data_1IRP
# 
_entry.id   1IRP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IRP         
WWPDB D_1000174244 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IRP 
_pdbx_database_status.recvd_initial_deposition_date   1994-10-18 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Stockman, B.J.'     1 
'Scahill, T.A.'      2 
'Strakalaitis, N.A.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Solution structure of human interleukin-1 receptor antagonist protein.' 'FEBS Lett.'     349 79   83 1994 FEBLAL NE 
0014-5793 0165 ? 8045306 '10.1016/0014-5793(94)00643-1' 
1       
;Interleukin-1 Receptor Antagonist Protein: Solution Secondary Structure from Noe'S and 1H Alpha and 13C Alpha Chemical Shifts
;
Bull.Magn.Reson. 14  202  ?  1992 BUMRDT US 0163-559X 2045 ? ?       ?                              
2       
;Proton, Carbon and Nitrogen Chemical Shifts Accurately Delineate Differences and Similarities in Secondary Structure between the Homologous Proteins Irap and Il-1Beta
;
J.Biomol.NMR     2   591  ?  1992 JBNME9 NE 0925-2738 0800 ? ?       ?                              
3       
;Secondary Structure and Topology of Interleukin-1 Receptor Antagonist Protein Determined by Heteronuclear Three-Dimensional NMR Spectroscopy
;
Biochemistry     31  5237 ?  1992 BICHAW US 0006-2960 0033 ? ?       ?                              
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Stockman, B.J.'     1  
primary 'Scahill, T.A.'      2  
primary 'Strakalaitis, N.A.' 3  
primary 'Brunner, D.P.'      4  
primary 'Yem, A.W.'          5  
primary 'Deibel Jr., M.R.'   6  
1       'Stockman, B.J.'     7  
1       'Scahill, T.A.'      8  
1       'Euvrard, A.'        9  
1       'Strakalaitis, N.A.' 10 
1       'Brunner, D.P.'      11 
1       'Yem, A.W.'          12 
1       'Deibel, M.R.'       13 
2       'Stockman, B.J.'     14 
2       'Scahill, T.A.'      15 
2       'Strakalaitis, N.A.' 16 
2       'Brunner, D.P.'      17 
2       'Yem, A.W.'          18 
2       'Deibel, M.R.'       19 
3       'Stockman, B.J.'     20 
3       'Scahill, T.A.'      21 
3       'Roy, M.'            22 
3       'Ulrich, E.L.'       23 
3       'Strakalaitis, N.A.' 24 
3       'Brunner, D.P.'      25 
3       'Yem, A.W.'          26 
3       'Deibel, M.R.'       27 
# 
_cell.entry_id           1IRP 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IRP 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'INTERLEUKIN-1 RECEPTOR ANTAGONIST' 
_entity.formula_weight             17276.602 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQ
LEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQ
LEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   PRO n 
1 4   SER n 
1 5   GLY n 
1 6   ARG n 
1 7   LYS n 
1 8   SER n 
1 9   SER n 
1 10  LYS n 
1 11  MET n 
1 12  GLN n 
1 13  ALA n 
1 14  PHE n 
1 15  ARG n 
1 16  ILE n 
1 17  TRP n 
1 18  ASP n 
1 19  VAL n 
1 20  ASN n 
1 21  GLN n 
1 22  LYS n 
1 23  THR n 
1 24  PHE n 
1 25  TYR n 
1 26  LEU n 
1 27  ARG n 
1 28  ASN n 
1 29  ASN n 
1 30  GLN n 
1 31  LEU n 
1 32  VAL n 
1 33  ALA n 
1 34  GLY n 
1 35  TYR n 
1 36  LEU n 
1 37  GLN n 
1 38  GLY n 
1 39  PRO n 
1 40  ASN n 
1 41  VAL n 
1 42  ASN n 
1 43  LEU n 
1 44  GLU n 
1 45  GLU n 
1 46  LYS n 
1 47  ILE n 
1 48  ASP n 
1 49  VAL n 
1 50  VAL n 
1 51  PRO n 
1 52  ILE n 
1 53  GLU n 
1 54  PRO n 
1 55  HIS n 
1 56  ALA n 
1 57  LEU n 
1 58  PHE n 
1 59  LEU n 
1 60  GLY n 
1 61  ILE n 
1 62  HIS n 
1 63  GLY n 
1 64  GLY n 
1 65  LYS n 
1 66  MET n 
1 67  CYS n 
1 68  LEU n 
1 69  SER n 
1 70  CYS n 
1 71  VAL n 
1 72  LYS n 
1 73  SER n 
1 74  GLY n 
1 75  ASP n 
1 76  GLU n 
1 77  THR n 
1 78  ARG n 
1 79  LEU n 
1 80  GLN n 
1 81  LEU n 
1 82  GLU n 
1 83  ALA n 
1 84  VAL n 
1 85  ASN n 
1 86  ILE n 
1 87  THR n 
1 88  ASP n 
1 89  LEU n 
1 90  SER n 
1 91  GLU n 
1 92  ASN n 
1 93  ARG n 
1 94  LYS n 
1 95  GLN n 
1 96  ASP n 
1 97  LYS n 
1 98  ARG n 
1 99  PHE n 
1 100 ALA n 
1 101 PHE n 
1 102 ILE n 
1 103 ARG n 
1 104 SER n 
1 105 ASP n 
1 106 SER n 
1 107 GLY n 
1 108 PRO n 
1 109 THR n 
1 110 THR n 
1 111 SER n 
1 112 PHE n 
1 113 GLU n 
1 114 SER n 
1 115 ALA n 
1 116 ALA n 
1 117 CYS n 
1 118 PRO n 
1 119 GLY n 
1 120 TRP n 
1 121 PHE n 
1 122 LEU n 
1 123 CYS n 
1 124 THR n 
1 125 ALA n 
1 126 MET n 
1 127 GLU n 
1 128 ALA n 
1 129 ASP n 
1 130 GLN n 
1 131 PRO n 
1 132 VAL n 
1 133 SER n 
1 134 LEU n 
1 135 THR n 
1 136 ASN n 
1 137 MET n 
1 138 PRO n 
1 139 ASP n 
1 140 GLU n 
1 141 GLY n 
1 142 VAL n 
1 143 MET n 
1 144 VAL n 
1 145 THR n 
1 146 LYS n 
1 147 PHE n 
1 148 TYR n 
1 149 PHE n 
1 150 GLN n 
1 151 GLU n 
1 152 ASP n 
1 153 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IL1RA_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P18510 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHA
LFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTN
MPDEGVMVTKFYFQEDE
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1IRP 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 153 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P18510 
_struct_ref_seq.db_align_beg                  26 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  177 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       153 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_ensemble.entry_id                             1IRP 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    12 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             DGII 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.authors          'BIOSYM TECHNOLOGIES, INC.' 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.entry_id          1IRP 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1IRP 
_struct.title                     'SOLUTION STRUCTURE OF HUMAN INTERLEUKIN-1 RECEPTOR ANTAGONIST PROTEIN' 
_struct.pdbx_descriptor           'INTERLEUKIN-1 RECEPTOR ANTAGONIST PROTEIN (NMR, 12 STRUCTURES)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IRP 
_struct_keywords.pdbx_keywords   CYTOKINE 
_struct_keywords.text            CYTOKINE 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 7 ? 
C ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 109 ? THR A 110 ? THR A 109 THR A 110 
A 2 PHE A 147 ? GLU A 151 ? PHE A 147 GLU A 151 
A 3 ALA A 13  ? ASP A 18  ? ALA A 13  ASP A 18  
A 4 LYS A 22  ? LEU A 26  ? LYS A 22  LEU A 26  
A 5 LEU A 31  ? GLY A 34  ? LEU A 31  GLY A 34  
B 1 THR A 109 ? THR A 110 ? THR A 109 THR A 110 
B 2 PHE A 147 ? GLU A 151 ? PHE A 147 GLU A 151 
B 3 ALA A 13  ? ASP A 18  ? ALA A 13  ASP A 18  
B 4 ILE A 47  ? PRO A 51  ? ILE A 47  PRO A 51  
B 5 LEU A 57  ? ILE A 61  ? LEU A 57  ILE A 61  
B 6 MET A 66  ? SER A 73  ? MET A 66  SER A 73  
B 7 GLU A 76  ? ALA A 83  ? GLU A 76  ALA A 83  
C 1 ALA A 100 ? ARG A 103 ? ALA A 100 ARG A 103 
C 2 PHE A 112 ? ALA A 115 ? PHE A 112 ALA A 115 
C 3 GLY A 119 ? THR A 124 ? GLY A 119 THR A 124 
C 4 VAL A 132 ? THR A 135 ? VAL A 132 THR A 135 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 110 ? N THR A 110 O PHE A 147 ? O PHE A 147 
A 2 3 O GLN A 150 ? O GLN A 150 N ARG A 15  ? N ARG A 15  
A 3 4 N ASP A 18  ? N ASP A 18  O LYS A 22  ? O LYS A 22  
A 4 5 O TYR A 25  ? O TYR A 25  N VAL A 32  ? N VAL A 32  
B 1 2 N THR A 110 ? N THR A 110 O PHE A 147 ? O PHE A 147 
B 2 3 O GLN A 150 ? O GLN A 150 N ARG A 15  ? N ARG A 15  
B 3 4 N PHE A 14  ? N PHE A 14  O ILE A 47  ? O ILE A 47  
B 4 5 N VAL A 50  ? N VAL A 50  O PHE A 58  ? O PHE A 58  
B 5 6 N ILE A 61  ? N ILE A 61  O MET A 66  ? O MET A 66  
B 6 7 N SER A 73  ? N SER A 73  O GLU A 76  ? O GLU A 76  
C 1 2 O ILE A 102 ? O ILE A 102 N GLU A 113 ? N GLU A 113 
C 2 3 N SER A 114 ? N SER A 114 O TRP A 120 ? O TRP A 120 
C 3 4 O CYS A 123 ? O CYS A 123 N SER A 133 ? N SER A 133 
# 
_database_PDB_matrix.entry_id          1IRP 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IRP 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? -8.670  5.442   0.056   1.00 0.00 ? 1   MET A N    1  
ATOM 2     C CA   . MET A 1 1   ? -9.242  5.911   -1.233  1.00 0.00 ? 1   MET A CA   1  
ATOM 3     C C    . MET A 1 1   ? -10.587 6.627   -0.896  1.00 0.00 ? 1   MET A C    1  
ATOM 4     O O    . MET A 1 1   ? -11.615 5.965   -0.730  1.00 0.00 ? 1   MET A O    1  
ATOM 5     C CB   . MET A 1 1   ? -9.371  4.678   -2.167  1.00 0.00 ? 1   MET A CB   1  
ATOM 6     C CG   . MET A 1 1   ? -9.695  4.973   -3.645  1.00 0.00 ? 1   MET A CG   1  
ATOM 7     S SD   . MET A 1 1   ? -11.377 5.612   -3.822  1.00 0.00 ? 1   MET A SD   1  
ATOM 8     C CE   . MET A 1 1   ? -11.877 4.830   -5.366  1.00 0.00 ? 1   MET A CE   1  
ATOM 9     H H1   . MET A 1 1   ? -8.648  6.235   0.762   1.00 0.00 ? 1   MET A H1   1  
ATOM 10    H H2   . MET A 1 1   ? -9.220  4.703   0.505   1.00 0.00 ? 1   MET A H2   1  
ATOM 11    H H3   . MET A 1 1   ? -7.685  5.131   0.036   1.00 0.00 ? 1   MET A H3   1  
ATOM 12    H HA   . MET A 1 1   ? -8.553  6.644   -1.706  1.00 0.00 ? 1   MET A HA   1  
ATOM 13    H HB2  . MET A 1 1   ? -8.441  4.075   -2.145  1.00 0.00 ? 1   MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1   ? -10.143 3.993   -1.772  1.00 0.00 ? 1   MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1   ? -8.981  5.687   -4.095  1.00 0.00 ? 1   MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1   ? -9.602  4.037   -4.229  1.00 0.00 ? 1   MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1   ? -11.134 4.995   -6.164  1.00 0.00 ? 1   MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1   ? -11.997 3.739   -5.224  1.00 0.00 ? 1   MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1   ? -12.850 5.229   -5.704  1.00 0.00 ? 1   MET A HE3  1  
ATOM 20    N N    . ARG A 1 2   ? -10.569 7.966   -0.764  1.00 0.00 ? 2   ARG A N    1  
ATOM 21    C CA   . ARG A 1 2   ? -11.769 8.753   -0.364  1.00 0.00 ? 2   ARG A CA   1  
ATOM 22    C C    . ARG A 1 2   ? -11.923 10.034  -1.260  1.00 0.00 ? 2   ARG A C    1  
ATOM 23    O O    . ARG A 1 2   ? -10.996 10.855  -1.260  1.00 0.00 ? 2   ARG A O    1  
ATOM 24    C CB   . ARG A 1 2   ? -11.601 9.132   1.139   1.00 0.00 ? 2   ARG A CB   1  
ATOM 25    C CG   . ARG A 1 2   ? -12.892 9.649   1.826   1.00 0.00 ? 2   ARG A CG   1  
ATOM 26    C CD   . ARG A 1 2   ? -12.684 10.064  3.297   1.00 0.00 ? 2   ARG A CD   1  
ATOM 27    N NE   . ARG A 1 2   ? -12.240 11.484  3.409   1.00 0.00 ? 2   ARG A NE   1  
ATOM 28    C CZ   . ARG A 1 2   ? -11.632 12.023  4.468   1.00 0.00 ? 2   ARG A CZ   1  
ATOM 29    N NH1  . ARG A 1 2   ? -11.064 11.323  5.417   1.00 0.00 ? 2   ARG A NH1  1  
ATOM 30    N NH2  . ARG A 1 2   ? -11.601 13.322  4.562   1.00 0.00 ? 2   ARG A NH2  1  
ATOM 31    H H    . ARG A 1 2   ? -9.661  8.427   -0.898  1.00 0.00 ? 2   ARG A H    1  
ATOM 32    H HA   . ARG A 1 2   ? -12.678 8.130   -0.454  1.00 0.00 ? 2   ARG A HA   1  
ATOM 33    H HB2  . ARG A 1 2   ? -11.245 8.248   1.705   1.00 0.00 ? 2   ARG A HB2  1  
ATOM 34    H HB3  . ARG A 1 2   ? -10.782 9.872   1.253   1.00 0.00 ? 2   ARG A HB3  1  
ATOM 35    H HG2  . ARG A 1 2   ? -13.350 10.475  1.245   1.00 0.00 ? 2   ARG A HG2  1  
ATOM 36    H HG3  . ARG A 1 2   ? -13.647 8.839   1.796   1.00 0.00 ? 2   ARG A HG3  1  
ATOM 37    H HD2  . ARG A 1 2   ? -13.643 9.951   3.843   1.00 0.00 ? 2   ARG A HD2  1  
ATOM 38    H HD3  . ARG A 1 2   ? -11.993 9.354   3.789   1.00 0.00 ? 2   ARG A HD3  1  
ATOM 39    H HE   . ARG A 1 2   ? -12.599 12.200  2.762   1.00 0.00 ? 2   ARG A HE   1  
ATOM 40    H HH11 . ARG A 1 2   ? -11.071 10.313  5.264   1.00 0.00 ? 2   ARG A HH11 1  
ATOM 41    H HH12 . ARG A 1 2   ? -10.519 11.839  6.131   1.00 0.00 ? 2   ARG A HH12 1  
ATOM 42    H HH21 . ARG A 1 2   ? -12.104 13.840  3.830   1.00 0.00 ? 2   ARG A HH21 1  
ATOM 43    H HH22 . ARG A 1 2   ? -11.244 13.713  5.448   1.00 0.00 ? 2   ARG A HH22 1  
ATOM 44    N N    . PRO A 1 3   ? -13.054 10.305  -1.984  1.00 0.00 ? 3   PRO A N    1  
ATOM 45    C CA   . PRO A 1 3   ? -13.212 11.546  -2.799  1.00 0.00 ? 3   PRO A CA   1  
ATOM 46    C C    . PRO A 1 3   ? -13.580 12.815  -1.951  1.00 0.00 ? 3   PRO A C    1  
ATOM 47    O O    . PRO A 1 3   ? -14.686 13.359  -2.045  1.00 0.00 ? 3   PRO A O    1  
ATOM 48    C CB   . PRO A 1 3   ? -14.299 11.092  -3.796  1.00 0.00 ? 3   PRO A CB   1  
ATOM 49    C CG   . PRO A 1 3   ? -15.185 10.131  -3.000  1.00 0.00 ? 3   PRO A CG   1  
ATOM 50    C CD   . PRO A 1 3   ? -14.205 9.386   -2.096  1.00 0.00 ? 3   PRO A CD   1  
ATOM 51    H HA   . PRO A 1 3   ? -12.287 11.783  -3.362  1.00 0.00 ? 3   PRO A HA   1  
ATOM 52    H HB2  . PRO A 1 3   ? -14.874 11.932  -4.231  1.00 0.00 ? 3   PRO A HB2  1  
ATOM 53    H HB3  . PRO A 1 3   ? -13.839 10.561  -4.652  1.00 0.00 ? 3   PRO A HB3  1  
ATOM 54    H HG2  . PRO A 1 3   ? -15.911 10.703  -2.390  1.00 0.00 ? 3   PRO A HG2  1  
ATOM 55    H HG3  . PRO A 1 3   ? -15.774 9.451   -3.645  1.00 0.00 ? 3   PRO A HG3  1  
ATOM 56    H HD2  . PRO A 1 3   ? -14.663 9.148   -1.116  1.00 0.00 ? 3   PRO A HD2  1  
ATOM 57    H HD3  . PRO A 1 3   ? -13.888 8.436   -2.566  1.00 0.00 ? 3   PRO A HD3  1  
ATOM 58    N N    . SER A 1 4   ? -12.612 13.295  -1.139  1.00 0.00 ? 4   SER A N    1  
ATOM 59    C CA   . SER A 1 4   ? -12.744 14.463  -0.210  1.00 0.00 ? 4   SER A CA   1  
ATOM 60    C C    . SER A 1 4   ? -13.741 14.195  0.977   1.00 0.00 ? 4   SER A C    1  
ATOM 61    O O    . SER A 1 4   ? -13.291 14.031  2.119   1.00 0.00 ? 4   SER A O    1  
ATOM 62    C CB   . SER A 1 4   ? -13.058 15.764  -1.017  1.00 0.00 ? 4   SER A CB   1  
ATOM 63    O OG   . SER A 1 4   ? -13.200 16.905  -0.167  1.00 0.00 ? 4   SER A OG   1  
ATOM 64    H H    . SER A 1 4   ? -11.765 12.707  -1.171  1.00 0.00 ? 4   SER A H    1  
ATOM 65    H HA   . SER A 1 4   ? -11.762 14.608  0.278   1.00 0.00 ? 4   SER A HA   1  
ATOM 66    H HB2  . SER A 1 4   ? -12.257 15.950  -1.759  1.00 0.00 ? 4   SER A HB2  1  
ATOM 67    H HB3  . SER A 1 4   ? -13.979 15.654  -1.619  1.00 0.00 ? 4   SER A HB3  1  
ATOM 68    H HG   . SER A 1 4   ? -12.335 17.071  0.227   1.00 0.00 ? 4   SER A HG   1  
ATOM 69    N N    . GLY A 1 5   ? -15.065 14.187  0.725   1.00 0.00 ? 5   GLY A N    1  
ATOM 70    C CA   . GLY A 1 5   ? -16.102 14.028  1.777   1.00 0.00 ? 5   GLY A CA   1  
ATOM 71    C C    . GLY A 1 5   ? -16.345 15.348  2.544   1.00 0.00 ? 5   GLY A C    1  
ATOM 72    O O    . GLY A 1 5   ? -16.727 16.362  1.944   1.00 0.00 ? 5   GLY A O    1  
ATOM 73    H H    . GLY A 1 5   ? -15.280 14.291  -0.277  1.00 0.00 ? 5   GLY A H    1  
ATOM 74    H HA2  . GLY A 1 5   ? -17.056 13.730  1.304   1.00 0.00 ? 5   GLY A HA2  1  
ATOM 75    H HA3  . GLY A 1 5   ? -15.845 13.189  2.455   1.00 0.00 ? 5   GLY A HA3  1  
ATOM 76    N N    . ARG A 1 6   ? -16.107 15.327  3.865   1.00 0.00 ? 6   ARG A N    1  
ATOM 77    C CA   . ARG A 1 6   ? -16.212 16.543  4.720   1.00 0.00 ? 6   ARG A CA   1  
ATOM 78    C C    . ARG A 1 6   ? -14.903 17.395  4.582   1.00 0.00 ? 6   ARG A C    1  
ATOM 79    O O    . ARG A 1 6   ? -13.777 16.887  4.647   1.00 0.00 ? 6   ARG A O    1  
ATOM 80    C CB   . ARG A 1 6   ? -16.460 16.130  6.197   1.00 0.00 ? 6   ARG A CB   1  
ATOM 81    C CG   . ARG A 1 6   ? -17.910 15.697  6.527   1.00 0.00 ? 6   ARG A CG   1  
ATOM 82    C CD   . ARG A 1 6   ? -18.105 15.443  8.033   1.00 0.00 ? 6   ARG A CD   1  
ATOM 83    N NE   . ARG A 1 6   ? -19.530 15.115  8.314   1.00 0.00 ? 6   ARG A NE   1  
ATOM 84    C CZ   . ARG A 1 6   ? -20.038 14.856  9.520   1.00 0.00 ? 6   ARG A CZ   1  
ATOM 85    N NH1  . ARG A 1 6   ? -19.331 14.865  10.623  1.00 0.00 ? 6   ARG A NH1  1  
ATOM 86    N NH2  . ARG A 1 6   ? -21.307 14.578  9.608   1.00 0.00 ? 6   ARG A NH2  1  
ATOM 87    H H    . ARG A 1 6   ? -15.786 14.427  4.234   1.00 0.00 ? 6   ARG A H    1  
ATOM 88    H HA   . ARG A 1 6   ? -17.075 17.155  4.384   1.00 0.00 ? 6   ARG A HA   1  
ATOM 89    H HB2  . ARG A 1 6   ? -15.744 15.341  6.501   1.00 0.00 ? 6   ARG A HB2  1  
ATOM 90    H HB3  . ARG A 1 6   ? -16.212 16.992  6.848   1.00 0.00 ? 6   ARG A HB3  1  
ATOM 91    H HG2  . ARG A 1 6   ? -18.612 16.483  6.184   1.00 0.00 ? 6   ARG A HG2  1  
ATOM 92    H HG3  . ARG A 1 6   ? -18.170 14.790  5.945   1.00 0.00 ? 6   ARG A HG3  1  
ATOM 93    H HD2  . ARG A 1 6   ? -17.437 14.619  8.361   1.00 0.00 ? 6   ARG A HD2  1  
ATOM 94    H HD3  . ARG A 1 6   ? -17.795 16.344  8.604   1.00 0.00 ? 6   ARG A HD3  1  
ATOM 95    H HE   . ARG A 1 6   ? -20.212 15.067  7.551   1.00 0.00 ? 6   ARG A HE   1  
ATOM 96    H HH11 . ARG A 1 6   ? -18.344 15.092  10.486  1.00 0.00 ? 6   ARG A HH11 1  
ATOM 97    H HH12 . ARG A 1 6   ? -19.798 14.656  11.507  1.00 0.00 ? 6   ARG A HH12 1  
ATOM 98    H HH21 . ARG A 1 6   ? -21.843 14.575  8.738   1.00 0.00 ? 6   ARG A HH21 1  
ATOM 99    H HH22 . ARG A 1 6   ? -21.677 14.382  10.540  1.00 0.00 ? 6   ARG A HH22 1  
ATOM 100   N N    . LYS A 1 7   ? -15.071 18.713  4.390   1.00 0.00 ? 7   LYS A N    1  
ATOM 101   C CA   . LYS A 1 7   ? -13.937 19.657  4.160   1.00 0.00 ? 7   LYS A CA   1  
ATOM 102   C C    . LYS A 1 7   ? -13.176 19.958  5.492   1.00 0.00 ? 7   LYS A C    1  
ATOM 103   O O    . LYS A 1 7   ? -13.770 20.078  6.569   1.00 0.00 ? 7   LYS A O    1  
ATOM 104   C CB   . LYS A 1 7   ? -14.529 20.919  3.457   1.00 0.00 ? 7   LYS A CB   1  
ATOM 105   C CG   . LYS A 1 7   ? -14.716 20.834  1.909   1.00 0.00 ? 7   LYS A CG   1  
ATOM 106   C CD   . LYS A 1 7   ? -15.398 19.546  1.389   1.00 0.00 ? 7   LYS A CD   1  
ATOM 107   C CE   . LYS A 1 7   ? -15.644 19.479  -0.127  1.00 0.00 ? 7   LYS A CE   1  
ATOM 108   N NZ   . LYS A 1 7   ? -15.889 18.047  -0.464  1.00 0.00 ? 7   LYS A NZ   1  
ATOM 109   H H    . LYS A 1 7   ? -16.045 19.030  4.363   1.00 0.00 ? 7   LYS A H    1  
ATOM 110   H HA   . LYS A 1 7   ? -13.213 19.184  3.465   1.00 0.00 ? 7   LYS A HA   1  
ATOM 111   H HB2  . LYS A 1 7   ? -15.481 21.221  3.939   1.00 0.00 ? 7   LYS A HB2  1  
ATOM 112   H HB3  . LYS A 1 7   ? -13.864 21.783  3.652   1.00 0.00 ? 7   LYS A HB3  1  
ATOM 113   H HG2  . LYS A 1 7   ? -15.281 21.725  1.570   1.00 0.00 ? 7   LYS A HG2  1  
ATOM 114   H HG3  . LYS A 1 7   ? -13.722 20.932  1.429   1.00 0.00 ? 7   LYS A HG3  1  
ATOM 115   H HD2  . LYS A 1 7   ? -14.759 18.693  1.697   1.00 0.00 ? 7   LYS A HD2  1  
ATOM 116   H HD3  . LYS A 1 7   ? -16.357 19.393  1.924   1.00 0.00 ? 7   LYS A HD3  1  
ATOM 117   H HE2  . LYS A 1 7   ? -16.504 20.128  -0.408  1.00 0.00 ? 7   LYS A HE2  1  
ATOM 118   H HE3  . LYS A 1 7   ? -14.771 19.876  -0.692  1.00 0.00 ? 7   LYS A HE3  1  
ATOM 119   H HZ1  . LYS A 1 7   ? -16.480 17.571  0.240   1.00 0.00 ? 7   LYS A HZ1  1  
ATOM 120   H HZ2  . LYS A 1 7   ? -16.317 17.883  -1.384  1.00 0.00 ? 7   LYS A HZ2  1  
ATOM 121   H HZ3  . LYS A 1 7   ? -15.006 17.501  -0.444  1.00 0.00 ? 7   LYS A HZ3  1  
ATOM 122   N N    . SER A 1 8   ? -11.827 19.990  5.405   1.00 0.00 ? 8   SER A N    1  
ATOM 123   C CA   . SER A 1 8   ? -10.899 20.131  6.585   1.00 0.00 ? 8   SER A CA   1  
ATOM 124   C C    . SER A 1 8   ? -11.047 19.003  7.688   1.00 0.00 ? 8   SER A C    1  
ATOM 125   O O    . SER A 1 8   ? -10.619 19.184  8.831   1.00 0.00 ? 8   SER A O    1  
ATOM 126   C CB   . SER A 1 8   ? -11.044 21.559  7.188   1.00 0.00 ? 8   SER A CB   1  
ATOM 127   O OG   . SER A 1 8   ? -10.675 22.562  6.238   1.00 0.00 ? 8   SER A OG   1  
ATOM 128   H H    . SER A 1 8   ? -11.458 19.894  4.455   1.00 0.00 ? 8   SER A H    1  
ATOM 129   H HA   . SER A 1 8   ? -9.859  20.027  6.222   1.00 0.00 ? 8   SER A HA   1  
ATOM 130   H HB2  . SER A 1 8   ? -12.076 21.736  7.550   1.00 0.00 ? 8   SER A HB2  1  
ATOM 131   H HB3  . SER A 1 8   ? -10.397 21.662  8.081   1.00 0.00 ? 8   SER A HB3  1  
ATOM 132   H HG   . SER A 1 8   ? -10.819 23.418  6.654   1.00 0.00 ? 8   SER A HG   1  
ATOM 133   N N    . SER A 1 9   ? -11.574 17.810  7.334   1.00 0.00 ? 9   SER A N    1  
ATOM 134   C CA   . SER A 1 9   ? -11.815 16.693  8.285   1.00 0.00 ? 9   SER A CA   1  
ATOM 135   C C    . SER A 1 9   ? -10.864 15.493  7.975   1.00 0.00 ? 9   SER A C    1  
ATOM 136   O O    . SER A 1 9   ? -11.215 14.571  7.229   1.00 0.00 ? 9   SER A O    1  
ATOM 137   C CB   . SER A 1 9   ? -13.314 16.318  8.165   1.00 0.00 ? 9   SER A CB   1  
ATOM 138   O OG   . SER A 1 9   ? -14.165 17.416  8.504   1.00 0.00 ? 9   SER A OG   1  
ATOM 139   H H    . SER A 1 9   ? -11.902 17.782  6.362   1.00 0.00 ? 9   SER A H    1  
ATOM 140   H HA   . SER A 1 9   ? -11.652 17.006  9.337   1.00 0.00 ? 9   SER A HA   1  
ATOM 141   H HB2  . SER A 1 9   ? -13.547 15.965  7.142   1.00 0.00 ? 9   SER A HB2  1  
ATOM 142   H HB3  . SER A 1 9   ? -13.548 15.465  8.831   1.00 0.00 ? 9   SER A HB3  1  
ATOM 143   H HG   . SER A 1 9   ? -13.805 18.196  8.058   1.00 0.00 ? 9   SER A HG   1  
ATOM 144   N N    . LYS A 1 10  ? -9.648  15.553  8.561   1.00 0.00 ? 10  LYS A N    1  
ATOM 145   C CA   . LYS A 1 10  ? -8.556  14.529  8.462   1.00 0.00 ? 10  LYS A CA   1  
ATOM 146   C C    . LYS A 1 10  ? -8.478  13.647  7.163   1.00 0.00 ? 10  LYS A C    1  
ATOM 147   O O    . LYS A 1 10  ? -9.176  12.635  7.025   1.00 0.00 ? 10  LYS A O    1  
ATOM 148   C CB   . LYS A 1 10  ? -8.639  13.611  9.733   1.00 0.00 ? 10  LYS A CB   1  
ATOM 149   C CG   . LYS A 1 10  ? -7.596  13.902  10.845  1.00 0.00 ? 10  LYS A CG   1  
ATOM 150   C CD   . LYS A 1 10  ? -6.315  13.027  10.840  1.00 0.00 ? 10  LYS A CD   1  
ATOM 151   C CE   . LYS A 1 10  ? -5.258  13.348  9.760   1.00 0.00 ? 10  LYS A CE   1  
ATOM 152   N NZ   . LYS A 1 10  ? -4.006  12.598  10.052  1.00 0.00 ? 10  LYS A NZ   1  
ATOM 153   H H    . LYS A 1 10  ? -9.532  16.394  9.137   1.00 0.00 ? 10  LYS A H    1  
ATOM 154   H HA   . LYS A 1 10  ? -7.599  15.085  8.498   1.00 0.00 ? 10  LYS A HA   1  
ATOM 155   H HB2  . LYS A 1 10  ? -9.655  13.654  10.175  1.00 0.00 ? 10  LYS A HB2  1  
ATOM 156   H HB3  . LYS A 1 10  ? -8.565  12.536  9.468   1.00 0.00 ? 10  LYS A HB3  1  
ATOM 157   H HG2  . LYS A 1 10  ? -7.340  14.979  10.887  1.00 0.00 ? 10  LYS A HG2  1  
ATOM 158   H HG3  . LYS A 1 10  ? -8.100  13.721  11.816  1.00 0.00 ? 10  LYS A HG3  1  
ATOM 159   H HD2  . LYS A 1 10  ? -5.852  13.132  11.843  1.00 0.00 ? 10  LYS A HD2  1  
ATOM 160   H HD3  . LYS A 1 10  ? -6.595  11.955  10.782  1.00 0.00 ? 10  LYS A HD3  1  
ATOM 161   H HE2  . LYS A 1 10  ? -5.635  13.094  8.745   1.00 0.00 ? 10  LYS A HE2  1  
ATOM 162   H HE3  . LYS A 1 10  ? -5.050  14.439  9.730   1.00 0.00 ? 10  LYS A HE3  1  
ATOM 163   H HZ1  . LYS A 1 10  ? -3.735  12.609  11.038  1.00 0.00 ? 10  LYS A HZ1  1  
ATOM 164   H HZ2  . LYS A 1 10  ? -4.011  11.561  9.817   1.00 0.00 ? 10  LYS A HZ2  1  
ATOM 165   H HZ3  . LYS A 1 10  ? -3.125  12.956  9.569   1.00 0.00 ? 10  LYS A HZ3  1  
ATOM 166   N N    . MET A 1 11  ? -7.609  14.032  6.213   1.00 0.00 ? 11  MET A N    1  
ATOM 167   C CA   . MET A 1 11  ? -7.284  13.179  5.033   1.00 0.00 ? 11  MET A CA   1  
ATOM 168   C C    . MET A 1 11  ? -6.372  12.008  5.536   1.00 0.00 ? 11  MET A C    1  
ATOM 169   O O    . MET A 1 11  ? -5.435  12.234  6.314   1.00 0.00 ? 11  MET A O    1  
ATOM 170   C CB   . MET A 1 11  ? -6.632  14.044  3.916   1.00 0.00 ? 11  MET A CB   1  
ATOM 171   C CG   . MET A 1 11  ? -5.219  14.647  4.137   1.00 0.00 ? 11  MET A CG   1  
ATOM 172   S SD   . MET A 1 11  ? -5.125  15.767  5.555   1.00 0.00 ? 11  MET A SD   1  
ATOM 173   C CE   . MET A 1 11  ? -5.938  17.242  4.912   1.00 0.00 ? 11  MET A CE   1  
ATOM 174   H H    . MET A 1 11  ? -7.073  14.882  6.409   1.00 0.00 ? 11  MET A H    1  
ATOM 175   H HA   . MET A 1 11  ? -8.219  12.750  4.619   1.00 0.00 ? 11  MET A HA   1  
ATOM 176   H HB2  . MET A 1 11  ? -6.580  13.419  3.004   1.00 0.00 ? 11  MET A HB2  1  
ATOM 177   H HB3  . MET A 1 11  ? -7.329  14.857  3.638   1.00 0.00 ? 11  MET A HB3  1  
ATOM 178   H HG2  . MET A 1 11  ? -4.480  13.840  4.300   1.00 0.00 ? 11  MET A HG2  1  
ATOM 179   H HG3  . MET A 1 11  ? -4.877  15.181  3.232   1.00 0.00 ? 11  MET A HG3  1  
ATOM 180   H HE1  . MET A 1 11  ? -5.438  17.596  3.992   1.00 0.00 ? 11  MET A HE1  1  
ATOM 181   H HE2  . MET A 1 11  ? -6.998  17.043  4.676   1.00 0.00 ? 11  MET A HE2  1  
ATOM 182   H HE3  . MET A 1 11  ? -5.899  18.058  5.656   1.00 0.00 ? 11  MET A HE3  1  
ATOM 183   N N    . GLN A 1 12  ? -6.650  10.750  5.151   1.00 0.00 ? 12  GLN A N    1  
ATOM 184   C CA   . GLN A 1 12  ? -5.877  9.581   5.683   1.00 0.00 ? 12  GLN A CA   1  
ATOM 185   C C    . GLN A 1 12  ? -4.550  9.345   4.880   1.00 0.00 ? 12  GLN A C    1  
ATOM 186   O O    . GLN A 1 12  ? -4.269  8.234   4.424   1.00 0.00 ? 12  GLN A O    1  
ATOM 187   C CB   . GLN A 1 12  ? -6.841  8.354   5.636   1.00 0.00 ? 12  GLN A CB   1  
ATOM 188   C CG   . GLN A 1 12  ? -8.195  8.455   6.406   1.00 0.00 ? 12  GLN A CG   1  
ATOM 189   C CD   . GLN A 1 12  ? -9.377  7.686   5.802   1.00 0.00 ? 12  GLN A CD   1  
ATOM 190   O OE1  . GLN A 1 12  ? -10.017 6.860   6.444   1.00 0.00 ? 12  GLN A OE1  1  
ATOM 191   N NE2  . GLN A 1 12  ? -9.763  7.962   4.577   1.00 0.00 ? 12  GLN A NE2  1  
ATOM 192   H H    . GLN A 1 12  ? -7.415  10.618  4.477   1.00 0.00 ? 12  GLN A H    1  
ATOM 193   H HA   . GLN A 1 12  ? -5.586  9.742   6.742   1.00 0.00 ? 12  GLN A HA   1  
ATOM 194   H HB2  . GLN A 1 12  ? -7.020  8.098   4.574   1.00 0.00 ? 12  GLN A HB2  1  
ATOM 195   H HB3  . GLN A 1 12  ? -6.311  7.465   6.019   1.00 0.00 ? 12  GLN A HB3  1  
ATOM 196   H HG2  . GLN A 1 12  ? -8.046  8.108   7.445   1.00 0.00 ? 12  GLN A HG2  1  
ATOM 197   H HG3  . GLN A 1 12  ? -8.518  9.505   6.518   1.00 0.00 ? 12  GLN A HG3  1  
ATOM 198   H HE21 . GLN A 1 12  ? -9.046  8.406   3.979   1.00 0.00 ? 12  GLN A HE21 1  
ATOM 199   H HE22 . GLN A 1 12  ? -10.434 7.264   4.251   1.00 0.00 ? 12  GLN A HE22 1  
ATOM 200   N N    . ALA A 1 13  ? -3.676  10.371  4.815   1.00 0.00 ? 13  ALA A N    1  
ATOM 201   C CA   . ALA A 1 13  ? -2.430  10.341  4.016   1.00 0.00 ? 13  ALA A CA   1  
ATOM 202   C C    . ALA A 1 13  ? -1.348  9.492   4.727   1.00 0.00 ? 13  ALA A C    1  
ATOM 203   O O    . ALA A 1 13  ? -0.847  9.846   5.796   1.00 0.00 ? 13  ALA A O    1  
ATOM 204   C CB   . ALA A 1 13  ? -1.988  11.805  3.830   1.00 0.00 ? 13  ALA A CB   1  
ATOM 205   H H    . ALA A 1 13  ? -4.029  11.235  5.252   1.00 0.00 ? 13  ALA A H    1  
ATOM 206   H HA   . ALA A 1 13  ? -2.645  9.919   3.011   1.00 0.00 ? 13  ALA A HA   1  
ATOM 207   H HB1  . ALA A 1 13  ? -1.819  12.318  4.799   1.00 0.00 ? 13  ALA A HB1  1  
ATOM 208   H HB2  . ALA A 1 13  ? -1.042  11.870  3.264   1.00 0.00 ? 13  ALA A HB2  1  
ATOM 209   H HB3  . ALA A 1 13  ? -2.739  12.395  3.273   1.00 0.00 ? 13  ALA A HB3  1  
ATOM 210   N N    . PHE A 1 14  ? -0.977  8.374   4.096   1.00 0.00 ? 14  PHE A N    1  
ATOM 211   C CA   . PHE A 1 14  ? -0.079  7.372   4.701   1.00 0.00 ? 14  PHE A CA   1  
ATOM 212   C C    . PHE A 1 14  ? 1.247   7.151   3.908   1.00 0.00 ? 14  PHE A C    1  
ATOM 213   O O    . PHE A 1 14  ? 1.314   7.262   2.680   1.00 0.00 ? 14  PHE A O    1  
ATOM 214   C CB   . PHE A 1 14  ? -0.937  6.067   4.843   1.00 0.00 ? 14  PHE A CB   1  
ATOM 215   C CG   . PHE A 1 14  ? -0.703  5.452   6.220   1.00 0.00 ? 14  PHE A CG   1  
ATOM 216   C CD1  . PHE A 1 14  ? -1.404  5.946   7.328   1.00 0.00 ? 14  PHE A CD1  1  
ATOM 217   C CD2  . PHE A 1 14  ? 0.418   4.646   6.414   1.00 0.00 ? 14  PHE A CD2  1  
ATOM 218   C CE1  . PHE A 1 14  ? -0.956  5.671   8.617   1.00 0.00 ? 14  PHE A CE1  1  
ATOM 219   C CE2  . PHE A 1 14  ? 0.885   4.415   7.697   1.00 0.00 ? 14  PHE A CE2  1  
ATOM 220   C CZ   . PHE A 1 14  ? 0.204   4.925   8.799   1.00 0.00 ? 14  PHE A CZ   1  
ATOM 221   H H    . PHE A 1 14  ? -1.498  8.178   3.233   1.00 0.00 ? 14  PHE A H    1  
ATOM 222   H HA   . PHE A 1 14  ? 0.222   7.734   5.709   1.00 0.00 ? 14  PHE A HA   1  
ATOM 223   H HB2  . PHE A 1 14  ? -2.028  6.246   4.730   1.00 0.00 ? 14  PHE A HB2  1  
ATOM 224   H HB3  . PHE A 1 14  ? -0.713  5.345   4.034   1.00 0.00 ? 14  PHE A HB3  1  
ATOM 225   H HD1  . PHE A 1 14  ? -2.242  6.618   7.195   1.00 0.00 ? 14  PHE A HD1  1  
ATOM 226   H HD2  . PHE A 1 14  ? 1.001   4.293   5.575   1.00 0.00 ? 14  PHE A HD2  1  
ATOM 227   H HE1  . PHE A 1 14  ? -1.477  6.086   9.469   1.00 0.00 ? 14  PHE A HE1  1  
ATOM 228   H HE2  . PHE A 1 14  ? 1.797   3.859   7.825   1.00 0.00 ? 14  PHE A HE2  1  
ATOM 229   H HZ   . PHE A 1 14  ? 0.592   4.743   9.790   1.00 0.00 ? 14  PHE A HZ   1  
ATOM 230   N N    . ARG A 1 15  ? 2.287   6.813   4.686   1.00 0.00 ? 15  ARG A N    1  
ATOM 231   C CA   . ARG A 1 15  ? 3.682   6.585   4.234   1.00 0.00 ? 15  ARG A CA   1  
ATOM 232   C C    . ARG A 1 15  ? 4.289   5.344   4.985   1.00 0.00 ? 15  ARG A C    1  
ATOM 233   O O    . ARG A 1 15  ? 3.943   5.067   6.141   1.00 0.00 ? 15  ARG A O    1  
ATOM 234   C CB   . ARG A 1 15  ? 4.440   7.892   4.591   1.00 0.00 ? 15  ARG A CB   1  
ATOM 235   C CG   . ARG A 1 15  ? 5.770   8.193   3.850   1.00 0.00 ? 15  ARG A CG   1  
ATOM 236   C CD   . ARG A 1 15  ? 6.706   9.219   4.540   1.00 0.00 ? 15  ARG A CD   1  
ATOM 237   N NE   . ARG A 1 15  ? 5.959   10.385  5.092   1.00 0.00 ? 15  ARG A NE   1  
ATOM 238   C CZ   . ARG A 1 15  ? 6.410   11.182  6.049   1.00 0.00 ? 15  ARG A CZ   1  
ATOM 239   N NH1  . ARG A 1 15  ? 7.670   11.465  6.233   1.00 0.00 ? 15  ARG A NH1  1  
ATOM 240   N NH2  . ARG A 1 15  ? 5.549   11.743  6.825   1.00 0.00 ? 15  ARG A NH2  1  
ATOM 241   H H    . ARG A 1 15  ? 2.075   6.767   5.696   1.00 0.00 ? 15  ARG A H    1  
ATOM 242   H HA   . ARG A 1 15  ? 3.706   6.410   3.138   1.00 0.00 ? 15  ARG A HA   1  
ATOM 243   H HB2  . ARG A 1 15  ? 3.784   8.766   4.399   1.00 0.00 ? 15  ARG A HB2  1  
ATOM 244   H HB3  . ARG A 1 15  ? 4.603   7.917   5.689   1.00 0.00 ? 15  ARG A HB3  1  
ATOM 245   H HG2  . ARG A 1 15  ? 6.341   7.258   3.689   1.00 0.00 ? 15  ARG A HG2  1  
ATOM 246   H HG3  . ARG A 1 15  ? 5.526   8.549   2.830   1.00 0.00 ? 15  ARG A HG3  1  
ATOM 247   H HD2  . ARG A 1 15  ? 7.258   8.697   5.350   1.00 0.00 ? 15  ARG A HD2  1  
ATOM 248   H HD3  . ARG A 1 15  ? 7.479   9.557   3.820   1.00 0.00 ? 15  ARG A HD3  1  
ATOM 249   H HE   . ARG A 1 15  ? 4.934   10.387  5.061   1.00 0.00 ? 15  ARG A HE   1  
ATOM 250   H HH11 . ARG A 1 15  ? 8.306   11.076  5.538   1.00 0.00 ? 15  ARG A HH11 1  
ATOM 251   H HH12 . ARG A 1 15  ? 7.850   12.196  6.931   1.00 0.00 ? 15  ARG A HH12 1  
ATOM 252   H HH21 . ARG A 1 15  ? 4.557   11.668  6.547   1.00 0.00 ? 15  ARG A HH21 1  
ATOM 253   H HH22 . ARG A 1 15  ? 5.898   12.612  7.316   1.00 0.00 ? 15  ARG A HH22 1  
ATOM 254   N N    . ILE A 1 16  ? 5.235   4.612   4.373   1.00 0.00 ? 16  ILE A N    1  
ATOM 255   C CA   . ILE A 1 16  ? 5.853   3.398   5.012   1.00 0.00 ? 16  ILE A CA   1  
ATOM 256   C C    . ILE A 1 16  ? 7.415   3.415   4.826   1.00 0.00 ? 16  ILE A C    1  
ATOM 257   O O    . ILE A 1 16  ? 7.972   3.830   3.801   1.00 0.00 ? 16  ILE A O    1  
ATOM 258   C CB   . ILE A 1 16  ? 5.197   2.047   4.498   1.00 0.00 ? 16  ILE A CB   1  
ATOM 259   C CG1  . ILE A 1 16  ? 4.669   2.032   3.027   1.00 0.00 ? 16  ILE A CG1  1  
ATOM 260   C CG2  . ILE A 1 16  ? 4.031   1.698   5.455   1.00 0.00 ? 16  ILE A CG2  1  
ATOM 261   C CD1  . ILE A 1 16  ? 4.153   0.678   2.505   1.00 0.00 ? 16  ILE A CD1  1  
ATOM 262   H H    . ILE A 1 16  ? 5.468   4.893   3.414   1.00 0.00 ? 16  ILE A H    1  
ATOM 263   H HA   . ILE A 1 16  ? 5.694   3.454   6.116   1.00 0.00 ? 16  ILE A HA   1  
ATOM 264   H HB   . ILE A 1 16  ? 5.941   1.228   4.574   1.00 0.00 ? 16  ILE A HB   1  
ATOM 265   H HG12 . ILE A 1 16  ? 3.868   2.786   2.895   1.00 0.00 ? 16  ILE A HG12 1  
ATOM 266   H HG13 . ILE A 1 16  ? 5.478   2.370   2.358   1.00 0.00 ? 16  ILE A HG13 1  
ATOM 267   H HG21 . ILE A 1 16  ? 4.396   1.600   6.493   1.00 0.00 ? 16  ILE A HG21 1  
ATOM 268   H HG22 . ILE A 1 16  ? 3.235   2.467   5.456   1.00 0.00 ? 16  ILE A HG22 1  
ATOM 269   H HG23 . ILE A 1 16  ? 3.552   0.732   5.212   1.00 0.00 ? 16  ILE A HG23 1  
ATOM 270   H HD11 . ILE A 1 16  ? 4.857   -0.143  2.727   1.00 0.00 ? 16  ILE A HD11 1  
ATOM 271   H HD12 . ILE A 1 16  ? 3.183   0.404   2.957   1.00 0.00 ? 16  ILE A HD12 1  
ATOM 272   H HD13 . ILE A 1 16  ? 4.004   0.699   1.410   1.00 0.00 ? 16  ILE A HD13 1  
ATOM 273   N N    . TRP A 1 17  ? 8.133   2.988   5.886   1.00 0.00 ? 17  TRP A N    1  
ATOM 274   C CA   . TRP A 1 17  ? 9.630   2.940   5.916   1.00 0.00 ? 17  TRP A CA   1  
ATOM 275   C C    . TRP A 1 17  ? 10.144  1.810   6.887   1.00 0.00 ? 17  TRP A C    1  
ATOM 276   O O    . TRP A 1 17  ? 9.373   0.937   7.286   1.00 0.00 ? 17  TRP A O    1  
ATOM 277   C CB   . TRP A 1 17  ? 10.120  4.397   6.264   1.00 0.00 ? 17  TRP A CB   1  
ATOM 278   C CG   . TRP A 1 17  ? 10.221  4.836   7.738   1.00 0.00 ? 17  TRP A CG   1  
ATOM 279   C CD1  . TRP A 1 17  ? 9.181   4.815   8.688   1.00 0.00 ? 17  TRP A CD1  1  
ATOM 280   C CD2  . TRP A 1 17  ? 11.366  5.171   8.449   1.00 0.00 ? 17  TRP A CD2  1  
ATOM 281   N NE1  . TRP A 1 17  ? 9.649   5.118   9.982   1.00 0.00 ? 17  TRP A NE1  1  
ATOM 282   C CE2  . TRP A 1 17  ? 11.007  5.307   9.813   1.00 0.00 ? 17  TRP A CE2  1  
ATOM 283   C CE3  . TRP A 1 17  ? 12.723  5.315   8.047   1.00 0.00 ? 17  TRP A CE3  1  
ATOM 284   C CZ2  . TRP A 1 17  ? 12.001  5.550   10.789  1.00 0.00 ? 17  TRP A CZ2  1  
ATOM 285   C CZ3  . TRP A 1 17  ? 13.685  5.562   9.028   1.00 0.00 ? 17  TRP A CZ3  1  
ATOM 286   C CH2  . TRP A 1 17  ? 13.330  5.674   10.378  1.00 0.00 ? 17  TRP A CH2  1  
ATOM 287   H H    . TRP A 1 17  ? 7.575   2.652   6.686   1.00 0.00 ? 17  TRP A H    1  
ATOM 288   H HA   . TRP A 1 17  ? 10.000  2.646   4.919   1.00 0.00 ? 17  TRP A HA   1  
ATOM 289   H HB2  . TRP A 1 17  ? 11.124  4.511   5.833   1.00 0.00 ? 17  TRP A HB2  1  
ATOM 290   H HB3  . TRP A 1 17  ? 9.537   5.155   5.706   1.00 0.00 ? 17  TRP A HB3  1  
ATOM 291   H HD1  . TRP A 1 17  ? 8.167   4.511   8.466   1.00 0.00 ? 17  TRP A HD1  1  
ATOM 292   H HE1  . TRP A 1 17  ? 9.144   5.052   10.875  1.00 0.00 ? 17  TRP A HE1  1  
ATOM 293   H HE3  . TRP A 1 17  ? 13.014  5.236   7.008   1.00 0.00 ? 17  TRP A HE3  1  
ATOM 294   H HZ2  . TRP A 1 17  ? 11.736  5.631   11.833  1.00 0.00 ? 17  TRP A HZ2  1  
ATOM 295   H HZ3  . TRP A 1 17  ? 14.722  5.660   8.740   1.00 0.00 ? 17  TRP A HZ3  1  
ATOM 296   H HH2  . TRP A 1 17  ? 14.099  5.857   11.115  1.00 0.00 ? 17  TRP A HH2  1  
ATOM 297   N N    . ASP A 1 18  ? 11.444  1.756   7.240   1.00 0.00 ? 18  ASP A N    1  
ATOM 298   C CA   . ASP A 1 18  ? 11.950  0.855   8.309   1.00 0.00 ? 18  ASP A CA   1  
ATOM 299   C C    . ASP A 1 18  ? 13.211  1.545   8.955   1.00 0.00 ? 18  ASP A C    1  
ATOM 300   O O    . ASP A 1 18  ? 14.036  2.241   8.326   1.00 0.00 ? 18  ASP A O    1  
ATOM 301   C CB   . ASP A 1 18  ? 12.144  -0.623  7.835   1.00 0.00 ? 18  ASP A CB   1  
ATOM 302   C CG   . ASP A 1 18  ? 13.508  -1.161  7.411   1.00 0.00 ? 18  ASP A CG   1  
ATOM 303   O OD1  . ASP A 1 18  ? 14.436  -1.192  8.250   1.00 0.00 ? 18  ASP A OD1  1  
ATOM 304   O OD2  . ASP A 1 18  ? 13.647  -1.600  6.250   1.00 0.00 ? 18  ASP A OD2  1  
ATOM 305   H H    . ASP A 1 18  ? 12.060  2.498   6.871   1.00 0.00 ? 18  ASP A H    1  
ATOM 306   H HA   . ASP A 1 18  ? 11.165  0.831   9.095   1.00 0.00 ? 18  ASP A HA   1  
ATOM 307   H HB2  . ASP A 1 18  ? 11.844  -1.275  8.675   1.00 0.00 ? 18  ASP A HB2  1  
ATOM 308   H HB3  . ASP A 1 18  ? 11.407  -0.872  7.054   1.00 0.00 ? 18  ASP A HB3  1  
ATOM 309   N N    . VAL A 1 19  ? 13.293  1.281   10.274  1.00 0.00 ? 19  VAL A N    1  
ATOM 310   C CA   . VAL A 1 19  ? 14.321  1.825   11.220  1.00 0.00 ? 19  VAL A CA   1  
ATOM 311   C C    . VAL A 1 19  ? 15.821  1.560   10.829  1.00 0.00 ? 19  VAL A C    1  
ATOM 312   O O    . VAL A 1 19  ? 16.683  2.305   11.306  1.00 0.00 ? 19  VAL A O    1  
ATOM 313   C CB   . VAL A 1 19  ? 13.954  1.267   12.652  1.00 0.00 ? 19  VAL A CB   1  
ATOM 314   C CG1  . VAL A 1 19  ? 14.945  1.649   13.782  1.00 0.00 ? 19  VAL A CG1  1  
ATOM 315   C CG2  . VAL A 1 19  ? 12.563  1.730   13.165  1.00 0.00 ? 19  VAL A CG2  1  
ATOM 316   H H    . VAL A 1 19  ? 12.536  0.673   10.599  1.00 0.00 ? 19  VAL A H    1  
ATOM 317   H HA   . VAL A 1 19  ? 14.227  2.928   11.238  1.00 0.00 ? 19  VAL A HA   1  
ATOM 318   H HB   . VAL A 1 19  ? 13.947  0.158   12.598  1.00 0.00 ? 19  VAL A HB   1  
ATOM 319   H HG11 . VAL A 1 19  ? 15.052  2.745   13.889  1.00 0.00 ? 19  VAL A HG11 1  
ATOM 320   H HG12 . VAL A 1 19  ? 14.638  1.250   14.767  1.00 0.00 ? 19  VAL A HG12 1  
ATOM 321   H HG13 . VAL A 1 19  ? 15.958  1.244   13.597  1.00 0.00 ? 19  VAL A HG13 1  
ATOM 322   H HG21 . VAL A 1 19  ? 11.744  1.427   12.488  1.00 0.00 ? 19  VAL A HG21 1  
ATOM 323   H HG22 . VAL A 1 19  ? 12.314  1.301   14.154  1.00 0.00 ? 19  VAL A HG22 1  
ATOM 324   H HG23 . VAL A 1 19  ? 12.500  2.831   13.262  1.00 0.00 ? 19  VAL A HG23 1  
ATOM 325   N N    . ASN A 1 20  ? 16.168  0.591   9.955   1.00 0.00 ? 20  ASN A N    1  
ATOM 326   C CA   . ASN A 1 20  ? 17.578  0.389   9.487   1.00 0.00 ? 20  ASN A CA   1  
ATOM 327   C C    . ASN A 1 20  ? 18.038  1.438   8.389   1.00 0.00 ? 20  ASN A C    1  
ATOM 328   O O    . ASN A 1 20  ? 18.982  1.181   7.636   1.00 0.00 ? 20  ASN A O    1  
ATOM 329   C CB   . ASN A 1 20  ? 17.669  -1.056  8.906   1.00 0.00 ? 20  ASN A CB   1  
ATOM 330   C CG   . ASN A 1 20  ? 17.360  -2.227  9.848   1.00 0.00 ? 20  ASN A CG   1  
ATOM 331   O OD1  . ASN A 1 20  ? 18.178  -2.644  10.660  1.00 0.00 ? 20  ASN A OD1  1  
ATOM 332   N ND2  . ASN A 1 20  ? 16.179  -2.791  9.763   1.00 0.00 ? 20  ASN A ND2  1  
ATOM 333   H H    . ASN A 1 20  ? 15.381  0.032   9.580   1.00 0.00 ? 20  ASN A H    1  
ATOM 334   H HA   . ASN A 1 20  ? 18.282  0.478   10.338  1.00 0.00 ? 20  ASN A HA   1  
ATOM 335   H HB2  . ASN A 1 20  ? 17.044  -1.130  7.995   1.00 0.00 ? 20  ASN A HB2  1  
ATOM 336   H HB3  . ASN A 1 20  ? 18.698  -1.229  8.541   1.00 0.00 ? 20  ASN A HB3  1  
ATOM 337   H HD21 . ASN A 1 20  ? 15.487  -2.288  9.168   1.00 0.00 ? 20  ASN A HD21 1  
ATOM 338   H HD22 . ASN A 1 20  ? 15.994  -3.485  10.490  1.00 0.00 ? 20  ASN A HD22 1  
ATOM 339   N N    . GLN A 1 21  ? 17.423  2.646   8.357   1.00 0.00 ? 21  GLN A N    1  
ATOM 340   C CA   . GLN A 1 21  ? 17.638  3.735   7.354   1.00 0.00 ? 21  GLN A CA   1  
ATOM 341   C C    . GLN A 1 21  ? 17.176  3.228   5.950   1.00 0.00 ? 21  GLN A C    1  
ATOM 342   O O    . GLN A 1 21  ? 17.959  3.086   5.008   1.00 0.00 ? 21  GLN A O    1  
ATOM 343   C CB   . GLN A 1 21  ? 19.096  4.292   7.404   1.00 0.00 ? 21  GLN A CB   1  
ATOM 344   C CG   . GLN A 1 21  ? 19.613  4.811   8.775   1.00 0.00 ? 21  GLN A CG   1  
ATOM 345   C CD   . GLN A 1 21  ? 18.761  5.891   9.458   1.00 0.00 ? 21  GLN A CD   1  
ATOM 346   O OE1  . GLN A 1 21  ? 18.833  7.074   9.144   1.00 0.00 ? 21  GLN A OE1  1  
ATOM 347   N NE2  . GLN A 1 21  ? 17.930  5.529   10.409  1.00 0.00 ? 21  GLN A NE2  1  
ATOM 348   H H    . GLN A 1 21  ? 16.633  2.677   9.017   1.00 0.00 ? 21  GLN A H    1  
ATOM 349   H HA   . GLN A 1 21  ? 16.960  4.573   7.606   1.00 0.00 ? 21  GLN A HA   1  
ATOM 350   H HB2  . GLN A 1 21  ? 19.799  3.525   7.025   1.00 0.00 ? 21  GLN A HB2  1  
ATOM 351   H HB3  . GLN A 1 21  ? 19.175  5.118   6.671   1.00 0.00 ? 21  GLN A HB3  1  
ATOM 352   H HG2  . GLN A 1 21  ? 19.765  3.955   9.461   1.00 0.00 ? 21  GLN A HG2  1  
ATOM 353   H HG3  . GLN A 1 21  ? 20.625  5.232   8.637   1.00 0.00 ? 21  GLN A HG3  1  
ATOM 354   H HE21 . GLN A 1 21  ? 17.868  4.528   10.622  1.00 0.00 ? 21  GLN A HE21 1  
ATOM 355   H HE22 . GLN A 1 21  ? 17.414  6.305   10.832  1.00 0.00 ? 21  GLN A HE22 1  
ATOM 356   N N    . LYS A 1 22  ? 15.868  2.932   5.831   1.00 0.00 ? 22  LYS A N    1  
ATOM 357   C CA   . LYS A 1 22  ? 15.258  2.347   4.623   1.00 0.00 ? 22  LYS A CA   1  
ATOM 358   C C    . LYS A 1 22  ? 13.820  2.945   4.545   1.00 0.00 ? 22  LYS A C    1  
ATOM 359   O O    . LYS A 1 22  ? 13.136  3.225   5.530   1.00 0.00 ? 22  LYS A O    1  
ATOM 360   C CB   . LYS A 1 22  ? 15.275  0.795   4.824   1.00 0.00 ? 22  LYS A CB   1  
ATOM 361   C CG   . LYS A 1 22  ? 16.638  0.097   4.572   1.00 0.00 ? 22  LYS A CG   1  
ATOM 362   C CD   . LYS A 1 22  ? 16.591  -1.425  4.833   1.00 0.00 ? 22  LYS A CD   1  
ATOM 363   C CE   . LYS A 1 22  ? 17.960  -2.137  4.789   1.00 0.00 ? 22  LYS A CE   1  
ATOM 364   N NZ   . LYS A 1 22  ? 18.439  -2.297  3.391   1.00 0.00 ? 22  LYS A NZ   1  
ATOM 365   H H    . LYS A 1 22  ? 15.250  3.036   6.649   1.00 0.00 ? 22  LYS A H    1  
ATOM 366   H HA   . LYS A 1 22  ? 15.834  2.661   3.685   1.00 0.00 ? 22  LYS A HA   1  
ATOM 367   H HB2  . LYS A 1 22  ? 14.947  0.565   5.858   1.00 0.00 ? 22  LYS A HB2  1  
ATOM 368   H HB3  . LYS A 1 22  ? 14.486  0.307   4.221   1.00 0.00 ? 22  LYS A HB3  1  
ATOM 369   H HG2  . LYS A 1 22  ? 16.991  0.309   3.545   1.00 0.00 ? 22  LYS A HG2  1  
ATOM 370   H HG3  . LYS A 1 22  ? 17.401  0.546   5.237   1.00 0.00 ? 22  LYS A HG3  1  
ATOM 371   H HD2  . LYS A 1 22  ? 16.155  -1.587  5.840   1.00 0.00 ? 22  LYS A HD2  1  
ATOM 372   H HD3  . LYS A 1 22  ? 15.862  -1.913  4.154   1.00 0.00 ? 22  LYS A HD3  1  
ATOM 373   H HE2  . LYS A 1 22  ? 18.705  -1.595  5.412   1.00 0.00 ? 22  LYS A HE2  1  
ATOM 374   H HE3  . LYS A 1 22  ? 17.864  -3.135  5.269   1.00 0.00 ? 22  LYS A HE3  1  
ATOM 375   H HZ1  . LYS A 1 22  ? 17.746  -2.787  2.787   1.00 0.00 ? 22  LYS A HZ1  1  
ATOM 376   H HZ2  . LYS A 1 22  ? 18.671  -1.419  2.915   1.00 0.00 ? 22  LYS A HZ2  1  
ATOM 377   H HZ3  . LYS A 1 22  ? 19.308  -2.893  3.260   1.00 0.00 ? 22  LYS A HZ3  1  
ATOM 378   N N    . THR A 1 23  ? 13.383  3.150   3.320   1.00 0.00 ? 23  THR A N    1  
ATOM 379   C CA   . THR A 1 23  ? 12.118  3.850   2.964   1.00 0.00 ? 23  THR A CA   1  
ATOM 380   C C    . THR A 1 23  ? 11.421  3.195   1.728   1.00 0.00 ? 23  THR A C    1  
ATOM 381   O O    . THR A 1 23  ? 12.055  2.559   0.877   1.00 0.00 ? 23  THR A O    1  
ATOM 382   C CB   . THR A 1 23  ? 12.435  5.363   2.666   1.00 0.00 ? 23  THR A CB   1  
ATOM 383   O OG1  . THR A 1 23  ? 13.475  5.478   1.698   1.00 0.00 ? 23  THR A OG1  1  
ATOM 384   C CG2  . THR A 1 23  ? 12.899  6.180   3.888   1.00 0.00 ? 23  THR A CG2  1  
ATOM 385   H H    . THR A 1 23  ? 14.098  2.864   2.653   1.00 0.00 ? 23  THR A H    1  
ATOM 386   H HA   . THR A 1 23  ? 11.409  3.806   3.802   1.00 0.00 ? 23  THR A HA   1  
ATOM 387   H HB   . THR A 1 23  ? 11.517  5.840   2.266   1.00 0.00 ? 23  THR A HB   1  
ATOM 388   H HG1  . THR A 1 23  ? 14.106  4.776   1.899   1.00 0.00 ? 23  THR A HG1  1  
ATOM 389   H HG21 . THR A 1 23  ? 12.146  6.187   4.696   1.00 0.00 ? 23  THR A HG21 1  
ATOM 390   H HG22 . THR A 1 23  ? 13.839  5.791   4.322   1.00 0.00 ? 23  THR A HG22 1  
ATOM 391   H HG23 . THR A 1 23  ? 13.090  7.233   3.615   1.00 0.00 ? 23  THR A HG23 1  
ATOM 392   N N    . PHE A 1 24  ? 10.091  3.368   1.639   1.00 0.00 ? 24  PHE A N    1  
ATOM 393   C CA   . PHE A 1 24  ? 9.296   2.954   0.448   1.00 0.00 ? 24  PHE A CA   1  
ATOM 394   C C    . PHE A 1 24  ? 9.000   4.248   -0.374  1.00 0.00 ? 24  PHE A C    1  
ATOM 395   O O    . PHE A 1 24  ? 8.587   5.262   0.209   1.00 0.00 ? 24  PHE A O    1  
ATOM 396   C CB   . PHE A 1 24  ? 7.940   2.318   0.853   1.00 0.00 ? 24  PHE A CB   1  
ATOM 397   C CG   . PHE A 1 24  ? 7.938   0.910   1.472   1.00 0.00 ? 24  PHE A CG   1  
ATOM 398   C CD1  . PHE A 1 24  ? 8.548   0.661   2.707   1.00 0.00 ? 24  PHE A CD1  1  
ATOM 399   C CD2  . PHE A 1 24  ? 7.198   -0.107  0.860   1.00 0.00 ? 24  PHE A CD2  1  
ATOM 400   C CE1  . PHE A 1 24  ? 8.424   -0.581  3.319   1.00 0.00 ? 24  PHE A CE1  1  
ATOM 401   C CE2  . PHE A 1 24  ? 7.052   -1.340  1.487   1.00 0.00 ? 24  PHE A CE2  1  
ATOM 402   C CZ   . PHE A 1 24  ? 7.662   -1.575  2.715   1.00 0.00 ? 24  PHE A CZ   1  
ATOM 403   H H    . PHE A 1 24  ? 9.624   3.886   2.402   1.00 0.00 ? 24  PHE A H    1  
ATOM 404   H HA   . PHE A 1 24  ? 9.850   2.214   -0.162  1.00 0.00 ? 24  PHE A HA   1  
ATOM 405   H HB2  . PHE A 1 24  ? 7.409   3.009   1.532   1.00 0.00 ? 24  PHE A HB2  1  
ATOM 406   H HB3  . PHE A 1 24  ? 7.283   2.312   -0.041  1.00 0.00 ? 24  PHE A HB3  1  
ATOM 407   H HD1  . PHE A 1 24  ? 9.106   1.431   3.211   1.00 0.00 ? 24  PHE A HD1  1  
ATOM 408   H HD2  . PHE A 1 24  ? 6.696   0.066   -0.081  1.00 0.00 ? 24  PHE A HD2  1  
ATOM 409   H HE1  . PHE A 1 24  ? 8.918   -0.767  4.260   1.00 0.00 ? 24  PHE A HE1  1  
ATOM 410   H HE2  . PHE A 1 24  ? 6.460   -2.114  1.029   1.00 0.00 ? 24  PHE A HE2  1  
ATOM 411   H HZ   . PHE A 1 24  ? 7.565   -2.544  3.181   1.00 0.00 ? 24  PHE A HZ   1  
ATOM 412   N N    . TYR A 1 25  ? 9.184   4.242   -1.708  1.00 0.00 ? 25  TYR A N    1  
ATOM 413   C CA   . TYR A 1 25  ? 8.871   5.454   -2.523  1.00 0.00 ? 25  TYR A CA   1  
ATOM 414   C C    . TYR A 1 25  ? 8.575   5.147   -4.023  1.00 0.00 ? 25  TYR A C    1  
ATOM 415   O O    . TYR A 1 25  ? 9.330   4.462   -4.720  1.00 0.00 ? 25  TYR A O    1  
ATOM 416   C CB   . TYR A 1 25  ? 9.999   6.522   -2.387  1.00 0.00 ? 25  TYR A CB   1  
ATOM 417   C CG   . TYR A 1 25  ? 11.498  6.162   -2.489  1.00 0.00 ? 25  TYR A CG   1  
ATOM 418   C CD1  . TYR A 1 25  ? 12.118  5.984   -3.730  1.00 0.00 ? 25  TYR A CD1  1  
ATOM 419   C CD2  . TYR A 1 25  ? 12.288  6.249   -1.337  1.00 0.00 ? 25  TYR A CD2  1  
ATOM 420   C CE1  . TYR A 1 25  ? 13.510  5.964   -3.823  1.00 0.00 ? 25  TYR A CE1  1  
ATOM 421   C CE2  . TYR A 1 25  ? 13.675  6.231   -1.433  1.00 0.00 ? 25  TYR A CE2  1  
ATOM 422   C CZ   . TYR A 1 25  ? 14.285  6.116   -2.674  1.00 0.00 ? 25  TYR A CZ   1  
ATOM 423   O OH   . TYR A 1 25  ? 15.644  6.243   -2.745  1.00 0.00 ? 25  TYR A OH   1  
ATOM 424   H H    . TYR A 1 25  ? 9.549   3.366   -2.105  1.00 0.00 ? 25  TYR A H    1  
ATOM 425   H HA   . TYR A 1 25  ? 7.947   5.914   -2.114  1.00 0.00 ? 25  TYR A HA   1  
ATOM 426   H HB2  . TYR A 1 25  ? 9.792   7.338   -3.103  1.00 0.00 ? 25  TYR A HB2  1  
ATOM 427   H HB3  . TYR A 1 25  ? 9.822   7.025   -1.415  1.00 0.00 ? 25  TYR A HB3  1  
ATOM 428   H HD1  . TYR A 1 25  ? 11.526  5.928   -4.631  1.00 0.00 ? 25  TYR A HD1  1  
ATOM 429   H HD2  . TYR A 1 25  ? 11.832  6.397   -0.367  1.00 0.00 ? 25  TYR A HD2  1  
ATOM 430   H HE1  . TYR A 1 25  ? 13.976  5.888   -4.793  1.00 0.00 ? 25  TYR A HE1  1  
ATOM 431   H HE2  . TYR A 1 25  ? 14.283  6.361   -0.550  1.00 0.00 ? 25  TYR A HE2  1  
ATOM 432   H HH   . TYR A 1 25  ? 15.923  6.269   -3.665  1.00 0.00 ? 25  TYR A HH   1  
ATOM 433   N N    . LEU A 1 26  ? 7.510   5.782   -4.544  1.00 0.00 ? 26  LEU A N    1  
ATOM 434   C CA   . LEU A 1 26  ? 7.085   5.655   -5.963  1.00 0.00 ? 26  LEU A CA   1  
ATOM 435   C C    . LEU A 1 26  ? 7.983   6.496   -6.930  1.00 0.00 ? 26  LEU A C    1  
ATOM 436   O O    . LEU A 1 26  ? 8.309   7.654   -6.648  1.00 0.00 ? 26  LEU A O    1  
ATOM 437   C CB   . LEU A 1 26  ? 5.601   6.136   -6.024  1.00 0.00 ? 26  LEU A CB   1  
ATOM 438   C CG   . LEU A 1 26  ? 4.910   6.155   -7.418  1.00 0.00 ? 26  LEU A CG   1  
ATOM 439   C CD1  . LEU A 1 26  ? 4.800   4.754   -8.037  1.00 0.00 ? 26  LEU A CD1  1  
ATOM 440   C CD2  . LEU A 1 26  ? 3.512   6.783   -7.331  1.00 0.00 ? 26  LEU A CD2  1  
ATOM 441   H H    . LEU A 1 26  ? 6.930   6.284   -3.856  1.00 0.00 ? 26  LEU A H    1  
ATOM 442   H HA   . LEU A 1 26  ? 7.122   4.592   -6.257  1.00 0.00 ? 26  LEU A HA   1  
ATOM 443   H HB2  . LEU A 1 26  ? 4.991   5.521   -5.331  1.00 0.00 ? 26  LEU A HB2  1  
ATOM 444   H HB3  . LEU A 1 26  ? 5.543   7.161   -5.602  1.00 0.00 ? 26  LEU A HB3  1  
ATOM 445   H HG   . LEU A 1 26  ? 5.502   6.793   -8.105  1.00 0.00 ? 26  LEU A HG   1  
ATOM 446   H HD11 . LEU A 1 26  ? 4.248   4.063   -7.374  1.00 0.00 ? 26  LEU A HD11 1  
ATOM 447   H HD12 . LEU A 1 26  ? 4.279   4.775   -9.012  1.00 0.00 ? 26  LEU A HD12 1  
ATOM 448   H HD13 . LEU A 1 26  ? 5.791   4.306   -8.223  1.00 0.00 ? 26  LEU A HD13 1  
ATOM 449   H HD21 . LEU A 1 26  ? 3.543   7.797   -6.888  1.00 0.00 ? 26  LEU A HD21 1  
ATOM 450   H HD22 . LEU A 1 26  ? 3.043   6.884   -8.327  1.00 0.00 ? 26  LEU A HD22 1  
ATOM 451   H HD23 . LEU A 1 26  ? 2.828   6.178   -6.710  1.00 0.00 ? 26  LEU A HD23 1  
ATOM 452   N N    . ARG A 1 27  ? 8.371   5.906   -8.081  1.00 0.00 ? 27  ARG A N    1  
ATOM 453   C CA   . ARG A 1 27  ? 9.152   6.647   -9.122  1.00 0.00 ? 27  ARG A CA   1  
ATOM 454   C C    . ARG A 1 27  ? 8.262   6.825   -10.393 1.00 0.00 ? 27  ARG A C    1  
ATOM 455   O O    . ARG A 1 27  ? 7.878   7.954   -10.704 1.00 0.00 ? 27  ARG A O    1  
ATOM 456   C CB   . ARG A 1 27  ? 10.505  5.926   -9.391  1.00 0.00 ? 27  ARG A CB   1  
ATOM 457   C CG   . ARG A 1 27  ? 11.558  6.109   -8.269  1.00 0.00 ? 27  ARG A CG   1  
ATOM 458   C CD   . ARG A 1 27  ? 12.959  5.574   -8.625  1.00 0.00 ? 27  ARG A CD   1  
ATOM 459   N NE   . ARG A 1 27  ? 13.656  6.507   -9.554  1.00 0.00 ? 27  ARG A NE   1  
ATOM 460   C CZ   . ARG A 1 27  ? 14.875  6.325   -10.056 1.00 0.00 ? 27  ARG A CZ   1  
ATOM 461   N NH1  . ARG A 1 27  ? 15.564  5.224   -9.909  1.00 0.00 ? 27  ARG A NH1  1  
ATOM 462   N NH2  . ARG A 1 27  ? 15.429  7.295   -10.721 1.00 0.00 ? 27  ARG A NH2  1  
ATOM 463   H H    . ARG A 1 27  ? 8.030   4.940   -8.218  1.00 0.00 ? 27  ARG A H    1  
ATOM 464   H HA   . ARG A 1 27  ? 9.390   7.679   -8.792  1.00 0.00 ? 27  ARG A HA   1  
ATOM 465   H HB2  . ARG A 1 27  ? 10.343  4.848   -9.585  1.00 0.00 ? 27  ARG A HB2  1  
ATOM 466   H HB3  . ARG A 1 27  ? 10.927  6.323   -10.335 1.00 0.00 ? 27  ARG A HB3  1  
ATOM 467   H HG2  . ARG A 1 27  ? 11.624  7.172   -7.963  1.00 0.00 ? 27  ARG A HG2  1  
ATOM 468   H HG3  . ARG A 1 27  ? 11.193  5.595   -7.358  1.00 0.00 ? 27  ARG A HG3  1  
ATOM 469   H HD2  . ARG A 1 27  ? 13.546  5.470   -7.688  1.00 0.00 ? 27  ARG A HD2  1  
ATOM 470   H HD3  . ARG A 1 27  ? 12.875  4.555   -9.055  1.00 0.00 ? 27  ARG A HD3  1  
ATOM 471   H HE   . ARG A 1 27  ? 13.251  7.425   -9.761  1.00 0.00 ? 27  ARG A HE   1  
ATOM 472   H HH11 . ARG A 1 27  ? 15.097  4.492   -9.373  1.00 0.00 ? 27  ARG A HH11 1  
ATOM 473   H HH12 . ARG A 1 27  ? 16.544  5.247   -10.227 1.00 0.00 ? 27  ARG A HH12 1  
ATOM 474   H HH21 . ARG A 1 27  ? 14.893  8.156   -10.837 1.00 0.00 ? 27  ARG A HH21 1  
ATOM 475   H HH22 . ARG A 1 27  ? 16.390  7.124   -11.040 1.00 0.00 ? 27  ARG A HH22 1  
ATOM 476   N N    . ASN A 1 28  ? 7.945   5.741   -11.125 1.00 0.00 ? 28  ASN A N    1  
ATOM 477   C CA   . ASN A 1 28  ? 7.044   5.790   -12.310 1.00 0.00 ? 28  ASN A CA   1  
ATOM 478   C C    . ASN A 1 28  ? 5.870   4.782   -12.080 1.00 0.00 ? 28  ASN A C    1  
ATOM 479   O O    . ASN A 1 28  ? 4.743   5.217   -11.832 1.00 0.00 ? 28  ASN A O    1  
ATOM 480   C CB   . ASN A 1 28  ? 7.916   5.554   -13.579 1.00 0.00 ? 28  ASN A CB   1  
ATOM 481   C CG   . ASN A 1 28  ? 7.168   5.750   -14.901 1.00 0.00 ? 28  ASN A CG   1  
ATOM 482   O OD1  . ASN A 1 28  ? 6.775   6.853   -15.262 1.00 0.00 ? 28  ASN A OD1  1  
ATOM 483   N ND2  . ASN A 1 28  ? 6.950   4.711   -15.671 1.00 0.00 ? 28  ASN A ND2  1  
ATOM 484   H H    . ASN A 1 28  ? 8.328   4.867   -10.756 1.00 0.00 ? 28  ASN A H    1  
ATOM 485   H HA   . ASN A 1 28  ? 6.568   6.790   -12.404 1.00 0.00 ? 28  ASN A HA   1  
ATOM 486   H HB2  . ASN A 1 28  ? 8.744   6.287   -13.588 1.00 0.00 ? 28  ASN A HB2  1  
ATOM 487   H HB3  . ASN A 1 28  ? 8.417   4.568   -13.544 1.00 0.00 ? 28  ASN A HB3  1  
ATOM 488   H HD21 . ASN A 1 28  ? 7.343   3.813   -15.383 1.00 0.00 ? 28  ASN A HD21 1  
ATOM 489   H HD22 . ASN A 1 28  ? 6.467   4.943   -16.544 1.00 0.00 ? 28  ASN A HD22 1  
ATOM 490   N N    . ASN A 1 29  ? 6.125   3.458   -12.117 1.00 0.00 ? 29  ASN A N    1  
ATOM 491   C CA   . ASN A 1 29  ? 5.071   2.421   -11.913 1.00 0.00 ? 29  ASN A CA   1  
ATOM 492   C C    . ASN A 1 29  ? 5.250   1.518   -10.634 1.00 0.00 ? 29  ASN A C    1  
ATOM 493   O O    . ASN A 1 29  ? 4.470   0.570   -10.498 1.00 0.00 ? 29  ASN A O    1  
ATOM 494   C CB   . ASN A 1 29  ? 5.079   1.603   -13.243 1.00 0.00 ? 29  ASN A CB   1  
ATOM 495   C CG   . ASN A 1 29  ? 3.851   0.710   -13.456 1.00 0.00 ? 29  ASN A CG   1  
ATOM 496   O OD1  . ASN A 1 29  ? 2.732   1.184   -13.611 1.00 0.00 ? 29  ASN A OD1  1  
ATOM 497   N ND2  . ASN A 1 29  ? 4.000   -0.593  -13.436 1.00 0.00 ? 29  ASN A ND2  1  
ATOM 498   H H    . ASN A 1 29  ? 7.094   3.217   -12.343 1.00 0.00 ? 29  ASN A H    1  
ATOM 499   H HA   . ASN A 1 29  ? 4.071   2.886   -11.798 1.00 0.00 ? 29  ASN A HA   1  
ATOM 500   H HB2  . ASN A 1 29  ? 5.079   2.288   -14.114 1.00 0.00 ? 29  ASN A HB2  1  
ATOM 501   H HB3  . ASN A 1 29  ? 6.016   1.022   -13.341 1.00 0.00 ? 29  ASN A HB3  1  
ATOM 502   H HD21 . ASN A 1 29  ? 4.922   -0.933  -13.153 1.00 0.00 ? 29  ASN A HD21 1  
ATOM 503   H HD22 . ASN A 1 29  ? 3.107   -1.091  -13.330 1.00 0.00 ? 29  ASN A HD22 1  
ATOM 504   N N    . GLN A 1 30  ? 6.204   1.740   -9.694  1.00 0.00 ? 30  GLN A N    1  
ATOM 505   C CA   . GLN A 1 30  ? 6.377   0.846   -8.506  1.00 0.00 ? 30  GLN A CA   1  
ATOM 506   C C    . GLN A 1 30  ? 6.981   1.603   -7.284  1.00 0.00 ? 30  GLN A C    1  
ATOM 507   O O    . GLN A 1 30  ? 7.767   2.549   -7.417  1.00 0.00 ? 30  GLN A O    1  
ATOM 508   C CB   . GLN A 1 30  ? 7.306   -0.363  -8.867  1.00 0.00 ? 30  GLN A CB   1  
ATOM 509   C CG   . GLN A 1 30  ? 6.672   -1.551  -9.641  1.00 0.00 ? 30  GLN A CG   1  
ATOM 510   C CD   . GLN A 1 30  ? 5.583   -2.331  -8.888  1.00 0.00 ? 30  GLN A CD   1  
ATOM 511   O OE1  . GLN A 1 30  ? 5.857   -3.204  -8.072  1.00 0.00 ? 30  GLN A OE1  1  
ATOM 512   N NE2  . GLN A 1 30  ? 4.327   -2.040  -9.134  1.00 0.00 ? 30  GLN A NE2  1  
ATOM 513   H H    . GLN A 1 30  ? 6.804   2.568   -9.830  1.00 0.00 ? 30  GLN A H    1  
ATOM 514   H HA   . GLN A 1 30  ? 5.383   0.465   -8.193  1.00 0.00 ? 30  GLN A HA   1  
ATOM 515   H HB2  . GLN A 1 30  ? 8.192   0.003   -9.422  1.00 0.00 ? 30  GLN A HB2  1  
ATOM 516   H HB3  . GLN A 1 30  ? 7.738   -0.794  -7.943  1.00 0.00 ? 30  GLN A HB3  1  
ATOM 517   H HG2  . GLN A 1 30  ? 6.305   -1.220  -10.629 1.00 0.00 ? 30  GLN A HG2  1  
ATOM 518   H HG3  . GLN A 1 30  ? 7.470   -2.277  -9.882  1.00 0.00 ? 30  GLN A HG3  1  
ATOM 519   H HE21 . GLN A 1 30  ? 4.166   -1.224  -9.742  1.00 0.00 ? 30  GLN A HE21 1  
ATOM 520   H HE22 . GLN A 1 30  ? 3.639   -2.557  -8.565  1.00 0.00 ? 30  GLN A HE22 1  
ATOM 521   N N    . LEU A 1 31  ? 6.623   1.114   -6.081  1.00 0.00 ? 31  LEU A N    1  
ATOM 522   C CA   . LEU A 1 31  ? 7.138   1.632   -4.785  1.00 0.00 ? 31  LEU A CA   1  
ATOM 523   C C    . LEU A 1 31  ? 8.499   0.911   -4.518  1.00 0.00 ? 31  LEU A C    1  
ATOM 524   O O    . LEU A 1 31  ? 8.509   -0.272  -4.147  1.00 0.00 ? 31  LEU A O    1  
ATOM 525   C CB   . LEU A 1 31  ? 6.126   1.342   -3.633  1.00 0.00 ? 31  LEU A CB   1  
ATOM 526   C CG   . LEU A 1 31  ? 4.747   2.057   -3.594  1.00 0.00 ? 31  LEU A CG   1  
ATOM 527   C CD1  . LEU A 1 31  ? 3.800   1.673   -4.749  1.00 0.00 ? 31  LEU A CD1  1  
ATOM 528   C CD2  . LEU A 1 31  ? 4.037   1.715   -2.269  1.00 0.00 ? 31  LEU A CD2  1  
ATOM 529   H H    . LEU A 1 31  ? 5.966   0.328   -6.109  1.00 0.00 ? 31  LEU A H    1  
ATOM 530   H HA   . LEU A 1 31  ? 7.286   2.727   -4.834  1.00 0.00 ? 31  LEU A HA   1  
ATOM 531   H HB2  . LEU A 1 31  ? 5.968   0.251   -3.550  1.00 0.00 ? 31  LEU A HB2  1  
ATOM 532   H HB3  . LEU A 1 31  ? 6.645   1.608   -2.690  1.00 0.00 ? 31  LEU A HB3  1  
ATOM 533   H HG   . LEU A 1 31  ? 4.919   3.154   -3.610  1.00 0.00 ? 31  LEU A HG   1  
ATOM 534   H HD11 . LEU A 1 31  ? 3.707   0.577   -4.864  1.00 0.00 ? 31  LEU A HD11 1  
ATOM 535   H HD12 . LEU A 1 31  ? 2.780   2.065   -4.602  1.00 0.00 ? 31  LEU A HD12 1  
ATOM 536   H HD13 . LEU A 1 31  ? 4.147   2.085   -5.713  1.00 0.00 ? 31  LEU A HD13 1  
ATOM 537   H HD21 . LEU A 1 31  ? 4.677   1.926   -1.392  1.00 0.00 ? 31  LEU A HD21 1  
ATOM 538   H HD22 . LEU A 1 31  ? 3.128   2.328   -2.128  1.00 0.00 ? 31  LEU A HD22 1  
ATOM 539   H HD23 . LEU A 1 31  ? 3.742   0.651   -2.203  1.00 0.00 ? 31  LEU A HD23 1  
ATOM 540   N N    . VAL A 1 32  ? 9.637   1.604   -4.738  1.00 0.00 ? 32  VAL A N    1  
ATOM 541   C CA   . VAL A 1 32  ? 10.997  0.986   -4.596  1.00 0.00 ? 32  VAL A CA   1  
ATOM 542   C C    . VAL A 1 32  ? 11.391  0.901   -3.083  1.00 0.00 ? 32  VAL A C    1  
ATOM 543   O O    . VAL A 1 32  ? 10.907  1.660   -2.236  1.00 0.00 ? 32  VAL A O    1  
ATOM 544   C CB   . VAL A 1 32  ? 12.128  1.708   -5.431  1.00 0.00 ? 32  VAL A CB   1  
ATOM 545   C CG1  . VAL A 1 32  ? 13.059  0.636   -6.024  1.00 0.00 ? 32  VAL A CG1  1  
ATOM 546   C CG2  . VAL A 1 32  ? 11.695  2.620   -6.604  1.00 0.00 ? 32  VAL A CG2  1  
ATOM 547   H H    . VAL A 1 32  ? 9.508   2.587   -5.024  1.00 0.00 ? 32  VAL A H    1  
ATOM 548   H HA   . VAL A 1 32  ? 10.907  -0.049  -4.973  1.00 0.00 ? 32  VAL A HA   1  
ATOM 549   H HB   . VAL A 1 32  ? 12.793  2.304   -4.773  1.00 0.00 ? 32  VAL A HB   1  
ATOM 550   H HG11 . VAL A 1 32  ? 13.472  -0.045  -5.257  1.00 0.00 ? 32  VAL A HG11 1  
ATOM 551   H HG12 . VAL A 1 32  ? 12.554  0.000   -6.776  1.00 0.00 ? 32  VAL A HG12 1  
ATOM 552   H HG13 . VAL A 1 32  ? 13.936  1.076   -6.514  1.00 0.00 ? 32  VAL A HG13 1  
ATOM 553   H HG21 . VAL A 1 32  ? 11.048  2.087   -7.326  1.00 0.00 ? 32  VAL A HG21 1  
ATOM 554   H HG22 . VAL A 1 32  ? 11.123  3.491   -6.239  1.00 0.00 ? 32  VAL A HG22 1  
ATOM 555   H HG23 . VAL A 1 32  ? 12.558  3.022   -7.161  1.00 0.00 ? 32  VAL A HG23 1  
ATOM 556   N N    . ALA A 1 33  ? 12.255  -0.069  -2.751  1.00 0.00 ? 33  ALA A N    1  
ATOM 557   C CA   . ALA A 1 33  ? 12.606  -0.385  -1.356  1.00 0.00 ? 33  ALA A CA   1  
ATOM 558   C C    . ALA A 1 33  ? 13.957  0.146   -0.856  1.00 0.00 ? 33  ALA A C    1  
ATOM 559   O O    . ALA A 1 33  ? 14.990  0.079   -1.534  1.00 0.00 ? 33  ALA A O    1  
ATOM 560   C CB   . ALA A 1 33  ? 12.759  -1.910  -1.259  1.00 0.00 ? 33  ALA A CB   1  
ATOM 561   H H    . ALA A 1 33  ? 12.647  -0.625  -3.522  1.00 0.00 ? 33  ALA A H    1  
ATOM 562   H HA   . ALA A 1 33  ? 11.781  -0.064  -0.679  1.00 0.00 ? 33  ALA A HA   1  
ATOM 563   H HB1  . ALA A 1 33  ? 11.870  -2.446  -1.613  1.00 0.00 ? 33  ALA A HB1  1  
ATOM 564   H HB2  . ALA A 1 33  ? 13.636  -2.259  -1.850  1.00 0.00 ? 33  ALA A HB2  1  
ATOM 565   H HB3  . ALA A 1 33  ? 12.965  -2.218  -0.216  1.00 0.00 ? 33  ALA A HB3  1  
ATOM 566   N N    . GLY A 1 34  ? 13.953  0.462   0.441   1.00 0.00 ? 34  GLY A N    1  
ATOM 567   C CA   . GLY A 1 34  ? 15.182  0.797   1.157   1.00 0.00 ? 34  GLY A CA   1  
ATOM 568   C C    . GLY A 1 34  ? 15.746  2.156   0.811   1.00 0.00 ? 34  GLY A C    1  
ATOM 569   O O    . GLY A 1 34  ? 15.455  3.147   1.476   1.00 0.00 ? 34  GLY A O    1  
ATOM 570   H H    . GLY A 1 34  ? 13.013  0.578   0.853   1.00 0.00 ? 34  GLY A H    1  
ATOM 571   H HA2  . GLY A 1 34  ? 14.952  0.788   2.224   1.00 0.00 ? 34  GLY A HA2  1  
ATOM 572   H HA3  . GLY A 1 34  ? 15.941  -0.002  1.032   1.00 0.00 ? 34  GLY A HA3  1  
ATOM 573   N N    . TYR A 1 35  ? 16.621  2.184   -0.181  1.00 0.00 ? 35  TYR A N    1  
ATOM 574   C CA   . TYR A 1 35  ? 17.258  3.478   -0.548  1.00 0.00 ? 35  TYR A CA   1  
ATOM 575   C C    . TYR A 1 35  ? 17.713  3.520   -2.065  1.00 0.00 ? 35  TYR A C    1  
ATOM 576   O O    . TYR A 1 35  ? 18.916  3.666   -2.308  1.00 0.00 ? 35  TYR A O    1  
ATOM 577   C CB   . TYR A 1 35  ? 18.469  3.767   0.432   1.00 0.00 ? 35  TYR A CB   1  
ATOM 578   C CG   . TYR A 1 35  ? 18.307  4.653   1.697   1.00 0.00 ? 35  TYR A CG   1  
ATOM 579   C CD1  . TYR A 1 35  ? 17.239  5.535   1.932   1.00 0.00 ? 35  TYR A CD1  1  
ATOM 580   C CD2  . TYR A 1 35  ? 19.381  4.649   2.598   1.00 0.00 ? 35  TYR A CD2  1  
ATOM 581   C CE1  . TYR A 1 35  ? 17.224  6.349   3.062   1.00 0.00 ? 35  TYR A CE1  1  
ATOM 582   C CE2  . TYR A 1 35  ? 19.379  5.487   3.711   1.00 0.00 ? 35  TYR A CE2  1  
ATOM 583   C CZ   . TYR A 1 35  ? 18.295  6.323   3.949   1.00 0.00 ? 35  TYR A CZ   1  
ATOM 584   O OH   . TYR A 1 35  ? 18.285  7.115   5.066   1.00 0.00 ? 35  TYR A OH   1  
ATOM 585   H H    . TYR A 1 35  ? 16.617  1.267   -0.674  1.00 0.00 ? 35  TYR A H    1  
ATOM 586   H HA   . TYR A 1 35  ? 16.499  4.256   -0.346  1.00 0.00 ? 35  TYR A HA   1  
ATOM 587   H HB2  . TYR A 1 35  ? 18.952  2.807   0.705   1.00 0.00 ? 35  TYR A HB2  1  
ATOM 588   H HB3  . TYR A 1 35  ? 19.274  4.291   -0.116  1.00 0.00 ? 35  TYR A HB3  1  
ATOM 589   H HD1  . TYR A 1 35  ? 16.404  5.614   1.254   1.00 0.00 ? 35  TYR A HD1  1  
ATOM 590   H HD2  . TYR A 1 35  ? 20.231  4.002   2.439   1.00 0.00 ? 35  TYR A HD2  1  
ATOM 591   H HE1  . TYR A 1 35  ? 16.385  7.006   3.236   1.00 0.00 ? 35  TYR A HE1  1  
ATOM 592   H HE2  . TYR A 1 35  ? 20.209  5.473   4.401   1.00 0.00 ? 35  TYR A HE2  1  
ATOM 593   H HH   . TYR A 1 35  ? 17.489  7.649   5.064   1.00 0.00 ? 35  TYR A HH   1  
ATOM 594   N N    . LEU A 1 36  ? 16.845  3.495   -3.121  1.00 0.00 ? 36  LEU A N    1  
ATOM 595   C CA   . LEU A 1 36  ? 17.365  3.615   -4.535  1.00 0.00 ? 36  LEU A CA   1  
ATOM 596   C C    . LEU A 1 36  ? 17.779  5.099   -4.851  1.00 0.00 ? 36  LEU A C    1  
ATOM 597   O O    . LEU A 1 36  ? 18.876  5.529   -4.488  1.00 0.00 ? 36  LEU A O    1  
ATOM 598   C CB   . LEU A 1 36  ? 16.379  2.929   -5.547  1.00 0.00 ? 36  LEU A CB   1  
ATOM 599   C CG   . LEU A 1 36  ? 16.795  2.984   -7.059  1.00 0.00 ? 36  LEU A CG   1  
ATOM 600   C CD1  . LEU A 1 36  ? 18.178  2.379   -7.369  1.00 0.00 ? 36  LEU A CD1  1  
ATOM 601   C CD2  . LEU A 1 36  ? 15.773  2.303   -7.980  1.00 0.00 ? 36  LEU A CD2  1  
ATOM 602   H H    . LEU A 1 36  ? 15.856  3.312   -2.889  1.00 0.00 ? 36  LEU A H    1  
ATOM 603   H HA   . LEU A 1 36  ? 18.304  3.091   -4.659  1.00 0.00 ? 36  LEU A HA   1  
ATOM 604   H HB2  . LEU A 1 36  ? 16.271  1.866   -5.255  1.00 0.00 ? 36  LEU A HB2  1  
ATOM 605   H HB3  . LEU A 1 36  ? 15.364  3.352   -5.427  1.00 0.00 ? 36  LEU A HB3  1  
ATOM 606   H HG   . LEU A 1 36  ? 16.835  4.042   -7.376  1.00 0.00 ? 36  LEU A HG   1  
ATOM 607   H HD11 . LEU A 1 36  ? 18.991  2.860   -6.796  1.00 0.00 ? 36  LEU A HD11 1  
ATOM 608   H HD12 . LEU A 1 36  ? 18.221  1.298   -7.142  1.00 0.00 ? 36  LEU A HD12 1  
ATOM 609   H HD13 . LEU A 1 36  ? 18.450  2.488   -8.436  1.00 0.00 ? 36  LEU A HD13 1  
ATOM 610   H HD21 . LEU A 1 36  ? 14.760  2.724   -7.858  1.00 0.00 ? 36  LEU A HD21 1  
ATOM 611   H HD22 . LEU A 1 36  ? 16.042  2.407   -9.048  1.00 0.00 ? 36  LEU A HD22 1  
ATOM 612   H HD23 . LEU A 1 36  ? 15.708  1.215   -7.791  1.00 0.00 ? 36  LEU A HD23 1  
ATOM 613   N N    . GLN A 1 37  ? 16.907  5.883   -5.475  1.00 0.00 ? 37  GLN A N    1  
ATOM 614   C CA   . GLN A 1 37  ? 17.233  7.277   -5.918  1.00 0.00 ? 37  GLN A CA   1  
ATOM 615   C C    . GLN A 1 37  ? 16.077  8.301   -5.663  1.00 0.00 ? 37  GLN A C    1  
ATOM 616   O O    . GLN A 1 37  ? 14.914  8.065   -6.004  1.00 0.00 ? 37  GLN A O    1  
ATOM 617   C CB   . GLN A 1 37  ? 17.553  7.274   -7.443  1.00 0.00 ? 37  GLN A CB   1  
ATOM 618   C CG   . GLN A 1 37  ? 18.838  6.528   -7.894  1.00 0.00 ? 37  GLN A CG   1  
ATOM 619   C CD   . GLN A 1 37  ? 19.075  6.561   -9.411  1.00 0.00 ? 37  GLN A CD   1  
ATOM 620   O OE1  . GLN A 1 37  ? 18.234  6.164   -10.216 1.00 0.00 ? 37  GLN A OE1  1  
ATOM 621   N NE2  . GLN A 1 37  ? 20.217  7.022   -9.859  1.00 0.00 ? 37  GLN A NE2  1  
ATOM 622   H H    . GLN A 1 37  ? 16.129  5.271   -5.724  1.00 0.00 ? 37  GLN A H    1  
ATOM 623   H HA   . GLN A 1 37  ? 18.139  7.642   -5.388  1.00 0.00 ? 37  GLN A HA   1  
ATOM 624   H HB2  . GLN A 1 37  ? 16.680  6.873   -7.984  1.00 0.00 ? 37  GLN A HB2  1  
ATOM 625   H HB3  . GLN A 1 37  ? 17.643  8.322   -7.794  1.00 0.00 ? 37  GLN A HB3  1  
ATOM 626   H HG2  . GLN A 1 37  ? 19.710  6.930   -7.343  1.00 0.00 ? 37  GLN A HG2  1  
ATOM 627   H HG3  . GLN A 1 37  ? 18.786  5.466   -7.597  1.00 0.00 ? 37  GLN A HG3  1  
ATOM 628   H HE21 . GLN A 1 37  ? 20.916  7.295   -9.163  1.00 0.00 ? 37  GLN A HE21 1  
ATOM 629   H HE22 . GLN A 1 37  ? 20.332  6.961   -10.875 1.00 0.00 ? 37  GLN A HE22 1  
ATOM 630   N N    . GLY A 1 38  ? 16.451  9.472   -5.123  1.00 0.00 ? 38  GLY A N    1  
ATOM 631   C CA   . GLY A 1 38  ? 15.525  10.613  -4.892  1.00 0.00 ? 38  GLY A CA   1  
ATOM 632   C C    . GLY A 1 38  ? 16.319  11.948  -4.970  1.00 0.00 ? 38  GLY A C    1  
ATOM 633   O O    . GLY A 1 38  ? 16.645  12.461  -3.898  1.00 0.00 ? 38  GLY A O    1  
ATOM 634   H H    . GLY A 1 38  ? 17.446  9.536   -4.877  1.00 0.00 ? 38  GLY A H    1  
ATOM 635   H HA2  . GLY A 1 38  ? 14.680  10.625  -5.607  1.00 0.00 ? 38  GLY A HA2  1  
ATOM 636   H HA3  . GLY A 1 38  ? 15.067  10.524  -3.889  1.00 0.00 ? 38  GLY A HA3  1  
ATOM 637   N N    . PRO A 1 39  ? 16.628  12.560  -6.157  1.00 0.00 ? 39  PRO A N    1  
ATOM 638   C CA   . PRO A 1 39  ? 17.502  13.773  -6.246  1.00 0.00 ? 39  PRO A CA   1  
ATOM 639   C C    . PRO A 1 39  ? 17.081  15.074  -5.486  1.00 0.00 ? 39  PRO A C    1  
ATOM 640   O O    . PRO A 1 39  ? 17.896  15.616  -4.736  1.00 0.00 ? 39  PRO A O    1  
ATOM 641   C CB   . PRO A 1 39  ? 17.607  13.983  -7.775  1.00 0.00 ? 39  PRO A CB   1  
ATOM 642   C CG   . PRO A 1 39  ? 17.349  12.610  -8.393  1.00 0.00 ? 39  PRO A CG   1  
ATOM 643   C CD   . PRO A 1 39  ? 16.290  11.995  -7.481  1.00 0.00 ? 39  PRO A CD   1  
ATOM 644   H HA   . PRO A 1 39  ? 18.501  13.507  -5.848  1.00 0.00 ? 39  PRO A HA   1  
ATOM 645   H HB2  . PRO A 1 39  ? 16.849  14.702  -8.146  1.00 0.00 ? 39  PRO A HB2  1  
ATOM 646   H HB3  . PRO A 1 39  ? 18.591  14.398  -8.068  1.00 0.00 ? 39  PRO A HB3  1  
ATOM 647   H HG2  . PRO A 1 39  ? 17.022  12.671  -9.448  1.00 0.00 ? 39  PRO A HG2  1  
ATOM 648   H HG3  . PRO A 1 39  ? 18.274  12.001  -8.374  1.00 0.00 ? 39  PRO A HG3  1  
ATOM 649   H HD2  . PRO A 1 39  ? 15.269  12.304  -7.782  1.00 0.00 ? 39  PRO A HD2  1  
ATOM 650   H HD3  . PRO A 1 39  ? 16.331  10.890  -7.523  1.00 0.00 ? 39  PRO A HD3  1  
ATOM 651   N N    . ASN A 1 40  ? 15.866  15.609  -5.706  1.00 0.00 ? 40  ASN A N    1  
ATOM 652   C CA   . ASN A 1 40  ? 15.384  16.852  -5.026  1.00 0.00 ? 40  ASN A CA   1  
ATOM 653   C C    . ASN A 1 40  ? 13.885  16.682  -4.595  1.00 0.00 ? 40  ASN A C    1  
ATOM 654   O O    . ASN A 1 40  ? 13.026  17.513  -4.901  1.00 0.00 ? 40  ASN A O    1  
ATOM 655   C CB   . ASN A 1 40  ? 15.595  18.068  -5.984  1.00 0.00 ? 40  ASN A CB   1  
ATOM 656   C CG   . ASN A 1 40  ? 17.043  18.456  -6.310  1.00 0.00 ? 40  ASN A CG   1  
ATOM 657   O OD1  . ASN A 1 40  ? 17.582  18.121  -7.359  1.00 0.00 ? 40  ASN A OD1  1  
ATOM 658   N ND2  . ASN A 1 40  ? 17.716  19.173  -5.442  1.00 0.00 ? 40  ASN A ND2  1  
ATOM 659   H H    . ASN A 1 40  ? 15.261  15.059  -6.322  1.00 0.00 ? 40  ASN A H    1  
ATOM 660   H HA   . ASN A 1 40  ? 15.950  17.038  -4.091  1.00 0.00 ? 40  ASN A HA   1  
ATOM 661   H HB2  . ASN A 1 40  ? 15.072  17.883  -6.941  1.00 0.00 ? 40  ASN A HB2  1  
ATOM 662   H HB3  . ASN A 1 40  ? 15.087  18.960  -5.572  1.00 0.00 ? 40  ASN A HB3  1  
ATOM 663   H HD21 . ASN A 1 40  ? 17.265  19.363  -4.544  1.00 0.00 ? 40  ASN A HD21 1  
ATOM 664   H HD22 . ASN A 1 40  ? 18.694  19.319  -5.704  1.00 0.00 ? 40  ASN A HD22 1  
ATOM 665   N N    . VAL A 1 41  ? 13.578  15.586  -3.865  1.00 0.00 ? 41  VAL A N    1  
ATOM 666   C CA   . VAL A 1 41  ? 12.202  15.229  -3.372  1.00 0.00 ? 41  VAL A CA   1  
ATOM 667   C C    . VAL A 1 41  ? 11.139  15.165  -4.546  1.00 0.00 ? 41  VAL A C    1  
ATOM 668   O O    . VAL A 1 41  ? 10.092  15.819  -4.523  1.00 0.00 ? 41  VAL A O    1  
ATOM 669   C CB   . VAL A 1 41  ? 11.789  16.168  -2.172  1.00 0.00 ? 41  VAL A CB   1  
ATOM 670   C CG1  . VAL A 1 41  ? 10.527  15.651  -1.440  1.00 0.00 ? 41  VAL A CG1  1  
ATOM 671   C CG2  . VAL A 1 41  ? 12.869  16.348  -1.072  1.00 0.00 ? 41  VAL A CG2  1  
ATOM 672   H H    . VAL A 1 41  ? 14.394  14.990  -3.683  1.00 0.00 ? 41  VAL A H    1  
ATOM 673   H HA   . VAL A 1 41  ? 12.245  14.193  -2.981  1.00 0.00 ? 41  VAL A HA   1  
ATOM 674   H HB   . VAL A 1 41  ? 11.561  17.171  -2.585  1.00 0.00 ? 41  VAL A HB   1  
ATOM 675   H HG11 . VAL A 1 41  ? 9.652   15.577  -2.110  1.00 0.00 ? 41  VAL A HG11 1  
ATOM 676   H HG12 . VAL A 1 41  ? 10.683  14.646  -1.003  1.00 0.00 ? 41  VAL A HG12 1  
ATOM 677   H HG13 . VAL A 1 41  ? 10.220  16.324  -0.618  1.00 0.00 ? 41  VAL A HG13 1  
ATOM 678   H HG21 . VAL A 1 41  ? 13.183  15.382  -0.634  1.00 0.00 ? 41  VAL A HG21 1  
ATOM 679   H HG22 . VAL A 1 41  ? 13.782  16.828  -1.472  1.00 0.00 ? 41  VAL A HG22 1  
ATOM 680   H HG23 . VAL A 1 41  ? 12.525  16.996  -0.245  1.00 0.00 ? 41  VAL A HG23 1  
ATOM 681   N N    . ASN A 1 42  ? 11.410  14.334  -5.572  1.00 0.00 ? 42  ASN A N    1  
ATOM 682   C CA   . ASN A 1 42  ? 10.476  14.107  -6.715  1.00 0.00 ? 42  ASN A CA   1  
ATOM 683   C C    . ASN A 1 42  ? 9.969   12.629  -6.630  1.00 0.00 ? 42  ASN A C    1  
ATOM 684   O O    . ASN A 1 42  ? 10.357  11.761  -7.418  1.00 0.00 ? 42  ASN A O    1  
ATOM 685   C CB   . ASN A 1 42  ? 11.255  14.484  -8.008  1.00 0.00 ? 42  ASN A CB   1  
ATOM 686   C CG   . ASN A 1 42  ? 10.422  14.512  -9.292  1.00 0.00 ? 42  ASN A CG   1  
ATOM 687   O OD1  . ASN A 1 42  ? 10.477  13.614  -10.123 1.00 0.00 ? 42  ASN A OD1  1  
ATOM 688   N ND2  . ASN A 1 42  ? 9.645   15.546  -9.516  1.00 0.00 ? 42  ASN A ND2  1  
ATOM 689   H H    . ASN A 1 42  ? 12.308  13.849  -5.491  1.00 0.00 ? 42  ASN A H    1  
ATOM 690   H HA   . ASN A 1 42  ? 9.585   14.767  -6.649  1.00 0.00 ? 42  ASN A HA   1  
ATOM 691   H HB2  . ASN A 1 42  ? 11.741  15.473  -7.891  1.00 0.00 ? 42  ASN A HB2  1  
ATOM 692   H HB3  . ASN A 1 42  ? 12.091  13.777  -8.164  1.00 0.00 ? 42  ASN A HB3  1  
ATOM 693   H HD21 . ASN A 1 42  ? 9.641   16.294  -8.818  1.00 0.00 ? 42  ASN A HD21 1  
ATOM 694   H HD22 . ASN A 1 42  ? 9.133   15.496  -10.401 1.00 0.00 ? 42  ASN A HD22 1  
ATOM 695   N N    . LEU A 1 43  ? 9.124   12.357  -5.618  1.00 0.00 ? 43  LEU A N    1  
ATOM 696   C CA   . LEU A 1 43  ? 8.628   10.986  -5.300  1.00 0.00 ? 43  LEU A CA   1  
ATOM 697   C C    . LEU A 1 43  ? 7.140   11.043  -4.807  1.00 0.00 ? 43  LEU A C    1  
ATOM 698   O O    . LEU A 1 43  ? 6.261   10.503  -5.480  1.00 0.00 ? 43  LEU A O    1  
ATOM 699   C CB   . LEU A 1 43  ? 9.582   10.344  -4.233  1.00 0.00 ? 43  LEU A CB   1  
ATOM 700   C CG   . LEU A 1 43  ? 11.060  10.056  -4.627  1.00 0.00 ? 43  LEU A CG   1  
ATOM 701   C CD1  . LEU A 1 43  ? 11.909  9.751   -3.381  1.00 0.00 ? 43  LEU A CD1  1  
ATOM 702   C CD2  . LEU A 1 43  ? 11.172  8.915   -5.650  1.00 0.00 ? 43  LEU A CD2  1  
ATOM 703   H H    . LEU A 1 43  ? 8.889   13.174  -5.044  1.00 0.00 ? 43  LEU A H    1  
ATOM 704   H HA   . LEU A 1 43  ? 8.628   10.350  -6.208  1.00 0.00 ? 43  LEU A HA   1  
ATOM 705   H HB2  . LEU A 1 43  ? 9.582   10.989  -3.333  1.00 0.00 ? 43  LEU A HB2  1  
ATOM 706   H HB3  . LEU A 1 43  ? 9.124   9.398   -3.885  1.00 0.00 ? 43  LEU A HB3  1  
ATOM 707   H HG   . LEU A 1 43  ? 11.501  10.960  -5.085  1.00 0.00 ? 43  LEU A HG   1  
ATOM 708   H HD11 . LEU A 1 43  ? 11.477  8.946   -2.765  1.00 0.00 ? 43  LEU A HD11 1  
ATOM 709   H HD12 . LEU A 1 43  ? 12.935  9.435   -3.642  1.00 0.00 ? 43  LEU A HD12 1  
ATOM 710   H HD13 . LEU A 1 43  ? 12.001  10.636  -2.726  1.00 0.00 ? 43  LEU A HD13 1  
ATOM 711   H HD21 . LEU A 1 43  ? 10.669  7.995   -5.303  1.00 0.00 ? 43  LEU A HD21 1  
ATOM 712   H HD22 . LEU A 1 43  ? 10.699  9.190   -6.611  1.00 0.00 ? 43  LEU A HD22 1  
ATOM 713   H HD23 . LEU A 1 43  ? 12.224  8.657   -5.873  1.00 0.00 ? 43  LEU A HD23 1  
ATOM 714   N N    . GLU A 1 44  ? 6.868   11.685  -3.642  1.00 0.00 ? 44  GLU A N    1  
ATOM 715   C CA   . GLU A 1 44  ? 5.512   11.841  -3.021  1.00 0.00 ? 44  GLU A CA   1  
ATOM 716   C C    . GLU A 1 44  ? 4.757   10.486  -2.774  1.00 0.00 ? 44  GLU A C    1  
ATOM 717   O O    . GLU A 1 44  ? 3.859   10.077  -3.516  1.00 0.00 ? 44  GLU A O    1  
ATOM 718   C CB   . GLU A 1 44  ? 4.665   12.871  -3.838  1.00 0.00 ? 44  GLU A CB   1  
ATOM 719   C CG   . GLU A 1 44  ? 4.954   14.360  -3.500  1.00 0.00 ? 44  GLU A CG   1  
ATOM 720   C CD   . GLU A 1 44  ? 4.467   14.813  -2.128  1.00 0.00 ? 44  GLU A CD   1  
ATOM 721   O OE1  . GLU A 1 44  ? 5.081   14.448  -1.104  1.00 0.00 ? 44  GLU A OE1  1  
ATOM 722   O OE2  . GLU A 1 44  ? 3.438   15.519  -2.046  1.00 0.00 ? 44  GLU A OE2  1  
ATOM 723   H H    . GLU A 1 44  ? 7.699   12.089  -3.200  1.00 0.00 ? 44  GLU A H    1  
ATOM 724   H HA   . GLU A 1 44  ? 5.670   12.264  -2.012  1.00 0.00 ? 44  GLU A HA   1  
ATOM 725   H HB2  . GLU A 1 44  ? 4.788   12.696  -4.924  1.00 0.00 ? 44  GLU A HB2  1  
ATOM 726   H HB3  . GLU A 1 44  ? 3.585   12.695  -3.666  1.00 0.00 ? 44  GLU A HB3  1  
ATOM 727   H HG2  . GLU A 1 44  ? 6.033   14.580  -3.568  1.00 0.00 ? 44  GLU A HG2  1  
ATOM 728   H HG3  . GLU A 1 44  ? 4.472   15.014  -4.248  1.00 0.00 ? 44  GLU A HG3  1  
ATOM 729   N N    . GLU A 1 45  ? 5.089   9.846   -1.639  1.00 0.00 ? 45  GLU A N    1  
ATOM 730   C CA   . GLU A 1 45  ? 4.494   8.545   -1.201  1.00 0.00 ? 45  GLU A CA   1  
ATOM 731   C C    . GLU A 1 45  ? 3.112   8.619   -0.441  1.00 0.00 ? 45  GLU A C    1  
ATOM 732   O O    . GLU A 1 45  ? 2.665   7.624   0.134   1.00 0.00 ? 45  GLU A O    1  
ATOM 733   C CB   . GLU A 1 45  ? 5.628   7.838   -0.396  1.00 0.00 ? 45  GLU A CB   1  
ATOM 734   C CG   . GLU A 1 45  ? 5.432   6.326   -0.082  1.00 0.00 ? 45  GLU A CG   1  
ATOM 735   C CD   . GLU A 1 45  ? 5.441   5.328   -1.237  1.00 0.00 ? 45  GLU A CD   1  
ATOM 736   O OE1  . GLU A 1 45  ? 5.245   5.703   -2.415  1.00 0.00 ? 45  GLU A OE1  1  
ATOM 737   O OE2  . GLU A 1 45  ? 5.666   4.137   -0.951  1.00 0.00 ? 45  GLU A OE2  1  
ATOM 738   H H    . GLU A 1 45  ? 5.857   10.284  -1.124  1.00 0.00 ? 45  GLU A H    1  
ATOM 739   H HA   . GLU A 1 45  ? 4.259   7.964   -2.101  1.00 0.00 ? 45  GLU A HA   1  
ATOM 740   H HB2  . GLU A 1 45  ? 6.589   7.917   -0.945  1.00 0.00 ? 45  GLU A HB2  1  
ATOM 741   H HB3  . GLU A 1 45  ? 5.798   8.382   0.550   1.00 0.00 ? 45  GLU A HB3  1  
ATOM 742   H HG2  . GLU A 1 45  ? 6.235   5.998   0.599   1.00 0.00 ? 45  GLU A HG2  1  
ATOM 743   H HG3  . GLU A 1 45  ? 4.505   6.144   0.483   1.00 0.00 ? 45  GLU A HG3  1  
ATOM 744   N N    . LYS A 1 46  ? 2.422   9.772   -0.404  1.00 0.00 ? 46  LYS A N    1  
ATOM 745   C CA   . LYS A 1 46  ? 1.153   9.945   0.366   1.00 0.00 ? 46  LYS A CA   1  
ATOM 746   C C    . LYS A 1 46  ? -0.047  9.214   -0.337  1.00 0.00 ? 46  LYS A C    1  
ATOM 747   O O    . LYS A 1 46  ? -0.514  9.583   -1.423  1.00 0.00 ? 46  LYS A O    1  
ATOM 748   C CB   . LYS A 1 46  ? 0.859   11.466  0.523   1.00 0.00 ? 46  LYS A CB   1  
ATOM 749   C CG   . LYS A 1 46  ? 1.796   12.228  1.499   1.00 0.00 ? 46  LYS A CG   1  
ATOM 750   C CD   . LYS A 1 46  ? 1.329   13.663  1.845   1.00 0.00 ? 46  LYS A CD   1  
ATOM 751   C CE   . LYS A 1 46  ? 1.449   14.722  0.728   1.00 0.00 ? 46  LYS A CE   1  
ATOM 752   N NZ   . LYS A 1 46  ? 2.851   15.177  0.538   1.00 0.00 ? 46  LYS A NZ   1  
ATOM 753   H H    . LYS A 1 46  ? 2.905   10.491  -0.951  1.00 0.00 ? 46  LYS A H    1  
ATOM 754   H HA   . LYS A 1 46  ? 1.290   9.522   1.384   1.00 0.00 ? 46  LYS A HA   1  
ATOM 755   H HB2  . LYS A 1 46  ? 0.859   11.953  -0.472  1.00 0.00 ? 46  LYS A HB2  1  
ATOM 756   H HB3  . LYS A 1 46  ? -0.179  11.583  0.889   1.00 0.00 ? 46  LYS A HB3  1  
ATOM 757   H HG2  . LYS A 1 46  ? 1.865   11.657  2.448   1.00 0.00 ? 46  LYS A HG2  1  
ATOM 758   H HG3  . LYS A 1 46  ? 2.832   12.239  1.108   1.00 0.00 ? 46  LYS A HG3  1  
ATOM 759   H HD2  . LYS A 1 46  ? 0.275   13.622  2.182   1.00 0.00 ? 46  LYS A HD2  1  
ATOM 760   H HD3  . LYS A 1 46  ? 1.869   14.010  2.747   1.00 0.00 ? 46  LYS A HD3  1  
ATOM 761   H HE2  . LYS A 1 46  ? 1.033   14.337  -0.226  1.00 0.00 ? 46  LYS A HE2  1  
ATOM 762   H HE3  . LYS A 1 46  ? 0.814   15.601  0.978   1.00 0.00 ? 46  LYS A HE3  1  
ATOM 763   H HZ1  . LYS A 1 46  ? 3.566   14.449  0.650   1.00 0.00 ? 46  LYS A HZ1  1  
ATOM 764   H HZ2  . LYS A 1 46  ? 3.079   15.475  -0.451  1.00 0.00 ? 46  LYS A HZ2  1  
ATOM 765   H HZ3  . LYS A 1 46  ? 3.164   15.973  1.171   1.00 0.00 ? 46  LYS A HZ3  1  
ATOM 766   N N    . ILE A 1 47  ? -0.562  8.184   0.359   1.00 0.00 ? 47  ILE A N    1  
ATOM 767   C CA   . ILE A 1 47  ? -1.631  7.283   -0.173  1.00 0.00 ? 47  ILE A CA   1  
ATOM 768   C C    . ILE A 1 47  ? -2.864  7.348   0.831   1.00 0.00 ? 47  ILE A C    1  
ATOM 769   O O    . ILE A 1 47  ? -2.636  7.390   2.042   1.00 0.00 ? 47  ILE A O    1  
ATOM 770   C CB   . ILE A 1 47  ? -0.897  5.878   -0.338  1.00 0.00 ? 47  ILE A CB   1  
ATOM 771   C CG1  . ILE A 1 47  ? -0.989  5.329   -1.782  1.00 0.00 ? 47  ILE A CG1  1  
ATOM 772   C CG2  . ILE A 1 47  ? -1.447  4.779   0.605   1.00 0.00 ? 47  ILE A CG2  1  
ATOM 773   C CD1  . ILE A 1 47  ? -2.350  5.056   -2.411  1.00 0.00 ? 47  ILE A CD1  1  
ATOM 774   H H    . ILE A 1 47  ? -0.052  7.958   1.227   1.00 0.00 ? 47  ILE A H    1  
ATOM 775   H HA   . ILE A 1 47  ? -1.986  7.630   -1.168  1.00 0.00 ? 47  ILE A HA   1  
ATOM 776   H HB   . ILE A 1 47  ? 0.192   5.945   -0.119  1.00 0.00 ? 47  ILE A HB   1  
ATOM 777   H HG12 . ILE A 1 47  ? -0.484  6.073   -2.420  1.00 0.00 ? 47  ILE A HG12 1  
ATOM 778   H HG13 . ILE A 1 47  ? -0.353  4.429   -1.879  1.00 0.00 ? 47  ILE A HG13 1  
ATOM 779   H HG21 . ILE A 1 47  ? -2.535  4.629   0.454   1.00 0.00 ? 47  ILE A HG21 1  
ATOM 780   H HG22 . ILE A 1 47  ? -0.952  3.806   0.453   1.00 0.00 ? 47  ILE A HG22 1  
ATOM 781   H HG23 . ILE A 1 47  ? -1.316  5.067   1.663   1.00 0.00 ? 47  ILE A HG23 1  
ATOM 782   H HD11 . ILE A 1 47  ? -3.047  5.867   -2.169  1.00 0.00 ? 47  ILE A HD11 1  
ATOM 783   H HD12 . ILE A 1 47  ? -2.290  4.986   -3.513  1.00 0.00 ? 47  ILE A HD12 1  
ATOM 784   H HD13 . ILE A 1 47  ? -2.785  4.117   -2.043  1.00 0.00 ? 47  ILE A HD13 1  
ATOM 785   N N    . ASP A 1 48  ? -4.155  7.313   0.422   1.00 0.00 ? 48  ASP A N    1  
ATOM 786   C CA   . ASP A 1 48  ? -5.291  7.394   1.405   1.00 0.00 ? 48  ASP A CA   1  
ATOM 787   C C    . ASP A 1 48  ? -5.656  5.945   1.872   1.00 0.00 ? 48  ASP A C    1  
ATOM 788   O O    . ASP A 1 48  ? -6.085  5.103   1.072   1.00 0.00 ? 48  ASP A O    1  
ATOM 789   C CB   . ASP A 1 48  ? -6.505  8.163   0.817   1.00 0.00 ? 48  ASP A CB   1  
ATOM 790   C CG   . ASP A 1 48  ? -7.698  8.355   1.757   1.00 0.00 ? 48  ASP A CG   1  
ATOM 791   O OD1  . ASP A 1 48  ? -7.756  9.329   2.538   1.00 0.00 ? 48  ASP A OD1  1  
ATOM 792   O OD2  . ASP A 1 48  ? -8.599  7.490   1.712   1.00 0.00 ? 48  ASP A OD2  1  
ATOM 793   H H    . ASP A 1 48  ? -4.312  7.242   -0.590  1.00 0.00 ? 48  ASP A H    1  
ATOM 794   H HA   . ASP A 1 48  ? -4.984  7.996   2.272   1.00 0.00 ? 48  ASP A HA   1  
ATOM 795   H HB2  . ASP A 1 48  ? -6.189  9.157   0.452   1.00 0.00 ? 48  ASP A HB2  1  
ATOM 796   H HB3  . ASP A 1 48  ? -6.904  7.636   -0.055  1.00 0.00 ? 48  ASP A HB3  1  
ATOM 797   N N    . VAL A 1 49  ? -5.501  5.673   3.177   1.00 0.00 ? 49  VAL A N    1  
ATOM 798   C CA   . VAL A 1 49  ? -5.804  4.340   3.777   1.00 0.00 ? 49  VAL A CA   1  
ATOM 799   C C    . VAL A 1 49  ? -7.307  4.247   4.218   1.00 0.00 ? 49  VAL A C    1  
ATOM 800   O O    . VAL A 1 49  ? -7.743  4.978   5.110   1.00 0.00 ? 49  VAL A O    1  
ATOM 801   C CB   . VAL A 1 49  ? -4.767  4.073   4.934   1.00 0.00 ? 49  VAL A CB   1  
ATOM 802   C CG1  . VAL A 1 49  ? -4.764  5.045   6.138   1.00 0.00 ? 49  VAL A CG1  1  
ATOM 803   C CG2  . VAL A 1 49  ? -4.860  2.642   5.503   1.00 0.00 ? 49  VAL A CG2  1  
ATOM 804   H H    . VAL A 1 49  ? -5.129  6.460   3.730   1.00 0.00 ? 49  VAL A H    1  
ATOM 805   H HA   . VAL A 1 49  ? -5.648  3.563   3.010   1.00 0.00 ? 49  VAL A HA   1  
ATOM 806   H HB   . VAL A 1 49  ? -3.760  4.151   4.476   1.00 0.00 ? 49  VAL A HB   1  
ATOM 807   H HG11 . VAL A 1 49  ? -5.738  5.080   6.660   1.00 0.00 ? 49  VAL A HG11 1  
ATOM 808   H HG12 . VAL A 1 49  ? -4.006  4.769   6.896   1.00 0.00 ? 49  VAL A HG12 1  
ATOM 809   H HG13 . VAL A 1 49  ? -4.519  6.076   5.829   1.00 0.00 ? 49  VAL A HG13 1  
ATOM 810   H HG21 . VAL A 1 49  ? -4.773  1.886   4.708   1.00 0.00 ? 49  VAL A HG21 1  
ATOM 811   H HG22 . VAL A 1 49  ? -4.049  2.430   6.227   1.00 0.00 ? 49  VAL A HG22 1  
ATOM 812   H HG23 . VAL A 1 49  ? -5.817  2.462   6.028   1.00 0.00 ? 49  VAL A HG23 1  
ATOM 813   N N    . VAL A 1 50  ? -8.102  3.344   3.596   1.00 0.00 ? 50  VAL A N    1  
ATOM 814   C CA   . VAL A 1 50  ? -9.543  3.154   3.975   1.00 0.00 ? 50  VAL A CA   1  
ATOM 815   C C    . VAL A 1 50  ? -9.718  1.691   4.547   1.00 0.00 ? 50  VAL A C    1  
ATOM 816   O O    . VAL A 1 50  ? -9.412  0.749   3.796   1.00 0.00 ? 50  VAL A O    1  
ATOM 817   C CB   . VAL A 1 50  ? -10.481 3.491   2.758   1.00 0.00 ? 50  VAL A CB   1  
ATOM 818   C CG1  . VAL A 1 50  ? -11.906 2.888   2.806   1.00 0.00 ? 50  VAL A CG1  1  
ATOM 819   C CG2  . VAL A 1 50  ? -10.695 5.019   2.655   1.00 0.00 ? 50  VAL A CG2  1  
ATOM 820   H H    . VAL A 1 50  ? -7.652  2.773   2.865   1.00 0.00 ? 50  VAL A H    1  
ATOM 821   H HA   . VAL A 1 50  ? -9.825  3.870   4.766   1.00 0.00 ? 50  VAL A HA   1  
ATOM 822   H HB   . VAL A 1 50  ? -10.009 3.121   1.827   1.00 0.00 ? 50  VAL A HB   1  
ATOM 823   H HG11 . VAL A 1 50  ? -12.431 3.113   3.754   1.00 0.00 ? 50  VAL A HG11 1  
ATOM 824   H HG12 . VAL A 1 50  ? -12.554 3.244   1.982   1.00 0.00 ? 50  VAL A HG12 1  
ATOM 825   H HG13 . VAL A 1 50  ? -11.875 1.790   2.707   1.00 0.00 ? 50  VAL A HG13 1  
ATOM 826   H HG21 . VAL A 1 50  ? -9.739  5.569   2.677   1.00 0.00 ? 50  VAL A HG21 1  
ATOM 827   H HG22 . VAL A 1 50  ? -11.233 5.312   1.735   1.00 0.00 ? 50  VAL A HG22 1  
ATOM 828   H HG23 . VAL A 1 50  ? -11.288 5.407   3.505   1.00 0.00 ? 50  VAL A HG23 1  
ATOM 829   N N    . PRO A 1 51  ? -10.230 1.484   5.814   1.00 0.00 ? 51  PRO A N    1  
ATOM 830   C CA   . PRO A 1 51  ? -10.462 0.145   6.442   1.00 0.00 ? 51  PRO A CA   1  
ATOM 831   C C    . PRO A 1 51  ? -11.912 -0.463  6.299   1.00 0.00 ? 51  PRO A C    1  
ATOM 832   O O    . PRO A 1 51  ? -12.893 0.281   6.203   1.00 0.00 ? 51  PRO A O    1  
ATOM 833   C CB   . PRO A 1 51  ? -10.153 0.503   7.910   1.00 0.00 ? 51  PRO A CB   1  
ATOM 834   C CG   . PRO A 1 51  ? -10.756 1.894   8.114   1.00 0.00 ? 51  PRO A CG   1  
ATOM 835   C CD   . PRO A 1 51  ? -10.522 2.584   6.771   1.00 0.00 ? 51  PRO A CD   1  
ATOM 836   H HA   . PRO A 1 51  ? -9.725  -0.603  6.098   1.00 0.00 ? 51  PRO A HA   1  
ATOM 837   H HB2  . PRO A 1 51  ? -10.541 -0.237  8.636   1.00 0.00 ? 51  PRO A HB2  1  
ATOM 838   H HB3  . PRO A 1 51  ? -9.058  0.555   8.064   1.00 0.00 ? 51  PRO A HB3  1  
ATOM 839   H HG2  . PRO A 1 51  ? -11.841 1.818   8.322   1.00 0.00 ? 51  PRO A HG2  1  
ATOM 840   H HG3  . PRO A 1 51  ? -10.300 2.440   8.962   1.00 0.00 ? 51  PRO A HG3  1  
ATOM 841   H HD2  . PRO A 1 51  ? -11.404 3.178   6.460   1.00 0.00 ? 51  PRO A HD2  1  
ATOM 842   H HD3  . PRO A 1 51  ? -9.662  3.278   6.862   1.00 0.00 ? 51  PRO A HD3  1  
ATOM 843   N N    . ILE A 1 52  ? -12.076 -1.802  6.433   1.00 0.00 ? 52  ILE A N    1  
ATOM 844   C CA   . ILE A 1 52  ? -13.426 -2.477  6.358   1.00 0.00 ? 52  ILE A CA   1  
ATOM 845   C C    . ILE A 1 52  ? -14.250 -2.237  7.687   1.00 0.00 ? 52  ILE A C    1  
ATOM 846   O O    . ILE A 1 52  ? -15.405 -1.804  7.693   1.00 0.00 ? 52  ILE A O    1  
ATOM 847   C CB   . ILE A 1 52  ? -13.294 -4.005  5.937   1.00 0.00 ? 52  ILE A CB   1  
ATOM 848   C CG1  . ILE A 1 52  ? -14.691 -4.592  5.569   1.00 0.00 ? 52  ILE A CG1  1  
ATOM 849   C CG2  . ILE A 1 52  ? -12.653 -4.952  6.994   1.00 0.00 ? 52  ILE A CG2  1  
ATOM 850   C CD1  . ILE A 1 52  ? -14.667 -5.896  4.751   1.00 0.00 ? 52  ILE A CD1  1  
ATOM 851   H H    . ILE A 1 52  ? -11.204 -2.353  6.435   1.00 0.00 ? 52  ILE A H    1  
ATOM 852   H HA   . ILE A 1 52  ? -13.954 -1.986  5.558   1.00 0.00 ? 52  ILE A HA   1  
ATOM 853   H HB   . ILE A 1 52  ? -12.673 -4.046  5.023   1.00 0.00 ? 52  ILE A HB   1  
ATOM 854   H HG12 . ILE A 1 52  ? -15.307 -4.735  6.479   1.00 0.00 ? 52  ILE A HG12 1  
ATOM 855   H HG13 . ILE A 1 52  ? -15.255 -3.857  4.973   1.00 0.00 ? 52  ILE A HG13 1  
ATOM 856   H HG21 . ILE A 1 52  ? -11.770 -4.514  7.490   1.00 0.00 ? 52  ILE A HG21 1  
ATOM 857   H HG22 . ILE A 1 52  ? -13.365 -5.233  7.790   1.00 0.00 ? 52  ILE A HG22 1  
ATOM 858   H HG23 . ILE A 1 52  ? -12.310 -5.895  6.531   1.00 0.00 ? 52  ILE A HG23 1  
ATOM 859   H HD11 . ILE A 1 52  ? -14.108 -5.773  3.804   1.00 0.00 ? 52  ILE A HD11 1  
ATOM 860   H HD12 . ILE A 1 52  ? -14.202 -6.732  5.306   1.00 0.00 ? 52  ILE A HD12 1  
ATOM 861   H HD13 . ILE A 1 52  ? -15.688 -6.219  4.475   1.00 0.00 ? 52  ILE A HD13 1  
ATOM 862   N N    . GLU A 1 53  ? -13.588 -2.606  8.772   1.00 0.00 ? 53  GLU A N    1  
ATOM 863   C CA   . GLU A 1 53  ? -13.984 -2.403  10.190  1.00 0.00 ? 53  GLU A CA   1  
ATOM 864   C C    . GLU A 1 53  ? -12.625 -2.583  10.979  1.00 0.00 ? 53  GLU A C    1  
ATOM 865   O O    . GLU A 1 53  ? -12.054 -1.531  11.298  1.00 0.00 ? 53  GLU A O    1  
ATOM 866   C CB   . GLU A 1 53  ? -15.204 -3.243  10.705  1.00 0.00 ? 53  GLU A CB   1  
ATOM 867   C CG   . GLU A 1 53  ? -15.743 -4.460  9.903   1.00 0.00 ? 53  GLU A CG   1  
ATOM 868   C CD   . GLU A 1 53  ? -16.845 -5.226  10.611  1.00 0.00 ? 53  GLU A CD   1  
ATOM 869   O OE1  . GLU A 1 53  ? -18.010 -4.771  10.569  1.00 0.00 ? 53  GLU A OE1  1  
ATOM 870   O OE2  . GLU A 1 53  ? -16.561 -6.295  11.182  1.00 0.00 ? 53  GLU A OE2  1  
ATOM 871   H H    . GLU A 1 53  ? -12.675 -2.877  8.399   1.00 0.00 ? 53  GLU A H    1  
ATOM 872   H HA   . GLU A 1 53  ? -14.258 -1.336  10.313  1.00 0.00 ? 53  GLU A HA   1  
ATOM 873   H HB2  . GLU A 1 53  ? -15.019 -3.544  11.755  1.00 0.00 ? 53  GLU A HB2  1  
ATOM 874   H HB3  . GLU A 1 53  ? -16.050 -2.536  10.805  1.00 0.00 ? 53  GLU A HB3  1  
ATOM 875   H HG2  . GLU A 1 53  ? -16.124 -4.129  8.924   1.00 0.00 ? 53  GLU A HG2  1  
ATOM 876   H HG3  . GLU A 1 53  ? -14.949 -5.182  9.667   1.00 0.00 ? 53  GLU A HG3  1  
ATOM 877   N N    . PRO A 1 54  ? -11.989 -3.772  11.264  1.00 0.00 ? 54  PRO A N    1  
ATOM 878   C CA   . PRO A 1 54  ? -10.680 -3.839  11.975  1.00 0.00 ? 54  PRO A CA   1  
ATOM 879   C C    . PRO A 1 54  ? -9.428  -3.584  11.059  1.00 0.00 ? 54  PRO A C    1  
ATOM 880   O O    . PRO A 1 54  ? -8.655  -4.493  10.741  1.00 0.00 ? 54  PRO A O    1  
ATOM 881   C CB   . PRO A 1 54  ? -10.751 -5.257  12.582  1.00 0.00 ? 54  PRO A CB   1  
ATOM 882   C CG   . PRO A 1 54  ? -11.502 -6.083  11.537  1.00 0.00 ? 54  PRO A CG   1  
ATOM 883   C CD   . PRO A 1 54  ? -12.550 -5.111  10.996  1.00 0.00 ? 54  PRO A CD   1  
ATOM 884   H HA   . PRO A 1 54  ? -10.635 -3.105  12.804  1.00 0.00 ? 54  PRO A HA   1  
ATOM 885   H HB2  . PRO A 1 54  ? -9.758  -5.680  12.827  1.00 0.00 ? 54  PRO A HB2  1  
ATOM 886   H HB3  . PRO A 1 54  ? -11.323 -5.236  13.531  1.00 0.00 ? 54  PRO A HB3  1  
ATOM 887   H HG2  . PRO A 1 54  ? -10.813 -6.395  10.727  1.00 0.00 ? 54  PRO A HG2  1  
ATOM 888   H HG3  . PRO A 1 54  ? -11.950 -7.004  11.956  1.00 0.00 ? 54  PRO A HG3  1  
ATOM 889   H HD2  . PRO A 1 54  ? -12.731 -5.281  9.922   1.00 0.00 ? 54  PRO A HD2  1  
ATOM 890   H HD3  . PRO A 1 54  ? -13.504 -5.260  11.538  1.00 0.00 ? 54  PRO A HD3  1  
ATOM 891   N N    . HIS A 1 55  ? -9.231  -2.314  10.651  1.00 0.00 ? 55  HIS A N    1  
ATOM 892   C CA   . HIS A 1 55  ? -8.066  -1.815  9.839   1.00 0.00 ? 55  HIS A CA   1  
ATOM 893   C C    . HIS A 1 55  ? -7.913  -2.333  8.355   1.00 0.00 ? 55  HIS A C    1  
ATOM 894   O O    . HIS A 1 55  ? -7.565  -1.529  7.487   1.00 0.00 ? 55  HIS A O    1  
ATOM 895   C CB   . HIS A 1 55  ? -6.753  -2.051  10.652  1.00 0.00 ? 55  HIS A CB   1  
ATOM 896   C CG   . HIS A 1 55  ? -5.546  -1.207  10.245  1.00 0.00 ? 55  HIS A CG   1  
ATOM 897   N ND1  . HIS A 1 55  ? -5.604  0.142   9.909   1.00 0.00 ? 55  HIS A ND1  1  
ATOM 898   C CD2  . HIS A 1 55  ? -4.215  -1.624  10.382  1.00 0.00 ? 55  HIS A CD2  1  
ATOM 899   C CE1  . HIS A 1 55  ? -4.263  0.417   9.887   1.00 0.00 ? 55  HIS A CE1  1  
ATOM 900   N NE2  . HIS A 1 55  ? -3.357  -0.580  10.113  1.00 0.00 ? 55  HIS A NE2  1  
ATOM 901   H H    . HIS A 1 55  ? -9.979  -1.689  10.986  1.00 0.00 ? 55  HIS A H    1  
ATOM 902   H HA   . HIS A 1 55  ? -8.214  -0.725  9.738   1.00 0.00 ? 55  HIS A HA   1  
ATOM 903   H HB2  . HIS A 1 55  ? -6.932  -1.829  11.721  1.00 0.00 ? 55  HIS A HB2  1  
ATOM 904   H HB3  . HIS A 1 55  ? -6.484  -3.125  10.635  1.00 0.00 ? 55  HIS A HB3  1  
ATOM 905   H HD2  . HIS A 1 55  ? -3.900  -2.594  10.743  1.00 0.00 ? 55  HIS A HD2  1  
ATOM 906   H HE1  . HIS A 1 55  ? -3.937  1.443   9.794   1.00 0.00 ? 55  HIS A HE1  1  
ATOM 907   H HE2  . HIS A 1 55  ? -2.364  -0.523  10.429  1.00 0.00 ? 55  HIS A HE2  1  
ATOM 908   N N    . ALA A 1 56  ? -8.132  -3.618  8.042   1.00 0.00 ? 56  ALA A N    1  
ATOM 909   C CA   . ALA A 1 56  ? -7.957  -4.205  6.681   1.00 0.00 ? 56  ALA A CA   1  
ATOM 910   C C    . ALA A 1 56  ? -8.970  -3.759  5.572   1.00 0.00 ? 56  ALA A C    1  
ATOM 911   O O    . ALA A 1 56  ? -10.157 -3.734  5.849   1.00 0.00 ? 56  ALA A O    1  
ATOM 912   C CB   . ALA A 1 56  ? -8.118  -5.713  6.937   1.00 0.00 ? 56  ALA A CB   1  
ATOM 913   H H    . ALA A 1 56  ? -8.410  -4.182  8.860   1.00 0.00 ? 56  ALA A H    1  
ATOM 914   H HA   . ALA A 1 56  ? -6.929  -4.002  6.322   1.00 0.00 ? 56  ALA A HA   1  
ATOM 915   H HB1  . ALA A 1 56  ? -7.371  -6.108  7.651   1.00 0.00 ? 56  ALA A HB1  1  
ATOM 916   H HB2  . ALA A 1 56  ? -9.120  -5.972  7.335   1.00 0.00 ? 56  ALA A HB2  1  
ATOM 917   H HB3  . ALA A 1 56  ? -8.006  -6.278  5.997   1.00 0.00 ? 56  ALA A HB3  1  
ATOM 918   N N    . LEU A 1 57  ? -8.527  -3.347  4.367   1.00 0.00 ? 57  LEU A N    1  
ATOM 919   C CA   . LEU A 1 57  ? -9.415  -2.959  3.200   1.00 0.00 ? 57  LEU A CA   1  
ATOM 920   C C    . LEU A 1 57  ? -8.450  -2.487  2.062   1.00 0.00 ? 57  LEU A C    1  
ATOM 921   O O    . LEU A 1 57  ? -7.687  -3.310  1.582   1.00 0.00 ? 57  LEU A O    1  
ATOM 922   C CB   . LEU A 1 57  ? -10.644 -2.041  3.483   1.00 0.00 ? 57  LEU A CB   1  
ATOM 923   C CG   . LEU A 1 57  ? -11.520 -1.486  2.316   1.00 0.00 ? 57  LEU A CG   1  
ATOM 924   C CD1  . LEU A 1 57  ? -11.871 -2.529  1.241   1.00 0.00 ? 57  LEU A CD1  1  
ATOM 925   C CD2  . LEU A 1 57  ? -12.825 -0.875  2.840   1.00 0.00 ? 57  LEU A CD2  1  
ATOM 926   H H    . LEU A 1 57  ? -7.515  -3.538  4.252   1.00 0.00 ? 57  LEU A H    1  
ATOM 927   H HA   . LEU A 1 57  ? -9.955  -3.806  2.816   1.00 0.00 ? 57  LEU A HA   1  
ATOM 928   H HB2  . LEU A 1 57  ? -11.334 -2.651  4.080   1.00 0.00 ? 57  LEU A HB2  1  
ATOM 929   H HB3  . LEU A 1 57  ? -10.357 -1.244  4.159   1.00 0.00 ? 57  LEU A HB3  1  
ATOM 930   H HG   . LEU A 1 57  ? -10.983 -0.660  1.825   1.00 0.00 ? 57  LEU A HG   1  
ATOM 931   H HD11 . LEU A 1 57  ? -12.379 -3.410  1.677   1.00 0.00 ? 57  LEU A HD11 1  
ATOM 932   H HD12 . LEU A 1 57  ? -12.543 -2.107  0.470   1.00 0.00 ? 57  LEU A HD12 1  
ATOM 933   H HD13 . LEU A 1 57  ? -10.972 -2.888  0.711   1.00 0.00 ? 57  LEU A HD13 1  
ATOM 934   H HD21 . LEU A 1 57  ? -12.649 -0.101  3.606   1.00 0.00 ? 57  LEU A HD21 1  
ATOM 935   H HD22 . LEU A 1 57  ? -13.408 -0.388  2.035   1.00 0.00 ? 57  LEU A HD22 1  
ATOM 936   H HD23 . LEU A 1 57  ? -13.482 -1.633  3.301   1.00 0.00 ? 57  LEU A HD23 1  
ATOM 937   N N    . PHE A 1 58  ? -8.422  -1.232  1.607   1.00 0.00 ? 58  PHE A N    1  
ATOM 938   C CA   . PHE A 1 58  ? -7.597  -0.833  0.397   1.00 0.00 ? 58  PHE A CA   1  
ATOM 939   C C    . PHE A 1 58  ? -6.884  0.558   0.481   1.00 0.00 ? 58  PHE A C    1  
ATOM 940   O O    . PHE A 1 58  ? -7.039  1.284   1.479   1.00 0.00 ? 58  PHE A O    1  
ATOM 941   C CB   . PHE A 1 58  ? -8.501  -0.990  -0.872  1.00 0.00 ? 58  PHE A CB   1  
ATOM 942   C CG   . PHE A 1 58  ? -9.584  0.039   -1.276  1.00 0.00 ? 58  PHE A CG   1  
ATOM 943   C CD1  . PHE A 1 58  ? -10.232 0.886   -0.367  1.00 0.00 ? 58  PHE A CD1  1  
ATOM 944   C CD2  . PHE A 1 58  ? -9.980  0.056   -2.619  1.00 0.00 ? 58  PHE A CD2  1  
ATOM 945   C CE1  . PHE A 1 58  ? -11.283 1.699   -0.786  1.00 0.00 ? 58  PHE A CE1  1  
ATOM 946   C CE2  . PHE A 1 58  ? -11.008 0.893   -3.041  1.00 0.00 ? 58  PHE A CE2  1  
ATOM 947   C CZ   . PHE A 1 58  ? -11.669 1.701   -2.122  1.00 0.00 ? 58  PHE A CZ   1  
ATOM 948   H H    . PHE A 1 58  ? -9.140  -0.710  2.135   1.00 0.00 ? 58  PHE A H    1  
ATOM 949   H HA   . PHE A 1 58  ? -6.752  -1.541  0.279   1.00 0.00 ? 58  PHE A HA   1  
ATOM 950   H HB2  . PHE A 1 58  ? -7.803  -1.093  -1.727  1.00 0.00 ? 58  PHE A HB2  1  
ATOM 951   H HB3  . PHE A 1 58  ? -8.983  -1.987  -0.846  1.00 0.00 ? 58  PHE A HB3  1  
ATOM 952   H HD1  . PHE A 1 58  ? -9.936  0.916   0.669   1.00 0.00 ? 58  PHE A HD1  1  
ATOM 953   H HD2  . PHE A 1 58  ? -9.511  -0.594  -3.345  1.00 0.00 ? 58  PHE A HD2  1  
ATOM 954   H HE1  . PHE A 1 58  ? -11.807 2.325   -0.080  1.00 0.00 ? 58  PHE A HE1  1  
ATOM 955   H HE2  . PHE A 1 58  ? -11.326 0.884   -4.075  1.00 0.00 ? 58  PHE A HE2  1  
ATOM 956   H HZ   . PHE A 1 58  ? -12.490 2.322   -2.450  1.00 0.00 ? 58  PHE A HZ   1  
ATOM 957   N N    . LEU A 1 59  ? -6.050  0.905   -0.543  1.00 0.00 ? 59  LEU A N    1  
ATOM 958   C CA   . LEU A 1 59  ? -5.262  2.180   -0.504  1.00 0.00 ? 59  LEU A CA   1  
ATOM 959   C C    . LEU A 1 59  ? -5.509  3.069   -1.782  1.00 0.00 ? 59  LEU A C    1  
ATOM 960   O O    . LEU A 1 59  ? -5.737  2.521   -2.862  1.00 0.00 ? 59  LEU A O    1  
ATOM 961   C CB   . LEU A 1 59  ? -3.773  1.735   -0.369  1.00 0.00 ? 59  LEU A CB   1  
ATOM 962   C CG   . LEU A 1 59  ? -3.277  0.947   0.877   1.00 0.00 ? 59  LEU A CG   1  
ATOM 963   C CD1  . LEU A 1 59  ? -1.853  0.409   0.652   1.00 0.00 ? 59  LEU A CD1  1  
ATOM 964   C CD2  . LEU A 1 59  ? -3.302  1.788   2.156   1.00 0.00 ? 59  LEU A CD2  1  
ATOM 965   H H    . LEU A 1 59  ? -5.941  0.271   -1.366  1.00 0.00 ? 59  LEU A H    1  
ATOM 966   H HA   . LEU A 1 59  ? -5.517  2.795   0.379   1.00 0.00 ? 59  LEU A HA   1  
ATOM 967   H HB2  . LEU A 1 59  ? -3.580  1.083   -1.230  1.00 0.00 ? 59  LEU A HB2  1  
ATOM 968   H HB3  . LEU A 1 59  ? -3.111  2.605   -0.510  1.00 0.00 ? 59  LEU A HB3  1  
ATOM 969   H HG   . LEU A 1 59  ? -3.933  0.068   1.023   1.00 0.00 ? 59  LEU A HG   1  
ATOM 970   H HD11 . LEU A 1 59  ? -1.805  -0.263  -0.226  1.00 0.00 ? 59  LEU A HD11 1  
ATOM 971   H HD12 . LEU A 1 59  ? -1.119  1.220   0.483   1.00 0.00 ? 59  LEU A HD12 1  
ATOM 972   H HD13 . LEU A 1 59  ? -1.492  -0.183  1.514   1.00 0.00 ? 59  LEU A HD13 1  
ATOM 973   H HD21 . LEU A 1 59  ? -2.745  2.737   2.055   1.00 0.00 ? 59  LEU A HD21 1  
ATOM 974   H HD22 . LEU A 1 59  ? -4.339  2.039   2.419   1.00 0.00 ? 59  LEU A HD22 1  
ATOM 975   H HD23 . LEU A 1 59  ? -2.874  1.253   3.023   1.00 0.00 ? 59  LEU A HD23 1  
ATOM 976   N N    . GLY A 1 60  ? -5.535  4.425   -1.718  1.00 0.00 ? 60  GLY A N    1  
ATOM 977   C CA   . GLY A 1 60  ? -5.676  5.258   -2.964  1.00 0.00 ? 60  GLY A CA   1  
ATOM 978   C C    . GLY A 1 60  ? -5.393  6.787   -2.943  1.00 0.00 ? 60  GLY A C    1  
ATOM 979   O O    . GLY A 1 60  ? -5.900  7.457   -2.061  1.00 0.00 ? 60  GLY A O    1  
ATOM 980   H H    . GLY A 1 60  ? -5.348  4.820   -0.783  1.00 0.00 ? 60  GLY A H    1  
ATOM 981   H HA2  . GLY A 1 60  ? -5.017  4.818   -3.735  1.00 0.00 ? 60  GLY A HA2  1  
ATOM 982   H HA3  . GLY A 1 60  ? -6.692  5.126   -3.376  1.00 0.00 ? 60  GLY A HA3  1  
ATOM 983   N N    . ILE A 1 61  ? -4.603  7.321   -3.897  1.00 0.00 ? 61  ILE A N    1  
ATOM 984   C CA   . ILE A 1 61  ? -4.346  8.786   -4.165  1.00 0.00 ? 61  ILE A CA   1  
ATOM 985   C C    . ILE A 1 61  ? -2.916  8.860   -4.822  1.00 0.00 ? 61  ILE A C    1  
ATOM 986   O O    . ILE A 1 61  ? -2.910  8.766   -6.050  1.00 0.00 ? 61  ILE A O    1  
ATOM 987   C CB   . ILE A 1 61  ? -4.685  9.896   -3.079  1.00 0.00 ? 61  ILE A CB   1  
