data_1IRO
# 
_entry.id   1IRO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IRO         
WWPDB D_1000174243 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IRO 
_pdbx_database_status.recvd_initial_deposition_date   1995-12-13 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dauter, Z.'   1 
'Wilson, K.S.' 2 
'Sieker, L.C.' 3 
'Moulis, J.M.' 4 
'Meyer, J.'    5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Zinc- and iron-rubredoxins from Clostridium pasteurianum at atomic resolution: a high-precision model of a ZnS4 coordination unit in a protein.
;
Proc.Natl.Acad.Sci.USA     93  8836 8840 1996 PNASA6 US 0027-8424 0040 ? 8799113 10.1073/pnas.93.17.8836 
1       'Crystallographic Refinement of Rubredoxin at 1.2 Angstroms Resolution' J.Mol.Biol.                138 615  ?    1980 
JMOBAK UK 0022-2836 0070 ? ?       ?                       
2       'Refinement of the Model of a Protein. Rubredoxin at 1.5 Angstroms Resolution' 'Acta Crystallogr.,Sect.B' 29  943  ?    
1973 ASBSDK DK 0108-7681 0622 ? ?       ?                       
3       'Structure of Rubredoxin. An X-Ray Study to 2.5 Angstroms Resolution' J.Mol.Biol.                50  391  ?    1970 JMOBAK 
UK 0022-2836 0070 ? ?       ?                       
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dauter, Z.'       1  
primary 'Wilson, K.S.'     2  
primary 'Sieker, L.C.'     3  
primary 'Moulis, J.M.'     4  
primary 'Meyer, J.'        5  
1       'Watenpaugh, K.D.' 6  
1       'Sieker, L.C.'     7  
1       'Jensen, L.H.'     8  
2       'Watenpaugh, K.D.' 9  
2       'Sieker, L.C.'     10 
2       'Herriott, J.R.'   11 
2       'Jensen, L.H.'     12 
3       'Herriott, J.R.'   13 
3       'Sieker, L.C.'     14 
3       'Jensen, L.H.'     15 
3       'Lovenberg, W.'    16 
# 
_cell.entry_id           1IRO 
_cell.length_a           64.040 
_cell.length_b           64.040 
_cell.length_c           32.510 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              9 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IRO 
_symmetry.space_group_name_H-M             'H 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                146 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat RUBREDOXIN     6051.611 1   ? ? ? 'OXIDIZED, FE(III)' 
2 non-polymer syn 'FE (III) ION' 55.845   1   ? ? ? ?                   
3 water       nat water          18.015   110 ? ? ? ?                   
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE 
_entity_poly.pdbx_seq_one_letter_code_can   MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  LYS n 
1 3  LYS n 
1 4  TYR n 
1 5  THR n 
1 6  CYS n 
1 7  THR n 
1 8  VAL n 
1 9  CYS n 
1 10 GLY n 
1 11 TYR n 
1 12 ILE n 
1 13 TYR n 
1 14 ASN n 
1 15 PRO n 
1 16 GLU n 
1 17 ASP n 
1 18 GLY n 
1 19 ASP n 
1 20 PRO n 
1 21 ASP n 
1 22 ASN n 
1 23 GLY n 
1 24 VAL n 
1 25 ASN n 
1 26 PRO n 
1 27 GLY n 
1 28 THR n 
1 29 ASP n 
1 30 PHE n 
1 31 LYS n 
1 32 ASP n 
1 33 ILE n 
1 34 PRO n 
1 35 ASP n 
1 36 ASP n 
1 37 TRP n 
1 38 VAL n 
1 39 CYS n 
1 40 PRO n 
1 41 LEU n 
1 42 CYS n 
1 43 GLY n 
1 44 VAL n 
1 45 GLY n 
1 46 LYS n 
1 47 ASP n 
1 48 GLN n 
1 49 PHE n 
1 50 GLU n 
1 51 GLU n 
1 52 VAL n 
1 53 GLU n 
1 54 GLU n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Clostridium pasteurianum' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      1501 
_entity_src_nat.genus                      Clostridium 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RUBR_CLOPA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00268 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1IRO 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 54 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00268 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  54 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       54 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
FE  non-polymer         . 'FE (III) ION'  ? 'Fe 3'           55.845  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1IRO 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.12 
_exptl_crystal.density_percent_sol   41.93 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 4.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ROOM 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1993-11 
_diffrn_detector.details                'FOCUSING MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X11' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, Hamburg' 
_diffrn_source.pdbx_synchrotron_beamline   X11 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.92 
# 
_reflns.entry_id                     1IRO 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   ? 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            0.047 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              5.5 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1IRO 
_refine.ls_number_reflns_obs                     34415 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          -3.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            1.1 
_refine.ls_percent_reflns_obs                    94.0 
_refine.ls_R_factor_obs                          0.0903 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     4898 
_refine.ls_number_restraints                     5771 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1IRO 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      6 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      522 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        748 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             110 
_refine_hist.number_atoms_total               859 
_refine_hist.d_res_high                       1.1 
_refine_hist.d_res_low                        10.0 
# 
_struct.entry_id                  1IRO 
_struct.title                     'RUBREDOXIN (OXIDIZED, FE(III)) AT 1.1 ANGSTROMS RESOLUTION' 
_struct.pdbx_descriptor           RUBREDOXIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IRO 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSPORT' 
_struct_keywords.text            'ELECTRON TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PRO A 20 ? ASN A 22 ? PRO A 20 ASN A 22 5 ? 3 
HELX_P HELX_P2 2 PHE A 30 ? ASP A 32 ? PHE A 30 ASP A 32 5 ? 3 
HELX_P HELX_P3 3 LYS A 46 ? GLN A 48 ? LYS A 46 GLN A 48 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B FE . FE ? ? ? 1_555 A CYS 6  SG ? ? A FE 55 A CYS 6  1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc2 metalc ? ? B FE . FE ? ? ? 1_555 A CYS 9  SG ? ? A FE 55 A CYS 9  1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc3 metalc ? ? B FE . FE ? ? ? 1_555 A CYS 42 SG ? ? A FE 55 A CYS 42 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc4 metalc ? ? B FE . FE ? ? ? 1_555 A CYS 39 SG ? ? A FE 55 A CYS 39 1_555 ? ? ? ? ? ? ? 2.283 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 4  ? CYS A 6  ? TYR A 4  CYS A 6  
A 2 PHE A 49 ? GLU A 51 ? PHE A 49 GLU A 51 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   THR 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    5 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    THR 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     5 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   GLU 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    50 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    GLU 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     50 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE FE A 55' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 6  ? CYS A 6  . ? 1_555 ? 
2 AC1 4 CYS A 9  ? CYS A 9  . ? 1_555 ? 
3 AC1 4 CYS A 39 ? CYS A 39 . ? 1_555 ? 
4 AC1 4 CYS A 42 ? CYS A 42 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1IRO 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IRO 
_atom_sites.fract_transf_matrix[1][1]   0.015615 
_atom_sites.fract_transf_matrix[1][2]   0.009015 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018031 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.030760 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N    . MET A 1 1  ? 19.605 28.118 6.318  1.00 34.33 ? 1   MET A N    1 
ATOM   2   C  CA   . MET A 1 1  ? 19.361 27.134 7.369  1.00 25.35 ? 1   MET A CA   1 
ATOM   3   C  C    . MET A 1 1  ? 18.208 27.651 8.231  1.00 24.33 ? 1   MET A C    1 
ATOM   4   O  O    . MET A 1 1  ? 18.024 28.865 8.330  1.00 29.82 ? 1   MET A O    1 
ATOM   5   C  CB   . MET A 1 1  ? 20.610 27.126 8.299  1.00 27.43 ? 1   MET A CB   1 
ATOM   6   C  CG   . MET A 1 1  ? 21.746 26.319 7.608  1.00 28.03 ? 1   MET A CG   1 
ATOM   7   S  SD   . MET A 1 1  ? 23.171 26.299 8.707  1.00 28.69 ? 1   MET A SD   1 
ATOM   8   C  CE   . MET A 1 1  ? 23.661 28.031 8.424  1.00 35.69 ? 1   MET A CE   1 
ATOM   9   H  H1   . MET A 1 1  ? 18.869 28.215 5.826  1.00 51.50 ? 1   MET A H1   1 
ATOM   10  H  H2   . MET A 1 1  ? 19.820 28.899 6.687  1.00 51.50 ? 1   MET A H2   1 
ATOM   11  H  H3   . MET A 1 1  ? 20.273 27.840 5.801  1.00 51.50 ? 1   MET A H3   1 
ATOM   12  H  HA   . MET A 1 1  ? 19.173 26.246 7.002  1.00 30.42 ? 1   MET A HA   1 
ATOM   13  H  HB2  . MET A 1 1  ? 20.904 28.035 8.466  1.00 32.91 ? 1   MET A HB2  1 
ATOM   14  H  HB3  . MET A 1 1  ? 20.385 26.718 9.150  1.00 32.91 ? 1   MET A HB3  1 
ATOM   15  H  HG2  . MET A 1 1  ? 21.450 25.412 7.431  1.00 33.64 ? 1   MET A HG2  1 
ATOM   16  H  HG3  . MET A 1 1  ? 21.983 26.734 6.764  1.00 33.64 ? 1   MET A HG3  1 
ATOM   17  H  HE1  . MET A 1 1  ? 23.856 28.161 7.493  1.00 53.54 ? 1   MET A HE1  1 
ATOM   18  H  HE2  . MET A 1 1  ? 22.944 28.613 8.685  1.00 53.54 ? 1   MET A HE2  1 
ATOM   19  H  HE3  . MET A 1 1  ? 24.442 28.232 8.946  1.00 53.54 ? 1   MET A HE3  1 
ATOM   20  N  N    . LYS A 1 2  ? 17.463 26.767 8.790  1.00 18.08 ? 2   LYS A N    1 
ATOM   21  C  CA   . LYS A 1 2  ? 16.286 27.076 9.500  1.00 17.06 ? 2   LYS A CA   1 
ATOM   22  C  C    . LYS A 1 2  ? 16.533 27.347 10.944 1.00 13.85 ? 2   LYS A C    1 
ATOM   23  O  O    . LYS A 1 2  ? 17.385 26.697 11.555 1.00 14.56 ? 2   LYS A O    1 
ATOM   24  C  CB   . LYS A 1 2  ? 15.273 25.845 9.385  1.00 22.63 ? 2   LYS A CB   1 
ATOM   25  C  CG   . LYS A 1 2  ? 14.837 25.656 7.949  1.00 32.79 ? 2   LYS A CG   1 
ATOM   26  C  CD   . LYS A 1 2  ? 14.432 26.954 7.300  1.00 36.38 ? 2   LYS A CD   1 
ATOM   27  C  CE   . LYS A 1 2  ? 14.051 26.768 5.840  0.00 35.17 ? 2   LYS A CE   1 
ATOM   28  N  NZ   . LYS A 1 2  ? 13.592 28.042 5.220  0.00 35.70 ? 2   LYS A NZ   1 
ATOM   29  H  H    . LYS A 1 2  ? 17.696 25.941 8.728  1.00 21.70 ? 2   LYS A H    1 
ATOM   30  H  HA   . LYS A 1 2  ? 15.871 27.866 9.096  1.00 20.47 ? 2   LYS A HA   1 
ATOM   31  H  HB2  . LYS A 1 2  ? 15.706 25.037 9.703  1.00 27.16 ? 2   LYS A HB2  1 
ATOM   32  H  HB3  . LYS A 1 2  ? 14.496 26.010 9.942  1.00 27.16 ? 2   LYS A HB3  1 
ATOM   33  N  N    . LYS A 1 3  ? 15.762 28.222 11.530 1.00 14.14 ? 3   LYS A N    1 
ATOM   34  C  CA   . LYS A 1 3  ? 15.683 28.383 12.957 1.00 11.64 ? 3   LYS A CA   1 
ATOM   35  C  C    . LYS A 1 3  ? 14.861 27.257 13.599 1.00 11.02 ? 3   LYS A C    1 
ATOM   36  O  O    . LYS A 1 3  ? 13.994 26.681 12.938 1.00 13.02 ? 3   LYS A O    1 
ATOM   37  C  CB   . LYS A 1 3  ? 15.081 29.710 13.288 1.00 13.78 ? 3   LYS A CB   1 
ATOM   38  C  CG   . LYS A 1 3  ? 15.855 30.895 12.826 1.00 17.59 ? 3   LYS A CG   1 
ATOM   39  C  CD   . LYS A 1 3  ? 15.192 32.215 13.089 1.00 24.27 ? 3   LYS A CD   1 
ATOM   40  C  CE   . LYS A 1 3  ? 15.805 33.332 12.309 1.00 34.90 ? 3   LYS A CE   1 
ATOM   41  N  NZ   . LYS A 1 3  ? 14.991 34.634 12.621 1.00 47.50 ? 3   LYS A NZ   1 
ATOM   42  H  H    . LYS A 1 3  ? 15.274 28.730 11.036 1.00 16.97 ? 3   LYS A H    1 
ATOM   43  H  HA   . LYS A 1 3  ? 16.591 28.354 13.324 1.00 13.97 ? 3   LYS A HA   1 
ATOM   44  H  HB2  . LYS A 1 3  ? 14.194 29.751 12.897 1.00 16.53 ? 3   LYS A HB2  1 
ATOM   45  H  HB3  . LYS A 1 3  ? 14.977 29.768 14.251 1.00 16.53 ? 3   LYS A HB3  1 
ATOM   46  H  HG2  . LYS A 1 3  ? 16.720 30.891 13.265 1.00 21.11 ? 3   LYS A HG2  1 
ATOM   47  H  HG3  . LYS A 1 3  ? 16.010 30.811 11.872 1.00 21.11 ? 3   LYS A HG3  1 
ATOM   48  H  HD2  . LYS A 1 3  ? 14.251 32.148 12.860 1.00 29.12 ? 3   LYS A HD2  1 
ATOM   49  H  HD3  . LYS A 1 3  ? 15.253 32.417 14.035 1.00 29.12 ? 3   LYS A HD3  1 
ATOM   50  H  HE2  . LYS A 1 3  ? 16.733 33.449 12.566 1.00 41.88 ? 3   LYS A HE2  1 
ATOM   51  H  HE3  . LYS A 1 3  ? 15.772 33.136 11.360 1.00 41.88 ? 3   LYS A HE3  1 
ATOM   52  H  HZ1  . LYS A 1 3  ? 15.031 34.807 13.493 1.00 71.25 ? 3   LYS A HZ1  1 
ATOM   53  H  HZ2  . LYS A 1 3  ? 15.339 35.317 12.167 1.00 71.25 ? 3   LYS A HZ2  1 
ATOM   54  H  HZ3  . LYS A 1 3  ? 14.143 34.519 12.379 1.00 71.25 ? 3   LYS A HZ3  1 
ATOM   55  N  N    . TYR A 1 4  ? 15.149 26.979 14.860 1.00 9.75  ? 4   TYR A N    1 
ATOM   56  C  CA   . TYR A 1 4  ? 14.442 26.008 15.635 1.00 9.85  ? 4   TYR A CA   1 
ATOM   57  C  C    . TYR A 1 4  ? 14.022 26.656 16.948 1.00 9.91  ? 4   TYR A C    1 
ATOM   58  O  O    . TYR A 1 4  ? 14.782 27.432 17.487 1.00 14.16 ? 4   TYR A O    1 
ATOM   59  C  CB   . TYR A 1 4  ? 15.261 24.736 15.923 1.00 10.04 ? 4   TYR A CB   1 
ATOM   60  C  CG   . TYR A 1 4  ? 15.344 23.846 14.721 1.00 9.89  ? 4   TYR A CG   1 
ATOM   61  C  CD1  . TYR A 1 4  ? 16.028 24.196 13.570 1.00 11.03 ? 4   TYR A CD1  1 
ATOM   62  C  CD2  . TYR A 1 4  ? 14.712 22.594 14.748 1.00 10.66 ? 4   TYR A CD2  1 
ATOM   63  C  CE1  . TYR A 1 4  ? 16.027 23.362 12.482 1.00 11.92 ? 4   TYR A CE1  1 
ATOM   64  C  CE2  . TYR A 1 4  ? 14.738 21.765 13.668 1.00 12.10 ? 4   TYR A CE2  1 
ATOM   65  C  CZ   . TYR A 1 4  ? 15.391 22.137 12.540 1.00 11.72 ? 4   TYR A CZ   1 
ATOM   66  O  OH   . TYR A 1 4  ? 15.423 21.365 11.394 1.00 15.69 ? 4   TYR A OH   1 
ATOM   67  H  H    . TYR A 1 4  ? 15.796 27.405 15.233 1.00 11.70 ? 4   TYR A H    1 
ATOM   68  H  HA   . TYR A 1 4  ? 13.633 25.751 15.145 1.00 11.81 ? 4   TYR A HA   1 
ATOM   69  H  HB2  . TYR A 1 4  ? 16.156 24.988 16.198 1.00 12.05 ? 4   TYR A HB2  1 
ATOM   70  H  HB3  . TYR A 1 4  ? 14.849 24.250 16.655 1.00 12.05 ? 4   TYR A HB3  1 
ATOM   71  H  HD1  . TYR A 1 4  ? 16.491 25.001 13.534 1.00 13.24 ? 4   TYR A HD1  1 
ATOM   72  H  HD2  . TYR A 1 4  ? 14.267 22.324 15.519 1.00 12.80 ? 4   TYR A HD2  1 
ATOM   73  H  HE1  . TYR A 1 4  ? 16.457 23.623 11.699 1.00 14.30 ? 4   TYR A HE1  1 
ATOM   74  H  HE2  . TYR A 1 4  ? 14.306 20.942 13.704 1.00 14.52 ? 4   TYR A HE2  1 
ATOM   75  H  HH   . TYR A 1 4  ? 14.997 20.676 11.517 1.00 23.54 ? 4   TYR A HH   1 
ATOM   76  N  N    . THR A 1 5  ? 12.874 26.298 17.455 1.00 10.25 ? 5   THR A N    1 
ATOM   77  C  CA   . THR A 1 5  ? 12.428 26.845 18.701 1.00 10.59 ? 5   THR A CA   1 
ATOM   78  C  C    . THR A 1 5  ? 12.295 25.750 19.737 1.00 8.86  ? 5   THR A C    1 
ATOM   79  O  O    . THR A 1 5  ? 11.830 24.661 19.479 1.00 10.48 ? 5   THR A O    1 
ATOM   80  C  CB   A THR A 1 5  ? 11.228 27.698 18.573 0.69 13.26 ? 5   THR A CB   1 
ATOM   81  C  CB   B THR A 1 5  ? 10.855 27.197 18.483 0.31 9.93  ? 5   THR A CB   1 
ATOM   82  O  OG1  A THR A 1 5  ? 10.784 28.231 19.868 0.69 19.29 ? 5   THR A OG1  1 
ATOM   83  O  OG1  B THR A 1 5  ? 10.750 28.126 17.321 0.31 15.26 ? 5   THR A OG1  1 
ATOM   84  C  CG2  A THR A 1 5  ? 10.093 26.853 18.154 0.69 16.73 ? 5   THR A CG2  1 
ATOM   85  C  CG2  B THR A 1 5  ? 10.971 28.287 19.548 0.31 11.66 ? 5   THR A CG2  1 
ATOM   86  H  H    . THR A 1 5  ? 12.382 25.730 17.038 1.00 12.29 ? 5   THR A H    1 
ATOM   87  H  HA   . THR A 1 5  ? 13.147 27.432 19.015 1.00 12.71 ? 5   THR A HA   1 
ATOM   88  N  N    . CYS A 1 6  ? 12.714 26.101 20.967 1.00 9.01  ? 6   CYS A N    1 
ATOM   89  C  CA   . CYS A 1 6  ? 12.485 25.285 22.129 1.00 8.85  ? 6   CYS A CA   1 
ATOM   90  C  C    . CYS A 1 6  ? 11.049 25.389 22.504 1.00 9.54  ? 6   CYS A C    1 
ATOM   91  O  O    . CYS A 1 6  ? 10.548 26.437 22.861 1.00 10.81 ? 6   CYS A O    1 
ATOM   92  C  CB   . CYS A 1 6  ? 13.342 25.778 23.285 1.00 9.57  ? 6   CYS A CB   1 
ATOM   93  S  SG   . CYS A 1 6  ? 13.057 24.795 24.754 1.00 11.01 ? 6   CYS A SG   1 
ATOM   94  H  H    . CYS A 1 6  ? 13.137 26.843 21.061 1.00 10.82 ? 6   CYS A H    1 
ATOM   95  H  HA   . CYS A 1 6  ? 12.707 24.352 21.927 1.00 10.62 ? 6   CYS A HA   1 
ATOM   96  H  HB2  . CYS A 1 6  ? 14.279 25.726 23.038 1.00 11.48 ? 6   CYS A HB2  1 
ATOM   97  H  HB3  . CYS A 1 6  ? 13.131 26.706 23.472 1.00 11.48 ? 6   CYS A HB3  1 
ATOM   98  N  N    . THR A 1 7  ? 10.292 24.282 22.384 1.00 10.26 ? 7   THR A N    1 
ATOM   99  C  CA   . THR A 1 7  ? 8.864  24.350 22.611 1.00 12.01 ? 7   THR A CA   1 
ATOM   100 C  C    . THR A 1 7  ? 8.488  24.417 24.053 1.00 13.13 ? 7   THR A C    1 
ATOM   101 O  O    . THR A 1 7  ? 7.333  24.709 24.381 1.00 17.51 ? 7   THR A O    1 
ATOM   102 C  CB   . THR A 1 7  ? 8.105  23.273 21.895 1.00 14.35 ? 7   THR A CB   1 
ATOM   103 O  OG1  . THR A 1 7  ? 8.359  22.037 22.542 1.00 14.97 ? 7   THR A OG1  1 
ATOM   104 C  CG2  . THR A 1 7  ? 8.353  23.218 20.399 1.00 17.23 ? 7   THR A CG2  1 
ATOM   105 H  H    . THR A 1 7  ? 10.658 23.533 22.173 1.00 12.31 ? 7   THR A H    1 
ATOM   106 H  HA   . THR A 1 7  ? 8.569  25.196 22.215 1.00 14.41 ? 7   THR A HA   1 
ATOM   107 H  HB   . THR A 1 7  ? 7.152  23.467 22.018 1.00 17.23 ? 7   THR A HB   1 
ATOM   108 H  HG1  . THR A 1 7  ? 7.949  21.439 22.160 1.00 22.45 ? 7   THR A HG1  1 
ATOM   109 H  HG21 . THR A 1 7  ? 8.096  24.053 20.001 1.00 25.84 ? 7   THR A HG21 1 
ATOM   110 H  HG22 . THR A 1 7  ? 9.285  23.059 20.235 1.00 25.84 ? 7   THR A HG22 1 
ATOM   111 H  HG23 . THR A 1 7  ? 7.834  22.507 20.015 1.00 25.84 ? 7   THR A HG23 1 
ATOM   112 N  N    . VAL A 1 8  ? 9.426  24.256 24.976 1.00 11.30 ? 8   VAL A N    1 
ATOM   113 C  CA   . VAL A 1 8  ? 9.214  24.395 26.391 1.00 11.61 ? 8   VAL A CA   1 
ATOM   114 C  C    . VAL A 1 8  ? 9.336  25.818 26.862 1.00 12.45 ? 8   VAL A C    1 
ATOM   115 O  O    . VAL A 1 8  ? 8.496  26.277 27.605 1.00 17.94 ? 8   VAL A O    1 
ATOM   116 C  CB   . VAL A 1 8  ? 10.169 23.467 27.127 1.00 14.31 ? 8   VAL A CB   1 
ATOM   117 C  CG1  . VAL A 1 8  ? 10.194 23.822 28.613 1.00 17.67 ? 8   VAL A CG1  1 
ATOM   118 C  CG2  . VAL A 1 8  ? 9.781  22.041 26.863 1.00 17.97 ? 8   VAL A CG2  1 
ATOM   119 H  H    . VAL A 1 8  ? 10.218 24.053 24.709 1.00 13.56 ? 8   VAL A H    1 
ATOM   120 H  HA   . VAL A 1 8  ? 8.301  24.095 26.585 1.00 13.93 ? 8   VAL A HA   1 
ATOM   121 H  HB   . VAL A 1 8  ? 11.069 23.609 26.766 1.00 17.18 ? 8   VAL A HB   1 
ATOM   122 H  HG11 . VAL A 1 8  ? 10.447 24.742 28.718 1.00 26.50 ? 8   VAL A HG11 1 
ATOM   123 H  HG12 . VAL A 1 8  ? 9.321  23.686 28.989 1.00 26.50 ? 8   VAL A HG12 1 
ATOM   124 H  HG13 . VAL A 1 8  ? 10.828 23.261 29.066 1.00 26.50 ? 8   VAL A HG13 1 
ATOM   125 H  HG21 . VAL A 1 8  ? 9.827  21.866 25.920 1.00 26.96 ? 8   VAL A HG21 1 
ATOM   126 H  HG22 . VAL A 1 8  ? 10.383 21.454 27.327 1.00 26.96 ? 8   VAL A HG22 1 
ATOM   127 H  HG23 . VAL A 1 8  ? 8.885  21.891 27.174 1.00 26.96 ? 8   VAL A HG23 1 
ATOM   128 N  N    . CYS A 1 9  ? 10.330 26.567 26.404 1.00 11.26 ? 9   CYS A N    1 
ATOM   129 C  CA   . CYS A 1 9  ? 10.542 27.895 26.873 1.00 10.93 ? 9   CYS A CA   1 
ATOM   130 C  C    . CYS A 1 9  ? 10.479 28.995 25.845 1.00 10.48 ? 9   CYS A C    1 
ATOM   131 O  O    . CYS A 1 9  ? 10.375 30.169 26.239 1.00 12.36 ? 9   CYS A O    1 
ATOM   132 C  CB   . CYS A 1 9  ? 11.849 28.027 27.656 1.00 12.07 ? 9   CYS A CB   1 
ATOM   133 S  SG   . CYS A 1 9  ? 13.348 28.117 26.557 1.00 12.70 ? 9   CYS A SG   1 
ATOM   134 H  H    . CYS A 1 9  ? 10.860 26.242 25.810 1.00 13.51 ? 9   CYS A H    1 
ATOM   135 H  HA   . CYS A 1 9  ? 9.822  28.078 27.512 1.00 13.12 ? 9   CYS A HA   1 
ATOM   136 H  HB2  . CYS A 1 9  ? 11.810 28.828 28.203 1.00 14.48 ? 9   CYS A HB2  1 
ATOM   137 H  HB3  . CYS A 1 9  ? 11.939 27.266 28.251 1.00 14.48 ? 9   CYS A HB3  1 
ATOM   138 N  N    . GLY A 1 10 ? 10.562 28.713 24.563 1.00 10.66 ? 10  GLY A N    1 
ATOM   139 C  CA   . GLY A 1 10 ? 10.517 29.678 23.542 1.00 11.81 ? 10  GLY A CA   1 
ATOM   140 C  C    . GLY A 1 10 ? 11.811 30.195 22.973 1.00 11.12 ? 10  GLY A C    1 
ATOM   141 O  O    . GLY A 1 10 ? 11.813 30.964 22.030 1.00 13.37 ? 10  GLY A O    1 
ATOM   142 H  H    . GLY A 1 10 ? 10.650 27.889 24.335 1.00 12.79 ? 10  GLY A H    1 
ATOM   143 H  HA2  . GLY A 1 10 ? 10.003 29.305 22.809 1.00 14.18 ? 10  GLY A HA2  1 
ATOM   144 H  HA3  . GLY A 1 10 ? 10.020 30.439 23.879 1.00 14.18 ? 10  GLY A HA3  1 
ATOM   145 N  N    . TYR A 1 11 ? 12.933 29.772 23.514 1.00 11.11 ? 11  TYR A N    1 
