.069  31.544 1.00 44.24  ? 45  PRO Y C   1 
ATOM   1495 O O   . PRO B 2 48  ? 27.120 -8.161  31.204 1.00 51.73  ? 45  PRO Y O   1 
ATOM   1496 C CB  . PRO B 2 48  ? 24.528 -6.427  30.367 1.00 33.25  ? 45  PRO Y CB  1 
ATOM   1497 C CG  . PRO B 2 48  ? 24.513 -7.533  29.371 1.00 46.09  ? 45  PRO Y CG  1 
ATOM   1498 C CD  . PRO B 2 48  ? 25.516 -7.063  28.340 1.00 34.76  ? 45  PRO Y CD  1 
ATOM   1499 N N   . VAL B 2 49  ? 26.738 -6.608  32.787 1.00 44.79  ? 46  VAL Y N   1 
ATOM   1500 C CA  . VAL B 2 49  ? 27.320 -7.396  33.863 1.00 43.01  ? 46  VAL Y CA  1 
ATOM   1501 C C   . VAL B 2 49  ? 26.273 -8.390  34.349 1.00 43.76  ? 46  VAL Y C   1 
ATOM   1502 O O   . VAL B 2 49  ? 25.077 -8.083  34.368 1.00 43.81  ? 46  VAL Y O   1 
ATOM   1503 C CB  . VAL B 2 49  ? 27.793 -6.488  35.025 1.00 39.87  ? 46  VAL Y CB  1 
ATOM   1504 C CG1 . VAL B 2 49  ? 28.185 -7.313  36.241 1.00 53.00  ? 46  VAL Y CG1 1 
ATOM   1505 C CG2 . VAL B 2 49  ? 28.977 -5.656  34.571 1.00 33.91  ? 46  VAL Y CG2 1 
ATOM   1506 N N   . SER B 2 50  ? 26.730 -9.582  34.720 1.00 45.73  ? 47  SER Y N   1 
ATOM   1507 C CA  . SER B 2 50  ? 25.856 -10.646 35.201 1.00 50.30  ? 47  SER Y CA  1 
ATOM   1508 C C   . SER B 2 50  ? 24.854 -10.162 36.243 1.00 53.10  ? 47  SER Y C   1 
ATOM   1509 O O   . SER B 2 50  ? 25.151 -9.276  37.052 1.00 52.62  ? 47  SER Y O   1 
ATOM   1510 C CB  . SER B 2 50  ? 26.693 -11.785 35.784 1.00 54.56  ? 47  SER Y CB  1 
ATOM   1511 O OG  . SER B 2 50  ? 25.871 -12.825 36.286 1.00 64.15  ? 47  SER Y OG  1 
ATOM   1512 N N   . THR B 2 51  ? 23.665 -10.752 36.215 1.00 55.09  ? 48  THR Y N   1 
ATOM   1513 C CA  . THR B 2 51  ? 22.604 -10.401 37.148 1.00 57.91  ? 48  THR Y CA  1 
ATOM   1514 C C   . THR B 2 51  ? 22.381 -11.524 38.166 1.00 57.71  ? 48  THR Y C   1 
ATOM   1515 O O   . THR B 2 51  ? 21.623 -11.370 39.125 1.00 53.83  ? 48  THR Y O   1 
ATOM   1516 C CB  . THR B 2 51  ? 21.286 -10.132 36.398 1.00 66.82  ? 48  THR Y CB  1 
ATOM   1517 O OG1 . THR B 2 51  ? 21.570 -9.793  35.034 1.00 77.94  ? 48  THR Y OG1 1 
ATOM   1518 C CG2 . THR B 2 51  ? 20.538 -8.977  37.047 1.00 72.21  ? 48  THR Y CG2 1 
ATOM   1519 N N   . GLU B 2 52  ? 23.047 -12.655 37.956 1.00 58.52  ? 49  GLU Y N   1 
ATOM   1520 C CA  . GLU B 2 52  ? 22.914 -13.794 38.857 1.00 63.11  ? 49  GLU Y CA  1 
ATOM   1521 C C   . GLU B 2 52  ? 23.892 -13.664 40.017 1.00 62.62  ? 49  GLU Y C   1 
ATOM   1522 O O   . GLU B 2 52  ? 25.105 -13.804 39.843 1.00 57.19  ? 49  GLU Y O   1 
ATOM   1523 C CB  . GLU B 2 52  ? 23.138 -15.106 38.101 1.00 74.56  ? 49  GLU Y CB  1 
ATOM   1524 C CG  . GLU B 2 52  ? 22.049 -15.408 37.078 1.00 104.05 ? 49  GLU Y CG  1 
ATOM   1525 C CD  . GLU B 2 52  ? 22.336 -16.653 36.258 1.00 129.07 ? 49  GLU Y CD  1 
ATOM   1526 O OE1 . GLU B 2 52  ? 22.216 -17.771 36.802 1.00 141.65 ? 49  GLU Y OE1 1 
ATOM   1527 O OE2 . GLU B 2 52  ? 22.677 -16.511 35.065 1.00 140.04 ? 49  GLU Y OE2 1 
ATOM   1528 N N   . GLN B 2 53  ? 23.348 -13.416 41.205 1.00 60.24  ? 50  GLN Y N   1 
ATOM   1529 C CA  . GLN B 2 53  ? 24.142 -13.246 42.420 1.00 56.26  ? 50  GLN Y CA  1 
ATOM   1530 C C   . GLN B 2 53  ? 25.172 -14.338 42.698 1.00 51.82  ? 50  GLN Y C   1 
ATOM   1531 O O   . GLN B 2 53  ? 26.071 -14.143 43.512 1.00 54.84  ? 50  GLN Y O   1 
ATOM   1532 C CB  . GLN B 2 53  ? 23.230 -13.094 43.639 1.00 61.28  ? 50  GLN Y CB  1 
ATOM   1533 C CG  . GLN B 2 53  ? 22.451 -11.791 43.692 1.00 72.39  ? 50  GLN Y CG  1 
ATOM   1534 C CD  . GLN B 2 53  ? 21.732 -11.590 45.018 1.00 85.60  ? 50  GLN Y CD  1 
ATOM   1535 O OE1 . GLN B 2 53  ? 20.635 -11.036 45.064 1.00 95.93  ? 50  GLN Y OE1 1 
ATOM   1536 N NE2 . GLN B 2 53  ? 22.364 -12.009 46.105 1.00 86.45  ? 50  GLN Y NE2 1 
ATOM   1537 N N   . ALA B 2 54  ? 25.033 -15.480 42.034 1.00 48.52  ? 51  ALA Y N   1 
ATOM   1538 C CA  . ALA B 2 54  ? 25.952 -16.596 42.221 1.00 47.05  ? 51  ALA Y CA  1 
ATOM   1539 C C   . ALA B 2 54  ? 27.350 -16.336 41.656 1.00 48.55  ? 51  ALA Y C   1 
ATOM   1540 O O   . ALA B 2 54  ? 28.331 -16.915 42.126 1.00 51.84  ? 51  ALA Y O   1 
ATOM   1541 C CB  . ALA B 2 54  ? 25.364 -17.861 41.612 1.00 54.44  ? 51  ALA Y CB  1 
ATOM   1542 N N   . SER B 2 55  ? 27.435 -15.490 40.632 1.00 47.35  ? 52  SER Y N   1 
ATOM   1543 C CA  . SER B 2 55  ? 28.716 -15.172 40.004 1.00 42.75  ? 52  SER Y CA  1 
ATOM   1544 C C   . SER B 2 55  ? 29.462 -14.057 40.737 1.00 39.52  ? 52  SER Y C   1 
ATOM   1545 O O   . SER B 2 55  ? 28.838 -13.165 41.319 1.00 44.05  ? 52  SER Y O   1 
ATOM   1546 C CB  . SER B 2 55  ? 28.506 -14.808 38.532 1.00 40.39  ? 52  SER Y CB  1 
ATOM   1547 O OG  . SER B 2 55  ? 27.465 -13.860 38.374 1.00 50.17  ? 52  SER Y OG  1 
ATOM   1548 N N   . ARG B 2 56  ? 30.793 -14.110 40.690 1.00 31.16  ? 53  ARG Y N   1 
ATOM   1549 C CA  . ARG B 2 56  ? 31.648 -13.122 41.351 1.00 31.40  ? 53  ARG Y CA  1 
ATOM   1550 C C   . ARG B 2 56  ? 31.206 -11.700 41.072 1.00 38.19  ? 53  ARG Y C   1 
ATOM   1551 O O   . ARG B 2 56  ? 30.558 -11.060 41.904 1.00 48.38  ? 53  ARG Y O   1 
ATOM   1552 C CB  . ARG B 2 56  ? 33.099 -13.271 40.900 1.00 13.04  ? 53  ARG Y CB  1 
ATOM   1553 C CG  . ARG B 2 56  ? 33.819 -14.468 41.449 1.00 18.57  ? 53  ARG Y CG  1 
ATOM   1554 C CD  . ARG B 2 56  ? 35.232 -14.500 40.906 1.00 15.87  ? 53  ARG Y CD  1 
ATOM   1555 N NE  . ARG B 2 56  ? 35.971 -13.298 41.275 1.00 35.34  ? 53  ARG Y NE  1 
ATOM   1556 C CZ  . ARG B 2 56  ? 36.604 -12.507 40.414 1.00 42.01  ? 53  ARG Y CZ  1 
ATOM   1557 N NH1 . ARG B 2 56  ? 36.598 -12.774 39.116 1.00 46.12  ? 53  ARG Y NH1 1 
ATOM   1558 N NH2 . ARG B 2 56  ? 37.263 -11.450 40.861 1.00 58.61  ? 53  ARG Y NH2 1 
ATOM   1559 N N   . ILE B 2 57  ? 31.594 -11.197 39.908 1.00 30.79  ? 54  ILE Y N   1 
ATOM   1560 C CA  . ILE B 2 57  ? 31.232 -9.855  39.513 1.00 22.33  ? 54  ILE Y CA  1 
ATOM   1561 C C   . ILE B 2 57  ? 29.816 -9.936  38.982 1.00 23.30  ? 54  ILE Y C   1 
ATOM   1562 O O   . ILE B 2 57  ? 29.566 -10.555 37.948 1.00 34.63  ? 54  ILE Y O   1 
ATOM   1563 C CB  . ILE B 2 57  ? 32.158 -9.331  38.412 1.00 18.61  ? 54  ILE Y CB  1 
ATOM   1564 C CG1 . ILE B 2 57  ? 33.619 -9.483  38.845 1.00 16.62  ? 54  ILE Y CG1 1 
ATOM   1565 C CG2 . ILE B 2 57  ? 31.832 -7.874  38.111 1.00 25.34  ? 54  ILE Y CG2 1 
ATOM   1566 C CD1 . ILE B 2 57  ? 34.622 -9.153  37.754 1.00 18.67  ? 54  ILE Y CD1 1 
ATOM   1567 N N   . HIS B 2 58  ? 28.884 -9.357  39.722 1.00 23.19  ? 55  HIS Y N   1 
ATOM   1568 C CA  . HIS B 2 58  ? 27.485 -9.352  39.327 1.00 26.64  ? 55  HIS Y CA  1 
ATOM   1569 C C   . HIS B 2 58  ? 26.887 -8.057  39.846 1.00 31.12  ? 55  HIS Y C   1 
ATOM   1570 O O   . HIS B 2 58  ? 27.434 -7.446  40.762 1.00 38.98  ? 55  HIS Y O   1 
ATOM   1571 C CB  . HIS B 2 58  ? 26.754 -10.542 39.947 1.00 27.45  ? 55  HIS Y CB  1 
ATOM   1572 C CG  . HIS B 2 58  ? 26.594 -10.449 41.434 1.00 31.23  ? 55  HIS Y CG  1 
ATOM   1573 N ND1 . HIS B 2 58  ? 27.534 -10.941 42.315 1.00 23.28  ? 55  HIS Y ND1 1 
ATOM   1574 C CD2 . HIS B 2 58  ? 25.605 -9.922  42.197 1.00 26.44  ? 55  HIS Y CD2 1 
ATOM   1575 C CE1 . HIS B 2 58  ? 27.131 -10.719 43.555 1.00 27.91  ? 55  HIS Y CE1 1 
ATOM   1576 N NE2 . HIS B 2 58  ? 25.964 -10.102 43.509 1.00 15.58  ? 55  HIS Y NE2 1 
ATOM   1577 N N   . GLN B 2 59  ? 25.762 -7.643  39.282 1.00 27.64  ? 56  GLN Y N   1 
ATOM   1578 C CA  . GLN B 2 59  ? 25.119 -6.420  39.725 1.00 28.51  ? 56  GLN Y CA  1 
ATOM   1579 C C   . GLN B 2 59  ? 23.930 -6.758  40.614 1.00 32.77  ? 56  GLN Y C   1 
ATOM   1580 O O   . GLN B 2 59  ? 23.188 -7.701  40.342 1.00 38.15  ? 56  GLN Y O   1 
ATOM   1581 C CB  . GLN B 2 59  ? 24.686 -5.570  38.527 1.00 33.61  ? 56  GLN Y CB  1 
ATOM   1582 C CG  . GLN B 2 59  ? 23.768 -6.272  37.544 1.00 51.29  ? 56  GLN Y CG  1 
ATOM   1583 C CD  . GLN B 2 59  ? 23.326 -5.360  36.419 1.00 61.37  ? 56  GLN Y CD  1 
ATOM   1584 O OE1 . GLN B 2 59  ? 23.057 -4.177  36.634 1.00 78.30  ? 56  GLN Y OE1 1 
ATOM   1585 N NE2 . GLN B 2 59  ? 23.263 -5.899  35.209 1.00 59.96  ? 56  GLN Y NE2 1 
ATOM   1586 N N   . HIS B 2 60  ? 23.791 -6.026  41.713 1.00 37.75  ? 57  HIS Y N   1 
ATOM   1587 C CA  . HIS B 2 60  ? 22.696 -6.242  42.648 1.00 42.76  ? 57  HIS Y CA  1 
ATOM   1588 C C   . HIS B 2 60  ? 22.386 -4.926  43.341 1.00 44.66  ? 57  HIS Y C   1 
ATOM   1589 O O   . HIS B 2 60  ? 23.298 -4.215  43.760 1.00 47.73  ? 57  HIS Y O   1 
ATOM   1590 C CB  . HIS B 2 60  ? 23.072 -7.301  43.685 1.00 47.03  ? 57  HIS Y CB  1 
ATOM   1591 C CG  . HIS B 2 60  ? 21.955 -7.659  44.615 1.00 42.92  ? 57  HIS Y CG  1 
ATOM   1592 N ND1 . HIS B 2 60  ? 22.020 -7.448  45.975 1.00 52.45  ? 57  HIS Y ND1 1 
ATOM   1593 C CD2 . HIS B 2 60  ? 20.740 -8.207  44.376 1.00 49.60  ? 57  HIS Y CD2 1 
ATOM   1594 C CE1 . HIS B 2 60  ? 20.894 -7.854  46.535 1.00 59.08  ? 57  HIS Y CE1 1 
ATOM   1595 N NE2 . HIS B 2 60  ? 20.101 -8.319  45.586 1.00 51.81  ? 57  HIS Y NE2 1 
ATOM   1596 N N   . LYS B 2 61  ? 21.099 -4.609  43.458 1.00 43.38  ? 58  LYS Y N   1 
ATOM   1597 C CA  . LYS B 2 61  ? 20.654 -3.365  44.083 1.00 45.57  ? 58  LYS Y CA  1 
ATOM   1598 C C   . LYS B 2 61  ? 21.292 -2.161  43.389 1.00 48.42  ? 58  LYS Y C   1 
ATOM   1599 O O   . LYS B 2 61  ? 21.766 -1.229  44.036 1.00 55.24  ? 58  LYS Y O   1 
ATOM   1600 C CB  . LYS B 2 61  ? 20.974 -3.354  45.584 1.00 55.06  ? 58  LYS Y CB  1 
ATOM   1601 C CG  . LYS B 2 61  ? 20.277 -4.439  46.390 1.00 65.78  ? 58  LYS Y CG  1 
ATOM   1602 C CD  . LYS B 2 61  ? 18.771 -4.402  46.192 1.00 82.93  ? 58  LYS Y CD  1 
ATOM   1603 C CE  . LYS B 2 61  ? 18.080 -5.461  47.035 1.00 98.53  ? 58  LYS Y CE  1 
ATOM   1604 N NZ  . LYS B 2 61  ? 16.639 -5.600  46.681 1.00 110.93 ? 58  LYS Y NZ  1 
ATOM   1605 N N   . GLU B 2 62  ? 21.322 -2.216  42.061 1.00 42.78  ? 59  GLU Y N   1 
ATOM   1606 C CA  . GLU B 2 62  ? 21.886 -1.156  41.227 1.00 38.75  ? 59  GLU Y CA  1 
ATOM   1607 C C   . GLU B 2 62  ? 23.374 -0.883  41.444 1.00 34.18  ? 59  GLU Y C   1 
ATOM   1608 O O   . GLU B 2 62  ? 23.918 0.079   40.900 1.00 37.87  ? 59  GLU Y O   1 
ATOM   1609 C CB  . GLU B 2 62  ? 21.085 0.140   41.388 1.00 42.56  ? 59  GLU Y CB  1 
ATOM   1610 C CG  . GLU B 2 62  ? 19.639 0.037   40.920 1.00 67.52  ? 59  GLU Y CG  1 
ATOM   1611 C CD  . GLU B 2 62  ? 18.948 1.387   40.832 1.00 86.21  ? 59  GLU Y CD  1 
ATOM   1612 O OE1 . GLU B 2 62  ? 19.117 2.217   41.754 1.00 93.99  ? 59  GLU Y OE1 1 
ATOM   1613 O OE2 . GLU B 2 62  ? 18.231 1.618   39.836 1.00 91.17  ? 59  GLU Y OE2 1 
ATOM   1614 N N   . LYS B 2 63  ? 24.039 -1.741  42.207 1.00 30.48  ? 60  LYS Y N   1 
ATOM   1615 C CA  . LYS B 2 63  ? 25.461 -1.569  42.474 1.00 30.95  ? 60  LYS Y CA  1 
ATOM   1616 C C   . LYS B 2 63  ? 26.243 -2.740  41.911 1.00 32.46  ? 60  LYS Y C   1 
ATOM   1617 O O   . LYS B 2 63  ? 25.705 -3.837  41.752 1.00 39.14  ? 60  LYS Y O   1 
ATOM   1618 C CB  . LYS B 2 63  ? 25.713 -1.477  43.978 1.00 36.48  ? 60  LYS Y CB  1 
ATOM   1619 C CG  . LYS B 2 63  ? 24.878 -0.433  44.678 1.00 27.79  ? 60  LYS Y CG  1 
ATOM   1620 C CD  . LYS B 2 63  ? 25.130 -0.447  46.166 1.00 31.91  ? 60  LYS Y CD  1 
ATOM   1621 C CE  . LYS B 2 63  ? 24.097 0.391   46.895 1.00 51.54  ? 60  LYS Y CE  1 
ATOM   1622 N NZ  . LYS B 2 63  ? 22.719 -0.138  46.690 1.00 45.45  ? 60  LYS Y NZ  1 
ATOM   1623 N N   . LEU B 2 64  ? 27.509 -2.496  41.596 1.00 28.47  ? 61  LEU Y N   1 
ATOM   1624 C CA  . LEU B 2 64  ? 28.390 -3.522  41.058 1.00 28.41  ? 61  LEU Y CA  1 
ATOM   1625 C C   . LEU B 2 64  ? 29.050 -4.236  42.238 1.00 36.93  ? 61  LEU Y C   1 
ATOM   1626 O O   . LEU B 2 64  ? 29.663 -3.588  43.091 1.00 43.03  ? 61  LEU Y O   1 
ATOM   1627 C CB  . LEU B 2 64  ? 29.454 -2.867  40.177 1.00 22.60  ? 61  LEU Y CB  1 
ATOM   1628 C CG  . LEU B 2 64  ? 30.417 -3.736  39.370 1.00 26.68  ? 61  LEU Y CG  1 
ATOM   1629 C CD1 . LEU B 2 64  ? 29.656 -4.588  38.362 1.00 22.89  ? 61  LEU Y CD1 1 
ATOM   1630 C CD2 . LEU B 2 64  ? 31.397 -2.824  38.654 1.00 13.41  ? 61  LEU Y CD2 1 
ATOM   1631 N N   . TRP B 2 65  ? 28.913 -5.559  42.296 1.00 37.15  ? 62  TRP Y N   1 
ATOM   1632 C CA  . TRP B 2 65  ? 29.487 -6.354  43.383 1.00 28.03  ? 62  TRP Y CA  1 
ATOM   1633 C C   . TRP B 2 65  ? 30.631 -7.248  42.922 1.00 32.65  ? 62  TRP Y C   1 
ATOM   1634 O O   . TRP B 2 65  ? 30.516 -7.941  41.913 1.00 38.01  ? 62  TRP Y O   1 
ATOM   1635 C CB  . TRP B 2 65  ? 28.419 -7.246  44.009 1.00 15.96  ? 62  TRP Y CB  1 
ATOM   1636 C CG  . TRP B 2 65  ? 27.338 -6.523  44.724 1.00 19.83  ? 62  TRP Y CG  1 
ATOM   1637 C CD1 . TRP B 2 65  ? 26.316 -5.818  44.164 1.00 22.01  ? 62  TRP Y CD1 1 
ATOM   1638 C CD2 . TRP B 2 65  ? 27.147 -6.459  46.141 1.00 40.23  ? 62  TRP Y CD2 1 
ATOM   1639 N NE1 . TRP B 2 65  ? 25.493 -5.320  45.143 1.00 38.83  ? 62  TRP Y NE1 1 
ATOM   1640 C CE2 . TRP B 2 65  ? 25.977 -5.699  46.367 1.00 42.91  ? 62  TRP Y CE2 1 
ATOM   1641 C CE3 . TRP B 2 65  ? 27.846 -6.972  47.242 1.00 35.30  ? 62  TRP Y CE3 1 
ATOM   1642 C CZ2 . TRP B 2 65  ? 25.489 -5.440  47.652 1.00 25.83  ? 62  TRP Y CZ2 1 
ATOM   1643 C CZ3 . TRP B 2 65  ? 27.361 -6.714  48.520 1.00 31.60  ? 62  TRP Y CZ3 1 
ATOM   1644 C CH2 . TRP B 2 65  ? 26.192 -5.954  48.712 1.00 18.35  ? 62  TRP Y CH2 1 
ATOM   1645 N N   . PHE B 2 66  ? 31.724 -7.239  43.675 1.00 35.57  ? 63  PHE Y N   1 
ATOM   1646 C CA  . PHE B 2 66  ? 32.883 -8.075  43.378 1.00 37.19  ? 63  PHE Y CA  1 
ATOM   1647 C C   . PHE B 2 66  ? 32.973 -9.038  44.553 1.00 41.88  ? 63  PHE Y C   1 
ATOM   1648 O O   . PHE B 2 66  ? 33.606 -8.744  45.568 1.00 44.99  ? 63  PHE Y O   1 
ATOM   1649 C CB  . PHE B 2 66  ? 34.157 -7.232  43.284 1.00 25.07  ? 63  PHE Y CB  1 
ATOM   1650 C CG  . PHE B 2 66  ? 34.133 -6.215  42.178 1.00 36.16  ? 63  PHE Y CG  1 
ATOM   1651 C CD1 . PHE B 2 66  ? 33.497 -4.990  42.354 1.00 40.53  ? 63  PHE Y CD1 1 
ATOM   1652 C CD2 . PHE B 2 66  ? 34.762 -6.471  40.967 1.00 48.34  ? 63  PHE Y CD2 1 
ATOM   1653 C CE1 . PHE B 2 66  ? 33.491 -4.036  41.338 1.00 41.67  ? 63  PHE Y CE1 1 
ATOM   1654 C CE2 . PHE B 2 66  ? 34.761 -5.525  39.946 1.00 50.03  ? 63  PHE Y CE2 1 
ATOM   1655 C CZ  . PHE B 2 66  ? 34.125 -4.303  40.133 1.00 39.25  ? 63  PHE Y CZ  1 
ATOM   1656 N N   . VAL B 2 67  ? 32.310 -10.179 44.421 1.00 43.20  ? 64  VAL Y N   1 
ATOM   1657 C CA  . VAL B 2 67  ? 32.270 -11.167 45.490 1.00 41.99  ? 64  VAL Y CA  1 
ATOM   1658 C C   . VAL B 2 67  ? 33.011 -12.470 45.170 1.00 49.88  ? 64  VAL Y C   1 
ATOM   1659 O O   . VAL B 2 67  ? 32.399 -13.427 44.692 1.00 59.18  ? 64  VAL Y O   1 
ATOM   1660 C CB  . VAL B 2 67  ? 30.800 -11.507 45.836 1.00 35.49  ? 64  VAL Y CB  1 
ATOM   1661 C CG1 . VAL B 2 67  ? 30.728 -12.320 47.104 1.00 42.74  ? 64  VAL Y CG1 1 
ATOM   1662 C CG2 . VAL B 2 67  ? 29.969 -10.240 45.959 1.00 30.99  ? 64  VAL Y CG2 1 
ATOM   1663 N N   . PRO B 2 68  ? 34.336 -12.520 45.394 1.00 49.95  ? 65  PRO Y N   1 
ATOM   1664 C CA  . PRO B 2 68  ? 35.214 -11.474 45.913 1.00 49.76  ? 65  PRO Y CA  1 
ATOM   1665 C C   . PRO B 2 68  ? 35.936 -10.776 44.761 1.00 54.55  ? 65  PRO Y C   1 
ATOM   1666 O O   . PRO B 2 68  ? 35.875 -11.218 43.611 1.00 59.91  ? 65  PRO Y O   1 
ATOM   1667 C CB  . PRO B 2 68  ? 36.200 -12.265 46.758 1.00 41.29  ? 65  PRO Y CB  1 
ATOM   1668 C CG  . PRO B 2 68  ? 36.433 -13.458 45.903 1.00 47.63  ? 65  PRO Y CG  1 
ATOM   1669 C CD  . PRO B 2 68  ? 35.035 -13.823 45.409 1.00 52.95  ? 65  PRO Y CD  1 
ATOM   1670 N N   . ALA B 2 69  ? 36.629 -9.695  45.079 1.00 50.69  ? 66  ALA Y N   1 
ATOM   1671 C CA  . ALA B 2 69  ? 37.358 -8.943  44.079 1.00 40.33  ? 66  ALA Y CA  1 
ATOM   1672 C C   . ALA B 2 69  ? 38.715 -9.577  43.824 1.00 38.40  ? 66  ALA Y C   1 
ATOM   1673 O O   . ALA B 2 69  ? 39.356 -10.079 44.749 1.00 41.17  ? 66  ALA Y O   1 
ATOM   1674 C CB  . ALA B 2 69  ? 37.530 -7.516  44.542 1.00 46.84  ? 66  ALA Y CB  1 
ATOM   1675 N N   . LYS B 2 70  ? 39.147 -9.559  42.567 1.00 38.44  ? 67  LYS Y N   1 
ATOM   1676 C CA  . LYS B 2 70  ? 40.442 -10.113 42.190 1.00 42.28  ? 67  LYS Y CA  1 
ATOM   1677 C C   . LYS B 2 70  ? 41.181 -9.101  41.327 1.00 33.45  ? 67  LYS Y C   1 
ATOM   1678 O O   . LYS B 2 70  ? 40.564 -8.373  40.553 1.00 33.16  ? 67  LYS Y O   1 
ATOM   1679 C CB  . LYS B 2 70  ? 40.281 -11.440 41.439 1.00 57.28  ? 67  LYS Y CB  1 
ATOM   1680 C CG  . LYS B 2 70  ? 41.602 -12.106 41.055 1.00 76.37  ? 67  LYS Y CG  1 
ATOM   1681 C CD  . LYS B 2 70  ? 42.513 -12.300 42.268 1.00 85.64  ? 67  LYS Y CD  1 
ATOM   1682 C CE  . LYS B 2 70  ? 43.920 -12.704 41.853 1.00 80.61  ? 67  LYS Y CE  1 
ATOM   1683 N NZ  . LYS B 2 70  ? 44.850 -12.726 43.016 1.00 76.48  ? 67  LYS Y NZ  1 
ATOM   1684 N N   . VAL B 2 71  ? 42.503 -9.075  41.461 1.00 26.35  ? 68  VAL Y N   1 
ATOM   1685 C CA  . VAL B 2 71  ? 43.359 -8.150  40.725 1.00 33.90  ? 68  VAL Y CA  1 
ATOM   1686 C C   . VAL B 2 71  ? 43.019 -8.026  39.241 1.00 42.72  ? 68  VAL Y C   1 
ATOM   1687 O O   . VAL B 2 71  ? 42.989 -6.921  38.697 1.00 49.35  ? 68  VAL Y O   1 
ATOM   1688 C CB  . VAL B 2 71  ? 44.846 -8.531  40.885 1.00 33.45  ? 68  VAL Y CB  1 
ATOM   1689 C CG1 . VAL B 2 71  ? 45.732 -7.537  40.156 1.00 38.26  ? 68  VAL Y CG1 1 
ATOM   1690 C CG2 . VAL B 2 71  ? 45.212 -8.579  42.360 1.00 33.03  ? 68  VAL Y CG2 1 
ATOM   1691 N N   . GLU B 2 72  ? 42.699 -9.148  38.606 1.00 50.61  ? 69  GLU Y N   1 
ATOM   1692 C CA  . GLU B 2 72  ? 42.361 -9.158  37.183 1.00 50.33  ? 69  GLU Y CA  1 
ATOM   1693 C C   . GLU B 2 72  ? 41.058 -8.433  36.850 1.00 46.73  ? 69  GLU Y C   1 
ATOM   1694 O O   . GLU B 2 72  ? 40.638 -8.419  35.694 1.00 54.88  ? 69  GLU Y O   1 
ATOM   1695 C CB  . GLU B 2 72  ? 42.298 -10.594 36.652 1.00 58.50  ? 69  GLU Y CB  1 
ATOM   1696 C CG  . GLU B 2 72  ? 43.627 -11.343 36.668 1.00 83.81  ? 69  GLU Y CG  1 
ATOM   1697 C CD  . GLU B 2 72  ? 44.004 -11.873 38.042 1.00 105.14 ? 69  GLU Y CD  1 
ATOM   1698 O OE1 . GLU B 2 72  ? 43.500 -12.952 38.423 1.00 116.90 ? 69  GLU Y OE1 1 
ATOM   1699 O OE2 . GLU B 2 72  ? 44.811 -11.220 38.739 1.00 108.57 ? 69  GLU Y OE2 1 
ATOM   1700 N N   . ASP B 2 73  ? 40.417 -7.843  37.856 1.00 40.01  ? 70  ASP Y N   1 
ATOM   1701 C CA  . ASP B 2 73  ? 39.162 -7.121  37.657 1.00 38.83  ? 70  ASP Y CA  1 
ATOM   1702 C C   . ASP B 2 73  ? 39.384 -5.629  37.433 1.00 33.37  ? 70  ASP Y C   1 
ATOM   1703 O O   . ASP B 2 73  ? 38.445 -4.894  37.124 1.00 30.97  ? 70  ASP Y O   1 
ATOM   1704 C CB  . ASP B 2 73  ? 38.238 -7.305  38.863 1.00 39.15  ? 70  ASP Y CB  1 
ATOM   1705 C CG  . ASP B 2 73  ? 37.832 -8.748  39.085 1.00 52.52  ? 70  ASP Y CG  1 
ATOM   1706 O OD1 . ASP B 2 73  ? 38.346 -9.653  38.394 1.00 64.62  ? 70  ASP Y OD1 1 
ATOM   1707 O OD2 . ASP B 2 73  ? 36.983 -8.973  39.969 1.00 68.44  ? 70  ASP Y OD2 1 
ATOM   1708 N N   . SER B 2 74  ? 40.617 -5.179  37.637 1.00 27.20  ? 71  SER Y N   1 
ATOM   1709 C CA  . SER B 2 74  ? 40.955 -3.777  37.461 1.00 29.89  ? 71  SER Y CA  1 
ATOM   1710 C C   . SER B 2 74  ? 40.654 -3.336  36.031 1.00 35.96  ? 71  SER Y C   1 
ATOM   1711 O O   . SER B 2 74  ? 41.136 -3.943  35.073 1.00 42.53  ? 71  SER Y O   1 
ATOM   1712 C CB  . SER B 2 74  ? 42.432 -3.557  37.782 1.00 31.15  ? 71  SER Y CB  1 
ATOM   1713 O OG  . SER B 2 74  ? 42.747 -4.059  39.070 1.00 37.95  ? 71  SER Y OG  1 
ATOM   1714 N N   . GLY B 2 75  ? 39.834 -2.299  35.893 1.00 36.73  ? 72  GLY Y N   1 
ATOM   1715 C CA  . GLY B 2 75  ? 39.484 -1.803  34.576 1.00 30.66  ? 72  GLY Y CA  1 
ATOM   1716 C C   . GLY B 2 75  ? 38.308 -0.849  34.588 1.00 31.95  ? 72  GLY Y C   1 
ATOM   1717 O O   . GLY B 2 75  ? 37.938 -0.316  35.634 1.00 36.81  ? 72  GLY Y O   1 
ATOM   1718 N N   . HIS B 2 76  ? 37.713 -0.639  33.419 1.00 32.59  ? 73  HIS Y N   1 
ATOM   1719 C CA  . HIS B 2 76  ? 36.574 0.263   33.287 1.00 32.13  ? 73  HIS Y CA  1 
ATOM   1720 C C   . HIS B 2 76  ? 35.256 -0.483  33.311 1.00 30.56  ? 73  HIS Y C   1 
ATOM   1721 O O   . HIS B 2 76  ? 35.181 -1.639  32.896 1.00 41.49  ? 73  HIS Y O   1 
ATOM   1722 C CB  . HIS B 2 76  ? 36.672 1.070   31.991 1.00 40.54  ? 73  HIS Y CB  1 
ATOM   1723 C CG  . HIS B 2 76  ? 37.836 2.006   31.952 1.00 58.00  ? 73  HIS Y CG  1 
ATOM   1724 N ND1 . HIS B 2 76  ? 37.878 3.173   32.680 1.00 73.91  ? 73  HIS Y ND1 1 
ATOM   1725 C CD2 . HIS B 2 76  ? 39.019 1.930   31.294 1.00 58.66  ? 73  HIS Y CD2 1 
ATOM   1726 C CE1 . HIS B 2 76  ? 39.033 3.779   32.476 1.00 83.37  ? 73  HIS Y CE1 1 
ATOM   1727 N NE2 . HIS B 2 76  ? 39.744 3.043   31.640 1.00 76.27  ? 73  HIS Y NE2 1 
ATOM   1728 N N   . TYR B 2 77  ? 34.228 0.190   33.814 1.00 23.83  ? 74  TYR Y N   1 
ATOM   1729 C CA  . TYR B 2 77  ? 32.878 -0.355  33.897 1.00 22.43  ? 74  TYR Y CA  1 
ATOM   1730 C C   . TYR B 2 77  ? 31.959 0.813   33.581 1.00 24.24  ? 74  TYR Y C   1 
ATOM   1731 O O   . TYR B 2 77  ? 32.388 1.970   33.636 1.00 31.77  ? 74  TYR Y O   1 
ATOM   1732 C CB  . TYR B 2 77  ? 32.579 -0.881  35.307 1.00 28.98  ? 74  TYR Y CB  1 
ATOM   1733 C CG  . TYR B 2 77  ? 33.414 -2.076  35.713 1.00 32.83  ? 74  TYR Y CG  1 
ATOM   1734 C CD1 . TYR B 2 77  ? 34.698 -1.910  36.240 1.00 32.72  ? 74  TYR Y CD1 1 
ATOM   1735 C CD2 . TYR B 2 77  ? 32.933 -3.373  35.547 1.00 33.61  ? 74  TYR Y CD2 1 
ATOM   1736 C CE1 . TYR B 2 77  ? 35.481 -3.007  36.586 1.00 33.55  ? 74  TYR Y CE1 1 
ATOM   1737 C CE2 . TYR B 2 77  ? 33.709 -4.479  35.892 1.00 23.41  ? 74  TYR Y CE2 1 
ATOM   1738 C CZ  . TYR B 2 77  ? 34.981 -4.288  36.408 1.00 31.97  ? 74  TYR Y CZ  1 
ATOM   1739 O OH  . TYR B 2 77  ? 35.751 -5.380  36.734 1.00 37.76  ? 74  TYR Y OH  1 
ATOM   1740 N N   . TYR B 2 78  ? 30.711 0.525   33.237 1.00 16.89  ? 75  TYR Y N   1 
ATOM   1741 C CA  . TYR B 2 78  ? 29.764 1.581   32.910 1.00 16.92  ? 75  TYR Y CA  1 
ATOM   1742 C C   . TYR B 2 78  ? 28.434 1.343   33.594 1.00 24.41  ? 75  TYR Y C   1 
ATOM   1743 O O   . TYR B 2 78  ? 27.978 0.207   33.696 1.00 30.30  ? 75  TYR Y O   1 
ATOM   1744 C CB  . TYR B 2 78  ? 29.519 1.648   31.394 1.00 14.82  ? 75  TYR Y CB  1 
ATOM   1745 C CG  . TYR B 2 78  ? 30.725 2.012   30.556 1.00 21.23  ? 75  TYR Y CG  1 
ATOM   1746 C CD1 . TYR B 2 78  ? 31.754 1.097   30.346 1.00 24.32  ? 75  TYR Y CD1 1 
ATOM   1747 C CD2 . TYR B 2 78  ? 30.838 3.274   29.973 1.00 14.09  ? 75  TYR Y CD2 1 
ATOM   1748 C CE1 . TYR B 2 78  ? 32.870 1.428   29.585 1.00 34.95  ? 75  TYR Y CE1 1 
ATOM   1749 C CE2 . TYR B 2 78  ? 31.954 3.616   29.205 1.00 18.11  ? 75  TYR Y CE2 1 
ATOM   1750 C CZ  . TYR B 2 78  ? 32.964 2.684   29.018 1.00 23.28  ? 75  TYR Y CZ  1 
ATOM   1751 O OH  . TYR B 2 78  ? 34.079 3.003   28.280 1.00 40.45  ? 75  TYR Y OH  1 
ATOM   1752 N N   . CYS B 2 79  ? 27.828 2.411   34.090 1.00 23.12  ? 76  CYS Y N   1 
ATOM   1753 C CA  . CYS B 2 79  ? 26.519 2.309   34.705 1.00 25.00  ? 76  CYS Y CA  1 
ATOM   1754 C C   . CYS B 2 79  ? 25.656 3.305   33.952 1.00 31.45  ? 76  CYS Y C   1 
ATOM   1755 O O   . CYS B 2 79  ? 26.053 4.452   33.728 1.00 40.42  ? 76  CYS Y O   1 
ATOM   1756 C CB  . CYS B 2 79  ? 26.562 2.576   36.218 1.00 30.96  ? 76  CYS Y CB  1 
ATOM   1757 S SG  . CYS B 2 79  ? 27.234 4.167   36.794 1.00 34.21  ? 76  CYS Y SG  1 
ATOM   1758 N N   . VAL B 2 80  ? 24.535 2.817   33.443 1.00 30.12  ? 77  VAL Y N   1 
ATOM   1759 C CA  . VAL B 2 80  ? 23.630 3.642   32.668 1.00 27.51  ? 77  VAL Y CA  1 
ATOM   1760 C C   . VAL B 2 80  ? 22.338 3.909   33.414 1.00 34.61  ? 77  VAL Y C   1 
ATOM   1761 O O   . VAL B 2 80  ? 21.763 3.007   34.027 1.00 38.29  ? 77  VAL Y O   1 
ATOM   1762 C CB  . VAL B 2 80  ? 23.321 2.972   31.300 1.00 28.32  ? 77  VAL Y CB  1 
ATOM   1763 C CG1 . VAL B 2 80  ? 22.351 3.821   30.489 1.00 34.81  ? 77  VAL Y CG1 1 
ATOM   1764 C CG2 . VAL B 2 80  ? 24.612 2.765   30.522 1.00 15.54  ? 77  VAL Y CG2 1 
ATOM   1765 N N   . VAL B 2 81  ? 21.923 5.170   33.401 1.00 42.21  ? 78  VAL Y N   1 
ATOM   1766 C CA  . VAL B 2 81  ? 20.686 5.604   34.034 1.00 49.34  ? 78  VAL Y CA  1 
ATOM   1767 C C   . VAL B 2 81  ? 19.776 5.953   32.874 1.00 55.46  ? 78  VAL Y C   1 
ATOM   1768 O O   . VAL B 2 81  ? 19.976 6.974   32.211 1.00 62.83  ? 78  VAL Y O   1 
ATOM   1769 C CB  . VAL B 2 81  ? 20.902 6.871   34.877 1.00 50.11  ? 78  VAL Y CB  1 
ATOM   1770 C CG1 . VAL B 2 81  ? 19.586 7.350   35.474 1.00 52.76  ? 78  VAL Y CG1 1 
ATOM   1771 C CG2 . VAL B 2 81  ? 21.904 6.592   35.957 1.00 78.25  ? 78  VAL Y CG2 1 
ATOM   1772 N N   . ARG B 2 82  ? 18.813 5.087   32.593 1.00 55.76  ? 79  ARG Y N   1 
ATOM   1773 C CA  . ARG B 2 82  ? 17.904 5.329   31.487 1.00 54.51  ? 79  ARG Y CA  1 
ATOM   1774 C C   . ARG B 2 82  ? 16.486 5.562   31.970 1.00 50.22  ? 79  ARG Y C   1 
ATOM   1775 O O   . ARG B 2 82  ? 16.116 5.152   33.068 1.00 44.04  ? 79  ARG Y O   1 
ATOM   1776 C CB  . ARG B 2 82  ? 17.950 4.165   30.493 1.00 65.82  ? 79  ARG Y CB  1 
ATOM   1777 C CG  . ARG B 2 82  ? 17.545 2.823   31.083 1.00 91.50  ? 79  ARG Y CG  1 
ATOM   1778 C CD  . ARG B 2 82  ? 17.673 1.706   30.058 1.00 110.85 ? 79  ARG Y CD  1 
ATOM   1779 N NE  . ARG B 2 82  ? 16.846 1.942   28.877 1.00 119.32 ? 79  ARG Y NE  1 
ATOM   1780 C CZ  . ARG B 2 82  ? 17.308 1.965   27.630 1.00 116.32 ? 79  ARG Y CZ  1 
ATOM   1781 N NH1 . ARG B 2 82  ? 18.596 1.764   27.386 1.00 109.33 ? 79  ARG Y NH1 1 
ATOM   1782 N NH2 . ARG B 2 82  ? 16.480 2.198   26.623 1.00 118.75 ? 79  ARG Y NH2 1 
ATOM   1783 N N   . ASN B 2 83  ? 15.702 6.219   31.128 1.00 55.25  ? 80  ASN Y N   1 
ATOM   1784 C CA  . ASN B 2 83  ? 14.312 6.539   31.412 1.00 65.31  ? 80  ASN Y CA  1 
ATOM   1785 C C   . ASN B 2 83  ? 13.656 6.770   30.055 1.00 74.00  ? 80  ASN Y C   1 
ATOM   1786 O O   . ASN B 2 83  ? 14.351 6.954   29.053 1.00 76.84  ? 80  ASN Y O   1 
ATOM   1787 C CB  . ASN B 2 83  ? 14.226 7.807   32.269 1.00 77.18  ? 80  ASN Y CB  1 
ATOM   1788 C CG  . ASN B 2 83  ? 12.800 8.180   32.628 1.00 97.34  ? 80  ASN Y CG  1 
ATOM   1789 O OD1 . ASN B 2 83  ? 11.914 7.327   32.676 1.00 101.06 ? 80  ASN Y OD1 1 
ATOM   1790 N ND2 . ASN B 2 83  ? 12.568 9.465   32.861 1.00 107.69 ? 80  ASN Y ND2 1 
ATOM   1791 N N   . SER B 2 84  ? 12.327 6.777   30.027 1.00 77.86  ? 81  SER Y N   1 
ATOM   1792 C CA  . SER B 2 84  ? 11.569 6.978   28.795 1.00 80.70  ? 81  SER Y CA  1 
ATOM   1793 C C   . SER B 2 84  ? 12.090 8.142   27.945 1.00 77.60  ? 81  SER Y C   1 
ATOM   1794 O O   . SER B 2 84  ? 11.928 8.148   26.724 1.00 73.86  ? 81  SER Y O   1 
ATOM   1795 C CB  . SER B 2 84  ? 10.090 7.198   29.130 1.00 94.54  ? 81  SER Y CB  1 
ATOM   1796 O OG  . SER B 2 84  ? 9.276  7.130   27.970 1.00 116.53 ? 81  SER Y OG  1 
ATOM   1797 N N   . SER B 2 85  ? 12.710 9.123   28.591 1.00 81.54  ? 82  SER Y N   1 
ATOM   1798 C CA  . SER B 2 85  ? 13.239 10.278  27.883 1.00 85.68  ? 82  SER Y CA  1 
ATOM   1799 C C   . SER B 2 85  ? 14.520 10.802  28.532 1.00 84.89  ? 82  SER Y C   1 
ATOM   1800 O O   . SER B 2 85  ? 14.710 12.011  28.662 1.00 89.97  ? 82  SER Y O   1 
ATOM   1801 C CB  . SER B 2 85  ? 12.177 11.381  27.834 1.00 93.72  ? 82  SER Y CB  1 
ATOM   1802 O OG  . SER B 2 85  ? 10.929 10.865  27.394 1.00 101.46 ? 82  SER Y OG  1 
ATOM   1803 N N   . TYR B 2 86  ? 15.398 9.889   28.937 1.00 78.71  ? 83  TYR Y N   1 
ATOM   1804 C CA  . TYR B 2 86  ? 16.663 10.265  29.566 1.00 69.05  ? 83  TYR Y CA  1 
ATOM   1805 C C   . TYR B 2 86  ? 17.604 9.068   29.630 1.00 61.83  ? 83  TYR Y C   1 
ATOM   1806 O O   . TYR B 2 86  ? 17.165 7.936   29.826 1.00 63.56  ? 83  TYR Y O   1 
ATOM   1807 C CB  . TYR B 2 86  ? 16.421 10.817  30.977 1.00 67.92  ? 83  TYR Y CB  1 
ATOM   1808 C CG  . TYR B 2 86  ? 17.691 11.165  31.731 1.00 76.58  ? 83  TYR Y CG  1 
ATOM   1809 C CD1 . TYR B 2 86  ? 18.598 12.101  31.226 1.00 73.30  ? 83  TYR Y CD1 1 
ATOM   1810 C CD2 . TYR B 2 86  ? 17.989 10.553  32.949 1.00 77.49  ? 83  TYR Y CD2 1 
ATOM   1811 C CE1 . TYR B 2 86  ? 19.766 12.417  31.913 1.00 66.74  ? 83  TYR Y CE1 1 
ATOM   1812 C CE2 . TYR B 2 86  ? 19.153 10.862  33.645 1.00 77.40  ? 83  TYR Y CE2 1 
ATOM   1813 C CZ  . TYR B 2 86  ? 20.036 11.793  33.123 1.00 73.87  ? 83  TYR Y CZ  1 
ATOM   1814 O OH  . TYR B 2 86  ? 21.183 12.107  33.813 1.00 78.59  ? 83  TYR Y OH  1 
ATOM   1815 N N   . CYS B 2 87  ? 18.895 9.325   29.456 1.00 50.21  ? 84  CYS Y N   1 
ATOM   1816 C CA  . CYS B 2 87  ? 19.896 8.272   29.503 1.00 44.95  ? 84  CYS Y CA  1 
ATOM   1817 C C   . CYS B 2 87  ? 21.279 8.872   29.728 1.00 42.49  ? 84  CYS Y C   1 