ATOM 988   C CG1  . ILE A 1 61  ? -4.685  11.310  -3.745  1.00 0.00 ? 61  ILE A CG1  1  
ATOM 989   C CG2  . ILE A 1 61  ? -3.767  9.937   -1.845  1.00 0.00 ? 61  ILE A CG2  1  
ATOM 990   C CD1  . ILE A 1 61  ? -5.368  12.422  -2.928  1.00 0.00 ? 61  ILE A CD1  1  
ATOM 991   H H    . ILE A 1 61  ? -4.252  6.627   -4.577  1.00 0.00 ? 61  ILE A H    1  
ATOM 992   H HA   . ILE A 1 61  ? -5.015  9.010   -5.006  1.00 0.00 ? 61  ILE A HA   1  
ATOM 993   H HB   . ILE A 1 61  ? -5.720  9.716   -2.734  1.00 0.00 ? 61  ILE A HB   1  
ATOM 994   H HG12 . ILE A 1 61  ? -3.652  11.621  -4.001  1.00 0.00 ? 61  ILE A HG12 1  
ATOM 995   H HG13 . ILE A 1 61  ? -5.208  11.265  -4.719  1.00 0.00 ? 61  ILE A HG13 1  
ATOM 996   H HG21 . ILE A 1 61  ? -3.572  8.924   -1.494  1.00 0.00 ? 61  ILE A HG21 1  
ATOM 997   H HG22 . ILE A 1 61  ? -2.797  10.433  -2.028  1.00 0.00 ? 61  ILE A HG22 1  
ATOM 998   H HG23 . ILE A 1 61  ? -4.243  10.472  -1.002  1.00 0.00 ? 61  ILE A HG23 1  
ATOM 999   H HD11 . ILE A 1 61  ? -6.418  12.171  -2.687  1.00 0.00 ? 61  ILE A HD11 1  
ATOM 1000  H HD12 . ILE A 1 61  ? -4.848  12.614  -1.972  1.00 0.00 ? 61  ILE A HD12 1  
ATOM 1001  H HD13 . ILE A 1 61  ? -5.381  13.379  -3.483  1.00 0.00 ? 61  ILE A HD13 1  
ATOM 1002  N N    . HIS A 1 62  ? -1.745  9.086   -4.159  1.00 0.00 ? 62  HIS A N    1  
ATOM 1003  C CA   . HIS A 1 62  ? -0.410  9.258   -4.848  1.00 0.00 ? 62  HIS A CA   1  
ATOM 1004  C C    . HIS A 1 62  ? -0.457  10.409  -5.927  1.00 0.00 ? 62  HIS A C    1  
ATOM 1005  O O    . HIS A 1 62  ? -0.406  10.167  -7.139  1.00 0.00 ? 62  HIS A O    1  
ATOM 1006  C CB   . HIS A 1 62  ? 0.098   7.914   -5.474  1.00 0.00 ? 62  HIS A CB   1  
ATOM 1007  C CG   . HIS A 1 62  ? 0.884   6.937   -4.604  1.00 0.00 ? 62  HIS A CG   1  
ATOM 1008  N ND1  . HIS A 1 62  ? 0.869   5.571   -4.849  1.00 0.00 ? 62  HIS A ND1  1  
ATOM 1009  C CD2  . HIS A 1 62  ? 1.925   7.259   -3.713  1.00 0.00 ? 62  HIS A CD2  1  
ATOM 1010  C CE1  . HIS A 1 62  ? 1.911   5.188   -4.041  1.00 0.00 ? 62  HIS A CE1  1  
ATOM 1011  N NE2  . HIS A 1 62  ? 2.593   6.115   -3.316  1.00 0.00 ? 62  HIS A NE2  1  
ATOM 1012  H H    . HIS A 1 62  ? -1.801  9.156   -3.129  1.00 0.00 ? 62  HIS A H    1  
ATOM 1013  H HA   . HIS A 1 62  ? 0.327   9.592   -4.091  1.00 0.00 ? 62  HIS A HA   1  
ATOM 1014  H HB2  . HIS A 1 62  ? -0.742  7.382   -5.957  1.00 0.00 ? 62  HIS A HB2  1  
ATOM 1015  H HB3  . HIS A 1 62  ? 0.779   8.132   -6.318  1.00 0.00 ? 62  HIS A HB3  1  
ATOM 1016  H HD2  . HIS A 1 62  ? 2.223   8.263   -3.456  1.00 0.00 ? 62  HIS A HD2  1  
ATOM 1017  H HE1  . HIS A 1 62  ? 2.217   4.154   -4.007  1.00 0.00 ? 62  HIS A HE1  1  
ATOM 1018  H HE2  . HIS A 1 62  ? 3.529   6.007   -2.867  1.00 0.00 ? 62  HIS A HE2  1  
ATOM 1019  N N    . GLY A 1 63  ? -0.591  11.673  -5.485  1.00 0.00 ? 63  GLY A N    1  
ATOM 1020  C CA   . GLY A 1 63  ? -0.705  12.827  -6.420  1.00 0.00 ? 63  GLY A CA   1  
ATOM 1021  C C    . GLY A 1 63  ? -2.127  13.109  -6.962  1.00 0.00 ? 63  GLY A C    1  
ATOM 1022  O O    . GLY A 1 63  ? -2.682  14.172  -6.676  1.00 0.00 ? 63  GLY A O    1  
ATOM 1023  H H    . GLY A 1 63  ? -0.631  11.768  -4.464  1.00 0.00 ? 63  GLY A H    1  
ATOM 1024  H HA2  . GLY A 1 63  ? -0.351  13.737  -5.902  1.00 0.00 ? 63  GLY A HA2  1  
ATOM 1025  H HA3  . GLY A 1 63  ? -0.011  12.716  -7.276  1.00 0.00 ? 63  GLY A HA3  1  
ATOM 1026  N N    . GLY A 1 64  ? -2.702  12.185  -7.754  1.00 0.00 ? 64  GLY A N    1  
ATOM 1027  C CA   . GLY A 1 64  ? -4.051  12.386  -8.347  1.00 0.00 ? 64  GLY A CA   1  
ATOM 1028  C C    . GLY A 1 64  ? -4.797  11.120  -8.812  1.00 0.00 ? 64  GLY A C    1  
ATOM 1029  O O    . GLY A 1 64  ? -4.732  10.759  -9.987  1.00 0.00 ? 64  GLY A O    1  
ATOM 1030  H H    . GLY A 1 64  ? -2.124  11.343  -7.896  1.00 0.00 ? 64  GLY A H    1  
ATOM 1031  H HA2  . GLY A 1 64  ? -4.705  12.956  -7.657  1.00 0.00 ? 64  GLY A HA2  1  
ATOM 1032  H HA3  . GLY A 1 64  ? -3.948  13.047  -9.228  1.00 0.00 ? 64  GLY A HA3  1  
ATOM 1033  N N    . LYS A 1 65  ? -5.555  10.490  -7.895  1.00 0.00 ? 65  LYS A N    1  
ATOM 1034  C CA   . LYS A 1 65  ? -6.425  9.289   -8.166  1.00 0.00 ? 65  LYS A CA   1  
ATOM 1035  C C    . LYS A 1 65  ? -5.686  7.996   -8.696  1.00 0.00 ? 65  LYS A C    1  
ATOM 1036  O O    . LYS A 1 65  ? -6.111  7.356   -9.665  1.00 0.00 ? 65  LYS A O    1  
ATOM 1037  C CB   . LYS A 1 65  ? -7.612  9.730   -9.095  1.00 0.00 ? 65  LYS A CB   1  
ATOM 1038  C CG   . LYS A 1 65  ? -8.660  10.695  -8.472  1.00 0.00 ? 65  LYS A CG   1  
ATOM 1039  C CD   . LYS A 1 65  ? -9.687  10.022  -7.530  1.00 0.00 ? 65  LYS A CD   1  
ATOM 1040  C CE   . LYS A 1 65  ? -10.873 9.388   -8.284  1.00 0.00 ? 65  LYS A CE   1  
ATOM 1041  N NZ   . LYS A 1 65  ? -11.625 8.469   -7.389  1.00 0.00 ? 65  LYS A NZ   1  
ATOM 1042  H H    . LYS A 1 65  ? -5.490  10.917  -6.967  1.00 0.00 ? 65  LYS A H    1  
ATOM 1043  H HA   . LYS A 1 65  ? -6.853  8.959   -7.201  1.00 0.00 ? 65  LYS A HA   1  
ATOM 1044  H HB2  . LYS A 1 65  ? -7.202  10.187  -10.017 1.00 0.00 ? 65  LYS A HB2  1  
ATOM 1045  H HB3  . LYS A 1 65  ? -8.141  8.837   -9.481  1.00 0.00 ? 65  LYS A HB3  1  
ATOM 1046  H HG2  . LYS A 1 65  ? -8.132  11.501  -7.926  1.00 0.00 ? 65  LYS A HG2  1  
ATOM 1047  H HG3  . LYS A 1 65  ? -9.189  11.237  -9.282  1.00 0.00 ? 65  LYS A HG3  1  
ATOM 1048  H HD2  . LYS A 1 65  ? -9.165  9.284   -6.888  1.00 0.00 ? 65  LYS A HD2  1  
ATOM 1049  H HD3  . LYS A 1 65  ? -10.075 10.782  -6.822  1.00 0.00 ? 65  LYS A HD3  1  
ATOM 1050  H HE2  . LYS A 1 65  ? -11.533 10.183  -8.697  1.00 0.00 ? 65  LYS A HE2  1  
ATOM 1051  H HE3  . LYS A 1 65  ? -10.517 8.840   -9.182  1.00 0.00 ? 65  LYS A HE3  1  
ATOM 1052  H HZ1  . LYS A 1 65  ? -11.994 8.926   -6.546  1.00 0.00 ? 65  LYS A HZ1  1  
ATOM 1053  H HZ2  . LYS A 1 65  ? -12.446 8.059   -7.886  1.00 0.00 ? 65  LYS A HZ2  1  
ATOM 1054  H HZ3  . LYS A 1 65  ? -11.068 7.669   -7.065  1.00 0.00 ? 65  LYS A HZ3  1  
ATOM 1055  N N    . MET A 1 66  ? -4.651  7.541   -7.966  1.00 0.00 ? 66  MET A N    1  
ATOM 1056  C CA   . MET A 1 66  ? -3.902  6.287   -8.269  1.00 0.00 ? 66  MET A CA   1  
ATOM 1057  C C    . MET A 1 66  ? -4.238  5.281   -7.122  1.00 0.00 ? 66  MET A C    1  
ATOM 1058  O O    . MET A 1 66  ? -3.816  5.439   -5.970  1.00 0.00 ? 66  MET A O    1  
ATOM 1059  C CB   . MET A 1 66  ? -2.379  6.598   -8.400  1.00 0.00 ? 66  MET A CB   1  
ATOM 1060  C CG   . MET A 1 66  ? -1.765  6.197   -9.757  1.00 0.00 ? 66  MET A CG   1  
ATOM 1061  S SD   . MET A 1 66  ? -2.699  6.819   -11.172 1.00 0.00 ? 66  MET A SD   1  
ATOM 1062  C CE   . MET A 1 66  ? -2.503  8.593   -10.982 1.00 0.00 ? 66  MET A CE   1  
ATOM 1063  H H    . MET A 1 66  ? -4.342  8.150   -7.192  1.00 0.00 ? 66  MET A H    1  
ATOM 1064  H HA   . MET A 1 66  ? -4.248  5.854   -9.230  1.00 0.00 ? 66  MET A HA   1  
ATOM 1065  H HB2  . MET A 1 66  ? -2.161  7.671   -8.231  1.00 0.00 ? 66  MET A HB2  1  
ATOM 1066  H HB3  . MET A 1 66  ? -1.805  6.098   -7.596  1.00 0.00 ? 66  MET A HB3  1  
ATOM 1067  H HG2  . MET A 1 66  ? -0.715  6.537   -9.830  1.00 0.00 ? 66  MET A HG2  1  
ATOM 1068  H HG3  . MET A 1 66  ? -1.739  5.099   -9.849  1.00 0.00 ? 66  MET A HG3  1  
ATOM 1069  H HE1  . MET A 1 66  ? -1.436  8.874   -10.992 1.00 0.00 ? 66  MET A HE1  1  
ATOM 1070  H HE2  . MET A 1 66  ? -3.029  9.126   -11.793 1.00 0.00 ? 66  MET A HE2  1  
ATOM 1071  H HE3  . MET A 1 66  ? -2.942  8.923   -10.025 1.00 0.00 ? 66  MET A HE3  1  
ATOM 1072  N N    . CYS A 1 67  ? -5.065  4.277   -7.439  1.00 0.00 ? 67  CYS A N    1  
ATOM 1073  C CA   . CYS A 1 67  ? -5.545  3.271   -6.461  1.00 0.00 ? 67  CYS A CA   1  
ATOM 1074  C C    . CYS A 1 67  ? -4.546  2.092   -6.256  1.00 0.00 ? 67  CYS A C    1  
ATOM 1075  O O    . CYS A 1 67  ? -4.187  1.390   -7.206  1.00 0.00 ? 67  CYS A O    1  
ATOM 1076  C CB   . CYS A 1 67  ? -6.910  2.770   -6.979  1.00 0.00 ? 67  CYS A CB   1  
ATOM 1077  S SG   . CYS A 1 67  ? -7.718  1.699   -5.737  1.00 0.00 ? 67  CYS A SG   1  
ATOM 1078  H H    . CYS A 1 67  ? -5.318  4.243   -8.441  1.00 0.00 ? 67  CYS A H    1  
ATOM 1079  H HA   . CYS A 1 67  ? -5.740  3.768   -5.494  1.00 0.00 ? 67  CYS A HA   1  
ATOM 1080  H HB2  . CYS A 1 67  ? -7.593  3.614   -7.186  1.00 0.00 ? 67  CYS A HB2  1  
ATOM 1081  H HB3  . CYS A 1 67  ? -6.809  2.216   -7.933  1.00 0.00 ? 67  CYS A HB3  1  
ATOM 1082  H HG   . CYS A 1 67  ? -6.946  0.628   -5.904  1.00 0.00 ? 67  CYS A HG   1  
ATOM 1083  N N    . LEU A 1 68  ? -4.083  1.894   -5.006  1.00 0.00 ? 68  LEU A N    1  
ATOM 1084  C CA   . LEU A 1 68  ? -3.227  0.738   -4.634  1.00 0.00 ? 68  LEU A CA   1  
ATOM 1085  C C    . LEU A 1 68  ? -4.190  -0.461  -4.305  1.00 0.00 ? 68  LEU A C    1  
ATOM 1086  O O    . LEU A 1 68  ? -4.933  -0.484  -3.291  1.00 0.00 ? 68  LEU A O    1  
ATOM 1087  C CB   . LEU A 1 68  ? -2.266  1.056   -3.452  1.00 0.00 ? 68  LEU A CB   1  
ATOM 1088  C CG   . LEU A 1 68  ? -0.771  1.193   -3.814  1.00 0.00 ? 68  LEU A CG   1  
ATOM 1089  C CD1  . LEU A 1 68  ? -0.514  2.497   -4.566  1.00 0.00 ? 68  LEU A CD1  1  
ATOM 1090  C CD2  . LEU A 1 68  ? 0.116   1.148   -2.558  1.00 0.00 ? 68  LEU A CD2  1  
ATOM 1091  H H    . LEU A 1 68  ? -4.487  2.509   -4.287  1.00 0.00 ? 68  LEU A H    1  
ATOM 1092  H HA   . LEU A 1 68  ? -2.579  0.494   -5.497  1.00 0.00 ? 68  LEU A HA   1  
ATOM 1093  H HB2  . LEU A 1 68  ? -2.592  1.962   -2.912  1.00 0.00 ? 68  LEU A HB2  1  
ATOM 1094  H HB3  . LEU A 1 68  ? -2.328  0.234   -2.713  1.00 0.00 ? 68  LEU A HB3  1  
ATOM 1095  H HG   . LEU A 1 68  ? -0.477  0.346   -4.467  1.00 0.00 ? 68  LEU A HG   1  
ATOM 1096  H HD11 . LEU A 1 68  ? -1.201  2.617   -5.423  1.00 0.00 ? 68  LEU A HD11 1  
ATOM 1097  H HD12 . LEU A 1 68  ? -0.663  3.382   -3.928  1.00 0.00 ? 68  LEU A HD12 1  
ATOM 1098  H HD13 . LEU A 1 68  ? 0.518   2.547   -4.952  1.00 0.00 ? 68  LEU A HD13 1  
ATOM 1099  H HD21 . LEU A 1 68  ? -0.022  0.212   -1.988  1.00 0.00 ? 68  LEU A HD21 1  
ATOM 1100  H HD22 . LEU A 1 68  ? 1.187   1.198   -2.820  1.00 0.00 ? 68  LEU A HD22 1  
ATOM 1101  H HD23 . LEU A 1 68  ? -0.094  1.985   -1.866  1.00 0.00 ? 68  LEU A HD23 1  
ATOM 1102  N N    . SER A 1 69  ? -4.054  -1.408  -5.257  1.00 0.00 ? 69  SER A N    1  
ATOM 1103  C CA   . SER A 1 69  ? -4.807  -2.679  -5.380  1.00 0.00 ? 69  SER A CA   1  
ATOM 1104  C C    . SER A 1 69  ? -3.855  -3.894  -5.670  1.00 0.00 ? 69  SER A C    1  
ATOM 1105  O O    . SER A 1 69  ? -2.677  -3.755  -6.038  1.00 0.00 ? 69  SER A O    1  
ATOM 1106  C CB   . SER A 1 69  ? -5.772  -2.479  -6.585  1.00 0.00 ? 69  SER A CB   1  
ATOM 1107  O OG   . SER A 1 69  ? -5.059  -2.303  -7.819  1.00 0.00 ? 69  SER A OG   1  
ATOM 1108  H H    . SER A 1 69  ? -3.400  -1.154  -6.015  1.00 0.00 ? 69  SER A H    1  
ATOM 1109  H HA   . SER A 1 69  ? -5.423  -2.904  -4.481  1.00 0.00 ? 69  SER A HA   1  
ATOM 1110  H HB2  . SER A 1 69  ? -6.444  -3.351  -6.689  1.00 0.00 ? 69  SER A HB2  1  
ATOM 1111  H HB3  . SER A 1 69  ? -6.441  -1.614  -6.416  1.00 0.00 ? 69  SER A HB3  1  
ATOM 1112  H HG   . SER A 1 69  ? -5.717  -2.138  -8.571  1.00 0.00 ? 69  SER A HG   1  
ATOM 1113  N N    . CYS A 1 70  ? -4.409  -5.110  -5.519  1.00 0.00 ? 70  CYS A N    1  
ATOM 1114  C CA   . CYS A 1 70  ? -3.730  -6.372  -5.913  1.00 0.00 ? 70  CYS A CA   1  
ATOM 1115  C C    . CYS A 1 70  ? -4.193  -6.674  -7.378  1.00 0.00 ? 70  CYS A C    1  
ATOM 1116  O O    . CYS A 1 70  ? -5.219  -7.328  -7.590  1.00 0.00 ? 70  CYS A O    1  
ATOM 1117  C CB   . CYS A 1 70  ? -4.127  -7.464  -4.894  1.00 0.00 ? 70  CYS A CB   1  
ATOM 1118  S SG   . CYS A 1 70  ? -3.752  -6.965  -3.180  1.00 0.00 ? 70  CYS A SG   1  
ATOM 1119  H H    . CYS A 1 70  ? -5.387  -5.102  -5.222  1.00 0.00 ? 70  CYS A H    1  
ATOM 1120  H HA   . CYS A 1 70  ? -2.626  -6.262  -5.885  1.00 0.00 ? 70  CYS A HA   1  
ATOM 1121  H HB2  . CYS A 1 70  ? -5.203  -7.712  -4.964  1.00 0.00 ? 70  CYS A HB2  1  
ATOM 1122  H HB3  . CYS A 1 70  ? -3.581  -8.398  -5.112  1.00 0.00 ? 70  CYS A HB3  1  
ATOM 1123  H HG   . CYS A 1 70  ? -4.809  -6.180  -2.979  1.00 0.00 ? 70  CYS A HG   1  
ATOM 1124  N N    . VAL A 1 71  ? -3.474  -6.170  -8.400  1.00 0.00 ? 71  VAL A N    1  
ATOM 1125  C CA   . VAL A 1 71  ? -3.962  -6.239  -9.821  1.00 0.00 ? 71  VAL A CA   1  
ATOM 1126  C C    . VAL A 1 71  ? -3.741  -7.644  -10.483 1.00 0.00 ? 71  VAL A C    1  
ATOM 1127  O O    . VAL A 1 71  ? -2.910  -8.433  -10.034 1.00 0.00 ? 71  VAL A O    1  
ATOM 1128  C CB   . VAL A 1 71  ? -3.289  -5.047  -10.595 1.00 0.00 ? 71  VAL A CB   1  
ATOM 1129  C CG1  . VAL A 1 71  ? -1.843  -5.301  -11.089 1.00 0.00 ? 71  VAL A CG1  1  
ATOM 1130  C CG2  . VAL A 1 71  ? -4.142  -4.525  -11.771 1.00 0.00 ? 71  VAL A CG2  1  
ATOM 1131  H H    . VAL A 1 71  ? -2.605  -5.681  -8.127  1.00 0.00 ? 71  VAL A H    1  
ATOM 1132  H HA   . VAL A 1 71  ? -5.059  -6.068  -9.812  1.00 0.00 ? 71  VAL A HA   1  
ATOM 1133  H HB   . VAL A 1 71  ? -3.257  -4.180  -9.905  1.00 0.00 ? 71  VAL A HB   1  
ATOM 1134  H HG11 . VAL A 1 71  ? -1.161  -5.519  -10.245 1.00 0.00 ? 71  VAL A HG11 1  
ATOM 1135  H HG12 . VAL A 1 71  ? -1.781  -6.149  -11.793 1.00 0.00 ? 71  VAL A HG12 1  
ATOM 1136  H HG13 . VAL A 1 71  ? -1.425  -4.429  -11.620 1.00 0.00 ? 71  VAL A HG13 1  
ATOM 1137  H HG21 . VAL A 1 71  ? -5.161  -4.240  -11.442 1.00 0.00 ? 71  VAL A HG21 1  
ATOM 1138  H HG22 . VAL A 1 71  ? -3.707  -3.605  -12.209 1.00 0.00 ? 71  VAL A HG22 1  
ATOM 1139  H HG23 . VAL A 1 71  ? -4.243  -5.257  -12.592 1.00 0.00 ? 71  VAL A HG23 1  
ATOM 1140  N N    . LYS A 1 72  ? -4.494  -7.979  -11.545 1.00 0.00 ? 72  LYS A N    1  
ATOM 1141  C CA   . LYS A 1 72  ? -4.368  -9.288  -12.250 1.00 0.00 ? 72  LYS A CA   1  
ATOM 1142  C C    . LYS A 1 72  ? -3.511  -9.165  -13.552 1.00 0.00 ? 72  LYS A C    1  
ATOM 1143  O O    . LYS A 1 72  ? -3.951  -8.588  -14.550 1.00 0.00 ? 72  LYS A O    1  
ATOM 1144  C CB   . LYS A 1 72  ? -5.819  -9.781  -12.542 1.00 0.00 ? 72  LYS A CB   1  
ATOM 1145  C CG   . LYS A 1 72  ? -5.980  -11.156 -13.253 1.00 0.00 ? 72  LYS A CG   1  
ATOM 1146  C CD   . LYS A 1 72  ? -6.267  -12.388 -12.361 1.00 0.00 ? 72  LYS A CD   1  
ATOM 1147  C CE   . LYS A 1 72  ? -5.188  -12.827 -11.352 1.00 0.00 ? 72  LYS A CE   1  
ATOM 1148  N NZ   . LYS A 1 72  ? -3.931  -13.237 -12.023 1.00 0.00 ? 72  LYS A NZ   1  
ATOM 1149  H H    . LYS A 1 72  ? -5.151  -7.252  -11.848 1.00 0.00 ? 72  LYS A H    1  
ATOM 1150  H HA   . LYS A 1 72  ? -3.874  -10.035 -11.595 1.00 0.00 ? 72  LYS A HA   1  
ATOM 1151  H HB2  . LYS A 1 72  ? -6.419  -9.777  -11.610 1.00 0.00 ? 72  LYS A HB2  1  
ATOM 1152  H HB3  . LYS A 1 72  ? -6.315  -9.020  -13.178 1.00 0.00 ? 72  LYS A HB3  1  
ATOM 1153  H HG2  . LYS A 1 72  ? -6.833  -11.067 -13.956 1.00 0.00 ? 72  LYS A HG2  1  
ATOM 1154  H HG3  . LYS A 1 72  ? -5.126  -11.363 -13.926 1.00 0.00 ? 72  LYS A HG3  1  
ATOM 1155  H HD2  . LYS A 1 72  ? -7.212  -12.204 -11.812 1.00 0.00 ? 72  LYS A HD2  1  
ATOM 1156  H HD3  . LYS A 1 72  ? -6.509  -13.246 -13.022 1.00 0.00 ? 72  LYS A HD3  1  
ATOM 1157  H HE2  . LYS A 1 72  ? -5.006  -12.017 -10.623 1.00 0.00 ? 72  LYS A HE2  1  
ATOM 1158  H HE3  . LYS A 1 72  ? -5.583  -13.669 -10.743 1.00 0.00 ? 72  LYS A HE3  1  
ATOM 1159  H HZ1  . LYS A 1 72  ? -4.064  -13.503 -13.021 1.00 0.00 ? 72  LYS A HZ1  1  
ATOM 1160  H HZ2  . LYS A 1 72  ? -3.168  -12.531 -12.018 1.00 0.00 ? 72  LYS A HZ2  1  
ATOM 1161  H HZ3  . LYS A 1 72  ? -3.452  -14.068 -11.619 1.00 0.00 ? 72  LYS A HZ3  1  
ATOM 1162  N N    . SER A 1 73  ? -2.304  -9.756  -13.548 1.00 0.00 ? 73  SER A N    1  
ATOM 1163  C CA   . SER A 1 73  ? -1.424  -9.823  -14.751 1.00 0.00 ? 73  SER A CA   1  
ATOM 1164  C C    . SER A 1 73  ? -1.501  -11.250 -15.403 1.00 0.00 ? 73  SER A C    1  
ATOM 1165  O O    . SER A 1 73  ? -0.492  -11.957 -15.501 1.00 0.00 ? 73  SER A O    1  
ATOM 1166  C CB   . SER A 1 73  ? -0.005  -9.437  -14.265 1.00 0.00 ? 73  SER A CB   1  
ATOM 1167  O OG   . SER A 1 73  ? 0.942   -9.584  -15.322 1.00 0.00 ? 73  SER A OG   1  
ATOM 1168  H H    . SER A 1 73  ? -2.024  -10.219 -12.671 1.00 0.00 ? 73  SER A H    1  
ATOM 1169  H HA   . SER A 1 73  ? -1.722  -9.088  -15.526 1.00 0.00 ? 73  SER A HA   1  
ATOM 1170  H HB2  . SER A 1 73  ? 0.013   -8.391  -13.899 1.00 0.00 ? 73  SER A HB2  1  
ATOM 1171  H HB3  . SER A 1 73  ? 0.313   -10.067 -13.409 1.00 0.00 ? 73  SER A HB3  1  
ATOM 1172  H HG   . SER A 1 73  ? 0.896   -10.513 -15.590 1.00 0.00 ? 73  SER A HG   1  
ATOM 1173  N N    . GLY A 1 74  ? -2.700  -11.663 -15.871 1.00 0.00 ? 74  GLY A N    1  
ATOM 1174  C CA   . GLY A 1 74  ? -2.925  -13.030 -16.422 1.00 0.00 ? 74  GLY A CA   1  
ATOM 1175  C C    . GLY A 1 74  ? -3.068  -14.077 -15.294 1.00 0.00 ? 74  GLY A C    1  
ATOM 1176  O O    . GLY A 1 74  ? -4.105  -14.144 -14.626 1.00 0.00 ? 74  GLY A O    1  
ATOM 1177  H H    . GLY A 1 74  ? -3.452  -10.978 -15.732 1.00 0.00 ? 74  GLY A H    1  
ATOM 1178  H HA2  . GLY A 1 74  ? -3.856  -13.037 -17.017 1.00 0.00 ? 74  GLY A HA2  1  
ATOM 1179  H HA3  . GLY A 1 74  ? -2.124  -13.306 -17.138 1.00 0.00 ? 74  GLY A HA3  1  
ATOM 1180  N N    . ASP A 1 75  ? -2.012  -14.864 -15.073 1.00 0.00 ? 75  ASP A N    1  
ATOM 1181  C CA   . ASP A 1 75  ? -1.914  -15.855 -13.959 1.00 0.00 ? 75  ASP A CA   1  
ATOM 1182  C C    . ASP A 1 75  ? -1.446  -15.195 -12.603 1.00 0.00 ? 75  ASP A C    1  
ATOM 1183  O O    . ASP A 1 75  ? -2.133  -15.324 -11.582 1.00 0.00 ? 75  ASP A O    1  
ATOM 1184  C CB   . ASP A 1 75  ? -0.979  -17.007 -14.439 1.00 0.00 ? 75  ASP A CB   1  
ATOM 1185  C CG   . ASP A 1 75  ? 0.480   -16.710 -14.832 1.00 0.00 ? 75  ASP A CG   1  
ATOM 1186  O OD1  . ASP A 1 75  ? 0.831   -15.534 -15.083 1.00 0.00 ? 75  ASP A OD1  1  
ATOM 1187  O OD2  . ASP A 1 75  ? 1.274   -17.670 -14.899 1.00 0.00 ? 75  ASP A OD2  1  
ATOM 1188  H H    . ASP A 1 75  ? -1.191  -14.713 -15.676 1.00 0.00 ? 75  ASP A H    1  
ATOM 1189  H HA   . ASP A 1 75  ? -2.910  -16.300 -13.762 1.00 0.00 ? 75  ASP A HA   1  
ATOM 1190  H HB2  . ASP A 1 75  ? -0.949  -17.785 -13.655 1.00 0.00 ? 75  ASP A HB2  1  
ATOM 1191  H HB3  . ASP A 1 75  ? -1.443  -17.513 -15.304 1.00 0.00 ? 75  ASP A HB3  1  
ATOM 1192  N N    . GLU A 1 76  ? -0.387  -14.370 -12.634 1.00 0.00 ? 76  GLU A N    1  
ATOM 1193  C CA   . GLU A 1 76  ? 0.190   -13.660 -11.459 1.00 0.00 ? 76  GLU A CA   1  
ATOM 1194  C C    . GLU A 1 76  ? -0.632  -12.394 -10.999 1.00 0.00 ? 76  GLU A C    1  
ATOM 1195  O O    . GLU A 1 76  ? -1.517  -11.878 -11.697 1.00 0.00 ? 76  GLU A O    1  
ATOM 1196  C CB   . GLU A 1 76  ? 1.637   -13.331 -11.955 1.00 0.00 ? 76  GLU A CB   1  
ATOM 1197  C CG   . GLU A 1 76  ? 2.588   -12.509 -11.050 1.00 0.00 ? 76  GLU A CG   1  
ATOM 1198  C CD   . GLU A 1 76  ? 2.873   -13.054 -9.664  1.00 0.00 ? 76  GLU A CD   1  
ATOM 1199  O OE1  . GLU A 1 76  ? 2.027   -12.868 -8.770  1.00 0.00 ? 76  GLU A OE1  1  
ATOM 1200  O OE2  . GLU A 1 76  ? 4.003   -13.509 -9.400  1.00 0.00 ? 76  GLU A OE2  1  
ATOM 1201  H H    . GLU A 1 76  ? 0.096   -14.403 -13.548 1.00 0.00 ? 76  GLU A H    1  
ATOM 1202  H HA   . GLU A 1 76  ? 0.255   -14.356 -10.598 1.00 0.00 ? 76  GLU A HA   1  
ATOM 1203  H HB2  . GLU A 1 76  ? 2.156   -14.281 -12.200 1.00 0.00 ? 76  GLU A HB2  1  
ATOM 1204  H HB3  . GLU A 1 76  ? 1.584   -12.791 -12.924 1.00 0.00 ? 76  GLU A HB3  1  
ATOM 1205  H HG2  . GLU A 1 76  ? 3.560   -12.394 -11.560 1.00 0.00 ? 76  GLU A HG2  1  
ATOM 1206  H HG3  . GLU A 1 76  ? 2.208   -11.480 -10.928 1.00 0.00 ? 76  GLU A HG3  1  
ATOM 1207  N N    . THR A 1 77  ? -0.399  -11.953 -9.748  1.00 0.00 ? 77  THR A N    1  
ATOM 1208  C CA   . THR A 1 77  ? -1.032  -10.733 -9.168  1.00 0.00 ? 77  THR A CA   1  
ATOM 1209  C C    . THR A 1 77  ? 0.001   -10.046 -8.220  1.00 0.00 ? 77  THR A C    1  
ATOM 1210  O O    . THR A 1 77  ? 0.486   -10.637 -7.249  1.00 0.00 ? 77  THR A O    1  
ATOM 1211  C CB   . THR A 1 77  ? -2.390  -11.071 -8.449  1.00 0.00 ? 77  THR A CB   1  
ATOM 1212  O OG1  . THR A 1 77  ? -3.436  -10.806 -9.359  1.00 0.00 ? 77  THR A OG1  1  
ATOM 1213  C CG2  . THR A 1 77  ? -2.776  -10.248 -7.202  1.00 0.00 ? 77  THR A CG2  1  
ATOM 1214  H H    . THR A 1 77  ? 0.400   -12.434 -9.279  1.00 0.00 ? 77  THR A H    1  
ATOM 1215  H HA   . THR A 1 77  ? -1.245  -10.040 -10.007 1.00 0.00 ? 77  THR A HA   1  
ATOM 1216  H HB   . THR A 1 77  ? -2.405  -12.141 -8.191  1.00 0.00 ? 77  THR A HB   1  
ATOM 1217  H HG1  . THR A 1 77  ? -3.334  -9.853  -9.566  1.00 0.00 ? 77  THR A HG1  1  
ATOM 1218  H HG21 . THR A 1 77  ? -2.752  -9.162  -7.409  1.00 0.00 ? 77  THR A HG21 1  
ATOM 1219  H HG22 . THR A 1 77  ? -3.792  -10.483 -6.840  1.00 0.00 ? 77  THR A HG22 1  
ATOM 1220  H HG23 . THR A 1 77  ? -2.083  -10.424 -6.359  1.00 0.00 ? 77  THR A HG23 1  
ATOM 1221  N N    . ARG A 1 78  ? 0.285   -8.760  -8.480  1.00 0.00 ? 78  ARG A N    1  
ATOM 1222  C CA   . ARG A 1 78  ? 1.219   -7.947  -7.652  1.00 0.00 ? 78  ARG A CA   1  
ATOM 1223  C C    . ARG A 1 78  ? 0.569   -6.570  -7.269  1.00 0.00 ? 78  ARG A C    1  
ATOM 1224  O O    . ARG A 1 78  ? -0.518  -6.179  -7.728  1.00 0.00 ? 78  ARG A O    1  
ATOM 1225  C CB   . ARG A 1 78  ? 2.545   -7.845  -8.479  1.00 0.00 ? 78  ARG A CB   1  
ATOM 1226  C CG   . ARG A 1 78  ? 3.838   -7.412  -7.734  1.00 0.00 ? 78  ARG A CG   1  
ATOM 1227  C CD   . ARG A 1 78  ? 4.356   -8.357  -6.620  1.00 0.00 ? 78  ARG A CD   1  
ATOM 1228  N NE   . ARG A 1 78  ? 5.113   -9.527  -7.155  1.00 0.00 ? 78  ARG A NE   1  
ATOM 1229  C CZ   . ARG A 1 78  ? 4.592   -10.711 -7.490  1.00 0.00 ? 78  ARG A CZ   1  
ATOM 1230  N NH1  . ARG A 1 78  ? 3.377   -11.089 -7.193  1.00 0.00 ? 78  ARG A NH1  1  
ATOM 1231  N NH2  . ARG A 1 78  ? 5.330   -11.536 -8.172  1.00 0.00 ? 78  ARG A NH2  1  
ATOM 1232  H H    . ARG A 1 78  ? -0.189  -8.366  -9.300  1.00 0.00 ? 78  ARG A H    1  
ATOM 1233  H HA   . ARG A 1 78  ? 1.419   -8.464  -6.694  1.00 0.00 ? 78  ARG A HA   1  
ATOM 1234  H HB2  . ARG A 1 78  ? 2.768   -8.818  -8.962  1.00 0.00 ? 78  ARG A HB2  1  
ATOM 1235  H HB3  . ARG A 1 78  ? 2.380   -7.160  -9.334  1.00 0.00 ? 78  ARG A HB3  1  
ATOM 1236  H HG2  . ARG A 1 78  ? 4.641   -7.264  -8.484  1.00 0.00 ? 78  ARG A HG2  1  
ATOM 1237  H HG3  . ARG A 1 78  ? 3.706   -6.393  -7.322  1.00 0.00 ? 78  ARG A HG3  1  
ATOM 1238  H HD2  . ARG A 1 78  ? 5.056   -7.770  -5.994  1.00 0.00 ? 78  ARG A HD2  1  
ATOM 1239  H HD3  . ARG A 1 78  ? 3.555   -8.655  -5.916  1.00 0.00 ? 78  ARG A HD3  1  
ATOM 1240  H HE   . ARG A 1 78  ? 6.081   -9.420  -7.471  1.00 0.00 ? 78  ARG A HE   1  
ATOM 1241  H HH11 . ARG A 1 78  ? 2.804   -10.434 -6.664  1.00 0.00 ? 78  ARG A HH11 1  
ATOM 1242  H HH12 . ARG A 1 78  ? 2.993   -11.935 -7.679  1.00 0.00 ? 78  ARG A HH12 1  
ATOM 1243  H HH21 . ARG A 1 78  ? 6.266   -11.239 -8.441  1.00 0.00 ? 78  ARG A HH21 1  
ATOM 1244  H HH22 . ARG A 1 78  ? 4.825   -12.380 -8.552  1.00 0.00 ? 78  ARG A HH22 1  
ATOM 1245  N N    . LEU A 1 79  ? 1.249   -5.834  -6.369  1.00 0.00 ? 79  LEU A N    1  
ATOM 1246  C CA   . LEU A 1 79  ? 0.800   -4.491  -5.920  1.00 0.00 ? 79  LEU A CA   1  
ATOM 1247  C C    . LEU A 1 79  ? 1.037   -3.432  -7.042  1.00 0.00 ? 79  LEU A C    1  
ATOM 1248  O O    . LEU A 1 79  ? 2.151   -3.253  -7.549  1.00 0.00 ? 79  LEU A O    1  
ATOM 1249  C CB   . LEU A 1 79  ? 1.573   -4.110  -4.630  1.00 0.00 ? 79  LEU A CB   1  
ATOM 1250  C CG   . LEU A 1 79  ? 1.110   -2.859  -3.818  1.00 0.00 ? 79  LEU A CG   1  
ATOM 1251  C CD1  . LEU A 1 79  ? -0.401  -2.576  -3.847  1.00 0.00 ? 79  LEU A CD1  1  
ATOM 1252  C CD2  . LEU A 1 79  ? 1.530   -2.990  -2.344  1.00 0.00 ? 79  LEU A CD2  1  
ATOM 1253  H H    . LEU A 1 79  ? 2.133   -6.240  -6.054  1.00 0.00 ? 79  LEU A H    1  
ATOM 1254  H HA   . LEU A 1 79  ? -0.279  -4.560  -5.676  1.00 0.00 ? 79  LEU A HA   1  
ATOM 1255  H HB2  . LEU A 1 79  ? 1.625   -4.989  -3.960  1.00 0.00 ? 79  LEU A HB2  1  
ATOM 1256  H HB3  . LEU A 1 79  ? 2.620   -3.948  -4.927  1.00 0.00 ? 79  LEU A HB3  1  
ATOM 1257  H HG   . LEU A 1 79  ? 1.617   -1.968  -4.242  1.00 0.00 ? 79  LEU A HG   1  
ATOM 1258  H HD11 . LEU A 1 79  ? -0.980  -3.494  -3.660  1.00 0.00 ? 79  LEU A HD11 1  
ATOM 1259  H HD12 . LEU A 1 79  ? -0.714  -1.826  -3.099  1.00 0.00 ? 79  LEU A HD12 1  
ATOM 1260  H HD13 . LEU A 1 79  ? -0.733  -2.186  -4.825  1.00 0.00 ? 79  LEU A HD13 1  
ATOM 1261  H HD21 . LEU A 1 79  ? 2.606   -3.202  -2.248  1.00 0.00 ? 79  LEU A HD21 1  
ATOM 1262  H HD22 . LEU A 1 79  ? 1.336   -2.064  -1.772  1.00 0.00 ? 79  LEU A HD22 1  
ATOM 1263  H HD23 . LEU A 1 79  ? 0.995   -3.810  -1.829  1.00 0.00 ? 79  LEU A HD23 1  
ATOM 1264  N N    . GLN A 1 80  ? -0.047  -2.754  -7.414  1.00 0.00 ? 80  GLN A N    1  
ATOM 1265  C CA   . GLN A 1 80  ? -0.036  -1.735  -8.496  1.00 0.00 ? 80  GLN A CA   1  
ATOM 1266  C C    . GLN A 1 80  ? -0.911  -0.500  -8.130  1.00 0.00 ? 80  GLN A C    1  
ATOM 1267  O O    . GLN A 1 80  ? -1.964  -0.591  -7.484  1.00 0.00 ? 80  GLN A O    1  
ATOM 1268  C CB   . GLN A 1 80  ? -0.551  -2.430  -9.790  1.00 0.00 ? 80  GLN A CB   1  
ATOM 1269  C CG   . GLN A 1 80  ? -0.725  -1.587  -11.086 1.00 0.00 ? 80  GLN A CG   1  
ATOM 1270  C CD   . GLN A 1 80  ? 0.545   -0.970  -11.683 1.00 0.00 ? 80  GLN A CD   1  
ATOM 1271  O OE1  . GLN A 1 80  ? 1.537   -1.638  -11.957 1.00 0.00 ? 80  GLN A OE1  1  
ATOM 1272  N NE2  . GLN A 1 80  ? 0.544   0.314   -11.943 1.00 0.00 ? 80  GLN A NE2  1  
ATOM 1273  H H    . GLN A 1 80  ? -0.883  -3.023  -6.879  1.00 0.00 ? 80  GLN A H    1  
ATOM 1274  H HA   . GLN A 1 80  ? 1.004   -1.392  -8.681  1.00 0.00 ? 80  GLN A HA   1  
ATOM 1275  H HB2  . GLN A 1 80  ? 0.113   -3.288  -10.020 1.00 0.00 ? 80  GLN A HB2  1  
ATOM 1276  H HB3  . GLN A 1 80  ? -1.533  -2.883  -9.563  1.00 0.00 ? 80  GLN A HB3  1  
ATOM 1277  H HG2  . GLN A 1 80  ? -1.158  -2.226  -11.876 1.00 0.00 ? 80  GLN A HG2  1  
ATOM 1278  H HG3  . GLN A 1 80  ? -1.505  -0.818  -10.920 1.00 0.00 ? 80  GLN A HG3  1  
ATOM 1279  H HE21 . GLN A 1 80  ? -0.322  0.833   -11.760 1.00 0.00 ? 80  GLN A HE21 1  
ATOM 1280  H HE22 . GLN A 1 80  ? 1.363   0.638   -12.480 1.00 0.00 ? 80  GLN A HE22 1  
ATOM 1281  N N    . LEU A 1 81  ? -0.430  0.650   -8.628  1.00 0.00 ? 81  LEU A N    1  
ATOM 1282  C CA   . LEU A 1 81  ? -1.113  1.956   -8.544  1.00 0.00 ? 81  LEU A CA   1  
ATOM 1283  C C    . LEU A 1 81  ? -1.897  2.180   -9.882  1.00 0.00 ? 81  LEU A C    1  
ATOM 1284  O O    . LEU A 1 81  ? -1.418  2.818   -10.823 1.00 0.00 ? 81  LEU A O    1  
ATOM 1285  C CB   . LEU A 1 81  ? -0.065  3.066   -8.179  1.00 0.00 ? 81  LEU A CB   1  
ATOM 1286  C CG   . LEU A 1 81  ? 1.355   3.269   -8.794  1.00 0.00 ? 81  LEU A CG   1  
ATOM 1287  C CD1  . LEU A 1 81  ? 2.332   2.107   -8.540  1.00 0.00 ? 81  LEU A CD1  1  
ATOM 1288  C CD2  . LEU A 1 81  ? 1.388   3.686   -10.270 1.00 0.00 ? 81  LEU A CD2  1  
ATOM 1289  H H    . LEU A 1 81  ? 0.452   0.565   -9.141  1.00 0.00 ? 81  LEU A H    1  
ATOM 1290  H HA   . LEU A 1 81  ? -1.860  1.957   -7.727  1.00 0.00 ? 81  LEU A HA   1  
ATOM 1291  H HB2  . LEU A 1 81  ? -0.588  4.038   -8.218  1.00 0.00 ? 81  LEU A HB2  1  
ATOM 1292  H HB3  . LEU A 1 81  ? 0.129   2.953   -7.104  1.00 0.00 ? 81  LEU A HB3  1  
ATOM 1293  H HG   . LEU A 1 81  ? 1.774   4.133   -8.240  1.00 0.00 ? 81  LEU A HG   1  
ATOM 1294  H HD11 . LEU A 1 81  ? 2.284   1.744   -7.497  1.00 0.00 ? 81  LEU A HD11 1  
ATOM 1295  H HD12 . LEU A 1 81  ? 2.154   1.243   -9.205  1.00 0.00 ? 81  LEU A HD12 1  
ATOM 1296  H HD13 . LEU A 1 81  ? 3.375   2.413   -8.721  1.00 0.00 ? 81  LEU A HD13 1  
ATOM 1297  H HD21 . LEU A 1 81  ? 0.691   4.518   -10.477 1.00 0.00 ? 81  LEU A HD21 1  
ATOM 1298  H HD22 . LEU A 1 81  ? 2.392   4.034   -10.576 1.00 0.00 ? 81  LEU A HD22 1  
ATOM 1299  H HD23 . LEU A 1 81  ? 1.113   2.858   -10.945 1.00 0.00 ? 81  LEU A HD23 1  
ATOM 1300  N N    . GLU A 1 82  ? -3.116  1.616   -9.990  1.00 0.00 ? 82  GLU A N    1  
ATOM 1301  C CA   . GLU A 1 82  ? -3.971  1.767   -11.203 1.00 0.00 ? 82  GLU A CA   1  
ATOM 1302  C C    . GLU A 1 82  ? -4.726  3.144   -11.213 1.00 0.00 ? 82  GLU A C    1  
ATOM 1303  O O    . GLU A 1 82  ? -5.248  3.607   -10.194 1.00 0.00 ? 82  GLU A O    1  
ATOM 1304  C CB   . GLU A 1 82  ? -4.926  0.541   -11.276 1.00 0.00 ? 82  GLU A CB   1  
ATOM 1305  C CG   . GLU A 1 82  ? -6.011  0.376   -10.177 1.00 0.00 ? 82  GLU A CG   1  
ATOM 1306  C CD   . GLU A 1 82  ? -6.830  -0.896  -10.305 1.00 0.00 ? 82  GLU A CD   1  
ATOM 1307  O OE1  . GLU A 1 82  ? -7.828  -0.898  -11.053 1.00 0.00 ? 82  GLU A OE1  1  
ATOM 1308  O OE2  . GLU A 1 82  ? -6.494  -1.892  -9.630  1.00 0.00 ? 82  GLU A OE2  1  
ATOM 1309  H H    . GLU A 1 82  ? -3.437  1.082   -9.167  1.00 0.00 ? 82  GLU A H    1  
ATOM 1310  H HA   . GLU A 1 82  ? -3.326  1.726   -12.105 1.00 0.00 ? 82  GLU A HA   1  
ATOM 1311  H HB2  . GLU A 1 82  ? -5.437  0.558   -12.259 1.00 0.00 ? 82  GLU A HB2  1  
ATOM 1312  H HB3  . GLU A 1 82  ? -4.313  -0.382  -11.310 1.00 0.00 ? 82  GLU A HB3  1  
ATOM 1313  H HG2  . GLU A 1 82  ? -5.559  0.381   -9.170  1.00 0.00 ? 82  GLU A HG2  1  
ATOM 1314  H HG3  . GLU A 1 82  ? -6.716  1.225   -10.196 1.00 0.00 ? 82  GLU A HG3  1  
ATOM 1315  N N    . ALA A 1 83  ? -4.806  3.806   -12.382 1.00 0.00 ? 83  ALA A N    1  
ATOM 1316  C CA   . ALA A 1 83  ? -5.468  5.132   -12.504 1.00 0.00 ? 83  ALA A CA   1  
ATOM 1317  C C    . ALA A 1 83  ? -7.023  4.997   -12.529 1.00 0.00 ? 83  ALA A C    1  
ATOM 1318  O O    . ALA A 1 83  ? -7.617  4.539   -13.512 1.00 0.00 ? 83  ALA A O    1  
ATOM 1319  C CB   . ALA A 1 83  ? -4.918  5.782   -13.789 1.00 0.00 ? 83  ALA A CB   1  
ATOM 1320  H H    . ALA A 1 83  ? -4.349  3.349   -13.176 1.00 0.00 ? 83  ALA A H    1  
ATOM 1321  H HA   . ALA A 1 83  ? -5.177  5.781   -11.653 1.00 0.00 ? 83  ALA A HA   1  
ATOM 1322  H HB1  . ALA A 1 83  ? -3.818  5.891   -13.761 1.00 0.00 ? 83  ALA A HB1  1  
ATOM 1323  H HB2  . ALA A 1 83  ? -5.173  5.201   -14.696 1.00 0.00 ? 83  ALA A HB2  1  
ATOM 1324  H HB3  . ALA A 1 83  ? -5.333  6.797   -13.932 1.00 0.00 ? 83  ALA A HB3  1  
ATOM 1325  N N    . VAL A 1 84  ? -7.681  5.390   -11.422 1.00 0.00 ? 84  VAL A N    1  
ATOM 1326  C CA   . VAL A 1 84  ? -9.162  5.273   -11.285 1.00 0.00 ? 84  VAL A CA   1  
ATOM 1327  C C    . VAL A 1 84  ? -9.835  6.579   -11.809 1.00 0.00 ? 84  VAL A C    1  
ATOM 1328  O O    . VAL A 1 84  ? -9.854  7.640   -11.177 1.00 0.00 ? 84  VAL A O    1  
ATOM 1329  C CB   . VAL A 1 84  ? -9.540  4.884   -9.821  1.00 0.00 ? 84  VAL A CB   1  
ATOM 1330  C CG1  . VAL A 1 84  ? -8.987  5.754   -8.664  1.00 0.00 ? 84  VAL A CG1  1  
ATOM 1331  C CG2  . VAL A 1 84  ? -11.058 4.681   -9.609  1.00 0.00 ? 84  VAL A CG2  1  
ATOM 1332  H H    . VAL A 1 84  ? -7.083  5.768   -10.673 1.00 0.00 ? 84  VAL A H    1  
ATOM 1333  H HA   . VAL A 1 84  ? -9.519  4.420   -11.904 1.00 0.00 ? 84  VAL A HA   1  
ATOM 1334  H HB   . VAL A 1 84  ? -9.096  3.880   -9.731  1.00 0.00 ? 84  VAL A HB   1  
ATOM 1335  H HG11 . VAL A 1 84  ? -7.882  5.761   -8.658  1.00 0.00 ? 84  VAL A HG11 1  
ATOM 1336  H HG12 . VAL A 1 84  ? -9.317  6.802   -8.740  1.00 0.00 ? 84  VAL A HG12 1  
ATOM 1337  H HG13 . VAL A 1 84  ? -9.292  5.371   -7.674  1.00 0.00 ? 84  VAL A HG13 1  
ATOM 1338  H HG21 . VAL A 1 84  ? -11.491 4.004   -10.369 1.00 0.00 ? 84  VAL A HG21 1  
ATOM 1339  H HG22 . VAL A 1 84  ? -11.279 4.221   -8.627  1.00 0.00 ? 84  VAL A HG22 1  
ATOM 1340  H HG23 . VAL A 1 84  ? -11.622 5.631   -9.659  1.00 0.00 ? 84  VAL A HG23 1  
ATOM 1341  N N    . ASN A 1 85  ? -10.440 6.432   -12.990 1.00 0.00 ? 85  ASN A N    1  
ATOM 1342  C CA   . ASN A 1 85  ? -11.123 7.547   -13.720 1.00 0.00 ? 85  ASN A CA   1  
ATOM 1343  C C    . ASN A 1 85  ? -12.630 7.792   -13.325 1.00 0.00 ? 85  ASN A C    1  
ATOM 1344  O O    . ASN A 1 85  ? -13.474 8.068   -14.183 1.00 0.00 ? 85  ASN A O    1  
ATOM 1345  C CB   . ASN A 1 85  ? -10.921 7.242   -15.239 1.00 0.00 ? 85  ASN A CB   1  
ATOM 1346  C CG   . ASN A 1 85  ? -11.543 5.961   -15.827 1.00 0.00 ? 85  ASN A CG   1  
ATOM 1347  O OD1  . ASN A 1 85  ? -10.928 4.902   -15.863 1.00 0.00 ? 85  ASN A OD1  1  
ATOM 1348  N ND2  . ASN A 1 85  ? -12.770 6.008   -16.285 1.00 0.00 ? 85  ASN A ND2  1  
ATOM 1349  H H    . ASN A 1 85  ? -10.308 5.478   -13.351 1.00 0.00 ? 85  ASN A H    1  
ATOM 1350  H HA   . ASN A 1 85  ? -10.613 8.508   -13.505 1.00 0.00 ? 85  ASN A HA   1  
ATOM 1351  H HB2  . ASN A 1 85  ? -11.269 8.111   -15.829 1.00 0.00 ? 85  ASN A HB2  1  
ATOM 1352  H HB3  . ASN A 1 85  ? -9.838  7.202   -15.459 1.00 0.00 ? 85  ASN A HB3  1  
ATOM 1353  H HD21 . ASN A 1 85  ? -13.308 6.835   -15.997 1.00 0.00 ? 85  ASN A HD21 1  
ATOM 1354  H HD22 . ASN A 1 85  ? -13.130 5.096   -16.579 1.00 0.00 ? 85  ASN A HD22 1  
ATOM 1355  N N    . ILE A 1 86  ? -12.958 7.752   -12.022 1.00 0.00 ? 86  ILE A N    1  
ATOM 1356  C CA   . ILE A 1 86  ? -14.343 7.970   -11.509 1.00 0.00 ? 86  ILE A CA   1  
ATOM 1357  C C    . ILE A 1 86  ? -14.235 8.460   -10.024 1.00 0.00 ? 86  ILE A C    1  
ATOM 1358  O O    . ILE A 1 86  ? -13.600 7.819   -9.177  1.00 0.00 ? 86  ILE A O    1  
ATOM 1359  C CB   . ILE A 1 86  ? -15.235 6.678   -11.704 1.00 0.00 ? 86  ILE A CB   1  
ATOM 1360  C CG1  . ILE A 1 86  ? -16.724 6.902   -11.308 1.00 0.00 ? 86  ILE A CG1  1  
ATOM 1361  C CG2  . ILE A 1 86  ? -14.737 5.438   -10.910 1.00 0.00 ? 86  ILE A CG2  1  
ATOM 1362  C CD1  . ILE A 1 86  ? -17.486 7.956   -12.132 1.00 0.00 ? 86  ILE A CD1  1  
ATOM 1363  H H    . ILE A 1 86  ? -12.168 7.507   -11.413 1.00 0.00 ? 86  ILE A H    1  
ATOM 1364  H HA   . ILE A 1 86  ? -14.800 8.787   -12.104 1.00 0.00 ? 86  ILE A HA   1  
ATOM 1365  H HB   . ILE A 1 86  ? -15.222 6.415   -12.781 1.00 0.00 ? 86  ILE A HB   1  
ATOM 1366  H HG12 . ILE A 1 86  ? -17.274 5.947   -11.415 1.00 0.00 ? 86  ILE A HG12 1  
ATOM 1367  H HG13 . ILE A 1 86  ? -16.806 7.156   -10.235 1.00 0.00 ? 86  ILE A HG13 1  
ATOM 1368  H HG21 . ILE A 1 86  ? -13.693 5.183   -11.165 1.00 0.00 ? 86  ILE A HG21 1  
ATOM 1369  H HG22 . ILE A 1 86  ? -14.777 5.585   -9.813  1.00 0.00 ? 86  ILE A HG22 1  
ATOM 1370  H HG23 . ILE A 1 86  ? -15.337 4.536   -11.135 1.00 0.00 ? 86  ILE A HG23 1  
ATOM 1371  H HD11 . ILE A 1 86  ? -17.433 7.754   -13.218 1.00 0.00 ? 86  ILE A HD11 1  
ATOM 1372  H HD12 . ILE A 1 86  ? -18.558 7.978   -11.858 1.00 0.00 ? 86  ILE A HD12 1  
ATOM 1373  H HD13 . ILE A 1 86  ? -17.110 8.981   -11.963 1.00 0.00 ? 86  ILE A HD13 1  
ATOM 1374  N N    . THR A 1 87  ? -14.807 9.637   -9.720  1.00 0.00 ? 87  THR A N    1  
ATOM 1375  C CA   . THR A 1 87  ? -14.830 10.194  -8.323  1.00 0.00 ? 87  THR A CA   1  
ATOM 1376  C C    . THR A 1 87  ? -16.033 9.697   -7.439  1.00 0.00 ? 87  THR A C    1  
ATOM 1377  O O    . THR A 1 87  ? -15.913 9.647   -6.215  1.00 0.00 ? 87  THR A O    1  
ATOM 1378  C CB   . THR A 1 87  ? -14.784 11.754  -8.431  1.00 0.00 ? 87  THR A CB   1  
ATOM 1379  O OG1  . THR A 1 87  ? -14.578 12.293  -7.133  1.00 0.00 ? 87  THR A OG1  1  
ATOM 1380  C CG2  . THR A 1 87  ? -16.044 12.451  -8.986  1.00 0.00 ? 87  THR A CG2  1  
ATOM 1381  H H    . THR A 1 87  ? -15.349 10.074  -10.474 1.00 0.00 ? 87  THR A H    1  
ATOM 1382  H HA   . THR A 1 87  ? -13.926 9.889   -7.773  1.00 0.00 ? 87  THR A HA   1  
ATOM 1383  H HB   . THR A 1 87  ? -13.912 12.028  -9.059  1.00 0.00 ? 87  THR A HB   1  
ATOM 1384  H HG1  . THR A 1 87  ? -15.449 12.322  -6.724  1.00 0.00 ? 87  THR A HG1  1  
ATOM 1385  H HG21 . THR A 1 87  ? -16.951 12.247  -8.384  1.00 0.00 ? 87  THR A HG21 1  
ATOM 1386  H HG22 . THR A 1 87  ? -15.918 13.549  -9.016  1.00 0.00 ? 87  THR A HG22 1  
ATOM 1387  H HG23 . THR A 1 87  ? -16.279 12.130  -10.017 1.00 0.00 ? 87  THR A HG23 1  
ATOM 1388  N N    . ASP A 1 88  ? -17.125 9.253   -8.065  1.00 0.00 ? 88  ASP A N    1  
ATOM 1389  C CA   . ASP A 1 88  ? -18.381 8.813   -7.413  1.00 0.00 ? 88  ASP A CA   1  
ATOM 1390  C C    . ASP A 1 88  ? -18.331 7.380   -6.778  1.00 0.00 ? 88  ASP A C    1  
ATOM 1391  O O    . ASP A 1 88  ? -18.818 7.185   -5.661  1.00 0.00 ? 88  ASP A O    1  
ATOM 1392  C CB   . ASP A 1 88  ? -19.446 8.910   -8.544  1.00 0.00 ? 88  ASP A CB   1  
ATOM 1393  C CG   . ASP A 1 88  ? -19.657 10.296  -9.168  1.00 0.00 ? 88  ASP A CG   1  
ATOM 1394  O OD1  . ASP A 1 88  ? -18.928 10.626  -10.131 1.00 0.00 ? 88  ASP A OD1  1  
ATOM 1395  O OD2  . ASP A 1 88  ? -20.526 11.053  -8.690  1.00 0.00 ? 88  ASP A OD2  1  
ATOM 1396  H H    . ASP A 1 88  ? -17.110 9.392   -9.082  1.00 0.00 ? 88  ASP A H    1  
ATOM 1397  H HA   . ASP A 1 88  ? -18.652 9.518   -6.602  1.00 0.00 ? 88  ASP A HA   1  
ATOM 1398  H HB2  . ASP A 1 88  ? -19.196 8.214   -9.368  1.00 0.00 ? 88  ASP A HB2  1  
ATOM 1399  H HB3  . ASP A 1 88  ? -20.422 8.569   -8.164  1.00 0.00 ? 88  ASP A HB3  1  
ATOM 1400  N N    . LEU A 1 89  ? -17.760 6.378   -7.477  1.00 0.00 ? 89  LEU A N    1  
ATOM 1401  C CA   . LEU A 1 89  ? -17.670 4.979   -6.983  1.00 0.00 ? 89  LEU A CA   1  
ATOM 1402  C C    . LEU A 1 89  ? -16.403 4.808   -6.078  1.00 0.00 ? 89  LEU A C    1  
ATOM 1403  O O    . LEU A 1 89  ? -15.270 4.718   -6.565  1.00 0.00 ? 89  LEU A O    1  
ATOM 1404  C CB   . LEU A 1 89  ? -17.643 4.017   -8.213  1.00 0.00 ? 89  LEU A CB   1  
ATOM 1405  C CG   . LEU A 1 89  ? -19.009 3.606   -8.833  1.00 0.00 ? 89  LEU A CG   1  
ATOM 1406  C CD1  . LEU A 1 89  ? -19.797 4.767   -9.468  1.00 0.00 ? 89  LEU A CD1  1  
ATOM 1407  C CD2  . LEU A 1 89  ? -18.792 2.517   -9.900  1.00 0.00 ? 89  LEU A CD2  1  
ATOM 1408  H H    . LEU A 1 89  ? -17.392 6.673   -8.385  1.00 0.00 ? 89  LEU A H    1  
ATOM 1409  H HA   . LEU A 1 89  ? -18.569 4.726   -6.384  1.00 0.00 ? 89  LEU A HA   1  
ATOM 1410  H HB2  . LEU A 1 89  ? -16.967 4.408   -8.998  1.00 0.00 ? 89  LEU A HB2  1  
ATOM 1411  H HB3  . LEU A 1 89  ? -17.150 3.078   -7.892  1.00 0.00 ? 89  LEU A HB3  1  
ATOM 1412  H HG   . LEU A 1 89  ? -19.636 3.168   -8.031  1.00 0.00 ? 89  LEU A HG   1  
ATOM 1413  H HD11 . LEU A 1 89  ? -19.220 5.284   -10.256 1.00 0.00 ? 89  LEU A HD11 1  
ATOM 1414  H HD12 . LEU A 1 89  ? -20.742 4.423   -9.928  1.00 0.00 ? 89  LEU A HD12 1  
ATOM 1415  H HD13 . LEU A 1 89  ? -20.079 5.529   -8.719  1.00 0.00 ? 89  LEU A HD13 1  
ATOM 1416  H HD21 . LEU A 1 89  ? -18.285 1.628   -9.481  1.00 0.00 ? 89  LEU A HD21 1  
ATOM 1417  H HD22 . LEU A 1 89  ? -19.748 2.162   -10.327 1.00 0.00 ? 89  LEU A HD22 1  
ATOM 1418  H HD23 . LEU A 1 89  ? -18.172 2.879   -10.742 1.00 0.00 ? 89  LEU A HD23 1  
ATOM 1419  N N    . SER A 1 90  ? -16.624 4.763   -4.754  1.00 0.00 ? 90  SER A N    1  
ATOM 1420  C CA   . SER A 1 90  ? -15.549 4.583   -3.741  1.00 0.00 ? 90  SER A CA   1  
ATOM 1421  C C    . SER A 1 90  ? -16.082 3.633   -2.627  1.00 0.00 ? 90  SER A C    1  
ATOM 1422  O O    . SER A 1 90  ? -17.000 3.989   -1.878  1.00 0.00 ? 90  SER A O    1  
ATOM 1423  C CB   . SER A 1 90  ? -15.158 5.974   -3.194  1.00 0.00 ? 90  SER A CB   1  
ATOM 1424  O OG   . SER A 1 90  ? -14.057 5.885   -2.291  1.00 0.00 ? 90  SER A OG   1  
ATOM 1425  H H    . SER A 1 90  ? -17.607 4.870   -4.481  1.00 0.00 ? 90  SER A H    1  
ATOM 1426  H HA   . SER A 1 90  ? -14.649 4.127   -4.206  1.00 0.00 ? 90  SER A HA   1  
ATOM 1427  H HB2  . SER A 1 90  ? -14.878 6.644   -4.031  1.00 0.00 ? 90  SER A HB2  1  
ATOM 1428  H HB3  . SER A 1 90  ? -16.018 6.463   -2.695  1.00 0.00 ? 90  SER A HB3  1  
ATOM 1429  H HG   . SER A 1 90  ? -14.288 5.247   -1.606  1.00 0.00 ? 90  SER A HG   1  
ATOM 1430  N N    . GLU A 1 91  ? -15.444 2.467   -2.446  1.00 0.00 ? 91  GLU A N    1  
ATOM 1431  C CA   . GLU A 1 91  ? -15.939 1.417   -1.518  1.00 0.00 ? 91  GLU A CA   1  
ATOM 1432  C C    . GLU A 1 91  ? -15.638 1.685   -0.004  1.00 0.00 ? 91  GLU A C    1  
ATOM 1433  O O    . GLU A 1 91  ? -14.491 1.853   0.424   1.00 0.00 ? 91  GLU A O    1  
ATOM 1434  C CB   . GLU A 1 91  ? -15.296 0.047   -1.895  1.00 0.00 ? 91  GLU A CB   1  
ATOM 1435  C CG   . GLU A 1 91  ? -15.373 -0.426  -3.374  1.00 0.00 ? 91  GLU A CG   1  
ATOM 1436  C CD   . GLU A 1 91  ? -14.158 -0.041  -4.206  1.00 0.00 ? 91  GLU A CD   1  
ATOM 1437  O OE1  . GLU A 1 91  ? -14.007 1.153   -4.549  1.00 0.00 ? 91  GLU A OE1  1  
ATOM 1438  O OE2  . GLU A 1 91  ? -13.344 -0.940  -4.510  1.00 0.00 ? 91  GLU A OE2  1  
ATOM 1439  H H    . GLU A 1 91  ? -14.725 2.224   -3.152  1.00 0.00 ? 91  GLU A H    1  
ATOM 1440  H HA   . GLU A 1 91  ? -17.034 1.314   -1.664  1.00 0.00 ? 91  GLU A HA   1  
ATOM 1441  H HB2  . GLU A 1 91  ? -14.239 0.010   -1.555  1.00 0.00 ? 91  GLU A HB2  1  
ATOM 1442  H HB3  . GLU A 1 91  ? -15.802 -0.719  -1.279  1.00 0.00 ? 91  GLU A HB3  1  
ATOM 1443  H HG2  . GLU A 1 91  ? -15.458 -1.524  -3.423  1.00 0.00 ? 91  GLU A HG2  1  
ATOM 1444  H HG3  . GLU A 1 91  ? -16.272 -0.035  -3.879  1.00 0.00 ? 91  GLU A HG3  1  
ATOM 1445  N N    . ASN A 1 92  ? -16.706 1.648   0.809   1.00 0.00 ? 92  ASN A N    1  
ATOM 1446  C CA   . ASN A 1 92  ? -16.607 1.756   2.294   1.00 0.00 ? 92  ASN A CA   1  
ATOM 1447  C C    . ASN A 1 92  ? -16.274 0.383   2.990   1.00 0.00 ? 92  ASN A C    1  
ATOM 1448  O O    . ASN A 1 92  ? -15.539 0.385   3.980   1.00 0.00 ? 92  ASN A O    1  
ATOM 1449  C CB   . ASN A 1 92  ? -17.959 2.361   2.774   1.00 0.00 ? 92  ASN A CB   1  
ATOM 1450  C CG   . ASN A 1 92  ? -18.081 2.621   4.281   1.00 0.00 ? 92  ASN A CG   1  
ATOM 1451  O OD1  . ASN A 1 92  ? -18.621 1.815   5.032   1.00 0.00 ? 92  ASN A OD1  1  
ATOM 1452  N ND2  . ASN A 1 92  ? -17.589 3.732   4.773   1.00 0.00 ? 92  ASN A ND2  1  
ATOM 1453  H H    . ASN A 1 92  ? -17.598 1.526   0.321   1.00 0.00 ? 92  ASN A H    1  
ATOM 1454  H HA   . ASN A 1 92  ? -15.787 2.453   2.567   1.00 0.00 ? 92  ASN A HA   1  
ATOM 1455  H HB2  . ASN A 1 92  ? -18.167 3.307   2.235   1.00 0.00 ? 92  ASN A HB2  1  
ATOM 1456  H HB3  . ASN A 1 92  ? -18.795 1.693   2.493   1.00 0.00 ? 92  ASN A HB3  1  
ATOM 1457  H HD21 . ASN A 1 92  ? -17.108 4.362   4.126   1.00 0.00 ? 92  ASN A HD21 1  
ATOM 1458  H HD22 . ASN A 1 92  ? -17.672 3.810   5.791   1.00 0.00 ? 92  ASN A HD22 1  
ATOM 1459  N N    . ARG A 1 93  ? -16.829 -0.759  2.526   1.00 0.00 ? 93  ARG A N    1  
ATOM 1460  C CA   . ARG A 1 93  ? -16.573 -2.100  3.129   1.00 0.00 ? 93  ARG A CA   1  
ATOM 1461  C C    . ARG A 1 93  ? -16.010 -3.110  2.077   1.00 0.00 ? 93  ARG A C    1  
ATOM 1462  O O    . ARG A 1 93  ? -14.868 -3.537  2.247   1.00 0.00 ? 93  ARG A O    1  
ATOM 1463  C CB   . ARG A 1 93  ? -17.881 -2.578  3.825   1.00 0.00 ? 93  ARG A CB   1  
ATOM 1464  C CG   . ARG A 1 93  ? -18.056 -1.971  5.237   1.00 0.00 ? 93  ARG A CG   1  
ATOM 1465  C CD   . ARG A 1 93  ? -19.418 -2.286  5.881   1.00 0.00 ? 93  ARG A CD   1  
ATOM 1466  N NE   . ARG A 1 93  ? -19.352 -1.967  7.335   1.00 0.00 ? 93  ARG A NE   1  
ATOM 1467  C CZ   . ARG A 1 93  ? -19.052 -2.838  8.300   1.00 0.00 ? 93  ARG A CZ   1  
ATOM 1468  N NH1  . ARG A 1 93  ? -18.941 -4.128  8.123   1.00 0.00 ? 93  ARG A NH1  1  
ATOM 1469  N NH2  . ARG A 1 93  ? -18.842 -2.402  9.504   1.00 0.00 ? 93  ARG A NH2  1  
ATOM 1470  H H    . ARG A 1 93  ? -17.409 -0.615  1.695   1.00 0.00 ? 93  ARG A H    1  
ATOM 1471  H HA   . ARG A 1 93  ? -15.778 -2.025  3.896   1.00 0.00 ? 93  ARG A HA   1  
ATOM 1472  H HB2  . ARG A 1 93  ? -18.767 -2.368  3.193   1.00 0.00 ? 93  ARG A HB2  1  
ATOM 1473  H HB3  . ARG A 1 93  ? -17.863 -3.681  3.931   1.00 0.00 ? 93  ARG A HB3  1  
ATOM 1474  H HG2  . ARG A 1 93  ? -17.228 -2.335  5.879   1.00 0.00 ? 93  ARG A HG2  1  
ATOM 1475  H HG3  . ARG A 1 93  ? -17.918 -0.870  5.205   1.00 0.00 ? 93  ARG A HG3  1  
ATOM 1476  H HD2  . ARG A 1 93  ? -20.205 -1.671  5.400   1.00 0.00 ? 93  ARG A HD2  1  
ATOM 1477  H HD3  . ARG A 1 93  ? -19.730 -3.332  5.686   1.00 0.00 ? 93  ARG A HD3  1  
ATOM 1478  H HE   . ARG A 1 93  ? -19.365 -0.995  7.656   1.00 0.00 ? 93  ARG A HE   1  
ATOM 1479  H HH11 . ARG A 1 93  ? -19.068 -4.478  7.175   1.00 0.00 ? 93  ARG A HH11 1  
ATOM 1480  H HH12 . ARG A 1 93  ? -18.634 -4.643  8.980   1.00 0.00 ? 93  ARG A HH12 1  
ATOM 1481  H HH21 . ARG A 1 93  ? -18.861 -1.397  9.678   1.00 0.00 ? 93  ARG A HH21 1  
ATOM 1482  H HH22 . ARG A 1 93  ? -18.533 -3.159  10.153  1.00 0.00 ? 93  ARG A HH22 1  
ATOM 1483  N N    . LYS A 1 94  ? -16.763 -3.505  1.018   1.00 0.00 ? 94  LYS A N    1  
ATOM 1484  C CA   . LYS A 1 94  ? -16.305 -4.441  -0.068  1.00 0.00 ? 94  LYS A CA   1  
ATOM 1485  C C    . LYS A 1 94  ? -16.068 -5.930  0.399   1.00 0.00 ? 94  LYS A C    1  
ATOM 1486  O O    . LYS A 1 94  ? -15.643 -6.215  1.521   1.00 0.00 ? 94  LYS A O    1  
ATOM 1487  C CB   . LYS A 1 94  ? -15.016 -3.868  -0.744  1.00 0.00 ? 94  LYS A CB   1  
ATOM 1488  C CG   . LYS A 1 94  ? -14.693 -4.378  -2.171  1.00 0.00 ? 94  LYS A CG   1  
ATOM 1489  C CD   . LYS A 1 94  ? -13.299 -3.944  -2.683  1.00 0.00 ? 94  LYS A CD   1  
ATOM 1490  C CE   . LYS A 1 94  ? -12.086 -4.577  -1.965  1.00 0.00 ? 94  LYS A CE   1  
ATOM 1491  N NZ   . LYS A 1 94  ? -11.999 -6.050  -2.211  1.00 0.00 ? 94  LYS A NZ   1  
ATOM 1492  H H    . LYS A 1 94  ? -17.692 -3.074  1.001   1.00 0.00 ? 94  LYS A H    1  
ATOM 1493  H HA   . LYS A 1 94  ? -17.119 -4.460  -0.820  1.00 0.00 ? 94  LYS A HA   1  
ATOM 1494  H HB2  . LYS A 1 94  ? -15.071 -2.765  -0.790  1.00 0.00 ? 94  LYS A HB2  1  
ATOM 1495  H HB3  . LYS A 1 94  ? -14.164 -4.060  -0.067  1.00 0.00 ? 94  LYS A HB3  1  
ATOM 1496  H HG2  . LYS A 1 94  ? -14.778 -5.478  -2.231  1.00 0.00 ? 94  LYS A HG2  1  
ATOM 1497  H HG3  . LYS A 1 94  ? -15.466 -3.999  -2.869  1.00 0.00 ? 94  LYS A HG3  1  
ATOM 1498  H HD2  . LYS A 1 94  ? -13.234 -4.134  -3.774  1.00 0.00 ? 94  LYS A HD2  1  
ATOM 1499  H HD3  . LYS A 1 94  ? -13.224 -2.838  -2.618  1.00 0.00 ? 94  LYS A HD3  1  
ATOM 1500  H HE2  . LYS A 1 94  ? -11.160 -4.063  -2.303  1.00 0.00 ? 94  LYS A HE2  1  
ATOM 1501  H HE3  . LYS A 1 94  ? -12.129 -4.363  -0.878  1.00 0.00 ? 94  LYS A HE3  1  
ATOM 1502  H HZ1  . LYS A 1 94  ? -12.060 -6.286  -3.208  1.00 0.00 ? 94  LYS A HZ1  1  
ATOM 1503  H HZ2  . LYS A 1 94  ? -11.133 -6.481  -1.862  1.00 0.00 ? 94  LYS A HZ2  1  
ATOM 1504  H HZ3  . LYS A 1 94  ? -12.768 -6.592  -1.769  1.00 0.00 ? 94  LYS A HZ3  1  
ATOM 1505  N N    . GLN A 1 95  ? -16.319 -6.892  -0.510  1.00 0.00 ? 95  GLN A N    1  
ATOM 1506  C CA   . GLN A 1 95  ? -16.086 -8.348  -0.254  1.00 0.00 ? 95  GLN A CA   1  
ATOM 1507  C C    . GLN A 1 95  ? -14.624 -8.803  -0.635  1.00 0.00 ? 95  GLN A C    1  
ATOM 1508  O O    . GLN A 1 95  ? -13.835 -8.050  -1.230  1.00 0.00 ? 95  GLN A O    1  
ATOM 1509  C CB   . GLN A 1 95  ? -17.172 -9.120  -1.065  1.00 0.00 ? 95  GLN A CB   1  
ATOM 1510  C CG   . GLN A 1 95  ? -18.610 -9.042  -0.485  1.00 0.00 ? 95  GLN A CG   1  
ATOM 1511  C CD   . GLN A 1 95  ? -19.642 -9.841  -1.288  1.00 0.00 ? 95  GLN A CD   1  
ATOM 1512  O OE1  . GLN A 1 95  ? -19.696 -11.064 -1.241  1.00 0.00 ? 95  GLN A OE1  1  
ATOM 1513  N NE2  . GLN A 1 95  ? -20.495 -9.192  -2.045  1.00 0.00 ? 95  GLN A NE2  1  
ATOM 1514  H H    . GLN A 1 95  ? -16.672 -6.556  -1.410  1.00 0.00 ? 95  GLN A H    1  
ATOM 1515  H HA   . GLN A 1 95  ? -16.218 -8.574  0.825   1.00 0.00 ? 95  GLN A HA   1  
ATOM 1516  H HB2  . GLN A 1 95  ? -17.166 -8.796  -2.126  1.00 0.00 ? 95  GLN A HB2  1  
ATOM 1517  H HB3  . GLN A 1 95  ? -16.900 -10.194 -1.112  1.00 0.00 ? 95  GLN A HB3  1  
ATOM 1518  H HG2  . GLN A 1 95  ? -18.615 -9.444  0.545   1.00 0.00 ? 95  GLN A HG2  1  
ATOM 1519  H HG3  . GLN A 1 95  ? -18.928 -7.988  -0.377  1.00 0.00 ? 95  GLN A HG3  1  
ATOM 1520  H HE21 . GLN A 1 95  ? -20.451 -8.171  -2.033  1.00 0.00 ? 95  GLN A HE21 1  
ATOM 1521  H HE22 . GLN A 1 95  ? -21.178 -9.796  -2.511  1.00 0.00 ? 95  GLN A HE22 1  
ATOM 1522  N N    . ASP A 1 96  ? -14.270 -10.061 -0.288  1.00 0.00 ? 96  ASP A N    1  
ATOM 1523  C CA   . ASP A 1 96  ? -12.932 -10.650 -0.583  1.00 0.00 ? 96  ASP A CA   1  
ATOM 1524  C C    . ASP A 1 96  ? -12.795 -11.028 -2.104  1.00 0.00 ? 96  ASP A C    1  
ATOM 1525  O O    . ASP A 1 96  ? -13.445 -11.937 -2.628  1.00 0.00 ? 96  ASP A O    1  
ATOM 1526  C CB   . ASP A 1 96  ? -12.733 -11.885 0.339   1.00 0.00 ? 96  ASP A CB   1  
ATOM 1527  C CG   . ASP A 1 96  ? -11.309 -12.461 0.363   1.00 0.00 ? 96  ASP A CG   1  
ATOM 1528  O OD1  . ASP A 1 96  ? -10.784 -12.848 -0.703  1.00 0.00 ? 96  ASP A OD1  1  
ATOM 1529  O OD2  . ASP A 1 96  ? -10.712 -12.548 1.457   1.00 0.00 ? 96  ASP A OD2  1  
ATOM 1530  H H    . ASP A 1 96  ? -14.987 -10.605 0.202   1.00 0.00 ? 96  ASP A H    1  
ATOM 1531  H HA   . ASP A 1 96  ? -12.149 -9.912  -0.309  1.00 0.00 ? 96  ASP A HA   1  
ATOM 1532  H HB2  . ASP A 1 96  ? -12.995 -11.627 1.382   1.00 0.00 ? 96  ASP A HB2  1  
ATOM 1533  H HB3  . ASP A 1 96  ? -13.425 -12.700 0.057   1.00 0.00 ? 96  ASP A HB3  1  
ATOM 1534  N N    . LYS A 1 97  ? -11.978 -10.232 -2.798  1.00 0.00 ? 97  LYS A N    1  
ATOM 1535  C CA   . LYS A 1 97  ? -11.601 -10.396 -4.232  1.00 0.00 ? 97  LYS A CA   1  
ATOM 1536  C C    . LYS A 1 97  ? -10.146 -9.798  -4.389  1.00 0.00 ? 97  LYS A C    1  
ATOM 1537  O O    . LYS A 1 97  ? -9.609  -9.173  -3.462  1.00 0.00 ? 97  LYS A O    1  
ATOM 1538  C CB   . LYS A 1 97  ? -12.629 -9.671  -5.162  1.00 0.00 ? 97  LYS A CB   1  
ATOM 1539  C CG   . LYS A 1 97  ? -14.076 -10.225 -5.299  1.00 0.00 ? 97  LYS A CG   1  
ATOM 1540  C CD   . LYS A 1 97  ? -14.280 -11.493 -6.171  1.00 0.00 ? 97  LYS A CD   1  
ATOM 1541  C CE   . LYS A 1 97  ? -14.347 -12.820 -5.386  1.00 0.00 ? 97  LYS A CE   1  
ATOM 1542  N NZ   . LYS A 1 97  ? -14.661 -13.957 -6.291  1.00 0.00 ? 97  LYS A NZ   1  
ATOM 1543  H H    . LYS A 1 97  ? -11.495 -9.550  -2.206  1.00 0.00 ? 97  LYS A H    1  
ATOM 1544  H HA   . LYS A 1 97  ? -11.556 -11.473 -4.485  1.00 0.00 ? 97  LYS A HA   1  
ATOM 1545  H HB2  . LYS A 1 97  ? -12.703 -8.619  -4.822  1.00 0.00 ? 97  LYS A HB2  1  
ATOM 1546  H HB3  . LYS A 1 97  ? -12.209 -9.583  -6.182  1.00 0.00 ? 97  LYS A HB3  1  
ATOM 1547  H HG2  . LYS A 1 97  ? -14.544 -10.338 -4.301  1.00 0.00 ? 97  LYS A HG2  1  
ATOM 1548  H HG3  . LYS A 1 97  ? -14.674 -9.414  -5.761  1.00 0.00 ? 97  LYS A HG3  1  
ATOM 1549  H HD2  . LYS A 1 97  ? -15.232 -11.361 -6.725  1.00 0.00 ? 97  LYS A HD2  1  
ATOM 1550  H HD3  . LYS A 1 97  ? -13.504 -11.536 -6.962  1.00 0.00 ? 97  LYS A HD3  1  
ATOM 1551  H HE2  . LYS A 1 97  ? -13.385 -12.991 -4.854  1.00 0.00 ? 97  LYS A HE2  1  
ATOM 1552  H HE3  . LYS A 1 97  ? -15.097 -12.740 -4.565  1.00 0.00 ? 97  LYS A HE3  1  
ATOM 1553  H HZ1  . LYS A 1 97  ? -13.968 -14.065 -7.043  1.00 0.00 ? 97  LYS A HZ1  1  
ATOM 1554  H HZ2  . LYS A 1 97  ? -14.698 -14.863 -5.804  1.00 0.00 ? 97  LYS A HZ2  1  
ATOM 1555  H HZ3  . LYS A 1 97  ? -15.570 -13.848 -6.760  1.00 0.00 ? 97  LYS A HZ3  1  
ATOM 1556  N N    . ARG A 1 98  ? -9.480  -9.938  -5.560  1.00 0.00 ? 98  ARG A N    1  
ATOM 1557  C CA   . ARG A 1 98  ? -8.101  -9.375  -5.773  1.00 0.00 ? 98  ARG A CA   1  
ATOM 1558  C C    . ARG A 1 98  ? -8.111  -7.804  -5.928  1.00 0.00 ? 98  ARG A C    1  
ATOM 1559  O O    . ARG A 1 98  ? -8.011  -7.240  -7.016  1.00 0.00 ? 98  ARG A O    1  
ATOM 1560  C CB   . ARG A 1 98  ? -7.446  -10.139 -6.965  1.00 0.00 ? 98  ARG A CB   1  
ATOM 1561  C CG   . ARG A 1 98  ? -6.728  -11.442 -6.517  1.00 0.00 ? 98  ARG A CG   1  
ATOM 1562  C CD   . ARG A 1 98  ? -6.080  -12.250 -7.656  1.00 0.00 ? 98  ARG A CD   1  
ATOM 1563  N NE   . ARG A 1 98  ? -5.088  -13.247 -7.138  1.00 0.00 ? 98  ARG A NE   1  
ATOM 1564  C CZ   . ARG A 1 98  ? -5.356  -14.502 -6.765  1.00 0.00 ? 98  ARG A CZ   1  
ATOM 1565  N NH1  . ARG A 1 98  ? -6.554  -15.028 -6.811  1.00 0.00 ? 98  ARG A NH1  1  
ATOM 1566  N NH2  . ARG A 1 98  ? -4.381  -15.249 -6.326  1.00 0.00 ? 98  ARG A NH2  1  
ATOM 1567  H H    . ARG A 1 98  ? -9.975  -10.461 -6.288  1.00 0.00 ? 98  ARG A H    1  
ATOM 1568  H HA   . ARG A 1 98  ? -7.469  -9.576  -4.890  1.00 0.00 ? 98  ARG A HA   1  
ATOM 1569  H HB2  . ARG A 1 98  ? -8.177  -10.328 -7.776  1.00 0.00 ? 98  ARG A HB2  1  
ATOM 1570  H HB3  . ARG A 1 98  ? -6.684  -9.486  -7.438  1.00 0.00 ? 98  ARG A HB3  1  
ATOM 1571  H HG2  . ARG A 1 98  ? -5.941  -11.159 -5.790  1.00 0.00 ? 98  ARG A HG2  1  
ATOM 1572  H HG3  . ARG A 1 98  ? -7.427  -12.088 -5.950  1.00 0.00 ? 98  ARG A HG3  1  
ATOM 1573  H HD2  . ARG A 1 98  ? -6.850  -12.708 -8.309  1.00 0.00 ? 98  ARG A HD2  1  
ATOM 1574  H HD3  . ARG A 1 98  ? -5.548  -11.545 -8.322  1.00 0.00 ? 98  ARG A HD3  1  
ATOM 1575  H HE   . ARG A 1 98  ? -4.105  -12.985 -7.011  1.00 0.00 ? 98  ARG A HE   1  
ATOM 1576  H HH11 . ARG A 1 98  ? -7.280  -14.387 -7.137  1.00 0.00 ? 98  ARG A HH11 1  
ATOM 1577  H HH12 . ARG A 1 98  ? -6.676  -15.995 -6.505  1.00 0.00 ? 98  ARG A HH12 1  
ATOM 1578  H HH21 . ARG A 1 98  ? -3.439  -14.838 -6.269  1.00 0.00 ? 98  ARG A HH21 1  
ATOM 1579  H HH22 . ARG A 1 98  ? -4.610  -16.207 -6.057  1.00 0.00 ? 98  ARG A HH22 1  
ATOM 1580  N N    . PHE A 1 99  ? -8.182  -7.140  -4.759  1.00 0.00 ? 99  PHE A N    1  
ATOM 1581  C CA   . PHE A 1 99  ? -8.227  -5.659  -4.570  1.00 0.00 ? 99  PHE A CA   1  
ATOM 1582  C C    . PHE A 1 99  ? -7.959  -5.211  -3.088  1.00 0.00 ? 99  PHE A C    1  
ATOM 1583  O O    . PHE A 1 99  ? -7.655  -4.023  -2.939  1.00 0.00 ? 99  PHE A O    1  
ATOM 1584  C CB   . PHE A 1 99  ? -9.618  -5.082  -5.025  1.00 0.00 ? 99  PHE A CB   1  
ATOM 1585  C CG   . PHE A 1 99  ? -9.623  -4.341  -6.370  1.00 0.00 ? 99  PHE A CG   1  
ATOM 1586  C CD1  . PHE A 1 99  ? -9.270  -2.985  -6.401  1.00 0.00 ? 99  PHE A CD1  1  
ATOM 1587  C CD2  . PHE A 1 99  ? -10.006 -4.974  -7.555  1.00 0.00 ? 99  PHE A CD2  1  
ATOM 1588  C CE1  . PHE A 1 99  ? -9.266  -2.287  -7.606  1.00 0.00 ? 99  PHE A CE1  1  
ATOM 1589  C CE2  . PHE A 1 99  ? -9.997  -4.276  -8.761  1.00 0.00 ? 99  PHE A CE2  1  
ATOM 1590  C CZ   . PHE A 1 99  ? -9.624  -2.934  -8.785  1.00 0.00 ? 99  PHE A CZ   1  
ATOM 1591  H H    . PHE A 1 99  ? -8.305  -7.792  -3.975  1.00 0.00 ? 99  PHE A H    1  
ATOM 1592  H HA   . PHE A 1 99  ? -7.409  -5.179  -5.156  1.00 0.00 ? 99  PHE A HA   1  
ATOM 1593  H HB2  . PHE A 1 99  ? -10.384 -5.880  -5.046  1.00 0.00 ? 99  PHE A HB2  1  
ATOM 1594  H HB3  . PHE A 1 99  ? -10.028 -4.377  -4.278  1.00 0.00 ? 99  PHE A HB3  1  
ATOM 1595  H HD1  . PHE A 1 99  ? -8.981  -2.471  -5.495  1.00 0.00 ? 99  PHE A HD1  1  
ATOM 1596  H HD2  . PHE A 1 99  ? -10.289 -6.017  -7.551  1.00 0.00 ? 99  PHE A HD2  1  
ATOM 1597  H HE1  . PHE A 1 99  ? -8.964  -1.250  -7.636  1.00 0.00 ? 99  PHE A HE1  1  
ATOM 1598  H HE2  . PHE A 1 99  ? -10.268 -4.775  -9.679  1.00 0.00 ? 99  PHE A HE2  1  
ATOM 1599  H HZ   . PHE A 1 99  ? -9.590  -2.395  -9.722  1.00 0.00 ? 99  PHE A HZ   1  
ATOM 1600  N N    . ALA A 1 100 ? -8.108  -6.023  -2.001  1.00 0.00 ? 100 ALA A N    1  
ATOM 1601  C CA   . ALA A 1 100 ? -7.866  -5.534  -0.620  1.00 0.00 ? 100 ALA A CA   1  
ATOM 1602  C C    . ALA A 1 100 ? -6.562  -6.120  0.012   1.00 0.00 ? 100 ALA A C    1  
ATOM 1603  O O    . ALA A 1 100 ? -5.814  -6.913  -0.580  1.00 0.00 ? 100 ALA A O    1  
ATOM 1604  C CB   . ALA A 1 100 ? -9.161  -5.868  0.164   1.00 0.00 ? 100 ALA A CB   1  
ATOM 1605  H H    . ALA A 1 100 ? -8.316  -7.032  -2.103  1.00 0.00 ? 100 ALA A H    1  
ATOM 1606  H HA   . ALA A 1 100 ? -7.734  -4.433  -0.604  1.00 0.00 ? 100 ALA A HA   1  
ATOM 1607  H HB1  . ALA A 1 100 ? -9.440  -6.936  0.121   1.00 0.00 ? 100 ALA A HB1  1  
ATOM 1608  H HB2  . ALA A 1 100 ? -9.065  -5.620  1.237   1.00 0.00 ? 100 ALA A HB2  1  
ATOM 1609  H HB3  . ALA A 1 100 ? -10.016 -5.278  -0.198  1.00 0.00 ? 100 ALA A HB3  1  
ATOM 1610  N N    . PHE A 1 101 ? -6.303  -5.669  1.249   1.00 0.00 ? 101 PHE A N    1  
ATOM 1611  C CA   . PHE A 1 101 ? -5.118  -6.044  2.037   1.00 0.00 ? 101 PHE A CA   1  
ATOM 1612  C C    . PHE A 1 101 ? -5.466  -6.182  3.542   1.00 0.00 ? 101 PHE A C    1  
ATOM 1613  O O    . PHE A 1 101 ? -6.223  -5.366  4.104   1.00 0.00 ? 101 PHE A O    1  
ATOM 1614  C CB   . PHE A 1 101 ? -3.958  -4.989  1.968   1.00 0.00 ? 101 PHE A CB   1  
ATOM 1615  C CG   . PHE A 1 101 ? -3.624  -4.353  0.619   1.00 0.00 ? 101 PHE A CG   1  
ATOM 1616  C CD1  . PHE A 1 101 ? -2.858  -5.030  -0.331  1.00 0.00 ? 101 PHE A CD1  1  
ATOM 1617  C CD2  . PHE A 1 101 ? -4.153  -3.094  0.317   1.00 0.00 ? 101 PHE A CD2  1  
ATOM 1618  C CE1  . PHE A 1 101 ? -2.643  -4.459  -1.582  1.00 0.00 ? 101 PHE A CE1  1  
ATOM 1619  C CE2  . PHE A 1 101 ? -3.937  -2.529  -0.932  1.00 0.00 ? 101 PHE A CE2  1  
ATOM 1620  C CZ   . PHE A 1 101 ? -3.194  -3.215  -1.885  1.00 0.00 ? 101 PHE A CZ   1  
ATOM 1621  H H    . PHE A 1 101 ? -6.996  -5.005  1.613   1.00 0.00 ? 101 PHE A H    1  
ATOM 1622  H HA   . PHE A 1 101 ? -4.806  -7.015  1.643   1.00 0.00 ? 101 PHE A HA   1  
ATOM 1623  H HB2  . PHE A 1 101 ? -4.149  -4.168  2.688   1.00 0.00 ? 101 PHE A HB2  1  
ATOM 1624  H HB3  . PHE A 1 101 ? -3.038  -5.461  2.365   1.00 0.00 ? 101 PHE A HB3  1  
ATOM 1625  H HD1  . PHE A 1 101 ? -2.456  -6.011  -0.112  1.00 0.00 ? 101 PHE A HD1  1  
ATOM 1626  H HD2  . PHE A 1 101 ? -4.756  -2.566  1.040   1.00 0.00 ? 101 PHE A HD2  1  
ATOM 1627  H HE1  . PHE A 1 101 ? -2.069  -4.995  -2.322  1.00 0.00 ? 101 PHE A HE1  1  
ATOM 1628  H HE2  . PHE A 1 101 ? -4.352  -1.560  -1.160  1.00 0.00 ? 101 PHE A HE2  1  
ATOM 1629  H HZ   . PHE A 1 101 ? -3.051  -2.781  -2.861  1.00 0.00 ? 101 PHE A HZ   1  
ATOM 1630  N N    . ILE A 1 102 ? -4.834  -7.186  4.187   1.00 0.00 ? 102 ILE A N    1  
ATOM 1631  C CA   . ILE A 1 102 ? -4.937  -7.341  5.674   1.00 0.00 ? 102 ILE A CA   1  
ATOM 1632  C C    . ILE A 1 102 ? -3.631  -6.682  6.224   1.00 0.00 ? 102 ILE A C    1  
ATOM 1633  O O    . ILE A 1 102 ? -2.520  -7.200  6.058   1.00 0.00 ? 102 ILE A O    1  
ATOM 1634  C CB   . ILE A 1 102 ? -5.092  -8.809  6.211   1.00 0.00 ? 102 ILE A CB   1  
ATOM 1635  C CG1  . ILE A 1 102 ? -6.235  -9.627  5.542   1.00 0.00 ? 102 ILE A CG1  1  
ATOM 1636  C CG2  . ILE A 1 102 ? -5.314  -8.824  7.750   1.00 0.00 ? 102 ILE A CG2  1  
ATOM 1637  C CD1  . ILE A 1 102 ? -7.691  -9.145  5.676   1.00 0.00 ? 102 ILE A CD1  1  
ATOM 1638  H H    . ILE A 1 102 ? -4.218  -7.758  3.579   1.00 0.00 ? 102 ILE A H    1  
ATOM 1639  H HA   . ILE A 1 102 ? -5.817  -6.791  6.046   1.00 0.00 ? 102 ILE A HA   1  
ATOM 1640  H HB   . ILE A 1 102 ? -4.155  -9.358  6.030   1.00 0.00 ? 102 ILE A HB   1  
ATOM 1641  H HG12 . ILE A 1 102 ? -6.015  -9.703  4.463   1.00 0.00 ? 102 ILE A HG12 1  
ATOM 1642  H HG13 . ILE A 1 102 ? -6.177  -10.674 5.896   1.00 0.00 ? 102 ILE A HG13 1  
ATOM 1643  H HG21 . ILE A 1 102 ? -6.200  -8.243  8.064   1.00 0.00 ? 102 ILE A HG21 1  
ATOM 1644  H HG22 . ILE A 1 102 ? -5.448  -9.853  8.134   1.00 0.00 ? 102 ILE A HG22 1  
ATOM 1645  H HG23 . ILE A 1 102 ? -4.447  -8.407  8.296   1.00 0.00 ? 102 ILE A HG23 1  
ATOM 1646  H HD11 . ILE A 1 102 ? -7.973  -8.916  6.719   1.00 0.00 ? 102 ILE A HD11 1  
ATOM 1647  H HD12 . ILE A 1 102 ? -7.876  -8.249  5.059   1.00 0.00 ? 102 ILE A HD12 1  
ATOM 1648  H HD13 . ILE A 1 102 ? -8.391  -9.925  5.324   1.00 0.00 ? 102 ILE A HD13 1  
ATOM 1649  N N    . ARG A 1 103 ? -3.789  -5.522  6.876   1.00 0.00 ? 103 ARG A N    1  
ATOM 1650  C CA   . ARG A 1 103 ? -2.655  -4.773  7.478   1.00 0.00 ? 103 ARG A CA   1  
ATOM 1651  C C    . ARG A 1 103 ? -2.400  -5.325  8.916   1.00 0.00 ? 103 ARG A C    1  
ATOM 1652  O O    . ARG A 1 103 ? -3.030  -4.899  9.891   1.00 0.00 ? 103 ARG A O    1  
ATOM 1653  C CB   . ARG A 1 103 ? -3.027  -3.265  7.440   1.00 0.00 ? 103 ARG A CB   1  
ATOM 1654  C CG   . ARG A 1 103 ? -3.012  -2.624  6.026   1.00 0.00 ? 103 ARG A CG   1  
ATOM 1655  C CD   . ARG A 1 103 ? -3.552  -1.183  5.982   1.00 0.00 ? 103 ARG A CD   1  
ATOM 1656  N NE   . ARG A 1 103 ? -5.043  -1.140  5.909   1.00 0.00 ? 103 ARG A NE   1  
ATOM 1657  C CZ   . ARG A 1 103 ? -5.757  -0.776  4.841   1.00 0.00 ? 103 ARG A CZ   1  
ATOM 1658  N NH1  . ARG A 1 103 ? -5.276  -0.681  3.630   1.00 0.00 ? 103 ARG A NH1  1  
ATOM 1659  N NH2  . ARG A 1 103 ? -7.009  -0.497  5.018   1.00 0.00 ? 103 ARG A NH2  1  
ATOM 1660  H H    . ARG A 1 103 ? -4.756  -5.194  6.951   1.00 0.00 ? 103 ARG A H    1  
ATOM 1661  H HA   . ARG A 1 103 ? -1.726  -4.906  6.884   1.00 0.00 ? 103 ARG A HA   1  
ATOM 1662  H HB2  . ARG A 1 103 ? -4.013  -3.110  7.920   1.00 0.00 ? 103 ARG A HB2  1  
ATOM 1663  H HB3  . ARG A 1 103 ? -2.319  -2.706  8.087   1.00 0.00 ? 103 ARG A HB3  1  
ATOM 1664  H HG2  . ARG A 1 103 ? -1.968  -2.626  5.662   1.00 0.00 ? 103 ARG A HG2  1  
ATOM 1665  H HG3  . ARG A 1 103 ? -3.558  -3.256  5.298   1.00 0.00 ? 103 ARG A HG3  1  
ATOM 1666  H HD2  . ARG A 1 103 ? -3.219  -0.636  6.889   1.00 0.00 ? 103 ARG A HD2  1  
ATOM 1667  H HD3  . ARG A 1 103 ? -3.070  -0.623  5.156   1.00 0.00 ? 103 ARG A HD3  1  
ATOM 1668  H HE   . ARG A 1 103 ? -5.612  -1.197  6.766   1.00 0.00 ? 103 ARG A HE   1  
ATOM 1669  H HH11 . ARG A 1 103 ? -4.293  -0.942  3.545   1.00 0.00 ? 103 ARG A HH11 1  
ATOM 1670  H HH12 . ARG A 1 103 ? -5.913  -0.362  2.894   1.00 0.00 ? 103 ARG A HH12 1  
ATOM 1671  H HH21 . ARG A 1 103 ? -7.355  -0.690  5.973   1.00 0.00 ? 103 ARG A HH21 1  
ATOM 1672  H HH22 . ARG A 1 103 ? -7.579  -0.178  4.225   1.00 0.00 ? 103 ARG A HH22 1  
ATOM 1673  N N    . SER A 1 104 ? -1.490  -6.311  9.031   1.00 0.00 ? 104 SER A N    1  
ATOM 1674  C CA   . SER A 1 104 ? -1.164  -6.962  10.332  1.00 0.00 ? 104 SER A CA   1  
ATOM 1675  C C    . SER A 1 104 ? -0.098  -6.156  11.149  1.00 0.00 ? 104 SER A C    1  
ATOM 1676  O O    . SER A 1 104 ? 1.048   -6.585  11.330  1.00 0.00 ? 104 SER A O    1  
ATOM 1677  C CB   . SER A 1 104 ? -0.729  -8.406  9.978   1.00 0.00 ? 104 SER A CB   1  
ATOM 1678  O OG   . SER A 1 104 ? -0.230  -9.086  11.129  1.00 0.00 ? 104 SER A OG   1  
ATOM 1679  H H    . SER A 1 104 ? -1.032  -6.580  8.149   1.00 0.00 ? 104 SER A H    1  
ATOM 1680  H HA   . SER A 1 104 ? -2.067  -7.046  10.971  1.00 0.00 ? 104 SER A HA   1  
ATOM 1681  H HB2  . SER A 1 104 ? -1.580  -8.977  9.559   1.00 0.00 ? 104 SER A HB2  1  
ATOM 1682  H HB3  . SER A 1 104 ? 0.047   -8.415  9.190   1.00 0.00 ? 104 SER A HB3  1  
ATOM 1683  H HG   . SER A 1 104 ? 0.517   -8.559  11.442  1.00 0.00 ? 104 SER A HG   1  
ATOM 1684  N N    . ASP A 1 105 ? -0.548  -5.032  11.732  1.00 0.00 ? 105 ASP A N    1  
ATOM 1685  C CA   . ASP A 1 105 ? 0.309   -4.098  12.507  1.00 0.00 ? 105 ASP A CA   1  
ATOM 1686  C C    . ASP A 1 105 ? 0.615   -4.664  13.931  1.00 0.00 ? 105 ASP A C    1  
ATOM 1687  O O    . ASP A 1 105 ? -0.236  -4.681  14.828  1.00 0.00 ? 105 ASP A O    1  
ATOM 1688  C CB   . ASP A 1 105 ? -0.419  -2.724  12.586  1.00 0.00 ? 105 ASP A CB   1  
ATOM 1689  C CG   . ASP A 1 105 ? -0.600  -1.907  11.300  1.00 0.00 ? 105 ASP A CG   1  
ATOM 1690  O OD1  . ASP A 1 105 ? -0.568  -2.463  10.178  1.00 0.00 ? 105 ASP A OD1  1  
ATOM 1691  O OD2  . ASP A 1 105 ? -0.832  -0.686  11.410  1.00 0.00 ? 105 ASP A OD2  1  
ATOM 1692  H H    . ASP A 1 105 ? -1.509  -4.776  11.468  1.00 0.00 ? 105 ASP A H    1  
ATOM 1693  H HA   . ASP A 1 105 ? 1.266   -3.933  11.975  1.00 0.00 ? 105 ASP A HA   1  
ATOM 1694  H HB2  . ASP A 1 105 ? -1.417  -2.844  13.047  1.00 0.00 ? 105 ASP A HB2  1  
ATOM 1695  H HB3  . ASP A 1 105 ? 0.133   -2.072  13.288  1.00 0.00 ? 105 ASP A HB3  1  
ATOM 1696  N N    . SER A 1 106 ? 1.846   -5.165  14.127  1.00 0.00 ? 106 SER A N    1  
ATOM 1697  C CA   . SER A 1 106 ? 2.297   -5.722  15.435  1.00 0.00 ? 106 SER A CA   1  
ATOM 1698  C C    . SER A 1 106 ? 2.986   -4.605  16.284  1.00 0.00 ? 106 SER A C    1  
ATOM 1699  O O    . SER A 1 106 ? 4.195   -4.630  16.538  1.00 0.00 ? 106 SER A O    1  
ATOM 1700  C CB   . SER A 1 106 ? 3.224   -6.919  15.113  1.00 0.00 ? 106 SER A CB   1  
ATOM 1701  O OG   . SER A 1 106 ? 2.520   -7.932  14.395  1.00 0.00 ? 106 SER A OG   1  
ATOM 1702  H H    . SER A 1 106 ? 2.487   -5.067  13.324  1.00 0.00 ? 106 SER A H    1  
ATOM 1703  H HA   . SER A 1 106 ? 1.443   -6.115  16.023  1.00 0.00 ? 106 SER A HA   1  
ATOM 1704  H HB2  . SER A 1 106 ? 4.110   -6.591  14.531  1.00 0.00 ? 106 SER A HB2  1  
ATOM 1705  H HB3  . SER A 1 106 ? 3.629   -7.352  16.048  1.00 0.00 ? 106 SER A HB3  1  
ATOM 1706  H HG   . SER A 1 106 ? 2.035   -7.470  13.701  1.00 0.00 ? 106 SER A HG   1  
ATOM 1707  N N    . GLY A 1 107 ? 2.181   -3.629  16.748  1.00 0.00 ? 107 GLY A N    1  
ATOM 1708  C CA   . GLY A 1 107 ? 2.688   -2.436  17.472  1.00 0.00 ? 107 GLY A CA   1  
ATOM 1709  C C    . GLY A 1 107 ? 3.332   -1.409  16.494  1.00 0.00 ? 107 GLY A C    1  
ATOM 1710  O O    . GLY A 1 107 ? 2.581   -0.847  15.691  1.00 0.00 ? 107 GLY A O    1  
ATOM 1711  H H    . GLY A 1 107 ? 1.204   -3.727  16.436  1.00 0.00 ? 107 GLY A H    1  
ATOM 1712  H HA2  . GLY A 1 107 ? 1.842   -1.933  17.974  1.00 0.00 ? 107 GLY A HA2  1  
ATOM 1713  H HA3  . GLY A 1 107 ? 3.367   -2.734  18.292  1.00 0.00 ? 107 GLY A HA3  1  
ATOM 1714  N N    . PRO A 1 108 ? 4.672   -1.158  16.467  1.00 0.00 ? 108 PRO A N    1  
ATOM 1715  C CA   . PRO A 1 108 ? 5.286   -0.205  15.497  1.00 0.00 ? 108 PRO A CA   1  
ATOM 1716  C C    . PRO A 1 108 ? 5.521   -0.695  14.021  1.00 0.00 ? 108 PRO A C    1  
ATOM 1717  O O    . PRO A 1 108 ? 5.723   0.164   13.159  1.00 0.00 ? 108 PRO A O    1  
ATOM 1718  C CB   . PRO A 1 108 ? 6.611   0.113   16.219  1.00 0.00 ? 108 PRO A CB   1  
ATOM 1719  C CG   . PRO A 1 108 ? 6.984   -1.166  16.973  1.00 0.00 ? 108 PRO A CG   1  
ATOM 1720  C CD   . PRO A 1 108 ? 5.640   -1.736  17.424  1.00 0.00 ? 108 PRO A CD   1  
ATOM 1721  H HA   . PRO A 1 108 ? 4.679   0.720   15.419  1.00 0.00 ? 108 PRO A HA   1  
ATOM 1722  H HB2  . PRO A 1 108 ? 7.414   0.442   15.534  1.00 0.00 ? 108 PRO A HB2  1  
ATOM 1723  H HB3  . PRO A 1 108 ? 6.459   0.946   16.934  1.00 0.00 ? 108 PRO A HB3  1  
ATOM 1724  H HG2  . PRO A 1 108 ? 7.491   -1.876  16.291  1.00 0.00 ? 108 PRO A HG2  1  
ATOM 1725  H HG3  . PRO A 1 108 ? 7.673   -0.980  17.818  1.00 0.00 ? 108 PRO A HG3  1  
ATOM 1726  H HD2  . PRO A 1 108 ? 5.649   -2.842  17.415  1.00 0.00 ? 108 PRO A HD2  1  
ATOM 1727  H HD3  . PRO A 1 108 ? 5.407   -1.409  18.456  1.00 0.00 ? 108 PRO A HD3  1  
ATOM 1728  N N    . THR A 1 109 ? 5.553   -2.014  13.727  1.00 0.00 ? 109 THR A N    1  
ATOM 1729  C CA   . THR A 1 109 ? 5.847   -2.549  12.353  1.00 0.00 ? 109 THR A CA   1  
ATOM 1730  C C    . THR A 1 109 ? 4.701   -3.469  11.807  1.00 0.00 ? 109 THR A C    1  
ATOM 1731  O O    . THR A 1 109 ? 4.091   -4.245  12.550  1.00 0.00 ? 109 THR A O    1  
ATOM 1732  C CB   . THR A 1 109 ? 7.200   -3.340  12.333  1.00 0.00 ? 109 THR A CB   1  
ATOM 1733  O OG1  . THR A 1 109 ? 7.208   -4.385  13.299  1.00 0.00 ? 109 THR A OG1  1  
ATOM 1734  C CG2  . THR A 1 109 ? 8.441   -2.474  12.612  1.00 0.00 ? 109 THR A CG2  1  
ATOM 1735  H H    . THR A 1 109 ? 5.330   -2.611  14.531  1.00 0.00 ? 109 THR A H    1  
ATOM 1736  H HA   . THR A 1 109 ? 5.947   -1.707  11.647  1.00 0.00 ? 109 THR A HA   1  
ATOM 1737  H HB   . THR A 1 109 ? 7.316   -3.786  11.328  1.00 0.00 ? 109 THR A HB   1  
ATOM 1738  H HG1  . THR A 1 109 ? 7.097   -3.952  14.148  1.00 0.00 ? 109 THR A HG1  1  
ATOM 1739  H HG21 . THR A 1 109 ? 8.538   -1.653  11.878  1.00 0.00 ? 109 THR A HG21 1  
ATOM 1740  H HG22 . THR A 1 109 ? 8.418   -2.015  13.617  1.00 0.00 ? 109 THR A HG22 1  
ATOM 1741  H HG23 . THR A 1 109 ? 9.367   -3.075  12.546  1.00 0.00 ? 109 THR A HG23 1  
ATOM 1742  N N    . THR A 1 110 ? 4.453   -3.416  10.480  1.00 0.00 ? 110 THR A N    1  
ATOM 1743  C CA   . THR A 1 110 ? 3.375   -4.205  9.814   1.00 0.00 ? 110 THR A CA   1  
ATOM 1744  C C    . THR A 1 110 ? 3.897   -5.200  8.702   1.00 0.00 ? 110 THR A C    1  
ATOM 1745  O O    . THR A 1 110 ? 5.092   -5.478  8.519   1.00 0.00 ? 110 THR A O    1  
ATOM 1746  C CB   . THR A 1 110 ? 2.291   -3.175  9.325   1.00 0.00 ? 110 THR A CB   1  
ATOM 1747  O OG1  . THR A 1 110 ? 1.045   -3.854  9.187   1.00 0.00 ? 110 THR A OG1  1  
ATOM 1748  C CG2  . THR A 1 110 ? 2.536   -2.525  7.961   1.00 0.00 ? 110 THR A CG2  1  
ATOM 1749  H H    . THR A 1 110 ? 5.021   -2.722  9.960   1.00 0.00 ? 110 THR A H    1  
ATOM 1750  H HA   . THR A 1 110 ? 2.884   -4.867  10.554  1.00 0.00 ? 110 THR A HA   1  
ATOM 1751  H HB   . THR A 1 110 ? 2.164   -2.386  10.096  1.00 0.00 ? 110 THR A HB   1  
ATOM 1752  H HG1  . THR A 1 110 ? 0.344   -3.254  9.600   1.00 0.00 ? 110 THR A HG1  1  
ATOM 1753  H HG21 . THR A 1 110 ? 2.595   -3.277  7.152   1.00 0.00 ? 110 THR A HG21 1  
ATOM 1754  H HG22 . THR A 1 110 ? 1.691   -1.869  7.702   1.00 0.00 ? 110 THR A HG22 1  
ATOM 1755  H HG23 . THR A 1 110 ? 3.470   -1.940  7.950   1.00 0.00 ? 110 THR A HG23 1  
ATOM 1756  N N    . SER A 1 111 ? 2.876   -5.807  8.075   1.00 0.00 ? 111 SER A N    1  
ATOM 1757  C CA   . SER A 1 111 ? 2.938   -6.880  7.042   1.00 0.00 ? 111 SER A CA   1  
ATOM 1758  C C    . SER A 1 111 ? 1.665   -6.795  6.127   1.00 0.00 ? 111 SER A C    1  
ATOM 1759  O O    . SER A 1 111 ? 0.570   -6.569  6.664   1.00 0.00 ? 111 SER A O    1  
ATOM 1760  C CB   . SER A 1 111 ? 2.950   -8.236  7.794   1.00 0.00 ? 111 SER A CB   1  
ATOM 1761  O OG   . SER A 1 111 ? 4.170   -8.439  8.492   1.00 0.00 ? 111 SER A OG   1  
ATOM 1762  H H    . SER A 1 111 ? 1.993   -5.334  8.342   1.00 0.00 ? 111 SER A H    1  
ATOM 1763  H HA   . SER A 1 111 ? 3.854   -6.778  6.425   1.00 0.00 ? 111 SER A HA   1  
ATOM 1764  H HB2  . SER A 1 111 ? 2.114   -8.294  8.515   1.00 0.00 ? 111 SER A HB2  1  
ATOM 1765  H HB3  . SER A 1 111 ? 2.789   -9.089  7.113   1.00 0.00 ? 111 SER A HB3  1  
ATOM 1766  H HG   . SER A 1 111 ? 4.487   -7.569  8.773   1.00 0.00 ? 111 SER A HG   1  
ATOM 1767  N N    . PHE A 1 112 ? 1.740   -6.992  4.783   1.00 0.00 ? 112 PHE A N    1  
ATOM 1768  C CA   . PHE A 1 112 ? 0.499   -6.831  3.924   1.00 0.00 ? 112 PHE A CA   1  
ATOM 1769  C C    . PHE A 1 112 ? -0.115  -8.139  3.286   1.00 0.00 ? 112 PHE A C    1  
ATOM 1770  O O    . PHE A 1 112 ? 0.310   -8.587  2.215   1.00 0.00 ? 112 PHE A O    1  
ATOM 1771  C CB   . PHE A 1 112 ? 0.846   -5.798  2.799   1.00 0.00 ? 112 PHE A CB   1  
ATOM 1772  C CG   . PHE A 1 112 ? 0.845   -4.277  3.093   1.00 0.00 ? 112 PHE A CG   1  
ATOM 1773  C CD1  . PHE A 1 112 ? 0.594   -3.717  4.354   1.00 0.00 ? 112 PHE A CD1  1  
ATOM 1774  C CD2  . PHE A 1 112 ? 1.098   -3.420  2.013   1.00 0.00 ? 112 PHE A CD2  1  
ATOM 1775  C CE1  . PHE A 1 112 ? 0.601   -2.336  4.529   1.00 0.00 ? 112 PHE A CE1  1  
ATOM 1776  C CE2  . PHE A 1 112 ? 1.100   -2.038  2.189   1.00 0.00 ? 112 PHE A CE2  1  
ATOM 1777  C CZ   . PHE A 1 112 ? 0.848   -1.498  3.446   1.00 0.00 ? 112 PHE A CZ   1  
ATOM 1778  H H    . PHE A 1 112 ? 2.687   -7.192  4.403   1.00 0.00 ? 112 PHE A H    1  
ATOM 1779  H HA   . PHE A 1 112 ? -0.343  -6.392  4.497   1.00 0.00 ? 112 PHE A HA   1  
ATOM 1780  H HB2  . PHE A 1 112 ? 1.808   -6.077  2.326   1.00 0.00 ? 112 PHE A HB2  1  
ATOM 1781  H HB3  . PHE A 1 112 ? 0.113   -5.931  1.977   1.00 0.00 ? 112 PHE A HB3  1  
ATOM 1782  H HD1  . PHE A 1 112 ? 0.402   -4.339  5.214   1.00 0.00 ? 112 PHE A HD1  1  
ATOM 1783  H HD2  . PHE A 1 112 ? 1.294   -3.821  1.028   1.00 0.00 ? 112 PHE A HD2  1  
ATOM 1784  H HE1  . PHE A 1 112 ? 0.419   -1.923  5.510   1.00 0.00 ? 112 PHE A HE1  1  
ATOM 1785  H HE2  . PHE A 1 112 ? 1.300   -1.386  1.350   1.00 0.00 ? 112 PHE A HE2  1  
ATOM 1786  H HZ   . PHE A 1 112 ? 0.854   -0.426  3.584   1.00 0.00 ? 112 PHE A HZ   1  
ATOM 1787  N N    . GLU A 1 113 ? -1.213  -8.720  3.822   1.00 0.00 ? 113 GLU A N    1  
ATOM 1788  C CA   . GLU A 1 113 ? -1.885  -9.879  3.125   1.00 0.00 ? 113 GLU A CA   1  
ATOM 1789  C C    . GLU A 1 113 ? -2.643  -9.308  1.863   1.00 0.00 ? 113 GLU A C    1  
ATOM 1790  O O    . GLU A 1 113 ? -2.950  -8.116  1.827   1.00 0.00 ? 113 GLU A O    1  
ATOM 1791  C CB   . GLU A 1 113 ? -2.815  -10.634 4.108   1.00 0.00 ? 113 GLU A CB   1  
ATOM 1792  C CG   . GLU A 1 113 ? -2.980  -12.153 3.854   1.00 0.00 ? 113 GLU A CG   1  
ATOM 1793  C CD   . GLU A 1 113 ? -1.760  -12.987 4.209   1.00 0.00 ? 113 GLU A CD   1  
ATOM 1794  O OE1  . GLU A 1 113 ? -0.810  -13.010 3.405   1.00 0.00 ? 113 GLU A OE1  1  
ATOM 1795  O OE2  . GLU A 1 113 ? -1.740  -13.613 5.289   1.00 0.00 ? 113 GLU A OE2  1  
ATOM 1796  H H    . GLU A 1 113 ? -1.554  -8.322  4.709   1.00 0.00 ? 113 GLU A H    1  
ATOM 1797  H HA   . GLU A 1 113 ? -1.102  -10.580 2.771   1.00 0.00 ? 113 GLU A HA   1  
ATOM 1798  H HB2  . GLU A 1 113 ? -2.464  -10.510 5.151   1.00 0.00 ? 113 GLU A HB2  1  
ATOM 1799  H HB3  . GLU A 1 113 ? -3.815  -10.173 4.072   1.00 0.00 ? 113 GLU A HB3  1  
ATOM 1800  H HG2  . GLU A 1 113 ? -3.822  -12.546 4.451   1.00 0.00 ? 113 GLU A HG2  1  
ATOM 1801  H HG3  . GLU A 1 113 ? -3.253  -12.369 2.807   1.00 0.00 ? 113 GLU A HG3  1  
ATOM 1802  N N    . SER A 1 114 ? -2.829  -10.100 0.797   1.00 0.00 ? 114 SER A N    1  
ATOM 1803  C CA   . SER A 1 114 ? -3.287  -9.608  -0.540  1.00 0.00 ? 114 SER A CA   1  
ATOM 1804  C C    . SER A 1 114 ? -4.491  -10.409 -1.075  1.00 0.00 ? 114 SER A C    1  
ATOM 1805  O O    . SER A 1 114 ? -4.501  -11.637 -1.011  1.00 0.00 ? 114 SER A O    1  
ATOM 1806  C CB   . SER A 1 114 ? -2.086  -9.749  -1.492  1.00 0.00 ? 114 SER A CB   1  
ATOM 1807  O OG   . SER A 1 114 ? -2.416  -9.480  -2.855  1.00 0.00 ? 114 SER A OG   1  
ATOM 1808  H H    . SER A 1 114 ? -2.632  -11.094 0.959   1.00 0.00 ? 114 SER A H    1  
ATOM 1809  H HA   . SER A 1 114 ? -3.560  -8.533  -0.490  1.00 0.00 ? 114 SER A HA   1  
ATOM 1810  H HB2  . SER A 1 114 ? -1.267  -9.091  -1.156  1.00 0.00 ? 114 SER A HB2  1  
ATOM 1811  H HB3  . SER A 1 114 ? -1.675  -10.763 -1.430  1.00 0.00 ? 114 SER A HB3  1  
ATOM 1812  H HG   . SER A 1 114 ? -3.202  -9.996  -3.062  1.00 0.00 ? 114 SER A HG   1  
ATOM 1813  N N    . ALA A 1 115 ? -5.418  -9.693  -1.752  1.00 0.00 ? 115 ALA A N    1  
ATOM 1814  C CA   . ALA A 1 115 ? -6.796  -10.180 -2.097  1.00 0.00 ? 115 ALA A CA   1  
ATOM 1815  C C    . ALA A 1 115 ? -7.501  -9.870  -0.765  1.00 0.00 ? 115 ALA A C    1  
ATOM 1816  O O    . ALA A 1 115 ? -8.041  -8.760  -0.651  1.00 0.00 ? 115 ALA A O    1  
ATOM 1817  C CB   . ALA A 1 115 ? -6.920  -11.556 -2.781  1.00 0.00 ? 115 ALA A CB   1  
ATOM 1818  H H    . ALA A 1 115 ? -5.261  -8.676  -1.655  1.00 0.00 ? 115 ALA A H    1  
ATOM 1819  H HA   . ALA A 1 115 ? -7.251  -9.480  -2.757  1.00 0.00 ? 115 ALA A HA   1  
ATOM 1820  H HB1  . ALA A 1 115 ? -6.190  -11.672 -3.597  1.00 0.00 ? 115 ALA A HB1  1  
ATOM 1821  H HB2  . ALA A 1 115 ? -6.769  -12.389 -2.097  1.00 0.00 ? 115 ALA A HB2  1  
ATOM 1822  H HB3  . ALA A 1 115 ? -7.932  -11.697 -3.204  1.00 0.00 ? 115 ALA A HB3  1  
ATOM 1823  N N    . ALA A 1 116 ? -7.450  -10.819 0.177   1.00 0.00 ? 116 ALA A N    1  
ATOM 1824  C CA   . ALA A 1 116 ? -7.519  -10.465 1.624   1.00 0.00 ? 116 ALA A CA   1  
ATOM 1825  C C    . ALA A 1 116 ? -7.161  -11.689 2.505   1.00 0.00 ? 116 ALA A C    1  
ATOM 1826  O O    . ALA A 1 116 ? -6.077  -11.711 3.093   1.00 0.00 ? 116 ALA A O    1  
ATOM 1827  C CB   . ALA A 1 116 ? -8.854  -9.779  2.030   1.00 0.00 ? 116 ALA A CB   1  
ATOM 1828  H H    . ALA A 1 116 ? -6.976  -11.641 -0.225  1.00 0.00 ? 116 ALA A H    1  
ATOM 1829  H HA   . ALA A 1 116 ? -6.616  -9.811  1.780   1.00 0.00 ? 116 ALA A HA   1  
ATOM 1830  H HB1  . ALA A 1 116 ? -9.736  -10.338 1.674   1.00 0.00 ? 116 ALA A HB1  1  
ATOM 1831  H HB2  . ALA A 1 116 ? -8.954  -9.680  3.124   1.00 0.00 ? 116 ALA A HB2  1  
ATOM 1832  H HB3  . ALA A 1 116 ? -8.933  -8.758  1.621   1.00 0.00 ? 116 ALA A HB3  1  
ATOM 1833  N N    . CYS A 1 117 ? -8.067  -12.667 2.671   1.00 0.00 ? 117 CYS A N    1  
ATOM 1834  C CA   . CYS A 1 117 ? -7.774  -13.902 3.458   1.00 0.00 ? 117 CYS A CA   1  
ATOM 1835  C C    . CYS A 1 117 ? -6.916  -14.808 2.509   1.00 0.00 ? 117 CYS A C    1  
ATOM 1836  O O    . CYS A 1 117 ? -5.708  -14.865 2.770   1.00 0.00 ? 117 CYS A O    1  
ATOM 1837  C CB   . CYS A 1 117 ? -9.092  -14.460 4.039   1.00 0.00 ? 117 CYS A CB   1  
ATOM 1838  S SG   . CYS A 1 117 ? -9.670  -13.393 5.404   1.00 0.00 ? 117 CYS A SG   1  
ATOM 1839  H H    . CYS A 1 117 ? -8.904  -12.534 2.071   1.00 0.00 ? 117 CYS A H    1  
ATOM 1840  H HA   . CYS A 1 117 ? -7.139  -13.659 4.333   1.00 0.00 ? 117 CYS A HA   1  
ATOM 1841  H HB2  . CYS A 1 117 ? -9.900  -14.503 3.286   1.00 0.00 ? 117 CYS A HB2  1  
ATOM 1842  H HB3  . CYS A 1 117 ? -8.951  -15.487 4.422   1.00 0.00 ? 117 CYS A HB3  1  
ATOM 1843  H HG   . CYS A 1 117 ? -8.644  -13.602 6.226   1.00 0.00 ? 117 CYS A HG   1  
ATOM 1844  N N    . PRO A 1 118 ? -7.392  -15.465 1.408   1.00 0.00 ? 118 PRO A N    1  
ATOM 1845  C CA   . PRO A 1 118 ? -6.478  -16.041 0.396   1.00 0.00 ? 118 PRO A CA   1  
ATOM 1846  C C    . PRO A 1 118 ? -5.891  -14.924 -0.546  1.00 0.00 ? 118 PRO A C    1  
ATOM 1847  O O    . PRO A 1 118 ? -6.197  -13.724 -0.415  1.00 0.00 ? 118 PRO A O    1  
ATOM 1848  C CB   . PRO A 1 118 ? -7.429  -17.051 -0.283  1.00 0.00 ? 118 PRO A CB   1  
ATOM 1849  C CG   . PRO A 1 118 ? -8.792  -16.346 -0.290  1.00 0.00 ? 118 PRO A CG   1  
ATOM 1850  C CD   . PRO A 1 118 ? -8.813  -15.536 1.010   1.00 0.00 ? 118 PRO A CD   1  
ATOM 1851  H HA   . PRO A 1 118 ? -5.612  -16.548 0.865   1.00 0.00 ? 118 PRO A HA   1  
ATOM 1852  H HB2  . PRO A 1 118 ? -7.106  -17.353 -1.296  1.00 0.00 ? 118 PRO A HB2  1  
ATOM 1853  H HB3  . PRO A 1 118 ? -7.484  -17.980 0.319   1.00 0.00 ? 118 PRO A HB3  1  
ATOM 1854  H HG2  . PRO A 1 118 ? -8.870  -15.657 -1.154  1.00 0.00 ? 118 PRO A HG2  1  
ATOM 1855  H HG3  . PRO A 1 118 ? -9.641  -17.051 -0.363  1.00 0.00 ? 118 PRO A HG3  1  
ATOM 1856  H HD2  . PRO A 1 118 ? -9.258  -14.535 0.851   1.00 0.00 ? 118 PRO A HD2  1  
ATOM 1857  H HD3  . PRO A 1 118 ? -9.412  -16.066 1.773   1.00 0.00 ? 118 PRO A HD3  1  
ATOM 1858  N N    . GLY A 1 119 ? -5.047  -15.380 -1.488  1.00 0.00 ? 119 GLY A N    1  
ATOM 1859  C CA   . GLY A 1 119 ? -4.436  -14.514 -2.520  1.00 0.00 ? 119 GLY A CA   1  
ATOM 1860  C C    . GLY A 1 119 ? -2.902  -14.549 -2.581  1.00 0.00 ? 119 GLY A C    1  
ATOM 1861  O O    . GLY A 1 119 ? -2.344  -15.417 -3.255  1.00 0.00 ? 119 GLY A O    1  
ATOM 1862  H H    . GLY A 1 119 ? -4.891  -16.393 -1.451  1.00 0.00 ? 119 GLY A H    1  
ATOM 1863  H HA2  . GLY A 1 119 ? -4.806  -14.856 -3.501  1.00 0.00 ? 119 GLY A HA2  1  
ATOM 1864  H HA3  . GLY A 1 119 ? -4.796  -13.474 -2.470  1.00 0.00 ? 119 GLY A HA3  1  
ATOM 1865  N N    . TRP A 1 120 ? -2.248  -13.542 -1.985  1.00 0.00 ? 120 TRP A N    1  
ATOM 1866  C CA   . TRP A 1 120 ? -0.748  -13.410 -1.997  1.00 0.00 ? 120 TRP A CA   1  
ATOM 1867  C C    . TRP A 1 120 ? -0.230  -12.879 -0.596  1.00 0.00 ? 120 TRP A C    1  
ATOM 1868  O O    . TRP A 1 120 ? -1.007  -12.390 0.238   1.00 0.00 ? 120 TRP A O    1  
ATOM 1869  C CB   . TRP A 1 120 ? -0.314  -12.538 -3.231  1.00 0.00 ? 120 TRP A CB   1  
ATOM 1870  C CG   . TRP A 1 120 ? -0.452  -13.211 -4.616  1.00 0.00 ? 120 TRP A CG   1  
ATOM 1871  C CD1  . TRP A 1 120 ? -1.596  -13.180 -5.442  1.00 0.00 ? 120 TRP A CD1  1  
ATOM 1872  C CD2  . TRP A 1 120 ? 0.461   -13.991 -5.303  1.00 0.00 ? 120 TRP A CD2  1  
ATOM 1873  N NE1  . TRP A 1 120 ? -1.445  -13.982 -6.597  1.00 0.00 ? 120 TRP A NE1  1  
ATOM 1874  C CE2  . TRP A 1 120 ? -0.159  -14.470 -6.483  1.00 0.00 ? 120 TRP A CE2  1  
ATOM 1875  C CE3  . TRP A 1 120 ? 1.817   -14.286 -5.046  1.00 0.00 ? 120 TRP A CE3  1  
ATOM 1876  C CZ2  . TRP A 1 120 ? 0.566   -15.273 -7.395  1.00 0.00 ? 120 TRP A CZ2  1  
ATOM 1877  C CZ3  . TRP A 1 120 ? 2.521   -15.071 -5.959  1.00 0.00 ? 120 TRP A CZ3  1  
ATOM 1878  C CH2  . TRP A 1 120 ? 1.901   -15.570 -7.110  1.00 0.00 ? 120 TRP A CH2  1  
ATOM 1879  H H    . TRP A 1 120 ? -2.876  -12.943 -1.422  1.00 0.00 ? 120 TRP A H    1  
ATOM 1880  H HA   . TRP A 1 120 ? -0.288  -14.416 -2.104  1.00 0.00 ? 120 TRP A HA   1  
ATOM 1881  H HB2  . TRP A 1 120 ? -0.855  -11.578 -3.255  1.00 0.00 ? 120 TRP A HB2  1  
ATOM 1882  H HB3  . TRP A 1 120 ? 0.744   -12.245 -3.114  1.00 0.00 ? 120 TRP A HB3  1  
ATOM 1883  H HD1  . TRP A 1 120 ? -2.484  -12.613 -5.202  1.00 0.00 ? 120 TRP A HD1  1  
ATOM 1884  H HE1  . TRP A 1 120 ? -1.885  -13.880 -7.518  1.00 0.00 ? 120 TRP A HE1  1  
ATOM 1885  H HE3  . TRP A 1 120 ? 2.306   -13.857 -4.192  1.00 0.00 ? 120 TRP A HE3  1  
ATOM 1886  H HZ2  . TRP A 1 120 ? 0.112   -15.619 -8.311  1.00 0.00 ? 120 TRP A HZ2  1  
ATOM 1887  H HZ3  . TRP A 1 120 ? 3.570   -15.266 -5.792  1.00 0.00 ? 120 TRP A HZ3  1  
ATOM 1888  H HH2  . TRP A 1 120 ? 2.477   -16.148 -7.818  1.00 0.00 ? 120 TRP A HH2  1  
ATOM 1889  N N    . PHE A 1 121 ? 1.104   -12.929 -0.363  1.00 0.00 ? 121 PHE A N    1  
ATOM 1890  C CA   . PHE A 1 121 ? 1.696   -12.728 0.996   1.00 0.00 ? 121 PHE A CA   1  
ATOM 1891  C C    . PHE A 1 121 ? 2.745   -11.555 1.235   1.00 0.00 ? 121 PHE A C    1  
ATOM 1892  O O    . PHE A 1 121 ? 3.918   -11.596 0.838   1.00 0.00 ? 121 PHE A O    1  
ATOM 1893  C CB   . PHE A 1 121 ? 2.407   -14.081 1.365   1.00 0.00 ? 121 PHE A CB   1  
ATOM 1894  C CG   . PHE A 1 121 ? 1.531   -15.340 1.565   1.00 0.00 ? 121 PHE A CG   1  
ATOM 1895  C CD1  . PHE A 1 121 ? 0.871   -15.561 2.778   1.00 0.00 ? 121 PHE A CD1  1  
ATOM 1896  C CD2  . PHE A 1 121 ? 1.414   -16.292 0.547   1.00 0.00 ? 121 PHE A CD2  1  
ATOM 1897  C CE1  . PHE A 1 121 ? 0.091   -16.701 2.963   1.00 0.00 ? 121 PHE A CE1  1  
ATOM 1898  C CE2  . PHE A 1 121 ? 0.644   -17.438 0.733   1.00 0.00 ? 121 PHE A CE2  1  
ATOM 1899  C CZ   . PHE A 1 121 ? -0.019  -17.640 1.941   1.00 0.00 ? 121 PHE A CZ   1  
ATOM 1900  H H    . PHE A 1 121 ? 1.653   -13.370 -1.112  1.00 0.00 ? 121 PHE A H    1  
ATOM 1901  H HA   . PHE A 1 121 ? 0.885   -12.603 1.741   1.00 0.00 ? 121 PHE A HA   1  
ATOM 1902  H HB2  . PHE A 1 121 ? 3.214   -14.297 0.640   1.00 0.00 ? 121 PHE A HB2  1  
ATOM 1903  H HB3  . PHE A 1 121 ? 2.969   -13.949 2.309   1.00 0.00 ? 121 PHE A HB3  1  
ATOM 1904  H HD1  . PHE A 1 121 ? 0.934   -14.841 3.580   1.00 0.00 ? 121 PHE A HD1  1  
ATOM 1905  H HD2  . PHE A 1 121 ? 1.917   -16.153 -0.394  1.00 0.00 ? 121 PHE A HD2  1  
ATOM 1906  H HE1  . PHE A 1 121 ? -0.435  -16.844 3.896   1.00 0.00 ? 121 PHE A HE1  1  
ATOM 1907  H HE2  . PHE A 1 121 ? 0.565   -18.168 -0.059  1.00 0.00 ? 121 PHE A HE2  1  
ATOM 1908  H HZ   . PHE A 1 121 ? -0.625  -18.523 2.084   1.00 0.00 ? 121 PHE A HZ   1  
ATOM 1909  N N    . LEU A 1 122 ? 2.283   -10.620 2.077   1.00 0.00 ? 122 LEU A N    1  
ATOM 1910  C CA   . LEU A 1 122 ? 2.988   -9.536  2.827   1.00 0.00 ? 122 LEU A CA   1  
ATOM 1911  C C    . LEU A 1 122 ? 4.428   -8.939  2.783   1.00 0.00 ? 122 LEU A C    1  
ATOM 1912  O O    . LEU A 1 122 ? 4.609   -8.058  3.646   1.00 0.00 ? 122 LEU A O    1  
ATOM 1913  C CB   . LEU A 1 122 ? 2.690   -10.037 4.306   1.00 0.00 ? 122 LEU A CB   1  
ATOM 1914  C CG   . LEU A 1 122 ? 3.135   -11.397 4.951   1.00 0.00 ? 122 LEU A CG   1  
ATOM 1915  C CD1  . LEU A 1 122 ? 2.001   -12.433 4.979   1.00 0.00 ? 122 LEU A CD1  1  
ATOM 1916  C CD2  . LEU A 1 122 ? 4.410   -12.039 4.390   1.00 0.00 ? 122 LEU A CD2  1  
ATOM 1917  H H    . LEU A 1 122 ? 1.266   -10.649 2.258   1.00 0.00 ? 122 LEU A H    1  
ATOM 1918  H HA   . LEU A 1 122 ? 2.474   -8.597  2.612   1.00 0.00 ? 122 LEU A HA   1  
ATOM 1919  H HB2  . LEU A 1 122 ? 3.097   -9.278  4.990   1.00 0.00 ? 122 LEU A HB2  1  
ATOM 1920  H HB3  . LEU A 1 122 ? 1.606   -9.921  4.498   1.00 0.00 ? 122 LEU A HB3  1  
ATOM 1921  H HG   . LEU A 1 122 ? 3.353   -11.179 6.016   1.00 0.00 ? 122 LEU A HG   1  
ATOM 1922  H HD11 . LEU A 1 122 ? 1.100   -12.055 5.499   1.00 0.00 ? 122 LEU A HD11 1  
ATOM 1923  H HD12 . LEU A 1 122 ? 1.675   -12.712 3.965   1.00 0.00 ? 122 LEU A HD12 1  
ATOM 1924  H HD13 . LEU A 1 122 ? 2.295   -13.365 5.497   1.00 0.00 ? 122 LEU A HD13 1  
ATOM 1925  H HD21 . LEU A 1 122 ? 5.237   -11.317 4.371   1.00 0.00 ? 122 LEU A HD21 1  
ATOM 1926  H HD22 . LEU A 1 122 ? 4.744   -12.895 5.003   1.00 0.00 ? 122 LEU A HD22 1  
ATOM 1927  H HD23 . LEU A 1 122 ? 4.284   -12.407 3.360   1.00 0.00 ? 122 LEU A HD23 1  
ATOM 1928  N N    . CYS A 1 123 ? 5.368   -9.224  1.862   1.00 0.00 ? 123 CYS A N    1  
ATOM 1929  C CA   . CYS A 1 123 ? 6.781   -8.763  2.008   1.00 0.00 ? 123 CYS A CA   1  
ATOM 1930  C C    . CYS A 1 123 ? 7.213   -7.498  1.175   1.00 0.00 ? 123 CYS A C    1  
ATOM 1931  O O    . CYS A 1 123 ? 6.419   -6.727  0.630   1.00 0.00 ? 123 CYS A O    1  
ATOM 1932  C CB   . CYS A 1 123 ? 7.584   -10.042 1.630   1.00 0.00 ? 123 CYS A CB   1  
ATOM 1933  S SG   . CYS A 1 123 ? 7.302   -11.442 2.766   1.00 0.00 ? 123 CYS A SG   1  
ATOM 1934  H H    . CYS A 1 123 ? 5.117   -9.885  1.109   1.00 0.00 ? 123 CYS A H    1  
ATOM 1935  H HA   . CYS A 1 123 ? 7.004   -8.505  3.060   1.00 0.00 ? 123 CYS A HA   1  
ATOM 1936  H HB2  . CYS A 1 123 ? 7.398   -10.365 0.591   1.00 0.00 ? 123 CYS A HB2  1  
ATOM 1937  H HB3  . CYS A 1 123 ? 8.662   -9.838  1.688   1.00 0.00 ? 123 CYS A HB3  1  
ATOM 1938  H HG   . CYS A 1 123 ? 6.307   -12.007 2.091   1.00 0.00 ? 123 CYS A HG   1  
ATOM 1939  N N    . THR A 1 124 ? 8.534   -7.241  1.156   1.00 0.00 ? 124 THR A N    1  
ATOM 1940  C CA   . THR A 1 124 ? 9.200   -6.128  0.413   1.00 0.00 ? 124 THR A CA   1  
ATOM 1941  C C    . THR A 1 124 ? 10.706  -6.493  0.234   1.00 0.00 ? 124 THR A C    1  
ATOM 1942  O O    . THR A 1 124 ? 11.325  -7.124  1.100   1.00 0.00 ? 124 THR A O    1  
ATOM 1943  C CB   . THR A 1 124 ? 9.029   -4.781  1.183   1.00 0.00 ? 124 THR A CB   1  
ATOM 1944  O OG1  . THR A 1 124 ? 7.648   -4.445  1.202   1.00 0.00 ? 124 THR A OG1  1  
ATOM 1945  C CG2  . THR A 1 124 ? 9.767   -3.568  0.578   1.00 0.00 ? 124 THR A CG2  1  
ATOM 1946  H H    . THR A 1 124 ? 9.098   -7.935  1.657   1.00 0.00 ? 124 THR A H    1  
ATOM 1947  H HA   . THR A 1 124 ? 8.747   -6.038  -0.592  1.00 0.00 ? 124 THR A HA   1  
ATOM 1948  H HB   . THR A 1 124 ? 9.391   -4.926  2.219   1.00 0.00 ? 124 THR A HB   1  
ATOM 1949  H HG1  . THR A 1 124 ? 7.165   -5.289  1.185   1.00 0.00 ? 124 THR A HG1  1  
ATOM 1950  H HG21 . THR A 1 124 ? 9.473   -3.359  -0.465  1.00 0.00 ? 124 THR A HG21 1  
ATOM 1951  H HG22 . THR A 1 124 ? 9.580   -2.648  1.155   1.00 0.00 ? 124 THR A HG22 1  
ATOM 1952  H HG23 . THR A 1 124 ? 10.864  -3.702  0.591   1.00 0.00 ? 124 THR A HG23 1  
ATOM 1953  N N    . ALA A 1 125 ? 11.322  -6.059  -0.880  1.00 0.00 ? 125 ALA A N    1  
ATOM 1954  C CA   . ALA A 1 125 ? 12.771  -6.289  -1.127  1.00 0.00 ? 125 ALA A CA   1  
ATOM 1955  C C    . ALA A 1 125 ? 13.713  -5.681  -0.027  1.00 0.00 ? 125 ALA A C    1  
ATOM 1956  O O    . ALA A 1 125 ? 13.440  -4.621  0.546   1.00 0.00 ? 125 ALA A O    1  
ATOM 1957  C CB   . ALA A 1 125 ? 13.069  -5.675  -2.496  1.00 0.00 ? 125 ALA A CB   1  
ATOM 1958  H H    . ALA A 1 125 ? 10.729  -5.537  -1.540  1.00 0.00 ? 125 ALA A H    1  
ATOM 1959  H HA   . ALA A 1 125 ? 12.947  -7.383  -1.176  1.00 0.00 ? 125 ALA A HA   1  
ATOM 1960  H HB1  . ALA A 1 125 ? 12.461  -6.129  -3.302  1.00 0.00 ? 125 ALA A HB1  1  
ATOM 1961  H HB2  . ALA A 1 125 ? 12.882  -4.585  -2.518  1.00 0.00 ? 125 ALA A HB2  1  
ATOM 1962  H HB3  . ALA A 1 125 ? 14.131  -5.821  -2.763  1.00 0.00 ? 125 ALA A HB3  1  
ATOM 1963  N N    . MET A 1 126 ? 14.825  -6.372  0.271   1.00 0.00 ? 126 MET A N    1  
ATOM 1964  C CA   . MET A 1 126 ? 15.756  -5.956  1.360   1.00 0.00 ? 126 MET A CA   1  
ATOM 1965  C C    . MET A 1 126 ? 16.657  -4.714  1.034   1.00 0.00 ? 126 MET A C    1  
ATOM 1966  O O    . MET A 1 126 ? 16.715  -3.802  1.867   1.00 0.00 ? 126 MET A O    1  
ATOM 1967  C CB   . MET A 1 126 ? 16.574  -7.231  1.730   1.00 0.00 ? 126 MET A CB   1  
ATOM 1968  C CG   . MET A 1 126 ? 17.205  -7.224  3.139   1.00 0.00 ? 126 MET A CG   1  
ATOM 1969  S SD   . MET A 1 126 ? 18.528  -6.008  3.263   1.00 0.00 ? 126 MET A SD   1  
ATOM 1970  C CE   . MET A 1 126 ? 18.955  -6.180  5.003   1.00 0.00 ? 126 MET A CE   1  
ATOM 1971  H H    . MET A 1 126 ? 14.957  -7.236  -0.262  1.00 0.00 ? 126 MET A H    1  
ATOM 1972  H HA   . MET A 1 126 ? 15.155  -5.659  2.241   1.00 0.00 ? 126 MET A HA   1  
ATOM 1973  H HB2  . MET A 1 126 ? 15.921  -8.127  1.701   1.00 0.00 ? 126 MET A HB2  1  
ATOM 1974  H HB3  . MET A 1 126 ? 17.356  -7.430  0.971   1.00 0.00 ? 126 MET A HB3  1  
ATOM 1975  H HG2  . MET A 1 126 ? 16.442  -7.024  3.915   1.00 0.00 ? 126 MET A HG2  1  
ATOM 1976  H HG3  . MET A 1 126 ? 17.627  -8.220  3.371   1.00 0.00 ? 126 MET A HG3  1  
ATOM 1977  H HE1  . MET A 1 126 ? 19.289  -7.209  5.226   1.00 0.00 ? 126 MET A HE1  1  
ATOM 1978  H HE2  . MET A 1 126 ? 19.781  -5.491  5.259   1.00 0.00 ? 126 MET A HE2  1  
ATOM 1979  H HE3  . MET A 1 126 ? 18.092  -5.944  5.651   1.00 0.00 ? 126 MET A HE3  1  
ATOM 1980  N N    . GLU A 1 127 ? 17.361  -4.660  -0.116  1.00 0.00 ? 127 GLU A N    1  
ATOM 1981  C CA   . GLU A 1 127 ? 18.284  -3.533  -0.443  1.00 0.00 ? 127 GLU A CA   1  
ATOM 1982  C C    . GLU A 1 127 ? 17.747  -2.551  -1.549  1.00 0.00 ? 127 GLU A C    1  
ATOM 1983  O O    . GLU A 1 127 ? 16.647  -2.667  -2.099  1.00 0.00 ? 127 GLU A O    1  
ATOM 1984  C CB   . GLU A 1 127 ? 19.675  -4.186  -0.753  1.00 0.00 ? 127 GLU A CB   1  
ATOM 1985  C CG   . GLU A 1 127 ? 20.505  -4.627  0.493   1.00 0.00 ? 127 GLU A CG   1  
ATOM 1986  C CD   . GLU A 1 127 ? 20.733  -3.566  1.572   1.00 0.00 ? 127 GLU A CD   1  
ATOM 1987  O OE1  . GLU A 1 127 ? 21.048  -2.407  1.238   1.00 0.00 ? 127 GLU A OE1  1  
ATOM 1988  O OE2  . GLU A 1 127 ? 20.483  -3.853  2.763   1.00 0.00 ? 127 GLU A OE2  1  
ATOM 1989  H H    . GLU A 1 127 ? 17.233  -5.461  -0.741  1.00 0.00 ? 127 GLU A H    1  
ATOM 1990  H HA   . GLU A 1 127 ? 18.412  -2.872  0.435   1.00 0.00 ? 127 GLU A HA   1  
ATOM 1991  H HB2  . GLU A 1 127 ? 19.567  -5.030  -1.464  1.00 0.00 ? 127 GLU A HB2  1  
ATOM 1992  H HB3  . GLU A 1 127 ? 20.311  -3.467  -1.303  1.00 0.00 ? 127 GLU A HB3  1  
ATOM 1993  H HG2  . GLU A 1 127 ? 20.024  -5.497  0.972   1.00 0.00 ? 127 GLU A HG2  1  
ATOM 1994  H HG3  . GLU A 1 127 ? 21.500  -4.982  0.177   1.00 0.00 ? 127 GLU A HG3  1  
ATOM 1995  N N    . ALA A 1 128 ? 18.570  -1.519  -1.793  1.00 0.00 ? 128 ALA A N    1  
ATOM 1996  C CA   . ALA A 1 128 ? 18.287  -0.359  -2.674  1.00 0.00 ? 128 ALA A CA   1  
ATOM 1997  C C    . ALA A 1 128 ? 18.079  -0.530  -4.223  1.00 0.00 ? 128 ALA A C    1  
ATOM 1998  O O    . ALA A 1 128 ? 18.737  0.160   -5.010  1.00 0.00 ? 128 ALA A O    1  
ATOM 1999  C CB   . ALA A 1 128 ? 19.526  0.512   -2.345  1.00 0.00 ? 128 ALA A CB   1  
ATOM 2000  H H    . ALA A 1 128 ? 19.446  -1.566  -1.261  1.00 0.00 ? 128 ALA A H    1  
ATOM 2001  H HA   . ALA A 1 128 ? 17.377  0.162   -2.326  1.00 0.00 ? 128 ALA A HA   1  
ATOM 2002  H HB1  . ALA A 1 128 ? 20.485  0.008   -2.581  1.00 0.00 ? 128 ALA A HB1  1  
ATOM 2003  H HB2  . ALA A 1 128 ? 19.536  1.432   -2.953  1.00 0.00 ? 128 ALA A HB2  1  
ATOM 2004  H HB3  . ALA A 1 128 ? 19.562  0.840   -1.288  1.00 0.00 ? 128 ALA A HB3  1  
ATOM 2005  N N    . ASP A 1 129 ? 17.109  -1.345  -4.680  1.00 0.00 ? 129 ASP A N    1  
ATOM 2006  C CA   . ASP A 1 129 ? 16.795  -1.479  -6.144  1.00 0.00 ? 129 ASP A CA   1  
ATOM 2007  C C    . ASP A 1 129 ? 15.384  -2.074  -6.471  1.00 0.00 ? 129 ASP A C    1  
ATOM 2008  O O    . ASP A 1 129 ? 14.661  -1.510  -7.296  1.00 0.00 ? 129 ASP A O    1  
ATOM 2009  C CB   . ASP A 1 129 ? 17.920  -2.288  -6.884  1.00 0.00 ? 129 ASP A CB   1  
ATOM 2010  C CG   . ASP A 1 129 ? 18.023  -3.816  -6.710  1.00 0.00 ? 129 ASP A CG   1  
ATOM 2011  O OD1  . ASP A 1 129 ? 17.702  -4.349  -5.623  1.00 0.00 ? 129 ASP A OD1  1  
ATOM 2012  O OD2  . ASP A 1 129 ? 18.393  -4.500  -7.685  1.00 0.00 ? 129 ASP A OD2  1  
ATOM 2013  H H    . ASP A 1 129 ? 16.643  -1.886  -3.936  1.00 0.00 ? 129 ASP A H    1  
ATOM 2014  H HA   . ASP A 1 129 ? 16.727  -0.443  -6.542  1.00 0.00 ? 129 ASP A HA   1  
ATOM 2015  H HB2  . ASP A 1 129 ? 17.809  -2.101  -7.967  1.00 0.00 ? 129 ASP A HB2  1  
ATOM 2016  H HB3  . ASP A 1 129 ? 18.912  -1.867  -6.645  1.00 0.00 ? 129 ASP A HB3  1  
ATOM 2017  N N    . GLN A 1 130 ? 14.985  -3.183  -5.836  1.00 0.00 ? 130 GLN A N    1  
ATOM 2018  C CA   . GLN A 1 130 ? 13.694  -3.872  -6.111  1.00 0.00 ? 130 GLN A CA   1  
ATOM 2019  C C    . GLN A 1 130 ? 12.495  -3.294  -5.256  1.00 0.00 ? 130 GLN A C    1  
ATOM 2020  O O    . GLN A 1 130 ? 12.739  -2.629  -4.242  1.00 0.00 ? 130 GLN A O    1  
ATOM 2021  C CB   . GLN A 1 130 ? 13.981  -5.380  -5.861  1.00 0.00 ? 130 GLN A CB   1  
ATOM 2022  C CG   . GLN A 1 130 ? 14.856  -6.074  -6.946  1.00 0.00 ? 130 GLN A CG   1  
ATOM 2023  C CD   . GLN A 1 130 ? 15.644  -7.282  -6.434  1.00 0.00 ? 130 GLN A CD   1  
ATOM 2024  O OE1  . GLN A 1 130 ? 15.195  -8.422  -6.481  1.00 0.00 ? 130 GLN A OE1  1  
ATOM 2025  N NE2  . GLN A 1 130 ? 16.838  -7.073  -5.926  1.00 0.00 ? 130 GLN A NE2  1  
ATOM 2026  H H    . GLN A 1 130 ? 15.716  -3.568  -5.220  1.00 0.00 ? 130 GLN A H    1  
ATOM 2027  H HA   . GLN A 1 130 ? 13.432  -3.730  -7.176  1.00 0.00 ? 130 GLN A HA   1  
ATOM 2028  H HB2  . GLN A 1 130 ? 14.465  -5.491  -4.874  1.00 0.00 ? 130 GLN A HB2  1  
ATOM 2029  H HB3  . GLN A 1 130 ? 13.035  -5.945  -5.767  1.00 0.00 ? 130 GLN A HB3  1  
ATOM 2030  H HG2  . GLN A 1 130 ? 14.222  -6.399  -7.791  1.00 0.00 ? 130 GLN A HG2  1  
ATOM 2031  H HG3  . GLN A 1 130 ? 15.570  -5.357  -7.399  1.00 0.00 ? 130 GLN A HG3  1  
ATOM 2032  H HE21 . GLN A 1 130 ? 17.188  -6.091  -5.932  1.00 0.00 ? 130 GLN A HE21 1  
ATOM 2033  H HE22 . GLN A 1 130 ? 17.347  -7.918  -5.663  1.00 0.00 ? 130 GLN A HE22 1  
ATOM 2034  N N    . PRO A 1 131 ? 11.186  -3.532  -5.584  1.00 0.00 ? 131 PRO A N    1  
ATOM 2035  C CA   . PRO A 1 131 ? 10.047  -2.904  -4.849  1.00 0.00 ? 131 PRO A CA   1  
ATOM 2036  C C    . PRO A 1 131 ? 9.312   -3.743  -3.742  1.00 0.00 ? 131 PRO A C    1  
ATOM 2037  O O    . PRO A 1 131 ? 9.767   -4.794  -3.272  1.00 0.00 ? 131 PRO A O    1  
ATOM 2038  C CB   . PRO A 1 131 ? 9.188   -2.584  -6.103  1.00 0.00 ? 131 PRO A CB   1  
ATOM 2039  C CG   . PRO A 1 131 ? 9.306   -3.825  -6.990  1.00 0.00 ? 131 PRO A CG   1  
ATOM 2040  C CD   . PRO A 1 131 ? 10.763  -4.251  -6.809  1.00 0.00 ? 131 PRO A CD   1  
ATOM 2041  H HA   . PRO A 1 131 ? 10.356  -1.976  -4.341  1.00 0.00 ? 131 PRO A HA   1  
ATOM 2042  H HB2  . PRO A 1 131 ? 8.133   -2.338  -5.879  1.00 0.00 ? 131 PRO A HB2  1  
ATOM 2043  H HB3  . PRO A 1 131 ? 9.593   -1.692  -6.623  1.00 0.00 ? 131 PRO A HB3  1  
ATOM 2044  H HG2  . PRO A 1 131 ? 8.620   -4.617  -6.630  1.00 0.00 ? 131 PRO A HG2  1  
ATOM 2045  H HG3  . PRO A 1 131 ? 9.040   -3.621  -8.044  1.00 0.00 ? 131 PRO A HG3  1  
ATOM 2046  H HD2  . PRO A 1 131 ? 10.860  -5.348  -6.699  1.00 0.00 ? 131 PRO A HD2  1  
ATOM 2047  H HD3  . PRO A 1 131 ? 11.345  -3.944  -7.698  1.00 0.00 ? 131 PRO A HD3  1  
ATOM 2048  N N    . VAL A 1 132 ? 8.130   -3.226  -3.342  1.00 0.00 ? 132 VAL A N    1  
ATOM 2049  C CA   . VAL A 1 132 ? 7.161   -3.929  -2.437  1.00 0.00 ? 132 VAL A CA   1  
ATOM 2050  C C    . VAL A 1 132 ? 6.667   -5.274  -3.095  1.00 0.00 ? 132 VAL A C    1  
ATOM 2051  O O    . VAL A 1 132 ? 6.365   -5.315  -4.295  1.00 0.00 ? 132 VAL A O    1  
ATOM 2052  C CB   . VAL A 1 132 ? 5.993   -2.937  -2.096  1.00 0.00 ? 132 VAL A CB   1  
ATOM 2053  C CG1  . VAL A 1 132 ? 5.129   -2.462  -3.292  1.00 0.00 ? 132 VAL A CG1  1  
ATOM 2054  C CG2  . VAL A 1 132 ? 5.051   -3.492  -1.003  1.00 0.00 ? 132 VAL A CG2  1  
ATOM 2055  H H    . VAL A 1 132 ? 7.913   -2.325  -3.796  1.00 0.00 ? 132 VAL A H    1  
ATOM 2056  H HA   . VAL A 1 132 ? 7.682   -4.179  -1.497  1.00 0.00 ? 132 VAL A HA   1  
ATOM 2057  H HB   . VAL A 1 132 ? 6.464   -2.031  -1.663  1.00 0.00 ? 132 VAL A HB   1  
ATOM 2058  H HG11 . VAL A 1 132 ? 5.742   -2.014  -4.095  1.00 0.00 ? 132 VAL A HG11 1  
ATOM 2059  H HG12 . VAL A 1 132 ? 4.571   -3.296  -3.755  1.00 0.00 ? 132 VAL A HG12 1  
ATOM 2060  H HG13 . VAL A 1 132 ? 4.390   -1.695  -2.993  1.00 0.00 ? 132 VAL A HG13 1  
ATOM 2061  H HG21 . VAL A 1 132 ? 5.602   -3.845  -0.115  1.00 0.00 ? 132 VAL A HG21 1  
ATOM 2062  H HG22 . VAL A 1 132 ? 4.339   -2.724  -0.644  1.00 0.00 ? 132 VAL A HG22 1  