ATOM   146 C  CA   . TYR A 1 11 ? 14.233 30.092 22.970 1.00 11.37 ? 11  TYR A CA   1 
ATOM   147 C  C    . TYR A 1 11 ? 14.295 29.734 21.495 1.00 10.24 ? 11  TYR A C    1 
ATOM   148 O  O    . TYR A 1 11 ? 13.804 28.682 21.116 1.00 11.47 ? 11  TYR A O    1 
ATOM   149 C  CB   . TYR A 1 11 ? 15.312 29.292 23.718 1.00 11.98 ? 11  TYR A CB   1 
ATOM   150 C  CG   . TYR A 1 11 ? 16.683 29.320 23.093 1.00 12.17 ? 11  TYR A CG   1 
ATOM   151 C  CD1  . TYR A 1 11 ? 17.553 30.372 23.275 1.00 15.96 ? 11  TYR A CD1  1 
ATOM   152 C  CD2  . TYR A 1 11 ? 17.118 28.278 22.328 1.00 12.26 ? 11  TYR A CD2  1 
ATOM   153 C  CE1  . TYR A 1 11 ? 18.806 30.371 22.698 1.00 17.27 ? 11  TYR A CE1  1 
ATOM   154 C  CE2  . TYR A 1 11 ? 18.341 28.269 21.720 1.00 13.53 ? 11  TYR A CE2  1 
ATOM   155 C  CZ   . TYR A 1 11 ? 19.192 29.297 21.900 1.00 15.31 ? 11  TYR A CZ   1 
ATOM   156 O  OH   . TYR A 1 11 ? 20.422 29.307 21.315 1.00 18.81 ? 11  TYR A OH   1 
ATOM   157 H  H    . TYR A 1 11 ? 12.891 29.285 24.222 1.00 13.33 ? 11  TYR A H    1 
ATOM   158 H  HA   . TYR A 1 11 ? 14.405 31.050 23.079 1.00 13.65 ? 11  TYR A HA   1 
ATOM   159 H  HB2  . TYR A 1 11 ? 15.379 29.639 24.621 1.00 14.38 ? 11  TYR A HB2  1 
ATOM   160 H  HB3  . TYR A 1 11 ? 15.021 28.369 23.781 1.00 14.38 ? 11  TYR A HB3  1 
ATOM   161 H  HD1  . TYR A 1 11 ? 17.291 31.097 23.795 1.00 19.15 ? 11  TYR A HD1  1 
ATOM   162 H  HD2  . TYR A 1 11 ? 16.559 27.543 22.216 1.00 14.71 ? 11  TYR A HD2  1 
ATOM   163 H  HE1  . TYR A 1 11 ? 19.389 31.081 22.841 1.00 20.72 ? 11  TYR A HE1  1 
ATOM   164 H  HE2  . TYR A 1 11 ? 18.587 27.551 21.181 1.00 16.23 ? 11  TYR A HE2  1 
ATOM   165 H  HH   . TYR A 1 11 ? 20.817 29.997 21.520 1.00 28.21 ? 11  TYR A HH   1 
ATOM   166 N  N    . ILE A 1 12 ? 14.908 30.570 20.725 1.00 11.17 ? 12  ILE A N    1 
ATOM   167 C  CA   . ILE A 1 12 ? 15.138 30.349 19.316 1.00 11.57 ? 12  ILE A CA   1 
ATOM   168 C  C    . ILE A 1 12 ? 16.582 30.075 19.048 1.00 10.54 ? 12  ILE A C    1 
ATOM   169 O  O    . ILE A 1 12 ? 17.473 30.873 19.361 1.00 13.08 ? 12  ILE A O    1 
ATOM   170 C  CB   . ILE A 1 12 ? 14.662 31.521 18.448 1.00 15.54 ? 12  ILE A CB   1 
ATOM   171 C  CG1  A ILE A 1 12 ? 13.259 31.940 18.645 0.55 18.99 ? 12  ILE A CG1  1 
ATOM   172 C  CG1  B ILE A 1 12 ? 12.934 31.376 18.713 0.45 19.90 ? 12  ILE A CG1  1 
ATOM   173 C  CG2  . ILE A 1 12 ? 15.031 31.244 16.953 1.00 20.64 ? 12  ILE A CG2  1 
ATOM   174 C  CD1  A ILE A 1 12 ? 12.259 30.848 18.172 0.55 25.92 ? 12  ILE A CD1  1 
ATOM   175 C  CD1  B ILE A 1 12 ? 12.379 32.561 17.808 0.45 21.09 ? 12  ILE A CD1  1 
ATOM   176 H  H    . ILE A 1 12 ? 15.195 31.303 21.072 1.00 13.41 ? 12  ILE A H    1 
ATOM   177 H  HA   . ILE A 1 12 ? 14.629 29.555 19.051 1.00 13.89 ? 12  ILE A HA   1 
ATOM   178 H  HB   . ILE A 1 12 ? 15.208 32.289 18.717 1.00 18.65 ? 12  ILE A HB   1 
ATOM   179 H  HG21 . ILE A 1 12 ? 14.604 30.435 16.662 1.00 30.96 ? 12  ILE A HG21 1 
ATOM   180 H  HG22 . ILE A 1 12 ? 14.734 31.977 16.408 1.00 30.96 ? 12  ILE A HG22 1 
ATOM   181 H  HG23 . ILE A 1 12 ? 15.983 31.150 16.870 1.00 30.96 ? 12  ILE A HG23 1 
ATOM   182 N  N    . TYR A 1 13 ? 16.890 28.926 18.479 1.00 10.07 ? 13  TYR A N    1 
ATOM   183 C  CA   . TYR A 1 13 ? 18.188 28.620 17.941 1.00 9.56  ? 13  TYR A CA   1 
ATOM   184 C  C    . TYR A 1 13 ? 18.300 29.219 16.576 1.00 10.28 ? 13  TYR A C    1 
ATOM   185 O  O    . TYR A 1 13 ? 17.529 28.844 15.677 1.00 11.76 ? 13  TYR A O    1 
ATOM   186 C  CB   . TYR A 1 13 ? 18.469 27.127 17.892 1.00 10.30 ? 13  TYR A CB   1 
ATOM   187 C  CG   . TYR A 1 13 ? 19.806 26.868 17.280 1.00 9.88  ? 13  TYR A CG   1 
ATOM   188 C  CD1  . TYR A 1 13 ? 20.961 27.092 17.988 1.00 10.24 ? 13  TYR A CD1  1 
ATOM   189 C  CD2  . TYR A 1 13 ? 19.944 26.467 15.975 1.00 10.13 ? 13  TYR A CD2  1 
ATOM   190 C  CE1  . TYR A 1 13 ? 22.197 26.939 17.421 1.00 10.55 ? 13  TYR A CE1  1 
ATOM   191 C  CE2  . TYR A 1 13 ? 21.206 26.315 15.370 1.00 10.01 ? 13  TYR A CE2  1 
ATOM   192 C  CZ   . TYR A 1 13 ? 22.326 26.568 16.123 1.00 9.98  ? 13  TYR A CZ   1 
ATOM   193 O  OH   . TYR A 1 13 ? 23.580 26.465 15.580 1.00 11.42 ? 13  TYR A OH   1 
ATOM   194 H  H    . TYR A 1 13 ? 16.278 28.324 18.426 1.00 12.09 ? 13  TYR A H    1 
ATOM   195 H  HA   . TYR A 1 13 ? 18.863 29.039 18.515 1.00 11.47 ? 13  TYR A HA   1 
ATOM   196 H  HB2  . TYR A 1 13 ? 18.447 26.763 18.791 1.00 12.36 ? 13  TYR A HB2  1 
ATOM   197 H  HB3  . TYR A 1 13 ? 17.782 26.684 17.370 1.00 12.36 ? 13  TYR A HB3  1 
ATOM   198 H  HD1  . TYR A 1 13 ? 20.901 27.355 18.878 1.00 12.29 ? 13  TYR A HD1  1 
ATOM   199 H  HD2  . TYR A 1 13 ? 19.180 26.290 15.475 1.00 12.15 ? 13  TYR A HD2  1 
ATOM   200 H  HE1  . TYR A 1 13 ? 22.958 27.091 17.933 1.00 12.65 ? 13  TYR A HE1  1 
ATOM   201 H  HE2  . TYR A 1 13 ? 21.280 26.050 14.481 1.00 12.01 ? 13  TYR A HE2  1 
ATOM   202 H  HH   . TYR A 1 13 ? 23.520 26.234 14.796 1.00 17.13 ? 13  TYR A HH   1 
ATOM   203 N  N    . ASN A 1 14 ? 19.232 30.149 16.369 1.00 11.22 ? 14  ASN A N    1 
ATOM   204 C  CA   . ASN A 1 14 ? 19.463 30.790 15.122 1.00 12.28 ? 14  ASN A CA   1 
ATOM   205 C  C    . ASN A 1 14 ? 20.838 30.307 14.618 1.00 11.28 ? 14  ASN A C    1 
ATOM   206 O  O    . ASN A 1 14 ? 21.834 30.618 15.218 1.00 12.11 ? 14  ASN A O    1 
ATOM   207 C  CB   . ASN A 1 14 ? 19.489 32.272 15.292 1.00 16.60 ? 14  ASN A CB   1 
ATOM   208 C  CG   . ASN A 1 14 ? 19.697 32.925 13.916 1.00 20.01 ? 14  ASN A CG   1 
ATOM   209 O  OD1  . ASN A 1 14 ? 20.081 32.347 12.915 1.00 22.51 ? 14  ASN A OD1  1 
ATOM   210 N  ND2  . ASN A 1 14 ? 19.363 34.193 13.985 1.00 32.58 ? 14  ASN A ND2  1 
ATOM   211 H  H    . ASN A 1 14 ? 19.727 30.377 17.035 1.00 13.47 ? 14  ASN A H    1 
ATOM   212 H  HA   . ASN A 1 14 ? 18.764 30.538 14.482 1.00 14.74 ? 14  ASN A HA   1 
ATOM   213 H  HB2  . ASN A 1 14 ? 18.653 32.576 15.679 1.00 19.93 ? 14  ASN A HB2  1 
ATOM   214 H  HB3  . ASN A 1 14 ? 20.211 32.524 15.889 1.00 19.93 ? 14  ASN A HB3  1 
ATOM   215 N  N    . PRO A 1 15 ? 20.869 29.540 13.539 1.00 12.68 ? 15  PRO A N    1 
ATOM   216 C  CA   . PRO A 1 15 ? 22.095 28.978 13.057 1.00 13.82 ? 15  PRO A CA   1 
ATOM   217 C  C    . PRO A 1 15 ? 23.141 30.043 12.710 1.00 14.24 ? 15  PRO A C    1 
ATOM   218 O  O    . PRO A 1 15 ? 24.304 29.698 12.791 1.00 17.92 ? 15  PRO A O    1 
ATOM   219 C  CB   A PRO A 1 15 ? 21.667 28.267 11.746 0.51 15.88 ? 15  PRO A CB   1 
ATOM   220 C  CB   B PRO A 1 15 ? 21.718 27.929 11.967 0.49 15.68 ? 15  PRO A CB   1 
ATOM   221 C  CG   A PRO A 1 15 ? 20.379 28.741 11.389 0.51 15.83 ? 15  PRO A CG   1 
ATOM   222 C  CG   B PRO A 1 15 ? 20.375 28.132 11.822 0.49 16.89 ? 15  PRO A CG   1 
ATOM   223 C  CD   . PRO A 1 15 ? 19.703 29.124 12.726 1.00 14.53 ? 15  PRO A CD   1 
ATOM   224 H  HA   . PRO A 1 15 ? 22.457 28.333 13.700 1.00 16.59 ? 15  PRO A HA   1 
ATOM   225 N  N    . GLU A 1 16 ? 22.761 31.264 12.368 1.00 16.26 ? 16  GLU A N    1 
ATOM   226 C  CA   . GLU A 1 16 ? 23.774 32.289 12.090 1.00 18.27 ? 16  GLU A CA   1 
ATOM   227 C  C    . GLU A 1 16 ? 24.522 32.704 13.325 1.00 17.89 ? 16  GLU A C    1 
ATOM   228 O  O    . GLU A 1 16 ? 25.629 33.197 13.178 1.00 21.16 ? 16  GLU A O    1 
ATOM   229 C  CB   . GLU A 1 16 ? 23.060 33.477 11.482 1.00 23.24 ? 16  GLU A CB   1 
ATOM   230 C  CG   . GLU A 1 16 ? 22.624 33.251 10.062 1.00 30.58 ? 16  GLU A CG   1 
ATOM   231 C  CD   . GLU A 1 16 ? 22.277 34.543 9.326  1.00 37.70 ? 16  GLU A CD   1 
ATOM   232 O  OE1  . GLU A 1 16 ? 22.357 35.677 9.872  1.00 54.86 ? 16  GLU A OE1  1 
ATOM   233 O  OE2  . GLU A 1 16 ? 22.114 34.391 8.100  1.00 54.38 ? 16  GLU A OE2  1 
ATOM   234 H  H    . GLU A 1 16 ? 21.925 31.456 12.309 1.00 19.52 ? 16  GLU A H    1 
ATOM   235 H  HA   . GLU A 1 16 ? 24.412 31.935 11.436 1.00 21.93 ? 16  GLU A HA   1 
ATOM   236 H  HB2  . GLU A 1 16 ? 22.280 33.684 12.020 1.00 27.89 ? 16  GLU A HB2  1 
ATOM   237 H  HB3  . GLU A 1 16 ? 23.651 34.246 11.510 1.00 27.89 ? 16  GLU A HB3  1 
ATOM   238 H  HG2  . GLU A 1 16 ? 23.335 32.797 9.583  1.00 36.69 ? 16  GLU A HG2  1 
ATOM   239 H  HG3  . GLU A 1 16 ? 21.848 32.669 10.060 1.00 36.69 ? 16  GLU A HG3  1 
ATOM   240 N  N    . ASP A 1 17 ? 23.924 32.549 14.462 1.00 14.97 ? 17  ASP A N    1 
ATOM   241 C  CA   . ASP A 1 17 ? 24.479 32.918 15.735 1.00 16.87 ? 17  ASP A CA   1 
ATOM   242 C  C    . ASP A 1 17 ? 25.146 31.730 16.443 1.00 13.33 ? 17  ASP A C    1 
ATOM   243 O  O    . ASP A 1 17 ? 26.069 31.914 17.203 1.00 16.17 ? 17  ASP A O    1 
ATOM   244 C  CB   . ASP A 1 17 ? 23.445 33.516 16.604 1.00 18.18 ? 17  ASP A CB   1 
ATOM   245 C  CG   . ASP A 1 17 ? 22.876 34.795 16.057 1.00 26.52 ? 17  ASP A CG   1 
ATOM   246 O  OD1  . ASP A 1 17 ? 23.609 35.545 15.416 1.00 31.13 ? 17  ASP A OD1  1 
ATOM   247 O  OD2  . ASP A 1 17 ? 21.702 35.049 16.366 1.00 37.44 ? 17  ASP A OD2  1 
ATOM   248 H  H    . ASP A 1 17 ? 23.139 32.200 14.456 1.00 17.97 ? 17  ASP A H    1 
ATOM   249 H  HA   . ASP A 1 17 ? 25.167 33.598 15.577 1.00 20.24 ? 17  ASP A HA   1 
ATOM   250 H  HB2  . ASP A 1 17 ? 22.725 32.877 16.721 1.00 21.82 ? 17  ASP A HB2  1 
ATOM   251 H  HB3  . ASP A 1 17 ? 23.830 33.691 17.477 1.00 21.82 ? 17  ASP A HB3  1 
ATOM   252 N  N    . GLY A 1 18 ? 24.596 30.561 16.231 1.00 12.76 ? 18  GLY A N    1 
ATOM   253 C  CA   . GLY A 1 18 ? 25.033 29.408 16.992 1.00 12.21 ? 18  GLY A CA   1 
ATOM   254 C  C    . GLY A 1 18 ? 24.697 29.539 18.456 1.00 11.28 ? 18  GLY A C    1 
ATOM   255 O  O    . GLY A 1 18 ? 23.809 30.245 18.888 1.00 13.16 ? 18  GLY A O    1 
ATOM   256 H  H    . GLY A 1 18 ? 23.976 30.477 15.640 1.00 15.31 ? 18  GLY A H    1 
ATOM   257 H  HA2  . GLY A 1 18 ? 24.608 28.612 16.637 1.00 14.65 ? 18  GLY A HA2  1 
ATOM   258 H  HA3  . GLY A 1 18 ? 25.992 29.305 16.893 1.00 14.65 ? 18  GLY A HA3  1 
ATOM   259 N  N    . ASP A 1 19 ? 25.464 28.787 19.257 1.00 10.85 ? 19  ASP A N    1 
ATOM   260 C  CA   . ASP A 1 19 ? 25.426 28.868 20.729 1.00 10.29 ? 19  ASP A CA   1 
ATOM   261 C  C    . ASP A 1 19 ? 26.887 28.682 21.156 1.00 10.43 ? 19  ASP A C    1 
ATOM   262 O  O    . ASP A 1 19 ? 27.259 27.636 21.695 1.00 10.66 ? 19  ASP A O    1 
ATOM   263 C  CB   . ASP A 1 19 ? 24.524 27.823 21.310 1.00 10.97 ? 19  ASP A CB   1 
ATOM   264 C  CG   . ASP A 1 19 ? 24.418 27.865 22.811 1.00 11.46 ? 19  ASP A CG   1 
ATOM   265 O  OD1  . ASP A 1 19 ? 24.566 28.952 23.352 1.00 16.12 ? 19  ASP A OD1  1 
ATOM   266 O  OD2  . ASP A 1 19 ? 24.157 26.828 23.404 1.00 12.91 ? 19  ASP A OD2  1 
ATOM   267 H  H    . ASP A 1 19 ? 26.007 28.228 18.894 1.00 13.02 ? 19  ASP A H    1 
ATOM   268 H  HA   . ASP A 1 19 ? 25.116 29.756 21.001 1.00 12.35 ? 19  ASP A HA   1 
ATOM   269 H  HB2  . ASP A 1 19 ? 23.638 27.932 20.932 1.00 13.17 ? 19  ASP A HB2  1 
ATOM   270 H  HB3  . ASP A 1 19 ? 24.851 26.948 21.045 1.00 13.17 ? 19  ASP A HB3  1 
ATOM   271 N  N    . PRO A 1 20 ? 27.712 29.680 20.861 1.00 11.40 ? 20  PRO A N    1 
ATOM   272 C  CA   . PRO A 1 20 ? 29.158 29.484 20.973 1.00 11.41 ? 20  PRO A CA   1 
ATOM   273 C  C    . PRO A 1 20 ? 29.661 29.162 22.331 1.00 12.76 ? 20  PRO A C    1 
ATOM   274 O  O    . PRO A 1 20 ? 30.635 28.441 22.493 1.00 13.90 ? 20  PRO A O    1 
ATOM   275 C  CB   . PRO A 1 20 ? 29.741 30.753 20.400 1.00 14.75 ? 20  PRO A CB   1 
ATOM   276 C  CG   . PRO A 1 20 ? 28.672 31.674 20.180 1.00 19.35 ? 20  PRO A CG   1 
ATOM   277 C  CD   . PRO A 1 20 ? 27.377 30.967 20.231 1.00 12.78 ? 20  PRO A CD   1 
ATOM   278 H  HA   . PRO A 1 20 ? 29.407 28.745 20.379 1.00 13.69 ? 20  PRO A HA   1 
ATOM   279 H  HB2  . PRO A 1 20 ? 30.386 31.132 21.018 1.00 17.70 ? 20  PRO A HB2  1 
ATOM   280 H  HB3  . PRO A 1 20 ? 30.194 30.563 19.563 1.00 17.70 ? 20  PRO A HB3  1 
ATOM   281 H  HG2  . PRO A 1 20 ? 28.693 32.366 20.858 1.00 23.22 ? 20  PRO A HG2  1 
ATOM   282 H  HG3  . PRO A 1 20 ? 28.778 32.097 19.313 1.00 23.22 ? 20  PRO A HG3  1 
ATOM   283 H  HD2  . PRO A 1 20 ? 26.733 31.459 20.765 1.00 15.34 ? 20  PRO A HD2  1 
ATOM   284 H  HD3  . PRO A 1 20 ? 27.016 30.836 19.341 1.00 15.34 ? 20  PRO A HD3  1 
ATOM   285 N  N    . ASP A 1 21 ? 29.018 29.696 23.382 1.00 13.84 ? 21  ASP A N    1 
ATOM   286 C  CA   . ASP A 1 21 ? 29.473 29.464 24.720 1.00 16.07 ? 21  ASP A CA   1 
ATOM   287 C  C    . ASP A 1 21 ? 29.316 27.999 25.163 1.00 14.77 ? 21  ASP A C    1 
ATOM   288 O  O    . ASP A 1 21 ? 29.930 27.627 26.109 1.00 17.51 ? 21  ASP A O    1 
ATOM   289 C  CB   . ASP A 1 21 ? 28.808 30.347 25.697 1.00 23.28 ? 21  ASP A CB   1 
ATOM   290 C  CG   . ASP A 1 21 ? 29.170 31.787 25.567 1.00 35.45 ? 21  ASP A CG   1 
ATOM   291 O  OD1  . ASP A 1 21 ? 30.171 32.148 24.839 1.00 42.86 ? 21  ASP A OD1  1 
ATOM   292 O  OD2  . ASP A 1 21 ? 28.479 32.593 26.245 1.00 41.87 ? 21  ASP A OD2  1 
ATOM   293 H  H    . ASP A 1 21 ? 28.322 30.184 23.250 1.00 16.61 ? 21  ASP A H    1 
ATOM   294 H  HA   . ASP A 1 21 ? 30.430 29.674 24.742 1.00 19.28 ? 21  ASP A HA   1 
ATOM   295 H  HB2  . ASP A 1 21 ? 27.848 30.257 25.593 1.00 27.93 ? 21  ASP A HB2  1 
ATOM   296 H  HB3  . ASP A 1 21 ? 29.036 30.048 26.591 1.00 27.93 ? 21  ASP A HB3  1 
ATOM   297 N  N    . ASN A 1 22 ? 28.480 27.276 24.425 1.00 13.18 ? 22  ASN A N    1 
ATOM   298 C  CA   . ASN A 1 22 ? 28.303 25.885 24.640 1.00 14.29 ? 22  ASN A CA   1 
ATOM   299 C  C    . ASN A 1 22 ? 28.874 25.043 23.479 1.00 12.75 ? 22  ASN A C    1 
ATOM   300 O  O    . ASN A 1 22 ? 28.507 23.903 23.326 1.00 16.59 ? 22  ASN A O    1 
ATOM   301 C  CB   . ASN A 1 22 ? 26.826 25.569 24.874 1.00 15.76 ? 22  ASN A CB   1 
ATOM   302 C  CG   . ASN A 1 22 ? 26.372 26.299 26.151 1.00 20.19 ? 22  ASN A CG   1 
ATOM   303 O  OD1  . ASN A 1 22 ? 26.962 26.056 27.255 1.00 25.48 ? 22  ASN A OD1  1 
ATOM   304 N  ND2  . ASN A 1 22 ? 25.472 27.270 26.020 1.00 22.76 ? 22  ASN A ND2  1 
ATOM   305 H  H    . ASN A 1 22 ? 28.034 27.663 23.800 1.00 15.82 ? 22  ASN A H    1 
ATOM   306 H  HA   . ASN A 1 22 ? 28.793 25.643 25.453 1.00 17.14 ? 22  ASN A HA   1 
ATOM   307 H  HB2  . ASN A 1 22 ? 26.299 25.866 24.116 1.00 18.92 ? 22  ASN A HB2  1 
ATOM   308 H  HB3  . ASN A 1 22 ? 26.703 24.613 24.977 1.00 18.92 ? 22  ASN A HB3  1 
ATOM   309 N  N    . GLY A 1 23 ? 29.763 25.634 22.719 1.00 11.90 ? 23  GLY A N    1 
ATOM   310 C  CA   . GLY A 1 23 ? 30.489 24.910 21.724 1.00 12.45 ? 23  GLY A CA   1 
ATOM   311 C  C    . GLY A 1 23 ? 29.799 24.719 20.390 1.00 10.58 ? 23  GLY A C    1 
ATOM   312 O  O    . GLY A 1 23 ? 30.300 23.936 19.617 1.00 13.57 ? 23  GLY A O    1 
ATOM   313 H  H    . GLY A 1 23 ? 29.912 26.474 22.822 1.00 14.28 ? 23  GLY A H    1 
ATOM   314 H  HA2  . GLY A 1 23 ? 31.328 25.371 21.567 1.00 14.94 ? 23  GLY A HA2  1 
ATOM   315 H  HA3  . GLY A 1 23 ? 30.703 24.035 22.082 1.00 14.94 ? 23  GLY A HA3  1 
ATOM   316 N  N    . VAL A 1 24 ? 28.736 25.437 20.123 1.00 9.57  ? 24  VAL A N    1 
ATOM   317 C  CA   . VAL A 1 24 ? 28.008 25.349 18.879 1.00 8.94  ? 24  VAL A CA   1 
ATOM   318 C  C    . VAL A 1 24 ? 28.341 26.600 18.069 1.00 8.37  ? 24  VAL A C    1 
ATOM   319 O  O    . VAL A 1 24 ? 27.865 27.675 18.390 1.00 10.73 ? 24  VAL A O    1 
ATOM   320 C  CB   . VAL A 1 24 ? 26.521 25.196 19.087 1.00 9.67  ? 24  VAL A CB   1 
ATOM   321 C  CG1  . VAL A 1 24 ? 25.828 25.143 17.771 1.00 11.50 ? 24  VAL A CG1  1 
ATOM   322 C  CG2  . VAL A 1 24 ? 26.258 23.940 19.891 1.00 12.17 ? 24  VAL A CG2  1 
ATOM   323 H  H    . VAL A 1 24 ? 28.458 25.991 20.719 1.00 11.48 ? 24  VAL A H    1 
ATOM   324 H  HA   . VAL A 1 24 ? 28.332 24.567 18.386 1.00 10.72 ? 24  VAL A HA   1 
ATOM   325 H  HB   . VAL A 1 24 ? 26.190 25.969 19.590 1.00 11.60 ? 24  VAL A HB   1 
ATOM   326 H  HG11 . VAL A 1 24 ? 25.998 25.954 17.286 1.00 17.24 ? 24  VAL A HG11 1 
ATOM   327 H  HG12 . VAL A 1 24 ? 26.155 24.395 17.266 1.00 17.24 ? 24  VAL A HG12 1 
ATOM   328 H  HG13 . VAL A 1 24 ? 24.883 25.045 17.910 1.00 17.24 ? 24  VAL A HG13 1 
ATOM   329 H  HG21 . VAL A 1 24 ? 26.715 23.998 20.733 1.00 18.26 ? 24  VAL A HG21 1 
ATOM   330 H  HG22 . VAL A 1 24 ? 25.315 23.849 20.043 1.00 18.26 ? 24  VAL A HG22 1 
ATOM   331 H  HG23 . VAL A 1 24 ? 26.579 23.176 19.405 1.00 18.26 ? 24  VAL A HG23 1 
ATOM   332 N  N    . ASN A 1 25 ? 29.161 26.456 17.070 1.00 8.97  ? 25  ASN A N    1 
ATOM   333 C  CA   . ASN A 1 25 ? 29.674 27.607 16.379 1.00 9.34  ? 25  ASN A CA   1 
ATOM   334 C  C    . ASN A 1 25 ? 28.594 28.185 15.458 1.00 10.15 ? 25  ASN A C    1 
ATOM   335 O  O    . ASN A 1 25 ? 27.736 27.478 14.943 1.00 10.83 ? 25  ASN A O    1 
ATOM   336 C  CB   . ASN A 1 25 ? 30.912 27.260 15.567 1.00 9.74  ? 25  ASN A CB   1 
ATOM   337 C  CG   . ASN A 1 25 ? 32.093 26.965 16.478 1.00 9.16  ? 25  ASN A CG   1 
ATOM   338 O  OD1  . ASN A 1 25 ? 31.942 26.875 17.663 1.00 10.00 ? 25  ASN A OD1  1 
ATOM   339 N  ND2  . ASN A 1 25 ? 33.236 26.772 15.869 1.00 11.46 ? 25  ASN A ND2  1 
ATOM   340 H  H    . ASN A 1 25 ? 29.398 25.667 16.822 1.00 10.76 ? 25  ASN A H    1 
ATOM   341 H  HA   . ASN A 1 25 ? 29.916 28.287 17.042 1.00 11.21 ? 25  ASN A HA   1 
ATOM   342 H  HB2  . ASN A 1 25 ? 30.729 26.484 15.014 1.00 11.69 ? 25  ASN A HB2  1 
ATOM   343 H  HB3  . ASN A 1 25 ? 31.133 28.001 14.981 1.00 11.69 ? 25  ASN A HB3  1 
ATOM   344 H  HD21 . ASN A 1 25 ? 33.937 26.567 16.325 1.00 13.75 ? 25  ASN A HD21 1 
ATOM   345 H  HD22 . ASN A 1 25 ? 33.287 26.851 15.014 1.00 13.75 ? 25  ASN A HD22 1 
ATOM   346 N  N    . PRO A 1 26 ? 28.680 29.455 15.160 1.00 12.19 ? 26  PRO A N    1 
ATOM   347 C  CA   . PRO A 1 26 ? 27.875 30.044 14.108 1.00 12.64 ? 26  PRO A CA   1 
ATOM   348 C  C    . PRO A 1 26 ? 27.985 29.206 12.864 1.00 13.70 ? 26  PRO A C    1 
ATOM   349 O  O    . PRO A 1 26 ? 29.045 28.723 12.481 1.00 15.48 ? 26  PRO A O    1 
ATOM   350 C  CB   . PRO A 1 26 ? 28.447 31.448 13.934 1.00 16.72 ? 26  PRO A CB   1 
ATOM   351 C  CG   . PRO A 1 26 ? 29.174 31.729 15.172 1.00 18.09 ? 26  PRO A CG   1 
ATOM   352 C  CD   . PRO A 1 26 ? 29.600 30.458 15.757 1.00 15.05 ? 26  PRO A CD   1 
ATOM   353 H  HA   . PRO A 1 26 ? 26.939 30.098 14.394 1.00 15.17 ? 26  PRO A HA   1 
ATOM   354 H  HB2  . PRO A 1 26 ? 29.045 31.481 13.171 1.00 20.07 ? 26  PRO A HB2  1 
ATOM   355 H  HB3  . PRO A 1 26 ? 27.735 32.093 13.801 1.00 20.07 ? 26  PRO A HB3  1 
ATOM   356 H  HG2  . PRO A 1 26 ? 29.948 32.284 14.984 1.00 21.71 ? 26  PRO A HG2  1 
ATOM   357 H  HG3  . PRO A 1 26 ? 28.601 32.205 15.794 1.00 21.71 ? 26  PRO A HG3  1 
ATOM   358 H  HD2  . PRO A 1 26 ? 30.521 30.263 15.527 1.00 18.06 ? 26  PRO A HD2  1 
ATOM   359 H  HD3  . PRO A 1 26 ? 29.513 30.475 16.723 1.00 18.06 ? 26  PRO A HD3  1 
ATOM   360 N  N    . GLY A 1 27 ? 26.865 29.073 12.165 1.00 13.18 ? 27  GLY A N    1 
ATOM   361 C  CA   . GLY A 1 27 ? 26.820 28.275 10.941 1.00 15.44 ? 27  GLY A CA   1 
ATOM   362 C  C    . GLY A 1 27 ? 26.499 26.829 11.123 1.00 15.57 ? 27  GLY A C    1 
ATOM   363 O  O    . GLY A 1 27 ? 26.433 26.090 10.133 1.00 21.80 ? 27  GLY A O    1 
ATOM   364 H  H    . GLY A 1 27 ? 26.150 29.466 12.437 1.00 15.82 ? 27  GLY A H    1 
ATOM   365 H  HA2  . GLY A 1 27 ? 26.158 28.662 10.348 1.00 18.53 ? 27  GLY A HA2  1 
ATOM   366 H  HA3  . GLY A 1 27 ? 27.681 28.344 10.500 1.00 18.53 ? 27  GLY A HA3  1 
ATOM   367 N  N    . THR A 1 28 ? 26.217 26.381 12.331 1.00 12.79 ? 28  THR A N    1 
ATOM   368 C  CA   . THR A 1 28 ? 25.845 24.990 12.609 1.00 11.83 ? 28  THR A CA   1 
ATOM   369 C  C    . THR A 1 28 ? 24.384 24.786 12.415 1.00 11.11 ? 28  THR A C    1 
ATOM   370 O  O    . THR A 1 28 ? 23.570 25.385 13.128 1.00 11.97 ? 28  THR A O    1 
ATOM   371 C  CB   . THR A 1 28 ? 26.316 24.609 14.005 1.00 11.53 ? 28  THR A CB   1 
ATOM   372 O  OG1  . THR A 1 28 ? 27.678 24.878 14.185 1.00 13.47 ? 28  THR A OG1  1 
ATOM   373 C  CG2  . THR A 1 28 ? 26.074 23.126 14.222 1.00 13.38 ? 28  THR A CG2  1 
ATOM   374 H  H    . THR A 1 28 ? 26.253 26.933 12.990 1.00 15.35 ? 28  THR A H    1 
ATOM   375 H  HA   . THR A 1 28 ? 26.316 24.419 11.967 1.00 14.19 ? 28  THR A HA   1 
ATOM   376 H  HB   . THR A 1 28 ? 25.800 25.117 14.665 1.00 13.83 ? 28  THR A HB   1 
ATOM   377 H  HG1  . THR A 1 28 ? 27.816 25.678 14.069 1.00 20.20 ? 28  THR A HG1  1 
ATOM   378 H  HG21 . THR A 1 28 ? 26.562 22.623 13.567 1.00 20.07 ? 28  THR A HG21 1 
ATOM   379 H  HG22 . THR A 1 28 ? 26.369 22.879 15.102 1.00 20.07 ? 28  THR A HG22 1 
ATOM   380 H  HG23 . THR A 1 28 ? 25.136 22.939 14.135 1.00 20.07 ? 28  THR A HG23 1 
ATOM   381 N  N    . ASP A 1 29 ? 24.013 23.927 11.481 1.00 11.94 ? 29  ASP A N    1 
ATOM   382 C  CA   . ASP A 1 29 ? 22.605 23.575 11.316 1.00 11.97 ? 29  ASP A CA   1 
ATOM   383 C  C    . ASP A 1 29 ? 22.191 22.768 12.550 1.00 11.02 ? 29  ASP A C    1 