ATOM   1818 O O   . CYS B 2 87  ? 21.679 9.804   29.029 1.00 46.86  ? 84  CYS Y O   1 
ATOM   1819 C CB  . CYS B 2 87  ? 19.874 7.452   28.207 1.00 48.65  ? 84  CYS Y CB  1 
ATOM   1820 S SG  . CYS B 2 87  ? 21.126 6.133   28.122 1.00 52.68  ? 84  CYS Y SG  1 
ATOM   1821 N N   . LEU B 2 88  ? 21.985 8.373   30.738 1.00 35.76  ? 85  LEU Y N   1 
ATOM   1822 C CA  . LEU B 2 88  ? 23.327 8.852   31.049 1.00 34.47  ? 85  LEU Y CA  1 
ATOM   1823 C C   . LEU B 2 88  ? 24.206 7.631   31.299 1.00 38.21  ? 85  LEU Y C   1 
ATOM   1824 O O   . LEU B 2 88  ? 23.795 6.682   31.964 1.00 40.14  ? 85  LEU Y O   1 
ATOM   1825 C CB  . LEU B 2 88  ? 23.313 9.736   32.301 1.00 44.05  ? 85  LEU Y CB  1 
ATOM   1826 C CG  . LEU B 2 88  ? 24.280 10.927  32.392 1.00 39.59  ? 85  LEU Y CG  1 
ATOM   1827 C CD1 . LEU B 2 88  ? 24.234 11.475  33.804 1.00 54.71  ? 85  LEU Y CD1 1 
ATOM   1828 C CD2 . LEU B 2 88  ? 25.712 10.550  32.029 1.00 31.64  ? 85  LEU Y CD2 1 
ATOM   1829 N N   . ARG B 2 89  ? 25.422 7.672   30.776 1.00 33.72  ? 86  ARG Y N   1 
ATOM   1830 C CA  . ARG B 2 89  ? 26.354 6.570   30.924 1.00 34.85  ? 86  ARG Y CA  1 
ATOM   1831 C C   . ARG B 2 89  ? 27.648 7.053   31.561 1.00 37.00  ? 86  ARG Y C   1 
ATOM   1832 O O   . ARG B 2 89  ? 28.358 7.879   30.984 1.00 37.76  ? 86  ARG Y O   1 
ATOM   1833 C CB  . ARG B 2 89  ? 26.646 5.968   29.553 1.00 39.25  ? 86  ARG Y CB  1 
ATOM   1834 C CG  . ARG B 2 89  ? 27.652 4.841   29.556 1.00 56.02  ? 86  ARG Y CG  1 
ATOM   1835 C CD  . ARG B 2 89  ? 27.873 4.346   28.149 1.00 56.75  ? 86  ARG Y CD  1 
ATOM   1836 N NE  . ARG B 2 89  ? 26.613 3.952   27.526 1.00 58.63  ? 86  ARG Y NE  1 
ATOM   1837 C CZ  . ARG B 2 89  ? 26.303 4.183   26.255 1.00 66.77  ? 86  ARG Y CZ  1 
ATOM   1838 N NH1 . ARG B 2 89  ? 27.162 4.810   25.460 1.00 73.55  ? 86  ARG Y NH1 1 
ATOM   1839 N NH2 . ARG B 2 89  ? 25.141 3.764   25.775 1.00 75.39  ? 86  ARG Y NH2 1 
ATOM   1840 N N   . ILE B 2 90  ? 27.937 6.560   32.759 1.00 33.68  ? 87  ILE Y N   1 
ATOM   1841 C CA  . ILE B 2 90  ? 29.151 6.943   33.461 1.00 30.58  ? 87  ILE Y CA  1 
ATOM   1842 C C   . ILE B 2 90  ? 30.222 5.867   33.308 1.00 33.57  ? 87  ILE Y C   1 
ATOM   1843 O O   . ILE B 2 90  ? 29.952 4.677   33.472 1.00 39.94  ? 87  ILE Y O   1 
ATOM   1844 C CB  . ILE B 2 90  ? 28.890 7.214   34.968 1.00 24.09  ? 87  ILE Y CB  1 
ATOM   1845 C CG1 . ILE B 2 90  ? 28.135 8.534   35.157 1.00 20.11  ? 87  ILE Y CG1 1 
ATOM   1846 C CG2 . ILE B 2 90  ? 30.203 7.291   35.726 1.00 34.36  ? 87  ILE Y CG2 1 
ATOM   1847 C CD1 . ILE B 2 90  ? 26.701 8.507   34.694 1.00 26.02  ? 87  ILE Y CD1 1 
ATOM   1848 N N   . LYS B 2 91  ? 31.428 6.302   32.965 1.00 30.52  ? 88  LYS Y N   1 
ATOM   1849 C CA  . LYS B 2 91  ? 32.569 5.419   32.788 1.00 28.38  ? 88  LYS Y CA  1 
ATOM   1850 C C   . LYS B 2 91  ? 33.433 5.506   34.033 1.00 34.91  ? 88  LYS Y C   1 
ATOM   1851 O O   . LYS B 2 91  ? 34.143 6.494   34.235 1.00 40.22  ? 88  LYS Y O   1 
ATOM   1852 C CB  . LYS B 2 91  ? 33.389 5.859   31.576 1.00 33.86  ? 88  LYS Y CB  1 
ATOM   1853 C CG  . LYS B 2 91  ? 34.679 5.086   31.378 1.00 40.39  ? 88  LYS Y CG  1 
ATOM   1854 C CD  . LYS B 2 91  ? 35.507 5.705   30.272 1.00 50.35  ? 88  LYS Y CD  1 
ATOM   1855 C CE  . LYS B 2 91  ? 36.776 4.913   30.032 1.00 69.70  ? 88  LYS Y CE  1 
ATOM   1856 N NZ  . LYS B 2 91  ? 37.631 5.528   28.980 1.00 84.33  ? 88  LYS Y NZ  1 
ATOM   1857 N N   . ILE B 2 92  ? 33.354 4.490   34.884 1.00 38.88  ? 89  ILE Y N   1 
ATOM   1858 C CA  . ILE B 2 92  ? 34.151 4.480   36.101 1.00 37.37  ? 89  ILE Y CA  1 
ATOM   1859 C C   . ILE B 2 92  ? 35.440 3.695   35.887 1.00 39.71  ? 89  ILE Y C   1 
ATOM   1860 O O   . ILE B 2 92  ? 35.633 3.062   34.843 1.00 43.91  ? 89  ILE Y O   1 
ATOM   1861 C CB  . ILE B 2 92  ? 33.380 3.890   37.305 1.00 29.90  ? 89  ILE Y CB  1 
ATOM   1862 C CG1 . ILE B 2 92  ? 33.095 2.407   37.088 1.00 36.21  ? 89  ILE Y CG1 1 
ATOM   1863 C CG2 . ILE B 2 92  ? 32.081 4.651   37.527 1.00 36.79  ? 89  ILE Y CG2 1 
ATOM   1864 C CD1 . ILE B 2 92  ? 32.534 1.724   38.310 1.00 25.36  ? 89  ILE Y CD1 1 
ATOM   1865 N N   . SER B 2 93  ? 36.330 3.756   36.868 1.00 41.14  ? 90  SER Y N   1 
ATOM   1866 C CA  . SER B 2 93  ? 37.599 3.054   36.789 1.00 46.57  ? 90  SER Y CA  1 
ATOM   1867 C C   . SER B 2 93  ? 37.846 2.387   38.136 1.00 50.18  ? 90  SER Y C   1 
ATOM   1868 O O   . SER B 2 93  ? 37.886 3.059   39.171 1.00 55.00  ? 90  SER Y O   1 
ATOM   1869 C CB  . SER B 2 93  ? 38.725 4.037   36.467 1.00 51.81  ? 90  SER Y CB  1 
ATOM   1870 O OG  . SER B 2 93  ? 39.873 3.360   35.983 1.00 73.53  ? 90  SER Y OG  1 
ATOM   1871 N N   . ALA B 2 94  ? 37.957 1.063   38.122 1.00 47.84  ? 91  ALA Y N   1 
ATOM   1872 C CA  . ALA B 2 94  ? 38.190 0.294   39.336 1.00 40.08  ? 91  ALA Y CA  1 
ATOM   1873 C C   . ALA B 2 94  ? 39.573 -0.330  39.280 1.00 39.36  ? 91  ALA Y C   1 
ATOM   1874 O O   . ALA B 2 94  ? 40.021 -0.775  38.221 1.00 43.69  ? 91  ALA Y O   1 
ATOM   1875 C CB  . ALA B 2 94  ? 37.126 -0.790  39.492 1.00 32.53  ? 91  ALA Y CB  1 
ATOM   1876 N N   . LYS B 2 95  ? 40.253 -0.348  40.420 1.00 36.61  ? 92  LYS Y N   1 
ATOM   1877 C CA  . LYS B 2 95  ? 41.585 -0.927  40.512 1.00 32.57  ? 92  LYS Y CA  1 
ATOM   1878 C C   . LYS B 2 95  ? 41.642 -1.774  41.771 1.00 29.77  ? 92  LYS Y C   1 
ATOM   1879 O O   . LYS B 2 95  ? 41.205 -1.340  42.837 1.00 36.11  ? 92  LYS Y O   1 
ATOM   1880 C CB  . LYS B 2 95  ? 42.646 0.173   40.563 1.00 32.06  ? 92  LYS Y CB  1 
ATOM   1881 C CG  . LYS B 2 95  ? 44.072 -0.339  40.472 1.00 34.84  ? 92  LYS Y CG  1 
ATOM   1882 C CD  . LYS B 2 95  ? 45.071 0.802   40.427 1.00 43.17  ? 92  LYS Y CD  1 
ATOM   1883 C CE  . LYS B 2 95  ? 46.481 0.308   40.130 1.00 53.75  ? 92  LYS Y CE  1 
ATOM   1884 N NZ  . LYS B 2 95  ? 47.016 -0.586  41.194 1.00 59.30  ? 92  LYS Y NZ  1 
ATOM   1885 N N   . PHE B 2 96  ? 42.143 -2.995  41.641 1.00 28.79  ? 93  PHE Y N   1 
ATOM   1886 C CA  . PHE B 2 96  ? 42.239 -3.901  42.774 1.00 22.25  ? 93  PHE Y CA  1 
ATOM   1887 C C   . PHE B 2 96  ? 43.682 -4.302  43.000 1.00 29.74  ? 93  PHE Y C   1 
ATOM   1888 O O   . PHE B 2 96  ? 44.330 -4.864  42.116 1.00 42.36  ? 93  PHE Y O   1 
ATOM   1889 C CB  . PHE B 2 96  ? 41.358 -5.126  42.546 1.00 8.93   ? 93  PHE Y CB  1 
ATOM   1890 C CG  . PHE B 2 96  ? 39.903 -4.792  42.383 1.00 13.94  ? 93  PHE Y CG  1 
ATOM   1891 C CD1 . PHE B 2 96  ? 39.069 -4.721  43.487 1.00 8.42   ? 93  PHE Y CD1 1 
ATOM   1892 C CD2 . PHE B 2 96  ? 39.376 -4.508  41.127 1.00 15.01  ? 93  PHE Y CD2 1 
ATOM   1893 C CE1 . PHE B 2 96  ? 37.725 -4.366  43.345 1.00 15.52  ? 93  PHE Y CE1 1 
ATOM   1894 C CE2 . PHE B 2 96  ? 38.036 -4.153  40.975 1.00 17.23  ? 93  PHE Y CE2 1 
ATOM   1895 C CZ  . PHE B 2 96  ? 37.212 -4.081  42.085 1.00 21.79  ? 93  PHE Y CZ  1 
ATOM   1896 N N   . VAL B 2 97  ? 44.189 -3.973  44.181 1.00 32.90  ? 94  VAL Y N   1 
ATOM   1897 C CA  . VAL B 2 97  ? 45.564 -4.273  44.552 1.00 28.39  ? 94  VAL Y CA  1 
ATOM   1898 C C   . VAL B 2 97  ? 45.632 -5.371  45.605 1.00 30.26  ? 94  VAL Y C   1 
ATOM   1899 O O   . VAL B 2 97  ? 44.606 -5.863  46.079 1.00 29.32  ? 94  VAL Y O   1 
ATOM   1900 C CB  . VAL B 2 97  ? 46.276 -3.008  45.109 1.00 36.30  ? 94  VAL Y CB  1 
ATOM   1901 C CG1 . VAL B 2 97  ? 46.424 -1.959  44.022 1.00 38.40  ? 94  VAL Y CG1 1 
ATOM   1902 C CG2 . VAL B 2 97  ? 45.501 -2.436  46.289 1.00 33.41  ? 94  VAL Y CG2 1 
ATOM   1903 N N   . GLU B 2 98  ? 46.851 -5.757  45.960 1.00 33.64  ? 95  GLU Y N   1 
ATOM   1904 C CA  . GLU B 2 98  ? 47.078 -6.776  46.977 1.00 41.58  ? 95  GLU Y CA  1 
ATOM   1905 C C   . GLU B 2 98  ? 48.007 -6.182  48.019 1.00 41.31  ? 95  GLU Y C   1 
ATOM   1906 O O   . GLU B 2 98  ? 48.803 -5.290  47.714 1.00 44.02  ? 95  GLU Y O   1 
ATOM   1907 C CB  . GLU B 2 98  ? 47.724 -8.027  46.378 1.00 53.47  ? 95  GLU Y CB  1 
ATOM   1908 C CG  . GLU B 2 98  ? 46.808 -8.846  45.494 1.00 75.27  ? 95  GLU Y CG  1 
ATOM   1909 C CD  . GLU B 2 98  ? 47.408 -10.187 45.130 1.00 87.61  ? 95  GLU Y CD  1 
ATOM   1910 O OE1 . GLU B 2 98  ? 48.437 -10.208 44.418 1.00 83.47  ? 95  GLU Y OE1 1 
ATOM   1911 O OE2 . GLU B 2 98  ? 46.849 -11.219 45.561 1.00 99.15  ? 95  GLU Y OE2 1 
ATOM   1912 N N   . ASN B 2 99  ? 47.895 -6.668  49.248 1.00 35.79  ? 96  ASN Y N   1 
ATOM   1913 C CA  . ASN B 2 99  ? 48.731 -6.189  50.337 1.00 35.21  ? 96  ASN Y CA  1 
ATOM   1914 C C   . ASN B 2 99  ? 50.195 -6.361  49.967 1.00 39.10  ? 96  ASN Y C   1 
ATOM   1915 O O   . ASN B 2 99  ? 50.587 -7.386  49.409 1.00 49.11  ? 96  ASN Y O   1 
ATOM   1916 C CB  . ASN B 2 99  ? 48.423 -6.955  51.626 1.00 48.14  ? 96  ASN Y CB  1 
ATOM   1917 C CG  . ASN B 2 99  ? 46.996 -6.749  52.107 1.00 61.09  ? 96  ASN Y CG  1 
ATOM   1918 O OD1 . ASN B 2 99  ? 46.189 -6.092  51.446 1.00 76.13  ? 96  ASN Y OD1 1 
ATOM   1919 N ND2 . ASN B 2 99  ? 46.673 -7.324  53.258 1.00 65.31  ? 96  ASN Y ND2 1 
ATOM   1920 N N   . GLU B 2 100 ? 50.990 -5.333  50.232 1.00 41.76  ? 97  GLU Y N   1 
ATOM   1921 C CA  . GLU B 2 100 ? 52.413 -5.373  49.928 1.00 46.51  ? 97  GLU Y CA  1 
ATOM   1922 C C   . GLU B 2 100 ? 53.093 -6.469  50.754 1.00 54.44  ? 97  GLU Y C   1 
ATOM   1923 O O   . GLU B 2 100 ? 52.531 -6.953  51.741 1.00 56.63  ? 97  GLU Y O   1 
ATOM   1924 C CB  . GLU B 2 100 ? 53.045 -4.009  50.225 1.00 55.27  ? 97  GLU Y CB  1 
ATOM   1925 C CG  . GLU B 2 100 ? 52.510 -2.873  49.370 1.00 62.16  ? 97  GLU Y CG  1 
ATOM   1926 C CD  . GLU B 2 100 ? 53.017 -1.523  49.829 1.00 70.35  ? 97  GLU Y CD  1 
ATOM   1927 O OE1 . GLU B 2 100 ? 54.110 -1.113  49.387 1.00 75.41  ? 97  GLU Y OE1 1 
ATOM   1928 O OE2 . GLU B 2 100 ? 52.327 -0.876  50.644 1.00 81.48  ? 97  GLU Y OE2 1 
ATOM   1929 N N   . PRO B 2 101 ? 54.309 -6.883  50.355 1.00 60.04  ? 98  PRO Y N   1 
ATOM   1930 C CA  . PRO B 2 101 ? 55.068 -7.926  51.055 1.00 61.19  ? 98  PRO Y CA  1 
ATOM   1931 C C   . PRO B 2 101 ? 55.117 -7.783  52.576 1.00 60.66  ? 98  PRO Y C   1 
ATOM   1932 O O   . PRO B 2 101 ? 55.665 -6.813  53.103 1.00 59.86  ? 98  PRO Y O   1 
ATOM   1933 C CB  . PRO B 2 101 ? 56.456 -7.795  50.436 1.00 63.73  ? 98  PRO Y CB  1 
ATOM   1934 C CG  . PRO B 2 101 ? 56.139 -7.446  49.024 1.00 67.92  ? 98  PRO Y CG  1 
ATOM   1935 C CD  . PRO B 2 101 ? 55.064 -6.394  49.185 1.00 63.73  ? 98  PRO Y CD  1 
ATOM   1936 N N   . ASN B 2 102 ? 54.531 -8.759  53.267 1.00 62.64  ? 99  ASN Y N   1 
ATOM   1937 C CA  . ASN B 2 102 ? 54.500 -8.802  54.729 1.00 62.21  ? 99  ASN Y CA  1 
ATOM   1938 C C   . ASN B 2 102 ? 53.861 -7.567  55.359 1.00 55.38  ? 99  ASN Y C   1 
ATOM   1939 O O   . ASN B 2 102 ? 54.241 -7.147  56.454 1.00 59.69  ? 99  ASN Y O   1 
ATOM   1940 C CB  . ASN B 2 102 ? 55.916 -8.994  55.290 1.00 79.39  ? 99  ASN Y CB  1 
ATOM   1941 C CG  . ASN B 2 102 ? 56.585 -10.257 54.772 1.00 101.89 ? 99  ASN Y CG  1 
ATOM   1942 O OD1 . ASN B 2 102 ? 56.001 -11.340 54.793 1.00 115.30 ? 99  ASN Y OD1 1 
ATOM   1943 N ND2 . ASN B 2 102 ? 57.821 -10.122 54.307 1.00 105.86 ? 99  ASN Y ND2 1 
ATOM   1944 N N   . LEU B 2 103 ? 52.875 -7.004  54.674 1.00 46.12  ? 100 LEU Y N   1 
ATOM   1945 C CA  . LEU B 2 103 ? 52.188 -5.820  55.164 1.00 30.79  ? 100 LEU Y CA  1 
ATOM   1946 C C   . LEU B 2 103 ? 50.693 -6.073  55.058 1.00 23.42  ? 100 LEU Y C   1 
ATOM   1947 O O   . LEU B 2 103 ? 50.228 -6.644  54.078 1.00 32.54  ? 100 LEU Y O   1 
ATOM   1948 C CB  . LEU B 2 103 ? 52.584 -4.614  54.322 1.00 38.10  ? 100 LEU Y CB  1 
ATOM   1949 C CG  . LEU B 2 103 ? 52.354 -3.246  54.952 1.00 52.66  ? 100 LEU Y CG  1 
ATOM   1950 C CD1 . LEU B 2 103 ? 53.096 -3.157  56.277 1.00 43.28  ? 100 LEU Y CD1 1 
ATOM   1951 C CD2 . LEU B 2 103 ? 52.832 -2.168  53.996 1.00 68.45  ? 100 LEU Y CD2 1 
ATOM   1952 N N   . CYS B 2 104 ? 49.938 -5.645  56.059 1.00 20.89  ? 101 CYS Y N   1 
ATOM   1953 C CA  . CYS B 2 104 ? 48.495 -5.859  56.071 1.00 20.95  ? 101 CYS Y CA  1 
ATOM   1954 C C   . CYS B 2 104 ? 47.691 -4.916  55.183 1.00 21.23  ? 101 CYS Y C   1 
ATOM   1955 O O   . CYS B 2 104 ? 46.459 -4.879  55.273 1.00 16.26  ? 101 CYS Y O   1 
ATOM   1956 C CB  . CYS B 2 104 ? 47.973 -5.782  57.500 1.00 26.61  ? 101 CYS Y CB  1 
ATOM   1957 S SG  . CYS B 2 104 ? 48.196 -4.149  58.268 1.00 25.07  ? 101 CYS Y SG  1 
ATOM   1958 N N   . TYR B 2 105 ? 48.379 -4.176  54.316 1.00 26.87  ? 102 TYR Y N   1 
ATOM   1959 C CA  . TYR B 2 105 ? 47.729 -3.228  53.410 1.00 27.16  ? 102 TYR Y CA  1 
ATOM   1960 C C   . TYR B 2 105 ? 48.648 -2.870  52.244 1.00 27.65  ? 102 TYR Y C   1 
ATOM   1961 O O   . TYR B 2 105 ? 49.800 -3.312  52.182 1.00 24.06  ? 102 TYR Y O   1 
ATOM   1962 C CB  . TYR B 2 105 ? 47.338 -1.939  54.163 1.00 24.55  ? 102 TYR Y CB  1 
ATOM   1963 C CG  . TYR B 2 105 ? 48.510 -1.208  54.799 1.00 19.73  ? 102 TYR Y CG  1 
ATOM   1964 C CD1 . TYR B 2 105 ? 49.324 -0.354  54.047 1.00 18.13  ? 102 TYR Y CD1 1 
ATOM   1965 C CD2 . TYR B 2 105 ? 48.831 -1.406  56.143 1.00 14.44  ? 102 TYR Y CD2 1 
ATOM   1966 C CE1 . TYR B 2 105 ? 50.434 0.277   54.618 1.00 8.52   ? 102 TYR Y CE1 1 
ATOM   1967 C CE2 . TYR B 2 105 ? 49.933 -0.782  56.722 1.00 15.49  ? 102 TYR Y CE2 1 
ATOM   1968 C CZ  . TYR B 2 105 ? 50.730 0.055   55.954 1.00 16.84  ? 102 TYR Y CZ  1 
ATOM   1969 O OH  . TYR B 2 105 ? 51.836 0.645   56.519 1.00 25.22  ? 102 TYR Y OH  1 
ATOM   1970 N N   . ASN B 2 106 ? 48.130 -2.058  51.331 1.00 28.24  ? 103 ASN Y N   1 
ATOM   1971 C CA  . ASN B 2 106 ? 48.888 -1.591  50.178 1.00 27.42  ? 103 ASN Y CA  1 
ATOM   1972 C C   . ASN B 2 106 ? 48.756 -0.070  50.168 1.00 20.63  ? 103 ASN Y C   1 
ATOM   1973 O O   . ASN B 2 106 ? 47.650 0.458   50.271 1.00 23.73  ? 103 ASN Y O   1 
ATOM   1974 C CB  . ASN B 2 106 ? 48.317 -2.185  48.888 1.00 35.58  ? 103 ASN Y CB  1 
ATOM   1975 C CG  . ASN B 2 106 ? 49.136 -1.819  47.666 1.00 44.59  ? 103 ASN Y CG  1 
ATOM   1976 O OD1 . ASN B 2 106 ? 49.077 -0.692  47.180 1.00 66.86  ? 103 ASN Y OD1 1 
ATOM   1977 N ND2 . ASN B 2 106 ? 49.902 -2.771  47.161 1.00 49.58  ? 103 ASN Y ND2 1 
ATOM   1978 N N   . ALA B 2 107 ? 49.879 0.626   50.041 1.00 19.01  ? 104 ALA Y N   1 
ATOM   1979 C CA  . ALA B 2 107 ? 49.901 2.091   50.042 1.00 22.70  ? 104 ALA Y CA  1 
ATOM   1980 C C   . ALA B 2 107 ? 48.907 2.769   49.098 1.00 26.37  ? 104 ALA Y C   1 
ATOM   1981 O O   . ALA B 2 107 ? 48.326 3.799   49.438 1.00 32.34  ? 104 ALA Y O   1 
ATOM   1982 C CB  . ALA B 2 107 ? 51.306 2.591   49.756 1.00 17.24  ? 104 ALA Y CB  1 
ATOM   1983 N N   . GLN B 2 108 ? 48.694 2.179   47.927 1.00 24.88  ? 105 GLN Y N   1 
ATOM   1984 C CA  . GLN B 2 108 ? 47.784 2.746   46.934 1.00 23.85  ? 105 GLN Y CA  1 
ATOM   1985 C C   . GLN B 2 108 ? 46.332 2.843   47.385 1.00 24.05  ? 105 GLN Y C   1 
ATOM   1986 O O   . GLN B 2 108 ? 45.531 3.521   46.741 1.00 36.65  ? 105 GLN Y O   1 
ATOM   1987 C CB  . GLN B 2 108 ? 47.851 1.947   45.632 1.00 35.34  ? 105 GLN Y CB  1 
ATOM   1988 C CG  . GLN B 2 108 ? 49.208 1.960   44.953 1.00 57.37  ? 105 GLN Y CG  1 
ATOM   1989 C CD  . GLN B 2 108 ? 49.210 1.174   43.660 1.00 57.10  ? 105 GLN Y CD  1 
ATOM   1990 O OE1 . GLN B 2 108 ? 49.215 1.746   42.572 1.00 57.81  ? 105 GLN Y OE1 1 
ATOM   1991 N NE2 . GLN B 2 108 ? 49.187 -0.146  43.772 1.00 67.02  ? 105 GLN Y NE2 1 
ATOM   1992 N N   . ALA B 2 109 ? 45.983 2.159   48.468 1.00 17.63  ? 106 ALA Y N   1 
ATOM   1993 C CA  . ALA B 2 109 ? 44.610 2.188   48.963 1.00 17.35  ? 106 ALA Y CA  1 
ATOM   1994 C C   . ALA B 2 109 ? 44.443 3.094   50.181 1.00 18.58  ? 106 ALA Y C   1 
ATOM   1995 O O   . ALA B 2 109 ? 43.357 3.182   50.753 1.00 22.34  ? 106 ALA Y O   1 
ATOM   1996 C CB  . ALA B 2 109 ? 44.138 0.777   49.280 1.00 4.62   ? 106 ALA Y CB  1 
ATOM   1997 N N   . ILE B 2 110 ? 45.513 3.788   50.553 1.00 18.54  ? 107 ILE Y N   1 
ATOM   1998 C CA  . ILE B 2 110 ? 45.500 4.681   51.705 1.00 19.15  ? 107 ILE Y CA  1 
ATOM   1999 C C   . ILE B 2 110 ? 44.619 5.917   51.575 1.00 19.14  ? 107 ILE Y C   1 
ATOM   2000 O O   . ILE B 2 110 ? 44.673 6.634   50.578 1.00 29.29  ? 107 ILE Y O   1 
ATOM   2001 C CB  . ILE B 2 110 ? 46.932 5.154   52.059 1.00 18.24  ? 107 ILE Y CB  1 
ATOM   2002 C CG1 . ILE B 2 110 ? 47.741 3.993   52.638 1.00 15.49  ? 107 ILE Y CG1 1 
ATOM   2003 C CG2 . ILE B 2 110 ? 46.893 6.318   53.046 1.00 22.97  ? 107 ILE Y CG2 1 
ATOM   2004 C CD1 . ILE B 2 110 ? 49.149 4.378   53.028 1.00 22.70  ? 107 ILE Y CD1 1 
ATOM   2005 N N   . PHE B 2 111 ? 43.779 6.129   52.580 1.00 18.57  ? 108 PHE Y N   1 
ATOM   2006 C CA  . PHE B 2 111 ? 42.922 7.303   52.651 1.00 19.42  ? 108 PHE Y CA  1 
ATOM   2007 C C   . PHE B 2 111 ? 43.650 8.154   53.678 1.00 22.00  ? 108 PHE Y C   1 
ATOM   2008 O O   . PHE B 2 111 ? 44.046 7.641   54.726 1.00 22.54  ? 108 PHE Y O   1 
ATOM   2009 C CB  . PHE B 2 111 ? 41.549 6.961   53.228 1.00 10.63  ? 108 PHE Y CB  1 
ATOM   2010 C CG  . PHE B 2 111 ? 40.694 6.120   52.335 1.00 26.68  ? 108 PHE Y CG  1 
ATOM   2011 C CD1 . PHE B 2 111 ? 40.816 4.736   52.336 1.00 26.50  ? 108 PHE Y CD1 1 
ATOM   2012 C CD2 . PHE B 2 111 ? 39.719 6.707   51.537 1.00 29.44  ? 108 PHE Y CD2 1 
ATOM   2013 C CE1 . PHE B 2 111 ? 39.973 3.950   51.559 1.00 15.18  ? 108 PHE Y CE1 1 
ATOM   2014 C CE2 . PHE B 2 111 ? 38.871 5.929   50.756 1.00 23.15  ? 108 PHE Y CE2 1 
ATOM   2015 C CZ  . PHE B 2 111 ? 38.995 4.551   50.768 1.00 21.35  ? 108 PHE Y CZ  1 
ATOM   2016 N N   . LYS B 2 112 ? 43.865 9.430   53.386 1.00 25.96  ? 109 LYS Y N   1 
ATOM   2017 C CA  . LYS B 2 112 ? 44.551 10.286  54.343 1.00 19.00  ? 109 LYS Y CA  1 
ATOM   2018 C C   . LYS B 2 112 ? 43.537 10.973  55.244 1.00 18.69  ? 109 LYS Y C   1 
ATOM   2019 O O   . LYS B 2 112 ? 42.533 11.516  54.772 1.00 10.28  ? 109 LYS Y O   1 
ATOM   2020 C CB  . LYS B 2 112 ? 45.440 11.314  53.640 1.00 25.11  ? 109 LYS Y CB  1 
ATOM   2021 C CG  . LYS B 2 112 ? 46.482 10.691  52.722 1.00 41.06  ? 109 LYS Y CG  1 
ATOM   2022 C CD  . LYS B 2 112 ? 47.817 11.406  52.803 1.00 36.69  ? 109 LYS Y CD  1 
ATOM   2023 C CE  . LYS B 2 112 ? 48.826 10.759  51.870 1.00 56.23  ? 109 LYS Y CE  1 
ATOM   2024 N NZ  . LYS B 2 112 ? 50.216 11.189  52.177 1.00 63.69  ? 109 LYS Y NZ  1 
ATOM   2025 N N   . GLN B 2 113 ? 43.764 10.863  56.548 1.00 20.82  ? 110 GLN Y N   1 
ATOM   2026 C CA  . GLN B 2 113 ? 42.893 11.468  57.544 1.00 23.78  ? 110 GLN Y CA  1 
ATOM   2027 C C   . GLN B 2 113 ? 43.749 12.183  58.572 1.00 25.24  ? 110 GLN Y C   1 
ATOM   2028 O O   . GLN B 2 113 ? 44.758 11.654  59.041 1.00 27.71  ? 110 GLN Y O   1 
ATOM   2029 C CB  . GLN B 2 113 ? 41.997 10.420  58.199 1.00 19.55  ? 110 GLN Y CB  1 
ATOM   2030 C CG  . GLN B 2 113 ? 40.875 9.951   57.281 1.00 20.65  ? 110 GLN Y CG  1 
ATOM   2031 C CD  . GLN B 2 113 ? 39.918 8.981   57.941 1.00 21.97  ? 110 GLN Y CD  1 
ATOM   2032 O OE1 . GLN B 2 113 ? 38.920 8.585   57.345 1.00 32.51  ? 110 GLN Y OE1 1 
ATOM   2033 N NE2 . GLN B 2 113 ? 40.203 8.606   59.179 1.00 20.50  ? 110 GLN Y NE2 1 
ATOM   2034 N N   . LYS B 2 114 ? 43.339 13.393  58.915 1.00 19.55  ? 111 LYS Y N   1 
ATOM   2035 C CA  . LYS B 2 114 ? 44.092 14.210  59.843 1.00 23.01  ? 111 LYS Y CA  1 
ATOM   2036 C C   . LYS B 2 114 ? 43.232 14.790  60.946 1.00 27.21  ? 111 LYS Y C   1 
ATOM   2037 O O   . LYS B 2 114 ? 42.008 14.896  60.815 1.00 23.98  ? 111 LYS Y O   1 
ATOM   2038 C CB  . LYS B 2 114 ? 44.791 15.334  59.073 1.00 31.50  ? 111 LYS Y CB  1 
ATOM   2039 C CG  . LYS B 2 114 ? 44.044 15.752  57.810 1.00 32.77  ? 111 LYS Y CG  1 
ATOM   2040 C CD  . LYS B 2 114 ? 44.735 16.877  57.069 1.00 42.91  ? 111 LYS Y CD  1 
ATOM   2041 C CE  . LYS B 2 114 ? 44.216 16.976  55.643 1.00 49.22  ? 111 LYS Y CE  1 
ATOM   2042 N NZ  . LYS B 2 114 ? 42.732 17.052  55.570 1.00 29.35  ? 111 LYS Y NZ  1 
ATOM   2043 N N   . LEU B 2 115 ? 43.888 15.136  62.046 1.00 22.52  ? 112 LEU Y N   1 
ATOM   2044 C CA  . LEU B 2 115 ? 43.224 15.723  63.197 1.00 26.29  ? 112 LEU Y CA  1 
ATOM   2045 C C   . LEU B 2 115 ? 44.212 16.598  63.945 1.00 26.07  ? 112 LEU Y C   1 
ATOM   2046 O O   . LEU B 2 115 ? 45.416 16.325  63.947 1.00 22.73  ? 112 LEU Y O   1 
ATOM   2047 C CB  . LEU B 2 115 ? 42.713 14.638  64.150 1.00 24.12  ? 112 LEU Y CB  1 
ATOM   2048 C CG  . LEU B 2 115 ? 41.419 13.888  63.838 1.00 23.63  ? 112 LEU Y CG  1 
ATOM   2049 C CD1 . LEU B 2 115 ? 41.240 12.762  64.839 1.00 20.12  ? 112 LEU Y CD1 1 
ATOM   2050 C CD2 . LEU B 2 115 ? 40.233 14.836  63.882 1.00 18.61  ? 112 LEU Y CD2 1 
ATOM   2051 N N   . PRO B 2 116 ? 43.734 17.719  64.502 1.00 25.73  ? 113 PRO Y N   1 
ATOM   2052 C CA  . PRO B 2 116 ? 44.598 18.625  65.258 1.00 26.95  ? 113 PRO Y CA  1 
ATOM   2053 C C   . PRO B 2 116 ? 44.869 17.980  66.619 1.00 31.13  ? 113 PRO Y C   1 
ATOM   2054 O O   . PRO B 2 116 ? 43.993 17.320  67.187 1.00 35.88  ? 113 PRO Y O   1 
ATOM   2055 C CB  . PRO B 2 116 ? 43.738 19.881  65.382 1.00 24.91  ? 113 PRO Y CB  1 
ATOM   2056 C CG  . PRO B 2 116 ? 42.349 19.333  65.427 1.00 18.82  ? 113 PRO Y CG  1 
ATOM   2057 C CD  . PRO B 2 116 ? 42.383 18.285  64.345 1.00 19.92  ? 113 PRO Y CD  1 
ATOM   2058 N N   . VAL B 2 117 ? 46.086 18.142  67.121 1.00 31.28  ? 114 VAL Y N   1 
ATOM   2059 C CA  . VAL B 2 117 ? 46.474 17.558  68.401 1.00 30.64  ? 114 VAL Y CA  1 
ATOM   2060 C C   . VAL B 2 117 ? 45.757 18.159  69.612 1.00 31.10  ? 114 VAL Y C   1 
ATOM   2061 O O   . VAL B 2 117 ? 44.873 19.010  69.474 1.00 30.19  ? 114 VAL Y O   1 
ATOM   2062 C CB  . VAL B 2 117 ? 48.003 17.661  68.622 1.00 31.74  ? 114 VAL Y CB  1 
ATOM   2063 C CG1 . VAL B 2 117 ? 48.742 16.895  67.537 1.00 25.22  ? 114 VAL Y CG1 1 
ATOM   2064 C CG2 . VAL B 2 117 ? 48.439 19.120  68.644 1.00 37.17  ? 114 VAL Y CG2 1 
ATOM   2065 N N   . ALA B 2 118 ? 46.116 17.659  70.792 1.00 30.07  ? 115 ALA Y N   1 
ATOM   2066 C CA  . ALA B 2 118 ? 45.572 18.107  72.071 1.00 30.34  ? 115 ALA Y CA  1 
ATOM   2067 C C   . ALA B 2 118 ? 44.150 17.669  72.391 1.00 33.34  ? 115 ALA Y C   1 
ATOM   2068 O O   . ALA B 2 118 ? 43.869 17.289  73.526 1.00 46.46  ? 115 ALA Y O   1 
ATOM   2069 C CB  . ALA B 2 118 ? 45.704 19.623  72.211 1.00 38.13  ? 115 ALA Y CB  1 
ATOM   2070 N N   . GLY B 2 119 ? 43.253 17.729  71.413 1.00 27.68  ? 116 GLY Y N   1 
ATOM   2071 C CA  . GLY B 2 119 ? 41.876 17.345  71.671 1.00 25.80  ? 116 GLY Y CA  1 
ATOM   2072 C C   . GLY B 2 119 ? 41.513 15.926  71.281 1.00 23.61  ? 116 GLY Y C   1 
ATOM   2073 O O   . GLY B 2 119 ? 42.372 15.132  70.889 1.00 26.96  ? 116 GLY Y O   1 
ATOM   2074 N N   . ASP B 2 120 ? 40.238 15.590  71.444 1.00 18.46  ? 117 ASP Y N   1 
ATOM   2075 C CA  . ASP B 2 120 ? 39.736 14.268  71.088 1.00 23.12  ? 117 ASP Y CA  1 
ATOM   2076 C C   . ASP B 2 120 ? 39.196 14.356  69.671 1.00 27.98  ? 117 ASP Y C   1 
ATOM   2077 O O   . ASP B 2 120 ? 38.552 15.341  69.311 1.00 38.55  ? 117 ASP Y O   1 
ATOM   2078 C CB  . ASP B 2 120 ? 38.606 13.845  72.028 1.00 25.10  ? 117 ASP Y CB  1 
ATOM   2079 C CG  . ASP B 2 120 ? 39.078 13.597  73.449 1.00 35.79  ? 117 ASP Y CG  1 
ATOM   2080 O OD1 . ASP B 2 120 ? 40.266 13.848  73.758 1.00 20.09  ? 117 ASP Y OD1 1 
ATOM   2081 O OD2 . ASP B 2 120 ? 38.245 13.147  74.262 1.00 53.56  ? 117 ASP Y OD2 1 
ATOM   2082 N N   . GLY B 2 121 ? 39.451 13.331  68.871 1.00 29.21  ? 118 GLY Y N   1 
ATOM   2083 C CA  . GLY B 2 121 ? 38.971 13.345  67.504 1.00 30.05  ? 118 GLY Y CA  1 
ATOM   2084 C C   . GLY B 2 121 ? 38.562 11.965  67.046 1.00 27.05  ? 118 GLY Y C   1 
ATOM   2085 O O   . GLY B 2 121 ? 38.580 11.019  67.831 1.00 29.49  ? 118 GLY Y O   1 
ATOM   2086 N N   . GLY B 2 122 ? 38.208 11.837  65.775 1.00 27.70  ? 119 GLY Y N   1 
ATOM   2087 C CA  . GLY B 2 122 ? 37.800 10.545  65.270 1.00 29.99  ? 119 GLY Y CA  1 
ATOM   2088 C C   . GLY B 2 122 ? 38.182 10.273  63.831 1.00 27.69  ? 119 GLY Y C   1 
ATOM   2089 O O   . GLY B 2 122 ? 38.262 11.187  63.008 1.00 30.65  ? 119 GLY Y O   1 
ATOM   2090 N N   . LEU B 2 123 ? 38.489 9.010   63.556 1.00 21.21  ? 120 LEU Y N   1 
ATOM   2091 C CA  . LEU B 2 123 ? 38.839 8.554   62.220 1.00 11.98  ? 120 LEU Y CA  1 
ATOM   2092 C C   . LEU B 2 123 ? 37.633 7.751   61.760 1.00 19.22  ? 120 LEU Y C   1 
ATOM   2093 O O   . LEU B 2 123 ? 37.003 7.069   62.566 1.00 19.95  ? 120 LEU Y O   1 
ATOM   2094 C CB  . LEU B 2 123 ? 40.072 7.653   62.260 1.00 9.62   ? 120 LEU Y CB  1 
ATOM   2095 C CG  . LEU B 2 123 ? 41.447 8.280   62.514 1.00 7.11   ? 120 LEU Y CG  1 
ATOM   2096 C CD1 . LEU B 2 123 ? 41.495 8.920   63.884 1.00 35.36  ? 120 LEU Y CD1 1 
ATOM   2097 C CD2 . LEU B 2 123 ? 42.511 7.202   62.402 1.00 2.00   ? 120 LEU Y CD2 1 
ATOM   2098 N N   . VAL B 2 124 ? 37.296 7.832   60.481 1.00 26.41  ? 121 VAL Y N   1 
ATOM   2099 C CA  . VAL B 2 124 ? 36.142 7.102   59.972 1.00 28.41  ? 121 VAL Y CA  1 
ATOM   2100 C C   . VAL B 2 124 ? 36.553 6.045   58.954 1.00 31.29  ? 121 VAL Y C   1 
ATOM   2101 O O   . VAL B 2 124 ? 37.324 6.332   58.041 1.00 28.31  ? 121 VAL Y O   1 
ATOM   2102 C CB  . VAL B 2 124 ? 35.125 8.071   59.324 1.00 22.44  ? 121 VAL Y CB  1 
ATOM   2103 C CG1 . VAL B 2 124 ? 34.003 7.303   58.654 1.00 29.84  ? 121 VAL Y CG1 1 
ATOM   2104 C CG2 . VAL B 2 124 ? 34.559 9.003   60.374 1.00 22.37  ? 121 VAL Y CG2 1 
ATOM   2105 N N   . CYS B 2 125 ? 36.079 4.815   59.145 1.00 30.00  ? 122 CYS Y N   1 
ATOM   2106 C CA  . CYS B 2 125 ? 36.364 3.711   58.227 1.00 21.71  ? 122 CYS Y CA  1 
ATOM   2107 C C   . CYS B 2 125 ? 35.483 4.007   57.010 1.00 19.72  ? 122 CYS Y C   1 
ATOM   2108 O O   . CYS B 2 125 ? 34.256 3.923   57.089 1.00 19.02  ? 122 CYS Y O   1 
ATOM   2109 C CB  . CYS B 2 125 ? 35.978 2.383   58.889 1.00 23.15  ? 122 CYS Y CB  1 
ATOM   2110 S SG  . CYS B 2 125 ? 36.505 0.874   58.019 1.00 15.02  ? 122 CYS Y SG  1 
ATOM   2111 N N   . PRO B 2 126 ? 36.097 4.416   55.887 1.00 22.21  ? 123 PRO Y N   1 
ATOM   2112 C CA  . PRO B 2 126 ? 35.432 4.763   54.627 1.00 20.90  ? 123 PRO Y CA  1 
ATOM   2113 C C   . PRO B 2 126 ? 34.601 3.676   53.960 1.00 31.30  ? 123 PRO Y C   1 
ATOM   2114 O O   . PRO B 2 126 ? 34.887 2.487   54.074 1.00 35.11  ? 123 PRO Y O   1 
ATOM   2115 C CB  . PRO B 2 126 ? 36.602 5.161   53.724 1.00 20.94  ? 123 PRO Y CB  1 
ATOM   2116 C CG  . PRO B 2 126 ? 37.683 5.541   54.673 1.00 18.24  ? 123 PRO Y CG  1 
ATOM   2117 C CD  . PRO B 2 126 ? 37.556 4.484   55.717 1.00 26.65  ? 123 PRO Y CD  1 
ATOM   2118 N N   . TYR B 2 127 ? 33.554 4.124   53.276 1.00 32.53  ? 124 TYR Y N   1 
ATOM   2119 C CA  . TYR B 2 127 ? 32.652 3.279   52.501 1.00 29.94  ? 124 TYR Y CA  1 
ATOM   2120 C C   . TYR B 2 127 ? 32.087 1.996   53.123 1.00 29.31  ? 124 TYR Y C   1 
ATOM   2121 O O   . TYR B 2 127 ? 31.830 1.023   52.419 1.00 37.94  ? 124 TYR Y O   1 
ATOM   2122 C CB  . TYR B 2 127 ? 33.303 2.974   51.150 1.00 27.84  ? 124 TYR Y CB  1 
ATOM   2123 C CG  . TYR B 2 127 ? 33.751 4.213   50.395 1.00 9.03   ? 124 TYR Y CG  1 
ATOM   2124 C CD1 . TYR B 2 127 ? 32.819 5.100   49.855 1.00 5.98   ? 124 TYR Y CD1 1 
ATOM   2125 C CD2 . TYR B 2 127 ? 35.103 4.489   50.212 1.00 7.73   ? 124 TYR Y CD2 1 
ATOM   2126 C CE1 . TYR B 2 127 ? 33.226 6.228   49.152 1.00 3.66   ? 124 TYR Y CE1 1 
ATOM   2127 C CE2 . TYR B 2 127 ? 35.521 5.620   49.505 1.00 8.58   ? 124 TYR Y CE2 1 
ATOM   2128 C CZ  . TYR B 2 127 ? 34.576 6.482   48.976 1.00 16.81  ? 124 TYR Y CZ  1 
ATOM   2129 O OH  . TYR B 2 127 ? 34.975 7.589   48.255 1.00 32.22  ? 124 TYR Y OH  1 
ATOM   2130 N N   . MET B 2 128 ? 31.832 2.008   54.424 1.00 31.37  ? 125 MET Y N   1 
ATOM   2131 C CA  . MET B 2 128 ? 31.270 0.832   55.086 1.00 30.15  ? 125 MET Y CA  1 
ATOM   2132 C C   . MET B 2 128 ? 29.749 0.842   54.983 1.00 28.65  ? 125 MET Y C   1 
ATOM   2133 O O   . MET B 2 128 ? 29.089 -0.156  55.256 1.00 37.54  ? 125 MET Y O   1 
ATOM   2134 C CB  . MET B 2 128 ? 31.687 0.788   56.558 1.00 25.67  ? 125 MET Y CB  1 
ATOM   2135 C CG  . MET B 2 128 ? 33.168 0.540   56.775 1.00 36.48  ? 125 MET Y CG  1 
ATOM   2136 S SD  . MET B 2 128 ? 33.694 -1.022  56.062 1.00 31.30  ? 125 MET Y SD  1 
ATOM   2137 C CE  . MET B 2 128 ? 32.594 -2.142  56.911 1.00 30.85  ? 125 MET Y CE  1 
ATOM   2138 N N   . GLU B 2 129 ? 29.203 1.975   54.563 1.00 37.33  ? 126 GLU Y N   1 
ATOM   2139 C CA  . GLU B 2 129 ? 27.762 2.157   54.418 1.00 41.02  ? 126 GLU Y CA  1 
ATOM   2140 C C   . GLU B 2 129 ? 27.052 1.069   53.608 1.00 39.53  ? 126 GLU Y C   1 