ATOM 2063  H HG23 . VAL A 1 132 ? 4.456   -4.354  -1.359  1.00 0.00 ? 132 VAL A HG23 1  
ATOM 2064  N N    . SER A 1 133 ? 6.599   -6.377  -2.321  1.00 0.00 ? 133 SER A N    1  
ATOM 2065  C CA   . SER A 1 133 ? 6.305   -7.718  -2.891  1.00 0.00 ? 133 SER A CA   1  
ATOM 2066  C C    . SER A 1 133 ? 5.265   -8.575  -2.101  1.00 0.00 ? 133 SER A C    1  
ATOM 2067  O O    . SER A 1 133 ? 5.500   -9.074  -0.989  1.00 0.00 ? 133 SER A O    1  
ATOM 2068  C CB   . SER A 1 133 ? 7.656   -8.479  -2.969  1.00 0.00 ? 133 SER A CB   1  
ATOM 2069  O OG   . SER A 1 133 ? 8.158   -8.810  -1.671  1.00 0.00 ? 133 SER A OG   1  
ATOM 2070  H H    . SER A 1 133 ? 6.843   -6.256  -1.330  1.00 0.00 ? 133 SER A H    1  
ATOM 2071  H HA   . SER A 1 133 ? 5.925   -7.604  -3.927  1.00 0.00 ? 133 SER A HA   1  
ATOM 2072  H HB2  . SER A 1 133 ? 7.534   -9.410  -3.556  1.00 0.00 ? 133 SER A HB2  1  
ATOM 2073  H HB3  . SER A 1 133 ? 8.416   -7.889  -3.520  1.00 0.00 ? 133 SER A HB3  1  
ATOM 2074  H HG   . SER A 1 133 ? 7.377   -8.957  -1.117  1.00 0.00 ? 133 SER A HG   1  
ATOM 2075  N N    . LEU A 1 134 ? 4.137   -8.837  -2.773  1.00 0.00 ? 134 LEU A N    1  
ATOM 2076  C CA   . LEU A 1 134 ? 3.076   -9.751  -2.271  1.00 0.00 ? 134 LEU A CA   1  
ATOM 2077  C C    . LEU A 1 134 ? 3.468   -11.144 -2.888  1.00 0.00 ? 134 LEU A C    1  
ATOM 2078  O O    . LEU A 1 134 ? 3.229   -11.458 -4.056  1.00 0.00 ? 134 LEU A O    1  
ATOM 2079  C CB   . LEU A 1 134 ? 1.681   -9.226  -2.687  1.00 0.00 ? 134 LEU A CB   1  
ATOM 2080  C CG   . LEU A 1 134 ? 1.361   -7.718  -2.424  1.00 0.00 ? 134 LEU A CG   1  
ATOM 2081  C CD1  . LEU A 1 134 ? 0.095   -7.251  -3.159  1.00 0.00 ? 134 LEU A CD1  1  
ATOM 2082  C CD2  . LEU A 1 134 ? 1.268   -7.383  -0.923  1.00 0.00 ? 134 LEU A CD2  1  
ATOM 2083  H H    . LEU A 1 134 ? 4.051   -8.362  -3.674  1.00 0.00 ? 134 LEU A H    1  
ATOM 2084  H HA   . LEU A 1 134 ? 3.083   -9.792  -1.161  1.00 0.00 ? 134 LEU A HA   1  
ATOM 2085  H HB2  . LEU A 1 134 ? 1.602   -9.464  -3.754  1.00 0.00 ? 134 LEU A HB2  1  
ATOM 2086  H HB3  . LEU A 1 134 ? 0.904   -9.852  -2.210  1.00 0.00 ? 134 LEU A HB3  1  
ATOM 2087  H HG   . LEU A 1 134 ? 2.183   -7.105  -2.840  1.00 0.00 ? 134 LEU A HG   1  
ATOM 2088  H HD11 . LEU A 1 134 ? 0.126   -7.485  -4.238  1.00 0.00 ? 134 LEU A HD11 1  
ATOM 2089  H HD12 . LEU A 1 134 ? -0.822  -7.700  -2.761  1.00 0.00 ? 134 LEU A HD12 1  
ATOM 2090  H HD13 . LEU A 1 134 ? -0.051  -6.160  -3.069  1.00 0.00 ? 134 LEU A HD13 1  
ATOM 2091  H HD21 . LEU A 1 134 ? 0.485   -7.963  -0.403  1.00 0.00 ? 134 LEU A HD21 1  
ATOM 2092  H HD22 . LEU A 1 134 ? 2.218   -7.591  -0.397  1.00 0.00 ? 134 LEU A HD22 1  
ATOM 2093  H HD23 . LEU A 1 134 ? 1.043   -6.313  -0.752  1.00 0.00 ? 134 LEU A HD23 1  
ATOM 2094  N N    . THR A 1 135 ? 4.177   -11.902 -2.058  1.00 0.00 ? 135 THR A N    1  
ATOM 2095  C CA   . THR A 1 135 ? 4.891   -13.171 -2.426  1.00 0.00 ? 135 THR A CA   1  
ATOM 2096  C C    . THR A 1 135 ? 4.053   -14.486 -2.301  1.00 0.00 ? 135 THR A C    1  
ATOM 2097  O O    . THR A 1 135 ? 2.904   -14.486 -1.865  1.00 0.00 ? 135 THR A O    1  
ATOM 2098  C CB   . THR A 1 135 ? 6.174   -13.283 -1.515  1.00 0.00 ? 135 THR A CB   1  
ATOM 2099  O OG1  . THR A 1 135 ? 5.826   -13.293 -0.129  1.00 0.00 ? 135 THR A OG1  1  
ATOM 2100  C CG2  . THR A 1 135 ? 7.203   -12.159 -1.719  1.00 0.00 ? 135 THR A CG2  1  
ATOM 2101  H H    . THR A 1 135 ? 4.215   -11.421 -1.156  1.00 0.00 ? 135 THR A H    1  
ATOM 2102  H HA   . THR A 1 135 ? 5.216   -13.111 -3.484  1.00 0.00 ? 135 THR A HA   1  
ATOM 2103  H HB   . THR A 1 135 ? 6.692   -14.233 -1.752  1.00 0.00 ? 135 THR A HB   1  
ATOM 2104  H HG1  . THR A 1 135 ? 5.178   -12.594 0.035   1.00 0.00 ? 135 THR A HG1  1  
ATOM 2105  H HG21 . THR A 1 135 ? 7.574   -12.124 -2.760  1.00 0.00 ? 135 THR A HG21 1  
ATOM 2106  H HG22 . THR A 1 135 ? 6.784   -11.167 -1.490  1.00 0.00 ? 135 THR A HG22 1  
ATOM 2107  H HG23 . THR A 1 135 ? 8.083   -12.300 -1.064  1.00 0.00 ? 135 THR A HG23 1  
ATOM 2108  N N    . ASN A 1 136 ? 4.613   -15.626 -2.739  1.00 0.00 ? 136 ASN A N    1  
ATOM 2109  C CA   . ASN A 1 136 ? 3.959   -16.966 -2.607  1.00 0.00 ? 136 ASN A CA   1  
ATOM 2110  C C    . ASN A 1 136 ? 4.210   -17.725 -1.245  1.00 0.00 ? 136 ASN A C    1  
ATOM 2111  O O    . ASN A 1 136 ? 3.475   -18.675 -0.968  1.00 0.00 ? 136 ASN A O    1  
ATOM 2112  C CB   . ASN A 1 136 ? 4.428   -17.828 -3.819  1.00 0.00 ? 136 ASN A CB   1  
ATOM 2113  C CG   . ASN A 1 136 ? 5.923   -18.195 -3.940  1.00 0.00 ? 136 ASN A CG   1  
ATOM 2114  O OD1  . ASN A 1 136 ? 6.822   -17.437 -3.591  1.00 0.00 ? 136 ASN A OD1  1  
ATOM 2115  N ND2  . ASN A 1 136 ? 6.238   -19.357 -4.457  1.00 0.00 ? 136 ASN A ND2  1  
ATOM 2116  H H    . ASN A 1 136 ? 5.572   -15.549 -3.098  1.00 0.00 ? 136 ASN A H    1  
ATOM 2117  H HA   . ASN A 1 136 ? 2.858   -16.856 -2.684  1.00 0.00 ? 136 ASN A HA   1  
ATOM 2118  H HB2  . ASN A 1 136 ? 3.820   -18.754 -3.822  1.00 0.00 ? 136 ASN A HB2  1  
ATOM 2119  H HB3  . ASN A 1 136 ? 4.142   -17.324 -4.759  1.00 0.00 ? 136 ASN A HB3  1  
ATOM 2120  H HD21 . ASN A 1 136 ? 5.471   -19.960 -4.765  1.00 0.00 ? 136 ASN A HD21 1  
ATOM 2121  H HD22 . ASN A 1 136 ? 7.246   -19.517 -4.538  1.00 0.00 ? 136 ASN A HD22 1  
ATOM 2122  N N    . MET A 1 137 ? 5.209   -17.347 -0.419  1.00 0.00 ? 137 MET A N    1  
ATOM 2123  C CA   . MET A 1 137 ? 5.552   -18.045 0.859   1.00 0.00 ? 137 MET A CA   1  
ATOM 2124  C C    . MET A 1 137 ? 5.707   -17.050 2.078   1.00 0.00 ? 137 MET A C    1  
ATOM 2125  O O    . MET A 1 137 ? 5.980   -15.863 1.856   1.00 0.00 ? 137 MET A O    1  
ATOM 2126  C CB   . MET A 1 137 ? 6.885   -18.824 0.625   1.00 0.00 ? 137 MET A CB   1  
ATOM 2127  C CG   . MET A 1 137 ? 6.796   -20.036 -0.328  1.00 0.00 ? 137 MET A CG   1  
ATOM 2128  S SD   . MET A 1 137 ? 8.384   -20.893 -0.377  1.00 0.00 ? 137 MET A SD   1  
ATOM 2129  C CE   . MET A 1 137 ? 8.064   -22.255 0.758   1.00 0.00 ? 137 MET A CE   1  
ATOM 2130  H H    . MET A 1 137 ? 5.747   -16.540 -0.751  1.00 0.00 ? 137 MET A H    1  
ATOM 2131  H HA   . MET A 1 137 ? 4.756   -18.767 1.123   1.00 0.00 ? 137 MET A HA   1  
ATOM 2132  H HB2  . MET A 1 137 ? 7.673   -18.132 0.268   1.00 0.00 ? 137 MET A HB2  1  
ATOM 2133  H HB3  . MET A 1 137 ? 7.277   -19.199 1.590   1.00 0.00 ? 137 MET A HB3  1  
ATOM 2134  H HG2  . MET A 1 137 ? 5.992   -20.732 -0.022  1.00 0.00 ? 137 MET A HG2  1  
ATOM 2135  H HG3  . MET A 1 137 ? 6.544   -19.708 -1.352  1.00 0.00 ? 137 MET A HG3  1  
ATOM 2136  H HE1  . MET A 1 137 ? 7.638   -21.884 1.708   1.00 0.00 ? 137 MET A HE1  1  
ATOM 2137  H HE2  . MET A 1 137 ? 7.357   -22.981 0.320   1.00 0.00 ? 137 MET A HE2  1  
ATOM 2138  H HE3  . MET A 1 137 ? 9.002   -22.783 1.006   1.00 0.00 ? 137 MET A HE3  1  
ATOM 2139  N N    . PRO A 1 138 ? 5.578   -17.472 3.379   1.00 0.00 ? 138 PRO A N    1  
ATOM 2140  C CA   . PRO A 1 138 ? 5.755   -16.559 4.553   1.00 0.00 ? 138 PRO A CA   1  
ATOM 2141  C C    . PRO A 1 138 ? 7.248   -16.169 4.869   1.00 0.00 ? 138 PRO A C    1  
ATOM 2142  O O    . PRO A 1 138 ? 8.154   -16.428 4.069   1.00 0.00 ? 138 PRO A O    1  
ATOM 2143  C CB   . PRO A 1 138 ? 5.047   -17.390 5.651   1.00 0.00 ? 138 PRO A CB   1  
ATOM 2144  C CG   . PRO A 1 138 ? 5.324   -18.849 5.287   1.00 0.00 ? 138 PRO A CG   1  
ATOM 2145  C CD   . PRO A 1 138 ? 5.238   -18.861 3.763   1.00 0.00 ? 138 PRO A CD   1  
ATOM 2146  H HA   . PRO A 1 138 ? 5.211   -15.609 4.390   1.00 0.00 ? 138 PRO A HA   1  
ATOM 2147  H HB2  . PRO A 1 138 ? 5.377   -17.150 6.679   1.00 0.00 ? 138 PRO A HB2  1  
ATOM 2148  H HB3  . PRO A 1 138 ? 3.957   -17.195 5.624   1.00 0.00 ? 138 PRO A HB3  1  
ATOM 2149  H HG2  . PRO A 1 138 ? 6.345   -19.145 5.606   1.00 0.00 ? 138 PRO A HG2  1  
ATOM 2150  H HG3  . PRO A 1 138 ? 4.620   -19.559 5.760   1.00 0.00 ? 138 PRO A HG3  1  
ATOM 2151  H HD2  . PRO A 1 138 ? 5.933   -19.612 3.341   1.00 0.00 ? 138 PRO A HD2  1  
ATOM 2152  H HD3  . PRO A 1 138 ? 4.214   -19.120 3.431   1.00 0.00 ? 138 PRO A HD3  1  
ATOM 2153  N N    . ASP A 1 139 ? 7.525   -15.545 6.038   1.00 0.00 ? 139 ASP A N    1  
ATOM 2154  C CA   . ASP A 1 139 ? 8.911   -15.115 6.408   1.00 0.00 ? 139 ASP A CA   1  
ATOM 2155  C C    . ASP A 1 139 ? 9.814   -16.281 6.958   1.00 0.00 ? 139 ASP A C    1  
ATOM 2156  O O    . ASP A 1 139 ? 10.281  -16.284 8.102   1.00 0.00 ? 139 ASP A O    1  
ATOM 2157  C CB   . ASP A 1 139 ? 8.778   -13.936 7.417   1.00 0.00 ? 139 ASP A CB   1  
ATOM 2158  C CG   . ASP A 1 139 ? 9.981   -12.982 7.516   1.00 0.00 ? 139 ASP A CG   1  
ATOM 2159  O OD1  . ASP A 1 139 ? 10.986  -13.136 6.787   1.00 0.00 ? 139 ASP A OD1  1  
ATOM 2160  O OD2  . ASP A 1 139 ? 9.917   -12.018 8.311   1.00 0.00 ? 139 ASP A OD2  1  
ATOM 2161  H H    . ASP A 1 139 ? 6.720   -15.367 6.645   1.00 0.00 ? 139 ASP A H    1  
ATOM 2162  H HA   . ASP A 1 139 ? 9.421   -14.727 5.503   1.00 0.00 ? 139 ASP A HA   1  
ATOM 2163  H HB2  . ASP A 1 139 ? 7.913   -13.309 7.159   1.00 0.00 ? 139 ASP A HB2  1  
ATOM 2164  H HB3  . ASP A 1 139 ? 8.549   -14.314 8.431   1.00 0.00 ? 139 ASP A HB3  1  
ATOM 2165  N N    . GLU A 1 140 ? 10.115  -17.253 6.083   1.00 0.00 ? 140 GLU A N    1  
ATOM 2166  C CA   . GLU A 1 140 ? 11.049  -18.381 6.383   1.00 0.00 ? 140 GLU A CA   1  
ATOM 2167  C C    . GLU A 1 140 ? 12.451  -18.091 5.726   1.00 0.00 ? 140 GLU A C    1  
ATOM 2168  O O    . GLU A 1 140 ? 13.027  -18.913 5.009   1.00 0.00 ? 140 GLU A O    1  
ATOM 2169  C CB   . GLU A 1 140 ? 10.341  -19.698 5.932   1.00 0.00 ? 140 GLU A CB   1  
ATOM 2170  C CG   . GLU A 1 140 ? 9.955   -19.882 4.435   1.00 0.00 ? 140 GLU A CG   1  
ATOM 2171  C CD   . GLU A 1 140 ? 9.149   -21.142 4.147   1.00 0.00 ? 140 GLU A CD   1  
ATOM 2172  O OE1  . GLU A 1 140 ? 9.755   -22.194 3.857   1.00 0.00 ? 140 GLU A OE1  1  
ATOM 2173  O OE2  . GLU A 1 140 ? 7.901   -21.073 4.186   1.00 0.00 ? 140 GLU A OE2  1  
ATOM 2174  H H    . GLU A 1 140 ? 9.651   -17.144 5.169   1.00 0.00 ? 140 GLU A H    1  
ATOM 2175  H HA   . GLU A 1 140 ? 11.232  -18.472 7.471   1.00 0.00 ? 140 GLU A HA   1  
ATOM 2176  H HB2  . GLU A 1 140 ? 10.980  -20.552 6.229   1.00 0.00 ? 140 GLU A HB2  1  
ATOM 2177  H HB3  . GLU A 1 140 ? 9.426   -19.820 6.546   1.00 0.00 ? 140 GLU A HB3  1  
ATOM 2178  H HG2  . GLU A 1 140 ? 9.354   -19.030 4.072   1.00 0.00 ? 140 GLU A HG2  1  
ATOM 2179  H HG3  . GLU A 1 140 ? 10.859  -19.908 3.802   1.00 0.00 ? 140 GLU A HG3  1  
ATOM 2180  N N    . GLY A 1 141 ? 13.029  -16.908 6.042   1.00 0.00 ? 141 GLY A N    1  
ATOM 2181  C CA   . GLY A 1 141 ? 14.277  -16.406 5.402   1.00 0.00 ? 141 GLY A CA   1  
ATOM 2182  C C    . GLY A 1 141 ? 14.053  -15.942 3.942   1.00 0.00 ? 141 GLY A C    1  
ATOM 2183  O O    . GLY A 1 141 ? 14.725  -16.447 3.042   1.00 0.00 ? 141 GLY A O    1  
ATOM 2184  H H    . GLY A 1 141 ? 12.415  -16.325 6.625   1.00 0.00 ? 141 GLY A H    1  
ATOM 2185  H HA2  . GLY A 1 141 ? 14.692  -15.567 5.990   1.00 0.00 ? 141 GLY A HA2  1  
ATOM 2186  H HA3  . GLY A 1 141 ? 15.058  -17.192 5.416   1.00 0.00 ? 141 GLY A HA3  1  
ATOM 2187  N N    . VAL A 1 142 ? 13.142  -14.972 3.717   1.00 0.00 ? 142 VAL A N    1  
ATOM 2188  C CA   . VAL A 1 142 ? 12.736  -14.568 2.334   1.00 0.00 ? 142 VAL A CA   1  
ATOM 2189  C C    . VAL A 1 142 ? 12.983  -13.046 2.099   1.00 0.00 ? 142 VAL A C    1  
ATOM 2190  O O    . VAL A 1 142 ? 13.968  -12.663 1.463   1.00 0.00 ? 142 VAL A O    1  
ATOM 2191  C CB   . VAL A 1 142 ? 11.257  -15.115 2.101   1.00 0.00 ? 142 VAL A CB   1  
ATOM 2192  C CG1  . VAL A 1 142 ? 9.992   -14.255 2.359   1.00 0.00 ? 142 VAL A CG1  1  
ATOM 2193  C CG2  . VAL A 1 142 ? 11.108  -15.713 0.684   1.00 0.00 ? 142 VAL A CG2  1  
ATOM 2194  H H    . VAL A 1 142 ? 12.649  -14.652 4.559   1.00 0.00 ? 142 VAL A H    1  
ATOM 2195  H HA   . VAL A 1 142 ? 13.405  -15.053 1.594   1.00 0.00 ? 142 VAL A HA   1  
ATOM 2196  H HB   . VAL A 1 142 ? 11.103  -15.923 2.831   1.00 0.00 ? 142 VAL A HB   1  
ATOM 2197  H HG11 . VAL A 1 142 ? 9.964   -13.850 3.387   1.00 0.00 ? 142 VAL A HG11 1  
ATOM 2198  H HG12 . VAL A 1 142 ? 9.893   -13.414 1.649   1.00 0.00 ? 142 VAL A HG12 1  
ATOM 2199  H HG13 . VAL A 1 142 ? 9.065   -14.853 2.253   1.00 0.00 ? 142 VAL A HG13 1  
ATOM 2200  H HG21 . VAL A 1 142 ? 11.872  -16.489 0.487   1.00 0.00 ? 142 VAL A HG21 1  
ATOM 2201  H HG22 . VAL A 1 142 ? 10.128  -16.206 0.538   1.00 0.00 ? 142 VAL A HG22 1  
ATOM 2202  H HG23 . VAL A 1 142 ? 11.211  -14.943 -0.104  1.00 0.00 ? 142 VAL A HG23 1  
ATOM 2203  N N    . MET A 1 143 ? 12.112  -12.194 2.649   1.00 0.00 ? 143 MET A N    1  
ATOM 2204  C CA   . MET A 1 143 ? 12.139  -10.715 2.430   1.00 0.00 ? 143 MET A CA   1  
ATOM 2205  C C    . MET A 1 143 ? 11.672  -9.902  3.701   1.00 0.00 ? 143 MET A C    1  
ATOM 2206  O O    . MET A 1 143 ? 11.533  -10.425 4.816   1.00 0.00 ? 143 MET A O    1  
ATOM 2207  C CB   . MET A 1 143 ? 11.289  -10.459 1.135   1.00 0.00 ? 143 MET A CB   1  
ATOM 2208  C CG   . MET A 1 143 ? 12.075  -10.490 -0.190  1.00 0.00 ? 143 MET A CG   1  
ATOM 2209  S SD   . MET A 1 143 ? 10.986  -9.984  -1.535  1.00 0.00 ? 143 MET A SD   1  
ATOM 2210  C CE   . MET A 1 143 ? 12.135  -10.056 -2.918  1.00 0.00 ? 143 MET A CE   1  
ATOM 2211  H H    . MET A 1 143 ? 11.367  -12.751 3.102   1.00 0.00 ? 143 MET A H    1  
ATOM 2212  H HA   . MET A 1 143 ? 13.181  -10.377 2.259   1.00 0.00 ? 143 MET A HA   1  
ATOM 2213  H HB2  . MET A 1 143 ? 10.431  -11.155 1.065   1.00 0.00 ? 143 MET A HB2  1  
ATOM 2214  H HB3  . MET A 1 143 ? 10.810  -9.470  1.174   1.00 0.00 ? 143 MET A HB3  1  
ATOM 2215  H HG2  . MET A 1 143 ? 12.944  -9.807  -0.151  1.00 0.00 ? 143 MET A HG2  1  
ATOM 2216  H HG3  . MET A 1 143 ? 12.472  -11.502 -0.397  1.00 0.00 ? 143 MET A HG3  1  
ATOM 2217  H HE1  . MET A 1 143 ? 12.990  -9.375  -2.761  1.00 0.00 ? 143 MET A HE1  1  
ATOM 2218  H HE2  . MET A 1 143 ? 12.527  -11.081 -3.051  1.00 0.00 ? 143 MET A HE2  1  
ATOM 2219  H HE3  . MET A 1 143 ? 11.629  -9.759  -3.854  1.00 0.00 ? 143 MET A HE3  1  
ATOM 2220  N N    . VAL A 1 144 ? 11.475  -8.575  3.551   1.00 0.00 ? 144 VAL A N    1  
ATOM 2221  C CA   . VAL A 1 144 ? 11.116  -7.663  4.678   1.00 0.00 ? 144 VAL A CA   1  
ATOM 2222  C C    . VAL A 1 144 ? 9.561   -7.506  4.819   1.00 0.00 ? 144 VAL A C    1  
ATOM 2223  O O    . VAL A 1 144 ? 8.936   -6.604  4.255   1.00 0.00 ? 144 VAL A O    1  
ATOM 2224  C CB   . VAL A 1 144 ? 11.847  -6.279  4.485   1.00 0.00 ? 144 VAL A CB   1  
ATOM 2225  C CG1  . VAL A 1 144 ? 11.531  -5.241  5.595   1.00 0.00 ? 144 VAL A CG1  1  
ATOM 2226  C CG2  . VAL A 1 144 ? 13.392  -6.386  4.440   1.00 0.00 ? 144 VAL A CG2  1  
ATOM 2227  H H    . VAL A 1 144 ? 11.612  -8.203  2.597   1.00 0.00 ? 144 VAL A H    1  
ATOM 2228  H HA   . VAL A 1 144 ? 11.494  -8.070  5.637   1.00 0.00 ? 144 VAL A HA   1  
ATOM 2229  H HB   . VAL A 1 144 ? 11.514  -5.843  3.521   1.00 0.00 ? 144 VAL A HB   1  
ATOM 2230  H HG11 . VAL A 1 144 ? 11.801  -5.602  6.605   1.00 0.00 ? 144 VAL A HG11 1  
ATOM 2231  H HG12 . VAL A 1 144 ? 12.070  -4.285  5.442   1.00 0.00 ? 144 VAL A HG12 1  
ATOM 2232  H HG13 . VAL A 1 144 ? 10.459  -4.972  5.625   1.00 0.00 ? 144 VAL A HG13 1  
ATOM 2233  H HG21 . VAL A 1 144 ? 13.733  -7.041  3.617   1.00 0.00 ? 144 VAL A HG21 1  
ATOM 2234  H HG22 . VAL A 1 144 ? 13.867  -5.401  4.269   1.00 0.00 ? 144 VAL A HG22 1  
ATOM 2235  H HG23 . VAL A 1 144 ? 13.815  -6.795  5.376   1.00 0.00 ? 144 VAL A HG23 1  
ATOM 2236  N N    . THR A 1 145 ? 8.949   -8.380  5.634   1.00 0.00 ? 145 THR A N    1  
ATOM 2237  C CA   . THR A 1 145 ? 7.523   -8.229  6.080   1.00 0.00 ? 145 THR A CA   1  
ATOM 2238  C C    . THR A 1 145 ? 7.476   -7.730  7.574   1.00 0.00 ? 145 THR A C    1  
ATOM 2239  O O    . THR A 1 145 ? 6.771   -8.261  8.433   1.00 0.00 ? 145 THR A O    1  
ATOM 2240  C CB   . THR A 1 145 ? 6.757   -9.561  5.852   1.00 0.00 ? 145 THR A CB   1  
ATOM 2241  O OG1  . THR A 1 145 ? 5.404   -9.380  6.239   1.00 0.00 ? 145 THR A OG1  1  
ATOM 2242  C CG2  . THR A 1 145 ? 7.255   -10.792 6.617   1.00 0.00 ? 145 THR A CG2  1  
ATOM 2243  H H    . THR A 1 145 ? 9.559   -9.096  6.034   1.00 0.00 ? 145 THR A H    1  
ATOM 2244  H HA   . THR A 1 145 ? 6.993   -7.458  5.484   1.00 0.00 ? 145 THR A HA   1  
ATOM 2245  H HB   . THR A 1 145 ? 6.788   -9.784  4.773   1.00 0.00 ? 145 THR A HB   1  
ATOM 2246  H HG1  . THR A 1 145 ? 5.402   -9.207  7.194   1.00 0.00 ? 145 THR A HG1  1  
ATOM 2247  H HG21 . THR A 1 145 ? 7.281   -10.649 7.713   1.00 0.00 ? 145 THR A HG21 1  
ATOM 2248  H HG22 . THR A 1 145 ? 6.603   -11.661 6.421   1.00 0.00 ? 145 THR A HG22 1  
ATOM 2249  H HG23 . THR A 1 145 ? 8.275   -11.076 6.299   1.00 0.00 ? 145 THR A HG23 1  
ATOM 2250  N N    . LYS A 1 146 ? 8.247   -6.685  7.880   1.00 0.00 ? 146 LYS A N    1  
ATOM 2251  C CA   . LYS A 1 146 ? 8.338   -6.075  9.230   1.00 0.00 ? 146 LYS A CA   1  
ATOM 2252  C C    . LYS A 1 146 ? 8.742   -4.594  8.970   1.00 0.00 ? 146 LYS A C    1  
ATOM 2253  O O    . LYS A 1 146 ? 9.899   -4.202  9.156   1.00 0.00 ? 146 LYS A O    1  
ATOM 2254  C CB   . LYS A 1 146 ? 9.298   -6.895  10.163  1.00 0.00 ? 146 LYS A CB   1  
ATOM 2255  C CG   . LYS A 1 146 ? 10.707  -7.356  9.673   1.00 0.00 ? 146 LYS A CG   1  
ATOM 2256  C CD   . LYS A 1 146 ? 10.709  -8.725  8.942   1.00 0.00 ? 146 LYS A CD   1  
ATOM 2257  C CE   . LYS A 1 146 ? 12.098  -9.221  8.497   1.00 0.00 ? 146 LYS A CE   1  
ATOM 2258  N NZ   . LYS A 1 146 ? 11.962  -10.473 7.692   1.00 0.00 ? 146 LYS A NZ   1  
ATOM 2259  H H    . LYS A 1 146 ? 8.795   -6.353  7.079   1.00 0.00 ? 146 LYS A H    1  
ATOM 2260  H HA   . LYS A 1 146 ? 7.339   -6.063  9.714   1.00 0.00 ? 146 LYS A HA   1  
ATOM 2261  H HB2  . LYS A 1 146 ? 9.436   -6.297  11.085  1.00 0.00 ? 146 LYS A HB2  1  
ATOM 2262  H HB3  . LYS A 1 146 ? 8.741   -7.783  10.520  1.00 0.00 ? 146 LYS A HB3  1  
ATOM 2263  H HG2  . LYS A 1 146 ? 11.160  -6.566  9.042   1.00 0.00 ? 146 LYS A HG2  1  
ATOM 2264  H HG3  . LYS A 1 146 ? 11.373  -7.428  10.556  1.00 0.00 ? 146 LYS A HG3  1  
ATOM 2265  H HD2  . LYS A 1 146 ? 10.233  -9.490  9.590   1.00 0.00 ? 146 LYS A HD2  1  
ATOM 2266  H HD3  . LYS A 1 146 ? 10.049  -8.663  8.064   1.00 0.00 ? 146 LYS A HD3  1  
ATOM 2267  H HE2  . LYS A 1 146 ? 12.635  -8.435  7.922   1.00 0.00 ? 146 LYS A HE2  1  
ATOM 2268  H HE3  . LYS A 1 146 ? 12.726  -9.402  9.397   1.00 0.00 ? 146 LYS A HE3  1  
ATOM 2269  H HZ1  . LYS A 1 146 ? 11.149  -11.093 7.990   1.00 0.00 ? 146 LYS A HZ1  1  
ATOM 2270  H HZ2  . LYS A 1 146 ? 11.774  -10.361 6.679   1.00 0.00 ? 146 LYS A HZ2  1  
ATOM 2271  H HZ3  . LYS A 1 146 ? 12.755  -11.124 7.738   1.00 0.00 ? 146 LYS A HZ3  1  
ATOM 2272  N N    . PHE A 1 147 ? 7.766   -3.773  8.524   1.00 0.00 ? 147 PHE A N    1  
ATOM 2273  C CA   . PHE A 1 147 ? 8.034   -2.360  8.110   1.00 0.00 ? 147 PHE A CA   1  
ATOM 2274  C C    . PHE A 1 147 ? 7.193   -1.334  8.931   1.00 0.00 ? 147 PHE A C    1  
ATOM 2275  O O    . PHE A 1 147 ? 6.016   -1.539  9.231   1.00 0.00 ? 147 PHE A O    1  
ATOM 2276  C CB   . PHE A 1 147 ? 7.819   -2.230  6.572   1.00 0.00 ? 147 PHE A CB   1  
ATOM 2277  C CG   . PHE A 1 147 ? 6.561   -2.809  5.887   1.00 0.00 ? 147 PHE A CG   1  
ATOM 2278  C CD1  . PHE A 1 147 ? 6.579   -4.126  5.408   1.00 0.00 ? 147 PHE A CD1  1  
ATOM 2279  C CD2  . PHE A 1 147 ? 5.448   -2.003  5.633   1.00 0.00 ? 147 PHE A CD2  1  
ATOM 2280  C CE1  . PHE A 1 147 ? 5.501   -4.628  4.686   1.00 0.00 ? 147 PHE A CE1  1  
ATOM 2281  C CE2  . PHE A 1 147 ? 4.373   -2.505  4.902   1.00 0.00 ? 147 PHE A CE2  1  
ATOM 2282  C CZ   . PHE A 1 147 ? 4.400   -3.816  4.432   1.00 0.00 ? 147 PHE A CZ   1  
ATOM 2283  H H    . PHE A 1 147 ? 6.844   -4.226  8.404   1.00 0.00 ? 147 PHE A H    1  
ATOM 2284  H HA   . PHE A 1 147 ? 9.101   -2.106  8.289   1.00 0.00 ? 147 PHE A HA   1  
ATOM 2285  H HB2  . PHE A 1 147 ? 7.916   -1.161  6.302   1.00 0.00 ? 147 PHE A HB2  1  
ATOM 2286  H HB3  . PHE A 1 147 ? 8.706   -2.678  6.083   1.00 0.00 ? 147 PHE A HB3  1  
ATOM 2287  H HD1  . PHE A 1 147 ? 7.444   -4.753  5.570   1.00 0.00 ? 147 PHE A HD1  1  
ATOM 2288  H HD2  . PHE A 1 147 ? 5.425   -0.981  5.981   1.00 0.00 ? 147 PHE A HD2  1  
ATOM 2289  H HE1  . PHE A 1 147 ? 5.528   -5.639  4.306   1.00 0.00 ? 147 PHE A HE1  1  
ATOM 2290  H HE2  . PHE A 1 147 ? 3.521   -1.875  4.695   1.00 0.00 ? 147 PHE A HE2  1  
ATOM 2291  H HZ   . PHE A 1 147 ? 3.572   -4.204  3.859   1.00 0.00 ? 147 PHE A HZ   1  
ATOM 2292  N N    . TYR A 1 148 ? 7.825   -0.206  9.291   1.00 0.00 ? 148 TYR A N    1  
ATOM 2293  C CA   . TYR A 1 148 ? 7.239   0.843   10.162  1.00 0.00 ? 148 TYR A CA   1  
ATOM 2294  C C    . TYR A 1 148 ? 6.191   1.735   9.411   1.00 0.00 ? 148 TYR A C    1  
ATOM 2295  O O    . TYR A 1 148 ? 6.388   2.203   8.283   1.00 0.00 ? 148 TYR A O    1  
ATOM 2296  C CB   . TYR A 1 148 ? 8.440   1.668   10.715  1.00 0.00 ? 148 TYR A CB   1  
ATOM 2297  C CG   . TYR A 1 148 ? 8.183   2.437   12.027  1.00 0.00 ? 148 TYR A CG   1  
ATOM 2298  C CD1  . TYR A 1 148 ? 7.377   3.582   12.048  1.00 0.00 ? 148 TYR A CD1  1  
ATOM 2299  C CD2  . TYR A 1 148 ? 8.786   2.010   13.216  1.00 0.00 ? 148 TYR A CD2  1  
ATOM 2300  C CE1  . TYR A 1 148 ? 7.168   4.278   13.235  1.00 0.00 ? 148 TYR A CE1  1  
ATOM 2301  C CE2  . TYR A 1 148 ? 8.596   2.723   14.399  1.00 0.00 ? 148 TYR A CE2  1  
ATOM 2302  C CZ   . TYR A 1 148 ? 7.781   3.850   14.408  1.00 0.00 ? 148 TYR A CZ   1  
ATOM 2303  O OH   . TYR A 1 148 ? 7.579   4.533   15.576  1.00 0.00 ? 148 TYR A OH   1  
ATOM 2304  H H    . TYR A 1 148 ? 8.785   -0.120  8.932   1.00 0.00 ? 148 TYR A H    1  
ATOM 2305  H HA   . TYR A 1 148 ? 6.745   0.335   11.009  1.00 0.00 ? 148 TYR A HA   1  
ATOM 2306  H HB2  . TYR A 1 148 ? 9.315   1.007   10.880  1.00 0.00 ? 148 TYR A HB2  1  
ATOM 2307  H HB3  . TYR A 1 148 ? 8.805   2.362   9.936   1.00 0.00 ? 148 TYR A HB3  1  
ATOM 2308  H HD1  . TYR A 1 148 ? 6.896   3.928   11.147  1.00 0.00 ? 148 TYR A HD1  1  
ATOM 2309  H HD2  . TYR A 1 148 ? 9.405   1.125   13.231  1.00 0.00 ? 148 TYR A HD2  1  
ATOM 2310  H HE1  . TYR A 1 148 ? 6.522   5.144   13.240  1.00 0.00 ? 148 TYR A HE1  1  
ATOM 2311  H HE2  . TYR A 1 148 ? 9.069   2.396   15.313  1.00 0.00 ? 148 TYR A HE2  1  
ATOM 2312  H HH   . TYR A 1 148 ? 6.975   5.259   15.407  1.00 0.00 ? 148 TYR A HH   1  
ATOM 2313  N N    . PHE A 1 149 ? 5.073   1.971   10.111  1.00 0.00 ? 149 PHE A N    1  
ATOM 2314  C CA   . PHE A 1 149 ? 3.879   2.676   9.582   1.00 0.00 ? 149 PHE A CA   1  
ATOM 2315  C C    . PHE A 1 149 ? 3.838   4.189   10.034  1.00 0.00 ? 149 PHE A C    1  
ATOM 2316  O O    . PHE A 1 149 ? 3.753   4.469   11.232  1.00 0.00 ? 149 PHE A O    1  
ATOM 2317  C CB   . PHE A 1 149 ? 2.694   1.779   10.123  1.00 0.00 ? 149 PHE A CB   1  
ATOM 2318  C CG   . PHE A 1 149 ? 1.522   1.471   9.179   1.00 0.00 ? 149 PHE A CG   1  
ATOM 2319  C CD1  . PHE A 1 149 ? 1.769   0.917   7.919   1.00 0.00 ? 149 PHE A CD1  1  
ATOM 2320  C CD2  . PHE A 1 149 ? 0.200   1.703   9.569   1.00 0.00 ? 149 PHE A CD2  1  
ATOM 2321  C CE1  . PHE A 1 149 ? 0.726   0.707   7.021   1.00 0.00 ? 149 PHE A CE1  1  
ATOM 2322  C CE2  . PHE A 1 149 ? -0.845  1.487   8.672   1.00 0.00 ? 149 PHE A CE2  1  
ATOM 2323  C CZ   . PHE A 1 149 ? -0.580  0.998   7.396   1.00 0.00 ? 149 PHE A CZ   1  
ATOM 2324  H H    . PHE A 1 149 ? 5.052   1.524   11.036  1.00 0.00 ? 149 PHE A H    1  
ATOM 2325  H HA   . PHE A 1 149 ? 3.904   2.661   8.469   1.00 0.00 ? 149 PHE A HA   1  
ATOM 2326  H HB2  . PHE A 1 149 ? 3.020   0.768   10.449  1.00 0.00 ? 149 PHE A HB2  1  
ATOM 2327  H HB3  . PHE A 1 149 ? 2.320   2.215   11.071  1.00 0.00 ? 149 PHE A HB3  1  
ATOM 2328  H HD1  . PHE A 1 149 ? 2.772   0.639   7.643   1.00 0.00 ? 149 PHE A HD1  1  
ATOM 2329  H HD2  . PHE A 1 149 ? -0.023  2.084   10.555  1.00 0.00 ? 149 PHE A HD2  1  
ATOM 2330  H HE1  . PHE A 1 149 ? 0.937   0.319   6.036   1.00 0.00 ? 149 PHE A HE1  1  
ATOM 2331  H HE2  . PHE A 1 149 ? -1.853  1.727   8.961   1.00 0.00 ? 149 PHE A HE2  1  
ATOM 2332  H HZ   . PHE A 1 149 ? -1.386  0.857   6.693   1.00 0.00 ? 149 PHE A HZ   1  
ATOM 2333  N N    . GLN A 1 150 ? 3.921   5.164   9.095   1.00 0.00 ? 150 GLN A N    1  
ATOM 2334  C CA   . GLN A 1 150 ? 3.912   6.636   9.410   1.00 0.00 ? 150 GLN A CA   1  
ATOM 2335  C C    . GLN A 1 150 ? 2.764   7.416   8.675   1.00 0.00 ? 150 GLN A C    1  
ATOM 2336  O O    . GLN A 1 150 ? 2.472   7.152   7.506   1.00 0.00 ? 150 GLN A O    1  
ATOM 2337  C CB   . GLN A 1 150 ? 5.278   7.248   8.969   1.00 0.00 ? 150 GLN A CB   1  
ATOM 2338  C CG   . GLN A 1 150 ? 6.521   6.870   9.812   1.00 0.00 ? 150 GLN A CG   1  
ATOM 2339  C CD   . GLN A 1 150 ? 6.613   7.512   11.204  1.00 0.00 ? 150 GLN A CD   1  
ATOM 2340  O OE1  . GLN A 1 150 ? 5.780   7.308   12.079  1.00 0.00 ? 150 GLN A OE1  1  
ATOM 2341  N NE2  . GLN A 1 150 ? 7.635   8.289   11.472  1.00 0.00 ? 150 GLN A NE2  1  
ATOM 2342  H H    . GLN A 1 150 ? 3.979   4.846   8.116   1.00 0.00 ? 150 GLN A H    1  
ATOM 2343  H HA   . GLN A 1 150 ? 3.786   6.798   10.500  1.00 0.00 ? 150 GLN A HA   1  
ATOM 2344  H HB2  . GLN A 1 150 ? 5.469   6.973   7.912   1.00 0.00 ? 150 GLN A HB2  1  
ATOM 2345  H HB3  . GLN A 1 150 ? 5.211   8.354   8.950   1.00 0.00 ? 150 GLN A HB3  1  
ATOM 2346  H HG2  . GLN A 1 150 ? 6.557   5.775   9.940   1.00 0.00 ? 150 GLN A HG2  1  
ATOM 2347  H HG3  . GLN A 1 150 ? 7.427   7.108   9.223   1.00 0.00 ? 150 GLN A HG3  1  
ATOM 2348  H HE21 . GLN A 1 150 ? 8.312   8.451   10.724  1.00 0.00 ? 150 GLN A HE21 1  
ATOM 2349  H HE22 . GLN A 1 150 ? 7.620   8.687   12.415  1.00 0.00 ? 150 GLN A HE22 1  
ATOM 2350  N N    . GLU A 1 151 ? 2.153   8.425   9.329   1.00 0.00 ? 151 GLU A N    1  
ATOM 2351  C CA   . GLU A 1 151 ? 1.049   9.241   8.727   1.00 0.00 ? 151 GLU A CA   1  
ATOM 2352  C C    . GLU A 1 151 ? 1.479   10.728  8.428   1.00 0.00 ? 151 GLU A C    1  
ATOM 2353  O O    . GLU A 1 151 ? 2.349   11.307  9.086   1.00 0.00 ? 151 GLU A O    1  
ATOM 2354  C CB   . GLU A 1 151 ? -0.158  9.164   9.712   1.00 0.00 ? 151 GLU A CB   1  
ATOM 2355  C CG   . GLU A 1 151 ? -1.529  9.556   9.088   1.00 0.00 ? 151 GLU A CG   1  
ATOM 2356  C CD   . GLU A 1 151 ? -2.778  9.344   9.937   1.00 0.00 ? 151 GLU A CD   1  
ATOM 2357  O OE1  . GLU A 1 151 ? -2.789  8.491   10.848  1.00 0.00 ? 151 GLU A OE1  1  
ATOM 2358  O OE2  . GLU A 1 151 ? -3.785  10.037  9.666   1.00 0.00 ? 151 GLU A OE2  1  
ATOM 2359  H H    . GLU A 1 151 ? 2.460   8.580   10.294  1.00 0.00 ? 151 GLU A H    1  
ATOM 2360  H HA   . GLU A 1 151 ? 0.723   8.787   7.769   1.00 0.00 ? 151 GLU A HA   1  
ATOM 2361  H HB2  . GLU A 1 151 ? -0.261  8.130   10.097  1.00 0.00 ? 151 GLU A HB2  1  
ATOM 2362  H HB3  . GLU A 1 151 ? 0.035   9.779   10.612  1.00 0.00 ? 151 GLU A HB3  1  
ATOM 2363  H HG2  . GLU A 1 151 ? -1.518  10.619  8.785   1.00 0.00 ? 151 GLU A HG2  1  
ATOM 2364  H HG3  . GLU A 1 151 ? -1.699  8.991   8.156   1.00 0.00 ? 151 GLU A HG3  1  
ATOM 2365  N N    . ASP A 1 152 ? 0.844   11.330  7.399   1.00 0.00 ? 152 ASP A N    1  
ATOM 2366  C CA   . ASP A 1 152 ? 1.017   12.752  6.949   1.00 0.00 ? 152 ASP A CA   1  
ATOM 2367  C C    . ASP A 1 152 ? 2.480   13.081  6.472   1.00 0.00 ? 152 ASP A C    1  
ATOM 2368  O O    . ASP A 1 152 ? 3.082   12.273  5.749   1.00 0.00 ? 152 ASP A O    1  
ATOM 2369  C CB   . ASP A 1 152 ? 0.366   13.686  8.028   1.00 0.00 ? 152 ASP A CB   1  
ATOM 2370  C CG   . ASP A 1 152 ? -1.163  13.624  8.098   1.00 0.00 ? 152 ASP A CG   1  
ATOM 2371  O OD1  . ASP A 1 152 ? -1.834  13.783  7.056   1.00 0.00 ? 152 ASP A OD1  1  
ATOM 2372  O OD2  . ASP A 1 152 ? -1.709  13.433  9.204   1.00 0.00 ? 152 ASP A OD2  1  
ATOM 2373  H H    . ASP A 1 152 ? 0.139   10.731  6.937   1.00 0.00 ? 152 ASP A H    1  
ATOM 2374  H HA   . ASP A 1 152 ? 0.450   12.902  6.016   1.00 0.00 ? 152 ASP A HA   1  
ATOM 2375  H HB2  . ASP A 1 152 ? 0.796   13.503  9.031   1.00 0.00 ? 152 ASP A HB2  1  
ATOM 2376  H HB3  . ASP A 1 152 ? 0.594   14.742  7.807   1.00 0.00 ? 152 ASP A HB3  1  
ATOM 2377  N N    . GLU A 1 153 ? 3.016   14.270  6.795   1.00 0.00 ? 153 GLU A N    1  
ATOM 2378  C CA   . GLU A 1 153 ? 4.355   14.751  6.339   1.00 0.00 ? 153 GLU A CA   1  
ATOM 2379  C C    . GLU A 1 153 ? 5.336   14.898  7.544   1.00 0.00 ? 153 GLU A C    1  
ATOM 2380  O O    . GLU A 1 153 ? 5.143   15.776  8.416   1.00 0.00 ? 153 GLU A O    1  
ATOM 2381  C CB   . GLU A 1 153 ? 4.175   16.088  5.563   1.00 0.00 ? 153 GLU A CB   1  
ATOM 2382  C CG   . GLU A 1 153 ? 3.382   15.952  4.234   1.00 0.00 ? 153 GLU A CG   1  
ATOM 2383  C CD   . GLU A 1 153 ? 3.294   17.182  3.347   1.00 0.00 ? 153 GLU A CD   1  
ATOM 2384  O OE1  . GLU A 1 153 ? 2.813   18.239  3.800   1.00 0.00 ? 153 GLU A OE1  1  
ATOM 2385  O OE2  . GLU A 1 153 ? 3.643   17.063  2.153   1.00 0.00 ? 153 GLU A OE2  1  
ATOM 2386  O OXT  . GLU A 1 153 ? 6.317   14.112  7.618   1.00 0.00 ? 153 GLU A OXT  1  
ATOM 2387  H H    . GLU A 1 153 ? 2.404   14.831  7.392   1.00 0.00 ? 153 GLU A H    1  
ATOM 2388  H HA   . GLU A 1 153 ? 4.820   14.040  5.632   1.00 0.00 ? 153 GLU A HA   1  
ATOM 2389  H HB2  . GLU A 1 153 ? 3.699   16.847  6.214   1.00 0.00 ? 153 GLU A HB2  1  
ATOM 2390  H HB3  . GLU A 1 153 ? 5.177   16.501  5.336   1.00 0.00 ? 153 GLU A HB3  1  
ATOM 2391  H HG2  . GLU A 1 153 ? 3.813   15.133  3.634   1.00 0.00 ? 153 GLU A HG2  1  
ATOM 2392  H HG3  . GLU A 1 153 ? 2.344   15.655  4.456   1.00 0.00 ? 153 GLU A HG3  1  
ATOM 2393  N N    . MET A 1 1   ? -6.890  7.792   -5.208  1.00 0.00 ? 1   MET A N    2  
ATOM 2394  C CA   . MET A 1 1   ? -8.350  7.528   -5.089  1.00 0.00 ? 1   MET A CA   2  
ATOM 2395  C C    . MET A 1 1   ? -8.948  8.351   -3.899  1.00 0.00 ? 1   MET A C    2  
ATOM 2396  O O    . MET A 1 1   ? -8.231  8.723   -2.968  1.00 0.00 ? 1   MET A O    2  
ATOM 2397  C CB   . MET A 1 1   ? -8.493  5.989   -4.940  1.00 0.00 ? 1   MET A CB   2  
ATOM 2398  C CG   . MET A 1 1   ? -9.931  5.443   -5.009  1.00 0.00 ? 1   MET A CG   2  
ATOM 2399  S SD   . MET A 1 1   ? -9.856  3.654   -5.219  1.00 0.00 ? 1   MET A SD   2  
ATOM 2400  C CE   . MET A 1 1   ? -11.608 3.299   -5.379  1.00 0.00 ? 1   MET A CE   2  
ATOM 2401  H H1   . MET A 1 1   ? -6.486  7.882   -4.263  1.00 0.00 ? 1   MET A H1   2  
ATOM 2402  H H2   . MET A 1 1   ? -6.355  7.013   -5.641  1.00 0.00 ? 1   MET A H2   2  
ATOM 2403  H H3   . MET A 1 1   ? -6.658  8.667   -5.686  1.00 0.00 ? 1   MET A H3   2  
ATOM 2404  H HA   . MET A 1 1   ? -8.863  7.846   -6.021  1.00 0.00 ? 1   MET A HA   2  
ATOM 2405  H HB2  . MET A 1 1   ? -7.933  5.478   -5.749  1.00 0.00 ? 1   MET A HB2  2  
ATOM 2406  H HB3  . MET A 1 1   ? -8.022  5.636   -4.001  1.00 0.00 ? 1   MET A HB3  2  
ATOM 2407  H HG2  . MET A 1 1   ? -10.505 5.675   -4.091  1.00 0.00 ? 1   MET A HG2  2  
ATOM 2408  H HG3  . MET A 1 1   ? -10.503 5.869   -5.855  1.00 0.00 ? 1   MET A HG3  2  
ATOM 2409  H HE1  . MET A 1 1   ? -12.057 3.878   -6.209  1.00 0.00 ? 1   MET A HE1  2  
ATOM 2410  H HE2  . MET A 1 1   ? -11.772 2.226   -5.583  1.00 0.00 ? 1   MET A HE2  2  
ATOM 2411  H HE3  . MET A 1 1   ? -12.143 3.560   -4.448  1.00 0.00 ? 1   MET A HE3  2  
ATOM 2412  N N    . ARG A 1 2   ? -10.257 8.663   -3.963  1.00 0.00 ? 2   ARG A N    2  
ATOM 2413  C CA   . ARG A 1 2   ? -11.011 9.413   -2.902  1.00 0.00 ? 2   ARG A CA   2  
ATOM 2414  C C    . ARG A 1 2   ? -10.508 10.879  -2.588  1.00 0.00 ? 2   ARG A C    2  
ATOM 2415  O O    . ARG A 1 2   ? -10.091 11.141  -1.457  1.00 0.00 ? 2   ARG A O    2  
ATOM 2416  C CB   . ARG A 1 2   ? -11.085 8.470   -1.654  1.00 0.00 ? 2   ARG A CB   2  
ATOM 2417  C CG   . ARG A 1 2   ? -12.061 8.818   -0.507  1.00 0.00 ? 2   ARG A CG   2  
ATOM 2418  C CD   . ARG A 1 2   ? -13.551 8.641   -0.860  1.00 0.00 ? 2   ARG A CD   2  
ATOM 2419  N NE   . ARG A 1 2   ? -14.349 8.678   0.390   1.00 0.00 ? 2   ARG A NE   2  
ATOM 2420  C CZ   . ARG A 1 2   ? -15.244 7.761   0.759   1.00 0.00 ? 2   ARG A CZ   2  
ATOM 2421  N NH1  . ARG A 1 2   ? -15.855 6.941   -0.054  1.00 0.00 ? 2   ARG A NH1  2  
ATOM 2422  N NH2  . ARG A 1 2   ? -15.557 7.661   2.015   1.00 0.00 ? 2   ARG A NH2  2  
ATOM 2423  H H    . ARG A 1 2   ? -10.744 8.276   -4.778  1.00 0.00 ? 2   ARG A H    2  
ATOM 2424  H HA   . ARG A 1 2   ? -12.033 9.577   -3.268  1.00 0.00 ? 2   ARG A HA   2  
ATOM 2425  H HB2  . ARG A 1 2   ? -11.324 7.442   -1.986  1.00 0.00 ? 2   ARG A HB2  2  
ATOM 2426  H HB3  . ARG A 1 2   ? -10.069 8.390   -1.214  1.00 0.00 ? 2   ARG A HB3  2  
ATOM 2427  H HG2  . ARG A 1 2   ? -11.796 8.152   0.341   1.00 0.00 ? 2   ARG A HG2  2  
ATOM 2428  H HG3  . ARG A 1 2   ? -11.858 9.839   -0.127  1.00 0.00 ? 2   ARG A HG3  2  
ATOM 2429  H HD2  . ARG A 1 2   ? -13.883 9.458   -1.527  1.00 0.00 ? 2   ARG A HD2  2  
ATOM 2430  H HD3  . ARG A 1 2   ? -13.687 7.693   -1.420  1.00 0.00 ? 2   ARG A HD3  2  
ATOM 2431  H HE   . ARG A 1 2   ? -14.020 9.243   1.177   1.00 0.00 ? 2   ARG A HE   2  
ATOM 2432  H HH11 . ARG A 1 2   ? -15.732 7.068   -1.071  1.00 0.00 ? 2   ARG A HH11 2  
ATOM 2433  H HH12 . ARG A 1 2   ? -16.492 6.277   0.431   1.00 0.00 ? 2   ARG A HH12 2  
ATOM 2434  H HH21 . ARG A 1 2   ? -15.089 8.256   2.696   1.00 0.00 ? 2   ARG A HH21 2  
ATOM 2435  H HH22 . ARG A 1 2   ? -16.220 6.869   2.205   1.00 0.00 ? 2   ARG A HH22 2  
ATOM 2436  N N    . PRO A 1 3   ? -10.600 11.891  -3.505  1.00 0.00 ? 3   PRO A N    2  
ATOM 2437  C CA   . PRO A 1 3   ? -10.242 13.302  -3.187  1.00 0.00 ? 3   PRO A CA   2  
ATOM 2438  C C    . PRO A 1 3   ? -11.397 14.102  -2.484  1.00 0.00 ? 3   PRO A C    2  
ATOM 2439  O O    . PRO A 1 3   ? -12.578 13.735  -2.557  1.00 0.00 ? 3   PRO A O    2  
ATOM 2440  C CB   . PRO A 1 3   ? -9.916  13.834  -4.596  1.00 0.00 ? 3   PRO A CB   2  
ATOM 2441  C CG   . PRO A 1 3   ? -10.919 13.117  -5.504  1.00 0.00 ? 3   PRO A CG   2  
ATOM 2442  C CD   . PRO A 1 3   ? -11.026 11.709  -4.910  1.00 0.00 ? 3   PRO A CD   2  
ATOM 2443  H HA   . PRO A 1 3   ? -9.338  13.347  -2.546  1.00 0.00 ? 3   PRO A HA   2  
ATOM 2444  H HB2  . PRO A 1 3   ? -9.980  14.937  -4.677  1.00 0.00 ? 3   PRO A HB2  2  
ATOM 2445  H HB3  . PRO A 1 3   ? -8.878  13.562  -4.875  1.00 0.00 ? 3   PRO A HB3  2  
ATOM 2446  H HG2  . PRO A 1 3   ? -11.904 13.623  -5.456  1.00 0.00 ? 3   PRO A HG2  2  
ATOM 2447  H HG3  . PRO A 1 3   ? -10.608 13.123  -6.560  1.00 0.00 ? 3   PRO A HG3  2  
ATOM 2448  H HD2  . PRO A 1 3   ? -12.053 11.307  -4.991  1.00 0.00 ? 3   PRO A HD2  2  
ATOM 2449  H HD3  . PRO A 1 3   ? -10.344 11.018  -5.440  1.00 0.00 ? 3   PRO A HD3  2  
ATOM 2450  N N    . SER A 1 4   ? -11.067 15.239  -1.848  1.00 0.00 ? 4   SER A N    2  
ATOM 2451  C CA   . SER A 1 4   ? -12.084 16.114  -1.194  1.00 0.00 ? 4   SER A CA   2  
ATOM 2452  C C    . SER A 1 4   ? -12.731 17.099  -2.233  1.00 0.00 ? 4   SER A C    2  
ATOM 2453  O O    . SER A 1 4   ? -12.350 18.272  -2.320  1.00 0.00 ? 4   SER A O    2  
ATOM 2454  C CB   . SER A 1 4   ? -11.378 16.842  -0.022  1.00 0.00 ? 4   SER A CB   2  
ATOM 2455  O OG   . SER A 1 4   ? -10.469 17.847  -0.479  1.00 0.00 ? 4   SER A OG   2  
ATOM 2456  H H    . SER A 1 4   ? -10.068 15.469  -1.829  1.00 0.00 ? 4   SER A H    2  
ATOM 2457  H HA   . SER A 1 4   ? -12.898 15.505  -0.751  1.00 0.00 ? 4   SER A HA   2  
ATOM 2458  H HB2  . SER A 1 4   ? -12.137 17.316  0.628   1.00 0.00 ? 4   SER A HB2  2  
ATOM 2459  H HB3  . SER A 1 4   ? -10.850 16.126  0.639   1.00 0.00 ? 4   SER A HB3  2  
ATOM 2460  H HG   . SER A 1 4   ? -10.954 18.341  -1.161  1.00 0.00 ? 4   SER A HG   2  
ATOM 2461  N N    . GLY A 1 5   ? -13.722 16.608  -3.005  1.00 0.00 ? 5   GLY A N    2  
ATOM 2462  C CA   . GLY A 1 5   ? -14.399 17.417  -4.058  1.00 0.00 ? 5   GLY A CA   2  
ATOM 2463  C C    . GLY A 1 5   ? -15.505 18.372  -3.565  1.00 0.00 ? 5   GLY A C    2  
ATOM 2464  O O    . GLY A 1 5   ? -15.282 19.581  -3.501  1.00 0.00 ? 5   GLY A O    2  
ATOM 2465  H H    . GLY A 1 5   ? -13.909 15.610  -2.842  1.00 0.00 ? 5   GLY A H    2  
ATOM 2466  H HA2  . GLY A 1 5   ? -13.652 18.021  -4.609  1.00 0.00 ? 5   GLY A HA2  2  
ATOM 2467  H HA3  . GLY A 1 5   ? -14.816 16.742  -4.829  1.00 0.00 ? 5   GLY A HA3  2  
ATOM 2468  N N    . ARG A 1 6   ? -16.699 17.845  -3.238  1.00 0.00 ? 6   ARG A N    2  
ATOM 2469  C CA   . ARG A 1 6   ? -17.827 18.688  -2.730  1.00 0.00 ? 6   ARG A CA   2  
ATOM 2470  C C    . ARG A 1 6   ? -17.655 19.130  -1.229  1.00 0.00 ? 6   ARG A C    2  
ATOM 2471  O O    . ARG A 1 6   ? -17.988 20.272  -0.903  1.00 0.00 ? 6   ARG A O    2  
ATOM 2472  C CB   . ARG A 1 6   ? -19.143 17.898  -2.988  1.00 0.00 ? 6   ARG A CB   2  
ATOM 2473  C CG   . ARG A 1 6   ? -20.428 18.752  -2.816  1.00 0.00 ? 6   ARG A CG   2  
ATOM 2474  C CD   . ARG A 1 6   ? -21.745 18.064  -3.228  1.00 0.00 ? 6   ARG A CD   2  
ATOM 2475  N NE   . ARG A 1 6   ? -22.150 17.022  -2.244  1.00 0.00 ? 6   ARG A NE   2  
ATOM 2476  C CZ   . ARG A 1 6   ? -23.276 16.308  -2.295  1.00 0.00 ? 6   ARG A CZ   2  
ATOM 2477  N NH1  . ARG A 1 6   ? -24.176 16.437  -3.239  1.00 0.00 ? 6   ARG A NH1  2  
ATOM 2478  N NH2  . ARG A 1 6   ? -23.494 15.435  -1.355  1.00 0.00 ? 6   ARG A NH2  2  
ATOM 2479  H H    . ARG A 1 6   ? -16.758 16.827  -3.337  1.00 0.00 ? 6   ARG A H    2  
ATOM 2480  H HA   . ARG A 1 6   ? -17.863 19.629  -3.318  1.00 0.00 ? 6   ARG A HA   2  
ATOM 2481  H HB2  . ARG A 1 6   ? -19.135 17.501  -4.024  1.00 0.00 ? 6   ARG A HB2  2  
ATOM 2482  H HB3  . ARG A 1 6   ? -19.185 17.003  -2.338  1.00 0.00 ? 6   ARG A HB3  2  
ATOM 2483  H HG2  . ARG A 1 6   ? -20.503 19.131  -1.777  1.00 0.00 ? 6   ARG A HG2  2  
ATOM 2484  H HG3  . ARG A 1 6   ? -20.322 19.669  -3.429  1.00 0.00 ? 6   ARG A HG3  2  
ATOM 2485  H HD2  . ARG A 1 6   ? -22.533 18.843  -3.302  1.00 0.00 ? 6   ARG A HD2  2  
ATOM 2486  H HD3  . ARG A 1 6   ? -21.644 17.636  -4.248  1.00 0.00 ? 6   ARG A HD3  2  
ATOM 2487  H HE   . ARG A 1 6   ? -21.553 16.812  -1.440  1.00 0.00 ? 6   ARG A HE   2  
ATOM 2488  H HH11 . ARG A 1 6   ? -23.949 17.141  -3.944  1.00 0.00 ? 6   ARG A HH11 2  
ATOM 2489  H HH12 . ARG A 1 6   ? -25.013 15.852  -3.201  1.00 0.00 ? 6   ARG A HH12 2  
ATOM 2490  H HH21 . ARG A 1 6   ? -22.782 15.352  -0.626  1.00 0.00 ? 6   ARG A HH21 2  
ATOM 2491  H HH22 . ARG A 1 6   ? -24.362 14.898  -1.408  1.00 0.00 ? 6   ARG A HH22 2  
ATOM 2492  N N    . LYS A 1 7   ? -17.198 18.247  -0.316  1.00 0.00 ? 7   LYS A N    2  
ATOM 2493  C CA   . LYS A 1 7   ? -16.913 18.615  1.097   1.00 0.00 ? 7   LYS A CA   2  
ATOM 2494  C C    . LYS A 1 7   ? -15.412 19.045  1.224   1.00 0.00 ? 7   LYS A C    2  
ATOM 2495  O O    . LYS A 1 7   ? -14.504 18.240  0.988   1.00 0.00 ? 7   LYS A O    2  
ATOM 2496  C CB   . LYS A 1 7   ? -17.270 17.400  2.007   1.00 0.00 ? 7   LYS A CB   2  
ATOM 2497  C CG   . LYS A 1 7   ? -16.844 17.534  3.495   1.00 0.00 ? 7   LYS A CG   2  
ATOM 2498  C CD   . LYS A 1 7   ? -17.480 16.490  4.441   1.00 0.00 ? 7   LYS A CD   2  
ATOM 2499  C CE   . LYS A 1 7   ? -16.744 16.256  5.783   1.00 0.00 ? 7   LYS A CE   2  
ATOM 2500  N NZ   . LYS A 1 7   ? -16.588 17.487  6.612   1.00 0.00 ? 7   LYS A NZ   2  
ATOM 2501  H H    . LYS A 1 7   ? -16.937 17.341  -0.717  1.00 0.00 ? 7   LYS A H    2  
ATOM 2502  H HA   . LYS A 1 7   ? -17.559 19.460  1.415   1.00 0.00 ? 7   LYS A HA   2  
ATOM 2503  H HB2  . LYS A 1 7   ? -18.363 17.231  1.944   1.00 0.00 ? 7   LYS A HB2  2  
ATOM 2504  H HB3  . LYS A 1 7   ? -16.816 16.474  1.599   1.00 0.00 ? 7   LYS A HB3  2  
ATOM 2505  H HG2  . LYS A 1 7   ? -15.740 17.452  3.540   1.00 0.00 ? 7   LYS A HG2  2  
ATOM 2506  H HG3  . LYS A 1 7   ? -17.072 18.553  3.866   1.00 0.00 ? 7   LYS A HG3  2  
ATOM 2507  H HD2  . LYS A 1 7   ? -18.542 16.752  4.621   1.00 0.00 ? 7   LYS A HD2  2  
ATOM 2508  H HD3  . LYS A 1 7   ? -17.530 15.515  3.916   1.00 0.00 ? 7   LYS A HD3  2  
ATOM 2509  H HE2  . LYS A 1 7   ? -17.293 15.474  6.353   1.00 0.00 ? 7   LYS A HE2  2  
ATOM 2510  H HE3  . LYS A 1 7   ? -15.752 15.791  5.583   1.00 0.00 ? 7   LYS A HE3  2  
ATOM 2511  H HZ1  . LYS A 1 7   ? -17.425 18.084  6.606   1.00 0.00 ? 7   LYS A HZ1  2  
ATOM 2512  H HZ2  . LYS A 1 7   ? -16.379 17.292  7.600   1.00 0.00 ? 7   LYS A HZ2  2  
ATOM 2513  H HZ3  . LYS A 1 7   ? -15.803 18.086  6.288   1.00 0.00 ? 7   LYS A HZ3  2  
ATOM 2514  N N    . SER A 1 8   ? -15.163 20.294  1.662   1.00 0.00 ? 8   SER A N    2  
ATOM 2515  C CA   . SER A 1 8   ? -13.782 20.797  1.904   1.00 0.00 ? 8   SER A CA   2  
ATOM 2516  C C    . SER A 1 8   ? -13.299 20.326  3.317   1.00 0.00 ? 8   SER A C    2  
ATOM 2517  O O    . SER A 1 8   ? -13.610 20.919  4.358   1.00 0.00 ? 8   SER A O    2  
ATOM 2518  C CB   . SER A 1 8   ? -13.791 22.335  1.764   1.00 0.00 ? 8   SER A CB   2  
ATOM 2519  O OG   . SER A 1 8   ? -12.454 22.834  1.830   1.00 0.00 ? 8   SER A OG   2  
ATOM 2520  H H    . SER A 1 8   ? -15.989 20.882  1.812   1.00 0.00 ? 8   SER A H    2  
ATOM 2521  H HA   . SER A 1 8   ? -13.088 20.407  1.129   1.00 0.00 ? 8   SER A HA   2  
ATOM 2522  H HB2  . SER A 1 8   ? -14.243 22.637  0.798   1.00 0.00 ? 8   SER A HB2  2  
ATOM 2523  H HB3  . SER A 1 8   ? -14.408 22.803  2.557   1.00 0.00 ? 8   SER A HB3  2  
ATOM 2524  H HG   . SER A 1 8   ? -12.497 23.794  1.777   1.00 0.00 ? 8   SER A HG   2  
ATOM 2525  N N    . SER A 1 9   ? -12.601 19.183  3.360   1.00 0.00 ? 9   SER A N    2  
ATOM 2526  C CA   . SER A 1 9   ? -12.090 18.561  4.614   1.00 0.00 ? 9   SER A CA   2  
ATOM 2527  C C    . SER A 1 9   ? -11.066 17.444  4.244   1.00 0.00 ? 9   SER A C    2  
ATOM 2528  O O    . SER A 1 9   ? -11.229 16.736  3.243   1.00 0.00 ? 9   SER A O    2  
ATOM 2529  C CB   . SER A 1 9   ? -13.249 17.941  5.446   1.00 0.00 ? 9   SER A CB   2  
ATOM 2530  O OG   . SER A 1 9   ? -14.192 18.930  5.867   1.00 0.00 ? 9   SER A OG   2  
ATOM 2531  H H    . SER A 1 9   ? -12.409 18.764  2.441   1.00 0.00 ? 9   SER A H    2  
ATOM 2532  H HA   . SER A 1 9   ? -11.578 19.338  5.218   1.00 0.00 ? 9   SER A HA   2  
ATOM 2533  H HB2  . SER A 1 9   ? -13.767 17.163  4.853   1.00 0.00 ? 9   SER A HB2  2  
ATOM 2534  H HB3  . SER A 1 9   ? -12.850 17.419  6.339   1.00 0.00 ? 9   SER A HB3  2  
ATOM 2535  H HG   . SER A 1 9   ? -13.977 19.738  5.350   1.00 0.00 ? 9   SER A HG   2  
ATOM 2536  N N    . LYS A 1 10  ? -10.022 17.249  5.070   1.00 0.00 ? 10  LYS A N    2  
ATOM 2537  C CA   . LYS A 1 10  ? -8.993  16.200  4.808   1.00 0.00 ? 10  LYS A CA   2  
ATOM 2538  C C    . LYS A 1 10  ? -9.540  14.731  4.946   1.00 0.00 ? 10  LYS A C    2  
ATOM 2539  O O    . LYS A 1 10  ? -10.401 14.435  5.782   1.00 0.00 ? 10  LYS A O    2  
ATOM 2540  C CB   . LYS A 1 10  ? -7.785  16.461  5.752   1.00 0.00 ? 10  LYS A CB   2  
ATOM 2541  C CG   . LYS A 1 10  ? -7.960  16.217  7.275   1.00 0.00 ? 10  LYS A CG   2  
ATOM 2542  C CD   . LYS A 1 10  ? -6.641  16.473  8.031   1.00 0.00 ? 10  LYS A CD   2  
ATOM 2543  C CE   . LYS A 1 10  ? -6.686  16.056  9.512   1.00 0.00 ? 10  LYS A CE   2  
ATOM 2544  N NZ   . LYS A 1 10  ? -5.352  16.301  10.114  1.00 0.00 ? 10  LYS A NZ   2  
ATOM 2545  H H    . LYS A 1 10  ? -9.967  17.881  5.873   1.00 0.00 ? 10  LYS A H    2  
ATOM 2546  H HA   . LYS A 1 10  ? -8.640  16.327  3.763   1.00 0.00 ? 10  LYS A HA   2  
ATOM 2547  H HB2  . LYS A 1 10  ? -6.954  15.821  5.396   1.00 0.00 ? 10  LYS A HB2  2  
ATOM 2548  H HB3  . LYS A 1 10  ? -7.413  17.492  5.584   1.00 0.00 ? 10  LYS A HB3  2  
ATOM 2549  H HG2  . LYS A 1 10  ? -8.769  16.856  7.680   1.00 0.00 ? 10  LYS A HG2  2  
ATOM 2550  H HG3  . LYS A 1 10  ? -8.297  15.174  7.446   1.00 0.00 ? 10  LYS A HG3  2  
ATOM 2551  H HD2  . LYS A 1 10  ? -5.825  15.917  7.522   1.00 0.00 ? 10  LYS A HD2  2  
ATOM 2552  H HD3  . LYS A 1 10  ? -6.364  17.542  7.939   1.00 0.00 ? 10  LYS A HD3  2  
ATOM 2553  H HE2  . LYS A 1 10  ? -7.480  16.601  10.066  1.00 0.00 ? 10  LYS A HE2  2  
ATOM 2554  H HE3  . LYS A 1 10  ? -6.949  14.978  9.600   1.00 0.00 ? 10  LYS A HE3  2  
ATOM 2555  H HZ1  . LYS A 1 10  ? -4.570  15.909  9.505   1.00 0.00 ? 10  LYS A HZ1  2  
ATOM 2556  H HZ2  . LYS A 1 10  ? -5.099  17.285  10.231  1.00 0.00 ? 10  LYS A HZ2  2  
ATOM 2557  H HZ3  . LYS A 1 10  ? -5.209  15.841  11.065  1.00 0.00 ? 10  LYS A HZ3  2  
ATOM 2558  N N    . MET A 1 11  ? -8.999  13.818  4.122   1.00 0.00 ? 11  MET A N    2  
ATOM 2559  C CA   . MET A 1 11  ? -9.408  12.383  4.107   1.00 0.00 ? 11  MET A CA   2  
ATOM 2560  C C    . MET A 1 11  ? -8.553  11.557  5.132   1.00 0.00 ? 11  MET A C    2  
ATOM 2561  O O    . MET A 1 11  ? -8.468  11.937  6.305   1.00 0.00 ? 11  MET A O    2  
ATOM 2562  C CB   . MET A 1 11  ? -9.383  11.970  2.600   1.00 0.00 ? 11  MET A CB   2  
ATOM 2563  C CG   . MET A 1 11  ? -10.483 12.586  1.708   1.00 0.00 ? 11  MET A CG   2  
ATOM 2564  S SD   . MET A 1 11  ? -12.096 11.909  2.145   1.00 0.00 ? 11  MET A SD   2  
ATOM 2565  C CE   . MET A 1 11  ? -13.089 12.621  0.822   1.00 0.00 ? 11  MET A CE   2  
ATOM 2566  H H    . MET A 1 11  ? -8.301  14.175  3.464   1.00 0.00 ? 11  MET A H    2  
ATOM 2567  H HA   . MET A 1 11  ? -10.435 12.220  4.457   1.00 0.00 ? 11  MET A HA   2  
ATOM 2568  H HB2  . MET A 1 11  ? -8.387  12.173  2.158   1.00 0.00 ? 11  MET A HB2  2  
ATOM 2569  H HB3  . MET A 1 11  ? -9.492  10.872  2.512   1.00 0.00 ? 11  MET A HB3  2  
ATOM 2570  H HG2  . MET A 1 11  ? -10.506 13.689  1.782   1.00 0.00 ? 11  MET A HG2  2  
ATOM 2571  H HG3  . MET A 1 11  ? -10.272 12.355  0.649   1.00 0.00 ? 11  MET A HG3  2  
ATOM 2572  H HE1  . MET A 1 11  ? -12.669 12.363  -0.169  1.00 0.00 ? 11  MET A HE1  2  
ATOM 2573  H HE2  . MET A 1 11  ? -14.127 12.249  0.863   1.00 0.00 ? 11  MET A HE2  2  
ATOM 2574  H HE3  . MET A 1 11  ? -13.112 13.722  0.907   1.00 0.00 ? 11  MET A HE3  2  
ATOM 2575  N N    . GLN A 1 12  ? -8.000  10.401  4.747   1.00 0.00 ? 12  GLN A N    2  
ATOM 2576  C CA   . GLN A 1 12  ? -7.174  9.544   5.647   1.00 0.00 ? 12  GLN A CA   2  
ATOM 2577  C C    . GLN A 1 12  ? -5.806  9.251   4.948   1.00 0.00 ? 12  GLN A C    2  
ATOM 2578  O O    . GLN A 1 12  ? -5.654  8.257   4.224   1.00 0.00 ? 12  GLN A O    2  
ATOM 2579  C CB   . GLN A 1 12  ? -7.986  8.254   5.985   1.00 0.00 ? 12  GLN A CB   2  
ATOM 2580  C CG   . GLN A 1 12  ? -7.646  7.523   7.319   1.00 0.00 ? 12  GLN A CG   2  
ATOM 2581  C CD   . GLN A 1 12  ? -6.180  7.334   7.730   1.00 0.00 ? 12  GLN A CD   2  
ATOM 2582  O OE1  . GLN A 1 12  ? -5.720  7.863   8.734   1.00 0.00 ? 12  GLN A OE1  2  
ATOM 2583  N NE2  . GLN A 1 12  ? -5.398  6.608   6.975   1.00 0.00 ? 12  GLN A NE2  2  
ATOM 2584  H H    . GLN A 1 12  ? -8.131  10.218  3.738   1.00 0.00 ? 12  GLN A H    2  
ATOM 2585  H HA   . GLN A 1 12  ? -6.964  10.064  6.605   1.00 0.00 ? 12  GLN A HA   2  
ATOM 2586  H HB2  . GLN A 1 12  ? -9.066  8.493   6.035   1.00 0.00 ? 12  GLN A HB2  2  
ATOM 2587  H HB3  . GLN A 1 12  ? -7.919  7.545   5.138   1.00 0.00 ? 12  GLN A HB3  2  
ATOM 2588  H HG2  . GLN A 1 12  ? -8.136  8.069   8.147   1.00 0.00 ? 12  GLN A HG2  2  
ATOM 2589  H HG3  . GLN A 1 12  ? -8.135  6.531   7.323   1.00 0.00 ? 12  GLN A HG3  2  
ATOM 2590  H HE21 . GLN A 1 12  ? -5.802  6.419   6.052   1.00 0.00 ? 12  GLN A HE21 2  
ATOM 2591  H HE22 . GLN A 1 12  ? -4.416  6.842   7.160   1.00 0.00 ? 12  GLN A HE22 2  
ATOM 2592  N N    . ALA A 1 13  ? -4.790  10.089  5.228   1.00 0.00 ? 13  ALA A N    2  
ATOM 2593  C CA   . ALA A 1 13  ? -3.450  9.966   4.598   1.00 0.00 ? 13  ALA A CA   2  
ATOM 2594  C C    . ALA A 1 13  ? -2.572  8.812   5.196   1.00 0.00 ? 13  ALA A C    2  
ATOM 2595  O O    . ALA A 1 13  ? -2.835  8.267   6.274   1.00 0.00 ? 13  ALA A O    2  
ATOM 2596  C CB   . ALA A 1 13  ? -2.808  11.360  4.751   1.00 0.00 ? 13  ALA A CB   2  
ATOM 2597  H H    . ALA A 1 13  ? -5.021  10.871  5.848   1.00 0.00 ? 13  ALA A H    2  
ATOM 2598  H HA   . ALA A 1 13  ? -3.580  9.755   3.518   1.00 0.00 ? 13  ALA A HA   2  
ATOM 2599  H HB1  . ALA A 1 13  ? -3.409  12.148  4.259   1.00 0.00 ? 13  ALA A HB1  2  
ATOM 2600  H HB2  . ALA A 1 13  ? -2.684  11.658  5.809   1.00 0.00 ? 13  ALA A HB2  2  
ATOM 2601  H HB3  . ALA A 1 13  ? -1.805  11.398  4.290   1.00 0.00 ? 13  ALA A HB3  2  
ATOM 2602  N N    . PHE A 1 14  ? -1.507  8.419   4.466   1.00 0.00 ? 14  PHE A N    2  
ATOM 2603  C CA   . PHE A 1 14  ? -0.682  7.236   4.830   1.00 0.00 ? 14  PHE A CA   2  
ATOM 2604  C C    . PHE A 1 14  ? 0.774   7.237   4.236   1.00 0.00 ? 14  PHE A C    2  
ATOM 2605  O O    . PHE A 1 14  ? 1.002   7.632   3.080   1.00 0.00 ? 14  PHE A O    2  
ATOM 2606  C CB   . PHE A 1 14  ? -1.507  6.008   4.315   1.00 0.00 ? 14  PHE A CB   2  
ATOM 2607  C CG   . PHE A 1 14  ? -1.067  4.672   4.899   1.00 0.00 ? 14  PHE A CG   2  
ATOM 2608  C CD1  . PHE A 1 14  ? -1.474  4.375   6.198   1.00 0.00 ? 14  PHE A CD1  2  
ATOM 2609  C CD2  . PHE A 1 14  ? -0.129  3.855   4.261   1.00 0.00 ? 14  PHE A CD2  2  
ATOM 2610  C CE1  . PHE A 1 14  ? -0.855  3.360   6.904   1.00 0.00 ? 14  PHE A CE1  2  
ATOM 2611  C CE2  . PHE A 1 14  ? 0.456   2.801   4.957   1.00 0.00 ? 14  PHE A CE2  2  
ATOM 2612  C CZ   . PHE A 1 14  ? 0.128   2.588   6.295   1.00 0.00 ? 14  PHE A CZ   2  
ATOM 2613  H H    . PHE A 1 14  ? -1.411  8.900   3.563   1.00 0.00 ? 14  PHE A H    2  
ATOM 2614  H HA   . PHE A 1 14  ? -0.592  7.192   5.933   1.00 0.00 ? 14  PHE A HA   2  
ATOM 2615  H HB2  . PHE A 1 14  ? -2.578  6.134   4.562   1.00 0.00 ? 14  PHE A HB2  2  
ATOM 2616  H HB3  . PHE A 1 14  ? -1.519  5.985   3.217   1.00 0.00 ? 14  PHE A HB3  2  
ATOM 2617  H HD1  . PHE A 1 14  ? -2.220  4.984   6.685   1.00 0.00 ? 14  PHE A HD1  2  
ATOM 2618  H HD2  . PHE A 1 14  ? 0.212   4.083   3.262   1.00 0.00 ? 14  PHE A HD2  2  
ATOM 2619  H HE1  . PHE A 1 14  ? -1.106  3.222   7.942   1.00 0.00 ? 14  PHE A HE1  2  
ATOM 2620  H HE2  . PHE A 1 14  ? 1.201   2.190   4.471   1.00 0.00 ? 14  PHE A HE2  2  
ATOM 2621  H HZ   . PHE A 1 14  ? 0.656   1.866   6.891   1.00 0.00 ? 14  PHE A HZ   2  
ATOM 2622  N N    . ARG A 1 15  ? 1.732   6.710   5.038   1.00 0.00 ? 15  ARG A N    2  
ATOM 2623  C CA   . ARG A 1 15  ? 3.158   6.518   4.641   1.00 0.00 ? 15  ARG A CA   2  
ATOM 2624  C C    . ARG A 1 15  ? 3.734   5.192   5.291   1.00 0.00 ? 15  ARG A C    2  
ATOM 2625  O O    . ARG A 1 15  ? 3.325   4.735   6.369   1.00 0.00 ? 15  ARG A O    2  
ATOM 2626  C CB   . ARG A 1 15  ? 3.974   7.779   5.057   1.00 0.00 ? 15  ARG A CB   2  
ATOM 2627  C CG   . ARG A 1 15  ? 5.348   7.940   4.345   1.00 0.00 ? 15  ARG A CG   2  
ATOM 2628  C CD   . ARG A 1 15  ? 6.221   9.093   4.879   1.00 0.00 ? 15  ARG A CD   2  
ATOM 2629  N NE   . ARG A 1 15  ? 6.876   8.729   6.166   1.00 0.00 ? 15  ARG A NE   2  
ATOM 2630  C CZ   . ARG A 1 15  ? 8.159   8.411   6.345   1.00 0.00 ? 15  ARG A CZ   2  
ATOM 2631  N NH1  . ARG A 1 15  ? 9.072   8.360   5.404   1.00 0.00 ? 15  ARG A NH1  2  
ATOM 2632  N NH2  . ARG A 1 15  ? 8.529   8.128   7.558   1.00 0.00 ? 15  ARG A NH2  2  
ATOM 2633  H H    . ARG A 1 15  ? 1.422   6.434   5.984   1.00 0.00 ? 15  ARG A H    2  
ATOM 2634  H HA   . ARG A 1 15  ? 3.204   6.402   3.538   1.00 0.00 ? 15  ARG A HA   2  
ATOM 2635  H HB2  . ARG A 1 15  ? 3.379   8.691   4.851   1.00 0.00 ? 15  ARG A HB2  2  
ATOM 2636  H HB3  . ARG A 1 15  ? 4.098   7.794   6.157   1.00 0.00 ? 15  ARG A HB3  2  
ATOM 2637  H HG2  . ARG A 1 15  ? 5.936   7.003   4.386   1.00 0.00 ? 15  ARG A HG2  2  
ATOM 2638  H HG3  . ARG A 1 15  ? 5.169   8.105   3.263   1.00 0.00 ? 15  ARG A HG3  2  
ATOM 2639  H HD2  . ARG A 1 15  ? 6.949   9.409   4.107   1.00 0.00 ? 15  ARG A HD2  2  
ATOM 2640  H HD3  . ARG A 1 15  ? 5.596   9.995   5.033   1.00 0.00 ? 15  ARG A HD3  2  
ATOM 2641  H HE   . ARG A 1 15  ? 6.330   8.693   7.043   1.00 0.00 ? 15  ARG A HE   2  
ATOM 2642  H HH11 . ARG A 1 15  ? 8.811   8.604   4.413   1.00 0.00 ? 15  ARG A HH11 2  
ATOM 2643  H HH12 . ARG A 1 15  ? 10.023  8.133   5.690   1.00 0.00 ? 15  ARG A HH12 2  
ATOM 2644  H HH21 . ARG A 1 15  ? 7.771   8.158   8.254   1.00 0.00 ? 15  ARG A HH21 2  
ATOM 2645  H HH22 . ARG A 1 15  ? 9.496   7.841   7.717   1.00 0.00 ? 15  ARG A HH22 2  
ATOM 2646  N N    . ILE A 1 16  ? 4.722   4.575   4.613   1.00 0.00 ? 16  ILE A N    2  
ATOM 2647  C CA   . ILE A 1 16  ? 5.384   3.303   5.064   1.00 0.00 ? 16  ILE A CA   2  
ATOM 2648  C C    . ILE A 1 16  ? 6.929   3.386   4.806   1.00 0.00 ? 16  ILE A C    2  
ATOM 2649  O O    . ILE A 1 16  ? 7.397   3.897   3.780   1.00 0.00 ? 16  ILE A O    2  
ATOM 2650  C CB   . ILE A 1 16  ? 4.789   2.002   4.373   1.00 0.00 ? 16  ILE A CB   2  
ATOM 2651  C CG1  . ILE A 1 16  ? 4.075   2.202   2.998   1.00 0.00 ? 16  ILE A CG1  2  
ATOM 2652  C CG2  . ILE A 1 16  ? 3.816   1.356   5.377   1.00 0.00 ? 16  ILE A CG2  2  
ATOM 2653  C CD1  . ILE A 1 16  ? 3.760   0.921   2.208   1.00 0.00 ? 16  ILE A CD1  2  
ATOM 2654  H H    . ILE A 1 16  ? 4.991   5.028   3.734   1.00 0.00 ? 16  ILE A H    2  
ATOM 2655  H HA   . ILE A 1 16  ? 5.261   3.220   6.169   1.00 0.00 ? 16  ILE A HA   2  
ATOM 2656  H HB   . ILE A 1 16  ? 5.599   1.264   4.196   1.00 0.00 ? 16  ILE A HB   2  
ATOM 2657  H HG12 . ILE A 1 16  ? 3.145   2.788   3.132   1.00 0.00 ? 16  ILE A HG12 2  
ATOM 2658  H HG13 . ILE A 1 16  ? 4.710   2.839   2.359   1.00 0.00 ? 16  ILE A HG13 2  
ATOM 2659  H HG21 . ILE A 1 16  ? 3.042   2.059   5.730   1.00 0.00 ? 16  ILE A HG21 2  
ATOM 2660  H HG22 . ILE A 1 16  ? 3.308   0.459   4.979   1.00 0.00 ? 16  ILE A HG22 2  
ATOM 2661  H HG23 . ILE A 1 16  ? 4.376   1.028   6.268   1.00 0.00 ? 16  ILE A HG23 2  
ATOM 2662  H HD11 . ILE A 1 16  ? 4.660   0.297   2.051   1.00 0.00 ? 16  ILE A HD11 2  
ATOM 2663  H HD12 . ILE A 1 16  ? 3.004   0.298   2.714   1.00 0.00 ? 16  ILE A HD12 2  
ATOM 2664  H HD13 . ILE A 1 16  ? 3.354   1.158   1.208   1.00 0.00 ? 16  ILE A HD13 2  
ATOM 2665  N N    . TRP A 1 17  ? 7.731   2.874   5.766   1.00 0.00 ? 17  TRP A N    2  
ATOM 2666  C CA   . TRP A 1 17  ? 9.225   2.900   5.683   1.00 0.00 ? 17  TRP A CA   2  
ATOM 2667  C C    . TRP A 1 17  ? 9.911   1.787   6.564   1.00 0.00 ? 17  TRP A C    2  
ATOM 2668  O O    . TRP A 1 17  ? 9.239   0.931   7.151   1.00 0.00 ? 17  TRP A O    2  
ATOM 2669  C CB   . TRP A 1 17  ? 9.661   4.368   6.047   1.00 0.00 ? 17  TRP A CB   2  
ATOM 2670  C CG   . TRP A 1 17  ? 9.819   4.768   7.524   1.00 0.00 ? 17  TRP A CG   2  
ATOM 2671  C CD1  . TRP A 1 17  ? 8.830   4.707   8.528   1.00 0.00 ? 17  TRP A CD1  2  
ATOM 2672  C CD2  . TRP A 1 17  ? 10.979  5.175   8.165   1.00 0.00 ? 17  TRP A CD2  2  
ATOM 2673  N NE1  . TRP A 1 17  ? 9.348   5.066   9.788   1.00 0.00 ? 17  TRP A NE1  2  
ATOM 2674  C CE2  . TRP A 1 17  ? 10.685  5.330   9.541   1.00 0.00 ? 17  TRP A CE2  2  
ATOM 2675  C CE3  . TRP A 1 17  ? 12.299  5.395   7.682   1.00 0.00 ? 17  TRP A CE3  2  
ATOM 2676  C CZ2  . TRP A 1 17  ? 11.708  5.682   10.451  1.00 0.00 ? 17  TRP A CZ2  2  
ATOM 2677  C CZ3  . TRP A 1 17  ? 13.293  5.737   8.600   1.00 0.00 ? 17  TRP A CZ3  2  
ATOM 2678  C CH2  . TRP A 1 17  ? 13.003  5.879   9.963   1.00 0.00 ? 17  TRP A CH2  2  
ATOM 2679  H H    . TRP A 1 17  ? 7.251   2.462   6.581   1.00 0.00 ? 17  TRP A H    2  
ATOM 2680  H HA   . TRP A 1 17  ? 9.525   2.661   4.645   1.00 0.00 ? 17  TRP A HA   2  
ATOM 2681  H HB2  . TRP A 1 17  ? 10.631  4.541   5.566   1.00 0.00 ? 17  TRP A HB2  2  
ATOM 2682  H HB3  . TRP A 1 17  ? 9.015   5.112   5.544   1.00 0.00 ? 17  TRP A HB3  2  
ATOM 2683  H HD1  . TRP A 1 17  ? 7.815   4.372   8.360   1.00 0.00 ? 17  TRP A HD1  2  
ATOM 2684  H HE1  . TRP A 1 17  ? 8.882   5.030   10.702  1.00 0.00 ? 17  TRP A HE1  2  
ATOM 2685  H HE3  . TRP A 1 17  ? 12.542  5.301   6.632   1.00 0.00 ? 17  TRP A HE3  2  
ATOM 2686  H HZ2  . TRP A 1 17  ? 11.495  5.787   11.504  1.00 0.00 ? 17  TRP A HZ2  2  
ATOM 2687  H HZ3  . TRP A 1 17  ? 14.306  5.884   8.253   1.00 0.00 ? 17  TRP A HZ3  2  
ATOM 2688  H HH2  . TRP A 1 17  ? 13.796  6.138   10.650  1.00 0.00 ? 17  TRP A HH2  2  
ATOM 2689  N N    . ASP A 1 18  ? 11.260  1.766   6.638   1.00 0.00 ? 18  ASP A N    2  
ATOM 2690  C CA   . ASP A 1 18  ? 12.014  0.853   7.528   1.00 0.00 ? 18  ASP A CA   2  
ATOM 2691  C C    . ASP A 1 18  ? 13.266  1.661   8.046   1.00 0.00 ? 18  ASP A C    2  
ATOM 2692  O O    . ASP A 1 18  ? 13.971  2.398   7.322   1.00 0.00 ? 18  ASP A O    2  
ATOM 2693  C CB   . ASP A 1 18  ? 12.314  -0.520  6.855   1.00 0.00 ? 18  ASP A CB   2  
ATOM 2694  C CG   . ASP A 1 18  ? 13.196  -0.630  5.616   1.00 0.00 ? 18  ASP A CG   2  
ATOM 2695  O OD1  . ASP A 1 18  ? 12.689  -0.541  4.474   1.00 0.00 ? 18  ASP A OD1  2  
ATOM 2696  O OD2  . ASP A 1 18  ? 14.408  -0.890  5.763   1.00 0.00 ? 18  ASP A OD2  2  
ATOM 2697  H H    . ASP A 1 18  ? 11.799  2.495   6.143   1.00 0.00 ? 18  ASP A H    2  
ATOM 2698  H HA   . ASP A 1 18  ? 11.378  0.627   8.408   1.00 0.00 ? 18  ASP A HA   2  
ATOM 2699  H HB2  . ASP A 1 18  ? 12.759  -1.186  7.617   1.00 0.00 ? 18  ASP A HB2  2  
ATOM 2700  H HB3  . ASP A 1 18  ? 11.353  -1.009  6.609   1.00 0.00 ? 18  ASP A HB3  2  
ATOM 2701  N N    . VAL A 1 19  ? 13.494  1.486   9.370   1.00 0.00 ? 19  VAL A N    2  
ATOM 2702  C CA   . VAL A 1 19  ? 14.562  2.181   10.168  1.00 0.00 ? 19  VAL A CA   2  
ATOM 2703  C C    . VAL A 1 19  ? 16.040  1.983   9.673   1.00 0.00 ? 19  VAL A C    2  
ATOM 2704  O O    . VAL A 1 19  ? 16.909  2.734   10.128  1.00 0.00 ? 19  VAL A O    2  
ATOM 2705  C CB   . VAL A 1 19  ? 14.319  1.771   11.676  1.00 0.00 ? 19  VAL A CB   2  
ATOM 2706  C CG1  . VAL A 1 19  ? 15.493  1.973   12.667  1.00 0.00 ? 19  VAL A CG1  2  
ATOM 2707  C CG2  . VAL A 1 19  ? 13.136  2.569   12.284  1.00 0.00 ? 19  VAL A CG2  2  
ATOM 2708  H H    . VAL A 1 19  ? 12.831  0.852   9.824   1.00 0.00 ? 19  VAL A H    2  
ATOM 2709  H HA   . VAL A 1 19  ? 14.412  3.273   10.072  1.00 0.00 ? 19  VAL A HA   2  
ATOM 2710  H HB   . VAL A 1 19  ? 14.076  0.689   11.723  1.00 0.00 ? 19  VAL A HB   2  
ATOM 2711  H HG11 . VAL A 1 19  ? 15.837  3.025   12.696  1.00 0.00 ? 19  VAL A HG11 2  
ATOM 2712  H HG12 . VAL A 1 19  ? 15.230  1.681   13.702  1.00 0.00 ? 19  VAL A HG12 2  
ATOM 2713  H HG13 . VAL A 1 19  ? 16.371  1.359   12.390  1.00 0.00 ? 19  VAL A HG13 2  
ATOM 2714  H HG21 . VAL A 1 19  ? 12.225  2.508   11.662  1.00 0.00 ? 19  VAL A HG21 2  
ATOM 2715  H HG22 . VAL A 1 19  ? 12.855  2.199   13.289  1.00 0.00 ? 19  VAL A HG22 2  
ATOM 2716  H HG23 . VAL A 1 19  ? 13.368  3.646   12.387  1.00 0.00 ? 19  VAL A HG23 2  
ATOM 2717  N N    . ASN A 1 20  ? 16.354  1.091   8.714   1.00 0.00 ? 20  ASN A N    2  
ATOM 2718  C CA   . ASN A 1 20  ? 17.717  1.014   8.103   1.00 0.00 ? 20  ASN A CA   2  
ATOM 2719  C C    . ASN A 1 20  ? 17.983  2.154   7.030   1.00 0.00 ? 20  ASN A C    2  
ATOM 2720  O O    . ASN A 1 20  ? 18.866  2.006   6.182   1.00 0.00 ? 20  ASN A O    2  
ATOM 2721  C CB   . ASN A 1 20  ? 17.842  -0.411  7.480   1.00 0.00 ? 20  ASN A CB   2  
ATOM 2722  C CG   . ASN A 1 20  ? 17.914  -1.575  8.479   1.00 0.00 ? 20  ASN A CG   2  
ATOM 2723  O OD1  . ASN A 1 20  ? 16.921  -2.210  8.814   1.00 0.00 ? 20  ASN A OD1  2  
ATOM 2724  N ND2  . ASN A 1 20  ? 19.079  -1.893  8.992   1.00 0.00 ? 20  ASN A ND2  2  
ATOM 2725  H H    . ASN A 1 20  ? 15.564  0.519   8.388   1.00 0.00 ? 20  ASN A H    2  
ATOM 2726  H HA   . ASN A 1 20  ? 18.497  1.138   8.880   1.00 0.00 ? 20  ASN A HA   2  
ATOM 2727  H HB2  . ASN A 1 20  ? 16.997  -0.603  6.789   1.00 0.00 ? 20  ASN A HB2  2  
ATOM 2728  H HB3  . ASN A 1 20  ? 18.732  -0.463  6.826   1.00 0.00 ? 20  ASN A HB3  2  
ATOM 2729  H HD21 . ASN A 1 20  ? 19.889  -1.341  8.700   1.00 0.00 ? 20  ASN A HD21 2  
ATOM 2730  H HD22 . ASN A 1 20  ? 19.040  -2.663  9.666   1.00 0.00 ? 20  ASN A HD22 2  
ATOM 2731  N N    . GLN A 1 21  ? 17.309  3.332   7.151   1.00 0.00 ? 21  GLN A N    2  
ATOM 2732  C CA   . GLN A 1 21  ? 17.379  4.508   6.226   1.00 0.00 ? 21  GLN A CA   2  
ATOM 2733  C C    . GLN A 1 21  ? 16.756  4.110   4.850   1.00 0.00 ? 21  GLN A C    2  
ATOM 2734  O O    . GLN A 1 21  ? 17.410  4.156   3.804   1.00 0.00 ? 21  GLN A O    2  
ATOM 2735  C CB   . GLN A 1 21  ? 18.822  5.094   6.127   1.00 0.00 ? 21  GLN A CB   2  
ATOM 2736  C CG   . GLN A 1 21  ? 19.385  5.704   7.437   1.00 0.00 ? 21  GLN A CG   2  
ATOM 2737  C CD   . GLN A 1 21  ? 20.777  6.327   7.305   1.00 0.00 ? 21  GLN A CD   2  
ATOM 2738  O OE1  . GLN A 1 21  ? 20.943  7.538   7.218   1.00 0.00 ? 21  GLN A OE1  2  
ATOM 2739  N NE2  . GLN A 1 21  ? 21.823  5.535   7.300   1.00 0.00 ? 21  GLN A NE2  2  
ATOM 2740  H H    . GLN A 1 21  ? 16.563  3.262   7.859   1.00 0.00 ? 21  GLN A H    2  
ATOM 2741  H HA   . GLN A 1 21  ? 16.727  5.307   6.629   1.00 0.00 ? 21  GLN A HA   2  
ATOM 2742  H HB2  . GLN A 1 21  ? 19.518  4.332   5.726   1.00 0.00 ? 21  GLN A HB2  2  
ATOM 2743  H HB3  . GLN A 1 21  ? 18.820  5.887   5.359   1.00 0.00 ? 21  GLN A HB3  2  
ATOM 2744  H HG2  . GLN A 1 21  ? 18.701  6.494   7.797   1.00 0.00 ? 21  GLN A HG2  2  
ATOM 2745  H HG3  . GLN A 1 21  ? 19.396  4.947   8.244   1.00 0.00 ? 21  GLN A HG3  2  
ATOM 2746  H HE21 . GLN A 1 21  ? 21.638  4.529   7.289   1.00 0.00 ? 21  GLN A HE21 2  
ATOM 2747  H HE22 . GLN A 1 21  ? 22.714  6.023   7.172   1.00 0.00 ? 21  GLN A HE22 2  
ATOM 2748  N N    . LYS A 1 22  ? 15.461  3.729   4.856   1.00 0.00 ? 22  LYS A N    2  
ATOM 2749  C CA   . LYS A 1 22  ? 14.769  3.217   3.667   1.00 0.00 ? 22  LYS A CA   2  
ATOM 2750  C C    . LYS A 1 22  ? 13.265  3.600   3.799   1.00 0.00 ? 22  LYS A C    2  
ATOM 2751  O O    . LYS A 1 22  ? 12.653  3.507   4.861   1.00 0.00 ? 22  LYS A O    2  
ATOM 2752  C CB   . LYS A 1 22  ? 14.966  1.667   3.669   1.00 0.00 ? 22  LYS A CB   2  
ATOM 2753  C CG   . LYS A 1 22  ? 16.289  1.139   3.061   1.00 0.00 ? 22  LYS A CG   2  
ATOM 2754  C CD   . LYS A 1 22  ? 16.372  -0.399  2.924   1.00 0.00 ? 22  LYS A CD   2  
ATOM 2755  C CE   . LYS A 1 22  ? 15.295  -1.092  2.049   1.00 0.00 ? 22  LYS A CE   2  
ATOM 2756  N NZ   . LYS A 1 22  ? 14.361  -1.887  2.888   1.00 0.00 ? 22  LYS A NZ   2  
ATOM 2757  H H    . LYS A 1 22  ? 14.936  3.666   5.741   1.00 0.00 ? 22  LYS A H    2  
ATOM 2758  H HA   . LYS A 1 22  ? 15.198  3.697   2.732   1.00 0.00 ? 22  LYS A HA   2  
ATOM 2759  H HB2  . LYS A 1 22  ? 14.882  1.286   4.706   1.00 0.00 ? 22  LYS A HB2  2  
ATOM 2760  H HB3  . LYS A 1 22  ? 14.109  1.178   3.174   1.00 0.00 ? 22  LYS A HB3  2  
ATOM 2761  H HG2  . LYS A 1 22  ? 16.499  1.621   2.090   1.00 0.00 ? 22  LYS A HG2  2  
ATOM 2762  H HG3  . LYS A 1 22  ? 17.127  1.473   3.705   1.00 0.00 ? 22  LYS A HG3  2  
ATOM 2763  H HD2  . LYS A 1 22  ? 17.364  -0.642  2.496   1.00 0.00 ? 22  LYS A HD2  2  
ATOM 2764  H HD3  . LYS A 1 22  ? 16.423  -0.840  3.942   1.00 0.00 ? 22  LYS A HD3  2  
ATOM 2765  H HE2  . LYS A 1 22  ? 14.736  -0.376  1.416   1.00 0.00 ? 22  LYS A HE2  2  
ATOM 2766  H HE3  . LYS A 1 22  ? 15.787  -1.758  1.313   1.00 0.00 ? 22  LYS A HE3  2  
ATOM 2767  H HZ1  . LYS A 1 22  ? 14.858  -2.424  3.607   1.00 0.00 ? 22  LYS A HZ1  2  
ATOM 2768  H HZ2  . LYS A 1 22  ? 13.702  -1.306  3.483   1.00 0.00 ? 22  LYS A HZ2  2  
ATOM 2769  H HZ3  . LYS A 1 22  ? 13.797  -2.573  2.352   1.00 0.00 ? 22  LYS A HZ3  2  
ATOM 2770  N N    . THR A 1 23  ? 12.669  4.005   2.687   1.00 0.00 ? 23  THR A N    2  
ATOM 2771  C CA   . THR A 1 23  ? 11.257  4.471   2.603   1.00 0.00 ? 23  THR A CA   2  
ATOM 2772  C C    . THR A 1 23  ? 10.549  3.910   1.319   1.00 0.00 ? 23  THR A C    2  
ATOM 2773  O O    . THR A 1 23  ? 11.179  3.470   0.351   1.00 0.00 ? 23  THR A O    2  
ATOM 2774  C CB   . THR A 1 23  ? 11.198  6.039   2.663   1.00 0.00 ? 23  THR A CB   2  
ATOM 2775  O OG1  . THR A 1 23  ? 11.683  6.626   1.462   1.00 0.00 ? 23  THR A OG1  2  
ATOM 2776  C CG2  . THR A 1 23  ? 12.014  6.728   3.775   1.00 0.00 ? 23  THR A CG2  2  
ATOM 2777  H H    . THR A 1 23  ? 13.317  4.051   1.900   1.00 0.00 ? 23  THR A H    2  
ATOM 2778  H HA   . THR A 1 23  ? 10.688  4.076   3.456   1.00 0.00 ? 23  THR A HA   2  
ATOM 2779  H HB   . THR A 1 23  ? 10.131  6.313   2.785   1.00 0.00 ? 23  THR A HB   2  
ATOM 2780  H HG1  . THR A 1 23  ? 11.285  7.553   1.462   1.00 0.00 ? 23  THR A HG1  2  
ATOM 2781  H HG21 . THR A 1 23  ? 11.736  6.372   4.778   1.00 0.00 ? 23  THR A HG21 2  
ATOM 2782  H HG22 . THR A 1 23  ? 13.099  6.545   3.649   1.00 0.00 ? 23  THR A HG22 2  
ATOM 2783  H HG23 . THR A 1 23  ? 11.879  7.825   3.749   1.00 0.00 ? 23  THR A HG23 2  
ATOM 2784  N N    . PHE A 1 24  ? 9.204   3.908   1.315   1.00 0.00 ? 24  PHE A N    2  
ATOM 2785  C CA   . PHE A 1 24  ? 8.394   3.440   0.154   1.00 0.00 ? 24  PHE A CA   2  
ATOM 2786  C C    . PHE A 1 24  ? 8.010   4.647   -0.770  1.00 0.00 ? 24  PHE A C    2  
ATOM 2787  O O    . PHE A 1 24  ? 7.325   5.577   -0.329  1.00 0.00 ? 24  PHE A O    2  
ATOM 2788  C CB   . PHE A 1 24  ? 7.146   2.756   0.769   1.00 0.00 ? 24  PHE A CB   2  
ATOM 2789  C CG   . PHE A 1 24  ? 6.246   2.011   -0.221  1.00 0.00 ? 24  PHE A CG   2  
ATOM 2790  C CD1  . PHE A 1 24  ? 6.516   0.677   -0.526  1.00 0.00 ? 24  PHE A CD1  2  
ATOM 2791  C CD2  . PHE A 1 24  ? 5.124   2.634   -0.780  1.00 0.00 ? 24  PHE A CD2  2  
ATOM 2792  C CE1  . PHE A 1 24  ? 5.669   -0.033  -1.367  1.00 0.00 ? 24  PHE A CE1  2  
ATOM 2793  C CE2  . PHE A 1 24  ? 4.276   1.920   -1.626  1.00 0.00 ? 24  PHE A CE2  2  
ATOM 2794  C CZ   . PHE A 1 24  ? 4.548   0.584   -1.916  1.00 0.00 ? 24  PHE A CZ   2  
ATOM 2795  H H    . PHE A 1 24  ? 8.743   4.271   2.163   1.00 0.00 ? 24  PHE A H    2  
ATOM 2796  H HA   . PHE A 1 24  ? 8.966   2.682   -0.437  1.00 0.00 ? 24  PHE A HA   2  
ATOM 2797  H HB2  . PHE A 1 24  ? 7.451   2.049   1.566   1.00 0.00 ? 24  PHE A HB2  2  
ATOM 2798  H HB3  . PHE A 1 24  ? 6.552   3.518   1.310   1.00 0.00 ? 24  PHE A HB3  2  
ATOM 2799  H HD1  . PHE A 1 24  ? 7.379   0.186   -0.102  1.00 0.00 ? 24  PHE A HD1  2  
ATOM 2800  H HD2  . PHE A 1 24  ? 4.902   3.667   -0.551  1.00 0.00 ? 24  PHE A HD2  2  
ATOM 2801  H HE1  . PHE A 1 24  ? 5.886   -1.064  -1.576  1.00 0.00 ? 24  PHE A HE1  2  
ATOM 2802  H HE2  . PHE A 1 24  ? 3.405   2.401   -2.046  1.00 0.00 ? 24  PHE A HE2  2  
ATOM 2803  H HZ   . PHE A 1 24  ? 3.891   0.027   -2.567  1.00 0.00 ? 24  PHE A HZ   2  
ATOM 2804  N N    . TYR A 1 25  ? 8.430   4.632   -2.049  1.00 0.00 ? 25  TYR A N    2  
ATOM 2805  C CA   . TYR A 1 25  ? 8.156   5.754   -3.000  1.00 0.00 ? 25  TYR A CA   2  
ATOM 2806  C C    . TYR A 1 25  ? 8.174   5.287   -4.502  1.00 0.00 ? 25  TYR A C    2  
ATOM 2807  O O    . TYR A 1 25  ? 8.414   4.120   -4.850  1.00 0.00 ? 25  TYR A O    2  
ATOM 2808  C CB   . TYR A 1 25  ? 9.162   6.896   -2.668  1.00 0.00 ? 25  TYR A CB   2  
ATOM 2809  C CG   . TYR A 1 25  ? 10.682  6.784   -2.857  1.00 0.00 ? 25  TYR A CG   2  
ATOM 2810  C CD1  . TYR A 1 25  ? 11.474  6.383   -1.778  1.00 0.00 ? 25  TYR A CD1  2  
ATOM 2811  C CD2  . TYR A 1 25  ? 11.290  7.337   -3.988  1.00 0.00 ? 25  TYR A CD2  2  
ATOM 2812  C CE1  . TYR A 1 25  ? 12.853  6.562   -1.813  1.00 0.00 ? 25  TYR A CE1  2  
ATOM 2813  C CE2  . TYR A 1 25  ? 12.672  7.513   -4.023  1.00 0.00 ? 25  TYR A CE2  2  
ATOM 2814  C CZ   . TYR A 1 25  ? 13.450  7.130   -2.935  1.00 0.00 ? 25  TYR A CZ   2  
ATOM 2815  O OH   . TYR A 1 25  ? 14.800  7.339   -2.958  1.00 0.00 ? 25  TYR A OH   2  
ATOM 2816  H H    . TYR A 1 25  ? 8.991   3.816   -2.329  1.00 0.00 ? 25  TYR A H    2  
ATOM 2817  H HA   . TYR A 1 25  ? 7.136   6.196   -2.835  1.00 0.00 ? 25  TYR A HA   2  
ATOM 2818  H HB2  . TYR A 1 25  ? 8.835   7.773   -3.231  1.00 0.00 ? 25  TYR A HB2  2  
ATOM 2819  H HB3  . TYR A 1 25  ? 8.973   7.217   -1.626  1.00 0.00 ? 25  TYR A HB3  2  
ATOM 2820  H HD1  . TYR A 1 25  ? 11.013  5.991   -0.882  1.00 0.00 ? 25  TYR A HD1  2  
ATOM 2821  H HD2  . TYR A 1 25  ? 10.687  7.688   -4.815  1.00 0.00 ? 25  TYR A HD2  2  
ATOM 2822  H HE1  . TYR A 1 25  ? 13.435  6.301   -0.942  1.00 0.00 ? 25  TYR A HE1  2  
ATOM 2823  H HE2  . TYR A 1 25  ? 13.142  7.964   -4.881  1.00 0.00 ? 25  TYR A HE2  2  
ATOM 2824  H HH   . TYR A 1 25  ? 15.134  7.120   -2.087  1.00 0.00 ? 25  TYR A HH   2  
ATOM 2825  N N    . LEU A 1 26  ? 7.841   6.230   -5.405  1.00 0.00 ? 26  LEU A N    2  
ATOM 2826  C CA   . LEU A 1 26  ? 7.766   5.970   -6.868  1.00 0.00 ? 26  LEU A CA   2  
ATOM 2827  C C    . LEU A 1 26  ? 8.705   6.923   -7.677  1.00 0.00 ? 26  LEU A C    2  
ATOM 2828  O O    . LEU A 1 26  ? 9.096   8.010   -7.237  1.00 0.00 ? 26  LEU A O    2  
ATOM 2829  C CB   . LEU A 1 26  ? 6.287   6.141   -7.345  1.00 0.00 ? 26  LEU A CB   2  
ATOM 2830  C CG   . LEU A 1 26  ? 5.265   5.061   -6.884  1.00 0.00 ? 26  LEU A CG   2  
ATOM 2831  C CD1  . LEU A 1 26  ? 4.538   5.439   -5.584  1.00 0.00 ? 26  LEU A CD1  2  
ATOM 2832  C CD2  . LEU A 1 26  ? 4.207   4.806   -7.967  1.00 0.00 ? 26  LEU A CD2  2  
ATOM 2833  H H    . LEU A 1 26  ? 7.674   7.168   -5.021  1.00 0.00 ? 26  LEU A H    2  
ATOM 2834  H HA   . LEU A 1 26  ? 8.085   4.934   -7.090  1.00 0.00 ? 26  LEU A HA   2  
ATOM 2835  H HB2  . LEU A 1 26  ? 5.913   7.154   -7.102  1.00 0.00 ? 26  LEU A HB2  2  
ATOM 2836  H HB3  . LEU A 1 26  ? 6.302   6.141   -8.453  1.00 0.00 ? 26  LEU A HB3  2  
ATOM 2837  H HG   . LEU A 1 26  ? 5.807   4.113   -6.711  1.00 0.00 ? 26  LEU A HG   2  
ATOM 2838  H HD11 . LEU A 1 26  ? 5.235   5.638   -4.753  1.00 0.00 ? 26  LEU A HD11 2  
ATOM 2839  H HD12 . LEU A 1 26  ? 3.923   6.347   -5.716  1.00 0.00 ? 26  LEU A HD12 2  
ATOM 2840  H HD13 . LEU A 1 26  ? 3.855   4.646   -5.233  1.00 0.00 ? 26  LEU A HD13 2  
ATOM 2841  H HD21 . LEU A 1 26  ? 4.670   4.467   -8.907  1.00 0.00 ? 26  LEU A HD21 2  
ATOM 2842  H HD22 . LEU A 1 26  ? 3.501   4.010   -7.670  1.00 0.00 ? 26  LEU A HD22 2  
ATOM 2843  H HD23 . LEU A 1 26  ? 3.625   5.717   -8.203  1.00 0.00 ? 26  LEU A HD23 2  
ATOM 2844  N N    . ARG A 1 27  ? 9.073   6.473   -8.892  1.00 0.00 ? 27  ARG A N    2  
ATOM 2845  C CA   . ARG A 1 27  ? 9.887   7.289   -9.848  1.00 0.00 ? 27  ARG A CA   2  
ATOM 2846  C C    . ARG A 1 27  ? 8.905   7.914   -10.894 1.00 0.00 ? 27  ARG A C    2  
ATOM 2847  O O    . ARG A 1 27  ? 8.699   9.129   -10.887 1.00 0.00 ? 27  ARG A O    2  
ATOM 2848  C CB   . ARG A 1 27  ? 11.018  6.413   -10.464 1.00 0.00 ? 27  ARG A CB   2  
ATOM 2849  C CG   . ARG A 1 27  ? 12.110  5.894   -9.493  1.00 0.00 ? 27  ARG A CG   2  
ATOM 2850  C CD   . ARG A 1 27  ? 13.016  6.952   -8.819  1.00 0.00 ? 27  ARG A CD   2  
ATOM 2851  N NE   . ARG A 1 27  ? 13.844  7.779   -9.744  1.00 0.00 ? 27  ARG A NE   2  
ATOM 2852  C CZ   . ARG A 1 27  ? 14.925  7.376   -10.418 1.00 0.00 ? 27  ARG A CZ   2  
ATOM 2853  N NH1  . ARG A 1 27  ? 15.359  6.143   -10.431 1.00 0.00 ? 27  ARG A NH1  2  
ATOM 2854  N NH2  . ARG A 1 27  ? 15.590  8.266   -11.092 1.00 0.00 ? 27  ARG A NH2  2  
ATOM 2855  H H    . ARG A 1 27  ? 8.658   5.563   -9.136  1.00 0.00 ? 27  ARG A H    2  
ATOM 2856  H HA   . ARG A 1 27  ? 10.367  8.144   -9.333  1.00 0.00 ? 27  ARG A HA   2  
ATOM 2857  H HB2  . ARG A 1 27  ? 10.572  5.541   -10.979 1.00 0.00 ? 27  ARG A HB2  2  
ATOM 2858  H HB3  . ARG A 1 27  ? 11.513  6.985   -11.273 1.00 0.00 ? 27  ARG A HB3  2  
ATOM 2859  H HG2  . ARG A 1 27  ? 11.621  5.301   -8.696  1.00 0.00 ? 27  ARG A HG2  2  
ATOM 2860  H HG3  . ARG A 1 27  ? 12.730  5.158   -10.036 1.00 0.00 ? 27  ARG A HG3  2  
ATOM 2861  H HD2  . ARG A 1 27  ? 12.377  7.627   -8.215  1.00 0.00 ? 27  ARG A HD2  2  
ATOM 2862  H HD3  . ARG A 1 27  ? 13.656  6.479   -8.049  1.00 0.00 ? 27  ARG A HD3  2  
ATOM 2863  H HE   . ARG A 1 27  ? 13.728  8.803   -9.784  1.00 0.00 ? 27  ARG A HE   2  
ATOM 2864  H HH11 . ARG A 1 27  ? 14.809  5.509   -9.851  1.00 0.00 ? 27  ARG A HH11 2  
ATOM 2865  H HH12 . ARG A 1 27  ? 16.215  5.930   -10.947 1.00 0.00 ? 27  ARG A HH12 2  
ATOM 2866  H HH21 . ARG A 1 27  ? 15.275  9.237   -10.969 1.00 0.00 ? 27  ARG A HH21 2  
ATOM 2867  H HH22 . ARG A 1 27  ? 16.422  7.959   -11.598 1.00 0.00 ? 27  ARG A HH22 2  
ATOM 2868  N N    . ASN A 1 28  ? 8.314   7.092   -11.783 1.00 0.00 ? 28  ASN A N    2  
ATOM 2869  C CA   . ASN A 1 28  ? 7.224   7.516   -12.700 1.00 0.00 ? 28  ASN A CA   2  
ATOM 2870  C C    . ASN A 1 28  ? 5.967   6.725   -12.203 1.00 0.00 ? 28  ASN A C    2  
ATOM 2871  O O    . ASN A 1 28  ? 5.195   7.265   -11.408 1.00 0.00 ? 28  ASN A O    2  
ATOM 2872  C CB   . ASN A 1 28  ? 7.685   7.297   -14.170 1.00 0.00 ? 28  ASN A CB   2  
ATOM 2873  C CG   . ASN A 1 28  ? 6.636   7.687   -15.217 1.00 0.00 ? 28  ASN A CG   2  
ATOM 2874  O OD1  . ASN A 1 28  ? 5.731   6.923   -15.538 1.00 0.00 ? 28  ASN A OD1  2  
ATOM 2875  N ND2  . ASN A 1 28  ? 6.703   8.875   -15.765 1.00 0.00 ? 28  ASN A ND2  2  
ATOM 2876  H H    . ASN A 1 28  ? 8.576   6.108   -11.672 1.00 0.00 ? 28  ASN A H    2  
ATOM 2877  H HA   . ASN A 1 28  ? 6.989   8.593   -12.571 1.00 0.00 ? 28  ASN A HA   2  
ATOM 2878  H HB2  . ASN A 1 28  ? 8.625   7.854   -14.353 1.00 0.00 ? 28  ASN A HB2  2  
ATOM 2879  H HB3  . ASN A 1 28  ? 7.956   6.239   -14.345 1.00 0.00 ? 28  ASN A HB3  2  
ATOM 2880  H HD21 . ASN A 1 28  ? 7.451   9.498   -15.450 1.00 0.00 ? 28  ASN A HD21 2  
ATOM 2881  H HD22 . ASN A 1 28  ? 5.973   9.060   -16.459 1.00 0.00 ? 28  ASN A HD22 2  
ATOM 2882  N N    . ASN A 1 29  ? 5.790   5.449   -12.606 1.00 0.00 ? 29  ASN A N    2  
ATOM 2883  C CA   . ASN A 1 29  ? 4.669   4.596   -12.121 1.00 0.00 ? 29  ASN A CA   2  
ATOM 2884  C C    . ASN A 1 29  ? 5.206   3.163   -11.770 1.00 0.00 ? 29  ASN A C    2  
ATOM 2885  O O    . ASN A 1 29  ? 4.837   2.171   -12.405 1.00 0.00 ? 29  ASN A O    2  
ATOM 2886  C CB   . ASN A 1 29  ? 3.535   4.591   -13.192 1.00 0.00 ? 29  ASN A CB   2  
ATOM 2887  C CG   . ASN A 1 29  ? 2.701   5.877   -13.271 1.00 0.00 ? 29  ASN A CG   2  
ATOM 2888  O OD1  . ASN A 1 29  ? 1.806   6.115   -12.468 1.00 0.00 ? 29  ASN A OD1  2  
ATOM 2889  N ND2  . ASN A 1 29  ? 2.962   6.743   -14.222 1.00 0.00 ? 29  ASN A ND2  2  
ATOM 2890  H H    . ASN A 1 29  ? 6.484   5.113   -13.280 1.00 0.00 ? 29  ASN A H    2  
ATOM 2891  H HA   . ASN A 1 29  ? 4.240   4.994   -11.178 1.00 0.00 ? 29  ASN A HA   2  
ATOM 2892  H HB2  . ASN A 1 29  ? 3.931   4.312   -14.187 1.00 0.00 ? 29  ASN A HB2  2  
ATOM 2893  H HB3  . ASN A 1 29  ? 2.816   3.787   -12.951 1.00 0.00 ? 29  ASN A HB3  2  
ATOM 2894  H HD21 . ASN A 1 29  ? 3.836   6.597   -14.746 1.00 0.00 ? 29  ASN A HD21 2  
ATOM 2895  H HD22 . ASN A 1 29  ? 2.427   7.610   -14.137 1.00 0.00 ? 29  ASN A HD22 2  
ATOM 2896  N N    . GLN A 1 30  ? 6.076   3.050   -10.741 1.00 0.00 ? 30  GLN A N    2  
ATOM 2897  C CA   . GLN A 1 30  ? 6.594   1.744   -10.227 1.00 0.00 ? 30  GLN A CA   2  
ATOM 2898  C C    . GLN A 1 30  ? 6.794   1.877   -8.682  1.00 0.00 ? 30  GLN A C    2  
ATOM 2899  O O    . GLN A 1 30  ? 7.350   2.866   -8.196  1.00 0.00 ? 30  GLN A O    2  
ATOM 2900  C CB   . GLN A 1 30  ? 7.947   1.329   -10.873 1.00 0.00 ? 30  GLN A CB   2  
ATOM 2901  C CG   . GLN A 1 30  ? 7.954   0.967   -12.381 1.00 0.00 ? 30  GLN A CG   2  
ATOM 2902  C CD   . GLN A 1 30  ? 7.283   -0.364  -12.745 1.00 0.00 ? 30  GLN A CD   2  
ATOM 2903  O OE1  . GLN A 1 30  ? 7.875   -1.434  -12.663 1.00 0.00 ? 30  GLN A OE1  2  
ATOM 2904  N NE2  . GLN A 1 30  ? 6.039   -0.351  -13.157 1.00 0.00 ? 30  GLN A NE2  2  
ATOM 2905  H H    . GLN A 1 30  ? 6.339   3.936   -10.289 1.00 0.00 ? 30  GLN A H    2  
ATOM 2906  H HA   . GLN A 1 30  ? 5.852   0.944   -10.427 1.00 0.00 ? 30  GLN A HA   2  
ATOM 2907  H HB2  . GLN A 1 30  ? 8.678   2.130   -10.678 1.00 0.00 ? 30  GLN A HB2  2  
ATOM 2908  H HB3  . GLN A 1 30  ? 8.360   0.458   -10.324 1.00 0.00 ? 30  GLN A HB3  2  
ATOM 2909  H HG2  . GLN A 1 30  ? 7.539   1.794   -12.987 1.00 0.00 ? 30  GLN A HG2  2  
ATOM 2910  H HG3  . GLN A 1 30  ? 9.005   0.887   -12.716 1.00 0.00 ? 30  GLN A HG3  2  
ATOM 2911  H HE21 . GLN A 1 30  ? 5.542   0.549   -13.071 1.00 0.00 ? 30  GLN A HE21 2  
ATOM 2912  H HE22 . GLN A 1 30  ? 5.647   -1.279  -13.338 1.00 0.00 ? 30  GLN A HE22 2  
ATOM 2913  N N    . LEU A 1 31  ? 6.361   0.862   -7.918  1.00 0.00 ? 31  LEU A N    2  
ATOM 2914  C CA   . LEU A 1 31  ? 6.465   0.851   -6.422  1.00 0.00 ? 31  LEU A CA   2  
ATOM 2915  C C    . LEU A 1 31  ? 7.880   0.334   -5.990  1.00 0.00 ? 31  LEU A C    2  
ATOM 2916  O O    . LEU A 1 31  ? 8.093   -0.880  -5.822  1.00 0.00 ? 31  LEU A O    2  
ATOM 2917  C CB   . LEU A 1 31  ? 5.331   -0.046  -5.844  1.00 0.00 ? 31  LEU A CB   2  
ATOM 2918  C CG   . LEU A 1 31  ? 3.852   0.293   -6.183  1.00 0.00 ? 31  LEU A CG   2  
ATOM 2919  C CD1  . LEU A 1 31  ? 2.920   -0.848  -5.751  1.00 0.00 ? 31  LEU A CD1  2  
ATOM 2920  C CD2  . LEU A 1 31  ? 3.369   1.606   -5.555  1.00 0.00 ? 31  LEU A CD2  2  
ATOM 2921  H H    . LEU A 1 31  ? 5.943   0.098   -8.454  1.00 0.00 ? 31  LEU A H    2  
ATOM 2922  H HA   . LEU A 1 31  ? 6.322   1.873   -6.015  1.00 0.00 ? 31  LEU A HA   2  
ATOM 2923  H HB2  . LEU A 1 31  ? 5.527   -1.088  -6.163  1.00 0.00 ? 31  LEU A HB2  2  
ATOM 2924  H HB3  . LEU A 1 31  ? 5.454   -0.066  -4.745  1.00 0.00 ? 31  LEU A HB3  2  
ATOM 2925  H HG   . LEU A 1 31  ? 3.759   0.387   -7.280  1.00 0.00 ? 31  LEU A HG   2  
ATOM 2926  H HD11 . LEU A 1 31  ? 3.205   -1.812  -6.212  1.00 0.00 ? 31  LEU A HD11 2  
ATOM 2927  H HD12 . LEU A 1 31  ? 2.914   -0.990  -4.655  1.00 0.00 ? 31  LEU A HD12 2  
ATOM 2928  H HD13 . LEU A 1 31  ? 1.875   -0.669  -6.059  1.00 0.00 ? 31  LEU A HD13 2  
ATOM 2929  H HD21 . LEU A 1 31  ? 3.435   1.595   -4.453  1.00 0.00 ? 31  LEU A HD21 2  
ATOM 2930  H HD22 . LEU A 1 31  ? 3.967   2.462   -5.909  1.00 0.00 ? 31  LEU A HD22 2  
ATOM 2931  H HD23 . LEU A 1 31  ? 2.316   1.817   -5.817  1.00 0.00 ? 31  LEU A HD23 2  
ATOM 2932  N N    . VAL A 1 32  ? 8.840   1.276   -5.857  1.00 0.00 ? 32  VAL A N    2  
ATOM 2933  C CA   . VAL A 1 32  ? 10.280  0.946   -5.596  1.00 0.00 ? 32  VAL A CA   2  
ATOM 2934  C C    . VAL A 1 32  ? 10.623  1.179   -4.078  1.00 0.00 ? 32  VAL A C    2  
ATOM 2935  O O    . VAL A 1 32  ? 9.875   1.815   -3.321  1.00 0.00 ? 32  VAL A O    2  
ATOM 2936  C CB   . VAL A 1 32  ? 11.262  1.721   -6.572  1.00 0.00 ? 32  VAL A CB   2  
ATOM 2937  C CG1  . VAL A 1 32  ? 12.354  0.746   -7.077  1.00 0.00 ? 32  VAL A CG1  2  
ATOM 2938  C CG2  . VAL A 1 32  ? 10.687  2.364   -7.862  1.00 0.00 ? 32  VAL A CG2  2  
ATOM 2939  H H    . VAL A 1 32  ? 8.522   2.253   -5.966  1.00 0.00 ? 32  VAL A H    2  
ATOM 2940  H HA   . VAL A 1 32  ? 10.423  -0.130  -5.773  1.00 0.00 ? 32  VAL A HA   2  
ATOM 2941  H HB   . VAL A 1 32  ? 11.793  2.513   -6.009  1.00 0.00 ? 32  VAL A HB   2  
ATOM 2942  H HG11 . VAL A 1 32  ? 12.916  0.290   -6.243  1.00 0.00 ? 32  VAL A HG11 2  
ATOM 2943  H HG12 . VAL A 1 32  ? 11.933  -0.092  -7.667  1.00 0.00 ? 32  VAL A HG12 2  
ATOM 2944  H HG13 . VAL A 1 32  ? 13.108  1.234   -7.722  1.00 0.00 ? 32  VAL A HG13 2  
ATOM 2945  H HG21 . VAL A 1 32  ? 10.148  1.625   -8.484  1.00 0.00 ? 32  VAL A HG21 2  
ATOM 2946  H HG22 . VAL A 1 32  ? 9.965   3.166   -7.620  1.00 0.00 ? 32  VAL A HG22 2  
ATOM 2947  H HG23 . VAL A 1 32  ? 11.468  2.824   -8.495  1.00 0.00 ? 32  VAL A HG23 2  
ATOM 2948  N N    . ALA A 1 33  ? 11.771  0.644   -3.617  1.00 0.00 ? 33  ALA A N    2  
ATOM 2949  C CA   . ALA A 1 33  ? 12.127  0.651   -2.184  1.00 0.00 ? 33  ALA A CA   2  
ATOM 2950  C C    . ALA A 1 33  ? 13.369  1.448   -1.765  1.00 0.00 ? 33  ALA A C    2  
ATOM 2951  O O    . ALA A 1 33  ? 14.397  1.558   -2.444  1.00 0.00 ? 33  ALA A O    2  
ATOM 2952  C CB   . ALA A 1 33  ? 12.516  -0.803  -1.830  1.00 0.00 ? 33  ALA A CB   2  
ATOM 2953  H H    . ALA A 1 33  ? 12.377  0.135   -4.279  1.00 0.00 ? 33  ALA A H    2  
ATOM 2954  H HA   . ALA A 1 33  ? 11.252  0.970   -1.559  1.00 0.00 ? 33  ALA A HA   2  
ATOM 2955  H HB1  . ALA A 1 33  ? 11.745  -1.530  -2.110  1.00 0.00 ? 33  ALA A HB1  2  
ATOM 2956  H HB2  . ALA A 1 33  ? 13.464  -1.094  -2.337  1.00 0.00 ? 33  ALA A HB2  2  
ATOM 2957  H HB3  . ALA A 1 33  ? 12.728  -0.915  -0.748  1.00 0.00 ? 33  ALA A HB3  2  
ATOM 2958  N N    . GLY A 1 34  ? 13.289  1.756   -0.473  1.00 0.00 ? 34  GLY A N    2  
ATOM 2959  C CA   . GLY A 1 34  ? 14.415  2.235   0.289   1.00 0.00 ? 34  GLY A CA   2  
ATOM 2960  C C    . GLY A 1 34  ? 14.911  3.619   0.003   1.00 0.00 ? 34  GLY A C    2  
ATOM 2961  O O    . GLY A 1 34  ? 14.389  4.599   0.520   1.00 0.00 ? 34  GLY A O    2  
ATOM 2962  H H    . GLY A 1 34  ? 12.345  1.693   -0.063  1.00 0.00 ? 34  GLY A H    2  
ATOM 2963  H HA2  . GLY A 1 34  ? 14.075  2.218   1.321   1.00 0.00 ? 34  GLY A HA2  2  
ATOM 2964  H HA3  . GLY A 1 34  ? 15.228  1.484   0.258   1.00 0.00 ? 34  GLY A HA3  2  
ATOM 2965  N N    . TYR A 1 35  ? 16.018  3.634   -0.703  1.00 0.00 ? 35  TYR A N    2  
ATOM 2966  C CA   . TYR A 1 35  ? 16.706  4.913   -1.024  1.00 0.00 ? 35  TYR A CA   2  
ATOM 2967  C C    . TYR A 1 35  ? 17.227  4.905   -2.512  1.00 0.00 ? 35  TYR A C    2  
ATOM 2968  O O    . TYR A 1 35  ? 18.336  5.379   -2.773  1.00 0.00 ? 35  TYR A O    2  
ATOM 2969  C CB   . TYR A 1 35  ? 17.840  5.165   0.045   1.00 0.00 ? 35  TYR A CB   2  
ATOM 2970  C CG   . TYR A 1 35  ? 17.627  6.157   1.226   1.00 0.00 ? 35  TYR A CG   2  
ATOM 2971  C CD1  . TYR A 1 35  ? 16.399  6.716   1.612   1.00 0.00 ? 35  TYR A CD1  2  
ATOM 2972  C CD2  . TYR A 1 35  ? 18.772  6.497   1.965   1.00 0.00 ? 35  TYR A CD2  2  
ATOM 2973  C CE1  . TYR A 1 35  ? 16.307  7.548   2.724   1.00 0.00 ? 35  TYR A CE1  2  
ATOM 2974  C CE2  . TYR A 1 35  ? 18.684  7.355   3.058   1.00 0.00 ? 35  TYR A CE2  2  
ATOM 2975  C CZ   . TYR A 1 35  ? 17.454  7.866   3.446   1.00 0.00 ? 35  TYR A CZ   2  
ATOM 2976  O OH   . TYR A 1 35  ? 17.364  8.675   4.545   1.00 0.00 ? 35  TYR A OH   2  
ATOM 2977  H H    . TYR A 1 35  ? 16.164  2.685   -1.102  1.00 0.00 ? 35  TYR A H    2  
ATOM 2978  H HA   . TYR A 1 35  ? 15.976  5.728   -0.913  1.00 0.00 ? 35  TYR A HA   2  
ATOM 2979  H HB2  . TYR A 1 35  ? 18.183  4.202   0.473   1.00 0.00 ? 35  TYR A HB2  2  
ATOM 2980  H HB3  . TYR A 1 35  ? 18.751  5.521   -0.472  1.00 0.00 ? 35  TYR A HB3  2  
ATOM 2981  H HD1  . TYR A 1 35  ? 15.488  6.537   1.070   1.00 0.00 ? 35  TYR A HD1  2  
ATOM 2982  H HD2  . TYR A 1 35  ? 19.735  6.088   1.704   1.00 0.00 ? 35  TYR A HD2  2  
ATOM 2983  H HE1  . TYR A 1 35  ? 15.348  7.943   3.020   1.00 0.00 ? 35  TYR A HE1  2  
ATOM 2984  H HE2  . TYR A 1 35  ? 19.571  7.606   3.625   1.00 0.00 ? 35  TYR A HE2  2  
ATOM 2985  H HH   . TYR A 1 35  ? 16.453  8.957   4.651   1.00 0.00 ? 35  TYR A HH   2  
ATOM 2986  N N    . LEU A 1 36  ? 16.419  4.525   -3.533  1.00 0.00 ? 36  LEU A N    2  
ATOM 2987  C CA   . LEU A 1 36  ? 16.938  4.408   -4.940  1.00 0.00 ? 36  LEU A CA   2  
ATOM 2988  C C    . LEU A 1 36  ? 17.143  5.712   -5.802  1.00 0.00 ? 36  LEU A C    2  
ATOM 2989  O O    . LEU A 1 36  ? 17.524  5.626   -6.973  1.00 0.00 ? 36  LEU A O    2  
ATOM 2990  C CB   . LEU A 1 36  ? 16.043  3.309   -5.589  1.00 0.00 ? 36  LEU A CB   2  
ATOM 2991  C CG   . LEU A 1 36  ? 14.660  3.569   -6.239  1.00 0.00 ? 36  LEU A CG   2  
ATOM 2992  C CD1  . LEU A 1 36  ? 13.763  4.585   -5.519  1.00 0.00 ? 36  LEU A CD1  2  
ATOM 2993  C CD2  . LEU A 1 36  ? 14.783  3.900   -7.731  1.00 0.00 ? 36  LEU A CD2  2  
ATOM 2994  H H    . LEU A 1 36  ? 15.516  4.086   -3.280  1.00 0.00 ? 36  LEU A H    2  
ATOM 2995  H HA   . LEU A 1 36  ? 17.972  4.033   -4.885  1.00 0.00 ? 36  LEU A HA   2  
ATOM 2996  H HB2  . LEU A 1 36  ? 16.680  2.799   -6.335  1.00 0.00 ? 36  LEU A HB2  2  
ATOM 2997  H HB3  . LEU A 1 36  ? 15.886  2.502   -4.845  1.00 0.00 ? 36  LEU A HB3  2  
ATOM 2998  H HG   . LEU A 1 36  ? 14.133  2.599   -6.187  1.00 0.00 ? 36  LEU A HG   2  
ATOM 2999  H HD11 . LEU A 1 36  ? 13.571  4.290   -4.471  1.00 0.00 ? 36  LEU A HD11 2  
ATOM 3000  H HD12 . LEU A 1 36  ? 14.218  5.591   -5.498  1.00 0.00 ? 36  LEU A HD12 2  
ATOM 3001  H HD13 . LEU A 1 36  ? 12.774  4.687   -6.002  1.00 0.00 ? 36  LEU A HD13 2  
ATOM 3002  H HD21 . LEU A 1 36  ? 15.372  3.133   -8.270  1.00 0.00 ? 36  LEU A HD21 2  
ATOM 3003  H HD22 . LEU A 1 36  ? 13.792  3.934   -8.215  1.00 0.00 ? 36  LEU A HD22 2  
ATOM 3004  H HD23 . LEU A 1 36  ? 15.287  4.868   -7.887  1.00 0.00 ? 36  LEU A HD23 2  
ATOM 3005  N N    . GLN A 1 37  ? 16.900  6.903   -5.240  1.00 0.00 ? 37  GLN A N    2  
ATOM 3006  C CA   . GLN A 1 37  ? 17.200  8.213   -5.895  1.00 0.00 ? 37  GLN A CA   2  
ATOM 3007  C C    . GLN A 1 37  ? 17.454  9.330   -4.822  1.00 0.00 ? 37  GLN A C    2  
ATOM 3008  O O    . GLN A 1 37  ? 18.542  9.910   -4.811  1.00 0.00 ? 37  GLN A O    2  
ATOM 3009  C CB   . GLN A 1 37  ? 16.075  8.635   -6.893  1.00 0.00 ? 37  GLN A CB   2  
ATOM 3010  C CG   . GLN A 1 37  ? 16.517  9.779   -7.857  1.00 0.00 ? 37  GLN A CG   2  
ATOM 3011  C CD   . GLN A 1 37  ? 15.408  10.718  -8.345  1.00 0.00 ? 37  GLN A CD   2  
ATOM 3012  O OE1  . GLN A 1 37  ? 14.760  10.499  -9.366  1.00 0.00 ? 37  GLN A OE1  2  
ATOM 3013  N NE2  . GLN A 1 37  ? 15.176  11.807  -7.654  1.00 0.00 ? 37  GLN A NE2  2  
ATOM 3014  H H    . GLN A 1 37  ? 16.626  6.763   -4.262  1.00 0.00 ? 37  GLN A H    2  
ATOM 3015  H HA   . GLN A 1 37  ? 18.149  8.111   -6.461  1.00 0.00 ? 37  GLN A HA   2  
ATOM 3016  H HB2  . GLN A 1 37  ? 15.771  7.763   -7.500  1.00 0.00 ? 37  GLN A HB2  2  
ATOM 3017  H HB3  . GLN A 1 37  ? 15.161  8.914   -6.333  1.00 0.00 ? 37  GLN A HB3  2  
ATOM 3018  H HG2  . GLN A 1 37  ? 17.320  10.394  -7.405  1.00 0.00 ? 37  GLN A HG2  2  
ATOM 3019  H HG3  . GLN A 1 37  ? 17.007  9.334   -8.741  1.00 0.00 ? 37  GLN A HG3  2  
ATOM 3020  H HE21 . GLN A 1 37  ? 15.737  11.953  -6.810  1.00 0.00 ? 37  GLN A HE21 2  
ATOM 3021  H HE22 . GLN A 1 37  ? 14.444  12.411  -8.039  1.00 0.00 ? 37  GLN A HE22 2  
ATOM 3022  N N    . GLY A 1 38  ? 16.467  9.674   -3.971  1.00 0.00 ? 38  GLY A N    2  
ATOM 3023  C CA   . GLY A 1 38  ? 16.610  10.758  -2.967  1.00 0.00 ? 38  GLY A CA   2  
ATOM 3024  C C    . GLY A 1 38  ? 15.221  11.276  -2.515  1.00 0.00 ? 38  GLY A C    2  
ATOM 3025  O O    . GLY A 1 38  ? 14.673  12.117  -3.237  1.00 0.00 ? 38  GLY A O    2  
ATOM 3026  H H    . GLY A 1 38  ? 15.611  9.111   -4.064  1.00 0.00 ? 38  GLY A H    2  
ATOM 3027  H HA2  . GLY A 1 38  ? 17.225  10.416  -2.115  1.00 0.00 ? 38  GLY A HA2  2  
ATOM 3028  H HA3  . GLY A 1 38  ? 17.167  11.615  -3.394  1.00 0.00 ? 38  GLY A HA3  2  
ATOM 3029  N N    . PRO A 1 39  ? 14.616  10.854  -1.367  1.00 0.00 ? 39  PRO A N    2  
ATOM 3030  C CA   . PRO A 1 39  ? 13.255  11.307  -0.968  1.00 0.00 ? 39  PRO A CA   2  
ATOM 3031  C C    . PRO A 1 39  ? 13.191  12.773  -0.423  1.00 0.00 ? 39  PRO A C    2  
ATOM 3032  O O    . PRO A 1 39  ? 13.731  13.087  0.641   1.00 0.00 ? 39  PRO A O    2  
ATOM 3033  C CB   . PRO A 1 39  ? 12.871  10.245  0.074   1.00 0.00 ? 39  PRO A CB   2  
ATOM 3034  C CG   . PRO A 1 39  ? 14.179  9.749   0.686   1.00 0.00 ? 39  PRO A CG   2  
ATOM 3035  C CD   . PRO A 1 39  ? 15.202  9.859   -0.443  1.00 0.00 ? 39  PRO A CD   2  
ATOM 3036  H HA   . PRO A 1 39  ? 12.553  11.213  -1.822  1.00 0.00 ? 39  PRO A HA   2  
ATOM 3037  H HB2  . PRO A 1 39  ? 12.167  10.620  0.842   1.00 0.00 ? 39  PRO A HB2  2  
ATOM 3038  H HB3  . PRO A 1 39  ? 12.356  9.399   -0.422  1.00 0.00 ? 39  PRO A HB3  2  
ATOM 3039  H HG2  . PRO A 1 39  ? 14.470  10.400  1.533   1.00 0.00 ? 39  PRO A HG2  2  
ATOM 3040  H HG3  . PRO A 1 39  ? 14.081  8.721   1.082   1.00 0.00 ? 39  PRO A HG3  2  
ATOM 3041  H HD2  . PRO A 1 39  ? 16.187  10.176  -0.048  1.00 0.00 ? 39  PRO A HD2  2  
ATOM 3042  H HD3  . PRO A 1 39  ? 15.339  8.886   -0.946  1.00 0.00 ? 39  PRO A HD3  2  
ATOM 3043  N N    . ASN A 1 40  ? 12.533  13.667  -1.182  1.00 0.00 ? 40  ASN A N    2  
ATOM 3044  C CA   . ASN A 1 40  ? 12.383  15.106  -0.807  1.00 0.00 ? 40  ASN A CA   2  
ATOM 3045  C C    . ASN A 1 40  ? 10.902  15.570  -1.032  1.00 0.00 ? 40  ASN A C    2  
ATOM 3046  O O    . ASN A 1 40  ? 10.211  15.887  -0.062  1.00 0.00 ? 40  ASN A O    2  
ATOM 3047  C CB   . ASN A 1 40  ? 13.414  15.962  -1.611  1.00 0.00 ? 40  ASN A CB   2  
ATOM 3048  C CG   . ASN A 1 40  ? 14.884  15.829  -1.193  1.00 0.00 ? 40  ASN A CG   2  
ATOM 3049  O OD1  . ASN A 1 40  ? 15.378  16.543  -0.329  1.00 0.00 ? 40  ASN A OD1  2  
ATOM 3050  N ND2  . ASN A 1 40  ? 15.639  14.940  -1.795  1.00 0.00 ? 40  ASN A ND2  2  
ATOM 3051  H H    . ASN A 1 40  ? 12.133  13.280  -2.041  1.00 0.00 ? 40  ASN A H    2  
ATOM 3052  H HA   . ASN A 1 40  ? 12.580  15.253  0.276   1.00 0.00 ? 40  ASN A HA   2  
ATOM 3053  H HB2  . ASN A 1 40  ? 13.315  15.790  -2.699  1.00 0.00 ? 40  ASN A HB2  2  
ATOM 3054  H HB3  . ASN A 1 40  ? 13.162  17.032  -1.482  1.00 0.00 ? 40  ASN A HB3  2  
ATOM 3055  H HD21 . ASN A 1 40  ? 15.146  14.232  -2.351  1.00 0.00 ? 40  ASN A HD21 2  
ATOM 3056  H HD22 . ASN A 1 40  ? 16.571  14.869  -1.380  1.00 0.00 ? 40  ASN A HD22 2  
ATOM 3057  N N    . VAL A 1 41  ? 10.419  15.629  -2.289  1.00 0.00 ? 41  VAL A N    2  
ATOM 3058  C CA   . VAL A 1 41  ? 9.023   16.045  -2.640  1.00 0.00 ? 41  VAL A CA   2  
ATOM 3059  C C    . VAL A 1 41  ? 8.650   15.396  -4.019  1.00 0.00 ? 41  VAL A C    2  
ATOM 3060  O O    . VAL A 1 41  ? 9.511   15.262  -4.900  1.00 0.00 ? 41  VAL A O    2  
ATOM 3061  C CB   . VAL A 1 41  ? 8.901   17.614  -2.640  1.00 0.00 ? 41  VAL A CB   2  
ATOM 3062  C CG1  . VAL A 1 41  ? 9.729   18.370  -3.710  1.00 0.00 ? 41  VAL A CG1  2  
ATOM 3063  C CG2  . VAL A 1 41  ? 7.433   18.085  -2.728  1.00 0.00 ? 41  VAL A CG2  2  
ATOM 3064  H H    . VAL A 1 41  ? 11.079  15.348  -3.020  1.00 0.00 ? 41  VAL A H    2  
ATOM 3065  H HA   . VAL A 1 41  ? 8.332   15.631  -1.876  1.00 0.00 ? 41  VAL A HA   2  
ATOM 3066  H HB   . VAL A 1 41  ? 9.268   17.959  -1.652  1.00 0.00 ? 41  VAL A HB   2  
ATOM 3067  H HG11 . VAL A 1 41  ? 10.803  18.117  -3.649  1.00 0.00 ? 41  VAL A HG11 2  
ATOM 3068  H HG12 . VAL A 1 41  ? 9.398   18.128  -4.738  1.00 0.00 ? 41  VAL A HG12 2  
ATOM 3069  H HG13 . VAL A 1 41  ? 9.652   19.467  -3.592  1.00 0.00 ? 41  VAL A HG13 2  
ATOM 3070  H HG21 . VAL A 1 41  ? 6.797   17.594  -1.967  1.00 0.00 ? 41  VAL A HG21 2  
ATOM 3071  H HG22 . VAL A 1 41  ? 7.339   19.175  -2.569  1.00 0.00 ? 41  VAL A HG22 2  
ATOM 3072  H HG23 . VAL A 1 41  ? 6.983   17.860  -3.714  1.00 0.00 ? 41  VAL A HG23 2  
ATOM 3073  N N    . ASN A 1 42  ? 7.381   14.969  -4.215  1.00 0.00 ? 42  ASN A N    2  
ATOM 3074  C CA   . ASN A 1 42  ? 6.871   14.317  -5.479  1.00 0.00 ? 42  ASN A CA   2  
ATOM 3075  C C    . ASN A 1 42  ? 7.419   12.866  -5.702  1.00 0.00 ? 42  ASN A C    2  
ATOM 3076  O O    . ASN A 1 42  ? 6.627   11.983  -6.038  1.00 0.00 ? 42  ASN A O    2  
ATOM 3077  C CB   . ASN A 1 42  ? 7.059   15.216  -6.740  1.00 0.00 ? 42  ASN A CB   2  
ATOM 3078  C CG   . ASN A 1 42  ? 6.447   16.628  -6.707  1.00 0.00 ? 42  ASN A CG   2  
ATOM 3079  O OD1  . ASN A 1 42  ? 7.094   17.604  -7.069  1.00 0.00 ? 42  ASN A OD1  2  
ATOM 3080  N ND2  . ASN A 1 42  ? 5.207   16.816  -6.311  1.00 0.00 ? 42  ASN A ND2  2  
ATOM 3081  H H    . ASN A 1 42  ? 6.724   15.124  -3.430  1.00 0.00 ? 42  ASN A H    2  
ATOM 3082  H HA   . ASN A 1 42  ? 5.787   14.159  -5.350  1.00 0.00 ? 42  ASN A HA   2  
ATOM 3083  H HB2  . ASN A 1 42  ? 8.133   15.316  -6.979  1.00 0.00 ? 42  ASN A HB2  2  
ATOM 3084  H HB3  . ASN A 1 42  ? 6.629   14.701  -7.619  1.00 0.00 ? 42  ASN A HB3  2  
ATOM 3085  H HD21 . ASN A 1 42  ? 4.771   16.076  -5.725  1.00 0.00 ? 42  ASN A HD21 2  
ATOM 3086  H HD22 . ASN A 1 42  ? 4.956   17.806  -6.290  1.00 0.00 ? 42  ASN A HD22 2  
ATOM 3087  N N    . LEU A 1 43  ? 8.730   12.591  -5.528  1.00 0.00 ? 43  LEU A N    2  
ATOM 3088  C CA   . LEU A 1 43  ? 9.291   11.207  -5.546  1.00 0.00 ? 43  LEU A CA   2  
ATOM 3089  C C    . LEU A 1 43  ? 8.704   10.423  -4.321  1.00 0.00 ? 43  LEU A C    2  
ATOM 3090  O O    . LEU A 1 43  ? 7.989   9.443   -4.546  1.00 0.00 ? 43  LEU A O    2  
ATOM 3091  C CB   . LEU A 1 43  ? 10.850  11.253  -5.541  1.00 0.00 ? 43  LEU A CB   2  
ATOM 3092  C CG   . LEU A 1 43  ? 11.611  11.636  -6.838  1.00 0.00 ? 43  LEU A CG   2  
ATOM 3093  C CD1  . LEU A 1 43  ? 11.310  10.690  -8.013  1.00 0.00 ? 43  LEU A CD1  2  
ATOM 3094  C CD2  . LEU A 1 43  ? 11.425  13.100  -7.272  1.00 0.00 ? 43  LEU A CD2  2  
ATOM 3095  H H    . LEU A 1 43  ? 9.273   13.426  -5.259  1.00 0.00 ? 43  LEU A H    2  
ATOM 3096  H HA   . LEU A 1 43  ? 8.949   10.680  -6.459  1.00 0.00 ? 43  LEU A HA   2  
ATOM 3097  H HB2  . LEU A 1 43  ? 11.203  11.900  -4.715  1.00 0.00 ? 43  LEU A HB2  2  
ATOM 3098  H HB3  . LEU A 1 43  ? 11.213  10.247  -5.253  1.00 0.00 ? 43  LEU A HB3  2  
ATOM 3099  H HG   . LEU A 1 43  ? 12.683  11.512  -6.593  1.00 0.00 ? 43  LEU A HG   2  
ATOM 3100  H HD11 . LEU A 1 43  ? 11.416  9.633   -7.715  1.00 0.00 ? 43  LEU A HD11 2  
ATOM 3101  H HD12 . LEU A 1 43  ? 10.280  10.813  -8.399  1.00 0.00 ? 43  LEU A HD12 2  
ATOM 3102  H HD13 . LEU A 1 43  ? 11.996  10.863  -8.863  1.00 0.00 ? 43  LEU A HD13 2  
ATOM 3103  H HD21 . LEU A 1 43  ? 11.626  13.805  -6.444  1.00 0.00 ? 43  LEU A HD21 2  
ATOM 3104  H HD22 . LEU A 1 43  ? 12.103  13.373  -8.101  1.00 0.00 ? 43  LEU A HD22 2  
ATOM 3105  H HD23 . LEU A 1 43  ? 10.396  13.301  -7.624  1.00 0.00 ? 43  LEU A HD23 2  
ATOM 3106  N N    . GLU A 1 44  ? 8.977   10.846  -3.063  1.00 0.00 ? 44  GLU A N    2  
ATOM 3107  C CA   . GLU A 1 44  ? 8.288   10.301  -1.864  1.00 0.00 ? 44  GLU A CA   2  
ATOM 3108  C C    . GLU A 1 44  ? 7.187   11.336  -1.478  1.00 0.00 ? 44  GLU A C    2  
ATOM 3109  O O    . GLU A 1 44  ? 7.450   12.389  -0.887  1.00 0.00 ? 44  GLU A O    2  
ATOM 3110  C CB   . GLU A 1 44  ? 9.273   10.033  -0.701  1.00 0.00 ? 44  GLU A CB   2  
ATOM 3111  C CG   . GLU A 1 44  ? 8.583   9.328   0.506   1.00 0.00 ? 44  GLU A CG   2  
ATOM 3112  C CD   . GLU A 1 44  ? 9.450   8.989   1.700   1.00 0.00 ? 44  GLU A CD   2  
ATOM 3113  O OE1  . GLU A 1 44  ? 10.662  8.745   1.542   1.00 0.00 ? 44  GLU A OE1  2  
ATOM 3114  O OE2  . GLU A 1 44  ? 8.900   8.908   2.818   1.00 0.00 ? 44  GLU A OE2  2  
ATOM 3115  H H    . GLU A 1 44  ? 9.564   11.684  -3.012  1.00 0.00 ? 44  GLU A H    2  
ATOM 3116  H HA   . GLU A 1 44  ? 7.807   9.331   -2.096  1.00 0.00 ? 44  GLU A HA   2  
ATOM 3117  H HB2  . GLU A 1 44  ? 10.101  9.395   -1.064  1.00 0.00 ? 44  GLU A HB2  2  
ATOM 3118  H HB3  . GLU A 1 44  ? 9.751   10.976  -0.368  1.00 0.00 ? 44  GLU A HB3  2  
ATOM 3119  H HG2  . GLU A 1 44  ? 7.756   9.953   0.890   1.00 0.00 ? 44  GLU A HG2  2  
ATOM 3120  H HG3  . GLU A 1 44  ? 8.110   8.381   0.193   1.00 0.00 ? 44  GLU A HG3  2  
ATOM 3121  N N    . GLU A 1 45  ? 5.945   10.983  -1.821  1.00 0.00 ? 45  GLU A N    2  
ATOM 3122  C CA   . GLU A 1 45  ? 4.757   11.821  -1.544  1.00 0.00 ? 45  GLU A CA   2  
ATOM 3123  C C    . GLU A 1 45  ? 3.934   11.112  -0.418  1.00 0.00 ? 45  GLU A C    2  
ATOM 3124  O O    . GLU A 1 45  ? 4.452   10.841  0.673   1.00 0.00 ? 45  GLU A O    2  
ATOM 3125  C CB   . GLU A 1 45  ? 4.117   12.029  -2.956  1.00 0.00 ? 45  GLU A CB   2  
ATOM 3126  C CG   . GLU A 1 45  ? 3.225   13.293  -3.106  1.00 0.00 ? 45  GLU A CG   2  
ATOM 3127  C CD   . GLU A 1 45  ? 3.976   14.598  -3.377  1.00 0.00 ? 45  GLU A CD   2  
ATOM 3128  O OE1  . GLU A 1 45  ? 4.807   15.019  -2.543  1.00 0.00 ? 45  GLU A OE1  2  
ATOM 3129  O OE2  . GLU A 1 45  ? 3.758   15.197  -4.452  1.00 0.00 ? 45  GLU A OE2  2  
ATOM 3130  H H    . GLU A 1 45  ? 5.877   10.092  -2.321  1.00 0.00 ? 45  GLU A H    2  
ATOM 3131  H HA   . GLU A 1 45  ? 5.007   12.811  -1.142  1.00 0.00 ? 45  GLU A HA   2  
ATOM 3132  H HB2  . GLU A 1 45  ? 4.891   12.046  -3.757  1.00 0.00 ? 45  GLU A HB2  2  
ATOM 3133  H HB3  . GLU A 1 45  ? 3.546   11.118  -3.211  1.00 0.00 ? 45  GLU A HB3  2  
ATOM 3134  H HG2  . GLU A 1 45  ? 2.531   13.151  -3.954  1.00 0.00 ? 45  GLU A HG2  2  
ATOM 3135  H HG3  . GLU A 1 45  ? 2.583   13.453  -2.224  1.00 0.00 ? 45  GLU A HG3  2  
ATOM 3136  N N    . LYS A 1 46  ? 2.658   10.807  -0.670  1.00 0.00 ? 46  LYS A N    2  
ATOM 3137  C CA   . LYS A 1 46  ? 1.807   10.004  0.257   1.00 0.00 ? 46  LYS A CA   2  
ATOM 3138  C C    . LYS A 1 46  ? 0.539   9.428   -0.466  1.00 0.00 ? 46  LYS A C    2  