ATOM   384 O  O    . ASP A 1 29 ? 22.952 22.037 13.153 1.00 11.90 ? 29  ASP A O    1 
ATOM   385 C  CB   . ASP A 1 29 ? 22.557 22.640 10.049 1.00 18.19 ? 29  ASP A CB   1 
ATOM   386 C  CG   . ASP A 1 29 ? 21.337 22.385 9.401  1.00 24.52 ? 29  ASP A CG   1 
ATOM   387 O  OD1  . ASP A 1 29 ? 20.363 23.051 9.700  1.00 35.57 ? 29  ASP A OD1  1 
ATOM   388 O  OD2  . ASP A 1 29 ? 21.381 21.671 8.358  1.00 39.82 ? 29  ASP A OD2  1 
ATOM   389 H  H    . ASP A 1 29 ? 24.605 23.573 10.966 1.00 14.32 ? 29  ASP A H    1 
ATOM   390 H  HA   . ASP A 1 29 ? 22.044 24.371 11.200 1.00 14.36 ? 29  ASP A HA   1 
ATOM   391 H  HB2  . ASP A 1 29 ? 23.159 23.019 9.390  1.00 21.83 ? 29  ASP A HB2  1 
ATOM   392 H  HB3  . ASP A 1 29 ? 22.928 21.783 10.310 1.00 21.83 ? 29  ASP A HB3  1 
ATOM   393 N  N    . PHE A 1 30 ? 20.909 22.897 12.912 1.00 11.25 ? 30  PHE A N    1 
ATOM   394 C  CA   . PHE A 1 30 ? 20.434 22.226 14.109 1.00 10.55 ? 30  PHE A CA   1 
ATOM   395 C  C    . PHE A 1 30 ? 20.701 20.750 14.134 1.00 10.93 ? 30  PHE A C    1 
ATOM   396 O  O    . PHE A 1 30 ? 21.059 20.181 15.168 1.00 11.23 ? 30  PHE A O    1 
ATOM   397 C  CB   . PHE A 1 30 ? 18.935 22.520 14.257 1.00 12.92 ? 30  PHE A CB   1 
ATOM   398 C  CG   . PHE A 1 30 ? 18.370 22.130 15.597 1.00 11.12 ? 30  PHE A CG   1 
ATOM   399 C  CD1  . PHE A 1 30 ? 18.549 22.949 16.703 1.00 12.10 ? 30  PHE A CD1  1 
ATOM   400 C  CD2  . PHE A 1 30 ? 17.672 20.956 15.798 1.00 12.08 ? 30  PHE A CD2  1 
ATOM   401 C  CE1  . PHE A 1 30 ? 18.072 22.606 17.965 1.00 12.97 ? 30  PHE A CE1  1 
ATOM   402 C  CE2  . PHE A 1 30 ? 17.160 20.631 17.036 1.00 12.99 ? 30  PHE A CE2  1 
ATOM   403 C  CZ   . PHE A 1 30 ? 17.381 21.460 18.100 1.00 13.22 ? 30  PHE A CZ   1 
ATOM   404 H  H    . PHE A 1 30 ? 20.371 23.374 12.440 1.00 13.50 ? 30  PHE A H    1 
ATOM   405 H  HA   . PHE A 1 30 ? 20.893 22.625 14.877 1.00 12.65 ? 30  PHE A HA   1 
ATOM   406 H  HB2  . PHE A 1 30 ? 18.787 23.468 14.120 1.00 15.51 ? 30  PHE A HB2  1 
ATOM   407 H  HB3  . PHE A 1 30 ? 18.453 22.043 13.564 1.00 15.51 ? 30  PHE A HB3  1 
ATOM   408 H  HD1  . PHE A 1 30 ? 19.002 23.755 16.597 1.00 14.52 ? 30  PHE A HD1  1 
ATOM   409 H  HD2  . PHE A 1 30 ? 17.544 20.374 15.084 1.00 14.50 ? 30  PHE A HD2  1 
ATOM   410 H  HE1  . PHE A 1 30 ? 18.228 23.157 18.698 1.00 15.56 ? 30  PHE A HE1  1 
ATOM   411 H  HE2  . PHE A 1 30 ? 16.667 19.850 17.147 1.00 15.58 ? 30  PHE A HE2  1 
ATOM   412 H  HZ   . PHE A 1 30 ? 17.046 21.227 18.935 1.00 15.86 ? 30  PHE A HZ   1 
ATOM   413 N  N    . LYS A 1 31 ? 20.525 20.085 12.997 1.00 12.85 ? 31  LYS A N    1 
ATOM   414 C  CA   . LYS A 1 31 ? 20.742 18.640 12.941 1.00 13.70 ? 31  LYS A CA   1 
ATOM   415 C  C    . LYS A 1 31 ? 22.157 18.258 13.324 1.00 14.10 ? 31  LYS A C    1 
ATOM   416 O  O    . LYS A 1 31 ? 22.353 17.141 13.833 1.00 19.68 ? 31  LYS A O    1 
ATOM   417 C  CB   . LYS A 1 31 ? 20.480 18.174 11.517 1.00 16.91 ? 31  LYS A CB   1 
ATOM   418 C  CG   A LYS A 1 31 ? 21.482 18.270 10.478 0.48 22.11 ? 31  LYS A CG   1 
ATOM   419 C  CG   B LYS A 1 31 ? 21.146 18.725 10.342 0.52 23.45 ? 31  LYS A CG   1 
ATOM   420 C  CD   A LYS A 1 31 ? 21.074 17.310 9.251  0.48 32.75 ? 31  LYS A CD   1 
ATOM   421 C  CD   B LYS A 1 31 ? 20.636 18.064 8.938  0.52 29.83 ? 31  LYS A CD   1 
ATOM   422 C  CE   A LYS A 1 31 ? 22.288 16.913 8.494  0.48 33.30 ? 31  LYS A CE   1 
ATOM   423 C  CE   B LYS A 1 31 ? 21.577 18.258 7.852  0.52 34.43 ? 31  LYS A CE   1 
ATOM   424 N  NZ   A LYS A 1 31 ? 23.264 16.075 9.265  0.48 36.60 ? 31  LYS A NZ   1 
ATOM   425 N  NZ   B LYS A 1 31 ? 22.515 19.425 7.904  0.52 41.90 ? 31  LYS A NZ   1 
ATOM   426 H  H    . LYS A 1 31 ? 20.282 20.508 12.289 1.00 15.42 ? 31  LYS A H    1 
ATOM   427 H  HA   . LYS A 1 31 ? 20.113 18.196 13.547 1.00 16.44 ? 31  LYS A HA   1 
ATOM   428 H  HB2  . LYS A 1 31 ? 20.221 17.241 11.571 1.00 20.29 ? 31  LYS A HB2  1 
ATOM   429 H  HB3  . LYS A 1 31 ? 19.702 18.660 11.201 1.00 20.29 ? 31  LYS A HB3  1 
ATOM   430 N  N    . ASP A 1 32 ? 23.126 19.133 13.062 1.00 11.76 ? 32  ASP A N    1 
ATOM   431 C  CA   . ASP A 1 32 ? 24.511 18.875 13.339 1.00 12.95 ? 32  ASP A CA   1 
ATOM   432 C  C    . ASP A 1 32 ? 24.971 19.234 14.733 1.00 10.83 ? 32  ASP A C    1 
ATOM   433 O  O    . ASP A 1 32 ? 26.086 18.960 15.122 1.00 14.31 ? 32  ASP A O    1 
ATOM   434 C  CB   . ASP A 1 32 ? 25.407 19.506 12.323 1.00 14.35 ? 32  ASP A CB   1 
ATOM   435 C  CG   . ASP A 1 32 ? 25.174 18.897 10.949 1.00 20.17 ? 32  ASP A CG   1 
ATOM   436 O  OD1  . ASP A 1 32 ? 24.955 17.718 10.839 1.00 24.97 ? 32  ASP A OD1  1 
ATOM   437 O  OD2  . ASP A 1 32 ? 25.103 19.698 10.006 1.00 24.95 ? 32  ASP A OD2  1 
ATOM   438 H  H    . ASP A 1 32 ? 22.913 19.888 12.710 1.00 14.11 ? 32  ASP A H    1 
ATOM   439 H  HA   . ASP A 1 32 ? 24.634 17.907 13.250 1.00 15.54 ? 32  ASP A HA   1 
ATOM   440 H  HB2  . ASP A 1 32 ? 25.234 20.460 12.287 1.00 17.22 ? 32  ASP A HB2  1 
ATOM   441 H  HB3  . ASP A 1 32 ? 26.332 19.377 12.582 1.00 17.22 ? 32  ASP A HB3  1 
ATOM   442 N  N    . ILE A 1 33 ? 24.131 19.892 15.515 1.00 10.16 ? 33  ILE A N    1 
ATOM   443 C  CA   . ILE A 1 33 ? 24.428 20.160 16.906 1.00 9.51  ? 33  ILE A CA   1 
ATOM   444 C  C    . ILE A 1 33 ? 24.598 18.809 17.613 1.00 8.62  ? 33  ILE A C    1 
ATOM   445 O  O    . ILE A 1 33 ? 23.709 17.950 17.448 1.00 9.09  ? 33  ILE A O    1 
ATOM   446 C  CB   . ILE A 1 33 ? 23.336 20.967 17.577 1.00 9.58  ? 33  ILE A CB   1 
ATOM   447 C  CG1  . ILE A 1 33 ? 23.225 22.370 16.924 1.00 11.19 ? 33  ILE A CG1  1 
ATOM   448 C  CG2  . ILE A 1 33 ? 23.547 21.072 19.058 1.00 11.64 ? 33  ILE A CG2  1 
ATOM   449 C  CD1  . ILE A 1 33 ? 22.086 23.160 17.518 1.00 13.99 ? 33  ILE A CD1  1 
ATOM   450 H  H    . ILE A 1 33 ? 23.385 20.168 15.187 1.00 12.19 ? 33  ILE A H    1 
ATOM   451 H  HA   . ILE A 1 33 ? 25.271 20.657 16.961 1.00 11.42 ? 33  ILE A HA   1 
ATOM   452 H  HB   . ILE A 1 33 ? 22.486 20.501 17.429 1.00 11.50 ? 33  ILE A HB   1 
ATOM   453 H  HG12 . ILE A 1 33 ? 24.055 22.854 17.056 1.00 13.43 ? 33  ILE A HG12 1 
ATOM   454 H  HG13 . ILE A 1 33 ? 23.084 22.271 15.969 1.00 13.43 ? 33  ILE A HG13 1 
ATOM   455 H  HG21 . ILE A 1 33 ? 23.551 20.193 19.444 1.00 17.45 ? 33  ILE A HG21 1 
ATOM   456 H  HG22 . ILE A 1 33 ? 24.388 21.502 19.232 1.00 17.45 ? 33  ILE A HG22 1 
ATOM   457 H  HG23 . ILE A 1 33 ? 22.838 21.589 19.447 1.00 17.45 ? 33  ILE A HG23 1 
ATOM   458 H  HD11 . ILE A 1 33 ? 22.231 23.272 18.460 1.00 20.98 ? 33  ILE A HD11 1 
ATOM   459 H  HD12 . ILE A 1 33 ? 22.040 24.022 17.097 1.00 20.98 ? 33  ILE A HD12 1 
ATOM   460 H  HD13 . ILE A 1 33 ? 21.262 22.690 17.374 1.00 20.98 ? 33  ILE A HD13 1 
ATOM   461 N  N    . PRO A 1 34 ? 25.628 18.601 18.393 1.00 9.69  ? 34  PRO A N    1 
ATOM   462 C  CA   . PRO A 1 34 ? 25.736 17.332 19.121 1.00 9.84  ? 34  PRO A CA   1 
ATOM   463 C  C    . PRO A 1 34 ? 24.467 17.055 19.928 1.00 8.53  ? 34  PRO A C    1 
ATOM   464 O  O    . PRO A 1 34 ? 23.904 17.924 20.561 1.00 9.61  ? 34  PRO A O    1 
ATOM   465 C  CB   . PRO A 1 34 ? 26.913 17.554 20.043 1.00 12.34 ? 34  PRO A CB   1 
ATOM   466 C  CG   . PRO A 1 34 ? 27.763 18.535 19.222 1.00 15.58 ? 34  PRO A CG   1 
ATOM   467 C  CD   . PRO A 1 34 ? 26.764 19.476 18.662 1.00 12.00 ? 34  PRO A CD   1 
ATOM   468 H  HA   . PRO A 1 34 ? 25.918 16.594 18.502 1.00 11.80 ? 34  PRO A HA   1 
ATOM   469 H  HB2  . PRO A 1 34 ? 26.635 17.944 20.886 1.00 14.81 ? 34  PRO A HB2  1 
ATOM   470 H  HB3  . PRO A 1 34 ? 27.391 16.727 20.214 1.00 14.81 ? 34  PRO A HB3  1 
ATOM   471 H  HG2  . PRO A 1 34 ? 28.401 18.999 19.786 1.00 18.70 ? 34  PRO A HG2  1 
ATOM   472 H  HG3  . PRO A 1 34 ? 28.242 18.074 18.515 1.00 18.70 ? 34  PRO A HG3  1 
ATOM   473 H  HD2  . PRO A 1 34 ? 26.533 20.167 19.302 1.00 14.40 ? 34  PRO A HD2  1 
ATOM   474 H  HD3  . PRO A 1 34 ? 27.089 19.892 17.848 1.00 14.40 ? 34  PRO A HD3  1 
ATOM   475 N  N    . ASP A 1 35 ? 24.088 15.776 19.937 1.00 8.55  ? 35  ASP A N    1 
ATOM   476 C  CA   . ASP A 1 35 ? 22.787 15.407 20.450 1.00 8.42  ? 35  ASP A CA   1 
ATOM   477 C  C    . ASP A 1 35 ? 22.678 15.460 21.965 1.00 9.95  ? 35  ASP A C    1 
ATOM   478 O  O    . ASP A 1 35 ? 21.576 15.224 22.442 1.00 12.64 ? 35  ASP A O    1 
ATOM   479 C  CB   . ASP A 1 35 ? 22.369 14.067 19.876 1.00 9.12  ? 35  ASP A CB   1 
ATOM   480 C  CG   . ASP A 1 35 ? 21.864 14.130 18.486 1.00 9.07  ? 35  ASP A CG   1 
ATOM   481 O  OD1  . ASP A 1 35 ? 21.499 15.151 17.959 1.00 10.15 ? 35  ASP A OD1  1 
ATOM   482 O  OD2  . ASP A 1 35 ? 21.810 12.973 17.880 1.00 10.59 ? 35  ASP A OD2  1 
ATOM   483 H  H    . ASP A 1 35 ? 24.618 15.169 19.638 1.00 10.26 ? 35  ASP A H    1 
ATOM   484 H  HA   . ASP A 1 35 ? 22.153 16.069 20.103 1.00 10.10 ? 35  ASP A HA   1 
ATOM   485 H  HB2  . ASP A 1 35 ? 23.130 13.466 19.904 1.00 10.94 ? 35  ASP A HB2  1 
ATOM   486 H  HB3  . ASP A 1 35 ? 21.676 13.689 20.441 1.00 10.94 ? 35  ASP A HB3  1 
ATOM   487 N  N    . ASP A 1 36 ? 23.725 15.801 22.684 1.00 9.22  ? 36  ASP A N    1 
ATOM   488 C  CA   . ASP A 1 36 ? 23.674 16.055 24.087 1.00 10.92 ? 36  ASP A CA   1 
ATOM   489 C  C    . ASP A 1 36 ? 23.534 17.515 24.449 1.00 10.85 ? 36  ASP A C    1 
ATOM   490 O  O    . ASP A 1 36 ? 23.471 17.823 25.628 1.00 13.62 ? 36  ASP A O    1 
ATOM   491 C  CB   . ASP A 1 36 ? 24.853 15.392 24.809 1.00 13.92 ? 36  ASP A CB   1 
ATOM   492 C  CG   . ASP A 1 36 ? 26.189 15.945 24.390 1.00 14.15 ? 36  ASP A CG   1 
ATOM   493 O  OD1  . ASP A 1 36 ? 26.297 16.608 23.414 1.00 14.59 ? 36  ASP A OD1  1 
ATOM   494 O  OD2  . ASP A 1 36 ? 27.134 15.576 25.128 1.00 20.77 ? 36  ASP A OD2  1 
ATOM   495 H  H    . ASP A 1 36 ? 24.483 15.876 22.285 1.00 11.07 ? 36  ASP A H    1 
ATOM   496 H  HA   . ASP A 1 36 ? 22.865 15.611 24.417 1.00 13.10 ? 36  ASP A HA   1 
ATOM   497 H  HB2  . ASP A 1 36 ? 24.747 15.516 25.765 1.00 16.71 ? 36  ASP A HB2  1 
ATOM   498 H  HB3  . ASP A 1 36 ? 24.837 14.439 24.631 1.00 16.71 ? 36  ASP A HB3  1 
ATOM   499 N  N    . TRP A 1 37 ? 23.475 18.384 23.461 1.00 9.93  ? 37  TRP A N    1 
ATOM   500 C  CA   . TRP A 1 37 ? 23.239 19.793 23.732 1.00 9.87  ? 37  TRP A CA   1 
ATOM   501 C  C    . TRP A 1 37 ? 21.846 19.983 24.278 1.00 9.49  ? 37  TRP A C    1 
ATOM   502 O  O    . TRP A 1 37 ? 20.894 19.306 23.898 1.00 11.78 ? 37  TRP A O    1 
ATOM   503 C  CB   . TRP A 1 37 ? 23.434 20.539 22.453 1.00 10.81 ? 37  TRP A CB   1 
ATOM   504 C  CG   . TRP A 1 37 ? 23.181 22.000 22.438 1.00 10.31 ? 37  TRP A CG   1 
ATOM   505 C  CD1  . TRP A 1 37 ? 24.077 22.993 22.686 1.00 11.35 ? 37  TRP A CD1  1 
ATOM   506 C  CD2  . TRP A 1 37 ? 21.964 22.638 22.091 1.00 9.68  ? 37  TRP A CD2  1 
ATOM   507 N  NE1  . TRP A 1 37 ? 23.499 24.219 22.500 1.00 11.51 ? 37  TRP A NE1  1 
ATOM   508 C  CE2  . TRP A 1 37 ? 22.213 24.039 22.118 1.00 10.25 ? 37  TRP A CE2  1 
ATOM   509 C  CE3  . TRP A 1 37 ? 20.725 22.198 21.738 1.00 11.85 ? 37  TRP A CE3  1 
ATOM   510 C  CZ2  . TRP A 1 37 ? 21.219 24.957 21.798 1.00 11.86 ? 37  TRP A CZ2  1 
ATOM   511 C  CZ3  . TRP A 1 37 ? 19.769 23.105 21.413 1.00 14.01 ? 37  TRP A CZ3  1 
ATOM   512 C  CH2  . TRP A 1 37 ? 20.017 24.461 21.458 1.00 13.42 ? 37  TRP A CH2  1 
ATOM   513 H  H    . TRP A 1 37 ? 23.576 18.116 22.650 1.00 11.91 ? 37  TRP A H    1 
ATOM   514 H  HA   . TRP A 1 37 ? 23.891 20.108 24.393 1.00 11.84 ? 37  TRP A HA   1 
ATOM   515 H  HB2  . TRP A 1 37 ? 24.350 20.395 22.165 1.00 12.97 ? 37  TRP A HB2  1 
ATOM   516 H  HB3  . TRP A 1 37 ? 22.859 20.133 21.785 1.00 12.97 ? 37  TRP A HB3  1 
ATOM   517 H  HD1  . TRP A 1 37 ? 24.960 22.858 22.945 1.00 13.62 ? 37  TRP A HD1  1 
ATOM   518 H  HE1  . TRP A 1 37 ? 23.888 24.979 22.608 1.00 13.82 ? 37  TRP A HE1  1 
ATOM   519 H  HE3  . TRP A 1 37 ? 20.536 21.288 21.720 1.00 14.23 ? 37  TRP A HE3  1 
ATOM   520 H  HZ2  . TRP A 1 37 ? 21.379 25.873 21.819 1.00 14.23 ? 37  TRP A HZ2  1 
ATOM   521 H  HZ3  . TRP A 1 37 ? 18.928 22.805 21.154 1.00 16.81 ? 37  TRP A HZ3  1 
ATOM   522 H  HH2  . TRP A 1 37 ? 19.330 25.051 21.245 1.00 16.10 ? 37  TRP A HH2  1 
ATOM   523 N  N    . VAL A 1 38 ? 21.712 20.975 25.119 1.00 10.55 ? 38  VAL A N    1 
ATOM   524 C  CA   . VAL A 1 38 ? 20.419 21.364 25.709 1.00 10.91 ? 38  VAL A CA   1 
ATOM   525 C  C    . VAL A 1 38 ? 20.153 22.837 25.484 1.00 10.34 ? 38  VAL A C    1 
ATOM   526 O  O    . VAL A 1 38 ? 21.003 23.665 25.266 1.00 11.56 ? 38  VAL A O    1 
ATOM   527 C  CB   . VAL A 1 38 ? 20.392 21.039 27.193 1.00 13.77 ? 38  VAL A CB   1 
ATOM   528 C  CG1  . VAL A 1 38 ? 20.513 19.554 27.422 1.00 15.71 ? 38  VAL A CG1  1 
ATOM   529 C  CG2  . VAL A 1 38 ? 21.354 21.809 28.018 1.00 16.91 ? 38  VAL A CG2  1 
ATOM   530 H  H    . VAL A 1 38 ? 22.413 21.422 25.338 1.00 12.66 ? 38  VAL A H    1 
ATOM   531 H  HA   . VAL A 1 38 ? 19.710 20.851 25.267 1.00 13.09 ? 38  VAL A HA   1 
ATOM   532 H  HB   . VAL A 1 38 ? 19.500 21.291 27.510 1.00 16.52 ? 38  VAL A HB   1 
ATOM   533 H  HG11 . VAL A 1 38 ? 19.876 19.092 26.872 1.00 23.57 ? 38  VAL A HG11 1 
ATOM   534 H  HG12 . VAL A 1 38 ? 21.400 19.267 27.195 1.00 23.57 ? 38  VAL A HG12 1 
ATOM   535 H  HG13 . VAL A 1 38 ? 20.340 19.358 28.346 1.00 23.57 ? 38  VAL A HG13 1 
ATOM   536 H  HG21 . VAL A 1 38 ? 21.246 22.747 27.844 1.00 25.37 ? 38  VAL A HG21 1 
ATOM   537 H  HG22 . VAL A 1 38 ? 21.189 21.634 28.947 1.00 25.37 ? 38  VAL A HG22 1 
ATOM   538 H  HG23 . VAL A 1 38 ? 22.249 21.543 27.796 1.00 25.37 ? 38  VAL A HG23 1 
ATOM   539 N  N    . CYS A 1 39 ? 18.858 23.190 25.575 1.00 10.85 ? 39  CYS A N    1 
ATOM   540 C  CA   . CYS A 1 39 ? 18.443 24.558 25.482 1.00 10.20 ? 39  CYS A CA   1 
ATOM   541 C  C    . CYS A 1 39 ? 19.203 25.423 26.492 1.00 10.65 ? 39  CYS A C    1 
ATOM   542 O  O    . CYS A 1 39 ? 19.176 25.089 27.673 1.00 13.12 ? 39  CYS A O    1 
ATOM   543 C  CB   . CYS A 1 39 ? 16.944 24.627 25.766 1.00 10.86 ? 39  CYS A CB   1 
ATOM   544 S  SG   . CYS A 1 39 ? 16.338 26.330 25.709 1.00 11.53 ? 39  CYS A SG   1 
ATOM   545 H  H    . CYS A 1 39 ? 18.264 22.579 25.693 1.00 13.02 ? 39  CYS A H    1 
ATOM   546 H  HA   . CYS A 1 39 ? 18.618 24.888 24.576 1.00 12.24 ? 39  CYS A HA   1 
ATOM   547 H  HB2  . CYS A 1 39 ? 16.468 24.095 25.109 1.00 13.03 ? 39  CYS A HB2  1 
ATOM   548 H  HB3  . CYS A 1 39 ? 16.765 24.252 26.642 1.00 13.03 ? 39  CYS A HB3  1 
ATOM   549 N  N    . PRO A 1 40 ? 19.811 26.494 26.064 1.00 11.57 ? 40  PRO A N    1 
ATOM   550 C  CA   . PRO A 1 40 ? 20.616 27.283 27.010 1.00 14.28 ? 40  PRO A CA   1 
ATOM   551 C  C    . PRO A 1 40 ? 19.755 27.945 28.065 1.00 14.93 ? 40  PRO A C    1 
ATOM   552 O  O    . PRO A 1 40 ? 20.282 28.331 29.115 1.00 21.10 ? 40  PRO A O    1 
ATOM   553 C  CB   . PRO A 1 40 ? 21.348 28.278 26.154 1.00 18.15 ? 40  PRO A CB   1 
ATOM   554 C  CG   . PRO A 1 40 ? 20.873 28.154 24.814 1.00 18.99 ? 40  PRO A CG   1 
ATOM   555 C  CD   . PRO A 1 40 ? 20.012 26.926 24.701 1.00 13.44 ? 40  PRO A CD   1 
ATOM   556 H  HA   . PRO A 1 40 ? 21.266 26.695 27.448 1.00 17.13 ? 40  PRO A HA   1 
ATOM   557 H  HB2  . PRO A 1 40 ? 21.190 29.178 26.480 1.00 21.78 ? 40  PRO A HB2  1 
ATOM   558 H  HB3  . PRO A 1 40 ? 22.302 28.105 26.185 1.00 21.78 ? 40  PRO A HB3  1 
ATOM   559 H  HG2  . PRO A 1 40 ? 20.356 28.939 24.574 1.00 22.78 ? 40  PRO A HG2  1 
ATOM   560 H  HG3  . PRO A 1 40 ? 21.623 28.086 24.204 1.00 22.78 ? 40  PRO A HG3  1 
ATOM   561 H  HD2  . PRO A 1 40 ? 19.166 27.136 24.277 1.00 16.12 ? 40  PRO A HD2  1 
ATOM   562 H  HD3  . PRO A 1 40 ? 20.460 26.238 24.184 1.00 16.12 ? 40  PRO A HD3  1 
ATOM   563 N  N    . LEU A 1 41 ? 18.497 28.205 27.797 1.00 13.71 ? 41  LEU A N    1 
ATOM   564 C  CA   . LEU A 1 41 ? 17.669 28.925 28.699 1.00 15.79 ? 41  LEU A CA   1 
ATOM   565 C  C    . LEU A 1 41 ? 17.001 28.027 29.659 1.00 17.30 ? 41  LEU A C    1 
ATOM   566 O  O    . LEU A 1 41 ? 16.796 28.417 30.803 1.00 31.50 ? 41  LEU A O    1 
ATOM   567 C  CB   A LEU A 1 41 ? 16.720 29.944 28.016 0.74 16.11 ? 41  LEU A CB   1 
ATOM   568 C  CB   B LEU A 1 41 ? 16.528 29.493 27.988 0.26 17.06 ? 41  LEU A CB   1 
ATOM   569 C  CG   A LEU A 1 41 ? 17.364 31.023 27.164 0.74 18.10 ? 41  LEU A CG   1 
ATOM   570 C  CG   B LEU A 1 41 ? 15.682 30.376 28.817 0.26 18.03 ? 41  LEU A CG   1 
ATOM   571 C  CD1  A LEU A 1 41 ? 16.367 32.003 26.592 0.74 21.27 ? 41  LEU A CD1  1 
ATOM   572 C  CD1  B LEU A 1 41 ? 14.456 30.943 28.196 0.26 19.57 ? 41  LEU A CD1  1 
ATOM   573 C  CD2  A LEU A 1 41 ? 18.512 31.736 27.835 0.74 24.16 ? 41  LEU A CD2  1 
ATOM   574 C  CD2  B LEU A 1 41 ? 15.625 30.165 30.274 0.26 21.09 ? 41  LEU A CD2  1 
ATOM   575 H  H    . LEU A 1 41 ? 18.164 27.931 27.053 1.00 16.46 ? 41  LEU A H    1 
ATOM   576 H  HA   . LEU A 1 41 ? 18.284 29.466 29.237 1.00 18.95 ? 41  LEU A HA   1 
ATOM   577 N  N    . CYS A 1 42 ? 16.485 26.853 29.246 1.00 14.25 ? 42  CYS A N    1 
ATOM   578 C  CA   . CYS A 1 42 ? 15.722 26.002 30.043 1.00 14.25 ? 42  CYS A CA   1 
ATOM   579 C  C    . CYS A 1 42 ? 16.267 24.637 30.296 1.00 15.22 ? 42  CYS A C    1 
ATOM   580 O  O    . CYS A 1 42 ? 15.683 23.873 31.140 1.00 17.31 ? 42  CYS A O    1 
ATOM   581 C  CB   . CYS A 1 42 ? 14.215 25.899 29.658 1.00 15.45 ? 42  CYS A CB   1 
ATOM   582 S  SG   . CYS A 1 42 ? 13.984 24.830 28.199 1.00 13.94 ? 42  CYS A SG   1 
ATOM   583 H  H    . CYS A 1 42 ? 16.637 26.612 28.434 1.00 17.11 ? 42  CYS A H    1 
ATOM   584 H  HA   . CYS A 1 42 ? 15.720 26.431 30.924 1.00 17.10 ? 42  CYS A HA   1 
ATOM   585 H  HB2  . CYS A 1 42 ? 13.715 25.537 30.406 1.00 18.54 ? 42  CYS A HB2  1 
ATOM   586 H  HB3  . CYS A 1 42 ? 13.870 26.785 29.467 1.00 18.54 ? 42  CYS A HB3  1 
ATOM   587 N  N    . GLY A 1 43 ? 17.261 24.181 29.600 1.00 14.26 ? 43  GLY A N    1 
ATOM   588 C  CA   . GLY A 1 43 ? 17.914 22.938 29.900 1.00 15.52 ? 43  GLY A CA   1 
ATOM   589 C  C    . GLY A 1 43 ? 17.337 21.710 29.310 1.00 14.28 ? 43  GLY A C    1 
ATOM   590 O  O    . GLY A 1 43 ? 17.839 20.620 29.556 1.00 16.41 ? 43  GLY A O    1 
ATOM   591 H  H    . GLY A 1 43 ? 17.541 24.643 28.931 1.00 17.11 ? 43  GLY A H    1 
ATOM   592 H  HA2  . GLY A 1 43 ? 18.837 23.006 29.607 1.00 18.63 ? 43  GLY A HA2  1 
ATOM   593 H  HA3  . GLY A 1 43 ? 17.926 22.830 30.864 1.00 18.63 ? 43  GLY A HA3  1 
ATOM   594 N  N    . VAL A 1 44 ? 16.274 21.756 28.492 1.00 14.60 ? 44  VAL A N    1 
ATOM   595 C  CA   . VAL A 1 44 ? 15.723 20.598 27.884 1.00 13.73 ? 44  VAL A CA   1 
ATOM   596 C  C    . VAL A 1 44 ? 16.476 20.190 26.647 1.00 12.58 ? 44  VAL A C    1 
ATOM   597 O  O    . VAL A 1 44 ? 17.173 20.969 26.031 1.00 13.47 ? 44  VAL A O    1 
ATOM   598 C  CB   . VAL A 1 44 ? 14.192 20.681 27.563 1.00 15.21 ? 44  VAL A CB   1 
ATOM   599 C  CG1  . VAL A 1 44 ? 13.402 21.033 28.839 1.00 18.77 ? 44  VAL A CG1  1 
ATOM   600 C  CG2  . VAL A 1 44 ? 13.932 21.631 26.422 1.00 14.29 ? 44  VAL A CG2  1 
ATOM   601 H  H    . VAL A 1 44 ? 15.912 22.519 28.329 1.00 17.52 ? 44  VAL A H    1 
ATOM   602 H  HA   . VAL A 1 44 ? 15.833 19.869 28.529 1.00 16.48 ? 44  VAL A HA   1 
ATOM   603 H  HB   . VAL A 1 44 ? 13.903 19.789 27.275 1.00 18.25 ? 44  VAL A HB   1 
ATOM   604 H  HG11 . VAL A 1 44 ? 13.607 20.397 29.528 1.00 28.16 ? 44  VAL A HG11 1 
ATOM   605 H  HG12 . VAL A 1 44 ? 13.647 21.914 29.134 1.00 28.16 ? 44  VAL A HG12 1 
ATOM   606 H  HG13 . VAL A 1 44 ? 12.461 21.009 28.650 1.00 28.16 ? 44  VAL A HG13 1 
ATOM   607 H  HG21 . VAL A 1 44 ? 14.448 21.363 25.658 1.00 21.44 ? 44  VAL A HG21 1 
ATOM   608 H  HG22 . VAL A 1 44 ? 12.998 21.616 26.199 1.00 21.44 ? 44  VAL A HG22 1 
ATOM   609 H  HG23 . VAL A 1 44 ? 14.184 22.520 26.682 1.00 21.44 ? 44  VAL A HG23 1 
ATOM   610 N  N    . GLY A 1 45 ? 16.356 18.939 26.215 1.00 13.86 ? 45  GLY A N    1 
ATOM   611 C  CA   . GLY A 1 45 ? 17.052 18.433 25.074 1.00 14.31 ? 45  GLY A CA   1 
ATOM   612 C  C    . GLY A 1 45 ? 16.508 18.802 23.734 1.00 12.18 ? 45  GLY A C    1 
ATOM   613 O  O    . GLY A 1 45 ? 15.431 19.410 23.585 1.00 12.04 ? 45  GLY A O    1 
ATOM   614 H  H    . GLY A 1 45 ? 15.833 18.407 26.644 1.00 16.63 ? 45  GLY A H    1 
ATOM   615 H  HA2  . GLY A 1 45 ? 17.970 18.741 25.121 1.00 17.17 ? 45  GLY A HA2  1 
ATOM   616 H  HA3  . GLY A 1 45 ? 17.069 17.465 25.136 1.00 17.17 ? 45  GLY A HA3  1 
ATOM   617 N  N    . LYS A 1 46 ? 17.243 18.429 22.689 1.00 12.41 ? 46  LYS A N    1 
ATOM   618 C  CA   . LYS A 1 46 ? 16.878 18.707 21.338 1.00 10.57 ? 46  LYS A CA   1 
ATOM   619 C  C    . LYS A 1 46 ? 15.530 18.209 20.909 1.00 11.92 ? 46  LYS A C    1 
ATOM   620 O  O    . LYS A 1 46 ? 14.891 18.791 20.033 1.00 12.25 ? 46  LYS A O    1 
ATOM   621 C  CB   . LYS A 1 46 ? 17.932 18.177 20.347 1.00 11.99 ? 46  LYS A CB   1 
ATOM   622 C  CG   . LYS A 1 46 ? 19.223 18.853 20.400 1.00 12.30 ? 46  LYS A CG   1 