ATOM   2141 O O   . GLU B 2 129 ? 25.918 0.700   53.914 1.00 38.63  ? 126 GLU Y O   1 
ATOM   2142 C CB  . GLU B 2 129 ? 27.477 3.546   53.820 1.00 54.87  ? 126 GLU Y CB  1 
ATOM   2143 C CG  . GLU B 2 129 ? 28.325 3.895   52.589 1.00 64.39  ? 126 GLU Y CG  1 
ATOM   2144 C CD  . GLU B 2 129 ? 28.158 5.336   52.131 1.00 62.25  ? 126 GLU Y CD  1 
ATOM   2145 O OE1 . GLU B 2 129 ? 27.008 5.754   51.870 1.00 70.92  ? 126 GLU Y OE1 1 
ATOM   2146 O OE2 . GLU B 2 129 ? 29.181 6.051   52.026 1.00 42.46  ? 126 GLU Y OE2 1 
ATOM   2147 N N   . PHE B 2 130 ? 27.735 0.535   52.600 1.00 43.53  ? 127 PHE Y N   1 
ATOM   2148 C CA  . PHE B 2 130 ? 27.156 -0.497  51.736 1.00 41.73  ? 127 PHE Y CA  1 
ATOM   2149 C C   . PHE B 2 130 ? 26.928 -1.824  52.451 1.00 42.45  ? 127 PHE Y C   1 
ATOM   2150 O O   . PHE B 2 130 ? 26.049 -2.598  52.072 1.00 46.12  ? 127 PHE Y O   1 
ATOM   2151 C CB  . PHE B 2 130 ? 28.066 -0.768  50.532 1.00 40.32  ? 127 PHE Y CB  1 
ATOM   2152 C CG  . PHE B 2 130 ? 28.589 0.468   49.866 1.00 27.95  ? 127 PHE Y CG  1 
ATOM   2153 C CD1 . PHE B 2 130 ? 27.725 1.353   49.230 1.00 31.16  ? 127 PHE Y CD1 1 
ATOM   2154 C CD2 . PHE B 2 130 ? 29.953 0.744   49.869 1.00 21.76  ? 127 PHE Y CD2 1 
ATOM   2155 C CE1 . PHE B 2 130 ? 28.214 2.497   48.607 1.00 32.79  ? 127 PHE Y CE1 1 
ATOM   2156 C CE2 . PHE B 2 130 ? 30.454 1.882   49.251 1.00 31.02  ? 127 PHE Y CE2 1 
ATOM   2157 C CZ  . PHE B 2 130 ? 29.584 2.762   48.619 1.00 40.58  ? 127 PHE Y CZ  1 
ATOM   2158 N N   . PHE B 2 131 ? 27.705 -2.073  53.497 1.00 38.15  ? 128 PHE Y N   1 
ATOM   2159 C CA  . PHE B 2 131 ? 27.625 -3.335  54.216 1.00 36.59  ? 128 PHE Y CA  1 
ATOM   2160 C C   . PHE B 2 131 ? 26.774 -3.379  55.485 1.00 37.86  ? 128 PHE Y C   1 
ATOM   2161 O O   . PHE B 2 131 ? 27.127 -4.063  56.445 1.00 37.34  ? 128 PHE Y O   1 
ATOM   2162 C CB  . PHE B 2 131 ? 29.041 -3.820  54.497 1.00 28.89  ? 128 PHE Y CB  1 
ATOM   2163 C CG  . PHE B 2 131 ? 29.954 -3.706  53.311 1.00 37.03  ? 128 PHE Y CG  1 
ATOM   2164 C CD1 . PHE B 2 131 ? 29.887 -4.631  52.273 1.00 29.71  ? 128 PHE Y CD1 1 
ATOM   2165 C CD2 . PHE B 2 131 ? 30.875 -2.670  53.224 1.00 34.97  ? 128 PHE Y CD2 1 
ATOM   2166 C CE1 . PHE B 2 131 ? 30.723 -4.525  51.169 1.00 17.02  ? 128 PHE Y CE1 1 
ATOM   2167 C CE2 . PHE B 2 131 ? 31.715 -2.558  52.122 1.00 35.83  ? 128 PHE Y CE2 1 
ATOM   2168 C CZ  . PHE B 2 131 ? 31.638 -3.488  51.093 1.00 35.54  ? 128 PHE Y CZ  1 
ATOM   2169 N N   . LYS B 2 132 ? 25.640 -2.686  55.478 1.00 41.92  ? 129 LYS Y N   1 
ATOM   2170 C CA  . LYS B 2 132 ? 24.752 -2.685  56.635 1.00 41.00  ? 129 LYS Y CA  1 
ATOM   2171 C C   . LYS B 2 132 ? 23.760 -3.839  56.567 1.00 46.71  ? 129 LYS Y C   1 
ATOM   2172 O O   . LYS B 2 132 ? 23.130 -4.073  55.534 1.00 45.56  ? 129 LYS Y O   1 
ATOM   2173 C CB  . LYS B 2 132 ? 23.995 -1.360  56.758 1.00 38.27  ? 129 LYS Y CB  1 
ATOM   2174 C CG  . LYS B 2 132 ? 24.842 -0.207  57.268 1.00 59.50  ? 129 LYS Y CG  1 
ATOM   2175 C CD  . LYS B 2 132 ? 23.979 0.956   57.747 1.00 75.37  ? 129 LYS Y CD  1 
ATOM   2176 C CE  . LYS B 2 132 ? 23.206 1.605   56.611 1.00 93.15  ? 129 LYS Y CE  1 
ATOM   2177 N NZ  . LYS B 2 132 ? 24.111 2.230   55.608 1.00 110.81 ? 129 LYS Y NZ  1 
ATOM   2178 N N   . ASN B 2 133 ? 23.636 -4.566  57.672 1.00 59.46  ? 130 ASN Y N   1 
ATOM   2179 C CA  . ASN B 2 133 ? 22.716 -5.694  57.759 1.00 67.33  ? 130 ASN Y CA  1 
ATOM   2180 C C   . ASN B 2 133 ? 21.286 -5.173  57.642 1.00 68.30  ? 130 ASN Y C   1 
ATOM   2181 O O   . ASN B 2 133 ? 21.037 -3.990  57.861 1.00 64.40  ? 130 ASN Y O   1 
ATOM   2182 C CB  . ASN B 2 133 ? 22.910 -6.428  59.090 1.00 82.68  ? 130 ASN Y CB  1 
ATOM   2183 C CG  . ASN B 2 133 ? 21.972 -7.611  59.252 1.00 104.02 ? 130 ASN Y CG  1 
ATOM   2184 O OD1 . ASN B 2 133 ? 21.687 -8.327  58.294 1.00 120.13 ? 130 ASN Y OD1 1 
ATOM   2185 N ND2 . ASN B 2 133 ? 21.471 -7.807  60.462 1.00 111.38 ? 130 ASN Y ND2 1 
ATOM   2186 N N   . GLU B 2 134 ? 20.350 -6.065  57.326 1.00 77.26  ? 131 GLU Y N   1 
ATOM   2187 C CA  . GLU B 2 134 ? 18.939 -5.711  57.165 1.00 84.63  ? 131 GLU Y CA  1 
ATOM   2188 C C   . GLU B 2 134 ? 18.340 -4.897  58.317 1.00 87.57  ? 131 GLU Y C   1 
ATOM   2189 O O   . GLU B 2 134 ? 17.332 -4.216  58.141 1.00 91.19  ? 131 GLU Y O   1 
ATOM   2190 C CB  . GLU B 2 134 ? 18.112 -6.969  56.923 1.00 89.93  ? 131 GLU Y CB  1 
ATOM   2191 N N   . ASN B 2 135 ? 18.952 -4.977  59.494 1.00 85.90  ? 132 ASN Y N   1 
ATOM   2192 C CA  . ASN B 2 135 ? 18.474 -4.233  60.658 1.00 83.32  ? 132 ASN Y CA  1 
ATOM   2193 C C   . ASN B 2 135 ? 19.117 -2.848  60.732 1.00 78.78  ? 132 ASN Y C   1 
ATOM   2194 O O   . ASN B 2 135 ? 18.958 -2.131  61.722 1.00 77.74  ? 132 ASN Y O   1 
ATOM   2195 C CB  . ASN B 2 135 ? 18.746 -5.017  61.947 1.00 90.51  ? 132 ASN Y CB  1 
ATOM   2196 C CG  . ASN B 2 135 ? 20.215 -5.351  62.132 1.00 101.46 ? 132 ASN Y CG  1 
ATOM   2197 O OD1 . ASN B 2 135 ? 21.026 -5.186  61.220 1.00 96.21  ? 132 ASN Y OD1 1 
ATOM   2198 N ND2 . ASN B 2 135 ? 20.562 -5.848  63.313 1.00 109.01 ? 132 ASN Y ND2 1 
ATOM   2199 N N   . ASN B 2 136 ? 19.823 -2.481  59.667 1.00 74.68  ? 133 ASN Y N   1 
ATOM   2200 C CA  . ASN B 2 136 ? 20.509 -1.196  59.546 1.00 71.70  ? 133 ASN Y CA  1 
ATOM   2201 C C   . ASN B 2 136 ? 21.641 -0.973  60.542 1.00 67.73  ? 133 ASN Y C   1 
ATOM   2202 O O   . ASN B 2 136 ? 21.731 0.076   61.180 1.00 73.11  ? 133 ASN Y O   1 
ATOM   2203 C CB  . ASN B 2 136 ? 19.509 -0.038  59.598 1.00 84.38  ? 133 ASN Y CB  1 
ATOM   2204 C CG  . ASN B 2 136 ? 18.613 0.007   58.380 1.00 99.42  ? 133 ASN Y CG  1 
ATOM   2205 O OD1 . ASN B 2 136 ? 19.080 0.186   57.254 1.00 96.89  ? 133 ASN Y OD1 1 
ATOM   2206 N ND2 . ASN B 2 136 ? 17.317 -0.162  58.596 1.00 112.12 ? 133 ASN Y ND2 1 
ATOM   2207 N N   . GLU B 2 137 ? 22.525 -1.957  60.648 1.00 61.24  ? 134 GLU Y N   1 
ATOM   2208 C CA  . GLU B 2 137 ? 23.669 -1.871  61.546 1.00 57.72  ? 134 GLU Y CA  1 
ATOM   2209 C C   . GLU B 2 137 ? 24.929 -2.171  60.751 1.00 56.83  ? 134 GLU Y C   1 
ATOM   2210 O O   . GLU B 2 137 ? 24.925 -3.057  59.897 1.00 63.59  ? 134 GLU Y O   1 
ATOM   2211 C CB  . GLU B 2 137 ? 23.555 -2.895  62.678 1.00 67.33  ? 134 GLU Y CB  1 
ATOM   2212 C CG  . GLU B 2 137 ? 22.424 -2.663  63.670 1.00 81.14  ? 134 GLU Y CG  1 
ATOM   2213 C CD  . GLU B 2 137 ? 22.391 -3.707  64.785 1.00 95.47  ? 134 GLU Y CD  1 
ATOM   2214 O OE1 . GLU B 2 137 ? 23.141 -4.708  64.710 1.00 86.68  ? 134 GLU Y OE1 1 
ATOM   2215 O OE2 . GLU B 2 137 ? 21.606 -3.530  65.740 1.00 110.73 ? 134 GLU Y OE2 1 
ATOM   2216 N N   . LEU B 2 138 ? 25.990 -1.411  61.000 1.00 52.75  ? 135 LEU Y N   1 
ATOM   2217 C CA  . LEU B 2 138 ? 27.256 -1.645  60.315 1.00 47.56  ? 135 LEU Y CA  1 
ATOM   2218 C C   . LEU B 2 138 ? 27.936 -2.783  61.066 1.00 50.18  ? 135 LEU Y C   1 
ATOM   2219 O O   . LEU B 2 138 ? 27.766 -2.919  62.278 1.00 52.74  ? 135 LEU Y O   1 
ATOM   2220 C CB  . LEU B 2 138 ? 28.149 -0.398  60.339 1.00 43.33  ? 135 LEU Y CB  1 
ATOM   2221 C CG  . LEU B 2 138 ? 27.642 0.868   59.641 1.00 54.82  ? 135 LEU Y CG  1 
ATOM   2222 C CD1 . LEU B 2 138 ? 26.700 1.628   60.561 1.00 69.79  ? 135 LEU Y CD1 1 
ATOM   2223 C CD2 . LEU B 2 138 ? 28.815 1.751   59.270 1.00 53.58  ? 135 LEU Y CD2 1 
ATOM   2224 N N   . PRO B 2 139 ? 28.678 -3.639  60.353 1.00 51.78  ? 136 PRO Y N   1 
ATOM   2225 C CA  . PRO B 2 139 ? 29.355 -4.755  61.014 1.00 49.93  ? 136 PRO Y CA  1 
ATOM   2226 C C   . PRO B 2 139 ? 30.397 -4.301  62.036 1.00 51.23  ? 136 PRO Y C   1 
ATOM   2227 O O   . PRO B 2 139 ? 30.989 -3.225  61.910 1.00 55.82  ? 136 PRO Y O   1 
ATOM   2228 C CB  . PRO B 2 139 ? 29.984 -5.512  59.844 1.00 52.90  ? 136 PRO Y CB  1 
ATOM   2229 C CG  . PRO B 2 139 ? 30.234 -4.435  58.837 1.00 57.84  ? 136 PRO Y CG  1 
ATOM   2230 C CD  . PRO B 2 139 ? 28.965 -3.630  58.909 1.00 57.58  ? 136 PRO Y CD  1 
ATOM   2231 N N   . LYS B 2 140 ? 30.594 -5.130  63.056 1.00 49.00  ? 137 LYS Y N   1 
ATOM   2232 C CA  . LYS B 2 140 ? 31.547 -4.860  64.127 1.00 48.61  ? 137 LYS Y CA  1 
ATOM   2233 C C   . LYS B 2 140 ? 32.965 -4.766  63.566 1.00 47.81  ? 137 LYS Y C   1 
ATOM   2234 O O   . LYS B 2 140 ? 33.514 -5.755  63.067 1.00 51.39  ? 137 LYS Y O   1 
ATOM   2235 C CB  . LYS B 2 140 ? 31.464 -5.974  65.174 1.00 54.76  ? 137 LYS Y CB  1 
ATOM   2236 C CG  . LYS B 2 140 ? 32.129 -5.667  66.501 1.00 77.92  ? 137 LYS Y CG  1 
ATOM   2237 C CD  . LYS B 2 140 ? 31.798 -6.759  67.509 1.00 104.02 ? 137 LYS Y CD  1 
ATOM   2238 C CE  . LYS B 2 140 ? 32.350 -6.458  68.893 1.00 113.60 ? 137 LYS Y CE  1 
ATOM   2239 N NZ  . LYS B 2 140 ? 31.956 -7.512  69.875 1.00 111.83 ? 137 LYS Y NZ  1 
ATOM   2240 N N   . LEU B 2 141 ? 33.541 -3.570  63.635 1.00 42.41  ? 138 LEU Y N   1 
ATOM   2241 C CA  . LEU B 2 141 ? 34.886 -3.331  63.133 1.00 32.64  ? 138 LEU Y CA  1 
ATOM   2242 C C   . LEU B 2 141 ? 35.952 -3.522  64.205 1.00 27.70  ? 138 LEU Y C   1 
ATOM   2243 O O   . LEU B 2 141 ? 35.737 -3.214  65.378 1.00 27.39  ? 138 LEU Y O   1 
ATOM   2244 C CB  . LEU B 2 141 ? 34.997 -1.912  62.569 1.00 17.45  ? 138 LEU Y CB  1 
ATOM   2245 C CG  . LEU B 2 141 ? 34.060 -1.528  61.425 1.00 19.54  ? 138 LEU Y CG  1 
ATOM   2246 C CD1 . LEU B 2 141 ? 34.077 -0.030  61.219 1.00 31.93  ? 138 LEU Y CD1 1 
ATOM   2247 C CD2 . LEU B 2 141 ? 34.478 -2.240  60.164 1.00 30.62  ? 138 LEU Y CD2 1 
ATOM   2248 N N   . GLN B 2 142 ? 37.096 -4.052  63.792 1.00 21.76  ? 139 GLN Y N   1 
ATOM   2249 C CA  . GLN B 2 142 ? 38.223 -4.253  64.686 1.00 24.72  ? 139 GLN Y CA  1 
ATOM   2250 C C   . GLN B 2 142 ? 39.356 -3.432  64.078 1.00 27.30  ? 139 GLN Y C   1 
ATOM   2251 O O   . GLN B 2 142 ? 39.679 -3.572  62.893 1.00 35.86  ? 139 GLN Y O   1 
ATOM   2252 C CB  . GLN B 2 142 ? 38.586 -5.741  64.797 1.00 41.21  ? 139 GLN Y CB  1 
ATOM   2253 C CG  . GLN B 2 142 ? 38.894 -6.433  63.475 1.00 80.76  ? 139 GLN Y CG  1 
ATOM   2254 C CD  . GLN B 2 142 ? 39.004 -7.947  63.600 1.00 94.63  ? 139 GLN Y CD  1 
ATOM   2255 O OE1 . GLN B 2 142 ? 38.608 -8.679  62.691 1.00 102.30 ? 139 GLN Y OE1 1 
ATOM   2256 N NE2 . GLN B 2 142 ? 39.547 -8.421  64.714 1.00 92.90  ? 139 GLN Y NE2 1 
ATOM   2257 N N   . TRP B 2 143 ? 39.890 -2.508  64.865 1.00 20.15  ? 140 TRP Y N   1 
ATOM   2258 C CA  . TRP B 2 143 ? 40.953 -1.629  64.408 1.00 12.31  ? 140 TRP Y CA  1 
ATOM   2259 C C   . TRP B 2 143 ? 42.344 -2.144  64.733 1.00 17.03  ? 140 TRP Y C   1 
ATOM   2260 O O   . TRP B 2 143 ? 42.540 -2.889  65.696 1.00 23.78  ? 140 TRP Y O   1 
ATOM   2261 C CB  . TRP B 2 143 ? 40.763 -0.225  64.986 1.00 11.39  ? 140 TRP Y CB  1 
ATOM   2262 C CG  . TRP B 2 143 ? 39.521 0.455   64.498 1.00 2.00   ? 140 TRP Y CG  1 
ATOM   2263 C CD1 . TRP B 2 143 ? 38.243 0.225   64.920 1.00 2.00   ? 140 TRP Y CD1 1 
ATOM   2264 C CD2 . TRP B 2 143 ? 39.436 1.457   63.483 1.00 2.00   ? 140 TRP Y CD2 1 
ATOM   2265 N NE1 . TRP B 2 143 ? 37.366 1.020   64.228 1.00 5.30   ? 140 TRP Y NE1 1 
ATOM   2266 C CE2 . TRP B 2 143 ? 38.070 1.787   63.337 1.00 8.37   ? 140 TRP Y CE2 1 
ATOM   2267 C CE3 . TRP B 2 143 ? 40.381 2.108   62.679 1.00 4.31   ? 140 TRP Y CE3 1 
ATOM   2268 C CZ2 . TRP B 2 143 ? 37.623 2.741   62.415 1.00 2.06   ? 140 TRP Y CZ2 1 
ATOM   2269 C CZ3 . TRP B 2 143 ? 39.936 3.060   61.761 1.00 3.56   ? 140 TRP Y CZ3 1 
ATOM   2270 C CH2 . TRP B 2 143 ? 38.567 3.364   61.639 1.00 2.08   ? 140 TRP Y CH2 1 
ATOM   2271 N N   . TYR B 2 144 ? 43.299 -1.759  63.896 1.00 18.48  ? 141 TYR Y N   1 
ATOM   2272 C CA  . TYR B 2 144 ? 44.693 -2.143  64.048 1.00 12.31  ? 141 TYR Y CA  1 
ATOM   2273 C C   . TYR B 2 144 ? 45.506 -0.906  63.720 1.00 16.19  ? 141 TYR Y C   1 
ATOM   2274 O O   . TYR B 2 144 ? 45.029 -0.021  63.007 1.00 22.38  ? 141 TYR Y O   1 
ATOM   2275 C CB  . TYR B 2 144 ? 45.071 -3.241  63.043 1.00 17.25  ? 141 TYR Y CB  1 
ATOM   2276 C CG  . TYR B 2 144 ? 44.407 -4.585  63.258 1.00 27.98  ? 141 TYR Y CG  1 
ATOM   2277 C CD1 . TYR B 2 144 ? 43.075 -4.793  62.906 1.00 28.14  ? 141 TYR Y CD1 1 
ATOM   2278 C CD2 . TYR B 2 144 ? 45.121 -5.659  63.792 1.00 25.20  ? 141 TYR Y CD2 1 
ATOM   2279 C CE1 . TYR B 2 144 ? 42.472 -6.031  63.076 1.00 31.04  ? 141 TYR Y CE1 1 
ATOM   2280 C CE2 . TYR B 2 144 ? 44.526 -6.901  63.967 1.00 13.33  ? 141 TYR Y CE2 1 
ATOM   2281 C CZ  . TYR B 2 144 ? 43.201 -7.078  63.605 1.00 27.85  ? 141 TYR Y CZ  1 
ATOM   2282 O OH  . TYR B 2 144 ? 42.595 -8.302  63.773 1.00 37.64  ? 141 TYR Y OH  1 
ATOM   2283 N N   . LYS B 2 145 ? 46.724 -0.840  64.240 1.00 15.05  ? 142 LYS Y N   1 
ATOM   2284 C CA  . LYS B 2 145 ? 47.610 0.277   63.964 1.00 12.97  ? 142 LYS Y CA  1 
ATOM   2285 C C   . LYS B 2 145 ? 48.924 -0.325  63.497 1.00 21.32  ? 142 LYS Y C   1 
ATOM   2286 O O   . LYS B 2 145 ? 49.579 -1.053  64.240 1.00 23.96  ? 142 LYS Y O   1 
ATOM   2287 C CB  . LYS B 2 145 ? 47.827 1.131   65.215 1.00 24.12  ? 142 LYS Y CB  1 
ATOM   2288 C CG  . LYS B 2 145 ? 48.743 2.333   64.995 1.00 24.27  ? 142 LYS Y CG  1 
ATOM   2289 C CD  . LYS B 2 145 ? 48.880 3.163   66.262 1.00 25.09  ? 142 LYS Y CD  1 
ATOM   2290 C CE  . LYS B 2 145 ? 49.995 4.191   66.139 1.00 28.44  ? 142 LYS Y CE  1 
ATOM   2291 N NZ  . LYS B 2 145 ? 51.326 3.555   65.924 1.00 13.42  ? 142 LYS Y NZ  1 
ATOM   2292 N N   . ASP B 2 146 ? 49.262 -0.072  62.238 1.00 24.30  ? 143 ASP Y N   1 
ATOM   2293 C CA  . ASP B 2 146 ? 50.488 -0.586  61.637 1.00 27.06  ? 143 ASP Y CA  1 
ATOM   2294 C C   . ASP B 2 146 ? 50.542 -2.110  61.690 1.00 31.53  ? 143 ASP Y C   1 
ATOM   2295 O O   . ASP B 2 146 ? 51.576 -2.701  61.997 1.00 33.53  ? 143 ASP Y O   1 
ATOM   2296 C CB  . ASP B 2 146 ? 51.726 0.034   62.298 1.00 22.08  ? 143 ASP Y CB  1 
ATOM   2297 C CG  . ASP B 2 146 ? 51.858 1.526   62.014 1.00 41.71  ? 143 ASP Y CG  1 
ATOM   2298 O OD1 . ASP B 2 146 ? 51.888 1.918   60.829 1.00 47.61  ? 143 ASP Y OD1 1 
ATOM   2299 O OD2 . ASP B 2 146 ? 51.936 2.312   62.982 1.00 54.94  ? 143 ASP Y OD2 1 
ATOM   2300 N N   . CYS B 2 147 ? 49.399 -2.727  61.402 1.00 36.99  ? 144 CYS Y N   1 
ATOM   2301 C CA  . CYS B 2 147 ? 49.236 -4.181  61.371 1.00 33.38  ? 144 CYS Y CA  1 
ATOM   2302 C C   . CYS B 2 147 ? 49.241 -4.915  62.716 1.00 34.19  ? 144 CYS Y C   1 
ATOM   2303 O O   . CYS B 2 147 ? 49.179 -6.148  62.758 1.00 40.77  ? 144 CYS Y O   1 
ATOM   2304 C CB  . CYS B 2 147 ? 50.237 -4.810  60.402 1.00 30.08  ? 144 CYS Y CB  1 
ATOM   2305 S SG  . CYS B 2 147 ? 50.165 -4.071  58.737 1.00 27.01  ? 144 CYS Y SG  1 
ATOM   2306 N N   . LYS B 2 148 ? 49.294 -4.166  63.811 1.00 25.40  ? 145 LYS Y N   1 
ATOM   2307 C CA  . LYS B 2 148 ? 49.263 -4.764  65.140 1.00 23.79  ? 145 LYS Y CA  1 
ATOM   2308 C C   . LYS B 2 148 ? 47.930 -4.375  65.781 1.00 26.83  ? 145 LYS Y C   1 
ATOM   2309 O O   . LYS B 2 148 ? 47.458 -3.254  65.601 1.00 33.10  ? 145 LYS Y O   1 
ATOM   2310 C CB  . LYS B 2 148 ? 50.447 -4.282  65.979 1.00 25.74  ? 145 LYS Y CB  1 
ATOM   2311 C CG  . LYS B 2 148 ? 51.800 -4.748  65.450 1.00 32.56  ? 145 LYS Y CG  1 
ATOM   2312 C CD  . LYS B 2 148 ? 52.942 -4.345  66.371 1.00 63.30  ? 145 LYS Y CD  1 
ATOM   2313 C CE  . LYS B 2 148 ? 53.119 -2.830  66.442 1.00 89.72  ? 145 LYS Y CE  1 
ATOM   2314 N NZ  . LYS B 2 148 ? 53.535 -2.232  65.139 1.00 94.95  ? 145 LYS Y NZ  1 
ATOM   2315 N N   . PRO B 2 149 ? 47.293 -5.307  66.510 1.00 28.50  ? 146 PRO Y N   1 
ATOM   2316 C CA  . PRO B 2 149 ? 46.005 -5.063  67.169 1.00 27.19  ? 146 PRO Y CA  1 
ATOM   2317 C C   . PRO B 2 149 ? 45.966 -3.806  68.037 1.00 24.23  ? 146 PRO Y C   1 
ATOM   2318 O O   . PRO B 2 149 ? 46.966 -3.421  68.641 1.00 18.14  ? 146 PRO Y O   1 
ATOM   2319 C CB  . PRO B 2 149 ? 45.790 -6.343  67.985 1.00 31.26  ? 146 PRO Y CB  1 
ATOM   2320 C CG  . PRO B 2 149 ? 47.189 -6.822  68.252 1.00 30.49  ? 146 PRO Y CG  1 
ATOM   2321 C CD  . PRO B 2 149 ? 47.839 -6.614  66.913 1.00 36.79  ? 146 PRO Y CD  1 
ATOM   2322 N N   . LEU B 2 150 ? 44.797 -3.175  68.087 1.00 30.19  ? 147 LEU Y N   1 
ATOM   2323 C CA  . LEU B 2 150 ? 44.597 -1.950  68.851 1.00 34.04  ? 147 LEU Y CA  1 
ATOM   2324 C C   . LEU B 2 150 ? 43.597 -2.190  69.978 1.00 35.72  ? 147 LEU Y C   1 
ATOM   2325 O O   . LEU B 2 150 ? 42.495 -2.688  69.747 1.00 39.99  ? 147 LEU Y O   1 
ATOM   2326 C CB  . LEU B 2 150 ? 44.073 -0.847  67.923 1.00 38.56  ? 147 LEU Y CB  1 
ATOM   2327 C CG  . LEU B 2 150 ? 44.241 0.611   68.346 1.00 37.62  ? 147 LEU Y CG  1 
ATOM   2328 C CD1 . LEU B 2 150 ? 45.716 0.989   68.288 1.00 22.96  ? 147 LEU Y CD1 1 
ATOM   2329 C CD2 . LEU B 2 150 ? 43.434 1.505   67.421 1.00 33.81  ? 147 LEU Y CD2 1 
ATOM   2330 N N   . LEU B 2 151 ? 43.987 -1.833  71.197 1.00 37.90  ? 148 LEU Y N   1 
ATOM   2331 C CA  . LEU B 2 151 ? 43.132 -2.009  72.364 1.00 37.54  ? 148 LEU Y CA  1 
ATOM   2332 C C   . LEU B 2 151 ? 42.124 -0.869  72.511 1.00 38.05  ? 148 LEU Y C   1 
ATOM   2333 O O   . LEU B 2 151 ? 42.485 0.254   72.884 1.00 42.71  ? 148 LEU Y O   1 
ATOM   2334 C CB  . LEU B 2 151 ? 43.991 -2.129  73.627 1.00 52.00  ? 148 LEU Y CB  1 
ATOM   2335 C CG  . LEU B 2 151 ? 43.288 -2.300  74.978 1.00 69.12  ? 148 LEU Y CG  1 
ATOM   2336 C CD1 . LEU B 2 151 ? 42.443 -3.569  75.000 1.00 68.96  ? 148 LEU Y CD1 1 
ATOM   2337 C CD2 . LEU B 2 151 ? 44.331 -2.333  76.082 1.00 87.39  ? 148 LEU Y CD2 1 
ATOM   2338 N N   . LEU B 2 152 ? 40.862 -1.161  72.211 1.00 27.97  ? 149 LEU Y N   1 
ATOM   2339 C CA  . LEU B 2 152 ? 39.796 -0.169  72.321 1.00 25.65  ? 149 LEU Y CA  1 
ATOM   2340 C C   . LEU B 2 152 ? 39.226 -0.247  73.732 1.00 27.82  ? 149 LEU Y C   1 
ATOM   2341 O O   . LEU B 2 152 ? 38.142 -0.788  73.952 1.00 28.03  ? 149 LEU Y O   1 
ATOM   2342 C CB  . LEU B 2 152 ? 38.694 -0.442  71.293 1.00 12.53  ? 149 LEU Y CB  1 
ATOM   2343 C CG  . LEU B 2 152 ? 39.127 -0.797  69.867 1.00 13.77  ? 149 LEU Y CG  1 
ATOM   2344 C CD1 . LEU B 2 152 ? 37.903 -0.837  68.979 1.00 8.27   ? 149 LEU Y CD1 1 
ATOM   2345 C CD2 . LEU B 2 152 ? 40.139 0.206   69.337 1.00 22.08  ? 149 LEU Y CD2 1 
ATOM   2346 N N   . ASP B 2 153 ? 39.977 0.293   74.685 1.00 27.21  ? 150 ASP Y N   1 
ATOM   2347 C CA  . ASP B 2 153 ? 39.596 0.277   76.094 1.00 24.05  ? 150 ASP Y CA  1 
ATOM   2348 C C   . ASP B 2 153 ? 38.633 1.366   76.565 1.00 26.92  ? 150 ASP Y C   1 
ATOM   2349 O O   . ASP B 2 153 ? 38.393 1.492   77.766 1.00 38.12  ? 150 ASP Y O   1 
ATOM   2350 C CB  . ASP B 2 153 ? 40.855 0.301   76.963 1.00 24.44  ? 150 ASP Y CB  1 
ATOM   2351 C CG  . ASP B 2 153 ? 41.832 1.383   76.542 1.00 33.99  ? 150 ASP Y CG  1 
ATOM   2352 O OD1 . ASP B 2 153 ? 41.388 2.399   75.974 1.00 32.12  ? 150 ASP Y OD1 1 
ATOM   2353 O OD2 . ASP B 2 153 ? 43.048 1.214   76.768 1.00 49.02  ? 150 ASP Y OD2 1 
ATOM   2354 N N   . ASN B 2 154 ? 38.103 2.158   75.637 1.00 23.55  ? 151 ASN Y N   1 
ATOM   2355 C CA  . ASN B 2 154 ? 37.172 3.246   75.967 1.00 20.19  ? 151 ASN Y CA  1 
ATOM   2356 C C   . ASN B 2 154 ? 37.803 4.330   76.838 1.00 21.92  ? 151 ASN Y C   1 
ATOM   2357 O O   . ASN B 2 154 ? 37.103 5.153   77.426 1.00 21.74  ? 151 ASN Y O   1 
ATOM   2358 C CB  . ASN B 2 154 ? 35.913 2.715   76.661 1.00 11.70  ? 151 ASN Y CB  1 
ATOM   2359 C CG  . ASN B 2 154 ? 35.042 1.890   75.743 1.00 30.56  ? 151 ASN Y CG  1 
ATOM   2360 O OD1 . ASN B 2 154 ? 34.721 0.744   76.048 1.00 47.00  ? 151 ASN Y OD1 1 
ATOM   2361 N ND2 . ASN B 2 154 ? 34.644 2.469   74.616 1.00 33.17  ? 151 ASN Y ND2 1 
ATOM   2362 N N   . ILE B 2 155 ? 39.128 4.328   76.905 1.00 22.74  ? 152 ILE Y N   1 
ATOM   2363 C CA  . ILE B 2 155 ? 39.872 5.295   77.699 1.00 24.12  ? 152 ILE Y CA  1 
ATOM   2364 C C   . ILE B 2 155 ? 40.855 6.033   76.791 1.00 26.97  ? 152 ILE Y C   1 
ATOM   2365 O O   . ILE B 2 155 ? 41.017 7.248   76.884 1.00 31.15  ? 152 ILE Y O   1 
ATOM   2366 C CB  . ILE B 2 155 ? 40.635 4.577   78.844 1.00 28.23  ? 152 ILE Y CB  1 
ATOM   2367 C CG1 . ILE B 2 155 ? 39.638 3.988   79.841 1.00 31.54  ? 152 ILE Y CG1 1 
ATOM   2368 C CG2 . ILE B 2 155 ? 41.584 5.525   79.554 1.00 33.64  ? 152 ILE Y CG2 1 
ATOM   2369 C CD1 . ILE B 2 155 ? 40.277 3.125   80.901 1.00 44.98  ? 152 ILE Y CD1 1 
ATOM   2370 N N   . HIS B 2 156 ? 41.519 5.281   75.919 1.00 23.35  ? 153 HIS Y N   1 
ATOM   2371 C CA  . HIS B 2 156 ? 42.487 5.839   74.979 1.00 24.83  ? 153 HIS Y CA  1 
ATOM   2372 C C   . HIS B 2 156 ? 41.942 5.767   73.554 1.00 25.25  ? 153 HIS Y C   1 
ATOM   2373 O O   . HIS B 2 156 ? 42.243 6.624   72.722 1.00 36.17  ? 153 HIS Y O   1 
ATOM   2374 C CB  . HIS B 2 156 ? 43.816 5.086   75.065 1.00 38.68  ? 153 HIS Y CB  1 
ATOM   2375 C CG  . HIS B 2 156 ? 44.440 5.110   76.426 1.00 66.66  ? 153 HIS Y CG  1 
ATOM   2376 N ND1 . HIS B 2 156 ? 45.045 4.006   76.987 1.00 78.61  ? 153 HIS Y ND1 1 
ATOM   2377 C CD2 . HIS B 2 156 ? 44.544 6.101   77.343 1.00 72.17  ? 153 HIS Y CD2 1 
ATOM   2378 C CE1 . HIS B 2 156 ? 45.493 4.314   78.191 1.00 81.11  ? 153 HIS Y CE1 1 
ATOM   2379 N NE2 . HIS B 2 156 ? 45.202 5.580   78.431 1.00 78.35  ? 153 HIS Y NE2 1 
ATOM   2380 N N   . PHE B 2 157 ? 41.148 4.735   73.282 1.00 16.88  ? 154 PHE Y N   1 
ATOM   2381 C CA  . PHE B 2 157 ? 40.541 4.526   71.973 1.00 7.53   ? 154 PHE Y CA  1 
ATOM   2382 C C   . PHE B 2 157 ? 39.154 3.945   72.189 1.00 15.00  ? 154 PHE Y C   1 
ATOM   2383 O O   . PHE B 2 157 ? 38.964 3.104   73.072 1.00 25.62  ? 154 PHE Y O   1 
ATOM   2384 C CB  . PHE B 2 157 ? 41.357 3.531   71.150 1.00 7.11   ? 154 PHE Y CB  1 
ATOM   2385 C CG  . PHE B 2 157 ? 42.706 4.040   70.738 1.00 5.09   ? 154 PHE Y CG  1 
ATOM   2386 C CD1 . PHE B 2 157 ? 42.854 4.787   69.578 1.00 12.78  ? 154 PHE Y CD1 1 
ATOM   2387 C CD2 . PHE B 2 157 ? 43.833 3.743   71.491 1.00 15.92  ? 154 PHE Y CD2 1 
ATOM   2388 C CE1 . PHE B 2 157 ? 44.107 5.233   69.168 1.00 31.81  ? 154 PHE Y CE1 1 
ATOM   2389 C CE2 . PHE B 2 157 ? 45.092 4.183   71.093 1.00 17.41  ? 154 PHE Y CE2 1 
ATOM   2390 C CZ  . PHE B 2 157 ? 45.230 4.928   69.927 1.00 26.82  ? 154 PHE Y CZ  1 
ATOM   2391 N N   . SER B 2 158 ? 38.191 4.391   71.392 1.00 16.01  ? 155 SER Y N   1 
ATOM   2392 C CA  . SER B 2 158 ? 36.823 3.904   71.492 1.00 17.13  ? 155 SER Y CA  1 
ATOM   2393 C C   . SER B 2 158 ? 36.286 3.622   70.099 1.00 25.58  ? 155 SER Y C   1 
ATOM   2394 O O   . SER B 2 158 ? 36.318 4.488   69.229 1.00 33.59  ? 155 SER Y O   1 
ATOM   2395 C CB  . SER B 2 158 ? 35.927 4.943   72.172 1.00 25.23  ? 155 SER Y CB  1 
ATOM   2396 O OG  . SER B 2 158 ? 36.377 5.249   73.480 1.00 39.33  ? 155 SER Y OG  1 
ATOM   2397 N N   . GLY B 2 159 ? 35.828 2.398   69.883 1.00 31.32  ? 156 GLY Y N   1 
ATOM   2398 C CA  . GLY B 2 159 ? 35.277 2.038   68.593 1.00 25.35  ? 156 GLY Y CA  1 
ATOM   2399 C C   . GLY B 2 159 ? 33.777 2.237   68.649 1.00 31.10  ? 156 GLY Y C   1 
ATOM   2400 O O   . GLY B 2 159 ? 33.081 1.522   69.370 1.00 40.27  ? 156 GLY Y O   1 
ATOM   2401 N N   . VAL B 2 160 ? 33.281 3.253   67.956 1.00 30.49  ? 157 VAL Y N   1 
ATOM   2402 C CA  . VAL B 2 160 ? 31.852 3.530   67.932 1.00 27.41  ? 157 VAL Y CA  1 
ATOM   2403 C C   . VAL B 2 160 ? 31.406 3.474   66.480 1.00 31.59  ? 157 VAL Y C   1 
ATOM   2404 O O   . VAL B 2 160 ? 31.899 4.234   65.644 1.00 37.37  ? 157 VAL Y O   1 
ATOM   2405 C CB  . VAL B 2 160 ? 31.530 4.919   68.520 1.00 30.05  ? 157 VAL Y CB  1 
ATOM   2406 C CG1 . VAL B 2 160 ? 30.043 5.211   68.403 1.00 26.63  ? 157 VAL Y CG1 1 
ATOM   2407 C CG2 . VAL B 2 160 ? 31.966 4.980   69.976 1.00 32.89  ? 157 VAL Y CG2 1 
ATOM   2408 N N   . LYS B 2 161 ? 30.498 2.550   66.182 1.00 30.97  ? 158 LYS Y N   1 
ATOM   2409 C CA  . LYS B 2 161 ? 29.982 2.363   64.830 1.00 29.33  ? 158 LYS Y CA  1 
ATOM   2410 C C   . LYS B 2 161 ? 31.111 2.230   63.800 1.00 31.26  ? 158 LYS Y C   1 
ATOM   2411 O O   . LYS B 2 161 ? 31.901 1.291   63.879 1.00 39.32  ? 158 LYS Y O   1 
ATOM   2412 C CB  . LYS B 2 161 ? 28.988 3.478   64.474 1.00 30.34  ? 158 LYS Y CB  1 
ATOM   2413 C CG  . LYS B 2 161 ? 27.650 3.336   65.198 1.00 29.19  ? 158 LYS Y CG  1 
ATOM   2414 C CD  . LYS B 2 161 ? 26.693 4.476   64.877 1.00 52.35  ? 158 LYS Y CD  1 
ATOM   2415 C CE  . LYS B 2 161 ? 25.281 4.165   65.362 1.00 69.21  ? 158 LYS Y CE  1 
ATOM   2416 N NZ  . LYS B 2 161 ? 25.208 3.931   66.832 1.00 85.31  ? 158 LYS Y NZ  1 
ATOM   2417 N N   . ASP B 2 162 ? 31.225 3.176   62.873 1.00 26.70  ? 159 ASP Y N   1 
ATOM   2418 C CA  . ASP B 2 162 ? 32.275 3.113   61.861 1.00 20.97  ? 159 ASP Y CA  1 
ATOM   2419 C C   . ASP B 2 162 ? 33.440 4.067   62.104 1.00 20.41  ? 159 ASP Y C   1 
ATOM   2420 O O   . ASP B 2 162 ? 34.189 4.380   61.177 1.00 24.03  ? 159 ASP Y O   1 
ATOM   2421 C CB  . ASP B 2 162 ? 31.691 3.350   60.463 1.00 23.84  ? 159 ASP Y CB  1 
ATOM   2422 C CG  . ASP B 2 162 ? 31.010 4.707   60.318 1.00 37.17  ? 159 ASP Y CG  1 
ATOM   2423 O OD1 . ASP B 2 162 ? 30.905 5.465   61.307 1.00 33.05  ? 159 ASP Y OD1 1 
ATOM   2424 O OD2 . ASP B 2 162 ? 30.567 5.013   59.192 1.00 56.18  ? 159 ASP Y OD2 1 
ATOM   2425 N N   . ARG B 2 163 ? 33.606 4.519   63.342 1.00 23.25  ? 160 ARG Y N   1 
ATOM   2426 C CA  . ARG B 2 163 ? 34.688 5.442   63.655 1.00 24.72  ? 160 ARG Y CA  1 
ATOM   2427 C C   . ARG B 2 163 ? 35.484 5.068   64.899 1.00 18.25  ? 160 ARG Y C   1 
ATOM   2428 O O   . ARG B 2 163 ? 34.985 4.382   65.791 1.00 19.46  ? 160 ARG Y O   1 
ATOM   2429 C CB  . ARG B 2 163 ? 34.149 6.872   63.773 1.00 21.97  ? 160 ARG Y CB  1 
ATOM   2430 C CG  . ARG B 2 163 ? 33.412 7.187   65.056 1.00 15.79  ? 160 ARG Y CG  1 
ATOM   2431 C CD  . ARG B 2 163 ? 32.447 8.355   64.869 1.00 43.37  ? 160 ARG Y CD  1 
ATOM   2432 N NE  . ARG B 2 163 ? 32.985 9.412   64.011 1.00 59.36  ? 160 ARG Y NE  1 
ATOM   2433 C CZ  . ARG B 2 163 ? 33.574 10.523  64.449 1.00 65.16  ? 160 ARG Y CZ  1 
ATOM   2434 N NH1 . ARG B 2 163 ? 33.717 10.750  65.747 1.00 59.45  ? 160 ARG Y NH1 1 
ATOM   2435 N NH2 . ARG B 2 163 ? 34.010 11.423  63.577 1.00 68.65  ? 160 ARG Y NH2 1 
ATOM   2436 N N   . LEU B 2 164 ? 36.742 5.498   64.914 1.00 17.89  ? 161 LEU Y N   1 
ATOM   2437 C CA  . LEU B 2 164 ? 37.663 5.253   66.014 1.00 18.77  ? 161 LEU Y CA  1 
ATOM   2438 C C   . LEU B 2 164 ? 37.910 6.576   66.730 1.00 24.55  ? 161 LEU Y C   1 
ATOM   2439 O O   . LEU B 2 164 ? 38.573 7.467   66.189 1.00 29.20  ? 161 LEU Y O   1 
ATOM   2440 C CB  . LEU B 2 164 ? 38.993 4.707   65.483 1.00 5.66   ? 161 LEU Y CB  1 
ATOM   2441 C CG  . LEU B 2 164 ? 40.095 4.458   66.521 1.00 14.72  ? 161 LEU Y CG  1 
ATOM   2442 C CD1 . LEU B 2 164 ? 39.722 3.284   67.420 1.00 16.22  ? 161 LEU Y CD1 1 
ATOM   2443 C CD2 . LEU B 2 164 ? 41.423 4.196   65.827 1.00 2.00   ? 161 LEU Y CD2 1 
ATOM   2444 N N   . ILE B 2 165 ? 37.327 6.724   67.914 1.00 19.64  ? 162 ILE Y N   1 
ATOM   2445 C CA  . ILE B 2 165 ? 37.493 7.936   68.703 1.00 14.88  ? 162 ILE Y CA  1 
ATOM   2446 C C   . ILE B 2 165 ? 38.845 7.868   69.419 1.00 16.01  ? 162 ILE Y C   1 
ATOM   2447 O O   . ILE B 2 165 ? 39.115 6.919   70.159 1.00 20.67  ? 162 ILE Y O   1 
ATOM   2448 C CB  . ILE B 2 165 ? 36.379 8.080   69.766 1.00 11.92  ? 162 ILE Y CB  1 
ATOM   2449 C CG1 . ILE B 2 165 ? 34.999 7.851   69.145 1.00 6.08   ? 162 ILE Y CG1 1 
ATOM   2450 C CG2 . ILE B 2 165 ? 36.437 9.458   70.398 1.00 18.69  ? 162 ILE Y CG2 1 
ATOM   2451 C CD1 . ILE B 2 165 ? 34.622 8.838   68.080 1.00 23.17  ? 162 ILE Y CD1 1 
ATOM   2452 N N   . VAL B 2 166 ? 39.704 8.848   69.168 1.00 20.95  ? 163 VAL Y N   1 
ATOM   2453 C CA  . VAL B 2 166 ? 41.020 8.891   69.798 1.00 22.91  ? 163 VAL Y CA  1 
ATOM   2454 C C   . VAL B 2 166 ? 41.040 9.993   70.851 1.00 28.78  ? 163 VAL Y C   1 
ATOM   2455 O O   . VAL B 2 166 ? 40.766 11.157  70.548 1.00 31.40  ? 163 VAL Y O   1 
ATOM   2456 C CB  . VAL B 2 166 ? 42.128 9.156   68.759 1.00 11.73  ? 163 VAL Y CB  1 
ATOM   2457 C CG1 . VAL B 2 166 ? 43.493 9.200   69.431 1.00 25.45  ? 163 VAL Y CG1 1 
ATOM   2458 C CG2 . VAL B 2 166 ? 42.103 8.079   67.690 1.00 21.76  ? 163 VAL Y CG2 1 
ATOM   2459 N N   . MET B 2 167 ? 41.320 9.614   72.093 1.00 31.58  ? 164 MET Y N   1 
ATOM   2460 C CA  . MET B 2 167 ? 41.376 10.562  73.200 1.00 25.55  ? 164 MET Y CA  1 
ATOM   2461 C C   . MET B 2 167 ? 42.746 11.226  73.264 1.00 23.82  ? 164 MET Y C   1 
ATOM   2462 O O   . MET B 2 167 ? 43.772 10.540  73.220 1.00 22.18  ? 164 MET Y O   1 
ATOM   2463 C CB  . MET B 2 167 ? 41.079 9.858   74.529 1.00 28.03  ? 164 MET Y CB  1 