ATOM 3139  O O    . LYS A 1 46  ? 0.144   9.744   -1.605  1.00 0.00 ? 46  LYS A O    2  
ATOM 3140  C CB   . LYS A 1 46  ? 1.486   10.785  1.575   1.00 0.00 ? 46  LYS A CB   2  
ATOM 3141  C CG   . LYS A 1 46  ? 0.981   12.246  1.537   1.00 0.00 ? 46  LYS A CG   2  
ATOM 3142  C CD   . LYS A 1 46  ? 1.024   12.937  2.924   1.00 0.00 ? 46  LYS A CD   2  
ATOM 3143  C CE   . LYS A 1 46  ? 2.407   13.443  3.407   1.00 0.00 ? 46  LYS A CE   2  
ATOM 3144  N NZ   . LYS A 1 46  ? 3.247   12.370  4.007   1.00 0.00 ? 46  LYS A NZ   2  
ATOM 3145  H H    . LYS A 1 46  ? 2.401   11.134  -1.606  1.00 0.00 ? 46  LYS A H    2  
ATOM 3146  H HA   . LYS A 1 46  ? 2.395   9.105   0.542   1.00 0.00 ? 46  LYS A HA   2  
ATOM 3147  H HB2  . LYS A 1 46  ? 0.799   10.191  2.209   1.00 0.00 ? 46  LYS A HB2  2  
ATOM 3148  H HB3  . LYS A 1 46  ? 2.424   10.750  2.148   1.00 0.00 ? 46  LYS A HB3  2  
ATOM 3149  H HG2  . LYS A 1 46  ? 1.556   12.843  0.802   1.00 0.00 ? 46  LYS A HG2  2  
ATOM 3150  H HG3  . LYS A 1 46  ? -0.057  12.251  1.150   1.00 0.00 ? 46  LYS A HG3  2  
ATOM 3151  H HD2  . LYS A 1 46  ? 0.353   13.818  2.864   1.00 0.00 ? 46  LYS A HD2  2  
ATOM 3152  H HD3  . LYS A 1 46  ? 0.546   12.299  3.697   1.00 0.00 ? 46  LYS A HD3  2  
ATOM 3153  H HE2  . LYS A 1 46  ? 2.943   13.956  2.578   1.00 0.00 ? 46  LYS A HE2  2  
ATOM 3154  H HE3  . LYS A 1 46  ? 2.238   14.240  4.164   1.00 0.00 ? 46  LYS A HE3  2  
ATOM 3155  H HZ1  . LYS A 1 46  ? 2.717   11.764  4.710   1.00 0.00 ? 46  LYS A HZ1  2  
ATOM 3156  H HZ2  . LYS A 1 46  ? 3.600   11.702  3.310   1.00 0.00 ? 46  LYS A HZ2  2  
ATOM 3157  H HZ3  . LYS A 1 46  ? 4.061   12.711  4.529   1.00 0.00 ? 46  LYS A HZ3  2  
ATOM 3158  N N    . ILE A 1 47  ? -0.070  8.465   0.238   1.00 0.00 ? 47  ILE A N    2  
ATOM 3159  C CA   . ILE A 1 47  ? -1.259  7.731   -0.269  1.00 0.00 ? 47  ILE A CA   2  
ATOM 3160  C C    . ILE A 1 47  ? -2.493  7.948   0.686   1.00 0.00 ? 47  ILE A C    2  
ATOM 3161  O O    . ILE A 1 47  ? -2.366  8.435   1.808   1.00 0.00 ? 47  ILE A O    2  
ATOM 3162  C CB   . ILE A 1 47  ? -0.723  6.264   -0.516  1.00 0.00 ? 47  ILE A CB   2  
ATOM 3163  C CG1  . ILE A 1 47  ? -1.559  5.547   -1.589  1.00 0.00 ? 47  ILE A CG1  2  
ATOM 3164  C CG2  . ILE A 1 47  ? -0.702  5.402   0.762   1.00 0.00 ? 47  ILE A CG2  2  
ATOM 3165  C CD1  . ILE A 1 47  ? -0.946  4.252   -2.145  1.00 0.00 ? 47  ILE A CD1  2  
ATOM 3166  H H    . ILE A 1 47  ? 0.322   8.265   1.171   1.00 0.00 ? 47  ILE A H    2  
ATOM 3167  H HA   . ILE A 1 47  ? -1.578  8.154   -1.241  1.00 0.00 ? 47  ILE A HA   2  
ATOM 3168  H HB   . ILE A 1 47  ? 0.311   6.308   -0.920  1.00 0.00 ? 47  ILE A HB   2  
ATOM 3169  H HG12 . ILE A 1 47  ? -2.566  5.347   -1.176  1.00 0.00 ? 47  ILE A HG12 2  
ATOM 3170  H HG13 . ILE A 1 47  ? -1.700  6.226   -2.450  1.00 0.00 ? 47  ILE A HG13 2  
ATOM 3171  H HG21 . ILE A 1 47  ? -0.099  5.884   1.548   1.00 0.00 ? 47  ILE A HG21 2  
ATOM 3172  H HG22 . ILE A 1 47  ? -1.724  5.250   1.150   1.00 0.00 ? 47  ILE A HG22 2  
ATOM 3173  H HG23 . ILE A 1 47  ? -0.267  4.403   0.589   1.00 0.00 ? 47  ILE A HG23 2  
ATOM 3174  H HD11 . ILE A 1 47  ? 0.101   4.392   -2.475  1.00 0.00 ? 47  ILE A HD11 2  
ATOM 3175  H HD12 . ILE A 1 47  ? -0.956  3.441   -1.395  1.00 0.00 ? 47  ILE A HD12 2  
ATOM 3176  H HD13 . ILE A 1 47  ? -1.511  3.890   -3.019  1.00 0.00 ? 47  ILE A HD13 2  
ATOM 3177  N N    . ASP A 1 48  ? -3.703  7.655   0.201   1.00 0.00 ? 48  ASP A N    2  
ATOM 3178  C CA   . ASP A 1 48  ? -4.982  7.756   0.970   1.00 0.00 ? 48  ASP A CA   2  
ATOM 3179  C C    . ASP A 1 48  ? -5.568  6.309   1.040   1.00 0.00 ? 48  ASP A C    2  
ATOM 3180  O O    . ASP A 1 48  ? -5.722  5.630   0.014   1.00 0.00 ? 48  ASP A O    2  
ATOM 3181  C CB   . ASP A 1 48  ? -5.951  8.764   0.294   1.00 0.00 ? 48  ASP A CB   2  
ATOM 3182  C CG   . ASP A 1 48  ? -7.244  9.023   1.073   1.00 0.00 ? 48  ASP A CG   2  
ATOM 3183  O OD1  . ASP A 1 48  ? -7.226  9.861   1.998   1.00 0.00 ? 48  ASP A OD1  2  
ATOM 3184  O OD2  . ASP A 1 48  ? -8.277  8.386   0.772   1.00 0.00 ? 48  ASP A OD2  2  
ATOM 3185  H H    . ASP A 1 48  ? -3.702  7.238   -0.737  1.00 0.00 ? 48  ASP A H    2  
ATOM 3186  H HA   . ASP A 1 48  ? -4.777  8.129   1.991   1.00 0.00 ? 48  ASP A HA   2  
ATOM 3187  H HB2  . ASP A 1 48  ? -5.445  9.736   0.157   1.00 0.00 ? 48  ASP A HB2  2  
ATOM 3188  H HB3  . ASP A 1 48  ? -6.233  8.431   -0.719  1.00 0.00 ? 48  ASP A HB3  2  
ATOM 3189  N N    . VAL A 1 49  ? -5.855  5.840   2.266   1.00 0.00 ? 49  VAL A N    2  
ATOM 3190  C CA   . VAL A 1 49  ? -6.323  4.437   2.511   1.00 0.00 ? 49  VAL A CA   2  
ATOM 3191  C C    . VAL A 1 49  ? -7.651  4.410   3.331   1.00 0.00 ? 49  VAL A C    2  
ATOM 3192  O O    . VAL A 1 49  ? -7.811  5.158   4.303   1.00 0.00 ? 49  VAL A O    2  
ATOM 3193  C CB   . VAL A 1 49  ? -5.213  3.602   3.248   1.00 0.00 ? 49  VAL A CB   2  
ATOM 3194  C CG1  . VAL A 1 49  ? -3.928  3.435   2.410   1.00 0.00 ? 49  VAL A CG1  2  
ATOM 3195  C CG2  . VAL A 1 49  ? -4.828  4.096   4.664   1.00 0.00 ? 49  VAL A CG2  2  
ATOM 3196  H H    . VAL A 1 49  ? -5.708  6.521   3.025   1.00 0.00 ? 49  VAL A H    2  
ATOM 3197  H HA   . VAL A 1 49  ? -6.508  3.923   1.550   1.00 0.00 ? 49  VAL A HA   2  
ATOM 3198  H HB   . VAL A 1 49  ? -5.623  2.579   3.367   1.00 0.00 ? 49  VAL A HB   2  
ATOM 3199  H HG11 . VAL A 1 49  ? -4.152  3.072   1.389   1.00 0.00 ? 49  VAL A HG11 2  
ATOM 3200  H HG12 . VAL A 1 49  ? -3.397  4.396   2.299   1.00 0.00 ? 49  VAL A HG12 2  
ATOM 3201  H HG13 . VAL A 1 49  ? -3.216  2.725   2.868   1.00 0.00 ? 49  VAL A HG13 2  
ATOM 3202  H HG21 . VAL A 1 49  ? -4.541  5.161   4.656   1.00 0.00 ? 49  VAL A HG21 2  
ATOM 3203  H HG22 . VAL A 1 49  ? -5.667  3.996   5.376   1.00 0.00 ? 49  VAL A HG22 2  
ATOM 3204  H HG23 . VAL A 1 49  ? -3.980  3.539   5.098   1.00 0.00 ? 49  VAL A HG23 2  
ATOM 3205  N N    . VAL A 1 50  ? -8.592  3.514   2.973   1.00 0.00 ? 50  VAL A N    2  
ATOM 3206  C CA   . VAL A 1 50  ? -9.866  3.350   3.737   1.00 0.00 ? 50  VAL A CA   2  
ATOM 3207  C C    . VAL A 1 50  ? -9.782  1.964   4.483   1.00 0.00 ? 50  VAL A C    2  
ATOM 3208  O O    . VAL A 1 50  ? -9.522  0.936   3.832   1.00 0.00 ? 50  VAL A O    2  
ATOM 3209  C CB   . VAL A 1 50  ? -11.110 3.505   2.790   1.00 0.00 ? 50  VAL A CB   2  
ATOM 3210  C CG1  . VAL A 1 50  ? -12.440 2.929   3.336   1.00 0.00 ? 50  VAL A CG1  2  
ATOM 3211  C CG2  . VAL A 1 50  ? -11.386 4.997   2.479   1.00 0.00 ? 50  VAL A CG2  2  
ATOM 3212  H H    . VAL A 1 50  ? -8.383  2.915   2.160   1.00 0.00 ? 50  VAL A H    2  
ATOM 3213  H HA   . VAL A 1 50  ? -9.961  4.150   4.491   1.00 0.00 ? 50  VAL A HA   2  
ATOM 3214  H HB   . VAL A 1 50  ? -10.896 2.977   1.841   1.00 0.00 ? 50  VAL A HB   2  
ATOM 3215  H HG11 . VAL A 1 50  ? -12.707 3.347   4.324   1.00 0.00 ? 50  VAL A HG11 2  
ATOM 3216  H HG12 . VAL A 1 50  ? -13.290 3.131   2.660   1.00 0.00 ? 50  VAL A HG12 2  
ATOM 3217  H HG13 . VAL A 1 50  ? -12.392 1.829   3.454   1.00 0.00 ? 50  VAL A HG13 2  
ATOM 3218  H HG21 . VAL A 1 50  ? -10.480 5.517   2.112   1.00 0.00 ? 50  VAL A HG21 2  
ATOM 3219  H HG22 . VAL A 1 50  ? -12.164 5.123   1.703   1.00 0.00 ? 50  VAL A HG22 2  
ATOM 3220  H HG23 . VAL A 1 50  ? -11.723 5.558   3.371   1.00 0.00 ? 50  VAL A HG23 2  
ATOM 3221  N N    . PRO A 1 51  ? -10.023 1.876   5.828   1.00 0.00 ? 51  PRO A N    2  
ATOM 3222  C CA   . PRO A 1 51  ? -9.992  0.592   6.558   1.00 0.00 ? 51  PRO A CA   2  
ATOM 3223  C C    . PRO A 1 51  ? -11.276 -0.286  6.375   1.00 0.00 ? 51  PRO A C    2  
ATOM 3224  O O    . PRO A 1 51  ? -12.418 0.182   6.428   1.00 0.00 ? 51  PRO A O    2  
ATOM 3225  C CB   . PRO A 1 51  ? -9.797  1.058   8.014   1.00 0.00 ? 51  PRO A CB   2  
ATOM 3226  C CG   . PRO A 1 51  ? -10.514 2.407   8.093   1.00 0.00 ? 51  PRO A CG   2  
ATOM 3227  C CD   . PRO A 1 51  ? -10.282 3.034   6.717   1.00 0.00 ? 51  PRO A CD   2  
ATOM 3228  H HA   . PRO A 1 51  ? -9.101  0.010   6.260   1.00 0.00 ? 51  PRO A HA   2  
ATOM 3229  H HB2  . PRO A 1 51  ? -10.166 0.328   8.762   1.00 0.00 ? 51  PRO A HB2  2  
ATOM 3230  H HB3  . PRO A 1 51  ? -8.717  1.189   8.226   1.00 0.00 ? 51  PRO A HB3  2  
ATOM 3231  H HG2  . PRO A 1 51  ? -11.598 2.249   8.258   1.00 0.00 ? 51  PRO A HG2  2  
ATOM 3232  H HG3  . PRO A 1 51  ? -10.149 3.041   8.923   1.00 0.00 ? 51  PRO A HG3  2  
ATOM 3233  H HD2  . PRO A 1 51  ? -11.160 3.629   6.397   1.00 0.00 ? 51  PRO A HD2  2  
ATOM 3234  H HD3  . PRO A 1 51  ? -9.403  3.710   6.741   1.00 0.00 ? 51  PRO A HD3  2  
ATOM 3235  N N    . ILE A 1 52  ? -11.046 -1.586  6.173   1.00 0.00 ? 52  ILE A N    2  
ATOM 3236  C CA   . ILE A 1 52  ? -12.121 -2.638  6.148   1.00 0.00 ? 52  ILE A CA   2  
ATOM 3237  C C    . ILE A 1 52  ? -12.548 -2.972  7.631   1.00 0.00 ? 52  ILE A C    2  
ATOM 3238  O O    . ILE A 1 52  ? -13.722 -2.965  8.006   1.00 0.00 ? 52  ILE A O    2  
ATOM 3239  C CB   . ILE A 1 52  ? -11.597 -3.854  5.285   1.00 0.00 ? 52  ILE A CB   2  
ATOM 3240  C CG1  . ILE A 1 52  ? -11.441 -3.484  3.773   1.00 0.00 ? 52  ILE A CG1  2  
ATOM 3241  C CG2  . ILE A 1 52  ? -12.540 -5.084  5.377   1.00 0.00 ? 52  ILE A CG2  2  
ATOM 3242  C CD1  . ILE A 1 52  ? -10.418 -4.345  3.014   1.00 0.00 ? 52  ILE A CD1  2  
ATOM 3243  H H    . ILE A 1 52  ? -10.047 -1.834  6.168   1.00 0.00 ? 52  ILE A H    2  
ATOM 3244  H HA   . ILE A 1 52  ? -13.013 -2.234  5.696   1.00 0.00 ? 52  ILE A HA   2  
ATOM 3245  H HB   . ILE A 1 52  ? -10.605 -4.157  5.673   1.00 0.00 ? 52  ILE A HB   2  
ATOM 3246  H HG12 . ILE A 1 52  ? -12.414 -3.536  3.248   1.00 0.00 ? 52  ILE A HG12 2  
ATOM 3247  H HG13 . ILE A 1 52  ? -11.125 -2.430  3.656   1.00 0.00 ? 52  ILE A HG13 2  
ATOM 3248  H HG21 . ILE A 1 52  ? -13.578 -4.839  5.089   1.00 0.00 ? 52  ILE A HG21 2  
ATOM 3249  H HG22 . ILE A 1 52  ? -12.213 -5.914  4.722   1.00 0.00 ? 52  ILE A HG22 2  
ATOM 3250  H HG23 . ILE A 1 52  ? -12.581 -5.503  6.400   1.00 0.00 ? 52  ILE A HG23 2  
ATOM 3251  H HD11 . ILE A 1 52  ? -9.406  -4.262  3.450   1.00 0.00 ? 52  ILE A HD11 2  
ATOM 3252  H HD12 . ILE A 1 52  ? -10.693 -5.418  3.010   1.00 0.00 ? 52  ILE A HD12 2  
ATOM 3253  H HD13 . ILE A 1 52  ? -10.343 -4.041  1.954   1.00 0.00 ? 52  ILE A HD13 2  
ATOM 3254  N N    . GLU A 1 53  ? -11.521 -3.297  8.399   1.00 0.00 ? 53  GLU A N    2  
ATOM 3255  C CA   . GLU A 1 53  ? -11.523 -3.494  9.871   1.00 0.00 ? 53  GLU A CA   2  
ATOM 3256  C C    . GLU A 1 53  ? -10.308 -2.677  10.492  1.00 0.00 ? 53  GLU A C    2  
ATOM 3257  O O    . GLU A 1 53  ? -9.459  -2.180  9.737   1.00 0.00 ? 53  GLU A O    2  
ATOM 3258  C CB   . GLU A 1 53  ? -11.414 -5.026  10.170  1.00 0.00 ? 53  GLU A CB   2  
ATOM 3259  C CG   . GLU A 1 53  ? -12.623 -5.631  10.931  1.00 0.00 ? 53  GLU A CG   2  
ATOM 3260  C CD   . GLU A 1 53  ? -12.254 -6.790  11.842  1.00 0.00 ? 53  GLU A CD   2  
ATOM 3261  O OE1  . GLU A 1 53  ? -12.056 -7.918  11.346  1.00 0.00 ? 53  GLU A OE1  2  
ATOM 3262  O OE2  . GLU A 1 53  ? -12.107 -6.559  13.060  1.00 0.00 ? 53  GLU A OE2  2  
ATOM 3263  H H    . GLU A 1 53  ? -10.706 -3.148  7.798   1.00 0.00 ? 53  GLU A H    2  
ATOM 3264  H HA   . GLU A 1 53  ? -12.457 -3.076  10.295  1.00 0.00 ? 53  GLU A HA   2  
ATOM 3265  H HB2  . GLU A 1 53  ? -11.246 -5.628  9.254   1.00 0.00 ? 53  GLU A HB2  2  
ATOM 3266  H HB3  . GLU A 1 53  ? -10.488 -5.223  10.746  1.00 0.00 ? 53  GLU A HB3  2  
ATOM 3267  H HG2  . GLU A 1 53  ? -13.127 -4.885  11.568  1.00 0.00 ? 53  GLU A HG2  2  
ATOM 3268  H HG3  . GLU A 1 53  ? -13.392 -5.981  10.221  1.00 0.00 ? 53  GLU A HG3  2  
ATOM 3269  N N    . PRO A 1 54  ? -10.109 -2.523  11.841  1.00 0.00 ? 54  PRO A N    2  
ATOM 3270  C CA   . PRO A 1 54  ? -8.893  -1.842  12.414  1.00 0.00 ? 54  PRO A CA   2  
ATOM 3271  C C    . PRO A 1 54  ? -7.482  -2.347  11.915  1.00 0.00 ? 54  PRO A C    2  
ATOM 3272  O O    . PRO A 1 54  ? -6.532  -1.565  11.775  1.00 0.00 ? 54  PRO A O    2  
ATOM 3273  C CB   . PRO A 1 54  ? -9.096  -2.054  13.930  1.00 0.00 ? 54  PRO A CB   2  
ATOM 3274  C CG   . PRO A 1 54  ? -10.604 -2.238  14.113  1.00 0.00 ? 54  PRO A CG   2  
ATOM 3275  C CD   . PRO A 1 54  ? -11.045 -3.013  12.871  1.00 0.00 ? 54  PRO A CD   2  
ATOM 3276  H HA   . PRO A 1 54  ? -8.947  -0.763  12.173  1.00 0.00 ? 54  PRO A HA   2  
ATOM 3277  H HB2  . PRO A 1 54  ? -8.574  -2.966  14.285  1.00 0.00 ? 54  PRO A HB2  2  
ATOM 3278  H HB3  . PRO A 1 54  ? -8.698  -1.213  14.528  1.00 0.00 ? 54  PRO A HB3  2  
ATOM 3279  H HG2  . PRO A 1 54  ? -10.861 -2.764  15.051  1.00 0.00 ? 54  PRO A HG2  2  
ATOM 3280  H HG3  . PRO A 1 54  ? -11.110 -1.253  14.147  1.00 0.00 ? 54  PRO A HG3  2  
ATOM 3281  H HD2  . PRO A 1 54  ? -10.937 -4.107  13.017  1.00 0.00 ? 54  PRO A HD2  2  
ATOM 3282  H HD3  . PRO A 1 54  ? -12.107 -2.810  12.629  1.00 0.00 ? 54  PRO A HD3  2  
ATOM 3283  N N    . HIS A 1 55  ? -7.372  -3.662  11.658  1.00 0.00 ? 55  HIS A N    2  
ATOM 3284  C CA   . HIS A 1 55  ? -6.163  -4.313  11.087  1.00 0.00 ? 55  HIS A CA   2  
ATOM 3285  C C    . HIS A 1 55  ? -6.111  -4.351  9.510   1.00 0.00 ? 55  HIS A C    2  
ATOM 3286  O O    . HIS A 1 55  ? -5.007  -4.354  8.965   1.00 0.00 ? 55  HIS A O    2  
ATOM 3287  C CB   . HIS A 1 55  ? -6.064  -5.746  11.702  1.00 0.00 ? 55  HIS A CB   2  
ATOM 3288  C CG   . HIS A 1 55  ? -7.176  -6.765  11.401  1.00 0.00 ? 55  HIS A CG   2  
ATOM 3289  N ND1  . HIS A 1 55  ? -7.159  -7.614  10.305  1.00 0.00 ? 55  HIS A ND1  2  
ATOM 3290  C CD2  . HIS A 1 55  ? -8.377  -6.915  12.120  1.00 0.00 ? 55  HIS A CD2  2  
ATOM 3291  C CE1  . HIS A 1 55  ? -8.391  -8.195  10.453  1.00 0.00 ? 55  HIS A CE1  2  
ATOM 3292  N NE2  . HIS A 1 55  ? -9.182  -7.860  11.514  1.00 0.00 ? 55  HIS A NE2  2  
ATOM 3293  H H    . HIS A 1 55  ? -8.251  -4.167  11.815  1.00 0.00 ? 55  HIS A H    2  
ATOM 3294  H HA   . HIS A 1 55  ? -5.265  -3.753  11.403  1.00 0.00 ? 55  HIS A HA   2  
ATOM 3295  H HB2  . HIS A 1 55  ? -5.101  -6.193  11.386  1.00 0.00 ? 55  HIS A HB2  2  
ATOM 3296  H HB3  . HIS A 1 55  ? -5.954  -5.662  12.800  1.00 0.00 ? 55  HIS A HB3  2  
ATOM 3297  H HD2  . HIS A 1 55  ? -8.666  -6.328  12.981  1.00 0.00 ? 55  HIS A HD2  2  
ATOM 3298  H HE1  . HIS A 1 55  ? -8.756  -8.879  9.698   1.00 0.00 ? 55  HIS A HE1  2  
ATOM 3299  H HE2  . HIS A 1 55  ? -10.214 -7.978  11.604  1.00 0.00 ? 55  HIS A HE2  2  
ATOM 3300  N N    . ALA A 1 56  ? -7.236  -4.398  8.766   1.00 0.00 ? 56  ALA A N    2  
ATOM 3301  C CA   . ALA A 1 56  ? -7.236  -4.510  7.281   1.00 0.00 ? 56  ALA A CA   2  
ATOM 3302  C C    . ALA A 1 56  ? -7.563  -3.177  6.536   1.00 0.00 ? 56  ALA A C    2  
ATOM 3303  O O    . ALA A 1 56  ? -8.469  -2.450  6.949   1.00 0.00 ? 56  ALA A O    2  
ATOM 3304  C CB   . ALA A 1 56  ? -8.288  -5.594  6.972   1.00 0.00 ? 56  ALA A CB   2  
ATOM 3305  H H    . ALA A 1 56  ? -8.104  -4.372  9.311   1.00 0.00 ? 56  ALA A H    2  
ATOM 3306  H HA   . ALA A 1 56  ? -6.234  -4.849  6.952   1.00 0.00 ? 56  ALA A HA   2  
ATOM 3307  H HB1  . ALA A 1 56  ? -8.038  -6.561  7.452   1.00 0.00 ? 56  ALA A HB1  2  
ATOM 3308  H HB2  . ALA A 1 56  ? -9.299  -5.317  7.330   1.00 0.00 ? 56  ALA A HB2  2  
ATOM 3309  H HB3  . ALA A 1 56  ? -8.374  -5.789  5.887   1.00 0.00 ? 56  ALA A HB3  2  
ATOM 3310  N N    . LEU A 1 57  ? -6.895  -2.866  5.401   1.00 0.00 ? 57  LEU A N    2  
ATOM 3311  C CA   . LEU A 1 57  ? -7.103  -1.566  4.680   1.00 0.00 ? 57  LEU A CA   2  
ATOM 3312  C C    . LEU A 1 57  ? -6.703  -1.596  3.161   1.00 0.00 ? 57  LEU A C    2  
ATOM 3313  O O    . LEU A 1 57  ? -5.893  -2.422  2.728   1.00 0.00 ? 57  LEU A O    2  
ATOM 3314  C CB   . LEU A 1 57  ? -6.291  -0.453  5.435   1.00 0.00 ? 57  LEU A CB   2  
ATOM 3315  C CG   . LEU A 1 57  ? -4.742  -0.617  5.523   1.00 0.00 ? 57  LEU A CG   2  
ATOM 3316  C CD1  . LEU A 1 57  ? -4.021  0.735   5.579   1.00 0.00 ? 57  LEU A CD1  2  
ATOM 3317  C CD2  . LEU A 1 57  ? -4.270  -1.456  6.729   1.00 0.00 ? 57  LEU A CD2  2  
ATOM 3318  H H    . LEU A 1 57  ? -6.125  -3.498  5.125   1.00 0.00 ? 57  LEU A H    2  
ATOM 3319  H HA   . LEU A 1 57  ? -8.184  -1.316  4.705   1.00 0.00 ? 57  LEU A HA   2  
ATOM 3320  H HB2  . LEU A 1 57  ? -6.530  0.510   4.942   1.00 0.00 ? 57  LEU A HB2  2  
ATOM 3321  H HB3  . LEU A 1 57  ? -6.702  -0.321  6.454   1.00 0.00 ? 57  LEU A HB3  2  
ATOM 3322  H HG   . LEU A 1 57  ? -4.424  -1.115  4.587   1.00 0.00 ? 57  LEU A HG   2  
ATOM 3323  H HD11 . LEU A 1 57  ? -4.344  1.355   6.437   1.00 0.00 ? 57  LEU A HD11 2  
ATOM 3324  H HD12 . LEU A 1 57  ? -2.922  0.624   5.645   1.00 0.00 ? 57  LEU A HD12 2  
ATOM 3325  H HD13 . LEU A 1 57  ? -4.213  1.307   4.658   1.00 0.00 ? 57  LEU A HD13 2  
ATOM 3326  H HD21 . LEU A 1 57  ? -4.696  -2.472  6.742   1.00 0.00 ? 57  LEU A HD21 2  
ATOM 3327  H HD22 . LEU A 1 57  ? -3.177  -1.605  6.711   1.00 0.00 ? 57  LEU A HD22 2  
ATOM 3328  H HD23 . LEU A 1 57  ? -4.534  -0.989  7.696   1.00 0.00 ? 57  LEU A HD23 2  
ATOM 3329  N N    . PHE A 1 58  ? -7.299  -0.702  2.339   1.00 0.00 ? 58  PHE A N    2  
ATOM 3330  C CA   . PHE A 1 58  ? -6.937  -0.557  0.882   1.00 0.00 ? 58  PHE A CA   2  
ATOM 3331  C C    . PHE A 1 58  ? -7.443  0.803   0.274   1.00 0.00 ? 58  PHE A C    2  
ATOM 3332  O O    . PHE A 1 58  ? -8.455  1.320   0.757   1.00 0.00 ? 58  PHE A O    2  
ATOM 3333  C CB   . PHE A 1 58  ? -7.456  -1.778  0.051   1.00 0.00 ? 58  PHE A CB   2  
ATOM 3334  C CG   . PHE A 1 58  ? -8.718  -1.644  -0.819  1.00 0.00 ? 58  PHE A CG   2  
ATOM 3335  C CD1  . PHE A 1 58  ? -9.988  -1.652  -0.240  1.00 0.00 ? 58  PHE A CD1  2  
ATOM 3336  C CD2  . PHE A 1 58  ? -8.584  -1.372  -2.183  1.00 0.00 ? 58  PHE A CD2  2  
ATOM 3337  C CE1  . PHE A 1 58  ? -11.109 -1.389  -1.020  1.00 0.00 ? 58  PHE A CE1  2  
ATOM 3338  C CE2  . PHE A 1 58  ? -9.710  -1.132  -2.967  1.00 0.00 ? 58  PHE A CE2  2  
ATOM 3339  C CZ   . PHE A 1 58  ? -10.974 -1.141  -2.384  1.00 0.00 ? 58  PHE A CZ   2  
ATOM 3340  H H    . PHE A 1 58  ? -7.946  -0.062  2.819   1.00 0.00 ? 58  PHE A H    2  
ATOM 3341  H HA   . PHE A 1 58  ? -5.833  -0.539  0.823   1.00 0.00 ? 58  PHE A HA   2  
ATOM 3342  H HB2  . PHE A 1 58  ? -6.613  -2.083  -0.597  1.00 0.00 ? 58  PHE A HB2  2  
ATOM 3343  H HB3  . PHE A 1 58  ? -7.589  -2.659  0.699   1.00 0.00 ? 58  PHE A HB3  2  
ATOM 3344  H HD1  . PHE A 1 58  ? -10.105 -1.812  0.823   1.00 0.00 ? 58  PHE A HD1  2  
ATOM 3345  H HD2  . PHE A 1 58  ? -7.602  -1.316  -2.623  1.00 0.00 ? 58  PHE A HD2  2  
ATOM 3346  H HE1  . PHE A 1 58  ? -12.076 -1.351  -0.552  1.00 0.00 ? 58  PHE A HE1  2  
ATOM 3347  H HE2  . PHE A 1 58  ? -9.600  -0.925  -4.022  1.00 0.00 ? 58  PHE A HE2  2  
ATOM 3348  H HZ   . PHE A 1 58  ? -11.845 -0.937  -2.989  1.00 0.00 ? 58  PHE A HZ   2  
ATOM 3349  N N    . LEU A 1 59  ? -6.631  1.489   -0.565  1.00 0.00 ? 59  LEU A N    2  
ATOM 3350  C CA   . LEU A 1 59  ? -7.048  2.696   -1.381  1.00 0.00 ? 59  LEU A CA   2  
ATOM 3351  C C    . LEU A 1 59  ? -5.749  3.268   -2.045  1.00 0.00 ? 59  LEU A C    2  
ATOM 3352  O O    . LEU A 1 59  ? -4.841  2.502   -2.352  1.00 0.00 ? 59  LEU A O    2  
ATOM 3353  C CB   . LEU A 1 59  ? -8.084  3.732   -0.796  1.00 0.00 ? 59  LEU A CB   2  
ATOM 3354  C CG   . LEU A 1 59  ? -9.471  3.704   -1.508  1.00 0.00 ? 59  LEU A CG   2  
ATOM 3355  C CD1  . LEU A 1 59  ? -10.321 2.440   -1.307  1.00 0.00 ? 59  LEU A CD1  2  
ATOM 3356  C CD2  . LEU A 1 59  ? -10.301 4.933   -1.125  1.00 0.00 ? 59  LEU A CD2  2  
ATOM 3357  H H    . LEU A 1 59  ? -5.862  0.903   -0.962  1.00 0.00 ? 59  LEU A H    2  
ATOM 3358  H HA   . LEU A 1 59  ? -7.523  2.264   -2.282  1.00 0.00 ? 59  LEU A HA   2  
ATOM 3359  H HB2  . LEU A 1 59  ? -8.234  3.600   0.282   1.00 0.00 ? 59  LEU A HB2  2  
ATOM 3360  H HB3  . LEU A 1 59  ? -7.702  4.763   -0.857  1.00 0.00 ? 59  LEU A HB3  2  
ATOM 3361  H HG   . LEU A 1 59  ? -9.281  3.791   -2.594  1.00 0.00 ? 59  LEU A HG   2  
ATOM 3362  H HD11 . LEU A 1 59  ? -9.783  1.530   -1.624  1.00 0.00 ? 59  LEU A HD11 2  
ATOM 3363  H HD12 . LEU A 1 59  ? -10.603 2.288   -0.251  1.00 0.00 ? 59  LEU A HD12 2  
ATOM 3364  H HD13 . LEU A 1 59  ? -11.261 2.475   -1.890  1.00 0.00 ? 59  LEU A HD13 2  
ATOM 3365  H HD21 . LEU A 1 59  ? -9.754  5.872   -1.329  1.00 0.00 ? 59  LEU A HD21 2  
ATOM 3366  H HD22 . LEU A 1 59  ? -11.257 4.980   -1.681  1.00 0.00 ? 59  LEU A HD22 2  
ATOM 3367  H HD23 . LEU A 1 59  ? -10.550 4.934   -0.054  1.00 0.00 ? 59  LEU A HD23 2  
ATOM 3368  N N    . GLY A 1 60  ? -5.759  4.496   -2.592  1.00 0.00 ? 60  GLY A N    2  
ATOM 3369  C CA   . GLY A 1 60  ? -4.563  5.062   -3.270  1.00 0.00 ? 60  GLY A CA   2  
ATOM 3370  C C    . GLY A 1 60  ? -4.401  6.601   -3.268  1.00 0.00 ? 60  GLY A C    2  
ATOM 3371  O O    . GLY A 1 60  ? -4.803  7.262   -2.330  1.00 0.00 ? 60  GLY A O    2  
ATOM 3372  H H    . GLY A 1 60  ? -6.451  5.080   -2.093  1.00 0.00 ? 60  GLY A H    2  
ATOM 3373  H HA2  . GLY A 1 60  ? -3.662  4.644   -2.808  1.00 0.00 ? 60  GLY A HA2  2  
ATOM 3374  H HA3  . GLY A 1 60  ? -4.493  4.640   -4.281  1.00 0.00 ? 60  GLY A HA3  2  
ATOM 3375  N N    . ILE A 1 61  ? -3.739  7.129   -4.304  1.00 0.00 ? 61  ILE A N    2  
ATOM 3376  C CA   . ILE A 1 61  ? -3.335  8.565   -4.564  1.00 0.00 ? 61  ILE A CA   2  
ATOM 3377  C C    . ILE A 1 61  ? -1.896  8.278   -5.125  1.00 0.00 ? 61  ILE A C    2  
ATOM 3378  O O    . ILE A 1 61  ? -1.845  7.853   -6.305  1.00 0.00 ? 61  ILE A O    2  
ATOM 3379  C CB   . ILE A 1 61  ? -3.500  9.654   -3.415  1.00 0.00 ? 61  ILE A CB   2  
ATOM 3380  C CG1  . ILE A 1 61  ? -4.974  10.168  -3.266  1.00 0.00 ? 61  ILE A CG1  2  
ATOM 3381  C CG2  . ILE A 1 61  ? -2.623  10.926  -3.612  1.00 0.00 ? 61  ILE A CG2  2  
ATOM 3382  C CD1  . ILE A 1 61  ? -5.614  10.993  -4.406  1.00 0.00 ? 61  ILE A CD1  2  
ATOM 3383  H H    . ILE A 1 61  ? -3.547  6.412   -5.021  1.00 0.00 ? 61  ILE A H    2  
ATOM 3384  H HA   . ILE A 1 61  ? -3.913  8.922   -5.435  1.00 0.00 ? 61  ILE A HA   2  
ATOM 3385  H HB   . ILE A 1 61  ? -3.206  9.201   -2.450  1.00 0.00 ? 61  ILE A HB   2  
ATOM 3386  H HG12 . ILE A 1 61  ? -5.651  9.332   -3.031  1.00 0.00 ? 61  ILE A HG12 2  
ATOM 3387  H HG13 . ILE A 1 61  ? -5.033  10.775  -2.340  1.00 0.00 ? 61  ILE A HG13 2  
ATOM 3388  H HG21 . ILE A 1 61  ? -2.745  11.375  -4.615  1.00 0.00 ? 61  ILE A HG21 2  
ATOM 3389  H HG22 . ILE A 1 61  ? -2.865  11.714  -2.873  1.00 0.00 ? 61  ILE A HG22 2  
ATOM 3390  H HG23 . ILE A 1 61  ? -1.545  10.737  -3.473  1.00 0.00 ? 61  ILE A HG23 2  
ATOM 3391  H HD11 . ILE A 1 61  ? -5.591  10.482  -5.382  1.00 0.00 ? 61  ILE A HD11 2  
ATOM 3392  H HD12 . ILE A 1 61  ? -6.671  11.227  -4.174  1.00 0.00 ? 61  ILE A HD12 2  
ATOM 3393  H HD13 . ILE A 1 61  ? -5.104  11.965  -4.537  1.00 0.00 ? 61  ILE A HD13 2  
ATOM 3394  N N    . HIS A 1 62  ? -0.777  8.394   -4.334  1.00 0.00 ? 62  HIS A N    2  
ATOM 3395  C CA   . HIS A 1 62  ? 0.579   8.046   -4.853  1.00 0.00 ? 62  HIS A CA   2  
ATOM 3396  C C    . HIS A 1 62  ? 0.876   6.504   -4.745  1.00 0.00 ? 62  HIS A C    2  
ATOM 3397  O O    . HIS A 1 62  ? 1.731   6.021   -3.997  1.00 0.00 ? 62  HIS A O    2  
ATOM 3398  C CB   . HIS A 1 62  ? 1.618   8.915   -4.098  1.00 0.00 ? 62  HIS A CB   2  
ATOM 3399  C CG   . HIS A 1 62  ? 2.993   8.982   -4.757  1.00 0.00 ? 62  HIS A CG   2  
ATOM 3400  N ND1  . HIS A 1 62  ? 3.219   9.601   -5.978  1.00 0.00 ? 62  HIS A ND1  2  
ATOM 3401  C CD2  . HIS A 1 62  ? 4.208   8.634   -4.139  1.00 0.00 ? 62  HIS A CD2  2  
ATOM 3402  C CE1  . HIS A 1 62  ? 4.588   9.573   -5.985  1.00 0.00 ? 62  HIS A CE1  2  
ATOM 3403  N NE2  . HIS A 1 62  ? 5.267   8.999   -4.947  1.00 0.00 ? 62  HIS A NE2  2  
ATOM 3404  H H    . HIS A 1 62  ? -0.872  8.778   -3.373  1.00 0.00 ? 62  HIS A H    2  
ATOM 3405  H HA   . HIS A 1 62  ? 0.646   8.317   -5.928  1.00 0.00 ? 62  HIS A HA   2  
ATOM 3406  H HB2  . HIS A 1 62  ? 1.257   9.958   -4.007  1.00 0.00 ? 62  HIS A HB2  2  
ATOM 3407  H HB3  . HIS A 1 62  ? 1.725   8.552   -3.059  1.00 0.00 ? 62  HIS A HB3  2  
ATOM 3408  H HD2  . HIS A 1 62  ? 4.297   8.229   -3.141  1.00 0.00 ? 62  HIS A HD2  2  
ATOM 3409  H HE1  . HIS A 1 62  ? 5.129   10.071  -6.778  1.00 0.00 ? 62  HIS A HE1  2  
ATOM 3410  H HE2  . HIS A 1 62  ? 6.274   9.118   -4.733  1.00 0.00 ? 62  HIS A HE2  2  
ATOM 3411  N N    . GLY A 1 63  ? 0.137   5.755   -5.563  1.00 0.00 ? 63  GLY A N    2  
ATOM 3412  C CA   . GLY A 1 63  ? 0.302   4.294   -5.760  1.00 0.00 ? 63  GLY A CA   2  
ATOM 3413  C C    . GLY A 1 63  ? -0.056  4.017   -7.229  1.00 0.00 ? 63  GLY A C    2  
ATOM 3414  O O    . GLY A 1 63  ? -1.097  3.424   -7.517  1.00 0.00 ? 63  GLY A O    2  
ATOM 3415  H H    . GLY A 1 63  ? -0.540  6.313   -6.102  1.00 0.00 ? 63  GLY A H    2  
ATOM 3416  H HA2  . GLY A 1 63  ? 1.328   3.947   -5.530  1.00 0.00 ? 63  GLY A HA2  2  
ATOM 3417  H HA3  . GLY A 1 63  ? -0.380  3.731   -5.098  1.00 0.00 ? 63  GLY A HA3  2  
ATOM 3418  N N    . GLY A 1 64  ? 0.805   4.494   -8.146  1.00 0.00 ? 64  GLY A N    2  
ATOM 3419  C CA   . GLY A 1 64  ? 0.538   4.463   -9.607  1.00 0.00 ? 64  GLY A CA   2  
ATOM 3420  C C    . GLY A 1 64  ? -0.519  5.427   -10.158 1.00 0.00 ? 64  GLY A C    2  
ATOM 3421  O O    . GLY A 1 64  ? -1.177  5.069   -11.127 1.00 0.00 ? 64  GLY A O    2  
ATOM 3422  H H    . GLY A 1 64  ? 1.621   4.961   -7.735  1.00 0.00 ? 64  GLY A H    2  
ATOM 3423  H HA2  . GLY A 1 64  ? 1.468   4.676   -10.154 1.00 0.00 ? 64  GLY A HA2  2  
ATOM 3424  H HA3  . GLY A 1 64  ? 0.202   3.462   -9.918  1.00 0.00 ? 64  GLY A HA3  2  
ATOM 3425  N N    . LYS A 1 65  ? -0.676  6.639   -9.596  1.00 0.00 ? 65  LYS A N    2  
ATOM 3426  C CA   . LYS A 1 65  ? -1.731  7.614   -9.998  1.00 0.00 ? 65  LYS A CA   2  
ATOM 3427  C C    . LYS A 1 65  ? -3.180  6.996   -9.923  1.00 0.00 ? 65  LYS A C    2  
ATOM 3428  O O    . LYS A 1 65  ? -3.821  6.825   -10.960 1.00 0.00 ? 65  LYS A O    2  
ATOM 3429  C CB   . LYS A 1 65  ? -1.357  8.240   -11.392 1.00 0.00 ? 65  LYS A CB   2  
ATOM 3430  C CG   . LYS A 1 65  ? -2.367  9.209   -12.075 1.00 0.00 ? 65  LYS A CG   2  
ATOM 3431  C CD   . LYS A 1 65  ? -2.796  10.443  -11.250 1.00 0.00 ? 65  LYS A CD   2  
ATOM 3432  C CE   . LYS A 1 65  ? -4.111  11.074  -11.758 1.00 0.00 ? 65  LYS A CE   2  
ATOM 3433  N NZ   . LYS A 1 65  ? -4.325  12.378  -11.071 1.00 0.00 ? 65  LYS A NZ   2  
ATOM 3434  H H    . LYS A 1 65  ? -0.057  6.791   -8.794  1.00 0.00 ? 65  LYS A H    2  
ATOM 3435  H HA   . LYS A 1 65  ? -1.728  8.432   -9.254  1.00 0.00 ? 65  LYS A HA   2  
ATOM 3436  H HB2  . LYS A 1 65  ? -0.377  8.747   -11.301 1.00 0.00 ? 65  LYS A HB2  2  
ATOM 3437  H HB3  . LYS A 1 65  ? -1.166  7.418   -12.111 1.00 0.00 ? 65  LYS A HB3  2  
ATOM 3438  H HG2  . LYS A 1 65  ? -1.934  9.548   -13.038 1.00 0.00 ? 65  LYS A HG2  2  
ATOM 3439  H HG3  . LYS A 1 65  ? -3.258  8.631   -12.390 1.00 0.00 ? 65  LYS A HG3  2  
ATOM 3440  H HD2  . LYS A 1 65  ? -2.925  10.161  -10.187 1.00 0.00 ? 65  LYS A HD2  2  
ATOM 3441  H HD3  . LYS A 1 65  ? -1.958  11.170  -11.258 1.00 0.00 ? 65  LYS A HD3  2  
ATOM 3442  H HE2  . LYS A 1 65  ? -4.095  11.211  -12.862 1.00 0.00 ? 65  LYS A HE2  2  
ATOM 3443  H HE3  . LYS A 1 65  ? -4.969  10.379  -11.581 1.00 0.00 ? 65  LYS A HE3  2  
ATOM 3444  H HZ1  . LYS A 1 65  ? -4.359  12.286  -10.048 1.00 0.00 ? 65  LYS A HZ1  2  
ATOM 3445  H HZ2  . LYS A 1 65  ? -3.563  13.044  -11.258 1.00 0.00 ? 65  LYS A HZ2  2  
ATOM 3446  H HZ3  . LYS A 1 65  ? -5.191  12.859  -11.350 1.00 0.00 ? 65  LYS A HZ3  2  
ATOM 3447  N N    . MET A 1 66  ? -3.663  6.681   -8.697  1.00 0.00 ? 66  MET A N    2  
ATOM 3448  C CA   . MET A 1 66  ? -5.109  6.312   -8.416  1.00 0.00 ? 66  MET A CA   2  
ATOM 3449  C C    . MET A 1 66  ? -5.227  5.287   -7.264  1.00 0.00 ? 66  MET A C    2  
ATOM 3450  O O    . MET A 1 66  ? -5.298  5.733   -6.126  1.00 0.00 ? 66  MET A O    2  
ATOM 3451  C CB   . MET A 1 66  ? -6.111  5.989   -9.576  1.00 0.00 ? 66  MET A CB   2  
ATOM 3452  C CG   . MET A 1 66  ? -7.617  6.180   -9.250  1.00 0.00 ? 66  MET A CG   2  
ATOM 3453  S SD   . MET A 1 66  ? -8.425  4.634   -8.810  1.00 0.00 ? 66  MET A SD   2  
ATOM 3454  C CE   . MET A 1 66  ? -10.143 5.179   -8.825  1.00 0.00 ? 66  MET A CE   2  
ATOM 3455  H H    . MET A 1 66  ? -2.948  6.842   -7.957  1.00 0.00 ? 66  MET A H    2  
ATOM 3456  H HA   . MET A 1 66  ? -5.563  7.172   -8.006  1.00 0.00 ? 66  MET A HA   2  
ATOM 3457  H HB2  . MET A 1 66  ? -5.962  6.743   -10.356 1.00 0.00 ? 66  MET A HB2  2  
ATOM 3458  H HB3  . MET A 1 66  ? -5.915  5.014   -10.049 1.00 0.00 ? 66  MET A HB3  2  
ATOM 3459  H HG2  . MET A 1 66  ? -7.791  6.932   -8.460  1.00 0.00 ? 66  MET A HG2  2  
ATOM 3460  H HG3  . MET A 1 66  ? -8.142  6.579   -10.140 1.00 0.00 ? 66  MET A HG3  2  
ATOM 3461  H HE1  . MET A 1 66  ? -10.297 6.060   -8.180  1.00 0.00 ? 66  MET A HE1  2  
ATOM 3462  H HE2  . MET A 1 66  ? -10.465 5.454   -9.845  1.00 0.00 ? 66  MET A HE2  2  
ATOM 3463  H HE3  . MET A 1 66  ? -10.816 4.376   -8.472  1.00 0.00 ? 66  MET A HE3  2  
ATOM 3464  N N    . CYS A 1 67  ? -5.337  3.993   -7.524  1.00 0.00 ? 67  CYS A N    2  
ATOM 3465  C CA   . CYS A 1 67  ? -5.659  2.954   -6.491  1.00 0.00 ? 67  CYS A CA   2  
ATOM 3466  C C    . CYS A 1 67  ? -4.576  1.854   -6.219  1.00 0.00 ? 67  CYS A C    2  
ATOM 3467  O O    . CYS A 1 67  ? -4.059  1.207   -7.129  1.00 0.00 ? 67  CYS A O    2  
ATOM 3468  C CB   . CYS A 1 67  ? -6.968  2.301   -6.994  1.00 0.00 ? 67  CYS A CB   2  
ATOM 3469  S SG   . CYS A 1 67  ? -7.491  0.905   -5.941  1.00 0.00 ? 67  CYS A SG   2  
ATOM 3470  H H    . CYS A 1 67  ? -5.289  3.908   -8.547  1.00 0.00 ? 67  CYS A H    2  
ATOM 3471  H HA   . CYS A 1 67  ? -5.903  3.443   -5.528  1.00 0.00 ? 67  CYS A HA   2  
ATOM 3472  H HB2  . CYS A 1 67  ? -7.791  3.035   -6.988  1.00 0.00 ? 67  CYS A HB2  2  
ATOM 3473  H HB3  . CYS A 1 67  ? -6.881  1.943   -8.038  1.00 0.00 ? 67  CYS A HB3  2  
ATOM 3474  H HG   . CYS A 1 67  ? -6.847  -0.035  -6.630  1.00 0.00 ? 67  CYS A HG   2  
ATOM 3475  N N    . LEU A 1 68  ? -4.304  1.592   -4.923  1.00 0.00 ? 68  LEU A N    2  
ATOM 3476  C CA   . LEU A 1 68  ? -3.424  0.486   -4.452  1.00 0.00 ? 68  LEU A CA   2  
ATOM 3477  C C    . LEU A 1 68  ? -4.365  -0.588  -3.774  1.00 0.00 ? 68  LEU A C    2  
ATOM 3478  O O    . LEU A 1 68  ? -5.097  -0.337  -2.782  1.00 0.00 ? 68  LEU A O    2  
ATOM 3479  C CB   . LEU A 1 68  ? -2.323  1.029   -3.497  1.00 0.00 ? 68  LEU A CB   2  
ATOM 3480  C CG   . LEU A 1 68  ? -1.202  0.040   -3.078  1.00 0.00 ? 68  LEU A CG   2  
ATOM 3481  C CD1  . LEU A 1 68  ? -0.268  -0.310  -4.247  1.00 0.00 ? 68  LEU A CD1  2  
ATOM 3482  C CD2  . LEU A 1 68  ? -0.349  0.626   -1.940  1.00 0.00 ? 68  LEU A CD2  2  
ATOM 3483  H H    . LEU A 1 68  ? -4.779  2.176   -4.220  1.00 0.00 ? 68  LEU A H    2  
ATOM 3484  H HA   . LEU A 1 68  ? -2.894  0.047   -5.322  1.00 0.00 ? 68  LEU A HA   2  
ATOM 3485  H HB2  . LEU A 1 68  ? -1.851  1.908   -3.973  1.00 0.00 ? 68  LEU A HB2  2  
ATOM 3486  H HB3  . LEU A 1 68  ? -2.793  1.420   -2.579  1.00 0.00 ? 68  LEU A HB3  2  
ATOM 3487  H HG   . LEU A 1 68  ? -1.665  -0.893  -2.700  1.00 0.00 ? 68  LEU A HG   2  
ATOM 3488  H HD11 . LEU A 1 68  ? 0.181   0.590   -4.706  1.00 0.00 ? 68  LEU A HD11 2  
ATOM 3489  H HD12 . LEU A 1 68  ? 0.563   -0.962  -3.925  1.00 0.00 ? 68  LEU A HD12 2  
ATOM 3490  H HD13 . LEU A 1 68  ? -0.794  -0.857  -5.046  1.00 0.00 ? 68  LEU A HD13 2  
ATOM 3491  H HD21 . LEU A 1 68  ? -0.963  0.894   -1.060  1.00 0.00 ? 68  LEU A HD21 2  
ATOM 3492  H HD22 . LEU A 1 68  ? 0.409   -0.093  -1.582  1.00 0.00 ? 68  LEU A HD22 2  
ATOM 3493  H HD23 . LEU A 1 68  ? 0.196   1.537   -2.251  1.00 0.00 ? 68  LEU A HD23 2  
ATOM 3494  N N    . SER A 1 69  ? -4.304  -1.768  -4.433  1.00 0.00 ? 69  SER A N    2  
ATOM 3495  C CA   . SER A 1 69  ? -5.098  -2.997  -4.133  1.00 0.00 ? 69  SER A CA   2  
ATOM 3496  C C    . SER A 1 69  ? -4.224  -4.279  -4.321  1.00 0.00 ? 69  SER A C    2  
ATOM 3497  O O    . SER A 1 69  ? -3.356  -4.325  -5.201  1.00 0.00 ? 69  SER A O    2  
ATOM 3498  C CB   . SER A 1 69  ? -6.267  -3.054  -5.151  1.00 0.00 ? 69  SER A CB   2  
ATOM 3499  O OG   . SER A 1 69  ? -7.162  -1.966  -4.963  1.00 0.00 ? 69  SER A OG   2  
ATOM 3500  H H    . SER A 1 69  ? -3.638  -1.779  -5.226  1.00 0.00 ? 69  SER A H    2  
ATOM 3501  H HA   . SER A 1 69  ? -5.551  -3.002  -3.119  1.00 0.00 ? 69  SER A HA   2  
ATOM 3502  H HB2  . SER A 1 69  ? -5.887  -3.043  -6.193  1.00 0.00 ? 69  SER A HB2  2  
ATOM 3503  H HB3  . SER A 1 69  ? -6.832  -4.001  -5.063  1.00 0.00 ? 69  SER A HB3  2  
ATOM 3504  H HG   . SER A 1 69  ? -6.612  -1.225  -4.684  1.00 0.00 ? 69  SER A HG   2  
ATOM 3505  N N    . CYS A 1 70  ? -4.459  -5.354  -3.545  1.00 0.00 ? 70  CYS A N    2  
ATOM 3506  C CA   . CYS A 1 70  ? -3.759  -6.652  -3.778  1.00 0.00 ? 70  CYS A CA   2  
ATOM 3507  C C    . CYS A 1 70  ? -4.528  -7.448  -4.883  1.00 0.00 ? 70  CYS A C    2  
ATOM 3508  O O    . CYS A 1 70  ? -5.492  -8.165  -4.605  1.00 0.00 ? 70  CYS A O    2  
ATOM 3509  C CB   . CYS A 1 70  ? -3.654  -7.413  -2.455  1.00 0.00 ? 70  CYS A CB   2  
ATOM 3510  S SG   . CYS A 1 70  ? -2.906  -9.053  -2.772  1.00 0.00 ? 70  CYS A SG   2  
ATOM 3511  H H    . CYS A 1 70  ? -5.189  -5.242  -2.830  1.00 0.00 ? 70  CYS A H    2  
ATOM 3512  H HA   . CYS A 1 70  ? -2.722  -6.473  -4.113  1.00 0.00 ? 70  CYS A HA   2  
ATOM 3513  H HB2  . CYS A 1 70  ? -3.043  -6.857  -1.718  1.00 0.00 ? 70  CYS A HB2  2  
ATOM 3514  H HB3  . CYS A 1 70  ? -4.653  -7.548  -1.999  1.00 0.00 ? 70  CYS A HB3  2  
ATOM 3515  H HG   . CYS A 1 70  ? -1.800  -8.629  -3.374  1.00 0.00 ? 70  CYS A HG   2  
ATOM 3516  N N    . VAL A 1 71  ? -4.111  -7.271  -6.147  1.00 0.00 ? 71  VAL A N    2  
ATOM 3517  C CA   . VAL A 1 71  ? -4.839  -7.812  -7.334  1.00 0.00 ? 71  VAL A CA   2  
ATOM 3518  C C    . VAL A 1 71  ? -3.850  -8.462  -8.369  1.00 0.00 ? 71  VAL A C    2  
ATOM 3519  O O    . VAL A 1 71  ? -2.638  -8.214  -8.408  1.00 0.00 ? 71  VAL A O    2  
ATOM 3520  C CB   . VAL A 1 71  ? -5.755  -6.646  -7.885  1.00 0.00 ? 71  VAL A CB   2  
ATOM 3521  C CG1  . VAL A 1 71  ? -5.065  -5.345  -8.355  1.00 0.00 ? 71  VAL A CG1  2  
ATOM 3522  C CG2  . VAL A 1 71  ? -6.725  -7.069  -9.006  1.00 0.00 ? 71  VAL A CG2  2  
ATOM 3523  H H    . VAL A 1 71  ? -3.258  -6.698  -6.234  1.00 0.00 ? 71  VAL A H    2  
ATOM 3524  H HA   . VAL A 1 71  ? -5.505  -8.634  -7.008  1.00 0.00 ? 71  VAL A HA   2  
ATOM 3525  H HB   . VAL A 1 71  ? -6.409  -6.351  -7.038  1.00 0.00 ? 71  VAL A HB   2  
ATOM 3526  H HG11 . VAL A 1 71  ? -4.461  -4.883  -7.552  1.00 0.00 ? 71  VAL A HG11 2  
ATOM 3527  H HG12 . VAL A 1 71  ? -4.401  -5.513  -9.224  1.00 0.00 ? 71  VAL A HG12 2  
ATOM 3528  H HG13 . VAL A 1 71  ? -5.786  -4.564  -8.664  1.00 0.00 ? 71  VAL A HG13 2  
ATOM 3529  H HG21 . VAL A 1 71  ? -7.330  -7.946  -8.723  1.00 0.00 ? 71  VAL A HG21 2  
ATOM 3530  H HG22 . VAL A 1 71  ? -7.438  -6.255  -9.245  1.00 0.00 ? 71  VAL A HG22 2  
ATOM 3531  H HG23 . VAL A 1 71  ? -6.193  -7.300  -9.950  1.00 0.00 ? 71  VAL A HG23 2  
ATOM 3532  N N    . LYS A 1 72  ? -4.395  -9.391  -9.177  1.00 0.00 ? 72  LYS A N    2  
ATOM 3533  C CA   . LYS A 1 72  ? -3.626  -10.144 -10.202 1.00 0.00 ? 72  LYS A CA   2  
ATOM 3534  C C    . LYS A 1 72  ? -3.549  -9.384  -11.567 1.00 0.00 ? 72  LYS A C    2  
ATOM 3535  O O    . LYS A 1 72  ? -4.570  -9.119  -12.209 1.00 0.00 ? 72  LYS A O    2  
ATOM 3536  C CB   . LYS A 1 72  ? -4.277  -11.561 -10.336 1.00 0.00 ? 72  LYS A CB   2  
ATOM 3537  C CG   . LYS A 1 72  ? -5.725  -11.688 -10.908 1.00 0.00 ? 72  LYS A CG   2  
ATOM 3538  C CD   . LYS A 1 72  ? -5.803  -12.197 -12.368 1.00 0.00 ? 72  LYS A CD   2  
ATOM 3539  C CE   . LYS A 1 72  ? -5.817  -13.734 -12.482 1.00 0.00 ? 72  LYS A CE   2  
ATOM 3540  N NZ   . LYS A 1 72  ? -5.564  -14.154 -13.889 1.00 0.00 ? 72  LYS A NZ   2  
ATOM 3541  H H    . LYS A 1 72  ? -5.409  -9.493  -9.077  1.00 0.00 ? 72  LYS A H    2  
ATOM 3542  H HA   . LYS A 1 72  ? -2.591  -10.302 -9.841  1.00 0.00 ? 72  LYS A HA   2  
ATOM 3543  H HB2  . LYS A 1 72  ? -3.584  -12.194 -10.926 1.00 0.00 ? 72  LYS A HB2  2  
ATOM 3544  H HB3  . LYS A 1 72  ? -4.250  -12.044 -9.340  1.00 0.00 ? 72  LYS A HB3  2  
ATOM 3545  H HG2  . LYS A 1 72  ? -6.343  -12.325 -10.245 1.00 0.00 ? 72  LYS A HG2  2  
ATOM 3546  H HG3  . LYS A 1 72  ? -6.225  -10.700 -10.860 1.00 0.00 ? 72  LYS A HG3  2  
ATOM 3547  H HD2  . LYS A 1 72  ? -6.719  -11.791 -12.842 1.00 0.00 ? 72  LYS A HD2  2  
ATOM 3548  H HD3  . LYS A 1 72  ? -4.970  -11.751 -12.953 1.00 0.00 ? 72  LYS A HD3  2  
ATOM 3549  H HE2  . LYS A 1 72  ? -5.054  -14.179 -11.805 1.00 0.00 ? 72  LYS A HE2  2  
ATOM 3550  H HE3  . LYS A 1 72  ? -6.778  -14.147 -12.108 1.00 0.00 ? 72  LYS A HE3  2  
ATOM 3551  H HZ1  . LYS A 1 72  ? -4.796  -13.611 -14.333 1.00 0.00 ? 72  LYS A HZ1  2  
ATOM 3552  H HZ2  . LYS A 1 72  ? -5.184  -15.148 -13.938 1.00 0.00 ? 72  LYS A HZ2  2  
ATOM 3553  H HZ3  . LYS A 1 72  ? -6.367  -14.098 -14.523 1.00 0.00 ? 72  LYS A HZ3  2  
ATOM 3554  N N    . SER A 1 73  ? -2.326  -9.040  -12.011 1.00 0.00 ? 73  SER A N    2  
ATOM 3555  C CA   . SER A 1 73  ? -2.099  -8.411  -13.349 1.00 0.00 ? 73  SER A CA   2  
ATOM 3556  C C    . SER A 1 73  ? -2.115  -9.521  -14.457 1.00 0.00 ? 73  SER A C    2  
ATOM 3557  O O    . SER A 1 73  ? -3.022  -9.527  -15.292 1.00 0.00 ? 73  SER A O    2  
ATOM 3558  C CB   . SER A 1 73  ? -0.797  -7.570  -13.289 1.00 0.00 ? 73  SER A CB   2  
ATOM 3559  O OG   . SER A 1 73  ? 0.365   -8.342  -12.965 1.00 0.00 ? 73  SER A OG   2  
ATOM 3560  H H    . SER A 1 73  ? -1.546  -9.301  -11.403 1.00 0.00 ? 73  SER A H    2  
ATOM 3561  H HA   . SER A 1 73  ? -2.930  -7.717  -13.586 1.00 0.00 ? 73  SER A HA   2  
ATOM 3562  H HB2  . SER A 1 73  ? -0.646  -7.066  -14.264 1.00 0.00 ? 73  SER A HB2  2  
ATOM 3563  H HB3  . SER A 1 73  ? -0.913  -6.749  -12.555 1.00 0.00 ? 73  SER A HB3  2  
ATOM 3564  H HG   . SER A 1 73  ? 1.126   -7.759  -13.065 1.00 0.00 ? 73  SER A HG   2  
ATOM 3565  N N    . GLY A 1 74  ? -1.155  -10.471 -14.445 1.00 0.00 ? 74  GLY A N    2  
ATOM 3566  C CA   . GLY A 1 74  ? -1.185  -11.665 -15.336 1.00 0.00 ? 74  GLY A CA   2  
ATOM 3567  C C    . GLY A 1 74  ? -2.034  -12.767 -14.661 1.00 0.00 ? 74  GLY A C    2  
ATOM 3568  O O    . GLY A 1 74  ? -3.242  -12.859 -14.910 1.00 0.00 ? 74  GLY A O    2  
ATOM 3569  H H    . GLY A 1 74  ? -0.463  -10.326 -13.701 1.00 0.00 ? 74  GLY A H    2  
ATOM 3570  H HA2  . GLY A 1 74  ? -1.614  -11.425 -16.328 1.00 0.00 ? 74  GLY A HA2  2  
ATOM 3571  H HA3  . GLY A 1 74  ? -0.157  -12.022 -15.534 1.00 0.00 ? 74  GLY A HA3  2  
ATOM 3572  N N    . ASP A 1 75  ? -1.417  -13.570 -13.778 1.00 0.00 ? 75  ASP A N    2  
ATOM 3573  C CA   . ASP A 1 75  ? -2.162  -14.575 -12.955 1.00 0.00 ? 75  ASP A CA   2  
ATOM 3574  C C    . ASP A 1 75  ? -1.752  -14.604 -11.438 1.00 0.00 ? 75  ASP A C    2  
ATOM 3575  O O    . ASP A 1 75  ? -2.597  -14.882 -10.579 1.00 0.00 ? 75  ASP A O    2  
ATOM 3576  C CB   . ASP A 1 75  ? -2.071  -15.962 -13.646 1.00 0.00 ? 75  ASP A CB   2  
ATOM 3577  C CG   . ASP A 1 75  ? -3.294  -16.832 -13.348 1.00 0.00 ? 75  ASP A CG   2  
ATOM 3578  O OD1  . ASP A 1 75  ? -4.397  -16.494 -13.843 1.00 0.00 ? 75  ASP A OD1  2  
ATOM 3579  O OD2  . ASP A 1 75  ? -3.174  -17.824 -12.604 1.00 0.00 ? 75  ASP A OD2  2  
ATOM 3580  H H    . ASP A 1 75  ? -0.405  -13.409 -13.662 1.00 0.00 ? 75  ASP A H    2  
ATOM 3581  H HA   . ASP A 1 75  ? -3.207  -14.257 -12.908 1.00 0.00 ? 75  ASP A HA   2  
ATOM 3582  H HB2  . ASP A 1 75  ? -2.031  -15.862 -14.746 1.00 0.00 ? 75  ASP A HB2  2  
ATOM 3583  H HB3  . ASP A 1 75  ? -1.142  -16.492 -13.368 1.00 0.00 ? 75  ASP A HB3  2  
ATOM 3584  N N    . GLU A 1 76  ? -0.519  -14.214 -11.083 1.00 0.00 ? 76  GLU A N    2  
ATOM 3585  C CA   . GLU A 1 76  ? 0.001   -14.185 -9.697  1.00 0.00 ? 76  GLU A CA   2  
ATOM 3586  C C    . GLU A 1 76  ? -0.588  -12.927 -8.962  1.00 0.00 ? 76  GLU A C    2  
ATOM 3587  O O    . GLU A 1 76  ? -0.618  -11.813 -9.503  1.00 0.00 ? 76  GLU A O    2  
ATOM 3588  C CB   . GLU A 1 76  ? 1.573   -14.158 -9.725  1.00 0.00 ? 76  GLU A CB   2  
ATOM 3589  C CG   . GLU A 1 76  ? 2.365   -14.766 -10.935 1.00 0.00 ? 76  GLU A CG   2  
ATOM 3590  C CD   . GLU A 1 76  ? 2.529   -13.833 -12.136 1.00 0.00 ? 76  GLU A CD   2  
ATOM 3591  O OE1  . GLU A 1 76  ? 1.521   -13.457 -12.778 1.00 0.00 ? 76  GLU A OE1  2  
ATOM 3592  O OE2  . GLU A 1 76  ? 3.650   -13.334 -12.358 1.00 0.00 ? 76  GLU A OE2  2  
ATOM 3593  H H    . GLU A 1 76  ? 0.129   -14.005 -11.866 1.00 0.00 ? 76  GLU A H    2  
ATOM 3594  H HA   . GLU A 1 76  ? -0.322  -15.112 -9.182  1.00 0.00 ? 76  GLU A HA   2  
ATOM 3595  H HB2  . GLU A 1 76  ? 1.941   -13.126 -9.567  1.00 0.00 ? 76  GLU A HB2  2  
ATOM 3596  H HB3  . GLU A 1 76  ? 1.913   -14.680 -8.810  1.00 0.00 ? 76  GLU A HB3  2  
ATOM 3597  H HG2  . GLU A 1 76  ? 3.381   -15.053 -10.613 1.00 0.00 ? 76  GLU A HG2  2  
ATOM 3598  H HG3  . GLU A 1 76  ? 1.898   -15.703 -11.287 1.00 0.00 ? 76  GLU A HG3  2  
ATOM 3599  N N    . THR A 1 77  ? -1.111  -13.115 -7.739  1.00 0.00 ? 77  THR A N    2  
ATOM 3600  C CA   . THR A 1 77  ? -1.769  -12.010 -6.974  1.00 0.00 ? 77  THR A CA   2  
ATOM 3601  C C    . THR A 1 77  ? -0.700  -11.199 -6.171  1.00 0.00 ? 77  THR A C    2  
ATOM 3602  O O    . THR A 1 77  ? -0.092  -11.699 -5.222  1.00 0.00 ? 77  THR A O    2  
ATOM 3603  C CB   . THR A 1 77  ? -2.884  -12.636 -6.085  1.00 0.00 ? 77  THR A CB   2  
ATOM 3604  O OG1  . THR A 1 77  ? -3.751  -13.437 -6.888  1.00 0.00 ? 77  THR A OG1  2  
ATOM 3605  C CG2  . THR A 1 77  ? -3.771  -11.585 -5.401  1.00 0.00 ? 77  THR A CG2  2  
ATOM 3606  H H    . THR A 1 77  ? -1.003  -14.065 -7.369  1.00 0.00 ? 77  THR A H    2  
ATOM 3607  H HA   . THR A 1 77  ? -2.282  -11.320 -7.675  1.00 0.00 ? 77  THR A HA   2  
ATOM 3608  H HB   . THR A 1 77  ? -2.412  -13.274 -5.313  1.00 0.00 ? 77  THR A HB   2  
ATOM 3609  H HG1  . THR A 1 77  ? -3.179  -13.764 -7.597  1.00 0.00 ? 77  THR A HG1  2  
ATOM 3610  H HG21 . THR A 1 77  ? -4.237  -10.890 -6.125  1.00 0.00 ? 77  THR A HG21 2  
ATOM 3611  H HG22 . THR A 1 77  ? -4.584  -12.062 -4.827  1.00 0.00 ? 77  THR A HG22 2  
ATOM 3612  H HG23 . THR A 1 77  ? -3.195  -10.968 -4.686  1.00 0.00 ? 77  THR A HG23 2  
ATOM 3613  N N    . ARG A 1 78  ? -0.459  -9.949  -6.595  1.00 0.00 ? 78  ARG A N    2  
ATOM 3614  C CA   . ARG A 1 78  ? 0.555   -9.049  -5.971  1.00 0.00 ? 78  ARG A CA   2  
ATOM 3615  C C    . ARG A 1 78  ? -0.064  -7.680  -5.537  1.00 0.00 ? 78  ARG A C    2  
ATOM 3616  O O    . ARG A 1 78  ? -1.225  -7.360  -5.825  1.00 0.00 ? 78  ARG A O    2  
ATOM 3617  C CB   . ARG A 1 78  ? 1.729   -8.864  -6.993  1.00 0.00 ? 78  ARG A CB   2  
ATOM 3618  C CG   . ARG A 1 78  ? 1.484   -8.004  -8.275  1.00 0.00 ? 78  ARG A CG   2  
ATOM 3619  C CD   . ARG A 1 78  ? 1.166   -8.802  -9.552  1.00 0.00 ? 78  ARG A CD   2  
ATOM 3620  N NE   . ARG A 1 78  ? 2.404   -9.415  -10.111 1.00 0.00 ? 78  ARG A NE   2  
ATOM 3621  C CZ   . ARG A 1 78  ? 2.443   -10.416 -10.990 1.00 0.00 ? 78  ARG A CZ   2  
ATOM 3622  N NH1  . ARG A 1 78  ? 1.380   -11.030 -11.443 1.00 0.00 ? 78  ARG A NH1  2  
ATOM 3623  N NH2  . ARG A 1 78  ? 3.607   -10.829 -11.400 1.00 0.00 ? 78  ARG A NH2  2  
ATOM 3624  H H    . ARG A 1 78  ? -1.051  -9.635  -7.373  1.00 0.00 ? 78  ARG A H    2  
ATOM 3625  H HA   . ARG A 1 78  ? 0.970   -9.511  -5.053  1.00 0.00 ? 78  ARG A HA   2  
ATOM 3626  H HB2  . ARG A 1 78  ? 2.572   -8.400  -6.446  1.00 0.00 ? 78  ARG A HB2  2  
ATOM 3627  H HB3  . ARG A 1 78  ? 2.137   -9.858  -7.266  1.00 0.00 ? 78  ARG A HB3  2  
ATOM 3628  H HG2  . ARG A 1 78  ? 0.654   -7.293  -8.099  1.00 0.00 ? 78  ARG A HG2  2  
ATOM 3629  H HG3  . ARG A 1 78  ? 2.348   -7.333  -8.453  1.00 0.00 ? 78  ARG A HG3  2  
ATOM 3630  H HD2  . ARG A 1 78  ? 0.382   -9.552  -9.329  1.00 0.00 ? 78  ARG A HD2  2  
ATOM 3631  H HD3  . ARG A 1 78  ? 0.720   -8.123  -10.307 1.00 0.00 ? 78  ARG A HD3  2  
ATOM 3632  H HE   . ARG A 1 78  ? 3.328   -9.074  -9.835  1.00 0.00 ? 78  ARG A HE   2  
ATOM 3633  H HH11 . ARG A 1 78  ? 0.534   -10.864 -10.888 1.00 0.00 ? 78  ARG A HH11 2  
ATOM 3634  H HH12 . ARG A 1 78  ? 1.547   -11.882 -12.025 1.00 0.00 ? 78  ARG A HH12 2  
ATOM 3635  H HH21 . ARG A 1 78  ? 4.434   -10.382 -11.009 1.00 0.00 ? 78  ARG A HH21 2  
ATOM 3636  H HH22 . ARG A 1 78  ? 3.607   -11.748 -11.915 1.00 0.00 ? 78  ARG A HH22 2  
ATOM 3637  N N    . LEU A 1 79  ? 0.739   -6.838  -4.851  1.00 0.00 ? 79  LEU A N    2  
ATOM 3638  C CA   . LEU A 1 79  ? 0.310   -5.461  -4.485  1.00 0.00 ? 79  LEU A CA   2  
ATOM 3639  C C    . LEU A 1 79  ? 0.445   -4.593  -5.780  1.00 0.00 ? 79  LEU A C    2  
ATOM 3640  O O    . LEU A 1 79  ? 1.541   -4.274  -6.256  1.00 0.00 ? 79  LEU A O    2  
ATOM 3641  C CB   . LEU A 1 79  ? 1.162   -4.925  -3.314  1.00 0.00 ? 79  LEU A CB   2  
ATOM 3642  C CG   . LEU A 1 79  ? 0.462   -3.820  -2.479  1.00 0.00 ? 79  LEU A CG   2  
ATOM 3643  C CD1  . LEU A 1 79  ? -0.623  -4.400  -1.556  1.00 0.00 ? 79  LEU A CD1  2  
ATOM 3644  C CD2  . LEU A 1 79  ? 1.472   -3.043  -1.623  1.00 0.00 ? 79  LEU A CD2  2  
ATOM 3645  H H    . LEU A 1 79  ? 1.686   -7.180  -4.663  1.00 0.00 ? 79  LEU A H    2  
ATOM 3646  H HA   . LEU A 1 79  ? -0.745  -5.492  -4.152  1.00 0.00 ? 79  LEU A HA   2  
ATOM 3647  H HB2  . LEU A 1 79  ? 1.480   -5.739  -2.633  1.00 0.00 ? 79  LEU A HB2  2  
ATOM 3648  H HB3  . LEU A 1 79  ? 2.096   -4.552  -3.761  1.00 0.00 ? 79  LEU A HB3  2  
ATOM 3649  H HG   . LEU A 1 79  ? -0.021  -3.096  -3.165  1.00 0.00 ? 79  LEU A HG   2  
ATOM 3650  H HD11 . LEU A 1 79  ? -0.216  -5.146  -0.847  1.00 0.00 ? 79  LEU A HD11 2  
ATOM 3651  H HD12 . LEU A 1 79  ? -1.093  -3.604  -0.954  1.00 0.00 ? 79  LEU A HD12 2  
ATOM 3652  H HD13 . LEU A 1 79  ? -1.442  -4.889  -2.114  1.00 0.00 ? 79  LEU A HD13 2  
ATOM 3653  H HD21 . LEU A 1 79  ? 2.075   -3.708  -0.976  1.00 0.00 ? 79  LEU A HD21 2  
ATOM 3654  H HD22 . LEU A 1 79  ? 2.166   -2.463  -2.256  1.00 0.00 ? 79  LEU A HD22 2  
ATOM 3655  H HD23 . LEU A 1 79  ? 0.974   -2.313  -0.957  1.00 0.00 ? 79  LEU A HD23 2  
ATOM 3656  N N    . GLN A 1 80  ? -0.715  -4.330  -6.373  1.00 0.00 ? 80  GLN A N    2  
ATOM 3657  C CA   . GLN A 1 80  ? -0.835  -3.690  -7.701  1.00 0.00 ? 80  GLN A CA   2  
ATOM 3658  C C    . GLN A 1 80  ? -1.338  -2.217  -7.605  1.00 0.00 ? 80  GLN A C    2  
ATOM 3659  O O    . GLN A 1 80  ? -2.231  -1.836  -6.830  1.00 0.00 ? 80  GLN A O    2  
ATOM 3660  C CB   . GLN A 1 80  ? -1.796  -4.553  -8.581  1.00 0.00 ? 80  GLN A CB   2  
ATOM 3661  C CG   . GLN A 1 80  ? -1.215  -5.098  -9.911  1.00 0.00 ? 80  GLN A CG   2  
ATOM 3662  C CD   . GLN A 1 80  ? -0.702  -4.065  -10.921 1.00 0.00 ? 80  GLN A CD   2  
ATOM 3663  O OE1  . GLN A 1 80  ? 0.499   -3.889  -11.096 1.00 0.00 ? 80  GLN A OE1  2  
ATOM 3664  N NE2  . GLN A 1 80  ? -1.561  -3.355  -11.609 1.00 0.00 ? 80  GLN A NE2  2  
ATOM 3665  H H    . GLN A 1 80  ? -1.513  -4.637  -5.809  1.00 0.00 ? 80  GLN A H    2  
ATOM 3666  H HA   . GLN A 1 80  ? 0.166   -3.698  -8.186  1.00 0.00 ? 80  GLN A HA   2  
ATOM 3667  H HB2  . GLN A 1 80  ? -2.183  -5.430  -8.024  1.00 0.00 ? 80  GLN A HB2  2  
ATOM 3668  H HB3  . GLN A 1 80  ? -2.710  -3.979  -8.826  1.00 0.00 ? 80  GLN A HB3  2  
ATOM 3669  H HG2  . GLN A 1 80  ? -0.387  -5.793  -9.686  1.00 0.00 ? 80  GLN A HG2  2  
ATOM 3670  H HG3  . GLN A 1 80  ? -1.979  -5.726  -10.407 1.00 0.00 ? 80  GLN A HG3  2  
ATOM 3671  H HE21 . GLN A 1 80  ? -2.565  -3.410  -11.320 1.00 0.00 ? 80  GLN A HE21 2  
ATOM 3672  H HE22 . GLN A 1 80  ? -1.134  -2.620  -12.178 1.00 0.00 ? 80  GLN A HE22 2  
ATOM 3673  N N    . LEU A 1 81  ? -0.714  -1.435  -8.489  1.00 0.00 ? 81  LEU A N    2  
ATOM 3674  C CA   . LEU A 1 81  ? -0.931  0.008   -8.662  1.00 0.00 ? 81  LEU A CA   2  
ATOM 3675  C C    . LEU A 1 81  ? -1.855  0.287   -9.894  1.00 0.00 ? 81  LEU A C    2  
ATOM 3676  O O    . LEU A 1 81  ? -1.396  0.586   -11.001 1.00 0.00 ? 81  LEU A O    2  
ATOM 3677  C CB   . LEU A 1 81  ? 0.504   0.626   -8.744  1.00 0.00 ? 81  LEU A CB   2  
ATOM 3678  C CG   . LEU A 1 81  ? 1.518   0.255   -9.880  1.00 0.00 ? 81  LEU A CG   2  
ATOM 3679  C CD1  . LEU A 1 81  ? 2.586   1.352   -10.028 1.00 0.00 ? 81  LEU A CD1  2  
ATOM 3680  C CD2  . LEU A 1 81  ? 2.246   -1.091  -9.684  1.00 0.00 ? 81  LEU A CD2  2  
ATOM 3681  H H    . LEU A 1 81  ? -0.010  -1.913  -9.059  1.00 0.00 ? 81  LEU A H    2  
ATOM 3682  H HA   . LEU A 1 81  ? -1.429  0.447   -7.772  1.00 0.00 ? 81  LEU A HA   2  
ATOM 3683  H HB2  . LEU A 1 81  ? 0.338   1.709   -8.778  1.00 0.00 ? 81  LEU A HB2  2  
ATOM 3684  H HB3  . LEU A 1 81  ? 1.004   0.494   -7.768  1.00 0.00 ? 81  LEU A HB3  2  
ATOM 3685  H HG   . LEU A 1 81  ? 0.982   0.203   -10.847 1.00 0.00 ? 81  LEU A HG   2  
ATOM 3686  H HD11 . LEU A 1 81  ? 3.091   1.595   -9.077  1.00 0.00 ? 81  LEU A HD11 2  
ATOM 3687  H HD12 . LEU A 1 81  ? 3.367   1.057   -10.749 1.00 0.00 ? 81  LEU A HD12 2  
ATOM 3688  H HD13 . LEU A 1 81  ? 2.154   2.288   -10.420 1.00 0.00 ? 81  LEU A HD13 2  
ATOM 3689  H HD21 . LEU A 1 81  ? 2.747   -1.165  -8.703  1.00 0.00 ? 81  LEU A HD21 2  
ATOM 3690  H HD22 . LEU A 1 81  ? 1.569   -1.955  -9.772  1.00 0.00 ? 81  LEU A HD22 2  
ATOM 3691  H HD23 . LEU A 1 81  ? 3.019   -1.256  -10.458 1.00 0.00 ? 81  LEU A HD23 2  
ATOM 3692  N N    . GLU A 1 82  ? -3.183  0.253   -9.681  1.00 0.00 ? 82  GLU A N    2  
ATOM 3693  C CA   . GLU A 1 82  ? -4.186  0.494   -10.753 1.00 0.00 ? 82  GLU A CA   2  
ATOM 3694  C C    . GLU A 1 82  ? -4.303  2.032   -11.067 1.00 0.00 ? 82  GLU A C    2  
ATOM 3695  O O    . GLU A 1 82  ? -4.915  2.812   -10.325 1.00 0.00 ? 82  GLU A O    2  
ATOM 3696  C CB   . GLU A 1 82  ? -5.546  -0.107  -10.284 1.00 0.00 ? 82  GLU A CB   2  
ATOM 3697  C CG   . GLU A 1 82  ? -5.604  -1.625  -9.945  1.00 0.00 ? 82  GLU A CG   2  
ATOM 3698  C CD   . GLU A 1 82  ? -5.203  -2.588  -11.054 1.00 0.00 ? 82  GLU A CD   2  
ATOM 3699  O OE1  . GLU A 1 82  ? -5.887  -2.632  -12.096 1.00 0.00 ? 82  GLU A OE1  2  
ATOM 3700  O OE2  . GLU A 1 82  ? -4.207  -3.321  -10.873 1.00 0.00 ? 82  GLU A OE2  2  
ATOM 3701  H H    . GLU A 1 82  ? -3.488  -0.043  -8.741  1.00 0.00 ? 82  GLU A H    2  
ATOM 3702  H HA   . GLU A 1 82  ? -3.888  -0.049  -11.674 1.00 0.00 ? 82  GLU A HA   2  
ATOM 3703  H HB2  . GLU A 1 82  ? -5.902  0.454   -9.401  1.00 0.00 ? 82  GLU A HB2  2  
ATOM 3704  H HB3  . GLU A 1 82  ? -6.304  0.096   -11.066 1.00 0.00 ? 82  GLU A HB3  2  
ATOM 3705  H HG2  . GLU A 1 82  ? -4.970  -1.845  -9.068  1.00 0.00 ? 82  GLU A HG2  2  
ATOM 3706  H HG3  . GLU A 1 82  ? -6.627  -1.904  -9.643  1.00 0.00 ? 82  GLU A HG3  2  
ATOM 3707  N N    . ALA A 1 83  ? -3.701  2.445   -12.200 1.00 0.00 ? 83  ALA A N    2  
ATOM 3708  C CA   . ALA A 1 83  ? -3.656  3.862   -12.648 1.00 0.00 ? 83  ALA A CA   2  
ATOM 3709  C C    . ALA A 1 83  ? -4.968  4.311   -13.355 1.00 0.00 ? 83  ALA A C    2  
ATOM 3710  O O    . ALA A 1 83  ? -5.300  3.830   -14.445 1.00 0.00 ? 83  ALA A O    2  
ATOM 3711  C CB   . ALA A 1 83  ? -2.449  3.965   -13.605 1.00 0.00 ? 83  ALA A CB   2  
ATOM 3712  H H    . ALA A 1 83  ? -3.214  1.701   -12.711 1.00 0.00 ? 83  ALA A H    2  
ATOM 3713  H HA   . ALA A 1 83  ? -3.482  4.515   -11.766 1.00 0.00 ? 83  ALA A HA   2  
ATOM 3714  H HB1  . ALA A 1 83  ? -1.516  3.593   -13.140 1.00 0.00 ? 83  ALA A HB1  2  
ATOM 3715  H HB2  . ALA A 1 83  ? -2.600  3.393   -14.540 1.00 0.00 ? 83  ALA A HB2  2  
ATOM 3716  H HB3  . ALA A 1 83  ? -2.257  5.016   -13.890 1.00 0.00 ? 83  ALA A HB3  2  
ATOM 3717  N N    . VAL A 1 84  ? -5.733  5.212   -12.714 1.00 0.00 ? 84  VAL A N    2  
ATOM 3718  C CA   . VAL A 1 84  ? -7.070  5.654   -13.230 1.00 0.00 ? 84  VAL A CA   2  
ATOM 3719  C C    . VAL A 1 84  ? -7.240  7.201   -12.954 1.00 0.00 ? 84  VAL A C    2  
ATOM 3720  O O    . VAL A 1 84  ? -6.382  7.898   -12.393 1.00 0.00 ? 84  VAL A O    2  
ATOM 3721  C CB   . VAL A 1 84  ? -8.161  4.689   -12.575 1.00 0.00 ? 84  VAL A CB   2  
ATOM 3722  C CG1  . VAL A 1 84  ? -9.648  5.113   -12.685 1.00 0.00 ? 84  VAL A CG1  2  
ATOM 3723  C CG2  . VAL A 1 84  ? -8.132  3.235   -13.119 1.00 0.00 ? 84  VAL A CG2  2  
ATOM 3724  H H    . VAL A 1 84  ? -5.346  5.576   -11.819 1.00 0.00 ? 84  VAL A H    2  
ATOM 3725  H HA   . VAL A 1 84  ? -7.117  5.542   -14.333 1.00 0.00 ? 84  VAL A HA   2  
ATOM 3726  H HB   . VAL A 1 84  ? -7.940  4.611   -11.493 1.00 0.00 ? 84  VAL A HB   2  
ATOM 3727  H HG11 . VAL A 1 84  ? -9.969  5.271   -13.731 1.00 0.00 ? 84  VAL A HG11 2  
ATOM 3728  H HG12 . VAL A 1 84  ? -10.336 4.363   -12.249 1.00 0.00 ? 84  VAL A HG12 2  
ATOM 3729  H HG13 . VAL A 1 84  ? -9.856  6.043   -12.124 1.00 0.00 ? 84  VAL A HG13 2  
ATOM 3730  H HG21 . VAL A 1 84  ? -8.306  3.192   -14.211 1.00 0.00 ? 84  VAL A HG21 2  
ATOM 3731  H HG22 . VAL A 1 84  ? -7.164  2.738   -12.928 1.00 0.00 ? 84  VAL A HG22 2  
ATOM 3732  H HG23 . VAL A 1 84  ? -8.888  2.585   -12.639 1.00 0.00 ? 84  VAL A HG23 2  
ATOM 3733  N N    . ASN A 1 85  ? -8.348  7.784   -13.430 1.00 0.00 ? 85  ASN A N    2  
ATOM 3734  C CA   . ASN A 1 85  ? -8.716  9.199   -13.153 1.00 0.00 ? 85  ASN A CA   2  
ATOM 3735  C C    . ASN A 1 85  ? -9.203  9.420   -11.675 1.00 0.00 ? 85  ASN A C    2  
ATOM 3736  O O    . ASN A 1 85  ? -9.762  8.520   -11.038 1.00 0.00 ? 85  ASN A O    2  
ATOM 3737  C CB   . ASN A 1 85  ? -9.832  9.609   -14.166 1.00 0.00 ? 85  ASN A CB   2  
ATOM 3738  C CG   . ASN A 1 85  ? -11.154 8.812   -14.176 1.00 0.00 ? 85  ASN A CG   2  
ATOM 3739  O OD1  . ASN A 1 85  ? -11.310 7.853   -14.923 1.00 0.00 ? 85  ASN A OD1  2  
ATOM 3740  N ND2  . ASN A 1 85  ? -12.126 9.150   -13.361 1.00 0.00 ? 85  ASN A ND2  2  
ATOM 3741  H H    . ASN A 1 85  ? -9.011  7.137   -13.872 1.00 0.00 ? 85  ASN A H    2  
ATOM 3742  H HA   . ASN A 1 85  ? -7.831  9.843   -13.327 1.00 0.00 ? 85  ASN A HA   2  
ATOM 3743  H HB2  . ASN A 1 85  ? -10.067 10.682  -14.044 1.00 0.00 ? 85  ASN A HB2  2  
ATOM 3744  H HB3  . ASN A 1 85  ? -9.418  9.549   -15.190 1.00 0.00 ? 85  ASN A HB3  2  
ATOM 3745  H HD21 . ASN A 1 85  ? -11.881 9.762   -12.570 1.00 0.00 ? 85  ASN A HD21 2  
ATOM 3746  H HD22 . ASN A 1 85  ? -12.905 8.485   -13.389 1.00 0.00 ? 85  ASN A HD22 2  
ATOM 3747  N N    . ILE A 1 86  ? -9.048  10.649  -11.151 1.00 0.00 ? 86  ILE A N    2  
ATOM 3748  C CA   . ILE A 1 86  ? -9.596  11.018  -9.795  1.00 0.00 ? 86  ILE A CA   2  
ATOM 3749  C C    . ILE A 1 86  ? -11.160 11.282  -9.896  1.00 0.00 ? 86  ILE A C    2  
ATOM 3750  O O    . ILE A 1 86  ? -11.835 10.635  -10.699 1.00 0.00 ? 86  ILE A O    2  
ATOM 3751  C CB   . ILE A 1 86  ? -8.729  12.183  -9.161  1.00 0.00 ? 86  ILE A CB   2  
ATOM 3752  C CG1  . ILE A 1 86  ? -8.623  13.461  -10.051 1.00 0.00 ? 86  ILE A CG1  2  
ATOM 3753  C CG2  . ILE A 1 86  ? -7.314  11.654  -8.802  1.00 0.00 ? 86  ILE A CG2  2  
ATOM 3754  C CD1  . ILE A 1 86  ? -8.183  14.735  -9.307  1.00 0.00 ? 86  ILE A CD1  2  
ATOM 3755  H H    . ILE A 1 86  ? -8.544  11.313  -11.749 1.00 0.00 ? 86  ILE A H    2  
ATOM 3756  H HA   . ILE A 1 86  ? -9.542  10.146  -9.109  1.00 0.00 ? 86  ILE A HA   2  
ATOM 3757  H HB   . ILE A 1 86  ? -9.198  12.491  -8.210  1.00 0.00 ? 86  ILE A HB   2  
ATOM 3758  H HG12 . ILE A 1 86  ? -7.951  13.287  -10.912 1.00 0.00 ? 86  ILE A HG12 2  
ATOM 3759  H HG13 . ILE A 1 86  ? -9.609  13.674  -10.509 1.00 0.00 ? 86  ILE A HG13 2  
ATOM 3760  H HG21 . ILE A 1 86  ? -7.371  10.786  -8.119  1.00 0.00 ? 86  ILE A HG21 2  
ATOM 3761  H HG22 . ILE A 1 86  ? -6.751  11.322  -9.692  1.00 0.00 ? 86  ILE A HG22 2  
ATOM 3762  H HG23 . ILE A 1 86  ? -6.706  12.417  -8.283  1.00 0.00 ? 86  ILE A HG23 2  
ATOM 3763  H HD11 . ILE A 1 86  ? -8.873  14.988  -8.480  1.00 0.00 ? 86  ILE A HD11 2  
ATOM 3764  H HD12 . ILE A 1 86  ? -7.170  14.646  -8.874  1.00 0.00 ? 86  ILE A HD12 2  
ATOM 3765  H HD13 . ILE A 1 86  ? -8.166  15.609  -9.985  1.00 0.00 ? 86  ILE A HD13 2  
ATOM 3766  N N    . THR A 1 87  ? -11.766 12.136  -9.038  1.00 0.00 ? 87  THR A N    2  
ATOM 3767  C CA   . THR A 1 87  ? -13.255 12.431  -8.949  1.00 0.00 ? 87  THR A CA   2  
ATOM 3768  C C    . THR A 1 87  ? -14.230 11.216  -8.651  1.00 0.00 ? 87  THR A C    2  
ATOM 3769  O O    . THR A 1 87  ? -15.432 11.432  -8.473  1.00 0.00 ? 87  THR A O    2  
ATOM 3770  C CB   . THR A 1 87  ? -13.759 13.261  -10.181 1.00 0.00 ? 87  THR A CB   2  
ATOM 3771  O OG1  . THR A 1 87  ? -15.035 13.798  -9.847  1.00 0.00 ? 87  THR A OG1  2  
ATOM 3772  C CG2  . THR A 1 87  ? -13.964 12.514  -11.510 1.00 0.00 ? 87  THR A CG2  2  
ATOM 3773  H H    . THR A 1 87  ? -11.105 12.594  -8.413  1.00 0.00 ? 87  THR A H    2  
ATOM 3774  H HA   . THR A 1 87  ? -13.389 13.069  -8.055  1.00 0.00 ? 87  THR A HA   2  
ATOM 3775  H HB   . THR A 1 87  ? -13.060 14.106  -10.341 1.00 0.00 ? 87  THR A HB   2  
ATOM 3776  H HG1  . THR A 1 87  ? -15.570 13.039  -9.572  1.00 0.00 ? 87  THR A HG1  2  
ATOM 3777  H HG21 . THR A 1 87  ? -14.507 11.558  -11.376 1.00 0.00 ? 87  THR A HG21 2  
ATOM 3778  H HG22 . THR A 1 87  ? -14.537 13.121  -12.231 1.00 0.00 ? 87  THR A HG22 2  
ATOM 3779  H HG23 . THR A 1 87  ? -13.000 12.276  -11.993 1.00 0.00 ? 87  THR A HG23 2  
ATOM 3780  N N    . ASP A 1 88  ? -13.694 10.006  -8.491  1.00 0.00 ? 88  ASP A N    2  
ATOM 3781  C CA   . ASP A 1 88  ? -14.425 8.744   -8.206  1.00 0.00 ? 88  ASP A CA   2  
ATOM 3782  C C    . ASP A 1 88  ? -15.110 8.675   -6.791  1.00 0.00 ? 88  ASP A C    2  
ATOM 3783  O O    . ASP A 1 88  ? -16.325 8.496   -6.694  1.00 0.00 ? 88  ASP A O    2  
ATOM 3784  C CB   . ASP A 1 88  ? -13.308 7.677   -8.434  1.00 0.00 ? 88  ASP A CB   2  
ATOM 3785  C CG   . ASP A 1 88  ? -13.704 6.228   -8.174  1.00 0.00 ? 88  ASP A CG   2  
ATOM 3786  O OD1  . ASP A 1 88  ? -13.802 5.837   -6.992  1.00 0.00 ? 88  ASP A OD1  2  
ATOM 3787  O OD2  . ASP A 1 88  ? -13.917 5.470   -9.138  1.00 0.00 ? 88  ASP A OD2  2  
ATOM 3788  H H    . ASP A 1 88  ? -12.702 10.035  -8.747  1.00 0.00 ? 88  ASP A H    2  
ATOM 3789  H HA   . ASP A 1 88  ? -15.228 8.598   -8.956  1.00 0.00 ? 88  ASP A HA   2  
ATOM 3790  H HB2  . ASP A 1 88  ? -12.926 7.739   -9.473  1.00 0.00 ? 88  ASP A HB2  2  
ATOM 3791  H HB3  . ASP A 1 88  ? -12.426 7.882   -7.797  1.00 0.00 ? 88  ASP A HB3  2  
ATOM 3792  N N    . LEU A 1 89  ? -14.311 8.786   -5.710  1.00 0.00 ? 89  LEU A N    2  
ATOM 3793  C CA   . LEU A 1 89  ? -14.771 8.682   -4.283  1.00 0.00 ? 89  LEU A CA   2  
ATOM 3794  C C    . LEU A 1 89  ? -15.405 7.295   -3.849  1.00 0.00 ? 89  LEU A C    2  
ATOM 3795  O O    . LEU A 1 89  ? -16.130 7.243   -2.850  1.00 0.00 ? 89  LEU A O    2  
ATOM 3796  C CB   . LEU A 1 89  ? -15.705 9.895   -3.922  1.00 0.00 ? 89  LEU A CB   2  
ATOM 3797  C CG   . LEU A 1 89  ? -15.038 11.292  -3.744  1.00 0.00 ? 89  LEU A CG   2  
ATOM 3798  C CD1  . LEU A 1 89  ? -14.907 12.063  -5.068  1.00 0.00 ? 89  LEU A CD1  2  
ATOM 3799  C CD2  . LEU A 1 89  ? -15.831 12.167  -2.756  1.00 0.00 ? 89  LEU A CD2  2  
ATOM 3800  H H    . LEU A 1 89  ? -13.338 8.935   -6.004  1.00 0.00 ? 89  LEU A H    2  
ATOM 3801  H HA   . LEU A 1 89  ? -13.878 8.730   -3.653  1.00 0.00 ? 89  LEU A HA   2  
ATOM 3802  H HB2  . LEU A 1 89  ? -16.555 9.958   -4.629  1.00 0.00 ? 89  LEU A HB2  2  
ATOM 3803  H HB3  . LEU A 1 89  ? -16.203 9.656   -2.963  1.00 0.00 ? 89  LEU A HB3  2  
ATOM 3804  H HG   . LEU A 1 89  ? -14.024 11.162  -3.316  1.00 0.00 ? 89  LEU A HG   2  
ATOM 3805  H HD11 . LEU A 1 89  ? -15.888 12.237  -5.550  1.00 0.00 ? 89  LEU A HD11 2  
ATOM 3806  H HD12 . LEU A 1 89  ? -14.428 13.050  -4.926  1.00 0.00 ? 89  LEU A HD12 2  
ATOM 3807  H HD13 . LEU A 1 89  ? -14.290 11.517  -5.800  1.00 0.00 ? 89  LEU A HD13 2  
ATOM 3808  H HD21 . LEU A 1 89  ? -15.918 11.688  -1.763  1.00 0.00 ? 89  LEU A HD21 2  
ATOM 3809  H HD22 . LEU A 1 89  ? -15.336 13.142  -2.589  1.00 0.00 ? 89  LEU A HD22 2  
ATOM 3810  H HD23 . LEU A 1 89  ? -16.858 12.372  -3.111  1.00 0.00 ? 89  LEU A HD23 2  
ATOM 3811  N N    . SER A 1 90  ? -15.009 6.149   -4.435  1.00 0.00 ? 90  SER A N    2  
ATOM 3812  C CA   . SER A 1 90  ? -15.584 4.810   -4.092  1.00 0.00 ? 90  SER A CA   2  
ATOM 3813  C C    . SER A 1 90  ? -14.919 4.138   -2.836  1.00 0.00 ? 90  SER A C    2  
ATOM 3814  O O    . SER A 1 90  ? -13.779 4.443   -2.465  1.00 0.00 ? 90  SER A O    2  
ATOM 3815  C CB   . SER A 1 90  ? -15.413 3.870   -5.320  1.00 0.00 ? 90  SER A CB   2  
ATOM 3816  O OG   . SER A 1 90  ? -15.771 4.480   -6.564  1.00 0.00 ? 90  SER A OG   2  
ATOM 3817  H H    . SER A 1 90  ? -14.425 6.269   -5.282  1.00 0.00 ? 90  SER A H    2  
ATOM 3818  H HA   . SER A 1 90  ? -16.670 4.922   -3.898  1.00 0.00 ? 90  SER A HA   2  
ATOM 3819  H HB2  . SER A 1 90  ? -14.372 3.510   -5.401  1.00 0.00 ? 90  SER A HB2  2  
ATOM 3820  H HB3  . SER A 1 90  ? -16.025 2.959   -5.186  1.00 0.00 ? 90  SER A HB3  2  
ATOM 3821  H HG   . SER A 1 90  ? -14.991 5.043   -6.834  1.00 0.00 ? 90  SER A HG   2  
ATOM 3822  N N    . GLU A 1 91  ? -15.643 3.202   -2.185  1.00 0.00 ? 91  GLU A N    2  
ATOM 3823  C CA   . GLU A 1 91  ? -15.125 2.438   -1.010  1.00 0.00 ? 91  GLU A CA   2  
ATOM 3824  C C    . GLU A 1 91  ? -15.745 0.996   -0.965  1.00 0.00 ? 91  GLU A C    2  
ATOM 3825  O O    . GLU A 1 91  ? -16.956 0.808   -1.121  1.00 0.00 ? 91  GLU A O    2  
ATOM 3826  C CB   . GLU A 1 91  ? -15.392 3.220   0.314   1.00 0.00 ? 91  GLU A CB   2  
ATOM 3827  C CG   . GLU A 1 91  ? -16.860 3.451   0.770   1.00 0.00 ? 91  GLU A CG   2  
ATOM 3828  C CD   . GLU A 1 91  ? -16.999 4.291   2.029   1.00 0.00 ? 91  GLU A CD   2  
ATOM 3829  O OE1  . GLU A 1 91  ? -16.931 3.742   3.148   1.00 0.00 ? 91  GLU A OE1  2  
ATOM 3830  O OE2  . GLU A 1 91  ? -17.174 5.521   1.903   1.00 0.00 ? 91  GLU A OE2  2  
ATOM 3831  H H    . GLU A 1 91  ? -16.576 3.019   -2.569  1.00 0.00 ? 91  GLU A H    2  
ATOM 3832  H HA   . GLU A 1 91  ? -14.025 2.328   -1.113  1.00 0.00 ? 91  GLU A HA   2  
ATOM 3833  H HB2  . GLU A 1 91  ? -14.866 2.687   1.128   1.00 0.00 ? 91  GLU A HB2  2  
ATOM 3834  H HB3  . GLU A 1 91  ? -14.868 4.194   0.250   1.00 0.00 ? 91  GLU A HB3  2  
ATOM 3835  H HG2  . GLU A 1 91  ? -17.446 3.934   -0.031  1.00 0.00 ? 91  GLU A HG2  2  
ATOM 3836  H HG3  . GLU A 1 91  ? -17.364 2.487   0.958   1.00 0.00 ? 91  GLU A HG3  2  
ATOM 3837  N N    . ASN A 1 92  ? -14.900 -0.029  -0.743  1.00 0.00 ? 92  ASN A N    2  
ATOM 3838  C CA   . ASN A 1 92  ? -15.341 -1.450  -0.617  1.00 0.00 ? 92  ASN A CA   2  
ATOM 3839  C C    . ASN A 1 92  ? -14.879 -1.957  0.791   1.00 0.00 ? 92  ASN A C    2  
ATOM 3840  O O    . ASN A 1 92  ? -13.691 -2.197  1.023   1.00 0.00 ? 92  ASN A O    2  
ATOM 3841  C CB   . ASN A 1 92  ? -14.764 -2.242  -1.825  1.00 0.00 ? 92  ASN A CB   2  
ATOM 3842  C CG   . ASN A 1 92  ? -15.055 -3.745  -1.856  1.00 0.00 ? 92  ASN A CG   2  
ATOM 3843  O OD1  . ASN A 1 92  ? -14.270 -4.564  -1.396  1.00 0.00 ? 92  ASN A OD1  2  
ATOM 3844  N ND2  . ASN A 1 92  ? -16.172 -4.170  -2.391  1.00 0.00 ? 92  ASN A ND2  2  
ATOM 3845  H H    . ASN A 1 92  ? -13.919 0.243   -0.625  1.00 0.00 ? 92  ASN A H    2  
ATOM 3846  H HA   . ASN A 1 92  ? -16.447 -1.531  -0.672  1.00 0.00 ? 92  ASN A HA   2  
ATOM 3847  H HB2  . ASN A 1 92  ? -15.107 -1.785  -2.772  1.00 0.00 ? 92  ASN A HB2  2  
ATOM 3848  H HB3  . ASN A 1 92  ? -13.669 -2.144  -1.859  1.00 0.00 ? 92  ASN A HB3  2  
ATOM 3849  H HD21 . ASN A 1 92  ? -16.833 -3.471  -2.739  1.00 0.00 ? 92  ASN A HD21 2  
ATOM 3850  H HD22 . ASN A 1 92  ? -16.315 -5.179  -2.248  1.00 0.00 ? 92  ASN A HD22 2  
ATOM 3851  N N    . ARG A 1 93  ? -15.825 -2.104  1.736   1.00 0.00 ? 93  ARG A N    2  
ATOM 3852  C CA   . ARG A 1 93  ? -15.505 -2.522  3.134   1.00 0.00 ? 93  ARG A CA   2  
ATOM 3853  C C    . ARG A 1 93  ? -16.017 -3.970  3.400   1.00 0.00 ? 93  ARG A C    2  
ATOM 3854  O O    . ARG A 1 93  ? -15.240 -4.909  3.204   1.00 0.00 ? 93  ARG A O    2  
ATOM 3855  C CB   . ARG A 1 93  ? -16.052 -1.414  4.085   1.00 0.00 ? 93  ARG A CB   2  
ATOM 3856  C CG   . ARG A 1 93  ? -15.187 -0.123  4.099   1.00 0.00 ? 93  ARG A CG   2  
ATOM 3857  C CD   . ARG A 1 93  ? -15.946 1.168   4.437   1.00 0.00 ? 93  ARG A CD   2  
ATOM 3858  N NE   . ARG A 1 93  ? -16.370 1.231   5.861   1.00 0.00 ? 93  ARG A NE   2  
ATOM 3859  C CZ   . ARG A 1 93  ? -17.027 2.259   6.402   1.00 0.00 ? 93  ARG A CZ   2  
ATOM 3860  N NH1  . ARG A 1 93  ? -17.405 3.331   5.739   1.00 0.00 ? 93  ARG A NH1  2  
ATOM 3861  N NH2  . ARG A 1 93  ? -17.312 2.200   7.671   1.00 0.00 ? 93  ARG A NH2  2  
ATOM 3862  H H    . ARG A 1 93  ? -16.774 -1.867  1.430   1.00 0.00 ? 93  ARG A H    2  
ATOM 3863  H HA   . ARG A 1 93  ? -14.413 -2.578  3.302   1.00 0.00 ? 93  ARG A HA   2  
ATOM 3864  H HB2  . ARG A 1 93  ? -17.103 -1.177  3.826   1.00 0.00 ? 93  ARG A HB2  2  
ATOM 3865  H HB3  . ARG A 1 93  ? -16.102 -1.803  5.120   1.00 0.00 ? 93  ARG A HB3  2  
ATOM 3866  H HG2  . ARG A 1 93  ? -14.309 -0.248  4.764   1.00 0.00 ? 93  ARG A HG2  2  
ATOM 3867  H HG3  . ARG A 1 93  ? -14.739 0.034   3.097   1.00 0.00 ? 93  ARG A HG3  2  
ATOM 3868  H HD2  . ARG A 1 93  ? -15.293 2.034   4.200   1.00 0.00 ? 93  ARG A HD2  2  
ATOM 3869  H HD3  . ARG A 1 93  ? -16.818 1.274   3.758   1.00 0.00 ? 93  ARG A HD3  2  
ATOM 3870  H HE   . ARG A 1 93  ? -16.117 0.484   6.512   1.00 0.00 ? 93  ARG A HE   2  
ATOM 3871  H HH11 . ARG A 1 93  ? -17.164 3.380   4.713   1.00 0.00 ? 93  ARG A HH11 2  
ATOM 3872  H HH12 . ARG A 1 93  ? -17.897 4.067   6.243   1.00 0.00 ? 93  ARG A HH12 2  
ATOM 3873  H HH21 . ARG A 1 93  ? -17.008 1.363   8.171   1.00 0.00 ? 93  ARG A HH21 2  
ATOM 3874  H HH22 . ARG A 1 93  ? -17.813 2.995   8.068   1.00 0.00 ? 93  ARG A HH22 2  
ATOM 3875  N N    . LYS A 1 94  ? -17.283 -4.207  3.809   1.00 0.00 ? 94  LYS A N    2  
ATOM 3876  C CA   . LYS A 1 94  ? -17.779 -5.593  4.098   1.00 0.00 ? 94  LYS A CA   2  
ATOM 3877  C C    . LYS A 1 94  ? -18.331 -6.302  2.803   1.00 0.00 ? 94  LYS A C    2  
ATOM 3878  O O    . LYS A 1 94  ? -19.509 -6.662  2.704   1.00 0.00 ? 94  LYS A O    2  
ATOM 3879  C CB   . LYS A 1 94  ? -18.792 -5.435  5.279   1.00 0.00 ? 94  LYS A CB   2  
ATOM 3880  C CG   . LYS A 1 94  ? -19.053 -6.686  6.164   1.00 0.00 ? 94  LYS A CG   2  
ATOM 3881  C CD   . LYS A 1 94  ? -20.040 -7.774  5.671   1.00 0.00 ? 94  LYS A CD   2  
ATOM 3882  C CE   . LYS A 1 94  ? -21.549 -7.468  5.804   1.00 0.00 ? 94  LYS A CE   2  
ATOM 3883  N NZ   . LYS A 1 94  ? -22.020 -6.567  4.717   1.00 0.00 ? 94  LYS A NZ   2  
ATOM 3884  H H    . LYS A 1 94  ? -17.857 -3.369  3.937   1.00 0.00 ? 94  LYS A H    2  
ATOM 3885  H HA   . LYS A 1 94  ? -16.943 -6.228  4.461   1.00 0.00 ? 94  LYS A HA   2  
ATOM 3886  H HB2  . LYS A 1 94  ? -18.387 -4.683  5.988   1.00 0.00 ? 94  LYS A HB2  2  
ATOM 3887  H HB3  . LYS A 1 94  ? -19.730 -4.976  4.924   1.00 0.00 ? 94  LYS A HB3  2  
ATOM 3888  H HG2  . LYS A 1 94  ? -18.077 -7.170  6.375   1.00 0.00 ? 94  LYS A HG2  2  
ATOM 3889  H HG3  . LYS A 1 94  ? -19.383 -6.347  7.167   1.00 0.00 ? 94  LYS A HG3  2  
ATOM 3890  H HD2  . LYS A 1 94  ? -19.782 -8.116  4.651   1.00 0.00 ? 94  LYS A HD2  2  
ATOM 3891  H HD3  . LYS A 1 94  ? -19.842 -8.675  6.286   1.00 0.00 ? 94  LYS A HD3  2  
ATOM 3892  H HE2  . LYS A 1 94  ? -22.112 -8.428  5.773   1.00 0.00 ? 94  LYS A HE2  2  
ATOM 3893  H HE3  . LYS A 1 94  ? -21.776 -7.051  6.812   1.00 0.00 ? 94  LYS A HE3  2  
ATOM 3894  H HZ1  . LYS A 1 94  ? -21.652 -6.853  3.796   1.00 0.00 ? 94  LYS A HZ1  2  
ATOM 3895  H HZ2  . LYS A 1 94  ? -23.044 -6.510  4.630   1.00 0.00 ? 94  LYS A HZ2  2  
ATOM 3896  H HZ3  . LYS A 1 94  ? -21.689 -5.603  4.841   1.00 0.00 ? 94  LYS A HZ3  2  
ATOM 3897  N N    . GLN A 1 95  ? -17.426 -6.496  1.817   1.00 0.00 ? 95  GLN A N    2  
ATOM 3898  C CA   . GLN A 1 95  ? -17.683 -7.177  0.507   1.00 0.00 ? 95  GLN A CA   2  
ATOM 3899  C C    . GLN A 1 95  ? -16.316 -7.358  -0.280  1.00 0.00 ? 95  GLN A C    2  
ATOM 3900  O O    . GLN A 1 95  ? -16.217 -7.007  -1.463  1.00 0.00 ? 95  GLN A O    2  
ATOM 3901  C CB   . GLN A 1 95  ? -18.716 -6.344  -0.326  1.00 0.00 ? 95  GLN A CB   2  
ATOM 3902  C CG   . GLN A 1 95  ? -19.326 -7.083  -1.550  1.00 0.00 ? 95  GLN A CG   2  
ATOM 3903  C CD   . GLN A 1 95  ? -19.601 -6.182  -2.756  1.00 0.00 ? 95  GLN A CD   2  
ATOM 3904  O OE1  . GLN A 1 95  ? -18.756 -6.018  -3.632  1.00 0.00 ? 95  GLN A OE1  2  
ATOM 3905  N NE2  . GLN A 1 95  ? -20.764 -5.585  -2.854  1.00 0.00 ? 95  GLN A NE2  2  
ATOM 3906  H H    . GLN A 1 95  ? -16.496 -6.120  2.058   1.00 0.00 ? 95  GLN A H    2  
ATOM 3907  H HA   . GLN A 1 95  ? -18.096 -8.186  0.703   1.00 0.00 ? 95  GLN A HA   2  
ATOM 3908  H HB2  . GLN A 1 95  ? -19.558 -6.003  0.305   1.00 0.00 ? 95  GLN A HB2  2  
ATOM 3909  H HB3  . GLN A 1 95  ? -18.224 -5.400  -0.636  1.00 0.00 ? 95  GLN A HB3  2  
ATOM 3910  H HG2  . GLN A 1 95  ? -18.641 -7.875  -1.903  1.00 0.00 ? 95  GLN A HG2  2  
ATOM 3911  H HG3  . GLN A 1 95  ? -20.240 -7.632  -1.254  1.00 0.00 ? 95  GLN A HG3  2  
ATOM 3912  H HE21 . GLN A 1 95  ? -21.420 -5.713  -2.078  1.00 0.00 ? 95  GLN A HE21 2  
ATOM 3913  H HE22 . GLN A 1 95  ? -20.872 -4.990  -3.680  1.00 0.00 ? 95  GLN A HE22 2  
ATOM 3914  N N    . ASP A 1 96  ? -15.269 -7.950  0.338   1.00 0.00 ? 96  ASP A N    2  
ATOM 3915  C CA   . ASP A 1 96  ? -13.918 -8.081  -0.289  1.00 0.00 ? 96  ASP A CA   2  
ATOM 3916  C C    . ASP A 1 96  ? -13.766 -9.342  -1.225  1.00 0.00 ? 96  ASP A C    2  
ATOM 3917  O O    . ASP A 1 96  ? -14.630 -10.220 -1.310  1.00 0.00 ? 96  ASP A O    2  
ATOM 3918  C CB   . ASP A 1 96  ? -12.916 -8.052  0.907   1.00 0.00 ? 96  ASP A CB   2  
ATOM 3919  C CG   . ASP A 1 96  ? -11.433 -7.802  0.596   1.00 0.00 ? 96  ASP A CG   2  
ATOM 3920  O OD1  . ASP A 1 96  ? -11.052 -7.614  -0.583  1.00 0.00 ? 96  ASP A OD1  2  
ATOM 3921  O OD2  . ASP A 1 96  ? -10.637 -7.801  1.555   1.00 0.00 ? 96  ASP A OD2  2  
ATOM 3922  H H    . ASP A 1 96  ? -15.427 -8.210  1.316   1.00 0.00 ? 96  ASP A H    2  
ATOM 3923  H HA   . ASP A 1 96  ? -13.724 -7.187  -0.918  1.00 0.00 ? 96  ASP A HA   2  
ATOM 3924  H HB2  . ASP A 1 96  ? -13.189 -7.244  1.614   1.00 0.00 ? 96  ASP A HB2  2  
ATOM 3925  H HB3  . ASP A 1 96  ? -12.989 -8.986  1.493   1.00 0.00 ? 96  ASP A HB3  2  
ATOM 3926  N N    . LYS A 1 97  ? -12.692 -9.320  -2.030  1.00 0.00 ? 97  LYS A N    2  
ATOM 3927  C CA   . LYS A 1 97  ? -12.312 -10.379 -3.010  1.00 0.00 ? 97  LYS A CA   2  
ATOM 3928  C C    . LYS A 1 97  ? -10.743 -10.317 -3.095  1.00 0.00 ? 97  LYS A C    2  
ATOM 3929  O O    . LYS A 1 97  ? -10.061 -11.022 -2.345  1.00 0.00 ? 97  LYS A O    2  
ATOM 3930  C CB   . LYS A 1 97  ? -13.065 -10.190 -4.372  1.00 0.00 ? 97  LYS A CB   2  
ATOM 3931  C CG   . LYS A 1 97  ? -14.495 -10.786 -4.469  1.00 0.00 ? 97  LYS A CG   2  
ATOM 3932  C CD   . LYS A 1 97  ? -15.549 -9.830  -5.069  1.00 0.00 ? 97  LYS A CD   2  
ATOM 3933  C CE   . LYS A 1 97  ? -15.992 -8.721  -4.094  1.00 0.00 ? 97  LYS A CE   2  
ATOM 3934  N NZ   . LYS A 1 97  ? -16.962 -7.826  -4.778  1.00 0.00 ? 97  LYS A NZ   2  
ATOM 3935  H H    . LYS A 1 97  ? -12.047 -8.550  -1.756  1.00 0.00 ? 97  LYS A H    2  
ATOM 3936  H HA   . LYS A 1 97  ? -12.559 -11.377 -2.597  1.00 0.00 ? 97  LYS A HA   2  
ATOM 3937  H HB2  . LYS A 1 97  ? -13.056 -9.117  -4.649  1.00 0.00 ? 97  LYS A HB2  2  
ATOM 3938  H HB3  . LYS A 1 97  ? -12.472 -10.667 -5.177  1.00 0.00 ? 97  LYS A HB3  2  
ATOM 3939  H HG2  . LYS A 1 97  ? -14.451 -11.702 -5.091  1.00 0.00 ? 97  LYS A HG2  2  
ATOM 3940  H HG3  . LYS A 1 97  ? -14.846 -11.168 -3.492  1.00 0.00 ? 97  LYS A HG3  2  
ATOM 3941  H HD2  . LYS A 1 97  ? -15.158 -9.405  -6.016  1.00 0.00 ? 97  LYS A HD2  2  
ATOM 3942  H HD3  . LYS A 1 97  ? -16.429 -10.435 -5.366  1.00 0.00 ? 97  LYS A HD3  2  
ATOM 3943  H HE2  . LYS A 1 97  ? -16.432 -9.171  -3.174  1.00 0.00 ? 97  LYS A HE2  2  
ATOM 3944  H HE3  . LYS A 1 97  ? -15.117 -8.147  -3.714  1.00 0.00 ? 97  LYS A HE3  2  
ATOM 3945  H HZ1  . LYS A 1 97  ? -17.739 -8.344  -5.205  1.00 0.00 ? 97  LYS A HZ1  2  
ATOM 3946  H HZ2  . LYS A 1 97  ? -17.422 -7.126  -4.160  1.00 0.00 ? 97  LYS A HZ2  2  
ATOM 3947  H HZ3  . LYS A 1 97  ? -16.537 -7.282  -5.539  1.00 0.00 ? 97  LYS A HZ3  2  
ATOM 3948  N N    . ARG A 1 98  ? -10.172 -9.564  -4.058  1.00 0.00 ? 98  ARG A N    2  
ATOM 3949  C CA   . ARG A 1 98  ? -8.705  -9.347  -4.183  1.00 0.00 ? 98  ARG A CA   2  
ATOM 3950  C C    . ARG A 1 98  ? -8.429  -7.812  -4.056  1.00 0.00 ? 98  ARG A C    2  
ATOM 3951  O O    . ARG A 1 98  ? -8.221  -7.120  -5.060  1.00 0.00 ? 98  ARG A O    2  
ATOM 3952  C CB   . ARG A 1 98  ? -8.217  -9.943  -5.538  1.00 0.00 ? 98  ARG A CB   2  
ATOM 3953  C CG   . ARG A 1 98  ? -7.860  -11.445 -5.509  1.00 0.00 ? 98  ARG A CG   2  
ATOM 3954  C CD   . ARG A 1 98  ? -7.356  -11.950 -6.878  1.00 0.00 ? 98  ARG A CD   2  
ATOM 3955  N NE   . ARG A 1 98  ? -6.567  -13.208 -6.755  1.00 0.00 ? 98  ARG A NE   2  
ATOM 3956  C CZ   . ARG A 1 98  ? -7.051  -14.448 -6.742  1.00 0.00 ? 98  ARG A CZ   2  
ATOM 3957  N NH1  . ARG A 1 98  ? -8.326  -14.733 -6.823  1.00 0.00 ? 98  ARG A NH1  2  
ATOM 3958  N NH2  . ARG A 1 98  ? -6.202  -15.428 -6.640  1.00 0.00 ? 98  ARG A NH2  2  
ATOM 3959  H H    . ARG A 1 98  ? -10.839 -9.011  -4.606  1.00 0.00 ? 98  ARG A H    2  
ATOM 3960  H HA   . ARG A 1 98  ? -8.146  -9.844  -3.365  1.00 0.00 ? 98  ARG A HA   2  
ATOM 3961  H HB2  . ARG A 1 98  ? -8.942  -9.720  -6.346  1.00 0.00 ? 98  ARG A HB2  2  
ATOM 3962  H HB3  . ARG A 1 98  ? -7.304  -9.401  -5.845  1.00 0.00 ? 98  ARG A HB3  2  
ATOM 3963  H HG2  . ARG A 1 98  ? -7.082  -11.604 -4.736  1.00 0.00 ? 98  ARG A HG2  2  
ATOM 3964  H HG3  . ARG A 1 98  ? -8.734  -12.036 -5.174  1.00 0.00 ? 98  ARG A HG3  2  
ATOM 3965  H HD2  . ARG A 1 98  ? -8.188  -12.035 -7.607  1.00 0.00 ? 98  ARG A HD2  2  
ATOM 3966  H HD3  . ARG A 1 98  ? -6.688  -11.187 -7.327  1.00 0.00 ? 98  ARG A HD3  2  
ATOM 3967  H HE   . ARG A 1 98  ? -5.533  -13.179 -6.688  1.00 0.00 ? 98  ARG A HE   2  
ATOM 3968  H HH11 . ARG A 1 98  ? -8.932  -13.912 -6.889  1.00 0.00 ? 98  ARG A HH11 2  
ATOM 3969  H HH12 . ARG A 1 98  ? -8.610  -15.714 -6.809  1.00 0.00 ? 98  ARG A HH12 2  
ATOM 3970  H HH21 . ARG A 1 98  ? -5.215  -15.160 -6.574  1.00 0.00 ? 98  ARG A HH21 2  
ATOM 3971  H HH22 . ARG A 1 98  ? -6.573  -16.380 -6.651  1.00 0.00 ? 98  ARG A HH22 2  
ATOM 3972  N N    . PHE A 1 99  ? -8.393  -7.285  -2.816  1.00 0.00 ? 99  PHE A N    2  
ATOM 3973  C CA   . PHE A 1 99  ? -8.165  -5.827  -2.577  1.00 0.00 ? 99  PHE A CA   2  
ATOM 3974  C C    . PHE A 1 99  ? -7.388  -5.452  -1.283  1.00 0.00 ? 99  PHE A C    2  
ATOM 3975  O O    . PHE A 1 99  ? -6.726  -4.412  -1.337  1.00 0.00 ? 99  PHE A O    2  
ATOM 3976  C CB   . PHE A 1 99  ? -9.555  -5.112  -2.462  1.00 0.00 ? 99  PHE A CB   2  
ATOM 3977  C CG   . PHE A 1 99  ? -10.510 -5.133  -3.666  1.00 0.00 ? 99  PHE A CG   2  
ATOM 3978  C CD1  . PHE A 1 99  ? -10.216 -4.399  -4.819  1.00 0.00 ? 99  PHE A CD1  2  
ATOM 3979  C CD2  . PHE A 1 99  ? -11.697 -5.870  -3.604  1.00 0.00 ? 99  PHE A CD2  2  
ATOM 3980  C CE1  . PHE A 1 99  ? -11.094 -4.412  -5.900  1.00 0.00 ? 99  PHE A CE1  2  
ATOM 3981  C CE2  . PHE A 1 99  ? -12.576 -5.879  -4.683  1.00 0.00 ? 99  PHE A CE2  2  
ATOM 3982  C CZ   . PHE A 1 99  ? -12.273 -5.151  -5.832  1.00 0.00 ? 99  PHE A CZ   2  
ATOM 3983  H H    . PHE A 1 99  ? -8.623  -7.939  -2.058  1.00 0.00 ? 99  PHE A H    2  
ATOM 3984  H HA   . PHE A 1 99  ? -7.583  -5.355  -3.403  1.00 0.00 ? 99  PHE A HA   2  
ATOM 3985  H HB2  . PHE A 1 99  ? -10.083 -5.495  -1.565  1.00 0.00 ? 99  PHE A HB2  2  
ATOM 3986  H HB3  . PHE A 1 99  ? -9.396  -4.048  -2.215  1.00 0.00 ? 99  PHE A HB3  2  
ATOM 3987  H HD1  . PHE A 1 99  ? -9.306  -3.819  -4.878  1.00 0.00 ? 99  PHE A HD1  2  
ATOM 3988  H HD2  . PHE A 1 99  ? -11.944 -6.429  -2.712  1.00 0.00 ? 99  PHE A HD2  2  
ATOM 3989  H HE1  . PHE A 1 99  ? -10.859 -3.846  -6.790  1.00 0.00 ? 99  PHE A HE1  2  
ATOM 3990  H HE2  . PHE A 1 99  ? -13.495 -6.441  -4.622  1.00 0.00 ? 99  PHE A HE2  2  
ATOM 3991  H HZ   . PHE A 1 99  ? -12.955 -5.154  -6.669  1.00 0.00 ? 99  PHE A HZ   2  
ATOM 3992  N N    . ALA A 1 100 ? -7.358  -6.222  -0.173  1.00 0.00 ? 100 ALA A N    2  
ATOM 3993  C CA   . ALA A 1 100 ? -6.773  -5.703  1.086   1.00 0.00 ? 100 ALA A CA   2  
ATOM 3994  C C    . ALA A 1 100 ? -5.239  -5.874  1.259   1.00 0.00 ? 100 ALA A C    2  
ATOM 3995  O O    . ALA A 1 100 ? -4.615  -6.797  0.735   1.00 0.00 ? 100 ALA A O    2  
ATOM 3996  C CB   . ALA A 1 100 ? -7.511  -6.436  2.228   1.00 0.00 ? 100 ALA A CB   2  
ATOM 3997  H H    . ALA A 1 100 ? -7.893  -7.110  -0.158  1.00 0.00 ? 100 ALA A H    2  
ATOM 3998  H HA   . ALA A 1 100 ? -7.014  -4.629  1.187   1.00 0.00 ? 100 ALA A HA   2  
ATOM 3999  H HB1  . ALA A 1 100 ? -8.610  -6.419  2.102   1.00 0.00 ? 100 ALA A HB1  2  
ATOM 4000  H HB2  . ALA A 1 100 ? -7.216  -7.497  2.318   1.00 0.00 ? 100 ALA A HB2  2  
ATOM 4001  H HB3  . ALA A 1 100 ? -7.304  -5.969  3.208   1.00 0.00 ? 100 ALA A HB3  2  
ATOM 4002  N N    . PHE A 1 101 ? -4.666  -4.949  2.041   1.00 0.00 ? 101 PHE A N    2  
ATOM 4003  C CA   . PHE A 1 101 ? -3.292  -5.056  2.589   1.00 0.00 ? 101 PHE A CA   2  
ATOM 4004  C C    . PHE A 1 101 ? -3.562  -4.921  4.127   1.00 0.00 ? 101 PHE A C    2  
ATOM 4005  O O    . PHE A 1 101 ? -4.075  -3.920  4.646   1.00 0.00 ? 101 PHE A O    2  
ATOM 4006  C CB   . PHE A 1 101 ? -2.254  -4.068  2.004   1.00 0.00 ? 101 PHE A CB   2  
ATOM 4007  C CG   . PHE A 1 101 ? -2.613  -2.599  1.718   1.00 0.00 ? 101 PHE A CG   2  
ATOM 4008  C CD1  . PHE A 1 101 ? -3.077  -2.228  0.451   1.00 0.00 ? 101 PHE A CD1  2  
ATOM 4009  C CD2  . PHE A 1 101 ? -2.341  -1.608  2.665   1.00 0.00 ? 101 PHE A CD2  2  
ATOM 4010  C CE1  . PHE A 1 101 ? -3.219  -0.883  0.123   1.00 0.00 ? 101 PHE A CE1  2  
ATOM 4011  C CE2  . PHE A 1 101 ? -2.494  -0.263  2.338   1.00 0.00 ? 101 PHE A CE2  2  
ATOM 4012  C CZ   . PHE A 1 101 ? -2.926  0.098   1.065   1.00 0.00 ? 101 PHE A CZ   2  
ATOM 4013  H H    . PHE A 1 101 ? -5.294  -4.206  2.387   1.00 0.00 ? 101 PHE A H    2  
ATOM 4014  H HA   . PHE A 1 101 ? -2.886  -6.067  2.381   1.00 0.00 ? 101 PHE A HA   2  
ATOM 4015  H HB2  . PHE A 1 101 ? -1.351  -4.106  2.645   1.00 0.00 ? 101 PHE A HB2  2  
ATOM 4016  H HB3  . PHE A 1 101 ? -1.883  -4.527  1.070   1.00 0.00 ? 101 PHE A HB3  2  
ATOM 4017  H HD1  . PHE A 1 101 ? -3.299  -2.980  -0.293  1.00 0.00 ? 101 PHE A HD1  2  
ATOM 4018  H HD2  . PHE A 1 101 ? -1.999  -1.878  3.652   1.00 0.00 ? 101 PHE A HD2  2  
ATOM 4019  H HE1  . PHE A 1 101 ? -3.545  -0.599  -0.864  1.00 0.00 ? 101 PHE A HE1  2  
ATOM 4020  H HE2  . PHE A 1 101 ? -2.261  0.498   3.069   1.00 0.00 ? 101 PHE A HE2  2  
ATOM 4021  H HZ   . PHE A 1 101 ? -3.023  1.138   0.796   1.00 0.00 ? 101 PHE A HZ   2  
ATOM 4022  N N    . ILE A 1 102 ? -3.284  -6.019  4.833   1.00 0.00 ? 102 ILE A N    2  
ATOM 4023  C CA   . ILE A 1 102 ? -3.642  -6.212  6.260   1.00 0.00 ? 102 ILE A CA   2  
ATOM 4024  C C    . ILE A 1 102 ? -2.379  -6.071  7.156   1.00 0.00 ? 102 ILE A C    2  
ATOM 4025  O O    . ILE A 1 102 ? -1.353  -6.704  6.893   1.00 0.00 ? 102 ILE A O    2  
ATOM 4026  C CB   . ILE A 1 102 ? -4.323  -7.633  6.390   1.00 0.00 ? 102 ILE A CB   2  
ATOM 4027  C CG1  . ILE A 1 102 ? -5.589  -7.841  5.491   1.00 0.00 ? 102 ILE A CG1  2  
ATOM 4028  C CG2  . ILE A 1 102 ? -4.744  -7.909  7.858   1.00 0.00 ? 102 ILE A CG2  2  
ATOM 4029  C CD1  . ILE A 1 102 ? -5.936  -9.313  5.197   1.00 0.00 ? 102 ILE A CD1  2  
ATOM 4030  H H    . ILE A 1 102 ? -2.860  -6.784  4.295   1.00 0.00 ? 102 ILE A H    2  
ATOM 4031  H HA   . ILE A 1 102 ? -4.361  -5.444  6.571   1.00 0.00 ? 102 ILE A HA   2  
ATOM 4032  H HB   . ILE A 1 102 ? -3.579  -8.387  6.080   1.00 0.00 ? 102 ILE A HB   2  
ATOM 4033  H HG12 . ILE A 1 102 ? -6.466  -7.333  5.925   1.00 0.00 ? 102 ILE A HG12 2  
ATOM 4034  H HG13 . ILE A 1 102 ? -5.457  -7.354  4.507   1.00 0.00 ? 102 ILE A HG13 2  
ATOM 4035  H HG21 . ILE A 1 102 ? -5.442  -7.140  8.238   1.00 0.00 ? 102 ILE A HG21 2  
ATOM 4036  H HG22 . ILE A 1 102 ? -5.241  -8.888  7.983   1.00 0.00 ? 102 ILE A HG22 2  
ATOM 4037  H HG23 . ILE A 1 102 ? -3.879  -7.927  8.548   1.00 0.00 ? 102 ILE A HG23 2  
ATOM 4038  H HD11 . ILE A 1 102 ? -5.102  -9.835  4.692   1.00 0.00 ? 102 ILE A HD11 2  
ATOM 4039  H HD12 . ILE A 1 102 ? -6.171  -9.882  6.115   1.00 0.00 ? 102 ILE A HD12 2  
ATOM 4040  H HD13 . ILE A 1 102 ? -6.816  -9.393  4.532   1.00 0.00 ? 102 ILE A HD13 2  
ATOM 4041  N N    . ARG A 1 103 ? -2.464  -5.257  8.226   1.00 0.00 ? 103 ARG A N    2  
ATOM 4042  C CA   . ARG A 1 103 ? -1.327  -5.127  9.192   1.00 0.00 ? 103 ARG A CA   2  
ATOM 4043  C C    . ARG A 1 103 ? -1.354  -6.328  10.202  1.00 0.00 ? 103 ARG A C    2  
ATOM 4044  O O    . ARG A 1 103 ? -2.080  -6.336  11.202  1.00 0.00 ? 103 ARG A O    2  
ATOM 4045  C CB   . ARG A 1 103 ? -1.298  -3.745  9.915   1.00 0.00 ? 103 ARG A CB   2  
ATOM 4046  C CG   . ARG A 1 103 ? -2.554  -3.183  10.628  1.00 0.00 ? 103 ARG A CG   2  
ATOM 4047  C CD   . ARG A 1 103 ? -2.242  -1.988  11.554  1.00 0.00 ? 103 ARG A CD   2  
ATOM 4048  N NE   . ARG A 1 103 ? -3.455  -1.144  11.787  1.00 0.00 ? 103 ARG A NE   2  
ATOM 4049  C CZ   . ARG A 1 103 ? -3.424  0.176   11.997  1.00 0.00 ? 103 ARG A CZ   2  
ATOM 4050  N NH1  . ARG A 1 103 ? -2.350  0.824   12.375  1.00 0.00 ? 103 ARG A NH1  2  
ATOM 4051  N NH2  . ARG A 1 103 ? -4.509  0.863   11.804  1.00 0.00 ? 103 ARG A NH2  2  
ATOM 4052  H H    . ARG A 1 103 ? -3.405  -4.821  8.338   1.00 0.00 ? 103 ARG A H    2  
ATOM 4053  H HA   . ARG A 1 103 ? -0.364  -5.176  8.639   1.00 0.00 ? 103 ARG A HA   2  
ATOM 4054  H HB2  . ARG A 1 103 ? -0.461  -3.775  10.642  1.00 0.00 ? 103 ARG A HB2  2  
ATOM 4055  H HB3  . ARG A 1 103 ? -0.969  -2.994  9.175   1.00 0.00 ? 103 ARG A HB3  2  
ATOM 4056  H HG2  . ARG A 1 103 ? -3.278  -2.882  9.848   1.00 0.00 ? 103 ARG A HG2  2  
ATOM 4057  H HG3  . ARG A 1 103 ? -3.043  -3.984  11.213  1.00 0.00 ? 103 ARG A HG3  2  
ATOM 4058  H HD2  . ARG A 1 103 ? -1.830  -2.354  12.517  1.00 0.00 ? 103 ARG A HD2  2  
ATOM 4059  H HD3  . ARG A 1 103 ? -1.427  -1.391  11.093  1.00 0.00 ? 103 ARG A HD3  2  
ATOM 4060  H HE   . ARG A 1 103 ? -4.403  -1.481  11.575  1.00 0.00 ? 103 ARG A HE   2  
ATOM 4061  H HH11 . ARG A 1 103 ? -1.527  0.236   12.494  1.00 0.00 ? 103 ARG A HH11 2  
ATOM 4062  H HH12 . ARG A 1 103 ? -2.350  1.869   12.290  1.00 0.00 ? 103 ARG A HH12 2  
ATOM 4063  H HH21 . ARG A 1 103 ? -5.347  0.349   11.519  1.00 0.00 ? 103 ARG A HH21 2  
ATOM 4064  H HH22 . ARG A 1 103 ? -4.372  1.908   11.808  1.00 0.00 ? 103 ARG A HH22 2  
ATOM 4065  N N    . SER A 1 104 ? -0.551  -7.361  9.890   1.00 0.00 ? 104 SER A N    2  
ATOM 4066  C CA   . SER A 1 104 ? -0.382  -8.570  10.739  1.00 0.00 ? 104 SER A CA   2  
ATOM 4067  C C    . SER A 1 104 ? 0.844   -8.279  11.659  1.00 0.00 ? 104 SER A C    2  
ATOM 4068  O O    . SER A 1 104 ? 2.005   -8.364  11.238  1.00 0.00 ? 104 SER A O    2  
ATOM 4069  C CB   . SER A 1 104 ? -0.231  -9.768  9.780   1.00 0.00 ? 104 SER A CB   2  
ATOM 4070  O OG   . SER A 1 104 ? -0.302  -11.008 10.483  1.00 0.00 ? 104 SER A OG   2  
ATOM 4071  H H    . SER A 1 104 ? 0.008   -7.228  9.031   1.00 0.00 ? 104 SER A H    2  
ATOM 4072  H HA   . SER A 1 104 ? -1.285  -8.755  11.355  1.00 0.00 ? 104 SER A HA   2  
ATOM 4073  H HB2  . SER A 1 104 ? -1.045  -9.756  9.028   1.00 0.00 ? 104 SER A HB2  2  
ATOM 4074  H HB3  . SER A 1 104 ? 0.706   -9.717  9.195   1.00 0.00 ? 104 SER A HB3  2  
ATOM 4075  H HG   . SER A 1 104 ? -0.782  -11.653 9.873   1.00 0.00 ? 104 SER A HG   2  
ATOM 4076  N N    . ASP A 1 105 ? 0.561   -7.878  12.909  1.00 0.00 ? 105 ASP A N    2  
ATOM 4077  C CA   . ASP A 1 105 ? 1.589   -7.295  13.808  1.00 0.00 ? 105 ASP A CA   2  
ATOM 4078  C C    . ASP A 1 105 ? 2.448   -8.285  14.676  1.00 0.00 ? 105 ASP A C    2  
ATOM 4079  O O    . ASP A 1 105 ? 2.533   -9.502  14.481  1.00 0.00 ? 105 ASP A O    2  
ATOM 4080  C CB   . ASP A 1 105 ? 0.786   -6.227  14.633  1.00 0.00 ? 105 ASP A CB   2  
ATOM 4081  C CG   . ASP A 1 105 ? 1.635   -4.992  14.923  1.00 0.00 ? 105 ASP A CG   2  
ATOM 4082  O OD1  . ASP A 1 105 ? 2.485   -5.041  15.839  1.00 0.00 ? 105 ASP A OD1  2  
ATOM 4083  O OD2  . ASP A 1 105 ? 1.525   -4.011  14.156  1.00 0.00 ? 105 ASP A OD2  2  
ATOM 4084  H H    . ASP A 1 105 ? -0.437  -7.840  13.135  1.00 0.00 ? 105 ASP A H    2  
ATOM 4085  H HA   . ASP A 1 105 ? 2.335   -6.779  13.177  1.00 0.00 ? 105 ASP A HA   2  
ATOM 4086  H HB2  . ASP A 1 105 ? -0.117  -5.849  14.112  1.00 0.00 ? 105 ASP A HB2  2  
ATOM 4087  H HB3  . ASP A 1 105 ? 0.411   -6.651  15.582  1.00 0.00 ? 105 ASP A HB3  2  
ATOM 4088  N N    . SER A 1 106 ? 3.262   -7.666  15.539  1.00 0.00 ? 106 SER A N    2  
ATOM 4089  C CA   . SER A 1 106 ? 4.202   -8.330  16.485  1.00 0.00 ? 106 SER A CA   2  
ATOM 4090  C C    . SER A 1 106 ? 4.691   -7.416  17.672  1.00 0.00 ? 106 SER A C    2  
ATOM 4091  O O    . SER A 1 106 ? 5.338   -7.949  18.579  1.00 0.00 ? 106 SER A O    2  
ATOM 4092  C CB   . SER A 1 106 ? 5.451   -8.791  15.689  1.00 0.00 ? 106 SER A CB   2  
ATOM 4093  O OG   . SER A 1 106 ? 5.133   -9.786  14.713  1.00 0.00 ? 106 SER A OG   2  
ATOM 4094  H H    . SER A 1 106 ? 3.039   -6.650  15.593  1.00 0.00 ? 106 SER A H    2  
ATOM 4095  H HA   . SER A 1 106 ? 3.713   -9.211  16.943  1.00 0.00 ? 106 SER A HA   2  
ATOM 4096  H HB2  . SER A 1 106 ? 5.926   -7.918  15.195  1.00 0.00 ? 106 SER A HB2  2  
ATOM 4097  H HB3  . SER A 1 106 ? 6.209   -9.205  16.381  1.00 0.00 ? 106 SER A HB3  2  
ATOM 4098  H HG   . SER A 1 106 ? 4.165   -9.714  14.560  1.00 0.00 ? 106 SER A HG   2  
ATOM 4099  N N    . GLY A 1 107 ? 4.477   -6.080  17.673  1.00 0.00 ? 107 GLY A N    2  
ATOM 4100  C CA   . GLY A 1 107 ? 4.993   -5.162  18.722  1.00 0.00 ? 107 GLY A CA   2  
ATOM 4101  C C    . GLY A 1 107 ? 5.983   -4.135  18.113  1.00 0.00 ? 107 GLY A C    2  
ATOM 4102  O O    . GLY A 1 107 ? 5.520   -3.049  17.755  1.00 0.00 ? 107 GLY A O    2  
ATOM 4103  H H    . GLY A 1 107 ? 3.900   -5.717  16.890  1.00 0.00 ? 107 GLY A H    2  
ATOM 4104  H HA2  . GLY A 1 107 ? 4.141   -4.608  19.157  1.00 0.00 ? 107 GLY A HA2  2  
ATOM 4105  H HA3  . GLY A 1 107 ? 5.454   -5.691  19.577  1.00 0.00 ? 107 GLY A HA3  2  
ATOM 4106  N N    . PRO A 1 108 ? 7.313   -4.404  17.938  1.00 0.00 ? 108 PRO A N    2  
ATOM 4107  C CA   . PRO A 1 108 ? 8.255   -3.419  17.325  1.00 0.00 ? 108 PRO A CA   2  
ATOM 4108  C C    . PRO A 1 108 ? 8.132   -3.148  15.781  1.00 0.00 ? 108 PRO A C    2  
ATOM 4109  O O    . PRO A 1 108 ? 8.595   -2.094  15.339  1.00 0.00 ? 108 PRO A O    2  
ATOM 4110  C CB   . PRO A 1 108 ? 9.619   -4.034  17.706  1.00 0.00 ? 108 PRO A CB   2  
ATOM 4111  C CG   . PRO A 1 108 ? 9.379   -5.543  17.802  1.00 0.00 ? 108 PRO A CG   2  
ATOM 4112  C CD   . PRO A 1 108 ? 7.962   -5.660  18.367  1.00 0.00 ? 108 PRO A CD   2  
ATOM 4113  H HA   . PRO A 1 108 ? 8.146   -2.432  17.815  1.00 0.00 ? 108 PRO A HA   2  
ATOM 4114  H HB2  . PRO A 1 108 ? 10.436  -3.777  17.003  1.00 0.00 ? 108 PRO A HB2  2  
ATOM 4115  H HB3  . PRO A 1 108 ? 9.938   -3.644  18.693  1.00 0.00 ? 108 PRO A HB3  2  
ATOM 4116  H HG2  . PRO A 1 108 ? 9.429   -6.004  16.797  1.00 0.00 ? 108 PRO A HG2  2  
ATOM 4117  H HG3  . PRO A 1 108 ? 10.131  -6.056  18.431  1.00 0.00 ? 108 PRO A HG3  2  
ATOM 4118  H HD2  . PRO A 1 108 ? 7.451   -6.563  17.986  1.00 0.00 ? 108 PRO A HD2  2  
ATOM 4119  H HD3  . PRO A 1 108 ? 7.983   -5.726  19.473  1.00 0.00 ? 108 PRO A HD3  2  
ATOM 4120  N N    . THR A 1 109 ? 7.603   -4.088  14.974  1.00 0.00 ? 109 THR A N    2  
ATOM 4121  C CA   . THR A 1 109 ? 7.441   -3.946  13.489  1.00 0.00 ? 109 THR A CA   2  
ATOM 4122  C C    . THR A 1 109 ? 6.201   -4.775  13.015  1.00 0.00 ? 109 THR A C    2  
ATOM 4123  O O    . THR A 1 109 ? 5.979   -5.903  13.477  1.00 0.00 ? 109 THR A O    2  
ATOM 4124  C CB   . THR A 1 109 ? 8.696   -4.449  12.691  1.00 0.00 ? 109 THR A CB   2  
ATOM 4125  O OG1  . THR A 1 109 ? 9.210   -5.654  13.244  1.00 0.00 ? 109 THR A OG1  2  
ATOM 4126  C CG2  . THR A 1 109 ? 9.865   -3.463  12.674  1.00 0.00 ? 109 THR A CG2  2  
ATOM 4127  H H    . THR A 1 109 ? 7.234   -4.896  15.489  1.00 0.00 ? 109 THR A H    2  
ATOM 4128  H HA   . THR A 1 109 ? 7.265   -2.879  13.240  1.00 0.00 ? 109 THR A HA   2  
ATOM 4129  H HB   . THR A 1 109 ? 8.399   -4.620  11.636  1.00 0.00 ? 109 THR A HB   2  
ATOM 4130  H HG1  . THR A 1 109 ? 9.510   -5.390  14.119  1.00 0.00 ? 109 THR A HG1  2  
ATOM 4131  H HG21 . THR A 1 109 ? 9.560   -2.504  12.216  1.00 0.00 ? 109 THR A HG21 2  
ATOM 4132  H HG22 . THR A 1 109 ? 10.255  -3.239  13.684  1.00 0.00 ? 109 THR A HG22 2  
ATOM 4133  H HG23 . THR A 1 109 ? 10.710  -3.850  12.075  1.00 0.00 ? 109 THR A HG23 2  
ATOM 4134  N N    . THR A 1 110 ? 5.409   -4.229  12.069  1.00 0.00 ? 110 THR A N    2  
ATOM 4135  C CA   . THR A 1 110 ? 4.219   -4.945  11.500  1.00 0.00 ? 110 THR A CA   2  
ATOM 4136  C C    . THR A 1 110 ? 4.594   -5.637  10.134  1.00 0.00 ? 110 THR A C    2  
ATOM 4137  O O    . THR A 1 110 ? 5.701   -5.494  9.617   1.00 0.00 ? 110 THR A O    2  
ATOM 4138  C CB   . THR A 1 110 ? 3.007   -3.940  11.436  1.00 0.00 ? 110 THR A CB   2  
ATOM 4139  O OG1  . THR A 1 110 ? 1.828   -4.606  11.869  1.00 0.00 ? 110 THR A OG1  2  
ATOM 4140  C CG2  . THR A 1 110 ? 2.632   -3.392  10.053  1.00 0.00 ? 110 THR A CG2  2  
ATOM 4141  H H    . THR A 1 110 ? 5.701   -3.302  11.734  1.00 0.00 ? 110 THR A H    2  
ATOM 4142  H HA   . THR A 1 110 ? 3.935   -5.771  12.177  1.00 0.00 ? 110 THR A HA   2  
ATOM 4143  H HB   . THR A 1 110 ? 3.188   -3.090  12.127  1.00 0.00 ? 110 THR A HB   2  
ATOM 4144  H HG1  . THR A 1 110 ? 1.698   -4.355  12.835  1.00 0.00 ? 110 THR A HG1  2  
ATOM 4145  H HG21 . THR A 1 110 ? 3.514   -2.975  9.537   1.00 0.00 ? 110 THR A HG21 2  
ATOM 4146  H HG22 . THR A 1 110 ? 2.223   -4.190  9.402   1.00 0.00 ? 110 THR A HG22 2  
ATOM 4147  H HG23 . THR A 1 110 ? 1.849   -2.624  10.133  1.00 0.00 ? 110 THR A HG23 2  
ATOM 4148  N N    . SER A 1 111 ? 3.667   -6.436  9.587   1.00 0.00 ? 111 SER A N    2  
ATOM 4149  C CA   . SER A 1 111 ? 3.855   -7.191  8.304   1.00 0.00 ? 111 SER A CA   2  
ATOM 4150  C C    . SER A 1 111 ? 2.583   -7.131  7.394   1.00 0.00 ? 111 SER A C    2  
ATOM 4151  O O    . SER A 1 111 ? 1.488   -6.845  7.896   1.00 0.00 ? 111 SER A O    2  
ATOM 4152  C CB   . SER A 1 111 ? 4.256   -8.648  8.647   1.00 0.00 ? 111 SER A CB   2  
ATOM 4153  O OG   . SER A 1 111 ? 3.208   -9.403  9.256   1.00 0.00 ? 111 SER A OG   2  
ATOM 4154  H H    . SER A 1 111 ? 2.772   -6.372  10.090  1.00 0.00 ? 111 SER A H    2  
ATOM 4155  H HA   . SER A 1 111 ? 4.676   -6.734  7.723   1.00 0.00 ? 111 SER A HA   2  
ATOM 4156  H HB2  . SER A 1 111 ? 4.576   -9.167  7.723   1.00 0.00 ? 111 SER A HB2  2  
ATOM 4157  H HB3  . SER A 1 111 ? 5.148   -8.658  9.299   1.00 0.00 ? 111 SER A HB3  2  
ATOM 4158  H HG   . SER A 1 111 ? 2.851   -8.899  10.017  1.00 0.00 ? 111 SER A HG   2  
ATOM 4159  N N    . PHE A 1 112 ? 2.688   -7.375  6.060   1.00 0.00 ? 112 PHE A N    2  
ATOM 4160  C CA   . PHE A 1 112 ? 1.496   -7.261  5.171   1.00 0.00 ? 112 PHE A CA   2  
ATOM 4161  C C    . PHE A 1 112 ? 0.896   -8.634  4.742   1.00 0.00 ? 112 PHE A C    2  
ATOM 4162  O O    . PHE A 1 112 ? 1.429   -9.305  3.855   1.00 0.00 ? 112 PHE A O    2  
ATOM 4163  C CB   . PHE A 1 112 ? 1.847   -6.415  3.901   1.00 0.00 ? 112 PHE A CB   2  
ATOM 4164  C CG   . PHE A 1 112 ? 1.754   -4.875  3.982   1.00 0.00 ? 112 PHE A CG   2  
ATOM 4165  C CD1  . PHE A 1 112 ? 0.687   -4.227  4.623   1.00 0.00 ? 112 PHE A CD1  2  
ATOM 4166  C CD2  . PHE A 1 112 ? 2.687   -4.104  3.277   1.00 0.00 ? 112 PHE A CD2  2  
ATOM 4167  C CE1  . PHE A 1 112 ? 0.581   -2.840  4.590   1.00 0.00 ? 112 PHE A CE1  2  
ATOM 4168  C CE2  . PHE A 1 112 ? 2.573   -2.716  3.238   1.00 0.00 ? 112 PHE A CE2  2  
ATOM 4169  C CZ   . PHE A 1 112 ? 1.519   -2.086  3.895   1.00 0.00 ? 112 PHE A CZ   2  
ATOM 4170  H H    . PHE A 1 112 ? 3.610   -7.635  5.662   1.00 0.00 ? 112 PHE A H    2  
ATOM 4171  H HA   . PHE A 1 112 ? 0.677   -6.711  5.665   1.00 0.00 ? 112 PHE A HA   2  
ATOM 4172  H HB2  . PHE A 1 112 ? 2.830   -6.732  3.506   1.00 0.00 ? 112 PHE A HB2  2  
ATOM 4173  H HB3  . PHE A 1 112 ? 1.153   -6.688  3.080   1.00 0.00 ? 112 PHE A HB3  2  
ATOM 4174  H HD1  . PHE A 1 112 ? -0.086  -4.783  5.132   1.00 0.00 ? 112 PHE A HD1  2  
ATOM 4175  H HD2  . PHE A 1 112 ? 3.499   -4.576  2.743   1.00 0.00 ? 112 PHE A HD2  2  
ATOM 4176  H HE1  . PHE A 1 112 ? -0.244  -2.354  5.086   1.00 0.00 ? 112 PHE A HE1  2  
ATOM 4177  H HE2  . PHE A 1 112 ? 3.301   -2.132  2.694   1.00 0.00 ? 112 PHE A HE2  2  
ATOM 4178  H HZ   . PHE A 1 112 ? 1.423   -1.010  3.865   1.00 0.00 ? 112 PHE A HZ   2  
ATOM 4179  N N    . GLU A 1 113 ? -0.250  -9.010  5.351   1.00 0.00 ? 113 GLU A N    2  
ATOM 4180  C CA   . GLU A 1 113 ? -1.138  -10.090 4.805   1.00 0.00 ? 113 GLU A CA   2  
ATOM 4181  C C    . GLU A 1 113 ? -1.973  -9.421  3.638   1.00 0.00 ? 113 GLU A C    2  
ATOM 4182  O O    . GLU A 1 113 ? -2.000  -8.185  3.523   1.00 0.00 ? 113 GLU A O    2  
ATOM 4183  C CB   . GLU A 1 113 ? -1.963  -10.730 5.954   1.00 0.00 ? 113 GLU A CB   2  
ATOM 4184  C CG   . GLU A 1 113 ? -1.209  -11.862 6.701   1.00 0.00 ? 113 GLU A CG   2  
ATOM 4185  C CD   . GLU A 1 113 ? -1.966  -12.495 7.859   1.00 0.00 ? 113 GLU A CD   2  
ATOM 4186  O OE1  . GLU A 1 113 ? -3.052  -13.066 7.633   1.00 0.00 ? 113 GLU A OE1  2  
ATOM 4187  O OE2  . GLU A 1 113 ? -1.457  -12.447 9.000   1.00 0.00 ? 113 GLU A OE2  2  
ATOM 4188  H H    . GLU A 1 113 ? -0.585  -8.351  6.069   1.00 0.00 ? 113 GLU A H    2  
ATOM 4189  H HA   . GLU A 1 113 ? -0.529  -10.875 4.328   1.00 0.00 ? 113 GLU A HA   2  
ATOM 4190  H HB2  . GLU A 1 113 ? -2.287  -9.969  6.688   1.00 0.00 ? 113 GLU A HB2  2  
ATOM 4191  H HB3  . GLU A 1 113 ? -2.903  -11.154 5.549   1.00 0.00 ? 113 GLU A HB3  2  
ATOM 4192  H HG2  . GLU A 1 113 ? -0.962  -12.686 6.012   1.00 0.00 ? 113 GLU A HG2  2  
ATOM 4193  H HG3  . GLU A 1 113 ? -0.244  -11.492 7.091   1.00 0.00 ? 113 GLU A HG3  2  
ATOM 4194  N N    . SER A 1 114 ? -2.587  -10.135 2.666   1.00 0.00 ? 114 SER A N    2  
ATOM 4195  C CA   . SER A 1 114 ? -3.075  -9.469  1.422   1.00 0.00 ? 114 SER A CA   2  
ATOM 4196  C C    . SER A 1 114 ? -3.959  -10.387 0.538   1.00 0.00 ? 114 SER A C    2  
ATOM 4197  O O    . SER A 1 114 ? -3.869  -11.624 0.533   1.00 0.00 ? 114 SER A O    2  
ATOM 4198  C CB   . SER A 1 114 ? -1.859  -8.956  0.595   1.00 0.00 ? 114 SER A CB   2  
ATOM 4199  O OG   . SER A 1 114 ? -1.259  -7.811  1.195   1.00 0.00 ? 114 SER A OG   2  
ATOM 4200  H H    . SER A 1 114 ? -2.652  -11.167 2.709   1.00 0.00 ? 114 SER A H    2  
ATOM 4201  H HA   . SER A 1 114 ? -3.701  -8.624  1.753   1.00 0.00 ? 114 SER A HA   2  
ATOM 4202  H HB2  . SER A 1 114 ? -1.106  -9.758  0.479   1.00 0.00 ? 114 SER A HB2  2  
ATOM 4203  H HB3  . SER A 1 114 ? -2.159  -8.671  -0.424  1.00 0.00 ? 114 SER A HB3  2  
ATOM 4204  H HG   . SER A 1 114 ? -1.439  -7.908  2.155   1.00 0.00 ? 114 SER A HG   2  
ATOM 4205  N N    . ALA A 1 115 ? -4.792  -9.661  -0.249  1.00 0.00 ? 115 ALA A N    2  
ATOM 4206  C CA   . ALA A 1 115 ? -5.976  -10.172 -0.998  1.00 0.00 ? 115 ALA A CA   2  
ATOM 4207  C C    . ALA A 1 115 ? -6.971  -10.228 0.182   1.00 0.00 ? 115 ALA A C    2  
ATOM 4208  O O    . ALA A 1 115 ? -7.467  -9.162  0.572   1.00 0.00 ? 115 ALA A O    2  
ATOM 4209  C CB   . ALA A 1 115 ? -5.680  -11.365 -1.937  1.00 0.00 ? 115 ALA A CB   2  
ATOM 4210  H H    . ALA A 1 115 ? -4.707  -8.650  -0.073  1.00 0.00 ? 115 ALA A H    2  
ATOM 4211  H HA   . ALA A 1 115 ? -6.400  -9.402  -1.631  1.00 0.00 ? 115 ALA A HA   2  
ATOM 4212  H HB1  . ALA A 1 115 ? -5.082  -12.162 -1.476  1.00 0.00 ? 115 ALA A HB1  2  
ATOM 4213  H HB2  . ALA A 1 115 ? -6.610  -11.817 -2.325  1.00 0.00 ? 115 ALA A HB2  2  
ATOM 4214  H HB3  . ALA A 1 115 ? -5.096  -11.017 -2.807  1.00 0.00 ? 115 ALA A HB3  2  