ATOM   623 C  CD   . LYS A 1 46 ? 20.254 18.261 19.431 1.00 10.45 ? 46  LYS A CD   1 
ATOM   624 C  CE   . LYS A 1 46 ? 20.076 18.774 18.049 1.00 10.49 ? 46  LYS A CE   1 
ATOM   625 N  NZ   . LYS A 1 46 ? 20.905 18.040 17.052 1.00 9.82  ? 46  LYS A NZ   1 
ATOM   626 H  H    . LYS A 1 46 ? 17.975 18.001 22.835 1.00 14.89 ? 46  LYS A H    1 
ATOM   627 H  HA   . LYS A 1 46 ? 16.863 19.682 21.243 1.00 12.69 ? 46  LYS A HA   1 
ATOM   628 H  HB2  . LYS A 1 46 ? 18.071 17.233 20.521 1.00 14.39 ? 46  LYS A HB2  1 
ATOM   629 H  HB3  . LYS A 1 46 ? 17.578 18.259 19.448 1.00 14.39 ? 46  LYS A HB3  1 
ATOM   630 H  HG2  . LYS A 1 46 ? 19.095 19.791 20.190 1.00 14.76 ? 46  LYS A HG2  1 
ATOM   631 H  HG3  . LYS A 1 46 ? 19.571 18.796 21.303 1.00 14.76 ? 46  LYS A HG3  1 
ATOM   632 H  HD2  . LYS A 1 46 ? 21.146 18.483 19.741 1.00 12.54 ? 46  LYS A HD2  1 
ATOM   633 H  HD3  . LYS A 1 46 ? 20.171 17.295 19.427 1.00 12.54 ? 46  LYS A HD3  1 
ATOM   634 H  HE2  . LYS A 1 46 ? 19.141 18.697 17.801 1.00 12.58 ? 46  LYS A HE2  1 
ATOM   635 H  HE3  . LYS A 1 46 ? 20.312 19.714 18.027 1.00 12.58 ? 46  LYS A HE3  1 
ATOM   636 H  HZ1  . LYS A 1 46 ? 21.765 18.121 17.265 1.00 14.73 ? 46  LYS A HZ1  1 
ATOM   637 H  HZ2  . LYS A 1 46 ? 20.679 17.179 17.055 1.00 14.73 ? 46  LYS A HZ2  1 
ATOM   638 H  HZ3  . LYS A 1 46 ? 20.765 18.380 16.242 1.00 14.73 ? 46  LYS A HZ3  1 
ATOM   639 N  N    . ASP A 1 47 ? 15.067 17.089 21.512 1.00 11.89 ? 47  ASP A N    1 
ATOM   640 C  CA   . ASP A 1 47 ? 13.805 16.527 21.148 1.00 13.35 ? 47  ASP A CA   1 
ATOM   641 C  C    . ASP A 1 47 ? 12.624 17.347 21.456 1.00 12.00 ? 47  ASP A C    1 
ATOM   642 O  O    . ASP A 1 47 ? 11.528 17.005 21.025 1.00 15.71 ? 47  ASP A O    1 
ATOM   643 C  CB   . ASP A 1 47 ? 13.693 15.121 21.673 1.00 16.84 ? 47  ASP A CB   1 
ATOM   644 C  CG   . ASP A 1 47 ? 13.672 15.020 23.119 1.00 20.43 ? 47  ASP A CG   1 
ATOM   645 O  OD1  . ASP A 1 47 ? 13.622 15.934 23.833 1.00 22.42 ? 47  ASP A OD1  1 
ATOM   646 O  OD2  . ASP A 1 47 ? 13.574 13.879 23.662 1.00 33.87 ? 47  ASP A OD2  1 
ATOM   647 H  H    . ASP A 1 47 ? 15.540 16.711 22.123 1.00 14.27 ? 47  ASP A H    1 
ATOM   648 H  HA   . ASP A 1 47 ? 13.823 16.444 20.171 1.00 16.02 ? 47  ASP A HA   1 
ATOM   649 H  HB2  . ASP A 1 47 ? 12.882 14.723 21.322 1.00 20.21 ? 47  ASP A HB2  1 
ATOM   650 H  HB3  . ASP A 1 47 ? 14.442 14.604 21.337 1.00 20.21 ? 47  ASP A HB3  1 
ATOM   651 N  N    . GLN A 1 48 ? 12.772 18.469 22.226 1.00 11.68 ? 48  GLN A N    1 
ATOM   652 C  CA   . GLN A 1 48 ? 11.659 19.381 22.471 1.00 10.60 ? 48  GLN A CA   1 
ATOM   653 C  C    . GLN A 1 48 ? 11.729 20.569 21.541 1.00 10.94 ? 48  GLN A C    1 
ATOM   654 O  O    . GLN A 1 48 ? 10.933 21.491 21.742 1.00 13.57 ? 48  GLN A O    1 
ATOM   655 C  CB   . GLN A 1 48 ? 11.609 19.812 23.857 1.00 12.89 ? 48  GLN A CB   1 
ATOM   656 C  CG   . GLN A 1 48 ? 11.567 18.673 24.871 1.00 13.80 ? 48  GLN A CG   1 
ATOM   657 C  CD   . GLN A 1 48 ? 10.394 17.765 24.661 1.00 13.84 ? 48  GLN A CD   1 
ATOM   658 O  OE1  . GLN A 1 48 ? 9.231  18.201 24.619 1.00 16.40 ? 48  GLN A OE1  1 
ATOM   659 N  NE2  . GLN A 1 48 ? 10.662 16.471 24.572 1.00 16.67 ? 48  GLN A NE2  1 
ATOM   660 H  H    . GLN A 1 48 ? 13.540 18.640 22.575 1.00 14.01 ? 48  GLN A H    1 
ATOM   661 H  HA   . GLN A 1 48 ? 10.828 18.897 22.278 1.00 12.72 ? 48  GLN A HA   1 
ATOM   662 H  HB2  . GLN A 1 48 ? 12.388 20.361 24.039 1.00 15.47 ? 48  GLN A HB2  1 
ATOM   663 H  HB3  . GLN A 1 48 ? 10.824 20.367 23.981 1.00 15.47 ? 48  GLN A HB3  1 
ATOM   664 H  HG2  . GLN A 1 48 ? 12.385 18.156 24.803 1.00 16.56 ? 48  GLN A HG2  1 
ATOM   665 H  HG3  . GLN A 1 48 ? 11.524 19.045 25.766 1.00 16.56 ? 48  GLN A HG3  1 
ATOM   666 N  N    . PHE A 1 49 ? 12.603 20.573 20.579 1.00 10.42 ? 49  PHE A N    1 
ATOM   667 C  CA   . PHE A 1 49 ? 12.704 21.624 19.608 1.00 9.86  ? 49  PHE A CA   1 
ATOM   668 C  C    . PHE A 1 49 ? 11.921 21.285 18.364 1.00 11.21 ? 49  PHE A C    1 
ATOM   669 O  O    . PHE A 1 49 ? 11.772 20.141 18.002 1.00 14.89 ? 49  PHE A O    1 
ATOM   670 C  CB   . PHE A 1 49 ? 14.121 21.960 19.225 1.00 10.35 ? 49  PHE A CB   1 
ATOM   671 C  CG   . PHE A 1 49 ? 14.917 22.739 20.262 1.00 9.28  ? 49  PHE A CG   1 
ATOM   672 C  CD1  . PHE A 1 49 ? 15.226 22.194 21.449 1.00 10.53 ? 49  PHE A CD1  1 
ATOM   673 C  CD2  . PHE A 1 49 ? 15.314 24.016 19.952 1.00 9.65  ? 49  PHE A CD2  1 
ATOM   674 C  CE1  . PHE A 1 49 ? 15.968 22.936 22.386 1.00 11.64 ? 49  PHE A CE1  1 
ATOM   675 C  CE2  . PHE A 1 49 ? 16.037 24.743 20.870 1.00 10.70 ? 49  PHE A CE2  1 
ATOM   676 C  CZ   . PHE A 1 49 ? 16.361 24.209 22.058 1.00 11.22 ? 49  PHE A CZ   1 
ATOM   677 H  H    . PHE A 1 49 ? 13.150 19.911 20.521 1.00 12.51 ? 49  PHE A H    1 
ATOM   678 H  HA   . PHE A 1 49 ? 12.305 22.428 20.000 1.00 11.83 ? 49  PHE A HA   1 
ATOM   679 H  HB2  . PHE A 1 49 ? 14.592 21.133 19.037 1.00 12.41 ? 49  PHE A HB2  1 
ATOM   680 H  HB3  . PHE A 1 49 ? 14.102 22.476 18.404 1.00 12.41 ? 49  PHE A HB3  1 
ATOM   681 H  HD1  . PHE A 1 49 ? 14.950 21.329 21.652 1.00 12.63 ? 49  PHE A HD1  1 
ATOM   682 H  HD2  . PHE A 1 49 ? 15.095 24.388 19.128 1.00 11.58 ? 49  PHE A HD2  1 
ATOM   683 H  HE1  . PHE A 1 49 ? 16.189 22.571 23.212 1.00 13.96 ? 49  PHE A HE1  1 
ATOM   684 H  HE2  . PHE A 1 49 ? 16.303 25.610 20.665 1.00 12.84 ? 49  PHE A HE2  1 
ATOM   685 H  HZ   . PHE A 1 49 ? 16.857 24.708 22.666 1.00 13.47 ? 49  PHE A HZ   1 
ATOM   686 N  N    . GLU A 1 50 ? 11.487 22.327 17.667 1.00 11.23 ? 50  GLU A N    1 
ATOM   687 C  CA   . GLU A 1 50 ? 10.816 22.150 16.395 1.00 12.11 ? 50  GLU A CA   1 
ATOM   688 C  C    . GLU A 1 50 ? 11.302 23.136 15.414 1.00 11.75 ? 50  GLU A C    1 
ATOM   689 O  O    . GLU A 1 50 ? 11.587 24.319 15.806 1.00 12.70 ? 50  GLU A O    1 
ATOM   690 C  CB   A GLU A 1 50 ? 9.302  22.216 16.625 0.55 12.85 ? 50  GLU A CB   1 
ATOM   691 C  CB   B GLU A 1 50 ? 9.322  22.210 16.271 0.45 16.00 ? 50  GLU A CB   1 
ATOM   692 C  CG   A GLU A 1 50 ? 8.770  21.027 17.307 0.55 16.19 ? 50  GLU A CG   1 
ATOM   693 C  CG   B GLU A 1 50 ? 8.829  23.411 16.901 0.45 15.64 ? 50  GLU A CG   1 
ATOM   694 C  CD   A GLU A 1 50 ? 7.200  20.985 17.449 0.55 22.56 ? 50  GLU A CD   1 
ATOM   695 C  CD   B GLU A 1 50 ? 7.216  23.490 17.110 0.45 19.65 ? 50  GLU A CD   1 
ATOM   696 O  OE1  A GLU A 1 50 ? 6.675  22.110 17.475 0.55 22.13 ? 50  GLU A OE1  1 
ATOM   697 O  OE1  B GLU A 1 50 ? 6.622  22.569 16.697 0.45 25.10 ? 50  GLU A OE1  1 
ATOM   698 O  OE2  A GLU A 1 50 ? 6.680  19.910 17.607 0.55 25.21 ? 50  GLU A OE2  1 
ATOM   699 O  OE2  B GLU A 1 50 ? 6.823  24.635 17.341 0.45 22.05 ? 50  GLU A OE2  1 
ATOM   700 H  H    . GLU A 1 50 ? 11.606 23.121 17.975 1.00 13.48 ? 50  GLU A H    1 
ATOM   701 H  HA   . GLU A 1 50 ? 11.033 21.256 16.059 1.00 14.53 ? 50  GLU A HA   1 
ATOM   702 N  N    . GLU A 1 51 ? 11.324 22.819 14.137 1.00 11.84 ? 51  GLU A N    1 
ATOM   703 C  CA   . GLU A 1 51 ? 11.716 23.722 13.113 1.00 13.00 ? 51  GLU A CA   1 
ATOM   704 C  C    . GLU A 1 51 ? 10.782 24.841 13.054 1.00 14.04 ? 51  GLU A C    1 
ATOM   705 O  O    . GLU A 1 51 ? 9.553  24.663 13.133 1.00 18.35 ? 51  GLU A O    1 
ATOM   706 C  CB   . GLU A 1 51 ? 11.721 22.927 11.765 1.00 19.49 ? 51  GLU A CB   1 
ATOM   707 C  CG   . GLU A 1 51 ? 12.361 23.612 10.692 1.00 28.41 ? 51  GLU A CG   1 
ATOM   708 C  CD   . GLU A 1 51 ? 12.524 22.672 9.431  1.00 36.84 ? 51  GLU A CD   1 
ATOM   709 O  OE1  . GLU A 1 51 ? 12.272 21.400 9.654  1.00 37.74 ? 51  GLU A OE1  1 
ATOM   710 O  OE2  . GLU A 1 51 ? 12.564 23.211 8.401  1.00 51.23 ? 51  GLU A OE2  1 
ATOM   711 H  H    . GLU A 1 51 ? 11.090 22.023 13.911 1.00 14.21 ? 51  GLU A H    1 
ATOM   712 H  HA   . GLU A 1 51 ? 12.618 24.057 13.299 1.00 15.60 ? 51  GLU A HA   1 
ATOM   713 H  HB2  . GLU A 1 51 ? 12.170 22.079 11.906 1.00 23.38 ? 51  GLU A HB2  1 
ATOM   714 H  HB3  . GLU A 1 51 ? 10.805 22.737 11.512 1.00 23.38 ? 51  GLU A HB3  1 
ATOM   715 H  HG2  . GLU A 1 51 ? 11.836 24.390 10.448 1.00 34.09 ? 51  GLU A HG2  1 
ATOM   716 H  HG3  . GLU A 1 51 ? 13.235 23.918 10.981 1.00 34.09 ? 51  GLU A HG3  1 
ATOM   717 N  N    . VAL A 1 52 ? 11.218 26.054 12.788 1.00 15.81 ? 52  VAL A N    1 
ATOM   718 C  CA   . VAL A 1 52 ? 10.506 27.182 12.458 1.00 18.41 ? 52  VAL A CA   1 
ATOM   719 C  C    . VAL A 1 52 ? 10.371 27.204 10.851 1.00 21.77 ? 52  VAL A C    1 
ATOM   720 O  O    . VAL A 1 52 ? 11.345 27.397 10.129 1.00 26.49 ? 52  VAL A O    1 
ATOM   721 C  CB   . VAL A 1 52 ? 11.065 28.486 12.922 1.00 19.53 ? 52  VAL A CB   1 
ATOM   722 C  CG1  . VAL A 1 52 ? 10.333 29.696 12.515 1.00 25.56 ? 52  VAL A CG1  1 
ATOM   723 C  CG2  . VAL A 1 52 ? 11.362 28.532 14.395 1.00 23.39 ? 52  VAL A CG2  1 
ATOM   724 H  H    . VAL A 1 52 ? 12.071 26.156 12.827 1.00 18.98 ? 52  VAL A H    1 
ATOM   725 H  HA   . VAL A 1 52 ? 9.605  27.090 12.834 1.00 22.09 ? 52  VAL A HA   1 
ATOM   726 H  HB   . VAL A 1 52 ? 11.939 28.558 12.484 1.00 23.43 ? 52  VAL A HB   1 
ATOM   727 H  HG11 . VAL A 1 52 ? 9.436  29.658 12.857 1.00 38.35 ? 52  VAL A HG11 1 
ATOM   728 H  HG12 . VAL A 1 52 ? 10.776 30.472 12.865 1.00 38.35 ? 52  VAL A HG12 1 
ATOM   729 H  HG13 . VAL A 1 52 ? 10.307 29.748 11.556 1.00 38.35 ? 52  VAL A HG13 1 
ATOM   730 H  HG21 . VAL A 1 52 ? 11.839 27.739 14.650 1.00 35.09 ? 52  VAL A HG21 1 
ATOM   731 H  HG22 . VAL A 1 52 ? 11.897 29.305 14.590 1.00 35.09 ? 52  VAL A HG22 1 
ATOM   732 H  HG23 . VAL A 1 52 ? 10.538 28.582 14.886 1.00 35.09 ? 52  VAL A HG23 1 
ATOM   733 N  N    . GLU A 1 53 ? 9.229  26.908 10.366 1.00 26.86 ? 53  GLU A N    1 
ATOM   734 C  CA   . GLU A 1 53 ? 8.967  26.924 8.894  1.00 35.57 ? 53  GLU A CA   1 
ATOM   735 C  C    . GLU A 1 53 ? 8.591  28.339 8.461  1.00 45.58 ? 53  GLU A C    1 
ATOM   736 O  O    . GLU A 1 53 ? 8.038  29.140 9.246  1.00 50.94 ? 53  GLU A O    1 
ATOM   737 C  CB   . GLU A 1 53 ? 7.866  25.972 8.510  1.00 38.95 ? 53  GLU A CB   1 
ATOM   738 C  CG   . GLU A 1 53 ? 8.545  24.838 7.540  1.00 42.56 ? 53  GLU A CG   1 
ATOM   739 C  CD   . GLU A 1 53 ? 8.580  23.713 8.556  1.00 38.29 ? 53  GLU A CD   1 
ATOM   740 O  OE1  . GLU A 1 53 ? 7.960  24.089 9.633  1.00 48.24 ? 53  GLU A OE1  1 
ATOM   741 O  OE2  . GLU A 1 53 ? 9.219  22.703 8.480  1.00 47.73 ? 53  GLU A OE2  1 
ATOM   742 H  H    . GLU A 1 53 ? 8.591  26.694 10.902 1.00 32.23 ? 53  GLU A H    1 
ATOM   743 H  HA   . GLU A 1 53 ? 9.787  26.660 8.427  1.00 42.68 ? 53  GLU A HA   1 
ATOM   744 H  HB2  . GLU A 1 53 ? 7.487  25.557 9.301  1.00 46.75 ? 53  GLU A HB2  1 
ATOM   745 H  HB3  . GLU A 1 53 ? 7.161  26.443 8.039  1.00 46.75 ? 53  GLU A HB3  1 
ATOM   746 H  HG2  . GLU A 1 53 ? 7.988  24.627 6.775  1.00 51.08 ? 53  GLU A HG2  1 
ATOM   747 H  HG3  . GLU A 1 53 ? 9.433  25.093 7.242  1.00 51.08 ? 53  GLU A HG3  1 
HETATM 748 FE FE   . FE  B 2 .  ? 14.161 26.032 26.330 1.00 11.64 ? 55  FE  A FE   1 
HETATM 749 O  O    . HOH C 3 .  ? 21.015 30.809 18.619 1.00 16.18 ? 56  HOH A O    1 
HETATM 750 O  O    . HOH C 3 .  ? 19.355 24.775 11.390 1.00 18.68 ? 57  HOH A O    1 
HETATM 751 O  O    . HOH C 3 .  ? 19.756 16.957 23.643 1.00 18.61 ? 58  HOH A O    1 
HETATM 752 O  O    . HOH C 3 .  ? 23.344 24.998 25.717 1.00 20.62 ? 59  HOH A O    1 
HETATM 753 O  O    . HOH C 3 .  ? 30.521 23.877 16.699 1.00 23.06 ? 60  HOH A O    1 
HETATM 754 O  O    . HOH C 3 .  ? 8.064  22.310 12.992 1.00 20.31 ? 61  HOH A O    1 
HETATM 755 O  O    . HOH C 3 .  ? 26.437 31.068 23.422 1.00 20.77 ? 62  HOH A O    1 
HETATM 756 O  O    . HOH C 3 .  ? 27.334 33.819 11.042 1.00 22.84 ? 63  HOH A O    1 
HETATM 757 O  O    . HOH C 3 .  ? 18.712 21.017 10.884 1.00 23.81 ? 64  HOH A O    1 
HETATM 758 O  O    . HOH C 3 .  ? 26.020 22.365 10.063 1.00 24.08 ? 65  HOH A O    1 
HETATM 759 O  O    . HOH C 3 .  ? 13.472 29.276 10.002 1.00 26.10 ? 66  HOH A O    1 
HETATM 760 O  O    . HOH C 3 .  ? 24.515 22.343 26.062 1.00 24.95 ? 67  HOH A O    1 
HETATM 761 O  O    . HOH C 3 .  ? 8.098  21.147 10.501 1.00 27.35 ? 68  HOH A O    1 
HETATM 762 O  O    . HOH C 3 .  ? 16.342 21.945 8.895  1.00 29.50 ? 69  HOH A O    1 
HETATM 763 O  O    . HOH C 3 .  ? 18.307 23.903 8.477  1.00 27.57 ? 70  HOH A O    1 
HETATM 764 O  O    . HOH C 3 .  ? 17.932 33.305 20.320 1.00 32.99 ? 71  HOH A O    1 
HETATM 765 O  O    . HOH C 3 .  ? 22.316 30.831 22.500 1.00 27.18 ? 72  HOH A O    1 
HETATM 766 O  O    . HOH C 3 .  ? 23.892 15.032 12.834 1.00 28.28 ? 73  HOH A O    1 
HETATM 767 O  O    . HOH C 3 .  ? 4.269  25.517 9.802  1.00 32.71 ? 74  HOH A O    1 
HETATM 768 O  O    . HOH C 3 .  ? 23.561 25.323 28.548 1.00 30.00 ? 75  HOH A O    1 
HETATM 769 O  O    . HOH C 3 .  ? 20.923 25.065 29.955 1.00 31.42 ? 76  HOH A O    1 
HETATM 770 O  O    . HOH C 3 .  ? 27.588 16.661 15.110 1.00 32.08 ? 77  HOH A O    1 
HETATM 771 O  O    . HOH C 3 .  ? 10.723 12.512 21.685 1.00 32.25 ? 78  HOH A O    1 
HETATM 772 O  O    . HOH C 3 .  ? 28.509 20.122 14.931 1.00 33.08 ? 79  HOH A O    1 
HETATM 773 O  O    . HOH C 3 .  ? 26.080 34.003 19.072 1.00 37.33 ? 80  HOH A O    1 
HETATM 774 O  O    . HOH C 3 .  ? 14.448 16.582 26.706 1.00 33.67 ? 81  HOH A O    1 
HETATM 775 O  O    . HOH C 3 .  ? 23.758 32.532 20.553 1.00 34.19 ? 82  HOH A O    1 
HETATM 776 O  O    . HOH C 3 .  ? 7.958  25.982 15.458 1.00 64.83 ? 83  HOH A O    1 
HETATM 777 O  O    . HOH C 3 .  ? 20.780 16.034 15.059 1.00 35.51 ? 84  HOH A O    1 
HETATM 778 O  O    . HOH C 3 .  ? 0.834  14.415 9.758  1.00 32.88 ? 85  HOH A O    1 
HETATM 779 O  O    . HOH C 3 .  ? 16.940 15.219 23.068 1.00 36.75 ? 86  HOH A O    1 
HETATM 780 O  O    . HOH C 3 .  ? 10.044 27.269 30.794 1.00 33.81 ? 87  HOH A O    1 
HETATM 781 O  O    . HOH C 3 .  ? 10.232 18.121 18.685 1.00 35.75 ? 88  HOH A O    1 
HETATM 782 O  O    . HOH C 3 .  ? 8.756  27.714 4.431  1.00 40.79 ? 89  HOH A O    1 
HETATM 783 O  O    . HOH C 3 .  ? 9.746  32.350 21.185 1.00 45.99 ? 90  HOH A O    1 
HETATM 784 O  O    . HOH C 3 .  ? 20.735 33.623 19.119 1.00 42.42 ? 91  HOH A O    1 
HETATM 785 O  O    . HOH C 3 .  ? 28.856 17.755 22.951 1.00 44.38 ? 92  HOH A O    1 
HETATM 786 O  O    . HOH C 3 .  ? 28.244 21.256 21.807 1.00 37.44 ? 93  HOH A O    1 
HETATM 787 O  O    . HOH C 3 .  ? 29.723 25.576 12.223 1.00 50.90 ? 94  HOH A O    1 
HETATM 788 O  O    . HOH C 3 .  ? 30.043 17.839 16.098 1.00 43.02 ? 95  HOH A O    1 
HETATM 789 O  O    . HOH C 3 .  ? 26.741 21.684 24.463 1.00 39.97 ? 96  HOH A O    1 
HETATM 790 O  O    . HOH C 3 .  ? 30.749 27.191 11.567 1.00 48.64 ? 97  HOH A O    1 
HETATM 791 O  O    . HOH C 3 .  ? 0.591  12.852 12.409 1.00 35.29 ? 98  HOH A O    1 
HETATM 792 O  O    . HOH C 3 .  ? 24.110 30.208 25.616 1.00 46.25 ? 99  HOH A O    1 
HETATM 793 O  O    . HOH C 3 .  ? 28.863 21.820 17.290 1.00 48.13 ? 100 HOH A O    1 
HETATM 794 O  O    . HOH C 3 .  ? 9.111  30.349 4.443  1.00 65.38 ? 101 HOH A O    1 
HETATM 795 O  O    . HOH C 3 .  ? 30.034 21.273 19.854 1.00 45.30 ? 102 HOH A O    1 
HETATM 796 O  O    . HOH C 3 .  ? 30.924 17.540 21.208 1.00 66.95 ? 103 HOH A O    1 
HETATM 797 O  O    . HOH C 3 .  ? 27.201 19.253 23.652 1.00 44.51 ? 104 HOH A O    1 
HETATM 798 O  O    . HOH C 3 .  ? 10.924 21.102 6.585  1.00 47.40 ? 105 HOH A O    1 
HETATM 799 O  O    . HOH C 3 .  ? 26.142 15.479 12.839 1.00 44.03 ? 106 HOH A O    1 
HETATM 800 O  O    . HOH C 3 .  ? 8.810  30.298 17.001 1.00 51.13 ? 107 HOH A O    1 
HETATM 801 O  O    . HOH C 3 .  ? 16.815 26.985 4.743  1.00 60.02 ? 108 HOH A O    1 
HETATM 802 O  O    . HOH C 3 .  ? 32.020 18.487 12.891 0.33 75.74 ? 109 HOH A O    1 
HETATM 803 O  O    . HOH C 3 .  ? 20.819 30.736 7.590  1.00 52.59 ? 110 HOH A O    1 
HETATM 804 O  O    . HOH C 3 .  ? 25.642 33.686 22.750 1.00 55.50 ? 111 HOH A O    1 
HETATM 805 O  O    . HOH C 3 .  ? 28.547 22.449 10.794 1.00 67.35 ? 112 HOH A O    1 
HETATM 806 O  O    . HOH C 3 .  ? -7.359 15.646 20.771 1.00 63.91 ? 113 HOH A O    1 
HETATM 807 O  O    . HOH C 3 .  ? 14.180 11.431 23.047 1.00 50.18 ? 114 HOH A O    1 
HETATM 808 O  O    . HOH C 3 .  ? 19.556 34.738 30.054 1.00 57.67 ? 115 HOH A O    1 
HETATM 809 O  O    . HOH C 3 .  ? 13.294 33.644 21.035 1.00 60.29 ? 116 HOH A O    1 
HETATM 810 O  O    . HOH C 3 .  ? 10.650 25.614 5.453  1.00 60.36 ? 117 HOH A O    1 
HETATM 811 O  O    . HOH C 3 .  ? 19.259 34.112 22.366 1.00 62.87 ? 118 HOH A O    1 
HETATM 812 O  O    . HOH C 3 .  ? 18.866 1.144  22.658 1.00 68.55 ? 119 HOH A O    1 
HETATM 813 O  O    . HOH C 3 .  ? 2.103  16.765 11.256 1.00 68.34 ? 120 HOH A O    1 
HETATM 814 O  O    . HOH C 3 .  ? 26.064 31.481 8.988  1.00 49.39 ? 121 HOH A O    1 
HETATM 815 O  O    . HOH C 3 .  ? 19.106 20.517 7.712  1.00 51.97 ? 122 HOH A O    1 
HETATM 816 O  O    . HOH C 3 .  ? 28.283 23.491 27.786 1.00 57.20 ? 123 HOH A O    1 
HETATM 817 O  O    . HOH C 3 .  ? 19.412 21.009 2.902  1.00 80.45 ? 124 HOH A O    1 
HETATM 818 O  O    . HOH C 3 .  ? 27.920 27.139 8.003  1.00 86.81 ? 125 HOH A O    1 
HETATM 819 O  O    . HOH C 3 .  ? 6.680  29.961 6.108  1.00 42.19 ? 126 HOH A O    1 
HETATM 820 O  O    . HOH C 3 .  ? 22.015 31.509 28.062 1.00 51.33 ? 127 HOH A O    1 
HETATM 821 O  O    . HOH C 3 .  ? 29.709 20.316 12.721 1.00 62.26 ? 128 HOH A O    1 
HETATM 822 O  O    . HOH C 3 .  ? 30.475 25.864 9.392  1.00 59.59 ? 129 HOH A O    1 
HETATM 823 O  O    . HOH C 3 .  ? 22.970 22.540 6.179  1.00 71.23 ? 130 HOH A O    1 
HETATM 824 O  O    . HOH C 3 .  ? 6.694  27.328 11.970 1.00 60.08 ? 131 HOH A O    1 
HETATM 825 O  O    . HOH C 3 .  ? 23.685 27.635 29.469 1.00 63.13 ? 132 HOH A O    1 
HETATM 826 O  O    . HOH C 3 .  ? 25.709 33.929 4.972  1.00 58.76 ? 133 HOH A O    1 
HETATM 827 O  O    . HOH C 3 .  ? 23.053 19.185 30.731 1.00 68.97 ? 134 HOH A O    1 
HETATM 828 O  O    . HOH C 3 .  ? 14.465 32.947 8.438  1.00 81.51 ? 135 HOH A O    1 
HETATM 829 O  O    . HOH C 3 .  ? 9.040  30.483 19.756 1.00 52.37 ? 136 HOH A O    1 
HETATM 830 O  O    . HOH C 3 .  ? -6.335 11.271 24.061 1.00 68.82 ? 137 HOH A O    1 
HETATM 831 O  O    . HOH C 3 .  ? 25.725 16.128 8.788  1.00 65.76 ? 138 HOH A O    1 
HETATM 832 O  O    . HOH C 3 .  ? 25.083 21.820 28.749 1.00 68.01 ? 139 HOH A O    1 
HETATM 833 O  O    . HOH C 3 .  ? 26.171 26.259 29.931 1.00 69.40 ? 140 HOH A O    1 
HETATM 834 O  O    . HOH C 3 .  ? 8.440  35.600 7.180  1.00 85.31 ? 141 HOH A O    1 
HETATM 835 O  O    . HOH C 3 .  ? 21.411 32.196 24.989 1.00 60.68 ? 142 HOH A O    1 
HETATM 836 O  O    . HOH C 3 .  ? 12.295 34.134 11.694 1.00 64.86 ? 143 HOH A O    1 
HETATM 837 O  O    . HOH C 3 .  ? 14.223 24.805 5.089  1.00 66.24 ? 144 HOH A O    1 
HETATM 838 O  O    . HOH C 3 .  ? 24.584 18.321 6.556  1.00 90.17 ? 145 HOH A O    1 
HETATM 839 O  O    . HOH C 3 .  ? 10.593 28.891 5.500  1.00 62.00 ? 146 HOH A O    1 
HETATM 840 O  O    . HOH C 3 .  ? 25.083 19.420 27.200 1.00 44.37 ? 147 HOH A O    1 
HETATM 841 O  O    . HOH C 3 .  ? 27.425 18.870 26.873 1.00 74.11 ? 148 HOH A O    1 
HETATM 842 O  O    . HOH C 3 .  ? 19.044 32.103 10.363 1.00 49.53 ? 149 HOH A O    1 
HETATM 843 O  O    . HOH C 3 .  ? 27.877 19.225 8.277  1.00 70.35 ? 150 HOH A O    1 
HETATM 844 O  O    . HOH C 3 .  ? 10.812 32.225 7.625  1.00 64.28 ? 151 HOH A O    1 
HETATM 845 O  O    . HOH C 3 .  ? 9.957  32.451 15.407 1.00 81.03 ? 152 HOH A O    1 
HETATM 846 O  O    . HOH C 3 .  ? 16.961 34.877 18.271 1.00 74.47 ? 153 HOH A O    1 
HETATM 847 O  O    . HOH C 3 .  ? 5.589  32.294 6.951  1.00 73.33 ? 154 HOH A O    1 
HETATM 848 O  O    . HOH C 3 .  ? 23.652 30.723 8.870  1.00 68.95 ? 155 HOH A O    1 
HETATM 849 O  O    . HOH C 3 .  ? 27.740 35.121 20.895 1.00 60.19 ? 156 HOH A O    1 
HETATM 850 O  O    . HOH C 3 .  ? 7.464  34.132 9.626  1.00 66.46 ? 157 HOH A O    1 
HETATM 851 O  O    . HOH C 3 .  ? 29.452 17.496 11.452 1.00 63.29 ? 158 HOH A O    1 
HETATM 852 O  O    . HOH C 3 .  ? 29.618 23.387 13.141 1.00 54.33 ? 159 HOH A O    1 
HETATM 853 O  O    . HOH C 3 .  ? 22.459 35.158 23.135 1.00 65.57 ? 160 HOH A O    1 
HETATM 854 O  O    . HOH C 3 .  ? 31.490 16.810 17.928 1.00 52.08 ? 161 HOH A O    1 
HETATM 855 O  O    . HOH C 3 .  ? 21.391 23.139 31.516 1.00 43.42 ? 162 HOH A O    1 
HETATM 856 O  O    . HOH C 3 .  ? 6.375  34.717 5.920  1.00 56.87 ? 163 HOH A O    1 
HETATM 857 O  O    . HOH C 3 .  ? 20.792 36.262 11.727 1.00 62.39 ? 164 HOH A O    1 
HETATM 858 O  O    . HOH C 3 .  ? 18.562 26.034 32.453 1.00 49.62 ? 165 HOH A O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N  N    . MET A 1  ? 0.4108 0.6201 0.2736 -0.0961 0.0608  0.1580  1   MET A N    
2   C  CA   . MET A 1  ? 0.2570 0.4319 0.2743 -0.0093 0.0804  0.0233  1   MET A CA   