ATOM   2464 C CG  . MET B 2 167 ? 39.637 9.996   75.013 1.00 36.42  ? 164 MET Y CG  1 
ATOM   2465 S SD  . MET B 2 167 ? 38.416 9.416   73.824 1.00 51.30  ? 164 MET Y SD  1 
ATOM   2466 C CE  . MET B 2 167 ? 38.358 7.693   74.234 1.00 62.28  ? 164 MET Y CE  1 
ATOM   2467 N N   . ASN B 2 168 ? 42.748 12.558  73.324 1.00 21.41  ? 165 ASN Y N   1 
ATOM   2468 C CA  . ASN B 2 168 ? 43.967 13.371  73.402 1.00 25.68  ? 165 ASN Y CA  1 
ATOM   2469 C C   . ASN B 2 168 ? 44.972 13.043  72.304 1.00 26.25  ? 165 ASN Y C   1 
ATOM   2470 O O   . ASN B 2 168 ? 45.951 12.322  72.522 1.00 34.26  ? 165 ASN Y O   1 
ATOM   2471 C CB  . ASN B 2 168 ? 44.612 13.260  74.789 1.00 24.97  ? 165 ASN Y CB  1 
ATOM   2472 C CG  . ASN B 2 168 ? 43.696 13.762  75.894 1.00 43.33  ? 165 ASN Y CG  1 
ATOM   2473 O OD1 . ASN B 2 168 ? 43.127 14.851  75.802 1.00 45.69  ? 165 ASN Y OD1 1 
ATOM   2474 N ND2 . ASN B 2 168 ? 43.528 12.956  76.934 1.00 44.57  ? 165 ASN Y ND2 1 
ATOM   2475 N N   . VAL B 2 169 ? 44.706 13.571  71.116 1.00 18.11  ? 166 VAL Y N   1 
ATOM   2476 C CA  . VAL B 2 169 ? 45.555 13.344  69.961 1.00 10.21  ? 166 VAL Y CA  1 
ATOM   2477 C C   . VAL B 2 169 ? 46.958 13.872  70.221 1.00 16.05  ? 166 VAL Y C   1 
ATOM   2478 O O   . VAL B 2 169 ? 47.133 14.975  70.736 1.00 29.23  ? 166 VAL Y O   1 
ATOM   2479 C CB  . VAL B 2 169 ? 44.970 14.019  68.708 1.00 11.09  ? 166 VAL Y CB  1 
ATOM   2480 C CG1 . VAL B 2 169 ? 45.840 13.736  67.495 1.00 12.59  ? 166 VAL Y CG1 1 
ATOM   2481 C CG2 . VAL B 2 169 ? 43.547 13.531  68.465 1.00 5.91   ? 166 VAL Y CG2 1 
ATOM   2482 N N   . ALA B 2 170 ? 47.951 13.075  69.853 1.00 17.35  ? 167 ALA Y N   1 
ATOM   2483 C CA  . ALA B 2 170 ? 49.349 13.429  70.032 1.00 18.07  ? 167 ALA Y CA  1 
ATOM   2484 C C   . ALA B 2 170 ? 50.134 12.788  68.897 1.00 25.39  ? 167 ALA Y C   1 
ATOM   2485 O O   . ALA B 2 170 ? 49.625 11.896  68.211 1.00 23.47  ? 167 ALA Y O   1 
ATOM   2486 C CB  . ALA B 2 170 ? 49.852 12.918  71.366 1.00 18.62  ? 167 ALA Y CB  1 
ATOM   2487 N N   . GLU B 2 171 ? 51.385 13.204  68.734 1.00 31.85  ? 168 GLU Y N   1 
ATOM   2488 C CA  . GLU B 2 171 ? 52.238 12.681  67.672 1.00 35.27  ? 168 GLU Y CA  1 
ATOM   2489 C C   . GLU B 2 171 ? 52.342 11.159  67.701 1.00 34.50  ? 168 GLU Y C   1 
ATOM   2490 O O   . GLU B 2 171 ? 52.366 10.515  66.654 1.00 34.64  ? 168 GLU Y O   1 
ATOM   2491 C CB  . GLU B 2 171 ? 53.637 13.300  67.758 1.00 51.77  ? 168 GLU Y CB  1 
ATOM   2492 C CG  . GLU B 2 171 ? 54.556 12.914  66.602 1.00 87.88  ? 168 GLU Y CG  1 
ATOM   2493 C CD  . GLU B 2 171 ? 55.981 13.418  66.770 1.00 105.08 ? 168 GLU Y CD  1 
ATOM   2494 O OE1 . GLU B 2 171 ? 56.176 14.648  66.875 1.00 113.75 ? 168 GLU Y OE1 1 
ATOM   2495 O OE2 . GLU B 2 171 ? 56.910 12.581  66.788 1.00 109.26 ? 168 GLU Y OE2 1 
ATOM   2496 N N   . LYS B 2 172 ? 52.358 10.584  68.901 1.00 32.80  ? 169 LYS Y N   1 
ATOM   2497 C CA  . LYS B 2 172 ? 52.472 9.134   69.062 1.00 28.91  ? 169 LYS Y CA  1 
ATOM   2498 C C   . LYS B 2 172 ? 51.327 8.305   68.467 1.00 24.75  ? 169 LYS Y C   1 
ATOM   2499 O O   . LYS B 2 172 ? 51.381 7.075   68.478 1.00 33.14  ? 169 LYS Y O   1 
ATOM   2500 C CB  . LYS B 2 172 ? 52.670 8.775   70.539 1.00 30.72  ? 169 LYS Y CB  1 
ATOM   2501 C CG  . LYS B 2 172 ? 51.517 9.169   71.448 1.00 25.76  ? 169 LYS Y CG  1 
ATOM   2502 C CD  . LYS B 2 172 ? 51.800 8.779   72.889 1.00 32.94  ? 169 LYS Y CD  1 
ATOM   2503 C CE  . LYS B 2 172 ? 50.652 9.163   73.814 1.00 52.19  ? 169 LYS Y CE  1 
ATOM   2504 N NZ  . LYS B 2 172 ? 50.912 8.730   75.219 1.00 62.73  ? 169 LYS Y NZ  1 
ATOM   2505 N N   . HIS B 2 173 ? 50.290 8.969   67.964 1.00 19.80  ? 170 HIS Y N   1 
ATOM   2506 C CA  . HIS B 2 173 ? 49.152 8.275   67.366 1.00 16.90  ? 170 HIS Y CA  1 
ATOM   2507 C C   . HIS B 2 173 ? 49.295 8.137   65.850 1.00 18.07  ? 170 HIS Y C   1 
ATOM   2508 O O   . HIS B 2 173 ? 48.460 7.514   65.195 1.00 14.88  ? 170 HIS Y O   1 
ATOM   2509 C CB  . HIS B 2 173 ? 47.847 9.008   67.682 1.00 14.07  ? 170 HIS Y CB  1 
ATOM   2510 C CG  . HIS B 2 173 ? 47.440 8.932   69.119 1.00 20.57  ? 170 HIS Y CG  1 
ATOM   2511 N ND1 . HIS B 2 173 ? 47.301 7.738   69.792 1.00 32.17  ? 170 HIS Y ND1 1 
ATOM   2512 C CD2 . HIS B 2 173 ? 47.115 9.903   70.007 1.00 29.81  ? 170 HIS Y CD2 1 
ATOM   2513 C CE1 . HIS B 2 173 ? 46.906 7.976   71.031 1.00 42.90  ? 170 HIS Y CE1 1 
ATOM   2514 N NE2 . HIS B 2 173 ? 46.787 9.282   71.186 1.00 33.91  ? 170 HIS Y NE2 1 
ATOM   2515 N N   . ARG B 2 174 ? 50.338 8.738   65.290 1.00 20.50  ? 171 ARG Y N   1 
ATOM   2516 C CA  . ARG B 2 174 ? 50.564 8.673   63.850 1.00 23.81  ? 171 ARG Y CA  1 
ATOM   2517 C C   . ARG B 2 174 ? 50.889 7.254   63.425 1.00 21.98  ? 171 ARG Y C   1 
ATOM   2518 O O   . ARG B 2 174 ? 51.637 6.549   64.102 1.00 27.11  ? 171 ARG Y O   1 
ATOM   2519 C CB  . ARG B 2 174 ? 51.698 9.614   63.440 1.00 25.14  ? 171 ARG Y CB  1 
ATOM   2520 C CG  . ARG B 2 174 ? 51.401 11.080  63.690 1.00 23.53  ? 171 ARG Y CG  1 
ATOM   2521 C CD  . ARG B 2 174 ? 52.601 11.966  63.386 1.00 52.75  ? 171 ARG Y CD  1 
ATOM   2522 N NE  . ARG B 2 174 ? 52.969 11.958  61.972 1.00 79.45  ? 171 ARG Y NE  1 
ATOM   2523 C CZ  . ARG B 2 174 ? 53.922 11.192  61.448 1.00 102.35 ? 171 ARG Y CZ  1 
ATOM   2524 N NH1 . ARG B 2 174 ? 54.613 10.361  62.220 1.00 114.76 ? 171 ARG Y NH1 1 
ATOM   2525 N NH2 . ARG B 2 174 ? 54.187 11.256  60.151 1.00 110.01 ? 171 ARG Y NH2 1 
ATOM   2526 N N   . GLY B 2 175 ? 50.307 6.841   62.306 1.00 25.32  ? 172 GLY Y N   1 
ATOM   2527 C CA  . GLY B 2 175 ? 50.531 5.505   61.784 1.00 30.48  ? 172 GLY Y CA  1 
ATOM   2528 C C   . GLY B 2 175 ? 49.430 5.128   60.812 1.00 31.01  ? 172 GLY Y C   1 
ATOM   2529 O O   . GLY B 2 175 ? 48.485 5.892   60.613 1.00 36.92  ? 172 GLY Y O   1 
ATOM   2530 N N   . ASN B 2 176 ? 49.560 3.971   60.175 1.00 24.00  ? 173 ASN Y N   1 
ATOM   2531 C CA  . ASN B 2 176 ? 48.546 3.521   59.233 1.00 18.58  ? 173 ASN Y CA  1 
ATOM   2532 C C   . ASN B 2 176 ? 47.606 2.547   59.926 1.00 15.47  ? 173 ASN Y C   1 
ATOM   2533 O O   . ASN B 2 176 ? 48.012 1.452   60.307 1.00 28.21  ? 173 ASN Y O   1 
ATOM   2534 C CB  . ASN B 2 176 ? 49.198 2.867   58.014 1.00 14.75  ? 173 ASN Y CB  1 
ATOM   2535 C CG  . ASN B 2 176 ? 49.869 3.878   57.102 1.00 24.87  ? 173 ASN Y CG  1 
ATOM   2536 O OD1 . ASN B 2 176 ? 49.222 4.810   56.626 1.00 34.58  ? 173 ASN Y OD1 1 
ATOM   2537 N ND2 . ASN B 2 176 ? 51.165 3.702   56.866 1.00 23.86  ? 173 ASN Y ND2 1 
ATOM   2538 N N   . TYR B 2 177 ? 46.373 2.979   60.159 1.00 14.26  ? 174 TYR Y N   1 
ATOM   2539 C CA  . TYR B 2 177 ? 45.375 2.142   60.814 1.00 17.50  ? 174 TYR Y CA  1 
ATOM   2540 C C   . TYR B 2 177 ? 44.569 1.378   59.776 1.00 22.53  ? 174 TYR Y C   1 
ATOM   2541 O O   . TYR B 2 177 ? 44.383 1.847   58.654 1.00 24.91  ? 174 TYR Y O   1 
ATOM   2542 C CB  . TYR B 2 177 ? 44.411 2.982   61.654 1.00 16.89  ? 174 TYR Y CB  1 
ATOM   2543 C CG  . TYR B 2 177 ? 45.032 3.668   62.843 1.00 20.94  ? 174 TYR Y CG  1 
ATOM   2544 C CD1 . TYR B 2 177 ? 46.046 4.606   62.677 1.00 14.75  ? 174 TYR Y CD1 1 
ATOM   2545 C CD2 . TYR B 2 177 ? 44.570 3.417   64.134 1.00 19.76  ? 174 TYR Y CD2 1 
ATOM   2546 C CE1 . TYR B 2 177 ? 46.584 5.279   63.762 1.00 21.35  ? 174 TYR Y CE1 1 
ATOM   2547 C CE2 . TYR B 2 177 ? 45.103 4.086   65.227 1.00 22.32  ? 174 TYR Y CE2 1 
ATOM   2548 C CZ  . TYR B 2 177 ? 46.106 5.018   65.031 1.00 11.05  ? 174 TYR Y CZ  1 
ATOM   2549 O OH  . TYR B 2 177 ? 46.621 5.708   66.098 1.00 18.88  ? 174 TYR Y OH  1 
ATOM   2550 N N   . THR B 2 178 ? 44.077 0.207   60.162 1.00 19.22  ? 175 THR Y N   1 
ATOM   2551 C CA  . THR B 2 178 ? 43.280 -0.618  59.273 1.00 14.11  ? 175 THR Y CA  1 
ATOM   2552 C C   . THR B 2 178 ? 42.030 -1.091  59.995 1.00 13.68  ? 175 THR Y C   1 
ATOM   2553 O O   . THR B 2 178 ? 42.101 -1.650  61.091 1.00 24.27  ? 175 THR Y O   1 
ATOM   2554 C CB  . THR B 2 178 ? 44.074 -1.847  58.754 1.00 16.30  ? 175 THR Y CB  1 
ATOM   2555 O OG1 . THR B 2 178 ? 44.892 -2.378  59.806 1.00 36.41  ? 175 THR Y OG1 1 
ATOM   2556 C CG2 . THR B 2 178 ? 44.953 -1.472  57.578 1.00 13.40  ? 175 THR Y CG2 1 
ATOM   2557 N N   . CYS B 2 179 ? 40.877 -0.812  59.413 1.00 3.27   ? 176 CYS Y N   1 
ATOM   2558 C CA  . CYS B 2 179 ? 39.638 -1.248  60.012 1.00 5.26   ? 176 CYS Y CA  1 
ATOM   2559 C C   . CYS B 2 179 ? 39.212 -2.515  59.289 1.00 22.33  ? 176 CYS Y C   1 
ATOM   2560 O O   . CYS B 2 179 ? 39.267 -2.593  58.058 1.00 28.10  ? 176 CYS Y O   1 
ATOM   2561 C CB  . CYS B 2 179 ? 38.582 -0.146  59.931 1.00 15.24  ? 176 CYS Y CB  1 
ATOM   2562 S SG  . CYS B 2 179 ? 38.504 0.779   58.365 1.00 13.37  ? 176 CYS Y SG  1 
ATOM   2563 N N   . HIS B 2 180 ? 38.902 -3.544  60.065 1.00 24.49  ? 177 HIS Y N   1 
ATOM   2564 C CA  . HIS B 2 180 ? 38.512 -4.826  59.505 1.00 17.83  ? 177 HIS Y CA  1 
ATOM   2565 C C   . HIS B 2 180 ? 37.072 -5.145  59.851 1.00 21.76  ? 177 HIS Y C   1 
ATOM   2566 O O   . HIS B 2 180 ? 36.586 -4.769  60.919 1.00 26.64  ? 177 HIS Y O   1 
ATOM   2567 C CB  . HIS B 2 180 ? 39.415 -5.934  60.053 1.00 20.39  ? 177 HIS Y CB  1 
ATOM   2568 C CG  . HIS B 2 180 ? 40.867 -5.756  59.726 1.00 16.11  ? 177 HIS Y CG  1 
ATOM   2569 N ND1 . HIS B 2 180 ? 41.593 -4.650  60.114 1.00 22.59  ? 177 HIS Y ND1 1 
ATOM   2570 C CD2 . HIS B 2 180 ? 41.729 -6.550  59.049 1.00 25.65  ? 177 HIS Y CD2 1 
ATOM   2571 C CE1 . HIS B 2 180 ? 42.838 -4.771  59.688 1.00 19.65  ? 177 HIS Y CE1 1 
ATOM   2572 N NE2 . HIS B 2 180 ? 42.947 -5.913  59.036 1.00 13.50  ? 177 HIS Y NE2 1 
ATOM   2573 N N   . ALA B 2 181 ? 36.399 -5.852  58.951 1.00 23.31  ? 178 ALA Y N   1 
ATOM   2574 C CA  . ALA B 2 181 ? 35.011 -6.251  59.152 1.00 19.20  ? 178 ALA Y CA  1 
ATOM   2575 C C   . ALA B 2 181 ? 34.751 -7.529  58.371 1.00 20.86  ? 178 ALA Y C   1 
ATOM   2576 O O   . ALA B 2 181 ? 35.555 -7.918  57.520 1.00 26.02  ? 178 ALA Y O   1 
ATOM   2577 C CB  . ALA B 2 181 ? 34.074 -5.160  58.682 1.00 18.00  ? 178 ALA Y CB  1 
ATOM   2578 N N   . SER B 2 182 ? 33.636 -8.184  58.666 1.00 20.23  ? 179 SER Y N   1 
ATOM   2579 C CA  . SER B 2 182 ? 33.265 -9.412  57.981 1.00 26.16  ? 179 SER Y CA  1 
ATOM   2580 C C   . SER B 2 182 ? 31.801 -9.328  57.583 1.00 30.82  ? 179 SER Y C   1 
ATOM   2581 O O   . SER B 2 182 ? 30.919 -9.196  58.439 1.00 32.12  ? 179 SER Y O   1 
ATOM   2582 C CB  . SER B 2 182 ? 33.507 -10.628 58.878 1.00 39.70  ? 179 SER Y CB  1 
ATOM   2583 O OG  . SER B 2 182 ? 34.885 -10.750 59.205 1.00 72.08  ? 179 SER Y OG  1 
ATOM   2584 N N   . TYR B 2 183 ? 31.554 -9.353  56.279 1.00 32.49  ? 180 TYR Y N   1 
ATOM   2585 C CA  . TYR B 2 183 ? 30.199 -9.273  55.762 1.00 34.77  ? 180 TYR Y CA  1 
ATOM   2586 C C   . TYR B 2 183 ? 29.752 -10.643 55.273 1.00 41.82  ? 180 TYR Y C   1 
ATOM   2587 O O   . TYR B 2 183 ? 30.490 -11.338 54.570 1.00 46.60  ? 180 TYR Y O   1 
ATOM   2588 C CB  . TYR B 2 183 ? 30.135 -8.255  54.627 1.00 26.84  ? 180 TYR Y CB  1 
ATOM   2589 C CG  . TYR B 2 183 ? 28.739 -7.968  54.139 1.00 19.79  ? 180 TYR Y CG  1 
ATOM   2590 C CD1 . TYR B 2 183 ? 27.792 -7.392  54.983 1.00 21.09  ? 180 TYR Y CD1 1 
ATOM   2591 C CD2 . TYR B 2 183 ? 28.364 -8.262  52.828 1.00 18.14  ? 180 TYR Y CD2 1 
ATOM   2592 C CE1 . TYR B 2 183 ? 26.503 -7.114  54.534 1.00 37.26  ? 180 TYR Y CE1 1 
ATOM   2593 C CE2 . TYR B 2 183 ? 27.079 -7.987  52.368 1.00 20.56  ? 180 TYR Y CE2 1 
ATOM   2594 C CZ  . TYR B 2 183 ? 26.154 -7.413  53.225 1.00 35.22  ? 180 TYR Y CZ  1 
ATOM   2595 O OH  . TYR B 2 183 ? 24.884 -7.122  52.777 1.00 50.84  ? 180 TYR Y OH  1 
ATOM   2596 N N   . THR B 2 184 ? 28.550 -11.036 55.672 1.00 44.83  ? 181 THR Y N   1 
ATOM   2597 C CA  . THR B 2 184 ? 27.991 -12.320 55.285 1.00 48.49  ? 181 THR Y CA  1 
ATOM   2598 C C   . THR B 2 184 ? 27.148 -12.143 54.022 1.00 50.77  ? 181 THR Y C   1 
ATOM   2599 O O   . THR B 2 184 ? 26.043 -11.594 54.079 1.00 50.44  ? 181 THR Y O   1 
ATOM   2600 C CB  . THR B 2 184 ? 27.103 -12.877 56.413 1.00 57.88  ? 181 THR Y CB  1 
ATOM   2601 O OG1 . THR B 2 184 ? 27.820 -12.821 57.655 1.00 56.51  ? 181 THR Y OG1 1 
ATOM   2602 C CG2 . THR B 2 184 ? 26.706 -14.315 56.120 1.00 67.00  ? 181 THR Y CG2 1 
ATOM   2603 N N   . TYR B 2 185 ? 27.672 -12.585 52.883 1.00 51.18  ? 182 TYR Y N   1 
ATOM   2604 C CA  . TYR B 2 185 ? 26.945 -12.461 51.626 1.00 53.20  ? 182 TYR Y CA  1 
ATOM   2605 C C   . TYR B 2 185 ? 26.507 -13.829 51.105 1.00 55.75  ? 182 TYR Y C   1 
ATOM   2606 O O   . TYR B 2 185 ? 27.342 -14.678 50.780 1.00 57.91  ? 182 TYR Y O   1 
ATOM   2607 C CB  . TYR B 2 185 ? 27.793 -11.732 50.579 1.00 49.71  ? 182 TYR Y CB  1 
ATOM   2608 C CG  . TYR B 2 185 ? 27.013 -11.291 49.356 1.00 51.77  ? 182 TYR Y CG  1 
ATOM   2609 C CD1 . TYR B 2 185 ? 25.883 -10.481 49.480 1.00 43.70  ? 182 TYR Y CD1 1 
ATOM   2610 C CD2 . TYR B 2 185 ? 27.395 -11.694 48.076 1.00 46.94  ? 182 TYR Y CD2 1 
ATOM   2611 C CE1 . TYR B 2 185 ? 25.156 -10.084 48.363 1.00 44.57  ? 182 TYR Y CE1 1 
ATOM   2612 C CE2 . TYR B 2 185 ? 26.674 -11.302 46.949 1.00 43.33  ? 182 TYR Y CE2 1 
ATOM   2613 C CZ  . TYR B 2 185 ? 25.554 -10.498 47.101 1.00 47.73  ? 182 TYR Y CZ  1 
ATOM   2614 O OH  . TYR B 2 185 ? 24.831 -10.104 45.993 1.00 42.93  ? 182 TYR Y OH  1 
ATOM   2615 N N   . LEU B 2 186 ? 25.192 -14.034 51.046 1.00 52.98  ? 183 LEU Y N   1 
ATOM   2616 C CA  . LEU B 2 186 ? 24.603 -15.287 50.571 1.00 51.86  ? 183 LEU Y CA  1 
ATOM   2617 C C   . LEU B 2 186 ? 25.173 -16.512 51.283 1.00 52.88  ? 183 LEU Y C   1 
ATOM   2618 O O   . LEU B 2 186 ? 25.645 -17.453 50.647 1.00 53.22  ? 183 LEU Y O   1 
ATOM   2619 C CB  . LEU B 2 186 ? 24.792 -15.431 49.058 1.00 51.33  ? 183 LEU Y CB  1 
ATOM   2620 C CG  . LEU B 2 186 ? 24.080 -14.427 48.152 1.00 61.71  ? 183 LEU Y CG  1 
ATOM   2621 C CD1 . LEU B 2 186 ? 24.440 -14.723 46.704 1.00 51.93  ? 183 LEU Y CD1 1 
ATOM   2622 C CD2 . LEU B 2 186 ? 22.572 -14.504 48.363 1.00 53.90  ? 183 LEU Y CD2 1 
ATOM   2623 N N   . GLY B 2 187 ? 25.129 -16.495 52.610 1.00 50.45  ? 184 GLY Y N   1 
ATOM   2624 C CA  . GLY B 2 187 ? 25.645 -17.616 53.373 1.00 48.62  ? 184 GLY Y CA  1 
ATOM   2625 C C   . GLY B 2 187 ? 27.135 -17.519 53.639 1.00 49.54  ? 184 GLY Y C   1 
ATOM   2626 O O   . GLY B 2 187 ? 27.569 -17.671 54.782 1.00 58.26  ? 184 GLY Y O   1 
ATOM   2627 N N   . LYS B 2 188 ? 27.922 -17.273 52.597 1.00 37.23  ? 185 LYS Y N   1 
ATOM   2628 C CA  . LYS B 2 188 ? 29.368 -17.156 52.752 1.00 36.32  ? 185 LYS Y CA  1 
ATOM   2629 C C   . LYS B 2 188 ? 29.738 -15.882 53.514 1.00 39.24  ? 185 LYS Y C   1 
ATOM   2630 O O   . LYS B 2 188 ? 28.921 -14.969 53.659 1.00 43.38  ? 185 LYS Y O   1 
ATOM   2631 C CB  . LYS B 2 188 ? 30.048 -17.188 51.396 1.00 37.44  ? 185 LYS Y CB  1 
ATOM   2632 N N   . GLN B 2 189 ? 30.973 -15.823 53.999 1.00 42.54  ? 186 GLN Y N   1 
ATOM   2633 C CA  . GLN B 2 189 ? 31.456 -14.674 54.758 1.00 43.64  ? 186 GLN Y CA  1 
ATOM   2634 C C   . GLN B 2 189 ? 32.741 -14.150 54.128 1.00 44.79  ? 186 GLN Y C   1 
ATOM   2635 O O   . GLN B 2 189 ? 33.676 -14.918 53.887 1.00 44.29  ? 186 GLN Y O   1 
ATOM   2636 C CB  . GLN B 2 189 ? 31.711 -15.088 56.209 1.00 53.41  ? 186 GLN Y CB  1 
ATOM   2637 C CG  . GLN B 2 189 ? 32.223 -13.982 57.111 1.00 78.18  ? 186 GLN Y CG  1 
ATOM   2638 C CD  . GLN B 2 189 ? 32.516 -14.480 58.511 1.00 97.85  ? 186 GLN Y CD  1 
ATOM   2639 O OE1 . GLN B 2 189 ? 31.695 -15.164 59.120 1.00 105.45 ? 186 GLN Y OE1 1 
ATOM   2640 N NE2 . GLN B 2 189 ? 33.694 -14.148 59.027 1.00 103.92 ? 186 GLN Y NE2 1 
ATOM   2641 N N   . TYR B 2 190 ? 32.783 -12.846 53.864 1.00 46.03  ? 187 TYR Y N   1 
ATOM   2642 C CA  . TYR B 2 190 ? 33.946 -12.215 53.244 1.00 38.34  ? 187 TYR Y CA  1 
ATOM   2643 C C   . TYR B 2 190 ? 34.484 -11.080 54.107 1.00 27.67  ? 187 TYR Y C   1 
ATOM   2644 O O   . TYR B 2 190 ? 33.728 -10.429 54.831 1.00 30.75  ? 187 TYR Y O   1 
ATOM   2645 C CB  . TYR B 2 190 ? 33.577 -11.685 51.856 1.00 37.77  ? 187 TYR Y CB  1 
ATOM   2646 C CG  . TYR B 2 190 ? 32.889 -12.707 50.981 1.00 33.36  ? 187 TYR Y CG  1 
ATOM   2647 C CD1 . TYR B 2 190 ? 31.502 -12.853 51.010 1.00 35.90  ? 187 TYR Y CD1 1 
ATOM   2648 C CD2 . TYR B 2 190 ? 33.623 -13.537 50.135 1.00 27.12  ? 187 TYR Y CD2 1 
ATOM   2649 C CE1 . TYR B 2 190 ? 30.862 -13.800 50.221 1.00 41.12  ? 187 TYR Y CE1 1 
ATOM   2650 C CE2 . TYR B 2 190 ? 32.992 -14.488 49.338 1.00 23.32  ? 187 TYR Y CE2 1 
ATOM   2651 C CZ  . TYR B 2 190 ? 31.610 -14.612 49.385 1.00 36.40  ? 187 TYR Y CZ  1 
ATOM   2652 O OH  . TYR B 2 190 ? 30.967 -15.531 48.586 1.00 42.93  ? 187 TYR Y OH  1 
ATOM   2653 N N   . PRO B 2 191 ? 35.807 -10.852 54.066 1.00 16.57  ? 188 PRO Y N   1 
ATOM   2654 C CA  . PRO B 2 191 ? 36.470 -9.800  54.838 1.00 20.44  ? 188 PRO Y CA  1 
ATOM   2655 C C   . PRO B 2 191 ? 36.432 -8.439  54.148 1.00 23.88  ? 188 PRO Y C   1 
ATOM   2656 O O   . PRO B 2 191 ? 36.296 -8.351  52.925 1.00 26.92  ? 188 PRO Y O   1 
ATOM   2657 C CB  . PRO B 2 191 ? 37.895 -10.324 54.934 1.00 19.14  ? 188 PRO Y CB  1 
ATOM   2658 C CG  . PRO B 2 191 ? 38.096 -10.903 53.578 1.00 9.23   ? 188 PRO Y CG  1 
ATOM   2659 C CD  . PRO B 2 191 ? 36.801 -11.667 53.344 1.00 16.09  ? 188 PRO Y CD  1 
ATOM   2660 N N   . ILE B 2 192 ? 36.563 -7.384  54.945 1.00 24.17  ? 189 ILE Y N   1 
ATOM   2661 C CA  . ILE B 2 192 ? 36.558 -6.011  54.449 1.00 16.88  ? 189 ILE Y CA  1 
ATOM   2662 C C   . ILE B 2 192 ? 37.626 -5.250  55.221 1.00 16.64  ? 189 ILE Y C   1 
ATOM   2663 O O   . ILE B 2 192 ? 37.735 -5.408  56.438 1.00 28.44  ? 189 ILE Y O   1 
ATOM   2664 C CB  . ILE B 2 192 ? 35.214 -5.309  54.739 1.00 13.25  ? 189 ILE Y CB  1 
ATOM   2665 C CG1 . ILE B 2 192 ? 34.041 -6.122  54.203 1.00 14.33  ? 189 ILE Y CG1 1 
ATOM   2666 C CG2 . ILE B 2 192 ? 35.189 -3.932  54.105 1.00 16.89  ? 189 ILE Y CG2 1 
ATOM   2667 C CD1 . ILE B 2 192 ? 32.705 -5.569  54.642 1.00 12.21  ? 189 ILE Y CD1 1 
ATOM   2668 N N   . THR B 2 193 ? 38.428 -4.457  54.519 1.00 21.45  ? 190 THR Y N   1 
ATOM   2669 C CA  . THR B 2 193 ? 39.471 -3.653  55.155 1.00 24.62  ? 190 THR Y CA  1 
ATOM   2670 C C   . THR B 2 193 ? 39.670 -2.337  54.417 1.00 30.82  ? 190 THR Y C   1 
ATOM   2671 O O   . THR B 2 193 ? 39.510 -2.266  53.190 1.00 34.05  ? 190 THR Y O   1 
ATOM   2672 C CB  . THR B 2 193 ? 40.851 -4.363  55.178 1.00 25.68  ? 190 THR Y CB  1 
ATOM   2673 O OG1 . THR B 2 193 ? 41.303 -4.599  53.839 1.00 47.73  ? 190 THR Y OG1 1 
ATOM   2674 C CG2 . THR B 2 193 ? 40.778 -5.675  55.920 1.00 40.93  ? 190 THR Y CG2 1 
ATOM   2675 N N   . ARG B 2 194 ? 39.997 -1.295  55.175 1.00 29.81  ? 191 ARG Y N   1 
ATOM   2676 C CA  . ARG B 2 194 ? 40.269 0.025   54.620 1.00 18.15  ? 191 ARG Y CA  1 
ATOM   2677 C C   . ARG B 2 194 ? 41.509 0.487   55.366 1.00 17.08  ? 191 ARG Y C   1 
ATOM   2678 O O   . ARG B 2 194 ? 41.595 0.321   56.587 1.00 19.06  ? 191 ARG Y O   1 
ATOM   2679 C CB  . ARG B 2 194 ? 39.140 1.012   54.922 1.00 14.57  ? 191 ARG Y CB  1 
ATOM   2680 C CG  . ARG B 2 194 ? 37.727 0.526   54.672 1.00 27.50  ? 191 ARG Y CG  1 
ATOM   2681 C CD  . ARG B 2 194 ? 37.440 0.313   53.205 1.00 35.53  ? 191 ARG Y CD  1 
ATOM   2682 N NE  . ARG B 2 194 ? 36.000 0.232   52.977 1.00 44.27  ? 191 ARG Y NE  1 
ATOM   2683 C CZ  . ARG B 2 194 ? 35.415 -0.595  52.120 1.00 28.39  ? 191 ARG Y CZ  1 
ATOM   2684 N NH1 . ARG B 2 194 ? 36.140 -1.437  51.400 1.00 28.67  ? 191 ARG Y NH1 1 
ATOM   2685 N NH2 . ARG B 2 194 ? 34.098 -0.560  51.970 1.00 30.83  ? 191 ARG Y NH2 1 
ATOM   2686 N N   . VAL B 2 195 ? 42.494 1.000   54.641 1.00 13.75  ? 192 VAL Y N   1 
ATOM   2687 C CA  . VAL B 2 195 ? 43.706 1.496   55.278 1.00 22.35  ? 192 VAL Y CA  1 
ATOM   2688 C C   . VAL B 2 195 ? 43.617 3.024   55.365 1.00 31.51  ? 192 VAL Y C   1 
ATOM   2689 O O   . VAL B 2 195 ? 43.314 3.705   54.381 1.00 31.37  ? 192 VAL Y O   1 
ATOM   2690 C CB  . VAL B 2 195 ? 44.990 1.019   54.548 1.00 13.33  ? 192 VAL Y CB  1 
ATOM   2691 C CG1 . VAL B 2 195 ? 44.922 1.345   53.076 1.00 30.69  ? 192 VAL Y CG1 1 
ATOM   2692 C CG2 . VAL B 2 195 ? 46.226 1.636   55.184 1.00 18.00  ? 192 VAL Y CG2 1 
ATOM   2693 N N   . ILE B 2 196 ? 43.844 3.543   56.566 1.00 31.54  ? 193 ILE Y N   1 
ATOM   2694 C CA  . ILE B 2 196 ? 43.772 4.968   56.847 1.00 20.55  ? 193 ILE Y CA  1 
ATOM   2695 C C   . ILE B 2 196 ? 45.090 5.475   57.407 1.00 19.55  ? 193 ILE Y C   1 
ATOM   2696 O O   . ILE B 2 196 ? 45.588 4.941   58.395 1.00 29.47  ? 193 ILE Y O   1 
ATOM   2697 C CB  . ILE B 2 196 ? 42.677 5.241   57.903 1.00 15.58  ? 193 ILE Y CB  1 
ATOM   2698 C CG1 . ILE B 2 196 ? 41.317 4.782   57.378 1.00 17.60  ? 193 ILE Y CG1 1 
ATOM   2699 C CG2 . ILE B 2 196 ? 42.663 6.713   58.297 1.00 17.45  ? 193 ILE Y CG2 1 
ATOM   2700 C CD1 . ILE B 2 196 ? 40.211 4.884   58.385 1.00 18.39  ? 193 ILE Y CD1 1 
ATOM   2701 N N   . GLU B 2 197 ? 45.666 6.489   56.772 1.00 16.13  ? 194 GLU Y N   1 
ATOM   2702 C CA  . GLU B 2 197 ? 46.907 7.065   57.268 1.00 22.25  ? 194 GLU Y CA  1 
ATOM   2703 C C   . GLU B 2 197 ? 46.545 8.249   58.157 1.00 29.48  ? 194 GLU Y C   1 
ATOM   2704 O O   . GLU B 2 197 ? 46.004 9.251   57.685 1.00 32.29  ? 194 GLU Y O   1 
ATOM   2705 C CB  . GLU B 2 197 ? 47.808 7.530   56.130 1.00 18.50  ? 194 GLU Y CB  1 
ATOM   2706 C CG  . GLU B 2 197 ? 49.101 8.168   56.628 1.00 20.42  ? 194 GLU Y CG  1 
ATOM   2707 C CD  . GLU B 2 197 ? 50.038 8.588   55.516 1.00 36.60  ? 194 GLU Y CD  1 
ATOM   2708 O OE1 . GLU B 2 197 ? 49.560 8.873   54.397 1.00 48.84  ? 194 GLU Y OE1 1 
ATOM   2709 O OE2 . GLU B 2 197 ? 51.259 8.642   55.765 1.00 45.92  ? 194 GLU Y OE2 1 
ATOM   2710 N N   . PHE B 2 198 ? 46.826 8.116   59.446 1.00 27.71  ? 195 PHE Y N   1 
ATOM   2711 C CA  . PHE B 2 198 ? 46.521 9.158   60.411 1.00 22.53  ? 195 PHE Y CA  1 
ATOM   2712 C C   . PHE B 2 198 ? 47.671 10.150  60.532 1.00 27.37  ? 195 PHE Y C   1 
ATOM   2713 O O   . PHE B 2 198 ? 48.808 9.767   60.821 1.00 27.21  ? 195 PHE Y O   1 
ATOM   2714 C CB  . PHE B 2 198 ? 46.213 8.527   61.770 1.00 19.38  ? 195 PHE Y CB  1 
ATOM   2715 C CG  . PHE B 2 198 ? 45.691 9.497   62.786 1.00 20.81  ? 195 PHE Y CG  1 
ATOM   2716 C CD1 . PHE B 2 198 ? 44.688 10.397  62.457 1.00 25.47  ? 195 PHE Y CD1 1 
ATOM   2717 C CD2 . PHE B 2 198 ? 46.195 9.505   64.079 1.00 30.52  ? 195 PHE Y CD2 1 
ATOM   2718 C CE1 . PHE B 2 198 ? 44.196 11.290  63.400 1.00 34.79  ? 195 PHE Y CE1 1 
ATOM   2719 C CE2 . PHE B 2 198 ? 45.710 10.394  65.029 1.00 15.38  ? 195 PHE Y CE2 1 
ATOM   2720 C CZ  . PHE B 2 198 ? 44.710 11.287  64.690 1.00 30.28  ? 195 PHE Y CZ  1 
ATOM   2721 N N   . ILE B 2 199 ? 47.373 11.421  60.279 1.00 29.52  ? 196 ILE Y N   1 
ATOM   2722 C CA  . ILE B 2 199 ? 48.361 12.493  60.362 1.00 21.96  ? 196 ILE Y CA  1 
ATOM   2723 C C   . ILE B 2 199 ? 47.918 13.496  61.427 1.00 17.91  ? 196 ILE Y C   1 
ATOM   2724 O O   . ILE B 2 199 ? 46.752 13.904  61.467 1.00 16.64  ? 196 ILE Y O   1 
ATOM   2725 C CB  . ILE B 2 199 ? 48.509 13.225  59.012 1.00 27.54  ? 196 ILE Y CB  1 
ATOM   2726 C CG1 . ILE B 2 199 ? 48.920 12.237  57.920 1.00 46.23  ? 196 ILE Y CG1 1 
ATOM   2727 C CG2 . ILE B 2 199 ? 49.541 14.333  59.123 1.00 36.54  ? 196 ILE Y CG2 1 
ATOM   2728 C CD1 . ILE B 2 199 ? 48.952 12.837  56.528 1.00 62.92  ? 196 ILE Y CD1 1 
ATOM   2729 N N   . THR B 2 200 ? 48.843 13.862  62.306 1.00 17.39  ? 197 THR Y N   1 
ATOM   2730 C CA  . THR B 2 200 ? 48.559 14.813  63.372 1.00 29.71  ? 197 THR Y CA  1 
ATOM   2731 C C   . THR B 2 200 ? 48.971 16.232  62.983 1.00 33.20  ? 197 THR Y C   1 
ATOM   2732 O O   . THR B 2 200 ? 50.106 16.465  62.556 1.00 29.76  ? 197 THR Y O   1 
ATOM   2733 C CB  . THR B 2 200 ? 49.289 14.421  64.668 1.00 32.38  ? 197 THR Y CB  1 
ATOM   2734 O OG1 . THR B 2 200 ? 50.681 14.214  64.390 1.00 32.93  ? 197 THR Y OG1 1 
ATOM   2735 C CG2 . THR B 2 200 ? 48.693 13.147  65.244 1.00 22.34  ? 197 THR Y CG2 1 
ATOM   2736 N N   . LEU B 2 201 ? 48.048 17.174  63.143 1.00 42.51  ? 198 LEU Y N   1 
ATOM   2737 C CA  . LEU B 2 201 ? 48.304 18.575  62.822 1.00 48.47  ? 198 LEU Y CA  1 
ATOM   2738 C C   . LEU B 2 201 ? 48.594 19.361  64.093 1.00 52.60  ? 198 LEU Y C   1 
ATOM   2739 O O   . LEU B 2 201 ? 47.865 19.248  65.082 1.00 56.40  ? 198 LEU Y O   1 
ATOM   2740 C CB  . LEU B 2 201 ? 47.093 19.199  62.129 1.00 38.51  ? 198 LEU Y CB  1 
ATOM   2741 C CG  . LEU B 2 201 ? 46.518 18.507  60.898 1.00 37.98  ? 198 LEU Y CG  1 
ATOM   2742 C CD1 . LEU B 2 201 ? 45.380 19.350  60.377 1.00 25.42  ? 198 LEU Y CD1 1 
ATOM   2743 C CD2 . LEU B 2 201 ? 47.584 18.326  59.827 1.00 51.19  ? 198 LEU Y CD2 1 
ATOM   2744 N N   . GLU B 2 202 ? 49.663 20.145  64.073 1.00 58.94  ? 199 GLU Y N   1 
ATOM   2745 C CA  . GLU B 2 202 ? 50.015 20.959  65.226 1.00 71.96  ? 199 GLU Y CA  1 
ATOM   2746 C C   . GLU B 2 202 ? 49.051 22.137  65.234 1.00 73.00  ? 199 GLU Y C   1 
ATOM   2747 O O   . GLU B 2 202 ? 48.906 22.826  64.224 1.00 70.21  ? 199 GLU Y O   1 
ATOM   2748 C CB  . GLU B 2 202 ? 51.455 21.459  65.110 1.00 85.80  ? 199 GLU Y CB  1 
ATOM   2749 C CG  . GLU B 2 202 ? 52.492 20.348  64.973 1.00 110.78 ? 199 GLU Y CG  1 
ATOM   2750 C CD  . GLU B 2 202 ? 53.912 20.868  64.815 1.00 127.71 ? 199 GLU Y CD  1 
ATOM   2751 O OE1 . GLU B 2 202 ? 54.089 22.009  64.332 1.00 133.38 ? 199 GLU Y OE1 1 
ATOM   2752 O OE2 . GLU B 2 202 ? 54.855 20.129  65.170 1.00 136.44 ? 199 GLU Y OE2 1 
ATOM   2753 N N   . GLU B 2 203 ? 48.344 22.326  66.344 1.00 82.01  ? 200 GLU Y N   1 
ATOM   2754 C CA  . GLU B 2 203 ? 47.393 23.428  66.456 1.00 95.86  ? 200 GLU Y CA  1 
ATOM   2755 C C   . GLU B 2 203 ? 48.118 24.765  66.341 1.00 104.09 ? 200 GLU Y C   1 
ATOM   2756 O O   . GLU B 2 203 ? 48.815 25.190  67.267 1.00 106.18 ? 200 GLU Y O   1 
ATOM   2757 C CB  . GLU B 2 203 ? 46.624 23.361  67.778 1.00 100.82 ? 200 GLU Y CB  1 
ATOM   2758 C CG  . GLU B 2 203 ? 45.623 22.221  67.872 1.00 109.32 ? 200 GLU Y CG  1 
ATOM   2759 C CD  . GLU B 2 203 ? 44.676 22.377  69.050 1.00 118.09 ? 200 GLU Y CD  1 
ATOM   2760 O OE1 . GLU B 2 203 ? 45.159 22.449  70.201 1.00 124.51 ? 200 GLU Y OE1 1 
ATOM   2761 O OE2 . GLU B 2 203 ? 43.449 22.437  68.823 1.00 115.49 ? 200 GLU Y OE2 1 
ATOM   2762 N N   . ASN B 2 204 ? 47.970 25.409  65.188 1.00 108.15 ? 201 ASN Y N   1 
ATOM   2763 C CA  . ASN B 2 204 ? 48.611 26.691  64.945 1.00 110.79 ? 201 ASN Y CA  1 
ATOM   2764 C C   . ASN B 2 204 ? 47.776 27.830  65.519 1.00 111.33 ? 201 ASN Y C   1 
ATOM   2765 O O   . ASN B 2 204 ? 46.545 27.815  65.435 1.00 110.12 ? 201 ASN Y O   1 
ATOM   2766 C CB  . ASN B 2 204 ? 48.837 26.897  63.449 1.00 119.99 ? 201 ASN Y CB  1 
ATOM   2767 C CG  . ASN B 2 204 ? 49.878 27.959  63.160 1.00 135.35 ? 201 ASN Y CG  1 
ATOM   2768 O OD1 . ASN B 2 204 ? 50.497 28.505  64.073 1.00 140.61 ? 201 ASN Y OD1 1 
ATOM   2769 N ND2 . ASN B 2 204 ? 50.088 28.246  61.884 1.00 147.54 ? 201 ASN Y ND2 1 
ATOM   2770 N N   . LYS B 2 205 ? 48.455 28.823  66.086 1.00 111.91 ? 202 LYS Y N   1 
ATOM   2771 C CA  . LYS B 2 205 ? 47.797 29.970  66.703 1.00 112.53 ? 202 LYS Y CA  1 
ATOM   2772 C C   . LYS B 2 205 ? 47.111 30.908  65.711 1.00 110.23 ? 202 LYS Y C   1 
ATOM   2773 O O   . LYS B 2 205 ? 47.656 31.218  64.649 1.00 108.87 ? 202 LYS Y O   1 
ATOM   2774 C CB  . LYS B 2 205 ? 48.792 30.744  67.559 1.00 115.75 ? 202 LYS Y CB  1 
ATOM   2775 N N   . PRO B 2 206 ? 45.891 31.364  66.045 1.00 107.37 ? 203 PRO Y N   1 
ATOM   2776 C CA  . PRO B 2 206 ? 45.104 32.273  65.208 1.00 101.34 ? 203 PRO Y CA  1 
ATOM   2777 C C   . PRO B 2 206 ? 45.566 33.726  65.355 1.00 96.89  ? 203 PRO Y C   1 
ATOM   2778 O O   . PRO B 2 206 ? 44.817 34.580  65.832 1.00 98.58  ? 203 PRO Y O   1 
ATOM   2779 C CB  . PRO B 2 206 ? 43.691 32.077  65.752 1.00 100.23 ? 203 PRO Y CB  1 
ATOM   2780 C CG  . PRO B 2 206 ? 43.937 31.883  67.209 1.00 104.63 ? 203 PRO Y CG  1 
ATOM   2781 C CD  . PRO B 2 206 ? 45.103 30.918  67.210 1.00 111.82 ? 203 PRO Y CD  1 
ATOM   2782 N N   . THR B 2 207 ? 46.788 34.000  64.907 1.00 92.28  ? 204 THR Y N   1 
ATOM   2783 C CA  . THR B 2 207 ? 47.382 35.334  64.985 1.00 83.84  ? 204 THR Y CA  1 
ATOM   2784 C C   . THR B 2 207 ? 46.467 36.473  64.515 1.00 73.77  ? 204 THR Y C   1 
ATOM   2785 O O   . THR B 2 207 ? 45.783 36.372  63.491 1.00 73.40  ? 204 THR Y O   1 
ATOM   2786 C CB  . THR B 2 207 ? 48.721 35.380  64.204 1.00 87.95  ? 204 THR Y CB  1 
ATOM   2787 O OG1 . THR B 2 207 ? 49.596 34.357  64.702 1.00 83.30  ? 204 THR Y OG1 1 