ATOM 4215  N N    . ALA A 1 116 ? -7.337  -11.420 0.632   1.00 0.00 ? 116 ALA A N    2  
ATOM 4216  C CA   . ALA A 1 116 ? -7.859  -11.626 2.020   1.00 0.00 ? 116 ALA A CA   2  
ATOM 4217  C C    . ALA A 1 116 ? -8.144  -13.151 2.189   1.00 0.00 ? 116 ALA A C    2  
ATOM 4218  O O    . ALA A 1 116 ? -7.467  -13.847 2.949   1.00 0.00 ? 116 ALA A O    2  
ATOM 4219  C CB   . ALA A 1 116 ? -9.089  -10.751 2.407   1.00 0.00 ? 116 ALA A CB   2  
ATOM 4220  H H    . ALA A 1 116 ? -6.756  -12.103 0.124   1.00 0.00 ? 116 ALA A H    2  
ATOM 4221  H HA   . ALA A 1 116 ? -6.951  -11.403 2.668   1.00 0.00 ? 116 ALA A HA   2  
ATOM 4222  H HB1  . ALA A 1 116 ? -9.893  -10.790 1.648   1.00 0.00 ? 116 ALA A HB1  2  
ATOM 4223  H HB2  . ALA A 1 116 ? -9.527  -11.057 3.374   1.00 0.00 ? 116 ALA A HB2  2  
ATOM 4224  H HB3  . ALA A 1 116 ? -8.822  -9.684  2.518   1.00 0.00 ? 116 ALA A HB3  2  
ATOM 4225  N N    . CYS A 1 117 ? -9.206  -13.642 1.495   1.00 0.00 ? 117 CYS A N    2  
ATOM 4226  C CA   . CYS A 1 117 ? -9.536  -15.093 1.384   1.00 0.00 ? 117 CYS A CA   2  
ATOM 4227  C C    . CYS A 1 117 ? -8.388  -15.759 0.543   1.00 0.00 ? 117 CYS A C    2  
ATOM 4228  O O    . CYS A 1 117 ? -7.786  -16.682 1.102   1.00 0.00 ? 117 CYS A O    2  
ATOM 4229  C CB   . CYS A 1 117 ? -10.975 -15.261 0.848   1.00 0.00 ? 117 CYS A CB   2  
ATOM 4230  S SG   . CYS A 1 117 ? -11.342 -17.020 0.527   1.00 0.00 ? 117 CYS A SG   2  
ATOM 4231  H H    . CYS A 1 117 ? -9.616  -12.918 0.896   1.00 0.00 ? 117 CYS A H    2  
ATOM 4232  H HA   . CYS A 1 117 ? -9.522  -15.551 2.394   1.00 0.00 ? 117 CYS A HA   2  
ATOM 4233  H HB2  . CYS A 1 117 ? -11.703 -14.879 1.588   1.00 0.00 ? 117 CYS A HB2  2  
ATOM 4234  H HB3  . CYS A 1 117 ? -11.167 -14.683 -0.070  1.00 0.00 ? 117 CYS A HB3  2  
ATOM 4235  H HG   . CYS A 1 117 ? -11.291 -17.433 1.791   1.00 0.00 ? 117 CYS A HG   2  
ATOM 4236  N N    . PRO A 1 118 ? -7.969  -15.340 -0.707  1.00 0.00 ? 118 PRO A N    2  
ATOM 4237  C CA   . PRO A 1 118 ? -6.643  -15.723 -1.255  1.00 0.00 ? 118 PRO A CA   2  
ATOM 4238  C C    . PRO A 1 118 ? -5.549  -15.140 -0.290  1.00 0.00 ? 118 PRO A C    2  
ATOM 4239  O O    . PRO A 1 118 ? -5.523  -13.927 -0.025  1.00 0.00 ? 118 PRO A O    2  
ATOM 4240  C CB   . PRO A 1 118 ? -6.624  -15.118 -2.674  1.00 0.00 ? 118 PRO A CB   2  
ATOM 4241  C CG   . PRO A 1 118 ? -8.040  -14.588 -2.919  1.00 0.00 ? 118 PRO A CG   2  
ATOM 4242  C CD   . PRO A 1 118 ? -8.620  -14.307 -1.534  1.00 0.00 ? 118 PRO A CD   2  
ATOM 4243  H HA   . PRO A 1 118 ? -6.550  -16.821 -1.312  1.00 0.00 ? 118 PRO A HA   2  
ATOM 4244  H HB2  . PRO A 1 118 ? -5.889  -14.294 -2.760  1.00 0.00 ? 118 PRO A HB2  2  
ATOM 4245  H HB3  . PRO A 1 118 ? -6.342  -15.869 -3.434  1.00 0.00 ? 118 PRO A HB3  2  
ATOM 4246  H HG2  . PRO A 1 118 ? -8.053  -13.690 -3.562  1.00 0.00 ? 118 PRO A HG2  2  
ATOM 4247  H HG3  . PRO A 1 118 ? -8.652  -15.358 -3.428  1.00 0.00 ? 118 PRO A HG3  2  
ATOM 4248  H HD2  . PRO A 1 118 ? -8.354  -13.291 -1.186  1.00 0.00 ? 118 PRO A HD2  2  
ATOM 4249  H HD3  . PRO A 1 118 ? -9.719  -14.381 -1.561  1.00 0.00 ? 118 PRO A HD3  2  
ATOM 4250  N N    . GLY A 1 119 ? -4.738  -16.036 0.289   1.00 0.00 ? 119 GLY A N    2  
ATOM 4251  C CA   . GLY A 1 119 ? -3.748  -15.657 1.324   1.00 0.00 ? 119 GLY A CA   2  
ATOM 4252  C C    . GLY A 1 119 ? -2.327  -15.376 0.834   1.00 0.00 ? 119 GLY A C    2  
ATOM 4253  O O    . GLY A 1 119 ? -1.443  -16.222 0.986   1.00 0.00 ? 119 GLY A O    2  
ATOM 4254  H H    . GLY A 1 119 ? -4.883  -17.006 -0.008  1.00 0.00 ? 119 GLY A H    2  
ATOM 4255  H HA2  . GLY A 1 119 ? -4.106  -14.799 1.930   1.00 0.00 ? 119 GLY A HA2  2  
ATOM 4256  H HA3  . GLY A 1 119 ? -3.688  -16.481 2.058   1.00 0.00 ? 119 GLY A HA3  2  
ATOM 4257  N N    . TRP A 1 120 ? -2.116  -14.190 0.249   1.00 0.00 ? 120 TRP A N    2  
ATOM 4258  C CA   . TRP A 1 120 ? -0.748  -13.742 -0.151  1.00 0.00 ? 120 TRP A CA   2  
ATOM 4259  C C    . TRP A 1 120 ? -0.197  -12.831 0.989   1.00 0.00 ? 120 TRP A C    2  
ATOM 4260  O O    . TRP A 1 120 ? -0.930  -12.014 1.547   1.00 0.00 ? 120 TRP A O    2  
ATOM 4261  C CB   . TRP A 1 120 ? -0.812  -13.039 -1.537  1.00 0.00 ? 120 TRP A CB   2  
ATOM 4262  C CG   . TRP A 1 120 ? -0.470  -13.978 -2.704  1.00 0.00 ? 120 TRP A CG   2  
ATOM 4263  C CD1  . TRP A 1 120 ? 0.782   -14.045 -3.354  1.00 0.00 ? 120 TRP A CD1  2  
ATOM 4264  C CD2  . TRP A 1 120 ? -1.269  -14.906 -3.351  1.00 0.00 ? 120 TRP A CD2  2  
ATOM 4265  N NE1  . TRP A 1 120 ? 0.786   -14.989 -4.400  1.00 0.00 ? 120 TRP A NE1  2  
ATOM 4266  C CE2  . TRP A 1 120 ? -0.501  -15.498 -4.388  1.00 0.00 ? 120 TRP A CE2  2  
ATOM 4267  C CE3  . TRP A 1 120 ? -2.621  -15.288 -3.153  1.00 0.00 ? 120 TRP A CE3  2  
ATOM 4268  C CZ2  . TRP A 1 120 ? -1.084  -16.462 -5.242  1.00 0.00 ? 120 TRP A CZ2  2  
ATOM 4269  C CZ3  . TRP A 1 120 ? -3.169  -16.253 -3.999  1.00 0.00 ? 120 TRP A CZ3  2  
ATOM 4270  C CH2  . TRP A 1 120 ? -2.415  -16.827 -5.031  1.00 0.00 ? 120 TRP A CH2  2  
ATOM 4271  H H    . TRP A 1 120 ? -2.954  -13.579 0.203   1.00 0.00 ? 120 TRP A H    2  
ATOM 4272  H HA   . TRP A 1 120 ? -0.062  -14.612 -0.229  1.00 0.00 ? 120 TRP A HA   2  
ATOM 4273  H HB2  . TRP A 1 120 ? -1.793  -12.554 -1.708  1.00 0.00 ? 120 TRP A HB2  2  
ATOM 4274  H HB3  . TRP A 1 120 ? -0.100  -12.193 -1.567  1.00 0.00 ? 120 TRP A HB3  2  
ATOM 4275  H HD1  . TRP A 1 120 ? 1.622   -13.411 -3.111  1.00 0.00 ? 120 TRP A HD1  2  
ATOM 4276  H HE1  . TRP A 1 120 ? 1.521   -15.139 -5.101  1.00 0.00 ? 120 TRP A HE1  2  
ATOM 4277  H HE3  . TRP A 1 120 ? -3.210  -14.849 -2.361  1.00 0.00 ? 120 TRP A HE3  2  
ATOM 4278  H HZ2  . TRP A 1 120 ? -0.510  -16.915 -6.037  1.00 0.00 ? 120 TRP A HZ2  2  
ATOM 4279  H HZ3  . TRP A 1 120 ? -4.187  -16.575 -3.848  1.00 0.00 ? 120 TRP A HZ3  2  
ATOM 4280  H HH2  . TRP A 1 120 ? -2.865  -17.577 -5.666  1.00 0.00 ? 120 TRP A HH2  2  
ATOM 4281  N N    . PHE A 1 121 ? 1.089   -12.956 1.355   1.00 0.00 ? 121 PHE A N    2  
ATOM 4282  C CA   . PHE A 1 121 ? 1.666   -12.199 2.501   1.00 0.00 ? 121 PHE A CA   2  
ATOM 4283  C C    . PHE A 1 121 ? 3.222   -12.042 2.423   1.00 0.00 ? 121 PHE A C    2  
ATOM 4284  O O    . PHE A 1 121 ? 3.939   -13.019 2.207   1.00 0.00 ? 121 PHE A O    2  
ATOM 4285  C CB   . PHE A 1 121 ? 1.243   -12.903 3.836   1.00 0.00 ? 121 PHE A CB   2  
ATOM 4286  C CG   . PHE A 1 121 ? 1.741   -14.331 4.146   1.00 0.00 ? 121 PHE A CG   2  
ATOM 4287  C CD1  . PHE A 1 121 ? 1.103   -15.447 3.590   1.00 0.00 ? 121 PHE A CD1  2  
ATOM 4288  C CD2  . PHE A 1 121 ? 2.826   -14.522 5.007   1.00 0.00 ? 121 PHE A CD2  2  
ATOM 4289  C CE1  . PHE A 1 121 ? 1.559   -16.731 3.875   1.00 0.00 ? 121 PHE A CE1  2  
ATOM 4290  C CE2  . PHE A 1 121 ? 3.274   -15.808 5.298   1.00 0.00 ? 121 PHE A CE2  2  
ATOM 4291  C CZ   . PHE A 1 121 ? 2.646   -16.911 4.724   1.00 0.00 ? 121 PHE A CZ   2  
ATOM 4292  H H    . PHE A 1 121 ? 1.634   -13.682 0.870   1.00 0.00 ? 121 PHE A H    2  
ATOM 4293  H HA   . PHE A 1 121 ? 1.226   -11.186 2.486   1.00 0.00 ? 121 PHE A HA   2  
ATOM 4294  H HB2  . PHE A 1 121 ? 1.507   -12.232 4.677   1.00 0.00 ? 121 PHE A HB2  2  
ATOM 4295  H HB3  . PHE A 1 121 ? 0.138   -12.927 3.880   1.00 0.00 ? 121 PHE A HB3  2  
ATOM 4296  H HD1  . PHE A 1 121 ? 0.259   -15.323 2.926   1.00 0.00 ? 121 PHE A HD1  2  
ATOM 4297  H HD2  . PHE A 1 121 ? 3.325   -13.673 5.451   1.00 0.00 ? 121 PHE A HD2  2  
ATOM 4298  H HE1  . PHE A 1 121 ? 1.065   -17.586 3.438   1.00 0.00 ? 121 PHE A HE1  2  
ATOM 4299  H HE2  . PHE A 1 121 ? 4.109   -15.947 5.969   1.00 0.00 ? 121 PHE A HE2  2  
ATOM 4300  H HZ   . PHE A 1 121 ? 3.003   -17.908 4.937   1.00 0.00 ? 121 PHE A HZ   2  
ATOM 4301  N N    . LEU A 1 122 ? 3.726   -10.796 2.537   1.00 0.00 ? 122 LEU A N    2  
ATOM 4302  C CA   . LEU A 1 122 ? 5.186   -10.462 2.647   1.00 0.00 ? 122 LEU A CA   2  
ATOM 4303  C C    . LEU A 1 122 ? 5.244   -8.892  2.882   1.00 0.00 ? 122 LEU A C    2  
ATOM 4304  O O    . LEU A 1 122 ? 4.606   -8.426  3.843   1.00 0.00 ? 122 LEU A O    2  
ATOM 4305  C CB   . LEU A 1 122 ? 6.052   -11.012 1.462   1.00 0.00 ? 122 LEU A CB   2  
ATOM 4306  C CG   . LEU A 1 122 ? 7.559   -11.211 1.728   1.00 0.00 ? 122 LEU A CG   2  
ATOM 4307  C CD1  . LEU A 1 122 ? 7.848   -12.514 2.498   1.00 0.00 ? 122 LEU A CD1  2  
ATOM 4308  C CD2  . LEU A 1 122 ? 8.286   -11.275 0.380   1.00 0.00 ? 122 LEU A CD2  2  
ATOM 4309  H H    . LEU A 1 122 ? 3.007   -10.088 2.751   1.00 0.00 ? 122 LEU A H    2  
ATOM 4310  H HA   . LEU A 1 122 ? 5.546   -10.934 3.561   1.00 0.00 ? 122 LEU A HA   2  
ATOM 4311  H HB2  . LEU A 1 122 ? 5.669   -11.966 1.067   1.00 0.00 ? 122 LEU A HB2  2  
ATOM 4312  H HB3  . LEU A 1 122 ? 5.944   -10.329 0.620   1.00 0.00 ? 122 LEU A HB3  2  
ATOM 4313  H HG   . LEU A 1 122 ? 7.961   -10.349 2.297   1.00 0.00 ? 122 LEU A HG   2  
ATOM 4314  H HD11 . LEU A 1 122 ? 7.284   -12.589 3.443   1.00 0.00 ? 122 LEU A HD11 2  
ATOM 4315  H HD12 . LEU A 1 122 ? 7.577   -13.413 1.913   1.00 0.00 ? 122 LEU A HD12 2  
ATOM 4316  H HD13 . LEU A 1 122 ? 8.922   -12.614 2.753   1.00 0.00 ? 122 LEU A HD13 2  
ATOM 4317  H HD21 . LEU A 1 122 ? 8.030   -10.430 -0.283  1.00 0.00 ? 122 LEU A HD21 2  
ATOM 4318  H HD22 . LEU A 1 122 ? 9.376   -11.246 0.532   1.00 0.00 ? 122 LEU A HD22 2  
ATOM 4319  H HD23 . LEU A 1 122 ? 8.056   -12.204 -0.175  1.00 0.00 ? 122 LEU A HD23 2  
ATOM 4320  N N    . CYS A 1 123 ? 6.117   -8.103  2.187   1.00 0.00 ? 123 CYS A N    2  
ATOM 4321  C CA   . CYS A 1 123 ? 6.076   -6.612  2.233   1.00 0.00 ? 123 CYS A CA   2  
ATOM 4322  C C    . CYS A 1 123 ? 6.952   -5.947  1.105   1.00 0.00 ? 123 CYS A C    2  
ATOM 4323  O O    . CYS A 1 123 ? 6.426   -5.713  0.015   1.00 0.00 ? 123 CYS A O    2  
ATOM 4324  C CB   . CYS A 1 123 ? 6.356   -5.980  3.621   1.00 0.00 ? 123 CYS A CB   2  
ATOM 4325  S SG   . CYS A 1 123 ? 6.170   -4.166  3.473   1.00 0.00 ? 123 CYS A SG   2  
ATOM 4326  H H    . CYS A 1 123 ? 6.516   -8.580  1.363   1.00 0.00 ? 123 CYS A H    2  
ATOM 4327  H HA   . CYS A 1 123 ? 5.049   -6.334  2.010   1.00 0.00 ? 123 CYS A HA   2  
ATOM 4328  H HB2  . CYS A 1 123 ? 5.639   -6.332  4.383   1.00 0.00 ? 123 CYS A HB2  2  
ATOM 4329  H HB3  . CYS A 1 123 ? 7.353   -6.218  4.015   1.00 0.00 ? 123 CYS A HB3  2  
ATOM 4330  H HG   . CYS A 1 123 ? 7.463   -3.863  3.522   1.00 0.00 ? 123 CYS A HG   2  
ATOM 4331  N N    . THR A 1 124 ? 8.232   -5.572  1.346   1.00 0.00 ? 124 THR A N    2  
ATOM 4332  C CA   . THR A 1 124 ? 9.047   -4.745  0.394   1.00 0.00 ? 124 THR A CA   2  
ATOM 4333  C C    . THR A 1 124 ? 10.555  -5.148  0.464   1.00 0.00 ? 124 THR A C    2  
ATOM 4334  O O    . THR A 1 124 ? 11.047  -5.577  1.513   1.00 0.00 ? 124 THR A O    2  
ATOM 4335  C CB   . THR A 1 124 ? 8.828   -3.226  0.749   1.00 0.00 ? 124 THR A CB   2  
ATOM 4336  O OG1  . THR A 1 124 ? 7.450   -2.874  0.671   1.00 0.00 ? 124 THR A OG1  2  
ATOM 4337  C CG2  . THR A 1 124 ? 9.518   -2.220  -0.187  1.00 0.00 ? 124 THR A CG2  2  
ATOM 4338  H H    . THR A 1 124 ? 8.600   -5.839  2.272   1.00 0.00 ? 124 THR A H    2  
ATOM 4339  H HA   . THR A 1 124 ? 8.709   -4.935  -0.638  1.00 0.00 ? 124 THR A HA   2  
ATOM 4340  H HB   . THR A 1 124 ? 9.185   -3.061  1.786   1.00 0.00 ? 124 THR A HB   2  
ATOM 4341  H HG1  . THR A 1 124 ? 7.401   -1.936  0.868   1.00 0.00 ? 124 THR A HG1  2  
ATOM 4342  H HG21 . THR A 1 124 ? 9.223   -2.361  -1.245  1.00 0.00 ? 124 THR A HG21 2  
ATOM 4343  H HG22 . THR A 1 124 ? 9.282   -1.174  0.080   1.00 0.00 ? 124 THR A HG22 2  
ATOM 4344  H HG23 . THR A 1 124 ? 10.618  -2.307  -0.131  1.00 0.00 ? 124 THR A HG23 2  
ATOM 4345  N N    . ALA A 1 125 ? 11.311  -4.983  -0.643  1.00 0.00 ? 125 ALA A N    2  
ATOM 4346  C CA   . ALA A 1 125 ? 12.748  -5.379  -0.718  1.00 0.00 ? 125 ALA A CA   2  
ATOM 4347  C C    . ALA A 1 125 ? 13.729  -4.985  0.447   1.00 0.00 ? 125 ALA A C    2  
ATOM 4348  O O    . ALA A 1 125 ? 13.581  -3.967  1.135   1.00 0.00 ? 125 ALA A O    2  
ATOM 4349  C CB   . ALA A 1 125 ? 13.264  -4.740  -2.020  1.00 0.00 ? 125 ALA A CB   2  
ATOM 4350  H H    . ALA A 1 125 ? 10.821  -4.636  -1.485  1.00 0.00 ? 125 ALA A H    2  
ATOM 4351  H HA   . ALA A 1 125 ? 12.780  -6.480  -0.814  1.00 0.00 ? 125 ALA A HA   2  
ATOM 4352  H HB1  . ALA A 1 125 ? 12.674  -5.049  -2.902  1.00 0.00 ? 125 ALA A HB1  2  
ATOM 4353  H HB2  . ALA A 1 125 ? 13.253  -3.635  -1.983  1.00 0.00 ? 125 ALA A HB2  2  
ATOM 4354  H HB3  . ALA A 1 125 ? 14.313  -5.037  -2.223  1.00 0.00 ? 125 ALA A HB3  2  
ATOM 4355  N N    . MET A 1 126 ? 14.731  -5.859  0.657   1.00 0.00 ? 126 MET A N    2  
ATOM 4356  C CA   . MET A 1 126 ? 15.859  -5.625  1.610   1.00 0.00 ? 126 MET A CA   2  
ATOM 4357  C C    . MET A 1 126 ? 16.842  -4.487  1.128   1.00 0.00 ? 126 MET A C    2  
ATOM 4358  O O    . MET A 1 126 ? 17.245  -3.627  1.915   1.00 0.00 ? 126 MET A O    2  
ATOM 4359  C CB   . MET A 1 126 ? 16.565  -7.009  1.765   1.00 0.00 ? 126 MET A CB   2  
ATOM 4360  C CG   . MET A 1 126 ? 17.498  -7.142  2.981   1.00 0.00 ? 126 MET A CG   2  
ATOM 4361  S SD   . MET A 1 126 ? 19.029  -6.238  2.687   1.00 0.00 ? 126 MET A SD   2  
ATOM 4362  C CE   . MET A 1 126 ? 19.708  -6.281  4.350   1.00 0.00 ? 126 MET A CE   2  
ATOM 4363  H H    . MET A 1 126 ? 14.770  -6.647  -0.002  1.00 0.00 ? 126 MET A H    2  
ATOM 4364  H HA   . MET A 1 126 ? 15.453  -5.310  2.590   1.00 0.00 ? 126 MET A HA   2  
ATOM 4365  H HB2  . MET A 1 126 ? 15.817  -7.821  1.839   1.00 0.00 ? 126 MET A HB2  2  
ATOM 4366  H HB3  . MET A 1 126 ? 17.130  -7.262  0.845   1.00 0.00 ? 126 MET A HB3  2  
ATOM 4367  H HG2  . MET A 1 126 ? 17.010  -6.780  3.905   1.00 0.00 ? 126 MET A HG2  2  
ATOM 4368  H HG3  . MET A 1 126 ? 17.747  -8.205  3.162   1.00 0.00 ? 126 MET A HG3  2  
ATOM 4369  H HE1  . MET A 1 126 ? 19.844  -7.324  4.690   1.00 0.00 ? 126 MET A HE1  2  
ATOM 4370  H HE2  . MET A 1 126 ? 20.689  -5.775  4.378   1.00 0.00 ? 126 MET A HE2  2  
ATOM 4371  H HE3  . MET A 1 126 ? 19.032  -5.766  5.056   1.00 0.00 ? 126 MET A HE3  2  
ATOM 4372  N N    . GLU A 1 127 ? 17.152  -4.472  -0.175  1.00 0.00 ? 127 GLU A N    2  
ATOM 4373  C CA   . GLU A 1 127 ? 18.036  -3.510  -0.870  1.00 0.00 ? 127 GLU A CA   2  
ATOM 4374  C C    . GLU A 1 127 ? 17.382  -2.098  -1.102  1.00 0.00 ? 127 GLU A C    2  
ATOM 4375  O O    . GLU A 1 127 ? 16.156  -1.929  -1.088  1.00 0.00 ? 127 GLU A O    2  
ATOM 4376  C CB   . GLU A 1 127 ? 18.380  -4.146  -2.265  1.00 0.00 ? 127 GLU A CB   2  
ATOM 4377  C CG   . GLU A 1 127 ? 18.611  -5.685  -2.418  1.00 0.00 ? 127 GLU A CG   2  
ATOM 4378  C CD   . GLU A 1 127 ? 17.323  -6.481  -2.643  1.00 0.00 ? 127 GLU A CD   2  
ATOM 4379  O OE1  . GLU A 1 127 ? 16.636  -6.828  -1.658  1.00 0.00 ? 127 GLU A OE1  2  
ATOM 4380  O OE2  . GLU A 1 127 ? 16.973  -6.726  -3.813  1.00 0.00 ? 127 GLU A OE2  2  
ATOM 4381  H H    . GLU A 1 127 ? 16.776  -5.280  -0.707  1.00 0.00 ? 127 GLU A H    2  
ATOM 4382  H HA   . GLU A 1 127 ? 18.969  -3.390  -0.285  1.00 0.00 ? 127 GLU A HA   2  
ATOM 4383  H HB2  . GLU A 1 127 ? 17.608  -3.860  -3.010  1.00 0.00 ? 127 GLU A HB2  2  
ATOM 4384  H HB3  . GLU A 1 127 ? 19.283  -3.630  -2.643  1.00 0.00 ? 127 GLU A HB3  2  
ATOM 4385  H HG2  . GLU A 1 127 ? 19.273  -5.882  -3.281  1.00 0.00 ? 127 GLU A HG2  2  
ATOM 4386  H HG3  . GLU A 1 127 ? 19.133  -6.101  -1.539  1.00 0.00 ? 127 GLU A HG3  2  
ATOM 4387  N N    . ALA A 1 128 ? 18.211  -1.063  -1.331  1.00 0.00 ? 128 ALA A N    2  
ATOM 4388  C CA   . ALA A 1 128 ? 17.723  0.304   -1.685  1.00 0.00 ? 128 ALA A CA   2  
ATOM 4389  C C    . ALA A 1 128 ? 17.585  0.518   -3.241  1.00 0.00 ? 128 ALA A C    2  
ATOM 4390  O O    . ALA A 1 128 ? 18.050  1.521   -3.792  1.00 0.00 ? 128 ALA A O    2  
ATOM 4391  C CB   . ALA A 1 128 ? 18.737  1.259   -1.013  1.00 0.00 ? 128 ALA A CB   2  
ATOM 4392  H H    . ALA A 1 128 ? 19.207  -1.304  -1.357  1.00 0.00 ? 128 ALA A H    2  
ATOM 4393  H HA   . ALA A 1 128 ? 16.721  0.498   -1.255  1.00 0.00 ? 128 ALA A HA   2  
ATOM 4394  H HB1  . ALA A 1 128 ? 19.775  1.065   -1.343  1.00 0.00 ? 128 ALA A HB1  2  
ATOM 4395  H HB2  . ALA A 1 128 ? 18.536  2.317   -1.262  1.00 0.00 ? 128 ALA A HB2  2  
ATOM 4396  H HB3  . ALA A 1 128 ? 18.720  1.181   0.091   1.00 0.00 ? 128 ALA A HB3  2  
ATOM 4397  N N    . ASP A 1 129 ? 16.909  -0.422  -3.933  1.00 0.00 ? 129 ASP A N    2  
ATOM 4398  C CA   . ASP A 1 129 ? 16.767  -0.434  -5.424  1.00 0.00 ? 129 ASP A CA   2  
ATOM 4399  C C    . ASP A 1 129 ? 15.609  -1.350  -5.954  1.00 0.00 ? 129 ASP A C    2  
ATOM 4400  O O    . ASP A 1 129 ? 14.960  -0.960  -6.928  1.00 0.00 ? 129 ASP A O    2  
ATOM 4401  C CB   . ASP A 1 129 ? 18.135  -0.796  -6.094  1.00 0.00 ? 129 ASP A CB   2  
ATOM 4402  C CG   . ASP A 1 129 ? 18.906  -2.045  -5.646  1.00 0.00 ? 129 ASP A CG   2  
ATOM 4403  O OD1  . ASP A 1 129 ? 19.531  -2.016  -4.564  1.00 0.00 ? 129 ASP A OD1  2  
ATOM 4404  O OD2  . ASP A 1 129 ? 18.930  -3.042  -6.397  1.00 0.00 ? 129 ASP A OD2  2  
ATOM 4405  H H    . ASP A 1 129 ? 16.590  -1.193  -3.336  1.00 0.00 ? 129 ASP A H    2  
ATOM 4406  H HA   . ASP A 1 129 ? 16.466  0.576   -5.758  1.00 0.00 ? 129 ASP A HA   2  
ATOM 4407  H HB2  . ASP A 1 129 ? 18.003  -0.852  -7.191  1.00 0.00 ? 129 ASP A HB2  2  
ATOM 4408  H HB3  . ASP A 1 129 ? 18.825  0.054   -5.954  1.00 0.00 ? 129 ASP A HB3  2  
ATOM 4409  N N    . GLN A 1 130 ? 15.313  -2.523  -5.359  1.00 0.00 ? 130 GLN A N    2  
ATOM 4410  C CA   . GLN A 1 130 ? 14.216  -3.421  -5.831  1.00 0.00 ? 130 GLN A CA   2  
ATOM 4411  C C    . GLN A 1 130 ? 12.764  -2.960  -5.384  1.00 0.00 ? 130 GLN A C    2  
ATOM 4412  O O    . GLN A 1 130 ? 12.633  -2.028  -4.579  1.00 0.00 ? 130 GLN A O    2  
ATOM 4413  C CB   . GLN A 1 130 ? 14.586  -4.860  -5.337  1.00 0.00 ? 130 GLN A CB   2  
ATOM 4414  C CG   . GLN A 1 130 ? 15.227  -5.793  -6.402  1.00 0.00 ? 130 GLN A CG   2  
ATOM 4415  C CD   . GLN A 1 130 ? 16.587  -5.355  -6.948  1.00 0.00 ? 130 GLN A CD   2  
ATOM 4416  O OE1  . GLN A 1 130 ? 16.704  -4.890  -8.077  1.00 0.00 ? 130 GLN A OE1  2  
ATOM 4417  N NE2  . GLN A 1 130 ? 17.630  -5.462  -6.164  1.00 0.00 ? 130 GLN A NE2  2  
ATOM 4418  H H    . GLN A 1 130 ? 15.929  -2.764  -4.577  1.00 0.00 ? 130 GLN A H    2  
ATOM 4419  H HA   . GLN A 1 130 ? 14.202  -3.401  -6.939  1.00 0.00 ? 130 GLN A HA   2  
ATOM 4420  H HB2  . GLN A 1 130 ? 15.224  -4.844  -4.430  1.00 0.00 ? 130 GLN A HB2  2  
ATOM 4421  H HB3  . GLN A 1 130 ? 13.682  -5.380  -4.975  1.00 0.00 ? 130 GLN A HB3  2  
ATOM 4422  H HG2  . GLN A 1 130 ? 15.331  -6.812  -5.983  1.00 0.00 ? 130 GLN A HG2  2  
ATOM 4423  H HG3  . GLN A 1 130 ? 14.541  -5.911  -7.260  1.00 0.00 ? 130 GLN A HG3  2  
ATOM 4424  H HE21 . GLN A 1 130 ? 17.400  -5.856  -5.225  1.00 0.00 ? 130 GLN A HE21 2  
ATOM 4425  H HE22 . GLN A 1 130 ? 18.288  -4.674  -6.333  1.00 0.00 ? 130 GLN A HE22 2  
ATOM 4426  N N    . PRO A 1 131 ? 11.640  -3.590  -5.857  1.00 0.00 ? 131 PRO A N    2  
ATOM 4427  C CA   . PRO A 1 131 ? 10.260  -3.142  -5.522  1.00 0.00 ? 131 PRO A CA   2  
ATOM 4428  C C    . PRO A 1 131 ? 9.511   -3.864  -4.344  1.00 0.00 ? 131 PRO A C    2  
ATOM 4429  O O    . PRO A 1 131 ? 10.077  -4.585  -3.506  1.00 0.00 ? 131 PRO A O    2  
ATOM 4430  C CB   . PRO A 1 131 ? 9.647   -3.347  -6.936  1.00 0.00 ? 131 PRO A CB   2  
ATOM 4431  C CG   . PRO A 1 131 ? 10.236  -4.664  -7.442  1.00 0.00 ? 131 PRO A CG   2  
ATOM 4432  C CD   . PRO A 1 131 ? 11.662  -4.651  -6.894  1.00 0.00 ? 131 PRO A CD   2  
ATOM 4433  H HA   . PRO A 1 131 ? 10.241  -2.081  -5.244  1.00 0.00 ? 131 PRO A HA   2  
ATOM 4434  H HB2  . PRO A 1 131 ? 8.541   -3.354  -6.955  1.00 0.00 ? 131 PRO A HB2  2  
ATOM 4435  H HB3  . PRO A 1 131 ? 9.945   -2.511  -7.602  1.00 0.00 ? 131 PRO A HB3  2  
ATOM 4436  H HG2  . PRO A 1 131 ? 9.669   -5.523  -7.031  1.00 0.00 ? 131 PRO A HG2  2  
ATOM 4437  H HG3  . PRO A 1 131 ? 10.202  -4.748  -8.545  1.00 0.00 ? 131 PRO A HG3  2  
ATOM 4438  H HD2  . PRO A 1 131 ? 11.937  -5.637  -6.474  1.00 0.00 ? 131 PRO A HD2  2  
ATOM 4439  H HD3  . PRO A 1 131 ? 12.372  -4.420  -7.711  1.00 0.00 ? 131 PRO A HD3  2  
ATOM 4440  N N    . VAL A 1 132 ? 8.187   -3.617  -4.308  1.00 0.00 ? 132 VAL A N    2  
ATOM 4441  C CA   . VAL A 1 132 ? 7.247   -4.286  -3.350  1.00 0.00 ? 132 VAL A CA   2  
ATOM 4442  C C    . VAL A 1 132 ? 6.952   -5.792  -3.724  1.00 0.00 ? 132 VAL A C    2  
ATOM 4443  O O    . VAL A 1 132 ? 6.956   -6.153  -4.908  1.00 0.00 ? 132 VAL A O    2  
ATOM 4444  C CB   . VAL A 1 132 ? 5.934   -3.429  -3.304  1.00 0.00 ? 132 VAL A CB   2  
ATOM 4445  C CG1  . VAL A 1 132 ? 4.961   -3.595  -4.496  1.00 0.00 ? 132 VAL A CG1  2  
ATOM 4446  C CG2  . VAL A 1 132 ? 5.142   -3.661  -2.002  1.00 0.00 ? 132 VAL A CG2  2  
ATOM 4447  H H    . VAL A 1 132 ? 7.881   -2.949  -5.038  1.00 0.00 ? 132 VAL A H    2  
ATOM 4448  H HA   . VAL A 1 132 ? 7.711   -4.271  -2.351  1.00 0.00 ? 132 VAL A HA   2  
ATOM 4449  H HB   . VAL A 1 132 ? 6.233   -2.362  -3.291  1.00 0.00 ? 132 VAL A HB   2  
ATOM 4450  H HG11 . VAL A 1 132 ? 5.445   -3.350  -5.458  1.00 0.00 ? 132 VAL A HG11 2  
ATOM 4451  H HG12 . VAL A 1 132 ? 4.580   -4.630  -4.587  1.00 0.00 ? 132 VAL A HG12 2  
ATOM 4452  H HG13 . VAL A 1 132 ? 4.076   -2.947  -4.392  1.00 0.00 ? 132 VAL A HG13 2  
ATOM 4453  H HG21 . VAL A 1 132 ? 5.773   -3.516  -1.107  1.00 0.00 ? 132 VAL A HG21 2  
ATOM 4454  H HG22 . VAL A 1 132 ? 4.308   -2.948  -1.901  1.00 0.00 ? 132 VAL A HG22 2  
ATOM 4455  H HG23 . VAL A 1 132 ? 4.716   -4.680  -1.935  1.00 0.00 ? 132 VAL A HG23 2  
ATOM 4456  N N    . SER A 1 133 ? 6.674   -6.674  -2.736  1.00 0.00 ? 133 SER A N    2  
ATOM 4457  C CA   . SER A 1 133 ? 6.331   -8.101  -3.020  1.00 0.00 ? 133 SER A CA   2  
ATOM 4458  C C    . SER A 1 133 ? 5.532   -8.800  -1.864  1.00 0.00 ? 133 SER A C    2  
ATOM 4459  O O    . SER A 1 133 ? 5.664   -8.480  -0.679  1.00 0.00 ? 133 SER A O    2  
ATOM 4460  C CB   . SER A 1 133 ? 7.645   -8.882  -3.298  1.00 0.00 ? 133 SER A CB   2  
ATOM 4461  O OG   . SER A 1 133 ? 7.388   -10.196 -3.796  1.00 0.00 ? 133 SER A OG   2  
ATOM 4462  H H    . SER A 1 133 ? 6.675   -6.294  -1.775  1.00 0.00 ? 133 SER A H    2  
ATOM 4463  H HA   . SER A 1 133 ? 5.681   -8.112  -3.921  1.00 0.00 ? 133 SER A HA   2  
ATOM 4464  H HB2  . SER A 1 133 ? 8.261   -8.347  -4.048  1.00 0.00 ? 133 SER A HB2  2  
ATOM 4465  H HB3  . SER A 1 133 ? 8.268   -8.935  -2.386  1.00 0.00 ? 133 SER A HB3  2  
ATOM 4466  H HG   . SER A 1 133 ? 7.074   -10.736 -3.062  1.00 0.00 ? 133 SER A HG   2  
ATOM 4467  N N    . LEU A 1 134 ? 4.726   -9.802  -2.268  1.00 0.00 ? 134 LEU A N    2  
ATOM 4468  C CA   . LEU A 1 134 ? 3.868   -10.650 -1.382  1.00 0.00 ? 134 LEU A CA   2  
ATOM 4469  C C    . LEU A 1 134 ? 4.014   -12.149 -1.828  1.00 0.00 ? 134 LEU A C    2  
ATOM 4470  O O    . LEU A 1 134 ? 4.067   -12.430 -3.033  1.00 0.00 ? 134 LEU A O    2  
ATOM 4471  C CB   . LEU A 1 134 ? 2.378   -10.243 -1.527  1.00 0.00 ? 134 LEU A CB   2  
ATOM 4472  C CG   . LEU A 1 134 ? 1.971   -8.785  -1.188  1.00 0.00 ? 134 LEU A CG   2  
ATOM 4473  C CD1  . LEU A 1 134 ? 0.568   -8.527  -1.749  1.00 0.00 ? 134 LEU A CD1  2  
ATOM 4474  C CD2  . LEU A 1 134 ? 2.002   -8.499  0.322   1.00 0.00 ? 134 LEU A CD2  2  
ATOM 4475  H H    . LEU A 1 134 ? 4.723   -9.957  -3.282  1.00 0.00 ? 134 LEU A H    2  
ATOM 4476  H HA   . LEU A 1 134 ? 4.138   -10.545 -0.308  1.00 0.00 ? 134 LEU A HA   2  
ATOM 4477  H HB2  . LEU A 1 134 ? 2.066   -10.478 -2.564  1.00 0.00 ? 134 LEU A HB2  2  
ATOM 4478  H HB3  . LEU A 1 134 ? 1.765   -10.922 -0.902  1.00 0.00 ? 134 LEU A HB3  2  
ATOM 4479  H HG   . LEU A 1 134 ? 2.663   -8.078  -1.687  1.00 0.00 ? 134 LEU A HG   2  
ATOM 4480  H HD11 . LEU A 1 134 ? -0.148  -9.303  -1.438  1.00 0.00 ? 134 LEU A HD11 2  
ATOM 4481  H HD12 . LEU A 1 134 ? 0.160   -7.545  -1.446  1.00 0.00 ? 134 LEU A HD12 2  
ATOM 4482  H HD13 . LEU A 1 134 ? 0.570   -8.555  -2.848  1.00 0.00 ? 134 LEU A HD13 2  
ATOM 4483  H HD21 . LEU A 1 134 ? 1.338   -9.176  0.891   1.00 0.00 ? 134 LEU A HD21 2  
ATOM 4484  H HD22 . LEU A 1 134 ? 3.022   -8.608  0.733   1.00 0.00 ? 134 LEU A HD22 2  
ATOM 4485  H HD23 . LEU A 1 134 ? 1.680   -7.466  0.550   1.00 0.00 ? 134 LEU A HD23 2  
ATOM 4486  N N    . THR A 1 135 ? 4.014   -13.120 -0.898  1.00 0.00 ? 135 THR A N    2  
ATOM 4487  C CA   . THR A 1 135 ? 4.150   -14.576 -1.246  1.00 0.00 ? 135 THR A CA   2  
ATOM 4488  C C    . THR A 1 135 ? 3.059   -15.431 -0.533  1.00 0.00 ? 135 THR A C    2  
ATOM 4489  O O    . THR A 1 135 ? 2.692   -15.182 0.616   1.00 0.00 ? 135 THR A O    2  
ATOM 4490  C CB   . THR A 1 135 ? 5.559   -15.146 -0.850  1.00 0.00 ? 135 THR A CB   2  
ATOM 4491  O OG1  . THR A 1 135 ? 5.866   -14.882 0.521   1.00 0.00 ? 135 THR A OG1  2  
ATOM 4492  C CG2  . THR A 1 135 ? 6.707   -14.564 -1.689  1.00 0.00 ? 135 THR A CG2  2  
ATOM 4493  H H    . THR A 1 135 ? 3.977   -12.824 0.089   1.00 0.00 ? 135 THR A H    2  
ATOM 4494  H HA   . THR A 1 135 ? 4.026   -14.725 -2.338  1.00 0.00 ? 135 THR A HA   2  
ATOM 4495  H HB   . THR A 1 135 ? 5.560   -16.243 -1.016  1.00 0.00 ? 135 THR A HB   2  
ATOM 4496  H HG1  . THR A 1 135 ? 5.694   -15.695 1.034   1.00 0.00 ? 135 THR A HG1  2  
ATOM 4497  H HG21 . THR A 1 135 ? 6.770   -13.466 -1.603  1.00 0.00 ? 135 THR A HG21 2  
ATOM 4498  H HG22 . THR A 1 135 ? 7.682   -14.974 -1.366  1.00 0.00 ? 135 THR A HG22 2  
ATOM 4499  H HG23 . THR A 1 135 ? 6.600   -14.807 -2.762  1.00 0.00 ? 135 THR A HG23 2  
ATOM 4500  N N    . ASN A 1 136 ? 2.582   -16.511 -1.179  1.00 0.00 ? 136 ASN A N    2  
ATOM 4501  C CA   . ASN A 1 136 ? 1.629   -17.472 -0.520  1.00 0.00 ? 136 ASN A CA   2  
ATOM 4502  C C    . ASN A 1 136 ? 2.328   -18.429 0.531   1.00 0.00 ? 136 ASN A C    2  
ATOM 4503  O O    . ASN A 1 136 ? 1.643   -18.985 1.392   1.00 0.00 ? 136 ASN A O    2  
ATOM 4504  C CB   . ASN A 1 136 ? 0.862   -18.245 -1.630  1.00 0.00 ? 136 ASN A CB   2  
ATOM 4505  C CG   . ASN A 1 136 ? 1.669   -19.079 -2.638  1.00 0.00 ? 136 ASN A CG   2  
ATOM 4506  O OD1  . ASN A 1 136 ? 2.146   -20.170 -2.351  1.00 0.00 ? 136 ASN A OD1  2  
ATOM 4507  N ND2  . ASN A 1 136 ? 1.851   -18.595 -3.844  1.00 0.00 ? 136 ASN A ND2  2  
ATOM 4508  H H    . ASN A 1 136 ? 2.931   -16.651 -2.133  1.00 0.00 ? 136 ASN A H    2  
ATOM 4509  H HA   . ASN A 1 136 ? 0.879   -16.907 0.069   1.00 0.00 ? 136 ASN A HA   2  
ATOM 4510  H HB2  . ASN A 1 136 ? 0.150   -18.938 -1.144  1.00 0.00 ? 136 ASN A HB2  2  
ATOM 4511  H HB3  . ASN A 1 136 ? 0.201   -17.536 -2.165  1.00 0.00 ? 136 ASN A HB3  2  
ATOM 4512  H HD21 . ASN A 1 136 ? 1.371   -17.718 -4.069  1.00 0.00 ? 136 ASN A HD21 2  
ATOM 4513  H HD22 . ASN A 1 136 ? 2.344   -19.233 -4.475  1.00 0.00 ? 136 ASN A HD22 2  
ATOM 4514  N N    . MET A 1 137 ? 3.661   -18.613 0.464   1.00 0.00 ? 137 MET A N    2  
ATOM 4515  C CA   . MET A 1 137 ? 4.479   -19.316 1.486   1.00 0.00 ? 137 MET A CA   2  
ATOM 4516  C C    . MET A 1 137 ? 5.306   -18.252 2.331   1.00 0.00 ? 137 MET A C    2  
ATOM 4517  O O    . MET A 1 137 ? 5.499   -17.123 1.849   1.00 0.00 ? 137 MET A O    2  
ATOM 4518  C CB   . MET A 1 137 ? 5.366   -20.362 0.750   1.00 0.00 ? 137 MET A CB   2  
ATOM 4519  C CG   . MET A 1 137 ? 6.509   -19.833 -0.148  1.00 0.00 ? 137 MET A CG   2  
ATOM 4520  S SD   . MET A 1 137 ? 7.278   -21.196 -1.048  1.00 0.00 ? 137 MET A SD   2  
ATOM 4521  C CE   . MET A 1 137 ? 6.270   -21.216 -2.543  1.00 0.00 ? 137 MET A CE   2  
ATOM 4522  H H    . MET A 1 137 ? 4.098   -18.084 -0.295  1.00 0.00 ? 137 MET A H    2  
ATOM 4523  H HA   . MET A 1 137 ? 3.811   -19.855 2.184   1.00 0.00 ? 137 MET A HA   2  
ATOM 4524  H HB2  . MET A 1 137 ? 5.811   -21.043 1.499   1.00 0.00 ? 137 MET A HB2  2  
ATOM 4525  H HB3  . MET A 1 137 ? 4.712   -21.022 0.147   1.00 0.00 ? 137 MET A HB3  2  
ATOM 4526  H HG2  . MET A 1 137 ? 6.150   -19.071 -0.865  1.00 0.00 ? 137 MET A HG2  2  
ATOM 4527  H HG3  . MET A 1 137 ? 7.283   -19.331 0.463   1.00 0.00 ? 137 MET A HG3  2  
ATOM 4528  H HE1  . MET A 1 137 ? 5.196   -21.317 -2.299  1.00 0.00 ? 137 MET A HE1  2  
ATOM 4529  H HE2  . MET A 1 137 ? 6.407   -20.282 -3.118  1.00 0.00 ? 137 MET A HE2  2  
ATOM 4530  H HE3  . MET A 1 137 ? 6.556   -22.063 -3.192  1.00 0.00 ? 137 MET A HE3  2  
ATOM 4531  N N    . PRO A 1 138 ? 5.851   -18.544 3.557   1.00 0.00 ? 138 PRO A N    2  
ATOM 4532  C CA   . PRO A 1 138 ? 6.589   -17.535 4.382   1.00 0.00 ? 138 PRO A CA   2  
ATOM 4533  C C    . PRO A 1 138 ? 7.800   -16.798 3.714   1.00 0.00 ? 138 PRO A C    2  
ATOM 4534  O O    . PRO A 1 138 ? 7.730   -15.576 3.569   1.00 0.00 ? 138 PRO A O    2  
ATOM 4535  C CB   . PRO A 1 138 ? 6.961   -18.348 5.644   1.00 0.00 ? 138 PRO A CB   2  
ATOM 4536  C CG   . PRO A 1 138 ? 5.930   -19.473 5.714   1.00 0.00 ? 138 PRO A CG   2  
ATOM 4537  C CD   . PRO A 1 138 ? 5.681   -19.837 4.252   1.00 0.00 ? 138 PRO A CD   2  
ATOM 4538  H HA   . PRO A 1 138 ? 5.881   -16.734 4.661   1.00 0.00 ? 138 PRO A HA   2  
ATOM 4539  H HB2  . PRO A 1 138 ? 7.976   -18.785 5.571   1.00 0.00 ? 138 PRO A HB2  2  
ATOM 4540  H HB3  . PRO A 1 138 ? 6.960   -17.720 6.555   1.00 0.00 ? 138 PRO A HB3  2  
ATOM 4541  H HG2  . PRO A 1 138 ? 6.276   -20.335 6.315   1.00 0.00 ? 138 PRO A HG2  2  
ATOM 4542  H HG3  . PRO A 1 138 ? 4.995   -19.107 6.182   1.00 0.00 ? 138 PRO A HG3  2  
ATOM 4543  H HD2  . PRO A 1 138 ? 6.429   -20.568 3.888   1.00 0.00 ? 138 PRO A HD2  2  
ATOM 4544  H HD3  . PRO A 1 138 ? 4.678   -20.287 4.133   1.00 0.00 ? 138 PRO A HD3  2  
ATOM 4545  N N    . ASP A 1 139 ? 8.884   -17.498 3.328   1.00 0.00 ? 139 ASP A N    2  
ATOM 4546  C CA   . ASP A 1 139 ? 10.065  -16.871 2.669   1.00 0.00 ? 139 ASP A CA   2  
ATOM 4547  C C    . ASP A 1 139 ? 10.880  -17.977 1.922   1.00 0.00 ? 139 ASP A C    2  
ATOM 4548  O O    . ASP A 1 139 ? 11.321  -18.960 2.533   1.00 0.00 ? 139 ASP A O    2  
ATOM 4549  C CB   . ASP A 1 139 ? 10.953  -16.145 3.728   1.00 0.00 ? 139 ASP A CB   2  
ATOM 4550  C CG   . ASP A 1 139 ? 12.030  -15.206 3.170   1.00 0.00 ? 139 ASP A CG   2  
ATOM 4551  O OD1  . ASP A 1 139 ? 12.859  -15.637 2.335   1.00 0.00 ? 139 ASP A OD1  2  
ATOM 4552  O OD2  . ASP A 1 139 ? 12.047  -14.021 3.562   1.00 0.00 ? 139 ASP A OD2  2  
ATOM 4553  H H    . ASP A 1 139 ? 8.831   -18.507 3.495   1.00 0.00 ? 139 ASP A H    2  
ATOM 4554  H HA   . ASP A 1 139 ? 9.702   -16.123 1.934   1.00 0.00 ? 139 ASP A HA   2  
ATOM 4555  H HB2  . ASP A 1 139 ? 10.314  -15.535 4.394   1.00 0.00 ? 139 ASP A HB2  2  
ATOM 4556  H HB3  . ASP A 1 139 ? 11.443  -16.876 4.397   1.00 0.00 ? 139 ASP A HB3  2  
ATOM 4557  N N    . GLU A 1 140 ? 11.083  -17.816 0.604   1.00 0.00 ? 140 GLU A N    2  
ATOM 4558  C CA   . GLU A 1 140 ? 11.948  -18.733 -0.206  1.00 0.00 ? 140 GLU A CA   2  
ATOM 4559  C C    . GLU A 1 140 ? 13.187  -17.948 -0.791  1.00 0.00 ? 140 GLU A C    2  
ATOM 4560  O O    . GLU A 1 140 ? 13.618  -18.177 -1.925  1.00 0.00 ? 140 GLU A O    2  
ATOM 4561  C CB   . GLU A 1 140 ? 11.066  -19.460 -1.286  1.00 0.00 ? 140 GLU A CB   2  
ATOM 4562  C CG   . GLU A 1 140 ? 9.809   -18.799 -1.930  1.00 0.00 ? 140 GLU A CG   2  
ATOM 4563  C CD   . GLU A 1 140 ? 9.967   -17.432 -2.571  1.00 0.00 ? 140 GLU A CD   2  
ATOM 4564  O OE1  . GLU A 1 140 ? 9.771   -16.426 -1.858  1.00 0.00 ? 140 GLU A OE1  2  
ATOM 4565  O OE2  . GLU A 1 140 ? 10.229  -17.358 -3.789  1.00 0.00 ? 140 GLU A OE2  2  
ATOM 4566  H H    . GLU A 1 140 ? 10.682  -16.974 0.158   1.00 0.00 ? 140 GLU A H    2  
ATOM 4567  H HA   . GLU A 1 140 ? 12.399  -19.524 0.425   1.00 0.00 ? 140 GLU A HA   2  
ATOM 4568  H HB2  . GLU A 1 140 ? 11.720  -19.821 -2.102  1.00 0.00 ? 140 GLU A HB2  2  
ATOM 4569  H HB3  . GLU A 1 140 ? 10.709  -20.396 -0.817  1.00 0.00 ? 140 GLU A HB3  2  
ATOM 4570  H HG2  . GLU A 1 140 ? 9.380   -19.466 -2.696  1.00 0.00 ? 140 GLU A HG2  2  
ATOM 4571  H HG3  . GLU A 1 140 ? 9.021   -18.689 -1.166  1.00 0.00 ? 140 GLU A HG3  2  
ATOM 4572  N N    . GLY A 1 141 ? 13.867  -17.125 0.044   1.00 0.00 ? 141 GLY A N    2  
ATOM 4573  C CA   . GLY A 1 141 ? 14.975  -16.232 -0.401  1.00 0.00 ? 141 GLY A CA   2  
ATOM 4574  C C    . GLY A 1 141 ? 14.437  -14.991 -1.149  1.00 0.00 ? 141 GLY A C    2  
ATOM 4575  O O    . GLY A 1 141 ? 14.793  -14.772 -2.309  1.00 0.00 ? 141 GLY A O    2  
ATOM 4576  H H    . GLY A 1 141 ? 13.392  -16.974 0.952   1.00 0.00 ? 141 GLY A H    2  
ATOM 4577  H HA2  . GLY A 1 141 ? 15.563  -15.901 0.475   1.00 0.00 ? 141 GLY A HA2  2  
ATOM 4578  H HA3  . GLY A 1 141 ? 15.683  -16.779 -1.052  1.00 0.00 ? 141 GLY A HA3  2  
ATOM 4579  N N    . VAL A 1 142 ? 13.619  -14.169 -0.465  1.00 0.00 ? 142 VAL A N    2  
ATOM 4580  C CA   . VAL A 1 142 ? 12.861  -13.066 -1.127  1.00 0.00 ? 142 VAL A CA   2  
ATOM 4581  C C    . VAL A 1 142 ? 13.094  -11.668 -0.451  1.00 0.00 ? 142 VAL A C    2  
ATOM 4582  O O    . VAL A 1 142 ? 14.219  -11.233 -0.191  1.00 0.00 ? 142 VAL A O    2  
ATOM 4583  C CB   . VAL A 1 142 ? 11.366  -13.604 -1.212  1.00 0.00 ? 142 VAL A CB   2  
ATOM 4584  C CG1  . VAL A 1 142 ? 10.617  -13.854 0.120   1.00 0.00 ? 142 VAL A CG1  2  
ATOM 4585  C CG2  . VAL A 1 142 ? 10.457  -12.880 -2.235  1.00 0.00 ? 142 VAL A CG2  2  
ATOM 4586  H H    . VAL A 1 142 ? 13.397  -14.496 0.489   1.00 0.00 ? 142 VAL A H    2  
ATOM 4587  H HA   . VAL A 1 142 ? 13.223  -12.911 -2.163  1.00 0.00 ? 142 VAL A HA   2  
ATOM 4588  H HB   . VAL A 1 142 ? 11.439  -14.605 -1.633  1.00 0.00 ? 142 VAL A HB   2  
ATOM 4589  H HG11 . VAL A 1 142 ? 10.641  -13.006 0.824   1.00 0.00 ? 142 VAL A HG11 2  
ATOM 4590  H HG12 . VAL A 1 142 ? 9.562   -14.149 -0.034  1.00 0.00 ? 142 VAL A HG12 2  
ATOM 4591  H HG13 . VAL A 1 142 ? 11.082  -14.697 0.657   1.00 0.00 ? 142 VAL A HG13 2  
ATOM 4592  H HG21 . VAL A 1 142 ? 10.972  -12.723 -3.201  1.00 0.00 ? 142 VAL A HG21 2  
ATOM 4593  H HG22 . VAL A 1 142 ? 9.565   -13.495 -2.461  1.00 0.00 ? 142 VAL A HG22 2  
ATOM 4594  H HG23 . VAL A 1 142 ? 10.083  -11.899 -1.896  1.00 0.00 ? 142 VAL A HG23 2  
ATOM 4595  N N    . MET A 1 143 ? 11.992  -10.943 -0.284  1.00 0.00 ? 143 MET A N    2  
ATOM 4596  C CA   . MET A 1 143 ? 11.947  -9.554  0.263   1.00 0.00 ? 143 MET A CA   2  
ATOM 4597  C C    . MET A 1 143 ? 11.667  -9.507  1.805   1.00 0.00 ? 143 MET A C    2  
ATOM 4598  O O    . MET A 1 143 ? 11.248  -10.489 2.428   1.00 0.00 ? 143 MET A O    2  
ATOM 4599  C CB   . MET A 1 143 ? 10.862  -8.759  -0.534  1.00 0.00 ? 143 MET A CB   2  
ATOM 4600  C CG   . MET A 1 143 ? 11.047  -8.658  -2.069  1.00 0.00 ? 143 MET A CG   2  
ATOM 4601  S SD   . MET A 1 143 ? 12.770  -8.380  -2.532  1.00 0.00 ? 143 MET A SD   2  
ATOM 4602  C CE   . MET A 1 143 ? 12.561  -8.091  -4.295  1.00 0.00 ? 143 MET A CE   2  
ATOM 4603  H H    . MET A 1 143 ? 11.206  -11.560 -0.562  1.00 0.00 ? 143 MET A H    2  
ATOM 4604  H HA   . MET A 1 143 ? 12.928  -9.063  0.104   1.00 0.00 ? 143 MET A HA   2  
ATOM 4605  H HB2  . MET A 1 143 ? 9.845   -9.133  -0.311  1.00 0.00 ? 143 MET A HB2  2  
ATOM 4606  H HB3  . MET A 1 143 ? 10.808  -7.733  -0.132  1.00 0.00 ? 143 MET A HB3  2  
ATOM 4607  H HG2  . MET A 1 143 ? 10.711  -9.591  -2.557  1.00 0.00 ? 143 MET A HG2  2  
ATOM 4608  H HG3  . MET A 1 143 ? 10.421  -7.846  -2.484  1.00 0.00 ? 143 MET A HG3  2  
ATOM 4609  H HE1  . MET A 1 143 ? 11.878  -7.241  -4.473  1.00 0.00 ? 143 MET A HE1  2  
ATOM 4610  H HE2  . MET A 1 143 ? 13.536  -7.856  -4.756  1.00 0.00 ? 143 MET A HE2  2  
ATOM 4611  H HE3  . MET A 1 143 ? 12.149  -8.985  -4.799  1.00 0.00 ? 143 MET A HE3  2  
ATOM 4612  N N    . VAL A 1 144 ? 11.912  -8.341  2.439   1.00 0.00 ? 144 VAL A N    2  
ATOM 4613  C CA   . VAL A 1 144 ? 11.709  -8.158  3.908   1.00 0.00 ? 144 VAL A CA   2  
ATOM 4614  C C    . VAL A 1 144 ? 10.188  -7.928  4.187   1.00 0.00 ? 144 VAL A C    2  
ATOM 4615  O O    . VAL A 1 144 ? 9.596   -6.918  3.796   1.00 0.00 ? 144 VAL A O    2  
ATOM 4616  C CB   . VAL A 1 144 ? 12.597  -6.972  4.438   1.00 0.00 ? 144 VAL A CB   2  
ATOM 4617  C CG1  . VAL A 1 144 ? 12.280  -6.493  5.878   1.00 0.00 ? 144 VAL A CG1  2  
ATOM 4618  C CG2  . VAL A 1 144 ? 14.098  -7.332  4.456   1.00 0.00 ? 144 VAL A CG2  2  
ATOM 4619  H H    . VAL A 1 144 ? 12.216  -7.559  1.848   1.00 0.00 ? 144 VAL A H    2  
ATOM 4620  H HA   . VAL A 1 144 ? 12.042  -9.075  4.438   1.00 0.00 ? 144 VAL A HA   2  
ATOM 4621  H HB   . VAL A 1 144 ? 12.451  -6.102  3.765   1.00 0.00 ? 144 VAL A HB   2  
ATOM 4622  H HG11 . VAL A 1 144 ? 12.410  -7.296  6.627   1.00 0.00 ? 144 VAL A HG11 2  
ATOM 4623  H HG12 . VAL A 1 144 ? 12.922  -5.648  6.190   1.00 0.00 ? 144 VAL A HG12 2  
ATOM 4624  H HG13 . VAL A 1 144 ? 11.240  -6.129  5.974   1.00 0.00 ? 144 VAL A HG13 2  
ATOM 4625  H HG21 . VAL A 1 144 ? 14.422  -7.753  3.491   1.00 0.00 ? 144 VAL A HG21 2  
ATOM 4626  H HG22 . VAL A 1 144 ? 14.730  -6.447  4.654   1.00 0.00 ? 144 VAL A HG22 2  
ATOM 4627  H HG23 . VAL A 1 144 ? 14.345  -8.090  5.223   1.00 0.00 ? 144 VAL A HG23 2  
ATOM 4628  N N    . THR A 1 145 ? 9.599   -8.867  4.937   1.00 0.00 ? 145 THR A N    2  
ATOM 4629  C CA   . THR A 1 145 ? 8.168   -8.813  5.357   1.00 0.00 ? 145 THR A CA   2  
ATOM 4630  C C    . THR A 1 145 ? 7.867   -7.868  6.575   1.00 0.00 ? 145 THR A C    2  
ATOM 4631  O O    . THR A 1 145 ? 6.741   -7.372  6.640   1.00 0.00 ? 145 THR A O    2  
ATOM 4632  C CB   . THR A 1 145 ? 7.729   -10.292 5.628   1.00 0.00 ? 145 THR A CB   2  
ATOM 4633  O OG1  . THR A 1 145 ? 6.337   -10.328 5.912   1.00 0.00 ? 145 THR A OG1  2  
ATOM 4634  C CG2  . THR A 1 145 ? 8.406   -11.037 6.798   1.00 0.00 ? 145 THR A CG2  2  
ATOM 4635  H H    . THR A 1 145 ? 10.202  -9.664  5.166   1.00 0.00 ? 145 THR A H    2  
ATOM 4636  H HA   . THR A 1 145 ? 7.544   -8.422  4.520   1.00 0.00 ? 145 THR A HA   2  
ATOM 4637  H HB   . THR A 1 145 ? 7.916   -10.856 4.696   1.00 0.00 ? 145 THR A HB   2  
ATOM 4638  H HG1  . THR A 1 145 ? 6.162   -11.205 6.262   1.00 0.00 ? 145 THR A HG1  2  
ATOM 4639  H HG21 . THR A 1 145 ? 9.509   -11.016 6.722   1.00 0.00 ? 145 THR A HG21 2  
ATOM 4640  H HG22 . THR A 1 145 ? 8.137   -10.606 7.777   1.00 0.00 ? 145 THR A HG22 2  
ATOM 4641  H HG23 . THR A 1 145 ? 8.120   -12.105 6.817   1.00 0.00 ? 145 THR A HG23 2  
ATOM 4642  N N    . LYS A 1 146 ? 8.797   -7.612  7.528   1.00 0.00 ? 146 LYS A N    2  
ATOM 4643  C CA   . LYS A 1 146 ? 8.515   -6.750  8.716   1.00 0.00 ? 146 LYS A CA   2  
ATOM 4644  C C    . LYS A 1 146 ? 9.098   -5.303  8.541   1.00 0.00 ? 146 LYS A C    2  
ATOM 4645  O O    . LYS A 1 146 ? 10.273  -5.106  8.224   1.00 0.00 ? 146 LYS A O    2  
ATOM 4646  C CB   . LYS A 1 146 ? 9.005   -7.498  9.990   1.00 0.00 ? 146 LYS A CB   2  
ATOM 4647  C CG   . LYS A 1 146 ? 7.963   -8.565  10.430  1.00 0.00 ? 146 LYS A CG   2  
ATOM 4648  C CD   . LYS A 1 146 ? 8.303   -9.459  11.635  1.00 0.00 ? 146 LYS A CD   2  
ATOM 4649  C CE   . LYS A 1 146 ? 8.254   -8.718  12.983  1.00 0.00 ? 146 LYS A CE   2  
ATOM 4650  N NZ   . LYS A 1 146 ? 8.067   -9.696  14.088  1.00 0.00 ? 146 LYS A NZ   2  
ATOM 4651  H H    . LYS A 1 146 ? 9.701   -8.066  7.365   1.00 0.00 ? 146 LYS A H    2  
ATOM 4652  H HA   . LYS A 1 146 ? 7.428   -6.642  8.805   1.00 0.00 ? 146 LYS A HA   2  
ATOM 4653  H HB2  . LYS A 1 146 ? 10.008  -7.943  9.837   1.00 0.00 ? 146 LYS A HB2  2  
ATOM 4654  H HB3  . LYS A 1 146 ? 9.138   -6.775  10.817  1.00 0.00 ? 146 LYS A HB3  2  
ATOM 4655  H HG2  . LYS A 1 146 ? 6.992   -8.063  10.620  1.00 0.00 ? 146 LYS A HG2  2  
ATOM 4656  H HG3  . LYS A 1 146 ? 7.754   -9.229  9.569   1.00 0.00 ? 146 LYS A HG3  2  
ATOM 4657  H HD2  . LYS A 1 146 ? 7.566   -10.289 11.625  1.00 0.00 ? 146 LYS A HD2  2  
ATOM 4658  H HD3  . LYS A 1 146 ? 9.287   -9.946  11.485  1.00 0.00 ? 146 LYS A HD3  2  
ATOM 4659  H HE2  . LYS A 1 146 ? 9.187   -8.128  13.112  1.00 0.00 ? 146 LYS A HE2  2  
ATOM 4660  H HE3  . LYS A 1 146 ? 7.437   -7.960  12.993  1.00 0.00 ? 146 LYS A HE3  2  
ATOM 4661  H HZ1  . LYS A 1 146 ? 8.528   -10.597 13.912  1.00 0.00 ? 146 LYS A HZ1  2  
ATOM 4662  H HZ2  . LYS A 1 146 ? 8.409   -9.361  14.997  1.00 0.00 ? 146 LYS A HZ2  2  
ATOM 4663  H HZ3  . LYS A 1 146 ? 7.062   -9.911  14.240  1.00 0.00 ? 146 LYS A HZ3  2  
ATOM 4664  N N    . PHE A 1 147 ? 8.241   -4.289  8.782   1.00 0.00 ? 147 PHE A N    2  
ATOM 4665  C CA   . PHE A 1 147 ? 8.531   -2.844  8.502   1.00 0.00 ? 147 PHE A CA   2  
ATOM 4666  C C    . PHE A 1 147 ? 7.839   -1.845  9.512   1.00 0.00 ? 147 PHE A C    2  
ATOM 4667  O O    . PHE A 1 147 ? 7.148   -2.244  10.458  1.00 0.00 ? 147 PHE A O    2  
ATOM 4668  C CB   . PHE A 1 147 ? 8.063   -2.591  7.020   1.00 0.00 ? 147 PHE A CB   2  
ATOM 4669  C CG   . PHE A 1 147 ? 6.544   -2.721  6.751   1.00 0.00 ? 147 PHE A CG   2  
ATOM 4670  C CD1  . PHE A 1 147 ? 5.991   -3.981  6.508   1.00 0.00 ? 147 PHE A CD1  2  
ATOM 4671  C CD2  . PHE A 1 147 ? 5.696   -1.617  6.883   1.00 0.00 ? 147 PHE A CD2  2  
ATOM 4672  C CE1  . PHE A 1 147 ? 4.613   -4.137  6.411   1.00 0.00 ? 147 PHE A CE1  2  
ATOM 4673  C CE2  . PHE A 1 147 ? 4.316   -1.785  6.815   1.00 0.00 ? 147 PHE A CE2  2  
ATOM 4674  C CZ   . PHE A 1 147 ? 3.776   -3.045  6.589   1.00 0.00 ? 147 PHE A CZ   2  
ATOM 4675  H H    . PHE A 1 147 ? 7.286   -4.593  9.036   1.00 0.00 ? 147 PHE A H    2  
ATOM 4676  H HA   . PHE A 1 147 ? 9.621   -2.657  8.576   1.00 0.00 ? 147 PHE A HA   2  
ATOM 4677  H HB2  . PHE A 1 147 ? 8.404   -1.588  6.697   1.00 0.00 ? 147 PHE A HB2  2  
ATOM 4678  H HB3  . PHE A 1 147 ? 8.619   -3.265  6.339   1.00 0.00 ? 147 PHE A HB3  2  
ATOM 4679  H HD1  . PHE A 1 147 ? 6.630   -4.845  6.405   1.00 0.00 ? 147 PHE A HD1  2  
ATOM 4680  H HD2  . PHE A 1 147 ? 6.103   -0.638  7.084   1.00 0.00 ? 147 PHE A HD2  2  
ATOM 4681  H HE1  . PHE A 1 147 ? 4.196   -5.101  6.182   1.00 0.00 ? 147 PHE A HE1  2  
ATOM 4682  H HE2  . PHE A 1 147 ? 3.659   -0.945  6.952   1.00 0.00 ? 147 PHE A HE2  2  
ATOM 4683  H HZ   . PHE A 1 147 ? 2.706   -3.178  6.541   1.00 0.00 ? 147 PHE A HZ   2  
ATOM 4684  N N    . TYR A 1 148 ? 8.030   -0.523  9.299   1.00 0.00 ? 148 TYR A N    2  
ATOM 4685  C CA   . TYR A 1 148 ? 7.392   0.551   10.116  1.00 0.00 ? 148 TYR A CA   2  
ATOM 4686  C C    . TYR A 1 148 ? 6.189   1.193   9.339   1.00 0.00 ? 148 TYR A C    2  
ATOM 4687  O O    . TYR A 1 148 ? 6.333   1.868   8.312   1.00 0.00 ? 148 TYR A O    2  
ATOM 4688  C CB   . TYR A 1 148 ? 8.472   1.607   10.501  1.00 0.00 ? 148 TYR A CB   2  
ATOM 4689  C CG   . TYR A 1 148 ? 9.256   1.198   11.756  1.00 0.00 ? 148 TYR A CG   2  
ATOM 4690  C CD1  . TYR A 1 148 ? 8.723   1.479   13.019  1.00 0.00 ? 148 TYR A CD1  2  
ATOM 4691  C CD2  . TYR A 1 148 ? 10.389  0.385   11.652  1.00 0.00 ? 148 TYR A CD2  2  
ATOM 4692  C CE1  . TYR A 1 148 ? 9.285   0.910   14.158  1.00 0.00 ? 148 TYR A CE1  2  
ATOM 4693  C CE2  . TYR A 1 148 ? 10.960  -0.169  12.796  1.00 0.00 ? 148 TYR A CE2  2  
ATOM 4694  C CZ   . TYR A 1 148 ? 10.391  0.074   14.042  1.00 0.00 ? 148 TYR A CZ   2  
ATOM 4695  O OH   . TYR A 1 148 ? 10.766  -0.679  15.119  1.00 0.00 ? 148 TYR A OH   2  
ATOM 4696  H H    . TYR A 1 148 ? 8.610   -0.274  8.481   1.00 0.00 ? 148 TYR A H    2  
ATOM 4697  H HA   . TYR A 1 148 ? 6.998   0.123   11.063  1.00 0.00 ? 148 TYR A HA   2  
ATOM 4698  H HB2  . TYR A 1 148 ? 9.154   1.821   9.654   1.00 0.00 ? 148 TYR A HB2  2  
ATOM 4699  H HB3  . TYR A 1 148 ? 7.990   2.584   10.696  1.00 0.00 ? 148 TYR A HB3  2  
ATOM 4700  H HD1  . TYR A 1 148 ? 7.825   2.072   13.118  1.00 0.00 ? 148 TYR A HD1  2  
ATOM 4701  H HD2  . TYR A 1 148 ? 10.782  0.119   10.682  1.00 0.00 ? 148 TYR A HD2  2  
ATOM 4702  H HE1  . TYR A 1 148 ? 8.826   1.066   15.123  1.00 0.00 ? 148 TYR A HE1  2  
ATOM 4703  H HE2  . TYR A 1 148 ? 11.789  -0.855  12.711  1.00 0.00 ? 148 TYR A HE2  2  
ATOM 4704  H HH   . TYR A 1 148 ? 9.975   -1.184  15.378  1.00 0.00 ? 148 TYR A HH   2  
ATOM 4705  N N    . PHE A 1 149 ? 4.989   0.966   9.890   1.00 0.00 ? 149 PHE A N    2  
ATOM 4706  C CA   . PHE A 1 149 ? 3.683   1.428   9.343   1.00 0.00 ? 149 PHE A CA   2  
ATOM 4707  C C    . PHE A 1 149 ? 3.196   2.747   10.021  1.00 0.00 ? 149 PHE A C    2  
ATOM 4708  O O    . PHE A 1 149 ? 3.139   2.790   11.256  1.00 0.00 ? 149 PHE A O    2  
ATOM 4709  C CB   . PHE A 1 149 ? 2.738   0.215   9.635   1.00 0.00 ? 149 PHE A CB   2  
ATOM 4710  C CG   . PHE A 1 149 ? 1.279   0.238   9.149   1.00 0.00 ? 149 PHE A CG   2  
ATOM 4711  C CD1  . PHE A 1 149 ? 0.339   1.053   9.791   1.00 0.00 ? 149 PHE A CD1  2  
ATOM 4712  C CD2  . PHE A 1 149 ? 0.844   -0.641  8.147   1.00 0.00 ? 149 PHE A CD2  2  
ATOM 4713  C CE1  . PHE A 1 149 ? -0.997  1.019   9.411   1.00 0.00 ? 149 PHE A CE1  2  
ATOM 4714  C CE2  . PHE A 1 149 ? -0.498  -0.679  7.778   1.00 0.00 ? 149 PHE A CE2  2  
ATOM 4715  C CZ   . PHE A 1 149 ? -1.417  0.151   8.413   1.00 0.00 ? 149 PHE A CZ   2  
ATOM 4716  H H    . PHE A 1 149 ? 5.020   0.389   10.737  1.00 0.00 ? 149 PHE A H    2  
ATOM 4717  H HA   . PHE A 1 149 ? 3.756   1.599   8.251   1.00 0.00 ? 149 PHE A HA   2  
ATOM 4718  H HB2  . PHE A 1 149 ? 3.214   -0.705  9.247   1.00 0.00 ? 149 PHE A HB2  2  
ATOM 4719  H HB3  . PHE A 1 149 ? 2.705   0.034   10.729  1.00 0.00 ? 149 PHE A HB3  2  
ATOM 4720  H HD1  . PHE A 1 149 ? 0.635   1.725   10.585  1.00 0.00 ? 149 PHE A HD1  2  
ATOM 4721  H HD2  . PHE A 1 149 ? 1.532   -1.316  7.664   1.00 0.00 ? 149 PHE A HD2  2  
ATOM 4722  H HE1  . PHE A 1 149 ? -1.706  1.693   9.868   1.00 0.00 ? 149 PHE A HE1  2  
ATOM 4723  H HE2  . PHE A 1 149 ? -0.831  -1.360  7.012   1.00 0.00 ? 149 PHE A HE2  2  
ATOM 4724  H HZ   . PHE A 1 149 ? -2.455  0.147   8.124   1.00 0.00 ? 149 PHE A HZ   2  
ATOM 4725  N N    . GLN A 1 150 ? 2.783   3.793   9.266   1.00 0.00 ? 150 GLN A N    2  
ATOM 4726  C CA   . GLN A 1 150 ? 2.268   5.043   9.905   1.00 0.00 ? 150 GLN A CA   2  
ATOM 4727  C C    . GLN A 1 150 ? 1.143   5.739   9.069   1.00 0.00 ? 150 GLN A C    2  
ATOM 4728  O O    . GLN A 1 150 ? 1.356   6.261   7.970   1.00 0.00 ? 150 GLN A O    2  
ATOM 4729  C CB   . GLN A 1 150 ? 3.452   6.010   10.215  1.00 0.00 ? 150 GLN A CB   2  
ATOM 4730  C CG   . GLN A 1 150 ? 4.420   6.432   9.070   1.00 0.00 ? 150 GLN A CG   2  
ATOM 4731  C CD   . GLN A 1 150 ? 5.631   7.284   9.471   1.00 0.00 ? 150 GLN A CD   2  
ATOM 4732  O OE1  . GLN A 1 150 ? 5.954   8.294   8.853   1.00 0.00 ? 150 GLN A OE1  2  
ATOM 4733  N NE2  . GLN A 1 150 ? 6.401   6.895   10.461  1.00 0.00 ? 150 GLN A NE2  2  
ATOM 4734  H H    . GLN A 1 150 ? 2.871   3.727   8.237   1.00 0.00 ? 150 GLN A H    2  
ATOM 4735  H HA   . GLN A 1 150 ? 1.818   4.793   10.890  1.00 0.00 ? 150 GLN A HA   2  
ATOM 4736  H HB2  . GLN A 1 150 ? 3.040   6.927   10.681  1.00 0.00 ? 150 GLN A HB2  2  
ATOM 4737  H HB3  . GLN A 1 150 ? 4.038   5.536   11.025  1.00 0.00 ? 150 GLN A HB3  2  
ATOM 4738  H HG2  . GLN A 1 150 ? 4.794   5.542   8.533   1.00 0.00 ? 150 GLN A HG2  2  
ATOM 4739  H HG3  . GLN A 1 150 ? 3.842   6.997   8.315   1.00 0.00 ? 150 GLN A HG3  2  
ATOM 4740  H HE21 . GLN A 1 150 ? 6.062   6.081   10.982  1.00 0.00 ? 150 GLN A HE21 2  
ATOM 4741  H HE22 . GLN A 1 150 ? 7.060   7.608   10.784  1.00 0.00 ? 150 GLN A HE22 2  
ATOM 4742  N N    . GLU A 1 151 ? -0.064  5.795   9.661   1.00 0.00 ? 151 GLU A N    2  
ATOM 4743  C CA   . GLU A 1 151 ? -1.231  6.520   9.092   1.00 0.00 ? 151 GLU A CA   2  
ATOM 4744  C C    . GLU A 1 151 ? -1.142  8.063   9.408   1.00 0.00 ? 151 GLU A C    2  
ATOM 4745  O O    . GLU A 1 151 ? -1.444  8.526   10.511  1.00 0.00 ? 151 GLU A O    2  
ATOM 4746  C CB   . GLU A 1 151 ? -2.540  5.819   9.592   1.00 0.00 ? 151 GLU A CB   2  
ATOM 4747  C CG   . GLU A 1 151 ? -2.784  5.524   11.108  1.00 0.00 ? 151 GLU A CG   2  
ATOM 4748  C CD   . GLU A 1 151 ? -2.849  4.048   11.515  1.00 0.00 ? 151 GLU A CD   2  
ATOM 4749  O OE1  . GLU A 1 151 ? -1.794  3.444   11.794  1.00 0.00 ? 151 GLU A OE1  2  
ATOM 4750  O OE2  . GLU A 1 151 ? -3.955  3.469   11.581  1.00 0.00 ? 151 GLU A OE2  2  
ATOM 4751  H H    . GLU A 1 151 ? -0.148  5.281   10.544  1.00 0.00 ? 151 GLU A H    2  
ATOM 4752  H HA   . GLU A 1 151 ? -1.228  6.424   7.993   1.00 0.00 ? 151 GLU A HA   2  
ATOM 4753  H HB2  . GLU A 1 151 ? -3.393  6.424   9.228   1.00 0.00 ? 151 GLU A HB2  2  
ATOM 4754  H HB3  . GLU A 1 151 ? -2.653  4.873   9.029   1.00 0.00 ? 151 GLU A HB3  2  
ATOM 4755  H HG2  . GLU A 1 151 ? -2.025  6.021   11.737  1.00 0.00 ? 151 GLU A HG2  2  
ATOM 4756  H HG3  . GLU A 1 151 ? -3.739  5.982   11.419  1.00 0.00 ? 151 GLU A HG3  2  
ATOM 4757  N N    . ASP A 1 152 ? -0.696  8.846   8.400   1.00 0.00 ? 152 ASP A N    2  
ATOM 4758  C CA   . ASP A 1 152 ? -0.540  10.329  8.472   1.00 0.00 ? 152 ASP A CA   2  
ATOM 4759  C C    . ASP A 1 152 ? -1.907  11.113  8.569   1.00 0.00 ? 152 ASP A C    2  
ATOM 4760  O O    . ASP A 1 152 ? -2.955  10.640  8.111   1.00 0.00 ? 152 ASP A O    2  
ATOM 4761  C CB   . ASP A 1 152 ? 0.182   10.804  7.163   1.00 0.00 ? 152 ASP A CB   2  
ATOM 4762  C CG   . ASP A 1 152 ? 1.616   10.387  6.804   1.00 0.00 ? 152 ASP A CG   2  
ATOM 4763  O OD1  . ASP A 1 152 ? 2.283   9.648   7.557   1.00 0.00 ? 152 ASP A OD1  2  
ATOM 4764  O OD2  . ASP A 1 152 ? 2.086   10.821  5.726   1.00 0.00 ? 152 ASP A OD2  2  
ATOM 4765  H H    . ASP A 1 152 ? -0.468  8.343   7.540   1.00 0.00 ? 152 ASP A H    2  
ATOM 4766  H HA   . ASP A 1 152 ? 0.087   10.583  9.349   1.00 0.00 ? 152 ASP A HA   2  
ATOM 4767  H HB2  . ASP A 1 152 ? -0.442  10.545  6.290   1.00 0.00 ? 152 ASP A HB2  2  
ATOM 4768  H HB3  . ASP A 1 152 ? 0.204   11.909  7.159   1.00 0.00 ? 152 ASP A HB3  2  
ATOM 4769  N N    . GLU A 1 153 ? -1.894  12.338  9.132   1.00 0.00 ? 153 GLU A N    2  
ATOM 4770  C CA   . GLU A 1 153 ? -3.094  13.224  9.167   1.00 0.00 ? 153 GLU A CA   2  
ATOM 4771  C C    . GLU A 1 153 ? -2.694  14.716  8.949   1.00 0.00 ? 153 GLU A C    2  
ATOM 4772  O O    . GLU A 1 153 ? -3.541  15.472  8.420   1.00 0.00 ? 153 GLU A O    2  
ATOM 4773  C CB   . GLU A 1 153 ? -3.922  13.024  10.474  1.00 0.00 ? 153 GLU A CB   2  
ATOM 4774  C CG   . GLU A 1 153 ? -3.387  13.599  11.821  1.00 0.00 ? 153 GLU A CG   2  
ATOM 4775  C CD   . GLU A 1 153 ? -4.459  14.135  12.765  1.00 0.00 ? 153 GLU A CD   2  
ATOM 4776  O OE1  . GLU A 1 153 ? -5.053  15.190  12.448  1.00 0.00 ? 153 GLU A OE1  2  
ATOM 4777  O OE2  . GLU A 1 153 ? -4.705  13.520  13.821  1.00 0.00 ? 153 GLU A OE2  2  
ATOM 4778  O OXT  . GLU A 1 153 ? -1.587  15.164  9.332   1.00 0.00 ? 153 GLU A OXT  2  
ATOM 4779  H H    . GLU A 1 153 ? -0.993  12.675  9.484   1.00 0.00 ? 153 GLU A H    2  
ATOM 4780  H HA   . GLU A 1 153 ? -3.754  12.977  8.311   1.00 0.00 ? 153 GLU A HA   2  
ATOM 4781  H HB2  . GLU A 1 153 ? -4.916  13.462  10.269  1.00 0.00 ? 153 GLU A HB2  2  
ATOM 4782  H HB3  . GLU A 1 153 ? -4.148  11.948  10.604  1.00 0.00 ? 153 GLU A HB3  2  
ATOM 4783  H HG2  . GLU A 1 153 ? -2.793  12.835  12.352  1.00 0.00 ? 153 GLU A HG2  2  
ATOM 4784  H HG3  . GLU A 1 153 ? -2.685  14.432  11.643  1.00 0.00 ? 153 GLU A HG3  2  
ATOM 4785  N N    . MET A 1 1   ? -8.017  5.715   -0.255  1.00 0.00 ? 1   MET A N    3  
ATOM 4786  C CA   . MET A 1 1   ? -8.990  6.064   -1.341  1.00 0.00 ? 1   MET A CA   3  
ATOM 4787  C C    . MET A 1 1   ? -9.976  7.205   -0.904  1.00 0.00 ? 1   MET A C    3  
ATOM 4788  O O    . MET A 1 1   ? -9.967  7.660   0.241   1.00 0.00 ? 1   MET A O    3  
ATOM 4789  C CB   . MET A 1 1   ? -9.685  4.737   -1.761  1.00 0.00 ? 1   MET A CB   3  
ATOM 4790  C CG   . MET A 1 1   ? -8.910  3.933   -2.829  1.00 0.00 ? 1   MET A CG   3  
ATOM 4791  S SD   . MET A 1 1   ? -9.264  4.586   -4.475  1.00 0.00 ? 1   MET A SD   3  
ATOM 4792  C CE   . MET A 1 1   ? -10.696 3.581   -4.914  1.00 0.00 ? 1   MET A CE   3  
ATOM 4793  H H1   . MET A 1 1   ? -7.647  6.574   0.253   1.00 0.00 ? 1   MET A H1   3  
ATOM 4794  H H2   . MET A 1 1   ? -8.464  5.190   0.504   1.00 0.00 ? 1   MET A H2   3  
ATOM 4795  H H3   . MET A 1 1   ? -7.204  5.161   -0.543  1.00 0.00 ? 1   MET A H3   3  
ATOM 4796  H HA   . MET A 1 1   ? -8.439  6.487   -2.209  1.00 0.00 ? 1   MET A HA   3  
ATOM 4797  H HB2  . MET A 1 1   ? -9.896  4.090   -0.887  1.00 0.00 ? 1   MET A HB2  3  
ATOM 4798  H HB3  . MET A 1 1   ? -10.693 4.943   -2.176  1.00 0.00 ? 1   MET A HB3  3  
ATOM 4799  H HG2  . MET A 1 1   ? -7.820  3.949   -2.658  1.00 0.00 ? 1   MET A HG2  3  
ATOM 4800  H HG3  . MET A 1 1   ? -9.183  2.862   -2.808  1.00 0.00 ? 1   MET A HG3  3  
ATOM 4801  H HE1  . MET A 1 1   ? -10.446 2.505   -4.922  1.00 0.00 ? 1   MET A HE1  3  
ATOM 4802  H HE2  . MET A 1 1   ? -11.519 3.744   -4.195  1.00 0.00 ? 1   MET A HE2  3  
ATOM 4803  H HE3  . MET A 1 1   ? -11.067 3.860   -5.916  1.00 0.00 ? 1   MET A HE3  3  
ATOM 4804  N N    . ARG A 1 2   ? -10.781 7.725   -1.855  1.00 0.00 ? 2   ARG A N    3  
ATOM 4805  C CA   . ARG A 1 2   ? -11.710 8.892   -1.664  1.00 0.00 ? 2   ARG A CA   3  
ATOM 4806  C C    . ARG A 1 2   ? -10.886 10.206  -1.336  1.00 0.00 ? 2   ARG A C    3  
ATOM 4807  O O    . ARG A 1 2   ? -10.960 10.695  -0.201  1.00 0.00 ? 2   ARG A O    3  
ATOM 4808  C CB   . ARG A 1 2   ? -12.839 8.533   -0.635  1.00 0.00 ? 2   ARG A CB   3  
ATOM 4809  C CG   . ARG A 1 2   ? -14.272 8.967   -1.037  1.00 0.00 ? 2   ARG A CG   3  
ATOM 4810  C CD   . ARG A 1 2   ? -14.613 10.462  -0.885  1.00 0.00 ? 2   ARG A CD   3  
ATOM 4811  N NE   . ARG A 1 2   ? -16.028 10.644  -1.323  1.00 0.00 ? 2   ARG A NE   3  
ATOM 4812  C CZ   . ARG A 1 2   ? -16.812 11.683  -1.051  1.00 0.00 ? 2   ARG A CZ   3  
ATOM 4813  N NH1  . ARG A 1 2   ? -16.399 12.780  -0.481  1.00 0.00 ? 2   ARG A NH1  3  
ATOM 4814  N NH2  . ARG A 1 2   ? -18.061 11.601  -1.398  1.00 0.00 ? 2   ARG A NH2  3  
ATOM 4815  H H    . ARG A 1 2   ? -10.776 7.249   -2.776  1.00 0.00 ? 2   ARG A H    3  
ATOM 4816  H HA   . ARG A 1 2   ? -12.193 9.080   -2.640  1.00 0.00 ? 2   ARG A HA   3  
ATOM 4817  H HB2  . ARG A 1 2   ? -12.884 7.433   -0.514  1.00 0.00 ? 2   ARG A HB2  3  
ATOM 4818  H HB3  . ARG A 1 2   ? -12.583 8.884   0.383   1.00 0.00 ? 2   ARG A HB3  3  
ATOM 4819  H HG2  . ARG A 1 2   ? -14.458 8.640   -2.082  1.00 0.00 ? 2   ARG A HG2  3  
ATOM 4820  H HG3  . ARG A 1 2   ? -14.983 8.374   -0.428  1.00 0.00 ? 2   ARG A HG3  3  
ATOM 4821  H HD2  . ARG A 1 2   ? -14.464 10.773  0.168   1.00 0.00 ? 2   ARG A HD2  3  
ATOM 4822  H HD3  . ARG A 1 2   ? -13.924 11.084  -1.492  1.00 0.00 ? 2   ARG A HD3  3  
ATOM 4823  H HE   . ARG A 1 2   ? -16.522 9.906   -1.850  1.00 0.00 ? 2   ARG A HE   3  
ATOM 4824  H HH11 . ARG A 1 2   ? -15.374 12.847  -0.417  1.00 0.00 ? 2   ARG A HH11 3  
ATOM 4825  H HH12 . ARG A 1 2   ? -17.046 13.557  -0.350  1.00 0.00 ? 2   ARG A HH12 3  
ATOM 4826  H HH21 . ARG A 1 2   ? -18.312 10.741  -1.910  1.00 0.00 ? 2   ARG A HH21 3  
ATOM 4827  H HH22 . ARG A 1 2   ? -18.659 12.410  -1.230  1.00 0.00 ? 2   ARG A HH22 3  
ATOM 4828  N N    . PRO A 1 3   ? -10.105 10.824  -2.285  1.00 0.00 ? 3   PRO A N    3  
ATOM 4829  C CA   . PRO A 1 3   ? -9.262  12.022  -1.985  1.00 0.00 ? 3   PRO A CA   3  
ATOM 4830  C C    . PRO A 1 3   ? -10.031 13.350  -1.681  1.00 0.00 ? 3   PRO A C    3  
ATOM 4831  O O    . PRO A 1 3   ? -9.658  14.058  -0.741  1.00 0.00 ? 3   PRO A O    3  
ATOM 4832  C CB   . PRO A 1 3   ? -8.350  12.085  -3.229  1.00 0.00 ? 3   PRO A CB   3  
ATOM 4833  C CG   . PRO A 1 3   ? -9.141  11.424  -4.363  1.00 0.00 ? 3   PRO A CG   3  
ATOM 4834  C CD   . PRO A 1 3   ? -9.942  10.324  -3.668  1.00 0.00 ? 3   PRO A CD   3  
ATOM 4835  H HA   . PRO A 1 3   ? -8.640  11.825  -1.089  1.00 0.00 ? 3   PRO A HA   3  
ATOM 4836  H HB2  . PRO A 1 3   ? -8.018  13.110  -3.481  1.00 0.00 ? 3   PRO A HB2  3  
ATOM 4837  H HB3  . PRO A 1 3   ? -7.427  11.504  -3.034  1.00 0.00 ? 3   PRO A HB3  3  
ATOM 4838  H HG2  . PRO A 1 3   ? -9.825  12.156  -4.833  1.00 0.00 ? 3   PRO A HG2  3  
ATOM 4839  H HG3  . PRO A 1 3   ? -8.490  11.027  -5.164  1.00 0.00 ? 3   PRO A HG3  3  
ATOM 4840  H HD2  . PRO A 1 3   ? -10.908 10.145  -4.179  1.00 0.00 ? 3   PRO A HD2  3  
ATOM 4841  H HD3  . PRO A 1 3   ? -9.381  9.369   -3.672  1.00 0.00 ? 3   PRO A HD3  3  
ATOM 4842  N N    . SER A 1 4   ? -11.073 13.704  -2.462  1.00 0.00 ? 4   SER A N    3  
ATOM 4843  C CA   . SER A 1 4   ? -11.918 14.897  -2.185  1.00 0.00 ? 4   SER A CA   3  
ATOM 4844  C C    . SER A 1 4   ? -12.955 14.502  -1.084  1.00 0.00 ? 4   SER A C    3  
ATOM 4845  O O    . SER A 1 4   ? -13.933 13.796  -1.348  1.00 0.00 ? 4   SER A O    3  
ATOM 4846  C CB   . SER A 1 4   ? -12.572 15.354  -3.507  1.00 0.00 ? 4   SER A CB   3  
ATOM 4847  O OG   . SER A 1 4   ? -13.275 16.581  -3.310  1.00 0.00 ? 4   SER A OG   3  
ATOM 4848  H H    . SER A 1 4   ? -11.283 13.018  -3.193  1.00 0.00 ? 4   SER A H    3  
ATOM 4849  H HA   . SER A 1 4   ? -11.290 15.738  -1.825  1.00 0.00 ? 4   SER A HA   3  
ATOM 4850  H HB2  . SER A 1 4   ? -11.800 15.500  -4.289  1.00 0.00 ? 4   SER A HB2  3  
ATOM 4851  H HB3  . SER A 1 4   ? -13.265 14.583  -3.897  1.00 0.00 ? 4   SER A HB3  3  
ATOM 4852  H HG   . SER A 1 4   ? -13.623 16.855  -4.165  1.00 0.00 ? 4   SER A HG   3  
ATOM 4853  N N    . GLY A 1 5   ? -12.707 14.936  0.161   1.00 0.00 ? 5   GLY A N    3  
ATOM 4854  C CA   . GLY A 1 5   ? -13.532 14.539  1.328   1.00 0.00 ? 5   GLY A CA   3  
ATOM 4855  C C    . GLY A 1 5   ? -14.717 15.444  1.718   1.00 0.00 ? 5   GLY A C    3  
ATOM 4856  O O    . GLY A 1 5   ? -15.811 15.322  1.160   1.00 0.00 ? 5   GLY A O    3  
ATOM 4857  H H    . GLY A 1 5   ? -11.851 15.497  0.242   1.00 0.00 ? 5   GLY A H    3  
ATOM 4858  H HA2  . GLY A 1 5   ? -13.921 13.510  1.207   1.00 0.00 ? 5   GLY A HA2  3  
ATOM 4859  H HA3  . GLY A 1 5   ? -12.840 14.437  2.181   1.00 0.00 ? 5   GLY A HA3  3  
ATOM 4860  N N    . ARG A 1 6   ? -14.489 16.323  2.715   1.00 0.00 ? 6   ARG A N    3  
ATOM 4861  C CA   . ARG A 1 6   ? -15.498 17.271  3.293   1.00 0.00 ? 6   ARG A CA   3  
ATOM 4862  C C    . ARG A 1 6   ? -16.582 16.498  4.141   1.00 0.00 ? 6   ARG A C    3  
ATOM 4863  O O    . ARG A 1 6   ? -16.507 16.545  5.375   1.00 0.00 ? 6   ARG A O    3  
ATOM 4864  C CB   . ARG A 1 6   ? -16.048 18.225  2.181   1.00 0.00 ? 6   ARG A CB   3  
ATOM 4865  C CG   . ARG A 1 6   ? -16.718 19.520  2.709   1.00 0.00 ? 6   ARG A CG   3  
ATOM 4866  C CD   . ARG A 1 6   ? -17.213 20.483  1.607   1.00 0.00 ? 6   ARG A CD   3  
ATOM 4867  N NE   . ARG A 1 6   ? -16.083 21.178  0.921   1.00 0.00 ? 6   ARG A NE   3  
ATOM 4868  C CZ   . ARG A 1 6   ? -16.208 22.032  -0.097  1.00 0.00 ? 6   ARG A CZ   3  
ATOM 4869  N NH1  . ARG A 1 6   ? -17.360 22.373  -0.620  1.00 0.00 ? 6   ARG A NH1  3  
ATOM 4870  N NH2  . ARG A 1 6   ? -15.128 22.557  -0.599  1.00 0.00 ? 6   ARG A NH2  3  
ATOM 4871  H H    . ARG A 1 6   ? -13.525 16.290  3.061   1.00 0.00 ? 6   ARG A H    3  
ATOM 4872  H HA   . ARG A 1 6   ? -14.958 17.894  4.031   1.00 0.00 ? 6   ARG A HA   3  
ATOM 4873  H HB2  . ARG A 1 6   ? -15.211 18.516  1.516   1.00 0.00 ? 6   ARG A HB2  3  
ATOM 4874  H HB3  . ARG A 1 6   ? -16.746 17.682  1.516   1.00 0.00 ? 6   ARG A HB3  3  
ATOM 4875  H HG2  . ARG A 1 6   ? -17.584 19.236  3.340   1.00 0.00 ? 6   ARG A HG2  3  
ATOM 4876  H HG3  . ARG A 1 6   ? -16.038 20.056  3.401   1.00 0.00 ? 6   ARG A HG3  3  
ATOM 4877  H HD2  . ARG A 1 6   ? -17.840 19.922  0.883   1.00 0.00 ? 6   ARG A HD2  3  
ATOM 4878  H HD3  . ARG A 1 6   ? -17.886 21.232  2.074   1.00 0.00 ? 6   ARG A HD3  3  
ATOM 4879  H HE   . ARG A 1 6   ? -15.117 21.011  1.216   1.00 0.00 ? 6   ARG A HE   3  
ATOM 4880  H HH11 . ARG A 1 6   ? -18.167 21.926  -0.180  1.00 0.00 ? 6   ARG A HH11 3  
ATOM 4881  H HH12 . ARG A 1 6   ? -17.369 23.034  -1.399  1.00 0.00 ? 6   ARG A HH12 3  
ATOM 4882  H HH21 . ARG A 1 6   ? -14.238 22.281  -0.178  1.00 0.00 ? 6   ARG A HH21 3  
ATOM 4883  H HH22 . ARG A 1 6   ? -15.245 23.208  -1.377  1.00 0.00 ? 6   ARG A HH22 3  
ATOM 4884  N N    . LYS A 1 7   ? -17.572 15.821  3.520   1.00 0.00 ? 7   LYS A N    3  
ATOM 4885  C CA   . LYS A 1 7   ? -18.611 15.023  4.244   1.00 0.00 ? 7   LYS A CA   3  
ATOM 4886  C C    . LYS A 1 7   ? -18.104 13.559  4.509   1.00 0.00 ? 7   LYS A C    3  
ATOM 4887  O O    . LYS A 1 7   ? -17.901 13.200  5.671   1.00 0.00 ? 7   LYS A O    3  
ATOM 4888  C CB   . LYS A 1 7   ? -19.931 15.117  3.410   1.00 0.00 ? 7   LYS A CB   3  
ATOM 4889  C CG   . LYS A 1 7   ? -21.165 14.332  3.942   1.00 0.00 ? 7   LYS A CG   3  
ATOM 4890  C CD   . LYS A 1 7   ? -21.875 14.915  5.186   1.00 0.00 ? 7   LYS A CD   3  
ATOM 4891  C CE   . LYS A 1 7   ? -22.892 16.028  4.859   1.00 0.00 ? 7   LYS A CE   3  
ATOM 4892  N NZ   . LYS A 1 7   ? -23.514 16.523  6.117   1.00 0.00 ? 7   LYS A NZ   3  
ATOM 4893  H H    . LYS A 1 7   ? -17.486 15.844  2.496   1.00 0.00 ? 7   LYS A H    3  
ATOM 4894  H HA   . LYS A 1 7   ? -18.805 15.468  5.240   1.00 0.00 ? 7   LYS A HA   3  
ATOM 4895  H HB2  . LYS A 1 7   ? -20.207 16.181  3.280   1.00 0.00 ? 7   LYS A HB2  3  
ATOM 4896  H HB3  . LYS A 1 7   ? -19.731 14.765  2.379   1.00 0.00 ? 7   LYS A HB3  3  
ATOM 4897  H HG2  . LYS A 1 7   ? -21.898 14.203  3.120   1.00 0.00 ? 7   LYS A HG2  3  
ATOM 4898  H HG3  . LYS A 1 7   ? -20.858 13.292  4.170   1.00 0.00 ? 7   LYS A HG3  3  
ATOM 4899  H HD2  . LYS A 1 7   ? -22.400 14.082  5.697   1.00 0.00 ? 7   LYS A HD2  3  
ATOM 4900  H HD3  . LYS A 1 7   ? -21.118 15.258  5.920   1.00 0.00 ? 7   LYS A HD3  3  
ATOM 4901  H HE2  . LYS A 1 7   ? -22.389 16.856  4.312   1.00 0.00 ? 7   LYS A HE2  3  
ATOM 4902  H HE3  . LYS A 1 7   ? -23.666 15.646  4.154   1.00 0.00 ? 7   LYS A HE3  3  
ATOM 4903  H HZ1  . LYS A 1 7   ? -22.819 16.889  6.781   1.00 0.00 ? 7   LYS A HZ1  3  
ATOM 4904  H HZ2  . LYS A 1 7   ? -24.195 17.282  5.972   1.00 0.00 ? 7   LYS A HZ2  3  
ATOM 4905  H HZ3  . LYS A 1 7   ? -24.016 15.784  6.626   1.00 0.00 ? 7   LYS A HZ3  3  
ATOM 4906  N N    . SER A 1 8   ? -17.946 12.709  3.471   1.00 0.00 ? 8   SER A N    3  
ATOM 4907  C CA   . SER A 1 8   ? -17.434 11.316  3.625   1.00 0.00 ? 8   SER A CA   3  
ATOM 4908  C C    . SER A 1 8   ? -15.892 11.305  3.404   1.00 0.00 ? 8   SER A C    3  
ATOM 4909  O O    . SER A 1 8   ? -15.418 11.678  2.326   1.00 0.00 ? 8   SER A O    3  
ATOM 4910  C CB   . SER A 1 8   ? -18.149 10.401  2.604   1.00 0.00 ? 8   SER A CB   3  
ATOM 4911  O OG   . SER A 1 8   ? -19.548 10.329  2.867   1.00 0.00 ? 8   SER A OG   3  
ATOM 4912  H H    . SER A 1 8   ? -18.118 13.127  2.553   1.00 0.00 ? 8   SER A H    3  
ATOM 4913  H HA   . SER A 1 8   ? -17.669 10.924  4.637   1.00 0.00 ? 8   SER A HA   3  
ATOM 4914  H HB2  . SER A 1 8   ? -17.976 10.744  1.566   1.00 0.00 ? 8   SER A HB2  3  
ATOM 4915  H HB3  . SER A 1 8   ? -17.731 9.376   2.647   1.00 0.00 ? 8   SER A HB3  3  
ATOM 4916  H HG   . SER A 1 8   ? -19.813 11.202  3.172   1.00 0.00 ? 8   SER A HG   3  
ATOM 4917  N N    . SER A 1 9   ? -15.119 10.858  4.420   1.00 0.00 ? 9   SER A N    3  
ATOM 4918  C CA   . SER A 1 9   ? -13.614 10.861  4.417   1.00 0.00 ? 9   SER A CA   3  
ATOM 4919  C C    . SER A 1 9   ? -13.025 12.318  4.448   1.00 0.00 ? 9   SER A C    3  
ATOM 4920  O O    . SER A 1 9   ? -13.698 13.302  4.123   1.00 0.00 ? 9   SER A O    3  
ATOM 4921  C CB   . SER A 1 9   ? -13.024 10.056  3.220   1.00 0.00 ? 9   SER A CB   3  
ATOM 4922  O OG   . SER A 1 9   ? -13.488 8.708   3.220   1.00 0.00 ? 9   SER A OG   3  
ATOM 4923  H H    . SER A 1 9   ? -15.648 10.592  5.257   1.00 0.00 ? 9   SER A H    3  
ATOM 4924  H HA   . SER A 1 9   ? -13.284 10.365  5.350   1.00 0.00 ? 9   SER A HA   3  
ATOM 4925  H HB2  . SER A 1 9   ? -13.254 10.534  2.249   1.00 0.00 ? 9   SER A HB2  3  
ATOM 4926  H HB3  . SER A 1 9   ? -11.919 10.045  3.269   1.00 0.00 ? 9   SER A HB3  3  
ATOM 4927  H HG   . SER A 1 9   ? -14.448 8.753   3.254   1.00 0.00 ? 9   SER A HG   3  
ATOM 4928  N N    . LYS A 1 10  ? -11.766 12.480  4.893   1.00 0.00 ? 10  LYS A N    3  
ATOM 4929  C CA   . LYS A 1 10  ? -11.085 13.818  4.916   1.00 0.00 ? 10  LYS A CA   3  
ATOM 4930  C C    . LYS A 1 10  ? -9.573  13.681  4.507   1.00 0.00 ? 10  LYS A C    3  
ATOM 4931  O O    . LYS A 1 10  ? -8.694  14.179  5.215   1.00 0.00 ? 10  LYS A O    3  
ATOM 4932  C CB   . LYS A 1 10  ? -11.277 14.462  6.330   1.00 0.00 ? 10  LYS A CB   3  
ATOM 4933  C CG   . LYS A 1 10  ? -12.729 14.812  6.749   1.00 0.00 ? 10  LYS A CG   3  
ATOM 4934  C CD   . LYS A 1 10  ? -12.807 15.565  8.096   1.00 0.00 ? 10  LYS A CD   3  
ATOM 4935  C CE   . LYS A 1 10  ? -14.222 15.669  8.704   1.00 0.00 ? 10  LYS A CE   3  
ATOM 4936  N NZ   . LYS A 1 10  ? -15.118 16.571  7.920   1.00 0.00 ? 10  LYS A NZ   3  
ATOM 4937  H H    . LYS A 1 10  ? -11.278 11.614  5.146   1.00 0.00 ? 10  LYS A H    3  
ATOM 4938  H HA   . LYS A 1 10  ? -11.529 14.502  4.167   1.00 0.00 ? 10  LYS A HA   3  
ATOM 4939  H HB2  . LYS A 1 10  ? -10.817 13.805  7.095   1.00 0.00 ? 10  LYS A HB2  3  
ATOM 4940  H HB3  . LYS A 1 10  ? -10.675 15.391  6.368   1.00 0.00 ? 10  LYS A HB3  3  
ATOM 4941  H HG2  . LYS A 1 10  ? -13.217 15.402  5.948   1.00 0.00 ? 10  LYS A HG2  3  
ATOM 4942  H HG3  . LYS A 1 10  ? -13.318 13.876  6.814   1.00 0.00 ? 10  LYS A HG3  3  
ATOM 4943  H HD2  . LYS A 1 10  ? -12.165 15.037  8.829   1.00 0.00 ? 10  LYS A HD2  3  
ATOM 4944  H HD3  . LYS A 1 10  ? -12.343 16.567  8.000   1.00 0.00 ? 10  LYS A HD3  3  
ATOM 4945  H HE2  . LYS A 1 10  ? -14.668 14.654  8.802   1.00 0.00 ? 10  LYS A HE2  3  
ATOM 4946  H HE3  . LYS A 1 10  ? -14.135 16.032  9.752   1.00 0.00 ? 10  LYS A HE3  3  
ATOM 4947  H HZ1  . LYS A 1 10  ? -14.700 17.493  7.744   1.00 0.00 ? 10  LYS A HZ1  3  
ATOM 4948  H HZ2  . LYS A 1 10  ? -15.373 16.212  6.982   1.00 0.00 ? 10  LYS A HZ2  3  
ATOM 4949  H HZ3  . LYS A 1 10  ? -16.022 16.753  8.374   1.00 0.00 ? 10  LYS A HZ3  3  
ATOM 4950  N N    . MET A 1 11  ? -9.272  13.043  3.344   1.00 0.00 ? 11  MET A N    3  
ATOM 4951  C CA   . MET A 1 11  ? -7.884  12.775  2.830   1.00 0.00 ? 11  MET A CA   3  
ATOM 4952  C C    . MET A 1 11  ? -7.029  11.970  3.879   1.00 0.00 ? 11  MET A C    3  
ATOM 4953  O O    . MET A 1 11  ? -6.408  12.538  4.784   1.00 0.00 ? 11  MET A O    3  
ATOM 4954  C CB   . MET A 1 11  ? -7.225  14.110  2.380   1.00 0.00 ? 11  MET A CB   3  
ATOM 4955  C CG   . MET A 1 11  ? -5.950  13.928  1.532   1.00 0.00 ? 11  MET A CG   3  
ATOM 4956  S SD   . MET A 1 11  ? -5.229  15.534  1.138   1.00 0.00 ? 11  MET A SD   3  
ATOM 4957  C CE   . MET A 1 11  ? -4.180  15.791  2.582   1.00 0.00 ? 11  MET A CE   3  
ATOM 4958  H H    . MET A 1 11  ? -10.097 12.682  2.853   1.00 0.00 ? 11  MET A H    3  
ATOM 4959  H HA   . MET A 1 11  ? -7.980  12.136  1.929   1.00 0.00 ? 11  MET A HA   3  
ATOM 4960  H HB2  . MET A 1 11  ? -7.948  14.702  1.784   1.00 0.00 ? 11  MET A HB2  3  
ATOM 4961  H HB3  . MET A 1 11  ? -7.002  14.737  3.266   1.00 0.00 ? 11  MET A HB3  3  
ATOM 4962  H HG2  . MET A 1 11  ? -5.199  13.300  2.051   1.00 0.00 ? 11  MET A HG2  3  
ATOM 4963  H HG3  . MET A 1 11  ? -6.186  13.404  0.587   1.00 0.00 ? 11  MET A HG3  3  
ATOM 4964  H HE1  . MET A 1 11  ? -4.763  15.712  3.517   1.00 0.00 ? 11  MET A HE1  3  
ATOM 4965  H HE2  . MET A 1 11  ? -3.371  15.039  2.618   1.00 0.00 ? 11  MET A HE2  3  
ATOM 4966  H HE3  . MET A 1 11  ? -3.715  16.792  2.551   1.00 0.00 ? 11  MET A HE3  3  
ATOM 4967  N N    . GLN A 1 12  ? -7.017  10.631  3.774   1.00 0.00 ? 12  GLN A N    3  
ATOM 4968  C CA   . GLN A 1 12  ? -6.328  9.747   4.766   1.00 0.00 ? 12  GLN A CA   3  
ATOM 4969  C C    . GLN A 1 12  ? -4.810  9.559   4.429   1.00 0.00 ? 12  GLN A C    3  
ATOM 4970  O O    . GLN A 1 12  ? -4.341  8.446   4.175   1.00 0.00 ? 12  GLN A O    3  
ATOM 4971  C CB   . GLN A 1 12  ? -7.136  8.414   4.786   1.00 0.00 ? 12  GLN A CB   3  
ATOM 4972  C CG   . GLN A 1 12  ? -8.603  8.505   5.316   1.00 0.00 ? 12  GLN A CG   3  
ATOM 4973  C CD   . GLN A 1 12  ? -9.681  7.746   4.531   1.00 0.00 ? 12  GLN A CD   3  
ATOM 4974  O OE1  . GLN A 1 12  ? -10.387 6.886   5.048   1.00 0.00 ? 12  GLN A OE1  3  
ATOM 4975  N NE2  . GLN A 1 12  ? -9.891  8.076   3.278   1.00 0.00 ? 12  GLN A NE2  3  
ATOM 4976  H H    . GLN A 1 12  ? -7.523  10.244  2.970   1.00 0.00 ? 12  GLN A H    3  
ATOM 4977  H HA   . GLN A 1 12  ? -6.376  10.184  5.785   1.00 0.00 ? 12  GLN A HA   3  
ATOM 4978  H HB2  . GLN A 1 12  ? -7.104  7.956   3.776   1.00 0.00 ? 12  GLN A HB2  3  
ATOM 4979  H HB3  . GLN A 1 12  ? -6.599  7.676   5.412   1.00 0.00 ? 12  GLN A HB3  3  
ATOM 4980  H HG2  . GLN A 1 12  ? -8.631  8.149   6.363   1.00 0.00 ? 12  GLN A HG2  3  
ATOM 4981  H HG3  . GLN A 1 12  ? -8.935  9.557   5.384   1.00 0.00 ? 12  GLN A HG3  3  
ATOM 4982  H HE21 . GLN A 1 12  ? -9.118  8.555   2.806   1.00 0.00 ? 12  GLN A HE21 3  
ATOM 4983  H HE22 . GLN A 1 12  ? -10.618 7.517   2.824   1.00 0.00 ? 12  GLN A HE22 3  
ATOM 4984  N N    . ALA A 1 13  ? -4.018  10.637  4.593   1.00 0.00 ? 13  ALA A N    3  
ATOM 4985  C CA   . ALA A 1 13  ? -2.589  10.676  4.188   1.00 0.00 ? 13  ALA A CA   3  
ATOM 4986  C C    . ALA A 1 13  ? -1.654  9.847   5.122   1.00 0.00 ? 13  ALA A C    3  
ATOM 4987  O O    . ALA A 1 13  ? -1.579  10.059  6.336   1.00 0.00 ? 13  ALA A O    3  
ATOM 4988  C CB   . ALA A 1 13  ? -2.227  12.174  4.201   1.00 0.00 ? 13  ALA A CB   3  
ATOM 4989  H H    . ALA A 1 13  ? -4.543  11.498  4.801   1.00 0.00 ? 13  ALA A H    3  
ATOM 4990  H HA   . ALA A 1 13  ? -2.497  10.299  3.148   1.00 0.00 ? 13  ALA A HA   3  
ATOM 4991  H HB1  . ALA A 1 13  ? -2.365  12.633  5.201   1.00 0.00 ? 13  ALA A HB1  3  
ATOM 4992  H HB2  . ALA A 1 13  ? -1.168  12.350  3.945   1.00 0.00 ? 13  ALA A HB2  3  
ATOM 4993  H HB3  . ALA A 1 13  ? -2.831  12.758  3.482   1.00 0.00 ? 13  ALA A HB3  3  
ATOM 4994  N N    . PHE A 1 14  ? -0.904  8.906   4.517   1.00 0.00 ? 14  PHE A N    3  
ATOM 4995  C CA   . PHE A 1 14  ? -0.106  7.909   5.273   1.00 0.00 ? 14  PHE A CA   3  
ATOM 4996  C C    . PHE A 1 14  ? 1.286   7.557   4.633   1.00 0.00 ? 14  PHE A C    3  
ATOM 4997  O O    . PHE A 1 14  ? 1.544   7.743   3.436   1.00 0.00 ? 14  PHE A O    3  
ATOM 4998  C CB   . PHE A 1 14  ? -1.067  6.673   5.362   1.00 0.00 ? 14  PHE A CB   3  
ATOM 4999  C CG   . PHE A 1 14  ? -0.960  5.883   6.662   1.00 0.00 ? 14  PHE A CG   3  
ATOM 5000  C CD1  . PHE A 1 14  ? -1.725  6.261   7.772   1.00 0.00 ? 14  PHE A CD1  3  
ATOM 5001  C CD2  . PHE A 1 14  ? -0.111  4.780   6.751   1.00 0.00 ? 14  PHE A CD2  3  
ATOM 5002  C CE1  . PHE A 1 14  ? -1.613  5.560   8.969   1.00 0.00 ? 14  PHE A CE1  3  
ATOM 5003  C CE2  . PHE A 1 14  ? 0.003   4.086   7.949   1.00 0.00 ? 14  PHE A CE2  3  
ATOM 5004  C CZ   . PHE A 1 14  ? -0.739  4.483   9.060   1.00 0.00 ? 14  PHE A CZ   3  
ATOM 5005  H H    . PHE A 1 14  ? -1.080  8.780   3.508   1.00 0.00 ? 14  PHE A H    3  
ATOM 5006  H HA   . PHE A 1 14  ? 0.106   8.295   6.288   1.00 0.00 ? 14  PHE A HA   3  
ATOM 5007  H HB2  . PHE A 1 14  ? -2.138  6.956   5.268   1.00 0.00 ? 14  PHE A HB2  3  
ATOM 5008  H HB3  . PHE A 1 14  ? -0.933  6.014   4.487   1.00 0.00 ? 14  PHE A HB3  3  
ATOM 5009  H HD1  . PHE A 1 14  ? -2.383  7.117   7.718   1.00 0.00 ? 14  PHE A HD1  3  
ATOM 5010  H HD2  . PHE A 1 14  ? 0.489   4.485   5.903   1.00 0.00 ? 14  PHE A HD2  3  
ATOM 5011  H HE1  . PHE A 1 14  ? -2.174  5.876   9.836   1.00 0.00 ? 14  PHE A HE1  3  
ATOM 5012  H HE2  . PHE A 1 14  ? 0.697   3.266   8.026   1.00 0.00 ? 14  PHE A HE2  3  
ATOM 5013  H HZ   . PHE A 1 14  ? -0.608  3.982   10.006  1.00 0.00 ? 14  PHE A HZ   3  
ATOM 5014  N N    . ARG A 1 15  ? 2.182   7.012   5.476   1.00 0.00 ? 15  ARG A N    3  
ATOM 5015  C CA   . ARG A 1 15  ? 3.531   6.527   5.088   1.00 0.00 ? 15  ARG A CA   3  
ATOM 5016  C C    . ARG A 1 15  ? 3.791   5.149   5.795   1.00 0.00 ? 15  ARG A C    3  
ATOM 5017  O O    . ARG A 1 15  ? 3.731   5.015   7.026   1.00 0.00 ? 15  ARG A O    3  
ATOM 5018  C CB   . ARG A 1 15  ? 4.605   7.577   5.493   1.00 0.00 ? 15  ARG A CB   3  
ATOM 5019  C CG   . ARG A 1 15  ? 6.067   7.225   5.094   1.00 0.00 ? 15  ARG A CG   3  
ATOM 5020  C CD   . ARG A 1 15  ? 7.129   8.156   5.704   1.00 0.00 ? 15  ARG A CD   3  
ATOM 5021  N NE   . ARG A 1 15  ? 7.329   9.391   4.903   1.00 0.00 ? 15  ARG A NE   3  
ATOM 5022  C CZ   . ARG A 1 15  ? 7.841   10.536  5.356   1.00 0.00 ? 15  ARG A CZ   3  
ATOM 5023  N NH1  . ARG A 1 15  ? 8.176   10.766  6.598   1.00 0.00 ? 15  ARG A NH1  3  
ATOM 5024  N NH2  . ARG A 1 15  ? 7.989   11.508  4.511   1.00 0.00 ? 15  ARG A NH2  3  
ATOM 5025  H H    . ARG A 1 15  ? 1.858   6.916   6.451   1.00 0.00 ? 15  ARG A H    3  
ATOM 5026  H HA   . ARG A 1 15  ? 3.583   6.393   3.987   1.00 0.00 ? 15  ARG A HA   3  
ATOM 5027  H HB2  . ARG A 1 15  ? 4.351   8.554   5.043   1.00 0.00 ? 15  ARG A HB2  3  
ATOM 5028  H HB3  . ARG A 1 15  ? 4.546   7.756   6.588   1.00 0.00 ? 15  ARG A HB3  3  
ATOM 5029  H HG2  . ARG A 1 15  ? 6.298   6.204   5.453   1.00 0.00 ? 15  ARG A HG2  3  
ATOM 5030  H HG3  . ARG A 1 15  ? 6.179   7.169   3.993   1.00 0.00 ? 15  ARG A HG3  3  
ATOM 5031  H HD2  . ARG A 1 15  ? 6.864   8.358   6.757   1.00 0.00 ? 15  ARG A HD2  3  
ATOM 5032  H HD3  . ARG A 1 15  ? 8.096   7.624   5.754   1.00 0.00 ? 15  ARG A HD3  3  
ATOM 5033  H HE   . ARG A 1 15  ? 7.389   9.343   3.857   1.00 0.00 ? 15  ARG A HE   3  
ATOM 5034  H HH11 . ARG A 1 15  ? 7.670   10.172  7.296   1.00 0.00 ? 15  ARG A HH11 3  
ATOM 5035  H HH12 . ARG A 1 15  ? 8.430   11.765  6.792   1.00 0.00 ? 15  ARG A HH12 3  
ATOM 5036  H HH21 . ARG A 1 15  ? 7.619   11.305  3.554   1.00 0.00 ? 15  ARG A HH21 3  
ATOM 5037  H HH22 . ARG A 1 15  ? 8.069   12.455  4.936   1.00 0.00 ? 15  ARG A HH22 3  
ATOM 5038  N N    . ILE A 1 16  ? 4.117   4.124   4.991   1.00 0.00 ? 16  ILE A N    3  
ATOM 5039  C CA   . ILE A 1 16  ? 4.490   2.765   5.501   1.00 0.00 ? 16  ILE A CA   3  
ATOM 5040  C C    . ILE A 1 16  ? 6.032   2.638   5.214   1.00 0.00 ? 16  ILE A C    3  
ATOM 5041  O O    . ILE A 1 16  ? 6.501   2.680   4.060   1.00 0.00 ? 16  ILE A O    3  
ATOM 5042  C CB   . ILE A 1 16  ? 3.571   1.619   4.921   1.00 0.00 ? 16  ILE A CB   3  
ATOM 5043  C CG1  . ILE A 1 16  ? 3.481   1.559   3.363   1.00 0.00 ? 16  ILE A CG1  3  
ATOM 5044  C CG2  . ILE A 1 16  ? 2.154   1.769   5.539   1.00 0.00 ? 16  ILE A CG2  3  
ATOM 5045  C CD1  . ILE A 1 16  ? 2.472   0.570   2.743   1.00 0.00 ? 16  ILE A CD1  3  
ATOM 5046  H H    . ILE A 1 16  ? 4.139   4.344   3.990   1.00 0.00 ? 16  ILE A H    3  
ATOM 5047  H HA   . ILE A 1 16  ? 4.360   2.720   6.603   1.00 0.00 ? 16  ILE A HA   3  
ATOM 5048  H HB   . ILE A 1 16  ? 3.982   0.647   5.258   1.00 0.00 ? 16  ILE A HB   3  
ATOM 5049  H HG12 . ILE A 1 16  ? 3.266   2.561   2.947   1.00 0.00 ? 16  ILE A HG12 3  
ATOM 5050  H HG13 . ILE A 1 16  ? 4.485   1.299   2.985   1.00 0.00 ? 16  ILE A HG13 3  
ATOM 5051  H HG21 . ILE A 1 16  ? 2.186   1.912   6.634   1.00 0.00 ? 16  ILE A HG21 3  
ATOM 5052  H HG22 . ILE A 1 16  ? 1.612   2.634   5.115   1.00 0.00 ? 16  ILE A HG22 3  
ATOM 5053  H HG23 . ILE A 1 16  ? 1.527   0.876   5.360   1.00 0.00 ? 16  ILE A HG23 3  
ATOM 5054  H HD11 . ILE A 1 16  ? 2.603   -0.461  3.113   1.00 0.00 ? 16  ILE A HD11 3  
ATOM 5055  H HD12 . ILE A 1 16  ? 1.428   0.860   2.961   1.00 0.00 ? 16  ILE A HD12 3  
ATOM 5056  H HD13 . ILE A 1 16  ? 2.563   0.535   1.642   1.00 0.00 ? 16  ILE A HD13 3  
ATOM 5057  N N    . TRP A 1 17  ? 6.819   2.576   6.315   1.00 0.00 ? 17  TRP A N    3  
ATOM 5058  C CA   . TRP A 1 17  ? 8.314   2.609   6.250   1.00 0.00 ? 17  TRP A CA   3  
ATOM 5059  C C    . TRP A 1 17  ? 9.026   1.899   7.448   1.00 0.00 ? 17  TRP A C    3  
ATOM 5060  O O    . TRP A 1 17  ? 8.403   1.696   8.487   1.00 0.00 ? 17  TRP A O    3  
ATOM 5061  C CB   . TRP A 1 17  ? 8.748   4.112   6.164   1.00 0.00 ? 17  TRP A CB   3  
ATOM 5062  C CG   . TRP A 1 17  ? 8.589   5.072   7.369   1.00 0.00 ? 17  TRP A CG   3  
ATOM 5063  C CD1  . TRP A 1 17  ? 7.476   5.196   8.238   1.00 0.00 ? 17  TRP A CD1  3  
ATOM 5064  C CD2  . TRP A 1 17  ? 9.412   6.147   7.682   1.00 0.00 ? 17  TRP A CD2  3  
ATOM 5065  N NE1  . TRP A 1 17  ? 7.596   6.309   9.090   1.00 0.00 ? 17  TRP A NE1  3  
ATOM 5066  C CE2  . TRP A 1 17  ? 8.792   6.889   8.721   1.00 0.00 ? 17  TRP A CE2  3  
ATOM 5067  C CE3  . TRP A 1 17  ? 10.568  6.659   7.034   1.00 0.00 ? 17  TRP A CE3  3  
ATOM 5068  C CZ2  . TRP A 1 17  ? 9.316   8.143   9.109   1.00 0.00 ? 17  TRP A CZ2  3  
ATOM 5069  C CZ3  . TRP A 1 17  ? 11.073  7.894   7.442   1.00 0.00 ? 17  TRP A CZ3  3  
ATOM 5070  C CH2  . TRP A 1 17  ? 10.459  8.623   8.467   1.00 0.00 ? 17  TRP A CH2  3  
ATOM 5071  H H    . TRP A 1 17  ? 6.329   2.537   7.223   1.00 0.00 ? 17  TRP A H    3  
ATOM 5072  H HA   . TRP A 1 17  ? 8.629   2.069   5.338   1.00 0.00 ? 17  TRP A HA   3  
ATOM 5073  H HB2  . TRP A 1 17  ? 9.813   4.122   5.867   1.00 0.00 ? 17  TRP A HB2  3  
ATOM 5074  H HB3  . TRP A 1 17  ? 8.237   4.579   5.302   1.00 0.00 ? 17  TRP A HB3  3  
ATOM 5075  H HD1  . TRP A 1 17  ? 6.589   4.580   8.192   1.00 0.00 ? 17  TRP A HD1  3  
ATOM 5076  H HE1  . TRP A 1 17  ? 6.861   6.774   9.637   1.00 0.00 ? 17  TRP A HE1  3  
ATOM 5077  H HE3  . TRP A 1 17  ? 11.018  6.137   6.203   1.00 0.00 ? 17  TRP A HE3  3  
ATOM 5078  H HZ2  . TRP A 1 17  ? 8.804   8.745   9.848   1.00 0.00 ? 17  TRP A HZ2  3  
ATOM 5079  H HZ3  . TRP A 1 17  ? 11.926  8.315   6.930   1.00 0.00 ? 17  TRP A HZ3  3  
ATOM 5080  H HH2  . TRP A 1 17  ? 10.846  9.596   8.737   1.00 0.00 ? 17  TRP A HH2  3  
ATOM 5081  N N    . ASP A 1 18  ? 10.332  1.556   7.353   1.00 0.00 ? 18  ASP A N    3  
ATOM 5082  C CA   . ASP A 1 18  ? 11.062  0.883   8.472   1.00 0.00 ? 18  ASP A CA   3  
ATOM 5083  C C    . ASP A 1 18  ? 12.479  1.503   8.781   1.00 0.00 ? 18  ASP A C    3  
ATOM 5084  O O    . ASP A 1 18  ? 13.174  2.036   7.908   1.00 0.00 ? 18  ASP A O    3  
ATOM 5085  C CB   . ASP A 1 18  ? 11.117  -0.648  8.165   1.00 0.00 ? 18  ASP A CB   3  
ATOM 5086  C CG   . ASP A 1 18  ? 12.197  -1.226  7.247   1.00 0.00 ? 18  ASP A CG   3  
ATOM 5087  O OD1  . ASP A 1 18  ? 12.124  -1.061  6.012   1.00 0.00 ? 18  ASP A OD1  3  
ATOM 5088  O OD2  . ASP A 1 18  ? 13.119  -1.885  7.780   1.00 0.00 ? 18  ASP A OD2  3  
ATOM 5089  H H    . ASP A 1 18  ? 10.781  1.752   6.445   1.00 0.00 ? 18  ASP A H    3  
ATOM 5090  H HA   . ASP A 1 18  ? 10.472  0.997   9.405   1.00 0.00 ? 18  ASP A HA   3  
ATOM 5091  H HB2  . ASP A 1 18  ? 11.208  -1.174  9.131   1.00 0.00 ? 18  ASP A HB2  3  
ATOM 5092  H HB3  . ASP A 1 18  ? 10.145  -1.000  7.780   1.00 0.00 ? 18  ASP A HB3  3  
ATOM 5093  N N    . VAL A 1 19  ? 12.837  1.398   10.086  1.00 0.00 ? 19  VAL A N    3  
ATOM 5094  C CA   . VAL A 1 19  ? 14.130  1.777   10.761  1.00 0.00 ? 19  VAL A CA   3  
ATOM 5095  C C    . VAL A 1 19  ? 15.014  2.850   10.029  1.00 0.00 ? 19  VAL A C    3  
ATOM 5096  O O    . VAL A 1 19  ? 14.973  4.027   10.397  1.00 0.00 ? 19  VAL A O    3  
ATOM 5097  C CB   . VAL A 1 19  ? 14.859  0.433   11.177  1.00 0.00 ? 19  VAL A CB   3  
ATOM 5098  C CG1  . VAL A 1 19  ? 16.223  0.638   11.887  1.00 0.00 ? 19  VAL A CG1  3  
ATOM 5099  C CG2  . VAL A 1 19  ? 14.034  -0.425  12.177  1.00 0.00 ? 19  VAL A CG2  3  
ATOM 5100  H H    . VAL A 1 19  ? 12.126  0.914   10.631  1.00 0.00 ? 19  VAL A H    3  
ATOM 5101  H HA   . VAL A 1 19  ? 13.860  2.302   11.698  1.00 0.00 ? 19  VAL A HA   3  
ATOM 5102  H HB   . VAL A 1 19  ? 15.042  -0.161  10.259  1.00 0.00 ? 19  VAL A HB   3  
ATOM 5103  H HG11 . VAL A 1 19  ? 16.125  1.235   12.815  1.00 0.00 ? 19  VAL A HG11 3  
ATOM 5104  H HG12 . VAL A 1 19  ? 16.702  -0.319  12.168  1.00 0.00 ? 19  VAL A HG12 3  
ATOM 5105  H HG13 . VAL A 1 19  ? 16.962  1.163   11.255  1.00 0.00 ? 19  VAL A HG13 3  
ATOM 5106  H HG21 . VAL A 1 19  ? 13.827  0.128   13.114  1.00 0.00 ? 19  VAL A HG21 3  
ATOM 5107  H HG22 . VAL A 1 19  ? 13.051  -0.723  11.772  1.00 0.00 ? 19  VAL A HG22 3  
ATOM 5108  H HG23 . VAL A 1 19  ? 14.556  -1.355  12.472  1.00 0.00 ? 19  VAL A HG23 3  
ATOM 5109  N N    . ASN A 1 20  ? 15.918  2.437   9.124   1.00 0.00 ? 20  ASN A N    3  
ATOM 5110  C CA   . ASN A 1 20  ? 16.865  3.352   8.408   1.00 0.00 ? 20  ASN A CA   3  
ATOM 5111  C C    . ASN A 1 20  ? 16.224  4.150   7.211   1.00 0.00 ? 20  ASN A C    3  
ATOM 5112  O O    . ASN A 1 20  ? 16.836  4.376   6.165   1.00 0.00 ? 20  ASN A O    3  
ATOM 5113  C CB   . ASN A 1 20  ? 18.047  2.418   7.997   1.00 0.00 ? 20  ASN A CB   3  
ATOM 5114  C CG   . ASN A 1 20  ? 19.316  3.092   7.464   1.00 0.00 ? 20  ASN A CG   3  
ATOM 5115  O OD1  . ASN A 1 20  ? 19.683  2.960   6.303   1.00 0.00 ? 20  ASN A OD1  3  
ATOM 5116  N ND2  . ASN A 1 20  ? 20.054  3.800   8.286   1.00 0.00 ? 20  ASN A ND2  3  
ATOM 5117  H H    . ASN A 1 20  ? 15.755  1.463   8.875   1.00 0.00 ? 20  ASN A H    3  
ATOM 5118  H HA   . ASN A 1 20  ? 17.243  4.121   9.112   1.00 0.00 ? 20  ASN A HA   3  
ATOM 5119  H HB2  . ASN A 1 20  ? 18.361  1.778   8.845   1.00 0.00 ? 20  ASN A HB2  3  
ATOM 5120  H HB3  . ASN A 1 20  ? 17.702  1.706   7.223   1.00 0.00 ? 20  ASN A HB3  3  
ATOM 5121  H HD21 . ASN A 1 20  ? 19.743  3.879   9.257   1.00 0.00 ? 20  ASN A HD21 3  
ATOM 5122  H HD22 . ASN A 1 20  ? 20.881  4.212   7.845   1.00 0.00 ? 20  ASN A HD22 3  
ATOM 5123  N N    . GLN A 1 21  ? 15.010  4.673   7.450   1.00 0.00 ? 21  GLN A N    3  
ATOM 5124  C CA   . GLN A 1 21  ? 14.192  5.480   6.491   1.00 0.00 ? 21  GLN A CA   3  
ATOM 5125  C C    . GLN A 1 21  ? 13.910  4.762   5.119   1.00 0.00 ? 21  GLN A C    3  
ATOM 5126  O O    . GLN A 1 21  ? 14.018  5.354   4.043   1.00 0.00 ? 21  GLN A O    3  
ATOM 5127  C CB   . GLN A 1 21  ? 14.851  6.881   6.299   1.00 0.00 ? 21  GLN A CB   3  
ATOM 5128  C CG   . GLN A 1 21  ? 15.027  7.770   7.559   1.00 0.00 ? 21  GLN A CG   3  
ATOM 5129  C CD   . GLN A 1 21  ? 15.668  9.140   7.291   1.00 0.00 ? 21  GLN A CD   3  
ATOM 5130  O OE1  . GLN A 1 21  ? 16.263  9.421   6.253   1.00 0.00 ? 21  GLN A OE1  3  
ATOM 5131  N NE2  . GLN A 1 21  ? 15.577  10.046  8.233   1.00 0.00 ? 21  GLN A NE2  3  
ATOM 5132  H H    . GLN A 1 21  ? 14.657  4.318   8.353   1.00 0.00 ? 21  GLN A H    3  
ATOM 5133  H HA   . GLN A 1 21  ? 13.197  5.626   6.946   1.00 0.00 ? 21  GLN A HA   3  
ATOM 5134  H HB2  . GLN A 1 21  ? 15.833  6.749   5.804   1.00 0.00 ? 21  GLN A HB2  3  
ATOM 5135  H HB3  . GLN A 1 21  ? 14.243  7.448   5.567   1.00 0.00 ? 21  GLN A HB3  3  
ATOM 5136  H HG2  . GLN A 1 21  ? 14.047  7.904   8.053   1.00 0.00 ? 21  GLN A HG2  3  
ATOM 5137  H HG3  . GLN A 1 21  ? 15.660  7.242   8.296   1.00 0.00 ? 21  GLN A HG3  3  
ATOM 5138  H HE21 . GLN A 1 21  ? 15.121  9.770   9.106   1.00 0.00 ? 21  GLN A HE21 3  
ATOM 5139  H HE22 . GLN A 1 21  ? 16.058  10.924  8.016   1.00 0.00 ? 21  GLN A HE22 3  
ATOM 5140  N N    . LYS A 1 22  ? 13.507  3.481   5.158   1.00 0.00 ? 22  LYS A N    3  
ATOM 5141  C CA   . LYS A 1 22  ? 13.183  2.681   3.963   1.00 0.00 ? 22  LYS A CA   3  
ATOM 5142  C C    . LYS A 1 22  ? 11.628  2.748   3.808   1.00 0.00 ? 22  LYS A C    3  
ATOM 5143  O O    . LYS A 1 22  ? 10.867  2.200   4.601   1.00 0.00 ? 22  LYS A O    3  
ATOM 5144  C CB   . LYS A 1 22  ? 13.663  1.208   4.179   1.00 0.00 ? 22  LYS A CB   3  
ATOM 5145  C CG   . LYS A 1 22  ? 15.117  0.877   3.754   1.00 0.00 ? 22  LYS A CG   3  
ATOM 5146  C CD   . LYS A 1 22  ? 15.374  -0.644  3.579   1.00 0.00 ? 22  LYS A CD   3  
ATOM 5147  C CE   . LYS A 1 22  ? 14.846  -1.249  2.254   1.00 0.00 ? 22  LYS A CE   3  
ATOM 5148  N NZ   . LYS A 1 22  ? 14.959  -2.731  2.285   1.00 0.00 ? 22  LYS A NZ   3  
ATOM 5149  H H    . LYS A 1 22  ? 13.411  3.068   6.085   1.00 0.00 ? 22  LYS A H    3  
ATOM 5150  H HA   . LYS A 1 22  ? 13.700  3.146   3.059   1.00 0.00 ? 22  LYS A HA   3  
ATOM 5151  H HB2  . LYS A 1 22  ? 13.512  0.903   5.236   1.00 0.00 ? 22  LYS A HB2  3  
ATOM 5152  H HB3  . LYS A 1 22  ? 12.972  0.524   3.651   1.00 0.00 ? 22  LYS A HB3  3  
ATOM 5153  H HG2  . LYS A 1 22  ? 15.407  1.424   2.836   1.00 0.00 ? 22  LYS A HG2  3  
ATOM 5154  H HG3  . LYS A 1 22  ? 15.797  1.280   4.532   1.00 0.00 ? 22  LYS A HG3  3  
ATOM 5155  H HD2  . LYS A 1 22  ? 16.465  -0.827  3.653   1.00 0.00 ? 22  LYS A HD2  3  
ATOM 5156  H HD3  . LYS A 1 22  ? 14.942  -1.170  4.458   1.00 0.00 ? 22  LYS A HD3  3  
ATOM 5157  H HE2  . LYS A 1 22  ? 13.784  -0.960  2.099   1.00 0.00 ? 22  LYS A HE2  3  
ATOM 5158  H HE3  . LYS A 1 22  ? 15.402  -0.835  1.385   1.00 0.00 ? 22  LYS A HE3  3  
ATOM 5159  H HZ1  . LYS A 1 22  ? 14.674  -3.135  3.185   1.00 0.00 ? 22  LYS A HZ1  3  
ATOM 5160  H HZ2  . LYS A 1 22  ? 14.396  -3.229  1.564   1.00 0.00 ? 22  LYS A HZ2  3  
ATOM 5161  H HZ3  . LYS A 1 22  ? 15.922  -3.074  2.094   1.00 0.00 ? 22  LYS A HZ3  3  
ATOM 5162  N N    . THR A 1 23  ? 11.200  3.447   2.770   1.00 0.00 ? 23  THR A N    3  
ATOM 5163  C CA   . THR A 1 23  ? 9.782   3.798   2.478   1.00 0.00 ? 23  THR A CA   3  
ATOM 5164  C C    . THR A 1 23  ? 9.186   3.054   1.239   1.00 0.00 ? 23  THR A C    3  
ATOM 5165  O O    . THR A 1 23  ? 9.889   2.694   0.287   1.00 0.00 ? 23  THR A O    3  
ATOM 5166  C CB   . THR A 1 23  ? 9.703   5.348   2.192   1.00 0.00 ? 23  THR A CB   3  
ATOM 5167  O OG1  . THR A 1 23  ? 10.498  5.702   1.062   1.00 0.00 ? 23  THR A OG1  3  
ATOM 5168  C CG2  . THR A 1 23  ? 10.183  6.271   3.326   1.00 0.00 ? 23  THR A CG2  3  
ATOM 5169  H H    . THR A 1 23  ? 11.992  3.778   2.217   1.00 0.00 ? 23  THR A H    3  
ATOM 5170  H HA   . THR A 1 23  ? 9.146   3.572   3.355   1.00 0.00 ? 23  THR A HA   3  
ATOM 5171  H HB   . THR A 1 23  ? 8.645   5.601   1.971   1.00 0.00 ? 23  THR A HB   3  
ATOM 5172  H HG1  . THR A 1 23  ? 11.415  5.548   1.304   1.00 0.00 ? 23  THR A HG1  3  
ATOM 5173  H HG21 . THR A 1 23  ? 11.242  6.098   3.598   1.00 0.00 ? 23  THR A HG21 3  
ATOM 5174  H HG22 . THR A 1 23  ? 10.097  7.334   3.030   1.00 0.00 ? 23  THR A HG22 3  
ATOM 5175  H HG23 . THR A 1 23  ? 9.577   6.150   4.239   1.00 0.00 ? 23  THR A HG23 3  
ATOM 5176  N N    . PHE A 1 24  ? 7.851   2.881   1.235   1.00 0.00 ? 24  PHE A N    3  
ATOM 5177  C CA   . PHE A 1 24  ? 7.112   2.393   0.029   1.00 0.00 ? 24  PHE A CA   3  
ATOM 5178  C C    . PHE A 1 24  ? 6.793   3.638   -0.883  1.00 0.00 ? 24  PHE A C    3  
ATOM 5179  O O    . PHE A 1 24  ? 6.027   4.514   -0.467  1.00 0.00 ? 24  PHE A O    3  
ATOM 5180  C CB   . PHE A 1 24  ? 5.832   1.688   0.566   1.00 0.00 ? 24  PHE A CB   3  
ATOM 5181  C CG   . PHE A 1 24  ? 4.812   1.070   -0.416  1.00 0.00 ? 24  PHE A CG   3  
ATOM 5182  C CD1  . PHE A 1 24  ? 4.028   1.886   -1.245  1.00 0.00 ? 24  PHE A CD1  3  
ATOM 5183  C CD2  . PHE A 1 24  ? 4.520   -0.297  -0.344  1.00 0.00 ? 24  PHE A CD2  3  
ATOM 5184  C CE1  . PHE A 1 24  ? 2.999   1.341   -2.006  1.00 0.00 ? 24  PHE A CE1  3  
ATOM 5185  C CE2  . PHE A 1 24  ? 3.462   -0.832  -1.078  1.00 0.00 ? 24  PHE A CE2  3  
ATOM 5186  C CZ   . PHE A 1 24  ? 2.713   -0.015  -1.916  1.00 0.00 ? 24  PHE A CZ   3  
ATOM 5187  H H    . PHE A 1 24  ? 7.356   3.172   2.096   1.00 0.00 ? 24  PHE A H    3  
ATOM 5188  H HA   . PHE A 1 24  ? 7.738   1.657   -0.536  1.00 0.00 ? 24  PHE A HA   3  
ATOM 5189  H HB2  . PHE A 1 24  ? 6.146   0.918   1.299   1.00 0.00 ? 24  PHE A HB2  3  
ATOM 5190  H HB3  . PHE A 1 24  ? 5.271   2.420   1.179   1.00 0.00 ? 24  PHE A HB3  3  
ATOM 5191  H HD1  . PHE A 1 24  ? 4.174   2.955   -1.277  1.00 0.00 ? 24  PHE A HD1  3  
ATOM 5192  H HD2  . PHE A 1 24  ? 5.078   -0.942  0.320   1.00 0.00 ? 24  PHE A HD2  3  
ATOM 5193  H HE1  . PHE A 1 24  ? 2.395   1.985   -2.629  1.00 0.00 ? 24  PHE A HE1  3  
ATOM 5194  H HE2  . PHE A 1 24  ? 3.207   -1.877  -0.988  1.00 0.00 ? 24  PHE A HE2  3  
ATOM 5195  H HZ   . PHE A 1 24  ? 1.894   -0.431  -2.480  1.00 0.00 ? 24  PHE A HZ   3  
ATOM 5196  N N    . TYR A 1 25  ? 7.356   3.726   -2.104  1.00 0.00 ? 25  TYR A N    3  
ATOM 5197  C CA   . TYR A 1 25  ? 7.129   4.892   -3.027  1.00 0.00 ? 25  TYR A CA   3  
ATOM 5198  C C    . TYR A 1 25  ? 7.516   4.545   -4.510  1.00 0.00 ? 25  TYR A C    3  
ATOM 5199  O O    . TYR A 1 25  ? 8.316   3.641   -4.774  1.00 0.00 ? 25  TYR A O    3  
ATOM 5200  C CB   . TYR A 1 25  ? 7.894   6.155   -2.511  1.00 0.00 ? 25  TYR A CB   3  
ATOM 5201  C CG   . TYR A 1 25  ? 9.430   6.266   -2.355  1.00 0.00 ? 25  TYR A CG   3  
ATOM 5202  C CD1  . TYR A 1 25  ? 10.328  5.190   -2.333  1.00 0.00 ? 25  TYR A CD1  3  
ATOM 5203  C CD2  . TYR A 1 25  ? 9.923   7.560   -2.147  1.00 0.00 ? 25  TYR A CD2  3  
ATOM 5204  C CE1  . TYR A 1 25  ? 11.688  5.409   -2.110  1.00 0.00 ? 25  TYR A CE1  3  
ATOM 5205  C CE2  . TYR A 1 25  ? 11.276  7.779   -1.927  1.00 0.00 ? 25  TYR A CE2  3  
ATOM 5206  C CZ   . TYR A 1 25  ? 12.156  6.708   -1.910  1.00 0.00 ? 25  TYR A CZ   3  
ATOM 5207  O OH   . TYR A 1 25  ? 13.490  6.955   -1.752  1.00 0.00 ? 25  TYR A OH   3  
ATOM 5208  H H    . TYR A 1 25  ? 7.977   2.949   -2.364  1.00 0.00 ? 25  TYR A H    3  
ATOM 5209  H HA   . TYR A 1 25  ? 6.046   5.154   -3.034  1.00 0.00 ? 25  TYR A HA   3  
ATOM 5210  H HB2  . TYR A 1 25  ? 7.555   6.996   -3.147  1.00 0.00 ? 25  TYR A HB2  3  
ATOM 5211  H HB3  . TYR A 1 25  ? 7.456   6.416   -1.527  1.00 0.00 ? 25  TYR A HB3  3  
ATOM 5212  H HD1  . TYR A 1 25  ? 9.983   4.176   -2.472  1.00 0.00 ? 25  TYR A HD1  3  
ATOM 5213  H HD2  . TYR A 1 25  ? 9.255   8.405   -2.144  1.00 0.00 ? 25  TYR A HD2  3  
ATOM 5214  H HE1  . TYR A 1 25  ? 12.372  4.575   -2.085  1.00 0.00 ? 25  TYR A HE1  3  
ATOM 5215  H HE2  . TYR A 1 25  ? 11.633  8.789   -1.779  1.00 0.00 ? 25  TYR A HE2  3  
ATOM 5216  H HH   . TYR A 1 25  ? 13.621  7.903   -1.671  1.00 0.00 ? 25  TYR A HH   3  
ATOM 5217  N N    . LEU A 1 26  ? 6.941   5.255   -5.505  1.00 0.00 ? 26  LEU A N    3  
ATOM 5218  C CA   . LEU A 1 26  ? 7.231   4.987   -6.949  1.00 0.00 ? 26  LEU A CA   3  
ATOM 5219  C C    . LEU A 1 26  ? 8.308   5.931   -7.599  1.00 0.00 ? 26  LEU A C    3  
ATOM 5220  O O    . LEU A 1 26  ? 8.804   6.884   -6.991  1.00 0.00 ? 26  LEU A O    3  
ATOM 5221  C CB   . LEU A 1 26  ? 5.872   4.974   -7.730  1.00 0.00 ? 26  LEU A CB   3  
ATOM 5222  C CG   . LEU A 1 26  ? 4.885   6.173   -7.833  1.00 0.00 ? 26  LEU A CG   3  
ATOM 5223  C CD1  . LEU A 1 26  ? 3.786   6.093   -6.763  1.00 0.00 ? 26  LEU A CD1  3  
ATOM 5224  C CD2  . LEU A 1 26  ? 5.513   7.576   -7.863  1.00 0.00 ? 26  LEU A CD2  3  
ATOM 5225  H H    . LEU A 1 26  ? 6.294   5.992   -5.204  1.00 0.00 ? 26  LEU A H    3  
ATOM 5226  H HA   . LEU A 1 26  ? 7.662   3.980   -7.044  1.00 0.00 ? 26  LEU A HA   3  
ATOM 5227  H HB2  . LEU A 1 26  ? 6.110   4.693   -8.772  1.00 0.00 ? 26  LEU A HB2  3  
ATOM 5228  H HB3  . LEU A 1 26  ? 5.309   4.084   -7.387  1.00 0.00 ? 26  LEU A HB3  3  
ATOM 5229  H HG   . LEU A 1 26  ? 4.376   6.051   -8.810  1.00 0.00 ? 26  LEU A HG   3  
ATOM 5230  H HD11 . LEU A 1 26  ? 3.218   5.148   -6.830  1.00 0.00 ? 26  LEU A HD11 3  
ATOM 5231  H HD12 . LEU A 1 26  ? 4.197   6.145   -5.738  1.00 0.00 ? 26  LEU A HD12 3  
ATOM 5232  H HD13 . LEU A 1 26  ? 3.047   6.910   -6.865  1.00 0.00 ? 26  LEU A HD13 3  
ATOM 5233  H HD21 . LEU A 1 26  ? 6.241   7.680   -8.688  1.00 0.00 ? 26  LEU A HD21 3  
ATOM 5234  H HD22 . LEU A 1 26  ? 4.751   8.364   -8.014  1.00 0.00 ? 26  LEU A HD22 3  
ATOM 5235  H HD23 . LEU A 1 26  ? 6.045   7.816   -6.924  1.00 0.00 ? 26  LEU A HD23 3  
ATOM 5236  N N    . ARG A 1 27  ? 8.713   5.601   -8.848  1.00 0.00 ? 27  ARG A N    3  
ATOM 5237  C CA   . ARG A 1 27  ? 9.677   6.430   -9.646  1.00 0.00 ? 27  ARG A CA   3  
ATOM 5238  C C    . ARG A 1 27  ? 8.995   6.920   -10.974 1.00 0.00 ? 27  ARG A C    3  
ATOM 5239  O O    . ARG A 1 27  ? 8.961   8.129   -11.209 1.00 0.00 ? 27  ARG A O    3  
ATOM 5240  C CB   . ARG A 1 27  ? 11.036  5.667   -9.796  1.00 0.00 ? 27  ARG A CB   3  
ATOM 5241  C CG   . ARG A 1 27  ? 11.253  4.567   -10.875 1.00 0.00 ? 27  ARG A CG   3  
ATOM 5242  C CD   . ARG A 1 27  ? 12.381  3.526   -10.637 1.00 0.00 ? 27  ARG A CD   3  
ATOM 5243  N NE   . ARG A 1 27  ? 13.689  4.079   -10.170 1.00 0.00 ? 27  ARG A NE   3  
ATOM 5244  C CZ   . ARG A 1 27  ? 14.683  3.360   -9.631  1.00 0.00 ? 27  ARG A CZ   3  
ATOM 5245  N NH1  . ARG A 1 27  ? 14.649  2.058   -9.485  1.00 0.00 ? 27  ARG A NH1  3  
ATOM 5246  N NH2  . ARG A 1 27  ? 15.755  3.973   -9.220  1.00 0.00 ? 27  ARG A NH2  3  
ATOM 5247  H H    . ARG A 1 27  ? 8.195   4.803   -9.236  1.00 0.00 ? 27  ARG A H    3  
ATOM 5248  H HA   . ARG A 1 27  ? 9.904   7.369   -9.099  1.00 0.00 ? 27  ARG A HA   3  
ATOM 5249  H HB2  . ARG A 1 27  ? 11.819  6.432   -9.956  1.00 0.00 ? 27  ARG A HB2  3  
ATOM 5250  H HB3  . ARG A 1 27  ? 11.294  5.253   -8.808  1.00 0.00 ? 27  ARG A HB3  3  
ATOM 5251  H HG2  . ARG A 1 27  ? 10.314  3.996   -11.001 1.00 0.00 ? 27  ARG A HG2  3  
ATOM 5252  H HG3  . ARG A 1 27  ? 11.411  5.056   -11.857 1.00 0.00 ? 27  ARG A HG3  3  
ATOM 5253  H HD2  . ARG A 1 27  ? 12.009  2.767   -9.925  1.00 0.00 ? 27  ARG A HD2  3  
ATOM 5254  H HD3  . ARG A 1 27  ? 12.539  2.958   -11.578 1.00 0.00 ? 27  ARG A HD3  3  
ATOM 5255  H HE   . ARG A 1 27  ? 13.891  5.081   -10.217 1.00 0.00 ? 27  ARG A HE   3  
ATOM 5256  H HH11 . ARG A 1 27  ? 13.808  1.589   -9.813  1.00 0.00 ? 27  ARG A HH11 3  
ATOM 5257  H HH12 . ARG A 1 27  ? 15.513  1.589   -9.105  1.00 0.00 ? 27  ARG A HH12 3  
ATOM 5258  H HH21 . ARG A 1 27  ? 15.841  4.990   -9.330  1.00 0.00 ? 27  ARG A HH21 3  
ATOM 5259  H HH22 . ARG A 1 27  ? 16.424  3.369   -8.675  1.00 0.00 ? 27  ARG A HH22 3  
ATOM 5260  N N    . ASN A 1 28  ? 8.448   6.027   -11.827 1.00 0.00 ? 28  ASN A N    3  
ATOM 5261  C CA   . ASN A 1 28  ? 7.671   6.410   -13.044 1.00 0.00 ? 28  ASN A CA   3  
ATOM 5262  C C    . ASN A 1 28  ? 6.277   5.699   -12.932 1.00 0.00 ? 28  ASN A C    3  
ATOM 5263  O O    . ASN A 1 28  ? 5.276   6.361   -12.657 1.00 0.00 ? 28  ASN A O    3  
ATOM 5264  C CB   . ASN A 1 28  ? 8.528   6.077   -14.299 1.00 0.00 ? 28  ASN A CB   3  
ATOM 5265  C CG   . ASN A 1 28  ? 7.968   6.622   -15.616 1.00 0.00 ? 28  ASN A CG   3  
ATOM 5266  O OD1  . ASN A 1 28  ? 8.239   7.748   -16.013 1.00 0.00 ? 28  ASN A OD1  3  
ATOM 5267  N ND2  . ASN A 1 28  ? 7.179   5.863   -16.338 1.00 0.00 ? 28  ASN A ND2  3  
ATOM 5268  H H    . ASN A 1 28  ? 8.542   5.049   -11.537 1.00 0.00 ? 28  ASN A H    3  
ATOM 5269  H HA   . ASN A 1 28  ? 7.461   7.501   -13.046 1.00 0.00 ? 28  ASN A HA   3  
ATOM 5270  H HB2  . ASN A 1 28  ? 9.528   6.533   -14.182 1.00 0.00 ? 28  ASN A HB2  3  
ATOM 5271  H HB3  . ASN A 1 28  ? 8.728   4.992   -14.381 1.00 0.00 ? 28  ASN A HB3  3  
ATOM 5272  H HD21 . ASN A 1 28  ? 6.871   4.979   -15.925 1.00 0.00 ? 28  ASN A HD21 3  
ATOM 5273  H HD22 . ASN A 1 28  ? 6.813   6.334   -17.170 1.00 0.00 ? 28  ASN A HD22 3  
ATOM 5274  N N    . ASN A 1 29  ? 6.202   4.371   -13.154 1.00 0.00 ? 29  ASN A N    3  
ATOM 5275  C CA   . ASN A 1 29  ? 4.960   3.566   -12.940 1.00 0.00 ? 29  ASN A CA   3  
ATOM 5276  C C    . ASN A 1 29  ? 5.377   2.166   -12.351 1.00 0.00 ? 29  ASN A C    3  
ATOM 5277  O O    . ASN A 1 29  ? 5.107   1.111   -12.932 1.00 0.00 ? 29  ASN A O    3  
ATOM 5278  C CB   . ASN A 1 29  ? 4.182   3.505   -14.287 1.00 0.00 ? 29  ASN A CB   3  
ATOM 5279  C CG   . ASN A 1 29  ? 2.745   2.984   -14.175 1.00 0.00 ? 29  ASN A CG   3  
ATOM 5280  O OD1  . ASN A 1 29  ? 1.808   3.718   -13.885 1.00 0.00 ? 29  ASN A OD1  3  
ATOM 5281  N ND2  . ASN A 1 29  ? 2.519   1.711   -14.388 1.00 0.00 ? 29  ASN A ND2  3  
ATOM 5282  H H    . ASN A 1 29  ? 7.107   3.926   -13.353 1.00 0.00 ? 29  ASN A H    3  
ATOM 5283  H HA   . ASN A 1 29  ? 4.314   4.054   -12.180 1.00 0.00 ? 29  ASN A HA   3  
ATOM 5284  H HB2  . ASN A 1 29  ? 4.100   4.522   -14.714 1.00 0.00 ? 29  ASN A HB2  3  
ATOM 5285  H HB3  . ASN A 1 29  ? 4.748   2.927   -15.043 1.00 0.00 ? 29  ASN A HB3  3  
ATOM 5286  H HD21 . ASN A 1 29  ? 3.353   1.114   -14.343 1.00 0.00 ? 29  ASN A HD21 3  
ATOM 5287  H HD22 . ASN A 1 29  ? 1.547   1.442   -14.212 1.00 0.00 ? 29  ASN A HD22 3  
ATOM 5288  N N    . GLN A 1 30  ? 6.046   2.172   -11.181 1.00 0.00 ? 30  GLN A N    3  
ATOM 5289  C CA   . GLN A 1 30  ? 6.571   0.949   -10.512 1.00 0.00 ? 30  GLN A CA   3  
ATOM 5290  C C    . GLN A 1 30  ? 6.560   1.198   -8.974  1.00 0.00 ? 30  GLN A C    3  