3   C  C    . MET A 1  ? 0.3018 0.3235 0.2990 -0.0463 0.0185  0.1185  1   MET A C    
4   O  O    . MET A 1  ? 0.3827 0.3107 0.4396 -0.0528 0.1106  0.1399  1   MET A O    
5   C  CB   . MET A 1  ? 0.2746 0.4841 0.2833 -0.0334 0.0776  0.0053  1   MET A CB   
6   C  CG   . MET A 1  ? 0.3007 0.4653 0.2992 -0.0141 0.0534  0.0664  1   MET A CG   
7   S  SD   . MET A 1  ? 0.3252 0.4834 0.2816 0.0373  0.0214  0.0618  1   MET A SD   
8   C  CE   . MET A 1  ? 0.4572 0.5273 0.3716 -0.0706 0.0986  0.1482  1   MET A CE   
9   H  H1   . MET A 1  ? 0.6522 0.6522 0.6522 0.0000  0.0000  0.0000  1   MET A H1   
10  H  H2   . MET A 1  ? 0.6522 0.6522 0.6522 0.0000  0.0000  0.0000  1   MET A H2   
11  H  H3   . MET A 1  ? 0.6522 0.6522 0.6522 0.0000  0.0000  0.0000  1   MET A H3   
12  H  HA   . MET A 1  ? 0.3852 0.3852 0.3852 0.0000  0.0000  0.0000  1   MET A HA   
13  H  HB2  . MET A 1  ? 0.4168 0.4168 0.4168 0.0000  0.0000  0.0000  1   MET A HB2  
14  H  HB3  . MET A 1  ? 0.4168 0.4168 0.4168 0.0000  0.0000  0.0000  1   MET A HB3  
15  H  HG2  . MET A 1  ? 0.4260 0.4260 0.4260 0.0000  0.0000  0.0000  1   MET A HG2  
16  H  HG3  . MET A 1  ? 0.4260 0.4260 0.4260 0.0000  0.0000  0.0000  1   MET A HG3  
17  H  HE1  . MET A 1  ? 0.6780 0.6780 0.6780 0.0000  0.0000  0.0000  1   MET A HE1  
18  H  HE2  . MET A 1  ? 0.6780 0.6780 0.6780 0.0000  0.0000  0.0000  1   MET A HE2  
19  H  HE3  . MET A 1  ? 0.6780 0.6780 0.6780 0.0000  0.0000  0.0000  1   MET A HE3  
20  N  N    . LYS A 2  ? 0.2525 0.2505 0.1840 -0.0022 -0.0053 0.0285  2   LYS A N    
21  C  CA   . LYS A 2  ? 0.2267 0.2495 0.1719 0.0013  0.0021  0.0580  2   LYS A CA   
22  C  C    . LYS A 2  ? 0.1543 0.1971 0.1747 -0.0068 -0.0021 0.0551  2   LYS A C    
23  O  O    . LYS A 2  ? 0.1749 0.1960 0.1822 0.0129  0.0020  0.0206  2   LYS A O    
24  C  CB   . LYS A 2  ? 0.3388 0.2825 0.2386 -0.0845 -0.0625 0.0231  2   LYS A CB   
25  C  CG   . LYS A 2  ? 0.5412 0.4185 0.2861 -0.1737 -0.0552 0.0168  2   LYS A CG   
26  C  CD   . LYS A 2  ? 0.6350 0.4348 0.3125 -0.0964 -0.0287 0.0091  2   LYS A CD   
27  C  CE   . LYS A 2  ? 0.6123 0.4180 0.3059 -0.0758 -0.0288 0.0091  2   LYS A CE   
28  N  NZ   . LYS A 2  ? 0.6177 0.4148 0.3240 -0.0763 -0.0288 0.0091  2   LYS A NZ   
29  H  H    . LYS A 2  ? 0.2748 0.2748 0.2748 0.0000  0.0000  0.0000  2   LYS A H    
30  H  HA   . LYS A 2  ? 0.2592 0.2592 0.2592 0.0000  0.0000  0.0000  2   LYS A HA   
31  H  HB2  . LYS A 2  ? 0.3439 0.3439 0.3439 0.0000  0.0000  0.0000  2   LYS A HB2  
32  H  HB3  . LYS A 2  ? 0.3439 0.3439 0.3439 0.0000  0.0000  0.0000  2   LYS A HB3  
33  N  N    . LYS A 3  ? 0.1632 0.2015 0.1727 0.0030  -0.0005 0.0672  3   LYS A N    
34  C  CA   . LYS A 3  ? 0.1321 0.1451 0.1650 0.0016  -0.0059 0.0473  3   LYS A CA   
35  C  C    . LYS A 3  ? 0.1162 0.1395 0.1631 0.0054  -0.0030 0.0078  3   LYS A C    
36  O  O    . LYS A 3  ? 0.1394 0.1939 0.1612 -0.0311 -0.0284 0.0336  3   LYS A O    
37  C  CB   . LYS A 3  ? 0.1551 0.1384 0.2300 -0.0088 -0.0138 0.0475  3   LYS A CB   
38  C  CG   . LYS A 3  ? 0.2041 0.1656 0.2987 -0.0077 -0.0261 0.0847  3   LYS A CG   
39  C  CD   . LYS A 3  ? 0.3137 0.1615 0.4469 -0.0359 -0.0446 0.0941  3   LYS A CD   
40  C  CE   . LYS A 3  ? 0.5111 0.1807 0.6343 -0.0392 -0.0153 0.0091  3   LYS A CE   
41  N  NZ   . LYS A 3  ? 0.6389 0.2237 0.9423 -0.0006 -0.2356 0.0927  3   LYS A NZ   
42  H  H    . LYS A 3  ? 0.2149 0.2149 0.2149 0.0000  0.0000  0.0000  3   LYS A H    
43  H  HA   . LYS A 3  ? 0.1769 0.1769 0.1769 0.0000  0.0000  0.0000  3   LYS A HA   
44  H  HB2  . LYS A 3  ? 0.2093 0.2093 0.2093 0.0000  0.0000  0.0000  3   LYS A HB2  
45  H  HB3  . LYS A 3  ? 0.2093 0.2093 0.2093 0.0000  0.0000  0.0000  3   LYS A HB3  
46  H  HG2  . LYS A 3  ? 0.2673 0.2673 0.2673 0.0000  0.0000  0.0000  3   LYS A HG2  
47  H  HG3  . LYS A 3  ? 0.2673 0.2673 0.2673 0.0000  0.0000  0.0000  3   LYS A HG3  
48  H  HD2  . LYS A 3  ? 0.3688 0.3688 0.3688 0.0000  0.0000  0.0000  3   LYS A HD2  
49  H  HD3  . LYS A 3  ? 0.3688 0.3688 0.3688 0.0000  0.0000  0.0000  3   LYS A HD3  
50  H  HE2  . LYS A 3  ? 0.5304 0.5304 0.5304 0.0000  0.0000  0.0000  3   LYS A HE2  
51  H  HE3  . LYS A 3  ? 0.5304 0.5304 0.5304 0.0000  0.0000  0.0000  3   LYS A HE3  
52  H  HZ1  . LYS A 3  ? 0.9023 0.9023 0.9023 0.0000  0.0000  0.0000  3   LYS A HZ1  
53  H  HZ2  . LYS A 3  ? 0.9023 0.9023 0.9023 0.0000  0.0000  0.0000  3   LYS A HZ2  
54  H  HZ3  . LYS A 3  ? 0.9023 0.9023 0.9023 0.0000  0.0000  0.0000  3   LYS A HZ3  
55  N  N    . TYR A 4  ? 0.1114 0.1236 0.1356 -0.0066 -0.0171 0.0152  4   TYR A N    
56  C  CA   . TYR A 4  ? 0.1140 0.1115 0.1485 -0.0138 -0.0060 0.0089  4   TYR A CA   
57  C  C    . TYR A 4  ? 0.1060 0.1289 0.1416 -0.0087 -0.0074 -0.0027 4   TYR A C    
58  O  O    . TYR A 4  ? 0.1298 0.2100 0.1982 -0.0561 0.0294  -0.0763 4   TYR A O    
59  C  CB   . TYR A 4  ? 0.1188 0.1222 0.1406 -0.0060 0.0000  -0.0008 4   TYR A CB   
60  C  CG   . TYR A 4  ? 0.1227 0.1011 0.1520 0.0024  -0.0182 0.0029  4   TYR A CG   
61  C  CD1  . TYR A 4  ? 0.1552 0.1223 0.1419 -0.0063 0.0097  -0.0006 4   TYR A CD1  
62  C  CD2  . TYR A 4  ? 0.1403 0.1187 0.1462 -0.0038 -0.0134 0.0044  4   TYR A CD2  
63  C  CE1  . TYR A 4  ? 0.1914 0.1125 0.1489 0.0016  0.0102  0.0153  4   TYR A CE1  
64  C  CE2  . TYR A 4  ? 0.1641 0.1200 0.1757 -0.0138 -0.0060 0.0106  4   TYR A CE2  
65  C  CZ   . TYR A 4  ? 0.1779 0.1232 0.1442 0.0055  -0.0124 -0.0073 4   TYR A CZ   
66  O  OH   . TYR A 4  ? 0.2894 0.1251 0.1817 -0.0054 0.0143  -0.0189 4   TYR A OH   
67  H  H    . TYR A 4  ? 0.1481 0.1481 0.1481 0.0000  0.0000  0.0000  4   TYR A H    
68  H  HA   . TYR A 4  ? 0.1495 0.1495 0.1495 0.0000  0.0000  0.0000  4   TYR A HA   
69  H  HB2  . TYR A 4  ? 0.1526 0.1526 0.1526 0.0000  0.0000  0.0000  4   TYR A HB2  
70  H  HB3  . TYR A 4  ? 0.1526 0.1526 0.1526 0.0000  0.0000  0.0000  4   TYR A HB3  
71  H  HD1  . TYR A 4  ? 0.1676 0.1676 0.1676 0.0000  0.0000  0.0000  4   TYR A HD1  
72  H  HD2  . TYR A 4  ? 0.1621 0.1621 0.1621 0.0000  0.0000  0.0000  4   TYR A HD2  
73  H  HE1  . TYR A 4  ? 0.1811 0.1811 0.1811 0.0000  0.0000  0.0000  4   TYR A HE1  
74  H  HE2  . TYR A 4  ? 0.1838 0.1838 0.1838 0.0000  0.0000  0.0000  4   TYR A HE2  
75  H  HH   . TYR A 4  ? 0.2981 0.2981 0.2981 0.0000  0.0000  0.0000  4   TYR A HH   
76  N  N    . THR A 5  ? 0.1079 0.1156 0.1658 -0.0148 0.0160  -0.0038 5   THR A N    
77  C  CA   . THR A 5  ? 0.1407 0.1071 0.1547 0.0000  0.0294  -0.0156 5   THR A CA   
78  C  C    . THR A 5  ? 0.0942 0.0957 0.1467 -0.0023 0.0134  -0.0008 5   THR A C    
79  O  O    . THR A 5  ? 0.1321 0.1107 0.1553 -0.0261 -0.0013 0.0013  5   THR A O    
80  C  CB   A THR A 5  ? 0.1974 0.1285 0.1779 0.0279  0.0566  -0.0006 5   THR A CB   
81  C  CB   B THR A 5  ? 0.1122 0.0911 0.1740 0.0691  0.0041  0.0172  5   THR A CB   
82  O  OG1  A THR A 5  ? 0.2956 0.2196 0.2177 0.0986  0.0406  -0.0193 5   THR A OG1  
83  O  OG1  B THR A 5  ? 0.2360 0.1732 0.1707 0.0897  0.0395  0.0439  5   THR A OG1  
84  C  CG2  A THR A 5  ? 0.0862 0.2508 0.2987 0.0136  -0.0458 -0.0185 5   THR A CG2  
85  C  CG2  B THR A 5  ? 0.1694 0.1176 0.1561 0.0771  0.0560  0.0509  5   THR A CG2  
86  H  H    . THR A 5  ? 0.1556 0.1556 0.1556 0.0000  0.0000  0.0000  5   THR A H    
87  H  HA   . THR A 5  ? 0.1609 0.1609 0.1609 0.0000  0.0000  0.0000  5   THR A HA   
88  N  N    . CYS A 6  ? 0.0969 0.0969 0.1486 -0.0117 0.0193  0.0004  6   CYS A N    
89  C  CA   . CYS A 6  ? 0.0851 0.1015 0.1496 0.0096  0.0226  -0.0159 6   CYS A CA   
90  C  C    . CYS A 6  ? 0.0910 0.1144 0.1571 0.0106  0.0296  -0.0055 6   CYS A C    
91  O  O    . CYS A 6  ? 0.1045 0.1208 0.1852 0.0195  0.0350  -0.0117 6   CYS A O    
92  C  CB   . CYS A 6  ? 0.0864 0.1237 0.1534 0.0030  0.0071  -0.0103 6   CYS A CB   
93  S  SG   . CYS A 6  ? 0.1261 0.1432 0.1490 0.0189  0.0192  -0.0043 6   CYS A SG   
94  H  H    . CYS A 6  ? 0.1370 0.1370 0.1370 0.0000  0.0000  0.0000  6   CYS A H    
95  H  HA   . CYS A 6  ? 0.1345 0.1345 0.1345 0.0000  0.0000  0.0000  6   CYS A HA   
96  H  HB2  . CYS A 6  ? 0.1453 0.1453 0.1453 0.0000  0.0000  0.0000  6   CYS A HB2  
97  H  HB3  . CYS A 6  ? 0.1453 0.1453 0.1453 0.0000  0.0000  0.0000  6   CYS A HB3  
98  N  N    . THR A 7  ? 0.0844 0.1209 0.1844 0.0031  0.0298  -0.0131 7   THR A N    
99  C  CA   . THR A 7  ? 0.0955 0.1483 0.2123 -0.0113 0.0340  0.0026  7   THR A CA   
100 C  C    . THR A 7  ? 0.1197 0.1584 0.2206 0.0290  0.0472  0.0313  7   THR A C    
101 O  O    . THR A 7  ? 0.1226 0.2893 0.2534 0.0630  0.0695  0.0559  7   THR A O    
102 C  CB   . THR A 7  ? 0.1140 0.1694 0.2620 -0.0378 0.0276  0.0039  7   THR A CB   
103 O  OG1  . THR A 7  ? 0.1425 0.1562 0.2701 -0.0261 0.0660  -0.0003 7   THR A OG1  
104 C  CG2  . THR A 7  ? 0.1377 0.2649 0.2518 -0.0256 -0.0008 -0.0392 7   THR A CG2  
105 H  H    . THR A 7  ? 0.1559 0.1559 0.1559 0.0000  0.0000  0.0000  7   THR A H    
106 H  HA   . THR A 7  ? 0.1825 0.1825 0.1825 0.0000  0.0000  0.0000  7   THR A HA   
107 H  HB   . THR A 7  ? 0.2182 0.2182 0.2182 0.0000  0.0000  0.0000  7   THR A HB   
108 H  HG1  . THR A 7  ? 0.2843 0.2843 0.2843 0.0000  0.0000  0.0000  7   THR A HG1  
109 H  HG21 . THR A 7  ? 0.3272 0.3272 0.3272 0.0000  0.0000  0.0000  7   THR A HG21 
110 H  HG22 . THR A 7  ? 0.3272 0.3272 0.3272 0.0000  0.0000  0.0000  7   THR A HG22 
111 H  HG23 . THR A 7  ? 0.3272 0.3272 0.3272 0.0000  0.0000  0.0000  7   THR A HG23 
112 N  N    . VAL A 8  ? 0.1251 0.1144 0.1898 0.0179  0.0557  -0.0017 8   VAL A N    
113 C  CA   . VAL A 8  ? 0.1540 0.1071 0.1799 0.0263  0.0560  0.0066  8   VAL A CA   
114 C  C    . VAL A 8  ? 0.1541 0.1077 0.2114 0.0286  0.0806  -0.0067 8   VAL A C    
115 O  O    . VAL A 8  ? 0.2511 0.1154 0.3152 0.0165  0.1773  -0.0221 8   VAL A O    
116 C  CB   . VAL A 8  ? 0.2131 0.1248 0.2060 0.0476  0.0818  0.0079  8   VAL A CB   
117 C  CG1  . VAL A 8  ? 0.2937 0.1963 0.1814 0.0710  0.0627  0.0207  8   VAL A CG1  
118 C  CG2  . VAL A 8  ? 0.2615 0.1169 0.3043 0.0441  0.1087  0.0279  8   VAL A CG2  
119 H  H    . VAL A 8  ? 0.1717 0.1717 0.1717 0.0000  0.0000  0.0000  8   VAL A H    
120 H  HA   . VAL A 8  ? 0.1764 0.1764 0.1764 0.0000  0.0000  0.0000  8   VAL A HA   
121 H  HB   . VAL A 8  ? 0.2175 0.2175 0.2175 0.0000  0.0000  0.0000  8   VAL A HB   
122 H  HG11 . VAL A 8  ? 0.3356 0.3356 0.3356 0.0000  0.0000  0.0000  8   VAL A HG11 
123 H  HG12 . VAL A 8  ? 0.3356 0.3356 0.3356 0.0000  0.0000  0.0000  8   VAL A HG12 
124 H  HG13 . VAL A 8  ? 0.3356 0.3356 0.3356 0.0000  0.0000  0.0000  8   VAL A HG13 
125 H  HG21 . VAL A 8  ? 0.3414 0.3414 0.3414 0.0000  0.0000  0.0000  8   VAL A HG21 
126 H  HG22 . VAL A 8  ? 0.3414 0.3414 0.3414 0.0000  0.0000  0.0000  8   VAL A HG22 
127 H  HG23 . VAL A 8  ? 0.3414 0.3414 0.3414 0.0000  0.0000  0.0000  8   VAL A HG23 
128 N  N    . CYS A 9  ? 0.1305 0.1121 0.1852 0.0298  0.0557  -0.0086 9   CYS A N    
129 C  CA   . CYS A 9  ? 0.1395 0.0971 0.1786 0.0244  0.0417  -0.0093 9   CYS A CA   
130 C  C    . CYS A 9  ? 0.1183 0.1117 0.1683 0.0198  0.0436  -0.0182 9   CYS A C    
131 O  O    . CYS A 9  ? 0.1825 0.1124 0.1747 0.0052  0.0532  -0.0136 9   CYS A O    
132 C  CB   . CYS A 9  ? 0.1611 0.1405 0.1569 0.0526  0.0231  -0.0179 9   CYS A CB   
133 S  SG   . CYS A 9  ? 0.1318 0.1671 0.1835 0.0281  0.0275  -0.0147 9   CYS A SG   
134 H  H    . CYS A 9  ? 0.1711 0.1711 0.1711 0.0000  0.0000  0.0000  9   CYS A H    
135 H  HA   . CYS A 9  ? 0.1661 0.1661 0.1661 0.0000  0.0000  0.0000  9   CYS A HA   
136 H  HB2  . CYS A 9  ? 0.1833 0.1833 0.1833 0.0000  0.0000  0.0000  9   CYS A HB2  
137 H  HB3  . CYS A 9  ? 0.1833 0.1833 0.1833 0.0000  0.0000  0.0000  9   CYS A HB3  
138 N  N    . GLY A 10 ? 0.1307 0.1124 0.1619 0.0171  0.0439  -0.0100 10  GLY A N    
139 C  CA   . GLY A 10 ? 0.1327 0.1382 0.1780 0.0142  0.0411  -0.0234 10  GLY A CA   
140 C  C    . GLY A 10 ? 0.1336 0.1158 0.1729 0.0158  0.0425  -0.0205 10  GLY A C    
141 O  O    . GLY A 10 ? 0.1684 0.1370 0.2027 0.0198  0.0466  0.0237  10  GLY A O    
142 H  H    . GLY A 10 ? 0.1619 0.1619 0.1619 0.0000  0.0000  0.0000  10  GLY A H    
143 H  HA2  . GLY A 10 ? 0.1795 0.1795 0.1795 0.0000  0.0000  0.0000  10  GLY A HA2  
144 H  HA3  . GLY A 10 ? 0.1795 0.1795 0.1795 0.0000  0.0000  0.0000  10  GLY A HA3  
145 N  N    . TYR A 11 ? 0.1166 0.1272 0.1782 0.0129  0.0257  -0.0179 11  TYR A N    
146 C  CA   . TYR A 11 ? 0.1323 0.1245 0.1753 -0.0083 0.0259  -0.0328 11  TYR A CA   
147 C  C    . TYR A 11 ? 0.1124 0.0991 0.1775 0.0021  0.0335  -0.0119 11  TYR A C    
148 O  O    . TYR A 11 ? 0.1509 0.0996 0.1852 -0.0184 0.0321  -0.0233 11  TYR A O    
149 C  CB   . TYR A 11 ? 0.1263 0.1485 0.1806 -0.0129 0.0124  -0.0345 11  TYR A CB   
150 C  CG   . TYR A 11 ? 0.1163 0.1561 0.1901 0.0003  0.0149  -0.0201 11  TYR A CG   
151 C  CD1  . TYR A 11 ? 0.1386 0.1899 0.2779 -0.0148 0.0243  -0.0682 11  TYR A CD1  
152 C  CD2  . TYR A 11 ? 0.1476 0.1483 0.1699 0.0317  0.0156  -0.0210 11  TYR A CD2  
153 C  CE1  . TYR A 11 ? 0.1319 0.2182 0.3060 -0.0369 0.0343  -0.0567 11  TYR A CE1  
154 C  CE2  . TYR A 11 ? 0.1520 0.1658 0.1963 0.0478  0.0040  -0.0354 11  TYR A CE2  
155 C  CZ   . TYR A 11 ? 0.1513 0.2315 0.1989 0.0223  0.0189  -0.0266 11  TYR A CZ   
156 O  OH   . TYR A 11 ? 0.1242 0.3260 0.2644 0.0376  0.0471  -0.0044 11  TYR A OH   
157 H  H    . TYR A 11 ? 0.1688 0.1688 0.1688 0.0000  0.0000  0.0000  11  TYR A H    
158 H  HA   . TYR A 11 ? 0.1728 0.1728 0.1728 0.0000  0.0000  0.0000  11  TYR A HA   
159 H  HB2  . TYR A 11 ? 0.1821 0.1821 0.1821 0.0000  0.0000  0.0000  11  TYR A HB2  
160 H  HB3  . TYR A 11 ? 0.1821 0.1821 0.1821 0.0000  0.0000  0.0000  11  TYR A HB3  
161 H  HD1  . TYR A 11 ? 0.2425 0.2425 0.2425 0.0000  0.0000  0.0000  11  TYR A HD1  
162 H  HD2  . TYR A 11 ? 0.1863 0.1863 0.1863 0.0000  0.0000  0.0000  11  TYR A HD2  
163 H  HE1  . TYR A 11 ? 0.2624 0.2624 0.2624 0.0000  0.0000  0.0000  11  TYR A HE1  
164 H  HE2  . TYR A 11 ? 0.2055 0.2055 0.2055 0.0000  0.0000  0.0000  11  TYR A HE2  
165 H  HH   . TYR A 11 ? 0.3572 0.3572 0.3572 0.0000  0.0000  0.0000  11  TYR A HH   
166 N  N    . ILE A 12 ? 0.1295 0.1086 0.1865 -0.0105 0.0292  -0.0012 12  ILE A N    
167 C  CA   . ILE A 12 ? 0.1259 0.1313 0.1825 -0.0018 0.0318  -0.0077 12  ILE A CA   
168 C  C    . ILE A 12 ? 0.1192 0.1158 0.1655 -0.0087 0.0240  -0.0074 12  ILE A C    
169 O  O    . ILE A 12 ? 0.1398 0.1338 0.2236 -0.0374 0.0405  -0.0336 12  ILE A O    
170 C  CB   . ILE A 12 ? 0.2056 0.1685 0.2164 0.0369  0.0383  0.0537  12  ILE A CB   
171 C  CG1  A ILE A 12 ? 0.1887 0.2056 0.3274 0.0655  0.0238  0.0661  12  ILE A CG1  
172 C  CG1  B ILE A 12 ? 0.1808 0.1893 0.3860 0.0441  0.0033  0.1031  12  ILE A CG1  
173 C  CG2  . ILE A 12 ? 0.3297 0.2380 0.2166 0.0798  0.0599  0.0504  12  ILE A CG2  
174 C  CD1  A ILE A 12 ? 0.2111 0.3324 0.4414 -0.0226 -0.0528 -0.0325 12  ILE A CD1  
175 C  CD1  B ILE A 12 ? 0.2180 0.2515 0.3317 0.1301  -0.0078 0.0488  12  ILE A CD1  
176 H  H    . ILE A 12 ? 0.1698 0.1698 0.1698 0.0000  0.0000  0.0000  12  ILE A H    
177 H  HA   . ILE A 12 ? 0.1759 0.1759 0.1759 0.0000  0.0000  0.0000  12  ILE A HA   
178 H  HB   . ILE A 12 ? 0.2362 0.2362 0.2362 0.0000  0.0000  0.0000  12  ILE A HB   
179 H  HG21 . ILE A 12 ? 0.3921 0.3921 0.3921 0.0000  0.0000  0.0000  12  ILE A HG21 
180 H  HG22 . ILE A 12 ? 0.3921 0.3921 0.3921 0.0000  0.0000  0.0000  12  ILE A HG22 
181 H  HG23 . ILE A 12 ? 0.3921 0.3921 0.3921 0.0000  0.0000  0.0000  12  ILE A HG23 
182 N  N    . TYR A 13 ? 0.1031 0.1228 0.1568 -0.0117 0.0168  -0.0110 13  TYR A N    
183 C  CA   . TYR A 13 ? 0.1056 0.1205 0.1370 -0.0053 0.0037  -0.0109 13  TYR A CA   
184 C  C    . TYR A 13 ? 0.0885 0.1333 0.1689 0.0027  0.0013  -0.0061 13  TYR A C    
185 O  O    . TYR A 13 ? 0.1129 0.1613 0.1724 -0.0190 0.0016  0.0138  13  TYR A O    
186 C  CB   . TYR A 13 ? 0.1132 0.1318 0.1465 -0.0094 0.0013  -0.0020 13  TYR A CB   
187 C  CG   . TYR A 13 ? 0.1179 0.1081 0.1493 -0.0042 0.0174  -0.0006 13  TYR A CG   
188 C  CD1  . TYR A 13 ? 0.1222 0.1247 0.1423 -0.0069 -0.0053 -0.0046 13  TYR A CD1  
189 C  CD2  . TYR A 13 ? 0.1280 0.1105 0.1463 -0.0141 0.0003  0.0091  13  TYR A CD2  
190 C  CE1  . TYR A 13 ? 0.1159 0.1278 0.1569 0.0026  0.0013  -0.0147 13  TYR A CE1  
191 C  CE2  . TYR A 13 ? 0.1230 0.1114 0.1456 0.0018  0.0171  0.0043  13  TYR A CE2  
192 C  CZ   . TYR A 13 ? 0.1160 0.1074 0.1558 -0.0060 -0.0066 -0.0012 13  TYR A CZ   
193 O  OH   . TYR A 13 ? 0.1083 0.1680 0.1576 0.0145  0.0073  -0.0118 13  TYR A OH   
194 H  H    . TYR A 13 ? 0.1531 0.1531 0.1531 0.0000  0.0000  0.0000  13  TYR A H    
195 H  HA   . TYR A 13 ? 0.1452 0.1452 0.1452 0.0000  0.0000  0.0000  13  TYR A HA   
196 H  HB2  . TYR A 13 ? 0.1565 0.1565 0.1565 0.0000  0.0000  0.0000  13  TYR A HB2  
197 H  HB3  . TYR A 13 ? 0.1565 0.1565 0.1565 0.0000  0.0000  0.0000  13  TYR A HB3  
198 H  HD1  . TYR A 13 ? 0.1556 0.1556 0.1556 0.0000  0.0000  0.0000  13  TYR A HD1  
199 H  HD2  . TYR A 13 ? 0.1538 0.1538 0.1538 0.0000  0.0000  0.0000  13  TYR A HD2  
200 H  HE1  . TYR A 13 ? 0.1602 0.1602 0.1602 0.0000  0.0000  0.0000  13  TYR A HE1  
201 H  HE2  . TYR A 13 ? 0.1521 0.1521 0.1521 0.0000  0.0000  0.0000  13  TYR A HE2  
202 H  HH   . TYR A 13 ? 0.2169 0.2169 0.2169 0.0000  0.0000  0.0000  13  TYR A HH   
203 N  N    . ASN A 14 ? 0.1059 0.1336 0.1870 -0.0240 0.0148  0.0179  14  ASN A N    
204 C  CA   . ASN A 14 ? 0.1139 0.1439 0.2089 -0.0038 0.0125  0.0504  14  ASN A CA   
205 C  C    . ASN A 14 ? 0.1197 0.1379 0.1712 -0.0111 0.0179  0.0421  14  ASN A C    
206 O  O    . ASN A 14 ? 0.1134 0.1566 0.1903 -0.0111 0.0044  0.0355  14  ASN A O    
207 C  CB   . ASN A 14 ? 0.1611 0.1430 0.3268 0.0227  0.0537  0.0973  14  ASN A CB   
208 C  CG   . ASN A 14 ? 0.1972 0.1465 0.4168 0.0418  0.0480  0.1135  14  ASN A CG   
209 O  OD1  . ASN A 14 ? 0.2509 0.2393 0.3650 0.0552  0.0763  0.1291  14  ASN A OD1  
210 N  ND2  . ASN A 14 ? 0.4836 0.2006 0.5536 0.1015  0.1608  0.1715  14  ASN A ND2  
211 H  H    . ASN A 14 ? 0.1705 0.1705 0.1705 0.0000  0.0000  0.0000  14  ASN A H    
212 H  HA   . ASN A 14 ? 0.1866 0.1866 0.1866 0.0000  0.0000  0.0000  14  ASN A HA   
213 H  HB2  . ASN A 14 ? 0.2524 0.2524 0.2524 0.0000  0.0000  0.0000  14  ASN A HB2  
214 H  HB3  . ASN A 14 ? 0.2524 0.2524 0.2524 0.0000  0.0000  0.0000  14  ASN A HB3  
215 N  N    . PRO A 15 ? 0.1300 0.1698 0.1821 -0.0115 0.0000  0.0474  15  PRO A N    
216 C  CA   . PRO A 15 ? 0.1459 0.1964 0.1830 0.0342  0.0310  0.0380  15  PRO A CA   
217 C  C    . PRO A 15 ? 0.1205 0.2282 0.1922 0.0243  0.0263  0.0687  15  PRO A C    
218 O  O    . PRO A 15 ? 0.1470 0.2776 0.2561 0.0344  0.0395  0.0668  15  PRO A O    
219 C  CB   A PRO A 15 ? 0.2050 0.1914 0.2071 -0.0001 -0.0129 0.0088  15  PRO A CB   
220 C  CB   B PRO A 15 ? 0.1919 0.2039 0.1998 0.0468  -0.0179 0.0458  15  PRO A CB   
221 C  CG   A PRO A 15 ? 0.2076 0.2115 0.1825 -0.0053 0.0023  0.0229  15  PRO A CG   
222 C  CG   B PRO A 15 ? 0.2125 0.2089 0.2205 -0.0282 0.0241  0.0130  15  PRO A CG   
223 C  CD   . PRO A 15 ? 0.1571 0.2144 0.1805 -0.0208 -0.0095 0.0179  15  PRO A CD   
224 H  HA   . PRO A 15 ? 0.2101 0.2101 0.2101 0.0000  0.0000  0.0000  15  PRO A HA   
225 N  N    . GLU A 16 ? 0.1416 0.2238 0.2525 -0.0047 0.0068  0.1151  16  GLU A N    
226 C  CA   . GLU A 16 ? 0.1747 0.2496 0.2700 -0.0285 0.0310  0.1410  16  GLU A CA   
227 C  C    . GLU A 16 ? 0.1433 0.2460 0.2904 -0.0232 -0.0161 0.1405  16  GLU A C    
228 O  O    . GLU A 16 ? 0.1324 0.3533 0.3181 -0.0531 -0.0044 0.1509  16  GLU A O    
229 C  CB   . GLU A 16 ? 0.2772 0.2764 0.3295 -0.0866 -0.0440 0.2002  16  GLU A CB   
230 C  CG   . GLU A 16 ? 0.3899 0.3924 0.3794 -0.0201 -0.0316 0.1251  16  GLU A CG   
231 C  CD   . GLU A 16 ? 0.6735 0.4300 0.3289 -0.0348 -0.1583 0.1641  16  GLU A CD   
232 O  OE1  . GLU A 16 ? 1.1669 0.3697 0.5477 0.0574  -0.2336 0.1077  16  GLU A OE1  
233 O  OE2  . GLU A 16 ? 0.9227 0.7881 0.3554 -0.0346 -0.1247 0.0829  16  GLU A OE2  
234 H  H    . GLU A 16 ? 0.2472 0.2472 0.2472 0.0000  0.0000  0.0000  16  GLU A H    
235 H  HA   . GLU A 16 ? 0.2777 0.2777 0.2777 0.0000  0.0000  0.0000  16  GLU A HA   
236 H  HB2  . GLU A 16 ? 0.3532 0.3532 0.3532 0.0000  0.0000  0.0000  16  GLU A HB2  
237 H  HB3  . GLU A 16 ? 0.3532 0.3532 0.3532 0.0000  0.0000  0.0000  16  GLU A HB3  
238 H  HG2  . GLU A 16 ? 0.4646 0.4646 0.4646 0.0000  0.0000  0.0000  16  GLU A HG2  
239 H  HG3  . GLU A 16 ? 0.4646 0.4646 0.4646 0.0000  0.0000  0.0000  16  GLU A HG3  
240 N  N    . ASP A 17 ? 0.1425 0.1719 0.2545 -0.0168 0.0143  0.0822  17  ASP A N    