ATOM   2788 C CG2 . THR B 2 207 ? 49.402 36.735  64.358 1.00 92.24  ? 204 THR Y CG2 1 
ATOM   2789 N N   . ARG B 2 208 ? 46.438 37.535  65.312 1.00 64.49  ? 205 ARG Y N   1 
ATOM   2790 C CA  . ARG B 2 208 ? 45.645 38.729  65.042 1.00 56.42  ? 205 ARG Y CA  1 
ATOM   2791 C C   . ARG B 2 208 ? 46.628 39.863  64.727 1.00 47.14  ? 205 ARG Y C   1 
ATOM   2792 O O   . ARG B 2 208 ? 47.734 39.894  65.271 1.00 45.87  ? 205 ARG Y O   1 
ATOM   2793 C CB  . ARG B 2 208 ? 44.787 39.045  66.274 1.00 59.12  ? 205 ARG Y CB  1 
ATOM   2794 C CG  . ARG B 2 208 ? 44.424 40.504  66.491 1.00 82.83  ? 205 ARG Y CG  1 
ATOM   2795 C CD  . ARG B 2 208 ? 43.628 40.653  67.779 1.00 107.02 ? 205 ARG Y CD  1 
ATOM   2796 N NE  . ARG B 2 208 ? 43.730 41.988  68.365 1.00 125.34 ? 205 ARG Y NE  1 
ATOM   2797 C CZ  . ARG B 2 208 ? 44.815 42.463  68.973 1.00 135.30 ? 205 ARG Y CZ  1 
ATOM   2798 N NH1 . ARG B 2 208 ? 45.908 41.716  69.076 1.00 136.43 ? 205 ARG Y NH1 1 
ATOM   2799 N NH2 . ARG B 2 208 ? 44.795 43.674  69.515 1.00 142.85 ? 205 ARG Y NH2 1 
ATOM   2800 N N   . PRO B 2 209 ? 46.256 40.787  63.823 1.00 39.40  ? 206 PRO Y N   1 
ATOM   2801 C CA  . PRO B 2 209 ? 47.128 41.907  63.450 1.00 32.27  ? 206 PRO Y CA  1 
ATOM   2802 C C   . PRO B 2 209 ? 47.509 42.828  64.614 1.00 31.55  ? 206 PRO Y C   1 
ATOM   2803 O O   . PRO B 2 209 ? 46.656 43.263  65.392 1.00 27.13  ? 206 PRO Y O   1 
ATOM   2804 C CB  . PRO B 2 209 ? 46.306 42.627  62.382 1.00 23.95  ? 206 PRO Y CB  1 
ATOM   2805 C CG  . PRO B 2 209 ? 44.900 42.343  62.794 1.00 27.18  ? 206 PRO Y CG  1 
ATOM   2806 C CD  . PRO B 2 209 ? 44.963 40.885  63.126 1.00 34.01  ? 206 PRO Y CD  1 
ATOM   2807 N N   . VAL B 2 210 ? 48.802 43.123  64.716 1.00 30.41  ? 207 VAL Y N   1 
ATOM   2808 C CA  . VAL B 2 210 ? 49.327 43.967  65.782 1.00 27.64  ? 207 VAL Y CA  1 
ATOM   2809 C C   . VAL B 2 210 ? 49.903 45.272  65.240 1.00 27.80  ? 207 VAL Y C   1 
ATOM   2810 O O   . VAL B 2 210 ? 50.833 45.262  64.433 1.00 27.39  ? 207 VAL Y O   1 
ATOM   2811 C CB  . VAL B 2 210 ? 50.429 43.220  66.581 1.00 27.29  ? 207 VAL Y CB  1 
ATOM   2812 C CG1 . VAL B 2 210 ? 50.990 44.106  67.685 1.00 31.38  ? 207 VAL Y CG1 1 
ATOM   2813 C CG2 . VAL B 2 210 ? 49.870 41.939  67.177 1.00 41.45  ? 207 VAL Y CG2 1 
ATOM   2814 N N   . ILE B 2 211 ? 49.353 46.394  65.695 1.00 30.01  ? 208 ILE Y N   1 
ATOM   2815 C CA  . ILE B 2 211 ? 49.821 47.712  65.277 1.00 27.18  ? 208 ILE Y CA  1 
ATOM   2816 C C   . ILE B 2 211 ? 50.941 48.129  66.219 1.00 26.42  ? 208 ILE Y C   1 
ATOM   2817 O O   . ILE B 2 211 ? 50.708 48.342  67.408 1.00 31.83  ? 208 ILE Y O   1 
ATOM   2818 C CB  . ILE B 2 211 ? 48.697 48.765  65.351 1.00 13.47  ? 208 ILE Y CB  1 
ATOM   2819 C CG1 . ILE B 2 211 ? 47.558 48.394  64.401 1.00 22.00  ? 208 ILE Y CG1 1 
ATOM   2820 C CG2 . ILE B 2 211 ? 49.239 50.130  64.981 1.00 26.71  ? 208 ILE Y CG2 1 
ATOM   2821 C CD1 . ILE B 2 211 ? 46.369 49.306  64.509 1.00 23.24  ? 208 ILE Y CD1 1 
ATOM   2822 N N   . VAL B 2 212 ? 52.156 48.206  65.694 1.00 24.44  ? 209 VAL Y N   1 
ATOM   2823 C CA  . VAL B 2 212 ? 53.303 48.595  66.500 1.00 34.12  ? 209 VAL Y CA  1 
ATOM   2824 C C   . VAL B 2 212 ? 53.529 50.111  66.444 1.00 41.09  ? 209 VAL Y C   1 
ATOM   2825 O O   . VAL B 2 212 ? 54.306 50.666  67.229 1.00 38.56  ? 209 VAL Y O   1 
ATOM   2826 C CB  . VAL B 2 212 ? 54.575 47.811  66.064 1.00 40.71  ? 209 VAL Y CB  1 
ATOM   2827 C CG1 . VAL B 2 212 ? 54.932 48.122  64.626 1.00 40.31  ? 209 VAL Y CG1 1 
ATOM   2828 C CG2 . VAL B 2 212 ? 55.743 48.114  66.992 1.00 59.75  ? 209 VAL Y CG2 1 
ATOM   2829 N N   . SER B 2 213 ? 52.837 50.771  65.517 1.00 44.95  ? 210 SER Y N   1 
ATOM   2830 C CA  . SER B 2 213 ? 52.927 52.220  65.334 1.00 42.46  ? 210 SER Y CA  1 
ATOM   2831 C C   . SER B 2 213 ? 51.785 52.661  64.421 1.00 40.63  ? 210 SER Y C   1 
ATOM   2832 O O   . SER B 2 213 ? 51.544 52.036  63.391 1.00 46.77  ? 210 SER Y O   1 
ATOM   2833 C CB  . SER B 2 213 ? 54.264 52.606  64.694 1.00 43.09  ? 210 SER Y CB  1 
ATOM   2834 O OG  . SER B 2 213 ? 54.380 54.012  64.565 1.00 56.44  ? 210 SER Y OG  1 
ATOM   2835 N N   . PRO B 2 214 ? 51.061 53.732  64.786 1.00 41.05  ? 211 PRO Y N   1 
ATOM   2836 C CA  . PRO B 2 214 ? 51.212 54.573  65.980 1.00 40.95  ? 211 PRO Y CA  1 
ATOM   2837 C C   . PRO B 2 214 ? 50.844 53.841  67.267 1.00 42.54  ? 211 PRO Y C   1 
ATOM   2838 O O   . PRO B 2 214 ? 50.444 52.679  67.236 1.00 45.07  ? 211 PRO Y O   1 
ATOM   2839 C CB  . PRO B 2 214 ? 50.237 55.711  65.705 1.00 34.13  ? 211 PRO Y CB  1 
ATOM   2840 C CG  . PRO B 2 214 ? 49.140 55.027  64.951 1.00 21.42  ? 211 PRO Y CG  1 
ATOM   2841 C CD  . PRO B 2 214 ? 49.931 54.205  63.966 1.00 37.65  ? 211 PRO Y CD  1 
ATOM   2842 N N   . ALA B 2 215 ? 50.935 54.545  68.388 1.00 42.94  ? 212 ALA Y N   1 
ATOM   2843 C CA  . ALA B 2 215 ? 50.620 53.949  69.678 1.00 44.27  ? 212 ALA Y CA  1 
ATOM   2844 C C   . ALA B 2 215 ? 49.809 54.899  70.545 1.00 42.89  ? 212 ALA Y C   1 
ATOM   2845 O O   . ALA B 2 215 ? 50.176 55.165  71.688 1.00 52.29  ? 212 ALA Y O   1 
ATOM   2846 C CB  . ALA B 2 215 ? 51.908 53.550  70.392 1.00 45.83  ? 212 ALA Y CB  1 
ATOM   2847 N N   . ASN B 2 216 ? 48.706 55.406  70.000 1.00 36.69  ? 213 ASN Y N   1 
ATOM   2848 C CA  . ASN B 2 216 ? 47.838 56.334  70.727 1.00 41.38  ? 213 ASN Y CA  1 
ATOM   2849 C C   . ASN B 2 216 ? 48.651 57.496  71.295 1.00 39.43  ? 213 ASN Y C   1 
ATOM   2850 O O   . ASN B 2 216 ? 48.693 57.716  72.507 1.00 39.68  ? 213 ASN Y O   1 
ATOM   2851 C CB  . ASN B 2 216 ? 47.092 55.598  71.844 1.00 43.52  ? 213 ASN Y CB  1 
ATOM   2852 C CG  . ASN B 2 216 ? 46.170 54.525  71.311 1.00 40.32  ? 213 ASN Y CG  1 
ATOM   2853 O OD1 . ASN B 2 216 ? 46.343 54.062  70.180 1.00 43.67  ? 213 ASN Y OD1 1 
ATOM   2854 N ND2 . ASN B 2 216 ? 45.184 54.132  72.113 1.00 36.63  ? 213 ASN Y ND2 1 
ATOM   2855 N N   . GLU B 2 217 ? 49.268 58.253  70.395 1.00 38.31  ? 214 GLU Y N   1 
ATOM   2856 C CA  . GLU B 2 217 ? 50.114 59.379  70.768 1.00 38.94  ? 214 GLU Y CA  1 
ATOM   2857 C C   . GLU B 2 217 ? 49.636 60.679  70.131 1.00 37.67  ? 214 GLU Y C   1 
ATOM   2858 O O   . GLU B 2 217 ? 48.659 60.693  69.384 1.00 39.34  ? 214 GLU Y O   1 
ATOM   2859 C CB  . GLU B 2 217 ? 51.549 59.084  70.331 1.00 38.34  ? 214 GLU Y CB  1 
ATOM   2860 C CG  . GLU B 2 217 ? 51.665 58.724  68.853 1.00 45.22  ? 214 GLU Y CG  1 
ATOM   2861 C CD  . GLU B 2 217 ? 52.949 57.997  68.522 1.00 51.97  ? 214 GLU Y CD  1 
ATOM   2862 O OE1 . GLU B 2 217 ? 54.022 58.635  68.569 1.00 71.60  ? 214 GLU Y OE1 1 
ATOM   2863 O OE2 . GLU B 2 217 ? 52.886 56.788  68.214 1.00 41.08  ? 214 GLU Y OE2 1 
ATOM   2864 N N   . THR B 2 218 ? 50.326 61.770  70.441 1.00 36.38  ? 215 THR Y N   1 
ATOM   2865 C CA  . THR B 2 218 ? 49.993 63.076  69.893 1.00 36.67  ? 215 THR Y CA  1 
ATOM   2866 C C   . THR B 2 218 ? 51.195 63.554  69.095 1.00 41.40  ? 215 THR Y C   1 
ATOM   2867 O O   . THR B 2 218 ? 52.315 63.086  69.314 1.00 43.80  ? 215 THR Y O   1 
ATOM   2868 C CB  . THR B 2 218 ? 49.666 64.102  70.997 1.00 29.54  ? 215 THR Y CB  1 
ATOM   2869 O OG1 . THR B 2 218 ? 50.828 64.334  71.804 1.00 47.20  ? 215 THR Y OG1 1 
ATOM   2870 C CG2 . THR B 2 218 ? 48.530 63.597  71.873 1.00 18.76  ? 215 THR Y CG2 1 
ATOM   2871 N N   . MET B 2 219 ? 50.969 64.490  68.182 1.00 39.72  ? 216 MET Y N   1 
ATOM   2872 C CA  . MET B 2 219 ? 52.044 65.002  67.349 1.00 35.01  ? 216 MET Y CA  1 
ATOM   2873 C C   . MET B 2 219 ? 51.868 66.491  67.123 1.00 38.98  ? 216 MET Y C   1 
ATOM   2874 O O   . MET B 2 219 ? 50.818 66.936  66.658 1.00 39.52  ? 216 MET Y O   1 
ATOM   2875 C CB  . MET B 2 219 ? 52.041 64.263  66.011 1.00 27.46  ? 216 MET Y CB  1 
ATOM   2876 C CG  . MET B 2 219 ? 53.162 64.641  65.061 1.00 45.63  ? 216 MET Y CG  1 
ATOM   2877 S SD  . MET B 2 219 ? 52.969 63.815  63.467 1.00 58.94  ? 216 MET Y SD  1 
ATOM   2878 C CE  . MET B 2 219 ? 53.559 62.172  63.870 1.00 76.04  ? 216 MET Y CE  1 
ATOM   2879 N N   . GLU B 2 220 ? 52.886 67.262  67.490 1.00 44.91  ? 217 GLU Y N   1 
ATOM   2880 C CA  . GLU B 2 220 ? 52.855 68.708  67.317 1.00 43.23  ? 217 GLU Y CA  1 
ATOM   2881 C C   . GLU B 2 220 ? 53.097 69.021  65.848 1.00 37.66  ? 217 GLU Y C   1 
ATOM   2882 O O   . GLU B 2 220 ? 54.175 68.752  65.322 1.00 37.72  ? 217 GLU Y O   1 
ATOM   2883 C CB  . GLU B 2 220 ? 53.935 69.384  68.170 1.00 54.80  ? 217 GLU Y CB  1 
ATOM   2884 C CG  . GLU B 2 220 ? 53.749 69.247  69.675 1.00 62.53  ? 217 GLU Y CG  1 
ATOM   2885 C CD  . GLU B 2 220 ? 54.715 70.117  70.469 1.00 80.73  ? 217 GLU Y CD  1 
ATOM   2886 O OE1 . GLU B 2 220 ? 55.943 69.973  70.289 1.00 86.28  ? 217 GLU Y OE1 1 
ATOM   2887 O OE2 . GLU B 2 220 ? 54.245 70.952  71.273 1.00 85.02  ? 217 GLU Y OE2 1 
ATOM   2888 N N   . VAL B 2 221 ? 52.084 69.560  65.183 1.00 40.21  ? 218 VAL Y N   1 
ATOM   2889 C CA  . VAL B 2 221 ? 52.187 69.905  63.771 1.00 45.98  ? 218 VAL Y CA  1 
ATOM   2890 C C   . VAL B 2 221 ? 51.718 71.342  63.573 1.00 49.13  ? 218 VAL Y C   1 
ATOM   2891 O O   . VAL B 2 221 ? 50.793 71.800  64.250 1.00 46.38  ? 218 VAL Y O   1 
ATOM   2892 C CB  . VAL B 2 221 ? 51.314 68.969  62.891 1.00 50.10  ? 218 VAL Y CB  1 
ATOM   2893 C CG1 . VAL B 2 221 ? 51.529 69.273  61.418 1.00 47.55  ? 218 VAL Y CG1 1 
ATOM   2894 C CG2 . VAL B 2 221 ? 51.640 67.516  63.176 1.00 63.14  ? 218 VAL Y CG2 1 
ATOM   2895 N N   . ASP B 2 222 ? 52.377 72.055  62.665 1.00 50.71  ? 219 ASP Y N   1 
ATOM   2896 C CA  . ASP B 2 222 ? 52.022 73.436  62.367 1.00 55.92  ? 219 ASP Y CA  1 
ATOM   2897 C C   . ASP B 2 222 ? 50.949 73.488  61.287 1.00 56.04  ? 219 ASP Y C   1 
ATOM   2898 O O   . ASP B 2 222 ? 50.809 72.560  60.488 1.00 53.37  ? 219 ASP Y O   1 
ATOM   2899 C CB  . ASP B 2 222 ? 53.252 74.227  61.913 1.00 69.98  ? 219 ASP Y CB  1 
ATOM   2900 C CG  . ASP B 2 222 ? 54.215 74.512  63.049 1.00 84.50  ? 219 ASP Y CG  1 
ATOM   2901 O OD1 . ASP B 2 222 ? 54.935 73.582  63.473 1.00 103.12 ? 219 ASP Y OD1 1 
ATOM   2902 O OD2 . ASP B 2 222 ? 54.250 75.668  63.520 1.00 86.38  ? 219 ASP Y OD2 1 
ATOM   2903 N N   . LEU B 2 223 ? 50.198 74.581  61.263 1.00 59.63  ? 220 LEU Y N   1 
ATOM   2904 C CA  . LEU B 2 223 ? 49.138 74.755  60.281 1.00 56.71  ? 220 LEU Y CA  1 
ATOM   2905 C C   . LEU B 2 223 ? 49.752 75.061  58.914 1.00 52.12  ? 220 LEU Y C   1 
ATOM   2906 O O   . LEU B 2 223 ? 50.733 75.802  58.814 1.00 46.18  ? 220 LEU Y O   1 
ATOM   2907 C CB  . LEU B 2 223 ? 48.203 75.889  60.718 1.00 56.83  ? 220 LEU Y CB  1 
ATOM   2908 C CG  . LEU B 2 223 ? 46.841 76.037  60.038 1.00 59.85  ? 220 LEU Y CG  1 
ATOM   2909 C CD1 . LEU B 2 223 ? 45.986 74.800  60.285 1.00 63.02  ? 220 LEU Y CD1 1 
ATOM   2910 C CD2 . LEU B 2 223 ? 46.142 77.274  60.579 1.00 61.33  ? 220 LEU Y CD2 1 
ATOM   2911 N N   . GLY B 2 224 ? 49.201 74.453  57.868 1.00 50.52  ? 221 GLY Y N   1 
ATOM   2912 C CA  . GLY B 2 224 ? 49.702 74.689  56.526 1.00 49.11  ? 221 GLY Y CA  1 
ATOM   2913 C C   . GLY B 2 224 ? 50.921 73.884  56.112 1.00 49.01  ? 221 GLY Y C   1 
ATOM   2914 O O   . GLY B 2 224 ? 51.496 74.133  55.049 1.00 53.58  ? 221 GLY Y O   1 
ATOM   2915 N N   . SER B 2 225 ? 51.331 72.931  56.943 1.00 45.65  ? 222 SER Y N   1 
ATOM   2916 C CA  . SER B 2 225 ? 52.484 72.099  56.619 1.00 41.53  ? 222 SER Y CA  1 
ATOM   2917 C C   . SER B 2 225 ? 52.029 70.766  56.023 1.00 44.32  ? 222 SER Y C   1 
ATOM   2918 O O   . SER B 2 225 ? 50.829 70.527  55.870 1.00 43.31  ? 222 SER Y O   1 
ATOM   2919 C CB  . SER B 2 225 ? 53.356 71.882  57.859 1.00 29.59  ? 222 SER Y CB  1 
ATOM   2920 O OG  . SER B 2 225 ? 52.614 71.327  58.928 1.00 35.13  ? 222 SER Y OG  1 
ATOM   2921 N N   . GLN B 2 226 ? 52.983 69.910  55.674 1.00 45.89  ? 223 GLN Y N   1 
ATOM   2922 C CA  . GLN B 2 226 ? 52.676 68.610  55.088 1.00 52.26  ? 223 GLN Y CA  1 
ATOM   2923 C C   . GLN B 2 226 ? 53.354 67.513  55.898 1.00 51.98  ? 223 GLN Y C   1 
ATOM   2924 O O   . GLN B 2 226 ? 54.541 67.615  56.214 1.00 56.46  ? 223 GLN Y O   1 
ATOM   2925 C CB  . GLN B 2 226 ? 53.163 68.565  53.639 1.00 67.96  ? 223 GLN Y CB  1 
ATOM   2926 C CG  . GLN B 2 226 ? 52.912 67.245  52.931 1.00 89.80  ? 223 GLN Y CG  1 
ATOM   2927 C CD  . GLN B 2 226 ? 53.297 67.294  51.468 1.00 108.15 ? 223 GLN Y CD  1 
ATOM   2928 O OE1 . GLN B 2 226 ? 54.003 66.417  50.971 1.00 116.22 ? 223 GLN Y OE1 1 
ATOM   2929 N NE2 . GLN B 2 226 ? 52.830 68.317  50.767 1.00 114.00 ? 223 GLN Y NE2 1 
ATOM   2930 N N   . ILE B 2 227 ? 52.610 66.462  56.229 1.00 47.71  ? 224 ILE Y N   1 
ATOM   2931 C CA  . ILE B 2 227 ? 53.161 65.361  57.016 1.00 47.15  ? 224 ILE Y CA  1 
ATOM   2932 C C   . ILE B 2 227 ? 52.719 63.991  56.508 1.00 45.05  ? 224 ILE Y C   1 
ATOM   2933 O O   . ILE B 2 227 ? 51.775 63.880  55.721 1.00 44.63  ? 224 ILE Y O   1 
ATOM   2934 C CB  . ILE B 2 227 ? 52.762 65.468  58.512 1.00 45.78  ? 224 ILE Y CB  1 
ATOM   2935 C CG1 . ILE B 2 227 ? 51.239 65.500  58.649 1.00 45.75  ? 224 ILE Y CG1 1 
ATOM   2936 C CG2 . ILE B 2 227 ? 53.389 66.701  59.149 1.00 48.97  ? 224 ILE Y CG2 1 
ATOM   2937 C CD1 . ILE B 2 227 ? 50.755 65.446  60.077 1.00 60.25  ? 224 ILE Y CD1 1 
ATOM   2938 N N   . GLN B 2 228 ? 53.420 62.955  56.959 1.00 45.90  ? 225 GLN Y N   1 
ATOM   2939 C CA  . GLN B 2 228 ? 53.114 61.577  56.591 1.00 42.87  ? 225 GLN Y CA  1 
ATOM   2940 C C   . GLN B 2 228 ? 52.897 60.777  57.860 1.00 42.58  ? 225 GLN Y C   1 
ATOM   2941 O O   . GLN B 2 228 ? 53.776 60.727  58.724 1.00 45.96  ? 225 GLN Y O   1 
ATOM   2942 C CB  . GLN B 2 228 ? 54.266 60.938  55.818 1.00 32.61  ? 225 GLN Y CB  1 
ATOM   2943 C CG  . GLN B 2 228 ? 54.436 61.411  54.394 1.00 60.20  ? 225 GLN Y CG  1 
ATOM   2944 C CD  . GLN B 2 228 ? 55.557 60.675  53.689 1.00 82.72  ? 225 GLN Y CD  1 
ATOM   2945 O OE1 . GLN B 2 228 ? 56.693 60.657  54.162 1.00 96.67  ? 225 GLN Y OE1 1 
ATOM   2946 N NE2 . GLN B 2 228 ? 55.241 60.048  52.567 1.00 82.16  ? 225 GLN Y NE2 1 
ATOM   2947 N N   . LEU B 2 229 ? 51.713 60.196  57.997 1.00 37.58  ? 226 LEU Y N   1 
ATOM   2948 C CA  . LEU B 2 229 ? 51.404 59.374  59.156 1.00 34.91  ? 226 LEU Y CA  1 
ATOM   2949 C C   . LEU B 2 229 ? 51.545 57.922  58.714 1.00 37.14  ? 226 LEU Y C   1 
ATOM   2950 O O   . LEU B 2 229 ? 50.799 57.446  57.856 1.00 38.23  ? 226 LEU Y O   1 
ATOM   2951 C CB  . LEU B 2 229 ? 49.986 59.653  59.659 1.00 30.58  ? 226 LEU Y CB  1 
ATOM   2952 C CG  . LEU B 2 229 ? 49.708 61.089  60.103 1.00 8.66   ? 226 LEU Y CG  1 
ATOM   2953 C CD1 . LEU B 2 229 ? 48.361 61.144  60.798 1.00 7.07   ? 226 LEU Y CD1 1 
ATOM   2954 C CD2 . LEU B 2 229 ? 50.801 61.563  61.039 1.00 9.46   ? 226 LEU Y CD2 1 
ATOM   2955 N N   . ILE B 2 230 ? 52.534 57.236  59.271 1.00 36.05  ? 227 ILE Y N   1 
ATOM   2956 C CA  . ILE B 2 230 ? 52.801 55.848  58.919 1.00 37.57  ? 227 ILE Y CA  1 
ATOM   2957 C C   . ILE B 2 230 ? 52.245 54.844  59.925 1.00 34.28  ? 227 ILE Y C   1 
ATOM   2958 O O   . ILE B 2 230 ? 52.432 54.989  61.136 1.00 36.01  ? 227 ILE Y O   1 
ATOM   2959 C CB  . ILE B 2 230 ? 54.327 55.608  58.755 1.00 38.30  ? 227 ILE Y CB  1 
ATOM   2960 C CG1 . ILE B 2 230 ? 54.894 56.559  57.697 1.00 23.29  ? 227 ILE Y CG1 1 
ATOM   2961 C CG2 . ILE B 2 230 ? 54.608 54.152  58.376 1.00 27.44  ? 227 ILE Y CG2 1 
ATOM   2962 C CD1 . ILE B 2 230 ? 56.399 56.459  57.518 1.00 41.64  ? 227 ILE Y CD1 1 
ATOM   2963 N N   . CYS B 2 231 ? 51.521 53.856  59.414 1.00 30.07  ? 228 CYS Y N   1 
ATOM   2964 C CA  . CYS B 2 231 ? 50.969 52.803  60.250 1.00 29.19  ? 228 CYS Y CA  1 
ATOM   2965 C C   . CYS B 2 231 ? 51.790 51.544  59.970 1.00 31.09  ? 228 CYS Y C   1 
ATOM   2966 O O   . CYS B 2 231 ? 51.935 51.132  58.818 1.00 30.98  ? 228 CYS Y O   1 
ATOM   2967 C CB  . CYS B 2 231 ? 49.496 52.565  59.942 1.00 16.75  ? 228 CYS Y CB  1 
ATOM   2968 S SG  . CYS B 2 231 ? 48.749 51.469  61.175 1.00 20.29  ? 228 CYS Y SG  1 
ATOM   2969 N N   . ASN B 2 232 ? 52.368 50.977  61.023 1.00 32.12  ? 229 ASN Y N   1 
ATOM   2970 C CA  . ASN B 2 232 ? 53.218 49.793  60.930 1.00 33.44  ? 229 ASN Y CA  1 
ATOM   2971 C C   . ASN B 2 232 ? 52.530 48.621  61.627 1.00 30.94  ? 229 ASN Y C   1 
ATOM   2972 O O   . ASN B 2 232 ? 52.433 48.596  62.855 1.00 29.29  ? 229 ASN Y O   1 
ATOM   2973 C CB  . ASN B 2 232 ? 54.553 50.109  61.607 1.00 44.56  ? 229 ASN Y CB  1 
ATOM   2974 C CG  . ASN B 2 232 ? 55.654 49.134  61.250 1.00 65.72  ? 229 ASN Y CG  1 
ATOM   2975 O OD1 . ASN B 2 232 ? 55.434 48.142  60.558 1.00 84.30  ? 229 ASN Y OD1 1 
ATOM   2976 N ND2 . ASN B 2 232 ? 56.850 49.422  61.756 1.00 87.38  ? 229 ASN Y ND2 1 
ATOM   2977 N N   . VAL B 2 233 ? 52.023 47.674  60.840 1.00 31.83  ? 230 VAL Y N   1 
ATOM   2978 C CA  . VAL B 2 233 ? 51.322 46.509  61.376 1.00 26.39  ? 230 VAL Y CA  1 
ATOM   2979 C C   . VAL B 2 233 ? 52.104 45.215  61.165 1.00 26.09  ? 230 VAL Y C   1 
ATOM   2980 O O   . VAL B 2 233 ? 52.757 45.036  60.142 1.00 30.57  ? 230 VAL Y O   1 
ATOM   2981 C CB  . VAL B 2 233 ? 49.932 46.346  60.718 1.00 25.95  ? 230 VAL Y CB  1 
ATOM   2982 C CG1 . VAL B 2 233 ? 49.197 45.155  61.310 1.00 27.47  ? 230 VAL Y CG1 1 
ATOM   2983 C CG2 . VAL B 2 233 ? 49.111 47.614  60.887 1.00 37.10  ? 230 VAL Y CG2 1 
ATOM   2984 N N   . THR B 2 234 ? 52.026 44.318  62.139 1.00 30.53  ? 231 THR Y N   1 
ATOM   2985 C CA  . THR B 2 234 ? 52.695 43.024  62.075 1.00 33.90  ? 231 THR Y CA  1 
ATOM   2986 C C   . THR B 2 234 ? 51.614 41.955  61.931 1.00 33.02  ? 231 THR Y C   1 
ATOM   2987 O O   . THR B 2 234 ? 50.651 41.932  62.705 1.00 33.24  ? 231 THR Y O   1 
ATOM   2988 C CB  . THR B 2 234 ? 53.505 42.745  63.359 1.00 39.09  ? 231 THR Y CB  1 
ATOM   2989 O OG1 . THR B 2 234 ? 54.482 43.778  63.546 1.00 65.65  ? 231 THR Y OG1 1 
ATOM   2990 C CG2 . THR B 2 234 ? 54.208 41.400  63.271 1.00 21.49  ? 231 THR Y CG2 1 
ATOM   2991 N N   . GLY B 2 235 ? 51.749 41.106  60.918 1.00 33.87  ? 232 GLY Y N   1 
ATOM   2992 C CA  . GLY B 2 235 ? 50.774 40.054  60.701 1.00 33.86  ? 232 GLY Y CA  1 
ATOM   2993 C C   . GLY B 2 235 ? 50.895 39.436  59.323 1.00 33.47  ? 232 GLY Y C   1 
ATOM   2994 O O   . GLY B 2 235 ? 51.917 39.597  58.646 1.00 31.35  ? 232 GLY Y O   1 
ATOM   2995 N N   . GLN B 2 236 ? 49.872 38.686  58.924 1.00 35.57  ? 233 GLN Y N   1 
ATOM   2996 C CA  . GLN B 2 236 ? 49.862 38.044  57.614 1.00 40.12  ? 233 GLN Y CA  1 
ATOM   2997 C C   . GLN B 2 236 ? 49.707 39.116  56.546 1.00 38.38  ? 233 GLN Y C   1 
ATOM   2998 O O   . GLN B 2 236 ? 48.996 40.097  56.751 1.00 41.33  ? 233 GLN Y O   1 
ATOM   2999 C CB  . GLN B 2 236 ? 48.693 37.054  57.485 1.00 44.76  ? 233 GLN Y CB  1 
ATOM   3000 C CG  . GLN B 2 236 ? 48.744 35.848  58.406 1.00 36.48  ? 233 GLN Y CG  1 
ATOM   3001 C CD  . GLN B 2 236 ? 47.912 36.030  59.657 1.00 48.81  ? 233 GLN Y CD  1 
ATOM   3002 O OE1 . GLN B 2 236 ? 47.772 37.141  60.168 1.00 64.36  ? 233 GLN Y OE1 1 
ATOM   3003 N NE2 . GLN B 2 236 ? 47.342 34.940  60.150 1.00 51.94  ? 233 GLN Y NE2 1 
ATOM   3004 N N   . LEU B 2 237 ? 50.340 38.908  55.396 1.00 36.80  ? 234 LEU Y N   1 
ATOM   3005 C CA  . LEU B 2 237 ? 50.251 39.852  54.286 1.00 36.17  ? 234 LEU Y CA  1 
ATOM   3006 C C   . LEU B 2 237 ? 48.797 40.016  53.839 1.00 37.79  ? 234 LEU Y C   1 
ATOM   3007 O O   . LEU B 2 237 ? 48.438 41.005  53.196 1.00 49.74  ? 234 LEU Y O   1 
ATOM   3008 C CB  . LEU B 2 237 ? 51.120 39.382  53.113 1.00 16.51  ? 234 LEU Y CB  1 
ATOM   3009 C CG  . LEU B 2 237 ? 52.625 39.308  53.395 1.00 23.13  ? 234 LEU Y CG  1 
ATOM   3010 C CD1 . LEU B 2 237 ? 53.335 38.609  52.258 1.00 8.69   ? 234 LEU Y CD1 1 
ATOM   3011 C CD2 . LEU B 2 237 ? 53.202 40.699  53.612 1.00 30.18  ? 234 LEU Y CD2 1 
ATOM   3012 N N   . SER B 2 238 ? 47.963 39.051  54.206 1.00 30.33  ? 235 SER Y N   1 
ATOM   3013 C CA  . SER B 2 238 ? 46.550 39.067  53.861 1.00 31.69  ? 235 SER Y CA  1 
ATOM   3014 C C   . SER B 2 238 ? 45.703 39.920  54.807 1.00 33.31  ? 235 SER Y C   1 
ATOM   3015 O O   . SER B 2 238 ? 44.483 40.006  54.644 1.00 37.69  ? 235 SER Y O   1 
ATOM   3016 C CB  . SER B 2 238 ? 46.018 37.632  53.845 1.00 35.01  ? 235 SER Y CB  1 
ATOM   3017 O OG  . SER B 2 238 ? 46.469 36.920  54.987 1.00 48.15  ? 235 SER Y OG  1 
ATOM   3018 N N   . ASP B 2 239 ? 46.339 40.530  55.805 1.00 29.84  ? 236 ASP Y N   1 
ATOM   3019 C CA  . ASP B 2 239 ? 45.619 41.354  56.770 1.00 24.68  ? 236 ASP Y CA  1 
ATOM   3020 C C   . ASP B 2 239 ? 45.250 42.724  56.221 1.00 24.61  ? 236 ASP Y C   1 
ATOM   3021 O O   . ASP B 2 239 ? 45.966 43.284  55.389 1.00 22.56  ? 236 ASP Y O   1 
ATOM   3022 C CB  . ASP B 2 239 ? 46.417 41.496  58.065 1.00 30.42  ? 236 ASP Y CB  1 
ATOM   3023 C CG  . ASP B 2 239 ? 46.505 40.198  58.841 1.00 32.16  ? 236 ASP Y CG  1 
ATOM   3024 O OD1 . ASP B 2 239 ? 45.552 39.392  58.774 1.00 42.97  ? 236 ASP Y OD1 1 
ATOM   3025 O OD2 . ASP B 2 239 ? 47.524 39.983  59.525 1.00 32.46  ? 236 ASP Y OD2 1 
ATOM   3026 N N   . ILE B 2 240 ? 44.122 43.248  56.696 1.00 24.81  ? 237 ILE Y N   1 
ATOM   3027 C CA  . ILE B 2 240 ? 43.597 44.546  56.279 1.00 29.44  ? 237 ILE Y CA  1 
ATOM   3028 C C   . ILE B 2 240 ? 44.060 45.667  57.203 1.00 30.72  ? 237 ILE Y C   1 
ATOM   3029 O O   . ILE B 2 240 ? 43.682 45.700  58.368 1.00 34.39  ? 237 ILE Y O   1 
ATOM   3030 C CB  . ILE B 2 240 ? 42.047 44.545  56.305 1.00 37.73  ? 237 ILE Y CB  1 
ATOM   3031 C CG1 . ILE B 2 240 ? 41.497 43.412  55.440 1.00 49.19  ? 237 ILE Y CG1 1 
ATOM   3032 C CG2 . ILE B 2 240 ? 41.498 45.891  55.852 1.00 31.27  ? 237 ILE Y CG2 1 
ATOM   3033 C CD1 . ILE B 2 240 ? 39.996 43.260  55.525 1.00 59.37  ? 237 ILE Y CD1 1 
ATOM   3034 N N   . ALA B 2 241 ? 44.859 46.587  56.676 1.00 34.27  ? 238 ALA Y N   1 
ATOM   3035 C CA  . ALA B 2 241 ? 45.347 47.729  57.446 1.00 32.90  ? 238 ALA Y CA  1 
ATOM   3036 C C   . ALA B 2 241 ? 44.903 48.979  56.694 1.00 35.79  ? 238 ALA Y C   1 
ATOM   3037 O O   . ALA B 2 241 ? 45.106 49.075  55.483 1.00 42.88  ? 238 ALA Y O   1 
ATOM   3038 C CB  . ALA B 2 241 ? 46.857 47.685  57.553 1.00 30.82  ? 238 ALA Y CB  1 
ATOM   3039 N N   . TYR B 2 242 ? 44.276 49.921  57.390 1.00 32.57  ? 239 TYR Y N   1 
ATOM   3040 C CA  . TYR B 2 242 ? 43.800 51.139  56.741 1.00 34.58  ? 239 TYR Y CA  1 
ATOM   3041 C C   . TYR B 2 242 ? 43.571 52.286  57.727 1.00 39.40  ? 239 TYR Y C   1 
ATOM   3042 O O   . TYR B 2 242 ? 43.399 52.055  58.923 1.00 38.62  ? 239 TYR Y O   1 
ATOM   3043 C CB  . TYR B 2 242 ? 42.511 50.845  55.964 1.00 26.97  ? 239 TYR Y CB  1 
ATOM   3044 C CG  . TYR B 2 242 ? 41.352 50.379  56.824 1.00 35.86  ? 239 TYR Y CG  1 
ATOM   3045 C CD1 . TYR B 2 242 ? 41.358 49.118  57.418 1.00 46.36  ? 239 TYR Y CD1 1 
ATOM   3046 C CD2 . TYR B 2 242 ? 40.251 51.204  57.049 1.00 33.04  ? 239 TYR Y CD2 1 
ATOM   3047 C CE1 . TYR B 2 242 ? 40.297 48.691  58.216 1.00 38.48  ? 239 TYR Y CE1 1 
ATOM   3048 C CE2 . TYR B 2 242 ? 39.188 50.788  57.844 1.00 28.02  ? 239 TYR Y CE2 1 
ATOM   3049 C CZ  . TYR B 2 242 ? 39.218 49.532  58.424 1.00 34.64  ? 239 TYR Y CZ  1 
ATOM   3050 O OH  . TYR B 2 242 ? 38.170 49.120  59.216 1.00 44.20  ? 239 TYR Y OH  1 
ATOM   3051 N N   . TRP B 2 243 ? 43.566 53.516  57.217 1.00 41.56  ? 240 TRP Y N   1 
ATOM   3052 C CA  . TRP B 2 243 ? 43.360 54.708  58.039 1.00 30.18  ? 240 TRP Y CA  1 
ATOM   3053 C C   . TRP B 2 243 ? 41.907 55.150  58.058 1.00 29.45  ? 240 TRP Y C   1 
ATOM   3054 O O   . TRP B 2 243 ? 41.152 54.880  57.121 1.00 32.99  ? 240 TRP Y O   1 
ATOM   3055 C CB  . TRP B 2 243 ? 44.209 55.869  57.523 1.00 19.69  ? 240 TRP Y CB  1 
ATOM   3056 C CG  . TRP B 2 243 ? 45.648 55.804  57.901 1.00 10.68  ? 240 TRP Y CG  1 
ATOM   3057 C CD1 . TRP B 2 243 ? 46.692 55.448  57.097 1.00 9.66   ? 240 TRP Y CD1 1 
ATOM   3058 C CD2 . TRP B 2 243 ? 46.210 56.132  59.175 1.00 9.52   ? 240 TRP Y CD2 1 
ATOM   3059 N NE1 . TRP B 2 243 ? 47.876 55.535  57.795 1.00 20.41  ? 240 TRP Y NE1 1 
ATOM   3060 C CE2 . TRP B 2 243 ? 47.611 55.950  59.073 1.00 6.32   ? 240 TRP Y CE2 1 
ATOM   3061 C CE3 . TRP B 2 243 ? 45.673 56.562  60.395 1.00 14.58  ? 240 TRP Y CE3 1 
ATOM   3062 C CZ2 . TRP B 2 243 ? 48.476 56.181  60.146 1.00 10.78  ? 240 TRP Y CZ2 1 
ATOM   3063 C CZ3 . TRP B 2 243 ? 46.534 56.792  61.463 1.00 16.68  ? 240 TRP Y CZ3 1 
ATOM   3064 C CH2 . TRP B 2 243 ? 47.921 56.599  61.329 1.00 6.57   ? 240 TRP Y CH2 1 
ATOM   3065 N N   . LYS B 2 244 ? 41.538 55.859  59.119 1.00 29.42  ? 241 LYS Y N   1 
ATOM   3066 C CA  . LYS B 2 244 ? 40.190 56.387  59.297 1.00 31.38  ? 241 LYS Y CA  1 
ATOM   3067 C C   . LYS B 2 244 ? 40.269 57.690  60.085 1.00 34.64  ? 241 LYS Y C   1 
ATOM   3068 O O   . LYS B 2 244 ? 41.022 57.790  61.057 1.00 34.24  ? 241 LYS Y O   1 
ATOM   3069 C CB  . LYS B 2 244 ? 39.295 55.403  60.065 1.00 29.63  ? 241 LYS Y CB  1 
ATOM   3070 C CG  . LYS B 2 244 ? 38.924 54.134  59.317 1.00 29.17  ? 241 LYS Y CG  1 
ATOM   3071 C CD  . LYS B 2 244 ? 37.443 53.801  59.479 1.00 39.56  ? 241 LYS Y CD  1 
ATOM   3072 C CE  . LYS B 2 244 ? 37.045 53.612  60.934 1.00 47.21  ? 241 LYS Y CE  1 
ATOM   3073 N NZ  . LYS B 2 244 ? 35.593 53.301  61.066 1.00 47.06  ? 241 LYS Y NZ  1 
ATOM   3074 N N   . TRP B 2 245 ? 39.516 58.693  59.649 1.00 41.73  ? 242 TRP Y N   1 
ATOM   3075 C CA  . TRP B 2 245 ? 39.479 59.981  60.332 1.00 41.86  ? 242 TRP Y CA  1 
ATOM   3076 C C   . TRP B 2 245 ? 38.017 60.318  60.583 1.00 41.92  ? 242 TRP Y C   1 
ATOM   3077 O O   . TRP B 2 245 ? 37.201 60.303  59.657 1.00 42.11  ? 242 TRP Y O   1 
ATOM   3078 C CB  . TRP B 2 245 ? 40.137 61.080  59.490 1.00 39.19  ? 242 TRP Y CB  1 
ATOM   3079 C CG  . TRP B 2 245 ? 40.204 62.405  60.203 1.00 47.73  ? 242 TRP Y CG  1 
ATOM   3080 C CD1 . TRP B 2 245 ? 41.071 62.758  61.196 1.00 45.43  ? 242 TRP Y CD1 1 
ATOM   3081 C CD2 . TRP B 2 245 ? 39.345 63.535  59.999 1.00 50.91  ? 242 TRP Y CD2 1 
ATOM   3082 N NE1 . TRP B 2 245 ? 40.805 64.035  61.626 1.00 38.24  ? 242 TRP Y NE1 1 
ATOM   3083 C CE2 . TRP B 2 245 ? 39.751 64.537  60.911 1.00 39.64  ? 242 TRP Y CE2 1 
ATOM   3084 C CE3 . TRP B 2 245 ? 38.271 63.801  59.139 1.00 51.79  ? 242 TRP Y CE3 1 
ATOM   3085 C CZ2 . TRP B 2 245 ? 39.120 65.782  60.984 1.00 46.40  ? 242 TRP Y CZ2 1 
ATOM   3086 C CZ3 . TRP B 2 245 ? 37.642 65.040  59.214 1.00 39.85  ? 242 TRP Y CZ3 1 
ATOM   3087 C CH2 . TRP B 2 245 ? 38.071 66.015  60.132 1.00 46.91  ? 242 TRP Y CH2 1 
ATOM   3088 N N   . ASN B 2 246 ? 37.684 60.588  61.841 1.00 44.47  ? 243 ASN Y N   1 
ATOM   3089 C CA  . ASN B 2 246 ? 36.315 60.916  62.228 1.00 47.90  ? 243 ASN Y CA  1 
ATOM   3090 C C   . ASN B 2 246 ? 35.362 59.811  61.761 1.00 49.90  ? 243 ASN Y C   1 
ATOM   3091 O O   . ASN B 2 246 ? 34.361 60.072  61.088 1.00 53.93  ? 243 ASN Y O   1 
ATOM   3092 C CB  . ASN B 2 246 ? 35.896 62.277  61.649 1.00 50.27  ? 243 ASN Y CB  1 
ATOM   3093 C CG  . ASN B 2 246 ? 34.528 62.727  62.135 1.00 58.83  ? 243 ASN Y CG  1 
ATOM   3094 O OD1 . ASN B 2 246 ? 34.344 63.007  63.322 1.00 60.55  ? 243 ASN Y OD1 1 
ATOM   3095 N ND2 . ASN B 2 246 ? 33.570 62.792  61.217 1.00 74.32  ? 243 ASN Y ND2 1 
ATOM   3096 N N   . GLY B 2 247 ? 35.731 58.568  62.066 1.00 47.90  ? 244 GLY Y N   1 
ATOM   3097 C CA  . GLY B 2 247 ? 34.918 57.421  61.697 1.00 43.35  ? 244 GLY Y CA  1 
ATOM   3098 C C   . GLY B 2 247 ? 34.638 57.264  60.215 1.00 42.73  ? 244 GLY Y C   1 
ATOM   3099 O O   . GLY B 2 247 ? 33.720 56.542  59.832 1.00 45.75  ? 244 GLY Y O   1 
ATOM   3100 N N   . SER B 2 248 ? 35.432 57.924  59.381 1.00 42.71  ? 245 SER Y N   1 
ATOM   3101 C CA  . SER B 2 248 ? 35.258 57.853  57.937 1.00 47.11  ? 245 SER Y CA  1 
ATOM   3102 C C   . SER B 2 248 ? 36.561 57.387  57.304 1.00 50.59  ? 245 SER Y C   1 
ATOM   3103 O O   . SER B 2 248 ? 37.632 57.540  57.894 1.00 48.53  ? 245 SER Y O   1 
ATOM   3104 C CB  . SER B 2 248 ? 34.883 59.230  57.386 1.00 56.10  ? 245 SER Y CB  1 
ATOM   3105 O OG  . SER B 2 248 ? 33.809 59.801  58.118 1.00 61.70  ? 245 SER Y OG  1 
ATOM   3106 N N   . VAL B 2 249 ? 36.469 56.800  56.116 1.00 56.70  ? 246 VAL Y N   1 
ATOM   3107 C CA  . VAL B 2 249 ? 37.654 56.322  55.410 1.00 58.85  ? 246 VAL Y CA  1 
ATOM   3108 C C   . VAL B 2 249 ? 38.134 57.369  54.404 1.00 60.36  ? 246 VAL Y C   1 
ATOM   3109 O O   . VAL B 2 249 ? 37.343 58.173  53.904 1.00 61.62  ? 246 VAL Y O   1 
ATOM   3110 C CB  . VAL B 2 249 ? 37.392 54.973  54.696 1.00 56.24  ? 246 VAL Y CB  1 