ATOM 5291  O O    . GLN A 1 30  ? 6.997   2.261   -8.528  1.00 0.00 ? 30  GLN A O    3  
ATOM 5292  C CB   . GLN A 1 30  ? 8.044   0.629   -10.932 1.00 0.00 ? 30  GLN A CB   3  
ATOM 5293  C CG   . GLN A 1 30  ? 8.383   0.438   -12.437 1.00 0.00 ? 30  GLN A CG   3  
ATOM 5294  C CD   . GLN A 1 30  ? 8.700   1.707   -13.252 1.00 0.00 ? 30  GLN A CD   3  
ATOM 5295  O OE1  . GLN A 1 30  ? 8.811   2.830   -12.766 1.00 0.00 ? 30  GLN A OE1  3  
ATOM 5296  N NE2  . GLN A 1 30  ? 8.867   1.562   -14.544 1.00 0.00 ? 30  GLN A NE2  3  
ATOM 5297  H H    . GLN A 1 30  ? 6.227   3.107   -10.797 1.00 0.00 ? 30  GLN A H    3  
ATOM 5298  H HA   . GLN A 1 30  ? 5.930   0.078   -10.759 1.00 0.00 ? 30  GLN A HA   3  
ATOM 5299  H HB2  . GLN A 1 30  ? 8.728   1.386   -10.501 1.00 0.00 ? 30  GLN A HB2  3  
ATOM 5300  H HB3  . GLN A 1 30  ? 8.334   -0.307  -10.414 1.00 0.00 ? 30  GLN A HB3  3  
ATOM 5301  H HG2  . GLN A 1 30  ? 9.268   -0.221  -12.511 1.00 0.00 ? 30  GLN A HG2  3  
ATOM 5302  H HG3  . GLN A 1 30  ? 7.565   -0.124  -12.928 1.00 0.00 ? 30  GLN A HG3  3  
ATOM 5303  H HE21 . GLN A 1 30  ? 8.793   0.610   -14.915 1.00 0.00 ? 30  GLN A HE21 3  
ATOM 5304  H HE22 . GLN A 1 30  ? 9.156   2.409   -15.039 1.00 0.00 ? 30  GLN A HE22 3  
ATOM 5305  N N    . LEU A 1 31  ? 6.124   0.233   -8.149  1.00 0.00 ? 31  LEU A N    3  
ATOM 5306  C CA   . LEU A 1 31  ? 6.109   0.402   -6.660  1.00 0.00 ? 31  LEU A CA   3  
ATOM 5307  C C    . LEU A 1 31  ? 7.508   0.000   -6.079  1.00 0.00 ? 31  LEU A C    3  
ATOM 5308  O O    . LEU A 1 31  ? 7.789   -1.178  -5.815  1.00 0.00 ? 31  LEU A O    3  
ATOM 5309  C CB   . LEU A 1 31  ? 4.933   -0.430  -6.077  1.00 0.00 ? 31  LEU A CB   3  
ATOM 5310  C CG   . LEU A 1 31  ? 3.494   0.003   -6.476  1.00 0.00 ? 31  LEU A CG   3  
ATOM 5311  C CD1  . LEU A 1 31  ? 2.461   -0.992  -5.921  1.00 0.00 ? 31  LEU A CD1  3  
ATOM 5312  C CD2  . LEU A 1 31  ? 3.158   1.429   -6.003  1.00 0.00 ? 31  LEU A CD2  3  
ATOM 5313  H H    . LEU A 1 31  ? 5.788   -0.617  -8.612  1.00 0.00 ? 31  LEU A H    3  
ATOM 5314  H HA   . LEU A 1 31  ? 5.925   1.461   -6.387  1.00 0.00 ? 31  LEU A HA   3  
ATOM 5315  H HB2  . LEU A 1 31  ? 5.080   -1.495  -6.343  1.00 0.00 ? 31  LEU A HB2  3  
ATOM 5316  H HB3  . LEU A 1 31  ? 5.011   -0.403  -4.972  1.00 0.00 ? 31  LEU A HB3  3  
ATOM 5317  H HG   . LEU A 1 31  ? 3.409   -0.018  -7.581  1.00 0.00 ? 31  LEU A HG   3  
ATOM 5318  H HD11 . LEU A 1 31  ? 2.639   -2.021  -6.289  1.00 0.00 ? 31  LEU A HD11 3  
ATOM 5319  H HD12 . LEU A 1 31  ? 2.478   -1.034  -4.817  1.00 0.00 ? 31  LEU A HD12 3  
ATOM 5320  H HD13 . LEU A 1 31  ? 1.431   -0.727  -6.224  1.00 0.00 ? 31  LEU A HD13 3  
ATOM 5321  H HD21 . LEU A 1 31  ? 3.286   1.547   -4.912  1.00 0.00 ? 31  LEU A HD21 3  
ATOM 5322  H HD22 . LEU A 1 31  ? 3.798   2.189   -6.487  1.00 0.00 ? 31  LEU A HD22 3  
ATOM 5323  H HD23 . LEU A 1 31  ? 2.119   1.709   -6.248  1.00 0.00 ? 31  LEU A HD23 3  
ATOM 5324  N N    . VAL A 1 32  ? 8.392   1.011   -5.949  1.00 0.00 ? 32  VAL A N    3  
ATOM 5325  C CA   . VAL A 1 32  ? 9.821   0.833   -5.548  1.00 0.00 ? 32  VAL A CA   3  
ATOM 5326  C C    . VAL A 1 32  ? 9.946   0.813   -3.982  1.00 0.00 ? 32  VAL A C    3  
ATOM 5327  O O    . VAL A 1 32  ? 8.992   1.066   -3.230  1.00 0.00 ? 32  VAL A O    3  
ATOM 5328  C CB   . VAL A 1 32  ? 10.739  1.920   -6.244  1.00 0.00 ? 32  VAL A CB   3  
ATOM 5329  C CG1  . VAL A 1 32  ? 12.187  1.420   -6.411  1.00 0.00 ? 32  VAL A CG1  3  
ATOM 5330  C CG2  . VAL A 1 32  ? 10.331  2.359   -7.674  1.00 0.00 ? 32  VAL A CG2  3  
ATOM 5331  H H    . VAL A 1 32  ? 8.038   1.960   -6.135  1.00 0.00 ? 32  VAL A H    3  
ATOM 5332  H HA   . VAL A 1 32  ? 10.159  -0.151  -5.912  1.00 0.00 ? 32  VAL A HA   3  
ATOM 5333  H HB   . VAL A 1 32  ? 10.808  2.818   -5.601  1.00 0.00 ? 32  VAL A HB   3  
ATOM 5334  H HG11 . VAL A 1 32  ? 12.212  0.462   -6.965  1.00 0.00 ? 32  VAL A HG11 3  
ATOM 5335  H HG12 . VAL A 1 32  ? 12.835  2.123   -6.966  1.00 0.00 ? 32  VAL A HG12 3  
ATOM 5336  H HG13 . VAL A 1 32  ? 12.708  1.250   -5.454  1.00 0.00 ? 32  VAL A HG13 3  
ATOM 5337  H HG21 . VAL A 1 32  ? 9.321   2.790   -7.702  1.00 0.00 ? 32  VAL A HG21 3  
ATOM 5338  H HG22 . VAL A 1 32  ? 10.989  3.148   -8.065  1.00 0.00 ? 32  VAL A HG22 3  
ATOM 5339  H HG23 . VAL A 1 32  ? 10.336  1.516   -8.391  1.00 0.00 ? 32  VAL A HG23 3  
ATOM 5340  N N    . ALA A 1 33  ? 11.144  0.471   -3.485  1.00 0.00 ? 33  ALA A N    3  
ATOM 5341  C CA   . ALA A 1 33  ? 11.373  0.248   -2.050  1.00 0.00 ? 33  ALA A CA   3  
ATOM 5342  C C    . ALA A 1 33  ? 12.573  0.968   -1.445  1.00 0.00 ? 33  ALA A C    3  
ATOM 5343  O O    . ALA A 1 33  ? 13.674  1.073   -2.000  1.00 0.00 ? 33  ALA A O    3  
ATOM 5344  C CB   . ALA A 1 33  ? 11.735  -1.244  -1.914  1.00 0.00 ? 33  ALA A CB   3  
ATOM 5345  H H    . ALA A 1 33  ? 11.906  0.295   -4.162  1.00 0.00 ? 33  ALA A H    3  
ATOM 5346  H HA   . ALA A 1 33  ? 10.456  0.503   -1.445  1.00 0.00 ? 33  ALA A HA   3  
ATOM 5347  H HB1  . ALA A 1 33  ? 10.931  -1.905  -2.262  1.00 0.00 ? 33  ALA A HB1  3  
ATOM 5348  H HB2  . ALA A 1 33  ? 12.656  -1.485  -2.487  1.00 0.00 ? 33  ALA A HB2  3  
ATOM 5349  H HB3  . ALA A 1 33  ? 11.983  -1.496  -0.866  1.00 0.00 ? 33  ALA A HB3  3  
ATOM 5350  N N    . GLY A 1 34  ? 12.358  1.229   -0.160  1.00 0.00 ? 34  GLY A N    3  
ATOM 5351  C CA   . GLY A 1 34  ? 13.393  1.728   0.714   1.00 0.00 ? 34  GLY A CA   3  
ATOM 5352  C C    . GLY A 1 34  ? 13.818  3.155   0.452   1.00 0.00 ? 34  GLY A C    3  
ATOM 5353  O O    . GLY A 1 34  ? 13.264  4.125   0.969   1.00 0.00 ? 34  GLY A O    3  
ATOM 5354  H H    . GLY A 1 34  ? 11.372  1.159   0.136   1.00 0.00 ? 34  GLY A H    3  
ATOM 5355  H HA2  . GLY A 1 34  ? 12.966  1.636   1.704   1.00 0.00 ? 34  GLY A HA2  3  
ATOM 5356  H HA3  . GLY A 1 34  ? 14.254  1.034   0.721   1.00 0.00 ? 34  GLY A HA3  3  
ATOM 5357  N N    . TYR A 1 35  ? 14.917  3.218   -0.269  1.00 0.00 ? 35  TYR A N    3  
ATOM 5358  C CA   . TYR A 1 35  ? 15.491  4.521   -0.652  1.00 0.00 ? 35  TYR A CA   3  
ATOM 5359  C C    . TYR A 1 35  ? 16.163  4.291   -2.046  1.00 0.00 ? 35  TYR A C    3  
ATOM 5360  O O    . TYR A 1 35  ? 17.362  4.004   -2.072  1.00 0.00 ? 35  TYR A O    3  
ATOM 5361  C CB   . TYR A 1 35  ? 16.476  5.089   0.436   1.00 0.00 ? 35  TYR A CB   3  
ATOM 5362  C CG   . TYR A 1 35  ? 16.019  6.202   1.424   1.00 0.00 ? 35  TYR A CG   3  
ATOM 5363  C CD1  . TYR A 1 35  ? 14.796  6.893   1.350   1.00 0.00 ? 35  TYR A CD1  3  
ATOM 5364  C CD2  . TYR A 1 35  ? 16.956  6.610   2.384   1.00 0.00 ? 35  TYR A CD2  3  
ATOM 5365  C CE1  . TYR A 1 35  ? 14.535  7.971   2.190   1.00 0.00 ? 35  TYR A CE1  3  
ATOM 5366  C CE2  . TYR A 1 35  ? 16.691  7.689   3.227   1.00 0.00 ? 35  TYR A CE2  3  
ATOM 5367  C CZ   . TYR A 1 35  ? 15.484  8.373   3.120   1.00 0.00 ? 35  TYR A CZ   3  
ATOM 5368  O OH   . TYR A 1 35  ? 15.201  9.432   3.943   1.00 0.00 ? 35  TYR A OH   3  
ATOM 5369  H H    . TYR A 1 35  ? 15.106  2.289   -0.692  1.00 0.00 ? 35  TYR A H    3  
ATOM 5370  H HA   . TYR A 1 35  ? 14.629  5.186   -0.707  1.00 0.00 ? 35  TYR A HA   3  
ATOM 5371  H HB2  . TYR A 1 35  ? 16.912  4.249   1.011   1.00 0.00 ? 35  TYR A HB2  3  
ATOM 5372  H HB3  . TYR A 1 35  ? 17.356  5.516   -0.083  1.00 0.00 ? 35  TYR A HB3  3  
ATOM 5373  H HD1  . TYR A 1 35  ? 14.016  6.612   0.665   1.00 0.00 ? 35  TYR A HD1  3  
ATOM 5374  H HD2  . TYR A 1 35  ? 17.906  6.104   2.472   1.00 0.00 ? 35  TYR A HD2  3  
ATOM 5375  H HE1  . TYR A 1 35  ? 13.589  8.489   2.130   1.00 0.00 ? 35  TYR A HE1  3  
ATOM 5376  H HE2  . TYR A 1 35  ? 17.425  7.996   3.958   1.00 0.00 ? 35  TYR A HE2  3  
ATOM 5377  H HH   . TYR A 1 35  ? 15.751  9.394   4.748   1.00 0.00 ? 35  TYR A HH   3  
ATOM 5378  N N    . LEU A 1 36  ? 15.483  4.551   -3.188  1.00 0.00 ? 36  LEU A N    3  
ATOM 5379  C CA   . LEU A 1 36  ? 16.038  4.197   -4.535  1.00 0.00 ? 36  LEU A CA   3  
ATOM 5380  C C    . LEU A 1 36  ? 17.246  5.057   -5.097  1.00 0.00 ? 36  LEU A C    3  
ATOM 5381  O O    . LEU A 1 36  ? 18.207  5.340   -4.378  1.00 0.00 ? 36  LEU A O    3  
ATOM 5382  C CB   . LEU A 1 36  ? 14.721  4.177   -5.410  1.00 0.00 ? 36  LEU A CB   3  
ATOM 5383  C CG   . LEU A 1 36  ? 14.065  5.483   -5.991  1.00 0.00 ? 36  LEU A CG   3  
ATOM 5384  C CD1  . LEU A 1 36  ? 12.587  5.241   -6.322  1.00 0.00 ? 36  LEU A CD1  3  
ATOM 5385  C CD2  . LEU A 1 36  ? 14.150  6.758   -5.136  1.00 0.00 ? 36  LEU A CD2  3  
ATOM 5386  H H    . LEU A 1 36  ? 14.467  4.675   -3.069  1.00 0.00 ? 36  LEU A H    3  
ATOM 5387  H HA   . LEU A 1 36  ? 16.445  3.179   -4.535  1.00 0.00 ? 36  LEU A HA   3  
ATOM 5388  H HB2  . LEU A 1 36  ? 14.941  3.530   -6.280  1.00 0.00 ? 36  LEU A HB2  3  
ATOM 5389  H HB3  . LEU A 1 36  ? 13.947  3.574   -4.888  1.00 0.00 ? 36  LEU A HB3  3  
ATOM 5390  H HG   . LEU A 1 36  ? 14.567  5.722   -6.947  1.00 0.00 ? 36  LEU A HG   3  
ATOM 5391  H HD11 . LEU A 1 36  ? 12.479  4.410   -7.036  1.00 0.00 ? 36  LEU A HD11 3  
ATOM 5392  H HD12 . LEU A 1 36  ? 11.993  4.986   -5.424  1.00 0.00 ? 36  LEU A HD12 3  
ATOM 5393  H HD13 . LEU A 1 36  ? 12.107  6.127   -6.780  1.00 0.00 ? 36  LEU A HD13 3  
ATOM 5394  H HD21 . LEU A 1 36  ? 15.190  7.028   -4.880  1.00 0.00 ? 36  LEU A HD21 3  
ATOM 5395  H HD22 . LEU A 1 36  ? 13.722  7.638   -5.653  1.00 0.00 ? 36  LEU A HD22 3  
ATOM 5396  H HD23 . LEU A 1 36  ? 13.603  6.644   -4.190  1.00 0.00 ? 36  LEU A HD23 3  
ATOM 5397  N N    . GLN A 1 37  ? 17.203  5.516   -6.355  1.00 0.00 ? 37  GLN A N    3  
ATOM 5398  C CA   . GLN A 1 37  ? 18.312  6.253   -7.025  1.00 0.00 ? 37  GLN A CA   3  
ATOM 5399  C C    . GLN A 1 37  ? 17.739  7.114   -8.200  1.00 0.00 ? 37  GLN A C    3  
ATOM 5400  O O    . GLN A 1 37  ? 16.809  6.715   -8.917  1.00 0.00 ? 37  GLN A O    3  
ATOM 5401  C CB   . GLN A 1 37  ? 19.367  5.212   -7.514  1.00 0.00 ? 37  GLN A CB   3  
ATOM 5402  C CG   . GLN A 1 37  ? 20.676  5.799   -8.108  1.00 0.00 ? 37  GLN A CG   3  
ATOM 5403  C CD   . GLN A 1 37  ? 21.781  4.781   -8.411  1.00 0.00 ? 37  GLN A CD   3  
ATOM 5404  O OE1  . GLN A 1 37  ? 22.827  4.750   -7.773  1.00 0.00 ? 37  GLN A OE1  3  
ATOM 5405  N NE2  . GLN A 1 37  ? 21.614  3.936   -9.401  1.00 0.00 ? 37  GLN A NE2  3  
ATOM 5406  H H    . GLN A 1 37  ? 16.369  5.178   -6.838  1.00 0.00 ? 37  GLN A H    3  
ATOM 5407  H HA   . GLN A 1 37  ? 18.787  6.929   -6.284  1.00 0.00 ? 37  GLN A HA   3  
ATOM 5408  H HB2  . GLN A 1 37  ? 19.643  4.561   -6.658  1.00 0.00 ? 37  GLN A HB2  3  
ATOM 5409  H HB3  . GLN A 1 37  ? 18.901  4.521   -8.243  1.00 0.00 ? 37  GLN A HB3  3  
ATOM 5410  H HG2  . GLN A 1 37  ? 20.463  6.371   -9.030  1.00 0.00 ? 37  GLN A HG2  3  
ATOM 5411  H HG3  . GLN A 1 37  ? 21.099  6.538   -7.403  1.00 0.00 ? 37  GLN A HG3  3  
ATOM 5412  H HE21 . GLN A 1 37  ? 20.680  3.902   -9.819  1.00 0.00 ? 37  GLN A HE21 3  
ATOM 5413  H HE22 . GLN A 1 37  ? 22.370  3.253   -9.486  1.00 0.00 ? 37  GLN A HE22 3  
ATOM 5414  N N    . GLY A 1 38  ? 18.346  8.296   -8.404  1.00 0.00 ? 38  GLY A N    3  
ATOM 5415  C CA   . GLY A 1 38  ? 17.913  9.278   -9.432  1.00 0.00 ? 38  GLY A CA   3  
ATOM 5416  C C    . GLY A 1 38  ? 17.303  10.506  -8.716  1.00 0.00 ? 38  GLY A C    3  
ATOM 5417  O O    . GLY A 1 38  ? 18.086  11.377  -8.323  1.00 0.00 ? 38  GLY A O    3  
ATOM 5418  H H    . GLY A 1 38  ? 19.097  8.507   -7.738  1.00 0.00 ? 38  GLY A H    3  
ATOM 5419  H HA2  . GLY A 1 38  ? 18.793  9.612   -10.012 1.00 0.00 ? 38  GLY A HA2  3  
ATOM 5420  H HA3  . GLY A 1 38  ? 17.223  8.849   -10.183 1.00 0.00 ? 38  GLY A HA3  3  
ATOM 5421  N N    . PRO A 1 39  ? 15.964  10.625  -8.483  1.00 0.00 ? 39  PRO A N    3  
ATOM 5422  C CA   . PRO A 1 39  ? 15.392  11.745  -7.696  1.00 0.00 ? 39  PRO A CA   3  
ATOM 5423  C C    . PRO A 1 39  ? 15.630  11.511  -6.160  1.00 0.00 ? 39  PRO A C    3  
ATOM 5424  O O    . PRO A 1 39  ? 15.176  10.512  -5.592  1.00 0.00 ? 39  PRO A O    3  
ATOM 5425  C CB   . PRO A 1 39  ? 13.927  11.718  -8.167  1.00 0.00 ? 39  PRO A CB   3  
ATOM 5426  C CG   . PRO A 1 39  ? 13.621  10.241  -8.447  1.00 0.00 ? 39  PRO A CG   3  
ATOM 5427  C CD   . PRO A 1 39  ? 14.948  9.650   -8.936  1.00 0.00 ? 39  PRO A CD   3  
ATOM 5428  H HA   . PRO A 1 39  ? 15.845  12.712  -7.997  1.00 0.00 ? 39  PRO A HA   3  
ATOM 5429  H HB2  . PRO A 1 39  ? 13.228  12.177  -7.446  1.00 0.00 ? 39  PRO A HB2  3  
ATOM 5430  H HB3  . PRO A 1 39  ? 13.828  12.302  -9.103  1.00 0.00 ? 39  PRO A HB3  3  
ATOM 5431  H HG2  . PRO A 1 39  ? 13.304  9.739   -7.511  1.00 0.00 ? 39  PRO A HG2  3  
ATOM 5432  H HG3  . PRO A 1 39  ? 12.800  10.110  -9.177  1.00 0.00 ? 39  PRO A HG3  3  
ATOM 5433  H HD2  . PRO A 1 39  ? 15.117  8.644   -8.506  1.00 0.00 ? 39  PRO A HD2  3  
ATOM 5434  H HD3  . PRO A 1 39  ? 14.953  9.556   -10.040 1.00 0.00 ? 39  PRO A HD3  3  
ATOM 5435  N N    . ASN A 1 40  ? 16.372  12.417  -5.502  1.00 0.00 ? 40  ASN A N    3  
ATOM 5436  C CA   . ASN A 1 40  ? 16.755  12.252  -4.063  1.00 0.00 ? 40  ASN A CA   3  
ATOM 5437  C C    . ASN A 1 40  ? 15.917  13.098  -3.044  1.00 0.00 ? 40  ASN A C    3  
ATOM 5438  O O    . ASN A 1 40  ? 15.594  12.564  -1.980  1.00 0.00 ? 40  ASN A O    3  
ATOM 5439  C CB   . ASN A 1 40  ? 18.274  12.574  -3.951  1.00 0.00 ? 40  ASN A CB   3  
ATOM 5440  C CG   . ASN A 1 40  ? 19.218  11.449  -4.400  1.00 0.00 ? 40  ASN A CG   3  
ATOM 5441  O OD1  . ASN A 1 40  ? 19.633  10.608  -3.612  1.00 0.00 ? 40  ASN A OD1  3  
ATOM 5442  N ND2  . ASN A 1 40  ? 19.606  11.382  -5.650  1.00 0.00 ? 40  ASN A ND2  3  
ATOM 5443  H H    . ASN A 1 40  ? 16.699  13.195  -6.082  1.00 0.00 ? 40  ASN A H    3  
ATOM 5444  H HA   . ASN A 1 40  ? 16.608  11.201  -3.736  1.00 0.00 ? 40  ASN A HA   3  
ATOM 5445  H HB2  . ASN A 1 40  ? 18.534  13.525  -4.453  1.00 0.00 ? 40  ASN A HB2  3  
ATOM 5446  H HB3  . ASN A 1 40  ? 18.530  12.756  -2.890  1.00 0.00 ? 40  ASN A HB3  3  
ATOM 5447  H HD21 . ASN A 1 40  ? 19.053  11.904  -6.339  1.00 0.00 ? 40  ASN A HD21 3  
ATOM 5448  H HD22 . ASN A 1 40  ? 20.203  10.571  -5.830  1.00 0.00 ? 40  ASN A HD22 3  
ATOM 5449  N N    . VAL A 1 41  ? 15.590  14.381  -3.303  1.00 0.00 ? 41  VAL A N    3  
ATOM 5450  C CA   . VAL A 1 41  ? 14.798  15.233  -2.356  1.00 0.00 ? 41  VAL A CA   3  
ATOM 5451  C C    . VAL A 1 41  ? 13.554  15.857  -3.075  1.00 0.00 ? 41  VAL A C    3  
ATOM 5452  O O    . VAL A 1 41  ? 13.555  16.110  -4.285  1.00 0.00 ? 41  VAL A O    3  
ATOM 5453  C CB   . VAL A 1 41  ? 15.771  16.289  -1.712  1.00 0.00 ? 41  VAL A CB   3  
ATOM 5454  C CG1  . VAL A 1 41  ? 16.233  17.445  -2.634  1.00 0.00 ? 41  VAL A CG1  3  
ATOM 5455  C CG2  . VAL A 1 41  ? 15.212  16.896  -0.406  1.00 0.00 ? 41  VAL A CG2  3  
ATOM 5456  H H    . VAL A 1 41  ? 15.894  14.728  -4.218  1.00 0.00 ? 41  VAL A H    3  
ATOM 5457  H HA   . VAL A 1 41  ? 14.374  14.586  -1.555  1.00 0.00 ? 41  VAL A HA   3  
ATOM 5458  H HB   . VAL A 1 41  ? 16.687  15.743  -1.406  1.00 0.00 ? 41  VAL A HB   3  
ATOM 5459  H HG11 . VAL A 1 41  ? 16.691  17.068  -3.566  1.00 0.00 ? 41  VAL A HG11 3  
ATOM 5460  H HG12 . VAL A 1 41  ? 15.393  18.101  -2.931  1.00 0.00 ? 41  VAL A HG12 3  
ATOM 5461  H HG13 . VAL A 1 41  ? 16.989  18.088  -2.145  1.00 0.00 ? 41  VAL A HG13 3  
ATOM 5462  H HG21 . VAL A 1 41  ? 14.938  16.114  0.326   1.00 0.00 ? 41  VAL A HG21 3  
ATOM 5463  H HG22 . VAL A 1 41  ? 15.957  17.543  0.095   1.00 0.00 ? 41  VAL A HG22 3  
ATOM 5464  H HG23 . VAL A 1 41  ? 14.313  17.518  -0.579  1.00 0.00 ? 41  VAL A HG23 3  
ATOM 5465  N N    . ASN A 1 42  ? 12.472  16.087  -2.298  1.00 0.00 ? 42  ASN A N    3  
ATOM 5466  C CA   . ASN A 1 42  ? 11.152  16.617  -2.798  1.00 0.00 ? 42  ASN A CA   3  
ATOM 5467  C C    . ASN A 1 42  ? 10.472  15.713  -3.904  1.00 0.00 ? 42  ASN A C    3  
ATOM 5468  O O    . ASN A 1 42  ? 9.803   16.207  -4.816  1.00 0.00 ? 42  ASN A O    3  
ATOM 5469  C CB   . ASN A 1 42  ? 11.315  18.100  -3.264  1.00 0.00 ? 42  ASN A CB   3  
ATOM 5470  C CG   . ASN A 1 42  ? 11.710  19.095  -2.166  1.00 0.00 ? 42  ASN A CG   3  
ATOM 5471  O OD1  . ASN A 1 42  ? 11.059  19.218  -1.135  1.00 0.00 ? 42  ASN A OD1  3  
ATOM 5472  N ND2  . ASN A 1 42  ? 12.779  19.833  -2.341  1.00 0.00 ? 42  ASN A ND2  3  
ATOM 5473  H H    . ASN A 1 42  ? 12.611  15.848  -1.311  1.00 0.00 ? 42  ASN A H    3  
ATOM 5474  H HA   . ASN A 1 42  ? 10.434  16.601  -1.955  1.00 0.00 ? 42  ASN A HA   3  
ATOM 5475  H HB2  . ASN A 1 42  ? 12.003  18.154  -4.129  1.00 0.00 ? 42  ASN A HB2  3  
ATOM 5476  H HB3  . ASN A 1 42  ? 10.348  18.461  -3.662  1.00 0.00 ? 42  ASN A HB3  3  
ATOM 5477  H HD21 . ASN A 1 42  ? 13.293  19.708  -3.217  1.00 0.00 ? 42  ASN A HD21 3  
ATOM 5478  H HD22 . ASN A 1 42  ? 12.973  20.479  -1.571  1.00 0.00 ? 42  ASN A HD22 3  
ATOM 5479  N N    . LEU A 1 43  ? 10.584  14.379  -3.759  1.00 0.00 ? 43  LEU A N    3  
ATOM 5480  C CA   . LEU A 1 43  ? 10.016  13.378  -4.711  1.00 0.00 ? 43  LEU A CA   3  
ATOM 5481  C C    . LEU A 1 43  ? 8.968   12.400  -4.096  1.00 0.00 ? 43  LEU A C    3  
ATOM 5482  O O    . LEU A 1 43  ? 8.137   11.891  -4.852  1.00 0.00 ? 43  LEU A O    3  
ATOM 5483  C CB   . LEU A 1 43  ? 11.212  12.619  -5.365  1.00 0.00 ? 43  LEU A CB   3  
ATOM 5484  C CG   . LEU A 1 43  ? 12.017  11.474  -4.678  1.00 0.00 ? 43  LEU A CG   3  
ATOM 5485  C CD1  . LEU A 1 43  ? 12.554  11.793  -3.275  1.00 0.00 ? 43  LEU A CD1  3  
ATOM 5486  C CD2  . LEU A 1 43  ? 11.319  10.103  -4.702  1.00 0.00 ? 43  LEU A CD2  3  
ATOM 5487  H H    . LEU A 1 43  ? 11.189  14.111  -2.978  1.00 0.00 ? 43  LEU A H    3  
ATOM 5488  H HA   . LEU A 1 43  ? 9.468   13.897  -5.523  1.00 0.00 ? 43  LEU A HA   3  
ATOM 5489  H HB2  . LEU A 1 43  ? 10.829  12.211  -6.317  1.00 0.00 ? 43  LEU A HB2  3  
ATOM 5490  H HB3  . LEU A 1 43  ? 11.944  13.382  -5.692  1.00 0.00 ? 43  LEU A HB3  3  
ATOM 5491  H HG   . LEU A 1 43  ? 12.908  11.341  -5.313  1.00 0.00 ? 43  LEU A HG   3  
ATOM 5492  H HD11 . LEU A 1 43  ? 13.057  12.775  -3.252  1.00 0.00 ? 43  LEU A HD11 3  
ATOM 5493  H HD12 . LEU A 1 43  ? 11.761  11.806  -2.507  1.00 0.00 ? 43  LEU A HD12 3  
ATOM 5494  H HD13 . LEU A 1 43  ? 13.305  11.049  -2.951  1.00 0.00 ? 43  LEU A HD13 3  
ATOM 5495  H HD21 . LEU A 1 43  ? 10.933  9.851   -5.706  1.00 0.00 ? 43  LEU A HD21 3  
ATOM 5496  H HD22 . LEU A 1 43  ? 12.015  9.291   -4.420  1.00 0.00 ? 43  LEU A HD22 3  
ATOM 5497  H HD23 . LEU A 1 43  ? 10.465  10.045  -4.004  1.00 0.00 ? 43  LEU A HD23 3  
ATOM 5498  N N    . GLU A 1 44  ? 8.991   12.125  -2.772  1.00 0.00 ? 44  GLU A N    3  
ATOM 5499  C CA   . GLU A 1 44  ? 8.017   11.202  -2.122  1.00 0.00 ? 44  GLU A CA   3  
ATOM 5500  C C    . GLU A 1 44  ? 6.539   11.703  -2.260  1.00 0.00 ? 44  GLU A C    3  
ATOM 5501  O O    . GLU A 1 44  ? 6.215   12.877  -2.045  1.00 0.00 ? 44  GLU A O    3  
ATOM 5502  C CB   . GLU A 1 44  ? 8.382   11.034  -0.616  1.00 0.00 ? 44  GLU A CB   3  
ATOM 5503  C CG   . GLU A 1 44  ? 7.620   9.872   0.094   1.00 0.00 ? 44  GLU A CG   3  
ATOM 5504  C CD   . GLU A 1 44  ? 7.503   9.958   1.602   1.00 0.00 ? 44  GLU A CD   3  
ATOM 5505  O OE1  . GLU A 1 44  ? 6.870   10.902  2.125   1.00 0.00 ? 44  GLU A OE1  3  
ATOM 5506  O OE2  . GLU A 1 44  ? 7.959   9.036   2.299   1.00 0.00 ? 44  GLU A OE2  3  
ATOM 5507  H H    . GLU A 1 44  ? 9.754   12.616  -2.290  1.00 0.00 ? 44  GLU A H    3  
ATOM 5508  H HA   . GLU A 1 44  ? 8.113   10.219  -2.623  1.00 0.00 ? 44  GLU A HA   3  
ATOM 5509  H HB2  . GLU A 1 44  ? 9.468   10.856  -0.497  1.00 0.00 ? 44  GLU A HB2  3  
ATOM 5510  H HB3  . GLU A 1 44  ? 8.190   11.991  -0.089  1.00 0.00 ? 44  GLU A HB3  3  
ATOM 5511  H HG2  . GLU A 1 44  ? 6.580   9.789   -0.265  1.00 0.00 ? 44  GLU A HG2  3  
ATOM 5512  H HG3  . GLU A 1 44  ? 8.074   8.896   -0.156  1.00 0.00 ? 44  GLU A HG3  3  
ATOM 5513  N N    . GLU A 1 45  ? 5.660   10.770  -2.641  1.00 0.00 ? 45  GLU A N    3  
ATOM 5514  C CA   . GLU A 1 45  ? 4.214   11.026  -2.793  1.00 0.00 ? 45  GLU A CA   3  
ATOM 5515  C C    . GLU A 1 45  ? 3.486   10.819  -1.423  1.00 0.00 ? 45  GLU A C    3  
ATOM 5516  O O    . GLU A 1 45  ? 3.841   11.444  -0.416  1.00 0.00 ? 45  GLU A O    3  
ATOM 5517  C CB   . GLU A 1 45  ? 3.780   10.125  -4.005  1.00 0.00 ? 45  GLU A CB   3  
ATOM 5518  C CG   . GLU A 1 45  ? 4.171   8.615   -4.111  1.00 0.00 ? 45  GLU A CG   3  
ATOM 5519  C CD   . GLU A 1 45  ? 4.206   7.765   -2.849  1.00 0.00 ? 45  GLU A CD   3  
ATOM 5520  O OE1  . GLU A 1 45  ? 5.241   7.789   -2.153  1.00 0.00 ? 45  GLU A OE1  3  
ATOM 5521  O OE2  . GLU A 1 45  ? 3.209   7.077   -2.555  1.00 0.00 ? 45  GLU A OE2  3  
ATOM 5522  H H    . GLU A 1 45  ? 6.025   9.817   -2.771  1.00 0.00 ? 45  GLU A H    3  
ATOM 5523  H HA   . GLU A 1 45  ? 3.988   12.064  -3.070  1.00 0.00 ? 45  GLU A HA   3  
ATOM 5524  H HB2  . GLU A 1 45  ? 2.684   10.196  -4.097  1.00 0.00 ? 45  GLU A HB2  3  
ATOM 5525  H HB3  . GLU A 1 45  ? 4.146   10.605  -4.932  1.00 0.00 ? 45  GLU A HB3  3  
ATOM 5526  H HG2  . GLU A 1 45  ? 3.482   8.124   -4.817  1.00 0.00 ? 45  GLU A HG2  3  
ATOM 5527  H HG3  . GLU A 1 45  ? 5.171   8.527   -4.569  1.00 0.00 ? 45  GLU A HG3  3  
ATOM 5528  N N    . LYS A 1 46  ? 2.425   10.015  -1.386  1.00 0.00 ? 46  LYS A N    3  
ATOM 5529  C CA   . LYS A 1 46  ? 1.707   9.628   -0.145  1.00 0.00 ? 46  LYS A CA   3  
ATOM 5530  C C    . LYS A 1 46  ? 0.758   8.423   -0.444  1.00 0.00 ? 46  LYS A C    3  
ATOM 5531  O O    . LYS A 1 46  ? 0.100   8.376   -1.494  1.00 0.00 ? 46  LYS A O    3  
ATOM 5532  C CB   . LYS A 1 46  ? 0.930   10.849  0.447   1.00 0.00 ? 46  LYS A CB   3  
ATOM 5533  C CG   . LYS A 1 46  ? 0.927   10.955  1.993   1.00 0.00 ? 46  LYS A CG   3  
ATOM 5534  C CD   . LYS A 1 46  ? 2.081   11.770  2.643   1.00 0.00 ? 46  LYS A CD   3  
ATOM 5535  C CE   . LYS A 1 46  ? 3.308   11.001  3.182   1.00 0.00 ? 46  LYS A CE   3  
ATOM 5536  N NZ   . LYS A 1 46  ? 4.237   10.567  2.106   1.00 0.00 ? 46  LYS A NZ   3  
ATOM 5537  H H    . LYS A 1 46  ? 2.298   9.564   -2.300  1.00 0.00 ? 46  LYS A H    3  
ATOM 5538  H HA   . LYS A 1 46  ? 2.465   9.273   0.576   1.00 0.00 ? 46  LYS A HA   3  
ATOM 5539  H HB2  . LYS A 1 46  ? 1.307   11.808  0.040   1.00 0.00 ? 46  LYS A HB2  3  
ATOM 5540  H HB3  . LYS A 1 46  ? -0.115  10.833  0.080   1.00 0.00 ? 46  LYS A HB3  3  
ATOM 5541  H HG2  . LYS A 1 46  ? -0.013  11.472  2.258   1.00 0.00 ? 46  LYS A HG2  3  
ATOM 5542  H HG3  . LYS A 1 46  ? 0.816   9.963   2.468   1.00 0.00 ? 46  LYS A HG3  3  
ATOM 5543  H HD2  . LYS A 1 46  ? 2.397   12.604  1.985   1.00 0.00 ? 46  LYS A HD2  3  
ATOM 5544  H HD3  . LYS A 1 46  ? 1.643   12.298  3.517   1.00 0.00 ? 46  LYS A HD3  3  
ATOM 5545  H HE2  . LYS A 1 46  ? 3.854   11.658  3.897   1.00 0.00 ? 46  LYS A HE2  3  
ATOM 5546  H HE3  . LYS A 1 46  ? 2.983   10.144  3.812   1.00 0.00 ? 46  LYS A HE3  3  
ATOM 5547  H HZ1  . LYS A 1 46  ? 4.036   11.015  1.183   1.00 0.00 ? 46  LYS A HZ1  3  
ATOM 5548  H HZ2  . LYS A 1 46  ? 5.262   10.784  2.248   1.00 0.00 ? 46  LYS A HZ2  3  
ATOM 5549  H HZ3  . LYS A 1 46  ? 4.223   9.560   1.916   1.00 0.00 ? 46  LYS A HZ3  3  
ATOM 5550  N N    . ILE A 1 47  ? 0.664   7.448   0.481   1.00 0.00 ? 47  ILE A N    3  
ATOM 5551  C CA   . ILE A 1 47  ? -0.335  6.338   0.357   1.00 0.00 ? 47  ILE A CA   3  
ATOM 5552  C C    . ILE A 1 47  ? -1.622  6.788   1.155   1.00 0.00 ? 47  ILE A C    3  
ATOM 5553  O O    . ILE A 1 47  ? -1.553  7.604   2.083   1.00 0.00 ? 47  ILE A O    3  
ATOM 5554  C CB   . ILE A 1 47  ? 0.338   4.970   0.774   1.00 0.00 ? 47  ILE A CB   3  
ATOM 5555  C CG1  . ILE A 1 47  ? -0.260  3.805   -0.069  1.00 0.00 ? 47  ILE A CG1  3  
ATOM 5556  C CG2  . ILE A 1 47  ? 0.202   4.659   2.286   1.00 0.00 ? 47  ILE A CG2  3  
ATOM 5557  C CD1  . ILE A 1 47  ? 0.358   2.416   0.167   1.00 0.00 ? 47  ILE A CD1  3  
ATOM 5558  H H    . ILE A 1 47  ? 1.223   7.570   1.338   1.00 0.00 ? 47  ILE A H    3  
ATOM 5559  H HA   . ILE A 1 47  ? -0.645  6.253   -0.705  1.00 0.00 ? 47  ILE A HA   3  
ATOM 5560  H HB   . ILE A 1 47  ? 1.418   5.009   0.525   1.00 0.00 ? 47  ILE A HB   3  
ATOM 5561  H HG12 . ILE A 1 47  ? -1.355  3.747   0.069   1.00 0.00 ? 47  ILE A HG12 3  
ATOM 5562  H HG13 . ILE A 1 47  ? -0.133  4.043   -1.144  1.00 0.00 ? 47  ILE A HG13 3  
ATOM 5563  H HG21 . ILE A 1 47  ? 0.611   5.480   2.892   1.00 0.00 ? 47  ILE A HG21 3  
ATOM 5564  H HG22 . ILE A 1 47  ? -0.854  4.520   2.587   1.00 0.00 ? 47  ILE A HG22 3  
ATOM 5565  H HG23 . ILE A 1 47  ? 0.750   3.746   2.576   1.00 0.00 ? 47  ILE A HG23 3  
ATOM 5566  H HD11 . ILE A 1 47  ? 1.460   2.442   0.089   1.00 0.00 ? 47  ILE A HD11 3  
ATOM 5567  H HD12 . ILE A 1 47  ? 0.113   2.015   1.167   1.00 0.00 ? 47  ILE A HD12 3  
ATOM 5568  H HD13 . ILE A 1 47  ? -0.008  1.677   -0.565  1.00 0.00 ? 47  ILE A HD13 3  
ATOM 5569  N N    . ASP A 1 48  ? -2.799  6.260   0.795   1.00 0.00 ? 48  ASP A N    3  
ATOM 5570  C CA   . ASP A 1 48  ? -4.088  6.682   1.420   1.00 0.00 ? 48  ASP A CA   3  
ATOM 5571  C C    . ASP A 1 48  ? -4.807  5.469   2.105   1.00 0.00 ? 48  ASP A C    3  
ATOM 5572  O O    . ASP A 1 48  ? -5.197  4.507   1.441   1.00 0.00 ? 48  ASP A O    3  
ATOM 5573  C CB   . ASP A 1 48  ? -4.908  7.376   0.305   1.00 0.00 ? 48  ASP A CB   3  
ATOM 5574  C CG   . ASP A 1 48  ? -6.014  8.276   0.836   1.00 0.00 ? 48  ASP A CG   3  
ATOM 5575  O OD1  . ASP A 1 48  ? -7.109  7.748   1.126   1.00 0.00 ? 48  ASP A OD1  3  
ATOM 5576  O OD2  . ASP A 1 48  ? -5.810  9.504   0.937   1.00 0.00 ? 48  ASP A OD2  3  
ATOM 5577  H H    . ASP A 1 48  ? -2.728  5.592   0.017   1.00 0.00 ? 48  ASP A H    3  
ATOM 5578  H HA   . ASP A 1 48  ? -3.897  7.443   2.189   1.00 0.00 ? 48  ASP A HA   3  
ATOM 5579  H HB2  . ASP A 1 48  ? -4.260  8.011   -0.326  1.00 0.00 ? 48  ASP A HB2  3  
ATOM 5580  H HB3  . ASP A 1 48  ? -5.335  6.638   -0.387  1.00 0.00 ? 48  ASP A HB3  3  
ATOM 5581  N N    . VAL A 1 49  ? -4.995  5.506   3.435   1.00 0.00 ? 49  VAL A N    3  
ATOM 5582  C CA   . VAL A 1 49  ? -5.576  4.358   4.214   1.00 0.00 ? 49  VAL A CA   3  
ATOM 5583  C C    . VAL A 1 49  ? -7.140  4.387   4.289   1.00 0.00 ? 49  VAL A C    3  
ATOM 5584  O O    . VAL A 1 49  ? -7.704  5.274   4.932   1.00 0.00 ? 49  VAL A O    3  
ATOM 5585  C CB   . VAL A 1 49  ? -4.882  4.371   5.636   1.00 0.00 ? 49  VAL A CB   3  
ATOM 5586  C CG1  . VAL A 1 49  ? -5.632  3.666   6.796   1.00 0.00 ? 49  VAL A CG1  3  
ATOM 5587  C CG2  . VAL A 1 49  ? -3.474  3.736   5.577   1.00 0.00 ? 49  VAL A CG2  3  
ATOM 5588  H H    . VAL A 1 49  ? -4.646  6.369   3.879   1.00 0.00 ? 49  VAL A H    3  
ATOM 5589  H HA   . VAL A 1 49  ? -5.316  3.398   3.733   1.00 0.00 ? 49  VAL A HA   3  
ATOM 5590  H HB   . VAL A 1 49  ? -4.762  5.423   5.969   1.00 0.00 ? 49  VAL A HB   3  
ATOM 5591  H HG11 . VAL A 1 49  ? -5.950  2.643   6.533   1.00 0.00 ? 49  VAL A HG11 3  
ATOM 5592  H HG12 . VAL A 1 49  ? -5.029  3.605   7.722   1.00 0.00 ? 49  VAL A HG12 3  
ATOM 5593  H HG13 . VAL A 1 49  ? -6.550  4.218   7.071   1.00 0.00 ? 49  VAL A HG13 3  
ATOM 5594  H HG21 . VAL A 1 49  ? -2.821  4.255   4.851   1.00 0.00 ? 49  VAL A HG21 3  
ATOM 5595  H HG22 . VAL A 1 49  ? -2.955  3.779   6.553   1.00 0.00 ? 49  VAL A HG22 3  
ATOM 5596  H HG23 . VAL A 1 49  ? -3.503  2.673   5.281   1.00 0.00 ? 49  VAL A HG23 3  
ATOM 5597  N N    . VAL A 1 50  ? -7.839  3.379   3.711   1.00 0.00 ? 50  VAL A N    3  
ATOM 5598  C CA   . VAL A 1 50  ? -9.323  3.244   3.869   1.00 0.00 ? 50  VAL A CA   3  
ATOM 5599  C C    . VAL A 1 50  ? -9.553  1.923   4.708   1.00 0.00 ? 50  VAL A C    3  
ATOM 5600  O O    . VAL A 1 50  ? -9.487  0.826   4.133   1.00 0.00 ? 50  VAL A O    3  
ATOM 5601  C CB   . VAL A 1 50  ? -10.023 3.331   2.466   1.00 0.00 ? 50  VAL A CB   3  
ATOM 5602  C CG1  . VAL A 1 50  ? -11.416 2.676   2.382   1.00 0.00 ? 50  VAL A CG1  3  
ATOM 5603  C CG2  . VAL A 1 50  ? -10.245 4.816   2.091   1.00 0.00 ? 50  VAL A CG2  3  
ATOM 5604  H H    . VAL A 1 50  ? -7.312  2.673   3.167   1.00 0.00 ? 50  VAL A H    3  
ATOM 5605  H HA   . VAL A 1 50  ? -9.739  4.080   4.462   1.00 0.00 ? 50  VAL A HA   3  
ATOM 5606  H HB   . VAL A 1 50  ? -9.388  2.842   1.699   1.00 0.00 ? 50  VAL A HB   3  
ATOM 5607  H HG11 . VAL A 1 50  ? -12.081 3.064   3.170   1.00 0.00 ? 50  VAL A HG11 3  
ATOM 5608  H HG12 . VAL A 1 50  ? -11.914 2.863   1.412   1.00 0.00 ? 50  VAL A HG12 3  
ATOM 5609  H HG13 . VAL A 1 50  ? -11.364 1.577   2.497   1.00 0.00 ? 50  VAL A HG13 3  
ATOM 5610  H HG21 . VAL A 1 50  ? -9.317  5.409   2.176   1.00 0.00 ? 50  VAL A HG21 3  
ATOM 5611  H HG22 . VAL A 1 50  ? -10.655 4.949   1.075   1.00 0.00 ? 50  VAL A HG22 3  
ATOM 5612  H HG23 . VAL A 1 50  ? -10.968 5.302   2.776   1.00 0.00 ? 50  VAL A HG23 3  
ATOM 5613  N N    . PRO A 1 51  ? -9.839  1.968   6.052   1.00 0.00 ? 51  PRO A N    3  
ATOM 5614  C CA   . PRO A 1 51  ? -10.013 0.749   6.884   1.00 0.00 ? 51  PRO A CA   3  
ATOM 5615  C C    . PRO A 1 51  ? -11.388 0.032   6.707   1.00 0.00 ? 51  PRO A C    3  
ATOM 5616  O O    . PRO A 1 51  ? -12.459 0.643   6.779   1.00 0.00 ? 51  PRO A O    3  
ATOM 5617  C CB   . PRO A 1 51  ? -9.789  1.301   8.305   1.00 0.00 ? 51  PRO A CB   3  
ATOM 5618  C CG   . PRO A 1 51  ? -10.278 2.749   8.253   1.00 0.00 ? 51  PRO A CG   3  
ATOM 5619  C CD   . PRO A 1 51  ? -9.915  3.219   6.844   1.00 0.00 ? 51  PRO A CD   3  
ATOM 5620  H HA   . PRO A 1 51  ? -9.210  0.025   6.667   1.00 0.00 ? 51  PRO A HA   3  
ATOM 5621  H HB2  . PRO A 1 51  ? -10.286 0.704   9.094   1.00 0.00 ? 51  PRO A HB2  3  
ATOM 5622  H HB3  . PRO A 1 51  ? -8.707  1.283   8.544   1.00 0.00 ? 51  PRO A HB3  3  
ATOM 5623  H HG2  . PRO A 1 51  ? -11.376 2.784   8.391   1.00 0.00 ? 51  PRO A HG2  3  
ATOM 5624  H HG3  . PRO A 1 51  ? -9.831  3.383   9.042   1.00 0.00 ? 51  PRO A HG3  3  
ATOM 5625  H HD2  . PRO A 1 51  ? -10.675 3.925   6.458   1.00 0.00 ? 51  PRO A HD2  3  
ATOM 5626  H HD3  . PRO A 1 51  ? -8.939  3.743   6.841   1.00 0.00 ? 51  PRO A HD3  3  
ATOM 5627  N N    . ILE A 1 52  ? -11.334 -1.288  6.484   1.00 0.00 ? 52  ILE A N    3  
ATOM 5628  C CA   . ILE A 1 52  ? -12.541 -2.157  6.312   1.00 0.00 ? 52  ILE A CA   3  
ATOM 5629  C C    . ILE A 1 52  ? -13.066 -2.511  7.744   1.00 0.00 ? 52  ILE A C    3  
ATOM 5630  O O    . ILE A 1 52  ? -13.994 -1.900  8.278   1.00 0.00 ? 52  ILE A O    3  
ATOM 5631  C CB   . ILE A 1 52  ? -12.152 -3.337  5.326   1.00 0.00 ? 52  ILE A CB   3  
ATOM 5632  C CG1  . ILE A 1 52  ? -11.806 -2.846  3.883   1.00 0.00 ? 52  ILE A CG1  3  
ATOM 5633  C CG2  . ILE A 1 52  ? -13.294 -4.379  5.210   1.00 0.00 ? 52  ILE A CG2  3  
ATOM 5634  C CD1  . ILE A 1 52  ? -10.896 -3.824  3.116   1.00 0.00 ? 52  ILE A CD1  3  
ATOM 5635  H H    . ILE A 1 52  ? -10.389 -1.695  6.478   1.00 0.00 ? 52  ILE A H    3  
ATOM 5636  H HA   . ILE A 1 52  ? -13.358 -1.617  5.864   1.00 0.00 ? 52  ILE A HA   3  
ATOM 5637  H HB   . ILE A 1 52  ? -11.261 -3.856  5.731   1.00 0.00 ? 52  ILE A HB   3  
ATOM 5638  H HG12 . ILE A 1 52  ? -12.723 -2.627  3.300   1.00 0.00 ? 52  ILE A HG12 3  
ATOM 5639  H HG13 . ILE A 1 52  ? -11.276 -1.875  3.919   1.00 0.00 ? 52  ILE A HG13 3  
ATOM 5640  H HG21 . ILE A 1 52  ? -14.246 -3.924  4.896   1.00 0.00 ? 52  ILE A HG21 3  
ATOM 5641  H HG22 . ILE A 1 52  ? -13.061 -5.189  4.495   1.00 0.00 ? 52  ILE A HG22 3  
ATOM 5642  H HG23 . ILE A 1 52  ? -13.488 -4.884  6.174   1.00 0.00 ? 52  ILE A HG23 3  
ATOM 5643  H HD11 . ILE A 1 52  ? -9.979  -4.059  3.687   1.00 0.00 ? 52  ILE A HD11 3  
ATOM 5644  H HD12 . ILE A 1 52  ? -11.399 -4.781  2.904   1.00 0.00 ? 52  ILE A HD12 3  
ATOM 5645  H HD13 . ILE A 1 52  ? -10.564 -3.413  2.149   1.00 0.00 ? 52  ILE A HD13 3  
ATOM 5646  N N    . GLU A 1 53  ? -12.388 -3.492  8.305   1.00 0.00 ? 53  GLU A N    3  
ATOM 5647  C CA   . GLU A 1 53  ? -12.538 -3.993  9.696   1.00 0.00 ? 53  GLU A CA   3  
ATOM 5648  C C    . GLU A 1 53  ? -11.201 -3.693  10.498  1.00 0.00 ? 53  GLU A C    3  
ATOM 5649  O O    . GLU A 1 53  ? -10.194 -3.310  9.885   1.00 0.00 ? 53  GLU A O    3  
ATOM 5650  C CB   . GLU A 1 53  ? -12.887 -5.516  9.599   1.00 0.00 ? 53  GLU A CB   3  
ATOM 5651  C CG   . GLU A 1 53  ? -14.396 -5.883  9.656   1.00 0.00 ? 53  GLU A CG   3  
ATOM 5652  C CD   . GLU A 1 53  ? -15.281 -5.424  8.507   1.00 0.00 ? 53  GLU A CD   3  
ATOM 5653  O OE1  . GLU A 1 53  ? -15.309 -6.075  7.443   1.00 0.00 ? 53  GLU A OE1  3  
ATOM 5654  O OE2  . GLU A 1 53  ? -16.013 -4.424  8.664   1.00 0.00 ? 53  GLU A OE2  3  
ATOM 5655  H H    . GLU A 1 53  ? -11.690 -3.770  7.615   1.00 0.00 ? 53  GLU A H    3  
ATOM 5656  H HA   . GLU A 1 53  ? -13.359 -3.457  10.211  1.00 0.00 ? 53  GLU A HA   3  
ATOM 5657  H HB2  . GLU A 1 53  ? -12.426 -5.985  8.705   1.00 0.00 ? 53  GLU A HB2  3  
ATOM 5658  H HB3  . GLU A 1 53  ? -12.405 -6.057  10.433  1.00 0.00 ? 53  GLU A HB3  3  
ATOM 5659  H HG2  . GLU A 1 53  ? -14.503 -6.980  9.703   1.00 0.00 ? 53  GLU A HG2  3  
ATOM 5660  H HG3  . GLU A 1 53  ? -14.848 -5.507  10.590  1.00 0.00 ? 53  GLU A HG3  3  
ATOM 5661  N N    . PRO A 1 54  ? -11.080 -3.865  11.854  1.00 0.00 ? 54  PRO A N    3  
ATOM 5662  C CA   . PRO A 1 54  ? -9.806  -3.587  12.606  1.00 0.00 ? 54  PRO A CA   3  
ATOM 5663  C C    . PRO A 1 54  ? -8.450  -4.199  12.089  1.00 0.00 ? 54  PRO A C    3  
ATOM 5664  O O    . PRO A 1 54  ? -7.390  -3.598  12.291  1.00 0.00 ? 54  PRO A O    3  
ATOM 5665  C CB   . PRO A 1 54  ? -10.161 -4.099  14.017  1.00 0.00 ? 54  PRO A CB   3  
ATOM 5666  C CG   . PRO A 1 54  ? -11.676 -3.924  14.127  1.00 0.00 ? 54  PRO A CG   3  
ATOM 5667  C CD   . PRO A 1 54  ? -12.190 -4.286  12.734  1.00 0.00 ? 54  PRO A CD   3  
ATOM 5668  H HA   . PRO A 1 54  ? -9.654  -2.490  12.633  1.00 0.00 ? 54  PRO A HA   3  
ATOM 5669  H HB2  . PRO A 1 54  ? -9.902  -5.171  14.136  1.00 0.00 ? 54  PRO A HB2  3  
ATOM 5670  H HB3  . PRO A 1 54  ? -9.616  -3.552  14.810  1.00 0.00 ? 54  PRO A HB3  3  
ATOM 5671  H HG2  . PRO A 1 54  ? -12.125 -4.550  14.922  1.00 0.00 ? 54  PRO A HG2  3  
ATOM 5672  H HG3  . PRO A 1 54  ? -11.925 -2.871  14.365  1.00 0.00 ? 54  PRO A HG3  3  
ATOM 5673  H HD2  . PRO A 1 54  ? -12.367 -5.375  12.648  1.00 0.00 ? 54  PRO A HD2  3  
ATOM 5674  H HD3  . PRO A 1 54  ? -13.144 -3.769  12.513  1.00 0.00 ? 54  PRO A HD3  3  
ATOM 5675  N N    . HIS A 1 55  ? -8.489  -5.375  11.443  1.00 0.00 ? 55  HIS A N    3  
ATOM 5676  C CA   . HIS A 1 55  ? -7.300  -6.068  10.863  1.00 0.00 ? 55  HIS A CA   3  
ATOM 5677  C C    . HIS A 1 55  ? -7.057  -5.814  9.324   1.00 0.00 ? 55  HIS A C    3  
ATOM 5678  O O    . HIS A 1 55  ? -5.898  -5.839  8.896   1.00 0.00 ? 55  HIS A O    3  
ATOM 5679  C CB   . HIS A 1 55  ? -7.550  -7.570  11.197  1.00 0.00 ? 55  HIS A CB   3  
ATOM 5680  C CG   . HIS A 1 55  ? -6.423  -8.574  10.942  1.00 0.00 ? 55  HIS A CG   3  
ATOM 5681  N ND1  . HIS A 1 55  ? -6.666  -9.841  10.429  1.00 0.00 ? 55  HIS A ND1  3  
ATOM 5682  C CD2  . HIS A 1 55  ? -5.070  -8.440  11.308  1.00 0.00 ? 55  HIS A CD2  3  
ATOM 5683  C CE1  . HIS A 1 55  ? -5.401  -10.365 10.525  1.00 0.00 ? 55  HIS A CE1  3  
ATOM 5684  N NE2  . HIS A 1 55  ? -4.384  -9.610  11.040  1.00 0.00 ? 55  HIS A NE2  3  
ATOM 5685  H H    . HIS A 1 55  ? -9.445  -5.737  11.355  1.00 0.00 ? 55  HIS A H    3  
ATOM 5686  H HA   . HIS A 1 55  ? -6.375  -5.739  11.377  1.00 0.00 ? 55  HIS A HA   3  
ATOM 5687  H HB2  . HIS A 1 55  ? -7.805  -7.682  12.270  1.00 0.00 ? 55  HIS A HB2  3  
ATOM 5688  H HB3  . HIS A 1 55  ? -8.455  -7.919  10.662  1.00 0.00 ? 55  HIS A HB3  3  
ATOM 5689  H HD2  . HIS A 1 55  ? -4.632  -7.551  11.741  1.00 0.00 ? 55  HIS A HD2  3  
ATOM 5690  H HE1  . HIS A 1 55  ? -5.193  -11.345 10.116  1.00 0.00 ? 55  HIS A HE1  3  
ATOM 5691  H HE2  . HIS A 1 55  ? -3.368  -9.778  10.947  1.00 0.00 ? 55  HIS A HE2  3  
ATOM 5692  N N    . ALA A 1 56  ? -8.103  -5.605  8.492   1.00 0.00 ? 56  ALA A N    3  
ATOM 5693  C CA   . ALA A 1 56  ? -7.969  -5.415  7.021   1.00 0.00 ? 56  ALA A CA   3  
ATOM 5694  C C    . ALA A 1 56  ? -8.298  -3.969  6.522   1.00 0.00 ? 56  ALA A C    3  
ATOM 5695  O O    . ALA A 1 56  ? -9.156  -3.266  7.065   1.00 0.00 ? 56  ALA A O    3  
ATOM 5696  C CB   . ALA A 1 56  ? -8.947  -6.425  6.382   1.00 0.00 ? 56  ALA A CB   3  
ATOM 5697  H H    . ALA A 1 56  ? -9.014  -5.576  8.960   1.00 0.00 ? 56  ALA A H    3  
ATOM 5698  H HA   . ALA A 1 56  ? -6.933  -5.662  6.703   1.00 0.00 ? 56  ALA A HA   3  
ATOM 5699  H HB1  . ALA A 1 56  ? -8.769  -7.461  6.724   1.00 0.00 ? 56  ALA A HB1  3  
ATOM 5700  H HB2  . ALA A 1 56  ? -10.003 -6.187  6.615   1.00 0.00 ? 56  ALA A HB2  3  
ATOM 5701  H HB3  . ALA A 1 56  ? -8.853  -6.436  5.280   1.00 0.00 ? 56  ALA A HB3  3  
ATOM 5702  N N    . LEU A 1 57  ? -7.650  -3.548  5.422   1.00 0.00 ? 57  LEU A N    3  
ATOM 5703  C CA   . LEU A 1 57  ? -7.843  -2.195  4.824   1.00 0.00 ? 57  LEU A CA   3  
ATOM 5704  C C    . LEU A 1 57  ? -7.473  -2.178  3.303   1.00 0.00 ? 57  LEU A C    3  
ATOM 5705  O O    . LEU A 1 57  ? -6.570  -2.898  2.880   1.00 0.00 ? 57  LEU A O    3  
ATOM 5706  C CB   . LEU A 1 57  ? -6.989  -1.153  5.621   1.00 0.00 ? 57  LEU A CB   3  
ATOM 5707  C CG   . LEU A 1 57  ? -5.437  -1.211  5.535   1.00 0.00 ? 57  LEU A CG   3  
ATOM 5708  C CD1  . LEU A 1 57  ? -4.824  0.168   5.812   1.00 0.00 ? 57  LEU A CD1  3  
ATOM 5709  C CD2  . LEU A 1 57  ? -4.789  -2.222  6.498   1.00 0.00 ? 57  LEU A CD2  3  
ATOM 5710  H H    . LEU A 1 57  ? -6.937  -4.193  5.046   1.00 0.00 ? 57  LEU A H    3  
ATOM 5711  H HA   . LEU A 1 57  ? -8.911  -1.910  4.903   1.00 0.00 ? 57  LEU A HA   3  
ATOM 5712  H HB2  . LEU A 1 57  ? -7.320  -0.158  5.266   1.00 0.00 ? 57  LEU A HB2  3  
ATOM 5713  H HB3  . LEU A 1 57  ? -7.290  -1.166  6.686   1.00 0.00 ? 57  LEU A HB3  3  
ATOM 5714  H HG   . LEU A 1 57  ? -5.175  -1.490  4.499   1.00 0.00 ? 57  LEU A HG   3  
ATOM 5715  H HD11 . LEU A 1 57  ? -5.200  0.925   5.100   1.00 0.00 ? 57  LEU A HD11 3  
ATOM 5716  H HD12 . LEU A 1 57  ? -5.059  0.525   6.831   1.00 0.00 ? 57  LEU A HD12 3  
ATOM 5717  H HD13 . LEU A 1 57  ? -3.723  0.159   5.706   1.00 0.00 ? 57  LEU A HD13 3  
ATOM 5718  H HD21 . LEU A 1 57  ? -5.132  -3.254  6.316   1.00 0.00 ? 57  LEU A HD21 3  
ATOM 5719  H HD22 . LEU A 1 57  ? -3.691  -2.239  6.380   1.00 0.00 ? 57  LEU A HD22 3  
ATOM 5720  H HD23 . LEU A 1 57  ? -5.010  -1.993  7.557   1.00 0.00 ? 57  LEU A HD23 3  
ATOM 5721  N N    . PHE A 1 58  ? -8.168  -1.398  2.455   1.00 0.00 ? 58  PHE A N    3  
ATOM 5722  C CA   . PHE A 1 58  ? -7.762  -1.225  1.019   1.00 0.00 ? 58  PHE A CA   3  
ATOM 5723  C C    . PHE A 1 58  ? -7.046  0.160   0.899   1.00 0.00 ? 58  PHE A C    3  
ATOM 5724  O O    . PHE A 1 58  ? -7.360  1.117   1.634   1.00 0.00 ? 58  PHE A O    3  
ATOM 5725  C CB   . PHE A 1 58  ? -8.944  -1.469  0.039   1.00 0.00 ? 58  PHE A CB   3  
ATOM 5726  C CG   . PHE A 1 58  ? -10.159 -0.526  -0.058  1.00 0.00 ? 58  PHE A CG   3  
ATOM 5727  C CD1  . PHE A 1 58  ? -10.070 0.664   -0.792  1.00 0.00 ? 58  PHE A CD1  3  
ATOM 5728  C CD2  . PHE A 1 58  ? -11.415 -0.965  0.377   1.00 0.00 ? 58  PHE A CD2  3  
ATOM 5729  C CE1  . PHE A 1 58  ? -11.222 1.390   -1.095  1.00 0.00 ? 58  PHE A CE1  3  
ATOM 5730  C CE2  . PHE A 1 58  ? -12.560 -0.235  0.075   1.00 0.00 ? 58  PHE A CE2  3  
ATOM 5731  C CZ   . PHE A 1 58  ? -12.464 0.940   -0.661  1.00 0.00 ? 58  PHE A CZ   3  
ATOM 5732  H H    . PHE A 1 58  ? -8.855  -0.789  2.920   1.00 0.00 ? 58  PHE A H    3  
ATOM 5733  H HA   . PHE A 1 58  ? -7.001  -1.982  0.744   1.00 0.00 ? 58  PHE A HA   3  
ATOM 5734  H HB2  . PHE A 1 58  ? -8.510  -1.541  -0.978  1.00 0.00 ? 58  PHE A HB2  3  
ATOM 5735  H HB3  . PHE A 1 58  ? -9.296  -2.506  0.205   1.00 0.00 ? 58  PHE A HB3  3  
ATOM 5736  H HD1  . PHE A 1 58  ? -9.115  0.998   -1.174  1.00 0.00 ? 58  PHE A HD1  3  
ATOM 5737  H HD2  . PHE A 1 58  ? -11.529 -1.905  0.890   1.00 0.00 ? 58  PHE A HD2  3  
ATOM 5738  H HE1  . PHE A 1 58  ? -11.169 2.285   -1.694  1.00 0.00 ? 58  PHE A HE1  3  
ATOM 5739  H HE2  . PHE A 1 58  ? -13.528 -0.605  0.374   1.00 0.00 ? 58  PHE A HE2  3  
ATOM 5740  H HZ   . PHE A 1 58  ? -13.359 1.493   -0.911  1.00 0.00 ? 58  PHE A HZ   3  
ATOM 5741  N N    . LEU A 1 59  ? -6.012  0.260   0.030   1.00 0.00 ? 59  LEU A N    3  
ATOM 5742  C CA   . LEU A 1 59  ? -5.180  1.491   0.007   1.00 0.00 ? 59  LEU A CA   3  
ATOM 5743  C C    . LEU A 1 59  ? -5.473  2.355   -1.255  1.00 0.00 ? 59  LEU A C    3  
ATOM 5744  O O    . LEU A 1 59  ? -6.147  1.962   -2.213  1.00 0.00 ? 59  LEU A O    3  
ATOM 5745  C CB   . LEU A 1 59  ? -3.690  1.020   0.137   1.00 0.00 ? 59  LEU A CB   3  
ATOM 5746  C CG   . LEU A 1 59  ? -3.072  0.734   1.536   1.00 0.00 ? 59  LEU A CG   3  
ATOM 5747  C CD1  . LEU A 1 59  ? -2.821  2.011   2.348   1.00 0.00 ? 59  LEU A CD1  3  
ATOM 5748  C CD2  . LEU A 1 59  ? -3.866  -0.255  2.397   1.00 0.00 ? 59  LEU A CD2  3  
ATOM 5749  H H    . LEU A 1 59  ? -5.776  -0.517  -0.622  1.00 0.00 ? 59  LEU A H    3  
ATOM 5750  H HA   . LEU A 1 59  ? -5.387  2.137   0.882   1.00 0.00 ? 59  LEU A HA   3  
ATOM 5751  H HB2  . LEU A 1 59  ? -3.534  0.117   -0.481  1.00 0.00 ? 59  LEU A HB2  3  
ATOM 5752  H HB3  . LEU A 1 59  ? -3.031  1.775   -0.332  1.00 0.00 ? 59  LEU A HB3  3  
ATOM 5753  H HG   . LEU A 1 59  ? -2.081  0.272   1.352   1.00 0.00 ? 59  LEU A HG   3  
ATOM 5754  H HD11 . LEU A 1 59  ? -2.164  2.716   1.818   1.00 0.00 ? 59  LEU A HD11 3  
ATOM 5755  H HD12 . LEU A 1 59  ? -3.755  2.552   2.557   1.00 0.00 ? 59  LEU A HD12 3  
ATOM 5756  H HD13 . LEU A 1 59  ? -2.336  1.797   3.319   1.00 0.00 ? 59  LEU A HD13 3  
ATOM 5757  H HD21 . LEU A 1 59  ? -4.148  -1.163  1.838   1.00 0.00 ? 59  LEU A HD21 3  
ATOM 5758  H HD22 . LEU A 1 59  ? -3.283  -0.588  3.275   1.00 0.00 ? 59  LEU A HD22 3  
ATOM 5759  H HD23 . LEU A 1 59  ? -4.808  0.186   2.770   1.00 0.00 ? 59  LEU A HD23 3  
ATOM 5760  N N    . GLY A 1 60  ? -4.970  3.588   -1.203  1.00 0.00 ? 60  GLY A N    3  
ATOM 5761  C CA   . GLY A 1 60  ? -4.988  4.543   -2.330  1.00 0.00 ? 60  GLY A CA   3  
ATOM 5762  C C    . GLY A 1 60  ? -3.581  5.090   -2.613  1.00 0.00 ? 60  GLY A C    3  
ATOM 5763  O O    . GLY A 1 60  ? -2.651  4.941   -1.812  1.00 0.00 ? 60  GLY A O    3  
ATOM 5764  H H    . GLY A 1 60  ? -4.457  3.789   -0.331  1.00 0.00 ? 60  GLY A H    3  
ATOM 5765  H HA2  . GLY A 1 60  ? -5.350  4.054   -3.245  1.00 0.00 ? 60  GLY A HA2  3  
ATOM 5766  H HA3  . GLY A 1 60  ? -5.681  5.379   -2.141  1.00 0.00 ? 60  GLY A HA3  3  
ATOM 5767  N N    . ILE A 1 61  ? -3.420  5.737   -3.769  1.00 0.00 ? 61  ILE A N    3  
ATOM 5768  C CA   . ILE A 1 61  ? -2.092  6.247   -4.198  1.00 0.00 ? 61  ILE A CA   3  
ATOM 5769  C C    . ILE A 1 61  ? -2.224  7.693   -4.779  1.00 0.00 ? 61  ILE A C    3  
ATOM 5770  O O    . ILE A 1 61  ? -2.960  7.966   -5.742  1.00 0.00 ? 61  ILE A O    3  
ATOM 5771  C CB   . ILE A 1 61  ? -1.443  5.180   -5.164  1.00 0.00 ? 61  ILE A CB   3  
ATOM 5772  C CG1  . ILE A 1 61  ? 0.051   5.487   -5.478  1.00 0.00 ? 61  ILE A CG1  3  
ATOM 5773  C CG2  . ILE A 1 61  ? -2.191  5.015   -6.514  1.00 0.00 ? 61  ILE A CG2  3  
ATOM 5774  C CD1  . ILE A 1 61  ? 0.995   5.417   -4.261  1.00 0.00 ? 61  ILE A CD1  3  
ATOM 5775  H H    . ILE A 1 61  ? -4.254  5.812   -4.374  1.00 0.00 ? 61  ILE A H    3  
ATOM 5776  H HA   . ILE A 1 61  ? -1.426  6.311   -3.312  1.00 0.00 ? 61  ILE A HA   3  
ATOM 5777  H HB   . ILE A 1 61  ? -1.468  4.198   -4.655  1.00 0.00 ? 61  ILE A HB   3  
ATOM 5778  H HG12 . ILE A 1 61  ? 0.427   4.763   -6.227  1.00 0.00 ? 61  ILE A HG12 3  
ATOM 5779  H HG13 . ILE A 1 61  ? 0.154   6.477   -5.961  1.00 0.00 ? 61  ILE A HG13 3  
ATOM 5780  H HG21 . ILE A 1 61  ? -3.246  4.723   -6.362  1.00 0.00 ? 61  ILE A HG21 3  
ATOM 5781  H HG22 . ILE A 1 61  ? -2.200  5.942   -7.110  1.00 0.00 ? 61  ILE A HG22 3  
ATOM 5782  H HG23 . ILE A 1 61  ? -1.743  4.224   -7.140  1.00 0.00 ? 61  ILE A HG23 3  
ATOM 5783  H HD11 . ILE A 1 61  ? 0.902   4.469   -3.703  1.00 0.00 ? 61  ILE A HD11 3  
ATOM 5784  H HD12 . ILE A 1 61  ? 2.054   5.507   -4.560  1.00 0.00 ? 61  ILE A HD12 3  
ATOM 5785  H HD13 . ILE A 1 61  ? 0.823   6.240   -3.541  1.00 0.00 ? 61  ILE A HD13 3  
ATOM 5786  N N    . HIS A 1 62  ? -1.476  8.605   -4.133  1.00 0.00 ? 62  HIS A N    3  
ATOM 5787  C CA   . HIS A 1 62  ? -1.291  10.011  -4.584  1.00 0.00 ? 62  HIS A CA   3  
ATOM 5788  C C    . HIS A 1 62  ? -0.074  9.993   -5.577  1.00 0.00 ? 62  HIS A C    3  
ATOM 5789  O O    . HIS A 1 62  ? 0.883   9.224   -5.410  1.00 0.00 ? 62  HIS A O    3  
ATOM 5790  C CB   . HIS A 1 62  ? -1.068  10.931  -3.351  1.00 0.00 ? 62  HIS A CB   3  
ATOM 5791  C CG   . HIS A 1 62  ? -2.293  11.119  -2.441  1.00 0.00 ? 62  HIS A CG   3  
ATOM 5792  N ND1  . HIS A 1 62  ? -3.238  12.118  -2.637  1.00 0.00 ? 62  HIS A ND1  3  
ATOM 5793  C CD2  . HIS A 1 62  ? -2.652  10.311  -1.342  1.00 0.00 ? 62  HIS A CD2  3  
ATOM 5794  C CE1  . HIS A 1 62  ? -4.097  11.812  -1.607  1.00 0.00 ? 62  HIS A CE1  3  
ATOM 5795  N NE2  . HIS A 1 62  ? -3.832  10.761  -0.776  1.00 0.00 ? 62  HIS A NE2  3  
ATOM 5796  H H    . HIS A 1 62  ? -0.912  8.234   -3.354  1.00 0.00 ? 62  HIS A H    3  
ATOM 5797  H HA   . HIS A 1 62  ? -2.195  10.359  -5.125  1.00 0.00 ? 62  HIS A HA   3  
ATOM 5798  H HB2  . HIS A 1 62  ? -0.210  10.573  -2.752  1.00 0.00 ? 62  HIS A HB2  3  
ATOM 5799  H HB3  . HIS A 1 62  ? -0.751  11.931  -3.700  1.00 0.00 ? 62  HIS A HB3  3  
ATOM 5800  H HD2  . HIS A 1 62  ? -2.112  9.436   -1.011  1.00 0.00 ? 62  HIS A HD2  3  
ATOM 5801  H HE1  . HIS A 1 62  ? -5.003  12.388  -1.476  1.00 0.00 ? 62  HIS A HE1  3  
ATOM 5802  H HE2  . HIS A 1 62  ? -4.456  10.317  -0.071  1.00 0.00 ? 62  HIS A HE2  3  
ATOM 5803  N N    . GLY A 1 63  ? -0.109  10.784  -6.665  1.00 0.00 ? 63  GLY A N    3  
ATOM 5804  C CA   . GLY A 1 63  ? 0.918   10.653  -7.753  1.00 0.00 ? 63  GLY A CA   3  
ATOM 5805  C C    . GLY A 1 63  ? 0.433   9.613   -8.796  1.00 0.00 ? 63  GLY A C    3  
ATOM 5806  O O    . GLY A 1 63  ? 0.147   9.976   -9.938  1.00 0.00 ? 63  GLY A O    3  
ATOM 5807  H H    . GLY A 1 63  ? -0.928  11.397  -6.738  1.00 0.00 ? 63  GLY A H    3  
ATOM 5808  H HA2  . GLY A 1 63  ? 1.057   11.628  -8.254  1.00 0.00 ? 63  GLY A HA2  3  
ATOM 5809  H HA3  . GLY A 1 63  ? 1.919   10.374  -7.368  1.00 0.00 ? 63  GLY A HA3  3  
ATOM 5810  N N    . GLY A 1 64  ? 0.308   8.333   -8.378  1.00 0.00 ? 64  GLY A N    3  
ATOM 5811  C CA   . GLY A 1 64  ? -0.365  7.267   -9.189  1.00 0.00 ? 64  GLY A CA   3  
ATOM 5812  C C    . GLY A 1 64  ? -1.813  7.575   -9.659  1.00 0.00 ? 64  GLY A C    3  
ATOM 5813  O O    . GLY A 1 64  ? -2.174  7.285   -10.797 1.00 0.00 ? 64  GLY A O    3  
ATOM 5814  H H    . GLY A 1 64  ? 0.590   8.212   -7.395  1.00 0.00 ? 64  GLY A H    3  
ATOM 5815  H HA2  . GLY A 1 64  ? 0.237   7.021   -10.077 1.00 0.00 ? 64  GLY A HA2  3  
ATOM 5816  H HA3  . GLY A 1 64  ? -0.422  6.339   -8.591  1.00 0.00 ? 64  GLY A HA3  3  
ATOM 5817  N N    . LYS A 1 65  ? -2.604  8.175   -8.753  1.00 0.00 ? 65  LYS A N    3  
ATOM 5818  C CA   . LYS A 1 65  ? -3.978  8.706   -8.965  1.00 0.00 ? 65  LYS A CA   3  
ATOM 5819  C C    . LYS A 1 65  ? -5.128  7.649   -8.865  1.00 0.00 ? 65  LYS A C    3  
ATOM 5820  O O    . LYS A 1 65  ? -5.845  7.425   -9.841  1.00 0.00 ? 65  LYS A O    3  
ATOM 5821  C CB   . LYS A 1 65  ? -4.048  9.568   -10.278 1.00 0.00 ? 65  LYS A CB   3  
ATOM 5822  C CG   . LYS A 1 65  ? -5.273  10.507  -10.430 1.00 0.00 ? 65  LYS A CG   3  
ATOM 5823  C CD   . LYS A 1 65  ? -5.266  11.722  -9.475  1.00 0.00 ? 65  LYS A CD   3  
ATOM 5824  C CE   . LYS A 1 65  ? -6.505  12.616  -9.665  1.00 0.00 ? 65  LYS A CE   3  
ATOM 5825  N NZ   . LYS A 1 65  ? -6.410  13.803  -8.773  1.00 0.00 ? 65  LYS A NZ   3  
ATOM 5826  H H    . LYS A 1 65  ? -2.115  8.326   -7.862  1.00 0.00 ? 65  LYS A H    3  
ATOM 5827  H HA   . LYS A 1 65  ? -4.167  9.389   -8.116  1.00 0.00 ? 65  LYS A HA   3  
ATOM 5828  H HB2  . LYS A 1 65  ? -3.122  10.167  -10.387 1.00 0.00 ? 65  LYS A HB2  3  
ATOM 5829  H HB3  . LYS A 1 65  ? -4.031  8.884   -11.149 1.00 0.00 ? 65  LYS A HB3  3  
ATOM 5830  H HG2  . LYS A 1 65  ? -5.299  10.865  -11.479 1.00 0.00 ? 65  LYS A HG2  3  
ATOM 5831  H HG3  . LYS A 1 65  ? -6.208  9.921   -10.316 1.00 0.00 ? 65  LYS A HG3  3  
ATOM 5832  H HD2  . LYS A 1 65  ? -5.213  11.371  -8.426  1.00 0.00 ? 65  LYS A HD2  3  
ATOM 5833  H HD3  . LYS A 1 65  ? -4.334  12.300  -9.644  1.00 0.00 ? 65  LYS A HD3  3  
ATOM 5834  H HE2  . LYS A 1 65  ? -6.591  12.926  -10.731 1.00 0.00 ? 65  LYS A HE2  3  
ATOM 5835  H HE3  . LYS A 1 65  ? -7.430  12.031  -9.460  1.00 0.00 ? 65  LYS A HE3  3  
ATOM 5836  H HZ1  . LYS A 1 65  ? -5.561  14.358  -8.951  1.00 0.00 ? 65  LYS A HZ1  3  
ATOM 5837  H HZ2  . LYS A 1 65  ? -7.198  14.458  -8.869  1.00 0.00 ? 65  LYS A HZ2  3  
ATOM 5838  H HZ3  . LYS A 1 65  ? -6.366  13.549  -7.778  1.00 0.00 ? 65  LYS A HZ3  3  
ATOM 5839  N N    . MET A 1 66  ? -5.345  7.116   -7.640  1.00 0.00 ? 66  MET A N    3  
ATOM 5840  C CA   . MET A 1 66  ? -6.593  6.368   -7.213  1.00 0.00 ? 66  MET A CA   3  
ATOM 5841  C C    . MET A 1 66  ? -6.260  5.244   -6.197  1.00 0.00 ? 66  MET A C    3  
ATOM 5842  O O    . MET A 1 66  ? -5.988  5.546   -5.035  1.00 0.00 ? 66  MET A O    3  
ATOM 5843  C CB   . MET A 1 66  ? -7.646  5.929   -8.290  1.00 0.00 ? 66  MET A CB   3  
ATOM 5844  C CG   . MET A 1 66  ? -8.641  7.059   -8.648  1.00 0.00 ? 66  MET A CG   3  
ATOM 5845  S SD   . MET A 1 66  ? -9.757  7.359   -7.259  1.00 0.00 ? 66  MET A SD   3  
ATOM 5846  C CE   . MET A 1 66  ? -11.218 6.451   -7.796  1.00 0.00 ? 66  MET A CE   3  
ATOM 5847  H H    . MET A 1 66  ? -4.586  7.361   -6.977  1.00 0.00 ? 66  MET A H    3  
ATOM 5848  H HA   . MET A 1 66  ? -7.185  7.014   -6.610  1.00 0.00 ? 66  MET A HA   3  
ATOM 5849  H HB2  . MET A 1 66  ? -7.128  5.479   -9.141  1.00 0.00 ? 66  MET A HB2  3  
ATOM 5850  H HB3  . MET A 1 66  ? -8.285  5.104   -7.918  1.00 0.00 ? 66  MET A HB3  3  
ATOM 5851  H HG2  . MET A 1 66  ? -8.119  8.000   -8.900  1.00 0.00 ? 66  MET A HG2  3  
ATOM 5852  H HG3  . MET A 1 66  ? -9.240  6.816   -9.537  1.00 0.00 ? 66  MET A HG3  3  
ATOM 5853  H HE1  . MET A 1 66  ? -10.977 5.391   -7.990  1.00 0.00 ? 66  MET A HE1  3  
ATOM 5854  H HE2  . MET A 1 66  ? -11.998 6.490   -7.014  1.00 0.00 ? 66  MET A HE2  3  
ATOM 5855  H HE3  . MET A 1 66  ? -11.637 6.889   -8.720  1.00 0.00 ? 66  MET A HE3  3  
ATOM 5856  N N    . CYS A 1 67  ? -6.324  3.987   -6.616  1.00 0.00 ? 67  CYS A N    3  
ATOM 5857  C CA   . CYS A 1 67  ? -6.271  2.803   -5.724  1.00 0.00 ? 67  CYS A CA   3  
ATOM 5858  C C    . CYS A 1 67  ? -4.909  2.034   -5.679  1.00 0.00 ? 67  CYS A C    3  
ATOM 5859  O O    . CYS A 1 67  ? -4.093  2.044   -6.601  1.00 0.00 ? 67  CYS A O    3  
ATOM 5860  C CB   . CYS A 1 67  ? -7.433  1.926   -6.249  1.00 0.00 ? 67  CYS A CB   3  
ATOM 5861  S SG   . CYS A 1 67  ? -7.651  0.422   -5.246  1.00 0.00 ? 67  CYS A SG   3  
ATOM 5862  H H    . CYS A 1 67  ? -6.601  3.989   -7.608  1.00 0.00 ? 67  CYS A H    3  
ATOM 5863  H HA   . CYS A 1 67  ? -6.546  3.104   -4.696  1.00 0.00 ? 67  CYS A HA   3  
ATOM 5864  H HB2  . CYS A 1 67  ? -8.392  2.476   -6.224  1.00 0.00 ? 67  CYS A HB2  3  
ATOM 5865  H HB3  . CYS A 1 67  ? -7.295  1.630   -7.305  1.00 0.00 ? 67  CYS A HB3  3  
ATOM 5866  H HG   . CYS A 1 67  ? -6.749  -0.297  -5.908  1.00 0.00 ? 67  CYS A HG   3  
ATOM 5867  N N    . LEU A 1 68  ? -4.685  1.354   -4.546  1.00 0.00 ? 68  LEU A N    3  
ATOM 5868  C CA   . LEU A 1 68  ? -3.545  0.429   -4.325  1.00 0.00 ? 68  LEU A CA   3  
ATOM 5869  C C    . LEU A 1 68  ? -4.232  -0.882  -3.780  1.00 0.00 ? 68  LEU A C    3  
ATOM 5870  O O    . LEU A 1 68  ? -4.785  -0.943  -2.655  1.00 0.00 ? 68  LEU A O    3  
ATOM 5871  C CB   . LEU A 1 68  ? -2.486  1.031   -3.366  1.00 0.00 ? 68  LEU A CB   3  
ATOM 5872  C CG   . LEU A 1 68  ? -1.020  0.512   -3.450  1.00 0.00 ? 68  LEU A CG   3  
ATOM 5873  C CD1  . LEU A 1 68  ? -0.827  -0.966  -3.838  1.00 0.00 ? 68  LEU A CD1  3  
ATOM 5874  C CD2  . LEU A 1 68  ? -0.176  1.379   -4.391  1.00 0.00 ? 68  LEU A CD2  3  
ATOM 5875  H H    . LEU A 1 68  ? -5.438  1.428   -3.847  1.00 0.00 ? 68  LEU A H    3  
ATOM 5876  H HA   . LEU A 1 68  ? -3.036  0.232   -5.291  1.00 0.00 ? 68  LEU A HA   3  
ATOM 5877  H HB2  . LEU A 1 68  ? -2.480  2.135   -3.461  1.00 0.00 ? 68  LEU A HB2  3  
ATOM 5878  H HB3  . LEU A 1 68  ? -2.839  0.880   -2.342  1.00 0.00 ? 68  LEU A HB3  3  
ATOM 5879  H HG   . LEU A 1 68  ? -0.584  0.632   -2.441  1.00 0.00 ? 68  LEU A HG   3  
ATOM 5880  H HD11 . LEU A 1 68  ? -1.436  -1.650  -3.226  1.00 0.00 ? 68  LEU A HD11 3  
ATOM 5881  H HD12 . LEU A 1 68  ? -1.099  -1.163  -4.889  1.00 0.00 ? 68  LEU A HD12 3  
ATOM 5882  H HD13 . LEU A 1 68  ? 0.221   -1.288  -3.725  1.00 0.00 ? 68  LEU A HD13 3  
ATOM 5883  H HD21 . LEU A 1 68  ? -0.175  2.437   -4.078  1.00 0.00 ? 68  LEU A HD21 3  
ATOM 5884  H HD22 . LEU A 1 68  ? 0.878   1.056   -4.392  1.00 0.00 ? 68  LEU A HD22 3  
ATOM 5885  H HD23 . LEU A 1 68  ? -0.539  1.339   -5.433  1.00 0.00 ? 68  LEU A HD23 3  
ATOM 5886  N N    . SER A 1 69  ? -4.191  -1.889  -4.675  1.00 0.00 ? 69  SER A N    3  
ATOM 5887  C CA   . SER A 1 69  ? -4.899  -3.191  -4.524  1.00 0.00 ? 69  SER A CA   3  
ATOM 5888  C C    . SER A 1 69  ? -4.077  -4.403  -5.065  1.00 0.00 ? 69  SER A C    3  
ATOM 5889  O O    . SER A 1 69  ? -3.145  -4.270  -5.867  1.00 0.00 ? 69  SER A O    3  
ATOM 5890  C CB   . SER A 1 69  ? -6.219  -3.049  -5.334  1.00 0.00 ? 69  SER A CB   3  
ATOM 5891  O OG   . SER A 1 69  ? -5.990  -2.795  -6.729  1.00 0.00 ? 69  SER A OG   3  
ATOM 5892  H H    . SER A 1 69  ? -3.691  -1.678  -5.555  1.00 0.00 ? 69  SER A H    3  
ATOM 5893  H HA   . SER A 1 69  ? -5.200  -3.415  -3.478  1.00 0.00 ? 69  SER A HA   3  
ATOM 5894  H HB2  . SER A 1 69  ? -6.811  -3.970  -5.239  1.00 0.00 ? 69  SER A HB2  3  
ATOM 5895  H HB3  . SER A 1 69  ? -6.858  -2.260  -4.897  1.00 0.00 ? 69  SER A HB3  3  
ATOM 5896  H HG   . SER A 1 69  ? -6.821  -2.413  -7.154  1.00 0.00 ? 69  SER A HG   3  
ATOM 5897  N N    . CYS A 1 70  ? -4.452  -5.619  -4.625  1.00 0.00 ? 70  CYS A N    3  
ATOM 5898  C CA   . CYS A 1 70  ? -3.893  -6.878  -5.179  1.00 0.00 ? 70  CYS A CA   3  
ATOM 5899  C C    . CYS A 1 70  ? -4.813  -7.306  -6.368  1.00 0.00 ? 70  CYS A C    3  
ATOM 5900  O O    . CYS A 1 70  ? -5.925  -7.817  -6.181  1.00 0.00 ? 70  CYS A O    3  
ATOM 5901  C CB   . CYS A 1 70  ? -3.805  -7.917  -4.058  1.00 0.00 ? 70  CYS A CB   3  
ATOM 5902  S SG   . CYS A 1 70  ? -2.860  -9.367  -4.628  1.00 0.00 ? 70  CYS A SG   3  
ATOM 5903  H H    . CYS A 1 70  ? -5.227  -5.619  -3.958  1.00 0.00 ? 70  CYS A H    3  
ATOM 5904  H HA   . CYS A 1 70  ? -2.859  -6.718  -5.537  1.00 0.00 ? 70  CYS A HA   3  
ATOM 5905  H HB2  . CYS A 1 70  ? -3.295  -7.494  -3.174  1.00 0.00 ? 70  CYS A HB2  3  
ATOM 5906  H HB3  . CYS A 1 70  ? -4.811  -8.231  -3.728  1.00 0.00 ? 70  CYS A HB3  3  
ATOM 5907  H HG   . CYS A 1 70  ? -2.727  -9.942  -3.434  1.00 0.00 ? 70  CYS A HG   3  
ATOM 5908  N N    . VAL A 1 71  ? -4.355  -6.996  -7.588  1.00 0.00 ? 71  VAL A N    3  
ATOM 5909  C CA   . VAL A 1 71  ? -5.115  -7.223  -8.852  1.00 0.00 ? 71  VAL A CA   3  
ATOM 5910  C C    . VAL A 1 71  ? -4.106  -7.776  -9.921  1.00 0.00 ? 71  VAL A C    3  
ATOM 5911  O O    . VAL A 1 71  ? -2.927  -7.405  -9.977  1.00 0.00 ? 71  VAL A O    3  
ATOM 5912  C CB   . VAL A 1 71  ? -5.888  -5.903  -9.233  1.00 0.00 ? 71  VAL A CB   3  
ATOM 5913  C CG1  . VAL A 1 71  ? -5.053  -4.618  -9.429  1.00 0.00 ? 71  VAL A CG1  3  
ATOM 5914  C CG2  . VAL A 1 71  ? -6.823  -6.057  -10.449 1.00 0.00 ? 71  VAL A CG2  3  
ATOM 5915  H H    . VAL A 1 71  ? -3.397  -6.611  -7.603  1.00 0.00 ? 71  VAL A H    3  
ATOM 5916  H HA   . VAL A 1 71  ? -5.873  -8.014  -8.682  1.00 0.00 ? 71  VAL A HA   3  
ATOM 5917  H HB   . VAL A 1 71  ? -6.560  -5.688  -8.376  1.00 0.00 ? 71  VAL A HB   3  
ATOM 5918  H HG11 . VAL A 1 71  ? -4.311  -4.714  -10.243 1.00 0.00 ? 71  VAL A HG11 3  
ATOM 5919  H HG12 . VAL A 1 71  ? -5.687  -3.739  -9.661  1.00 0.00 ? 71  VAL A HG12 3  
ATOM 5920  H HG13 . VAL A 1 71  ? -4.515  -4.353  -8.500  1.00 0.00 ? 71  VAL A HG13 3  
ATOM 5921  H HG21 . VAL A 1 71  ? -7.526  -6.900  -10.326 1.00 0.00 ? 71  VAL A HG21 3  
ATOM 5922  H HG22 . VAL A 1 71  ? -7.446  -5.150  -10.589 1.00 0.00 ? 71  VAL A HG22 3  
ATOM 5923  H HG23 . VAL A 1 71  ? -6.264  -6.210  -11.391 1.00 0.00 ? 71  VAL A HG23 3  
ATOM 5924  N N    . LYS A 1 72  ? -4.575  -8.695  -10.782 1.00 0.00 ? 72  LYS A N    3  
ATOM 5925  C CA   . LYS A 1 72  ? -3.690  -9.406  -11.745 1.00 0.00 ? 72  LYS A CA   3  
ATOM 5926  C C    . LYS A 1 72  ? -3.252  -8.613  -13.021 1.00 0.00 ? 72  LYS A C    3  
ATOM 5927  O O    . LYS A 1 72  ? -3.968  -7.756  -13.547 1.00 0.00 ? 72  LYS A O    3  
ATOM 5928  C CB   . LYS A 1 72  ? -4.422  -10.721 -12.152 1.00 0.00 ? 72  LYS A CB   3  
ATOM 5929  C CG   . LYS A 1 72  ? -5.766  -10.664 -12.935 1.00 0.00 ? 72  LYS A CG   3  
ATOM 5930  C CD   . LYS A 1 72  ? -5.880  -11.715 -14.064 1.00 0.00 ? 72  LYS A CD   3  
ATOM 5931  C CE   . LYS A 1 72  ? -5.744  -13.184 -13.606 1.00 0.00 ? 72  LYS A CE   3  
ATOM 5932  N NZ   . LYS A 1 72  ? -5.725  -14.090 -14.782 1.00 0.00 ? 72  LYS A NZ   3  
ATOM 5933  H H    . LYS A 1 72  ? -5.565  -8.931  -10.670 1.00 0.00 ? 72  LYS A H    3  
ATOM 5934  H HA   . LYS A 1 72  ? -2.758  -9.679  -11.212 1.00 0.00 ? 72  LYS A HA   3  
ATOM 5935  H HB2  . LYS A 1 72  ? -3.697  -11.290 -12.762 1.00 0.00 ? 72  LYS A HB2  3  
ATOM 5936  H HB3  . LYS A 1 72  ? -4.550  -11.359 -11.256 1.00 0.00 ? 72  LYS A HB3  3  
ATOM 5937  H HG2  . LYS A 1 72  ? -6.619  -10.746 -12.234 1.00 0.00 ? 72  LYS A HG2  3  
ATOM 5938  H HG3  . LYS A 1 72  ? -5.886  -9.662  -13.395 1.00 0.00 ? 72  LYS A HG3  3  
ATOM 5939  H HD2  . LYS A 1 72  ? -6.841  -11.568 -14.595 1.00 0.00 ? 72  LYS A HD2  3  
ATOM 5940  H HD3  . LYS A 1 72  ? -5.103  -11.475 -14.818 1.00 0.00 ? 72  LYS A HD3  3  
ATOM 5941  H HE2  . LYS A 1 72  ? -4.804  -13.315 -13.025 1.00 0.00 ? 72  LYS A HE2  3  
ATOM 5942  H HE3  . LYS A 1 72  ? -6.557  -13.453 -12.897 1.00 0.00 ? 72  LYS A HE3  3  
ATOM 5943  H HZ1  . LYS A 1 72  ? -5.137  -13.690 -15.549 1.00 0.00 ? 72  LYS A HZ1  3  
ATOM 5944  H HZ2  . LYS A 1 72  ? -5.300  -15.006 -14.579 1.00 0.00 ? 72  LYS A HZ2  3  
ATOM 5945  H HZ3  . LYS A 1 72  ? -6.645  -14.253 -15.208 1.00 0.00 ? 72  LYS A HZ3  3  
ATOM 5946  N N    . SER A 1 73  ? -2.055  -8.969  -13.527 1.00 0.00 ? 73  SER A N    3  
ATOM 5947  C CA   . SER A 1 73  ? -1.481  -8.386  -14.779 1.00 0.00 ? 73  SER A CA   3  
ATOM 5948  C C    . SER A 1 73  ? -2.155  -8.960  -16.082 1.00 0.00 ? 73  SER A C    3  
ATOM 5949  O O    . SER A 1 73  ? -2.559  -8.213  -16.975 1.00 0.00 ? 73  SER A O    3  
ATOM 5950  C CB   . SER A 1 73  ? 0.050   -8.675  -14.811 1.00 0.00 ? 73  SER A CB   3  
ATOM 5951  O OG   . SER A 1 73  ? 0.720   -8.404  -13.578 1.00 0.00 ? 73  SER A OG   3  
ATOM 5952  H H    . SER A 1 73  ? -1.549  -9.693  -12.997 1.00 0.00 ? 73  SER A H    3  
ATOM 5953  H HA   . SER A 1 73  ? -1.630  -7.288  -14.777 1.00 0.00 ? 73  SER A HA   3  
ATOM 5954  H HB2  . SER A 1 73  ? 0.252   -9.733  -15.077 1.00 0.00 ? 73  SER A HB2  3  
ATOM 5955  H HB3  . SER A 1 73  ? 0.525   -8.082  -15.616 1.00 0.00 ? 73  SER A HB3  3  
ATOM 5956  H HG   . SER A 1 73  ? 0.916   -9.297  -13.159 1.00 0.00 ? 73  SER A HG   3  
ATOM 5957  N N    . GLY A 1 74  ? -2.245  -10.295 -16.165 1.00 0.00 ? 74  GLY A N    3  
ATOM 5958  C CA   . GLY A 1 74  ? -2.838  -11.053 -17.297 1.00 0.00 ? 74  GLY A CA   3  
ATOM 5959  C C    . GLY A 1 74  ? -3.101  -12.507 -16.840 1.00 0.00 ? 74  GLY A C    3  
ATOM 5960  O O    . GLY A 1 74  ? -4.249  -12.948 -16.756 1.00 0.00 ? 74  GLY A O    3  
ATOM 5961  H H    . GLY A 1 74  ? -1.862  -10.763 -15.335 1.00 0.00 ? 74  GLY A H    3  
ATOM 5962  H HA2  . GLY A 1 74  ? -3.789  -10.592 -17.627 1.00 0.00 ? 74  GLY A HA2  3  
ATOM 5963  H HA3  . GLY A 1 74  ? -2.164  -11.044 -18.174 1.00 0.00 ? 74  GLY A HA3  3  
ATOM 5964  N N    . ASP A 1 75  ? -2.023  -13.227 -16.508 1.00 0.00 ? 75  ASP A N    3  
ATOM 5965  C CA   . ASP A 1 75  ? -2.050  -14.596 -15.931 1.00 0.00 ? 75  ASP A CA   3  
ATOM 5966  C C    . ASP A 1 75  ? -1.938  -14.560 -14.355 1.00 0.00 ? 75  ASP A C    3  
ATOM 5967  O O    . ASP A 1 75  ? -2.883  -14.950 -13.660 1.00 0.00 ? 75  ASP A O    3  
ATOM 5968  C CB   . ASP A 1 75  ? -0.916  -15.409 -16.635 1.00 0.00 ? 75  ASP A CB   3  
ATOM 5969  C CG   . ASP A 1 75  ? 0.554   -14.950 -16.523 1.00 0.00 ? 75  ASP A CG   3  
ATOM 5970  O OD1  . ASP A 1 75  ? 0.811   -13.756 -16.245 1.00 0.00 ? 75  ASP A OD1  3  
ATOM 5971  O OD2  . ASP A 1 75  ? 1.450   -15.797 -16.711 1.00 0.00 ? 75  ASP A OD2  3  
ATOM 5972  H H    . ASP A 1 75  ? -1.110  -12.765 -16.631 1.00 0.00 ? 75  ASP A H    3  
ATOM 5973  H HA   . ASP A 1 75  ? -3.006  -15.100 -16.168 1.00 0.00 ? 75  ASP A HA   3  
ATOM 5974  H HB2  . ASP A 1 75  ? -0.956  -16.452 -16.271 1.00 0.00 ? 75  ASP A HB2  3  
ATOM 5975  H HB3  . ASP A 1 75  ? -1.142  -15.488 -17.713 1.00 0.00 ? 75  ASP A HB3  3  
ATOM 5976  N N    . GLU A 1 76  ? -0.823  -14.034 -13.817 1.00 0.00 ? 76  GLU A N    3  
ATOM 5977  C CA   . GLU A 1 76  ? -0.492  -13.990 -12.366 1.00 0.00 ? 76  GLU A CA   3  
ATOM 5978  C C    . GLU A 1 76  ? -1.142  -12.830 -11.532 1.00 0.00 ? 76  GLU A C    3  
ATOM 5979  O O    . GLU A 1 76  ? -1.497  -11.762 -12.037 1.00 0.00 ? 76  GLU A O    3  
ATOM 5980  C CB   . GLU A 1 76  ? 1.070   -13.939 -12.300 1.00 0.00 ? 76  GLU A CB   3  
ATOM 5981  C CG   . GLU A 1 76  ? 1.862   -12.812 -13.035 1.00 0.00 ? 76  GLU A CG   3  
ATOM 5982  C CD   . GLU A 1 76  ? 1.982   -11.467 -12.347 1.00 0.00 ? 76  GLU A CD   3  
ATOM 5983  O OE1  . GLU A 1 76  ? 2.955   -11.276 -11.587 1.00 0.00 ? 76  GLU A OE1  3  
ATOM 5984  O OE2  . GLU A 1 76  ? 1.190   -10.543 -12.625 1.00 0.00 ? 76  GLU A OE2  3  
ATOM 5985  H H    . GLU A 1 76  ? -0.126  -13.778 -14.538 1.00 0.00 ? 76  GLU A H    3  
ATOM 5986  H HA   . GLU A 1 76  ? -0.824  -14.944 -11.908 1.00 0.00 ? 76  GLU A HA   3  
ATOM 5987  H HB2  . GLU A 1 76  ? 1.395   -13.966 -11.241 1.00 0.00 ? 76  GLU A HB2  3  
ATOM 5988  H HB3  . GLU A 1 76  ? 1.440   -14.903 -12.703 1.00 0.00 ? 76  GLU A HB3  3  
ATOM 5989  H HG2  . GLU A 1 76  ? 2.894   -13.162 -13.207 1.00 0.00 ? 76  GLU A HG2  3  
ATOM 5990  H HG3  . GLU A 1 76  ? 1.468   -12.635 -14.052 1.00 0.00 ? 76  GLU A HG3  3  
ATOM 5991  N N    . THR A 1 77  ? -1.329  -13.093 -10.221 1.00 0.00 ? 77  THR A N    3  
ATOM 5992  C CA   . THR A 1 77  ? -1.904  -12.115 -9.245  1.00 0.00 ? 77  THR A CA   3  
ATOM 5993  C C    . THR A 1 77  ? -0.749  -11.360 -8.508  1.00 0.00 ? 77  THR A C    3  
ATOM 5994  O O    . THR A 1 77  ? 0.116   -11.990 -7.890  1.00 0.00 ? 77  THR A O    3  
ATOM 5995  C CB   . THR A 1 77  ? -2.822  -12.887 -8.243  1.00 0.00 ? 77  THR A CB   3  
ATOM 5996  O OG1  . THR A 1 77  ? -3.869  -13.537 -8.958  1.00 0.00 ? 77  THR A OG1  3  
ATOM 5997  C CG2  . THR A 1 77  ? -3.515  -11.994 -7.197  1.00 0.00 ? 77  THR A CG2  3  
ATOM 5998  H H    . THR A 1 77  ? -0.959  -14.002 -9.925  1.00 0.00 ? 77  THR A H    3  
ATOM 5999  H HA   . THR A 1 77  ? -2.541  -11.380 -9.771  1.00 0.00 ? 77  THR A HA   3  
ATOM 6000  H HB   . THR A 1 77  ? -2.210  -13.648 -7.715  1.00 0.00 ? 77  THR A HB   3  
ATOM 6001  H HG1  . THR A 1 77  ? -3.455  -13.869 -9.762  1.00 0.00 ? 77  THR A HG1  3  
ATOM 6002  H HG21 . THR A 1 77  ? -4.148  -11.218 -7.665  1.00 0.00 ? 77  THR A HG21 3  
ATOM 6003  H HG22 . THR A 1 77  ? -4.157  -12.587 -6.525  1.00 0.00 ? 77  THR A HG22 3  
ATOM 6004  H HG23 . THR A 1 77  ? -2.782  -11.475 -6.550  1.00 0.00 ? 77  THR A HG23 3  
ATOM 6005  N N    . ARG A 1 78  ? -0.761  -10.014 -8.542  1.00 0.00 ? 78  ARG A N    3  
ATOM 6006  C CA   . ARG A 1 78  ? 0.288   -9.187  -7.876  1.00 0.00 ? 78  ARG A CA   3  
ATOM 6007  C C    . ARG A 1 78  ? -0.271  -7.845  -7.280  1.00 0.00 ? 78  ARG A C    3  
ATOM 6008  O O    . ARG A 1 78  ? -1.426  -7.453  -7.479  1.00 0.00 ? 78  ARG A O    3  
ATOM 6009  C CB   . ARG A 1 78  ? 1.438   -8.943  -8.907  1.00 0.00 ? 78  ARG A CB   3  
ATOM 6010  C CG   . ARG A 1 78  ? 1.120   -8.069  -10.155 1.00 0.00 ? 78  ARG A CG   3  
ATOM 6011  C CD   . ARG A 1 78  ? 2.345   -7.477  -10.877 1.00 0.00 ? 78  ARG A CD   3  
ATOM 6012  N NE   . ARG A 1 78  ? 3.157   -8.565  -11.477 1.00 0.00 ? 78  ARG A NE   3  
ATOM 6013  C CZ   . ARG A 1 78  ? 4.225   -8.418  -12.243 1.00 0.00 ? 78  ARG A CZ   3  
ATOM 6014  N NH1  . ARG A 1 78  ? 4.770   -7.263  -12.524 1.00 0.00 ? 78  ARG A NH1  3  
ATOM 6015  N NH2  . ARG A 1 78  ? 4.742   -9.503  -12.729 1.00 0.00 ? 78  ARG A NH2  3  
ATOM 6016  H H    . ARG A 1 78  ? -1.519  -9.578  -9.077  1.00 0.00 ? 78  ARG A H    3  
ATOM 6017  H HA   . ARG A 1 78  ? 0.701   -9.748  -7.017  1.00 0.00 ? 78  ARG A HA   3  
ATOM 6018  H HB2  . ARG A 1 78  ? 2.291   -8.493  -8.367  1.00 0.00 ? 78  ARG A HB2  3  
ATOM 6019  H HB3  . ARG A 1 78  ? 1.833   -9.922  -9.247  1.00 0.00 ? 78  ARG A HB3  3  
ATOM 6020  H HG2  . ARG A 1 78  ? 0.494   -8.646  -10.865 1.00 0.00 ? 78  ARG A HG2  3  
ATOM 6021  H HG3  . ARG A 1 78  ? 0.479   -7.224  -9.854  1.00 0.00 ? 78  ARG A HG3  3  
ATOM 6022  H HD2  . ARG A 1 78  ? 1.987   -6.787  -11.669 1.00 0.00 ? 78  ARG A HD2  3  
ATOM 6023  H HD3  . ARG A 1 78  ? 2.942   -6.863  -10.173 1.00 0.00 ? 78  ARG A HD3  3  
ATOM 6024  H HE   . ARG A 1 78  ? 2.840   -9.564  -11.438 1.00 0.00 ? 78  ARG A HE   3  
ATOM 6025  H HH11 . ARG A 1 78  ? 4.285   -6.470  -12.100 1.00 0.00 ? 78  ARG A HH11 3  
ATOM 6026  H HH12 . ARG A 1 78  ? 5.584   -7.250  -13.139 1.00 0.00 ? 78  ARG A HH12 3  
ATOM 6027  H HH21 . ARG A 1 78  ? 4.212   -10.352 -12.436 1.00 0.00 ? 78  ARG A HH21 3  
ATOM 6028  H HH22 . ARG A 1 78  ? 5.552   -9.449  -13.345 1.00 0.00 ? 78  ARG A HH22 3  
ATOM 6029  N N    . LEU A 1 79  ? 0.586   -7.126  -6.529  1.00 0.00 ? 79  LEU A N    3  
ATOM 6030  C CA   . LEU A 1 79  ? 0.244   -5.794  -5.960  1.00 0.00 ? 79  LEU A CA   3  
ATOM 6031  C C    . LEU A 1 79  ? 0.415   -4.688  -7.054  1.00 0.00 ? 79  LEU A C    3  
ATOM 6032  O O    . LEU A 1 79  ? 1.471   -4.579  -7.687  1.00 0.00 ? 79  LEU A O    3  
ATOM 6033  C CB   . LEU A 1 79  ? 1.160   -5.520  -4.741  1.00 0.00 ? 79  LEU A CB   3  
ATOM 6034  C CG   . LEU A 1 79  ? 0.608   -4.448  -3.766  1.00 0.00 ? 79  LEU A CG   3  
ATOM 6035  C CD1  . LEU A 1 79  ? -0.495  -5.022  -2.860  1.00 0.00 ? 79  LEU A CD1  3  
ATOM 6036  C CD2  . LEU A 1 79  ? 1.735   -3.846  -2.916  1.00 0.00 ? 79  LEU A CD2  3  
ATOM 6037  H H    . LEU A 1 79  ? 1.520   -7.534  -6.434  1.00 0.00 ? 79  LEU A H    3  
ATOM 6038  H HA   . LEU A 1 79  ? -0.808  -5.814  -5.616  1.00 0.00 ? 79  LEU A HA   3  
ATOM 6039  H HB2  . LEU A 1 79  ? 1.359   -6.448  -4.174  1.00 0.00 ? 79  LEU A HB2  3  
ATOM 6040  H HB3  . LEU A 1 79  ? 2.152   -5.215  -5.123  1.00 0.00 ? 79  LEU A HB3  3  
ATOM 6041  H HG   . LEU A 1 79  ? 0.171   -3.618  -4.355  1.00 0.00 ? 79  LEU A HG   3  
ATOM 6042  H HD11 . LEU A 1 79  ? -1.342  -5.439  -3.435  1.00 0.00 ? 79  LEU A HD11 3  
ATOM 6043  H HD12 . LEU A 1 79  ? -0.118  -5.827  -2.203  1.00 0.00 ? 79  LEU A HD12 3  
ATOM 6044  H HD13 . LEU A 1 79  ? -0.926  -4.251  -2.201  1.00 0.00 ? 79  LEU A HD13 3  
ATOM 6045  H HD21 . LEU A 1 79  ? 2.290   -4.605  -2.338  1.00 0.00 ? 79  LEU A HD21 3  
ATOM 6046  H HD22 . LEU A 1 79  ? 2.468   -3.318  -3.551  1.00 0.00 ? 79  LEU A HD22 3  
ATOM 6047  H HD23 . LEU A 1 79  ? 1.355   -3.103  -2.195  1.00 0.00 ? 79  LEU A HD23 3  
ATOM 6048  N N    . GLN A 1 80  ? -0.629  -3.875  -7.258  1.00 0.00 ? 80  GLN A N    3  
ATOM 6049  C CA   . GLN A 1 80  ? -0.659  -2.854  -8.342  1.00 0.00 ? 80  GLN A CA   3  
ATOM 6050  C C    . GLN A 1 80  ? -1.272  -1.487  -7.899  1.00 0.00 ? 80  GLN A C    3  
ATOM 6051  O O    . GLN A 1 80  ? -2.199  -1.394  -7.077  1.00 0.00 ? 80  GLN A O    3  
ATOM 6052  C CB   . GLN A 1 80  ? -1.538  -3.403  -9.511  1.00 0.00 ? 80  GLN A CB   3  
ATOM 6053  C CG   . GLN A 1 80  ? -1.007  -4.613  -10.321 1.00 0.00 ? 80  GLN A CG   3  
ATOM 6054  C CD   . GLN A 1 80  ? 0.161   -4.309  -11.264 1.00 0.00 ? 80  GLN A CD   3  
ATOM 6055  O OE1  . GLN A 1 80  ? 1.332   -4.355  -10.901 1.00 0.00 ? 80  GLN A OE1  3  
ATOM 6056  N NE2  . GLN A 1 80  ? -0.110  -3.996  -12.509 1.00 0.00 ? 80  GLN A NE2  3  
ATOM 6057  H H    . GLN A 1 80  ? -1.442  -4.068  -6.656  1.00 0.00 ? 80  GLN A H    3  
ATOM 6058  H HA   . GLN A 1 80  ? 0.367   -2.675  -8.727  1.00 0.00 ? 80  GLN A HA   3  
ATOM 6059  H HB2  . GLN A 1 80  ? -2.522  -3.672  -9.093  1.00 0.00 ? 80  GLN A HB2  3  
ATOM 6060  H HB3  . GLN A 1 80  ? -1.773  -2.593  -10.231 1.00 0.00 ? 80  GLN A HB3  3  
ATOM 6061  H HG2  . GLN A 1 80  ? -0.705  -5.412  -9.625  1.00 0.00 ? 80  GLN A HG2  3  
ATOM 6062  H HG3  . GLN A 1 80  ? -1.840  -5.067  -10.893 1.00 0.00 ? 80  GLN A HG3  3  
ATOM 6063  H HE21 . GLN A 1 80  ? -1.096  -3.992  -12.781 1.00 0.00 ? 80  GLN A HE21 3  
ATOM 6064  H HE22 . GLN A 1 80  ? 0.713   -3.823  -13.091 1.00 0.00 ? 80  GLN A HE22 3  
ATOM 6065  N N    . LEU A 1 81  ? -0.749  -0.427  -8.549  1.00 0.00 ? 81  LEU A N    3  
ATOM 6066  C CA   . LEU A 1 81  ? -1.290  0.953   -8.440  1.00 0.00 ? 81  LEU A CA   3  
ATOM 6067  C C    . LEU A 1 81  ? -2.429  1.090   -9.512  1.00 0.00 ? 81  LEU A C    3  
ATOM 6068  O O    . LEU A 1 81  ? -2.224  1.423   -10.683 1.00 0.00 ? 81  LEU A O    3  
ATOM 6069  C CB   . LEU A 1 81  ? -0.160  2.032   -8.575  1.00 0.00 ? 81  LEU A CB   3  
ATOM 6070  C CG   . LEU A 1 81  ? 1.103   1.838   -9.468  1.00 0.00 ? 81  LEU A CG   3  
ATOM 6071  C CD1  . LEU A 1 81  ? 0.797   1.660   -10.963 1.00 0.00 ? 81  LEU A CD1  3  
ATOM 6072  C CD2  . LEU A 1 81  ? 2.056   3.038   -9.312  1.00 0.00 ? 81  LEU A CD2  3  
ATOM 6073  H H    . LEU A 1 81  ? 0.007   -0.647  -9.204  1.00 0.00 ? 81  LEU A H    3  
ATOM 6074  H HA   . LEU A 1 81  ? -1.747  1.108   -7.441  1.00 0.00 ? 81  LEU A HA   3  
ATOM 6075  H HB2  . LEU A 1 81  ? -0.635  2.995   -8.845  1.00 0.00 ? 81  LEU A HB2  3  
ATOM 6076  H HB3  . LEU A 1 81  ? 0.208   2.210   -7.548  1.00 0.00 ? 81  LEU A HB3  3  
ATOM 6077  H HG   . LEU A 1 81  ? 1.644   0.937   -9.117  1.00 0.00 ? 81  LEU A HG   3  
ATOM 6078  H HD11 . LEU A 1 81  ? 0.235   2.519   -11.377 1.00 0.00 ? 81  LEU A HD11 3  
ATOM 6079  H HD12 . LEU A 1 81  ? 1.720   1.554   -11.562 1.00 0.00 ? 81  LEU A HD12 3  
ATOM 6080  H HD13 . LEU A 1 81  ? 0.192   0.756   -11.156 1.00 0.00 ? 81  LEU A HD13 3  
ATOM 6081  H HD21 . LEU A 1 81  ? 2.347   3.203   -8.259  1.00 0.00 ? 81  LEU A HD21 3  
ATOM 6082  H HD22 . LEU A 1 81  ? 2.995   2.893   -9.878  1.00 0.00 ? 81  LEU A HD22 3  
ATOM 6083  H HD23 . LEU A 1 81  ? 1.602   3.981   -9.673  1.00 0.00 ? 81  LEU A HD23 3  
ATOM 6084  N N    . GLU A 1 82  ? -3.658  0.788   -9.073  1.00 0.00 ? 82  GLU A N    3  
ATOM 6085  C CA   . GLU A 1 82  ? -4.891  0.831   -9.897  1.00 0.00 ? 82  GLU A CA   3  
ATOM 6086  C C    . GLU A 1 82  ? -5.405  2.313   -10.047 1.00 0.00 ? 82  GLU A C    3  
ATOM 6087  O O    . GLU A 1 82  ? -6.308  2.799   -9.356  1.00 0.00 ? 82  GLU A O    3  
ATOM 6088  C CB   . GLU A 1 82  ? -5.798  -0.190  -9.150  1.00 0.00 ? 82  GLU A CB   3  
ATOM 6089  C CG   . GLU A 1 82  ? -7.201  -0.496  -9.725  1.00 0.00 ? 82  GLU A CG   3  
ATOM 6090  C CD   . GLU A 1 82  ? -7.871  -1.709  -9.075  1.00 0.00 ? 82  GLU A CD   3  
ATOM 6091  O OE1  . GLU A 1 82  ? -7.862  -1.832  -7.827  1.00 0.00 ? 82  GLU A OE1  3  
ATOM 6092  O OE2  . GLU A 1 82  ? -8.385  -2.567  -9.819  1.00 0.00 ? 82  GLU A OE2  3  
ATOM 6093  H H    . GLU A 1 82  ? -3.720  0.531   -8.079  1.00 0.00 ? 82  GLU A H    3  
ATOM 6094  H HA   . GLU A 1 82  ? -4.699  0.429   -10.912 1.00 0.00 ? 82  GLU A HA   3  
ATOM 6095  H HB2  . GLU A 1 82  ? -5.259  -1.161  -9.096  1.00 0.00 ? 82  GLU A HB2  3  
ATOM 6096  H HB3  . GLU A 1 82  ? -5.920  0.107   -8.091  1.00 0.00 ? 82  GLU A HB3  3  
ATOM 6097  H HG2  . GLU A 1 82  ? -7.873  0.371   -9.602  1.00 0.00 ? 82  GLU A HG2  3  
ATOM 6098  H HG3  . GLU A 1 82  ? -7.143  -0.689  -10.811 1.00 0.00 ? 82  GLU A HG3  3  
ATOM 6099  N N    . ALA A 1 83  ? -4.789  3.020   -11.015 1.00 0.00 ? 83  ALA A N    3  
ATOM 6100  C CA   . ALA A 1 83  ? -5.058  4.449   -11.305 1.00 0.00 ? 83  ALA A CA   3  
ATOM 6101  C C    . ALA A 1 83  ? -6.363  4.660   -12.130 1.00 0.00 ? 83  ALA A C    3  
ATOM 6102  O O    . ALA A 1 83  ? -6.528  4.086   -13.213 1.00 0.00 ? 83  ALA A O    3  
ATOM 6103  C CB   . ALA A 1 83  ? -3.829  4.958   -12.079 1.00 0.00 ? 83  ALA A CB   3  
ATOM 6104  H H    . ALA A 1 83  ? -4.043  2.501   -11.492 1.00 0.00 ? 83  ALA A H    3  
ATOM 6105  H HA   . ALA A 1 83  ? -5.122  5.011   -10.352 1.00 0.00 ? 83  ALA A HA   3  
ATOM 6106  H HB1  . ALA A 1 83  ? -2.895  4.838   -11.498 1.00 0.00 ? 83  ALA A HB1  3  
ATOM 6107  H HB2  . ALA A 1 83  ? -3.690  4.435   -13.044 1.00 0.00 ? 83  ALA A HB2  3  
ATOM 6108  H HB3  . ALA A 1 83  ? -3.919  6.037   -12.307 1.00 0.00 ? 83  ALA A HB3  3  
ATOM 6109  N N    . VAL A 1 84  ? -7.292  5.482   -11.613 1.00 0.00 ? 84  VAL A N    3  
ATOM 6110  C CA   . VAL A 1 84  ? -8.623  5.702   -12.261 1.00 0.00 ? 84  VAL A CA   3  
ATOM 6111  C C    . VAL A 1 84  ? -8.936  7.244   -12.312 1.00 0.00 ? 84  VAL A C    3  
ATOM 6112  O O    . VAL A 1 84  ? -8.352  8.077   -11.608 1.00 0.00 ? 84  VAL A O    3  
ATOM 6113  C CB   . VAL A 1 84  ? -9.662  4.796   -11.472 1.00 0.00 ? 84  VAL A CB   3  
ATOM 6114  C CG1  . VAL A 1 84  ? -11.157 5.176   -11.603 1.00 0.00 ? 84  VAL A CG1  3  
ATOM 6115  C CG2  . VAL A 1 84  ? -9.565  3.300   -11.863 1.00 0.00 ? 84  VAL A CG2  3  
ATOM 6116  H H    . VAL A 1 84  ? -7.060  5.930   -10.696 1.00 0.00 ? 84  VAL A H    3  
ATOM 6117  H HA   . VAL A 1 84  ? -8.602  5.367   -13.319 1.00 0.00 ? 84  VAL A HA   3  
ATOM 6118  H HB   . VAL A 1 84  ? -9.423  4.837   -10.388 1.00 0.00 ? 84  VAL A HB   3  
ATOM 6119  H HG11 . VAL A 1 84  ? -11.355 6.203   -11.243 1.00 0.00 ? 84  VAL A HG11 3  
ATOM 6120  H HG12 . VAL A 1 84  ? -11.519 5.119   -12.647 1.00 0.00 ? 84  VAL A HG12 3  
ATOM 6121  H HG13 . VAL A 1 84  ? -11.807 4.517   -10.997 1.00 0.00 ? 84  VAL A HG13 3  
ATOM 6122  H HG21 . VAL A 1 84  ? -8.552  2.893   -11.682 1.00 0.00 ? 84  VAL A HG21 3  
ATOM 6123  H HG22 . VAL A 1 84  ? -10.253 2.667   -11.272 1.00 0.00 ? 84  VAL A HG22 3  
ATOM 6124  H HG23 . VAL A 1 84  ? -9.794  3.128   -12.931 1.00 0.00 ? 84  VAL A HG23 3  
ATOM 6125  N N    . ASN A 1 85  ? -9.861  7.642   -13.205 1.00 0.00 ? 85  ASN A N    3  
ATOM 6126  C CA   . ASN A 1 85  ? -10.322 9.057   -13.315 1.00 0.00 ? 85  ASN A CA   3  
ATOM 6127  C C    . ASN A 1 85  ? -11.330 9.369   -12.155 1.00 0.00 ? 85  ASN A C    3  
ATOM 6128  O O    . ASN A 1 85  ? -12.348 8.684   -12.004 1.00 0.00 ? 85  ASN A O    3  
ATOM 6129  C CB   . ASN A 1 85  ? -10.913 9.300   -14.736 1.00 0.00 ? 85  ASN A CB   3  
ATOM 6130  C CG   . ASN A 1 85  ? -12.175 8.534   -15.175 1.00 0.00 ? 85  ASN A CG   3  
ATOM 6131  O OD1  . ASN A 1 85  ? -13.301 8.973   -14.980 1.00 0.00 ? 85  ASN A OD1  3  
ATOM 6132  N ND2  . ASN A 1 85  ? -12.037 7.391   -15.805 1.00 0.00 ? 85  ASN A ND2  3  
ATOM 6133  H H    . ASN A 1 85  ? -10.306 6.880   -13.725 1.00 0.00 ? 85  ASN A H    3  
ATOM 6134  H HA   . ASN A 1 85  ? -9.449  9.733   -13.209 1.00 0.00 ? 85  ASN A HA   3  
ATOM 6135  H HB2  . ASN A 1 85  ? -11.160 10.374  -14.823 1.00 0.00 ? 85  ASN A HB2  3  
ATOM 6136  H HB3  . ASN A 1 85  ? -10.116 9.155   -15.489 1.00 0.00 ? 85  ASN A HB3  3  
ATOM 6137  H HD21 . ASN A 1 85  ? -11.092 7.134   -16.099 1.00 0.00 ? 85  ASN A HD21 3  
ATOM 6138  H HD22 . ASN A 1 85  ? -12.927 6.989   -16.112 1.00 0.00 ? 85  ASN A HD22 3  
ATOM 6139  N N    . ILE A 1 86  ? -11.042 10.385  -11.316 1.00 0.00 ? 86  ILE A N    3  
ATOM 6140  C CA   . ILE A 1 86  ? -11.923 10.718  -10.156 1.00 0.00 ? 86  ILE A CA   3  
ATOM 6141  C C    . ILE A 1 86  ? -13.155 11.573  -10.637 1.00 0.00 ? 86  ILE A C    3  
ATOM 6142  O O    . ILE A 1 86  ? -13.043 12.723  -11.070 1.00 0.00 ? 86  ILE A O    3  
ATOM 6143  C CB   . ILE A 1 86  ? -11.068 11.359  -8.998  1.00 0.00 ? 86  ILE A CB   3  
ATOM 6144  C CG1  . ILE A 1 86  ? -11.877 11.390  -7.666  1.00 0.00 ? 86  ILE A CG1  3  
ATOM 6145  C CG2  . ILE A 1 86  ? -10.564 12.800  -9.285  1.00 0.00 ? 86  ILE A CG2  3  
ATOM 6146  C CD1  . ILE A 1 86  ? -12.060 10.012  -7.001  1.00 0.00 ? 86  ILE A CD1  3  
ATOM 6147  H H    . ILE A 1 86  ? -10.180 10.897  -11.518 1.00 0.00 ? 86  ILE A H    3  
ATOM 6148  H HA   . ILE A 1 86  ? -12.313 9.761   -9.753  1.00 0.00 ? 86  ILE A HA   3  
ATOM 6149  H HB   . ILE A 1 86  ? -10.176 10.722  -8.830  1.00 0.00 ? 86  ILE A HB   3  
ATOM 6150  H HG12 . ILE A 1 86  ? -11.377 12.043  -6.928  1.00 0.00 ? 86  ILE A HG12 3  
ATOM 6151  H HG13 . ILE A 1 86  ? -12.870 11.858  -7.822  1.00 0.00 ? 86  ILE A HG13 3  
ATOM 6152  H HG21 . ILE A 1 86  ? -10.034 12.870  -10.252 1.00 0.00 ? 86  ILE A HG21 3  
ATOM 6153  H HG22 . ILE A 1 86  ? -11.391 13.535  -9.322  1.00 0.00 ? 86  ILE A HG22 3  
ATOM 6154  H HG23 . ILE A 1 86  ? -9.865  13.150  -8.503  1.00 0.00 ? 86  ILE A HG23 3  
ATOM 6155  H HD11 . ILE A 1 86  ? -11.091 9.542   -6.763  1.00 0.00 ? 86  ILE A HD11 3  
ATOM 6156  H HD12 . ILE A 1 86  ? -12.616 10.082  -6.049  1.00 0.00 ? 86  ILE A HD12 3  
ATOM 6157  H HD13 . ILE A 1 86  ? -12.627 9.298   -7.625  1.00 0.00 ? 86  ILE A HD13 3  
ATOM 6158  N N    . THR A 1 87  ? -14.336 10.947  -10.564 1.00 0.00 ? 87  THR A N    3  
ATOM 6159  C CA   . THR A 1 87  ? -15.643 11.571  -10.962 1.00 0.00 ? 87  THR A CA   3  
ATOM 6160  C C    . THR A 1 87  ? -16.894 10.973  -10.215 1.00 0.00 ? 87  THR A C    3  
ATOM 6161  O O    . THR A 1 87  ? -17.907 11.669  -10.129 1.00 0.00 ? 87  THR A O    3  
ATOM 6162  C CB   . THR A 1 87  ? -15.820 11.482  -12.518 1.00 0.00 ? 87  THR A CB   3  
ATOM 6163  O OG1  . THR A 1 87  ? -16.985 12.211  -12.892 1.00 0.00 ? 87  THR A OG1  3  
ATOM 6164  C CG2  . THR A 1 87  ? -15.981 10.070  -13.117 1.00 0.00 ? 87  THR A CG2  3  
ATOM 6165  H H    . THR A 1 87  ? -14.254 10.001  -10.184 1.00 0.00 ? 87  THR A H    3  
ATOM 6166  H HA   . THR A 1 87  ? -15.629 12.643  -10.682 1.00 0.00 ? 87  THR A HA   3  
ATOM 6167  H HB   . THR A 1 87  ? -14.939 11.968  -12.985 1.00 0.00 ? 87  THR A HB   3  
ATOM 6168  H HG1  . THR A 1 87  ? -17.697 11.888  -12.329 1.00 0.00 ? 87  THR A HG1  3  
ATOM 6169  H HG21 . THR A 1 87  ? -15.105 9.430   -12.899 1.00 0.00 ? 87  THR A HG21 3  
ATOM 6170  H HG22 . THR A 1 87  ? -16.879 9.546   -12.742 1.00 0.00 ? 87  THR A HG22 3  
ATOM 6171  H HG23 . THR A 1 87  ? -16.067 10.117  -14.218 1.00 0.00 ? 87  THR A HG23 3  
ATOM 6172  N N    . ASP A 1 88  ? -16.845 9.735   -9.685  1.00 0.00 ? 88  ASP A N    3  
ATOM 6173  C CA   . ASP A 1 88  ? -17.950 9.107   -8.910  1.00 0.00 ? 88  ASP A CA   3  
ATOM 6174  C C    . ASP A 1 88  ? -17.947 9.566   -7.407  1.00 0.00 ? 88  ASP A C    3  
ATOM 6175  O O    . ASP A 1 88  ? -18.940 10.123  -6.931  1.00 0.00 ? 88  ASP A O    3  
ATOM 6176  C CB   . ASP A 1 88  ? -17.757 7.575   -9.123  1.00 0.00 ? 88  ASP A CB   3  
ATOM 6177  C CG   . ASP A 1 88  ? -18.642 6.674   -8.266  1.00 0.00 ? 88  ASP A CG   3  
ATOM 6178  O OD1  . ASP A 1 88  ? -18.213 6.334   -7.142  1.00 0.00 ? 88  ASP A OD1  3  
ATOM 6179  O OD2  . ASP A 1 88  ? -19.757 6.319   -8.698  1.00 0.00 ? 88  ASP A OD2  3  
ATOM 6180  H H    . ASP A 1 88  ? -15.965 9.239   -9.837  1.00 0.00 ? 88  ASP A H    3  
ATOM 6181  H HA   . ASP A 1 88  ? -18.934 9.395   -9.332  1.00 0.00 ? 88  ASP A HA   3  
ATOM 6182  H HB2  . ASP A 1 88  ? -17.939 7.316   -10.182 1.00 0.00 ? 88  ASP A HB2  3  
ATOM 6183  H HB3  . ASP A 1 88  ? -16.713 7.269   -8.924  1.00 0.00 ? 88  ASP A HB3  3  
ATOM 6184  N N    . LEU A 1 89  ? -16.836 9.328   -6.674  1.00 0.00 ? 89  LEU A N    3  
ATOM 6185  C CA   . LEU A 1 89  ? -16.671 9.643   -5.217  1.00 0.00 ? 89  LEU A CA   3  
ATOM 6186  C C    . LEU A 1 89  ? -17.627 8.868   -4.227  1.00 0.00 ? 89  LEU A C    3  
ATOM 6187  O O    . LEU A 1 89  ? -17.768 9.270   -3.065  1.00 0.00 ? 89  LEU A O    3  
ATOM 6188  C CB   . LEU A 1 89  ? -16.701 11.200  -5.023  1.00 0.00 ? 89  LEU A CB   3  
ATOM 6189  C CG   . LEU A 1 89  ? -15.426 11.961  -5.479  1.00 0.00 ? 89  LEU A CG   3  
ATOM 6190  C CD1  . LEU A 1 89  ? -15.717 13.462  -5.643  1.00 0.00 ? 89  LEU A CD1  3  
ATOM 6191  C CD2  . LEU A 1 89  ? -14.260 11.785  -4.488  1.00 0.00 ? 89  LEU A CD2  3  
ATOM 6192  H H    . LEU A 1 89  ? -16.108 8.846   -7.209  1.00 0.00 ? 89  LEU A H    3  
ATOM 6193  H HA   . LEU A 1 89  ? -15.682 9.253   -4.921  1.00 0.00 ? 89  LEU A HA   3  
ATOM 6194  H HB2  . LEU A 1 89  ? -17.592 11.617  -5.530  1.00 0.00 ? 89  LEU A HB2  3  
ATOM 6195  H HB3  . LEU A 1 89  ? -16.876 11.454  -3.965  1.00 0.00 ? 89  LEU A HB3  3  
ATOM 6196  H HG   . LEU A 1 89  ? -15.114 11.570  -6.469  1.00 0.00 ? 89  LEU A HG   3  
ATOM 6197  H HD11 . LEU A 1 89  ? -16.522 13.639  -6.381  1.00 0.00 ? 89  LEU A HD11 3  
ATOM 6198  H HD12 . LEU A 1 89  ? -16.034 13.932  -4.693  1.00 0.00 ? 89  LEU A HD12 3  
ATOM 6199  H HD13 . LEU A 1 89  ? -14.831 14.014  -6.006  1.00 0.00 ? 89  LEU A HD13 3  
ATOM 6200  H HD21 . LEU A 1 89  ? -14.023 10.720  -4.303  1.00 0.00 ? 89  LEU A HD21 3  
ATOM 6201  H HD22 . LEU A 1 89  ? -13.332 12.253  -4.864  1.00 0.00 ? 89  LEU A HD22 3  
ATOM 6202  H HD23 . LEU A 1 89  ? -14.479 12.241  -3.505  1.00 0.00 ? 89  LEU A HD23 3  
ATOM 6203  N N    . SER A 1 90  ? -18.203 7.714   -4.613  1.00 0.00 ? 90  SER A N    3  
ATOM 6204  C CA   . SER A 1 90  ? -18.996 6.835   -3.702  1.00 0.00 ? 90  SER A CA   3  
ATOM 6205  C C    . SER A 1 90  ? -18.151 5.580   -3.267  1.00 0.00 ? 90  SER A C    3  
ATOM 6206  O O    . SER A 1 90  ? -18.625 4.437   -3.300  1.00 0.00 ? 90  SER A O    3  
ATOM 6207  C CB   . SER A 1 90  ? -20.298 6.470   -4.456  1.00 0.00 ? 90  SER A CB   3  
ATOM 6208  O OG   . SER A 1 90  ? -21.071 5.548   -3.689  1.00 0.00 ? 90  SER A OG   3  
ATOM 6209  H H    . SER A 1 90  ? -18.035 7.451   -5.604  1.00 0.00 ? 90  SER A H    3  
ATOM 6210  H HA   . SER A 1 90  ? -19.290 7.362   -2.773  1.00 0.00 ? 90  SER A HA   3  
ATOM 6211  H HB2  . SER A 1 90  ? -20.899 7.375   -4.666  1.00 0.00 ? 90  SER A HB2  3  
ATOM 6212  H HB3  . SER A 1 90  ? -20.077 6.022   -5.447  1.00 0.00 ? 90  SER A HB3  3  
ATOM 6213  H HG   . SER A 1 90  ? -20.476 4.802   -3.520  1.00 0.00 ? 90  SER A HG   3  
ATOM 6214  N N    . GLU A 1 91  ? -16.929 5.818   -2.753  1.00 0.00 ? 91  GLU A N    3  
ATOM 6215  C CA   . GLU A 1 91  ? -15.959 4.754   -2.381  1.00 0.00 ? 91  GLU A CA   3  
ATOM 6216  C C    . GLU A 1 91  ? -16.213 4.264   -0.917  1.00 0.00 ? 91  GLU A C    3  
ATOM 6217  O O    . GLU A 1 91  ? -15.682 4.803   0.060   1.00 0.00 ? 91  GLU A O    3  
ATOM 6218  C CB   . GLU A 1 91  ? -14.538 5.356   -2.601  1.00 0.00 ? 91  GLU A CB   3  
ATOM 6219  C CG   . GLU A 1 91  ? -14.143 5.661   -4.080  1.00 0.00 ? 91  GLU A CG   3  
ATOM 6220  C CD   . GLU A 1 91  ? -13.109 6.762   -4.257  1.00 0.00 ? 91  GLU A CD   3  
ATOM 6221  O OE1  . GLU A 1 91  ? -11.893 6.481   -4.169  1.00 0.00 ? 91  GLU A OE1  3  
ATOM 6222  O OE2  . GLU A 1 91  ? -13.508 7.928   -4.467  1.00 0.00 ? 91  GLU A OE2  3  
ATOM 6223  H H    . GLU A 1 91  ? -16.647 6.802   -2.804  1.00 0.00 ? 91  GLU A H    3  
ATOM 6224  H HA   . GLU A 1 91  ? -16.055 3.885   -3.065  1.00 0.00 ? 91  GLU A HA   3  
ATOM 6225  H HB2  . GLU A 1 91  ? -14.441 6.270   -1.986  1.00 0.00 ? 91  GLU A HB2  3  
ATOM 6226  H HB3  . GLU A 1 91  ? -13.776 4.673   -2.177  1.00 0.00 ? 91  GLU A HB3  3  
ATOM 6227  H HG2  . GLU A 1 91  ? -13.771 4.752   -4.581  1.00 0.00 ? 91  GLU A HG2  3  
ATOM 6228  H HG3  . GLU A 1 91  ? -15.023 5.972   -4.672  1.00 0.00 ? 91  GLU A HG3  3  
ATOM 6229  N N    . ASN A 1 92  ? -17.038 3.210   -0.788  1.00 0.00 ? 92  ASN A N    3  
ATOM 6230  C CA   . ASN A 1 92  ? -17.405 2.611   0.524   1.00 0.00 ? 92  ASN A CA   3  
ATOM 6231  C C    . ASN A 1 92  ? -16.268 1.680   1.064   1.00 0.00 ? 92  ASN A C    3  
ATOM 6232  O O    . ASN A 1 92  ? -15.688 0.884   0.318   1.00 0.00 ? 92  ASN A O    3  
ATOM 6233  C CB   . ASN A 1 92  ? -18.740 1.845   0.297   1.00 0.00 ? 92  ASN A CB   3  
ATOM 6234  C CG   . ASN A 1 92  ? -19.415 1.318   1.571   1.00 0.00 ? 92  ASN A CG   3  
ATOM 6235  O OD1  . ASN A 1 92  ? -19.065 0.273   2.110   1.00 0.00 ? 92  ASN A OD1  3  
ATOM 6236  N ND2  . ASN A 1 92  ? -20.388 2.016   2.105   1.00 0.00 ? 92  ASN A ND2  3  
ATOM 6237  H H    . ASN A 1 92  ? -17.418 2.871   -1.680  1.00 0.00 ? 92  ASN A H    3  
ATOM 6238  H HA   . ASN A 1 92  ? -17.579 3.430   1.253   1.00 0.00 ? 92  ASN A HA   3  
ATOM 6239  H HB2  . ASN A 1 92  ? -19.459 2.478   -0.258  1.00 0.00 ? 92  ASN A HB2  3  
ATOM 6240  H HB3  . ASN A 1 92  ? -18.566 0.978   -0.369  1.00 0.00 ? 92  ASN A HB3  3  
ATOM 6241  H HD21 . ASN A 1 92  ? -20.697 2.852   1.602   1.00 0.00 ? 92  ASN A HD21 3  
ATOM 6242  H HD22 . ASN A 1 92  ? -20.830 1.564   2.910   1.00 0.00 ? 92  ASN A HD22 3  
ATOM 6243  N N    . ARG A 1 93  ? -16.002 1.728   2.382   1.00 0.00 ? 93  ARG A N    3  
ATOM 6244  C CA   . ARG A 1 93  ? -14.908 0.929   3.009   1.00 0.00 ? 93  ARG A CA   3  
ATOM 6245  C C    . ARG A 1 93  ? -15.252 -0.586  3.272   1.00 0.00 ? 93  ARG A C    3  
ATOM 6246  O O    . ARG A 1 93  ? -15.176 -1.087  4.392   1.00 0.00 ? 93  ARG A O    3  
ATOM 6247  C CB   . ARG A 1 93  ? -14.457 1.739   4.267   1.00 0.00 ? 93  ARG A CB   3  
ATOM 6248  C CG   . ARG A 1 93  ? -15.396 2.108   5.452   1.00 0.00 ? 93  ARG A CG   3  
ATOM 6249  C CD   . ARG A 1 93  ? -15.782 0.951   6.391   1.00 0.00 ? 93  ARG A CD   3  
ATOM 6250  N NE   . ARG A 1 93  ? -16.269 1.446   7.709   1.00 0.00 ? 93  ARG A NE   3  
ATOM 6251  C CZ   . ARG A 1 93  ? -15.552 1.481   8.837   1.00 0.00 ? 93  ARG A CZ   3  
ATOM 6252  N NH1  . ARG A 1 93  ? -14.275 1.192   8.910   1.00 0.00 ? 93  ARG A NH1  3  
ATOM 6253  N NH2  . ARG A 1 93  ? -16.156 1.832   9.935   1.00 0.00 ? 93  ARG A NH2  3  
ATOM 6254  H H    . ARG A 1 93  ? -16.538 2.426   2.905   1.00 0.00 ? 93  ARG A H    3  
ATOM 6255  H HA   . ARG A 1 93  ? -14.033 0.897   2.329   1.00 0.00 ? 93  ARG A HA   3  
ATOM 6256  H HB2  . ARG A 1 93  ? -13.554 1.245   4.671   1.00 0.00 ? 93  ARG A HB2  3  
ATOM 6257  H HB3  . ARG A 1 93  ? -14.067 2.703   3.892   1.00 0.00 ? 93  ARG A HB3  3  
ATOM 6258  H HG2  . ARG A 1 93  ? -14.866 2.881   6.044   1.00 0.00 ? 93  ARG A HG2  3  
ATOM 6259  H HG3  . ARG A 1 93  ? -16.306 2.620   5.087   1.00 0.00 ? 93  ARG A HG3  3  
ATOM 6260  H HD2  . ARG A 1 93  ? -16.581 0.352   5.912   1.00 0.00 ? 93  ARG A HD2  3  
ATOM 6261  H HD3  . ARG A 1 93  ? -14.946 0.232   6.504   1.00 0.00 ? 93  ARG A HD3  3  
ATOM 6262  H HE   . ARG A 1 93  ? -17.244 1.732   7.830   1.00 0.00 ? 93  ARG A HE   3  
ATOM 6263  H HH11 . ARG A 1 93  ? -13.824 0.919   8.020   1.00 0.00 ? 93  ARG A HH11 3  
ATOM 6264  H HH12 . ARG A 1 93  ? -13.826 1.196   9.825   1.00 0.00 ? 93  ARG A HH12 3  
ATOM 6265  H HH21 . ARG A 1 93  ? -17.152 2.049   9.869   1.00 0.00 ? 93  ARG A HH21 3  
ATOM 6266  H HH22 . ARG A 1 93  ? -15.595 1.840   10.789  1.00 0.00 ? 93  ARG A HH22 3  
ATOM 6267  N N    . LYS A 1 94  ? -15.547 -1.348  2.205   1.00 0.00 ? 94  LYS A N    3  
ATOM 6268  C CA   . LYS A 1 94  ? -15.845 -2.810  2.274   1.00 0.00 ? 94  LYS A CA   3  
ATOM 6269  C C    . LYS A 1 94  ? -15.023 -3.585  1.186   1.00 0.00 ? 94  LYS A C    3  
ATOM 6270  O O    . LYS A 1 94  ? -14.661 -3.046  0.134   1.00 0.00 ? 94  LYS A O    3  
ATOM 6271  C CB   . LYS A 1 94  ? -17.387 -3.027  2.125   1.00 0.00 ? 94  LYS A CB   3  
ATOM 6272  C CG   . LYS A 1 94  ? -18.080 -3.798  3.281   1.00 0.00 ? 94  LYS A CG   3  
ATOM 6273  C CD   . LYS A 1 94  ? -18.355 -2.970  4.566   1.00 0.00 ? 94  LYS A CD   3  
ATOM 6274  C CE   . LYS A 1 94  ? -17.327 -3.080  5.715   1.00 0.00 ? 94  LYS A CE   3  
ATOM 6275  N NZ   . LYS A 1 94  ? -17.443 -4.356  6.467   1.00 0.00 ? 94  LYS A NZ   3  
ATOM 6276  H H    . LYS A 1 94  ? -15.592 -0.816  1.322   1.00 0.00 ? 94  LYS A H    3  
ATOM 6277  H HA   . LYS A 1 94  ? -15.514 -3.206  3.249   1.00 0.00 ? 94  LYS A HA   3  
ATOM 6278  H HB2  . LYS A 1 94  ? -17.925 -2.071  1.965   1.00 0.00 ? 94  LYS A HB2  3  
ATOM 6279  H HB3  . LYS A 1 94  ? -17.597 -3.571  1.182   1.00 0.00 ? 94  LYS A HB3  3  
ATOM 6280  H HG2  . LYS A 1 94  ? -19.061 -4.139  2.894   1.00 0.00 ? 94  LYS A HG2  3  
ATOM 6281  H HG3  . LYS A 1 94  ? -17.548 -4.743  3.506   1.00 0.00 ? 94  LYS A HG3  3  
ATOM 6282  H HD2  . LYS A 1 94  ? -18.459 -1.902  4.284   1.00 0.00 ? 94  LYS A HD2  3  
ATOM 6283  H HD3  . LYS A 1 94  ? -19.362 -3.224  4.952   1.00 0.00 ? 94  LYS A HD3  3  
ATOM 6284  H HE2  . LYS A 1 94  ? -16.293 -2.949  5.345   1.00 0.00 ? 94  LYS A HE2  3  
ATOM 6285  H HE3  . LYS A 1 94  ? -17.463 -2.226  6.413   1.00 0.00 ? 94  LYS A HE3  3  
ATOM 6286  H HZ1  . LYS A 1 94  ? -18.385 -4.583  6.800   1.00 0.00 ? 94  LYS A HZ1  3  
ATOM 6287  H HZ2  . LYS A 1 94  ? -17.081 -5.185  5.977   1.00 0.00 ? 94  LYS A HZ2  3  
ATOM 6288  H HZ3  . LYS A 1 94  ? -16.835 -4.380  7.345   1.00 0.00 ? 94  LYS A HZ3  3  
ATOM 6289  N N    . GLN A 1 95  ? -14.727 -4.872  1.446   1.00 0.00 ? 95  GLN A N    3  
ATOM 6290  C CA   . GLN A 1 95  ? -13.953 -5.728  0.502   1.00 0.00 ? 95  GLN A CA   3  
ATOM 6291  C C    . GLN A 1 95  ? -14.873 -6.391  -0.579  1.00 0.00 ? 95  GLN A C    3  
ATOM 6292  O O    . GLN A 1 95  ? -15.907 -6.983  -0.251  1.00 0.00 ? 95  GLN A O    3  
ATOM 6293  C CB   . GLN A 1 95  ? -13.224 -6.813  1.348   1.00 0.00 ? 95  GLN A CB   3  
ATOM 6294  C CG   . GLN A 1 95  ? -12.040 -7.510  0.621   1.00 0.00 ? 95  GLN A CG   3  
ATOM 6295  C CD   . GLN A 1 95  ? -11.327 -8.616  1.409   1.00 0.00 ? 95  GLN A CD   3  
ATOM 6296  O OE1  . GLN A 1 95  ? -11.344 -9.788  1.050   1.00 0.00 ? 95  GLN A OE1  3  
ATOM 6297  N NE2  . GLN A 1 95  ? -10.664 -8.296  2.496   1.00 0.00 ? 95  GLN A NE2  3  
ATOM 6298  H H    . GLN A 1 95  ? -15.079 -5.237  2.336   1.00 0.00 ? 95  GLN A H    3  
ATOM 6299  H HA   . GLN A 1 95  ? -13.185 -5.105  -0.003  1.00 0.00 ? 95  GLN A HA   3  
ATOM 6300  H HB2  . GLN A 1 95  ? -12.833 -6.367  2.281   1.00 0.00 ? 95  GLN A HB2  3  
ATOM 6301  H HB3  . GLN A 1 95  ? -13.953 -7.575  1.692   1.00 0.00 ? 95  GLN A HB3  3  
ATOM 6302  H HG2  . GLN A 1 95  ? -12.394 -7.963  -0.324  1.00 0.00 ? 95  GLN A HG2  3  
ATOM 6303  H HG3  . GLN A 1 95  ? -11.285 -6.765  0.306   1.00 0.00 ? 95  GLN A HG3  3  
ATOM 6304  H HE21 . GLN A 1 95  ? -10.722 -7.323  2.804   1.00 0.00 ? 95  GLN A HE21 3  
ATOM 6305  H HE22 . GLN A 1 95  ? -10.274 -9.101  2.992   1.00 0.00 ? 95  GLN A HE22 3  
ATOM 6306  N N    . ASP A 1 96  ? -14.458 -6.332  -1.858  1.00 0.00 ? 96  ASP A N    3  
ATOM 6307  C CA   . ASP A 1 96  ? -15.206 -6.963  -2.985  1.00 0.00 ? 96  ASP A CA   3  
ATOM 6308  C C    . ASP A 1 96  ? -14.935 -8.517  -3.020  1.00 0.00 ? 96  ASP A C    3  
ATOM 6309  O O    . ASP A 1 96  ? -15.831 -9.294  -2.682  1.00 0.00 ? 96  ASP A O    3  
ATOM 6310  C CB   . ASP A 1 96  ? -14.805 -6.149  -4.250  1.00 0.00 ? 96  ASP A CB   3  
ATOM 6311  C CG   . ASP A 1 96  ? -15.533 -6.543  -5.530  1.00 0.00 ? 96  ASP A CG   3  
ATOM 6312  O OD1  . ASP A 1 96  ? -16.779 -6.635  -5.534  1.00 0.00 ? 96  ASP A OD1  3  
ATOM 6313  O OD2  . ASP A 1 96  ? -14.866 -6.843  -6.540  1.00 0.00 ? 96  ASP A OD2  3  
ATOM 6314  H H    . ASP A 1 96  ? -13.597 -5.802  -2.014  1.00 0.00 ? 96  ASP A H    3  
ATOM 6315  H HA   . ASP A 1 96  ? -16.297 -6.838  -2.829  1.00 0.00 ? 96  ASP A HA   3  
ATOM 6316  H HB2  . ASP A 1 96  ? -15.015 -5.075  -4.094  1.00 0.00 ? 96  ASP A HB2  3  
ATOM 6317  H HB3  . ASP A 1 96  ? -13.717 -6.209  -4.435  1.00 0.00 ? 96  ASP A HB3  3  
ATOM 6318  N N    . LYS A 1 97  ? -13.737 -8.976  -3.439  1.00 0.00 ? 97  LYS A N    3  
ATOM 6319  C CA   . LYS A 1 97  ? -13.341 -10.427 -3.369  1.00 0.00 ? 97  LYS A CA   3  
ATOM 6320  C C    . LYS A 1 97  ? -11.833 -10.617 -2.961  1.00 0.00 ? 97  LYS A C    3  
ATOM 6321  O O    . LYS A 1 97  ? -11.502 -11.628 -2.338  1.00 0.00 ? 97  LYS A O    3  
ATOM 6322  C CB   . LYS A 1 97  ? -13.573 -11.162 -4.732  1.00 0.00 ? 97  LYS A CB   3  
ATOM 6323  C CG   . LYS A 1 97  ? -15.035 -11.297 -5.234  1.00 0.00 ? 97  LYS A CG   3  
ATOM 6324  C CD   . LYS A 1 97  ? -15.444 -10.152 -6.184  1.00 0.00 ? 97  LYS A CD   3  
ATOM 6325  C CE   . LYS A 1 97  ? -16.966 -9.994  -6.343  1.00 0.00 ? 97  LYS A CE   3  
ATOM 6326  N NZ   . LYS A 1 97  ? -17.243 -8.726  -7.069  1.00 0.00 ? 97  LYS A NZ   3  
ATOM 6327  H H    . LYS A 1 97  ? -13.088 -8.223  -3.687  1.00 0.00 ? 97  LYS A H    3  
ATOM 6328  H HA   . LYS A 1 97  ? -13.936 -10.944 -2.588  1.00 0.00 ? 97  LYS A HA   3  
ATOM 6329  H HB2  . LYS A 1 97  ? -12.932 -10.721 -5.522  1.00 0.00 ? 97  LYS A HB2  3  
ATOM 6330  H HB3  . LYS A 1 97  ? -13.184 -12.194 -4.623  1.00 0.00 ? 97  LYS A HB3  3  
ATOM 6331  H HG2  . LYS A 1 97  ? -15.166 -12.264 -5.760  1.00 0.00 ? 97  LYS A HG2  3  
ATOM 6332  H HG3  . LYS A 1 97  ? -15.715 -11.355 -4.360  1.00 0.00 ? 97  LYS A HG3  3  
ATOM 6333  H HD2  . LYS A 1 97  ? -15.018 -9.211  -5.795  1.00 0.00 ? 97  LYS A HD2  3  
ATOM 6334  H HD3  . LYS A 1 97  ? -14.954 -10.290 -7.168  1.00 0.00 ? 97  LYS A HD3  3  
ATOM 6335  H HE2  . LYS A 1 97  ? -17.396 -10.874 -6.868  1.00 0.00 ? 97  LYS A HE2  3  
ATOM 6336  H HE3  . LYS A 1 97  ? -17.449 -9.970  -5.339  1.00 0.00 ? 97  LYS A HE3  3  
ATOM 6337  H HZ1  . LYS A 1 97  ? -16.626 -8.570  -7.875  1.00 0.00 ? 97  LYS A HZ1  3  
ATOM 6338  H HZ2  . LYS A 1 97  ? -18.213 -8.578  -7.366  1.00 0.00 ? 97  LYS A HZ2  3  
ATOM 6339  H HZ3  . LYS A 1 97  ? -17.014 -7.880  -6.462  1.00 0.00 ? 97  LYS A HZ3  3  
ATOM 6340  N N    . ARG A 1 98  ? -10.938 -9.658  -3.272  1.00 0.00 ? 98  ARG A N    3  
ATOM 6341  C CA   . ARG A 1 98  ? -9.508  -9.657  -2.874  1.00 0.00 ? 98  ARG A CA   3  
ATOM 6342  C C    . ARG A 1 98  ? -9.183  -8.140  -2.631  1.00 0.00 ? 98  ARG A C    3  
ATOM 6343  O O    . ARG A 1 98  ? -9.673  -7.592  -1.642  1.00 0.00 ? 98  ARG A O    3  
ATOM 6344  C CB   . ARG A 1 98  ? -8.663  -10.421 -3.950  1.00 0.00 ? 98  ARG A CB   3  
ATOM 6345  C CG   . ARG A 1 98  ? -8.725  -11.965 -3.838  1.00 0.00 ? 98  ARG A CG   3  
ATOM 6346  C CD   . ARG A 1 98  ? -7.770  -12.688 -4.802  1.00 0.00 ? 98  ARG A CD   3  
ATOM 6347  N NE   . ARG A 1 98  ? -7.715  -14.129 -4.432  1.00 0.00 ? 98  ARG A NE   3  
ATOM 6348  C CZ   . ARG A 1 98  ? -6.984  -15.055 -5.054  1.00 0.00 ? 98  ARG A CZ   3  
ATOM 6349  N NH1  . ARG A 1 98  ? -6.217  -14.803 -6.088  1.00 0.00 ? 98  ARG A NH1  3  
ATOM 6350  N NH2  . ARG A 1 98  ? -7.039  -16.280 -4.616  1.00 0.00 ? 98  ARG A NH2  3  
ATOM 6351  H H    . ARG A 1 98  ? -11.344 -8.880  -3.795  1.00 0.00 ? 98  ARG A H    3  
ATOM 6352  H HA   . ARG A 1 98  ? -9.383  -10.151 -1.888  1.00 0.00 ? 98  ARG A HA   3  
ATOM 6353  H HB2  . ARG A 1 98  ? -8.955  -10.101 -4.970  1.00 0.00 ? 98  ARG A HB2  3  
ATOM 6354  H HB3  . ARG A 1 98  ? -7.606  -10.113 -3.858  1.00 0.00 ? 98  ARG A HB3  3  
ATOM 6355  H HG2  . ARG A 1 98  ? -8.518  -12.253 -2.787  1.00 0.00 ? 98  ARG A HG2  3  
ATOM 6356  H HG3  . ARG A 1 98  ? -9.760  -12.311 -4.028  1.00 0.00 ? 98  ARG A HG3  3  
ATOM 6357  H HD2  . ARG A 1 98  ? -8.128  -12.554 -5.844  1.00 0.00 ? 98  ARG A HD2  3  
ATOM 6358  H HD3  . ARG A 1 98  ? -6.759  -12.236 -4.757  1.00 0.00 ? 98  ARG A HD3  3  
ATOM 6359  H HE   . ARG A 1 98  ? -8.273  -14.484 -3.649  1.00 0.00 ? 98  ARG A HE   3  
ATOM 6360  H HH11 . ARG A 1 98  ? -6.246  -13.832 -6.406  1.00 0.00 ? 98  ARG A HH11 3  
ATOM 6361  H HH12 . ARG A 1 98  ? -5.707  -15.572 -6.525  1.00 0.00 ? 98  ARG A HH12 3  
ATOM 6362  H HH21 . ARG A 1 98  ? -7.662  -16.458 -3.826  1.00 0.00 ? 98  ARG A HH21 3  
ATOM 6363  H HH22 . ARG A 1 98  ? -6.490  -16.980 -5.118  1.00 0.00 ? 98  ARG A HH22 3  
ATOM 6364  N N    . PHE A 1 99  ? -8.362  -7.463  -3.468  1.00 0.00 ? 99  PHE A N    3  
ATOM 6365  C CA   . PHE A 1 99  ? -8.066  -5.981  -3.406  1.00 0.00 ? 99  PHE A CA   3  
ATOM 6366  C C    . PHE A 1 99  ? -7.618  -5.318  -2.047  1.00 0.00 ? 99  PHE A C    3  