241 C  CA   . ASP A 17 ? 0.1888 0.1636 0.2886 -0.0326 0.0009  0.0703  17  ASP A CA   
242 C  C    . ASP A 17 ? 0.1113 0.1474 0.2477 -0.0253 0.0066  0.0559  17  ASP A C    
243 O  O    . ASP A 17 ? 0.1279 0.1846 0.3019 -0.0250 -0.0182 0.0282  17  ASP A O    
244 C  CB   . ASP A 17 ? 0.2072 0.1685 0.3151 0.0303  0.0309  0.0114  17  ASP A CB   
245 C  CG   . ASP A 17 ? 0.3432 0.1864 0.4782 0.0337  -0.0559 0.0067  17  ASP A CG   
246 O  OD1  . ASP A 17 ? 0.3782 0.1819 0.6227 0.0013  -0.0617 0.0902  17  ASP A OD1  
247 O  OD2  . ASP A 17 ? 0.2556 0.2788 0.8881 0.0867  -0.0118 0.0323  17  ASP A OD2  
248 H  H    . ASP A 17 ? 0.2275 0.2275 0.2275 0.0000  0.0000  0.0000  17  ASP A H    
249 H  HA   . ASP A 17 ? 0.2563 0.2563 0.2563 0.0000  0.0000  0.0000  17  ASP A HA   
250 H  HB2  . ASP A 17 ? 0.2763 0.2763 0.2763 0.0000  0.0000  0.0000  17  ASP A HB2  
251 H  HB3  . ASP A 17 ? 0.2763 0.2763 0.2763 0.0000  0.0000  0.0000  17  ASP A HB3  
252 N  N    . GLY A 18 ? 0.1276 0.1351 0.2220 -0.0166 -0.0003 0.0413  18  GLY A N    
253 C  CA   . GLY A 18 ? 0.1190 0.1482 0.1966 -0.0115 0.0020  0.0163  18  GLY A CA   
254 C  C    . GLY A 18 ? 0.1063 0.1204 0.2020 -0.0146 0.0133  0.0051  18  GLY A C    
255 O  O    . GLY A 18 ? 0.1075 0.1460 0.2464 0.0243  0.0190  0.0093  18  GLY A O    
256 H  H    . GLY A 18 ? 0.1939 0.1939 0.1939 0.0000  0.0000  0.0000  18  GLY A H    
257 H  HA2  . GLY A 18 ? 0.1855 0.1855 0.1855 0.0000  0.0000  0.0000  18  GLY A HA2  
258 H  HA3  . GLY A 18 ? 0.1855 0.1855 0.1855 0.0000  0.0000  0.0000  18  GLY A HA3  
259 N  N    . ASP A 19 ? 0.0993 0.1117 0.2011 0.0059  0.0118  0.0026  19  ASP A N    
260 C  CA   . ASP A 19 ? 0.1041 0.1198 0.1670 -0.0174 0.0218  -0.0132 19  ASP A CA   
261 C  C    . ASP A 19 ? 0.1033 0.1140 0.1790 -0.0320 0.0194  -0.0363 19  ASP A C    
262 O  O    . ASP A 19 ? 0.1124 0.1125 0.1803 -0.0160 0.0010  -0.0100 19  ASP A O    
263 C  CB   . ASP A 19 ? 0.0988 0.1419 0.1763 -0.0037 0.0212  -0.0055 19  ASP A CB   
264 C  CG   . ASP A 19 ? 0.1208 0.1390 0.1758 -0.0198 0.0211  -0.0234 19  ASP A CG   
265 O  OD1  . ASP A 19 ? 0.2248 0.1606 0.2270 -0.0498 0.0537  -0.0508 19  ASP A OD1  
266 O  OD2  . ASP A 19 ? 0.1502 0.1532 0.1873 -0.0199 0.0239  -0.0024 19  ASP A OD2  
267 H  H    . ASP A 19 ? 0.1649 0.1649 0.1649 0.0000  0.0000  0.0000  19  ASP A H    
268 H  HA   . ASP A 19 ? 0.1564 0.1564 0.1564 0.0000  0.0000  0.0000  19  ASP A HA   
269 H  HB2  . ASP A 19 ? 0.1668 0.1668 0.1668 0.0000  0.0000  0.0000  19  ASP A HB2  
270 H  HB3  . ASP A 19 ? 0.1668 0.1668 0.1668 0.0000  0.0000  0.0000  19  ASP A HB3  
271 N  N    . PRO A 20 ? 0.1098 0.1254 0.1981 -0.0264 0.0171  -0.0189 20  PRO A N    
272 C  CA   . PRO A 20 ? 0.0994 0.1390 0.1951 -0.0234 0.0161  -0.0108 20  PRO A CA   
273 C  C    . PRO A 20 ? 0.1129 0.1559 0.2158 -0.0245 0.0204  -0.0447 20  PRO A C    
274 O  O    . PRO A 20 ? 0.1036 0.1955 0.2291 -0.0291 -0.0021 -0.0171 20  PRO A O    
275 C  CB   . PRO A 20 ? 0.1217 0.1674 0.2713 -0.0178 0.0392  -0.0210 20  PRO A CB   
276 C  CG   . PRO A 20 ? 0.1389 0.1665 0.4299 -0.0312 0.0337  0.0359  20  PRO A CG   
277 C  CD   . PRO A 20 ? 0.1311 0.1134 0.2413 -0.0150 0.0179  -0.0128 20  PRO A CD   
278 H  HA   . PRO A 20 ? 0.1733 0.1733 0.1733 0.0000  0.0000  0.0000  20  PRO A HA   
279 H  HB2  . PRO A 20 ? 0.2241 0.2241 0.2241 0.0000  0.0000  0.0000  20  PRO A HB2  
280 H  HB3  . PRO A 20 ? 0.2241 0.2241 0.2241 0.0000  0.0000  0.0000  20  PRO A HB3  
281 H  HG2  . PRO A 20 ? 0.2940 0.2940 0.2940 0.0000  0.0000  0.0000  20  PRO A HG2  
282 H  HG3  . PRO A 20 ? 0.2940 0.2940 0.2940 0.0000  0.0000  0.0000  20  PRO A HG3  
283 H  HD2  . PRO A 20 ? 0.1942 0.1942 0.1942 0.0000  0.0000  0.0000  20  PRO A HD2  
284 H  HD3  . PRO A 20 ? 0.1942 0.1942 0.1942 0.0000  0.0000  0.0000  20  PRO A HD3  
285 N  N    . ASP A 21 ? 0.1361 0.1763 0.2134 -0.0203 -0.0140 -0.0524 21  ASP A N    
286 C  CA   . ASP A 21 ? 0.1770 0.2255 0.2079 -0.0322 -0.0120 -0.0819 21  ASP A CA   
287 C  C    . ASP A 21 ? 0.1307 0.2412 0.1894 -0.0217 -0.0130 -0.0591 21  ASP A C    
288 O  O    . ASP A 21 ? 0.1860 0.2920 0.1872 -0.0183 -0.0390 -0.0376 21  ASP A O    
289 C  CB   . ASP A 21 ? 0.4063 0.2676 0.2104 -0.0119 0.0146  -0.0804 21  ASP A CB   
290 C  CG   . ASP A 21 ? 0.7171 0.2606 0.3692 -0.0504 -0.0795 -0.1141 21  ASP A CG   
291 O  OD1  . ASP A 21 ? 0.8600 0.2986 0.4699 -0.2084 0.0061  -0.1538 21  ASP A OD1  
292 O  OD2  . ASP A 21 ? 0.7306 0.2850 0.5751 0.0513  -0.0377 -0.2084 21  ASP A OD2  
293 H  H    . ASP A 21 ? 0.2103 0.2103 0.2103 0.0000  0.0000  0.0000  21  ASP A H    
294 H  HA   . ASP A 21 ? 0.2441 0.2441 0.2441 0.0000  0.0000  0.0000  21  ASP A HA   
295 H  HB2  . ASP A 21 ? 0.3537 0.3537 0.3537 0.0000  0.0000  0.0000  21  ASP A HB2  
296 H  HB3  . ASP A 21 ? 0.3537 0.3537 0.3537 0.0000  0.0000  0.0000  21  ASP A HB3  
297 N  N    . ASN A 22 ? 0.1244 0.2082 0.1684 -0.0146 0.0008  -0.0363 22  ASN A N    
298 C  CA   . ASN A 22 ? 0.1407 0.2216 0.1806 -0.0336 -0.0079 0.0041  22  ASN A CA   
299 C  C    . ASN A 22 ? 0.1377 0.1828 0.1640 -0.0079 -0.0146 0.0066  22  ASN A C    
300 O  O    . ASN A 22 ? 0.2148 0.1703 0.2454 -0.0274 -0.0100 0.0166  22  ASN A O    
301 C  CB   . ASN A 22 ? 0.1579 0.2662 0.1747 -0.0410 0.0087  0.0117  22  ASN A CB   
302 C  CG   . ASN A 22 ? 0.1909 0.4031 0.1733 -0.0385 0.0281  0.0374  22  ASN A CG   
303 O  OD1  . ASN A 22 ? 0.2490 0.5327 0.1863 -0.0396 0.0189  0.0141  22  ASN A OD1  
304 N  ND2  . ASN A 22 ? 0.2467 0.4089 0.2091 0.0402  0.0193  -0.0159 22  ASN A ND2  
305 H  H    . ASN A 22 ? 0.2003 0.2003 0.2003 0.0000  0.0000  0.0000  22  ASN A H    
306 H  HA   . ASN A 22 ? 0.2170 0.2170 0.2170 0.0000  0.0000  0.0000  22  ASN A HA   
307 H  HB2  . ASN A 22 ? 0.2396 0.2396 0.2396 0.0000  0.0000  0.0000  22  ASN A HB2  
308 H  HB3  . ASN A 22 ? 0.2396 0.2396 0.2396 0.0000  0.0000  0.0000  22  ASN A HB3  
309 N  N    . GLY A 23 ? 0.1178 0.1811 0.1532 -0.0032 -0.0059 -0.0168 23  GLY A N    
310 C  CA   . GLY A 23 ? 0.1174 0.1757 0.1801 0.0008  -0.0315 -0.0108 23  GLY A CA   
311 C  C    . GLY A 23 ? 0.0942 0.1329 0.1747 0.0106  -0.0013 -0.0170 23  GLY A C    
312 O  O    . GLY A 23 ? 0.1266 0.1913 0.1976 0.0402  -0.0162 -0.0250 23  GLY A O    
313 H  H    . GLY A 23 ? 0.1808 0.1808 0.1808 0.0000  0.0000  0.0000  23  GLY A H    
314 H  HA2  . GLY A 23 ? 0.1892 0.1892 0.1892 0.0000  0.0000  0.0000  23  GLY A HA2  
315 H  HA3  . GLY A 23 ? 0.1892 0.1892 0.1892 0.0000  0.0000  0.0000  23  GLY A HA3  
316 N  N    . VAL A 24 ? 0.0983 0.1131 0.1521 -0.0097 -0.0087 -0.0129 24  VAL A N    
317 C  CA   . VAL A 24 ? 0.0791 0.1133 0.1471 -0.0146 0.0072  -0.0059 24  VAL A CA   
318 C  C    . VAL A 24 ? 0.0644 0.1127 0.1407 -0.0081 0.0108  -0.0023 24  VAL A C    
319 O  O    . VAL A 24 ? 0.1052 0.1143 0.1883 -0.0025 0.0278  -0.0075 24  VAL A O    
320 C  CB   . VAL A 24 ? 0.0831 0.1199 0.1643 -0.0227 -0.0067 -0.0121 24  VAL A CB   
321 C  CG1  . VAL A 24 ? 0.0895 0.1588 0.1883 -0.0251 -0.0210 -0.0084 24  VAL A CG1  
322 C  CG2  . VAL A 24 ? 0.1163 0.1605 0.1857 -0.0403 0.0149  0.0177  24  VAL A CG2  
323 H  H    . VAL A 24 ? 0.1453 0.1453 0.1453 0.0000  0.0000  0.0000  24  VAL A H    
324 H  HA   . VAL A 24 ? 0.1357 0.1357 0.1357 0.0000  0.0000  0.0000  24  VAL A HA   
325 H  HB   . VAL A 24 ? 0.1469 0.1469 0.1469 0.0000  0.0000  0.0000  24  VAL A HB   
326 H  HG11 . VAL A 24 ? 0.2183 0.2183 0.2183 0.0000  0.0000  0.0000  24  VAL A HG11 
327 H  HG12 . VAL A 24 ? 0.2183 0.2183 0.2183 0.0000  0.0000  0.0000  24  VAL A HG12 
328 H  HG13 . VAL A 24 ? 0.2183 0.2183 0.2183 0.0000  0.0000  0.0000  24  VAL A HG13 
329 H  HG21 . VAL A 24 ? 0.2312 0.2312 0.2312 0.0000  0.0000  0.0000  24  VAL A HG21 
330 H  HG22 . VAL A 24 ? 0.2312 0.2312 0.2312 0.0000  0.0000  0.0000  24  VAL A HG22 
331 H  HG23 . VAL A 24 ? 0.2312 0.2312 0.2312 0.0000  0.0000  0.0000  24  VAL A HG23 
332 N  N    . ASN A 25 ? 0.0891 0.1104 0.1412 -0.0118 0.0021  0.0023  25  ASN A N    
333 C  CA   . ASN A 25 ? 0.0793 0.1152 0.1604 -0.0096 -0.0027 0.0248  25  ASN A CA   
334 C  C    . ASN A 25 ? 0.0756 0.1429 0.1673 -0.0104 -0.0060 0.0147  25  ASN A C    
335 O  O    . ASN A 25 ? 0.0892 0.1525 0.1694 -0.0259 -0.0187 0.0286  25  ASN A O    
336 C  CB   . ASN A 25 ? 0.0925 0.1326 0.1452 -0.0147 -0.0089 0.0052  25  ASN A CB   
337 C  CG   . ASN A 25 ? 0.1005 0.1090 0.1386 -0.0174 -0.0075 0.0122  25  ASN A CG   
338 O  OD1  . ASN A 25 ? 0.0868 0.1465 0.1465 -0.0126 -0.0099 0.0038  25  ASN A OD1  
339 N  ND2  . ASN A 25 ? 0.0816 0.1923 0.1612 0.0117  0.0118  0.0029  25  ASN A ND2  
340 H  H    . ASN A 25 ? 0.1362 0.1362 0.1362 0.0000  0.0000  0.0000  25  ASN A H    
341 H  HA   . ASN A 25 ? 0.1419 0.1419 0.1419 0.0000  0.0000  0.0000  25  ASN A HA   
342 H  HB2  . ASN A 25 ? 0.1480 0.1480 0.1480 0.0000  0.0000  0.0000  25  ASN A HB2  
343 H  HB3  . ASN A 25 ? 0.1480 0.1480 0.1480 0.0000  0.0000  0.0000  25  ASN A HB3  
344 H  HD21 . ASN A 25 ? 0.1741 0.1741 0.1741 0.0000  0.0000  0.0000  25  ASN A HD21 
345 H  HD22 . ASN A 25 ? 0.1741 0.1741 0.1741 0.0000  0.0000  0.0000  25  ASN A HD22 
346 N  N    . PRO A 26 ? 0.0895 0.1407 0.2331 -0.0193 -0.0302 0.0594  26  PRO A N    
347 C  CA   . PRO A 26 ? 0.1069 0.1573 0.2161 -0.0107 0.0078  0.0498  26  PRO A CA   
348 C  C    . PRO A 26 ? 0.0923 0.2058 0.2225 -0.0150 0.0074  0.0952  26  PRO A C    
349 O  O    . PRO A 26 ? 0.1164 0.2338 0.2380 -0.0047 0.0317  0.0564  26  PRO A O    
350 C  CB   . PRO A 26 ? 0.1694 0.1788 0.2873 -0.0175 -0.0044 0.1049  26  PRO A CB   
351 C  CG   . PRO A 26 ? 0.1929 0.1538 0.3407 -0.0617 -0.0381 0.0738  26  PRO A CG   
352 C  CD   . PRO A 26 ? 0.1217 0.1330 0.3171 -0.0363 -0.0540 0.0484  26  PRO A CD   
353 H  HA   . PRO A 26 ? 0.1921 0.1921 0.1921 0.0000  0.0000  0.0000  26  PRO A HA   
354 H  HB2  . PRO A 26 ? 0.2541 0.2541 0.2541 0.0000  0.0000  0.0000  26  PRO A HB2  
355 H  HB3  . PRO A 26 ? 0.2541 0.2541 0.2541 0.0000  0.0000  0.0000  26  PRO A HB3  
356 H  HG2  . PRO A 26 ? 0.2749 0.2749 0.2749 0.0000  0.0000  0.0000  26  PRO A HG2  
357 H  HG3  . PRO A 26 ? 0.2749 0.2749 0.2749 0.0000  0.0000  0.0000  26  PRO A HG3  
358 H  HD2  . PRO A 26 ? 0.2287 0.2287 0.2287 0.0000  0.0000  0.0000  26  PRO A HD2  
359 H  HD3  . PRO A 26 ? 0.2287 0.2287 0.2287 0.0000  0.0000  0.0000  26  PRO A HD3  
360 N  N    . GLY A 27 ? 0.1262 0.1949 0.1796 -0.0127 0.0154  0.0655  27  GLY A N    
361 C  CA   . GLY A 27 ? 0.1608 0.2395 0.1863 -0.0139 0.0190  0.0719  27  GLY A CA   
362 C  C    . GLY A 27 ? 0.1835 0.2436 0.1643 -0.0359 0.0185  0.0385  27  GLY A C    
363 O  O    . GLY A 27 ? 0.3562 0.3037 0.1684 -0.0522 0.0614  0.0055  27  GLY A O    
364 H  H    . GLY A 27 ? 0.2003 0.2003 0.2003 0.0000  0.0000  0.0000  27  GLY A H    
365 H  HA2  . GLY A 27 ? 0.2346 0.2346 0.2346 0.0000  0.0000  0.0000  27  GLY A HA2  
366 H  HA3  . GLY A 27 ? 0.2346 0.2346 0.2346 0.0000  0.0000  0.0000  27  GLY A HA3  
367 N  N    . THR A 28 ? 0.1329 0.1971 0.1560 -0.0230 0.0212  0.0071  28  THR A N    
368 C  CA   . THR A 28 ? 0.1284 0.1577 0.1632 -0.0185 0.0096  -0.0108 28  THR A CA   
369 C  C    . THR A 28 ? 0.1327 0.1499 0.1394 -0.0153 0.0124  -0.0032 28  THR A C    
370 O  O    . THR A 28 ? 0.1315 0.1743 0.1492 -0.0006 0.0049  -0.0116 28  THR A O    
371 C  CB   . THR A 28 ? 0.1228 0.1685 0.1468 -0.0076 -0.0084 -0.0041 28  THR A CB   
372 O  OG1  . THR A 28 ? 0.1194 0.1857 0.2067 -0.0109 -0.0055 -0.0060 28  THR A OG1  
373 C  CG2  . THR A 28 ? 0.1738 0.1548 0.1797 -0.0034 0.0010  0.0141  28  THR A CG2  
374 H  H    . THR A 28 ? 0.1944 0.1944 0.1944 0.0000  0.0000  0.0000  28  THR A H    
375 H  HA   . THR A 28 ? 0.1797 0.1797 0.1797 0.0000  0.0000  0.0000  28  THR A HA   
376 H  HB   . THR A 28 ? 0.1751 0.1751 0.1751 0.0000  0.0000  0.0000  28  THR A HB   
377 H  HG1  . THR A 28 ? 0.2558 0.2558 0.2558 0.0000  0.0000  0.0000  28  THR A HG1  
378 H  HG21 . THR A 28 ? 0.2541 0.2541 0.2541 0.0000  0.0000  0.0000  28  THR A HG21 
379 H  HG22 . THR A 28 ? 0.2541 0.2541 0.2541 0.0000  0.0000  0.0000  28  THR A HG22 
380 H  HG23 . THR A 28 ? 0.2541 0.2541 0.2541 0.0000  0.0000  0.0000  28  THR A HG23 
381 N  N    . ASP A 29 ? 0.1478 0.1796 0.1261 -0.0288 0.0223  -0.0065 29  ASP A N    
382 C  CA   . ASP A 29 ? 0.1406 0.1759 0.1384 -0.0163 -0.0154 -0.0111 29  ASP A CA   
383 C  C    . ASP A 29 ? 0.1259 0.1541 0.1386 -0.0055 -0.0155 0.0085  29  ASP A C    
384 O  O    . ASP A 29 ? 0.1251 0.1613 0.1657 -0.0137 -0.0088 0.0153  29  ASP A O    
385 C  CB   . ASP A 29 ? 0.2282 0.3240 0.1391 -0.0995 -0.0216 0.0189  29  ASP A CB   
386 C  CG   . ASP A 29 ? 0.2404 0.4392 0.2521 -0.0085 -0.0114 -0.0666 29  ASP A CG   
387 O  OD1  . ASP A 29 ? 0.2552 0.5718 0.5243 -0.0592 -0.0950 -0.1889 29  ASP A OD1  
388 O  OD2  . ASP A 29 ? 0.7040 0.5599 0.2491 -0.1561 0.0040  -0.1348 29  ASP A OD2  
389 H  H    . ASP A 29 ? 0.1813 0.1813 0.1813 0.0000  0.0000  0.0000  29  ASP A H    
390 H  HA   . ASP A 29 ? 0.1818 0.1818 0.1818 0.0000  0.0000  0.0000  29  ASP A HA   
391 H  HB2  . ASP A 29 ? 0.2764 0.2764 0.2764 0.0000  0.0000  0.0000  29  ASP A HB2  
392 H  HB3  . ASP A 29 ? 0.2764 0.2764 0.2764 0.0000  0.0000  0.0000  29  ASP A HB3  
393 N  N    . PHE A 30 ? 0.1202 0.1421 0.1652 0.0005  -0.0124 0.0216  30  PHE A N    
394 C  CA   . PHE A 30 ? 0.1252 0.1329 0.1426 0.0140  0.0098  0.0265  30  PHE A CA   
395 C  C    . PHE A 30 ? 0.1145 0.1430 0.1577 -0.0111 -0.0069 0.0060  30  PHE A C    
396 O  O    . PHE A 30 ? 0.1249 0.1360 0.1657 0.0013  0.0010  0.0190  30  PHE A O    
397 C  CB   . PHE A 30 ? 0.1311 0.1604 0.1995 0.0051  -0.0024 0.0230  30  PHE A CB   
398 C  CG   . PHE A 30 ? 0.1185 0.1276 0.1763 0.0150  0.0086  0.0259  30  PHE A CG   
399 C  CD1  . PHE A 30 ? 0.1366 0.1120 0.2113 0.0081  0.0103  0.0054  30  PHE A CD1  
400 C  CD2  . PHE A 30 ? 0.1277 0.1034 0.2281 0.0092  -0.0088 0.0150  30  PHE A CD2  
401 C  CE1  . PHE A 30 ? 0.1549 0.1543 0.1835 0.0242  0.0162  -0.0151 30  PHE A CE1  
402 C  CE2  . PHE A 30 ? 0.1644 0.1280 0.2010 0.0102  0.0405  0.0250  30  PHE A CE2  
403 C  CZ   . PHE A 30 ? 0.1189 0.1649 0.2186 0.0416  0.0431  0.0282  30  PHE A CZ   
404 H  H    . PHE A 30 ? 0.1709 0.1709 0.1709 0.0000  0.0000  0.0000  30  PHE A H    
405 H  HA   . PHE A 30 ? 0.1602 0.1602 0.1602 0.0000  0.0000  0.0000  30  PHE A HA   
406 H  HB2  . PHE A 30 ? 0.1964 0.1964 0.1964 0.0000  0.0000  0.0000  30  PHE A HB2  
407 H  HB3  . PHE A 30 ? 0.1964 0.1964 0.1964 0.0000  0.0000  0.0000  30  PHE A HB3  
408 H  HD1  . PHE A 30 ? 0.1838 0.1838 0.1838 0.0000  0.0000  0.0000  30  PHE A HD1  
409 H  HD2  . PHE A 30 ? 0.1836 0.1836 0.1836 0.0000  0.0000  0.0000  30  PHE A HD2  
410 H  HE1  . PHE A 30 ? 0.1970 0.1970 0.1970 0.0000  0.0000  0.0000  30  PHE A HE1  
411 H  HE2  . PHE A 30 ? 0.1973 0.1973 0.1973 0.0000  0.0000  0.0000  30  PHE A HE2  
412 H  HZ   . PHE A 30 ? 0.2008 0.2008 0.2008 0.0000  0.0000  0.0000  30  PHE A HZ   
413 N  N    . LYS A 31 ? 0.1459 0.1446 0.1978 -0.0102 -0.0170 0.0062  31  LYS A N    
414 C  CA   . LYS A 31 ? 0.1578 0.1430 0.2198 -0.0285 -0.0269 -0.0119 31  LYS A CA   
415 C  C    . LYS A 31 ? 0.1549 0.1351 0.2457 -0.0139 -0.0058 -0.0038 31  LYS A C    
416 O  O    . LYS A 31 ? 0.1964 0.1411 0.4104 -0.0059 -0.0604 0.0150  31  LYS A O    
417 C  CB   . LYS A 31 ? 0.2318 0.1725 0.2381 -0.0097 -0.0264 -0.0298 31  LYS A CB   
418 C  CG   A LYS A 31 ? 0.3015 0.3194 0.2191 -0.0233 -0.0577 -0.0729 31  LYS A CG   
419 C  CG   B LYS A 31 ? 0.3677 0.2945 0.2288 -0.0427 -0.0313 -0.0661 31  LYS A CG   
420 C  CD   A LYS A 31 ? 0.6361 0.4187 0.1897 -0.1574 0.0186  -0.1153 31  LYS A CD   
421 C  CD   B LYS A 31 ? 0.4993 0.4090 0.2253 -0.0857 -0.0807 -0.0165 31  LYS A CD   
422 C  CE   A LYS A 31 ? 0.6689 0.4425 0.1540 -0.1481 -0.0070 -0.0791 31  LYS A CE   
423 C  CE   B LYS A 31 ? 0.6264 0.4666 0.2151 -0.1552 -0.0104 -0.0700 31  LYS A CE   
424 N  NZ   A LYS A 31 ? 0.6308 0.4500 0.3098 -0.0462 -0.1128 -0.1173 31  LYS A NZ   
425 N  NZ   B LYS A 31 ? 0.7139 0.6472 0.2311 -0.3070 0.0854  -0.1359 31  LYS A NZ   
426 H  H    . LYS A 31 ? 0.1952 0.1952 0.1952 0.0000  0.0000  0.0000  31  LYS A H    
427 H  HA   . LYS A 31 ? 0.2082 0.2082 0.2082 0.0000  0.0000  0.0000  31  LYS A HA   
428 H  HB2  . LYS A 31 ? 0.2569 0.2569 0.2569 0.0000  0.0000  0.0000  31  LYS A HB2  
429 H  HB3  . LYS A 31 ? 0.2569 0.2569 0.2569 0.0000  0.0000  0.0000  31  LYS A HB3  
430 N  N    . ASP A 32 ? 0.1367 0.1381 0.1718 0.0081  -0.0100 -0.0259 32  ASP A N    
431 C  CA   . ASP A 32 ? 0.1603 0.1499 0.1817 0.0010  0.0066  -0.0236 32  ASP A CA   
432 C  C    . ASP A 32 ? 0.1016 0.1386 0.1711 0.0050  0.0063  -0.0003 32  ASP A C    
433 O  O    . ASP A 32 ? 0.1132 0.2245 0.2062 0.0234  0.0043  -0.0160 32  ASP A O    
434 C  CB   . ASP A 32 ? 0.1694 0.2070 0.1688 0.0126  0.0201  -0.0254 32  ASP A CB   
435 C  CG   . ASP A 32 ? 0.3044 0.2443 0.2177 0.0350  0.0736  -0.0532 32  ASP A CG   
436 O  OD1  . ASP A 32 ? 0.4606 0.2602 0.2280 0.0011  0.0575  -0.0807 32  ASP A OD1  
437 O  OD2  . ASP A 32 ? 0.4372 0.3204 0.1905 0.0073  0.0417  -0.0444 32  ASP A OD2  
438 H  H    . ASP A 32 ? 0.1787 0.1787 0.1787 0.0000  0.0000  0.0000  32  ASP A H    
439 H  HA   . ASP A 32 ? 0.1968 0.1968 0.1968 0.0000  0.0000  0.0000  32  ASP A HA   
440 H  HB2  . ASP A 32 ? 0.2180 0.2180 0.2180 0.0000  0.0000  0.0000  32  ASP A HB2  
441 H  HB3  . ASP A 32 ? 0.2180 0.2180 0.2180 0.0000  0.0000  0.0000  32  ASP A HB3  
442 N  N    . ILE A 33 ? 0.1165 0.1161 0.1535 -0.0011 0.0032  0.0125  33  ILE A N    
443 C  CA   . ILE A 33 ? 0.1208 0.0961 0.1446 -0.0212 -0.0010 0.0120  33  ILE A CA   
444 C  C    . ILE A 33 ? 0.0812 0.0914 0.1548 -0.0122 0.0153  -0.0113 33  ILE A C    
445 O  O    . ILE A 33 ? 0.0908 0.0955 0.1590 0.0044  0.0027  0.0005  33  ILE A O    
446 C  CB   . ILE A 33 ? 0.1131 0.0905 0.1604 -0.0009 0.0063  -0.0016 33  ILE A CB   
447 C  CG1  . ILE A 33 ? 0.1577 0.0959 0.1717 -0.0260 -0.0013 0.0170  33  ILE A CG1  
448 C  CG2  . ILE A 33 ? 0.1663 0.1188 0.1571 0.0185  0.0048  0.0029  33  ILE A CG2  
449 C  CD1  . ILE A 33 ? 0.1985 0.1031 0.2300 0.0441  0.0106  0.0082  33  ILE A CD1  
450 H  H    . ILE A 33 ? 0.1543 0.1543 0.1543 0.0000  0.0000  0.0000  33  ILE A H    
451 H  HA   . ILE A 33 ? 0.1446 0.1446 0.1446 0.0000  0.0000  0.0000  33  ILE A HA   
452 H  HB   . ILE A 33 ? 0.1456 0.1456 0.1456 0.0000  0.0000  0.0000  33  ILE A HB   
453 H  HG12 . ILE A 33 ? 0.1700 0.1700 0.1700 0.0000  0.0000  0.0000  33  ILE A HG12 
454 H  HG13 . ILE A 33 ? 0.1700 0.1700 0.1700 0.0000  0.0000  0.0000  33  ILE A HG13 
455 H  HG21 . ILE A 33 ? 0.2210 0.2210 0.2210 0.0000  0.0000  0.0000  33  ILE A HG21 
456 H  HG22 . ILE A 33 ? 0.2210 0.2210 0.2210 0.0000  0.0000  0.0000  33  ILE A HG22 
457 H  HG23 . ILE A 33 ? 0.2210 0.2210 0.2210 0.0000  0.0000  0.0000  33  ILE A HG23 
458 H  HD11 . ILE A 33 ? 0.2657 0.2657 0.2657 0.0000  0.0000  0.0000  33  ILE A HD11 
459 H  HD12 . ILE A 33 ? 0.2657 0.2657 0.2657 0.0000  0.0000  0.0000  33  ILE A HD12 
460 H  HD13 . ILE A 33 ? 0.2657 0.2657 0.2657 0.0000  0.0000  0.0000  33  ILE A HD13 
461 N  N    . PRO A 34 ? 0.0850 0.1172 0.1659 -0.0088 -0.0029 0.0030  34  PRO A N    
462 C  CA   . PRO A 34 ? 0.0996 0.1070 0.1670 0.0000  0.0000  0.0029  34  PRO A CA   
463 C  C    . PRO A 34 ? 0.0930 0.0908 0.1402 0.0122  -0.0012 0.0076  34  PRO A C    
464 O  O    . PRO A 34 ? 0.1262 0.0988 0.1401 0.0182  0.0140  -0.0082 34  PRO A O    
465 C  CB   . PRO A 34 ? 0.1146 0.1335 0.2207 0.0053  -0.0383 0.0075  34  PRO A CB   
466 C  CG   . PRO A 34 ? 0.1375 0.1960 0.2585 -0.0465 -0.0453 0.0401  34  PRO A CG   
467 C  CD   . PRO A 34 ? 0.0982 0.1481 0.2095 -0.0273 -0.0222 0.0236  34  PRO A CD   
468 H  HA   . PRO A 34 ? 0.1494 0.1494 0.1494 0.0000  0.0000  0.0000  34  PRO A HA   
469 H  HB2  . PRO A 34 ? 0.1875 0.1875 0.1875 0.0000  0.0000  0.0000  34  PRO A HB2  
470 H  HB3  . PRO A 34 ? 0.1875 0.1875 0.1875 0.0000  0.0000  0.0000  34  PRO A HB3  
471 H  HG2  . PRO A 34 ? 0.2368 0.2368 0.2368 0.0000  0.0000  0.0000  34  PRO A HG2  
472 H  HG3  . PRO A 34 ? 0.2368 0.2368 0.2368 0.0000  0.0000  0.0000  34  PRO A HG3  
473 H  HD2  . PRO A 34 ? 0.1823 0.1823 0.1823 0.0000  0.0000  0.0000  34  PRO A HD2  
474 H  HD3  . PRO A 34 ? 0.1823 0.1823 0.1823 0.0000  0.0000  0.0000  34  PRO A HD3  
475 N  N    . ASP A 35 ? 0.0955 0.0895 0.1399 0.0182  -0.0023 0.0055  35  ASP A N    
476 C  CA   . ASP A 35 ? 0.0859 0.0921 0.1418 0.0159  0.0066  0.0057  35  ASP A CA   
477 C  C    . ASP A 35 ? 0.1117 0.1140 0.1523 0.0282  0.0216  0.0073  35  ASP A C    
478 O  O    . ASP A 35 ? 0.1336 0.1743 0.1726 -0.0023 0.0342  -0.0134 35  ASP A O    
479 C  CB   . ASP A 35 ? 0.0995 0.0961 0.1509 0.0055  0.0001  0.0102  35  ASP A CB   