ATOM   3111 C CG1 . VAL B 2 249 ? 37.093 53.895  55.720 1.00 50.04  ? 246 VAL Y CG1 1 
ATOM   3112 C CG2 . VAL B 2 249 ? 36.239 55.103  53.709 1.00 63.03  ? 246 VAL Y CG2 1 
ATOM   3113 N N   . ILE B 2 250 ? 39.434 57.367  54.128 1.00 63.46  ? 247 ILE Y N   1 
ATOM   3114 C CA  . ILE B 2 250 ? 40.032 58.319  53.196 1.00 66.03  ? 247 ILE Y CA  1 
ATOM   3115 C C   . ILE B 2 250 ? 39.633 57.988  51.759 1.00 71.74  ? 247 ILE Y C   1 
ATOM   3116 O O   . ILE B 2 250 ? 39.962 56.916  51.248 1.00 72.16  ? 247 ILE Y O   1 
ATOM   3117 C CB  . ILE B 2 250 ? 41.577 58.308  53.301 1.00 62.14  ? 247 ILE Y CB  1 
ATOM   3118 C CG1 . ILE B 2 250 ? 42.022 58.458  54.763 1.00 52.75  ? 247 ILE Y CG1 1 
ATOM   3119 C CG2 . ILE B 2 250 ? 42.172 59.412  52.440 1.00 51.55  ? 247 ILE Y CG2 1 
ATOM   3120 C CD1 . ILE B 2 250 ? 41.550 59.731  55.445 1.00 49.24  ? 247 ILE Y CD1 1 
ATOM   3121 N N   . ASP B 2 251 ? 38.919 58.907  51.116 1.00 75.67  ? 248 ASP Y N   1 
ATOM   3122 C CA  . ASP B 2 251 ? 38.479 58.706  49.739 1.00 84.08  ? 248 ASP Y CA  1 
ATOM   3123 C C   . ASP B 2 251 ? 39.436 59.329  48.732 1.00 88.19  ? 248 ASP Y C   1 
ATOM   3124 O O   . ASP B 2 251 ? 40.016 60.382  48.988 1.00 87.72  ? 248 ASP Y O   1 
ATOM   3125 C CB  . ASP B 2 251 ? 37.070 59.270  49.538 1.00 98.66  ? 248 ASP Y CB  1 
ATOM   3126 C CG  . ASP B 2 251 ? 36.005 58.444  50.241 1.00 121.41 ? 248 ASP Y CG  1 
ATOM   3127 O OD1 . ASP B 2 251 ? 35.580 57.413  49.675 1.00 125.38 ? 248 ASP Y OD1 1 
ATOM   3128 O OD2 . ASP B 2 251 ? 35.592 58.827  51.357 1.00 135.02 ? 248 ASP Y OD2 1 
ATOM   3129 N N   . GLU B 2 252 ? 39.552 58.692  47.570 1.00 95.64  ? 249 GLU Y N   1 
ATOM   3130 C CA  . GLU B 2 252 ? 40.427 59.152  46.489 1.00 104.20 ? 249 GLU Y CA  1 
ATOM   3131 C C   . GLU B 2 252 ? 40.094 60.572  46.030 1.00 105.25 ? 249 GLU Y C   1 
ATOM   3132 O O   . GLU B 2 252 ? 40.961 61.295  45.541 1.00 105.10 ? 249 GLU Y O   1 
ATOM   3133 C CB  . GLU B 2 252 ? 40.326 58.201  45.292 1.00 117.35 ? 249 GLU Y CB  1 
ATOM   3134 C CG  . GLU B 2 252 ? 41.197 58.597  44.102 1.00 141.97 ? 249 GLU Y CG  1 
ATOM   3135 C CD  . GLU B 2 252 ? 40.823 57.863  42.828 1.00 158.61 ? 249 GLU Y CD  1 
ATOM   3136 O OE1 . GLU B 2 252 ? 39.736 58.143  42.278 1.00 163.66 ? 249 GLU Y OE1 1 
ATOM   3137 O OE2 . GLU B 2 252 ? 41.618 57.014  42.371 1.00 167.08 ? 249 GLU Y OE2 1 
ATOM   3138 N N   . ASP B 2 253 ? 38.831 60.958  46.175 1.00 105.77 ? 250 ASP Y N   1 
ATOM   3139 C CA  . ASP B 2 253 ? 38.385 62.285  45.770 1.00 106.19 ? 250 ASP Y CA  1 
ATOM   3140 C C   . ASP B 2 253 ? 38.836 63.384  46.735 1.00 104.26 ? 250 ASP Y C   1 
ATOM   3141 O O   . ASP B 2 253 ? 38.415 64.534  46.610 1.00 107.48 ? 250 ASP Y O   1 
ATOM   3142 C CB  . ASP B 2 253 ? 36.867 62.303  45.620 1.00 109.04 ? 250 ASP Y CB  1 
ATOM   3143 N N   . ASP B 2 254 ? 39.686 63.030  47.695 1.00 98.36  ? 251 ASP Y N   1 
ATOM   3144 C CA  . ASP B 2 254 ? 40.180 63.994  48.671 1.00 93.87  ? 251 ASP Y CA  1 
ATOM   3145 C C   . ASP B 2 254 ? 41.453 64.650  48.128 1.00 91.92  ? 251 ASP Y C   1 
ATOM   3146 O O   . ASP B 2 254 ? 42.511 64.025  48.076 1.00 94.78  ? 251 ASP Y O   1 
ATOM   3147 C CB  . ASP B 2 254 ? 40.470 63.287  49.999 1.00 87.65  ? 251 ASP Y CB  1 
ATOM   3148 C CG  . ASP B 2 254 ? 40.229 64.177  51.205 1.00 82.56  ? 251 ASP Y CG  1 
ATOM   3149 O OD1 . ASP B 2 254 ? 40.590 65.373  51.163 1.00 65.52  ? 251 ASP Y OD1 1 
ATOM   3150 O OD2 . ASP B 2 254 ? 39.672 63.673  52.203 1.00 87.56  ? 251 ASP Y OD2 1 
ATOM   3151 N N   . PRO B 2 255 ? 41.377 65.941  47.761 1.00 84.98  ? 252 PRO Y N   1 
ATOM   3152 C CA  . PRO B 2 255 ? 42.526 66.677  47.222 1.00 75.85  ? 252 PRO Y CA  1 
ATOM   3153 C C   . PRO B 2 255 ? 43.626 66.984  48.236 1.00 72.24  ? 252 PRO Y C   1 
ATOM   3154 O O   . PRO B 2 255 ? 44.607 67.646  47.902 1.00 74.92  ? 252 PRO Y O   1 
ATOM   3155 C CB  . PRO B 2 255 ? 41.885 67.961  46.706 1.00 72.44  ? 252 PRO Y CB  1 
ATOM   3156 C CG  . PRO B 2 255 ? 40.799 68.196  47.702 1.00 80.83  ? 252 PRO Y CG  1 
ATOM   3157 C CD  . PRO B 2 255 ? 40.193 66.816  47.842 1.00 87.01  ? 252 PRO Y CD  1 
ATOM   3158 N N   . VAL B 2 256 ? 43.458 66.520  49.472 1.00 67.51  ? 253 VAL Y N   1 
ATOM   3159 C CA  . VAL B 2 256 ? 44.450 66.773  50.512 1.00 59.99  ? 253 VAL Y CA  1 
ATOM   3160 C C   . VAL B 2 256 ? 44.875 65.507  51.267 1.00 54.28  ? 253 VAL Y C   1 
ATOM   3161 O O   . VAL B 2 256 ? 45.944 65.478  51.879 1.00 58.99  ? 253 VAL Y O   1 
ATOM   3162 C CB  . VAL B 2 256 ? 43.949 67.864  51.506 1.00 50.31  ? 253 VAL Y CB  1 
ATOM   3163 C CG1 . VAL B 2 256 ? 42.748 67.368  52.293 1.00 52.93  ? 253 VAL Y CG1 1 
ATOM   3164 C CG2 . VAL B 2 256 ? 45.068 68.302  52.435 1.00 43.08  ? 253 VAL Y CG2 1 
ATOM   3165 N N   . LEU B 2 257 ? 44.063 64.454  51.192 1.00 42.72  ? 254 LEU Y N   1 
ATOM   3166 C CA  . LEU B 2 257 ? 44.370 63.205  51.884 1.00 38.35  ? 254 LEU Y CA  1 
ATOM   3167 C C   . LEU B 2 257 ? 44.489 62.004  50.956 1.00 43.05  ? 254 LEU Y C   1 
ATOM   3168 O O   . LEU B 2 257 ? 43.491 61.530  50.410 1.00 49.39  ? 254 LEU Y O   1 
ATOM   3169 C CB  . LEU B 2 257 ? 43.315 62.907  52.950 1.00 28.52  ? 254 LEU Y CB  1 
ATOM   3170 C CG  . LEU B 2 257 ? 43.312 63.792  54.193 1.00 23.69  ? 254 LEU Y CG  1 
ATOM   3171 C CD1 . LEU B 2 257 ? 42.159 63.395  55.094 1.00 44.30  ? 254 LEU Y CD1 1 
ATOM   3172 C CD2 . LEU B 2 257 ? 44.635 63.658  54.928 1.00 26.07  ? 254 LEU Y CD2 1 
ATOM   3173 N N   . GLY B 2 258 ? 45.708 61.498  50.805 1.00 42.54  ? 255 GLY Y N   1 
ATOM   3174 C CA  . GLY B 2 258 ? 45.930 60.340  49.959 1.00 44.40  ? 255 GLY Y CA  1 
ATOM   3175 C C   . GLY B 2 258 ? 46.748 59.293  50.692 1.00 46.89  ? 255 GLY Y C   1 
ATOM   3176 O O   . GLY B 2 258 ? 47.790 59.615  51.270 1.00 44.20  ? 255 GLY Y O   1 
ATOM   3177 N N   . GLU B 2 259 ? 46.287 58.046  50.682 1.00 48.97  ? 256 GLU Y N   1 
ATOM   3178 C CA  . GLU B 2 259 ? 47.007 56.972  51.363 1.00 49.17  ? 256 GLU Y CA  1 
ATOM   3179 C C   . GLU B 2 259 ? 47.575 55.926  50.406 1.00 46.86  ? 256 GLU Y C   1 
ATOM   3180 O O   . GLU B 2 259 ? 47.076 55.751  49.293 1.00 48.53  ? 256 GLU Y O   1 
ATOM   3181 C CB  . GLU B 2 259 ? 46.120 56.304  52.421 1.00 52.82  ? 256 GLU Y CB  1 
ATOM   3182 C CG  . GLU B 2 259 ? 44.845 55.655  51.896 1.00 57.12  ? 256 GLU Y CG  1 
ATOM   3183 C CD  . GLU B 2 259 ? 44.045 54.963  52.993 1.00 66.71  ? 256 GLU Y CD  1 
ATOM   3184 O OE1 . GLU B 2 259 ? 44.657 54.332  53.883 1.00 50.86  ? 256 GLU Y OE1 1 
ATOM   3185 O OE2 . GLU B 2 259 ? 42.798 55.043  52.963 1.00 77.91  ? 256 GLU Y OE2 1 
ATOM   3186 N N   . ASP B 2 260 ? 48.635 55.252  50.842 1.00 51.59  ? 257 ASP Y N   1 
ATOM   3187 C CA  . ASP B 2 260 ? 49.286 54.216  50.045 1.00 54.04  ? 257 ASP Y CA  1 
ATOM   3188 C C   . ASP B 2 260 ? 49.514 52.978  50.901 1.00 48.15  ? 257 ASP Y C   1 
ATOM   3189 O O   . ASP B 2 260 ? 49.655 53.075  52.124 1.00 47.73  ? 257 ASP Y O   1 
ATOM   3190 C CB  . ASP B 2 260 ? 50.624 54.717  49.498 1.00 70.69  ? 257 ASP Y CB  1 
ATOM   3191 C CG  . ASP B 2 260 ? 50.465 55.905  48.572 1.00 97.70  ? 257 ASP Y CG  1 
ATOM   3192 O OD1 . ASP B 2 260 ? 49.894 55.735  47.473 1.00 115.25 ? 257 ASP Y OD1 1 
ATOM   3193 O OD2 . ASP B 2 260 ? 50.907 57.012  48.945 1.00 112.45 ? 257 ASP Y OD2 1 
ATOM   3194 N N   . TYR B 2 261 ? 49.573 51.819  50.257 1.00 48.03  ? 258 TYR Y N   1 
ATOM   3195 C CA  . TYR B 2 261 ? 49.770 50.559  50.965 1.00 46.02  ? 258 TYR Y CA  1 
ATOM   3196 C C   . TYR B 2 261 ? 50.960 49.794  50.407 1.00 48.23  ? 258 TYR Y C   1 
ATOM   3197 O O   . TYR B 2 261 ? 51.127 49.708  49.193 1.00 54.51  ? 258 TYR Y O   1 
ATOM   3198 C CB  . TYR B 2 261 ? 48.532 49.672  50.820 1.00 40.79  ? 258 TYR Y CB  1 
ATOM   3199 C CG  . TYR B 2 261 ? 47.217 50.319  51.192 1.00 58.76  ? 258 TYR Y CG  1 
ATOM   3200 C CD1 . TYR B 2 261 ? 46.516 51.101  50.273 1.00 77.38  ? 258 TYR Y CD1 1 
ATOM   3201 C CD2 . TYR B 2 261 ? 46.649 50.111  52.447 1.00 70.22  ? 258 TYR Y CD2 1 
ATOM   3202 C CE1 . TYR B 2 261 ? 45.280 51.658  50.596 1.00 89.41  ? 258 TYR Y CE1 1 
ATOM   3203 C CE2 . TYR B 2 261 ? 45.415 50.663  52.780 1.00 80.69  ? 258 TYR Y CE2 1 
ATOM   3204 C CZ  . TYR B 2 261 ? 44.735 51.433  51.849 1.00 91.27  ? 258 TYR Y CZ  1 
ATOM   3205 O OH  . TYR B 2 261 ? 43.506 51.966  52.169 1.00 102.11 ? 258 TYR Y OH  1 
ATOM   3206 N N   . TYR B 2 262 ? 51.791 49.258  51.293 1.00 55.27  ? 259 TYR Y N   1 
ATOM   3207 C CA  . TYR B 2 262 ? 52.936 48.455  50.884 1.00 61.47  ? 259 TYR Y CA  1 
ATOM   3208 C C   . TYR B 2 262 ? 53.353 47.528  52.019 1.00 60.01  ? 259 TYR Y C   1 
ATOM   3209 O O   . TYR B 2 262 ? 53.470 47.948  53.172 1.00 60.90  ? 259 TYR Y O   1 
ATOM   3210 C CB  . TYR B 2 262 ? 54.106 49.312  50.358 1.00 68.62  ? 259 TYR Y CB  1 
ATOM   3211 C CG  . TYR B 2 262 ? 54.902 50.107  51.373 1.00 80.46  ? 259 TYR Y CG  1 
ATOM   3212 C CD1 . TYR B 2 262 ? 56.004 49.543  52.020 1.00 85.58  ? 259 TYR Y CD1 1 
ATOM   3213 C CD2 . TYR B 2 262 ? 54.603 51.445  51.630 1.00 92.14  ? 259 TYR Y CD2 1 
ATOM   3214 C CE1 . TYR B 2 262 ? 56.793 50.293  52.893 1.00 96.79  ? 259 TYR Y CE1 1 
ATOM   3215 C CE2 . TYR B 2 262 ? 55.386 52.205  52.500 1.00 104.07 ? 259 TYR Y CE2 1 
ATOM   3216 C CZ  . TYR B 2 262 ? 56.480 51.623  53.128 1.00 104.70 ? 259 TYR Y CZ  1 
ATOM   3217 O OH  . TYR B 2 262 ? 57.261 52.372  53.982 1.00 104.42 ? 259 TYR Y OH  1 
ATOM   3218 N N   . SER B 2 263 ? 53.527 46.253  51.690 1.00 59.06  ? 260 SER Y N   1 
ATOM   3219 C CA  . SER B 2 263 ? 53.893 45.246  52.674 1.00 54.94  ? 260 SER Y CA  1 
ATOM   3220 C C   . SER B 2 263 ? 55.225 44.577  52.357 1.00 56.49  ? 260 SER Y C   1 
ATOM   3221 O O   . SER B 2 263 ? 55.658 44.543  51.201 1.00 58.93  ? 260 SER Y O   1 
ATOM   3222 C CB  . SER B 2 263 ? 52.788 44.197  52.752 1.00 45.07  ? 260 SER Y CB  1 
ATOM   3223 O OG  . SER B 2 263 ? 51.538 44.805  53.038 1.00 60.87  ? 260 SER Y OG  1 
ATOM   3224 N N   . VAL B 2 264 ? 55.873 44.061  53.397 1.00 54.21  ? 261 VAL Y N   1 
ATOM   3225 C CA  . VAL B 2 264 ? 57.154 43.381  53.259 1.00 49.26  ? 261 VAL Y CA  1 
ATOM   3226 C C   . VAL B 2 264 ? 57.057 42.014  53.936 1.00 46.48  ? 261 VAL Y C   1 
ATOM   3227 O O   . VAL B 2 264 ? 56.762 41.919  55.131 1.00 45.36  ? 261 VAL Y O   1 
ATOM   3228 C CB  . VAL B 2 264 ? 58.294 44.194  53.909 1.00 44.21  ? 261 VAL Y CB  1 
ATOM   3229 C CG1 . VAL B 2 264 ? 59.629 43.509  53.674 1.00 50.46  ? 261 VAL Y CG1 1 
ATOM   3230 C CG2 . VAL B 2 264 ? 58.317 45.611  53.353 1.00 51.31  ? 261 VAL Y CG2 1 
ATOM   3231 N N   . GLU B 2 265 ? 57.282 40.959  53.163 1.00 45.87  ? 262 GLU Y N   1 
ATOM   3232 C CA  . GLU B 2 265 ? 57.212 39.599  53.680 1.00 45.24  ? 262 GLU Y CA  1 
ATOM   3233 C C   . GLU B 2 265 ? 58.407 39.262  54.559 1.00 41.00  ? 262 GLU Y C   1 
ATOM   3234 O O   . GLU B 2 265 ? 59.551 39.571  54.212 1.00 34.28  ? 262 GLU Y O   1 
ATOM   3235 C CB  . GLU B 2 265 ? 57.125 38.596  52.528 1.00 55.96  ? 262 GLU Y CB  1 
ATOM   3236 C CG  . GLU B 2 265 ? 56.980 37.151  52.978 1.00 70.12  ? 262 GLU Y CG  1 
ATOM   3237 C CD  . GLU B 2 265 ? 56.895 36.185  51.817 1.00 77.56  ? 262 GLU Y CD  1 
ATOM   3238 O OE1 . GLU B 2 265 ? 57.954 35.856  51.242 1.00 83.78  ? 262 GLU Y OE1 1 
ATOM   3239 O OE2 . GLU B 2 265 ? 55.771 35.755  51.481 1.00 75.17  ? 262 GLU Y OE2 1 
ATOM   3240 N N   . ASN B 2 266 ? 58.130 38.634  55.699 1.00 43.37  ? 263 ASN Y N   1 
ATOM   3241 C CA  . ASN B 2 266 ? 59.168 38.227  56.643 1.00 43.87  ? 263 ASN Y CA  1 
ATOM   3242 C C   . ASN B 2 266 ? 59.755 36.899  56.158 1.00 44.69  ? 263 ASN Y C   1 
ATOM   3243 O O   . ASN B 2 266 ? 59.078 35.869  56.178 1.00 44.47  ? 263 ASN Y O   1 
ATOM   3244 C CB  . ASN B 2 266 ? 58.564 38.066  58.041 1.00 37.12  ? 263 ASN Y CB  1 
ATOM   3245 C CG  . ASN B 2 266 ? 59.604 37.774  59.105 1.00 25.25  ? 263 ASN Y CG  1 
ATOM   3246 O OD1 . ASN B 2 266 ? 60.623 37.135  58.842 1.00 35.94  ? 263 ASN Y OD1 1 
ATOM   3247 N ND2 . ASN B 2 266 ? 59.347 38.231  60.318 1.00 40.18  ? 263 ASN Y ND2 1 
ATOM   3248 N N   . PRO B 2 267 ? 61.034 36.903  55.740 1.00 47.56  ? 264 PRO Y N   1 
ATOM   3249 C CA  . PRO B 2 267 ? 61.735 35.713  55.241 1.00 51.85  ? 264 PRO Y CA  1 
ATOM   3250 C C   . PRO B 2 267 ? 61.908 34.575  56.249 1.00 58.57  ? 264 PRO Y C   1 
ATOM   3251 O O   . PRO B 2 267 ? 62.330 33.474  55.878 1.00 63.26  ? 264 PRO Y O   1 
ATOM   3252 C CB  . PRO B 2 267 ? 63.082 36.280  54.793 1.00 45.80  ? 264 PRO Y CB  1 
ATOM   3253 C CG  . PRO B 2 267 ? 63.303 37.402  55.752 1.00 43.83  ? 264 PRO Y CG  1 
ATOM   3254 C CD  . PRO B 2 267 ? 61.945 38.062  55.778 1.00 55.94  ? 264 PRO Y CD  1 
ATOM   3255 N N   . ALA B 2 268 ? 61.611 34.848  57.516 1.00 53.79  ? 265 ALA Y N   1 
ATOM   3256 C CA  . ALA B 2 268 ? 61.730 33.844  58.563 1.00 44.55  ? 265 ALA Y CA  1 
ATOM   3257 C C   . ALA B 2 268 ? 60.358 33.349  58.997 1.00 43.75  ? 265 ALA Y C   1 
ATOM   3258 O O   . ALA B 2 268 ? 60.180 32.168  59.276 1.00 53.53  ? 265 ALA Y O   1 
ATOM   3259 C CB  . ALA B 2 268 ? 62.488 34.408  59.750 1.00 44.64  ? 265 ALA Y CB  1 
ATOM   3260 N N   . ASN B 2 269 ? 59.385 34.251  59.052 1.00 42.07  ? 266 ASN Y N   1 
ATOM   3261 C CA  . ASN B 2 269 ? 58.037 33.882  59.463 1.00 44.84  ? 266 ASN Y CA  1 
ATOM   3262 C C   . ASN B 2 269 ? 56.985 34.723  58.754 1.00 50.47  ? 266 ASN Y C   1 
ATOM   3263 O O   . ASN B 2 269 ? 56.735 35.869  59.130 1.00 51.85  ? 266 ASN Y O   1 
ATOM   3264 C CB  . ASN B 2 269 ? 57.887 34.032  60.980 1.00 49.50  ? 266 ASN Y CB  1 
ATOM   3265 C CG  . ASN B 2 269 ? 56.524 33.580  61.483 1.00 65.12  ? 266 ASN Y CG  1 
ATOM   3266 O OD1 . ASN B 2 269 ? 55.676 33.127  60.710 1.00 69.60  ? 266 ASN Y OD1 1 
ATOM   3267 N ND2 . ASN B 2 269 ? 56.307 33.706  62.786 1.00 73.85  ? 266 ASN Y ND2 1 
ATOM   3268 N N   . LYS B 2 270 ? 56.336 34.128  57.759 1.00 52.42  ? 267 LYS Y N   1 
ATOM   3269 C CA  . LYS B 2 270 ? 55.304 34.813  56.984 1.00 51.96  ? 267 LYS Y CA  1 
ATOM   3270 C C   . LYS B 2 270 ? 54.136 35.292  57.847 1.00 46.05  ? 267 LYS Y C   1 
ATOM   3271 O O   . LYS B 2 270 ? 53.405 36.200  57.455 1.00 51.25  ? 267 LYS Y O   1 
ATOM   3272 C CB  . LYS B 2 270 ? 54.781 33.900  55.869 1.00 68.85  ? 267 LYS Y CB  1 
ATOM   3273 C CG  . LYS B 2 270 ? 54.006 32.683  56.366 1.00 102.98 ? 267 LYS Y CG  1 
ATOM   3274 C CD  . LYS B 2 270 ? 53.474 31.845  55.212 1.00 125.92 ? 267 LYS Y CD  1 
ATOM   3275 C CE  . LYS B 2 270 ? 52.571 30.723  55.708 1.00 132.61 ? 267 LYS Y CE  1 
ATOM   3276 N NZ  . LYS B 2 270 ? 52.074 29.873  54.589 1.00 133.91 ? 267 LYS Y NZ  1 
ATOM   3277 N N   . ARG B 2 271 ? 53.953 34.670  59.010 1.00 42.26  ? 268 ARG Y N   1 
ATOM   3278 C CA  . ARG B 2 271 ? 52.872 35.038  59.923 1.00 41.83  ? 268 ARG Y CA  1 
ATOM   3279 C C   . ARG B 2 271 ? 53.138 36.387  60.590 1.00 39.77  ? 268 ARG Y C   1 
ATOM   3280 O O   . ARG B 2 271 ? 52.221 37.029  61.107 1.00 38.91  ? 268 ARG Y O   1 
ATOM   3281 C CB  . ARG B 2 271 ? 52.683 33.964  61.001 1.00 49.03  ? 268 ARG Y CB  1 
ATOM   3282 C CG  . ARG B 2 271 ? 52.283 32.588  60.484 1.00 42.83  ? 268 ARG Y CG  1 
ATOM   3283 C CD  . ARG B 2 271 ? 50.925 32.608  59.801 1.00 51.48  ? 268 ARG Y CD  1 
ATOM   3284 N NE  . ARG B 2 271 ? 49.852 33.062  60.686 1.00 59.57  ? 268 ARG Y NE  1 
ATOM   3285 C CZ  . ARG B 2 271 ? 49.297 32.323  61.642 1.00 65.47  ? 268 ARG Y CZ  1 
ATOM   3286 N NH1 . ARG B 2 271 ? 49.711 31.084  61.857 1.00 75.24  ? 268 ARG Y NH1 1 
ATOM   3287 N NH2 . ARG B 2 271 ? 48.300 32.816  62.362 1.00 72.63  ? 268 ARG Y NH2 1 
ATOM   3288 N N   . ARG B 2 272 ? 54.400 36.798  60.602 1.00 37.99  ? 269 ARG Y N   1 
ATOM   3289 C CA  . ARG B 2 272 ? 54.781 38.066  61.204 1.00 36.54  ? 269 ARG Y CA  1 
ATOM   3290 C C   . ARG B 2 272 ? 55.494 38.976  60.220 1.00 37.67  ? 269 ARG Y C   1 
ATOM   3291 O O   . ARG B 2 272 ? 56.676 39.285  60.387 1.00 33.22  ? 269 ARG Y O   1 
ATOM   3292 C CB  . ARG B 2 272 ? 55.646 37.843  62.446 1.00 35.26  ? 269 ARG Y CB  1 
ATOM   3293 C CG  . ARG B 2 272 ? 54.845 37.495  63.686 1.00 63.45  ? 269 ARG Y CG  1 
ATOM   3294 C CD  . ARG B 2 272 ? 55.697 37.576  64.948 1.00 83.63  ? 269 ARG Y CD  1 
ATOM   3295 N NE  . ARG B 2 272 ? 54.911 37.297  66.150 1.00 94.99  ? 269 ARG Y NE  1 
ATOM   3296 C CZ  . ARG B 2 272 ? 54.119 38.178  66.757 1.00 96.77  ? 269 ARG Y CZ  1 
ATOM   3297 N NH1 . ARG B 2 272 ? 53.999 39.413  66.289 1.00 90.56  ? 269 ARG Y NH1 1 
ATOM   3298 N NH2 . ARG B 2 272 ? 53.418 37.812  67.822 1.00 104.15 ? 269 ARG Y NH2 1 
ATOM   3299 N N   . SER B 2 273 ? 54.774 39.377  59.178 1.00 38.88  ? 270 SER Y N   1 
ATOM   3300 C CA  . SER B 2 273 ? 55.315 40.273  58.168 1.00 41.84  ? 270 SER Y CA  1 
ATOM   3301 C C   . SER B 2 273 ? 54.825 41.679  58.500 1.00 44.68  ? 270 SER Y C   1 
ATOM   3302 O O   . SER B 2 273 ? 53.955 41.848  59.362 1.00 45.63  ? 270 SER Y O   1 
ATOM   3303 C CB  . SER B 2 273 ? 54.828 39.865  56.780 1.00 42.12  ? 270 SER Y CB  1 
ATOM   3304 O OG  . SER B 2 273 ? 55.254 38.551  56.455 1.00 54.08  ? 270 SER Y OG  1 
ATOM   3305 N N   . THR B 2 274 ? 55.383 42.686  57.837 1.00 39.99  ? 271 THR Y N   1 
ATOM   3306 C CA  . THR B 2 274 ? 54.978 44.065  58.083 1.00 29.53  ? 271 THR Y CA  1 
ATOM   3307 C C   . THR B 2 274 ? 54.086 44.597  56.968 1.00 26.55  ? 271 THR Y C   1 
ATOM   3308 O O   . THR B 2 274 ? 54.319 44.334  55.785 1.00 21.77  ? 271 THR Y O   1 
ATOM   3309 C CB  . THR B 2 274 ? 56.193 45.005  58.252 1.00 27.86  ? 271 THR Y CB  1 
ATOM   3310 O OG1 . THR B 2 274 ? 57.104 44.819  57.162 1.00 45.61  ? 271 THR Y OG1 1 
ATOM   3311 C CG2 . THR B 2 274 ? 56.910 44.726  59.566 1.00 40.52  ? 271 THR Y CG2 1 
ATOM   3312 N N   . LEU B 2 275 ? 53.027 45.291  57.355 1.00 31.29  ? 272 LEU Y N   1 
ATOM   3313 C CA  . LEU B 2 275 ? 52.104 45.885  56.402 1.00 31.94  ? 272 LEU Y CA  1 
ATOM   3314 C C   . LEU B 2 275 ? 52.118 47.368  56.743 1.00 29.78  ? 272 LEU Y C   1 
ATOM   3315 O O   . LEU B 2 275 ? 51.856 47.745  57.888 1.00 24.83  ? 272 LEU Y O   1 
ATOM   3316 C CB  . LEU B 2 275 ? 50.693 45.313  56.581 1.00 31.34  ? 272 LEU Y CB  1 
ATOM   3317 C CG  . LEU B 2 275 ? 50.521 43.797  56.719 1.00 26.41  ? 272 LEU Y CG  1 
ATOM   3318 C CD1 . LEU B 2 275 ? 49.047 43.459  56.715 1.00 28.68  ? 272 LEU Y CD1 1 
ATOM   3319 C CD2 . LEU B 2 275 ? 51.220 43.070  55.595 1.00 28.80  ? 272 LEU Y CD2 1 
ATOM   3320 N N   . ILE B 2 276 ? 52.489 48.197  55.774 1.00 32.02  ? 273 ILE Y N   1 
ATOM   3321 C CA  . ILE B 2 276 ? 52.559 49.633  55.990 1.00 26.41  ? 273 ILE Y CA  1 
ATOM   3322 C C   . ILE B 2 276 ? 51.497 50.397  55.221 1.00 26.12  ? 273 ILE Y C   1 
ATOM   3323 O O   . ILE B 2 276 ? 51.258 50.142  54.043 1.00 30.62  ? 273 ILE Y O   1 
ATOM   3324 C CB  . ILE B 2 276 ? 53.945 50.202  55.609 1.00 15.91  ? 273 ILE Y CB  1 
ATOM   3325 C CG1 . ILE B 2 276 ? 55.014 49.754  56.611 1.00 38.03  ? 273 ILE Y CG1 1 
ATOM   3326 C CG2 . ILE B 2 276 ? 53.901 51.715  55.582 1.00 24.09  ? 273 ILE Y CG2 1 
ATOM   3327 C CD1 . ILE B 2 276 ? 55.460 48.319  56.465 1.00 55.38  ? 273 ILE Y CD1 1 
ATOM   3328 N N   . THR B 2 277 ? 50.870 51.345  55.903 1.00 31.50  ? 274 THR Y N   1 
ATOM   3329 C CA  . THR B 2 277 ? 49.846 52.190  55.308 1.00 33.60  ? 274 THR Y CA  1 
ATOM   3330 C C   . THR B 2 277 ? 50.216 53.629  55.655 1.00 34.49  ? 274 THR Y C   1 
ATOM   3331 O O   . THR B 2 277 ? 50.113 54.046  56.813 1.00 32.24  ? 274 THR Y O   1 
ATOM   3332 C CB  . THR B 2 277 ? 48.465 51.865  55.885 1.00 34.64  ? 274 THR Y CB  1 
ATOM   3333 O OG1 . THR B 2 277 ? 48.249 50.451  55.825 1.00 53.76  ? 274 THR Y OG1 1 
ATOM   3334 C CG2 . THR B 2 277 ? 47.381 52.578  55.096 1.00 42.17  ? 274 THR Y CG2 1 
ATOM   3335 N N   . VAL B 2 278 ? 50.705 54.364  54.664 1.00 35.16  ? 275 VAL Y N   1 
ATOM   3336 C CA  . VAL B 2 278 ? 51.107 55.749  54.865 1.00 34.14  ? 275 VAL Y CA  1 
ATOM   3337 C C   . VAL B 2 278 ? 50.000 56.702  54.443 1.00 36.24  ? 275 VAL Y C   1 
ATOM   3338 O O   . VAL B 2 278 ? 49.420 56.550  53.367 1.00 40.15  ? 275 VAL Y O   1 
ATOM   3339 C CB  . VAL B 2 278 ? 52.381 56.086  54.054 1.00 33.78  ? 275 VAL Y CB  1 
ATOM   3340 C CG1 . VAL B 2 278 ? 52.800 57.527  54.290 1.00 39.85  ? 275 VAL Y CG1 1 
ATOM   3341 C CG2 . VAL B 2 278 ? 53.508 55.151  54.438 1.00 48.00  ? 275 VAL Y CG2 1 
ATOM   3342 N N   . LEU B 2 279 ? 49.676 57.650  55.315 1.00 39.44  ? 276 LEU Y N   1 
ATOM   3343 C CA  . LEU B 2 279 ? 48.667 58.657  55.019 1.00 36.99  ? 276 LEU Y CA  1 
ATOM   3344 C C   . LEU B 2 279 ? 49.427 59.938  54.720 1.00 44.56  ? 276 LEU Y C   1 
ATOM   3345 O O   . LEU B 2 279 ? 50.140 60.459  55.581 1.00 46.64  ? 276 LEU Y O   1 
ATOM   3346 C CB  . LEU B 2 279 ? 47.735 58.868  56.211 1.00 25.22  ? 276 LEU Y CB  1 
ATOM   3347 C CG  . LEU B 2 279 ? 46.644 59.924  56.025 1.00 22.65  ? 276 LEU Y CG  1 
ATOM   3348 C CD1 . LEU B 2 279 ? 45.861 59.656  54.754 1.00 33.46  ? 276 LEU Y CD1 1 
ATOM   3349 C CD2 . LEU B 2 279 ? 45.716 59.922  57.220 1.00 26.87  ? 276 LEU Y CD2 1 
ATOM   3350 N N   . ASN B 2 280 ? 49.318 60.411  53.483 1.00 49.38  ? 277 ASN Y N   1 
ATOM   3351 C CA  . ASN B 2 280 ? 50.004 61.627  53.062 1.00 46.50  ? 277 ASN Y CA  1 
ATOM   3352 C C   . ASN B 2 280 ? 49.047 62.799  53.139 1.00 43.81  ? 277 ASN Y C   1 
ATOM   3353 O O   . ASN B 2 280 ? 48.070 62.860  52.389 1.00 47.90  ? 277 ASN Y O   1 
ATOM   3354 C CB  . ASN B 2 280 ? 50.513 61.489  51.626 1.00 46.08  ? 277 ASN Y CB  1 
ATOM   3355 C CG  . ASN B 2 280 ? 51.344 60.244  51.419 1.00 59.58  ? 277 ASN Y CG  1 
ATOM   3356 O OD1 . ASN B 2 280 ? 52.550 60.238  51.661 1.00 61.04  ? 277 ASN Y OD1 1 
ATOM   3357 N ND2 . ASN B 2 280 ? 50.699 59.172  50.978 1.00 67.61  ? 277 ASN Y ND2 1 
ATOM   3358 N N   . ILE B 2 281 ? 49.301 63.702  54.077 1.00 42.55  ? 278 ILE Y N   1 
ATOM   3359 C CA  . ILE B 2 281 ? 48.467 64.884  54.237 1.00 43.86  ? 278 ILE Y CA  1 
ATOM   3360 C C   . ILE B 2 281 ? 49.159 66.016  53.484 1.00 36.31  ? 278 ILE Y C   1 
ATOM   3361 O O   . ILE B 2 281 ? 50.165 66.561  53.948 1.00 25.68  ? 278 ILE Y O   1 
ATOM   3362 C CB  . ILE B 2 281 ? 48.294 65.269  55.727 1.00 50.98  ? 278 ILE Y CB  1 
ATOM   3363 C CG1 . ILE B 2 281 ? 47.750 64.075  56.523 1.00 37.59  ? 278 ILE Y CG1 1 
ATOM   3364 C CG2 . ILE B 2 281 ? 47.359 66.466  55.850 1.00 43.33  ? 278 ILE Y CG2 1 
ATOM   3365 C CD1 . ILE B 2 281 ? 47.579 64.337  58.004 1.00 42.78  ? 278 ILE Y CD1 1 
ATOM   3366 N N   . SER B 2 282 ? 48.635 66.332  52.304 1.00 36.35  ? 279 SER Y N   1 
ATOM   3367 C CA  . SER B 2 282 ? 49.183 67.379  51.450 1.00 39.84  ? 279 SER Y CA  1 
ATOM   3368 C C   . SER B 2 282 ? 49.384 68.691  52.201 1.00 41.28  ? 279 SER Y C   1 
ATOM   3369 O O   . SER B 2 282 ? 50.415 69.348  52.043 1.00 36.25  ? 279 SER Y O   1 
ATOM   3370 C CB  . SER B 2 282 ? 48.265 67.598  50.247 1.00 46.09  ? 279 SER Y CB  1 
ATOM   3371 O OG  . SER B 2 282 ? 47.977 66.366  49.608 1.00 72.86  ? 279 SER Y OG  1 
ATOM   3372 N N   . GLU B 2 283 ? 48.407 69.053  53.029 1.00 43.08  ? 280 GLU Y N   1 
ATOM   3373 C CA  . GLU B 2 283 ? 48.474 70.282  53.810 1.00 42.70  ? 280 GLU Y CA  1 
ATOM   3374 C C   . GLU B 2 283 ? 47.559 70.213  55.027 1.00 35.58  ? 280 GLU Y C   1 
ATOM   3375 O O   . GLU B 2 283 ? 46.394 69.814  54.926 1.00 30.77  ? 280 GLU Y O   1 
ATOM   3376 C CB  . GLU B 2 283 ? 48.113 71.491  52.941 1.00 71.26  ? 280 GLU Y CB  1 
ATOM   3377 C CG  . GLU B 2 283 ? 48.356 72.839  53.613 1.00 92.07  ? 280 GLU Y CG  1 
ATOM   3378 C CD  . GLU B 2 283 ? 48.396 73.992  52.628 1.00 94.08  ? 280 GLU Y CD  1 
ATOM   3379 O OE1 . GLU B 2 283 ? 47.316 74.413  52.161 1.00 94.41  ? 280 GLU Y OE1 1 
ATOM   3380 O OE2 . GLU B 2 283 ? 49.512 74.474  52.325 1.00 89.73  ? 280 GLU Y OE2 1 
ATOM   3381 N N   . ILE B 2 284 ? 48.101 70.604  56.174 1.00 31.21  ? 281 ILE Y N   1 
ATOM   3382 C CA  . ILE B 2 284 ? 47.371 70.591  57.435 1.00 30.29  ? 281 ILE Y CA  1 
ATOM   3383 C C   . ILE B 2 284 ? 46.279 71.657  57.483 1.00 28.99  ? 281 ILE Y C   1 
ATOM   3384 O O   . ILE B 2 284 ? 46.557 72.853  57.396 1.00 37.17  ? 281 ILE Y O   1 
ATOM   3385 C CB  . ILE B 2 284 ? 48.331 70.786  58.635 1.00 31.17  ? 281 ILE Y CB  1 
ATOM   3386 C CG1 . ILE B 2 284 ? 49.364 69.658  58.680 1.00 31.21  ? 281 ILE Y CG1 1 
ATOM   3387 C CG2 . ILE B 2 284 ? 47.558 70.800  59.934 1.00 43.45  ? 281 ILE Y CG2 1 
ATOM   3388 C CD1 . ILE B 2 284 ? 48.761 68.279  58.838 1.00 37.52  ? 281 ILE Y CD1 1 
ATOM   3389 N N   . GLU B 2 285 ? 45.039 71.209  57.620 1.00 26.85  ? 282 GLU Y N   1 
ATOM   3390 C CA  . GLU B 2 285 ? 43.889 72.099  57.697 1.00 32.51  ? 282 GLU Y CA  1 
ATOM   3391 C C   . GLU B 2 285 ? 43.385 72.118  59.141 1.00 38.63  ? 282 GLU Y C   1 
ATOM   3392 O O   . GLU B 2 285 ? 43.651 71.188  59.903 1.00 45.75  ? 282 GLU Y O   1 
ATOM   3393 C CB  . GLU B 2 285 ? 42.787 71.604  56.759 1.00 37.64  ? 282 GLU Y CB  1 
ATOM   3394 C CG  . GLU B 2 285 ? 43.262 71.355  55.329 1.00 56.21  ? 282 GLU Y CG  1 
ATOM   3395 C CD  . GLU B 2 285 ? 42.173 70.798  54.424 1.00 76.05  ? 282 GLU Y CD  1 
ATOM   3396 O OE1 . GLU B 2 285 ? 41.446 69.872  54.845 1.00 87.55  ? 282 GLU Y OE1 1 
ATOM   3397 O OE2 . GLU B 2 285 ? 42.047 71.285  53.282 1.00 83.05  ? 282 GLU Y OE2 1 
ATOM   3398 N N   . SER B 2 286 ? 42.638 73.158  59.507 1.00 43.31  ? 283 SER Y N   1 
ATOM   3399 C CA  . SER B 2 286 ? 42.101 73.302  60.863 1.00 41.19  ? 283 SER Y CA  1 
ATOM   3400 C C   . SER B 2 286 ? 41.329 72.086  61.381 1.00 34.79  ? 283 SER Y C   1 
ATOM   3401 O O   . SER B 2 286 ? 41.498 71.678  62.531 1.00 38.03  ? 283 SER Y O   1 
ATOM   3402 C CB  . SER B 2 286 ? 41.215 74.548  60.944 1.00 49.09  ? 283 SER Y CB  1 
ATOM   3403 O OG  . SER B 2 286 ? 41.992 75.729  60.840 1.00 76.04  ? 283 SER Y OG  1 
ATOM   3404 N N   . ARG B 2 287 ? 40.505 71.501  60.520 1.00 38.05  ? 284 ARG Y N   1 
ATOM   3405 C CA  . ARG B 2 287 ? 39.691 70.336  60.863 1.00 39.08  ? 284 ARG Y CA  1 
ATOM   3406 C C   . ARG B 2 287 ? 40.482 69.143  61.401 1.00 39.80  ? 284 ARG Y C   1 
ATOM   3407 O O   . ARG B 2 287 ? 40.002 68.417  62.272 1.00 42.27  ? 284 ARG Y O   1 
ATOM   3408 C CB  . ARG B 2 287 ? 38.879 69.904  59.639 1.00 37.22  ? 284 ARG Y CB  1 
ATOM   3409 C CG  . ARG B 2 287 ? 39.729 69.558  58.423 1.00 46.18  ? 284 ARG Y CG  1 
ATOM   3410 C CD  . ARG B 2 287 ? 39.002 69.853  57.122 1.00 54.97  ? 284 ARG Y CD  1 
ATOM   3411 N NE  . ARG B 2 287 ? 37.713 69.175  57.032 1.00 84.31  ? 284 ARG Y NE  1 
ATOM   3412 C CZ  . ARG B 2 287 ? 36.768 69.480  56.148 1.00 96.02  ? 284 ARG Y CZ  1 
ATOM   3413 N NH1 . ARG B 2 287 ? 36.962 70.454  55.270 1.00 98.55  ? 284 ARG Y NH1 1 
ATOM   3414 N NH2 . ARG B 2 287 ? 35.623 68.813  56.143 1.00 106.94 ? 284 ARG Y NH2 1 
ATOM   3415 N N   . PHE B 2 288 ? 41.707 68.974  60.912 1.00 38.47  ? 285 PHE Y N   1 
ATOM   3416 C CA  . PHE B 2 288 ? 42.564 67.860  61.314 1.00 34.19  ? 285 PHE Y CA  1 
ATOM   3417 C C   . PHE B 2 288 ? 42.944 67.800  62.792 1.00 37.55  ? 285 PHE Y C   1 
ATOM   3418 O O   . PHE B 2 288 ? 43.258 66.728  63.311 1.00 43.50  ? 285 PHE Y O   1 
ATOM   3419 C CB  . PHE B 2 288 ? 43.812 67.808  60.427 1.00 14.86  ? 285 PHE Y CB  1 
ATOM   3420 C CG  . PHE B 2 288 ? 43.507 67.535  58.979 1.00 9.17   ? 285 PHE Y CG  1 
ATOM   3421 C CD1 . PHE B 2 288 ? 42.303 66.934  58.610 1.00 13.01  ? 285 PHE Y CD1 1 
ATOM   3422 C CD2 . PHE B 2 288 ? 44.405 67.897  57.984 1.00 24.03  ? 285 PHE Y CD2 1 
ATOM   3423 C CE1 . PHE B 2 288 ? 41.998 66.700  57.272 1.00 9.33   ? 285 PHE Y CE1 1 
ATOM   3424 C CE2 . PHE B 2 288 ? 44.111 67.668  56.638 1.00 25.74  ? 285 PHE Y CE2 1 
ATOM   3425 C CZ  . PHE B 2 288 ? 42.905 67.069  56.283 1.00 22.28  ? 285 PHE Y CZ  1 
ATOM   3426 N N   . TYR B 2 289 ? 42.901 68.941  63.472 1.00 39.23  ? 286 TYR Y N   1 
ATOM   3427 C CA  . TYR B 2 289 ? 43.228 68.988  64.894 1.00 35.25  ? 286 TYR Y CA  1 
ATOM   3428 C C   . TYR B 2 289 ? 42.002 68.631  65.731 1.00 36.99  ? 286 TYR Y C   1 
ATOM   3429 O O   . TYR B 2 289 ? 42.114 68.377  66.928 1.00 41.97  ? 286 TYR Y O   1 
ATOM   3430 C CB  . TYR B 2 289 ? 43.719 70.381  65.293 1.00 25.99  ? 286 TYR Y CB  1 
ATOM   3431 C CG  . TYR B 2 289 ? 44.987 70.824  64.603 1.00 19.40  ? 286 TYR Y CG  1 
ATOM   3432 C CD1 . TYR B 2 289 ? 44.947 71.411  63.341 1.00 25.25  ? 286 TYR Y CD1 1 
ATOM   3433 C CD2 . TYR B 2 289 ? 46.226 70.674  65.221 1.00 16.01  ? 286 TYR Y CD2 1 