ATOM 6367  O O    . PHE A 1 99  ? -7.399  -4.101  -2.063  1.00 0.00 ? 99  PHE A O    3  
ATOM 6368  C CB   . PHE A 1 99  ? -9.328  -5.220  -3.958  1.00 0.00 ? 99  PHE A CB   3  
ATOM 6369  C CG   . PHE A 1 99  ? -9.857  -5.574  -5.370  1.00 0.00 ? 99  PHE A CG   3  
ATOM 6370  C CD1  . PHE A 1 99  ? -9.340  -4.970  -6.523  1.00 0.00 ? 99  PHE A CD1  3  
ATOM 6371  C CD2  . PHE A 1 99  ? -10.909 -6.489  -5.497  1.00 0.00 ? 99  PHE A CD2  3  
ATOM 6372  C CE1  . PHE A 1 99  ? -9.848  -5.294  -7.778  1.00 0.00 ? 99  PHE A CE1  3  
ATOM 6373  C CE2  . PHE A 1 99  ? -11.421 -6.810  -6.751  1.00 0.00 ? 99  PHE A CE2  3  
ATOM 6374  C CZ   . PHE A 1 99  ? -10.886 -6.215  -7.891  1.00 0.00 ? 99  PHE A CZ   3  
ATOM 6375  H H    . PHE A 1 99  ? -8.068  -8.025  -4.272  1.00 0.00 ? 99  PHE A H    3  
ATOM 6376  H HA   . PHE A 1 99  ? -7.202  -5.754  -4.065  1.00 0.00 ? 99  PHE A HA   3  
ATOM 6377  H HB2  . PHE A 1 99  ? -10.153 -5.320  -3.225  1.00 0.00 ? 99  PHE A HB2  3  
ATOM 6378  H HB3  . PHE A 1 99  ? -9.125  -4.131  -3.952  1.00 0.00 ? 99  PHE A HB3  3  
ATOM 6379  H HD1  . PHE A 1 99  ? -8.568  -4.220  -6.467  1.00 0.00 ? 99  PHE A HD1  3  
ATOM 6380  H HD2  . PHE A 1 99  ? -11.343 -6.939  -4.618  1.00 0.00 ? 99  PHE A HD2  3  
ATOM 6381  H HE1  . PHE A 1 99  ? -9.449  -4.808  -8.659  1.00 0.00 ? 99  PHE A HE1  3  
ATOM 6382  H HE2  . PHE A 1 99  ? -12.251 -7.497  -6.838  1.00 0.00 ? 99  PHE A HE2  3  
ATOM 6383  H HZ   . PHE A 1 99  ? -11.293 -6.450  -8.864  1.00 0.00 ? 99  PHE A HZ   3  
ATOM 6384  N N    . ALA A 1 100 ? -7.392  -6.028  -0.920  1.00 0.00 ? 100 ALA A N    3  
ATOM 6385  C CA   . ALA A 1 100 ? -7.065  -5.381  0.376   1.00 0.00 ? 100 ALA A CA   3  
ATOM 6386  C C    . ALA A 1 100 ? -5.734  -5.869  1.004   1.00 0.00 ? 100 ALA A C    3  
ATOM 6387  O O    . ALA A 1 100 ? -5.289  -6.998  0.798   1.00 0.00 ? 100 ALA A O    3  
ATOM 6388  C CB   . ALA A 1 100 ? -8.252  -5.710  1.305   1.00 0.00 ? 100 ALA A CB   3  
ATOM 6389  H H    . ALA A 1 100 ? -7.595  -7.044  -0.947  1.00 0.00 ? 100 ALA A H    3  
ATOM 6390  H HA   . ALA A 1 100 ? -7.012  -4.278  0.275   1.00 0.00 ? 100 ALA A HA   3  
ATOM 6391  H HB1  . ALA A 1 100 ? -9.209  -5.334  0.900   1.00 0.00 ? 100 ALA A HB1  3  
ATOM 6392  H HB2  . ALA A 1 100 ? -8.365  -6.801  1.460   1.00 0.00 ? 100 ALA A HB2  3  
ATOM 6393  H HB3  . ALA A 1 100 ? -8.125  -5.251  2.304   1.00 0.00 ? 100 ALA A HB3  3  
ATOM 6394  N N    . PHE A 1 101 ? -5.084  -4.987  1.771   1.00 0.00 ? 101 PHE A N    3  
ATOM 6395  C CA   . PHE A 1 101 ? -3.890  -5.335  2.574   1.00 0.00 ? 101 PHE A CA   3  
ATOM 6396  C C    . PHE A 1 101 ? -4.384  -5.760  3.993   1.00 0.00 ? 101 PHE A C    3  
ATOM 6397  O O    . PHE A 1 101 ? -5.217  -5.079  4.608   1.00 0.00 ? 101 PHE A O    3  
ATOM 6398  C CB   . PHE A 1 101 ? -2.899  -4.147  2.765   1.00 0.00 ? 101 PHE A CB   3  
ATOM 6399  C CG   . PHE A 1 101 ? -2.081  -3.608  1.575   1.00 0.00 ? 101 PHE A CG   3  
ATOM 6400  C CD1  . PHE A 1 101 ? -2.716  -3.039  0.465   1.00 0.00 ? 101 PHE A CD1  3  
ATOM 6401  C CD2  . PHE A 1 101 ? -0.690  -3.481  1.700   1.00 0.00 ? 101 PHE A CD2  3  
ATOM 6402  C CE1  . PHE A 1 101 ? -1.985  -2.318  -0.472  1.00 0.00 ? 101 PHE A CE1  3  
ATOM 6403  C CE2  . PHE A 1 101 ? 0.042   -2.763  0.757   1.00 0.00 ? 101 PHE A CE2  3  
ATOM 6404  C CZ   . PHE A 1 101 ? -0.610  -2.165  -0.317  1.00 0.00 ? 101 PHE A CZ   3  
ATOM 6405  H H    . PHE A 1 101 ? -5.560  -4.085  1.899   1.00 0.00 ? 101 PHE A H    3  
ATOM 6406  H HA   . PHE A 1 101 ? -3.345  -6.153  2.083   1.00 0.00 ? 101 PHE A HA   3  
ATOM 6407  H HB2  . PHE A 1 101 ? -3.429  -3.294  3.229   1.00 0.00 ? 101 PHE A HB2  3  
ATOM 6408  H HB3  . PHE A 1 101 ? -2.179  -4.453  3.554   1.00 0.00 ? 101 PHE A HB3  3  
ATOM 6409  H HD1  . PHE A 1 101 ? -3.788  -3.091  0.353   1.00 0.00 ? 101 PHE A HD1  3  
ATOM 6410  H HD2  . PHE A 1 101 ? -0.173  -3.894  2.555   1.00 0.00 ? 101 PHE A HD2  3  
ATOM 6411  H HE1  . PHE A 1 101 ? -2.501  -1.856  -1.300  1.00 0.00 ? 101 PHE A HE1  3  
ATOM 6412  H HE2  . PHE A 1 101 ? 1.110   -2.646  0.876   1.00 0.00 ? 101 PHE A HE2  3  
ATOM 6413  H HZ   . PHE A 1 101 ? -0.049  -1.581  -1.030  1.00 0.00 ? 101 PHE A HZ   3  
ATOM 6414  N N    . ILE A 1 102 ? -3.887  -6.890  4.515   1.00 0.00 ? 102 ILE A N    3  
ATOM 6415  C CA   . ILE A 1 102 ? -4.162  -7.278  5.932   1.00 0.00 ? 102 ILE A CA   3  
ATOM 6416  C C    . ILE A 1 102 ? -2.884  -6.803  6.719   1.00 0.00 ? 102 ILE A C    3  
ATOM 6417  O O    . ILE A 1 102 ? -1.727  -7.094  6.378   1.00 0.00 ? 102 ILE A O    3  
ATOM 6418  C CB   . ILE A 1 102 ? -4.590  -8.791  6.063   1.00 0.00 ? 102 ILE A CB   3  
ATOM 6419  C CG1  . ILE A 1 102 ? -6.133  -8.921  5.868   1.00 0.00 ? 102 ILE A CG1  3  
ATOM 6420  C CG2  . ILE A 1 102 ? -4.210  -9.386  7.444   1.00 0.00 ? 102 ILE A CG2  3  
ATOM 6421  C CD1  . ILE A 1 102 ? -6.744  -10.329 5.996   1.00 0.00 ? 102 ILE A CD1  3  
ATOM 6422  H H    . ILE A 1 102 ? -3.181  -7.361  3.928   1.00 0.00 ? 102 ILE A H    3  
ATOM 6423  H HA   . ILE A 1 102 ? -5.011  -6.691  6.332   1.00 0.00 ? 102 ILE A HA   3  
ATOM 6424  H HB   . ILE A 1 102 ? -4.099  -9.399  5.282   1.00 0.00 ? 102 ILE A HB   3  
ATOM 6425  H HG12 . ILE A 1 102 ? -6.646  -8.270  6.600   1.00 0.00 ? 102 ILE A HG12 3  
ATOM 6426  H HG13 . ILE A 1 102 ? -6.404  -8.512  4.875   1.00 0.00 ? 102 ILE A HG13 3  
ATOM 6427  H HG21 . ILE A 1 102 ? -3.126  -9.322  7.649   1.00 0.00 ? 102 ILE A HG21 3  
ATOM 6428  H HG22 . ILE A 1 102 ? -4.724  -8.862  8.269   1.00 0.00 ? 102 ILE A HG22 3  
ATOM 6429  H HG23 . ILE A 1 102 ? -4.446  -10.464 7.519   1.00 0.00 ? 102 ILE A HG23 3  
ATOM 6430  H HD11 . ILE A 1 102 ? -6.232  -11.061 5.349   1.00 0.00 ? 102 ILE A HD11 3  
ATOM 6431  H HD12 . ILE A 1 102 ? -6.675  -10.713 7.031   1.00 0.00 ? 102 ILE A HD12 3  
ATOM 6432  H HD13 . ILE A 1 102 ? -7.817  -10.333 5.734   1.00 0.00 ? 102 ILE A HD13 3  
ATOM 6433  N N    . ARG A 1 103 ? -3.143  -6.011  7.770   1.00 0.00 ? 103 ARG A N    3  
ATOM 6434  C CA   . ARG A 1 103 ? -2.083  -5.453  8.643   1.00 0.00 ? 103 ARG A CA   3  
ATOM 6435  C C    . ARG A 1 103 ? -2.066  -6.247  9.983   1.00 0.00 ? 103 ARG A C    3  
ATOM 6436  O O    . ARG A 1 103 ? -2.835  -5.970  10.909  1.00 0.00 ? 103 ARG A O    3  
ATOM 6437  C CB   . ARG A 1 103 ? -2.384  -3.933  8.757   1.00 0.00 ? 103 ARG A CB   3  
ATOM 6438  C CG   . ARG A 1 103 ? -1.438  -3.070  9.639   1.00 0.00 ? 103 ARG A CG   3  
ATOM 6439  C CD   . ARG A 1 103 ? -1.903  -2.816  11.090  1.00 0.00 ? 103 ARG A CD   3  
ATOM 6440  N NE   . ARG A 1 103 ? -3.168  -2.026  11.113  1.00 0.00 ? 103 ARG A NE   3  
ATOM 6441  C CZ   . ARG A 1 103 ? -4.333  -2.460  11.596  1.00 0.00 ? 103 ARG A CZ   3  
ATOM 6442  N NH1  . ARG A 1 103 ? -4.467  -3.437  12.458  1.00 0.00 ? 103 ARG A NH1  3  
ATOM 6443  N NH2  . ARG A 1 103 ? -5.421  -1.874  11.196  1.00 0.00 ? 103 ARG A NH2  3  
ATOM 6444  H H    . ARG A 1 103 ? -4.150  -5.860  7.958   1.00 0.00 ? 103 ARG A H    3  
ATOM 6445  H HA   . ARG A 1 103 ? -1.079  -5.542  8.176   1.00 0.00 ? 103 ARG A HA   3  
ATOM 6446  H HB2  . ARG A 1 103 ? -2.332  -3.517  7.732   1.00 0.00 ? 103 ARG A HB2  3  
ATOM 6447  H HB3  . ARG A 1 103 ? -3.438  -3.775  9.060   1.00 0.00 ? 103 ARG A HB3  3  
ATOM 6448  H HG2  . ARG A 1 103 ? -0.433  -3.529  9.658   1.00 0.00 ? 103 ARG A HG2  3  
ATOM 6449  H HG3  . ARG A 1 103 ? -1.273  -2.092  9.149   1.00 0.00 ? 103 ARG A HG3  3  
ATOM 6450  H HD2  . ARG A 1 103 ? -1.977  -3.784  11.618  1.00 0.00 ? 103 ARG A HD2  3  
ATOM 6451  H HD3  . ARG A 1 103 ? -1.120  -2.261  11.644  1.00 0.00 ? 103 ARG A HD3  3  
ATOM 6452  H HE   . ARG A 1 103 ? -3.260  -1.214  10.498  1.00 0.00 ? 103 ARG A HE   3  
ATOM 6453  H HH11 . ARG A 1 103 ? -3.592  -3.805  12.918  1.00 0.00 ? 103 ARG A HH11 3  
ATOM 6454  H HH12 . ARG A 1 103 ? -5.426  -3.663  12.741  1.00 0.00 ? 103 ARG A HH12 3  
ATOM 6455  H HH21 . ARG A 1 103 ? -5.338  -1.120  10.514  1.00 0.00 ? 103 ARG A HH21 3  
ATOM 6456  H HH22 . ARG A 1 103 ? -6.293  -2.298  11.550  1.00 0.00 ? 103 ARG A HH22 3  
ATOM 6457  N N    . SER A 1 104 ? -1.170  -7.246  10.070  1.00 0.00 ? 104 SER A N    3  
ATOM 6458  C CA   . SER A 1 104 ? -0.989  -8.066  11.298  1.00 0.00 ? 104 SER A CA   3  
ATOM 6459  C C    . SER A 1 104 ? 0.045   -7.349  12.219  1.00 0.00 ? 104 SER A C    3  
ATOM 6460  O O    . SER A 1 104 ? 1.249   -7.316  11.935  1.00 0.00 ? 104 SER A O    3  
ATOM 6461  C CB   . SER A 1 104 ? -0.544  -9.488  10.883  1.00 0.00 ? 104 SER A CB   3  
ATOM 6462  O OG   . SER A 1 104 ? -1.629  -10.205 10.284  1.00 0.00 ? 104 SER A OG   3  
ATOM 6463  H H    . SER A 1 104 ? -0.601  -7.395  9.229   1.00 0.00 ? 104 SER A H    3  
ATOM 6464  H HA   . SER A 1 104 ? -1.948  -8.173  11.843  1.00 0.00 ? 104 SER A HA   3  
ATOM 6465  H HB2  . SER A 1 104 ? 0.326   -9.462  10.198  1.00 0.00 ? 104 SER A HB2  3  
ATOM 6466  H HB3  . SER A 1 104 ? -0.203  -10.054 11.772  1.00 0.00 ? 104 SER A HB3  3  
ATOM 6467  H HG   . SER A 1 104 ? -1.352  -10.511 9.359   1.00 0.00 ? 104 SER A HG   3  
ATOM 6468  N N    . ASP A 1 105 ? -0.444  -6.717  13.296  1.00 0.00 ? 105 ASP A N    3  
ATOM 6469  C CA   . ASP A 1 105 ? 0.397   -5.928  14.239  1.00 0.00 ? 105 ASP A CA   3  
ATOM 6470  C C    . ASP A 1 105 ? 0.354   -6.487  15.707  1.00 0.00 ? 105 ASP A C    3  
ATOM 6471  O O    . ASP A 1 105 ? -0.088  -7.606  15.996  1.00 0.00 ? 105 ASP A O    3  
ATOM 6472  C CB   . ASP A 1 105 ? -0.068  -4.444  14.076  1.00 0.00 ? 105 ASP A CB   3  
ATOM 6473  C CG   . ASP A 1 105 ? -1.459  -4.067  14.595  1.00 0.00 ? 105 ASP A CG   3  
ATOM 6474  O OD1  . ASP A 1 105 ? -2.461  -4.371  13.912  1.00 0.00 ? 105 ASP A OD1  3  
ATOM 6475  O OD2  . ASP A 1 105 ? -1.550  -3.455  15.677  1.00 0.00 ? 105 ASP A OD2  3  
ATOM 6476  H H    . ASP A 1 105 ? -1.459  -6.780  13.431  1.00 0.00 ? 105 ASP A H    3  
ATOM 6477  H HA   . ASP A 1 105 ? 1.466   -5.973  13.948  1.00 0.00 ? 105 ASP A HA   3  
ATOM 6478  H HB2  . ASP A 1 105 ? 0.662   -3.779  14.572  1.00 0.00 ? 105 ASP A HB2  3  
ATOM 6479  H HB3  . ASP A 1 105 ? -0.012  -4.144  13.015  1.00 0.00 ? 105 ASP A HB3  3  
ATOM 6480  N N    . SER A 1 106 ? 0.987   -5.746  16.626  1.00 0.00 ? 106 SER A N    3  
ATOM 6481  C CA   . SER A 1 106 ? 1.045   -6.075  18.085  1.00 0.00 ? 106 SER A CA   3  
ATOM 6482  C C    . SER A 1 106 ? 1.444   -4.819  18.931  1.00 0.00 ? 106 SER A C    3  
ATOM 6483  O O    . SER A 1 106 ? 0.819   -4.558  19.962  1.00 0.00 ? 106 SER A O    3  
ATOM 6484  C CB   . SER A 1 106 ? 2.021   -7.256  18.338  1.00 0.00 ? 106 SER A CB   3  
ATOM 6485  O OG   . SER A 1 106 ? 1.484   -8.466  17.803  1.00 0.00 ? 106 SER A OG   3  
ATOM 6486  H H    . SER A 1 106 ? 1.272   -4.833  16.257  1.00 0.00 ? 106 SER A H    3  
ATOM 6487  H HA   . SER A 1 106 ? 0.035   -6.371  18.433  1.00 0.00 ? 106 SER A HA   3  
ATOM 6488  H HB2  . SER A 1 106 ? 3.016   -7.058  17.895  1.00 0.00 ? 106 SER A HB2  3  
ATOM 6489  H HB3  . SER A 1 106 ? 2.193   -7.398  19.422  1.00 0.00 ? 106 SER A HB3  3  
ATOM 6490  H HG   . SER A 1 106 ? 0.888   -8.203  17.069  1.00 0.00 ? 106 SER A HG   3  
ATOM 6491  N N    . GLY A 1 107 ? 2.490   -4.068  18.532  1.00 0.00 ? 107 GLY A N    3  
ATOM 6492  C CA   . GLY A 1 107 ? 2.929   -2.847  19.250  1.00 0.00 ? 107 GLY A CA   3  
ATOM 6493  C C    . GLY A 1 107 ? 3.982   -2.045  18.445  1.00 0.00 ? 107 GLY A C    3  
ATOM 6494  O O    . GLY A 1 107 ? 3.590   -1.040  17.847  1.00 0.00 ? 107 GLY A O    3  
ATOM 6495  H H    . GLY A 1 107 ? 2.921   -4.387  17.658  1.00 0.00 ? 107 GLY A H    3  
ATOM 6496  H HA2  . GLY A 1 107 ? 2.060   -2.186  19.439  1.00 0.00 ? 107 GLY A HA2  3  
ATOM 6497  H HA3  . GLY A 1 107 ? 3.322   -3.102  20.251  1.00 0.00 ? 107 GLY A HA3  3  
ATOM 6498  N N    . PRO A 1 108 ? 5.289   -2.435  18.360  1.00 0.00 ? 108 PRO A N    3  
ATOM 6499  C CA   . PRO A 1 108 ? 6.308   -1.650  17.608  1.00 0.00 ? 108 PRO A CA   3  
ATOM 6500  C C    . PRO A 1 108 ? 6.271   -1.723  16.041  1.00 0.00 ? 108 PRO A C    3  
ATOM 6501  O O    . PRO A 1 108 ? 6.485   -0.689  15.405  1.00 0.00 ? 108 PRO A O    3  
ATOM 6502  C CB   . PRO A 1 108 ? 7.614   -2.206  18.216  1.00 0.00 ? 108 PRO A CB   3  
ATOM 6503  C CG   . PRO A 1 108 ? 7.303   -3.649  18.626  1.00 0.00 ? 108 PRO A CG   3  
ATOM 6504  C CD   . PRO A 1 108 ? 5.842   -3.607  19.074  1.00 0.00 ? 108 PRO A CD   3  
ATOM 6505  H HA   . PRO A 1 108 ? 6.221   -0.574  17.859  1.00 0.00 ? 108 PRO A HA   3  
ATOM 6506  H HB2  . PRO A 1 108 ? 8.485   -2.134  17.536  1.00 0.00 ? 108 PRO A HB2  3  
ATOM 6507  H HB3  . PRO A 1 108 ? 7.883   -1.615  19.114  1.00 0.00 ? 108 PRO A HB3  3  
ATOM 6508  H HG2  . PRO A 1 108 ? 7.421   -4.331  17.763  1.00 0.00 ? 108 PRO A HG2  3  
ATOM 6509  H HG3  . PRO A 1 108 ? 7.979   -4.020  19.420  1.00 0.00 ? 108 PRO A HG3  3  
ATOM 6510  H HD2  . PRO A 1 108 ? 5.314   -4.548  18.826  1.00 0.00 ? 108 PRO A HD2  3  
ATOM 6511  H HD3  . PRO A 1 108 ? 5.773   -3.462  20.170  1.00 0.00 ? 108 PRO A HD3  3  
ATOM 6512  N N    . THR A 1 109 ? 6.079   -2.906  15.416  1.00 0.00 ? 109 THR A N    3  
ATOM 6513  C CA   . THR A 1 109 ? 6.089   -3.052  13.922  1.00 0.00 ? 109 THR A CA   3  
ATOM 6514  C C    . THR A 1 109 ? 5.077   -4.143  13.413  1.00 0.00 ? 109 THR A C    3  
ATOM 6515  O O    . THR A 1 109 ? 4.693   -5.070  14.135  1.00 0.00 ? 109 THR A O    3  
ATOM 6516  C CB   . THR A 1 109 ? 7.533   -3.401  13.403  1.00 0.00 ? 109 THR A CB   3  
ATOM 6517  O OG1  . THR A 1 109 ? 8.105   -4.474  14.140  1.00 0.00 ? 109 THR A OG1  3  
ATOM 6518  C CG2  . THR A 1 109 ? 8.531   -2.234  13.479  1.00 0.00 ? 109 THR A CG2  3  
ATOM 6519  H H    . THR A 1 109 ? 5.883   -3.687  16.050  1.00 0.00 ? 109 THR A H    3  
ATOM 6520  H HA   . THR A 1 109 ? 5.770   -2.093  13.468  1.00 0.00 ? 109 THR A HA   3  
ATOM 6521  H HB   . THR A 1 109 ? 7.452   -3.700  12.344  1.00 0.00 ? 109 THR A HB   3  
ATOM 6522  H HG1  . THR A 1 109 ? 8.089   -4.181  15.054  1.00 0.00 ? 109 THR A HG1  3  
ATOM 6523  H HG21 . THR A 1 109 ? 8.150   -1.340  12.950  1.00 0.00 ? 109 THR A HG21 3  
ATOM 6524  H HG22 . THR A 1 109 ? 8.747   -1.927  14.519  1.00 0.00 ? 109 THR A HG22 3  
ATOM 6525  H HG23 . THR A 1 109 ? 9.495   -2.499  13.010  1.00 0.00 ? 109 THR A HG23 3  
ATOM 6526  N N    . THR A 1 110 ? 4.669   -4.022  12.131  1.00 0.00 ? 110 THR A N    3  
ATOM 6527  C CA   . THR A 1 110 ? 3.725   -4.970  11.452  1.00 0.00 ? 110 THR A CA   3  
ATOM 6528  C C    . THR A 1 110 ? 4.407   -5.728  10.241  1.00 0.00 ? 110 THR A C    3  
ATOM 6529  O O    . THR A 1 110 ? 5.628   -5.882  10.183  1.00 0.00 ? 110 THR A O    3  
ATOM 6530  C CB   . THR A 1 110 ? 2.442   -4.133  11.087  1.00 0.00 ? 110 THR A CB   3  
ATOM 6531  O OG1  . THR A 1 110 ? 1.381   -5.011  10.716  1.00 0.00 ? 110 THR A OG1  3  
ATOM 6532  C CG2  . THR A 1 110 ? 2.596   -3.161  9.899   1.00 0.00 ? 110 THR A CG2  3  
ATOM 6533  H H    . THR A 1 110 ? 5.057   -3.198  11.642  1.00 0.00 ? 110 THR A H    3  
ATOM 6534  H HA   . THR A 1 110 ? 3.421   -5.774  12.151  1.00 0.00 ? 110 THR A HA   3  
ATOM 6535  H HB   . THR A 1 110 ? 2.125   -3.568  11.987  1.00 0.00 ? 110 THR A HB   3  
ATOM 6536  H HG1  . THR A 1 110 ? 1.358   -5.757  11.345  1.00 0.00 ? 110 THR A HG1  3  
ATOM 6537  H HG21 . THR A 1 110 ? 3.434   -2.460  10.045  1.00 0.00 ? 110 THR A HG21 3  
ATOM 6538  H HG22 . THR A 1 110 ? 2.780   -3.698  8.948   1.00 0.00 ? 110 THR A HG22 3  
ATOM 6539  H HG23 . THR A 1 110 ? 1.679   -2.567  9.750   1.00 0.00 ? 110 THR A HG23 3  
ATOM 6540  N N    . SER A 1 111 ? 3.580   -6.288  9.340   1.00 0.00 ? 111 SER A N    3  
ATOM 6541  C CA   . SER A 1 111 ? 3.988   -7.039  8.107   1.00 0.00 ? 111 SER A CA   3  
ATOM 6542  C C    . SER A 1 111 ? 2.935   -6.790  6.960   1.00 0.00 ? 111 SER A C    3  
ATOM 6543  O O    . SER A 1 111 ? 1.878   -6.194  7.214   1.00 0.00 ? 111 SER A O    3  
ATOM 6544  C CB   . SER A 1 111 ? 4.133   -8.536  8.481   1.00 0.00 ? 111 SER A CB   3  
ATOM 6545  O OG   . SER A 1 111 ? 4.688   -9.292  7.403   1.00 0.00 ? 111 SER A OG   3  
ATOM 6546  H H    . SER A 1 111 ? 2.605   -5.994  9.507   1.00 0.00 ? 111 SER A H    3  
ATOM 6547  H HA   . SER A 1 111 ? 4.964   -6.667  7.745   1.00 0.00 ? 111 SER A HA   3  
ATOM 6548  H HB2  . SER A 1 111 ? 4.807   -8.638  9.354   1.00 0.00 ? 111 SER A HB2  3  
ATOM 6549  H HB3  . SER A 1 111 ? 3.164   -8.968  8.799   1.00 0.00 ? 111 SER A HB3  3  
ATOM 6550  H HG   . SER A 1 111 ? 3.970   -9.519  6.801   1.00 0.00 ? 111 SER A HG   3  
ATOM 6551  N N    . PHE A 1 112 ? 3.178   -7.210  5.689   1.00 0.00 ? 112 PHE A N    3  
ATOM 6552  C CA   . PHE A 1 112 ? 2.219   -6.898  4.582   1.00 0.00 ? 112 PHE A CA   3  
ATOM 6553  C C    . PHE A 1 112 ? 1.519   -8.158  3.984   1.00 0.00 ? 112 PHE A C    3  
ATOM 6554  O O    . PHE A 1 112 ? 2.066   -8.866  3.130   1.00 0.00 ? 112 PHE A O    3  
ATOM 6555  C CB   . PHE A 1 112 ? 2.977   -6.128  3.457   1.00 0.00 ? 112 PHE A CB   3  
ATOM 6556  C CG   . PHE A 1 112 ? 3.539   -4.706  3.682   1.00 0.00 ? 112 PHE A CG   3  
ATOM 6557  C CD1  . PHE A 1 112 ? 3.147   -3.873  4.739   1.00 0.00 ? 112 PHE A CD1  3  
ATOM 6558  C CD2  . PHE A 1 112 ? 4.450   -4.219  2.736   1.00 0.00 ? 112 PHE A CD2  3  
ATOM 6559  C CE1  . PHE A 1 112 ? 3.687   -2.596  4.869   1.00 0.00 ? 112 PHE A CE1  3  
ATOM 6560  C CE2  . PHE A 1 112 ? 4.977   -2.937  2.860   1.00 0.00 ? 112 PHE A CE2  3  
ATOM 6561  C CZ   . PHE A 1 112 ? 4.611   -2.135  3.934   1.00 0.00 ? 112 PHE A CZ   3  
ATOM 6562  H H    . PHE A 1 112 ? 4.053   -7.728  5.489   1.00 0.00 ? 112 PHE A H    3  
ATOM 6563  H HA   . PHE A 1 112 ? 1.403   -6.211  4.904   1.00 0.00 ? 112 PHE A HA   3  
ATOM 6564  H HB2  . PHE A 1 112 ? 3.785   -6.784  3.082   1.00 0.00 ? 112 PHE A HB2  3  
ATOM 6565  H HB3  . PHE A 1 112 ? 2.287   -6.034  2.596   1.00 0.00 ? 112 PHE A HB3  3  
ATOM 6566  H HD1  . PHE A 1 112 ? 2.435   -4.210  5.477   1.00 0.00 ? 112 PHE A HD1  3  
ATOM 6567  H HD2  . PHE A 1 112 ? 4.758   -4.831  1.899   1.00 0.00 ? 112 PHE A HD2  3  
ATOM 6568  H HE1  . PHE A 1 112 ? 3.399   -1.970  5.702   1.00 0.00 ? 112 PHE A HE1  3  
ATOM 6569  H HE2  . PHE A 1 112 ? 5.676   -2.567  2.127   1.00 0.00 ? 112 PHE A HE2  3  
ATOM 6570  H HZ   . PHE A 1 112 ? 5.045   -1.151  4.040   1.00 0.00 ? 112 PHE A HZ   3  
ATOM 6571  N N    . GLU A 1 113 ? 0.271   -8.413  4.408   1.00 0.00 ? 113 GLU A N    3  
ATOM 6572  C CA   . GLU A 1 113 ? -0.606  -9.426  3.746   1.00 0.00 ? 113 GLU A CA   3  
ATOM 6573  C C    . GLU A 1 113 ? -1.394  -8.664  2.600   1.00 0.00 ? 113 GLU A C    3  
ATOM 6574  O O    . GLU A 1 113 ? -1.502  -7.430  2.614   1.00 0.00 ? 113 GLU A O    3  
ATOM 6575  C CB   . GLU A 1 113 ? -1.457  -10.109 4.844   1.00 0.00 ? 113 GLU A CB   3  
ATOM 6576  C CG   . GLU A 1 113 ? -0.684  -11.089 5.771   1.00 0.00 ? 113 GLU A CG   3  
ATOM 6577  C CD   . GLU A 1 113 ? -1.406  -11.476 7.050   1.00 0.00 ? 113 GLU A CD   3  
ATOM 6578  O OE1  . GLU A 1 113 ? -2.311  -12.333 7.002   1.00 0.00 ? 113 GLU A OE1  3  
ATOM 6579  O OE2  . GLU A 1 113 ? -1.057  -10.929 8.120   1.00 0.00 ? 113 GLU A OE2  3  
ATOM 6580  H H    . GLU A 1 113 ? -0.119  -7.785  5.130   1.00 0.00 ? 113 GLU A H    3  
ATOM 6581  H HA   . GLU A 1 113 ? -0.006  -10.214 3.264   1.00 0.00 ? 113 GLU A HA   3  
ATOM 6582  H HB2  . GLU A 1 113 ? -1.938  -9.335  5.461   1.00 0.00 ? 113 GLU A HB2  3  
ATOM 6583  H HB3  . GLU A 1 113 ? -2.289  -10.666 4.379   1.00 0.00 ? 113 GLU A HB3  3  
ATOM 6584  H HG2  . GLU A 1 113 ? -0.458  -12.026 5.243   1.00 0.00 ? 113 GLU A HG2  3  
ATOM 6585  H HG3  . GLU A 1 113 ? 0.289   -10.660 6.069   1.00 0.00 ? 113 GLU A HG3  3  
ATOM 6586  N N    . SER A 1 114 ? -1.862  -9.320  1.520   1.00 0.00 ? 114 SER A N    3  
ATOM 6587  C CA   . SER A 1 114 ? -2.464  -8.632  0.333   1.00 0.00 ? 114 SER A CA   3  
ATOM 6588  C C    . SER A 1 114 ? -3.383  -9.635  -0.427  1.00 0.00 ? 114 SER A C    3  
ATOM 6589  O O    . SER A 1 114 ? -3.128  -10.842 -0.487  1.00 0.00 ? 114 SER A O    3  
ATOM 6590  C CB   . SER A 1 114 ? -1.355  -8.020  -0.560  1.00 0.00 ? 114 SER A CB   3  
ATOM 6591  O OG   . SER A 1 114 ? -0.705  -6.955  0.135   1.00 0.00 ? 114 SER A OG   3  
ATOM 6592  H H    . SER A 1 114 ? -1.828  -10.349 1.496   1.00 0.00 ? 114 SER A H    3  
ATOM 6593  H HA   . SER A 1 114 ? -3.099  -7.806  0.687   1.00 0.00 ? 114 SER A HA   3  
ATOM 6594  H HB2  . SER A 1 114 ? -0.614  -8.777  -0.873  1.00 0.00 ? 114 SER A HB2  3  
ATOM 6595  H HB3  . SER A 1 114 ? -1.781  -7.618  -1.496  1.00 0.00 ? 114 SER A HB3  3  
ATOM 6596  H HG   . SER A 1 114 ? -0.892  -7.093  1.083   1.00 0.00 ? 114 SER A HG   3  
ATOM 6597  N N    . ALA A 1 115 ? -4.458  -9.095  -1.050  1.00 0.00 ? 115 ALA A N    3  
ATOM 6598  C CA   . ALA A 1 115 ? -5.661  -9.872  -1.519  1.00 0.00 ? 115 ALA A CA   3  
ATOM 6599  C C    . ALA A 1 115 ? -6.450  -9.913  -0.194  1.00 0.00 ? 115 ALA A C    3  
ATOM 6600  O O    . ALA A 1 115 ? -7.204  -8.967  0.084   1.00 0.00 ? 115 ALA A O    3  
ATOM 6601  C CB   . ALA A 1 115 ? -5.383  -11.151 -2.331  1.00 0.00 ? 115 ALA A CB   3  
ATOM 6602  H H    . ALA A 1 115 ? -4.545  -8.086  -0.857  1.00 0.00 ? 115 ALA A H    3  
ATOM 6603  H HA   . ALA A 1 115 ? -6.286  -9.263  -2.135  1.00 0.00 ? 115 ALA A HA   3  
ATOM 6604  H HB1  . ALA A 1 115 ? -4.651  -11.802 -1.848  1.00 0.00 ? 115 ALA A HB1  3  
ATOM 6605  H HB2  . ALA A 1 115 ? -6.293  -11.760 -2.449  1.00 0.00 ? 115 ALA A HB2  3  
ATOM 6606  H HB3  . ALA A 1 115 ? -4.995  -10.915 -3.338  1.00 0.00 ? 115 ALA A HB3  3  
ATOM 6607  N N    . ALA A 1 116 ? -6.150  -10.931 0.619   1.00 0.00 ? 116 ALA A N    3  
ATOM 6608  C CA   . ALA A 1 116 ? -6.365  -10.803 2.083   1.00 0.00 ? 116 ALA A CA   3  
ATOM 6609  C C    . ALA A 1 116 ? -5.389  -11.767 2.811   1.00 0.00 ? 116 ALA A C    3  
ATOM 6610  O O    . ALA A 1 116 ? -4.289  -11.362 3.191   1.00 0.00 ? 116 ALA A O    3  
ATOM 6611  C CB   . ALA A 1 116 ? -7.881  -10.933 2.408   1.00 0.00 ? 116 ALA A CB   3  
ATOM 6612  H H    . ALA A 1 116 ? -5.561  -11.617 0.121   1.00 0.00 ? 116 ALA A H    3  
ATOM 6613  H HA   . ALA A 1 116 ? -5.930  -9.815  2.369   1.00 0.00 ? 116 ALA A HA   3  
ATOM 6614  H HB1  . ALA A 1 116 ? -8.316  -11.877 2.033   1.00 0.00 ? 116 ALA A HB1  3  
ATOM 6615  H HB2  . ALA A 1 116 ? -8.073  -10.887 3.493   1.00 0.00 ? 116 ALA A HB2  3  
ATOM 6616  H HB3  . ALA A 1 116 ? -8.463  -10.113 1.948   1.00 0.00 ? 116 ALA A HB3  3  
ATOM 6617  N N    . CYS A 1 117 ? -5.835  -12.986 3.093   1.00 0.00 ? 117 CYS A N    3  
ATOM 6618  C CA   . CYS A 1 117 ? -4.980  -14.075 3.640   1.00 0.00 ? 117 CYS A CA   3  
ATOM 6619  C C    . CYS A 1 117 ? -4.591  -14.883 2.360   1.00 0.00 ? 117 CYS A C    3  
ATOM 6620  O O    . CYS A 1 117 ? -3.408  -14.804 2.016   1.00 0.00 ? 117 CYS A O    3  
ATOM 6621  C CB   . CYS A 1 117 ? -5.684  -14.831 4.786   1.00 0.00 ? 117 CYS A CB   3  
ATOM 6622  S SG   . CYS A 1 117 ? -5.792  -13.761 6.264   1.00 0.00 ? 117 CYS A SG   3  
ATOM 6623  H H    . CYS A 1 117 ? -6.726  -13.124 2.612   1.00 0.00 ? 117 CYS A H    3  
ATOM 6624  H HA   . CYS A 1 117 ? -4.042  -13.672 4.075   1.00 0.00 ? 117 CYS A HA   3  
ATOM 6625  H HB2  . CYS A 1 117 ? -6.703  -15.161 4.522   1.00 0.00 ? 117 CYS A HB2  3  
ATOM 6626  H HB3  . CYS A 1 117 ? -5.115  -15.740 5.055   1.00 0.00 ? 117 CYS A HB3  3  
ATOM 6627  H HG   . CYS A 1 117 ? -4.486  -13.557 6.435   1.00 0.00 ? 117 CYS A HG   3  
ATOM 6628  N N    . PRO A 1 118 ? -5.478  -15.571 1.564   1.00 0.00 ? 118 PRO A N    3  
ATOM 6629  C CA   . PRO A 1 118 ? -5.085  -16.082 0.234   1.00 0.00 ? 118 PRO A CA   3  
ATOM 6630  C C    . PRO A 1 118 ? -4.794  -14.906 -0.783  1.00 0.00 ? 118 PRO A C    3  
ATOM 6631  O O    . PRO A 1 118 ? -5.224  -13.741 -0.629  1.00 0.00 ? 118 PRO A O    3  
ATOM 6632  C CB   . PRO A 1 118 ? -6.291  -16.967 -0.142  1.00 0.00 ? 118 PRO A CB   3  
ATOM 6633  C CG   . PRO A 1 118 ? -7.488  -16.322 0.561   1.00 0.00 ? 118 PRO A CG   3  
ATOM 6634  C CD   . PRO A 1 118 ? -6.906  -15.801 1.875   1.00 0.00 ? 118 PRO A CD   3  
ATOM 6635  H HA   . PRO A 1 118 ? -4.173  -16.706 0.332   1.00 0.00 ? 118 PRO A HA   3  
ATOM 6636  H HB2  . PRO A 1 118 ? -6.441  -17.071 -1.232  1.00 0.00 ? 118 PRO A HB2  3  
ATOM 6637  H HB3  . PRO A 1 118 ? -6.136  -17.992 0.250   1.00 0.00 ? 118 PRO A HB3  3  
ATOM 6638  H HG2  . PRO A 1 118 ? -7.879  -15.478 -0.040  1.00 0.00 ? 118 PRO A HG2  3  
ATOM 6639  H HG3  . PRO A 1 118 ? -8.326  -17.027 0.718   1.00 0.00 ? 118 PRO A HG3  3  
ATOM 6640  H HD2  . PRO A 1 118 ? -7.448  -14.898 2.209   1.00 0.00 ? 118 PRO A HD2  3  
ATOM 6641  H HD3  . PRO A 1 118 ? -7.001  -16.565 2.671   1.00 0.00 ? 118 PRO A HD3  3  
ATOM 6642  N N    . GLY A 1 119 ? -4.034  -15.300 -1.818  1.00 0.00 ? 119 GLY A N    3  
ATOM 6643  C CA   . GLY A 1 119 ? -3.583  -14.400 -2.902  1.00 0.00 ? 119 GLY A CA   3  
ATOM 6644  C C    . GLY A 1 119 ? -2.081  -14.082 -2.840  1.00 0.00 ? 119 GLY A C    3  
ATOM 6645  O O    . GLY A 1 119 ? -1.308  -14.780 -3.500  1.00 0.00 ? 119 GLY A O    3  
ATOM 6646  H H    . GLY A 1 119 ? -3.757  -16.287 -1.775  1.00 0.00 ? 119 GLY A H    3  
ATOM 6647  H HA2  . GLY A 1 119 ? -3.771  -14.906 -3.866  1.00 0.00 ? 119 GLY A HA2  3  
ATOM 6648  H HA3  . GLY A 1 119 ? -4.181  -13.482 -2.980  1.00 0.00 ? 119 GLY A HA3  3  
ATOM 6649  N N    . TRP A 1 120 ? -1.663  -13.050 -2.084  1.00 0.00 ? 120 TRP A N    3  
ATOM 6650  C CA   . TRP A 1 120 ? -0.224  -12.658 -2.004  1.00 0.00 ? 120 TRP A CA   3  
ATOM 6651  C C    . TRP A 1 120 ? 0.084   -12.092 -0.573  1.00 0.00 ? 120 TRP A C    3  
ATOM 6652  O O    . TRP A 1 120 ? -0.485  -11.089 -0.149  1.00 0.00 ? 120 TRP A O    3  
ATOM 6653  C CB   . TRP A 1 120 ? 0.063   -11.645 -3.175  1.00 0.00 ? 120 TRP A CB   3  
ATOM 6654  C CG   . TRP A 1 120 ? 1.195   -12.011 -4.160  1.00 0.00 ? 120 TRP A CG   3  
ATOM 6655  C CD1  . TRP A 1 120 ? 1.475   -13.296 -4.684  1.00 0.00 ? 120 TRP A CD1  3  
ATOM 6656  C CD2  . TRP A 1 120 ? 2.089   -11.163 -4.804  1.00 0.00 ? 120 TRP A CD2  3  
ATOM 6657  N NE1  . TRP A 1 120 ? 2.545   -13.278 -5.597  1.00 0.00 ? 120 TRP A NE1  3  
ATOM 6658  C CE2  . TRP A 1 120 ? 2.906   -11.945 -5.658  1.00 0.00 ? 120 TRP A CE2  3  
ATOM 6659  C CE3  . TRP A 1 120 ? 2.278   -9.759  -4.732  1.00 0.00 ? 120 TRP A CE3  3  
ATOM 6660  C CZ2  . TRP A 1 120 ? 3.934   -11.336 -6.415  1.00 0.00 ? 120 TRP A CZ2  3  
ATOM 6661  C CZ3  . TRP A 1 120 ? 3.312   -9.180  -5.470  1.00 0.00 ? 120 TRP A CZ3  3  
ATOM 6662  C CH2  . TRP A 1 120 ? 4.127   -9.958  -6.300  1.00 0.00 ? 120 TRP A CH2  3  
ATOM 6663  H H    . TRP A 1 120 ? -2.386  -12.529 -1.562  1.00 0.00 ? 120 TRP A H    3  
ATOM 6664  H HA   . TRP A 1 120 ? 0.406   -13.562 -2.131  1.00 0.00 ? 120 TRP A HA   3  
ATOM 6665  H HB2  . TRP A 1 120 ? -0.831  -11.495 -3.811  1.00 0.00 ? 120 TRP A HB2  3  
ATOM 6666  H HB3  . TRP A 1 120 ? 0.230   -10.631 -2.767  1.00 0.00 ? 120 TRP A HB3  3  
ATOM 6667  H HD1  . TRP A 1 120 ? 0.926   -14.189 -4.430  1.00 0.00 ? 120 TRP A HD1  3  
ATOM 6668  H HE1  . TRP A 1 120 ? 2.907   -14.043 -6.176  1.00 0.00 ? 120 TRP A HE1  3  
ATOM 6669  H HE3  . TRP A 1 120 ? 1.626   -9.150  -4.130  1.00 0.00 ? 120 TRP A HE3  3  
ATOM 6670  H HZ2  . TRP A 1 120 ? 4.565   -11.929 -7.061  1.00 0.00 ? 120 TRP A HZ2  3  
ATOM 6671  H HZ3  . TRP A 1 120 ? 3.482   -8.115  -5.407  1.00 0.00 ? 120 TRP A HZ3  3  
ATOM 6672  H HH2  . TRP A 1 120 ? 4.918   -9.485  -6.865  1.00 0.00 ? 120 TRP A HH2  3  
ATOM 6673  N N    . PHE A 1 121 ? 1.015   -12.691 0.185   1.00 0.00 ? 121 PHE A N    3  
ATOM 6674  C CA   . PHE A 1 121 ? 1.355   -12.249 1.573   1.00 0.00 ? 121 PHE A CA   3  
ATOM 6675  C C    . PHE A 1 121 ? 2.887   -12.341 1.885   1.00 0.00 ? 121 PHE A C    3  
ATOM 6676  O O    . PHE A 1 121 ? 3.462   -13.421 1.767   1.00 0.00 ? 121 PHE A O    3  
ATOM 6677  C CB   . PHE A 1 121 ? 0.518   -13.099 2.586   1.00 0.00 ? 121 PHE A CB   3  
ATOM 6678  C CG   . PHE A 1 121 ? 0.581   -14.645 2.515   1.00 0.00 ? 121 PHE A CG   3  
ATOM 6679  C CD1  . PHE A 1 121 ? -0.295  -15.339 1.673   1.00 0.00 ? 121 PHE A CD1  3  
ATOM 6680  C CD2  . PHE A 1 121 ? 1.521   -15.364 3.262   1.00 0.00 ? 121 PHE A CD2  3  
ATOM 6681  C CE1  . PHE A 1 121 ? -0.228  -16.725 1.573   1.00 0.00 ? 121 PHE A CE1  3  
ATOM 6682  C CE2  . PHE A 1 121 ? 1.594   -16.752 3.154   1.00 0.00 ? 121 PHE A CE2  3  
ATOM 6683  C CZ   . PHE A 1 121 ? 0.717   -17.431 2.312   1.00 0.00 ? 121 PHE A CZ   3  
ATOM 6684  H H    . PHE A 1 121 ? 1.434   -13.539 -0.216  1.00 0.00 ? 121 PHE A H    3  
ATOM 6685  H HA   . PHE A 1 121 ? 1.075   -11.186 1.702   1.00 0.00 ? 121 PHE A HA   3  
ATOM 6686  H HB2  . PHE A 1 121 ? 0.794   -12.783 3.608   1.00 0.00 ? 121 PHE A HB2  3  
ATOM 6687  H HB3  . PHE A 1 121 ? -0.542  -12.787 2.504   1.00 0.00 ? 121 PHE A HB3  3  
ATOM 6688  H HD1  . PHE A 1 121 ? -1.019  -14.800 1.078   1.00 0.00 ? 121 PHE A HD1  3  
ATOM 6689  H HD2  . PHE A 1 121 ? 2.217   -14.845 3.907   1.00 0.00 ? 121 PHE A HD2  3  
ATOM 6690  H HE1  . PHE A 1 121 ? -0.902  -17.250 0.912   1.00 0.00 ? 121 PHE A HE1  3  
ATOM 6691  H HE2  . PHE A 1 121 ? 2.335   -17.300 3.719   1.00 0.00 ? 121 PHE A HE2  3  
ATOM 6692  H HZ   . PHE A 1 121 ? 0.771   -18.506 2.226   1.00 0.00 ? 121 PHE A HZ   3  
ATOM 6693  N N    . LEU A 1 122 ? 3.572   -11.213 2.191   1.00 0.00 ? 122 LEU A N    3  
ATOM 6694  C CA   . LEU A 1 122 ? 4.999   -11.204 2.660   1.00 0.00 ? 122 LEU A CA   3  
ATOM 6695  C C    . LEU A 1 122 ? 5.386   -9.727  3.076   1.00 0.00 ? 122 LEU A C    3  
ATOM 6696  O O    . LEU A 1 122 ? 4.930   -9.260  4.136   1.00 0.00 ? 122 LEU A O    3  
ATOM 6697  C CB   . LEU A 1 122 ? 6.036   -11.889 1.681   1.00 0.00 ? 122 LEU A CB   3  
ATOM 6698  C CG   . LEU A 1 122 ? 7.100   -12.810 2.334   1.00 0.00 ? 122 LEU A CG   3  
ATOM 6699  C CD1  . LEU A 1 122 ? 8.034   -13.380 1.252   1.00 0.00 ? 122 LEU A CD1  3  
ATOM 6700  C CD2  . LEU A 1 122 ? 7.973   -12.134 3.401   1.00 0.00 ? 122 LEU A CD2  3  
ATOM 6701  H H    . LEU A 1 122 ? 2.983   -10.370 2.289   1.00 0.00 ? 122 LEU A H    3  
ATOM 6702  H HA   . LEU A 1 122 ? 5.012   -11.773 3.601   1.00 0.00 ? 122 LEU A HA   3  
ATOM 6703  H HB2  . LEU A 1 122 ? 5.505   -12.520 0.957   1.00 0.00 ? 122 LEU A HB2  3  
ATOM 6704  H HB3  . LEU A 1 122 ? 6.545   -11.161 1.027   1.00 0.00 ? 122 LEU A HB3  3  
ATOM 6705  H HG   . LEU A 1 122 ? 6.575   -13.660 2.818   1.00 0.00 ? 122 LEU A HG   3  
ATOM 6706  H HD11 . LEU A 1 122 ? 7.479   -13.907 0.462   1.00 0.00 ? 122 LEU A HD11 3  
ATOM 6707  H HD12 . LEU A 1 122 ? 8.641   -12.596 0.760   1.00 0.00 ? 122 LEU A HD12 3  
ATOM 6708  H HD13 . LEU A 1 122 ? 8.733   -14.121 1.676   1.00 0.00 ? 122 LEU A HD13 3  
ATOM 6709  H HD21 . LEU A 1 122 ? 7.369   -11.692 4.212   1.00 0.00 ? 122 LEU A HD21 3  
ATOM 6710  H HD22 . LEU A 1 122 ? 8.657   -12.860 3.881   1.00 0.00 ? 122 LEU A HD22 3  
ATOM 6711  H HD23 . LEU A 1 122 ? 8.598   -11.336 2.970   1.00 0.00 ? 122 LEU A HD23 3  
ATOM 6712  N N    . CYS A 1 123 ? 6.247   -8.989  2.313   1.00 0.00 ? 123 CYS A N    3  
ATOM 6713  C CA   . CYS A 1 123 ? 6.785   -7.671  2.747   1.00 0.00 ? 123 CYS A CA   3  
ATOM 6714  C C    . CYS A 1 123 ? 7.362   -6.797  1.559   1.00 0.00 ? 123 CYS A C    3  
ATOM 6715  O O    . CYS A 1 123 ? 6.696   -6.551  0.549   1.00 0.00 ? 123 CYS A O    3  
ATOM 6716  C CB   . CYS A 1 123 ? 7.809   -8.048  3.853   1.00 0.00 ? 123 CYS A CB   3  
ATOM 6717  S SG   . CYS A 1 123 ? 9.231   -8.953  3.178   1.00 0.00 ? 123 CYS A SG   3  
ATOM 6718  H H    . CYS A 1 123 ? 6.559   -9.414  1.426   1.00 0.00 ? 123 CYS A H    3  
ATOM 6719  H HA   . CYS A 1 123 ? 5.994   -7.071  3.231   1.00 0.00 ? 123 CYS A HA   3  
ATOM 6720  H HB2  . CYS A 1 123 ? 8.180   -7.142  4.344   1.00 0.00 ? 123 CYS A HB2  3  
ATOM 6721  H HB3  . CYS A 1 123 ? 7.342   -8.648  4.655   1.00 0.00 ? 123 CYS A HB3  3  
ATOM 6722  H HG   . CYS A 1 123 ? 9.668   -9.438  4.336   1.00 0.00 ? 123 CYS A HG   3  
ATOM 6723  N N    . THR A 1 124 ? 8.596   -6.282  1.708   1.00 0.00 ? 124 THR A N    3  
ATOM 6724  C CA   . THR A 1 124 ? 9.293   -5.393  0.738   1.00 0.00 ? 124 THR A CA   3  
ATOM 6725  C C    . THR A 1 124 ? 10.748  -5.921  0.534   1.00 0.00 ? 124 THR A C    3  
ATOM 6726  O O    . THR A 1 124 ? 11.370  -6.438  1.474   1.00 0.00 ? 124 THR A O    3  
ATOM 6727  C CB   . THR A 1 124 ? 9.284   -3.932  1.295   1.00 0.00 ? 124 THR A CB   3  
ATOM 6728  O OG1  . THR A 1 124 ? 7.957   -3.486  1.540   1.00 0.00 ? 124 THR A OG1  3  
ATOM 6729  C CG2  . THR A 1 124 ? 9.870   -2.874  0.360   1.00 0.00 ? 124 THR A CG2  3  
ATOM 6730  H H    . THR A 1 124 ? 9.053   -6.571  2.582   1.00 0.00 ? 124 THR A H    3  
ATOM 6731  H HA   . THR A 1 124 ? 8.769   -5.425  -0.228  1.00 0.00 ? 124 THR A HA   3  
ATOM 6732  H HB   . THR A 1 124 ? 9.864   -3.926  2.239   1.00 0.00 ? 124 THR A HB   3  
ATOM 6733  H HG1  . THR A 1 124 ? 8.038   -2.657  2.019   1.00 0.00 ? 124 THR A HG1  3  
ATOM 6734  H HG21 . THR A 1 124 ? 10.923  -3.104  0.125   1.00 0.00 ? 124 THR A HG21 3  
ATOM 6735  H HG22 . THR A 1 124 ? 9.317   -2.807  -0.595  1.00 0.00 ? 124 THR A HG22 3  
ATOM 6736  H HG23 . THR A 1 124 ? 9.857   -1.867  0.817   1.00 0.00 ? 124 THR A HG23 3  
ATOM 6737  N N    . ALA A 1 125 ? 11.332  -5.754  -0.672  1.00 0.00 ? 125 ALA A N    3  
ATOM 6738  C CA   . ALA A 1 125 ? 12.704  -6.258  -0.947  1.00 0.00 ? 125 ALA A CA   3  
ATOM 6739  C C    . ALA A 1 125 ? 13.862  -5.690  -0.047  1.00 0.00 ? 125 ALA A C    3  
ATOM 6740  O O    . ALA A 1 125 ? 13.809  -4.574  0.488   1.00 0.00 ? 125 ALA A O    3  
ATOM 6741  C CB   . ALA A 1 125 ? 12.959  -5.932  -2.419  1.00 0.00 ? 125 ALA A CB   3  
ATOM 6742  H H    . ALA A 1 125 ? 10.774  -5.311  -1.421  1.00 0.00 ? 125 ALA A H    3  
ATOM 6743  H HA   . ALA A 1 125 ? 12.692  -7.357  -0.825  1.00 0.00 ? 125 ALA A HA   3  
ATOM 6744  H HB1  . ALA A 1 125 ? 12.211  -6.394  -3.092  1.00 0.00 ? 125 ALA A HB1  3  
ATOM 6745  H HB2  . ALA A 1 125 ? 12.954  -4.841  -2.613  1.00 0.00 ? 125 ALA A HB2  3  
ATOM 6746  H HB3  . ALA A 1 125 ? 13.941  -6.321  -2.742  1.00 0.00 ? 125 ALA A HB3  3  
ATOM 6747  N N    . MET A 1 126 ? 14.921  -6.508  0.108   1.00 0.00 ? 126 MET A N    3  
ATOM 6748  C CA   . MET A 1 126 ? 16.123  -6.168  0.924   1.00 0.00 ? 126 MET A CA   3  
ATOM 6749  C C    . MET A 1 126 ? 16.945  -4.937  0.396   1.00 0.00 ? 126 MET A C    3  
ATOM 6750  O O    . MET A 1 126 ? 17.169  -4.002  1.175   1.00 0.00 ? 126 MET A O    3  
ATOM 6751  C CB   . MET A 1 126 ? 16.960  -7.479  0.996   1.00 0.00 ? 126 MET A CB   3  
ATOM 6752  C CG   . MET A 1 126 ? 18.234  -7.417  1.863   1.00 0.00 ? 126 MET A CG   3  
ATOM 6753  S SD   . MET A 1 126 ? 17.833  -6.999  3.570   1.00 0.00 ? 126 MET A SD   3  
ATOM 6754  C CE   . MET A 1 126 ? 19.499  -6.817  4.226   1.00 0.00 ? 126 MET A CE   3  
ATOM 6755  H H    . MET A 1 126 ? 14.847  -7.401  -0.388  1.00 0.00 ? 126 MET A H    3  
ATOM 6756  H HA   . MET A 1 126 ? 15.800  -5.907  1.949   1.00 0.00 ? 126 MET A HA   3  
ATOM 6757  H HB2  . MET A 1 126 ? 16.333  -8.304  1.388   1.00 0.00 ? 126 MET A HB2  3  
ATOM 6758  H HB3  . MET A 1 126 ? 17.256  -7.800  -0.023  1.00 0.00 ? 126 MET A HB3  3  
ATOM 6759  H HG2  . MET A 1 126 ? 18.760  -8.390  1.847   1.00 0.00 ? 126 MET A HG2  3  
ATOM 6760  H HG3  . MET A 1 126 ? 18.954  -6.679  1.456   1.00 0.00 ? 126 MET A HG3  3  
ATOM 6761  H HE1  . MET A 1 126 ? 20.047  -6.022  3.687   1.00 0.00 ? 126 MET A HE1  3  
ATOM 6762  H HE2  . MET A 1 126 ? 19.470  -6.551  5.297   1.00 0.00 ? 126 MET A HE2  3  
ATOM 6763  H HE3  . MET A 1 126 ? 20.067  -7.759  4.120   1.00 0.00 ? 126 MET A HE3  3  
ATOM 6764  N N    . GLU A 1 127 ? 17.335  -4.901  -0.891  1.00 0.00 ? 127 GLU A N    3  
ATOM 6765  C CA   . GLU A 1 127 ? 18.151  -3.792  -1.458  1.00 0.00 ? 127 GLU A CA   3  
ATOM 6766  C C    . GLU A 1 127 ? 17.288  -2.527  -1.788  1.00 0.00 ? 127 GLU A C    3  
ATOM 6767  O O    . GLU A 1 127 ? 16.157  -2.607  -2.286  1.00 0.00 ? 127 GLU A O    3  
ATOM 6768  C CB   . GLU A 1 127 ? 18.883  -4.317  -2.727  1.00 0.00 ? 127 GLU A CB   3  
ATOM 6769  C CG   . GLU A 1 127 ? 19.912  -5.465  -2.515  1.00 0.00 ? 127 GLU A CG   3  
ATOM 6770  C CD   . GLU A 1 127 ? 21.031  -5.170  -1.526  1.00 0.00 ? 127 GLU A CD   3  
ATOM 6771  O OE1  . GLU A 1 127 ? 22.052  -4.581  -1.936  1.00 0.00 ? 127 GLU A OE1  3  
ATOM 6772  O OE2  . GLU A 1 127 ? 20.889  -5.529  -0.339  1.00 0.00 ? 127 GLU A OE2  3  
ATOM 6773  H H    . GLU A 1 127 ? 17.101  -5.733  -1.439  1.00 0.00 ? 127 GLU A H    3  
ATOM 6774  H HA   . GLU A 1 127 ? 18.925  -3.504  -0.716  1.00 0.00 ? 127 GLU A HA   3  
ATOM 6775  H HB2  . GLU A 1 127 ? 18.140  -4.628  -3.485  1.00 0.00 ? 127 GLU A HB2  3  
ATOM 6776  H HB3  . GLU A 1 127 ? 19.425  -3.473  -3.198  1.00 0.00 ? 127 GLU A HB3  3  
ATOM 6777  H HG2  . GLU A 1 127 ? 19.409  -6.384  -2.169  1.00 0.00 ? 127 GLU A HG2  3  
ATOM 6778  H HG3  . GLU A 1 127 ? 20.391  -5.732  -3.473  1.00 0.00 ? 127 GLU A HG3  3  
ATOM 6779  N N    . ALA A 1 128 ? 17.856  -1.341  -1.513  1.00 0.00 ? 128 ALA A N    3  
ATOM 6780  C CA   . ALA A 1 128 ? 17.156  -0.042  -1.692  1.00 0.00 ? 128 ALA A CA   3  
ATOM 6781  C C    . ALA A 1 128 ? 17.150  0.557   -3.146  1.00 0.00 ? 128 ALA A C    3  
ATOM 6782  O O    . ALA A 1 128 ? 17.755  1.592   -3.418  1.00 0.00 ? 128 ALA A O    3  
ATOM 6783  C CB   . ALA A 1 128 ? 17.847  0.871   -0.655  1.00 0.00 ? 128 ALA A CB   3  
ATOM 6784  H H    . ALA A 1 128 ? 18.797  -1.399  -1.112  1.00 0.00 ? 128 ALA A H    3  
ATOM 6785  H HA   . ALA A 1 128 ? 16.089  -0.137  -1.406  1.00 0.00 ? 128 ALA A HA   3  
ATOM 6786  H HB1  . ALA A 1 128 ? 17.785  0.478   0.378   1.00 0.00 ? 128 ALA A HB1  3  
ATOM 6787  H HB2  . ALA A 1 128 ? 18.916  1.035   -0.890  1.00 0.00 ? 128 ALA A HB2  3  
ATOM 6788  H HB3  . ALA A 1 128 ? 17.388  1.874   -0.636  1.00 0.00 ? 128 ALA A HB3  3  
ATOM 6789  N N    . ASP A 1 129 ? 16.510  -0.153  -4.087  1.00 0.00 ? 129 ASP A N    3  
ATOM 6790  C CA   . ASP A 1 129 ? 16.221  0.321   -5.487  1.00 0.00 ? 129 ASP A CA   3  
ATOM 6791  C C    . ASP A 1 129 ? 15.193  -0.614  -6.221  1.00 0.00 ? 129 ASP A C    3  
ATOM 6792  O O    . ASP A 1 129 ? 14.528  -0.152  -7.150  1.00 0.00 ? 129 ASP A O    3  
ATOM 6793  C CB   . ASP A 1 129 ? 17.506  0.507   -6.353  1.00 0.00 ? 129 ASP A CB   3  
ATOM 6794  C CG   . ASP A 1 129 ? 17.258  1.386   -7.586  1.00 0.00 ? 129 ASP A CG   3  
ATOM 6795  O OD1  . ASP A 1 129 ? 17.286  2.627   -7.473  1.00 0.00 ? 129 ASP A OD1  3  
ATOM 6796  O OD2  . ASP A 1 129 ? 16.934  0.859   -8.669  1.00 0.00 ? 129 ASP A OD2  3  
ATOM 6797  H H    . ASP A 1 129 ? 16.067  -0.987  -3.681  1.00 0.00 ? 129 ASP A H    3  
ATOM 6798  H HA   . ASP A 1 129 ? 15.671  1.285   -5.397  1.00 0.00 ? 129 ASP A HA   3  
ATOM 6799  H HB2  . ASP A 1 129 ? 18.311  0.990   -5.772  1.00 0.00 ? 129 ASP A HB2  3  
ATOM 6800  H HB3  . ASP A 1 129 ? 17.921  -0.468  -6.668  1.00 0.00 ? 129 ASP A HB3  3  
ATOM 6801  N N    . GLN A 1 130 ? 15.066  -1.909  -5.874  1.00 0.00 ? 130 GLN A N    3  
ATOM 6802  C CA   . GLN A 1 130 ? 14.058  -2.817  -6.481  1.00 0.00 ? 130 GLN A CA   3  
ATOM 6803  C C    . GLN A 1 130 ? 12.624  -2.640  -5.790  1.00 0.00 ? 130 GLN A C    3  
ATOM 6804  O O    . GLN A 1 130 ? 12.441  -1.677  -5.024  1.00 0.00 ? 130 GLN A O    3  
ATOM 6805  C CB   . GLN A 1 130 ? 14.767  -4.211  -6.469  1.00 0.00 ? 130 GLN A CB   3  
ATOM 6806  C CG   . GLN A 1 130 ? 14.877  -4.947  -5.113  1.00 0.00 ? 130 GLN A CG   3  
ATOM 6807  C CD   . GLN A 1 130 ? 15.460  -6.360  -5.188  1.00 0.00 ? 130 GLN A CD   3  
ATOM 6808  O OE1  . GLN A 1 130 ? 14.744  -7.356  -5.189  1.00 0.00 ? 130 GLN A OE1  3  
ATOM 6809  N NE2  . GLN A 1 130 ? 16.762  -6.505  -5.232  1.00 0.00 ? 130 GLN A NE2  3  
ATOM 6810  H H    . GLN A 1 130 ? 15.669  -2.199  -5.099  1.00 0.00 ? 130 GLN A H    3  
ATOM 6811  H HA   . GLN A 1 130 ? 13.891  -2.539  -7.540  1.00 0.00 ? 130 GLN A HA   3  
ATOM 6812  H HB2  . GLN A 1 130 ? 14.261  -4.875  -7.191  1.00 0.00 ? 130 GLN A HB2  3  
ATOM 6813  H HB3  . GLN A 1 130 ? 15.779  -4.118  -6.913  1.00 0.00 ? 130 GLN A HB3  3  
ATOM 6814  H HG2  . GLN A 1 130 ? 15.434  -4.345  -4.370  1.00 0.00 ? 130 GLN A HG2  3  
ATOM 6815  H HG3  . GLN A 1 130 ? 13.858  -5.033  -4.706  1.00 0.00 ? 130 GLN A HG3  3  
ATOM 6816  H HE21 . GLN A 1 130 ? 17.324  -5.651  -5.278  1.00 0.00 ? 130 GLN A HE21 3  
ATOM 6817  H HE22 . GLN A 1 130 ? 17.074  -7.477  -5.304  1.00 0.00 ? 130 GLN A HE22 3  
ATOM 6818  N N    . PRO A 1 131 ? 11.570  -3.489  -6.007  1.00 0.00 ? 131 PRO A N    3  
ATOM 6819  C CA   . PRO A 1 131 ? 10.194  -3.209  -5.498  1.00 0.00 ? 131 PRO A CA   3  
ATOM 6820  C C    . PRO A 1 131 ? 9.680   -3.876  -4.173  1.00 0.00 ? 131 PRO A C    3  
ATOM 6821  O O    . PRO A 1 131 ? 10.360  -4.602  -3.433  1.00 0.00 ? 131 PRO A O    3  
ATOM 6822  C CB   . PRO A 1 131 ? 9.421   -3.680  -6.760  1.00 0.00 ? 131 PRO A CB   3  
ATOM 6823  C CG   . PRO A 1 131 ? 10.139  -4.951  -7.212  1.00 0.00 ? 131 PRO A CG   3  
ATOM 6824  C CD   . PRO A 1 131 ? 11.609  -4.633  -6.946  1.00 0.00 ? 131 PRO A CD   3  
ATOM 6825  H HA   . PRO A 1 131 ? 10.041  -2.130  -5.350  1.00 0.00 ? 131 PRO A HA   3  
ATOM 6826  H HB2  . PRO A 1 131 ? 8.341   -3.854  -6.589  1.00 0.00 ? 131 PRO A HB2  3  
ATOM 6827  H HB3  . PRO A 1 131 ? 9.472   -2.903  -7.550  1.00 0.00 ? 131 PRO A HB3  3  
ATOM 6828  H HG2  . PRO A 1 131 ? 9.812   -5.813  -6.598  1.00 0.00 ? 131 PRO A HG2  3  
ATOM 6829  H HG3  . PRO A 1 131 ? 9.937   -5.206  -8.269  1.00 0.00 ? 131 PRO A HG3  3  
ATOM 6830  H HD2  . PRO A 1 131 ? 12.131  -5.507  -6.510  1.00 0.00 ? 131 PRO A HD2  3  
ATOM 6831  H HD3  . PRO A 1 131 ? 12.111  -4.364  -7.895  1.00 0.00 ? 131 PRO A HD3  3  
ATOM 6832  N N    . VAL A 1 132 ? 8.396   -3.573  -3.894  1.00 0.00 ? 132 VAL A N    3  
ATOM 6833  C CA   . VAL A 1 132 ? 7.612   -4.256  -2.818  1.00 0.00 ? 132 VAL A CA   3  
ATOM 6834  C C    . VAL A 1 132 ? 7.177   -5.684  -3.329  1.00 0.00 ? 132 VAL A C    3  
ATOM 6835  O O    . VAL A 1 132 ? 6.862   -5.846  -4.516  1.00 0.00 ? 132 VAL A O    3  
ATOM 6836  C CB   . VAL A 1 132 ? 6.404   -3.356  -2.389  1.00 0.00 ? 132 VAL A CB   3  
ATOM 6837  C CG1  . VAL A 1 132 ? 5.346   -3.087  -3.485  1.00 0.00 ? 132 VAL A CG1  3  
ATOM 6838  C CG2  . VAL A 1 132 ? 5.692   -3.915  -1.136  1.00 0.00 ? 132 VAL A CG2  3  
ATOM 6839  H H    . VAL A 1 132 ? 7.961   -2.941  -4.587  1.00 0.00 ? 132 VAL A H    3  
ATOM 6840  H HA   . VAL A 1 132 ? 8.270   -4.385  -1.947  1.00 0.00 ? 132 VAL A HA   3  
ATOM 6841  H HB   . VAL A 1 132 ? 6.824   -2.372  -2.097  1.00 0.00 ? 132 VAL A HB   3  
ATOM 6842  H HG11 . VAL A 1 132 ? 5.808   -2.680  -4.402  1.00 0.00 ? 132 VAL A HG11 3  
ATOM 6843  H HG12 . VAL A 1 132 ? 4.809   -4.007  -3.781  1.00 0.00 ? 132 VAL A HG12 3  
ATOM 6844  H HG13 . VAL A 1 132 ? 4.592   -2.349  -3.161  1.00 0.00 ? 132 VAL A HG13 3  
ATOM 6845  H HG21 . VAL A 1 132 ? 6.401   -4.105  -0.311  1.00 0.00 ? 132 VAL A HG21 3  
ATOM 6846  H HG22 . VAL A 1 132 ? 4.938   -3.223  -0.733  1.00 0.00 ? 132 VAL A HG22 3  
ATOM 6847  H HG23 . VAL A 1 132 ? 5.173   -4.872  -1.334  1.00 0.00 ? 132 VAL A HG23 3  
ATOM 6848  N N    . SER A 1 133 ? 7.196   -6.735  -2.476  1.00 0.00 ? 133 SER A N    3  
ATOM 6849  C CA   . SER A 1 133 ? 6.850   -8.108  -2.946  1.00 0.00 ? 133 SER A CA   3  
ATOM 6850  C C    . SER A 1 133 ? 6.263   -9.012  -1.821  1.00 0.00 ? 133 SER A C    3  
ATOM 6851  O O    . SER A 1 133 ? 6.799   -9.175  -0.715  1.00 0.00 ? 133 SER A O    3  
ATOM 6852  C CB   . SER A 1 133 ? 8.116   -8.779  -3.534  1.00 0.00 ? 133 SER A CB   3  
ATOM 6853  O OG   . SER A 1 133 ? 7.795   -10.010 -4.188  1.00 0.00 ? 133 SER A OG   3  
ATOM 6854  H H    . SER A 1 133 ? 7.414   -6.541  -1.486  1.00 0.00 ? 133 SER A H    3  
ATOM 6855  H HA   . SER A 1 133 ? 6.098   -8.023  -3.765  1.00 0.00 ? 133 SER A HA   3  
ATOM 6856  H HB2  . SER A 1 133 ? 8.589   -8.108  -4.277  1.00 0.00 ? 133 SER A HB2  3  
ATOM 6857  H HB3  . SER A 1 133 ? 8.876   -8.949  -2.748  1.00 0.00 ? 133 SER A HB3  3  
ATOM 6858  H HG   . SER A 1 133 ? 7.423   -10.608 -3.531  1.00 0.00 ? 133 SER A HG   3  
ATOM 6859  N N    . LEU A 1 134 ? 5.137   -9.632  -2.178  1.00 0.00 ? 134 LEU A N    3  
ATOM 6860  C CA   . LEU A 1 134 ? 4.401   -10.590 -1.319  1.00 0.00 ? 134 LEU A CA   3  
ATOM 6861  C C    . LEU A 1 134 ? 4.481   -12.034 -1.974  1.00 0.00 ? 134 LEU A C    3  
ATOM 6862  O O    . LEU A 1 134 ? 4.818   -12.164 -3.157  1.00 0.00 ? 134 LEU A O    3  
ATOM 6863  C CB   . LEU A 1 134 ? 2.949   -10.052 -1.148  1.00 0.00 ? 134 LEU A CB   3  
ATOM 6864  C CG   . LEU A 1 134 ? 2.586   -8.618  -0.642  1.00 0.00 ? 134 LEU A CG   3  
ATOM 6865  C CD1  . LEU A 1 134 ? 3.556   -7.979  0.355   1.00 0.00 ? 134 LEU A CD1  3  
ATOM 6866  C CD2  . LEU A 1 134 ? 2.335   -7.620  -1.777  1.00 0.00 ? 134 LEU A CD2  3  
ATOM 6867  H H    . LEU A 1 134 ? 4.818   -9.416  -3.128  1.00 0.00 ? 134 LEU A H    3  
ATOM 6868  H HA   . LEU A 1 134 ? 4.845   -10.646 -0.306  1.00 0.00 ? 134 LEU A HA   3  
ATOM 6869  H HB2  . LEU A 1 134 ? 2.374   -10.263 -2.061  1.00 0.00 ? 134 LEU A HB2  3  
ATOM 6870  H HB3  . LEU A 1 134 ? 2.497   -10.720 -0.412  1.00 0.00 ? 134 LEU A HB3  3  
ATOM 6871  H HG   . LEU A 1 134 ? 1.620   -8.709  -0.106  1.00 0.00 ? 134 LEU A HG   3  
ATOM 6872  H HD11 . LEU A 1 134 ? 3.687   -8.606  1.246   1.00 0.00 ? 134 LEU A HD11 3  
ATOM 6873  H HD12 . LEU A 1 134 ? 4.556   -7.799  -0.071  1.00 0.00 ? 134 LEU A HD12 3  
ATOM 6874  H HD13 . LEU A 1 134 ? 3.189   -7.000  0.709   1.00 0.00 ? 134 LEU A HD13 3  
ATOM 6875  H HD21 . LEU A 1 134 ? 3.207   -7.502  -2.446  1.00 0.00 ? 134 LEU A HD21 3  
ATOM 6876  H HD22 . LEU A 1 134 ? 1.465   -7.923  -2.382  1.00 0.00 ? 134 LEU A HD22 3  
ATOM 6877  H HD23 . LEU A 1 134 ? 2.082   -6.619  -1.382  1.00 0.00 ? 134 LEU A HD23 3  
ATOM 6878  N N    . THR A 1 135 ? 4.201   -13.139 -1.246  1.00 0.00 ? 135 THR A N    3  
ATOM 6879  C CA   . THR A 1 135 ? 4.278   -14.533 -1.817  1.00 0.00 ? 135 THR A CA   3  
ATOM 6880  C C    . THR A 1 135 ? 2.912   -15.280 -1.707  1.00 0.00 ? 135 THR A C    3  
ATOM 6881  O O    . THR A 1 135 ? 2.161   -15.118 -0.744  1.00 0.00 ? 135 THR A O    3  
ATOM 6882  C CB   . THR A 1 135 ? 5.431   -15.337 -1.115  1.00 0.00 ? 135 THR A CB   3  
ATOM 6883  O OG1  . THR A 1 135 ? 5.655   -16.573 -1.785  1.00 0.00 ? 135 THR A OG1  3  
ATOM 6884  C CG2  . THR A 1 135 ? 5.209   -15.734 0.358   1.00 0.00 ? 135 THR A CG2  3  
ATOM 6885  H H    . THR A 1 135 ? 3.927   -12.993 -0.263  1.00 0.00 ? 135 THR A H    3  
ATOM 6886  H HA   . THR A 1 135 ? 4.535   -14.493 -2.895  1.00 0.00 ? 135 THR A HA   3  
ATOM 6887  H HB   . THR A 1 135 ? 6.352   -14.731 -1.209  1.00 0.00 ? 135 THR A HB   3  
ATOM 6888  H HG1  . THR A 1 135 ? 6.312   -17.041 -1.244  1.00 0.00 ? 135 THR A HG1  3  
ATOM 6889  H HG21 . THR A 1 135 ? 4.252   -16.263 0.522   1.00 0.00 ? 135 THR A HG21 3  
ATOM 6890  H HG22 . THR A 1 135 ? 5.999   -16.404 0.729   1.00 0.00 ? 135 THR A HG22 3  
ATOM 6891  H HG23 . THR A 1 135 ? 5.219   -14.859 1.025   1.00 0.00 ? 135 THR A HG23 3  
ATOM 6892  N N    . ASN A 1 136 ? 2.608   -16.173 -2.662  1.00 0.00 ? 136 ASN A N    3  
ATOM 6893  C CA   . ASN A 1 136 ? 1.362   -17.000 -2.603  1.00 0.00 ? 136 ASN A CA   3  
ATOM 6894  C C    . ASN A 1 136 ? 1.451   -18.185 -1.564  1.00 0.00 ? 136 ASN A C    3  
ATOM 6895  O O    . ASN A 1 136 ? 0.415   -18.578 -1.024  1.00 0.00 ? 136 ASN A O    3  
ATOM 6896  C CB   . ASN A 1 136 ? 1.100   -17.477 -4.059  1.00 0.00 ? 136 ASN A CB   3  
ATOM 6897  C CG   . ASN A 1 136 ? -0.212  -18.231 -4.293  1.00 0.00 ? 136 ASN A CG   3  
ATOM 6898  O OD1  . ASN A 1 136 ? -0.240  -19.445 -4.456  1.00 0.00 ? 136 ASN A OD1  3  
ATOM 6899  N ND2  . ASN A 1 136 ? -1.336  -17.556 -4.326  1.00 0.00 ? 136 ASN A ND2  3  
ATOM 6900  H H    . ASN A 1 136 ? 3.294   -16.241 -3.421  1.00 0.00 ? 136 ASN A H    3  
ATOM 6901  H HA   . ASN A 1 136 ? 0.512   -16.367 -2.276  1.00 0.00 ? 136 ASN A HA   3  
ATOM 6902  H HB2  . ASN A 1 136 ? 1.120   -16.618 -4.757  1.00 0.00 ? 136 ASN A HB2  3  
ATOM 6903  H HB3  . ASN A 1 136 ? 1.924   -18.133 -4.397  1.00 0.00 ? 136 ASN A HB3  3  
ATOM 6904  H HD21 . ASN A 1 136 ? -1.283  -16.557 -4.075  1.00 0.00 ? 136 ASN A HD21 3  
ATOM 6905  H HD22 . ASN A 1 136 ? -2.162  -18.152 -4.413  1.00 0.00 ? 136 ASN A HD22 3  
ATOM 6906  N N    . MET A 1 137 ? 2.643   -18.768 -1.314  1.00 0.00 ? 137 MET A N    3  
ATOM 6907  C CA   . MET A 1 137 ? 2.852   -19.835 -0.295  1.00 0.00 ? 137 MET A CA   3  
ATOM 6908  C C    . MET A 1 137 ? 4.372   -19.938 0.131   1.00 0.00 ? 137 MET A C    3  
ATOM 6909  O O    . MET A 1 137 ? 4.581   -19.902 1.348   1.00 0.00 ? 137 MET A O    3  
ATOM 6910  C CB   . MET A 1 137 ? 2.278   -21.198 -0.798  1.00 0.00 ? 137 MET A CB   3  
ATOM 6911  C CG   . MET A 1 137 ? 2.209   -22.301 0.278   1.00 0.00 ? 137 MET A CG   3  
ATOM 6912  S SD   . MET A 1 137 ? 1.480   -23.802 -0.412  1.00 0.00 ? 137 MET A SD   3  
ATOM 6913  C CE   . MET A 1 137 ? 2.939   -24.606 -1.103  1.00 0.00 ? 137 MET A CE   3  
ATOM 6914  H H    . MET A 1 137 ? 3.418   -18.319 -1.811  1.00 0.00 ? 137 MET A H    3  
ATOM 6915  H HA   . MET A 1 137 ? 2.300   -19.547 0.622   1.00 0.00 ? 137 MET A HA   3  
ATOM 6916  H HB2  . MET A 1 137 ? 1.248   -21.044 -1.176  1.00 0.00 ? 137 MET A HB2  3  
ATOM 6917  H HB3  . MET A 1 137 ? 2.834   -21.577 -1.671  1.00 0.00 ? 137 MET A HB3  3  
ATOM 6918  H HG2  . MET A 1 137 ? 3.207   -22.528 0.698   1.00 0.00 ? 137 MET A HG2  3  
ATOM 6919  H HG3  . MET A 1 137 ? 1.586   -21.971 1.130   1.00 0.00 ? 137 MET A HG3  3  
ATOM 6920  H HE1  . MET A 1 137 ? 3.415   -23.970 -1.870  1.00 0.00 ? 137 MET A HE1  3  
ATOM 6921  H HE2  . MET A 1 137 ? 3.683   -24.815 -0.314  1.00 0.00 ? 137 MET A HE2  3  
ATOM 6922  H HE3  . MET A 1 137 ? 2.662   -25.565 -1.576  1.00 0.00 ? 137 MET A HE3  3  
ATOM 6923  N N    . PRO A 1 138 ? 5.454   -20.028 -0.718  1.00 0.00 ? 138 PRO A N    3  
ATOM 6924  C CA   . PRO A 1 138 ? 6.849   -20.232 -0.226  1.00 0.00 ? 138 PRO A CA   3  
ATOM 6925  C C    . PRO A 1 138 ? 7.584   -19.005 0.417   1.00 0.00 ? 138 PRO A C    3  
ATOM 6926  O O    . PRO A 1 138 ? 7.724   -17.950 -0.214  1.00 0.00 ? 138 PRO A O    3  
ATOM 6927  C CB   . PRO A 1 138 ? 7.588   -20.703 -1.504  1.00 0.00 ? 138 PRO A CB   3  
ATOM 6928  C CG   . PRO A 1 138 ? 6.502   -21.088 -2.508  1.00 0.00 ? 138 PRO A CG   3  
ATOM 6929  C CD   . PRO A 1 138 ? 5.367   -20.121 -2.189  1.00 0.00 ? 138 PRO A CD   3  
ATOM 6930  H HA   . PRO A 1 138 ? 6.841   -21.068 0.504   1.00 0.00 ? 138 PRO A HA   3  
ATOM 6931  H HB2  . PRO A 1 138 ? 8.209   -19.896 -1.943  1.00 0.00 ? 138 PRO A HB2  3  
ATOM 6932  H HB3  . PRO A 1 138 ? 8.280   -21.541 -1.296  1.00 0.00 ? 138 PRO A HB3  3  
ATOM 6933  H HG2  . PRO A 1 138 ? 6.843   -21.014 -3.557  1.00 0.00 ? 138 PRO A HG2  3  
ATOM 6934  H HG3  . PRO A 1 138 ? 6.175   -22.134 -2.344  1.00 0.00 ? 138 PRO A HG3  3  
ATOM 6935  H HD2  . PRO A 1 138 ? 5.547   -19.128 -2.646  1.00 0.00 ? 138 PRO A HD2  3  
ATOM 6936  H HD3  . PRO A 1 138 ? 4.408   -20.493 -2.586  1.00 0.00 ? 138 PRO A HD3  3  
ATOM 6937  N N    . ASP A 1 139 ? 8.073   -19.195 1.658   1.00 0.00 ? 139 ASP A N    3  
ATOM 6938  C CA   . ASP A 1 139 ? 8.930   -18.220 2.394   1.00 0.00 ? 139 ASP A CA   3  
ATOM 6939  C C    . ASP A 1 139 ? 9.662   -18.985 3.555   1.00 0.00 ? 139 ASP A C    3  
ATOM 6940  O O    . ASP A 1 139 ? 9.057   -19.764 4.299   1.00 0.00 ? 139 ASP A O    3  
ATOM 6941  C CB   . ASP A 1 139 ? 8.120   -17.021 2.974   1.00 0.00 ? 139 ASP A CB   3  
ATOM 6942  C CG   . ASP A 1 139 ? 8.919   -15.965 3.764   1.00 0.00 ? 139 ASP A CG   3  
ATOM 6943  O OD1  . ASP A 1 139 ? 10.115  -15.733 3.470   1.00 0.00 ? 139 ASP A OD1  3  
ATOM 6944  O OD2  . ASP A 1 139 ? 8.348   -15.367 4.698   1.00 0.00 ? 139 ASP A OD2  3  
ATOM 6945  H H    . ASP A 1 139 ? 7.870   -20.112 2.070   1.00 0.00 ? 139 ASP A H    3  
ATOM 6946  H HA   . ASP A 1 139 ? 9.685   -17.815 1.689   1.00 0.00 ? 139 ASP A HA   3  
ATOM 6947  H HB2  . ASP A 1 139 ? 7.630   -16.480 2.151   1.00 0.00 ? 139 ASP A HB2  3  
ATOM 6948  H HB3  . ASP A 1 139 ? 7.300   -17.391 3.616   1.00 0.00 ? 139 ASP A HB3  3  
ATOM 6949  N N    . GLU A 1 140 ? 10.976  -18.746 3.685   1.00 0.00 ? 140 GLU A N    3  
ATOM 6950  C CA   . GLU A 1 140 ? 11.802  -19.258 4.830   1.00 0.00 ? 140 GLU A CA   3  
ATOM 6951  C C    . GLU A 1 140 ? 12.512  -18.058 5.577   1.00 0.00 ? 140 GLU A C    3  
ATOM 6952  O O    . GLU A 1 140 ? 13.640  -18.190 6.064   1.00 0.00 ? 140 GLU A O    3  
ATOM 6953  C CB   . GLU A 1 140 ? 12.814  -20.301 4.256   1.00 0.00 ? 140 GLU A CB   3  
ATOM 6954  C CG   . GLU A 1 140 ? 12.244  -21.715 3.960   1.00 0.00 ? 140 GLU A CG   3  
ATOM 6955  C CD   . GLU A 1 140 ? 12.124  -22.636 5.168   1.00 0.00 ? 140 GLU A CD   3  
ATOM 6956  O OE1  . GLU A 1 140 ? 11.066  -22.633 5.831   1.00 0.00 ? 140 GLU A OE1  3  
ATOM 6957  O OE2  . GLU A 1 140 ? 13.084  -23.388 5.441   1.00 0.00 ? 140 GLU A OE2  3  
ATOM 6958  H H    . GLU A 1 140 ? 11.342  -18.058 3.016   1.00 0.00 ? 140 GLU A H    3  
ATOM 6959  H HA   . GLU A 1 140 ? 11.176  -19.764 5.592   1.00 0.00 ? 140 GLU A HA   3  
ATOM 6960  H HB2  . GLU A 1 140 ? 13.289  -19.896 3.342   1.00 0.00 ? 140 GLU A HB2  3  
ATOM 6961  H HB3  . GLU A 1 140 ? 13.664  -20.427 4.956   1.00 0.00 ? 140 GLU A HB3  3  
ATOM 6962  H HG2  . GLU A 1 140 ? 11.252  -21.652 3.481   1.00 0.00 ? 140 GLU A HG2  3  
ATOM 6963  H HG3  . GLU A 1 140 ? 12.894  -22.236 3.237   1.00 0.00 ? 140 GLU A HG3  3  
ATOM 6964  N N    . GLY A 1 141 ? 11.832  -16.900 5.752   1.00 0.00 ? 141 GLY A N    3  
ATOM 6965  C CA   . GLY A 1 141 ? 12.446  -15.663 6.314   1.00 0.00 ? 141 GLY A CA   3  
ATOM 6966  C C    . GLY A 1 141 ? 13.390  -14.955 5.310   1.00 0.00 ? 141 GLY A C    3  
ATOM 6967  O O    . GLY A 1 141 ? 14.556  -14.711 5.623   1.00 0.00 ? 141 GLY A O    3  
ATOM 6968  H H    . GLY A 1 141 ? 10.919  -16.887 5.270   1.00 0.00 ? 141 GLY A H    3  
ATOM 6969  H HA2  . GLY A 1 141 ? 11.649  -14.958 6.615   1.00 0.00 ? 141 GLY A HA2  3  
ATOM 6970  H HA3  . GLY A 1 141 ? 13.006  -15.893 7.241   1.00 0.00 ? 141 GLY A HA3  3  
ATOM 6971  N N    . VAL A 1 142 ? 12.867  -14.593 4.126   1.00 0.00 ? 142 VAL A N    3  
ATOM 6972  C CA   . VAL A 1 142 ? 13.694  -14.047 3.003   1.00 0.00 ? 142 VAL A CA   3  
ATOM 6973  C C    . VAL A 1 142 ? 13.918  -12.504 3.076   1.00 0.00 ? 142 VAL A C    3  
ATOM 6974  O O    . VAL A 1 142 ? 15.017  -12.019 3.356   1.00 0.00 ? 142 VAL A O    3  
ATOM 6975  C CB   . VAL A 1 142 ? 13.017  -14.571 1.672   1.00 0.00 ? 142 VAL A CB   3  
ATOM 6976  C CG1  . VAL A 1 142 ? 11.686  -13.974 1.152   1.00 0.00 ? 142 VAL A CG1  3  
ATOM 6977  C CG2  . VAL A 1 142 ? 14.017  -14.643 0.498   1.00 0.00 ? 142 VAL A CG2  3  
ATOM 6978  H H    . VAL A 1 142 ? 11.882  -14.888 3.997   1.00 0.00 ? 142 VAL A H    3  
ATOM 6979  H HA   . VAL A 1 142 ? 14.711  -14.485 3.065   1.00 0.00 ? 142 VAL A HA   3  
ATOM 6980  H HB   . VAL A 1 142 ? 12.697  -15.587 1.910   1.00 0.00 ? 142 VAL A HB   3  
ATOM 6981  H HG11 . VAL A 1 142 ? 10.954  -13.846 1.970   1.00 0.00 ? 142 VAL A HG11 3  
ATOM 6982  H HG12 . VAL A 1 142 ? 11.808  -12.999 0.652   1.00 0.00 ? 142 VAL A HG12 3  
ATOM 6983  H HG13 . VAL A 1 142 ? 11.203  -14.643 0.414   1.00 0.00 ? 142 VAL A HG13 3  
ATOM 6984  H HG21 . VAL A 1 142 ? 14.923  -15.219 0.764   1.00 0.00 ? 142 VAL A HG21 3  
ATOM 6985  H HG22 . VAL A 1 142 ? 13.581  -15.137 -0.390  1.00 0.00 ? 142 VAL A HG22 3  
ATOM 6986  H HG23 . VAL A 1 142 ? 14.350  -13.637 0.182   1.00 0.00 ? 142 VAL A HG23 3  
ATOM 6987  N N    . MET A 1 143 ? 12.837  -11.771 2.852   1.00 0.00 ? 143 MET A N    3  
ATOM 6988  C CA   . MET A 1 143 ? 12.831  -10.278 2.801   1.00 0.00 ? 143 MET A CA   3  
ATOM 6989  C C    . MET A 1 143 ? 12.548  -9.588  4.191   1.00 0.00 ? 143 MET A C    3  
ATOM 6990  O O    . MET A 1 143 ? 12.305  -10.232 5.217   1.00 0.00 ? 143 MET A O    3  
ATOM 6991  C CB   . MET A 1 143 ? 11.809  -9.915  1.681   1.00 0.00 ? 143 MET A CB   3  
ATOM 6992  C CG   . MET A 1 143 ? 12.346  -10.045 0.241   1.00 0.00 ? 143 MET A CG   3  
ATOM 6993  S SD   . MET A 1 143 ? 11.037  -9.609  -0.921  1.00 0.00 ? 143 MET A SD   3  
ATOM 6994  C CE   . MET A 1 143 ? 11.905  -9.869  -2.478  1.00 0.00 ? 143 MET A CE   3  
ATOM 6995  H H    . MET A 1 143 ? 12.093  -12.449 2.599   1.00 0.00 ? 143 MET A H    3  
ATOM 6996  H HA   . MET A 1 143 ? 13.831  -9.907  2.498   1.00 0.00 ? 143 MET A HA   3  
ATOM 6997  H HB2  . MET A 1 143 ? 10.875  -10.502 1.785   1.00 0.00 ? 143 MET A HB2  3  
ATOM 6998  H HB3  . MET A 1 143 ? 11.481  -8.868  1.798   1.00 0.00 ? 143 MET A HB3  3  
ATOM 6999  H HG2  . MET A 1 143 ? 13.218  -9.384  0.085   1.00 0.00 ? 143 MET A HG2  3  
ATOM 7000  H HG3  . MET A 1 143 ? 12.698  -11.070 0.028   1.00 0.00 ? 143 MET A HG3  3  
ATOM 7001  H HE1  . MET A 1 143 ? 12.797  -9.221  -2.551  1.00 0.00 ? 143 MET A HE1  3  
ATOM 7002  H HE2  . MET A 1 143 ? 12.230  -10.920 -2.576  1.00 0.00 ? 143 MET A HE2  3  
ATOM 7003  H HE3  . MET A 1 143 ? 11.245  -9.635  -3.332  1.00 0.00 ? 143 MET A HE3  3  
ATOM 7004  N N    . VAL A 1 144 ? 12.612  -8.238  4.226   1.00 0.00 ? 144 VAL A N    3  
ATOM 7005  C CA   . VAL A 1 144 ? 12.454  -7.426  5.480   1.00 0.00 ? 144 VAL A CA   3  
ATOM 7006  C C    . VAL A 1 144 ? 10.938  -7.278  5.848   1.00 0.00 ? 144 VAL A C    3  
ATOM 7007  O O    . VAL A 1 144 ? 10.234  -6.441  5.282   1.00 0.00 ? 144 VAL A O    3  
ATOM 7008  C CB   . VAL A 1 144 ? 13.171  -6.038  5.266   1.00 0.00 ? 144 VAL A CB   3  
ATOM 7009  C CG1  . VAL A 1 144 ? 13.006  -5.052  6.450   1.00 0.00 ? 144 VAL A CG1  3  
ATOM 7010  C CG2  . VAL A 1 144 ? 14.696  -6.154  5.012   1.00 0.00 ? 144 VAL A CG2  3  
ATOM 7011  H H    . VAL A 1 144 ? 12.796  -7.792  3.321   1.00 0.00 ? 144 VAL A H    3  
ATOM 7012  H HA   . VAL A 1 144 ? 12.963  -7.933  6.326   1.00 0.00 ? 144 VAL A HA   3  
ATOM 7013  H HB   . VAL A 1 144 ? 12.712  -5.553  4.380   1.00 0.00 ? 144 VAL A HB   3  
ATOM 7014  H HG11 . VAL A 1 144 ? 11.943  -4.812  6.648   1.00 0.00 ? 144 VAL A HG11 3  
ATOM 7015  H HG12 . VAL A 1 144 ? 13.431  -5.449  7.389   1.00 0.00 ? 144 VAL A HG12 3  
ATOM 7016  H HG13 . VAL A 1 144 ? 13.490  -4.075  6.255   1.00 0.00 ? 144 VAL A HG13 3  
ATOM 7017  H HG21 . VAL A 1 144 ? 14.921  -6.769  4.122   1.00 0.00 ? 144 VAL A HG21 3  
ATOM 7018  H HG22 . VAL A 1 144 ? 15.170  -5.170  4.841   1.00 0.00 ? 144 VAL A HG22 3  
ATOM 7019  H HG23 . VAL A 1 144 ? 15.223  -6.625  5.863   1.00 0.00 ? 144 VAL A HG23 3  
ATOM 7020  N N    . THR A 1 145 ? 10.467  -8.054  6.840   1.00 0.00 ? 145 THR A N    3  
ATOM 7021  C CA   . THR A 1 145 ? 9.030   -8.070  7.276   1.00 0.00 ? 145 THR A CA   3  
ATOM 7022  C C    . THR A 1 145 ? 8.580   -6.958  8.279   1.00 0.00 ? 145 THR A C    3  
ATOM 7023  O O    . THR A 1 145 ? 7.439   -6.514  8.169   1.00 0.00 ? 145 THR A O    3  
ATOM 7024  C CB   . THR A 1 145 ? 8.693   -9.466  7.908   1.00 0.00 ? 145 THR A CB   3  
ATOM 7025  O OG1  . THR A 1 145 ? 9.597   -9.785  8.964   1.00 0.00 ? 145 THR A OG1  3  
ATOM 7026  C CG2  . THR A 1 145 ? 8.755   -10.642 6.919   1.00 0.00 ? 145 THR A CG2  3  
ATOM 7027  H H    . THR A 1 145 ? 11.138  -8.732  7.217   1.00 0.00 ? 145 THR A H    3  
ATOM 7028  H HA   . THR A 1 145 ? 8.371   -7.928  6.403   1.00 0.00 ? 145 THR A HA   3  
ATOM 7029  H HB   . THR A 1 145 ? 7.658   -9.424  8.310   1.00 0.00 ? 145 THR A HB   3  
ATOM 7030  H HG1  . THR A 1 145 ? 9.512   -10.733 9.099   1.00 0.00 ? 145 THR A HG1  3  
ATOM 7031  H HG21 . THR A 1 145 ? 8.062   -10.487 6.073   1.00 0.00 ? 145 THR A HG21 3  
ATOM 7032  H HG22 . THR A 1 145 ? 9.767   -10.785 6.494   1.00 0.00 ? 145 THR A HG22 3  
ATOM 7033  H HG23 . THR A 1 145 ? 8.461   -11.597 7.392   1.00 0.00 ? 145 THR A HG23 3  
ATOM 7034  N N    . LYS A 1 146 ? 9.409   -6.528  9.243   1.00 0.00 ? 146 LYS A N    3  
ATOM 7035  C CA   . LYS A 1 146 ? 9.015   -5.542  10.294  1.00 0.00 ? 146 LYS A CA   3  
ATOM 7036  C C    . LYS A 1 146 ? 8.871   -4.063  9.773   1.00 0.00 ? 146 LYS A C    3  
ATOM 7037  O O    . LYS A 1 146 ? 9.869   -3.381  9.526   1.00 0.00 ? 146 LYS A O    3  
ATOM 7038  C CB   . LYS A 1 146 ? 10.031  -5.653  11.487  1.00 0.00 ? 146 LYS A CB   3  
ATOM 7039  C CG   . LYS A 1 146 ? 11.531  -6.032  11.293  1.00 0.00 ? 146 LYS A CG   3  
ATOM 7040  C CD   . LYS A 1 146 ? 12.386  -5.140  10.366  1.00 0.00 ? 146 LYS A CD   3  
ATOM 7041  C CE   . LYS A 1 146 ? 12.724  -3.762  10.958  1.00 0.00 ? 146 LYS A CE   3  
ATOM 7042  N NZ   . LYS A 1 146 ? 13.674  -3.053  10.052  1.00 0.00 ? 146 LYS A NZ   3  
ATOM 7043  H H    . LYS A 1 146 ? 10.327  -6.981  9.211   1.00 0.00 ? 146 LYS A H    3  
ATOM 7044  H HA   . LYS A 1 146 ? 8.026   -5.833  10.702  1.00 0.00 ? 146 LYS A HA   3  
ATOM 7045  H HB2  . LYS A 1 146 ? 9.974   -4.735  12.102  1.00 0.00 ? 146 LYS A HB2  3  
ATOM 7046  H HB3  . LYS A 1 146 ? 9.614   -6.419  12.170  1.00 0.00 ? 146 LYS A HB3  3  
ATOM 7047  H HG2  . LYS A 1 146 ? 12.016  -6.108  12.287  1.00 0.00 ? 146 LYS A HG2  3  
ATOM 7048  H HG3  . LYS A 1 146 ? 11.575  -7.071  10.910  1.00 0.00 ? 146 LYS A HG3  3  
ATOM 7049  H HD2  . LYS A 1 146 ? 13.319  -5.692  10.137  1.00 0.00 ? 146 LYS A HD2  3  
ATOM 7050  H HD3  . LYS A 1 146 ? 11.878  -5.022  9.387   1.00 0.00 ? 146 LYS A HD3  3  
ATOM 7051  H HE2  . LYS A 1 146 ? 11.795  -3.167  11.100  1.00 0.00 ? 146 LYS A HE2  3  
ATOM 7052  H HE3  . LYS A 1 146 ? 13.159  -3.878  11.975  1.00 0.00 ? 146 LYS A HE3  3  
ATOM 7053  H HZ1  . LYS A 1 146 ? 14.461  -3.634  9.746   1.00 0.00 ? 146 LYS A HZ1  3  
ATOM 7054  H HZ2  . LYS A 1 146 ? 13.270  -2.692  9.137   1.00 0.00 ? 146 LYS A HZ2  3  
ATOM 7055  H HZ3  . LYS A 1 146 ? 14.084  -2.202  10.456  1.00 0.00 ? 146 LYS A HZ3  3  
ATOM 7056  N N    . PHE A 1 147 ? 7.624   -3.543  9.694   1.00 0.00 ? 147 PHE A N    3  
ATOM 7057  C CA   . PHE A 1 147 ? 7.348   -2.147  9.215   1.00 0.00 ? 147 PHE A CA   3  
ATOM 7058  C C    . PHE A 1 147 ? 6.656   -1.236  10.271  1.00 0.00 ? 147 PHE A C    3  
ATOM 7059  O O    . PHE A 1 147 ? 5.786   -1.668  11.032  1.00 0.00 ? 147 PHE A O    3  
ATOM 7060  C CB   . PHE A 1 147 ? 6.388   -2.163  7.988   1.00 0.00 ? 147 PHE A CB   3  
ATOM 7061  C CG   . PHE A 1 147 ? 6.943   -2.855  6.752   1.00 0.00 ? 147 PHE A CG   3  
ATOM 7062  C CD1  . PHE A 1 147 ? 7.995   -2.294  6.020   1.00 0.00 ? 147 PHE A CD1  3  
ATOM 7063  C CD2  . PHE A 1 147 ? 6.447   -4.111  6.404   1.00 0.00 ? 147 PHE A CD2  3  
ATOM 7064  C CE1  . PHE A 1 147 ? 8.575   -3.010  4.980   1.00 0.00 ? 147 PHE A CE1  3  
ATOM 7065  C CE2  . PHE A 1 147 ? 7.011   -4.813  5.353   1.00 0.00 ? 147 PHE A CE2  3  
ATOM 7066  C CZ   . PHE A 1 147 ? 8.085   -4.271  4.654   1.00 0.00 ? 147 PHE A CZ   3  
ATOM 7067  H H    . PHE A 1 147 ? 6.874   -4.221  9.892   1.00 0.00 ? 147 PHE A H    3  
ATOM 7068  H HA   . PHE A 1 147 ? 8.291   -1.658  8.901   1.00 0.00 ? 147 PHE A HA   3  
ATOM 7069  H HB2  . PHE A 1 147 ? 5.412   -2.604  8.277   1.00 0.00 ? 147 PHE A HB2  3  
ATOM 7070  H HB3  . PHE A 1 147 ? 6.133   -1.126  7.690   1.00 0.00 ? 147 PHE A HB3  3  
ATOM 7071  H HD1  . PHE A 1 147 ? 8.393   -1.324  6.281   1.00 0.00 ? 147 PHE A HD1  3  
ATOM 7072  H HD2  . PHE A 1 147 ? 5.639   -4.559  6.964   1.00 0.00 ? 147 PHE A HD2  3  
ATOM 7073  H HE1  . PHE A 1 147 ? 9.423   -2.600  4.450   1.00 0.00 ? 147 PHE A HE1  3  
ATOM 7074  H HE2  . PHE A 1 147 ? 6.615   -5.784  5.108   1.00 0.00 ? 147 PHE A HE2  3  
ATOM 7075  H HZ   . PHE A 1 147 ? 8.561   -4.843  3.883   1.00 0.00 ? 147 PHE A HZ   3  
ATOM 7076  N N    . TYR A 1 148 ? 7.012   0.057   10.262  1.00 0.00 ? 148 TYR A N    3  
ATOM 7077  C CA   . TYR A 1 148 ? 6.358   1.098   11.090  1.00 0.00 ? 148 TYR A CA   3  
ATOM 7078  C C    . TYR A 1 148 ? 5.208   1.745   10.231  1.00 0.00 ? 148 TYR A C    3  
ATOM 7079  O O    . TYR A 1 148 ? 5.400   2.257   9.115   1.00 0.00 ? 148 TYR A O    3  
ATOM 7080  C CB   . TYR A 1 148 ? 7.439   2.114   11.552  1.00 0.00 ? 148 TYR A CB   3  
ATOM 7081  C CG   . TYR A 1 148 ? 6.986   3.067   12.670  1.00 0.00 ? 148 TYR A CG   3  
ATOM 7082  C CD1  . TYR A 1 148 ? 6.758   2.580   13.962  1.00 0.00 ? 148 TYR A CD1  3  
ATOM 7083  C CD2  . TYR A 1 148 ? 6.805   4.430   12.411  1.00 0.00 ? 148 TYR A CD2  3  
ATOM 7084  C CE1  . TYR A 1 148 ? 6.335   3.438   14.975  1.00 0.00 ? 148 TYR A CE1  3  
ATOM 7085  C CE2  . TYR A 1 148 ? 6.388   5.289   13.427  1.00 0.00 ? 148 TYR A CE2  3  
ATOM 7086  C CZ   . TYR A 1 148 ? 6.152   4.792   14.705  1.00 0.00 ? 148 TYR A CZ   3  
ATOM 7087  O OH   . TYR A 1 148 ? 5.739   5.639   15.698  1.00 0.00 ? 148 TYR A OH   3  
ATOM 7088  H H    . TYR A 1 148 ? 7.731   0.328   9.575   1.00 0.00 ? 148 TYR A H    3  
ATOM 7089  H HA   . TYR A 1 148 ? 5.933   0.625   12.001  1.00 0.00 ? 148 TYR A HA   3  
ATOM 7090  H HB2  . TYR A 1 148 ? 8.331   1.571   11.920  1.00 0.00 ? 148 TYR A HB2  3  
ATOM 7091  H HB3  . TYR A 1 148 ? 7.816   2.689   10.683  1.00 0.00 ? 148 TYR A HB3  3  
ATOM 7092  H HD1  . TYR A 1 148 ? 6.900   1.531   14.184  1.00 0.00 ? 148 TYR A HD1  3  
ATOM 7093  H HD2  . TYR A 1 148 ? 6.984   4.825   11.422  1.00 0.00 ? 148 TYR A HD2  3  
ATOM 7094  H HE1  . TYR A 1 148 ? 6.154   3.045   15.964  1.00 0.00 ? 148 TYR A HE1  3  
ATOM 7095  H HE2  . TYR A 1 148 ? 6.243   6.341   13.225  1.00 0.00 ? 148 TYR A HE2  3  
ATOM 7096  H HH   . TYR A 1 148 ? 5.555   5.127   16.487  1.00 0.00 ? 148 TYR A HH   3  
ATOM 7097  N N    . PHE A 1 149 ? 3.994   1.661   10.793  1.00 0.00 ? 149 PHE A N    3  
ATOM 7098  C CA   . PHE A 1 149 ? 2.732   2.139   10.167  1.00 0.00 ? 149 PHE A CA   3  
ATOM 7099  C C    . PHE A 1 149 ? 2.415   3.585   10.692  1.00 0.00 ? 149 PHE A C    3  
ATOM 7100  O O    . PHE A 1 149 ? 1.851   3.734   11.780  1.00 0.00 ? 149 PHE A O    3  
ATOM 7101  C CB   . PHE A 1 149 ? 1.714   1.014   10.553  1.00 0.00 ? 149 PHE A CB   3  
ATOM 7102  C CG   . PHE A 1 149 ? 0.362   0.963   9.830   1.00 0.00 ? 149 PHE A CG   3  
ATOM 7103  C CD1  . PHE A 1 149 ? 0.282   0.503   8.510   1.00 0.00 ? 149 PHE A CD1  3  
ATOM 7104  C CD2  . PHE A 1 149 ? -0.815  1.288   10.512  1.00 0.00 ? 149 PHE A CD2  3  
ATOM 7105  C CE1  . PHE A 1 149 ? -0.951  0.426   7.865   1.00 0.00 ? 149 PHE A CE1  3  
ATOM 7106  C CE2  . PHE A 1 149 ? -2.048  1.204   9.869   1.00 0.00 ? 149 PHE A CE2  3  
ATOM 7107  C CZ   . PHE A 1 149 ? -2.114  0.777   8.545   1.00 0.00 ? 149 PHE A CZ   3  
ATOM 7108  H H    . PHE A 1 149 ? 3.987   1.220   11.718  1.00 0.00 ? 149 PHE A H    3  
ATOM 7109  H HA   . PHE A 1 149 ? 2.827   2.172   9.063   1.00 0.00 ? 149 PHE A HA   3  
ATOM 7110  H HB2  . PHE A 1 149 ? 2.170   0.015   10.388  1.00 0.00 ? 149 PHE A HB2  3  
ATOM 7111  H HB3  . PHE A 1 149 ? 1.550   1.036   11.650  1.00 0.00 ? 149 PHE A HB3  3  
ATOM 7112  H HD1  . PHE A 1 149 ? 1.176   0.205   7.981   1.00 0.00 ? 149 PHE A HD1  3  
ATOM 7113  H HD2  . PHE A 1 149 ? -0.775  1.630   11.538  1.00 0.00 ? 149 PHE A HD2  3  
ATOM 7114  H HE1  . PHE A 1 149 ? -1.005  0.089   6.839   1.00 0.00 ? 149 PHE A HE1  3  
ATOM 7115  H HE2  . PHE A 1 149 ? -2.950  1.484   10.395  1.00 0.00 ? 149 PHE A HE2  3  
ATOM 7116  H HZ   . PHE A 1 149 ? -3.068  0.725   8.046   1.00 0.00 ? 149 PHE A HZ   3  
ATOM 7117  N N    . GLN A 1 150 ? 2.798   4.642   9.939   1.00 0.00 ? 150 GLN A N    3  
ATOM 7118  C CA   . GLN A 1 150 ? 2.688   6.062   10.406  1.00 0.00 ? 150 GLN A CA   3  
ATOM 7119  C C    . GLN A 1 150 ? 1.776   6.986   9.531   1.00 0.00 ? 150 GLN A C    3  
ATOM 7120  O O    . GLN A 1 150 ? 1.772   6.897   8.302   1.00 0.00 ? 150 GLN A O    3  
ATOM 7121  C CB   . GLN A 1 150 ? 4.165   6.565   10.408  1.00 0.00 ? 150 GLN A CB   3  
ATOM 7122  C CG   . GLN A 1 150 ? 4.453   8.043   10.780  1.00 0.00 ? 150 GLN A CG   3  
ATOM 7123  C CD   . GLN A 1 150 ? 4.028   8.558   12.160  1.00 0.00 ? 150 GLN A CD   3  
ATOM 7124  O OE1  . GLN A 1 150 ? 3.347   7.915   12.954  1.00 0.00 ? 150 GLN A OE1  3  
ATOM 7125  N NE2  . GLN A 1 150 ? 4.412   9.771   12.467  1.00 0.00 ? 150 GLN A NE2  3  
ATOM 7126  H H    . GLN A 1 150 ? 3.249   4.433   9.035   1.00 0.00 ? 150 GLN A H    3  
ATOM 7127  H HA   . GLN A 1 150 ? 2.306   6.104   11.447  1.00 0.00 ? 150 GLN A HA   3  
ATOM 7128  H HB2  . GLN A 1 150 ? 4.755   5.925   11.090  1.00 0.00 ? 150 GLN A HB2  3  
ATOM 7129  H HB3  . GLN A 1 150 ? 4.607   6.398   9.405   1.00 0.00 ? 150 GLN A HB3  3  
ATOM 7130  H HG2  . GLN A 1 150 ? 5.541   8.219   10.671  1.00 0.00 ? 150 GLN A HG2  3  
ATOM 7131  H HG3  . GLN A 1 150 ? 4.002   8.708   10.017  1.00 0.00 ? 150 GLN A HG3  3  
ATOM 7132  H HE21 . GLN A 1 150 ? 4.924   10.266  11.702  1.00 0.00 ? 150 GLN A HE21 3  
ATOM 7133  H HE22 . GLN A 1 150 ? 3.991   10.160  13.312  1.00 0.00 ? 150 GLN A HE22 3  
ATOM 7134  N N    . GLU A 1 151 ? 1.038   7.918   10.168  1.00 0.00 ? 151 GLU A N    3  
ATOM 7135  C CA   . GLU A 1 151 ? 0.194   8.920   9.448   1.00 0.00 ? 151 GLU A CA   3  
ATOM 7136  C C    . GLU A 1 151 ? 1.058   10.175  9.052   1.00 0.00 ? 151 GLU A C    3  
ATOM 7137  O O    . GLU A 1 151 ? 1.781   10.755  9.869   1.00 0.00 ? 151 GLU A O    3  
ATOM 7138  C CB   . GLU A 1 151 ? -1.064  9.248   10.303  1.00 0.00 ? 151 GLU A CB   3  
ATOM 7139  C CG   . GLU A 1 151 ? -0.910  9.878   11.713  1.00 0.00 ? 151 GLU A CG   3  
ATOM 7140  C CD   . GLU A 1 151 ? -2.224  9.981   12.482  1.00 0.00 ? 151 GLU A CD   3  
ATOM 7141  O OE1  . GLU A 1 151 ? -2.628  8.980   13.112  1.00 0.00 ? 151 GLU A OE1  3  
ATOM 7142  O OE2  . GLU A 1 151 ? -2.844  11.065  12.474  1.00 0.00 ? 151 GLU A OE2  3  
ATOM 7143  H H    . GLU A 1 151 ? 1.115   7.922   11.190  1.00 0.00 ? 151 GLU A H    3  
ATOM 7144  H HA   . GLU A 1 151 ? -0.191  8.467   8.516   1.00 0.00 ? 151 GLU A HA   3  
ATOM 7145  H HB2  . GLU A 1 151 ? -1.721  9.908   9.701   1.00 0.00 ? 151 GLU A HB2  3  
ATOM 7146  H HB3  . GLU A 1 151 ? -1.652  8.314   10.405  1.00 0.00 ? 151 GLU A HB3  3  
ATOM 7147  H HG2  . GLU A 1 151 ? -0.217  9.291   12.338  1.00 0.00 ? 151 GLU A HG2  3  
ATOM 7148  H HG3  . GLU A 1 151 ? -0.470  10.889  11.641  1.00 0.00 ? 151 GLU A HG3  3  
ATOM 7149  N N    . ASP A 1 152 ? 1.026   10.520  7.747   1.00 0.00 ? 152 ASP A N    3  
ATOM 7150  C CA   . ASP A 1 152 ? 1.812   11.621  7.107   1.00 0.00 ? 152 ASP A CA   3  
ATOM 7151  C C    . ASP A 1 152 ? 3.355   11.367  7.137   1.00 0.00 ? 152 ASP A C    3  
ATOM 7152  O O    . ASP A 1 152 ? 3.882   10.660  6.271   1.00 0.00 ? 152 ASP A O    3  
ATOM 7153  C CB   . ASP A 1 152 ? 1.296   13.021  7.590   1.00 0.00 ? 152 ASP A CB   3  
ATOM 7154  C CG   . ASP A 1 152 ? 0.193   13.585  6.694   1.00 0.00 ? 152 ASP A CG   3  
ATOM 7155  O OD1  . ASP A 1 152 ? 0.439   13.746  5.476   1.00 0.00 ? 152 ASP A OD1  3  
ATOM 7156  O OD2  . ASP A 1 152 ? -0.914  13.877  7.192   1.00 0.00 ? 152 ASP A OD2  3  
ATOM 7157  H H    . ASP A 1 152 ? 0.341   9.988   7.200   1.00 0.00 ? 152 ASP A H    3  
ATOM 7158  H HA   . ASP A 1 152 ? 1.664   11.585  6.036   1.00 0.00 ? 152 ASP A HA   3  
ATOM 7159  H HB2  . ASP A 1 152 ? 0.963   13.012  8.644   1.00 0.00 ? 152 ASP A HB2  3  
ATOM 7160  H HB3  . ASP A 1 152 ? 2.106   13.770  7.552   1.00 0.00 ? 152 ASP A HB3  3  
ATOM 7161  N N    . GLU A 1 153 ? 4.047   11.984  8.082   1.00 0.00 ? 153 GLU A N    3  
ATOM 7162  C CA   . GLU A 1 153 ? 5.527   11.915  8.207   1.00 0.00 ? 153 GLU A CA   3  
ATOM 7163  C C    . GLU A 1 153 ? 6.018   10.746  9.113   1.00 0.00 ? 153 GLU A C    3  
ATOM 7164  O O    . GLU A 1 153 ? 6.606   9.778   8.575   1.00 0.00 ? 153 GLU A O    3  
ATOM 7165  C CB   . GLU A 1 153 ? 6.074   13.279  8.729   1.00 0.00 ? 153 GLU A CB   3  
ATOM 7166  C CG   . GLU A 1 153 ? 6.411   14.335  7.639   1.00 0.00 ? 153 GLU A CG   3  
ATOM 7167  C CD   . GLU A 1 153 ? 7.522   13.952  6.659   1.00 0.00 ? 153 GLU A CD   3  
ATOM 7168  O OE1  . GLU A 1 153 ? 8.564   13.401  7.077   1.00 0.00 ? 153 GLU A OE1  3  
ATOM 7169  O OE2  . GLU A 1 153 ? 7.332   14.111  5.438   1.00 0.00 ? 153 GLU A OE2  3  
ATOM 7170  O OXT  . GLU A 1 153 ? 5.872   10.802  10.357  1.00 0.00 ? 153 GLU A OXT  3  
ATOM 7171  H H    . GLU A 1 153 ? 3.369   12.495  8.645   1.00 0.00 ? 153 GLU A H    3  
ATOM 7172  H HA   . GLU A 1 153 ? 5.942   11.739  7.204   1.00 0.00 ? 153 GLU A HA   3  
ATOM 7173  H HB2  . GLU A 1 153 ? 5.386   13.702  9.485   1.00 0.00 ? 153 GLU A HB2  3  
ATOM 7174  H HB3  . GLU A 1 153 ? 7.008   13.106  9.302   1.00 0.00 ? 153 GLU A HB3  3  
ATOM 7175  H HG2  . GLU A 1 153 ? 5.505   14.575  7.055   1.00 0.00 ? 153 GLU A HG2  3  
ATOM 7176  H HG3  . GLU A 1 153 ? 6.716   15.280  8.117   1.00 0.00 ? 153 GLU A HG3  3  
ATOM 7177  N N    . MET A 1 1   ? -8.568  5.747   -1.163  1.00 0.00 ? 1   MET A N    4  
ATOM 7178  C CA   . MET A 1 1   ? -8.817  5.900   -2.628  1.00 0.00 ? 1   MET A CA   4  
ATOM 7179  C C    . MET A 1 1   ? -10.275 6.413   -2.885  1.00 0.00 ? 1   MET A C    4  
ATOM 7180  O O    . MET A 1 1   ? -11.158 5.659   -3.300  1.00 0.00 ? 1   MET A O    4  
ATOM 7181  C CB   . MET A 1 1   ? -8.485  4.534   -3.296  1.00 0.00 ? 1   MET A CB   4  
ATOM 7182  C CG   . MET A 1 1   ? -8.132  4.613   -4.795  1.00 0.00 ? 1   MET A CG   4  
ATOM 7183  S SD   . MET A 1 1   ? -9.504  5.238   -5.792  1.00 0.00 ? 1   MET A SD   4  
ATOM 7184  C CE   . MET A 1 1   ? -8.893  6.881   -6.209  1.00 0.00 ? 1   MET A CE   4  
ATOM 7185  H H1   . MET A 1 1   ? -9.172  5.075   -0.682  1.00 0.00 ? 1   MET A H1   4  
ATOM 7186  H H2   . MET A 1 1   ? -7.584  5.532   -0.926  1.00 0.00 ? 1   MET A H2   4  
ATOM 7187  H H3   . MET A 1 1   ? -8.659  6.677   -0.666  1.00 0.00 ? 1   MET A H3   4  
ATOM 7188  H HA   . MET A 1 1   ? -8.135  6.676   -3.035  1.00 0.00 ? 1   MET A HA   4  
ATOM 7189  H HB2  . MET A 1 1   ? -7.626  4.039   -2.798  1.00 0.00 ? 1   MET A HB2  4  
ATOM 7190  H HB3  . MET A 1 1   ? -9.327  3.828   -3.161  1.00 0.00 ? 1   MET A HB3  4  
ATOM 7191  H HG2  . MET A 1 1   ? -7.221  5.214   -4.972  1.00 0.00 ? 1   MET A HG2  4  
ATOM 7192  H HG3  . MET A 1 1   ? -7.887  3.601   -5.168  1.00 0.00 ? 1   MET A HG3  4  
ATOM 7193  H HE1  . MET A 1 1   ? -7.883  6.826   -6.653  1.00 0.00 ? 1   MET A HE1  4  
ATOM 7194  H HE2  . MET A 1 1   ? -9.553  7.368   -6.947  1.00 0.00 ? 1   MET A HE2  4  
ATOM 7195  H HE3  . MET A 1 1   ? -8.845  7.532   -5.318  1.00 0.00 ? 1   MET A HE3  4  
ATOM 7196  N N    . ARG A 1 2   ? -10.502 7.709   -2.602  1.00 0.00 ? 2   ARG A N    4  
ATOM 7197  C CA   . ARG A 1 2   ? -11.808 8.421   -2.749  1.00 0.00 ? 2   ARG A CA   4  
ATOM 7198  C C    . ARG A 1 2   ? -11.615 9.811   -2.018  1.00 0.00 ? 2   ARG A C    4  
ATOM 7199  O O    . ARG A 1 2   ? -11.442 9.796   -0.793  1.00 0.00 ? 2   ARG A O    4  
ATOM 7200  C CB   . ARG A 1 2   ? -13.070 7.657   -2.215  1.00 0.00 ? 2   ARG A CB   4  
ATOM 7201  C CG   . ARG A 1 2   ? -12.981 6.895   -0.860  1.00 0.00 ? 2   ARG A CG   4  
ATOM 7202  C CD   . ARG A 1 2   ? -13.970 7.316   0.241   1.00 0.00 ? 2   ARG A CD   4  
ATOM 7203  N NE   . ARG A 1 2   ? -13.592 8.677   0.704   1.00 0.00 ? 2   ARG A NE   4  
ATOM 7204  C CZ   . ARG A 1 2   ? -13.479 9.086   1.962   1.00 0.00 ? 2   ARG A CZ   4  
ATOM 7205  N NH1  . ARG A 1 2   ? -13.790 8.367   3.010   1.00 0.00 ? 2   ARG A NH1  4  
ATOM 7206  N NH2  . ARG A 1 2   ? -13.025 10.281  2.164   1.00 0.00 ? 2   ARG A NH2  4  
ATOM 7207  H H    . ARG A 1 2   ? -9.666  8.237   -2.260  1.00 0.00 ? 2   ARG A H    4  
ATOM 7208  H HA   . ARG A 1 2   ? -11.970 8.586   -3.823  1.00 0.00 ? 2   ARG A HA   4  
ATOM 7209  H HB2  . ARG A 1 2   ? -13.926 8.354   -2.205  1.00 0.00 ? 2   ARG A HB2  4  
ATOM 7210  H HB3  . ARG A 1 2   ? -13.360 6.922   -2.990  1.00 0.00 ? 2   ARG A HB3  4  
ATOM 7211  H HG2  . ARG A 1 2   ? -13.116 5.813   -1.060  1.00 0.00 ? 2   ARG A HG2  4  
ATOM 7212  H HG3  . ARG A 1 2   ? -11.950 6.962   -0.467  1.00 0.00 ? 2   ARG A HG3  4  
ATOM 7213  H HD2  . ARG A 1 2   ? -15.010 7.308   -0.142  1.00 0.00 ? 2   ARG A HD2  4  
ATOM 7214  H HD3  . ARG A 1 2   ? -13.945 6.556   1.048   1.00 0.00 ? 2   ARG A HD3  4  
ATOM 7215  H HE   . ARG A 1 2   ? -13.104 9.319   0.058   1.00 0.00 ? 2   ARG A HE   4  
ATOM 7216  H HH11 . ARG A 1 2   ? -14.166 7.440   2.808   1.00 0.00 ? 2   ARG A HH11 4  
ATOM 7217  H HH12 . ARG A 1 2   ? -13.625 8.793   3.928   1.00 0.00 ? 2   ARG A HH12 4  
ATOM 7218  H HH21 . ARG A 1 2   ? -12.862 10.857  1.320   1.00 0.00 ? 2   ARG A HH21 4  
ATOM 7219  H HH22 . ARG A 1 2   ? -12.879 10.549  3.148   1.00 0.00 ? 2   ARG A HH22 4  
ATOM 7220  N N    . PRO A 1 3   ? -11.681 11.019  -2.667  1.00 0.00 ? 3   PRO A N    4  
ATOM 7221  C CA   . PRO A 1 3   ? -11.421 12.337  -1.993  1.00 0.00 ? 3   PRO A CA   4  
ATOM 7222  C C    . PRO A 1 3   ? -12.194 12.733  -0.677  1.00 0.00 ? 3   PRO A C    4  
ATOM 7223  O O    . PRO A 1 3   ? -13.010 11.990  -0.122  1.00 0.00 ? 3   PRO A O    4  
ATOM 7224  C CB   . PRO A 1 3   ? -11.731 13.315  -3.154  1.00 0.00 ? 3   PRO A CB   4  
ATOM 7225  C CG   . PRO A 1 3   ? -11.380 12.561  -4.429  1.00 0.00 ? 3   PRO A CG   4  
ATOM 7226  C CD   . PRO A 1 3   ? -11.856 11.146  -4.133  1.00 0.00 ? 3   PRO A CD   4  
ATOM 7227  H HA   . PRO A 1 3   ? -10.343 12.374  -1.738  1.00 0.00 ? 3   PRO A HA   4  
ATOM 7228  H HB2  . PRO A 1 3   ? -12.807 13.588  -3.170  1.00 0.00 ? 3   PRO A HB2  4  
ATOM 7229  H HB3  . PRO A 1 3   ? -11.169 14.264  -3.069  1.00 0.00 ? 3   PRO A HB3  4  
ATOM 7230  H HG2  . PRO A 1 3   ? -11.857 12.990  -5.331  1.00 0.00 ? 3   PRO A HG2  4  
ATOM 7231  H HG3  . PRO A 1 3   ? -10.285 12.571  -4.598  1.00 0.00 ? 3   PRO A HG3  4  
ATOM 7232  H HD2  . PRO A 1 3   ? -12.920 11.017  -4.413  1.00 0.00 ? 3   PRO A HD2  4  
ATOM 7233  H HD3  . PRO A 1 3   ? -11.256 10.423  -4.719  1.00 0.00 ? 3   PRO A HD3  4  
ATOM 7234  N N    . SER A 1 4   ? -11.862 13.923  -0.139  1.00 0.00 ? 4   SER A N    4  
ATOM 7235  C CA   . SER A 1 4   ? -12.505 14.499  1.080   1.00 0.00 ? 4   SER A CA   4  
ATOM 7236  C C    . SER A 1 4   ? -12.468 16.062  1.026   1.00 0.00 ? 4   SER A C    4  
ATOM 7237  O O    . SER A 1 4   ? -11.486 16.654  0.562   1.00 0.00 ? 4   SER A O    4  
ATOM 7238  C CB   . SER A 1 4   ? -11.790 13.970  2.348   1.00 0.00 ? 4   SER A CB   4  
ATOM 7239  O OG   . SER A 1 4   ? -10.424 14.379  2.431   1.00 0.00 ? 4   SER A OG   4  
ATOM 7240  H H    . SER A 1 4   ? -11.184 14.463  -0.689  1.00 0.00 ? 4   SER A H    4  
ATOM 7241  H HA   . SER A 1 4   ? -13.566 14.180  1.117   1.00 0.00 ? 4   SER A HA   4  
ATOM 7242  H HB2  . SER A 1 4   ? -12.321 14.311  3.254   1.00 0.00 ? 4   SER A HB2  4  
ATOM 7243  H HB3  . SER A 1 4   ? -11.847 12.869  2.381   1.00 0.00 ? 4   SER A HB3  4  
ATOM 7244  H HG   . SER A 1 4   ? -10.044 14.247  1.556   1.00 0.00 ? 4   SER A HG   4  
ATOM 7245  N N    . GLY A 1 5   ? -13.534 16.742  1.494   1.00 0.00 ? 5   GLY A N    4  
ATOM 7246  C CA   . GLY A 1 5   ? -13.568 18.235  1.459   1.00 0.00 ? 5   GLY A CA   4  
ATOM 7247  C C    . GLY A 1 5   ? -14.824 19.011  1.920   1.00 0.00 ? 5   GLY A C    4  
ATOM 7248  O O    . GLY A 1 5   ? -14.686 20.190  2.257   1.00 0.00 ? 5   GLY A O    4  
ATOM 7249  H H    . GLY A 1 5   ? -14.289 16.162  1.872   1.00 0.00 ? 5   GLY A H    4  
ATOM 7250  H HA2  . GLY A 1 5   ? -12.719 18.617  2.059   1.00 0.00 ? 5   GLY A HA2  4  
ATOM 7251  H HA3  . GLY A 1 5   ? -13.353 18.577  0.429   1.00 0.00 ? 5   GLY A HA3  4  
ATOM 7252  N N    . ARG A 1 6   ? -16.042 18.452  1.831   1.00 0.00 ? 6   ARG A N    4  
ATOM 7253  C CA   . ARG A 1 6   ? -17.298 19.136  2.271   1.00 0.00 ? 6   ARG A CA   4  
ATOM 7254  C C    . ARG A 1 6   ? -17.823 18.468  3.589   1.00 0.00 ? 6   ARG A C    4  
ATOM 7255  O O    . ARG A 1 6   ? -17.896 17.240  3.698   1.00 0.00 ? 6   ARG A O    4  
ATOM 7256  C CB   . ARG A 1 6   ? -18.345 19.079  1.113   1.00 0.00 ? 6   ARG A CB   4  
ATOM 7257  C CG   . ARG A 1 6   ? -18.434 20.318  0.175   1.00 0.00 ? 6   ARG A CG   4  
ATOM 7258  C CD   . ARG A 1 6   ? -17.326 20.538  -0.881  1.00 0.00 ? 6   ARG A CD   4  
ATOM 7259  N NE   . ARG A 1 6   ? -16.088 21.078  -0.255  1.00 0.00 ? 6   ARG A NE   4  
ATOM 7260  C CZ   . ARG A 1 6   ? -15.085 21.684  -0.882  1.00 0.00 ? 6   ARG A CZ   4  
ATOM 7261  N NH1  . ARG A 1 6   ? -15.099 21.995  -2.154  1.00 0.00 ? 6   ARG A NH1  4  
ATOM 7262  N NH2  . ARG A 1 6   ? -14.029 21.982  -0.182  1.00 0.00 ? 6   ARG A NH2  4  
ATOM 7263  H H    . ARG A 1 6   ? -16.039 17.469  1.540   1.00 0.00 ? 6   ARG A H    4  
ATOM 7264  H HA   . ARG A 1 6   ? -17.104 20.205  2.496   1.00 0.00 ? 6   ARG A HA   4  
ATOM 7265  H HB2  . ARG A 1 6   ? -18.242 18.150  0.519   1.00 0.00 ? 6   ARG A HB2  4  
ATOM 7266  H HB3  . ARG A 1 6   ? -19.354 18.974  1.560   1.00 0.00 ? 6   ARG A HB3  4  
ATOM 7267  H HG2  . ARG A 1 6   ? -19.387 20.226  -0.383  1.00 0.00 ? 6   ARG A HG2  4  
ATOM 7268  H HG3  . ARG A 1 6   ? -18.578 21.241  0.772   1.00 0.00 ? 6   ARG A HG3  4  
ATOM 7269  H HD2  . ARG A 1 6   ? -17.114 19.589  -1.416  1.00 0.00 ? 6   ARG A HD2  4  
ATOM 7270  H HD3  . ARG A 1 6   ? -17.720 21.237  -1.646  1.00 0.00 ? 6   ARG A HD3  4  
ATOM 7271  H HE   . ARG A 1 6   ? -15.877 20.867  0.730   1.00 0.00 ? 6   ARG A HE   4  
ATOM 7272  H HH11 . ARG A 1 6   ? -15.955 21.728  -2.644  1.00 0.00 ? 6   ARG A HH11 4  
ATOM 7273  H HH12 . ARG A 1 6   ? -14.283 22.465  -2.550  1.00 0.00 ? 6   ARG A HH12 4  
ATOM 7274  H HH21 . ARG A 1 6   ? -14.050 21.697  0.805   1.00 0.00 ? 6   ARG A HH21 4  
ATOM 7275  H HH22 . ARG A 1 6   ? -13.259 22.451  -0.660  1.00 0.00 ? 6   ARG A HH22 4  
ATOM 7276  N N    . LYS A 1 7   ? -18.206 19.300  4.586   1.00 0.00 ? 7   LYS A N    4  
ATOM 7277  C CA   . LYS A 1 7   ? -18.676 18.857  5.949   1.00 0.00 ? 7   LYS A CA   4  
ATOM 7278  C C    . LYS A 1 7   ? -17.572 18.040  6.729   1.00 0.00 ? 7   LYS A C    4  
ATOM 7279  O O    . LYS A 1 7   ? -17.798 16.900  7.155   1.00 0.00 ? 7   LYS A O    4  
ATOM 7280  C CB   . LYS A 1 7   ? -20.030 18.076  5.851   1.00 0.00 ? 7   LYS A CB   4  
ATOM 7281  C CG   . LYS A 1 7   ? -21.264 18.885  5.381   1.00 0.00 ? 7   LYS A CG   4  
ATOM 7282  C CD   . LYS A 1 7   ? -22.537 18.010  5.337   1.00 0.00 ? 7   LYS A CD   4  
ATOM 7283  C CE   . LYS A 1 7   ? -23.793 18.797  4.916   1.00 0.00 ? 7   LYS A CE   4  
ATOM 7284  N NZ   . LYS A 1 7   ? -24.962 17.877  4.854   1.00 0.00 ? 7   LYS A NZ   4  
ATOM 7285  H H    . LYS A 1 7   ? -18.097 20.293  4.361   1.00 0.00 ? 7   LYS A H    4  
ATOM 7286  H HA   . LYS A 1 7   ? -18.856 19.760  6.563   1.00 0.00 ? 7   LYS A HA   4  
ATOM 7287  H HB2  . LYS A 1 7   ? -19.894 17.181  5.212   1.00 0.00 ? 7   LYS A HB2  4  
ATOM 7288  H HB3  . LYS A 1 7   ? -20.259 17.659  6.851   1.00 0.00 ? 7   LYS A HB3  4  
ATOM 7289  H HG2  . LYS A 1 7   ? -21.414 19.752  6.055   1.00 0.00 ? 7   LYS A HG2  4  
ATOM 7290  H HG3  . LYS A 1 7   ? -21.063 19.314  4.380   1.00 0.00 ? 7   LYS A HG3  4  
ATOM 7291  H HD2  . LYS A 1 7   ? -22.360 17.162  4.644   1.00 0.00 ? 7   LYS A HD2  4  
ATOM 7292  H HD3  . LYS A 1 7   ? -22.692 17.547  6.333   1.00 0.00 ? 7   LYS A HD3  4  
ATOM 7293  H HE2  . LYS A 1 7   ? -23.978 19.632  5.629   1.00 0.00 ? 7   LYS A HE2  4  
ATOM 7294  H HE3  . LYS A 1 7   ? -23.623 19.289  3.932   1.00 0.00 ? 7   LYS A HE3  4  
ATOM 7295  H HZ1  . LYS A 1 7   ? -25.141 17.407  5.752   1.00 0.00 ? 7   LYS A HZ1  4  
ATOM 7296  H HZ2  . LYS A 1 7   ? -25.842 18.343  4.596   1.00 0.00 ? 7   LYS A HZ2  4  
ATOM 7297  H HZ3  . LYS A 1 7   ? -24.830 17.119  4.171   1.00 0.00 ? 7   LYS A HZ3  4  
ATOM 7298  N N    . SER A 1 8   ? -16.394 18.671  6.964   1.00 0.00 ? 8   SER A N    4  
ATOM 7299  C CA   . SER A 1 8   ? -15.187 18.063  7.627   1.00 0.00 ? 8   SER A CA   4  
ATOM 7300  C C    . SER A 1 8   ? -14.555 16.908  6.768   1.00 0.00 ? 8   SER A C    4  
ATOM 7301  O O    . SER A 1 8   ? -15.256 16.073  6.187   1.00 0.00 ? 8   SER A O    4  
ATOM 7302  C CB   . SER A 1 8   ? -15.498 17.589  9.073   1.00 0.00 ? 8   SER A CB   4  
ATOM 7303  O OG   . SER A 1 8   ? -15.913 18.682  9.890   1.00 0.00 ? 8   SER A OG   4  
ATOM 7304  H H    . SER A 1 8   ? -16.348 19.602  6.536   1.00 0.00 ? 8   SER A H    4  
ATOM 7305  H HA   . SER A 1 8   ? -14.425 18.863  7.701   1.00 0.00 ? 8   SER A HA   4  
ATOM 7306  H HB2  . SER A 1 8   ? -16.271 16.801  9.095   1.00 0.00 ? 8   SER A HB2  4  
ATOM 7307  H HB3  . SER A 1 8   ? -14.599 17.133  9.532   1.00 0.00 ? 8   SER A HB3  4  
ATOM 7308  H HG   . SER A 1 8   ? -16.642 19.111  9.430   1.00 0.00 ? 8   SER A HG   4  
ATOM 7309  N N    . SER A 1 9   ? -13.214 16.826  6.708   1.00 0.00 ? 9   SER A N    4  
ATOM 7310  C CA   . SER A 1 9   ? -12.512 15.799  5.884   1.00 0.00 ? 9   SER A CA   4  
ATOM 7311  C C    . SER A 1 9   ? -12.232 14.476  6.671   1.00 0.00 ? 9   SER A C    4  
ATOM 7312  O O    . SER A 1 9   ? -11.465 14.460  7.637   1.00 0.00 ? 9   SER A O    4  
ATOM 7313  C CB   . SER A 1 9   ? -11.184 16.409  5.372   1.00 0.00 ? 9   SER A CB   4  
ATOM 7314  O OG   . SER A 1 9   ? -11.426 17.430  4.403   1.00 0.00 ? 9   SER A OG   4  
ATOM 7315  H H    . SER A 1 9   ? -12.695 17.555  7.209   1.00 0.00 ? 9   SER A H    4  
ATOM 7316  H HA   . SER A 1 9   ? -13.117 15.561  4.986   1.00 0.00 ? 9   SER A HA   4  
ATOM 7317  H HB2  . SER A 1 9   ? -10.573 16.806  6.208   1.00 0.00 ? 9   SER A HB2  4  
ATOM 7318  H HB3  . SER A 1 9   ? -10.562 15.620  4.902   1.00 0.00 ? 9   SER A HB3  4  
ATOM 7319  H HG   . SER A 1 9   ? -10.574 17.669  4.023   1.00 0.00 ? 9   SER A HG   4  
ATOM 7320  N N    . LYS A 1 10  ? -12.849 13.359  6.238   1.00 0.00 ? 10  LYS A N    4  
ATOM 7321  C CA   . LYS A 1 10  ? -12.611 12.011  6.839   1.00 0.00 ? 10  LYS A CA   4  
ATOM 7322  C C    . LYS A 1 10  ? -11.844 11.131  5.791   1.00 0.00 ? 10  LYS A C    4  
ATOM 7323  O O    . LYS A 1 10  ? -12.443 10.422  4.971   1.00 0.00 ? 10  LYS A O    4  
ATOM 7324  C CB   . LYS A 1 10  ? -13.975 11.402  7.287   1.00 0.00 ? 10  LYS A CB   4  
ATOM 7325  C CG   . LYS A 1 10  ? -14.497 11.885  8.674   1.00 0.00 ? 10  LYS A CG   4  
ATOM 7326  C CD   . LYS A 1 10  ? -15.950 12.414  8.696   1.00 0.00 ? 10  LYS A CD   4  
ATOM 7327  C CE   . LYS A 1 10  ? -16.062 13.834  8.115   1.00 0.00 ? 10  LYS A CE   4  
ATOM 7328  N NZ   . LYS A 1 10  ? -17.472 14.302  8.057   1.00 0.00 ? 10  LYS A NZ   4  
ATOM 7329  H H    . LYS A 1 10  ? -13.464 13.497  5.430   1.00 0.00 ? 10  LYS A H    4  
ATOM 7330  H HA   . LYS A 1 10  ? -11.972 12.074  7.745   1.00 0.00 ? 10  LYS A HA   4  
ATOM 7331  H HB2  . LYS A 1 10  ? -14.734 11.531  6.491   1.00 0.00 ? 10  LYS A HB2  4  
ATOM 7332  H HB3  . LYS A 1 10  ? -13.866 10.300  7.347   1.00 0.00 ? 10  LYS A HB3  4  
ATOM 7333  H HG2  . LYS A 1 10  ? -14.424 11.037  9.384   1.00 0.00 ? 10  LYS A HG2  4  
ATOM 7334  H HG3  . LYS A 1 10  ? -13.817 12.644  9.114   1.00 0.00 ? 10  LYS A HG3  4  
ATOM 7335  H HD2  . LYS A 1 10  ? -16.614 11.703  8.164   1.00 0.00 ? 10  LYS A HD2  4  
ATOM 7336  H HD3  . LYS A 1 10  ? -16.310 12.415  9.744   1.00 0.00 ? 10  LYS A HD3  4  
ATOM 7337  H HE2  . LYS A 1 10  ? -15.430 14.537  8.701   1.00 0.00 ? 10  LYS A HE2  4  
ATOM 7338  H HE3  . LYS A 1 10  ? -15.616 13.848  7.097   1.00 0.00 ? 10  LYS A HE3  4  
ATOM 7339  H HZ1  . LYS A 1 10  ? -17.928 14.341  8.976   1.00 0.00 ? 10  LYS A HZ1  4  
ATOM 7340  H HZ2  . LYS A 1 10  ? -17.561 15.265  7.655   1.00 0.00 ? 10  LYS A HZ2  4  
ATOM 7341  H HZ3  . LYS A 1 10  ? -18.067 13.711  7.464   1.00 0.00 ? 10  LYS A HZ3  4  
ATOM 7342  N N    . MET A 1 11  ? -10.500 11.214  5.832   1.00 0.00 ? 11  MET A N    4  
ATOM 7343  C CA   . MET A 1 11  ? -9.571  10.478  4.923   1.00 0.00 ? 11  MET A CA   4  
ATOM 7344  C C    . MET A 1 11  ? -8.152  10.451  5.581   1.00 0.00 ? 11  MET A C    4  
ATOM 7345  O O    . MET A 1 11  ? -7.640  11.496  6.000   1.00 0.00 ? 11  MET A O    4  
ATOM 7346  C CB   . MET A 1 11  ? -9.545  11.184  3.534   1.00 0.00 ? 11  MET A CB   4  
ATOM 7347  C CG   . MET A 1 11  ? -8.619  10.586  2.453   1.00 0.00 ? 11  MET A CG   4  
ATOM 7348  S SD   . MET A 1 11  ? -6.916  11.145  2.695   1.00 0.00 ? 11  MET A SD   4  
ATOM 7349  C CE   . MET A 1 11  ? -6.908  12.682  1.753   1.00 0.00 ? 11  MET A CE   4  
ATOM 7350  H H    . MET A 1 11  ? -10.127 11.849  6.548   1.00 0.00 ? 11  MET A H    4  
ATOM 7351  H HA   . MET A 1 11  ? -9.931  9.438   4.786   1.00 0.00 ? 11  MET A HA   4  
ATOM 7352  H HB2  . MET A 1 11  ? -10.567 11.176  3.124   1.00 0.00 ? 11  MET A HB2  4  
ATOM 7353  H HB3  . MET A 1 11  ? -9.298  12.257  3.658   1.00 0.00 ? 11  MET A HB3  4  
ATOM 7354  H HG2  . MET A 1 11  ? -8.643  9.479   2.462   1.00 0.00 ? 11  MET A HG2  4  
ATOM 7355  H HG3  . MET A 1 11  ? -8.952  10.874  1.437   1.00 0.00 ? 11  MET A HG3  4  
ATOM 7356  H HE1  . MET A 1 11  ? -7.147  12.492  0.691   1.00 0.00 ? 11  MET A HE1  4  
ATOM 7357  H HE2  . MET A 1 11  ? -7.646  13.397  2.159   1.00 0.00 ? 11  MET A HE2  4  
ATOM 7358  H HE3  . MET A 1 11  ? -5.911  13.155  1.802   1.00 0.00 ? 11  MET A HE3  4  
ATOM 7359  N N    . GLN A 1 12  ? -7.509  9.271   5.671   1.00 0.00 ? 12  GLN A N    4  
ATOM 7360  C CA   . GLN A 1 12  ? -6.130  9.160   6.234   1.00 0.00 ? 12  GLN A CA   4  
ATOM 7361  C C    . GLN A 1 12  ? -5.042  9.469   5.152   1.00 0.00 ? 12  GLN A C    4  
ATOM 7362  O O    . GLN A 1 12  ? -5.121  8.995   4.013   1.00 0.00 ? 12  GLN A O    4  
ATOM 7363  C CB   . GLN A 1 12  ? -5.884  7.727   6.777   1.00 0.00 ? 12  GLN A CB   4  
ATOM 7364  C CG   . GLN A 1 12  ? -6.551  7.392   8.132   1.00 0.00 ? 12  GLN A CG   4  
ATOM 7365  C CD   . GLN A 1 12  ? -6.121  6.032   8.694   1.00 0.00 ? 12  GLN A CD   4  
ATOM 7366  O OE1  . GLN A 1 12  ? -6.783  5.014   8.519   1.00 0.00 ? 12  GLN A OE1  4  
ATOM 7367  N NE2  . GLN A 1 12  ? -5.001  5.967   9.379   1.00 0.00 ? 12  GLN A NE2  4  
ATOM 7368  H H    . GLN A 1 12  ? -7.999  8.455   5.291   1.00 0.00 ? 12  GLN A H    4  
ATOM 7369  H HA   . GLN A 1 12  ? -6.009  9.867   7.083   1.00 0.00 ? 12  GLN A HA   4  
ATOM 7370  H HB2  . GLN A 1 12  ? -6.165  6.975   6.016   1.00 0.00 ? 12  GLN A HB2  4  
ATOM 7371  H HB3  . GLN A 1 12  ? -4.790  7.593   6.920   1.00 0.00 ? 12  GLN A HB3  4  
ATOM 7372  H HG2  . GLN A 1 12  ? -6.327  8.183   8.873   1.00 0.00 ? 12  GLN A HG2  4  
ATOM 7373  H HG3  . GLN A 1 12  ? -7.651  7.394   8.022   1.00 0.00 ? 12  GLN A HG3  4  
ATOM 7374  H HE21 . GLN A 1 12  ? -4.405  6.824   9.384   1.00 0.00 ? 12  GLN A HE21 4  
ATOM 7375  H HE22 . GLN A 1 12  ? -4.737  5.024   9.670   1.00 0.00 ? 12  GLN A HE22 4  
ATOM 7376  N N    . ALA A 1 13  ? -4.056  10.300  5.529   1.00 0.00 ? 13  ALA A N    4  
ATOM 7377  C CA   . ALA A 1 13  ? -2.878  10.619  4.686   1.00 0.00 ? 13  ALA A CA   4  
ATOM 7378  C C    . ALA A 1 13  ? -1.718  9.742   5.225   1.00 0.00 ? 13  ALA A C    4  
ATOM 7379  O O    . ALA A 1 13  ? -1.221  9.981   6.327   1.00 0.00 ? 13  ALA A O    4  
ATOM 7380  C CB   . ALA A 1 13  ? -2.598  12.129  4.767   1.00 0.00 ? 13  ALA A CB   4  
ATOM 7381  H H    . ALA A 1 13  ? -4.080  10.559  6.532   1.00 0.00 ? 13  ALA A H    4  
ATOM 7382  H HA   . ALA A 1 13  ? -3.073  10.358  3.633   1.00 0.00 ? 13  ALA A HA   4  
ATOM 7383  H HB1  . ALA A 1 13  ? -3.457  12.726  4.408   1.00 0.00 ? 13  ALA A HB1  4  
ATOM 7384  H HB2  . ALA A 1 13  ? -2.379  12.454  5.803   1.00 0.00 ? 13  ALA A HB2  4  
ATOM 7385  H HB3  . ALA A 1 13  ? -1.723  12.406  4.150   1.00 0.00 ? 13  ALA A HB3  4  
ATOM 7386  N N    . PHE A 1 14  ? -1.283  8.732   4.456   1.00 0.00 ? 14  PHE A N    4  
ATOM 7387  C CA   . PHE A 1 14  ? -0.365  7.686   4.983   1.00 0.00 ? 14  PHE A CA   4  
ATOM 7388  C C    . PHE A 1 14  ? 0.807   7.273   4.039   1.00 0.00 ? 14  PHE A C    4  
ATOM 7389  O O    . PHE A 1 14  ? 0.666   7.281   2.808   1.00 0.00 ? 14  PHE A O    4  
ATOM 7390  C CB   . PHE A 1 14  ? -1.337  6.500   5.249   1.00 0.00 ? 14  PHE A CB   4  
ATOM 7391  C CG   . PHE A 1 14  ? -0.961  5.557   6.378   1.00 0.00 ? 14  PHE A CG   4  
ATOM 7392  C CD1  . PHE A 1 14  ? -0.108  4.481   6.140   1.00 0.00 ? 14  PHE A CD1  4  
ATOM 7393  C CD2  . PHE A 1 14  ? -1.503  5.749   7.652   1.00 0.00 ? 14  PHE A CD2  4  
ATOM 7394  C CE1  . PHE A 1 14  ? 0.238   3.630   7.180   1.00 0.00 ? 14  PHE A CE1  4  
ATOM 7395  C CE2  . PHE A 1 14  ? -1.172  4.882   8.689   1.00 0.00 ? 14  PHE A CE2  4  
ATOM 7396  C CZ   . PHE A 1 14  ? -0.294  3.828   8.454   1.00 0.00 ? 14  PHE A CZ   4  
ATOM 7397  H H    . PHE A 1 14  ? -1.797  8.616   3.570   1.00 0.00 ? 14  PHE A H    4  
ATOM 7398  H HA   . PHE A 1 14  ? 0.089   8.019   5.938   1.00 0.00 ? 14  PHE A HA   4  
ATOM 7399  H HB2  . PHE A 1 14  ? -2.359  6.857   5.493   1.00 0.00 ? 14  PHE A HB2  4  
ATOM 7400  H HB3  . PHE A 1 14  ? -1.486  5.928   4.318   1.00 0.00 ? 14  PHE A HB3  4  
ATOM 7401  H HD1  . PHE A 1 14  ? 0.309   4.334   5.153   1.00 0.00 ? 14  PHE A HD1  4  
ATOM 7402  H HD2  . PHE A 1 14  ? -2.164  6.587   7.834   1.00 0.00 ? 14  PHE A HD2  4  
ATOM 7403  H HE1  . PHE A 1 14  ? 0.946   2.840   7.000   1.00 0.00 ? 14  PHE A HE1  4  
ATOM 7404  H HE2  . PHE A 1 14  ? -1.572  5.053   9.678   1.00 0.00 ? 14  PHE A HE2  4  
ATOM 7405  H HZ   . PHE A 1 14  ? 0.007   3.189   9.268   1.00 0.00 ? 14  PHE A HZ   4  
ATOM 7406  N N    . ARG A 1 15  ? 1.945   6.864   4.649   1.00 0.00 ? 15  ARG A N    4  
ATOM 7407  C CA   . ARG A 1 15  ? 3.152   6.384   3.919   1.00 0.00 ? 15  ARG A CA   4  
ATOM 7408  C C    . ARG A 1 15  ? 3.781   5.104   4.585   1.00 0.00 ? 15  ARG A C    4  
ATOM 7409  O O    . ARG A 1 15  ? 3.702   4.863   5.801   1.00 0.00 ? 15  ARG A O    4  
ATOM 7410  C CB   . ARG A 1 15  ? 4.189   7.552   3.800   1.00 0.00 ? 15  ARG A CB   4  
ATOM 7411  C CG   . ARG A 1 15  ? 5.169   7.904   4.950   1.00 0.00 ? 15  ARG A CG   4  
ATOM 7412  C CD   . ARG A 1 15  ? 4.474   8.485   6.189   1.00 0.00 ? 15  ARG A CD   4  
ATOM 7413  N NE   . ARG A 1 15  ? 5.433   9.138   7.115   1.00 0.00 ? 15  ARG A NE   4  
ATOM 7414  C CZ   . ARG A 1 15  ? 5.818   10.411  7.068   1.00 0.00 ? 15  ARG A CZ   4  
ATOM 7415  N NH1  . ARG A 1 15  ? 5.499   11.271  6.128   1.00 0.00 ? 15  ARG A NH1  4  
ATOM 7416  N NH2  . ARG A 1 15  ? 6.535   10.854  8.050   1.00 0.00 ? 15  ARG A NH2  4  
ATOM 7417  H H    . ARG A 1 15  ? 1.916   6.891   5.682   1.00 0.00 ? 15  ARG A H    4  
ATOM 7418  H HA   . ARG A 1 15  ? 2.849   6.096   2.891   1.00 0.00 ? 15  ARG A HA   4  
ATOM 7419  H HB2  . ARG A 1 15  ? 4.816   7.334   2.915   1.00 0.00 ? 15  ARG A HB2  4  
ATOM 7420  H HB3  . ARG A 1 15  ? 3.654   8.481   3.518   1.00 0.00 ? 15  ARG A HB3  4  
ATOM 7421  H HG2  . ARG A 1 15  ? 5.782   7.027   5.236   1.00 0.00 ? 15  ARG A HG2  4  
ATOM 7422  H HG3  . ARG A 1 15  ? 5.898   8.641   4.561   1.00 0.00 ? 15  ARG A HG3  4  
ATOM 7423  H HD2  . ARG A 1 15  ? 3.648   9.164   5.902   1.00 0.00 ? 15  ARG A HD2  4  
ATOM 7424  H HD3  . ARG A 1 15  ? 3.965   7.666   6.727   1.00 0.00 ? 15  ARG A HD3  4  
ATOM 7425  H HE   . ARG A 1 15  ? 5.749   8.680   7.984   1.00 0.00 ? 15  ARG A HE   4  
ATOM 7426  H HH11 . ARG A 1 15  ? 4.782   10.977  5.436   1.00 0.00 ? 15  ARG A HH11 4  
ATOM 7427  H HH12 . ARG A 1 15  ? 5.758   12.244  6.368   1.00 0.00 ? 15  ARG A HH12 4  
ATOM 7428  H HH21 . ARG A 1 15  ? 6.646   10.216  8.850   1.00 0.00 ? 15  ARG A HH21 4  
ATOM 7429  H HH22 . ARG A 1 15  ? 6.603   11.905  8.067   1.00 0.00 ? 15  ARG A HH22 4  
ATOM 7430  N N    . ILE A 1 16  ? 4.452   4.300   3.739   1.00 0.00 ? 16  ILE A N    4  
ATOM 7431  C CA   . ILE A 1 16  ? 5.163   3.052   4.154   1.00 0.00 ? 16  ILE A CA   4  
ATOM 7432  C C    . ILE A 1 16  ? 6.692   3.259   3.859   1.00 0.00 ? 16  ILE A C    4  
ATOM 7433  O O    . ILE A 1 16  ? 7.138   3.636   2.765   1.00 0.00 ? 16  ILE A O    4  
ATOM 7434  C CB   . ILE A 1 16  ? 4.603   1.738   3.485   1.00 0.00 ? 16  ILE A CB   4  
ATOM 7435  C CG1  . ILE A 1 16  ? 4.242   1.805   1.963   1.00 0.00 ? 16  ILE A CG1  4  
ATOM 7436  C CG2  . ILE A 1 16  ? 3.388   1.238   4.306   1.00 0.00 ? 16  ILE A CG2  4  
ATOM 7437  C CD1  . ILE A 1 16  ? 2.929   2.472   1.494   1.00 0.00 ? 16  ILE A CD1  4  
ATOM 7438  H H    . ILE A 1 16  ? 4.451   4.598   2.759   1.00 0.00 ? 16  ILE A H    4  
ATOM 7439  H HA   . ILE A 1 16  ? 5.055   2.925   5.252   1.00 0.00 ? 16  ILE A HA   4  
ATOM 7440  H HB   . ILE A 1 16  ? 5.387   0.955   3.563   1.00 0.00 ? 16  ILE A HB   4  
ATOM 7441  H HG12 . ILE A 1 16  ? 5.083   2.276   1.424   1.00 0.00 ? 16  ILE A HG12 4  