480 C  CG   . ASP A 35 ? 0.0831 0.1120 0.1497 0.0053  -0.0079 0.0131  35  ASP A CG   
481 O  OD1  . ASP A 35 ? 0.1144 0.1169 0.1542 0.0098  -0.0203 0.0084  35  ASP A OD1  
482 O  OD2  . ASP A 35 ? 0.1203 0.1057 0.1764 0.0188  -0.0241 -0.0190 35  ASP A OD2  
483 H  H    . ASP A 35 ? 0.1299 0.1299 0.1299 0.0000  0.0000  0.0000  35  ASP A H    
484 H  HA   . ASP A 35 ? 0.1279 0.1279 0.1279 0.0000  0.0000  0.0000  35  ASP A HA   
485 H  HB2  . ASP A 35 ? 0.1385 0.1385 0.1385 0.0000  0.0000  0.0000  35  ASP A HB2  
486 H  HB3  . ASP A 35 ? 0.1385 0.1385 0.1385 0.0000  0.0000  0.0000  35  ASP A HB3  
487 N  N    . ASP A 36 ? 0.1112 0.1116 0.1276 0.0285  0.0001  0.0006  36  ASP A N    
488 C  CA   . ASP A 36 ? 0.1587 0.1356 0.1206 0.0442  -0.0021 -0.0035 36  ASP A CA   
489 C  C    . ASP A 36 ? 0.1430 0.1365 0.1329 0.0479  0.0040  -0.0238 36  ASP A C    
490 O  O    . ASP A 36 ? 0.2285 0.1578 0.1313 0.0612  -0.0015 -0.0207 36  ASP A O    
491 C  CB   . ASP A 36 ? 0.2117 0.1675 0.1499 0.0766  -0.0245 -0.0153 36  ASP A CB   
492 C  CG   . ASP A 36 ? 0.1658 0.1962 0.1757 0.0776  -0.0457 -0.0370 36  ASP A CG   
493 O  OD1  . ASP A 36 ? 0.1451 0.2120 0.1971 0.0416  -0.0230 -0.0223 36  ASP A OD1  
494 O  OD2  . ASP A 36 ? 0.2186 0.3272 0.2434 0.0925  -0.0803 -0.0273 36  ASP A OD2  
495 H  H    . ASP A 36 ? 0.1402 0.1402 0.1402 0.0000  0.0000  0.0000  36  ASP A H    
496 H  HA   . ASP A 36 ? 0.1659 0.1659 0.1659 0.0000  0.0000  0.0000  36  ASP A HA   
497 H  HB2  . ASP A 36 ? 0.2116 0.2116 0.2116 0.0000  0.0000  0.0000  36  ASP A HB2  
498 H  HB3  . ASP A 36 ? 0.2116 0.2116 0.2116 0.0000  0.0000  0.0000  36  ASP A HB3  
499 N  N    . TRP A 37 ? 0.1333 0.1190 0.1248 0.0501  0.0060  -0.0089 37  TRP A N    
500 C  CA   . TRP A 37 ? 0.1220 0.1189 0.1341 0.0337  0.0000  -0.0141 37  TRP A CA   
501 C  C    . TRP A 37 ? 0.1239 0.1044 0.1324 0.0387  0.0113  -0.0230 37  TRP A C    
502 O  O    . TRP A 37 ? 0.1235 0.1415 0.1826 0.0228  -0.0019 -0.0343 37  TRP A O    
503 C  CB   . TRP A 37 ? 0.1358 0.1235 0.1514 0.0254  0.0088  -0.0134 37  TRP A CB   
504 C  CG   . TRP A 37 ? 0.1248 0.1077 0.1592 0.0163  0.0284  -0.0150 37  TRP A CG   
505 C  CD1  . TRP A 37 ? 0.1113 0.1264 0.1935 0.0150  0.0220  -0.0064 37  TRP A CD1  
506 C  CD2  . TRP A 37 ? 0.1067 0.1088 0.1524 0.0040  -0.0006 -0.0190 37  TRP A CD2  
507 N  NE1  . TRP A 37 ? 0.1275 0.1164 0.1936 -0.0176 0.0217  -0.0168 37  TRP A NE1  
508 C  CE2  . TRP A 37 ? 0.1228 0.1239 0.1429 0.0001  0.0223  -0.0078 37  TRP A CE2  
509 C  CE3  . TRP A 37 ? 0.1395 0.1203 0.1905 0.0097  -0.0116 -0.0201 37  TRP A CE3  
510 C  CZ2  . TRP A 37 ? 0.1530 0.1233 0.1744 0.0276  0.0111  -0.0162 37  TRP A CZ2  
511 C  CZ3  . TRP A 37 ? 0.1372 0.1659 0.2289 0.0340  -0.0284 -0.0229 37  TRP A CZ3  
512 C  CH2  . TRP A 37 ? 0.1527 0.1467 0.2104 0.0389  -0.0340 -0.0115 37  TRP A CH2  
513 H  H    . TRP A 37 ? 0.1508 0.1508 0.1508 0.0000  0.0000  0.0000  37  TRP A H    
514 H  HA   . TRP A 37 ? 0.1499 0.1499 0.1499 0.0000  0.0000  0.0000  37  TRP A HA   
515 H  HB2  . TRP A 37 ? 0.1642 0.1642 0.1642 0.0000  0.0000  0.0000  37  TRP A HB2  
516 H  HB3  . TRP A 37 ? 0.1642 0.1642 0.1642 0.0000  0.0000  0.0000  37  TRP A HB3  
517 H  HD1  . TRP A 37 ? 0.1724 0.1724 0.1724 0.0000  0.0000  0.0000  37  TRP A HD1  
518 H  HE1  . TRP A 37 ? 0.1750 0.1750 0.1750 0.0000  0.0000  0.0000  37  TRP A HE1  
519 H  HE3  . TRP A 37 ? 0.1802 0.1802 0.1802 0.0000  0.0000  0.0000  37  TRP A HE3  
520 H  HZ2  . TRP A 37 ? 0.1802 0.1802 0.1802 0.0000  0.0000  0.0000  37  TRP A HZ2  
521 H  HZ3  . TRP A 37 ? 0.2129 0.2129 0.2129 0.0000  0.0000  0.0000  37  TRP A HZ3  
522 H  HH2  . TRP A 37 ? 0.2039 0.2039 0.2039 0.0000  0.0000  0.0000  37  TRP A HH2  
523 N  N    . VAL A 38 ? 0.1167 0.1395 0.1447 0.0384  0.0065  -0.0182 38  VAL A N    
524 C  CA   . VAL A 38 ? 0.1259 0.1364 0.1522 0.0170  0.0173  -0.0183 38  VAL A CA   
525 C  C    . VAL A 38 ? 0.1274 0.1118 0.1536 0.0345  0.0147  -0.0139 38  VAL A C    
526 O  O    . VAL A 38 ? 0.1274 0.1296 0.1823 0.0266  0.0083  -0.0198 38  VAL A O    
527 C  CB   . VAL A 38 ? 0.1846 0.1878 0.1508 0.0659  0.0258  0.0075  38  VAL A CB   
528 C  CG1  . VAL A 38 ? 0.2186 0.2050 0.1734 0.0728  0.0414  0.0317  38  VAL A CG1  
529 C  CG2  . VAL A 38 ? 0.2220 0.2722 0.1483 0.0432  -0.0270 -0.0247 38  VAL A CG2  
530 H  H    . VAL A 38 ? 0.1603 0.1603 0.1603 0.0000  0.0000  0.0000  38  VAL A H    
531 H  HA   . VAL A 38 ? 0.1657 0.1657 0.1657 0.0000  0.0000  0.0000  38  VAL A HA   
532 H  HB   . VAL A 38 ? 0.2092 0.2092 0.2092 0.0000  0.0000  0.0000  38  VAL A HB   
533 H  HG11 . VAL A 38 ? 0.2985 0.2985 0.2985 0.0000  0.0000  0.0000  38  VAL A HG11 
534 H  HG12 . VAL A 38 ? 0.2985 0.2985 0.2985 0.0000  0.0000  0.0000  38  VAL A HG12 
535 H  HG13 . VAL A 38 ? 0.2985 0.2985 0.2985 0.0000  0.0000  0.0000  38  VAL A HG13 
536 H  HG21 . VAL A 38 ? 0.3213 0.3213 0.3213 0.0000  0.0000  0.0000  38  VAL A HG21 
537 H  HG22 . VAL A 38 ? 0.3213 0.3213 0.3213 0.0000  0.0000  0.0000  38  VAL A HG22 
538 H  HG23 . VAL A 38 ? 0.3213 0.3213 0.3213 0.0000  0.0000  0.0000  38  VAL A HG23 
539 N  N    . CYS A 39 ? 0.1225 0.1351 0.1544 0.0216  0.0071  -0.0228 39  CYS A N    
540 C  CA   . CYS A 39 ? 0.1167 0.1132 0.1577 0.0433  0.0109  -0.0315 39  CYS A CA   
541 C  C    . CYS A 39 ? 0.1384 0.1234 0.1428 0.0380  -0.0044 -0.0167 39  CYS A C    
542 O  O    . CYS A 39 ? 0.1613 0.1845 0.1527 0.0458  -0.0026 -0.0165 39  CYS A O    
543 C  CB   . CYS A 39 ? 0.1244 0.1531 0.1351 0.0383  0.0165  -0.0264 39  CYS A CB   
544 S  SG   . CYS A 39 ? 0.1253 0.1453 0.1676 0.0379  0.0047  -0.0267 39  CYS A SG   
545 H  H    . CYS A 39 ? 0.1649 0.1649 0.1649 0.0000  0.0000  0.0000  39  CYS A H    
546 H  HA   . CYS A 39 ? 0.1550 0.1550 0.1550 0.0000  0.0000  0.0000  39  CYS A HA   
547 H  HB2  . CYS A 39 ? 0.1650 0.1650 0.1650 0.0000  0.0000  0.0000  39  CYS A HB2  
548 H  HB3  . CYS A 39 ? 0.1650 0.1650 0.1650 0.0000  0.0000  0.0000  39  CYS A HB3  
549 N  N    . PRO A 40 ? 0.1241 0.1503 0.1653 0.0303  -0.0094 -0.0330 40  PRO A N    
550 C  CA   . PRO A 40 ? 0.1548 0.1732 0.2145 0.0122  -0.0343 -0.0596 40  PRO A CA   
551 C  C    . PRO A 40 ? 0.1738 0.1902 0.2034 0.0335  -0.0200 -0.0616 40  PRO A C    
552 O  O    . PRO A 40 ? 0.2228 0.3195 0.2594 0.0732  -0.0664 -0.1452 40  PRO A O    
553 C  CB   . PRO A 40 ? 0.2197 0.1874 0.2825 -0.0285 0.0231  -0.0458 40  PRO A CB   
554 C  CG   . PRO A 40 ? 0.1986 0.2675 0.2552 -0.0848 -0.0225 -0.0184 40  PRO A CG   
555 C  CD   . PRO A 40 ? 0.1541 0.1698 0.1866 0.0146  0.0129  -0.0190 40  PRO A CD   
556 H  HA   . PRO A 40 ? 0.2169 0.2169 0.2169 0.0000  0.0000  0.0000  40  PRO A HA   
557 H  HB2  . PRO A 40 ? 0.2758 0.2758 0.2758 0.0000  0.0000  0.0000  40  PRO A HB2  
558 H  HB3  . PRO A 40 ? 0.2758 0.2758 0.2758 0.0000  0.0000  0.0000  40  PRO A HB3  
559 H  HG2  . PRO A 40 ? 0.2885 0.2885 0.2885 0.0000  0.0000  0.0000  40  PRO A HG2  
560 H  HG3  . PRO A 40 ? 0.2885 0.2885 0.2885 0.0000  0.0000  0.0000  40  PRO A HG3  
561 H  HD2  . PRO A 40 ? 0.2041 0.2041 0.2041 0.0000  0.0000  0.0000  40  PRO A HD2  
562 H  HD3  . PRO A 40 ? 0.2041 0.2041 0.2041 0.0000  0.0000  0.0000  40  PRO A HD3  
563 N  N    . LEU A 41 ? 0.1751 0.1657 0.1803 0.0523  -0.0125 -0.0577 41  LEU A N    
564 C  CA   . LEU A 41 ? 0.1981 0.1798 0.2220 0.0445  -0.0188 -0.0674 41  LEU A CA   
565 C  C    . LEU A 41 ? 0.2271 0.2032 0.2272 0.0223  0.0278  -0.1097 41  LEU A C    
566 O  O    . LEU A 41 ? 0.6090 0.3324 0.2556 -0.1485 0.1527  -0.1541 41  LEU A O    
567 C  CB   A LEU A 41 ? 0.1776 0.1838 0.2505 0.0476  -0.0243 -0.0770 41  LEU A CB   
568 C  CB   B LEU A 41 ? 0.2035 0.1886 0.2561 0.0497  0.0381  -0.1026 41  LEU A CB   
569 C  CG   A LEU A 41 ? 0.2496 0.1517 0.2866 0.0073  -0.0222 -0.0017 41  LEU A CG   
570 C  CG   B LEU A 41 ? 0.2220 0.2156 0.2474 0.0724  -0.0016 -0.0878 41  LEU A CG   
571 C  CD1  A LEU A 41 ? 0.3338 0.1734 0.3012 0.1287  -0.0439 -0.0093 41  LEU A CD1  
572 C  CD1  B LEU A 41 ? 0.2590 0.2069 0.2776 0.0614  -0.0115 -0.0743 41  LEU A CD1  
573 C  CD2  A LEU A 41 ? 0.3353 0.1824 0.4003 -0.0543 -0.1187 0.0105  41  LEU A CD2  
574 C  CD2  B LEU A 41 ? 0.2891 0.2478 0.2643 0.1250  0.0549  -0.0137 41  LEU A CD2  
575 H  H    . LEU A 41 ? 0.2084 0.2084 0.2084 0.0000  0.0000  0.0000  41  LEU A H    
576 H  HA   . LEU A 41 ? 0.2400 0.2400 0.2400 0.0000  0.0000  0.0000  41  LEU A HA   
577 N  N    . CYS A 42 ? 0.2053 0.1793 0.1570 0.0475  0.0167  -0.0226 42  CYS A N    
578 C  CA   . CYS A 42 ? 0.2121 0.1858 0.1434 0.0619  -0.0204 -0.0359 42  CYS A CA   
579 C  C    . CYS A 42 ? 0.2766 0.1901 0.1117 0.0444  -0.0036 0.0034  42  CYS A C    
580 O  O    . CYS A 42 ? 0.2544 0.2441 0.1590 0.0859  0.0261  0.0160  42  CYS A O    
581 C  CB   . CYS A 42 ? 0.2165 0.2218 0.1488 0.0705  0.0331  -0.0284 42  CYS A CB   
582 S  SG   . CYS A 42 ? 0.1995 0.1737 0.1564 0.0444  0.0192  -0.0153 42  CYS A SG   
583 H  H    . CYS A 42 ? 0.2167 0.2167 0.2167 0.0000  0.0000  0.0000  42  CYS A H    
584 H  HA   . CYS A 42 ? 0.2165 0.2165 0.2165 0.0000  0.0000  0.0000  42  CYS A HA   
585 H  HB2  . CYS A 42 ? 0.2348 0.2348 0.2348 0.0000  0.0000  0.0000  42  CYS A HB2  
586 H  HB3  . CYS A 42 ? 0.2348 0.2348 0.2348 0.0000  0.0000  0.0000  42  CYS A HB3  
587 N  N    . GLY A 43 ? 0.2079 0.2005 0.1335 0.0882  0.0219  -0.0212 43  GLY A N    
588 C  CA   . GLY A 43 ? 0.2265 0.2044 0.1590 0.0405  0.0377  -0.0187 43  GLY A CA   
589 C  C    . GLY A 43 ? 0.1874 0.2046 0.1503 0.0739  0.0173  0.0308  43  GLY A C    
590 O  O    . GLY A 43 ? 0.2389 0.2128 0.1716 0.0788  0.0207  0.0227  43  GLY A O    
591 H  H    . GLY A 43 ? 0.2167 0.2167 0.2167 0.0000  0.0000  0.0000  43  GLY A H    
592 H  HA2  . GLY A 43 ? 0.2359 0.2359 0.2359 0.0000  0.0000  0.0000  43  GLY A HA2  
593 H  HA3  . GLY A 43 ? 0.2359 0.2359 0.2359 0.0000  0.0000  0.0000  43  GLY A HA3  
594 N  N    . VAL A 44 ? 0.2371 0.1615 0.1561 0.0666  0.0362  -0.0065 44  VAL A N    
595 C  CA   . VAL A 44 ? 0.2191 0.1445 0.1582 0.0586  0.0570  0.0244  44  VAL A CA   
596 C  C    . VAL A 44 ? 0.1676 0.1500 0.1604 0.0353  0.0209  0.0240  44  VAL A C    
597 O  O    . VAL A 44 ? 0.1667 0.1700 0.1752 0.0163  0.0333  -0.0117 44  VAL A O    
598 C  CB   . VAL A 44 ? 0.2064 0.1967 0.1747 0.0658  0.0684  0.0186  44  VAL A CB   
599 C  CG1  . VAL A 44 ? 0.2605 0.2317 0.2210 0.0530  0.0996  0.0350  44  VAL A CG1  
600 C  CG2  . VAL A 44 ? 0.1930 0.1628 0.1872 0.0221  0.0219  -0.0013 44  VAL A CG2  
601 H  H    . VAL A 44 ? 0.2218 0.2218 0.2218 0.0000  0.0000  0.0000  44  VAL A H    
602 H  HA   . VAL A 44 ? 0.2087 0.2087 0.2087 0.0000  0.0000  0.0000  44  VAL A HA   
603 H  HB   . VAL A 44 ? 0.2311 0.2311 0.2311 0.0000  0.0000  0.0000  44  VAL A HB   
604 H  HG11 . VAL A 44 ? 0.3566 0.3566 0.3566 0.0000  0.0000  0.0000  44  VAL A HG11 
605 H  HG12 . VAL A 44 ? 0.3566 0.3566 0.3566 0.0000  0.0000  0.0000  44  VAL A HG12 
606 H  HG13 . VAL A 44 ? 0.3566 0.3566 0.3566 0.0000  0.0000  0.0000  44  VAL A HG13 
607 H  HG21 . VAL A 44 ? 0.2715 0.2715 0.2715 0.0000  0.0000  0.0000  44  VAL A HG21 
608 H  HG22 . VAL A 44 ? 0.2715 0.2715 0.2715 0.0000  0.0000  0.0000  44  VAL A HG22 
609 H  HG23 . VAL A 44 ? 0.2715 0.2715 0.2715 0.0000  0.0000  0.0000  44  VAL A HG23 
610 N  N    . GLY A 45 ? 0.1954 0.1450 0.1861 0.0294  0.0400  0.0167  45  GLY A N    
611 C  CA   . GLY A 45 ? 0.2156 0.1410 0.1870 0.0635  0.0530  -0.0005 45  GLY A CA   
612 C  C    . GLY A 45 ? 0.1567 0.1036 0.2026 0.0183  0.0447  0.0062  45  GLY A C    
613 O  O    . GLY A 45 ? 0.1599 0.1187 0.1790 0.0183  0.0456  -0.0122 45  GLY A O    
614 H  H    . GLY A 45 ? 0.2106 0.2106 0.2106 0.0000  0.0000  0.0000  45  GLY A H    
615 H  HA2  . GLY A 45 ? 0.2174 0.2174 0.2174 0.0000  0.0000  0.0000  45  GLY A HA2  
616 H  HA3  . GLY A 45 ? 0.2174 0.2174 0.2174 0.0000  0.0000  0.0000  45  GLY A HA3  
617 N  N    . LYS A 46 ? 0.1531 0.1313 0.1870 0.0305  0.0442  -0.0247 46  LYS A N    
618 C  CA   . LYS A 46 ? 0.1346 0.1045 0.1626 0.0189  0.0403  -0.0062 46  LYS A CA   
619 C  C    . LYS A 46 ? 0.1503 0.1439 0.1588 0.0292  0.0531  -0.0316 46  LYS A C    
620 O  O    . LYS A 46 ? 0.1613 0.1243 0.1798 -0.0027 0.0499  -0.0047 46  LYS A O    
621 C  CB   . LYS A 46 ? 0.1202 0.1291 0.2063 0.0030  0.0234  -0.0245 46  LYS A CB   
622 C  CG   . LYS A 46 ? 0.1102 0.1253 0.2319 0.0024  0.0277  -0.0355 46  LYS A CG   
623 C  CD   . LYS A 46 ? 0.1080 0.1221 0.1669 0.0081  0.0047  0.0098  46  LYS A CD   
624 C  CE   . LYS A 46 ? 0.0882 0.1052 0.2051 0.0178  0.0178  -0.0139 46  LYS A CE   
625 N  NZ   . LYS A 46 ? 0.1089 0.1080 0.1562 0.0055  -0.0012 0.0052  46  LYS A NZ   
626 H  H    . LYS A 46 ? 0.1885 0.1885 0.1885 0.0000  0.0000  0.0000  46  LYS A H    
627 H  HA   . LYS A 46 ? 0.1607 0.1607 0.1607 0.0000  0.0000  0.0000  46  LYS A HA   
628 H  HB2  . LYS A 46 ? 0.1822 0.1822 0.1822 0.0000  0.0000  0.0000  46  LYS A HB2  
629 H  HB3  . LYS A 46 ? 0.1822 0.1822 0.1822 0.0000  0.0000  0.0000  46  LYS A HB3  
630 H  HG2  . LYS A 46 ? 0.1869 0.1869 0.1869 0.0000  0.0000  0.0000  46  LYS A HG2  
631 H  HG3  . LYS A 46 ? 0.1869 0.1869 0.1869 0.0000  0.0000  0.0000  46  LYS A HG3  
632 H  HD2  . LYS A 46 ? 0.1588 0.1588 0.1588 0.0000  0.0000  0.0000  46  LYS A HD2  
633 H  HD3  . LYS A 46 ? 0.1588 0.1588 0.1588 0.0000  0.0000  0.0000  46  LYS A HD3  
634 H  HE2  . LYS A 46 ? 0.1593 0.1593 0.1593 0.0000  0.0000  0.0000  46  LYS A HE2  
635 H  HE3  . LYS A 46 ? 0.1593 0.1593 0.1593 0.0000  0.0000  0.0000  46  LYS A HE3  
636 H  HZ1  . LYS A 46 ? 0.1865 0.1865 0.1865 0.0000  0.0000  0.0000  46  LYS A HZ1  
637 H  HZ2  . LYS A 46 ? 0.1865 0.1865 0.1865 0.0000  0.0000  0.0000  46  LYS A HZ2  
638 H  HZ3  . LYS A 46 ? 0.1865 0.1865 0.1865 0.0000  0.0000  0.0000  46  LYS A HZ3  
639 N  N    . ASP A 47 ? 0.1384 0.1116 0.2018 -0.0020 0.0546  -0.0057 47  ASP A N    
640 C  CA   . ASP A 47 ? 0.1796 0.1264 0.2011 -0.0194 0.0506  -0.0217 47  ASP A CA   
641 C  C    . ASP A 47 ? 0.1442 0.1350 0.1768 -0.0138 0.0345  -0.0022 47  ASP A C    
642 O  O    . ASP A 47 ? 0.1851 0.1643 0.2474 -0.0378 0.0296  -0.0447 47  ASP A O    
643 C  CB   . ASP A 47 ? 0.2286 0.1126 0.2988 -0.0320 0.0339  -0.0129 47  ASP A CB   
644 C  CG   . ASP A 47 ? 0.3833 0.1234 0.2694 0.0262  0.0615  0.0168  47  ASP A CG   
645 O  OD1  . ASP A 47 ? 0.3514 0.2264 0.2740 0.0364  0.0535  0.0172  47  ASP A OD1  
646 O  OD2  . ASP A 47 ? 0.6739 0.2117 0.4014 -0.1027 0.0908  0.0693  47  ASP A OD2  
647 H  H    . ASP A 47 ? 0.1807 0.1807 0.1807 0.0000  0.0000  0.0000  47  ASP A H    
648 H  HA   . ASP A 47 ? 0.2028 0.2028 0.2028 0.0000  0.0000  0.0000  47  ASP A HA   
649 H  HB2  . ASP A 47 ? 0.2559 0.2559 0.2559 0.0000  0.0000  0.0000  47  ASP A HB2  
650 H  HB3  . ASP A 47 ? 0.2559 0.2559 0.2559 0.0000  0.0000  0.0000  47  ASP A HB3  
651 N  N    . GLN A 48 ? 0.1622 0.1170 0.1645 -0.0228 0.0454  -0.0144 48  GLN A N    
652 C  CA   . GLN A 48 ? 0.1377 0.1174 0.1474 -0.0132 0.0498  -0.0146 48  GLN A CA   
653 C  C    . GLN A 48 ? 0.1364 0.1280 0.1513 -0.0097 0.0422  -0.0248 48  GLN A C    
654 O  O    . GLN A 48 ? 0.1591 0.1472 0.2093 -0.0009 0.0727  -0.0070 48  GLN A O    
655 C  CB   . GLN A 48 ? 0.1707 0.1430 0.1760 -0.0192 0.0403  -0.0019 48  GLN A CB   
656 C  CG   . GLN A 48 ? 0.1529 0.2032 0.1684 -0.0086 0.0125  -0.0010 48  GLN A CG   
657 C  CD   . GLN A 48 ? 0.1350 0.1895 0.2016 -0.0020 0.0395  0.0193  48  GLN A CD   
658 O  OE1  . GLN A 48 ? 0.1489 0.2162 0.2579 -0.0125 0.0508  0.0059  48  GLN A OE1  
659 N  NE2  . GLN A 48 ? 0.1951 0.1795 0.2586 -0.0275 0.0336  0.0100  48  GLN A NE2  
660 H  H    . GLN A 48 ? 0.1774 0.1774 0.1774 0.0000  0.0000  0.0000  48  GLN A H    
661 H  HA   . GLN A 48 ? 0.1611 0.1611 0.1611 0.0000  0.0000  0.0000  48  GLN A HA   
662 H  HB2  . GLN A 48 ? 0.1959 0.1959 0.1959 0.0000  0.0000  0.0000  48  GLN A HB2  
663 H  HB3  . GLN A 48 ? 0.1959 0.1959 0.1959 0.0000  0.0000  0.0000  48  GLN A HB3  
664 H  HG2  . GLN A 48 ? 0.2097 0.2097 0.2097 0.0000  0.0000  0.0000  48  GLN A HG2  
665 H  HG3  . GLN A 48 ? 0.2097 0.2097 0.2097 0.0000  0.0000  0.0000  48  GLN A HG3  
666 N  N    . PHE A 49 ? 0.1397 0.1087 0.1476 -0.0051 0.0341  -0.0027 49  PHE A N    
667 C  CA   . PHE A 49 ? 0.1197 0.1136 0.1412 -0.0060 0.0105  -0.0203 49  PHE A CA   
668 C  C    . PHE A 49 ? 0.1571 0.1092 0.1594 -0.0262 0.0059  0.0027  49  PHE A C    
669 O  O    . PHE A 49 ? 0.2329 0.1284 0.2043 -0.0391 -0.0100 -0.0217 49  PHE A O    
670 C  CB   . PHE A 49 ? 0.1217 0.1307 0.1407 -0.0138 0.0108  -0.0150 49  PHE A CB   
671 C  CG   . PHE A 49 ? 0.1000 0.1222 0.1306 0.0143  0.0161  -0.0088 49  PHE A CG   
672 C  CD1  . PHE A 49 ? 0.1253 0.1262 0.1485 0.0081  -0.0026 -0.0168 49  PHE A CD1  
673 C  CD2  . PHE A 49 ? 0.1017 0.1199 0.1450 -0.0115 0.0103  -0.0018 49  PHE A CD2  
674 C  CE1  . PHE A 49 ? 0.1326 0.1439 0.1655 0.0196  0.0083  0.0067  49  PHE A CE1  
675 C  CE2  . PHE A 49 ? 0.1199 0.1289 0.1578 -0.0048 0.0157  -0.0100 49  PHE A CE2  
676 C  CZ   . PHE A 49 ? 0.1143 0.1435 0.1685 0.0017  0.0020  -0.0344 49  PHE A CZ   
677 H  H    . PHE A 49 ? 0.1584 0.1584 0.1584 0.0000  0.0000  0.0000  49  PHE A H    
678 H  HA   . PHE A 49 ? 0.1498 0.1498 0.1498 0.0000  0.0000  0.0000  49  PHE A HA   
679 H  HB2  . PHE A 49 ? 0.1571 0.1571 0.1571 0.0000  0.0000  0.0000  49  PHE A HB2  
680 H  HB3  . PHE A 49 ? 0.1571 0.1571 0.1571 0.0000  0.0000  0.0000  49  PHE A HB3  
681 H  HD1  . PHE A 49 ? 0.1599 0.1599 0.1599 0.0000  0.0000  0.0000  49  PHE A HD1  
682 H  HD2  . PHE A 49 ? 0.1466 0.1466 0.1466 0.0000  0.0000  0.0000  49  PHE A HD2  
683 H  HE1  . PHE A 49 ? 0.1768 0.1768 0.1768 0.0000  0.0000  0.0000  49  PHE A HE1  
684 H  HE2  . PHE A 49 ? 0.1626 0.1626 0.1626 0.0000  0.0000  0.0000  49  PHE A HE2  
685 H  HZ   . PHE A 49 ? 0.1705 0.1705 0.1705 0.0000  0.0000  0.0000  49  PHE A HZ   
686 N  N    . GLU A 50 ? 0.1335 0.1300 0.1632 -0.0297 -0.0006 -0.0124 50  GLU A N    
687 C  CA   . GLU A 50 ? 0.1421 0.1533 0.1647 -0.0444 -0.0140 -0.0065 50  GLU A CA   
688 C  C    . GLU A 50 ? 0.1346 0.1448 0.1668 -0.0403 -0.0257 -0.0135 50  GLU A C    
689 O  O    . GLU A 50 ? 0.1675 0.1562 0.1586 -0.0277 -0.0104 -0.0049 50  GLU A O    
690 C  CB   A GLU A 50 ? 0.1066 0.1951 0.1865 -0.0118 -0.0017 -0.0212 50  GLU A CB   
691 C  CB   B GLU A 50 ? 0.1752 0.2055 0.2271 -0.0879 0.0066  -0.0143 50  GLU A CB   
692 C  CG   A GLU A 50 ? 0.1973 0.2226 0.1951 -0.0752 0.0307  0.0098  50  GLU A CG   
693 C  CG   B GLU A 50 ? 0.1419 0.2349 0.2173 -0.0315 0.0157  -0.0381 50  GLU A CG   
694 C  CD   A GLU A 50 ? 0.1703 0.3395 0.3474 -0.0722 -0.0183 0.0540  50  GLU A CD   
695 C  CD   B GLU A 50 ? 0.1524 0.2893 0.3048 -0.0089 0.0569  -0.0616 50  GLU A CD   
696 O  OE1  A GLU A 50 ? 0.1485 0.3737 0.3186 0.0330  0.0332  0.0621  50  GLU A OE1  
697 O  OE1  B GLU A 50 ? 0.1692 0.4036 0.3809 -0.0648 -0.0223 0.1437  50  GLU A OE1  
698 O  OE2  A GLU A 50 ? 0.2474 0.3871 0.3236 -0.1544 -0.0131 0.1404  50  GLU A OE2  
699 O  OE2  B GLU A 50 ? 0.1976 0.3418 0.2984 0.1101  0.0350  -0.0386 50  GLU A OE2  
700 H  H    . GLU A 50 ? 0.1707 0.1707 0.1707 0.0000  0.0000  0.0000  50  GLU A H    
701 H  HA   . GLU A 50 ? 0.1840 0.1840 0.1840 0.0000  0.0000  0.0000  50  GLU A HA   
702 N  N    . GLU A 51 ? 0.1444 0.1513 0.1542 -0.0179 -0.0234 -0.0170 51  GLU A N    
703 C  CA   . GLU A 51 ? 0.1443 0.1845 0.1650 -0.0196 -0.0464 0.0363  51  GLU A CA   
704 C  C    . GLU A 51 ? 0.1444 0.1855 0.2036 -0.0381 -0.0544 0.0402  51  GLU A C    
705 O  O    . GLU A 51 ? 0.1514 0.2128 0.3328 -0.0380 -0.0678 0.0560  51  GLU A O    
706 C  CB   . GLU A 51 ? 0.2793 0.3226 0.1385 -0.1082 -0.0460 0.0148  51  GLU A CB   
707 C  CG   . GLU A 51 ? 0.2758 0.6023 0.2015 -0.1029 -0.0140 -0.0352 51  GLU A CG   
708 C  CD   . GLU A 51 ? 0.5560 0.6682 0.1756 -0.1757 0.0335  -0.0003 51  GLU A CD   
709 O  OE1  . GLU A 51 ? 0.4680 0.6454 0.3207 -0.0725 -0.0002 -0.1932 51  GLU A OE1  
710 O  OE2  . GLU A 51 ? 0.9123 0.7735 0.2606 -0.3756 0.1665  -0.0908 51  GLU A OE2  
711 H  H    . GLU A 51 ? 0.1799 0.1799 0.1799 0.0000  0.0000  0.0000  51  GLU A H    
712 H  HA   . GLU A 51 ? 0.1975 0.1975 0.1975 0.0000  0.0000  0.0000  51  GLU A HA   
713 H  HB2  . GLU A 51 ? 0.2961 0.2961 0.2961 0.0000  0.0000  0.0000  51  GLU A HB2  
714 H  HB3  . GLU A 51 ? 0.2961 0.2961 0.2961 0.0000  0.0000  0.0000  51  GLU A HB3  
715 H  HG2  . GLU A 51 ? 0.4317 0.4317 0.4317 0.0000  0.0000  0.0000  51  GLU A HG2  
716 H  HG3  . GLU A 51 ? 0.4317 0.4317 0.4317 0.0000  0.0000  0.0000  51  GLU A HG3  
717 N  N    . VAL A 52 ? 0.1700 0.1845 0.2463 -0.0236 -0.0927 0.0643  52  VAL A N    