ATOM   3434 C CE1 . TYR B 2 289 ? 46.107 71.840  62.712 1.00 19.98  ? 286 TYR Y CE1 1 
ATOM   3435 C CE2 . TYR B 2 289 ? 47.397 71.099  64.599 1.00 19.39  ? 286 TYR Y CE2 1 
ATOM   3436 C CZ  . TYR B 2 289 ? 47.329 71.681  63.346 1.00 29.88  ? 286 TYR Y CZ  1 
ATOM   3437 O OH  . TYR B 2 289 ? 48.477 72.114  62.727 1.00 33.62  ? 286 TYR Y OH  1 
ATOM   3438 N N   . LYS B 2 290 ? 40.837 68.605  65.089 1.00 34.56  ? 287 LYS Y N   1 
ATOM   3439 C CA  . LYS B 2 290 ? 39.579 68.305  65.765 1.00 35.31  ? 287 LYS Y CA  1 
ATOM   3440 C C   . LYS B 2 290 ? 39.336 66.841  66.109 1.00 34.92  ? 287 LYS Y C   1 
ATOM   3441 O O   . LYS B 2 290 ? 38.516 66.538  66.976 1.00 41.59  ? 287 LYS Y O   1 
ATOM   3442 C CB  . LYS B 2 290 ? 38.398 68.823  64.944 1.00 40.75  ? 287 LYS Y CB  1 
ATOM   3443 C CG  . LYS B 2 290 ? 38.292 70.334  64.885 1.00 52.29  ? 287 LYS Y CG  1 
ATOM   3444 C CD  . LYS B 2 290 ? 36.952 70.750  64.304 1.00 60.58  ? 287 LYS Y CD  1 
ATOM   3445 C CE  . LYS B 2 290 ? 36.759 72.255  64.367 1.00 68.81  ? 287 LYS Y CE  1 
ATOM   3446 N NZ  . LYS B 2 290 ? 35.386 72.644  63.932 1.00 89.50  ? 287 LYS Y NZ  1 
ATOM   3447 N N   . HIS B 2 291 ? 39.983 65.932  65.390 1.00 34.85  ? 288 HIS Y N   1 
ATOM   3448 C CA  . HIS B 2 291 ? 39.807 64.502  65.634 1.00 34.37  ? 288 HIS Y CA  1 
ATOM   3449 C C   . HIS B 2 291 ? 41.085 63.751  65.278 1.00 40.94  ? 288 HIS Y C   1 
ATOM   3450 O O   . HIS B 2 291 ? 41.818 64.158  64.373 1.00 47.13  ? 288 HIS Y O   1 
ATOM   3451 C CB  . HIS B 2 291 ? 38.630 63.962  64.811 1.00 33.10  ? 288 HIS Y CB  1 
ATOM   3452 C CG  . HIS B 2 291 ? 37.316 64.605  65.136 1.00 42.53  ? 288 HIS Y CG  1 
ATOM   3453 N ND1 . HIS B 2 291 ? 36.775 65.620  64.375 1.00 48.08  ? 288 HIS Y ND1 1 
ATOM   3454 C CD2 . HIS B 2 291 ? 36.444 64.395  66.153 1.00 51.71  ? 288 HIS Y CD2 1 
ATOM   3455 C CE1 . HIS B 2 291 ? 35.629 66.008  64.908 1.00 49.42  ? 288 HIS Y CE1 1 
ATOM   3456 N NE2 . HIS B 2 291 ? 35.408 65.281  65.989 1.00 54.12  ? 288 HIS Y NE2 1 
ATOM   3457 N N   . PRO B 2 292 ? 41.375 62.652  65.996 1.00 40.75  ? 289 PRO Y N   1 
ATOM   3458 C CA  . PRO B 2 292 ? 42.575 61.845  65.753 1.00 39.80  ? 289 PRO Y CA  1 
ATOM   3459 C C   . PRO B 2 292 ? 42.469 60.921  64.545 1.00 39.09  ? 289 PRO Y C   1 
ATOM   3460 O O   . PRO B 2 292 ? 41.371 60.525  64.142 1.00 40.39  ? 289 PRO Y O   1 
ATOM   3461 C CB  . PRO B 2 292 ? 42.694 61.039  67.043 1.00 37.02  ? 289 PRO Y CB  1 
ATOM   3462 C CG  . PRO B 2 292 ? 41.263 60.773  67.378 1.00 34.31  ? 289 PRO Y CG  1 
ATOM   3463 C CD  . PRO B 2 292 ? 40.627 62.132  67.156 1.00 44.71  ? 289 PRO Y CD  1 
ATOM   3464 N N   . PHE B 2 293 ? 43.621 60.602  63.963 1.00 39.66  ? 290 PHE Y N   1 
ATOM   3465 C CA  . PHE B 2 293 ? 43.690 59.699  62.822 1.00 39.80  ? 290 PHE Y CA  1 
ATOM   3466 C C   . PHE B 2 293 ? 43.870 58.298  63.393 1.00 39.47  ? 290 PHE Y C   1 
ATOM   3467 O O   . PHE B 2 293 ? 44.825 58.040  64.128 1.00 32.54  ? 290 PHE Y O   1 
ATOM   3468 C CB  . PHE B 2 293 ? 44.868 60.059  61.916 1.00 36.34  ? 290 PHE Y CB  1 
ATOM   3469 C CG  . PHE B 2 293 ? 44.629 61.270  61.065 1.00 39.85  ? 290 PHE Y CG  1 
ATOM   3470 C CD1 . PHE B 2 293 ? 43.949 61.155  59.857 1.00 37.13  ? 290 PHE Y CD1 1 
ATOM   3471 C CD2 . PHE B 2 293 ? 45.077 62.524  61.466 1.00 42.66  ? 290 PHE Y CD2 1 
ATOM   3472 C CE1 . PHE B 2 293 ? 43.718 62.274  59.060 1.00 32.71  ? 290 PHE Y CE1 1 
ATOM   3473 C CE2 . PHE B 2 293 ? 44.853 63.648  60.679 1.00 30.49  ? 290 PHE Y CE2 1 
ATOM   3474 C CZ  . PHE B 2 293 ? 44.172 63.524  59.475 1.00 28.52  ? 290 PHE Y CZ  1 
ATOM   3475 N N   . THR B 2 294 ? 42.936 57.410  63.078 1.00 39.08  ? 291 THR Y N   1 
ATOM   3476 C CA  . THR B 2 294 ? 42.973 56.046  63.581 1.00 37.52  ? 291 THR Y CA  1 
ATOM   3477 C C   . THR B 2 294 ? 43.365 55.036  62.503 1.00 37.01  ? 291 THR Y C   1 
ATOM   3478 O O   . THR B 2 294 ? 42.907 55.118  61.362 1.00 43.60  ? 291 THR Y O   1 
ATOM   3479 C CB  . THR B 2 294 ? 41.594 55.642  64.153 1.00 30.64  ? 291 THR Y CB  1 
ATOM   3480 O OG1 . THR B 2 294 ? 41.009 56.759  64.836 1.00 42.66  ? 291 THR Y OG1 1 
ATOM   3481 C CG2 . THR B 2 294 ? 41.738 54.491  65.138 1.00 35.24  ? 291 THR Y CG2 1 
ATOM   3482 N N   . CYS B 2 295 ? 44.242 54.108  62.861 1.00 35.68  ? 292 CYS Y N   1 
ATOM   3483 C CA  . CYS B 2 295 ? 44.668 53.062  61.946 1.00 30.91  ? 292 CYS Y CA  1 
ATOM   3484 C C   . CYS B 2 295 ? 44.025 51.767  62.421 1.00 33.00  ? 292 CYS Y C   1 
ATOM   3485 O O   . CYS B 2 295 ? 44.092 51.437  63.608 1.00 37.01  ? 292 CYS Y O   1 
ATOM   3486 C CB  . CYS B 2 295 ? 46.188 52.910  61.946 1.00 27.80  ? 292 CYS Y CB  1 
ATOM   3487 S SG  . CYS B 2 295 ? 46.763 51.597  60.822 1.00 24.42  ? 292 CYS Y SG  1 
ATOM   3488 N N   . PHE B 2 296 ? 43.350 51.077  61.510 1.00 33.24  ? 293 PHE Y N   1 
ATOM   3489 C CA  . PHE B 2 296 ? 42.695 49.815  61.815 1.00 28.32  ? 293 PHE Y CA  1 
ATOM   3490 C C   . PHE B 2 296 ? 43.349 48.666  61.064 1.00 30.47  ? 293 PHE Y C   1 
ATOM   3491 O O   . PHE B 2 296 ? 43.712 48.799  59.893 1.00 33.80  ? 293 PHE Y O   1 
ATOM   3492 C CB  . PHE B 2 296 ? 41.213 49.870  61.445 1.00 29.47  ? 293 PHE Y CB  1 
ATOM   3493 C CG  . PHE B 2 296 ? 40.360 50.550  62.468 1.00 46.57  ? 293 PHE Y CG  1 
ATOM   3494 C CD1 . PHE B 2 296 ? 39.792 49.822  63.509 1.00 47.89  ? 293 PHE Y CD1 1 
ATOM   3495 C CD2 . PHE B 2 296 ? 40.119 51.918  62.394 1.00 47.25  ? 293 PHE Y CD2 1 
ATOM   3496 C CE1 . PHE B 2 296 ? 38.995 50.449  64.463 1.00 51.27  ? 293 PHE Y CE1 1 
ATOM   3497 C CE2 . PHE B 2 296 ? 39.324 52.554  63.341 1.00 39.25  ? 293 PHE Y CE2 1 
ATOM   3498 C CZ  . PHE B 2 296 ? 38.761 51.820  64.377 1.00 46.95  ? 293 PHE Y CZ  1 
ATOM   3499 N N   . ALA B 2 297 ? 43.514 47.548  61.758 1.00 31.62  ? 294 ALA Y N   1 
ATOM   3500 C CA  . ALA B 2 297 ? 44.094 46.340  61.188 1.00 25.59  ? 294 ALA Y CA  1 
ATOM   3501 C C   . ALA B 2 297 ? 43.139 45.232  61.598 1.00 33.63  ? 294 ALA Y C   1 
ATOM   3502 O O   . ALA B 2 297 ? 42.690 45.206  62.747 1.00 39.93  ? 294 ALA Y O   1 
ATOM   3503 C CB  . ALA B 2 297 ? 45.478 46.093  61.760 1.00 5.48   ? 294 ALA Y CB  1 
ATOM   3504 N N   . LYS B 2 298 ? 42.790 44.346  60.670 1.00 38.39  ? 295 LYS Y N   1 
ATOM   3505 C CA  . LYS B 2 298 ? 41.857 43.271  60.992 1.00 37.31  ? 295 LYS Y CA  1 
ATOM   3506 C C   . LYS B 2 298 ? 41.922 42.050  60.085 1.00 34.81  ? 295 LYS Y C   1 
ATOM   3507 O O   . LYS B 2 298 ? 42.604 42.051  59.056 1.00 33.45  ? 295 LYS Y O   1 
ATOM   3508 C CB  . LYS B 2 298 ? 40.422 43.808  60.997 1.00 36.43  ? 295 LYS Y CB  1 
ATOM   3509 C CG  . LYS B 2 298 ? 39.933 44.323  59.653 1.00 51.11  ? 295 LYS Y CG  1 
ATOM   3510 C CD  . LYS B 2 298 ? 38.534 44.910  59.760 1.00 65.40  ? 295 LYS Y CD  1 
ATOM   3511 C CE  . LYS B 2 298 ? 38.028 45.402  58.410 1.00 66.41  ? 295 LYS Y CE  1 
ATOM   3512 N NZ  . LYS B 2 298 ? 36.689 46.047  58.527 1.00 65.24  ? 295 LYS Y NZ  1 
ATOM   3513 N N   . ASN B 2 299 ? 41.222 41.004  60.515 1.00 38.13  ? 296 ASN Y N   1 
ATOM   3514 C CA  . ASN B 2 299 ? 41.105 39.739  59.794 1.00 40.74  ? 296 ASN Y CA  1 
ATOM   3515 C C   . ASN B 2 299 ? 39.956 38.956  60.429 1.00 40.32  ? 296 ASN Y C   1 
ATOM   3516 O O   . ASN B 2 299 ? 39.183 39.517  61.209 1.00 40.33  ? 296 ASN Y O   1 
ATOM   3517 C CB  . ASN B 2 299 ? 42.424 38.932  59.784 1.00 36.38  ? 296 ASN Y CB  1 
ATOM   3518 C CG  . ASN B 2 299 ? 42.884 38.489  61.172 1.00 37.71  ? 296 ASN Y CG  1 
ATOM   3519 O OD1 . ASN B 2 299 ? 42.087 38.334  62.098 1.00 39.28  ? 296 ASN Y OD1 1 
ATOM   3520 N ND2 . ASN B 2 299 ? 44.184 38.249  61.306 1.00 28.52  ? 296 ASN Y ND2 1 
ATOM   3521 N N   . THR B 2 300 ? 39.843 37.673  60.105 1.00 39.82  ? 297 THR Y N   1 
ATOM   3522 C CA  . THR B 2 300 ? 38.772 36.832  60.635 1.00 40.52  ? 297 THR Y CA  1 
ATOM   3523 C C   . THR B 2 300 ? 38.735 36.763  62.168 1.00 36.76  ? 297 THR Y C   1 
ATOM   3524 O O   . THR B 2 300 ? 37.662 36.671  62.768 1.00 35.01  ? 297 THR Y O   1 
ATOM   3525 C CB  . THR B 2 300 ? 38.894 35.394  60.085 1.00 43.98  ? 297 THR Y CB  1 
ATOM   3526 O OG1 . THR B 2 300 ? 39.070 35.438  58.661 1.00 45.32  ? 297 THR Y OG1 1 
ATOM   3527 C CG2 . THR B 2 300 ? 37.647 34.584  60.414 1.00 52.10  ? 297 THR Y CG2 1 
ATOM   3528 N N   . HIS B 2 301 ? 39.907 36.824  62.790 1.00 34.45  ? 298 HIS Y N   1 
ATOM   3529 C CA  . HIS B 2 301 ? 40.022 36.726  64.237 1.00 39.42  ? 298 HIS Y CA  1 
ATOM   3530 C C   . HIS B 2 301 ? 39.565 37.956  65.012 1.00 50.54  ? 298 HIS Y C   1 
ATOM   3531 O O   . HIS B 2 301 ? 38.642 37.866  65.823 1.00 60.94  ? 298 HIS Y O   1 
ATOM   3532 C CB  . HIS B 2 301 ? 41.451 36.344  64.614 1.00 32.87  ? 298 HIS Y CB  1 
ATOM   3533 C CG  . HIS B 2 301 ? 41.955 35.140  63.880 1.00 57.76  ? 298 HIS Y CG  1 
ATOM   3534 N ND1 . HIS B 2 301 ? 43.180 35.106  63.249 1.00 69.50  ? 298 HIS Y ND1 1 
ATOM   3535 C CD2 . HIS B 2 301 ? 41.376 33.939  63.639 1.00 56.93  ? 298 HIS Y CD2 1 
ATOM   3536 C CE1 . HIS B 2 301 ? 43.334 33.940  62.649 1.00 67.91  ? 298 HIS Y CE1 1 
ATOM   3537 N NE2 . HIS B 2 301 ? 42.252 33.215  62.868 1.00 58.43  ? 298 HIS Y NE2 1 
ATOM   3538 N N   . GLY B 2 302 ? 40.195 39.099  64.758 1.00 50.47  ? 299 GLY Y N   1 
ATOM   3539 C CA  . GLY B 2 302 ? 39.820 40.315  65.460 1.00 46.57  ? 299 GLY Y CA  1 
ATOM   3540 C C   . GLY B 2 302 ? 40.421 41.560  64.842 1.00 45.05  ? 299 GLY Y C   1 
ATOM   3541 O O   . GLY B 2 302 ? 41.179 41.476  63.874 1.00 46.23  ? 299 GLY Y O   1 
ATOM   3542 N N   . ILE B 2 303 ? 40.080 42.717  65.398 1.00 45.73  ? 300 ILE Y N   1 
ATOM   3543 C CA  . ILE B 2 303 ? 40.592 43.988  64.896 1.00 49.56  ? 300 ILE Y CA  1 
ATOM   3544 C C   . ILE B 2 303 ? 41.552 44.611  65.905 1.00 48.18  ? 300 ILE Y C   1 
ATOM   3545 O O   . ILE B 2 303 ? 41.609 44.186  67.060 1.00 53.48  ? 300 ILE Y O   1 
ATOM   3546 C CB  . ILE B 2 303 ? 39.445 44.995  64.604 1.00 49.08  ? 300 ILE Y CB  1 
ATOM   3547 C CG1 . ILE B 2 303 ? 38.771 45.439  65.905 1.00 57.49  ? 300 ILE Y CG1 1 
ATOM   3548 C CG2 . ILE B 2 303 ? 38.415 44.367  63.678 1.00 62.19  ? 300 ILE Y CG2 1 
ATOM   3549 C CD1 . ILE B 2 303 ? 37.671 46.462  65.709 1.00 74.30  ? 300 ILE Y CD1 1 
ATOM   3550 N N   . ASP B 2 304 ? 42.289 45.625  65.467 1.00 42.36  ? 301 ASP Y N   1 
ATOM   3551 C CA  . ASP B 2 304 ? 43.233 46.325  66.327 1.00 35.40  ? 301 ASP Y CA  1 
ATOM   3552 C C   . ASP B 2 304 ? 43.225 47.795  65.925 1.00 39.39  ? 301 ASP Y C   1 
ATOM   3553 O O   . ASP B 2 304 ? 43.167 48.114  64.736 1.00 44.94  ? 301 ASP Y O   1 
ATOM   3554 C CB  . ASP B 2 304 ? 44.635 45.735  66.170 1.00 13.26  ? 301 ASP Y CB  1 
ATOM   3555 C CG  . ASP B 2 304 ? 45.592 46.205  67.254 1.00 31.23  ? 301 ASP Y CG  1 
ATOM   3556 O OD1 . ASP B 2 304 ? 45.129 46.638  68.332 1.00 37.80  ? 301 ASP Y OD1 1 
ATOM   3557 O OD2 . ASP B 2 304 ? 46.816 46.133  67.032 1.00 32.94  ? 301 ASP Y OD2 1 
ATOM   3558 N N   . ALA B 2 305 ? 43.270 48.687  66.910 1.00 36.74  ? 302 ALA Y N   1 
ATOM   3559 C CA  . ALA B 2 305 ? 43.244 50.117  66.630 1.00 28.42  ? 302 ALA Y CA  1 
ATOM   3560 C C   . ALA B 2 305 ? 44.278 50.918  67.418 1.00 27.31  ? 302 ALA Y C   1 
ATOM   3561 O O   . ALA B 2 305 ? 44.609 50.588  68.560 1.00 31.22  ? 302 ALA Y O   1 
ATOM   3562 C CB  . ALA B 2 305 ? 41.852 50.668  66.882 1.00 23.19  ? 302 ALA Y CB  1 
ATOM   3563 N N   . ALA B 2 306 ? 44.785 51.968  66.784 1.00 22.13  ? 303 ALA Y N   1 
ATOM   3564 C CA  . ALA B 2 306 ? 45.777 52.861  67.372 1.00 19.40  ? 303 ALA Y CA  1 
ATOM   3565 C C   . ALA B 2 306 ? 45.602 54.185  66.643 1.00 25.30  ? 303 ALA Y C   1 
ATOM   3566 O O   . ALA B 2 306 ? 45.198 54.194  65.484 1.00 32.62  ? 303 ALA Y O   1 
ATOM   3567 C CB  . ALA B 2 306 ? 47.177 52.319  67.150 1.00 13.93  ? 303 ALA Y CB  1 
ATOM   3568 N N   . TYR B 2 307 ? 45.914 55.297  67.295 1.00 28.69  ? 304 TYR Y N   1 
ATOM   3569 C CA  . TYR B 2 307 ? 45.733 56.591  66.650 1.00 32.31  ? 304 TYR Y CA  1 
ATOM   3570 C C   . TYR B 2 307 ? 46.857 57.589  66.866 1.00 34.21  ? 304 TYR Y C   1 
ATOM   3571 O O   . TYR B 2 307 ? 47.830 57.314  67.577 1.00 33.85  ? 304 TYR Y O   1 
ATOM   3572 C CB  . TYR B 2 307 ? 44.419 57.222  67.123 1.00 34.01  ? 304 TYR Y CB  1 
ATOM   3573 C CG  . TYR B 2 307 ? 44.390 57.552  68.601 1.00 51.04  ? 304 TYR Y CG  1 
ATOM   3574 C CD1 . TYR B 2 307 ? 44.997 58.710  69.095 1.00 53.66  ? 304 TYR Y CD1 1 
ATOM   3575 C CD2 . TYR B 2 307 ? 43.773 56.696  69.511 1.00 64.53  ? 304 TYR Y CD2 1 
ATOM   3576 C CE1 . TYR B 2 307 ? 44.993 59.005  70.454 1.00 48.97  ? 304 TYR Y CE1 1 
ATOM   3577 C CE2 . TYR B 2 307 ? 43.761 56.984  70.877 1.00 62.35  ? 304 TYR Y CE2 1 
ATOM   3578 C CZ  . TYR B 2 307 ? 44.374 58.138  71.339 1.00 55.66  ? 304 TYR Y CZ  1 
ATOM   3579 O OH  . TYR B 2 307 ? 44.375 58.418  72.684 1.00 69.87  ? 304 TYR Y OH  1 
ATOM   3580 N N   . ILE B 2 308 ? 46.694 58.749  66.233 1.00 38.50  ? 305 ILE Y N   1 
ATOM   3581 C CA  . ILE B 2 308 ? 47.610 59.882  66.329 1.00 37.49  ? 305 ILE Y CA  1 
ATOM   3582 C C   . ILE B 2 308 ? 46.728 61.123  66.434 1.00 40.75  ? 305 ILE Y C   1 
ATOM   3583 O O   . ILE B 2 308 ? 45.871 61.365  65.575 1.00 35.41  ? 305 ILE Y O   1 
ATOM   3584 C CB  . ILE B 2 308 ? 48.517 60.041  65.084 1.00 26.27  ? 305 ILE Y CB  1 
ATOM   3585 C CG1 . ILE B 2 308 ? 49.592 58.958  65.059 1.00 36.95  ? 305 ILE Y CG1 1 
ATOM   3586 C CG2 . ILE B 2 308 ? 49.191 61.406  65.097 1.00 29.71  ? 305 ILE Y CG2 1 
ATOM   3587 C CD1 . ILE B 2 308 ? 50.551 59.060  63.882 1.00 49.96  ? 305 ILE Y CD1 1 
ATOM   3588 N N   . GLN B 2 309 ? 46.900 61.872  67.515 1.00 44.15  ? 306 GLN Y N   1 
ATOM   3589 C CA  . GLN B 2 309 ? 46.135 63.087  67.730 1.00 42.69  ? 306 GLN Y CA  1 
ATOM   3590 C C   . GLN B 2 309 ? 47.040 64.285  67.454 1.00 42.63  ? 306 GLN Y C   1 
ATOM   3591 O O   . GLN B 2 309 ? 48.001 64.533  68.188 1.00 38.48  ? 306 GLN Y O   1 
ATOM   3592 C CB  . GLN B 2 309 ? 45.598 63.132  69.163 1.00 36.52  ? 306 GLN Y CB  1 
ATOM   3593 C CG  . GLN B 2 309 ? 44.831 64.399  69.506 1.00 45.95  ? 306 GLN Y CG  1 
ATOM   3594 C CD  . GLN B 2 309 ? 43.689 64.673  68.545 1.00 50.11  ? 306 GLN Y CD  1 
ATOM   3595 O OE1 . GLN B 2 309 ? 42.653 64.015  68.593 1.00 62.80  ? 306 GLN Y OE1 1 
ATOM   3596 N NE2 . GLN B 2 309 ? 43.875 65.649  67.668 1.00 54.54  ? 306 GLN Y NE2 1 
ATOM   3597 N N   . LEU B 2 310 ? 46.760 64.992  66.364 1.00 42.39  ? 307 LEU Y N   1 
ATOM   3598 C CA  . LEU B 2 310 ? 47.541 66.162  65.984 1.00 36.94  ? 307 LEU Y CA  1 
ATOM   3599 C C   . LEU B 2 310 ? 47.238 67.314  66.930 1.00 34.19  ? 307 LEU Y C   1 
ATOM   3600 O O   . LEU B 2 310 ? 46.089 67.504  67.340 1.00 33.14  ? 307 LEU Y O   1 
ATOM   3601 C CB  . LEU B 2 310 ? 47.218 66.580  64.549 1.00 32.94  ? 307 LEU Y CB  1 
ATOM   3602 C CG  . LEU B 2 310 ? 47.470 65.557  63.443 1.00 31.12  ? 307 LEU Y CG  1 
ATOM   3603 C CD1 . LEU B 2 310 ? 47.115 66.168  62.101 1.00 37.17  ? 307 LEU Y CD1 1 
ATOM   3604 C CD2 . LEU B 2 310 ? 48.923 65.118  63.460 1.00 41.34  ? 307 LEU Y CD2 1 
ATOM   3605 N N   . ILE B 2 311 ? 48.275 68.066  67.286 1.00 32.12  ? 308 ILE Y N   1 
ATOM   3606 C CA  . ILE B 2 311 ? 48.137 69.210  68.182 1.00 34.26  ? 308 ILE Y CA  1 
ATOM   3607 C C   . ILE B 2 311 ? 49.035 70.339  67.692 1.00 40.12  ? 308 ILE Y C   1 
ATOM   3608 O O   . ILE B 2 311 ? 50.024 70.102  66.994 1.00 44.33  ? 308 ILE Y O   1 
ATOM   3609 C CB  . ILE B 2 311 ? 48.558 68.870  69.631 1.00 28.37  ? 308 ILE Y CB  1 
ATOM   3610 C CG1 . ILE B 2 311 ? 50.016 68.401  69.662 1.00 32.15  ? 308 ILE Y CG1 1 
ATOM   3611 C CG2 . ILE B 2 311 ? 47.630 67.824  70.227 1.00 24.81  ? 308 ILE Y CG2 1 
ATOM   3612 C CD1 . ILE B 2 311 ? 50.597 68.281  71.048 1.00 28.03  ? 308 ILE Y CD1 1 
ATOM   3613 N N   . TYR B 2 312 ? 48.685 71.568  68.053 1.00 40.09  ? 309 TYR Y N   1 
ATOM   3614 C CA  . TYR B 2 312 ? 49.470 72.727  67.656 1.00 36.72  ? 309 TYR Y CA  1 
ATOM   3615 C C   . TYR B 2 312 ? 50.709 72.776  68.530 1.00 39.18  ? 309 TYR Y C   1 
ATOM   3616 O O   . TYR B 2 312 ? 50.661 72.405  69.703 1.00 42.09  ? 309 TYR Y O   1 
ATOM   3617 C CB  . TYR B 2 312 ? 48.671 74.017  67.859 1.00 39.45  ? 309 TYR Y CB  1 
ATOM   3618 C CG  . TYR B 2 312 ? 47.387 74.095  67.066 1.00 23.04  ? 309 TYR Y CG  1 
ATOM   3619 C CD1 . TYR B 2 312 ? 47.397 74.459  65.721 1.00 19.00  ? 309 TYR Y CD1 1 
ATOM   3620 C CD2 . TYR B 2 312 ? 46.163 73.800  67.661 1.00 14.22  ? 309 TYR Y CD2 1 
ATOM   3621 C CE1 . TYR B 2 312 ? 46.217 74.524  64.987 1.00 25.85  ? 309 TYR Y CE1 1 
ATOM   3622 C CE2 . TYR B 2 312 ? 44.979 73.861  66.937 1.00 20.96  ? 309 TYR Y CE2 1 
ATOM   3623 C CZ  . TYR B 2 312 ? 45.014 74.222  65.601 1.00 30.40  ? 309 TYR Y CZ  1 
ATOM   3624 O OH  . TYR B 2 312 ? 43.849 74.254  64.872 1.00 53.64  ? 309 TYR Y OH  1 
ATOM   3625 N N   . PRO B 2 313 ? 51.847 73.195  67.960 1.00 45.03  ? 310 PRO Y N   1 
ATOM   3626 C CA  . PRO B 2 313 ? 53.074 73.273  68.755 1.00 55.80  ? 310 PRO Y CA  1 
ATOM   3627 C C   . PRO B 2 313 ? 52.940 74.385  69.799 1.00 71.80  ? 310 PRO Y C   1 
ATOM   3628 O O   . PRO B 2 313 ? 52.321 75.422  69.537 1.00 71.82  ? 310 PRO Y O   1 
ATOM   3629 C CB  . PRO B 2 313 ? 54.136 73.598  67.706 1.00 48.40  ? 310 PRO Y CB  1 
ATOM   3630 C CG  . PRO B 2 313 ? 53.369 74.403  66.694 1.00 49.25  ? 310 PRO Y CG  1 
ATOM   3631 C CD  . PRO B 2 313 ? 52.090 73.616  66.569 1.00 42.44  ? 310 PRO Y CD  1 
ATOM   3632 N N   . VAL B 2 314 ? 53.486 74.155  70.988 1.00 83.23  ? 311 VAL Y N   1 
ATOM   3633 C CA  . VAL B 2 314 ? 53.413 75.142  72.058 1.00 90.29  ? 311 VAL Y CA  1 
ATOM   3634 C C   . VAL B 2 314 ? 54.634 76.057  72.043 1.00 94.50  ? 311 VAL Y C   1 
ATOM   3635 O O   . VAL B 2 314 ? 55.760 75.599  71.838 1.00 98.10  ? 311 VAL Y O   1 
ATOM   3636 C CB  . VAL B 2 314 ? 53.300 74.467  73.442 1.00 95.39  ? 311 VAL Y CB  1 
ATOM   3637 C CG1 . VAL B 2 314 ? 53.130 75.520  74.526 1.00 102.12 ? 311 VAL Y CG1 1 
ATOM   3638 C CG2 . VAL B 2 314 ? 52.132 73.490  73.458 1.00 96.16  ? 311 VAL Y CG2 1 
HETATM 3639 C C1  . NAG C 3 .   ? 51.853 4.487   55.857 1.00 38.11  ? 401 NAG Y C1  1 
HETATM 3640 C C2  . NAG C 3 .   ? 52.846 5.432   56.540 1.00 48.61  ? 401 NAG Y C2  1 
HETATM 3641 C C3  . NAG C 3 .   ? 53.681 6.177   55.495 1.00 54.01  ? 401 NAG Y C3  1 
HETATM 3642 C C4  . NAG C 3 .   ? 54.315 5.197   54.518 1.00 51.02  ? 401 NAG Y C4  1 
HETATM 3643 C C5  . NAG C 3 .   ? 53.224 4.331   53.901 1.00 57.34  ? 401 NAG Y C5  1 
HETATM 3644 C C6  . NAG C 3 .   ? 53.761 3.298   52.927 1.00 59.49  ? 401 NAG Y C6  1 
HETATM 3645 C C7  . NAG C 3 .   ? 52.565 6.759   58.543 1.00 52.37  ? 401 NAG Y C7  1 
HETATM 3646 C C8  . NAG C 3 .   ? 51.728 7.784   59.292 1.00 43.50  ? 401 NAG Y C8  1 
HETATM 3647 N N2  . NAG C 3 .   ? 52.115 6.395   57.346 1.00 51.45  ? 401 NAG Y N2  1 
HETATM 3648 O O3  . NAG C 3 .   ? 54.702 6.928   56.134 1.00 64.38  ? 401 NAG Y O3  1 
HETATM 3649 O O4  . NAG C 3 .   ? 55.005 5.915   53.505 1.00 49.91  ? 401 NAG Y O4  1 
HETATM 3650 O O5  . NAG C 3 .   ? 52.530 3.617   54.941 1.00 62.25  ? 401 NAG Y O5  1 
HETATM 3651 O O6  . NAG C 3 .   ? 52.899 2.170   52.850 1.00 70.81  ? 401 NAG Y O6  1 
HETATM 3652 O O7  . NAG C 3 .   ? 53.587 6.288   59.038 1.00 55.95  ? 401 NAG Y O7  1 
HETATM 3653 C C1  . NAG D 3 .   ? 44.224 53.137  71.671 1.00 45.77  ? 402 NAG Y C1  1 
HETATM 3654 C C2  . NAG D 3 .   ? 44.373 51.876  72.514 1.00 62.84  ? 402 NAG Y C2  1 
HETATM 3655 C C3  . NAG D 3 .   ? 43.390 50.825  72.011 1.00 75.53  ? 402 NAG Y C3  1 
HETATM 3656 C C4  . NAG D 3 .   ? 41.975 51.391  72.068 1.00 81.72  ? 402 NAG Y C4  1 
HETATM 3657 C C5  . NAG D 3 .   ? 41.905 52.706  71.276 1.00 75.17  ? 402 NAG Y C5  1 
HETATM 3658 C C6  . NAG D 3 .   ? 40.550 53.390  71.372 1.00 81.35  ? 402 NAG Y C6  1 
HETATM 3659 C C7  . NAG D 3 .   ? 46.420 51.087  73.531 1.00 67.81  ? 402 NAG Y C7  1 
HETATM 3660 C C8  . NAG D 3 .   ? 47.839 50.584  73.327 1.00 63.78  ? 402 NAG Y C8  1 
HETATM 3661 N N2  . NAG D 3 .   ? 45.735 51.380  72.428 1.00 68.55  ? 402 NAG Y N2  1 
HETATM 3662 O O3  . NAG D 3 .   ? 43.475 49.653  72.811 1.00 84.34  ? 402 NAG Y O3  1 
HETATM 3663 O O4  . NAG D 3 .   ? 41.065 50.443  71.529 1.00 86.92  ? 402 NAG Y O4  1 
HETATM 3664 O O5  . NAG D 3 .   ? 42.888 53.641  71.778 1.00 58.26  ? 402 NAG Y O5  1 
HETATM 3665 O O6  . NAG D 3 .   ? 40.560 54.650  70.716 1.00 83.20  ? 402 NAG Y O6  1 
HETATM 3666 O O7  . NAG D 3 .   ? 45.938 51.186  74.660 1.00 74.29  ? 402 NAG Y O7  1 
HETATM 3667 C C1  . NAG E 3 .   ? 58.067 48.964  61.112 1.00 110.55 ? 403 NAG Y C1  1 
HETATM 3668 C C2  . NAG E 3 .   ? 59.055 50.124  60.963 1.00 116.71 ? 403 NAG Y C2  1 
HETATM 3669 C C3  . NAG E 3 .   ? 60.475 49.587  61.035 1.00 140.01 ? 403 NAG Y C3  1 
HETATM 3670 C C4  . NAG E 3 .   ? 60.725 49.051  62.438 1.00 151.66 ? 403 NAG Y C4  1 
HETATM 3671 C C5  . NAG E 3 .   ? 59.515 48.249  62.936 1.00 148.39 ? 403 NAG Y C5  1 
HETATM 3672 C C6  . NAG E 3 .   ? 58.672 48.972  63.980 1.00 148.81 ? 403 NAG Y C6  1 
HETATM 3673 C C7  . NAG E 3 .   ? 57.892 51.715  59.580 1.00 90.31  ? 403 NAG Y C7  1 
HETATM 3674 C C8  . NAG E 3 .   ? 57.754 52.377  58.219 1.00 89.43  ? 403 NAG Y C8  1 
HETATM 3675 N N2  . NAG E 3 .   ? 58.847 50.802  59.701 1.00 100.14 ? 403 NAG Y N2  1 
HETATM 3676 O O3  . NAG E 3 .   ? 61.400 50.622  60.743 1.00 152.18 ? 403 NAG Y O3  1 
HETATM 3677 O O4  . NAG E 3 .   ? 61.885 48.227  62.428 1.00 161.36 ? 403 NAG Y O4  1 
HETATM 3678 O O5  . NAG E 3 .   ? 58.653 47.861  61.835 1.00 134.92 ? 403 NAG Y O5  1 
HETATM 3679 O O6  . NAG E 3 .   ? 59.408 49.193  65.174 1.00 148.17 ? 403 NAG Y O6  1 
HETATM 3680 O O7  . NAG E 3 .   ? 57.143 52.017  60.513 1.00 83.33  ? 403 NAG Y O7  1 
HETATM 3681 C C1  . NAG F 3 .   ? 32.705 63.955  61.114 1.00 82.47  ? 404 NAG Y C1  1 
HETATM 3682 C C2  . NAG F 3 .   ? 31.330 63.635  61.700 1.00 91.22  ? 404 NAG Y C2  1 
HETATM 3683 C C3  . NAG F 3 .   ? 30.427 64.853  61.541 1.00 96.87  ? 404 NAG Y C3  1 
HETATM 3684 C C4  . NAG F 3 .   ? 31.075 66.048  62.226 1.00 95.45  ? 404 NAG Y C4  1 
HETATM 3685 C C5  . NAG F 3 .   ? 32.466 66.288  61.632 1.00 87.33  ? 404 NAG Y C5  1 
HETATM 3686 C C6  . NAG F 3 .   ? 33.214 67.420  62.317 1.00 75.35  ? 404 NAG Y C6  1 
HETATM 3687 C C7  . NAG F 3 .   ? 29.937 61.661  61.655 1.00 103.50 ? 404 NAG Y C7  1 
HETATM 3688 C C8  . NAG F 3 .   ? 29.386 60.500  60.842 1.00 98.37  ? 404 NAG Y C8  1 
HETATM 3689 N N2  . NAG F 3 .   ? 30.753 62.494  61.013 1.00 104.66 ? 404 NAG Y N2  1 
HETATM 3690 O O3  . NAG F 3 .   ? 29.153 64.599  62.114 1.00 110.04 ? 404 NAG Y O3  1 
HETATM 3691 O O4  . NAG F 3 .   ? 30.259 67.194  62.045 1.00 96.07  ? 404 NAG Y O4  1 
HETATM 3692 O O5  . NAG F 3 .   ? 33.275 65.099  61.772 1.00 94.16  ? 404 NAG Y O5  1 
HETATM 3693 O O6  . NAG F 3 .   ? 34.607 67.358  62.041 1.00 62.01  ? 404 NAG Y O6  1 
HETATM 3694 O O7  . NAG F 3 .   ? 29.631 61.810  62.838 1.00 105.78 ? 404 NAG Y O7  1 
HETATM 3695 O O   . HOH G 4 .   ? 40.233 25.704  45.512 1.00 20.80  ? 153 HOH X O   1 
HETATM 3696 O O   . HOH G 4 .   ? 36.119 13.738  64.449 1.00 43.82  ? 154 HOH X O   1 
HETATM 3697 O O   . HOH G 4 .   ? 29.700 30.364  68.658 1.00 28.08  ? 155 HOH X O   1 
HETATM 3698 O O   . HOH G 4 .   ? 28.966 13.547  50.998 1.00 27.50  ? 156 HOH X O   1 
HETATM 3699 O O   . HOH G 4 .   ? 28.403 24.709  58.961 1.00 26.32  ? 157 HOH X O   1 
HETATM 3700 O O   . HOH G 4 .   ? 25.506 33.464  51.841 1.00 21.98  ? 158 HOH X O   1 
HETATM 3701 O O   . HOH G 4 .   ? 28.690 31.817  37.206 1.00 45.43  ? 159 HOH X O   1 
HETATM 3702 O O   . HOH G 4 .   ? 40.701 21.933  51.666 1.00 33.32  ? 160 HOH X O   1 
HETATM 3703 O O   . HOH G 4 .   ? 34.831 14.027  39.813 1.00 36.50  ? 161 HOH X O   1 
HETATM 3704 O O   . HOH G 4 .   ? 32.234 31.851  67.633 1.00 33.97  ? 162 HOH X O   1 
HETATM 3705 O O   . HOH G 4 .   ? 39.836 7.880   46.092 1.00 53.63  ? 163 HOH X O   1 
HETATM 3706 O O   . HOH G 4 .   ? 27.452 18.307  62.555 1.00 30.58  ? 164 HOH X O   1 
HETATM 3707 O O   . HOH G 4 .   ? 30.143 27.726  68.330 1.00 39.64  ? 165 HOH X O   1 
HETATM 3708 O O   . HOH G 4 .   ? 31.307 34.009  65.543 1.00 45.00  ? 166 HOH X O   1 
HETATM 3709 O O   . HOH G 4 .   ? 30.346 9.451   58.098 1.00 80.78  ? 167 HOH X O   1 
HETATM 3710 O O   . HOH G 4 .   ? 24.046 31.711  38.190 1.00 44.48  ? 168 HOH X O   1 
HETATM 3711 O O   . HOH G 4 .   ? 39.615 17.445  67.361 1.00 31.17  ? 169 HOH X O   1 
HETATM 3712 O O   . HOH G 4 .   ? 20.004 34.817  47.426 1.00 48.87  ? 170 HOH X O   1 
HETATM 3713 O O   . HOH G 4 .   ? 38.270 18.676  42.811 1.00 35.65  ? 171 HOH X O   1 
HETATM 3714 O O   . HOH G 4 .   ? 31.229 25.046  65.331 1.00 40.33  ? 172 HOH X O   1 
HETATM 3715 O O   . HOH G 4 .   ? 38.445 19.998  51.057 1.00 39.04  ? 173 HOH X O   1 
HETATM 3716 O O   . HOH G 4 .   ? 27.758 16.220  51.187 1.00 22.22  ? 174 HOH X O   1 
HETATM 3717 O O   . HOH G 4 .   ? 41.377 22.956  64.145 1.00 94.21  ? 175 HOH X O   1 
HETATM 3718 O O   . HOH G 4 .   ? 42.699 27.566  44.962 1.00 56.99  ? 176 HOH X O   1 
HETATM 3719 O O   . HOH G 4 .   ? 41.114 18.907  53.970 1.00 43.79  ? 177 HOH X O   1 
HETATM 3720 O O   . HOH G 4 .   ? 25.766 28.036  39.246 1.00 88.64  ? 178 HOH X O   1 
HETATM 3721 O O   . HOH G 4 .   ? 27.566 16.253  32.164 1.00 50.65  ? 179 HOH X O   1 
HETATM 3722 O O   . HOH G 4 .   ? 27.087 39.736  41.687 1.00 62.34  ? 180 HOH X O   1 
HETATM 3723 O O   . HOH G 4 .   ? 28.001 6.711   47.945 1.00 43.16  ? 181 HOH X O   1 
HETATM 3724 O O   . HOH G 4 .   ? 34.244 16.716  37.720 1.00 88.13  ? 182 HOH X O   1 
HETATM 3725 O O   . HOH G 4 .   ? 20.766 19.823  52.803 1.00 86.87  ? 183 HOH X O   1 
HETATM 3726 O O   . HOH G 4 .   ? 47.070 22.435  57.177 1.00 47.49  ? 184 HOH X O   1 
HETATM 3727 O O   . HOH H 4 .   ? 38.326 57.650  63.554 1.00 41.74  ? 405 HOH Y O   1 
HETATM 3728 O O   . HOH H 4 .   ? 41.478 75.220  57.234 1.00 23.04  ? 406 HOH Y O   1 
HETATM 3729 O O   . HOH H 4 .   ? 49.459 47.313  53.409 1.00 40.23  ? 407 HOH Y O   1 
HETATM 3730 O O   . HOH H 4 .   ? 58.197 41.275  50.429 1.00 38.47  ? 408 HOH Y O   1 
HETATM 3731 O O   . HOH H 4 .   ? 44.114 -3.515  53.823 1.00 35.41  ? 409 HOH Y O   1 
HETATM 3732 O O   . HOH H 4 .   ? 34.604 1.716   64.926 1.00 34.84  ? 410 HOH Y O   1 
HETATM 3733 O O   . HOH H 4 .   ? 33.781 0.283   48.134 1.00 81.89  ? 411 HOH Y O   1 
HETATM 3734 O O   . HOH H 4 .   ? 58.784 41.800  60.751 1.00 36.86  ? 412 HOH Y O   1 
HETATM 3735 O O   . HOH H 4 .   ? 34.327 5.389   41.409 1.00 51.04  ? 413 HOH Y O   1 
HETATM 3736 O O   . HOH H 4 .   ? 20.721 0.354   29.532 1.00 27.69  ? 414 HOH Y O   1 
HETATM 3737 O O   . HOH H 4 .   ? 39.788 11.732  53.404 1.00 52.38  ? 415 HOH Y O   1 
HETATM 3738 O O   . HOH H 4 .   ? 29.463 -10.098 35.115 1.00 53.88  ? 416 HOH Y O   1 
HETATM 3739 O O   . HOH H 4 .   ? 44.529 64.583  64.701 1.00 34.81  ? 417 HOH Y O   1 
HETATM 3740 O O   . HOH H 4 .   ? 55.652 34.328  66.816 1.00 37.72  ? 418 HOH Y O   1 
HETATM 3741 O O   . HOH H 4 .   ? 41.103 73.501  65.051 1.00 45.16  ? 419 HOH Y O   1 
HETATM 3742 O O   . HOH H 4 .   ? 52.804 77.970  59.305 1.00 46.08  ? 420 HOH Y O   1 
HETATM 3743 O O   . HOH H 4 .   ? 46.338 54.940  74.883 1.00 37.10  ? 421 HOH Y O   1 
HETATM 3744 O O   . HOH H 4 .   ? 31.641 4.083   56.483 1.00 44.34  ? 422 HOH Y O   1 
HETATM 3745 O O   . HOH H 4 .   ? 20.175 1.417   32.088 1.00 34.60  ? 423 HOH Y O   1 
HETATM 3746 O O   . HOH H 4 .   ? 33.633 62.470  58.416 1.00 46.84  ? 424 HOH Y O   1 
HETATM 3747 O O   . HOH H 4 .   ? 37.136 7.471   46.541 1.00 40.50  ? 425 HOH Y O   1 
HETATM 3748 O O   . HOH H 4 .   ? 41.627 9.789   77.895 1.00 43.14  ? 426 HOH Y O   1 
HETATM 3749 O O   . HOH H 4 .   ? 48.717 4.915   69.879 1.00 49.10  ? 427 HOH Y O   1 
HETATM 3750 O O   . HOH H 4 .   ? 10.227 10.295  34.248 1.00 35.10  ? 428 HOH Y O   1 
HETATM 3751 O O   . HOH H 4 .   ? 46.495 43.022  52.609 1.00 49.06  ? 429 HOH Y O   1 
HETATM 3752 O O   . HOH H 4 .   ? 31.768 6.009   53.896 1.00 47.29  ? 430 HOH Y O   1 
HETATM 3753 O O   . HOH H 4 .   ? 54.448 40.998  69.159 1.00 63.62  ? 431 HOH Y O   1 
HETATM 3754 O O   . HOH H 4 .   ? 40.833 14.768  55.779 1.00 48.35  ? 432 HOH Y O   1 
HETATM 3755 O O   . HOH H 4 .   ? 21.772 16.961  42.608 1.00 59.14  ? 433 HOH Y O   1 
HETATM 3756 O O   . HOH H 4 .   ? 55.423 6.146   50.591 1.00 37.53  ? 434 HOH Y O   1 