718 C  CA   . VAL A 52 ? 0.1823 0.1782 0.3389 -0.0243 -0.0763 0.0710  52  VAL A CA   
719 C  C    . VAL A 52 ? 0.2429 0.2608 0.3235 -0.0210 -0.1408 0.1208  52  VAL A C    
720 O  O    . VAL A 52 ? 0.3094 0.3953 0.3017 -0.0656 -0.0942 0.0977  52  VAL A O    
721 C  CB   . VAL A 52 ? 0.2100 0.1920 0.3398 0.0199  -0.0511 0.0635  52  VAL A CB   
722 C  CG1  . VAL A 52 ? 0.3074 0.1981 0.4658 0.0096  -0.1268 0.0378  52  VAL A CG1  
723 C  CG2  . VAL A 52 ? 0.2594 0.2980 0.3315 0.0487  -0.0303 0.0401  52  VAL A CG2  
724 H  H    . VAL A 52 ? 0.2403 0.2403 0.2403 0.0000  0.0000  0.0000  52  VAL A H    
725 H  HA   . VAL A 52 ? 0.2797 0.2797 0.2797 0.0000  0.0000  0.0000  52  VAL A HA   
726 H  HB   . VAL A 52 ? 0.2967 0.2967 0.2967 0.0000  0.0000  0.0000  52  VAL A HB   
727 H  HG11 . VAL A 52 ? 0.4857 0.4857 0.4857 0.0000  0.0000  0.0000  52  VAL A HG11 
728 H  HG12 . VAL A 52 ? 0.4857 0.4857 0.4857 0.0000  0.0000  0.0000  52  VAL A HG12 
729 H  HG13 . VAL A 52 ? 0.4857 0.4857 0.4857 0.0000  0.0000  0.0000  52  VAL A HG13 
730 H  HG21 . VAL A 52 ? 0.4444 0.4444 0.4444 0.0000  0.0000  0.0000  52  VAL A HG21 
731 H  HG22 . VAL A 52 ? 0.4444 0.4444 0.4444 0.0000  0.0000  0.0000  52  VAL A HG22 
732 H  HG23 . VAL A 52 ? 0.4444 0.4444 0.4444 0.0000  0.0000  0.0000  52  VAL A HG23 
733 N  N    . GLU A 53 ? 0.2737 0.3473 0.3993 -0.0407 -0.1788 0.1111  53  GLU A N    
734 C  CA   . GLU A 53 ? 0.4871 0.4723 0.3920 -0.1886 -0.2841 0.1617  53  GLU A CA   
735 C  C    . GLU A 53 ? 0.8874 0.4608 0.3837 -0.1953 -0.2623 0.2489  53  GLU A C    
736 O  O    . GLU A 53 ? 0.7611 0.4926 0.6820 0.1037  -0.4096 0.0727  53  GLU A O    
737 C  CB   . GLU A 53 ? 0.5230 0.4847 0.4725 -0.2067 -0.2915 0.0915  53  GLU A CB   
738 C  CG   . GLU A 53 ? 0.6172 0.4922 0.5077 -0.2687 -0.1763 0.0537  53  GLU A CG   
739 C  CD   . GLU A 53 ? 0.3646 0.5066 0.5835 -0.1051 -0.2964 0.0574  53  GLU A CD   
740 O  OE1  . GLU A 53 ? 0.8287 0.5295 0.4745 -0.0704 -0.1095 -0.0710 53  GLU A OE1  
741 O  OE2  . GLU A 53 ? 0.3892 0.4927 0.9316 -0.0055 -0.1776 -0.2401 53  GLU A OE2  
742 H  H    . GLU A 53 ? 0.4081 0.4081 0.4081 0.0000  0.0000  0.0000  53  GLU A H    
743 H  HA   . GLU A 53 ? 0.5405 0.5405 0.5405 0.0000  0.0000  0.0000  53  GLU A HA   
744 H  HB2  . GLU A 53 ? 0.5920 0.5920 0.5920 0.0000  0.0000  0.0000  53  GLU A HB2  
745 H  HB3  . GLU A 53 ? 0.5920 0.5920 0.5920 0.0000  0.0000  0.0000  53  GLU A HB3  
746 H  HG2  . GLU A 53 ? 0.6469 0.6469 0.6469 0.0000  0.0000  0.0000  53  GLU A HG2  
747 H  HG3  . GLU A 53 ? 0.6469 0.6469 0.6469 0.0000  0.0000  0.0000  53  GLU A HG3  
748 FE FE   . FE  B .  ? 0.1314 0.1610 0.1499 0.0421  0.0163  -0.0223 55  FE  A FE   
749 O  O    . HOH C .  ? 0.1428 0.2020 0.2698 -0.0024 -0.0095 -0.0395 56  HOH A O    
750 O  O    . HOH C .  ? 0.2238 0.2457 0.2404 0.0428  0.0243  0.0856  57  HOH A O    
751 O  O    . HOH C .  ? 0.1775 0.1703 0.3590 0.0160  0.0727  -0.0242 58  HOH A O    
752 O  O    . HOH C .  ? 0.2027 0.3220 0.2590 -0.0411 -0.0080 -0.0688 59  HOH A O    
753 O  O    . HOH C .  ? 0.2859 0.1708 0.4196 -0.0272 0.1469  -0.0551 60  HOH A O    
754 O  O    . HOH C .  ? 0.1982 0.2184 0.3549 -0.0159 -0.0721 -0.0117 61  HOH A O    
755 O  O    . HOH C .  ? 0.1963 0.2400 0.3528 0.0025  0.0396  -0.0911 62  HOH A O    
756 O  O    . HOH C .  ? 0.1562 0.3743 0.3373 -0.0356 0.0111  0.1021  63  HOH A O    
757 O  O    . HOH C .  ? 0.2777 0.2999 0.3272 -0.0078 -0.0877 0.0066  64  HOH A O    
758 O  O    . HOH C .  ? 0.2629 0.3889 0.2630 0.0153  0.0794  -0.0714 65  HOH A O    
759 O  O    . HOH C .  ? 0.2656 0.4000 0.3259 0.0463  -0.0672 0.1204  66  HOH A O    
760 O  O    . HOH C .  ? 0.3259 0.3242 0.2979 -0.0604 -0.0105 -0.0504 67  HOH A O    
761 O  O    . HOH C .  ? 0.4451 0.2211 0.3730 0.0271  0.0124  -0.0647 68  HOH A O    
762 O  O    . HOH C .  ? 0.4435 0.3624 0.3151 -0.1514 -0.0048 -0.0171 69  HOH A O    
763 O  O    . HOH C .  ? 0.3785 0.3051 0.3641 -0.0337 -0.0460 0.0129  70  HOH A O    
764 O  O    . HOH C .  ? 0.3499 0.2292 0.6743 -0.0629 0.1699  -0.1544 71  HOH A O    
765 O  O    . HOH C .  ? 0.2026 0.2685 0.5616 0.0049  0.0201  -0.0384 72  HOH A O    
766 O  O    . HOH C .  ? 0.5216 0.2735 0.2793 0.0717  -0.0444 0.0000  73  HOH A O    
767 O  O    . HOH C .  ? 0.4759 0.4083 0.3585 -0.0359 0.0666  -0.1302 74  HOH A O    
768 O  O    . HOH C .  ? 0.3755 0.4719 0.2925 -0.0335 -0.0053 -0.0539 75  HOH A O    
769 O  O    . HOH C .  ? 0.4753 0.3551 0.3635 0.0298  -0.1620 -0.0238 76  HOH A O    
770 O  O    . HOH C .  ? 0.2782 0.3323 0.6085 0.0866  0.0995  0.1707  77  HOH A O    
771 O  O    . HOH C .  ? 0.4207 0.3766 0.4281 -0.0201 0.1786  -0.0829 78  HOH A O    
772 O  O    . HOH C .  ? 0.2013 0.3369 0.7188 -0.0288 -0.0155 -0.0089 79  HOH A O    
773 O  O    . HOH C .  ? 0.4347 0.3326 0.6509 0.1184  -0.1814 -0.1081 80  HOH A O    
774 O  O    . HOH C .  ? 0.4855 0.3116 0.4823 -0.0260 -0.0248 0.1256  81  HOH A O    
775 O  O    . HOH C .  ? 0.4836 0.3095 0.5059 0.0378  0.0693  -0.1180 82  HOH A O    
776 O  O    . HOH C .  ? 0.9563 0.5396 0.9675 0.3193  0.1060  0.1317  83  HOH A O    
777 O  O    . HOH C .  ? 0.5736 0.3318 0.4438 -0.1185 0.0915  -0.1263 84  HOH A O    
778 O  O    . HOH C .  ? 0.3268 0.4795 0.4431 -0.0307 -0.0223 -0.0025 85  HOH A O    
779 O  O    . HOH C .  ? 0.4608 0.2582 0.6773 0.0173  -0.0358 0.1208  86  HOH A O    
780 O  O    . HOH C .  ? 0.3256 0.3168 0.6424 -0.0520 -0.0063 -0.0063 87  HOH A O    
781 O  O    . HOH C .  ? 0.5848 0.2509 0.5229 -0.1315 -0.1214 0.0741  88  HOH A O    
782 O  O    . HOH C .  ? 0.6619 0.4831 0.4049 -0.0730 -0.2636 0.0540  89  HOH A O    
783 O  O    . HOH C .  ? 0.4923 0.4389 0.8161 0.2054  -0.2606 0.0099  90  HOH A O    
784 O  O    . HOH C .  ? 0.5383 0.3371 0.7363 0.0760  0.0687  -0.0726 91  HOH A O    
785 O  O    . HOH C .  ? 0.6581 0.5682 0.4599 -0.1274 -0.1561 -0.0372 92  HOH A O    
786 O  O    . HOH C .  ? 0.6451 0.3759 0.4017 -0.0216 -0.1658 -0.0072 93  HOH A O    
787 O  O    . HOH C .  ? 0.3197 0.8771 0.7372 0.1048  0.0717  -0.1270 94  HOH A O    
788 O  O    . HOH C .  ? 0.3389 0.5685 0.7271 0.0209  -0.0544 -0.0960 95  HOH A O    
789 O  O    . HOH C .  ? 0.2921 0.5746 0.6522 0.0776  -0.0051 -0.1081 96  HOH A O    
790 O  O    . HOH C .  ? 0.4123 0.7582 0.6776 0.1749  0.0798  -0.0429 97  HOH A O    
791 O  O    . HOH C .  ? 0.4215 0.3242 0.5953 0.0064  0.0558  -0.0744 98  HOH A O    
792 O  O    . HOH C .  ? 0.5978 0.5754 0.5842 -0.2403 0.2735  -0.3473 99  HOH A O    
793 O  O    . HOH C .  ? 0.6250 0.5267 0.6769 -0.1664 0.2787  0.0036  100 HOH A O    
794 O  O    . HOH C .  ? 0.8042 0.8511 0.8290 -0.1322 -0.3790 0.3762  101 HOH A O    
795 O  O    . HOH C .  ? 0.7100 0.2176 0.7937 -0.1588 0.2392  -0.0259 102 HOH A O    
796 O  O    . HOH C .  ? 0.6712 0.8168 1.0556 0.1735  -0.3529 -0.0702 103 HOH A O    
797 O  O    . HOH C .  ? 0.5472 0.6621 0.4817 -0.2497 -0.0424 -0.0792 104 HOH A O    
798 O  O    . HOH C .  ? 0.8340 0.4551 0.5118 -0.1680 0.0154  -0.0827 105 HOH A O    
799 O  O    . HOH C .  ? 0.7983 0.2784 0.5964 0.1489  0.0264  -0.0238 106 HOH A O    
800 O  O    . HOH C .  ? 0.5509 0.5937 0.7980 0.1852  0.1243  -0.0231 107 HOH A O    
801 O  O    . HOH C .  ? 0.5933 1.0351 0.6522 -0.0715 0.1125  0.0111  108 HOH A O    
802 O  O    . HOH C .  ? 0.9594 0.9594 0.9592 0.0000  0.0000  0.0000  109 HOH A O    
803 O  O    . HOH C .  ? 0.6967 0.4200 0.8814 -0.0583 0.2766  0.0495  110 HOH A O    
804 O  O    . HOH C .  ? 0.9044 0.5409 0.6634 0.1048  0.1612  -0.0875 111 HOH A O    
805 O  O    . HOH C .  ? 0.6613 0.9906 0.9072 0.1534  0.2090  -0.5152 112 HOH A O    
806 O  O    . HOH C .  ? 0.7852 0.9017 0.7415 -0.1166 -0.1189 -0.1480 113 HOH A O    
807 O  O    . HOH C .  ? 0.5917 0.7240 0.5906 0.1822  -0.0453 -0.2014 114 HOH A O    
808 O  O    . HOH C .  ? 0.6121 0.7707 0.8086 0.1684  -0.0287 -0.1226 115 HOH A O    
809 O  O    . HOH C .  ? 1.0259 0.4877 0.7773 0.0583  0.1155  0.2308  116 HOH A O    
810 O  O    . HOH C .  ? 0.9508 0.5181 0.8247 -0.2537 -0.0665 -0.0611 117 HOH A O    
811 O  O    . HOH C .  ? 1.0294 0.3094 1.0499 0.0942  -0.2778 -0.2270 118 HOH A O    
812 O  O    . HOH C .  ? 1.0089 0.7208 0.8748 0.0179  -0.3414 0.1121  119 HOH A O    
813 O  O    . HOH C .  ? 1.3865 0.7277 0.4822 -0.1671 -0.1150 0.3136  120 HOH A O    
814 O  O    . HOH C .  ? 0.5662 0.7070 0.6032 -0.1544 0.1051  0.2061  121 HOH A O    
815 O  O    . HOH C .  ? 0.4591 0.6544 0.8613 -0.1411 -0.2472 -0.1685 122 HOH A O    
816 O  O    . HOH C .  ? 0.7212 0.7870 0.6652 -0.0298 -0.0885 0.2573  123 HOH A O    
817 O  O    . HOH C .  ? 1.0470 0.9867 1.0228 -0.1376 0.4124  -0.1344 124 HOH A O    
818 O  O    . HOH C .  ? 1.3620 1.1849 0.7516 -0.0294 0.5643  -0.4043 125 HOH A O    
819 O  O    . HOH C .  ? 0.7469 0.3875 0.4685 -0.1357 -0.2637 0.1051  126 HOH A O    
820 O  O    . HOH C .  ? 0.7050 0.5158 0.7295 -0.0111 -0.0541 -0.1198 127 HOH A O    
821 O  O    . HOH C .  ? 0.6776 0.9374 0.7507 -0.1311 0.1729  0.0009  128 HOH A O    
822 O  O    . HOH C .  ? 0.7616 0.8305 0.6720 0.0658  -0.1253 -0.0646 129 HOH A O    
823 O  O    . HOH C .  ? 0.9958 0.9836 0.7270 -0.0130 0.1879  -0.0866 130 HOH A O    
824 O  O    . HOH C .  ? 0.3683 1.2897 0.6248 -0.1955 0.0722  0.0690  131 HOH A O    
825 O  O    . HOH C .  ? 0.9155 0.6438 0.8395 0.0851  -0.4210 -0.2297 132 HOH A O    
826 O  O    . HOH C .  ? 0.8081 0.8125 0.6118 -0.1170 -0.1261 0.0970  133 HOH A O    
827 O  O    . HOH C .  ? 0.9936 0.9395 0.6874 0.0647  -0.1342 0.1988  134 HOH A O    
828 O  O    . HOH C .  ? 1.2538 1.0193 0.8240 -0.1587 0.3810  -0.3720 135 HOH A O    
829 O  O    . HOH C .  ? 0.6713 0.6476 0.6709 0.1542  0.1160  0.2071  136 HOH A O    
830 O  O    . HOH C .  ? 1.0201 0.9853 0.6095 -0.1439 -0.1390 -0.2007 137 HOH A O    
831 O  O    . HOH C .  ? 0.9269 0.9218 0.6500 0.0071  0.1986  -0.3336 138 HOH A O    
832 O  O    . HOH C .  ? 0.5286 1.1904 0.8651 -0.1499 -0.3476 0.0535  139 HOH A O    
833 O  O    . HOH C .  ? 0.9745 1.0165 0.6459 -0.0679 0.0649  -0.1887 140 HOH A O    
834 O  O    . HOH C .  ? 1.5186 1.1001 0.6227 -0.2144 0.3116  -0.1837 141 HOH A O    
835 O  O    . HOH C .  ? 0.6990 0.7329 0.8739 -0.2982 -0.0489 -0.0582 142 HOH A O    
836 O  O    . HOH C .  ? 0.8625 0.8056 0.7965 -0.0254 0.0012  -0.1026 143 HOH A O    
837 O  O    . HOH C .  ? 0.8991 0.8545 0.7633 -0.0389 -0.2656 0.1458  144 HOH A O    
838 O  O    . HOH C .  ? 1.0869 1.1778 1.1615 -0.0212 0.3805  -0.0002 145 HOH A O    
839 O  O    . HOH C .  ? 0.7234 0.8631 0.7694 -0.0594 -0.2399 -0.0466 146 HOH A O    
840 O  O    . HOH C .  ? 0.5585 0.5823 0.5452 -0.0436 -0.3001 -0.1090 147 HOH A O    
841 O  O    . HOH C .  ? 1.1601 0.7835 0.8723 -0.0866 0.2108  -0.1283 148 HOH A O    
842 O  O    . HOH C .  ? 0.6067 0.7131 0.5622 -0.0284 0.0980  0.2157  149 HOH A O    
843 O  O    . HOH C .  ? 1.0807 0.8054 0.7869 0.1188  0.1324  0.2475  150 HOH A O    
844 O  O    . HOH C .  ? 0.9207 0.9191 0.6027 0.1091  -0.1680 0.1710  151 HOH A O    
845 O  O    . HOH C .  ? 1.0765 0.8395 1.1629 0.2748  -0.3064 0.1314  152 HOH A O    
846 O  O    . HOH C .  ? 1.1688 0.7823 0.8783 -0.3605 -0.0780 0.0546  153 HOH A O    
847 O  O    . HOH C .  ? 1.3131 0.8199 0.6534 -0.2746 0.0754  -0.0796 154 HOH A O    
848 O  O    . HOH C .  ? 0.9417 0.8627 0.8154 0.0438  0.0944  -0.0637 155 HOH A O    
849 O  O    . HOH C .  ? 1.3532 0.4045 0.5292 -0.1354 -0.0495 -0.0670 156 HOH A O    
850 O  O    . HOH C .  ? 0.8067 0.8875 0.8308 0.0536  0.0725  -0.0267 157 HOH A O    
851 O  O    . HOH C .  ? 0.7429 0.9046 0.7572 -0.0588 0.0636  0.1767  158 HOH A O    
852 O  O    . HOH C .  ? 0.3771 0.5930 1.0943 0.1599  0.0576  -0.2754 159 HOH A O    
853 O  O    . HOH C .  ? 1.2101 0.6343 0.6469 -0.2080 -0.1142 -0.0439 160 HOH A O    
854 O  O    . HOH C .  ? 0.4540 0.7273 0.7975 -0.0361 -0.1232 0.3405  161 HOH A O    
855 O  O    . HOH C .  ? 0.6712 0.5000 0.4786 -0.0216 0.0649  -0.1310 162 HOH A O    
856 O  O    . HOH C .  ? 0.8790 0.7730 0.5089 -0.1532 0.2427  -0.3441 163 HOH A O    
857 O  O    . HOH C .  ? 1.1051 0.4398 0.8256 0.1525  -0.0023 0.1966  164 HOH A O    
858 O  O    . HOH C .  ? 0.6175 0.7054 0.5623 0.0236  -0.0809 -0.0122 165 HOH A O    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  LYS 2  2  2  LYS LYS A . n 
A 1 3  LYS 3  3  3  LYS LYS A . n 
A 1 4  TYR 4  4  4  TYR TYR A . n 
A 1 5  THR 5  5  5  THR THR A . n 
A 1 6  CYS 6  6  6  CYS CYS A . n 
A 1 7  THR 7  7  7  THR THR A . n 
A 1 8  VAL 8  8  8  VAL VAL A . n 
A 1 9  CYS 9  9  9  CYS CYS A . n 
A 1 10 GLY 10 10 10 GLY GLY A . n 
A 1 11 TYR 11 11 11 TYR TYR A . n 
A 1 12 ILE 12 12 12 ILE ILE A . n 
A 1 13 TYR 13 13 13 TYR TYR A . n 
A 1 14 ASN 14 14 14 ASN ASN A . n 
A 1 15 PRO 15 15 15 PRO PRO A . n 
A 1 16 GLU 16 16 16 GLU GLU A . n 
A 1 17 ASP 17 17 17 ASP ASP A . n 
A 1 18 GLY 18 18 18 GLY GLY A . n 
A 1 19 ASP 19 19 19 ASP ASP A . n 
A 1 20 PRO 20 20 20 PRO PRO A . n 
A 1 21 ASP 21 21 21 ASP ASP A . n 
A 1 22 ASN 22 22 22 ASN ASN A . n 
A 1 23 GLY 23 23 23 GLY GLY A . n 
A 1 24 VAL 24 24 24 VAL VAL A . n 
A 1 25 ASN 25 25 25 ASN ASN A . n 
A 1 26 PRO 26 26 26 PRO PRO A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 THR 28 28 28 THR THR A . n 
A 1 29 ASP 29 29 29 ASP ASP A . n 
A 1 30 PHE 30 30 30 PHE PHE A . n 
A 1 31 LYS 31 31 31 LYS LYS A . n 
A 1 32 ASP 32 32 32 ASP ASP A . n 
A 1 33 ILE 33 33 33 ILE ILE A . n 
A 1 34 PRO 34 34 34 PRO PRO A . n 
A 1 35 ASP 35 35 35 ASP ASP A . n 
A 1 36 ASP 36 36 36 ASP ASP A . n 
A 1 37 TRP 37 37 37 TRP TRP A . n 
A 1 38 VAL 38 38 38 VAL VAL A . n 
A 1 39 CYS 39 39 39 CYS CYS A . n 
A 1 40 PRO 40 40 40 PRO PRO A . n 
A 1 41 LEU 41 41 41 LEU LEU A . n 
A 1 42 CYS 42 42 42 CYS CYS A . n 
A 1 43 GLY 43 43 43 GLY GLY A . n 
A 1 44 VAL 44 44 44 VAL VAL A . n 
A 1 45 GLY 45 45 45 GLY GLY A . n 
A 1 46 LYS 46 46 46 LYS LYS A . n 
A 1 47 ASP 47 47 47 ASP ASP A . n 
A 1 48 GLN 48 48 48 GLN GLN A . n 
A 1 49 PHE 49 49 49 PHE PHE A . n 
A 1 50 GLU 50 50 50 GLU GLU A . n 
A 1 51 GLU 51 51 51 GLU GLU A . n 
A 1 52 VAL 52 52 52 VAL VAL A . n 
A 1 53 GLU 53 53 53 GLU GLU A . n 
A 1 54 GLU 54 54 ?  ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_655 -y+1,x-y,z    -0.5000000000 -0.8660254038 0.0000000000 64.0400000000 0.8660254038  
-0.5000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038  0.0000000000 32.0200000000 -0.8660254038 
-0.5000000000 0.0000000000 55.4602668584 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     109 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? A CYS 6  ? A CYS 6  ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 9  ? A CYS 9  ? 1_555 113.3 ? 
2 SG ? A CYS 6  ? A CYS 6  ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 104.3 ? 
3 SG ? A CYS 9  ? A CYS 9  ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 112.7 ? 
4 SG ? A CYS 6  ? A CYS 6  ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 110.1 ? 
5 SG ? A CYS 9  ? A CYS 9  ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 104.5 ? 
6 SG ? A CYS 42 ? A CYS 42 ? 1_555 FE ? B FE . ? A FE 55 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 112.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-04-03 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
SHELXL-93 'model building' . ? 1 
SHELXL-93 refinement       . ? 2 
ARP       'model building' . ? 3 
DENZO     'data reduction' . ? 4 
SCALEPACK 'data scaling'   . ? 5 
SHELXL-93 phasing          . ? 6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O  A HOH 94 ? ? O A HOH 97  ? ? 2.02 
2 1 CE A LYS 2  ? ? O A HOH 144 ? ? 2.11 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A ILE 12 ? ? CG1 A ILE 12 ? B 1.754 1.536 0.218  0.028 N 
2 1 CG A GLU 50 ? B CD  A GLU 50 ? B 1.628 1.515 0.113  0.015 N 
3 1 CD A GLU 50 ? B OE1 A GLU 50 ? B 1.171 1.252 -0.081 0.011 N 
4 1 CD A GLU 51 ? ? OE2 A GLU 51 ? ? 1.163 1.252 -0.089 0.011 N 
5 1 CB A GLU 53 ? ? CG  A GLU 53 ? ? 1.639 1.517 0.122  0.019 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 OG1 A THR 5  ? B CB A THR 5  ? B CG2 A THR 5  ? B 95.97  110.00 -14.03 2.30 N 
2 1 CA  A THR 5  ? ? CB A THR 5  ? B CG2 A THR 5  ? B 89.29  112.40 -23.11 1.40 N 
3 1 CA  A ILE 12 ? ? CB A ILE 12 ? ? CG1 A ILE 12 ? B 99.03  111.00 -11.97 1.90 N 
4 1 CB  A ASP 47 ? ? CG A ASP 47 ? ? OD1 A ASP 47 ? ? 124.00 118.30 5.70   0.90 N 
5 1 N   A GLU 50 ? ? CA A GLU 50 ? ? CB  A GLU 50 ? B 121.92 110.60 11.32  1.80 N 
6 1 CB  A GLU 53 ? ? CG A GLU 53 ? ? CD  A GLU 53 ? ? 97.26  114.20 -16.94 2.70 N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 0 A LYS 2 ? CE ? A LYS 2 CE 
2 1 Y 0 A LYS 2 ? NZ ? A LYS 2 NZ 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     GLU 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      54 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    GLU 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     54 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE (III) ION' FE  
3 water          HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FE  1   55  1   FE  FE  A . 
C 3 HOH 1   56  1   HOH HOH A . 
C 3 HOH 2   57  2   HOH HOH A . 
C 3 HOH 3   58  3   HOH HOH A . 
C 3 HOH 4   59  4   HOH HOH A . 
C 3 HOH 5   60  5   HOH HOH A . 
C 3 HOH 6   61  6   HOH HOH A . 
C 3 HOH 7   62  7   HOH HOH A . 
C 3 HOH 8   63  8   HOH HOH A . 
C 3 HOH 9   64  9   HOH HOH A . 
C 3 HOH 10  65  10  HOH HOH A . 
C 3 HOH 11  66  11  HOH HOH A . 
C 3 HOH 12  67  12  HOH HOH A . 
C 3 HOH 13  68  13  HOH HOH A . 
C 3 HOH 14  69  14  HOH HOH A . 
C 3 HOH 15  70  15  HOH HOH A . 
C 3 HOH 16  71  16  HOH HOH A . 
C 3 HOH 17  72  17  HOH HOH A . 
C 3 HOH 18  73  18  HOH HOH A . 
C 3 HOH 19  74  19  HOH HOH A . 
C 3 HOH 20  75  20  HOH HOH A . 
C 3 HOH 21  76  21  HOH HOH A . 
C 3 HOH 22  77  22  HOH HOH A . 
C 3 HOH 23  78  23  HOH HOH A . 
C 3 HOH 24  79  24  HOH HOH A . 
C 3 HOH 25  80  25  HOH HOH A . 
C 3 HOH 26  81  26  HOH HOH A . 
C 3 HOH 27  82  27  HOH HOH A . 
C 3 HOH 28  83  28  HOH HOH A . 
C 3 HOH 29  84  29  HOH HOH A . 
C 3 HOH 30  85  30  HOH HOH A . 
C 3 HOH 31  86  31  HOH HOH A . 
C 3 HOH 32  87  32  HOH HOH A . 
C 3 HOH 33  88  33  HOH HOH A . 
C 3 HOH 34  89  34  HOH HOH A . 
C 3 HOH 35  90  35  HOH HOH A . 
C 3 HOH 36  91  36  HOH HOH A . 
C 3 HOH 37  92  37  HOH HOH A . 
C 3 HOH 38  93  38  HOH HOH A . 
C 3 HOH 39  94  39  HOH HOH A . 
C 3 HOH 40  95  40  HOH HOH A . 
C 3 HOH 41  96  41  HOH HOH A . 
C 3 HOH 42  97  42  HOH HOH A . 
C 3 HOH 43  98  43  HOH HOH A . 
C 3 HOH 44  99  44  HOH HOH A . 
C 3 HOH 45  100 45  HOH HOH A . 
C 3 HOH 46  101 46  HOH HOH A . 
C 3 HOH 47  102 47  HOH HOH A . 
C 3 HOH 48  103 48  HOH HOH A . 
C 3 HOH 49  104 49  HOH HOH A . 
C 3 HOH 50  105 50  HOH HOH A . 
C 3 HOH 51  106 51  HOH HOH A . 
C 3 HOH 52  107 52  HOH HOH A . 
C 3 HOH 53  108 53  HOH HOH A . 
C 3 HOH 54  109 54  HOH HOH A . 
C 3 HOH 55  110 55  HOH HOH A . 
C 3 HOH 56  111 56  HOH HOH A . 
C 3 HOH 57  112 57  HOH HOH A . 
C 3 HOH 58  113 58  HOH HOH A . 
C 3 HOH 59  114 59  HOH HOH A . 
C 3 HOH 60  115 60  HOH HOH A . 
C 3 HOH 61  116 61  HOH HOH A . 
C 3 HOH 62  117 62  HOH HOH A . 
C 3 HOH 63  118 63  HOH HOH A . 
C 3 HOH 64  119 64  HOH HOH A . 
C 3 HOH 65  120 65  HOH HOH A . 
C 3 HOH 66  121 66  HOH HOH A . 
C 3 HOH 67  122 67  HOH HOH A . 
C 3 HOH 68  123 68  HOH HOH A . 
C 3 HOH 69  124 69  HOH HOH A . 
C 3 HOH 70  125 70  HOH HOH A . 
C 3 HOH 71  126 71  HOH HOH A . 
C 3 HOH 72  127 72  HOH HOH A . 
C 3 HOH 73  128 73  HOH HOH A . 
C 3 HOH 74  129 74  HOH HOH A . 
C 3 HOH 75  130 75  HOH HOH A . 
C 3 HOH 76  131 76  HOH HOH A . 
C 3 HOH 77  132 77  HOH HOH A . 
C 3 HOH 78  133 78  HOH HOH A . 
C 3 HOH 79  134 79  HOH HOH A . 
C 3 HOH 80  135 80  HOH HOH A . 
C 3 HOH 81  136 81  HOH HOH A . 
C 3 HOH 82  137 82  HOH HOH A . 
C 3 HOH 83  138 83  HOH HOH A . 
C 3 HOH 84  139 84  HOH HOH A . 
C 3 HOH 85  140 85  HOH HOH A . 
C 3 HOH 86  141 86  HOH HOH A . 
C 3 HOH 87  142 87  HOH HOH A . 
C 3 HOH 88  143 88  HOH HOH A . 
C 3 HOH 89  144 89  HOH HOH A . 
C 3 HOH 90  145 90  HOH HOH A . 
C 3 HOH 91  146 91  HOH HOH A . 
C 3 HOH 92  147 92  HOH HOH A . 
C 3 HOH 93  148 93  HOH HOH A . 
C 3 HOH 94  149 94  HOH HOH A . 
C 3 HOH 95  150 95  HOH HOH A . 
C 3 HOH 96  151 96  HOH HOH A . 
C 3 HOH 97  152 97  HOH HOH A . 
C 3 HOH 98  153 98  HOH HOH A . 
C 3 HOH 99  154 99  HOH HOH A . 
C 3 HOH 100 155 100 HOH HOH A . 
C 3 HOH 101 156 101 HOH HOH A . 
C 3 HOH 102 157 102 HOH HOH A . 
C 3 HOH 103 158 103 HOH HOH A . 
C 3 HOH 104 159 104 HOH HOH A . 
C 3 HOH 105 160 105 HOH HOH A . 
C 3 HOH 106 161 106 HOH HOH A . 
C 3 HOH 107 162 107 HOH HOH A . 
C 3 HOH 108 163 108 HOH HOH A . 
C 3 HOH 109 164 109 HOH HOH A . 
C 3 HOH 110 165 110 HOH HOH A . 
#