HETATM 3757 O O   . HOH H 4 .   ? 47.117 5.255   73.593 1.00 38.56  ? 435 HOH Y O   1 
HETATM 3758 O O   . HOH H 4 .   ? 45.424 47.804  71.281 1.00 67.10  ? 436 HOH Y O   1 
HETATM 3759 O O   . HOH H 4 .   ? 39.507 -3.325  50.368 1.00 42.36  ? 437 HOH Y O   1 
HETATM 3760 O O   . HOH H 4 .   ? 25.598 2.147   68.953 1.00 41.02  ? 438 HOH Y O   1 
HETATM 3761 O O   . HOH H 4 .   ? 32.046 4.003   46.181 1.00 46.50  ? 439 HOH Y O   1 
HETATM 3762 O O   . HOH H 4 .   ? 35.748 50.218  59.582 1.00 48.20  ? 440 HOH Y O   1 
HETATM 3763 O O   . HOH H 4 .   ? 57.672 9.437   70.777 1.00 106.15 ? 441 HOH Y O   1 
HETATM 3764 O O   . HOH H 4 .   ? 27.419 13.015  43.446 1.00 58.62  ? 442 HOH Y O   1 
HETATM 3765 O O   . HOH H 4 .   ? 25.588 6.656   49.381 1.00 63.60  ? 443 HOH Y O   1 
HETATM 3766 O O   . HOH H 4 .   ? 37.433 -11.931 58.561 1.00 59.48  ? 444 HOH Y O   1 
HETATM 3767 O O   . HOH H 4 .   ? 45.879 8.864   73.731 1.00 54.31  ? 445 HOH Y O   1 
HETATM 3768 O O   . HOH H 4 .   ? 41.900 18.066  68.740 1.00 55.39  ? 446 HOH Y O   1 
HETATM 3769 O O   . HOH H 4 .   ? 51.943 40.220  70.396 1.00 83.70  ? 447 HOH Y O   1 
HETATM 3770 O O   . HOH H 4 .   ? 60.528 40.624  51.751 1.00 79.57  ? 448 HOH Y O   1 
HETATM 3771 O O   . HOH H 4 .   ? 18.726 -2.310  35.612 1.00 98.68  ? 449 HOH Y O   1 
HETATM 3772 O O   . HOH H 4 .   ? 28.061 -9.889  58.069 1.00 96.49  ? 450 HOH Y O   1 
HETATM 3773 O O   . HOH H 4 .   ? 41.803 35.856  58.726 1.00 48.72  ? 451 HOH Y O   1 
HETATM 3774 O O   . HOH H 4 .   ? 35.148 -8.172  27.120 1.00 57.33  ? 452 HOH Y O   1 
HETATM 3775 O O   . HOH H 4 .   ? 34.455 14.558  35.962 1.00 81.03  ? 453 HOH Y O   1 
HETATM 3776 O O   . HOH H 4 .   ? 42.719 13.648  52.051 1.00 71.74  ? 454 HOH Y O   1 
HETATM 3777 O O   . HOH H 4 .   ? 58.733 49.413  57.322 1.00 75.96  ? 455 HOH Y O   1 
HETATM 3778 O O   . HOH H 4 .   ? 45.147 -2.622  51.155 1.00 59.26  ? 456 HOH Y O   1 
HETATM 3779 O O   . HOH H 4 .   ? 27.803 15.215  29.493 1.00 71.56  ? 457 HOH Y O   1 
HETATM 3780 O O   . HOH H 4 .   ? 41.577 1.232   51.996 1.00 59.03  ? 458 HOH Y O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   1   ?   ?   ?   X . n 
A 1 2   PRO 2   2   ?   ?   ?   X . n 
A 1 3   SER 3   3   ?   ?   ?   X . n 
A 1 4   GLY 4   4   ?   ?   ?   X . n 
A 1 5   ARG 5   5   ?   ?   ?   X . n 
A 1 6   LYS 6   6   ?   ?   ?   X . n 
A 1 7   SER 7   7   7   SER SER X . n 
A 1 8   SER 8   8   8   SER SER X . n 
A 1 9   LYS 9   9   9   LYS LYS X . n 
A 1 10  MET 10  10  10  MET MET X . n 
A 1 11  GLN 11  11  11  GLN GLN X . n 
A 1 12  ALA 12  12  12  ALA ALA X . n 
A 1 13  PHE 13  13  13  PHE PHE X . n 
A 1 14  ARG 14  14  14  ARG ARG X . n 
A 1 15  ILE 15  15  15  ILE ILE X . n 
A 1 16  TRP 16  16  16  TRP TRP X . n 
A 1 17  ASP 17  17  17  ASP ASP X . n 
A 1 18  VAL 18  18  18  VAL VAL X . n 
A 1 19  ASN 19  19  19  ASN ASN X . n 
A 1 20  GLN 20  20  20  GLN GLN X . n 
A 1 21  LYS 21  21  21  LYS LYS X . n 
A 1 22  THR 22  22  22  THR THR X . n 
A 1 23  PHE 23  23  23  PHE PHE X . n 
A 1 24  TYR 24  24  24  TYR TYR X . n 
A 1 25  LEU 25  25  25  LEU LEU X . n 
A 1 26  ARG 26  26  26  ARG ARG X . n 
A 1 27  ASN 27  27  27  ASN ASN X . n 
A 1 28  ASN 28  28  28  ASN ASN X . n 
A 1 29  GLN 29  29  29  GLN GLN X . n 
A 1 30  LEU 30  30  30  LEU LEU X . n 
A 1 31  VAL 31  31  31  VAL VAL X . n 
A 1 32  ALA 32  32  32  ALA ALA X . n 
A 1 33  GLY 33  33  33  GLY GLY X . n 
A 1 34  TYR 34  34  34  TYR TYR X . n 
A 1 35  LEU 35  35  35  LEU LEU X . n 
A 1 36  GLN 36  36  36  GLN GLN X . n 
A 1 37  GLY 37  37  37  GLY GLY X . n 
A 1 38  PRO 38  38  38  PRO PRO X . n 
A 1 39  ASN 39  39  39  ASN ASN X . n 
A 1 40  VAL 40  40  40  VAL VAL X . n 
A 1 41  ASN 41  41  41  ASN ASN X . n 
A 1 42  LEU 42  42  42  LEU LEU X . n 
A 1 43  GLU 43  43  43  GLU GLU X . n 
A 1 44  GLU 44  44  44  GLU GLU X . n 
A 1 45  LYS 45  45  45  LYS LYS X . n 
A 1 46  ILE 46  46  46  ILE ILE X . n 
A 1 47  ASP 47  47  47  ASP ASP X . n 
A 1 48  VAL 48  48  48  VAL VAL X . n 
A 1 49  VAL 49  49  49  VAL VAL X . n 
A 1 50  PRO 50  50  50  PRO PRO X . n 
A 1 51  ILE 51  51  51  ILE ILE X . n 
A 1 52  GLU 52  52  52  GLU GLU X . n 
A 1 53  PRO 53  53  53  PRO PRO X . n 
A 1 54  HIS 54  54  54  HIS HIS X . n 
A 1 55  ALA 55  55  55  ALA ALA X . n 
A 1 56  LEU 56  56  56  LEU LEU X . n 
A 1 57  PHE 57  57  57  PHE PHE X . n 
A 1 58  LEU 58  58  58  LEU LEU X . n 
A 1 59  GLY 59  59  59  GLY GLY X . n 
A 1 60  ILE 60  60  60  ILE ILE X . n 
A 1 61  HIS 61  61  61  HIS HIS X . n 
A 1 62  GLY 62  62  62  GLY GLY X . n 
A 1 63  GLY 63  63  63  GLY GLY X . n 
A 1 64  LYS 64  64  64  LYS LYS X . n 
A 1 65  MET 65  65  65  MET MET X . n 
A 1 66  CYS 66  66  66  CYS CYS X . n 
A 1 67  LEU 67  67  67  LEU LEU X . n 
A 1 68  SER 68  68  68  SER SER X . n 
A 1 69  CYS 69  69  69  CYS CYS X . n 
A 1 70  VAL 70  70  70  VAL VAL X . n 
A 1 71  LYS 71  71  71  LYS LYS X . n 
A 1 72  SER 72  72  72  SER SER X . n 
A 1 73  GLY 73  73  73  GLY GLY X . n 
A 1 74  ASP 74  74  74  ASP ASP X . n 
A 1 75  GLU 75  75  75  GLU GLU X . n 
A 1 76  THR 76  76  76  THR THR X . n 
A 1 77  ARG 77  77  77  ARG ARG X . n 
A 1 78  LEU 78  78  78  LEU LEU X . n 
A 1 79  GLN 79  79  79  GLN GLN X . n 
A 1 80  LEU 80  80  80  LEU LEU X . n 
A 1 81  GLU 81  81  81  GLU GLU X . n 
A 1 82  ALA 82  82  82  ALA ALA X . n 
A 1 83  VAL 83  83  83  VAL VAL X . n 
A 1 84  ASN 84  84  84  ASN ASN X . n 
A 1 85  ILE 85  85  85  ILE ILE X . n 
A 1 86  THR 86  86  86  THR THR X . n 
A 1 87  ASP 87  87  87  ASP ASP X . n 
A 1 88  LEU 88  88  88  LEU LEU X . n 
A 1 89  SER 89  89  89  SER SER X . n 
A 1 90  GLU 90  90  90  GLU GLU X . n 
A 1 91  ASN 91  91  91  ASN ASN X . n 
A 1 92  ARG 92  92  92  ARG ARG X . n 
A 1 93  LYS 93  93  93  LYS LYS X . n 
A 1 94  GLN 94  94  94  GLN GLN X . n 
A 1 95  ASP 95  95  95  ASP ASP X . n 
A 1 96  LYS 96  96  96  LYS LYS X . n 
A 1 97  ARG 97  97  97  ARG ARG X . n 
A 1 98  PHE 98  98  98  PHE PHE X . n 
A 1 99  ALA 99  99  99  ALA ALA X . n 
A 1 100 PHE 100 100 100 PHE PHE X . n 
A 1 101 ILE 101 101 101 ILE ILE X . n 
A 1 102 ARG 102 102 102 ARG ARG X . n 
A 1 103 SER 103 103 103 SER SER X . n 
A 1 104 ASP 104 104 104 ASP ASP X . n 
A 1 105 SER 105 105 105 SER SER X . n 
A 1 106 GLY 106 106 106 GLY GLY X . n 
A 1 107 PRO 107 107 107 PRO PRO X . n 
A 1 108 THR 108 108 108 THR THR X . n 
A 1 109 THR 109 109 109 THR THR X . n 
A 1 110 SER 110 110 110 SER SER X . n 
A 1 111 PHE 111 111 111 PHE PHE X . n 
A 1 112 GLU 112 112 112 GLU GLU X . n 
A 1 113 SER 113 113 113 SER SER X . n 
A 1 114 ALA 114 114 114 ALA ALA X . n 
A 1 115 ALA 115 115 115 ALA ALA X . n 
A 1 116 CYS 116 116 116 CYS CYS X . n 
A 1 117 PRO 117 117 117 PRO PRO X . n 
A 1 118 GLY 118 118 118 GLY GLY X . n 
A 1 119 TRP 119 119 119 TRP TRP X . n 
A 1 120 PHE 120 120 120 PHE PHE X . n 
A 1 121 LEU 121 121 121 LEU LEU X . n 
A 1 122 CYS 122 122 122 CYS CYS X . n 
A 1 123 THR 123 123 123 THR THR X . n 
A 1 124 ALA 124 124 124 ALA ALA X . n 
A 1 125 MET 125 125 125 MET MET X . n 
A 1 126 GLU 126 126 126 GLU GLU X . n 
A 1 127 ALA 127 127 127 ALA ALA X . n 
A 1 128 ASP 128 128 128 ASP ASP X . n 
A 1 129 GLN 129 129 129 GLN GLN X . n 
A 1 130 PRO 130 130 130 PRO PRO X . n 
A 1 131 VAL 131 131 131 VAL VAL X . n 
A 1 132 SER 132 132 132 SER SER X . n 
A 1 133 LEU 133 133 133 LEU LEU X . n 
A 1 134 THR 134 134 134 THR THR X . n 
A 1 135 ASN 135 135 135 ASN ASN X . n 
A 1 136 MET 136 136 136 MET MET X . n 
A 1 137 PRO 137 137 137 PRO PRO X . n 
A 1 138 ASP 138 138 138 ASP ASP X . n 
A 1 139 GLU 139 139 139 GLU GLU X . n 
A 1 140 GLY 140 140 140 GLY GLY X . n 
A 1 141 VAL 141 141 141 VAL VAL X . n 
A 1 142 MET 142 142 142 MET MET X . n 
A 1 143 VAL 143 143 143 VAL VAL X . n 
A 1 144 THR 144 144 144 THR THR X . n 
A 1 145 LYS 145 145 145 LYS LYS X . n 
A 1 146 PHE 146 146 146 PHE PHE X . n 
A 1 147 TYR 147 147 147 TYR TYR X . n 
A 1 148 PHE 148 148 148 PHE PHE X . n 
A 1 149 GLN 149 149 149 GLN GLN X . n 
A 1 150 GLU 150 150 150 GLU GLU X . n 
A 1 151 ASP 151 151 151 ASP ASP X . n 
A 1 152 GLU 152 152 ?   ?   ?   X . n 
B 2 1   LEU 1   -2  ?   ?   ?   Y . n 
B 2 2   GLU 2   -1  ?   ?   ?   Y . n 
B 2 3   ALA 3   0   ?   ?   ?   Y . n 
B 2 4   ASP 4   1   1   ASP ASP Y . n 
B 2 5   LYS 5   2   2   LYS LYS Y . n 
B 2 6   CYS 6   3   3   CYS CYS Y . n 
B 2 7   LYS 7   4   4   LYS LYS Y . n 
B 2 8   GLU 8   5   5   GLU GLU Y . n 
B 2 9   ARG 9   6   6   ARG ARG Y . n 
B 2 10  GLU 10  7   7   GLU GLU Y . n 
B 2 11  GLU 11  8   8   GLU GLU Y . n 
B 2 12  LYS 12  9   9   LYS LYS Y . n 
B 2 13  ILE 13  10  10  ILE ILE Y . n 
B 2 14  ILE 14  11  11  ILE ILE Y . n 
B 2 15  LEU 15  12  12  LEU LEU Y . n 
B 2 16  VAL 16  13  13  VAL VAL Y . n 
B 2 17  SER 17  14  14  SER SER Y . n 
B 2 18  SER 18  15  15  SER SER Y . n 
B 2 19  ALA 19  16  16  ALA ALA Y . n 
B 2 20  ASN 20  17  17  ASN ASN Y . n 
B 2 21  GLU 21  18  18  GLU GLU Y . n 
B 2 22  ILE 22  19  19  ILE ILE Y . n 
B 2 23  ASP 23  20  20  ASP ASP Y . n 
B 2 24  VAL 24  21  21  VAL VAL Y . n 
B 2 25  ARG 25  22  22  ARG ARG Y . n 
B 2 26  PRO 26  23  23  PRO PRO Y . n 
B 2 27  CYS 27  24  24  CYS CYS Y . n 
B 2 28  PRO 28  25  25  PRO PRO Y . n 
B 2 29  LEU 29  26  26  LEU LEU Y . n 
B 2 30  ASN 30  27  27  ASN ASN Y . n 
B 2 31  PRO 31  28  28  PRO PRO Y . n 
B 2 32  ASN 32  29  29  ASN ASN Y . n 
B 2 33  GLU 33  30  30  GLU GLU Y . n 
B 2 34  HIS 34  31  31  HIS HIS Y . n 
B 2 35  LYS 35  32  32  LYS LYS Y . n 
B 2 36  GLY 36  33  33  GLY GLY Y . n 
B 2 37  THR 37  34  34  THR THR Y . n 
B 2 38  ILE 38  35  35  ILE ILE Y . n 
B 2 39  THR 39  36  36  THR THR Y . n 
B 2 40  TRP 40  37  37  TRP TRP Y . n 
B 2 41  TYR 41  38  38  TYR TYR Y . n 
B 2 42  LYS 42  39  39  LYS LYS Y . n 
B 2 43  ASP 43  40  40  ASP ASP Y . n 
B 2 44  ASP 44  41  41  ASP ASP Y . n 
B 2 45  SER 45  42  42  SER SER Y . n 
B 2 46  LYS 46  43  43  LYS LYS Y . n 
B 2 47  THR 47  44  44  THR THR Y . n 
B 2 48  PRO 48  45  45  PRO PRO Y . n 
B 2 49  VAL 49  46  46  VAL VAL Y . n 
B 2 50  SER 50  47  47  SER SER Y . n 
B 2 51  THR 51  48  48  THR THR Y . n 
B 2 52  GLU 52  49  49  GLU GLU Y . n 
B 2 53  GLN 53  50  50  GLN GLN Y . n 
B 2 54  ALA 54  51  51  ALA ALA Y . n 
B 2 55  SER 55  52  52  SER SER Y . n 
B 2 56  ARG 56  53  53  ARG ARG Y . n 
B 2 57  ILE 57  54  54  ILE ILE Y . n 
B 2 58  HIS 58  55  55  HIS HIS Y . n 
B 2 59  GLN 59  56  56  GLN GLN Y . n 
B 2 60  HIS 60  57  57  HIS HIS Y . n 
B 2 61  LYS 61  58  58  LYS LYS Y . n 
B 2 62  GLU 62  59  59  GLU GLU Y . n 
B 2 63  LYS 63  60  60  LYS LYS Y . n 
B 2 64  LEU 64  61  61  LEU LEU Y . n 
B 2 65  TRP 65  62  62  TRP TRP Y . n 
B 2 66  PHE 66  63  63  PHE PHE Y . n 
B 2 67  VAL 67  64  64  VAL VAL Y . n 
B 2 68  PRO 68  65  65  PRO PRO Y . n 
B 2 69  ALA 69  66  66  ALA ALA Y . n 
B 2 70  LYS 70  67  67  LYS LYS Y . n 
B 2 71  VAL 71  68  68  VAL VAL Y . n 
B 2 72  GLU 72  69  69  GLU GLU Y . n 
B 2 73  ASP 73  70  70  ASP ASP Y . n 
B 2 74  SER 74  71  71  SER SER Y . n 
B 2 75  GLY 75  72  72  GLY GLY Y . n 
B 2 76  HIS 76  73  73  HIS HIS Y . n 
B 2 77  TYR 77  74  74  TYR TYR Y . n 
B 2 78  TYR 78  75  75  TYR TYR Y . n 
B 2 79  CYS 79  76  76  CYS CYS Y . n 
B 2 80  VAL 80  77  77  VAL VAL Y . n 
B 2 81  VAL 81  78  78  VAL VAL Y . n 
B 2 82  ARG 82  79  79  ARG ARG Y . n 
B 2 83  ASN 83  80  80  ASN ASN Y . n 
B 2 84  SER 84  81  81  SER SER Y . n 
B 2 85  SER 85  82  82  SER SER Y . n 
B 2 86  TYR 86  83  83  TYR TYR Y . n 
B 2 87  CYS 87  84  84  CYS CYS Y . n 
B 2 88  LEU 88  85  85  LEU LEU Y . n 
B 2 89  ARG 89  86  86  ARG ARG Y . n 
B 2 90  ILE 90  87  87  ILE ILE Y . n 
B 2 91  LYS 91  88  88  LYS LYS Y . n 
B 2 92  ILE 92  89  89  ILE ILE Y . n 
B 2 93  SER 93  90  90  SER SER Y . n 
B 2 94  ALA 94  91  91  ALA ALA Y . n 
B 2 95  LYS 95  92  92  LYS LYS Y . n 
B 2 96  PHE 96  93  93  PHE PHE Y . n 
B 2 97  VAL 97  94  94  VAL VAL Y . n 
B 2 98  GLU 98  95  95  GLU GLU Y . n 
B 2 99  ASN 99  96  96  ASN ASN Y . n 
B 2 100 GLU 100 97  97  GLU GLU Y . n 
B 2 101 PRO 101 98  98  PRO PRO Y . n 
B 2 102 ASN 102 99  99  ASN ASN Y . n 
B 2 103 LEU 103 100 100 LEU LEU Y . n 
B 2 104 CYS 104 101 101 CYS CYS Y . n 
B 2 105 TYR 105 102 102 TYR TYR Y . n 
B 2 106 ASN 106 103 103 ASN ASN Y . n 
B 2 107 ALA 107 104 104 ALA ALA Y . n 
B 2 108 GLN 108 105 105 GLN GLN Y . n 
B 2 109 ALA 109 106 106 ALA ALA Y . n 
B 2 110 ILE 110 107 107 ILE ILE Y . n 
B 2 111 PHE 111 108 108 PHE PHE Y . n 
B 2 112 LYS 112 109 109 LYS LYS Y . n 
B 2 113 GLN 113 110 110 GLN GLN Y . n 
B 2 114 LYS 114 111 111 LYS LYS Y . n 
B 2 115 LEU 115 112 112 LEU LEU Y . n 
B 2 116 PRO 116 113 113 PRO PRO Y . n 
B 2 117 VAL 117 114 114 VAL VAL Y . n 
B 2 118 ALA 118 115 115 ALA ALA Y . n 
B 2 119 GLY 119 116 116 GLY GLY Y . n 
B 2 120 ASP 120 117 117 ASP ASP Y . n 
B 2 121 GLY 121 118 118 GLY GLY Y . n 
B 2 122 GLY 122 119 119 GLY GLY Y . n 
B 2 123 LEU 123 120 120 LEU LEU Y . n 
B 2 124 VAL 124 121 121 VAL VAL Y . n 
B 2 125 CYS 125 122 122 CYS CYS Y . n 
B 2 126 PRO 126 123 123 PRO PRO Y . n 
B 2 127 TYR 127 124 124 TYR TYR Y . n 
B 2 128 MET 128 125 125 MET MET Y . n 
B 2 129 GLU 129 126 126 GLU GLU Y . n 
B 2 130 PHE 130 127 127 PHE PHE Y . n 
B 2 131 PHE 131 128 128 PHE PHE Y . n 
B 2 132 LYS 132 129 129 LYS LYS Y . n 
B 2 133 ASN 133 130 130 ASN ASN Y . n 
B 2 134 GLU 134 131 131 GLU GLU Y . n 
B 2 135 ASN 135 132 132 ASN ASN Y . n 
B 2 136 ASN 136 133 133 ASN ASN Y . n 
B 2 137 GLU 137 134 134 GLU GLU Y . n 
B 2 138 LEU 138 135 135 LEU LEU Y . n 
B 2 139 PRO 139 136 136 PRO PRO Y . n 
B 2 140 LYS 140 137 137 LYS LYS Y . n 
B 2 141 LEU 141 138 138 LEU LEU Y . n 
B 2 142 GLN 142 139 139 GLN GLN Y . n 
B 2 143 TRP 143 140 140 TRP TRP Y . n 
B 2 144 TYR 144 141 141 TYR TYR Y . n 
B 2 145 LYS 145 142 142 LYS LYS Y . n 
B 2 146 ASP 146 143 143 ASP ASP Y . n 
B 2 147 CYS 147 144 144 CYS CYS Y . n 
B 2 148 LYS 148 145 145 LYS LYS Y . n 
B 2 149 PRO 149 146 146 PRO PRO Y . n 
B 2 150 LEU 150 147 147 LEU LEU Y . n 
B 2 151 LEU 151 148 148 LEU LEU Y . n 
B 2 152 LEU 152 149 149 LEU LEU Y . n 
B 2 153 ASP 153 150 150 ASP ASP Y . n 
B 2 154 ASN 154 151 151 ASN ASN Y . n 
B 2 155 ILE 155 152 152 ILE ILE Y . n 
B 2 156 HIS 156 153 153 HIS HIS Y . n 
B 2 157 PHE 157 154 154 PHE PHE Y . n 
B 2 158 SER 158 155 155 SER SER Y . n 
B 2 159 GLY 159 156 156 GLY GLY Y . n 
B 2 160 VAL 160 157 157 VAL VAL Y . n 
B 2 161 LYS 161 158 158 LYS LYS Y . n 
B 2 162 ASP 162 159 159 ASP ASP Y . n 
B 2 163 ARG 163 160 160 ARG ARG Y . n 
B 2 164 LEU 164 161 161 LEU LEU Y . n 
B 2 165 ILE 165 162 162 ILE ILE Y . n 
B 2 166 VAL 166 163 163 VAL VAL Y . n 
B 2 167 MET 167 164 164 MET MET Y . n 
B 2 168 ASN 168 165 165 ASN ASN Y . n 
B 2 169 VAL 169 166 166 VAL VAL Y . n 
B 2 170 ALA 170 167 167 ALA ALA Y . n 
B 2 171 GLU 171 168 168 GLU GLU Y . n 
B 2 172 LYS 172 169 169 LYS LYS Y . n 
B 2 173 HIS 173 170 170 HIS HIS Y . n 
B 2 174 ARG 174 171 171 ARG ARG Y . n 
B 2 175 GLY 175 172 172 GLY GLY Y . n 
B 2 176 ASN 176 173 173 ASN ASN Y . n 
B 2 177 TYR 177 174 174 TYR TYR Y . n 
B 2 178 THR 178 175 175 THR THR Y . n 
B 2 179 CYS 179 176 176 CYS CYS Y . n 
B 2 180 HIS 180 177 177 HIS HIS Y . n 
B 2 181 ALA 181 178 178 ALA ALA Y . n 
B 2 182 SER 182 179 179 SER SER Y . n 
B 2 183 TYR 183 180 180 TYR TYR Y . n 
B 2 184 THR 184 181 181 THR THR Y . n 
B 2 185 TYR 185 182 182 TYR TYR Y . n 
B 2 186 LEU 186 183 183 LEU LEU Y . n 
B 2 187 GLY 187 184 184 GLY GLY Y . n 
B 2 188 LYS 188 185 185 LYS LYS Y . n 
B 2 189 GLN 189 186 186 GLN GLN Y . n 
B 2 190 TYR 190 187 187 TYR TYR Y . n 
B 2 191 PRO 191 188 188 PRO PRO Y . n 
B 2 192 ILE 192 189 189 ILE ILE Y . n 
B 2 193 THR 193 190 190 THR THR Y . n 
B 2 194 ARG 194 191 191 ARG ARG Y . n 
B 2 195 VAL 195 192 192 VAL VAL Y . n 
B 2 196 ILE 196 193 193 ILE ILE Y . n 
B 2 197 GLU 197 194 194 GLU GLU Y . n 
B 2 198 PHE 198 195 195 PHE PHE Y . n 
B 2 199 ILE 199 196 196 ILE ILE Y . n 
B 2 200 THR 200 197 197 THR THR Y . n 
B 2 201 LEU 201 198 198 LEU LEU Y . n 
B 2 202 GLU 202 199 199 GLU GLU Y . n 
B 2 203 GLU 203 200 200 GLU GLU Y . n 
B 2 204 ASN 204 201 201 ASN ASN Y . n 
B 2 205 LYS 205 202 202 LYS LYS Y . n 
B 2 206 PRO 206 203 203 PRO PRO Y . n 
B 2 207 THR 207 204 204 THR THR Y . n 
B 2 208 ARG 208 205 205 ARG ARG Y . n 
B 2 209 PRO 209 206 206 PRO PRO Y . n 
B 2 210 VAL 210 207 207 VAL VAL Y . n 
B 2 211 ILE 211 208 208 ILE ILE Y . n 
B 2 212 VAL 212 209 209 VAL VAL Y . n 
B 2 213 SER 213 210 210 SER SER Y . n 
B 2 214 PRO 214 211 211 PRO PRO Y . n 
B 2 215 ALA 215 212 212 ALA ALA Y . n 
B 2 216 ASN 216 213 213 ASN ASN Y . n 
B 2 217 GLU 217 214 214 GLU GLU Y . n 
B 2 218 THR 218 215 215 THR THR Y . n 
B 2 219 MET 219 216 216 MET MET Y . n 
B 2 220 GLU 220 217 217 GLU GLU Y . n 
B 2 221 VAL 221 218 218 VAL VAL Y . n 
B 2 222 ASP 222 219 219 ASP ASP Y . n 
B 2 223 LEU 223 220 220 LEU LEU Y . n 
B 2 224 GLY 224 221 221 GLY GLY Y . n 
B 2 225 SER 225 222 222 SER SER Y . n 
B 2 226 GLN 226 223 223 GLN GLN Y . n 
B 2 227 ILE 227 224 224 ILE ILE Y . n 
B 2 228 GLN 228 225 225 GLN GLN Y . n 
B 2 229 LEU 229 226 226 LEU LEU Y . n 
B 2 230 ILE 230 227 227 ILE ILE Y . n 
B 2 231 CYS 231 228 228 CYS CYS Y . n 
B 2 232 ASN 232 229 229 ASN ASN Y . n 
B 2 233 VAL 233 230 230 VAL VAL Y . n 
B 2 234 THR 234 231 231 THR THR Y . n 
B 2 235 GLY 235 232 232 GLY GLY Y . n 
B 2 236 GLN 236 233 233 GLN GLN Y . n 
B 2 237 LEU 237 234 234 LEU LEU Y . n 
B 2 238 SER 238 235 235 SER SER Y . n 
B 2 239 ASP 239 236 236 ASP ASP Y . n 
B 2 240 ILE 240 237 237 ILE ILE Y . n 
B 2 241 ALA 241 238 238 ALA ALA Y . n 
B 2 242 TYR 242 239 239 TYR TYR Y . n 
B 2 243 TRP 243 240 240 TRP TRP Y . n 
B 2 244 LYS 244 241 241 LYS LYS Y . n 
B 2 245 TRP 245 242 242 TRP TRP Y . n 
B 2 246 ASN 246 243 243 ASN ASN Y . n 
B 2 247 GLY 247 244 244 GLY GLY Y . n 
B 2 248 SER 248 245 245 SER SER Y . n 
B 2 249 VAL 249 246 246 VAL VAL Y . n 
B 2 250 ILE 250 247 247 ILE ILE Y . n 
B 2 251 ASP 251 248 248 ASP ASP Y . n 
B 2 252 GLU 252 249 249 GLU GLU Y . n 
B 2 253 ASP 253 250 250 ASP ASP Y . n 
B 2 254 ASP 254 251 251 ASP ASP Y . n 
B 2 255 PRO 255 252 252 PRO PRO Y . n 
B 2 256 VAL 256 253 253 VAL VAL Y . n 
B 2 257 LEU 257 254 254 LEU LEU Y . n 
B 2 258 GLY 258 255 255 GLY GLY Y . n 
B 2 259 GLU 259 256 256 GLU GLU Y . n 
B 2 260 ASP 260 257 257 ASP ASP Y . n 
B 2 261 TYR 261 258 258 TYR TYR Y . n 
B 2 262 TYR 262 259 259 TYR TYR Y . n 
B 2 263 SER 263 260 260 SER SER Y . n 
B 2 264 VAL 264 261 261 VAL VAL Y . n 
B 2 265 GLU 265 262 262 GLU GLU Y . n 
B 2 266 ASN 266 263 263 ASN ASN Y . n 
B 2 267 PRO 267 264 264 PRO PRO Y . n 
B 2 268 ALA 268 265 265 ALA ALA Y . n 
B 2 269 ASN 269 266 266 ASN ASN Y . n 
B 2 270 LYS 270 267 267 LYS LYS Y . n 
B 2 271 ARG 271 268 268 ARG ARG Y . n 
B 2 272 ARG 272 269 269 ARG ARG Y . n 
B 2 273 SER 273 270 270 SER SER Y . n 
B 2 274 THR 274 271 271 THR THR Y . n 
B 2 275 LEU 275 272 272 LEU LEU Y . n 
B 2 276 ILE 276 273 273 ILE ILE Y . n 
B 2 277 THR 277 274 274 THR THR Y . n 
B 2 278 VAL 278 275 275 VAL VAL Y . n 
B 2 279 LEU 279 276 276 LEU LEU Y . n 
B 2 280 ASN 280 277 277 ASN ASN Y . n 
B 2 281 ILE 281 278 278 ILE ILE Y . n 
B 2 282 SER 282 279 279 SER SER Y . n 
B 2 283 GLU 283 280 280 GLU GLU Y . n 
B 2 284 ILE 284 281 281 ILE ILE Y . n 
B 2 285 GLU 285 282 282 GLU GLU Y . n 
B 2 286 SER 286 283 283 SER SER Y . n 
B 2 287 ARG 287 284 284 ARG ARG Y . n 
B 2 288 PHE 288 285 285 PHE PHE Y . n 
B 2 289 TYR 289 286 286 TYR TYR Y . n 
B 2 290 LYS 290 287 287 LYS LYS Y . n 
B 2 291 HIS 291 288 288 HIS HIS Y . n 
B 2 292 PRO 292 289 289 PRO PRO Y . n 
B 2 293 PHE 293 290 290 PHE PHE Y . n 
B 2 294 THR 294 291 291 THR THR Y . n 
B 2 295 CYS 295 292 292 CYS CYS Y . n 
B 2 296 PHE 296 293 293 PHE PHE Y . n 
B 2 297 ALA 297 294 294 ALA ALA Y . n 
B 2 298 LYS 298 295 295 LYS LYS Y . n 
B 2 299 ASN 299 296 296 ASN ASN Y . n 
B 2 300 THR 300 297 297 THR THR Y . n 
B 2 301 HIS 301 298 298 HIS HIS Y . n 
B 2 302 GLY 302 299 299 GLY GLY Y . n 
B 2 303 ILE 303 300 300 ILE ILE Y . n 
B 2 304 ASP 304 301 301 ASP ASP Y . n 
B 2 305 ALA 305 302 302 ALA ALA Y . n 
B 2 306 ALA 306 303 303 ALA ALA Y . n 
B 2 307 TYR 307 304 304 TYR TYR Y . n 
B 2 308 ILE 308 305 305 ILE ILE Y . n 
B 2 309 GLN 309 306 306 GLN GLN Y . n 
B 2 310 LEU 310 307 307 LEU LEU Y . n 
B 2 311 ILE 311 308 308 ILE ILE Y . n 
B 2 312 TYR 312 309 309 TYR TYR Y . n 
B 2 313 PRO 313 310 310 PRO PRO Y . n 
B 2 314 VAL 314 311 311 VAL VAL Y . n 
B 2 315 THR 315 312 ?   ?   ?   Y . n 
B 2 316 ASN 316 313 ?   ?   ?   Y . n 
B 2 317 PHE 317 314 ?   ?   ?   Y . n 
B 2 318 GLN 318 315 ?   ?   ?   Y . n 
B 2 319 LYS 319 316 ?   ?   ?   Y . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 NAG 1  401 401 NAG NAG Y . 
D 3 NAG 1  402 402 NAG NAG Y . 
E 3 NAG 1  403 403 NAG NAG Y . 
F 3 NAG 1  404 404 NAG NAG Y . 
G 4 HOH 1  153 2   HOH HOH X . 
G 4 HOH 2  154 6   HOH HOH X . 
G 4 HOH 3  155 8   HOH HOH X . 
G 4 HOH 4  156 9   HOH HOH X . 
G 4 HOH 5  157 10  HOH HOH X . 
G 4 HOH 6  158 12  HOH HOH X . 
G 4 HOH 7  159 13  HOH HOH X . 
G 4 HOH 8  160 14  HOH HOH X . 
G 4 HOH 9  161 15  HOH HOH X . 
G 4 HOH 10 162 18  HOH HOH X . 
G 4 HOH 11 163 19  HOH HOH X . 
G 4 HOH 12 164 24  HOH HOH X . 
G 4 HOH 13 165 27  HOH HOH X . 
G 4 HOH 14 166 29  HOH HOH X . 
G 4 HOH 15 167 32  HOH HOH X . 
G 4 HOH 16 168 35  HOH HOH X . 
G 4 HOH 17 169 36  HOH HOH X . 
G 4 HOH 18 170 37  HOH HOH X . 
G 4 HOH 19 171 38  HOH HOH X . 
G 4 HOH 20 172 39  HOH HOH X . 
G 4 HOH 21 173 40  HOH HOH X . 
G 4 HOH 22 174 41  HOH HOH X . 
G 4 HOH 23 175 43  HOH HOH X . 
G 4 HOH 24 176 50  HOH HOH X . 
G 4 HOH 25 177 51  HOH HOH X . 
G 4 HOH 26 178 52  HOH HOH X . 
G 4 HOH 27 179 68  HOH HOH X . 
G 4 HOH 28 180 74  HOH HOH X . 
G 4 HOH 29 181 75  HOH HOH X . 
G 4 HOH 30 182 78  HOH HOH X . 
G 4 HOH 31 183 79  HOH HOH X . 
G 4 HOH 32 184 84  HOH HOH X . 
H 4 HOH 1  405 1   HOH HOH Y . 
H 4 HOH 2  406 3   HOH HOH Y . 
H 4 HOH 3  407 4   HOH HOH Y . 
H 4 HOH 4  408 5   HOH HOH Y . 
H 4 HOH 5  409 7   HOH HOH Y . 
H 4 HOH 6  410 11  HOH HOH Y . 
H 4 HOH 7  411 16  HOH HOH Y . 
H 4 HOH 8  412 17  HOH HOH Y . 
H 4 HOH 9  413 20  HOH HOH Y . 
H 4 HOH 10 414 21  HOH HOH Y . 
H 4 HOH 11 415 22  HOH HOH Y . 
H 4 HOH 12 416 23  HOH HOH Y . 
H 4 HOH 13 417 25  HOH HOH Y . 
H 4 HOH 14 418 26  HOH HOH Y . 
H 4 HOH 15 419 28  HOH HOH Y . 
H 4 HOH 16 420 30  HOH HOH Y . 
H 4 HOH 17 421 31  HOH HOH Y . 
H 4 HOH 18 422 33  HOH HOH Y . 
H 4 HOH 19 423 34  HOH HOH Y . 
H 4 HOH 20 424 42  HOH HOH Y . 
H 4 HOH 21 425 44  HOH HOH Y . 
H 4 HOH 22 426 45  HOH HOH Y . 
H 4 HOH 23 427 46  HOH HOH Y . 
H 4 HOH 24 428 47  HOH HOH Y . 
H 4 HOH 25 429 48  HOH HOH Y . 
H 4 HOH 26 430 49  HOH HOH Y . 
H 4 HOH 27 431 53  HOH HOH Y . 
H 4 HOH 28 432 54  HOH HOH Y . 
H 4 HOH 29 433 55  HOH HOH Y . 
H 4 HOH 30 434 56  HOH HOH Y . 
H 4 HOH 31 435 57  HOH HOH Y . 
H 4 HOH 32 436 58  HOH HOH Y . 
H 4 HOH 33 437 59  HOH HOH Y . 
H 4 HOH 34 438 60  HOH HOH Y . 
H 4 HOH 35 439 61  HOH HOH Y . 
H 4 HOH 36 440 62  HOH HOH Y . 
H 4 HOH 37 441 63  HOH HOH Y . 
H 4 HOH 38 442 64  HOH HOH Y . 
H 4 HOH 39 443 65  HOH HOH Y . 
H 4 HOH 40 444 66  HOH HOH Y . 
H 4 HOH 41 445 67  HOH HOH Y . 
H 4 HOH 42 446 69  HOH HOH Y . 
H 4 HOH 43 447 70  HOH HOH Y . 
H 4 HOH 44 448 71  HOH HOH Y . 
H 4 HOH 45 449 72  HOH HOH Y . 
H 4 HOH 46 450 73  HOH HOH Y . 
H 4 HOH 47 451 76  HOH HOH Y . 
H 4 HOH 48 452 77  HOH HOH Y . 
H 4 HOH 49 453 80  HOH HOH Y . 
H 4 HOH 50 454 81  HOH HOH Y . 
H 4 HOH 51 455 82  HOH HOH Y . 
H 4 HOH 52 456 83  HOH HOH Y . 
H 4 HOH 53 457 85  HOH HOH Y . 
H 4 HOH 54 458 86  HOH HOH Y . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B ASN 176 Y ASN 173 ? ASN 'GLYCOSYLATION SITE' 
2 B ASN 216 Y ASN 213 ? ASN 'GLYCOSYLATION SITE' 
3 B ASN 232 Y ASN 229 ? ASN 'GLYCOSYLATION SITE' 
4 B ASN 246 Y ASN 243 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4420  ? 
1 MORE         6     ? 
1 'SSA (A^2)'  22630 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-06-17 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-04-04 
5 'Structure model' 1 4 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Data collection'           
5 5 'Structure model' 'Data collection'           
6 5 'Structure model' 'Derived calculations'      
7 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' diffrn_source             
2 5 'Structure model' chem_comp                 
3 5 'Structure model' entity                    
4 5 'Structure model' pdbx_chem_comp_identifier 
5 5 'Structure model' pdbx_entity_nonpoly       
6 5 'Structure model' struct_conn               
7 5 'Structure model' struct_site               
8 5 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_diffrn_source.type'                 
2  5 'Structure model' '_chem_comp.name'                     
3  5 'Structure model' '_chem_comp.type'                     
4  5 'Structure model' '_entity.pdbx_description'            
5  5 'Structure model' '_pdbx_entity_nonpoly.name'           
6  5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 
7  5 'Structure model' '_struct_conn.pdbx_role'              
8  5 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
9  5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
10 5 'Structure model' '_struct_conn.ptnr1_label_asym_id'    
11 5 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
12 5 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
13 5 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
14 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
15 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
16 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'    
17 5 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
18 5 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
19 5 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
XDS       'data scaling'   .   ? 1 
XSCALE    'data scaling'   .   ? 2 
SQUASH    phasing          .   ? 3 
X-PLOR    'model building' 3.1 ? 4 
X-PLOR    refinement       3.1 ? 5 
XDS       'data reduction' .   ? 6 
X-PLOR3.1 phasing          .   ? 7 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER X 8   ? ? -95.91  -77.58  
2  1 ASP X 74  ? ? -141.46 -10.69  
3  1 LYS Y 2   ? ? -78.93  43.34   
4  1 GLU Y 5   ? ? 70.23   124.99  
5  1 PRO Y 25  ? ? -63.80  76.50   
6  1 ASP Y 40  ? ? -32.62  -35.60  
7  1 SER Y 42  ? ? -58.16  -0.99   
8  1 ARG Y 53  ? ? -47.35  -80.78  
9  1 GLU Y 69  ? ? -66.90  2.48    
10 1 SER Y 82  ? ? -146.06 41.84   
11 1 VAL Y 114 ? ? -67.23  -178.71 
12 1 ALA Y 115 ? ? 73.84   -42.56  
13 1 PHE Y 128 ? ? -96.95  38.03   
14 1 LYS Y 158 ? ? 50.94   -115.25 
15 1 ASN Y 165 ? ? 52.65   78.90   
16 1 PRO Y 211 ? ? -68.58  -178.95 
17 1 ASN Y 296 ? ? -165.85 -167.09 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 X SER 7   ? OG  ? A SER 7   OG  
2  1 Y 1 X ASP 74  ? CG  ? A ASP 74  CG  
3  1 Y 1 X ASP 74  ? OD1 ? A ASP 74  OD1 
4  1 Y 1 X ASP 74  ? OD2 ? A ASP 74  OD2 
5  1 Y 1 Y LYS 4   ? CG  ? B LYS 7   CG  
6  1 Y 1 Y LYS 4   ? CD  ? B LYS 7   CD  
7  1 Y 1 Y LYS 4   ? CE  ? B LYS 7   CE  
8  1 Y 1 Y LYS 4   ? NZ  ? B LYS 7   NZ  
9  1 Y 1 Y GLU 131 ? CG  ? B GLU 134 CG  
10 1 Y 1 Y GLU 131 ? CD  ? B GLU 134 CD  
11 1 Y 1 Y GLU 131 ? OE1 ? B GLU 134 OE1 
12 1 Y 1 Y GLU 131 ? OE2 ? B GLU 134 OE2 
13 1 Y 1 Y LYS 185 ? CG  ? B LYS 188 CG  
14 1 Y 1 Y LYS 185 ? CD  ? B LYS 188 CD  
15 1 Y 1 Y LYS 185 ? CE  ? B LYS 188 CE  
16 1 Y 1 Y LYS 185 ? NZ  ? B LYS 188 NZ  
17 1 Y 1 Y LYS 202 ? CG  ? B LYS 205 CG  
18 1 Y 1 Y LYS 202 ? CD  ? B LYS 205 CD  
19 1 Y 1 Y LYS 202 ? CE  ? B LYS 205 CE  
20 1 Y 1 Y LYS 202 ? NZ  ? B LYS 205 NZ  
21 1 Y 1 Y ASP 250 ? CG  ? B ASP 253 CG  
22 1 Y 1 Y ASP 250 ? OD1 ? B ASP 253 OD1 
23 1 Y 1 Y ASP 250 ? OD2 ? B ASP 253 OD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 X ARG 1   ? A ARG 1   
2  1 Y 1 X PRO 2   ? A PRO 2   
3  1 Y 1 X SER 3   ? A SER 3   
4  1 Y 1 X GLY 4   ? A GLY 4   
5  1 Y 1 X ARG 5   ? A ARG 5   
6  1 Y 1 X LYS 6   ? A LYS 6   
7  1 Y 1 X GLU 152 ? A GLU 152 
8  1 Y 1 Y LEU -2  ? B LEU 1   
9  1 Y 1 Y GLU -1  ? B GLU 2   
10 1 Y 1 Y ALA 0   ? B ALA 3   
11 1 Y 1 Y THR 312 ? B THR 315 
12 1 Y 1 Y ASN 313 ? B ASN 316 
13 1 Y 1 Y PHE 314 ? B PHE 317 
14 1 Y 1 Y GLN 315 ? B GLN 318 
15 1 Y 1 Y LYS 316 ? B LYS 319 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
4 water                                    HOH 
#