ATOM 7442  H HG13 . ILE A 1 16  ? 4.229   0.768   1.576   1.00 0.00 ? 16  ILE A HG13 4  
ATOM 7443  H HG21 . ILE A 1 16  ? 2.582   1.995   4.372   1.00 0.00 ? 16  ILE A HG21 4  
ATOM 7444  H HG22 . ILE A 1 16  ? 2.947   0.324   3.871   1.00 0.00 ? 16  ILE A HG22 4  
ATOM 7445  H HG23 . ILE A 1 16  ? 3.678   0.985   5.343   1.00 0.00 ? 16  ILE A HG23 4  
ATOM 7446  H HD11 . ILE A 1 16  ? 2.038   1.969   1.912   1.00 0.00 ? 16  ILE A HD11 4  
ATOM 7447  H HD12 . ILE A 1 16  ? 2.861   3.538   1.767   1.00 0.00 ? 16  ILE A HD12 4  
ATOM 7448  H HD13 . ILE A 1 16  ? 2.833   2.428   0.394   1.00 0.00 ? 16  ILE A HD13 4  
ATOM 7449  N N    . TRP A 1 17  ? 7.496   3.038   4.910   1.00 0.00 ? 17  TRP A N    4  
ATOM 7450  C CA   . TRP A 1 17  ? 8.970   3.274   4.915   1.00 0.00 ? 17  TRP A CA   4  
ATOM 7451  C C    . TRP A 1 17  ? 9.695   2.321   5.940   1.00 0.00 ? 17  TRP A C    4  
ATOM 7452  O O    . TRP A 1 17  ? 9.072   1.351   6.384   1.00 0.00 ? 17  TRP A O    4  
ATOM 7453  C CB   . TRP A 1 17  ? 9.119   4.813   5.176   1.00 0.00 ? 17  TRP A CB   4  
ATOM 7454  C CG   . TRP A 1 17  ? 8.751   5.466   6.525   1.00 0.00 ? 17  TRP A CG   4  
ATOM 7455  C CD1  . TRP A 1 17  ? 7.532   5.370   7.241   1.00 0.00 ? 17  TRP A CD1  4  
ATOM 7456  C CD2  . TRP A 1 17  ? 9.496   6.420   7.201   1.00 0.00 ? 17  TRP A CD2  4  
ATOM 7457  N NE1  . TRP A 1 17  ? 7.521   6.215   8.367   1.00 0.00 ? 17  TRP A NE1  4  
ATOM 7458  C CE2  . TRP A 1 17  ? 8.742   6.861   8.316   1.00 0.00 ? 17  TRP A CE2  4  
ATOM 7459  C CE3  . TRP A 1 17  ? 10.760  7.005   6.913   1.00 0.00 ? 17  TRP A CE3  4  
ATOM 7460  C CZ2  . TRP A 1 17  ? 9.249   7.875   9.161   1.00 0.00 ? 17  TRP A CZ2  4  
ATOM 7461  C CZ3  . TRP A 1 17  ? 11.240  8.002   7.763   1.00 0.00 ? 17  TRP A CZ3  4  
ATOM 7462  C CH2  . TRP A 1 17  ? 10.495  8.432   8.869   1.00 0.00 ? 17  TRP A CH2  4  
ATOM 7463  H H    . TRP A 1 17  ? 7.021   2.713   5.767   1.00 0.00 ? 17  TRP A H    4  
ATOM 7464  H HA   . TRP A 1 17  ? 9.394   3.020   3.925   1.00 0.00 ? 17  TRP A HA   4  
ATOM 7465  H HB2  . TRP A 1 17  ? 10.157  5.078   4.962   1.00 0.00 ? 17  TRP A HB2  4  
ATOM 7466  H HB3  . TRP A 1 17  ? 8.570   5.370   4.391   1.00 0.00 ? 17  TRP A HB3  4  
ATOM 7467  H HD1  . TRP A 1 17  ? 6.689   4.761   6.947   1.00 0.00 ? 17  TRP A HD1  4  
ATOM 7468  H HE1  . TRP A 1 17  ? 6.807   6.315   9.097   1.00 0.00 ? 17  TRP A HE1  4  
ATOM 7469  H HE3  . TRP A 1 17  ? 11.335  6.712   6.044   1.00 0.00 ? 17  TRP A HE3  4  
ATOM 7470  H HZ2  . TRP A 1 17  ? 8.679   8.220   10.011  1.00 0.00 ? 17  TRP A HZ2  4  
ATOM 7471  H HZ3  . TRP A 1 17  ? 12.197  8.457   7.555   1.00 0.00 ? 17  TRP A HZ3  4  
ATOM 7472  H HH2  . TRP A 1 17  ? 10.886  9.218   9.498   1.00 0.00 ? 17  TRP A HH2  4  
ATOM 7473  N N    . ASP A 1 18  ? 11.003  2.458   6.287   1.00 0.00 ? 18  ASP A N    4  
ATOM 7474  C CA   . ASP A 1 18  ? 11.589  1.632   7.393   1.00 0.00 ? 18  ASP A CA   4  
ATOM 7475  C C    . ASP A 1 18  ? 12.766  2.426   8.063   1.00 0.00 ? 18  ASP A C    4  
ATOM 7476  O O    . ASP A 1 18  ? 13.494  3.238   7.460   1.00 0.00 ? 18  ASP A O    4  
ATOM 7477  C CB   . ASP A 1 18  ? 11.902  0.147   6.971   1.00 0.00 ? 18  ASP A CB   4  
ATOM 7478  C CG   . ASP A 1 18  ? 13.280  -0.415  6.608   1.00 0.00 ? 18  ASP A CG   4  
ATOM 7479  O OD1  . ASP A 1 18  ? 14.322  0.150   6.985   1.00 0.00 ? 18  ASP A OD1  4  
ATOM 7480  O OD2  . ASP A 1 18  ? 13.329  -1.484  5.959   1.00 0.00 ? 18  ASP A OD2  4  
ATOM 7481  H H    . ASP A 1 18  ? 11.539  3.264   5.926   1.00 0.00 ? 18  ASP A H    4  
ATOM 7482  H HA   . ASP A 1 18  ? 10.807  1.565   8.176   1.00 0.00 ? 18  ASP A HA   4  
ATOM 7483  H HB2  . ASP A 1 18  ? 11.603  -0.478  7.829   1.00 0.00 ? 18  ASP A HB2  4  
ATOM 7484  H HB3  . ASP A 1 18  ? 11.199  -0.177  6.183   1.00 0.00 ? 18  ASP A HB3  4  
ATOM 7485  N N    . VAL A 1 19  ? 12.888  2.143   9.377   1.00 0.00 ? 19  VAL A N    4  
ATOM 7486  C CA   . VAL A 1 19  ? 13.883  2.761   10.311  1.00 0.00 ? 19  VAL A CA   4  
ATOM 7487  C C    . VAL A 1 19  ? 15.390  2.505   9.927   1.00 0.00 ? 19  VAL A C    4  
ATOM 7488  O O    . VAL A 1 19  ? 16.242  3.279   10.373  1.00 0.00 ? 19  VAL A O    4  
ATOM 7489  C CB   . VAL A 1 19  ? 13.526  2.242   11.762  1.00 0.00 ? 19  VAL A CB   4  
ATOM 7490  C CG1  . VAL A 1 19  ? 14.478  2.726   12.885  1.00 0.00 ? 19  VAL A CG1  4  
ATOM 7491  C CG2  . VAL A 1 19  ? 12.102  2.626   12.253  1.00 0.00 ? 19  VAL A CG2  4  
ATOM 7492  H H    . VAL A 1 19  ? 12.220  1.441   9.708   1.00 0.00 ? 19  VAL A H    4  
ATOM 7493  H HA   . VAL A 1 19  ? 13.758  3.861   10.287  1.00 0.00 ? 19  VAL A HA   4  
ATOM 7494  H HB   . VAL A 1 19  ? 13.590  1.135   11.750  1.00 0.00 ? 19  VAL A HB   4  
ATOM 7495  H HG11 . VAL A 1 19  ? 14.499  3.829   12.973  1.00 0.00 ? 19  VAL A HG11 4  
ATOM 7496  H HG12 . VAL A 1 19  ? 14.196  2.322   13.876  1.00 0.00 ? 19  VAL A HG12 4  
ATOM 7497  H HG13 . VAL A 1 19  ? 15.519  2.396   12.715  1.00 0.00 ? 19  VAL A HG13 4  
ATOM 7498  H HG21 . VAL A 1 19  ? 11.308  2.223   11.599  1.00 0.00 ? 19  VAL A HG21 4  
ATOM 7499  H HG22 . VAL A 1 19  ? 11.884  2.230   13.264  1.00 0.00 ? 19  VAL A HG22 4  
ATOM 7500  H HG23 . VAL A 1 19  ? 11.956  3.722   12.295  1.00 0.00 ? 19  VAL A HG23 4  
ATOM 7501  N N    . ASN A 1 20  ? 15.755  1.479   9.128   1.00 0.00 ? 20  ASN A N    4  
ATOM 7502  C CA   . ASN A 1 20  ? 17.159  1.274   8.659   1.00 0.00 ? 20  ASN A CA   4  
ATOM 7503  C C    . ASN A 1 20  ? 17.521  2.135   7.383   1.00 0.00 ? 20  ASN A C    4  
ATOM 7504  O O    . ASN A 1 20  ? 18.377  1.728   6.593   1.00 0.00 ? 20  ASN A O    4  
ATOM 7505  C CB   . ASN A 1 20  ? 17.344  -0.253  8.399   1.00 0.00 ? 20  ASN A CB   4  
ATOM 7506  C CG   . ASN A 1 20  ? 17.294  -1.183  9.616   1.00 0.00 ? 20  ASN A CG   4  
ATOM 7507  O OD1  . ASN A 1 20  ? 16.306  -1.857  9.883   1.00 0.00 ? 20  ASN A OD1  4  
ATOM 7508  N ND2  . ASN A 1 20  ? 18.358  -1.277  10.377  1.00 0.00 ? 20  ASN A ND2  4  
ATOM 7509  H H    . ASN A 1 20  ? 14.978  0.907   8.755   1.00 0.00 ? 20  ASN A H    4  
ATOM 7510  H HA   . ASN A 1 20  ? 17.878  1.587   9.443   1.00 0.00 ? 20  ASN A HA   4  
ATOM 7511  H HB2  . ASN A 1 20  ? 16.587  -0.605  7.676   1.00 0.00 ? 20  ASN A HB2  4  
ATOM 7512  H HB3  . ASN A 1 20  ? 18.307  -0.432  7.885   1.00 0.00 ? 20  ASN A HB3  4  
ATOM 7513  H HD21 . ASN A 1 20  ? 19.159  -0.689  10.136  1.00 0.00 ? 20  ASN A HD21 4  
ATOM 7514  H HD22 . ASN A 1 20  ? 18.246  -1.908  11.175  1.00 0.00 ? 20  ASN A HD22 4  
ATOM 7515  N N    . GLN A 1 21  ? 16.971  3.371   7.263   1.00 0.00 ? 21  GLN A N    4  
ATOM 7516  C CA   . GLN A 1 21  ? 17.199  4.349   6.152   1.00 0.00 ? 21  GLN A CA   4  
ATOM 7517  C C    . GLN A 1 21  ? 16.466  3.878   4.857   1.00 0.00 ? 21  GLN A C    4  
ATOM 7518  O O    . GLN A 1 21  ? 17.087  3.562   3.836   1.00 0.00 ? 21  GLN A O    4  
ATOM 7519  C CB   . GLN A 1 21  ? 18.716  4.656   5.932   1.00 0.00 ? 21  GLN A CB   4  
ATOM 7520  C CG   . GLN A 1 21  ? 19.405  5.391   7.109   1.00 0.00 ? 21  GLN A CG   4  
ATOM 7521  C CD   . GLN A 1 21  ? 20.834  5.841   6.803   1.00 0.00 ? 21  GLN A CD   4  
ATOM 7522  O OE1  . GLN A 1 21  ? 21.075  6.935   6.305   1.00 0.00 ? 21  GLN A OE1  4  
ATOM 7523  N NE2  . GLN A 1 21  ? 21.822  5.024   7.081   1.00 0.00 ? 21  GLN A NE2  4  
ATOM 7524  H H    . GLN A 1 21  ? 16.221  3.523   7.954   1.00 0.00 ? 21  GLN A H    4  
ATOM 7525  H HA   . GLN A 1 21  ? 16.715  5.305   6.430   1.00 0.00 ? 21  GLN A HA   4  
ATOM 7526  H HB2  . GLN A 1 21  ? 19.274  3.737   5.674   1.00 0.00 ? 21  GLN A HB2  4  
ATOM 7527  H HB3  . GLN A 1 21  ? 18.823  5.278   5.028   1.00 0.00 ? 21  GLN A HB3  4  
ATOM 7528  H HG2  . GLN A 1 21  ? 18.823  6.291   7.377   1.00 0.00 ? 21  GLN A HG2  4  
ATOM 7529  H HG3  . GLN A 1 21  ? 19.384  4.760   8.018   1.00 0.00 ? 21  GLN A HG3  4  
ATOM 7530  H HE21 . GLN A 1 21  ? 21.567  4.093   7.421   1.00 0.00 ? 21  GLN A HE21 4  
ATOM 7531  H HE22 . GLN A 1 21  ? 22.743  5.374   6.806   1.00 0.00 ? 21  GLN A HE22 4  
ATOM 7532  N N    . LYS A 1 22  ? 15.117  3.896   4.889   1.00 0.00 ? 22  LYS A N    4  
ATOM 7533  C CA   . LYS A 1 22  ? 14.283  3.452   3.770   1.00 0.00 ? 22  LYS A CA   4  
ATOM 7534  C C    . LYS A 1 22  ? 12.939  4.250   3.720   1.00 0.00 ? 22  LYS A C    4  
ATOM 7535  O O    . LYS A 1 22  ? 12.395  4.746   4.706   1.00 0.00 ? 22  LYS A O    4  
ATOM 7536  C CB   . LYS A 1 22  ? 13.968  1.934   4.009   1.00 0.00 ? 22  LYS A CB   4  
ATOM 7537  C CG   . LYS A 1 22  ? 15.080  0.897   3.709   1.00 0.00 ? 22  LYS A CG   4  
ATOM 7538  C CD   . LYS A 1 22  ? 14.497  -0.428  3.145   1.00 0.00 ? 22  LYS A CD   4  
ATOM 7539  C CE   . LYS A 1 22  ? 15.418  -1.655  3.223   1.00 0.00 ? 22  LYS A CE   4  
ATOM 7540  N NZ   . LYS A 1 22  ? 15.540  -2.080  4.644   1.00 0.00 ? 22  LYS A NZ   4  
ATOM 7541  H H    . LYS A 1 22  ? 14.619  4.116   5.760   1.00 0.00 ? 22  LYS A H    4  
ATOM 7542  H HA   . LYS A 1 22  ? 14.848  3.656   2.806   1.00 0.00 ? 22  LYS A HA   4  
ATOM 7543  H HB2  . LYS A 1 22  ? 13.645  1.795   5.059   1.00 0.00 ? 22  LYS A HB2  4  
ATOM 7544  H HB3  . LYS A 1 22  ? 13.050  1.652   3.459   1.00 0.00 ? 22  LYS A HB3  4  
ATOM 7545  H HG2  . LYS A 1 22  ? 15.844  1.306   3.021   1.00 0.00 ? 22  LYS A HG2  4  
ATOM 7546  H HG3  . LYS A 1 22  ? 15.634  0.723   4.654   1.00 0.00 ? 22  LYS A HG3  4  
ATOM 7547  H HD2  . LYS A 1 22  ? 13.535  -0.667  3.643   1.00 0.00 ? 22  LYS A HD2  4  
ATOM 7548  H HD3  . LYS A 1 22  ? 14.199  -0.283  2.091   1.00 0.00 ? 22  LYS A HD3  4  
ATOM 7549  H HE2  . LYS A 1 22  ? 14.995  -2.484  2.609   1.00 0.00 ? 22  LYS A HE2  4  
ATOM 7550  H HE3  . LYS A 1 22  ? 16.411  -1.455  2.763   1.00 0.00 ? 22  LYS A HE3  4  
ATOM 7551  H HZ1  . LYS A 1 22  ? 14.639  -1.908  5.180   1.00 0.00 ? 22  LYS A HZ1  4  
ATOM 7552  H HZ2  . LYS A 1 22  ? 15.801  -3.069  4.756   1.00 0.00 ? 22  LYS A HZ2  4  
ATOM 7553  H HZ3  . LYS A 1 22  ? 16.221  -1.524  5.172   1.00 0.00 ? 22  LYS A HZ3  4  
ATOM 7554  N N    . THR A 1 23  ? 12.419  4.237   2.502   1.00 0.00 ? 23  THR A N    4  
ATOM 7555  C CA   . THR A 1 23  ? 11.157  4.857   2.017   1.00 0.00 ? 23  THR A CA   4  
ATOM 7556  C C    . THR A 1 23  ? 10.697  4.019   0.770   1.00 0.00 ? 23  THR A C    4  
ATOM 7557  O O    . THR A 1 23  ? 11.514  3.656   -0.085  1.00 0.00 ? 23  THR A O    4  
ATOM 7558  C CB   . THR A 1 23  ? 11.344  6.359   1.630   1.00 0.00 ? 23  THR A CB   4  
ATOM 7559  O OG1  . THR A 1 23  ? 12.504  6.551   0.824   1.00 0.00 ? 23  THR A OG1  4  
ATOM 7560  C CG2  . THR A 1 23  ? 11.512  7.295   2.832   1.00 0.00 ? 23  THR A CG2  4  
ATOM 7561  H H    . THR A 1 23  ? 13.076  3.780   1.866   1.00 0.00 ? 23  THR A H    4  
ATOM 7562  H HA   . THR A 1 23  ? 10.378  4.787   2.790   1.00 0.00 ? 23  THR A HA   4  
ATOM 7563  H HB   . THR A 1 23  ? 10.448  6.687   1.063   1.00 0.00 ? 23  THR A HB   4  
ATOM 7564  H HG1  . THR A 1 23  ? 12.965  5.699   0.763   1.00 0.00 ? 23  THR A HG1  4  
ATOM 7565  H HG21 . THR A 1 23  ? 10.705  7.168   3.573   1.00 0.00 ? 23  THR A HG21 4  
ATOM 7566  H HG22 . THR A 1 23  ? 12.476  7.123   3.346   1.00 0.00 ? 23  THR A HG22 4  
ATOM 7567  H HG23 . THR A 1 23  ? 11.497  8.346   2.501   1.00 0.00 ? 23  THR A HG23 4  
ATOM 7568  N N    . PHE A 1 24  ? 9.405   3.671   0.632   1.00 0.00 ? 24  PHE A N    4  
ATOM 7569  C CA   . PHE A 1 24  ? 8.929   2.876   -0.549  1.00 0.00 ? 24  PHE A CA   4  
ATOM 7570  C C    . PHE A 1 24  ? 8.556   3.850   -1.723  1.00 0.00 ? 24  PHE A C    4  
ATOM 7571  O O    . PHE A 1 24  ? 7.840   4.829   -1.488  1.00 0.00 ? 24  PHE A O    4  
ATOM 7572  C CB   . PHE A 1 24  ? 7.714   2.005   -0.120  1.00 0.00 ? 24  PHE A CB   4  
ATOM 7573  C CG   . PHE A 1 24  ? 7.881   0.802   0.853   1.00 0.00 ? 24  PHE A CG   4  
ATOM 7574  C CD1  . PHE A 1 24  ? 8.863   0.721   1.855   1.00 0.00 ? 24  PHE A CD1  4  
ATOM 7575  C CD2  . PHE A 1 24  ? 6.916   -0.212  0.782   1.00 0.00 ? 24  PHE A CD2  4  
ATOM 7576  C CE1  . PHE A 1 24  ? 8.868   -0.332  2.765   1.00 0.00 ? 24  PHE A CE1  4  
ATOM 7577  C CE2  . PHE A 1 24  ? 6.920   -1.264  1.694   1.00 0.00 ? 24  PHE A CE2  4  
ATOM 7578  C CZ   . PHE A 1 24  ? 7.896   -1.322  2.682   1.00 0.00 ? 24  PHE A CZ   4  
ATOM 7579  H H    . PHE A 1 24  ? 8.743   3.972   1.367   1.00 0.00 ? 24  PHE A H    4  
ATOM 7580  H HA   . PHE A 1 24  ? 9.720   2.185   -0.906  1.00 0.00 ? 24  PHE A HA   4  
ATOM 7581  H HB2  . PHE A 1 24  ? 6.935   2.675   0.289   1.00 0.00 ? 24  PHE A HB2  4  
ATOM 7582  H HB3  . PHE A 1 24  ? 7.260   1.618   -1.054  1.00 0.00 ? 24  PHE A HB3  4  
ATOM 7583  H HD1  . PHE A 1 24  ? 9.625   1.474   1.960   1.00 0.00 ? 24  PHE A HD1  4  
ATOM 7584  H HD2  . PHE A 1 24  ? 6.140   -0.178  0.030   1.00 0.00 ? 24  PHE A HD2  4  
ATOM 7585  H HE1  . PHE A 1 24  ? 9.621   -0.381  3.539   1.00 0.00 ? 24  PHE A HE1  4  
ATOM 7586  H HE2  . PHE A 1 24  ? 6.169   -2.039  1.639   1.00 0.00 ? 24  PHE A HE2  4  
ATOM 7587  H HZ   . PHE A 1 24  ? 7.908   -2.151  3.373   1.00 0.00 ? 24  PHE A HZ   4  
ATOM 7588  N N    . TYR A 1 25  ? 9.028   3.613   -2.972  1.00 0.00 ? 25  TYR A N    4  
ATOM 7589  C CA   . TYR A 1 25  ? 8.727   4.526   -4.127  1.00 0.00 ? 25  TYR A CA   4  
ATOM 7590  C C    . TYR A 1 25  ? 8.957   3.852   -5.529  1.00 0.00 ? 25  TYR A C    4  
ATOM 7591  O O    . TYR A 1 25  ? 9.980   3.203   -5.766  1.00 0.00 ? 25  TYR A O    4  
ATOM 7592  C CB   . TYR A 1 25  ? 9.544   5.855   -3.989  1.00 0.00 ? 25  TYR A CB   4  
ATOM 7593  C CG   . TYR A 1 25  ? 11.071  5.834   -3.771  1.00 0.00 ? 25  TYR A CG   4  
ATOM 7594  C CD1  . TYR A 1 25  ? 11.949  5.506   -4.810  1.00 0.00 ? 25  TYR A CD1  4  
ATOM 7595  C CD2  . TYR A 1 25  ? 11.593  6.239   -2.537  1.00 0.00 ? 25  TYR A CD2  4  
ATOM 7596  C CE1  . TYR A 1 25  ? 13.326  5.568   -4.611  1.00 0.00 ? 25  TYR A CE1  4  
ATOM 7597  C CE2  . TYR A 1 25  ? 12.970  6.336   -2.354  1.00 0.00 ? 25  TYR A CE2  4  
ATOM 7598  C CZ   . TYR A 1 25  ? 13.830  5.993   -3.388  1.00 0.00 ? 25  TYR A CZ   4  
ATOM 7599  O OH   . TYR A 1 25  ? 15.171  6.181   -3.239  1.00 0.00 ? 25  TYR A OH   4  
ATOM 7600  H H    . TYR A 1 25  ? 9.623   2.778   -3.080  1.00 0.00 ? 25  TYR A H    4  
ATOM 7601  H HA   . TYR A 1 25  ? 7.656   4.794   -4.088  1.00 0.00 ? 25  TYR A HA   4  
ATOM 7602  H HB2  . TYR A 1 25  ? 9.338   6.495   -4.860  1.00 0.00 ? 25  TYR A HB2  4  
ATOM 7603  H HB3  . TYR A 1 25  ? 9.072   6.430   -3.168  1.00 0.00 ? 25  TYR A HB3  4  
ATOM 7604  H HD1  . TYR A 1 25  ? 11.569  5.219   -5.780  1.00 0.00 ? 25  TYR A HD1  4  
ATOM 7605  H HD2  . TYR A 1 25  ? 10.936  6.506   -1.721  1.00 0.00 ? 25  TYR A HD2  4  
ATOM 7606  H HE1  . TYR A 1 25  ? 14.009  5.330   -5.409  1.00 0.00 ? 25  TYR A HE1  4  
ATOM 7607  H HE2  . TYR A 1 25  ? 13.369  6.701   -1.419  1.00 0.00 ? 25  TYR A HE2  4  
ATOM 7608  H HH   . TYR A 1 25  ? 15.317  7.078   -2.875  1.00 0.00 ? 25  TYR A HH   4  
ATOM 7609  N N    . LEU A 1 26  ? 8.058   4.101   -6.511  1.00 0.00 ? 26  LEU A N    4  
ATOM 7610  C CA   . LEU A 1 26  ? 8.140   3.477   -7.864  1.00 0.00 ? 26  LEU A CA   4  
ATOM 7611  C C    . LEU A 1 26  ? 8.969   4.238   -8.951  1.00 0.00 ? 26  LEU A C    4  
ATOM 7612  O O    . LEU A 1 26  ? 9.343   5.406   -8.830  1.00 0.00 ? 26  LEU A O    4  
ATOM 7613  C CB   . LEU A 1 26  ? 6.675   3.182   -8.356  1.00 0.00 ? 26  LEU A CB   4  
ATOM 7614  C CG   . LEU A 1 26  ? 5.736   4.197   -9.081  1.00 0.00 ? 26  LEU A CG   4  
ATOM 7615  C CD1  . LEU A 1 26  ? 5.140   5.266   -8.158  1.00 0.00 ? 26  LEU A CD1  4  
ATOM 7616  C CD2  . LEU A 1 26  ? 6.235   4.873   -10.367 1.00 0.00 ? 26  LEU A CD2  4  
ATOM 7617  H H    . LEU A 1 26  ? 7.197   4.581   -6.186  1.00 0.00 ? 26  LEU A H    4  
ATOM 7618  H HA   . LEU A 1 26  ? 8.663   2.518   -7.741  1.00 0.00 ? 26  LEU A HA   4  
ATOM 7619  H HB2  . LEU A 1 26  ? 6.759   2.320   -9.045  1.00 0.00 ? 26  LEU A HB2  4  
ATOM 7620  H HB3  . LEU A 1 26  ? 6.101   2.745   -7.515  1.00 0.00 ? 26  LEU A HB3  4  
ATOM 7621  H HG   . LEU A 1 26  ? 4.910   3.556   -9.426  1.00 0.00 ? 26  LEU A HG   4  
ATOM 7622  H HD11 . LEU A 1 26  ? 5.924   5.839   -7.637  1.00 0.00 ? 26  LEU A HD11 4  
ATOM 7623  H HD12 . LEU A 1 26  ? 4.500   5.993   -8.692  1.00 0.00 ? 26  LEU A HD12 4  
ATOM 7624  H HD13 . LEU A 1 26  ? 4.501   4.813   -7.379  1.00 0.00 ? 26  LEU A HD13 4  
ATOM 7625  H HD21 . LEU A 1 26  ? 6.702   4.142   -11.044 1.00 0.00 ? 26  LEU A HD21 4  
ATOM 7626  H HD22 . LEU A 1 26  ? 5.409   5.353   -10.923 1.00 0.00 ? 26  LEU A HD22 4  
ATOM 7627  H HD23 . LEU A 1 26  ? 6.979   5.665   -10.162 1.00 0.00 ? 26  LEU A HD23 4  
ATOM 7628  N N    . ARG A 1 27  ? 9.244   3.502   -10.047 1.00 0.00 ? 27  ARG A N    4  
ATOM 7629  C CA   . ARG A 1 27  ? 9.919   4.019   -11.270 1.00 0.00 ? 27  ARG A CA   4  
ATOM 7630  C C    . ARG A 1 27  ? 9.312   3.193   -12.451 1.00 0.00 ? 27  ARG A C    4  
ATOM 7631  O O    . ARG A 1 27  ? 9.608   2.005   -12.619 1.00 0.00 ? 27  ARG A O    4  
ATOM 7632  C CB   . ARG A 1 27  ? 11.471  3.914   -11.168 1.00 0.00 ? 27  ARG A CB   4  
ATOM 7633  C CG   . ARG A 1 27  ? 12.095  5.119   -10.423 1.00 0.00 ? 27  ARG A CG   4  
ATOM 7634  C CD   . ARG A 1 27  ? 13.632  5.156   -10.399 1.00 0.00 ? 27  ARG A CD   4  
ATOM 7635  N NE   . ARG A 1 27  ? 14.068  6.465   -9.828  1.00 0.00 ? 27  ARG A NE   4  
ATOM 7636  C CZ   . ARG A 1 27  ? 14.333  7.572   -10.525 1.00 0.00 ? 27  ARG A CZ   4  
ATOM 7637  N NH1  . ARG A 1 27  ? 14.307  7.636   -11.832 1.00 0.00 ? 27  ARG A NH1  4  
ATOM 7638  N NH2  . ARG A 1 27  ? 14.632  8.650   -9.862  1.00 0.00 ? 27  ARG A NH2  4  
ATOM 7639  H H    . ARG A 1 27  ? 8.831   2.555   -10.004 1.00 0.00 ? 27  ARG A H    4  
ATOM 7640  H HA   . ARG A 1 27  ? 9.648   5.085   -11.418 1.00 0.00 ? 27  ARG A HA   4  
ATOM 7641  H HB2  . ARG A 1 27  ? 11.767  2.957   -10.694 1.00 0.00 ? 27  ARG A HB2  4  
ATOM 7642  H HB3  . ARG A 1 27  ? 11.902  3.871   -12.187 1.00 0.00 ? 27  ARG A HB3  4  
ATOM 7643  H HG2  . ARG A 1 27  ? 11.709  6.054   -10.878 1.00 0.00 ? 27  ARG A HG2  4  
ATOM 7644  H HG3  . ARG A 1 27  ? 11.727  5.140   -9.379  1.00 0.00 ? 27  ARG A HG3  4  
ATOM 7645  H HD2  . ARG A 1 27  ? 14.014  4.329   -9.766  1.00 0.00 ? 27  ARG A HD2  4  
ATOM 7646  H HD3  . ARG A 1 27  ? 14.069  4.958   -11.399 1.00 0.00 ? 27  ARG A HD3  4  
ATOM 7647  H HE   . ARG A 1 27  ? 14.146  6.610   -8.811  1.00 0.00 ? 27  ARG A HE   4  
ATOM 7648  H HH11 . ARG A 1 27  ? 14.088  6.747   -12.285 1.00 0.00 ? 27  ARG A HH11 4  
ATOM 7649  H HH12 . ARG A 1 27  ? 14.551  8.519   -12.284 1.00 0.00 ? 27  ARG A HH12 4  
ATOM 7650  H HH21 . ARG A 1 27  ? 14.679  8.533   -8.838  1.00 0.00 ? 27  ARG A HH21 4  
ATOM 7651  H HH22 . ARG A 1 27  ? 14.834  9.499   -10.392 1.00 0.00 ? 27  ARG A HH22 4  
ATOM 7652  N N    . ASN A 1 28  ? 8.414   3.828   -13.246 1.00 0.00 ? 28  ASN A N    4  
ATOM 7653  C CA   . ASN A 1 28  ? 7.629   3.174   -14.352 1.00 0.00 ? 28  ASN A CA   4  
ATOM 7654  C C    . ASN A 1 28  ? 6.769   1.963   -13.812 1.00 0.00 ? 28  ASN A C    4  
ATOM 7655  O O    . ASN A 1 28  ? 6.978   0.805   -14.181 1.00 0.00 ? 28  ASN A O    4  
ATOM 7656  C CB   . ASN A 1 28  ? 8.608   2.820   -15.516 1.00 0.00 ? 28  ASN A CB   4  
ATOM 7657  C CG   . ASN A 1 28  ? 7.935   2.464   -16.844 1.00 0.00 ? 28  ASN A CG   4  
ATOM 7658  O OD1  . ASN A 1 28  ? 7.731   1.306   -17.183 1.00 0.00 ? 28  ASN A OD1  4  
ATOM 7659  N ND2  . ASN A 1 28  ? 7.575   3.436   -17.648 1.00 0.00 ? 28  ASN A ND2  4  
ATOM 7660  H H    . ASN A 1 28  ? 8.267   4.812   -12.998 1.00 0.00 ? 28  ASN A H    4  
ATOM 7661  H HA   . ASN A 1 28  ? 6.897   3.915   -14.729 1.00 0.00 ? 28  ASN A HA   4  
ATOM 7662  H HB2  . ASN A 1 28  ? 9.322   3.648   -15.692 1.00 0.00 ? 28  ASN A HB2  4  
ATOM 7663  H HB3  . ASN A 1 28  ? 9.245   1.966   -15.222 1.00 0.00 ? 28  ASN A HB3  4  
ATOM 7664  H HD21 . ASN A 1 28  ? 7.835   4.390   -17.385 1.00 0.00 ? 28  ASN A HD21 4  
ATOM 7665  H HD22 . ASN A 1 28  ? 7.170   3.108   -18.530 1.00 0.00 ? 28  ASN A HD22 4  
ATOM 7666  N N    . ASN A 1 29  ? 5.818   2.252   -12.892 1.00 0.00 ? 29  ASN A N    4  
ATOM 7667  C CA   . ASN A 1 29  ? 4.956   1.248   -12.170 1.00 0.00 ? 29  ASN A CA   4  
ATOM 7668  C C    . ASN A 1 29  ? 5.707   0.187   -11.258 1.00 0.00 ? 29  ASN A C    4  
ATOM 7669  O O    . ASN A 1 29  ? 5.043   -0.491  -10.469 1.00 0.00 ? 29  ASN A O    4  
ATOM 7670  C CB   . ASN A 1 29  ? 4.000   0.551   -13.193 1.00 0.00 ? 29  ASN A CB   4  
ATOM 7671  C CG   . ASN A 1 29  ? 2.640   0.134   -12.606 1.00 0.00 ? 29  ASN A CG   4  
ATOM 7672  O OD1  . ASN A 1 29  ? 2.445   -0.969  -12.107 1.00 0.00 ? 29  ASN A OD1  4  
ATOM 7673  N ND2  . ASN A 1 29  ? 1.659   1.007   -12.636 1.00 0.00 ? 29  ASN A ND2  4  
ATOM 7674  H H    . ASN A 1 29  ? 5.755   3.252   -12.680 1.00 0.00 ? 29  ASN A H    4  
ATOM 7675  H HA   . ASN A 1 29  ? 4.354   1.833   -11.451 1.00 0.00 ? 29  ASN A HA   4  
ATOM 7676  H HB2  . ASN A 1 29  ? 3.814   1.197   -14.072 1.00 0.00 ? 29  ASN A HB2  4  
ATOM 7677  H HB3  . ASN A 1 29  ? 4.489   -0.343  -13.625 1.00 0.00 ? 29  ASN A HB3  4  
ATOM 7678  H HD21 . ASN A 1 29  ? 1.861   1.919   -13.054 1.00 0.00 ? 29  ASN A HD21 4  
ATOM 7679  H HD22 . ASN A 1 29  ? 0.792   0.712   -12.175 1.00 0.00 ? 29  ASN A HD22 4  
ATOM 7680  N N    . GLN A 1 30  ? 7.048   0.051   -11.303 1.00 0.00 ? 30  GLN A N    4  
ATOM 7681  C CA   . GLN A 1 30  ? 7.813   -0.939  -10.497 1.00 0.00 ? 30  GLN A CA   4  
ATOM 7682  C C    . GLN A 1 30  ? 8.219   -0.265  -9.155  1.00 0.00 ? 30  GLN A C    4  
ATOM 7683  O O    . GLN A 1 30  ? 8.999   0.689   -9.118  1.00 0.00 ? 30  GLN A O    4  
ATOM 7684  C CB   . GLN A 1 30  ? 9.079   -1.393  -11.255 1.00 0.00 ? 30  GLN A CB   4  
ATOM 7685  C CG   . GLN A 1 30  ? 8.870   -2.036  -12.654 1.00 0.00 ? 30  GLN A CG   4  
ATOM 7686  C CD   . GLN A 1 30  ? 10.142  -2.115  -13.500 1.00 0.00 ? 30  GLN A CD   4  
ATOM 7687  O OE1  . GLN A 1 30  ? 10.835  -3.125  -13.548 1.00 0.00 ? 30  GLN A OE1  4  
ATOM 7688  N NE2  . GLN A 1 30  ? 10.485  -1.056  -14.196 1.00 0.00 ? 30  GLN A NE2  4  
ATOM 7689  H H    . GLN A 1 30  ? 7.511   0.665   -11.987 1.00 0.00 ? 30  GLN A H    4  
ATOM 7690  H HA   . GLN A 1 30  ? 7.194   -1.843  -10.320 1.00 0.00 ? 30  GLN A HA   4  
ATOM 7691  H HB2  . GLN A 1 30  ? 9.729   -0.508  -11.314 1.00 0.00 ? 30  GLN A HB2  4  
ATOM 7692  H HB3  . GLN A 1 30  ? 9.652   -2.104  -10.626 1.00 0.00 ? 30  GLN A HB3  4  
ATOM 7693  H HG2  . GLN A 1 30  ? 8.465   -3.057  -12.536 1.00 0.00 ? 30  GLN A HG2  4  
ATOM 7694  H HG3  . GLN A 1 30  ? 8.096   -1.495  -13.231 1.00 0.00 ? 30  GLN A HG3  4  
ATOM 7695  H HE21 . GLN A 1 30  ? 9.913   -0.216  -14.060 1.00 0.00 ? 30  GLN A HE21 4  
ATOM 7696  H HE22 . GLN A 1 30  ? 11.360  -1.159  -14.717 1.00 0.00 ? 30  GLN A HE22 4  
ATOM 7697  N N    . LEU A 1 31  ? 7.671   -0.798  -8.071  1.00 0.00 ? 31  LEU A N    4  
ATOM 7698  C CA   . LEU A 1 31  ? 7.820   -0.240  -6.696  1.00 0.00 ? 31  LEU A CA   4  
ATOM 7699  C C    . LEU A 1 31  ? 9.186   -0.629  -6.035  1.00 0.00 ? 31  LEU A C    4  
ATOM 7700  O O    . LEU A 1 31  ? 9.351   -1.734  -5.496  1.00 0.00 ? 31  LEU A O    4  
ATOM 7701  C CB   . LEU A 1 31  ? 6.599   -0.746  -5.884  1.00 0.00 ? 31  LEU A CB   4  
ATOM 7702  C CG   . LEU A 1 31  ? 5.190   -0.230  -6.303  1.00 0.00 ? 31  LEU A CG   4  
ATOM 7703  C CD1  . LEU A 1 31  ? 4.141   -1.344  -6.186  1.00 0.00 ? 31  LEU A CD1  4  
ATOM 7704  C CD2  . LEU A 1 31  ? 4.758   0.972   -5.447  1.00 0.00 ? 31  LEU A CD2  4  
ATOM 7705  H H    . LEU A 1 31  ? 7.070   -1.582  -8.320  1.00 0.00 ? 31  LEU A H    4  
ATOM 7706  H HA   . LEU A 1 31  ? 7.745   0.863   -6.709  1.00 0.00 ? 31  LEU A HA   4  
ATOM 7707  H HB2  . LEU A 1 31  ? 6.625   -1.854  -5.867  1.00 0.00 ? 31  LEU A HB2  4  
ATOM 7708  H HB3  . LEU A 1 31  ? 6.760   -0.457  -4.831  1.00 0.00 ? 31  LEU A HB3  4  
ATOM 7709  H HG   . LEU A 1 31  ? 5.209   0.095   -7.363  1.00 0.00 ? 31  LEU A HG   4  
ATOM 7710  H HD11 . LEU A 1 31  ? 4.400   -2.216  -6.815  1.00 0.00 ? 31  LEU A HD11 4  
ATOM 7711  H HD12 . LEU A 1 31  ? 4.038   -1.706  -5.146  1.00 0.00 ? 31  LEU A HD12 4  
ATOM 7712  H HD13 . LEU A 1 31  ? 3.143   -1.006  -6.518  1.00 0.00 ? 31  LEU A HD13 4  
ATOM 7713  H HD21 . LEU A 1 31  ? 5.510   1.781   -5.473  1.00 0.00 ? 31  LEU A HD21 4  
ATOM 7714  H HD22 . LEU A 1 31  ? 3.809   1.423   -5.794  1.00 0.00 ? 31  LEU A HD22 4  
ATOM 7715  H HD23 . LEU A 1 31  ? 4.617   0.708   -4.383  1.00 0.00 ? 31  LEU A HD23 4  
ATOM 7716  N N    . VAL A 1 32  ? 10.167  0.296   -6.094  1.00 0.00 ? 32  VAL A N    4  
ATOM 7717  C CA   . VAL A 1 32  ? 11.542  0.079   -5.546  1.00 0.00 ? 32  VAL A CA   4  
ATOM 7718  C C    . VAL A 1 32  ? 11.539  0.339   -3.995  1.00 0.00 ? 32  VAL A C    4  
ATOM 7719  O O    . VAL A 1 32  ? 10.646  0.993   -3.433  1.00 0.00 ? 32  VAL A O    4  
ATOM 7720  C CB   . VAL A 1 32  ? 12.640  0.957   -6.284  1.00 0.00 ? 32  VAL A CB   4  
ATOM 7721  C CG1  . VAL A 1 32  ? 13.913  0.117   -6.480  1.00 0.00 ? 32  VAL A CG1  4  
ATOM 7722  C CG2  . VAL A 1 32  ? 12.307  1.550   -7.681  1.00 0.00 ? 32  VAL A CG2  4  
ATOM 7723  H H    . VAL A 1 32  ? 9.924   1.198   -6.526  1.00 0.00 ? 32  VAL A H    4  
ATOM 7724  H HA   . VAL A 1 32  ? 11.787  -0.990  -5.698  1.00 0.00 ? 32  VAL A HA   4  
ATOM 7725  H HB   . VAL A 1 32  ? 12.968  1.792   -5.629  1.00 0.00 ? 32  VAL A HB   4  
ATOM 7726  H HG11 . VAL A 1 32  ? 13.733  -0.808  -7.060  1.00 0.00 ? 32  VAL A HG11 4  
ATOM 7727  H HG12 . VAL A 1 32  ? 14.709  0.668   -7.008  1.00 0.00 ? 32  VAL A HG12 4  
ATOM 7728  H HG13 . VAL A 1 32  ? 14.344  -0.186  -5.509  1.00 0.00 ? 32  VAL A HG13 4  
ATOM 7729  H HG21 . VAL A 1 32  ? 11.998  0.766   -8.399  1.00 0.00 ? 32  VAL A HG21 4  
ATOM 7730  H HG22 . VAL A 1 32  ? 11.478  2.279   -7.628  1.00 0.00 ? 32  VAL A HG22 4  
ATOM 7731  H HG23 . VAL A 1 32  ? 13.161  2.091   -8.129  1.00 0.00 ? 32  VAL A HG23 4  
ATOM 7732  N N    . ALA A 1 33  ? 12.535  -0.220  -3.286  1.00 0.00 ? 33  ALA A N    4  
ATOM 7733  C CA   . ALA A 1 33  ? 12.596  -0.140  -1.817  1.00 0.00 ? 33  ALA A CA   4  
ATOM 7734  C C    . ALA A 1 33  ? 13.714  0.752   -1.291  1.00 0.00 ? 33  ALA A C    4  
ATOM 7735  O O    . ALA A 1 33  ? 14.900  0.640   -1.630  1.00 0.00 ? 33  ALA A O    4  
ATOM 7736  C CB   . ALA A 1 33  ? 12.944  -1.512  -1.206  1.00 0.00 ? 33  ALA A CB   4  
ATOM 7737  H H    . ALA A 1 33  ? 13.278  -0.716  -3.799  1.00 0.00 ? 33  ALA A H    4  
ATOM 7738  H HA   . ALA A 1 33  ? 11.613  0.168   -1.393  1.00 0.00 ? 33  ALA A HA   4  
ATOM 7739  H HB1  . ALA A 1 33  ? 12.263  -2.302  -1.541  1.00 0.00 ? 33  ALA A HB1  4  
ATOM 7740  H HB2  . ALA A 1 33  ? 13.984  -1.815  -1.462  1.00 0.00 ? 33  ALA A HB2  4  
ATOM 7741  H HB3  . ALA A 1 33  ? 12.924  -1.468  -0.099  1.00 0.00 ? 33  ALA A HB3  4  
ATOM 7742  N N    . GLY A 1 34  ? 13.312  1.462   -0.251  1.00 0.00 ? 34  GLY A N    4  
ATOM 7743  C CA   . GLY A 1 34  ? 14.259  2.123   0.605   1.00 0.00 ? 34  GLY A CA   4  
ATOM 7744  C C    . GLY A 1 34  ? 14.813  3.435   0.143   1.00 0.00 ? 34  GLY A C    4  
ATOM 7745  O O    . GLY A 1 34  ? 14.210  4.490   0.338   1.00 0.00 ? 34  GLY A O    4  
ATOM 7746  H H    . GLY A 1 34  ? 12.295  1.577   -0.116  1.00 0.00 ? 34  GLY A H    4  
ATOM 7747  H HA2  . GLY A 1 34  ? 13.700  2.284   1.514   1.00 0.00 ? 34  GLY A HA2  4  
ATOM 7748  H HA3  . GLY A 1 34  ? 15.057  1.417   0.910   1.00 0.00 ? 34  GLY A HA3  4  
ATOM 7749  N N    . TYR A 1 35  ? 16.048  3.311   -0.296  1.00 0.00 ? 35  TYR A N    4  
ATOM 7750  C CA   . TYR A 1 35  ? 16.820  4.498   -0.732  1.00 0.00 ? 35  TYR A CA   4  
ATOM 7751  C C    . TYR A 1 35  ? 17.601  4.200   -2.065  1.00 0.00 ? 35  TYR A C    4  
ATOM 7752  O O    . TYR A 1 35  ? 18.823  4.375   -2.122  1.00 0.00 ? 35  TYR A O    4  
ATOM 7753  C CB   . TYR A 1 35  ? 17.750  5.004   0.435   1.00 0.00 ? 35  TYR A CB   4  
ATOM 7754  C CG   . TYR A 1 35  ? 17.244  6.029   1.490   1.00 0.00 ? 35  TYR A CG   4  
ATOM 7755  C CD1  . TYR A 1 35  ? 16.001  6.681   1.442   1.00 0.00 ? 35  TYR A CD1  4  
ATOM 7756  C CD2  . TYR A 1 35  ? 18.131  6.368   2.520   1.00 0.00 ? 35  TYR A CD2  4  
ATOM 7757  C CE1  . TYR A 1 35  ? 15.626  7.570   2.443   1.00 0.00 ? 35  TYR A CE1  4  
ATOM 7758  C CE2  . TYR A 1 35  ? 17.772  7.298   3.497   1.00 0.00 ? 35  TYR A CE2  4  
ATOM 7759  C CZ   . TYR A 1 35  ? 16.511  7.886   3.463   1.00 0.00 ? 35  TYR A CZ   4  
ATOM 7760  O OH   . TYR A 1 35  ? 16.152  8.806   4.412   1.00 0.00 ? 35  TYR A OH   4  
ATOM 7761  H H    . TYR A 1 35  ? 16.242  2.300   -0.457  1.00 0.00 ? 35  TYR A H    4  
ATOM 7762  H HA   . TYR A 1 35  ? 16.106  5.308   -0.931  1.00 0.00 ? 35  TYR A HA   4  
ATOM 7763  H HB2  . TYR A 1 35  ? 18.192  4.135   0.958   1.00 0.00 ? 35  TYR A HB2  4  
ATOM 7764  H HB3  . TYR A 1 35  ? 18.631  5.502   -0.015  1.00 0.00 ? 35  TYR A HB3  4  
ATOM 7765  H HD1  . TYR A 1 35  ? 15.320  6.553   0.622   1.00 0.00 ? 35  TYR A HD1  4  
ATOM 7766  H HD2  . TYR A 1 35  ? 19.111  5.913   2.570   1.00 0.00 ? 35  TYR A HD2  4  
ATOM 7767  H HE1  . TYR A 1 35  ? 14.662  8.055   2.391   1.00 0.00 ? 35  TYR A HE1  4  
ATOM 7768  H HE2  . TYR A 1 35  ? 18.473  7.557   4.276   1.00 0.00 ? 35  TYR A HE2  4  
ATOM 7769  H HH   . TYR A 1 35  ? 16.926  9.024   4.934   1.00 0.00 ? 35  TYR A HH   4  
ATOM 7770  N N    . LEU A 1 36  ? 16.912  3.825   -3.172  1.00 0.00 ? 36  LEU A N    4  
ATOM 7771  C CA   . LEU A 1 36  ? 17.574  3.674   -4.505  1.00 0.00 ? 36  LEU A CA   4  
ATOM 7772  C C    . LEU A 1 36  ? 17.758  5.100   -5.149  1.00 0.00 ? 36  LEU A C    4  
ATOM 7773  O O    . LEU A 1 36  ? 18.381  5.992   -4.562  1.00 0.00 ? 36  LEU A O    4  
ATOM 7774  C CB   . LEU A 1 36  ? 16.732  2.588   -5.264  1.00 0.00 ? 36  LEU A CB   4  
ATOM 7775  C CG   . LEU A 1 36  ? 17.289  1.905   -6.556  1.00 0.00 ? 36  LEU A CG   4  
ATOM 7776  C CD1  . LEU A 1 36  ? 16.765  2.498   -7.877  1.00 0.00 ? 36  LEU A CD1  4  
ATOM 7777  C CD2  . LEU A 1 36  ? 18.820  1.755   -6.615  1.00 0.00 ? 36  LEU A CD2  4  
ATOM 7778  H H    . LEU A 1 36  ? 15.905  3.641   -3.043  1.00 0.00 ? 36  LEU A H    4  
ATOM 7779  H HA   . LEU A 1 36  ? 18.596  3.292   -4.409  1.00 0.00 ? 36  LEU A HA   4  
ATOM 7780  H HB2  . LEU A 1 36  ? 16.560  1.757   -4.551  1.00 0.00 ? 36  LEU A HB2  4  
ATOM 7781  H HB3  . LEU A 1 36  ? 15.706  2.964   -5.446  1.00 0.00 ? 36  LEU A HB3  4  
ATOM 7782  H HG   . LEU A 1 36  ? 16.895  0.869   -6.536  1.00 0.00 ? 36  LEU A HG   4  
ATOM 7783  H HD11 . LEU A 1 36  ? 15.686  2.734   -7.835  1.00 0.00 ? 36  LEU A HD11 4  
ATOM 7784  H HD12 . LEU A 1 36  ? 17.300  3.410   -8.185  1.00 0.00 ? 36  LEU A HD12 4  
ATOM 7785  H HD13 . LEU A 1 36  ? 16.893  1.777   -8.707  1.00 0.00 ? 36  LEU A HD13 4  
ATOM 7786  H HD21 . LEU A 1 36  ? 19.216  1.268   -5.704  1.00 0.00 ? 36  LEU A HD21 4  
ATOM 7787  H HD22 . LEU A 1 36  ? 19.140  1.132   -7.471  1.00 0.00 ? 36  LEU A HD22 4  
ATOM 7788  H HD23 . LEU A 1 36  ? 19.333  2.730   -6.711  1.00 0.00 ? 36  LEU A HD23 4  
ATOM 7789  N N    . GLN A 1 37  ? 17.199  5.343   -6.330  1.00 0.00 ? 37  GLN A N    4  
ATOM 7790  C CA   . GLN A 1 37  ? 17.273  6.666   -7.019  1.00 0.00 ? 37  GLN A CA   4  
ATOM 7791  C C    . GLN A 1 37  ? 16.061  7.559   -6.575  1.00 0.00 ? 37  GLN A C    4  
ATOM 7792  O O    . GLN A 1 37  ? 15.015  7.612   -7.237  1.00 0.00 ? 37  GLN A O    4  
ATOM 7793  C CB   . GLN A 1 37  ? 17.310  6.426   -8.552  1.00 0.00 ? 37  GLN A CB   4  
ATOM 7794  C CG   . GLN A 1 37  ? 18.641  5.899   -9.146  1.00 0.00 ? 37  GLN A CG   4  
ATOM 7795  C CD   . GLN A 1 37  ? 18.585  5.607   -10.655 1.00 0.00 ? 37  GLN A CD   4  
ATOM 7796  O OE1  . GLN A 1 37  ? 17.559  5.687   -11.328 1.00 0.00 ? 37  GLN A OE1  4  
ATOM 7797  N NE2  . GLN A 1 37  ? 19.701  5.248   -11.239 1.00 0.00 ? 37  GLN A NE2  4  
ATOM 7798  H H    . GLN A 1 37  ? 16.768  4.480   -6.673  1.00 0.00 ? 37  GLN A H    4  
ATOM 7799  H HA   . GLN A 1 37  ? 18.209  7.200   -6.750  1.00 0.00 ? 37  GLN A HA   4  
ATOM 7800  H HB2  . GLN A 1 37  ? 16.487  5.745   -8.841  1.00 0.00 ? 37  GLN A HB2  4  
ATOM 7801  H HB3  . GLN A 1 37  ? 17.086  7.379   -9.068  1.00 0.00 ? 37  GLN A HB3  4  
ATOM 7802  H HG2  . GLN A 1 37  ? 19.445  6.634   -8.951  1.00 0.00 ? 37  GLN A HG2  4  
ATOM 7803  H HG3  . GLN A 1 37  ? 18.950  4.977   -8.621  1.00 0.00 ? 37  GLN A HG3  4  
ATOM 7804  H HE21 . GLN A 1 37  ? 20.540  5.194   -10.656 1.00 0.00 ? 37  GLN A HE21 4  
ATOM 7805  H HE22 . GLN A 1 37  ? 19.610  5.060   -12.241 1.00 0.00 ? 37  GLN A HE22 4  
ATOM 7806  N N    . GLY A 1 38  ? 16.237  8.298   -5.467  1.00 0.00 ? 38  GLY A N    4  
ATOM 7807  C CA   . GLY A 1 38  ? 15.168  9.156   -4.893  1.00 0.00 ? 38  GLY A CA   4  
ATOM 7808  C C    . GLY A 1 38  ? 15.436  9.516   -3.406  1.00 0.00 ? 38  GLY A C    4  
ATOM 7809  O O    . GLY A 1 38  ? 15.467  8.574   -2.607  1.00 0.00 ? 38  GLY A O    4  
ATOM 7810  H H    . GLY A 1 38  ? 17.139  8.138   -4.997  1.00 0.00 ? 38  GLY A H    4  
ATOM 7811  H HA2  . GLY A 1 38  ? 15.012  10.048  -5.526  1.00 0.00 ? 38  GLY A HA2  4  
ATOM 7812  H HA3  . GLY A 1 38  ? 14.199  8.621   -4.917  1.00 0.00 ? 38  GLY A HA3  4  
ATOM 7813  N N    . PRO A 1 39  ? 15.579  10.798  -2.952  1.00 0.00 ? 39  PRO A N    4  
ATOM 7814  C CA   . PRO A 1 39  ? 15.836  11.124  -1.512  1.00 0.00 ? 39  PRO A CA   4  
ATOM 7815  C C    . PRO A 1 39  ? 14.834  10.550  -0.452  1.00 0.00 ? 39  PRO A C    4  
ATOM 7816  O O    . PRO A 1 39  ? 15.276  9.944   0.523   1.00 0.00 ? 39  PRO A O    4  
ATOM 7817  C CB   . PRO A 1 39  ? 15.881  12.668  -1.532  1.00 0.00 ? 39  PRO A CB   4  
ATOM 7818  C CG   . PRO A 1 39  ? 16.298  13.034  -2.957  1.00 0.00 ? 39  PRO A CG   4  
ATOM 7819  C CD   . PRO A 1 39  ? 15.606  11.987  -3.829  1.00 0.00 ? 39  PRO A CD   4  
ATOM 7820  H HA   . PRO A 1 39  ? 16.834  10.730  -1.236  1.00 0.00 ? 39  PRO A HA   4  
ATOM 7821  H HB2  . PRO A 1 39  ? 14.889  13.112  -1.315  1.00 0.00 ? 39  PRO A HB2  4  
ATOM 7822  H HB3  . PRO A 1 39  ? 16.574  13.074  -0.771  1.00 0.00 ? 39  PRO A HB3  4  
ATOM 7823  H HG2  . PRO A 1 39  ? 16.022  14.068  -3.235  1.00 0.00 ? 39  PRO A HG2  4  
ATOM 7824  H HG3  . PRO A 1 39  ? 17.398  12.953  -3.065  1.00 0.00 ? 39  PRO A HG3  4  
ATOM 7825  H HD2  . PRO A 1 39  ? 14.578  12.299  -4.098  1.00 0.00 ? 39  PRO A HD2  4  
ATOM 7826  H HD3  . PRO A 1 39  ? 16.173  11.830  -4.767  1.00 0.00 ? 39  PRO A HD3  4  
ATOM 7827  N N    . ASN A 1 40  ? 13.516  10.756  -0.626  1.00 0.00 ? 40  ASN A N    4  
ATOM 7828  C CA   . ASN A 1 40  ? 12.461  10.223  0.292   1.00 0.00 ? 40  ASN A CA   4  
ATOM 7829  C C    . ASN A 1 40  ? 11.152  9.941   -0.525  1.00 0.00 ? 40  ASN A C    4  
ATOM 7830  O O    . ASN A 1 40  ? 10.688  8.801   -0.564  1.00 0.00 ? 40  ASN A O    4  
ATOM 7831  C CB   . ASN A 1 40  ? 12.188  11.202  1.482   1.00 0.00 ? 40  ASN A CB   4  
ATOM 7832  C CG   . ASN A 1 40  ? 13.304  11.359  2.521   1.00 0.00 ? 40  ASN A CG   4  
ATOM 7833  O OD1  . ASN A 1 40  ? 14.066  12.320  2.508   1.00 0.00 ? 40  ASN A OD1  4  
ATOM 7834  N ND2  . ASN A 1 40  ? 13.439  10.444  3.450   1.00 0.00 ? 40  ASN A ND2  4  
ATOM 7835  H H    . ASN A 1 40  ? 13.309  11.258  -1.493  1.00 0.00 ? 40  ASN A H    4  
ATOM 7836  H HA   . ASN A 1 40  ? 12.787  9.244   0.697   1.00 0.00 ? 40  ASN A HA   4  
ATOM 7837  H HB2  . ASN A 1 40  ? 11.955  12.211  1.094   1.00 0.00 ? 40  ASN A HB2  4  
ATOM 7838  H HB3  . ASN A 1 40  ? 11.267  10.896  2.014   1.00 0.00 ? 40  ASN A HB3  4  
ATOM 7839  H HD21 . ASN A 1 40  ? 12.870  9.602   3.341   1.00 0.00 ? 40  ASN A HD21 4  
ATOM 7840  H HD22 . ASN A 1 40  ? 14.325  10.524  3.960   1.00 0.00 ? 40  ASN A HD22 4  
ATOM 7841  N N    . VAL A 1 41  ? 10.551  10.968  -1.160  1.00 0.00 ? 41  VAL A N    4  
ATOM 7842  C CA   . VAL A 1 41  ? 9.325   10.836  -2.005  1.00 0.00 ? 41  VAL A CA   4  
ATOM 7843  C C    . VAL A 1 41  ? 9.766   11.081  -3.488  1.00 0.00 ? 41  VAL A C    4  
ATOM 7844  O O    . VAL A 1 41  ? 10.090  10.106  -4.169  1.00 0.00 ? 41  VAL A O    4  
ATOM 7845  C CB   . VAL A 1 41  ? 8.127   11.713  -1.469  1.00 0.00 ? 41  VAL A CB   4  
ATOM 7846  C CG1  . VAL A 1 41  ? 7.381   11.003  -0.317  1.00 0.00 ? 41  VAL A CG1  4  
ATOM 7847  C CG2  . VAL A 1 41  ? 8.422   13.169  -1.025  1.00 0.00 ? 41  VAL A CG2  4  
ATOM 7848  H H    . VAL A 1 41  ? 11.030  11.865  -1.041  1.00 0.00 ? 41  VAL A H    4  
ATOM 7849  H HA   . VAL A 1 41  ? 8.975   9.784   -2.009  1.00 0.00 ? 41  VAL A HA   4  
ATOM 7850  H HB   . VAL A 1 41  ? 7.388   11.785  -2.293  1.00 0.00 ? 41  VAL A HB   4  
ATOM 7851  H HG11 . VAL A 1 41  ? 7.048   9.988   -0.604  1.00 0.00 ? 41  VAL A HG11 4  
ATOM 7852  H HG12 . VAL A 1 41  ? 8.015   10.894  0.583   1.00 0.00 ? 41  VAL A HG12 4  
ATOM 7853  H HG13 . VAL A 1 41  ? 6.472   11.558  -0.019  1.00 0.00 ? 41  VAL A HG13 4  
ATOM 7854  H HG21 . VAL A 1 41  ? 8.928   13.768  -1.800  1.00 0.00 ? 41  VAL A HG21 4  
ATOM 7855  H HG22 . VAL A 1 41  ? 7.485   13.709  -0.786  1.00 0.00 ? 41  VAL A HG22 4  
ATOM 7856  H HG23 . VAL A 1 41  ? 9.055   13.207  -0.119  1.00 0.00 ? 41  VAL A HG23 4  
ATOM 7857  N N    . ASN A 1 42  ? 9.718   12.326  -4.020  1.00 0.00 ? 42  ASN A N    4  
ATOM 7858  C CA   . ASN A 1 42  ? 10.082  12.707  -5.430  1.00 0.00 ? 42  ASN A CA   4  
ATOM 7859  C C    . ASN A 1 42  ? 8.838   12.483  -6.359  1.00 0.00 ? 42  ASN A C    4  
ATOM 7860  O O    . ASN A 1 42  ? 8.282   13.457  -6.868  1.00 0.00 ? 42  ASN A O    4  
ATOM 7861  C CB   . ASN A 1 42  ? 11.397  12.018  -5.934  1.00 0.00 ? 42  ASN A CB   4  
ATOM 7862  C CG   . ASN A 1 42  ? 12.121  12.712  -7.087  1.00 0.00 ? 42  ASN A CG   4  
ATOM 7863  O OD1  . ASN A 1 42  ? 13.124  13.391  -6.900  1.00 0.00 ? 42  ASN A OD1  4  
ATOM 7864  N ND2  . ASN A 1 42  ? 11.670  12.555  -8.308  1.00 0.00 ? 42  ASN A ND2  4  
ATOM 7865  H H    . ASN A 1 42  ? 9.423   13.033  -3.338  1.00 0.00 ? 42  ASN A H    4  
ATOM 7866  H HA   . ASN A 1 42  ? 10.252  13.802  -5.425  1.00 0.00 ? 42  ASN A HA   4  
ATOM 7867  H HB2  . ASN A 1 42  ? 12.119  11.973  -5.098  1.00 0.00 ? 42  ASN A HB2  4  
ATOM 7868  H HB3  . ASN A 1 42  ? 11.225  10.958  -6.198  1.00 0.00 ? 42  ASN A HB3  4  
ATOM 7869  H HD21 . ASN A 1 42  ? 10.761  12.094  -8.404  1.00 0.00 ? 42  ASN A HD21 4  
ATOM 7870  H HD22 . ASN A 1 42  ? 12.148  13.146  -8.994  1.00 0.00 ? 42  ASN A HD22 4  
ATOM 7871  N N    . LEU A 1 43  ? 8.417   11.228  -6.595  1.00 0.00 ? 43  LEU A N    4  
ATOM 7872  C CA   . LEU A 1 43  ? 7.183   10.909  -7.380  1.00 0.00 ? 43  LEU A CA   4  
ATOM 7873  C C    . LEU A 1 43  ? 5.828   10.867  -6.574  1.00 0.00 ? 43  LEU A C    4  
ATOM 7874  O O    . LEU A 1 43  ? 4.768   10.752  -7.189  1.00 0.00 ? 43  LEU A O    4  
ATOM 7875  C CB   . LEU A 1 43  ? 7.436   9.555   -8.108  1.00 0.00 ? 43  LEU A CB   4  
ATOM 7876  C CG   . LEU A 1 43  ? 7.902   8.235   -7.418  1.00 0.00 ? 43  LEU A CG   4  
ATOM 7877  C CD1  . LEU A 1 43  ? 9.419   8.171   -7.162  1.00 0.00 ? 43  LEU A CD1  4  
ATOM 7878  C CD2  . LEU A 1 43  ? 7.115   7.864   -6.150  1.00 0.00 ? 43  LEU A CD2  4  
ATOM 7879  H H    . LEU A 1 43  ? 8.955   10.500  -6.108  1.00 0.00 ? 43  LEU A H    4  
ATOM 7880  H HA   . LEU A 1 43  ? 7.018   11.681  -8.156  1.00 0.00 ? 43  LEU A HA   4  
ATOM 7881  H HB2  . LEU A 1 43  ? 6.491   9.316   -8.629  1.00 0.00 ? 43  LEU A HB2  4  
ATOM 7882  H HB3  . LEU A 1 43  ? 8.144   9.773   -8.925  1.00 0.00 ? 43  LEU A HB3  4  
ATOM 7883  H HG   . LEU A 1 43  ? 7.698   7.431   -8.153  1.00 0.00 ? 43  LEU A HG   4  
ATOM 7884  H HD11 . LEU A 1 43  ? 10.002  8.498   -8.042  1.00 0.00 ? 43  LEU A HD11 4  
ATOM 7885  H HD12 . LEU A 1 43  ? 9.741   8.780   -6.301  1.00 0.00 ? 43  LEU A HD12 4  
ATOM 7886  H HD13 . LEU A 1 43  ? 9.742   7.135   -6.953  1.00 0.00 ? 43  LEU A HD13 4  
ATOM 7887  H HD21 . LEU A 1 43  ? 6.022   7.927   -6.309  1.00 0.00 ? 43  LEU A HD21 4  
ATOM 7888  H HD22 . LEU A 1 43  ? 7.313   6.827   -5.830  1.00 0.00 ? 43  LEU A HD22 4  
ATOM 7889  H HD23 . LEU A 1 43  ? 7.358   8.520   -5.295  1.00 0.00 ? 43  LEU A HD23 4  
ATOM 7890  N N    . GLU A 1 44  ? 5.883   10.973  -5.234  1.00 0.00 ? 44  GLU A N    4  
ATOM 7891  C CA   . GLU A 1 44  ? 4.731   10.940  -4.277  1.00 0.00 ? 44  GLU A CA   4  
ATOM 7892  C C    . GLU A 1 44  ? 4.069   9.520   -4.210  1.00 0.00 ? 44  GLU A C    4  
ATOM 7893  O O    . GLU A 1 44  ? 3.056   9.247   -4.857  1.00 0.00 ? 44  GLU A O    4  
ATOM 7894  C CB   . GLU A 1 44  ? 3.681   12.068  -4.562  1.00 0.00 ? 44  GLU A CB   4  
ATOM 7895  C CG   . GLU A 1 44  ? 4.081   13.492  -4.094  1.00 0.00 ? 44  GLU A CG   4  
ATOM 7896  C CD   . GLU A 1 44  ? 3.988   13.727  -2.592  1.00 0.00 ? 44  GLU A CD   4  
ATOM 7897  O OE1  . GLU A 1 44  ? 4.934   13.380  -1.857  1.00 0.00 ? 44  GLU A OE1  4  
ATOM 7898  O OE2  . GLU A 1 44  ? 2.954   14.254  -2.125  1.00 0.00 ? 44  GLU A OE2  4  
ATOM 7899  H H    . GLU A 1 44  ? 6.868   11.041  -4.968  1.00 0.00 ? 44  GLU A H    4  
ATOM 7900  H HA   . GLU A 1 44  ? 5.135   11.135  -3.264  1.00 0.00 ? 44  GLU A HA   4  
ATOM 7901  H HB2  . GLU A 1 44  ? 3.428   12.096  -5.637  1.00 0.00 ? 44  GLU A HB2  4  
ATOM 7902  H HB3  . GLU A 1 44  ? 2.716   11.815  -4.080  1.00 0.00 ? 44  GLU A HB3  4  
ATOM 7903  H HG2  . GLU A 1 44  ? 5.104   13.743  -4.425  1.00 0.00 ? 44  GLU A HG2  4  
ATOM 7904  H HG3  . GLU A 1 44  ? 3.423   14.236  -4.575  1.00 0.00 ? 44  GLU A HG3  4  
ATOM 7905  N N    . GLU A 1 45  ? 4.641   8.635   -3.366  1.00 0.00 ? 45  GLU A N    4  
ATOM 7906  C CA   . GLU A 1 45  ? 4.098   7.260   -3.093  1.00 0.00 ? 45  GLU A CA   4  
ATOM 7907  C C    . GLU A 1 45  ? 3.072   7.167   -1.893  1.00 0.00 ? 45  GLU A C    4  
ATOM 7908  O O    . GLU A 1 45  ? 2.771   6.085   -1.381  1.00 0.00 ? 45  GLU A O    4  
ATOM 7909  C CB   . GLU A 1 45  ? 5.306   6.304   -2.888  1.00 0.00 ? 45  GLU A CB   4  
ATOM 7910  C CG   . GLU A 1 45  ? 4.977   4.789   -3.057  1.00 0.00 ? 45  GLU A CG   4  
ATOM 7911  C CD   . GLU A 1 45  ? 4.632   4.360   -4.466  1.00 0.00 ? 45  GLU A CD   4  
ATOM 7912  O OE1  . GLU A 1 45  ? 5.564   4.302   -5.289  1.00 0.00 ? 45  GLU A OE1  4  
ATOM 7913  O OE2  . GLU A 1 45  ? 3.453   4.069   -4.757  1.00 0.00 ? 45  GLU A OE2  4  
ATOM 7914  H H    . GLU A 1 45  ? 5.485   8.978   -2.899  1.00 0.00 ? 45  GLU A H    4  
ATOM 7915  H HA   . GLU A 1 45  ? 3.528   6.929   -3.975  1.00 0.00 ? 45  GLU A HA   4  
ATOM 7916  H HB2  . GLU A 1 45  ? 6.118   6.550   -3.600  1.00 0.00 ? 45  GLU A HB2  4  
ATOM 7917  H HB3  . GLU A 1 45  ? 5.751   6.472   -1.888  1.00 0.00 ? 45  GLU A HB3  4  
ATOM 7918  H HG2  . GLU A 1 45  ? 5.837   4.175   -2.753  1.00 0.00 ? 45  GLU A HG2  4  
ATOM 7919  H HG3  . GLU A 1 45  ? 4.162   4.458   -2.393  1.00 0.00 ? 45  GLU A HG3  4  
ATOM 7920  N N    . LYS A 1 46  ? 2.602   8.299   -1.365  1.00 0.00 ? 46  LYS A N    4  
ATOM 7921  C CA   . LYS A 1 46  ? 1.682   8.367   -0.200  1.00 0.00 ? 46  LYS A CA   4  
ATOM 7922  C C    . LYS A 1 46  ? 0.364   9.171   -0.463  1.00 0.00 ? 46  LYS A C    4  
ATOM 7923  O O    . LYS A 1 46  ? 0.196   9.782   -1.526  1.00 0.00 ? 46  LYS A O    4  
ATOM 7924  C CB   . LYS A 1 46  ? 2.556   8.956   0.957   1.00 0.00 ? 46  LYS A CB   4  
ATOM 7925  C CG   . LYS A 1 46  ? 3.384   10.263  0.829   1.00 0.00 ? 46  LYS A CG   4  
ATOM 7926  C CD   . LYS A 1 46  ? 2.566   11.541  0.559   1.00 0.00 ? 46  LYS A CD   4  
ATOM 7927  C CE   . LYS A 1 46  ? 3.352   12.803  0.952   1.00 0.00 ? 46  LYS A CE   4  
ATOM 7928  N NZ   . LYS A 1 46  ? 2.648   14.006  0.446   1.00 0.00 ? 46  LYS A NZ   4  
ATOM 7929  H H    . LYS A 1 46  ? 2.918   9.109   -1.907  1.00 0.00 ? 46  LYS A H    4  
ATOM 7930  H HA   . LYS A 1 46  ? 1.352   7.351   0.101   1.00 0.00 ? 46  LYS A HA   4  
ATOM 7931  H HB2  . LYS A 1 46  ? 1.930   9.073   1.859   1.00 0.00 ? 46  LYS A HB2  4  
ATOM 7932  H HB3  . LYS A 1 46  ? 3.265   8.156   1.237   1.00 0.00 ? 46  LYS A HB3  4  
ATOM 7933  H HG2  . LYS A 1 46  ? 3.935   10.379  1.785   1.00 0.00 ? 46  LYS A HG2  4  
ATOM 7934  H HG3  . LYS A 1 46  ? 4.172   10.149  0.060   1.00 0.00 ? 46  LYS A HG3  4  
ATOM 7935  H HD2  . LYS A 1 46  ? 2.271   11.560  -0.511  1.00 0.00 ? 46  LYS A HD2  4  
ATOM 7936  H HD3  . LYS A 1 46  ? 1.618   11.504  1.134   1.00 0.00 ? 46  LYS A HD3  4  
ATOM 7937  H HE2  . LYS A 1 46  ? 3.477   12.832  2.059   1.00 0.00 ? 46  LYS A HE2  4  
ATOM 7938  H HE3  . LYS A 1 46  ? 4.381   12.765  0.531   1.00 0.00 ? 46  LYS A HE3  4  
ATOM 7939  H HZ1  . LYS A 1 46  ? 1.635   13.985  0.598   1.00 0.00 ? 46  LYS A HZ1  4  
ATOM 7940  H HZ2  . LYS A 1 46  ? 3.010   14.894  0.810   1.00 0.00 ? 46  LYS A HZ2  4  
ATOM 7941  H HZ3  . LYS A 1 46  ? 2.774   14.091  -0.612  1.00 0.00 ? 46  LYS A HZ3  4  
ATOM 7942  N N    . ILE A 1 47  ? -0.555  9.082   0.535   1.00 0.00 ? 47  ILE A N    4  
ATOM 7943  C CA   . ILE A 1 47  ? -1.818  9.892   0.718   1.00 0.00 ? 47  ILE A CA   4  
ATOM 7944  C C    . ILE A 1 47  ? -3.055  8.983   1.104   1.00 0.00 ? 47  ILE A C    4  
ATOM 7945  O O    . ILE A 1 47  ? -3.060  8.387   2.181   1.00 0.00 ? 47  ILE A O    4  
ATOM 7946  C CB   . ILE A 1 47  ? -2.033  11.101  -0.306  1.00 0.00 ? 47  ILE A CB   4  
ATOM 7947  C CG1  . ILE A 1 47  ? -2.923  12.215  0.332   1.00 0.00 ? 47  ILE A CG1  4  
ATOM 7948  C CG2  . ILE A 1 47  ? -2.625  10.707  -1.677  1.00 0.00 ? 47  ILE A CG2  4  
ATOM 7949  C CD1  . ILE A 1 47  ? -2.935  13.556  -0.424  1.00 0.00 ? 47  ILE A CD1  4  
ATOM 7950  H H    . ILE A 1 47  ? -0.202  8.518   1.325   1.00 0.00 ? 47  ILE A H    4  
ATOM 7951  H HA   . ILE A 1 47  ? -1.709  10.377  1.671   1.00 0.00 ? 47  ILE A HA   4  
ATOM 7952  H HB   . ILE A 1 47  ? -1.044  11.571  -0.471  1.00 0.00 ? 47  ILE A HB   4  
ATOM 7953  H HG12 . ILE A 1 47  ? -3.964  11.859  0.463   1.00 0.00 ? 47  ILE A HG12 4  
ATOM 7954  H HG13 . ILE A 1 47  ? -2.570  12.426  1.360   1.00 0.00 ? 47  ILE A HG13 4  
ATOM 7955  H HG21 . ILE A 1 47  ? -2.292  9.710   -1.993  1.00 0.00 ? 47  ILE A HG21 4  
ATOM 7956  H HG22 . ILE A 1 47  ? -3.730  10.724  -1.726  1.00 0.00 ? 47  ILE A HG22 4  
ATOM 7957  H HG23 . ILE A 1 47  ? -2.262  11.405  -2.438  1.00 0.00 ? 47  ILE A HG23 4  
ATOM 7958  H HD11 . ILE A 1 47  ? -1.915  13.958  -0.568  1.00 0.00 ? 47  ILE A HD11 4  
ATOM 7959  H HD12 . ILE A 1 47  ? -3.398  13.458  -1.423  1.00 0.00 ? 47  ILE A HD12 4  
ATOM 7960  H HD13 . ILE A 1 47  ? -3.514  14.321  0.125   1.00 0.00 ? 47  ILE A HD13 4  
ATOM 7961  N N    . ASP A 1 48  ? -4.141  9.077   0.350   1.00 0.00 ? 48  ASP A N    4  
ATOM 7962  C CA   . ASP A 1 48  ? -5.516  8.574   0.638   1.00 0.00 ? 48  ASP A CA   4  
ATOM 7963  C C    . ASP A 1 48  ? -5.690  7.040   0.858   1.00 0.00 ? 48  ASP A C    4  
ATOM 7964  O O    . ASP A 1 48  ? -6.071  6.292   -0.045  1.00 0.00 ? 48  ASP A O    4  
ATOM 7965  C CB   . ASP A 1 48  ? -6.317  9.172   -0.569  1.00 0.00 ? 48  ASP A CB   4  
ATOM 7966  C CG   . ASP A 1 48  ? -7.785  8.821   -0.804  1.00 0.00 ? 48  ASP A CG   4  
ATOM 7967  O OD1  . ASP A 1 48  ? -8.437  8.136   0.015   1.00 0.00 ? 48  ASP A OD1  4  
ATOM 7968  O OD2  . ASP A 1 48  ? -8.270  9.131   -1.911  1.00 0.00 ? 48  ASP A OD2  4  
ATOM 7969  H H    . ASP A 1 48  ? -3.860  9.495   -0.544  1.00 0.00 ? 48  ASP A H    4  
ATOM 7970  H HA   . ASP A 1 48  ? -5.897  9.057   1.556   1.00 0.00 ? 48  ASP A HA   4  
ATOM 7971  H HB2  . ASP A 1 48  ? -6.272  10.277  -0.533  1.00 0.00 ? 48  ASP A HB2  4  
ATOM 7972  H HB3  . ASP A 1 48  ? -5.826  8.903   -1.520  1.00 0.00 ? 48  ASP A HB3  4  
ATOM 7973  N N    . VAL A 1 49  ? -5.506  6.571   2.098   1.00 0.00 ? 49  VAL A N    4  
ATOM 7974  C CA   . VAL A 1 49  ? -5.703  5.129   2.446   1.00 0.00 ? 49  VAL A CA   4  
ATOM 7975  C C    . VAL A 1 49  ? -7.074  4.990   3.182   1.00 0.00 ? 49  VAL A C    4  
ATOM 7976  O O    . VAL A 1 49  ? -7.386  5.753   4.106   1.00 0.00 ? 49  VAL A O    4  
ATOM 7977  C CB   . VAL A 1 49  ? -4.500  4.548   3.263   1.00 0.00 ? 49  VAL A CB   4  
ATOM 7978  C CG1  . VAL A 1 49  ? -3.145  4.704   2.533   1.00 0.00 ? 49  VAL A CG1  4  
ATOM 7979  C CG2  . VAL A 1 49  ? -4.367  5.047   4.718   1.00 0.00 ? 49  VAL A CG2  4  
ATOM 7980  H H    . VAL A 1 49  ? -5.184  7.281   2.777   1.00 0.00 ? 49  VAL A H    4  
ATOM 7981  H HA   . VAL A 1 49  ? -5.758  4.519   1.524   1.00 0.00 ? 49  VAL A HA   4  
ATOM 7982  H HB   . VAL A 1 49  ? -4.681  3.458   3.324   1.00 0.00 ? 49  VAL A HB   4  
ATOM 7983  H HG11 . VAL A 1 49  ? -3.196  4.372   1.482   1.00 0.00 ? 49  VAL A HG11 4  
ATOM 7984  H HG12 . VAL A 1 49  ? -2.818  5.761   2.499   1.00 0.00 ? 49  VAL A HG12 4  
ATOM 7985  H HG13 . VAL A 1 49  ? -2.340  4.123   3.021   1.00 0.00 ? 49  VAL A HG13 4  
ATOM 7986  H HG21 . VAL A 1 49  ? -4.287  6.149   4.756   1.00 0.00 ? 49  VAL A HG21 4  
ATOM 7987  H HG22 . VAL A 1 49  ? -5.242  4.773   5.334   1.00 0.00 ? 49  VAL A HG22 4  
ATOM 7988  H HG23 . VAL A 1 49  ? -3.487  4.620   5.233   1.00 0.00 ? 49  VAL A HG23 4  
ATOM 7989  N N    . VAL A 1 50  ? -7.909  4.024   2.760   1.00 0.00 ? 50  VAL A N    4  
ATOM 7990  C CA   . VAL A 1 50  ? -9.253  3.815   3.381   1.00 0.00 ? 50  VAL A CA   4  
ATOM 7991  C C    . VAL A 1 50  ? -9.323  2.336   3.910   1.00 0.00 ? 50  VAL A C    4  
ATOM 7992  O O    . VAL A 1 50  ? -9.075  1.409   3.125   1.00 0.00 ? 50  VAL A O    4  
ATOM 7993  C CB   . VAL A 1 50  ? -10.387 4.171   2.356   1.00 0.00 ? 50  VAL A CB   4  
ATOM 7994  C CG1  . VAL A 1 50  ? -11.815 3.827   2.849   1.00 0.00 ? 50  VAL A CG1  4  
ATOM 7995  C CG2  . VAL A 1 50  ? -10.411 5.682   2.014   1.00 0.00 ? 50  VAL A CG2  4  
ATOM 7996  H H    . VAL A 1 50  ? -7.565  3.426   1.995   1.00 0.00 ? 50  VAL A H    4  
ATOM 7997  H HA   . VAL A 1 50  ? -9.391  4.499   4.236   1.00 0.00 ? 50  VAL A HA   4  
ATOM 7998  H HB   . VAL A 1 50  ? -10.206 3.596   1.426   1.00 0.00 ? 50  VAL A HB   4  
ATOM 7999  H HG11 . VAL A 1 50  ? -12.081 4.360   3.781   1.00 0.00 ? 50  VAL A HG11 4  
ATOM 8000  H HG12 . VAL A 1 50  ? -12.587 4.071   2.096   1.00 0.00 ? 50  VAL A HG12 4  
ATOM 8001  H HG13 . VAL A 1 50  ? -11.928 2.746   3.057   1.00 0.00 ? 50  VAL A HG13 4  
ATOM 8002  H HG21 . VAL A 1 50  ? -9.449  6.041   1.605   1.00 0.00 ? 50  VAL A HG21 4  
ATOM 8003  H HG22 . VAL A 1 50  ? -11.186 5.922   1.269   1.00 0.00 ? 50  VAL A HG22 4  
ATOM 8004  H HG23 . VAL A 1 50  ? -10.615 6.306   2.905   1.00 0.00 ? 50  VAL A HG23 4  
ATOM 8005  N N    . PRO A 1 51  ? -9.669  2.053   5.204   1.00 0.00 ? 51  PRO A N    4  
ATOM 8006  C CA   . PRO A 1 51  ? -9.772  0.661   5.717   1.00 0.00 ? 51  PRO A CA   4  
ATOM 8007  C C    . PRO A 1 51  ? -10.992 -0.153  5.166   1.00 0.00 ? 51  PRO A C    4  
ATOM 8008  O O    . PRO A 1 51  ? -11.923 0.387   4.562   1.00 0.00 ? 51  PRO A O    4  
ATOM 8009  C CB   . PRO A 1 51  ? -9.820  0.896   7.242   1.00 0.00 ? 51  PRO A CB   4  
ATOM 8010  C CG   . PRO A 1 51  ? -10.484 2.261   7.420   1.00 0.00 ? 51  PRO A CG   4  
ATOM 8011  C CD   . PRO A 1 51  ? -9.978  3.074   6.231   1.00 0.00 ? 51  PRO A CD   4  
ATOM 8012  H HA   . PRO A 1 51  ? -8.856  0.103   5.475   1.00 0.00 ? 51  PRO A HA   4  
ATOM 8013  H HB2  . PRO A 1 51  ? -10.346 0.094   7.796   1.00 0.00 ? 51  PRO A HB2  4  
ATOM 8014  H HB3  . PRO A 1 51  ? -8.789  0.924   7.646   1.00 0.00 ? 51  PRO A HB3  4  
ATOM 8015  H HG2  . PRO A 1 51  ? -11.585 2.158   7.371   1.00 0.00 ? 51  PRO A HG2  4  
ATOM 8016  H HG3  . PRO A 1 51  ? -10.242 2.733   8.391   1.00 0.00 ? 51  PRO A HG3  4  
ATOM 8017  H HD2  . PRO A 1 51  ? -10.747 3.798   5.899   1.00 0.00 ? 51  PRO A HD2  4  
ATOM 8018  H HD3  . PRO A 1 51  ? -9.065  3.642   6.499   1.00 0.00 ? 51  PRO A HD3  4  
ATOM 8019  N N    . ILE A 1 52  ? -10.966 -1.474  5.395   1.00 0.00 ? 52  ILE A N    4  
ATOM 8020  C CA   . ILE A 1 52  ? -12.082 -2.396  5.020   1.00 0.00 ? 52  ILE A CA   4  
ATOM 8021  C C    . ILE A 1 52  ? -12.962 -2.627  6.315   1.00 0.00 ? 52  ILE A C    4  
ATOM 8022  O O    . ILE A 1 52  ? -13.211 -1.674  7.067   1.00 0.00 ? 52  ILE A O    4  
ATOM 8023  C CB   . ILE A 1 52  ? -11.389 -3.592  4.236   1.00 0.00 ? 52  ILE A CB   4  
ATOM 8024  C CG1  . ILE A 1 52  ? -12.347 -4.212  3.181   1.00 0.00 ? 52  ILE A CG1  4  
ATOM 8025  C CG2  . ILE A 1 52  ? -10.848 -4.734  5.130   1.00 0.00 ? 52  ILE A CG2  4  
ATOM 8026  C CD1  . ILE A 1 52  ? -12.382 -3.414  1.864   1.00 0.00 ? 52  ILE A CD1  4  
ATOM 8027  H H    . ILE A 1 52  ? -10.123 -1.803  5.889   1.00 0.00 ? 52  ILE A H    4  
ATOM 8028  H HA   . ILE A 1 52  ? -12.785 -1.907  4.328   1.00 0.00 ? 52  ILE A HA   4  
ATOM 8029  H HB   . ILE A 1 52  ? -10.512 -3.211  3.669   1.00 0.00 ? 52  ILE A HB   4  
ATOM 8030  H HG12 . ILE A 1 52  ? -12.042 -5.244  2.917   1.00 0.00 ? 52  ILE A HG12 4  
ATOM 8031  H HG13 . ILE A 1 52  ? -13.367 -4.322  3.593   1.00 0.00 ? 52  ILE A HG13 4  
ATOM 8032  H HG21 . ILE A 1 52  ? -10.171 -4.358  5.918   1.00 0.00 ? 52  ILE A HG21 4  
ATOM 8033  H HG22 . ILE A 1 52  ? -11.632 -5.325  5.623   1.00 0.00 ? 52  ILE A HG22 4  
ATOM 8034  H HG23 . ILE A 1 52  ? -10.286 -5.465  4.524   1.00 0.00 ? 52  ILE A HG23 4  
ATOM 8035  H HD11 . ILE A 1 52  ? -12.636 -2.349  2.014   1.00 0.00 ? 52  ILE A HD11 4  
ATOM 8036  H HD12 . ILE A 1 52  ? -11.406 -3.443  1.343   1.00 0.00 ? 52  ILE A HD12 4  
ATOM 8037  H HD13 . ILE A 1 52  ? -13.125 -3.830  1.159   1.00 0.00 ? 52  ILE A HD13 4  
ATOM 8038  N N    . GLU A 1 53  ? -13.498 -3.830  6.568   1.00 0.00 ? 53  GLU A N    4  
ATOM 8039  C CA   . GLU A 1 53  ? -14.254 -4.130  7.825   1.00 0.00 ? 53  GLU A CA   4  
ATOM 8040  C C    . GLU A 1 53  ? -13.242 -4.567  8.973   1.00 0.00 ? 53  GLU A C    4  
ATOM 8041  O O    . GLU A 1 53  ? -13.046 -3.711  9.841   1.00 0.00 ? 53  GLU A O    4  
ATOM 8042  C CB   . GLU A 1 53  ? -15.413 -5.131  7.528   1.00 0.00 ? 53  GLU A CB   4  
ATOM 8043  C CG   . GLU A 1 53  ? -16.589 -4.638  6.633   1.00 0.00 ? 53  GLU A CG   4  
ATOM 8044  C CD   . GLU A 1 53  ? -17.463 -3.462  7.066   1.00 0.00 ? 53  GLU A CD   4  
ATOM 8045  O OE1  . GLU A 1 53  ? -17.281 -2.888  8.161   1.00 0.00 ? 53  GLU A OE1  4  
ATOM 8046  O OE2  . GLU A 1 53  ? -18.314 -3.045  6.254   1.00 0.00 ? 53  GLU A OE2  4  
ATOM 8047  H H    . GLU A 1 53  ? -13.244 -4.525  5.861   1.00 0.00 ? 53  GLU A H    4  
ATOM 8048  H HA   . GLU A 1 53  ? -14.741 -3.212  8.207   1.00 0.00 ? 53  GLU A HA   4  
ATOM 8049  H HB2  . GLU A 1 53  ? -15.018 -6.046  7.056   1.00 0.00 ? 53  GLU A HB2  4  
ATOM 8050  H HB3  . GLU A 1 53  ? -15.843 -5.464  8.492   1.00 0.00 ? 53  GLU A HB3  4  
ATOM 8051  H HG2  . GLU A 1 53  ? -16.202 -4.386  5.632   1.00 0.00 ? 53  GLU A HG2  4  
ATOM 8052  H HG3  . GLU A 1 53  ? -17.286 -5.475  6.466   1.00 0.00 ? 53  GLU A HG3  4  
ATOM 8053  N N    . PRO A 1 54  ? -12.519 -5.741  9.048   1.00 0.00 ? 54  PRO A N    4  
ATOM 8054  C CA   . PRO A 1 54  ? -11.610 -6.063  10.197  1.00 0.00 ? 54  PRO A CA   4  
ATOM 8055  C C    . PRO A 1 54  ? -10.234 -5.289  10.272  1.00 0.00 ? 54  PRO A C    4  
ATOM 8056  O O    . PRO A 1 54  ? -10.203 -4.209  10.865  1.00 0.00 ? 54  PRO A O    4  
ATOM 8057  C CB   . PRO A 1 54  ? -11.509 -7.604  10.069  1.00 0.00 ? 54  PRO A CB   4  
ATOM 8058  C CG   . PRO A 1 54  ? -11.658 -7.897  8.574   1.00 0.00 ? 54  PRO A CG   4  
ATOM 8059  C CD   . PRO A 1 54  ? -12.709 -6.883  8.132   1.00 0.00 ? 54  PRO A CD   4  
ATOM 8060  H HA   . PRO A 1 54  ? -12.113 -5.822  11.155  1.00 0.00 ? 54  PRO A HA   4  
ATOM 8061  H HB2  . PRO A 1 54  ? -10.583 -8.028  10.503  1.00 0.00 ? 54  PRO A HB2  4  
ATOM 8062  H HB3  . PRO A 1 54  ? -12.341 -8.077  10.627  1.00 0.00 ? 54  PRO A HB3  4  
ATOM 8063  H HG2  . PRO A 1 54  ? -10.707 -7.723  8.035   1.00 0.00 ? 54  PRO A HG2  4  
ATOM 8064  H HG3  . PRO A 1 54  ? -11.963 -8.940  8.370   1.00 0.00 ? 54  PRO A HG3  4  
ATOM 8065  H HD2  . PRO A 1 54  ? -12.611 -6.617  7.066   1.00 0.00 ? 54  PRO A HD2  4  
ATOM 8066  H HD3  . PRO A 1 54  ? -13.716 -7.320  8.279   1.00 0.00 ? 54  PRO A HD3  4  
ATOM 8067  N N    . HIS A 1 55  ? -9.098  -5.803  9.735   1.00 0.00 ? 55  HIS A N    4  
ATOM 8068  C CA   . HIS A 1 55  ? -7.749  -5.151  9.902   1.00 0.00 ? 55  HIS A CA   4  
ATOM 8069  C C    . HIS A 1 55  ? -6.921  -5.025  8.571   1.00 0.00 ? 55  HIS A C    4  
ATOM 8070  O O    . HIS A 1 55  ? -5.731  -5.357  8.504   1.00 0.00 ? 55  HIS A O    4  
ATOM 8071  C CB   . HIS A 1 55  ? -6.963  -5.970  10.980  1.00 0.00 ? 55  HIS A CB   4  
ATOM 8072  C CG   . HIS A 1 55  ? -7.553  -6.019  12.394  1.00 0.00 ? 55  HIS A CG   4  
ATOM 8073  N ND1  . HIS A 1 55  ? -8.092  -7.172  12.949  1.00 0.00 ? 55  HIS A ND1  4  
ATOM 8074  C CD2  . HIS A 1 55  ? -7.709  -4.925  13.263  1.00 0.00 ? 55  HIS A CD2  4  
ATOM 8075  C CE1  . HIS A 1 55  ? -8.542  -6.651  14.135  1.00 0.00 ? 55  HIS A CE1  4  
ATOM 8076  N NE2  . HIS A 1 55  ? -8.356  -5.324  14.419  1.00 0.00 ? 55  HIS A NE2  4  
ATOM 8077  H H    . HIS A 1 55  ? -9.229  -6.708  9.275   1.00 0.00 ? 55  HIS A H    4  
ATOM 8078  H HA   . HIS A 1 55  ? -7.853  -4.112  10.272  1.00 0.00 ? 55  HIS A HA   4  
ATOM 8079  H HB2  . HIS A 1 55  ? -6.806  -7.005  10.617  1.00 0.00 ? 55  HIS A HB2  4  
ATOM 8080  H HB3  . HIS A 1 55  ? -5.937  -5.565  11.074  1.00 0.00 ? 55  HIS A HB3  4  
ATOM 8081  H HD2  . HIS A 1 55  ? -7.417  -3.910  13.034  1.00 0.00 ? 55  HIS A HD2  4  
ATOM 8082  H HE1  . HIS A 1 55  ? -9.065  -7.293  14.832  1.00 0.00 ? 55  HIS A HE1  4  
ATOM 8083  H HE2  . HIS A 1 55  ? -8.698  -4.772  15.214  1.00 0.00 ? 55  HIS A HE2  4  
ATOM 8084  N N    . ALA A 1 56  ? -7.533  -4.471  7.513   1.00 0.00 ? 56  ALA A N    4  
ATOM 8085  C CA   . ALA A 1 56  ? -6.877  -4.266  6.192   1.00 0.00 ? 56  ALA A CA   4  
ATOM 8086  C C    . ALA A 1 56  ? -7.314  -2.924  5.532   1.00 0.00 ? 56  ALA A C    4  
ATOM 8087  O O    . ALA A 1 56  ? -8.293  -2.298  5.952   1.00 0.00 ? 56  ALA A O    4  
ATOM 8088  C CB   . ALA A 1 56  ? -7.226  -5.486  5.314   1.00 0.00 ? 56  ALA A CB   4  
ATOM 8089  H H    . ALA A 1 56  ? -8.514  -4.234  7.679   1.00 0.00 ? 56  ALA A H    4  
ATOM 8090  H HA   . ALA A 1 56  ? -5.779  -4.211  6.327   1.00 0.00 ? 56  ALA A HA   4  
ATOM 8091  H HB1  . ALA A 1 56  ? -7.233  -6.425  5.894   1.00 0.00 ? 56  ALA A HB1  4  
ATOM 8092  H HB2  . ALA A 1 56  ? -8.213  -5.401  4.841   1.00 0.00 ? 56  ALA A HB2  4  
ATOM 8093  H HB3  . ALA A 1 56  ? -6.504  -5.616  4.489   1.00 0.00 ? 56  ALA A HB3  4  
ATOM 8094  N N    . LEU A 1 57  ? -6.593  -2.477  4.486   1.00 0.00 ? 57  LEU A N    4  
ATOM 8095  C CA   . LEU A 1 57  ? -6.896  -1.181  3.808   1.00 0.00 ? 57  LEU A CA   4  
ATOM 8096  C C    . LEU A 1 57  ? -6.556  -1.173  2.284   1.00 0.00 ? 57  LEU A C    4  
ATOM 8097  O O    . LEU A 1 57  ? -5.593  -1.799  1.835   1.00 0.00 ? 57  LEU A O    4  
ATOM 8098  C CB   . LEU A 1 57  ? -6.154  -0.042  4.591   1.00 0.00 ? 57  LEU A CB   4  
ATOM 8099  C CG   . LEU A 1 57  ? -4.623  0.211   4.440   1.00 0.00 ? 57  LEU A CG   4  
ATOM 8100  C CD1  . LEU A 1 57  ? -4.194  1.353   5.379   1.00 0.00 ? 57  LEU A CD1  4  
ATOM 8101  C CD2  . LEU A 1 57  ? -3.729  -1.008  4.722   1.00 0.00 ? 57  LEU A CD2  4  
ATOM 8102  H H    . LEU A 1 57  ? -5.791  -3.067  4.224   1.00 0.00 ? 57  LEU A H    4  
ATOM 8103  H HA   . LEU A 1 57  ? -7.988  -1.005  3.867   1.00 0.00 ? 57  LEU A HA   4  
ATOM 8104  H HB2  . LEU A 1 57  ? -6.661  0.903   4.317   1.00 0.00 ? 57  LEU A HB2  4  
ATOM 8105  H HB3  . LEU A 1 57  ? -6.389  -0.148  5.669   1.00 0.00 ? 57  LEU A HB3  4  
ATOM 8106  H HG   . LEU A 1 57  ? -4.434  0.539   3.398   1.00 0.00 ? 57  LEU A HG   4  
ATOM 8107  H HD11 . LEU A 1 57  ? -4.818  2.253   5.244   1.00 0.00 ? 57  LEU A HD11 4  
ATOM 8108  H HD12 . LEU A 1 57  ? -4.282  1.073   6.445   1.00 0.00 ? 57  LEU A HD12 4  
ATOM 8109  H HD13 . LEU A 1 57  ? -3.145  1.661   5.206   1.00 0.00 ? 57  LEU A HD13 4  
ATOM 8110  H HD21 . LEU A 1 57  ? -3.898  -1.430  5.730   1.00 0.00 ? 57  LEU A HD21 4  
ATOM 8111  H HD22 . LEU A 1 57  ? -3.919  -1.816  3.995   1.00 0.00 ? 57  LEU A HD22 4  
ATOM 8112  H HD23 . LEU A 1 57  ? -2.654  -0.767  4.635   1.00 0.00 ? 57  LEU A HD23 4  
ATOM 8113  N N    . PHE A 1 58  ? -7.377  -0.465  1.487   1.00 0.00 ? 58  PHE A N    4  
ATOM 8114  C CA   . PHE A 1 58  ? -7.143  -0.259  0.025   1.00 0.00 ? 58  PHE A CA   4  
ATOM 8115  C C    . PHE A 1 58  ? -6.498  1.162   -0.130  1.00 0.00 ? 58  PHE A C    4  
ATOM 8116  O O    . PHE A 1 58  ? -6.991  2.155   0.434   1.00 0.00 ? 58  PHE A O    4  
ATOM 8117  C CB   . PHE A 1 58  ? -8.460  -0.487  -0.772  1.00 0.00 ? 58  PHE A CB   4  
ATOM 8118  C CG   . PHE A 1 58  ? -9.701  0.390   -0.499  1.00 0.00 ? 58  PHE A CG   4  
ATOM 8119  C CD1  . PHE A 1 58  ? -10.588 0.067   0.534   1.00 0.00 ? 58  PHE A CD1  4  
ATOM 8120  C CD2  . PHE A 1 58  ? -9.999  1.463   -1.346  1.00 0.00 ? 58  PHE A CD2  4  
ATOM 8121  C CE1  . PHE A 1 58  ? -11.753 0.809   0.720   1.00 0.00 ? 58  PHE A CE1  4  
ATOM 8122  C CE2  . PHE A 1 58  ? -11.167 2.200   -1.165  1.00 0.00 ? 58  PHE A CE2  4  
ATOM 8123  C CZ   . PHE A 1 58  ? -12.045 1.869   -0.135  1.00 0.00 ? 58  PHE A CZ   4  
ATOM 8124  H H    . PHE A 1 58  ? -8.136  0.035   1.975   1.00 0.00 ? 58  PHE A H    4  
ATOM 8125  H HA   . PHE A 1 58  ? -6.417  -1.010  -0.354  1.00 0.00 ? 58  PHE A HA   4  
ATOM 8126  H HB2  . PHE A 1 58  ? -8.211  -0.437  -1.849  1.00 0.00 ? 58  PHE A HB2  4  
ATOM 8127  H HB3  . PHE A 1 58  ? -8.752  -1.548  -0.647  1.00 0.00 ? 58  PHE A HB3  4  
ATOM 8128  H HD1  . PHE A 1 58  ? -10.383 -0.765  1.193   1.00 0.00 ? 58  PHE A HD1  4  
ATOM 8129  H HD2  . PHE A 1 58  ? -9.336  1.701   -2.165  1.00 0.00 ? 58  PHE A HD2  4  
ATOM 8130  H HE1  . PHE A 1 58  ? -12.428 0.558   1.525   1.00 0.00 ? 58  PHE A HE1  4  
ATOM 8131  H HE2  . PHE A 1 58  ? -11.406 3.013   -1.836  1.00 0.00 ? 58  PHE A HE2  4  
ATOM 8132  H HZ   . PHE A 1 58  ? -12.955 2.436   0.002   1.00 0.00 ? 58  PHE A HZ   4  
ATOM 8133  N N    . LEU A 1 59  ? -5.369  1.266   -0.863  1.00 0.00 ? 59  LEU A N    4  
ATOM 8134  C CA   . LEU A 1 59  ? -4.563  2.524   -0.858  1.00 0.00 ? 59  LEU A CA   4  
ATOM 8135  C C    . LEU A 1 59  ? -4.776  3.435   -2.120  1.00 0.00 ? 59  LEU A C    4  
ATOM 8136  O O    . LEU A 1 59  ? -4.939  2.958   -3.240  1.00 0.00 ? 59  LEU A O    4  
ATOM 8137  C CB   . LEU A 1 59  ? -3.083  2.073   -0.683  1.00 0.00 ? 59  LEU A CB   4  
ATOM 8138  C CG   . LEU A 1 59  ? -2.605  1.546   0.705   1.00 0.00 ? 59  LEU A CG   4  
ATOM 8139  C CD1  . LEU A 1 59  ? -2.905  0.053   0.907   1.00 0.00 ? 59  LEU A CD1  4  
ATOM 8140  C CD2  . LEU A 1 59  ? -1.089  1.758   0.877   1.00 0.00 ? 59  LEU A CD2  4  
ATOM 8141  H H    . LEU A 1 59  ? -5.013  0.413   -1.334  1.00 0.00 ? 59  LEU A H    4  
ATOM 8142  H HA   . LEU A 1 59  ? -4.810  3.142   0.027   1.00 0.00 ? 59  LEU A HA   4  
ATOM 8143  H HB2  . LEU A 1 59  ? -2.844  1.311   -1.440  1.00 0.00 ? 59  LEU A HB2  4  
ATOM 8144  H HB3  . LEU A 1 59  ? -2.452  2.937   -0.945  1.00 0.00 ? 59  LEU A HB3  4  
ATOM 8145  H HG   . LEU A 1 59  ? -3.119  2.103   1.510   1.00 0.00 ? 59  LEU A HG   4  
ATOM 8146  H HD11 . LEU A 1 59  ? -2.518  -0.565  0.076   1.00 0.00 ? 59  LEU A HD11 4  
ATOM 8147  H HD12 . LEU A 1 59  ? -2.473  -0.344  1.844   1.00 0.00 ? 59  LEU A HD12 4  
ATOM 8148  H HD13 . LEU A 1 59  ? -3.987  -0.140  0.966   1.00 0.00 ? 59  LEU A HD13 4  
ATOM 8149  H HD21 . LEU A 1 59  ? -0.814  2.827   0.812   1.00 0.00 ? 59  LEU A HD21 4  
ATOM 8150  H HD22 . LEU A 1 59  ? -0.732  1.404   1.863   1.00 0.00 ? 59  LEU A HD22 4  
ATOM 8151  H HD23 . LEU A 1 59  ? -0.503  1.223   0.106   1.00 0.00 ? 59  LEU A HD23 4  
ATOM 8152  N N    . GLY A 1 60  ? -4.731  4.765   -1.929  1.00 0.00 ? 60  GLY A N    4  
ATOM 8153  C CA   . GLY A 1 60  ? -4.912  5.796   -2.995  1.00 0.00 ? 60  GLY A CA   4  
ATOM 8154  C C    . GLY A 1 60  ? -3.788  6.852   -2.925  1.00 0.00 ? 60  GLY A C    4  
ATOM 8155  O O    . GLY A 1 60  ? -3.785  7.756   -2.084  1.00 0.00 ? 60  GLY A O    4  
ATOM 8156  H H    . GLY A 1 60  ? -4.617  5.064   -0.951  1.00 0.00 ? 60  GLY A H    4  
ATOM 8157  H HA2  . GLY A 1 60  ? -4.997  5.352   -4.006  1.00 0.00 ? 60  GLY A HA2  4  
ATOM 8158  H HA3  . GLY A 1 60  ? -5.863  6.328   -2.827  1.00 0.00 ? 60  GLY A HA3  4  
ATOM 8159  N N    . ILE A 1 61  ? -2.831  6.726   -3.838  1.00 0.00 ? 61  ILE A N    4  
ATOM 8160  C CA   . ILE A 1 61  ? -1.565  7.515   -3.818  1.00 0.00 ? 61  ILE A CA   4  
ATOM 8161  C C    . ILE A 1 61  ? -1.616  8.739   -4.805  1.00 0.00 ? 61  ILE A C    4  
ATOM 8162  O O    . ILE A 1 61  ? -2.317  8.724   -5.824  1.00 0.00 ? 61  ILE A O    4  
ATOM 8163  C CB   . ILE A 1 61  ? -0.456  6.414   -4.095  1.00 0.00 ? 61  ILE A CB   4  
ATOM 8164  C CG1  . ILE A 1 61  ? 0.037   5.750   -2.775  1.00 0.00 ? 61  ILE A CG1  4  
ATOM 8165  C CG2  . ILE A 1 61  ? 0.813   6.950   -4.797  1.00 0.00 ? 61  ILE A CG2  4  
ATOM 8166  C CD1  . ILE A 1 61  ? -0.974  4.908   -1.988  1.00 0.00 ? 61  ILE A CD1  4  
ATOM 8167  H H    . ILE A 1 61  ? -2.955  5.938   -4.492  1.00 0.00 ? 61  ILE A H    4  
ATOM 8168  H HA   . ILE A 1 61  ? -1.391  7.940   -2.798  1.00 0.00 ? 61  ILE A HA   4  
ATOM 8169  H HB   . ILE A 1 61  ? -0.830  5.609   -4.759  1.00 0.00 ? 61  ILE A HB   4  
ATOM 8170  H HG12 . ILE A 1 61  ? 0.911   5.101   -2.988  1.00 0.00 ? 61  ILE A HG12 4  
ATOM 8171  H HG13 . ILE A 1 61  ? 0.417   6.530   -2.095  1.00 0.00 ? 61  ILE A HG13 4  
ATOM 8172  H HG21 . ILE A 1 61  ? 1.291   7.747   -4.203  1.00 0.00 ? 61  ILE A HG21 4  
ATOM 8173  H HG22 . ILE A 1 61  ? 1.570   6.158   -4.963  1.00 0.00 ? 61  ILE A HG22 4  
ATOM 8174  H HG23 . ILE A 1 61  ? 0.598   7.376   -5.794  1.00 0.00 ? 61  ILE A HG23 4  
ATOM 8175  H HD11 . ILE A 1 61  ? -1.502  4.195   -2.648  1.00 0.00 ? 61  ILE A HD11 4  
ATOM 8176  H HD12 . ILE A 1 61  ? -0.471  4.328   -1.193  1.00 0.00 ? 61  ILE A HD12 4  
ATOM 8177  H HD13 . ILE A 1 61  ? -1.736  5.533   -1.490  1.00 0.00 ? 61  ILE A HD13 4  
ATOM 8178  N N    . HIS A 1 62  ? -0.842  9.804   -4.471  1.00 0.00 ? 62  HIS A N    4  
ATOM 8179  C CA   . HIS A 1 62  ? -0.690  11.060  -5.284  1.00 0.00 ? 62  HIS A CA   4  
ATOM 8180  C C    . HIS A 1 62  ? -2.064  11.778  -5.564  1.00 0.00 ? 62  HIS A C    4  
ATOM 8181  O O    . HIS A 1 62  ? -2.736  11.535  -6.573  1.00 0.00 ? 62  HIS A O    4  
ATOM 8182  C CB   . HIS A 1 62  ? 0.111   10.722  -6.581  1.00 0.00 ? 62  HIS A CB   4  
ATOM 8183  C CG   . HIS A 1 62  ? 0.778   11.898  -7.308  1.00 0.00 ? 62  HIS A CG   4  
ATOM 8184  N ND1  . HIS A 1 62  ? 0.414   13.238  -7.206  1.00 0.00 ? 62  HIS A ND1  4  
ATOM 8185  C CD2  . HIS A 1 62  ? 1.903   11.760  -8.139  1.00 0.00 ? 62  HIS A CD2  4  
ATOM 8186  C CE1  . HIS A 1 62  ? 1.388   13.794  -7.991  1.00 0.00 ? 62  HIS A CE1  4  
ATOM 8187  N NE2  . HIS A 1 62  ? 2.317   12.996  -8.601  1.00 0.00 ? 62  HIS A NE2  4  
ATOM 8188  H H    . HIS A 1 62  ? -0.316  9.675   -3.591  1.00 0.00 ? 62  HIS A H    4  
ATOM 8189  H HA   . HIS A 1 62  ? -0.073  11.762  -4.689  1.00 0.00 ? 62  HIS A HA   4  
ATOM 8190  H HB2  . HIS A 1 62  ? 0.915   10.003  -6.328  1.00 0.00 ? 62  HIS A HB2  4  
ATOM 8191  H HB3  . HIS A 1 62  ? -0.535  10.176  -7.294  1.00 0.00 ? 62  HIS A HB3  4  
ATOM 8192  H HD2  . HIS A 1 62  ? 2.413   10.825  -8.329  1.00 0.00 ? 62  HIS A HD2  4  
ATOM 8193  H HE1  . HIS A 1 62  ? 1.435   14.870  -8.099  1.00 0.00 ? 62  HIS A HE1  4  
ATOM 8194  H HE2  . HIS A 1 62  ? 3.164   13.251  -9.120  1.00 0.00 ? 62  HIS A HE2  4  
ATOM 8195  N N    . GLY A 1 63  ? -2.492  12.651  -4.630  1.00 0.00 ? 63  GLY A N    4  
ATOM 8196  C CA   . GLY A 1 63  ? -3.823  13.327  -4.694  1.00 0.00 ? 63  GLY A CA   4  
ATOM 8197  C C    . GLY A 1 63  ? -5.118  12.459  -4.699  1.00 0.00 ? 63  GLY A C    4  
ATOM 8198  O O    . GLY A 1 63  ? -6.180  12.983  -5.045  1.00 0.00 ? 63  GLY A O    4  
ATOM 8199  H H    . GLY A 1 63  ? -1.842  12.777  -3.846  1.00 0.00 ? 63  GLY A H    4  
ATOM 8200  H HA2  . GLY A 1 63  ? -3.907  14.030  -3.846  1.00 0.00 ? 63  GLY A HA2  4  
ATOM 8201  H HA3  . GLY A 1 63  ? -3.849  13.973  -5.592  1.00 0.00 ? 63  GLY A HA3  4  
ATOM 8202  N N    . GLY A 1 64  ? -5.047  11.172  -4.320  1.00 0.00 ? 64  GLY A N    4  
ATOM 8203  C CA   . GLY A 1 64  ? -6.191  10.221  -4.399  1.00 0.00 ? 64  GLY A CA   4  
ATOM 8204  C C    . GLY A 1 64  ? -6.511  9.703   -5.823  1.00 0.00 ? 64  GLY A C    4  
ATOM 8205  O O    . GLY A 1 64  ? -7.660  9.796   -6.259  1.00 0.00 ? 64  GLY A O    4  
ATOM 8206  H H    . GLY A 1 64  ? -4.093  10.883  -4.072  1.00 0.00 ? 64  GLY A H    4  
ATOM 8207  H HA2  . GLY A 1 64  ? -5.977  9.342   -3.764  1.00 0.00 ? 64  GLY A HA2  4  
ATOM 8208  H HA3  . GLY A 1 64  ? -7.102  10.668  -3.958  1.00 0.00 ? 64  GLY A HA3  4  
ATOM 8209  N N    . LYS A 1 65  ? -5.504  9.162   -6.535  1.00 0.00 ? 65  LYS A N    4  
ATOM 8210  C CA   . LYS A 1 65  ? -5.662  8.654   -7.934  1.00 0.00 ? 65  LYS A CA   4  
ATOM 8211  C C    . LYS A 1 65  ? -4.977  7.271   -8.196  1.00 0.00 ? 65  LYS A C    4  
ATOM 8212  O O    . LYS A 1 65  ? -5.528  6.494   -8.979  1.00 0.00 ? 65  LYS A O    4  
ATOM 8213  C CB   . LYS A 1 65  ? -5.107  9.712   -8.946  1.00 0.00 ? 65  LYS A CB   4  
ATOM 8214  C CG   . LYS A 1 65  ? -6.097  10.829  -9.365  1.00 0.00 ? 65  LYS A CG   4  
ATOM 8215  C CD   . LYS A 1 65  ? -6.140  12.054  -8.423  1.00 0.00 ? 65  LYS A CD   4  
ATOM 8216  C CE   . LYS A 1 65  ? -7.570  12.586  -8.221  1.00 0.00 ? 65  LYS A CE   4  
ATOM 8217  N NZ   . LYS A 1 65  ? -7.556  13.729  -7.274  1.00 0.00 ? 65  LYS A NZ   4  
ATOM 8218  H H    . LYS A 1 65  ? -4.596  9.178   -6.052  1.00 0.00 ? 65  LYS A H    4  
ATOM 8219  H HA   . LYS A 1 65  ? -6.734  8.479   -8.157  1.00 0.00 ? 65  LYS A HA   4  
ATOM 8220  H HB2  . LYS A 1 65  ? -4.142  10.136  -8.599  1.00 0.00 ? 65  LYS A HB2  4  
ATOM 8221  H HB3  . LYS A 1 65  ? -4.841  9.192   -9.889  1.00 0.00 ? 65  LYS A HB3  4  
ATOM 8222  H HG2  . LYS A 1 65  ? -5.836  11.182  -10.382 1.00 0.00 ? 65  LYS A HG2  4  
ATOM 8223  H HG3  . LYS A 1 65  ? -7.098  10.373  -9.499  1.00 0.00 ? 65  LYS A HG3  4  
ATOM 8224  H HD2  . LYS A 1 65  ? -5.697  11.790  -7.444  1.00 0.00 ? 65  LYS A HD2  4  
ATOM 8225  H HD3  . LYS A 1 65  ? -5.466  12.840  -8.818  1.00 0.00 ? 65  LYS A HD3  4  
ATOM 8226  H HE2  . LYS A 1 65  ? -8.020  12.872  -9.197  1.00 0.00 ? 65  LYS A HE2  4  
ATOM 8227  H HE3  . LYS A 1 65  ? -8.216  11.767  -7.828  1.00 0.00 ? 65  LYS A HE3  4  
ATOM 8228  H HZ1  . LYS A 1 65  ? -7.088  13.464  -6.377  1.00 0.00 ? 65  LYS A HZ1  4  
ATOM 8229  H HZ2  . LYS A 1 65  ? -7.027  14.537  -7.622  1.00 0.00 ? 65  LYS A HZ2  4  
ATOM 8230  H HZ3  . LYS A 1 65  ? -8.489  14.070  -7.010  1.00 0.00 ? 65  LYS A HZ3  4  
ATOM 8231  N N    . MET A 1 66  ? -3.801  6.938   -7.628  1.00 0.00 ? 66  MET A N    4  
ATOM 8232  C CA   . MET A 1 66  ? -3.120  5.643   -7.916  1.00 0.00 ? 66  MET A CA   4  
ATOM 8233  C C    . MET A 1 66  ? -3.614  4.559   -6.906  1.00 0.00 ? 66  MET A C    4  
ATOM 8234  O O    . MET A 1 66  ? -3.217  4.550   -5.736  1.00 0.00 ? 66  MET A O    4  
ATOM 8235  C CB   . MET A 1 66  ? -1.584  5.858   -7.859  1.00 0.00 ? 66  MET A CB   4  
ATOM 8236  C CG   . MET A 1 66  ? -0.974  6.829   -8.897  1.00 0.00 ? 66  MET A CG   4  
ATOM 8237  S SD   . MET A 1 66  ? -1.508  6.459   -10.584 1.00 0.00 ? 66  MET A SD   4  
ATOM 8238  C CE   . MET A 1 66  ? -0.480  5.034   -10.973 1.00 0.00 ? 66  MET A CE   4  
ATOM 8239  H H    . MET A 1 66  ? -3.398  7.628   -6.974  1.00 0.00 ? 66  MET A H    4  
ATOM 8240  H HA   . MET A 1 66  ? -3.352  5.297   -8.945  1.00 0.00 ? 66  MET A HA   4  
ATOM 8241  H HB2  . MET A 1 66  ? -1.292  6.198   -6.851  1.00 0.00 ? 66  MET A HB2  4  
ATOM 8242  H HB3  . MET A 1 66  ? -1.091  4.877   -7.978  1.00 0.00 ? 66  MET A HB3  4  
ATOM 8243  H HG2  . MET A 1 66  ? -1.275  7.868   -8.663  1.00 0.00 ? 66  MET A HG2  4  
ATOM 8244  H HG3  . MET A 1 66  ? 0.130   6.819   -8.845  1.00 0.00 ? 66  MET A HG3  4  
ATOM 8245  H HE1  . MET A 1 66  ? 0.593   5.272   -10.856 1.00 0.00 ? 66  MET A HE1  4  
ATOM 8246  H HE2  . MET A 1 66  ? -0.722  4.188   -10.307 1.00 0.00 ? 66  MET A HE2  4  
ATOM 8247  H HE3  . MET A 1 66  ? -0.648  4.702   -12.012 1.00 0.00 ? 66  MET A HE3  4  
ATOM 8248  N N    . CYS A 1 67  ? -4.499  3.654   -7.362  1.00 0.00 ? 67  CYS A N    4  
ATOM 8249  C CA   . CYS A 1 67  ? -5.085  2.588   -6.516  1.00 0.00 ? 67  CYS A CA   4  
ATOM 8250  C C    . CYS A 1 67  ? -4.096  1.407   -6.247  1.00 0.00 ? 67  CYS A C    4  
ATOM 8251  O O    . CYS A 1 67  ? -3.928  0.512   -7.082  1.00 0.00 ? 67  CYS A O    4  
ATOM 8252  C CB   . CYS A 1 67  ? -6.366  2.129   -7.242  1.00 0.00 ? 67  CYS A CB   4  
ATOM 8253  S SG   . CYS A 1 67  ? -7.235  0.847   -6.275  1.00 0.00 ? 67  CYS A SG   4  
ATOM 8254  H H    . CYS A 1 67  ? -4.772  3.744   -8.357  1.00 0.00 ? 67  CYS A H    4  
ATOM 8255  H HA   . CYS A 1 67  ? -5.407  3.031   -5.557  1.00 0.00 ? 67  CYS A HA   4  
ATOM 8256  H HB2  . CYS A 1 67  ? -7.060  2.975   -7.391  1.00 0.00 ? 67  CYS A HB2  4  
ATOM 8257  H HB3  . CYS A 1 67  ? -6.146  1.730   -8.249  1.00 0.00 ? 67  CYS A HB3  4  
ATOM 8258  H HG   . CYS A 1 67  ? -6.531  -0.192  -6.719  1.00 0.00 ? 67  CYS A HG   4  
ATOM 8259  N N    . LEU A 1 68  ? -3.432  1.428   -5.074  1.00 0.00 ? 68  LEU A N    4  
ATOM 8260  C CA   . LEU A 1 68  ? -2.516  0.339   -4.632  1.00 0.00 ? 68  LEU A CA   4  
ATOM 8261  C C    . LEU A 1 68  ? -3.407  -0.809  -4.027  1.00 0.00 ? 68  LEU A C    4  
ATOM 8262  O O    . LEU A 1 68  ? -3.998  -0.708  -2.933  1.00 0.00 ? 68  LEU A O    4  
ATOM 8263  C CB   . LEU A 1 68  ? -1.440  0.888   -3.641  1.00 0.00 ? 68  LEU A CB   4  
ATOM 8264  C CG   . LEU A 1 68  ? -0.031  1.177   -4.217  1.00 0.00 ? 68  LEU A CG   4  
ATOM 8265  C CD1  . LEU A 1 68  ? 0.882   1.828   -3.164  1.00 0.00 ? 68  LEU A CD1  4  
ATOM 8266  C CD2  . LEU A 1 68  ? 0.681   -0.095  -4.706  1.00 0.00 ? 68  LEU A CD2  4  
ATOM 8267  H H    . LEU A 1 68  ? -3.689  2.219   -4.465  1.00 0.00 ? 68  LEU A H    4  
ATOM 8268  H HA   . LEU A 1 68  ? -1.977  -0.048  -5.519  1.00 0.00 ? 68  LEU A HA   4  
ATOM 8269  H HB2  . LEU A 1 68  ? -1.801  1.828   -3.187  1.00 0.00 ? 68  LEU A HB2  4  
ATOM 8270  H HB3  . LEU A 1 68  ? -1.321  0.191   -2.788  1.00 0.00 ? 68  LEU A HB3  4  
ATOM 8271  H HG   . LEU A 1 68  ? -0.138  1.893   -5.054  1.00 0.00 ? 68  LEU A HG   4  
ATOM 8272  H HD11 . LEU A 1 68  ? 0.455   2.764   -2.774  1.00 0.00 ? 68  LEU A HD11 4  
ATOM 8273  H HD12 . LEU A 1 68  ? 1.068   1.170   -2.295  1.00 0.00 ? 68  LEU A HD12 4  
ATOM 8274  H HD13 . LEU A 1 68  ? 1.869   2.102   -3.588  1.00 0.00 ? 68  LEU A HD13 4  
ATOM 8275  H HD21 . LEU A 1 68  ? 0.776   -0.833  -3.892  1.00 0.00 ? 68  LEU A HD21 4  
ATOM 8276  H HD22 . LEU A 1 68  ? 0.155   -0.590  -5.542  1.00 0.00 ? 68  LEU A HD22 4  
ATOM 8277  H HD23 . LEU A 1 68  ? 1.702   0.125   -5.068  1.00 0.00 ? 68  LEU A HD23 4  
ATOM 8278  N N    . SER A 1 69  ? -3.475  -1.872  -4.852  1.00 0.00 ? 69  SER A N    4  
ATOM 8279  C CA   . SER A 1 69  ? -4.316  -3.086  -4.667  1.00 0.00 ? 69  SER A CA   4  
ATOM 8280  C C    . SER A 1 69  ? -3.617  -4.330  -5.331  1.00 0.00 ? 69  SER A C    4  
ATOM 8281  O O    . SER A 1 69  ? -2.506  -4.254  -5.877  1.00 0.00 ? 69  SER A O    4  
ATOM 8282  C CB   . SER A 1 69  ? -5.689  -2.736  -5.299  1.00 0.00 ? 69  SER A CB   4  
ATOM 8283  O OG   . SER A 1 69  ? -6.418  -1.828  -4.466  1.00 0.00 ? 69  SER A OG   4  
ATOM 8284  H H    . SER A 1 69  ? -2.927  -1.765  -5.721  1.00 0.00 ? 69  SER A H    4  
ATOM 8285  H HA   . SER A 1 69  ? -4.516  -3.349  -3.606  1.00 0.00 ? 69  SER A HA   4  
ATOM 8286  H HB2  . SER A 1 69  ? -5.578  -2.314  -6.319  1.00 0.00 ? 69  SER A HB2  4  
ATOM 8287  H HB3  . SER A 1 69  ? -6.291  -3.644  -5.446  1.00 0.00 ? 69  SER A HB3  4  
ATOM 8288  H HG   . SER A 1 69  ? -6.431  -2.195  -3.571  1.00 0.00 ? 69  SER A HG   4  
ATOM 8289  N N    . CYS A 1 70  ? -4.252  -5.513  -5.240  1.00 0.00 ? 70  CYS A N    4  
ATOM 8290  C CA   . CYS A 1 70  ? -3.728  -6.763  -5.852  1.00 0.00 ? 70  CYS A CA   4  
ATOM 8291  C C    . CYS A 1 70  ? -4.669  -7.165  -7.035  1.00 0.00 ? 70  CYS A C    4  
ATOM 8292  O O    . CYS A 1 70  ? -5.785  -7.651  -6.830  1.00 0.00 ? 70  CYS A O    4  
ATOM 8293  C CB   . CYS A 1 70  ? -3.618  -7.807  -4.728  1.00 0.00 ? 70  CYS A CB   4  
ATOM 8294  S SG   . CYS A 1 70  ? -2.337  -9.028  -5.147  1.00 0.00 ? 70  CYS A SG   4  
ATOM 8295  H H    . CYS A 1 70  ? -5.165  -5.495  -4.777  1.00 0.00 ? 70  CYS A H    4  
ATOM 8296  H HA   . CYS A 1 70  ? -2.702  -6.609  -6.235  1.00 0.00 ? 70  CYS A HA   4  
ATOM 8297  H HB2  . CYS A 1 70  ? -3.325  -7.352  -3.763  1.00 0.00 ? 70  CYS A HB2  4  
ATOM 8298  H HB3  . CYS A 1 70  ? -4.586  -8.308  -4.549  1.00 0.00 ? 70  CYS A HB3  4  
ATOM 8299  H HG   . CYS A 1 70  ? -1.290  -8.258  -4.864  1.00 0.00 ? 70  CYS A HG   4  
ATOM 8300  N N    . VAL A 1 71  ? -4.228  -6.915  -8.279  1.00 0.00 ? 71  VAL A N    4  
ATOM 8301  C CA   . VAL A 1 71  ? -5.063  -7.115  -9.506  1.00 0.00 ? 71  VAL A CA   4  
ATOM 8302  C C    . VAL A 1 71  ? -4.672  -8.402  -10.322 1.00 0.00 ? 71  VAL A C    4  
ATOM 8303  O O    . VAL A 1 71  ? -3.557  -8.927  -10.247 1.00 0.00 ? 71  VAL A O    4  
ATOM 8304  C CB   . VAL A 1 71  ? -4.958  -5.770  -10.320 1.00 0.00 ? 71  VAL A CB   4  
ATOM 8305  C CG1  . VAL A 1 71  ? -3.635  -5.535  -11.084 1.00 0.00 ? 71  VAL A CG1  4  
ATOM 8306  C CG2  . VAL A 1 71  ? -6.128  -5.552  -11.301 1.00 0.00 ? 71  VAL A CG2  4  
ATOM 8307  H H    . VAL A 1 71  ? -3.274  -6.535  -8.328  1.00 0.00 ? 71  VAL A H    4  
ATOM 8308  H HA   . VAL A 1 71  ? -6.123  -7.245  -9.208  1.00 0.00 ? 71  VAL A HA   4  
ATOM 8309  H HB   . VAL A 1 71  ? -5.056  -4.930  -9.599  1.00 0.00 ? 71  VAL A HB   4  
ATOM 8310  H HG11 . VAL A 1 71  ? -2.754  -5.707  -10.439 1.00 0.00 ? 71  VAL A HG11 4  
ATOM 8311  H HG12 . VAL A 1 71  ? -3.528  -6.198  -11.962 1.00 0.00 ? 71  VAL A HG12 4  
ATOM 8312  H HG13 . VAL A 1 71  ? -3.572  -4.492  -11.449 1.00 0.00 ? 71  VAL A HG13 4  
ATOM 8313  H HG21 . VAL A 1 71  ? -7.105  -5.561  -10.784 1.00 0.00 ? 71  VAL A HG21 4  
ATOM 8314  H HG22 . VAL A 1 71  ? -6.065  -4.559  -11.787 1.00 0.00 ? 71  VAL A HG22 4  
ATOM 8315  H HG23 . VAL A 1 71  ? -6.157  -6.299  -12.114 1.00 0.00 ? 71  VAL A HG23 4  
ATOM 8316  N N    . LYS A 1 72  ? -5.631  -8.908  -11.118 1.00 0.00 ? 72  LYS A N    4  
ATOM 8317  C CA   . LYS A 1 72  ? -5.458  -10.113 -11.982 1.00 0.00 ? 72  LYS A CA   4  
ATOM 8318  C C    . LYS A 1 72  ? -4.713  -9.717  -13.307 1.00 0.00 ? 72  LYS A C    4  
ATOM 8319  O O    . LYS A 1 72  ? -5.318  -9.128  -14.209 1.00 0.00 ? 72  LYS A O    4  
ATOM 8320  C CB   . LYS A 1 72  ? -6.909  -10.657 -12.181 1.00 0.00 ? 72  LYS A CB   4  
ATOM 8321  C CG   . LYS A 1 72  ? -7.116  -12.105 -12.682 1.00 0.00 ? 72  LYS A CG   4  
ATOM 8322  C CD   . LYS A 1 72  ? -7.010  -12.333 -14.206 1.00 0.00 ? 72  LYS A CD   4  
ATOM 8323  C CE   . LYS A 1 72  ? -7.689  -13.662 -14.611 1.00 0.00 ? 72  LYS A CE   4  
ATOM 8324  N NZ   . LYS A 1 72  ? -7.382  -14.019 -16.019 1.00 0.00 ? 72  LYS A NZ   4  
ATOM 8325  H H    . LYS A 1 72  ? -6.506  -8.375  -11.107 1.00 0.00 ? 72  LYS A H    4  
ATOM 8326  H HA   . LYS A 1 72  ? -4.862  -10.879 -11.442 1.00 0.00 ? 72  LYS A HA   4  
ATOM 8327  H HB2  . LYS A 1 72  ? -7.426  -10.631 -11.199 1.00 0.00 ? 72  LYS A HB2  4  
ATOM 8328  H HB3  . LYS A 1 72  ? -7.495  -9.958  -12.811 1.00 0.00 ? 72  LYS A HB3  4  
ATOM 8329  H HG2  . LYS A 1 72  ? -6.434  -12.794 -12.145 1.00 0.00 ? 72  LYS A HG2  4  
ATOM 8330  H HG3  . LYS A 1 72  ? -8.129  -12.411 -12.349 1.00 0.00 ? 72  LYS A HG3  4  
ATOM 8331  H HD2  . LYS A 1 72  ? -7.470  -11.490 -14.759 1.00 0.00 ? 72  LYS A HD2  4  
ATOM 8332  H HD3  . LYS A 1 72  ? -5.939  -12.317 -14.494 1.00 0.00 ? 72  LYS A HD3  4  
ATOM 8333  H HE2  . LYS A 1 72  ? -7.348  -14.479 -13.937 1.00 0.00 ? 72  LYS A HE2  4  
ATOM 8334  H HE3  . LYS A 1 72  ? -8.787  -13.609 -14.447 1.00 0.00 ? 72  LYS A HE3  4  
ATOM 8335  H HZ1  . LYS A 1 72  ? -6.422  -13.710 -16.298 1.00 0.00 ? 72  LYS A HZ1  4  
ATOM 8336  H HZ2  . LYS A 1 72  ? -7.256  -15.067 -16.166 1.00 0.00 ? 72  LYS A HZ2  4  
ATOM 8337  H HZ3  . LYS A 1 72  ? -8.026  -13.677 -16.738 1.00 0.00 ? 72  LYS A HZ3  4  
ATOM 8338  N N    . SER A 1 73  ? -3.401  -10.012 -13.417 1.00 0.00 ? 73  SER A N    4  
ATOM 8339  C CA   . SER A 1 73  ? -2.560  -9.599  -14.591 1.00 0.00 ? 73  SER A CA   4  
ATOM 8340  C C    . SER A 1 73  ? -2.769  -10.570 -15.803 1.00 0.00 ? 73  SER A C    4  
ATOM 8341  O O    . SER A 1 73  ? -3.350  -10.161 -16.812 1.00 0.00 ? 73  SER A O    4  
ATOM 8342  C CB   . SER A 1 73  ? -1.049  -9.469  -14.183 1.00 0.00 ? 73  SER A CB   4  
ATOM 8343  O OG   . SER A 1 73  ? -0.807  -9.308  -12.780 1.00 0.00 ? 73  SER A OG   4  
ATOM 8344  H H    . SER A 1 73  ? -2.976  -10.512 -12.617 1.00 0.00 ? 73  SER A H    4  
ATOM 8345  H HA   . SER A 1 73  ? -2.891  -8.598  -14.932 1.00 0.00 ? 73  SER A HA   4  
ATOM 8346  H HB2  . SER A 1 73  ? -0.459  -10.346 -14.511 1.00 0.00 ? 73  SER A HB2  4  
ATOM 8347  H HB3  . SER A 1 73  ? -0.598  -8.623  -14.733 1.00 0.00 ? 73  SER A HB3  4  
ATOM 8348  H HG   . SER A 1 73  ? -1.085  -10.175 -12.352 1.00 0.00 ? 73  SER A HG   4  
ATOM 8349  N N    . GLY A 1 74  ? -2.285  -11.824 -15.725 1.00 0.00 ? 74  GLY A N    4  
ATOM 8350  C CA   . GLY A 1 74  ? -2.530  -12.870 -16.752 1.00 0.00 ? 74  GLY A CA   4  
ATOM 8351  C C    . GLY A 1 74  ? -3.651  -13.772 -16.215 1.00 0.00 ? 74  GLY A C    4  
ATOM 8352  O O    . GLY A 1 74  ? -4.812  -13.563 -16.569 1.00 0.00 ? 74  GLY A O    4  
ATOM 8353  H H    . GLY A 1 74  ? -1.821  -12.056 -14.816 1.00 0.00 ? 74  GLY A H    4  
ATOM 8354  H HA2  . GLY A 1 74  ? -2.827  -12.447 -17.731 1.00 0.00 ? 74  GLY A HA2  4  
ATOM 8355  H HA3  . GLY A 1 74  ? -1.608  -13.453 -16.938 1.00 0.00 ? 74  GLY A HA3  4  
ATOM 8356  N N    . ASP A 1 75  ? -3.294  -14.739 -15.354 1.00 0.00 ? 75  ASP A N    4  
ATOM 8357  C CA   . ASP A 1 75  ? -4.274  -15.593 -14.615 1.00 0.00 ? 75  ASP A CA   4  
ATOM 8358  C C    . ASP A 1 75  ? -3.760  -15.832 -13.145 1.00 0.00 ? 75  ASP A C    4  
ATOM 8359  O O    . ASP A 1 75  ? -3.650  -16.966 -12.669 1.00 0.00 ? 75  ASP A O    4  
ATOM 8360  C CB   . ASP A 1 75  ? -4.542  -16.905 -15.410 1.00 0.00 ? 75  ASP A CB   4  
ATOM 8361  C CG   . ASP A 1 75  ? -5.536  -16.755 -16.561 1.00 0.00 ? 75  ASP A CG   4  
ATOM 8362  O OD1  . ASP A 1 75  ? -6.740  -16.531 -16.289 1.00 0.00 ? 75  ASP A OD1  4  
ATOM 8363  O OD2  . ASP A 1 75  ? -5.125  -16.816 -17.736 1.00 0.00 ? 75  ASP A OD2  4  
ATOM 8364  H H    . ASP A 1 75  ? -2.289  -14.771 -15.152 1.00 0.00 ? 75  ASP A H    4  
ATOM 8365  H HA   . ASP A 1 75  ? -5.231  -15.058 -14.491 1.00 0.00 ? 75  ASP A HA   4  
ATOM 8366  H HB2  . ASP A 1 75  ? -3.599  -17.348 -15.782 1.00 0.00 ? 75  ASP A HB2  4  
ATOM 8367  H HB3  . ASP A 1 75  ? -4.970  -17.672 -14.740 1.00 0.00 ? 75  ASP A HB3  4  
ATOM 8368  N N    . GLU A 1 76  ? -3.516  -14.738 -12.391 1.00 0.00 ? 76  GLU A N    4  
ATOM 8369  C CA   . GLU A 1 76  ? -2.999  -14.792 -10.992 1.00 0.00 ? 76  GLU A CA   4  
ATOM 8370  C C    . GLU A 1 76  ? -3.645  -13.629 -10.153 1.00 0.00 ? 76  GLU A C    4  
ATOM 8371  O O    . GLU A 1 76  ? -4.837  -13.316 -10.271 1.00 0.00 ? 76  GLU A O    4  
ATOM 8372  C CB   . GLU A 1 76  ? -1.423  -14.830 -11.092 1.00 0.00 ? 76  GLU A CB   4  
ATOM 8373  C CG   . GLU A 1 76  ? -0.569  -13.534 -11.277 1.00 0.00 ? 76  GLU A CG   4  
ATOM 8374  C CD   . GLU A 1 76  ? -1.072  -12.468 -12.237 1.00 0.00 ? 76  GLU A CD   4  
ATOM 8375  O OE1  . GLU A 1 76  ? -1.039  -12.693 -13.460 1.00 0.00 ? 76  GLU A OE1  4  
ATOM 8376  O OE2  . GLU A 1 76  ? -1.479  -11.376 -11.779 1.00 0.00 ? 76  GLU A OE2  4  
ATOM 8377  H H    . GLU A 1 76  ? -3.605  -13.850 -12.897 1.00 0.00 ? 76  GLU A H    4  
ATOM 8378  H HA   . GLU A 1 76  ? -3.336  -15.724 -10.500 1.00 0.00 ? 76  GLU A HA   4  
ATOM 8379  H HB2  . GLU A 1 76  ? -1.049  -15.334 -10.181 1.00 0.00 ? 76  GLU A HB2  4  
ATOM 8380  H HB3  . GLU A 1 76  ? -1.133  -15.542 -11.892 1.00 0.00 ? 76  GLU A HB3  4  
ATOM 8381  H HG2  . GLU A 1 76  ? -0.388  -13.039 -10.307 1.00 0.00 ? 76  GLU A HG2  4  
ATOM 8382  H HG3  . GLU A 1 76  ? 0.440   -13.813 -11.627 1.00 0.00 ? 76  GLU A HG3  4  
ATOM 8383  N N    . THR A 1 77  ? -2.914  -13.061 -9.187  1.00 0.00 ? 77  THR A N    4  
ATOM 8384  C CA   . THR A 1 77  ? -3.343  -11.867 -8.406  1.00 0.00 ? 77  THR A CA   4  
ATOM 8385  C C    . THR A 1 77  ? -2.001  -11.226 -7.919  1.00 0.00 ? 77  THR A C    4  
ATOM 8386  O O    . THR A 1 77  ? -1.307  -11.779 -7.060  1.00 0.00 ? 77  THR A O    4  
ATOM 8387  C CB   . THR A 1 77  ? -4.344  -12.240 -7.276  1.00 0.00 ? 77  THR A CB   4  
ATOM 8388  O OG1  . THR A 1 77  ? -5.456  -12.953 -7.814  1.00 0.00 ? 77  THR A OG1  4  
ATOM 8389  C CG2  . THR A 1 77  ? -4.930  -10.999 -6.604  1.00 0.00 ? 77  THR A CG2  4  
ATOM 8390  H H    . THR A 1 77  ? -1.945  -13.396 -9.187  1.00 0.00 ? 77  THR A H    4  
ATOM 8391  H HA   . THR A 1 77  ? -3.854  -11.160 -9.091  1.00 0.00 ? 77  THR A HA   4  
ATOM 8392  H HB   . THR A 1 77  ? -3.832  -12.878 -6.528  1.00 0.00 ? 77  THR A HB   4  
ATOM 8393  H HG1  . THR A 1 77  ? -5.227  -13.116 -8.752  1.00 0.00 ? 77  THR A HG1  4  
ATOM 8394  H HG21 . THR A 1 77  ? -5.431  -10.335 -7.334  1.00 0.00 ? 77  THR A HG21 4  
ATOM 8395  H HG22 . THR A 1 77  ? -5.672  -11.272 -5.838  1.00 0.00 ? 77  THR A HG22 4  
ATOM 8396  H HG23 . THR A 1 77  ? -4.149  -10.399 -6.111  1.00 0.00 ? 77  THR A HG23 4  
ATOM 8397  N N    . ARG A 1 78  ? -1.629  -10.074 -8.502  1.00 0.00 ? 78  ARG A N    4  
ATOM 8398  C CA   . ARG A 1 78  ? -0.299  -9.432  -8.289  1.00 0.00 ? 78  ARG A CA   4  
ATOM 8399  C C    . ARG A 1 78  ? -0.374  -7.947  -7.802  1.00 0.00 ? 78  ARG A C    4  
ATOM 8400  O O    . ARG A 1 78  ? -1.293  -7.199  -8.149  1.00 0.00 ? 78  ARG A O    4  
ATOM 8401  C CB   . ARG A 1 78  ? 0.399   -9.507  -9.680  1.00 0.00 ? 78  ARG A CB   4  
ATOM 8402  C CG   . ARG A 1 78  ? 1.936   -9.319  -9.712  1.00 0.00 ? 78  ARG A CG   4  
ATOM 8403  C CD   . ARG A 1 78  ? 2.446   -8.778  -11.065 1.00 0.00 ? 78  ARG A CD   4  
ATOM 8404  N NE   . ARG A 1 78  ? 2.462   -7.287  -11.060 1.00 0.00 ? 78  ARG A NE   4  
ATOM 8405  C CZ   . ARG A 1 78  ? 1.656   -6.479  -11.745 1.00 0.00 ? 78  ARG A CZ   4  
ATOM 8406  N NH1  . ARG A 1 78  ? 0.643   -6.867  -12.477 1.00 0.00 ? 78  ARG A NH1  4  
ATOM 8407  N NH2  . ARG A 1 78  ? 1.881   -5.203  -11.675 1.00 0.00 ? 78  ARG A NH2  4  
ATOM 8408  H H    . ARG A 1 78  ? -2.308  -9.708  -9.193  1.00 0.00 ? 78  ARG A H    4  
ATOM 8409  H HA   . ARG A 1 78  ? 0.295   -10.013 -7.555  1.00 0.00 ? 78  ARG A HA   4  
ATOM 8410  H HB2  . ARG A 1 78  ? 0.201   -10.483 -10.166 1.00 0.00 ? 78  ARG A HB2  4  
ATOM 8411  H HB3  . ARG A 1 78  ? -0.095  -8.774  -10.347 1.00 0.00 ? 78  ARG A HB3  4  
ATOM 8412  H HG2  . ARG A 1 78  ? 2.288   -8.671  -8.887  1.00 0.00 ? 78  ARG A HG2  4  
ATOM 8413  H HG3  . ARG A 1 78  ? 2.410   -10.298 -9.500  1.00 0.00 ? 78  ARG A HG3  4  
ATOM 8414  H HD2  . ARG A 1 78  ? 3.487   -9.128  -11.218 1.00 0.00 ? 78  ARG A HD2  4  
ATOM 8415  H HD3  . ARG A 1 78  ? 1.892   -9.220  -11.920 1.00 0.00 ? 78  ARG A HD3  4  
ATOM 8416  H HE   . ARG A 1 78  ? 3.141   -6.775  -10.490 1.00 0.00 ? 78  ARG A HE   4  
ATOM 8417  H HH11 . ARG A 1 78  ? 0.399   -7.868  -12.467 1.00 0.00 ? 78  ARG A HH11 4  
ATOM 8418  H HH12 . ARG A 1 78  ? 0.087   -6.113  -12.905 1.00 0.00 ? 78  ARG A HH12 4  
ATOM 8419  H HH21 . ARG A 1 78  ? 2.600   -4.893  -11.018 1.00 0.00 ? 78  ARG A HH21 4  
ATOM 8420  H HH22 . ARG A 1 78  ? 1.215   -4.609  -12.186 1.00 0.00 ? 78  ARG A HH22 4  
ATOM 8421  N N    . LEU A 1 79  ? 0.655   -7.494  -7.057  1.00 0.00 ? 79  LEU A N    4  
ATOM 8422  C CA   . LEU A 1 79  ? 0.765   -6.089  -6.560  1.00 0.00 ? 79  LEU A CA   4  
ATOM 8423  C C    . LEU A 1 79  ? 0.864   -5.051  -7.737  1.00 0.00 ? 79  LEU A C    4  
ATOM 8424  O O    . LEU A 1 79  ? 1.765   -5.121  -8.583  1.00 0.00 ? 79  LEU A O    4  
ATOM 8425  C CB   . LEU A 1 79  ? 2.048   -5.982  -5.678  1.00 0.00 ? 79  LEU A CB   4  
ATOM 8426  C CG   . LEU A 1 79  ? 2.136   -4.898  -4.566  1.00 0.00 ? 79  LEU A CG   4  
ATOM 8427  C CD1  . LEU A 1 79  ? 3.608   -4.718  -4.142  1.00 0.00 ? 79  LEU A CD1  4  
ATOM 8428  C CD2  . LEU A 1 79  ? 1.577   -3.513  -4.916  1.00 0.00 ? 79  LEU A CD2  4  
ATOM 8429  H H    . LEU A 1 79  ? 1.354   -8.209  -6.829  1.00 0.00 ? 79  LEU A H    4  
ATOM 8430  H HA   . LEU A 1 79  ? -0.123  -5.873  -5.932  1.00 0.00 ? 79  LEU A HA   4  
ATOM 8431  H HB2  . LEU A 1 79  ? 2.250   -6.943  -5.168  1.00 0.00 ? 79  LEU A HB2  4  
ATOM 8432  H HB3  . LEU A 1 79  ? 2.909   -5.864  -6.358  1.00 0.00 ? 79  LEU A HB3  4  
ATOM 8433  H HG   . LEU A 1 79  ? 1.559   -5.258  -3.691  1.00 0.00 ? 79  LEU A HG   4  
ATOM 8434  H HD11 . LEU A 1 79  ? 4.099   -5.678  -3.902  1.00 0.00 ? 79  LEU A HD11 4  
ATOM 8435  H HD12 . LEU A 1 79  ? 4.219   -4.252  -4.938  1.00 0.00 ? 79  LEU A HD12 4  
ATOM 8436  H HD13 . LEU A 1 79  ? 3.704   -4.079  -3.245  1.00 0.00 ? 79  LEU A HD13 4  
ATOM 8437  H HD21 . LEU A 1 79  ? 2.007   -3.115  -5.852  1.00 0.00 ? 79  LEU A HD21 4  
ATOM 8438  H HD22 . LEU A 1 79  ? 0.479   -3.531  -5.041  1.00 0.00 ? 79  LEU A HD22 4  
ATOM 8439  H HD23 . LEU A 1 79  ? 1.791   -2.781  -4.118  1.00 0.00 ? 79  LEU A HD23 4  
ATOM 8440  N N    . GLN A 1 80  ? -0.070  -4.091  -7.769  1.00 0.00 ? 80  GLN A N    4  
ATOM 8441  C CA   . GLN A 1 80  ? -0.093  -3.017  -8.799  1.00 0.00 ? 80  GLN A CA   4  
ATOM 8442  C C    . GLN A 1 80  ? -0.778  -1.716  -8.268  1.00 0.00 ? 80  GLN A C    4  
ATOM 8443  O O    . GLN A 1 80  ? -1.696  -1.734  -7.435  1.00 0.00 ? 80  GLN A O    4  
ATOM 8444  C CB   . GLN A 1 80  ? -0.845  -3.539  -10.062 1.00 0.00 ? 80  GLN A CB   4  
ATOM 8445  C CG   . GLN A 1 80  ? -0.672  -2.661  -11.335 1.00 0.00 ? 80  GLN A CG   4  
ATOM 8446  C CD   . GLN A 1 80  ? -1.100  -3.321  -12.647 1.00 0.00 ? 80  GLN A CD   4  
ATOM 8447  O OE1  . GLN A 1 80  ? -0.500  -4.293  -13.100 1.00 0.00 ? 80  GLN A OE1  4  
ATOM 8448  N NE2  . GLN A 1 80  ? -2.113  -2.818  -13.309 1.00 0.00 ? 80  GLN A NE2  4  
ATOM 8449  H H    . GLN A 1 80  ? -0.752  -4.154  -7.002  1.00 0.00 ? 80  GLN A H    4  
ATOM 8450  H HA   . GLN A 1 80  ? 0.954   -2.771  -9.075  1.00 0.00 ? 80  GLN A HA   4  
ATOM 8451  H HB2  . GLN A 1 80  ? -0.505  -4.569  -10.286 1.00 0.00 ? 80  GLN A HB2  4  
ATOM 8452  H HB3  . GLN A 1 80  ? -1.922  -3.645  -9.828  1.00 0.00 ? 80  GLN A HB3  4  
ATOM 8453  H HG2  . GLN A 1 80  ? -1.200  -1.697  -11.197 1.00 0.00 ? 80  GLN A HG2  4  
ATOM 8454  H HG3  . GLN A 1 80  ? 0.390   -2.380  -11.456 1.00 0.00 ? 80  GLN A HG3  4  
ATOM 8455  H HE21 . GLN A 1 80  ? -2.599  -2.024  -12.884 1.00 0.00 ? 80  GLN A HE21 4  
ATOM 8456  H HE22 . GLN A 1 80  ? -2.356  -3.319  -14.168 1.00 0.00 ? 80  GLN A HE22 4  
ATOM 8457  N N    . LEU A 1 81  ? -0.310  -0.579  -8.812  1.00 0.00 ? 81  LEU A N    4  
ATOM 8458  C CA   . LEU A 1 81  ? -0.921  0.748   -8.572  1.00 0.00 ? 81  LEU A CA   4  
ATOM 8459  C C    . LEU A 1 81  ? -1.667  1.162   -9.887  1.00 0.00 ? 81  LEU A C    4  
ATOM 8460  O O    . LEU A 1 81  ? -1.073  1.687   -10.835 1.00 0.00 ? 81  LEU A O    4  
ATOM 8461  C CB   . LEU A 1 81  ? 0.140   1.763   -8.056  1.00 0.00 ? 81  LEU A CB   4  
ATOM 8462  C CG   . LEU A 1 81  ? 1.368   2.219   -8.893  1.00 0.00 ? 81  LEU A CG   4  
ATOM 8463  C CD1  . LEU A 1 81  ? 1.928   3.525   -8.301  1.00 0.00 ? 81  LEU A CD1  4  
ATOM 8464  C CD2  . LEU A 1 81  ? 2.502   1.178   -8.915  1.00 0.00 ? 81  LEU A CD2  4  
ATOM 8465  H H    . LEU A 1 81  ? 0.455   -0.695  -9.483  1.00 0.00 ? 81  LEU A H    4  
ATOM 8466  H HA   . LEU A 1 81  ? -1.672  0.692   -7.766  1.00 0.00 ? 81  LEU A HA   4  
ATOM 8467  H HB2  . LEU A 1 81  ? -0.440  2.660   -7.769  1.00 0.00 ? 81  LEU A HB2  4  
ATOM 8468  H HB3  . LEU A 1 81  ? 0.522   1.388   -7.091  1.00 0.00 ? 81  LEU A HB3  4  
ATOM 8469  H HG   . LEU A 1 81  ? 1.061   2.433   -9.933  1.00 0.00 ? 81  LEU A HG   4  
ATOM 8470  H HD11 . LEU A 1 81  ? 1.167   4.323   -8.246  1.00 0.00 ? 81  LEU A HD11 4  
ATOM 8471  H HD12 . LEU A 1 81  ? 2.330   3.391   -7.277  1.00 0.00 ? 81  LEU A HD12 4  
ATOM 8472  H HD13 . LEU A 1 81  ? 2.742   3.931   -8.923  1.00 0.00 ? 81  LEU A HD13 4  
ATOM 8473  H HD21 . LEU A 1 81  ? 2.782   0.856   -7.897  1.00 0.00 ? 81  LEU A HD21 4  
ATOM 8474  H HD22 . LEU A 1 81  ? 2.237   0.272   -9.486  1.00 0.00 ? 81  LEU A HD22 4  
ATOM 8475  H HD23 . LEU A 1 81  ? 3.422   1.575   -9.378  1.00 0.00 ? 81  LEU A HD23 4  
ATOM 8476  N N    . GLU A 1 82  ? -2.989  0.912   -9.947  1.00 0.00 ? 82  GLU A N    4  
ATOM 8477  C CA   . GLU A 1 82  ? -3.831  1.256   -11.130 1.00 0.00 ? 82  GLU A CA   4  
ATOM 8478  C C    . GLU A 1 82  ? -4.202  2.779   -11.162 1.00 0.00 ? 82  GLU A C    4  
ATOM 8479  O O    . GLU A 1 82  ? -4.677  3.342   -10.171 1.00 0.00 ? 82  GLU A O    4  
ATOM 8480  C CB   . GLU A 1 82  ? -5.130  0.405   -11.061 1.00 0.00 ? 82  GLU A CB   4  
ATOM 8481  C CG   . GLU A 1 82  ? -4.964  -1.125  -11.240 1.00 0.00 ? 82  GLU A CG   4  
ATOM 8482  C CD   . GLU A 1 82  ? -6.234  -1.904  -10.948 1.00 0.00 ? 82  GLU A CD   4  
ATOM 8483  O OE1  . GLU A 1 82  ? -7.045  -2.095  -11.877 1.00 0.00 ? 82  GLU A OE1  4  
ATOM 8484  O OE2  . GLU A 1 82  ? -6.408  -2.356  -9.797  1.00 0.00 ? 82  GLU A OE2  4  
ATOM 8485  H H    . GLU A 1 82  ? -3.400  0.430   -9.131  1.00 0.00 ? 82  GLU A H    4  
ATOM 8486  H HA   . GLU A 1 82  ? -3.292  0.990   -12.062 1.00 0.00 ? 82  GLU A HA   4  
ATOM 8487  H HB2  . GLU A 1 82  ? -5.650  0.603   -10.104 1.00 0.00 ? 82  GLU A HB2  4  
ATOM 8488  H HB3  . GLU A 1 82  ? -5.843  0.755   -11.835 1.00 0.00 ? 82  GLU A HB3  4  
ATOM 8489  H HG2  . GLU A 1 82  ? -4.654  -1.369  -12.270 1.00 0.00 ? 82  GLU A HG2  4  
ATOM 8490  H HG3  . GLU A 1 82  ? -4.183  -1.526  -10.570 1.00 0.00 ? 82  GLU A HG3  4  
ATOM 8491  N N    . ALA A 1 83  ? -4.029  3.452   -12.314 1.00 0.00 ? 83  ALA A N    4  
ATOM 8492  C CA   . ALA A 1 83  ? -4.358  4.898   -12.451 1.00 0.00 ? 83  ALA A CA   4  
ATOM 8493  C C    . ALA A 1 83  ? -5.898  5.117   -12.619 1.00 0.00 ? 83  ALA A C    4  
ATOM 8494  O O    . ALA A 1 83  ? -6.467  4.877   -13.689 1.00 0.00 ? 83  ALA A O    4  
ATOM 8495  C CB   . ALA A 1 83  ? -3.553  5.415   -13.659 1.00 0.00 ? 83  ALA A CB   4  
ATOM 8496  H H    . ALA A 1 83  ? -3.631  2.908   -13.084 1.00 0.00 ? 83  ALA A H    4  
ATOM 8497  H HA   . ALA A 1 83  ? -4.011  5.454   -11.554 1.00 0.00 ? 83  ALA A HA   4  
ATOM 8498  H HB1  . ALA A 1 83  ? -2.465  5.262   -13.532 1.00 0.00 ? 83  ALA A HB1  4  
ATOM 8499  H HB2  . ALA A 1 83  ? -3.850  4.918   -14.603 1.00 0.00 ? 83  ALA A HB2  4  
ATOM 8500  H HB3  . ALA A 1 83  ? -3.706  6.500   -13.807 1.00 0.00 ? 83  ALA A HB3  4  
ATOM 8501  N N    . VAL A 1 84  ? -6.564  5.567   -11.540 1.00 0.00 ? 84  VAL A N    4  
ATOM 8502  C CA   . VAL A 1 84  ? -8.045  5.759   -11.506 1.00 0.00 ? 84  VAL A CA   4  
ATOM 8503  C C    . VAL A 1 84  ? -8.425  7.216   -11.051 1.00 0.00 ? 84  VAL A C    4  
ATOM 8504  O O    . VAL A 1 84  ? -7.606  7.992   -10.545 1.00 0.00 ? 84  VAL A O    4  
ATOM 8505  C CB   . VAL A 1 84  ? -8.626  4.598   -10.607 1.00 0.00 ? 84  VAL A CB   4  
ATOM 8506  C CG1  . VAL A 1 84  ? -8.572  4.814   -9.079  1.00 0.00 ? 84  VAL A CG1  4  
ATOM 8507  C CG2  . VAL A 1 84  ? -10.072 4.218   -10.993 1.00 0.00 ? 84  VAL A CG2  4  
ATOM 8508  H H    . VAL A 1 84  ? -5.994  5.732   -10.695 1.00 0.00 ? 84  VAL A H    4  
ATOM 8509  H HA   . VAL A 1 84  ? -8.453  5.653   -12.532 1.00 0.00 ? 84  VAL A HA   4  
ATOM 8510  H HB   . VAL A 1 84  ? -8.017  3.687   -10.790 1.00 0.00 ? 84  VAL A HB   4  
ATOM 8511  H HG11 . VAL A 1 84  ? -7.541  5.010   -8.733  1.00 0.00 ? 84  VAL A HG11 4  
ATOM 8512  H HG12 . VAL A 1 84  ? -9.194  5.669   -8.761  1.00 0.00 ? 84  VAL A HG12 4  
ATOM 8513  H HG13 . VAL A 1 84  ? -8.930  3.926   -8.525  1.00 0.00 ? 84  VAL A HG13 4  
ATOM 8514  H HG21 . VAL A 1 84  ? -10.166 3.999   -12.073 1.00 0.00 ? 84  VAL A HG21 4  
ATOM 8515  H HG22 . VAL A 1 84  ? -10.407 3.305   -10.464 1.00 0.00 ? 84  VAL A HG22 4  
ATOM 8516  H HG23 . VAL A 1 84  ? -10.803 5.011   -10.749 1.00 0.00 ? 84  VAL A HG23 4  
ATOM 8517  N N    . ASN A 1 85  ? -9.701  7.596   -11.238 1.00 0.00 ? 85  ASN A N    4  
ATOM 8518  C CA   . ASN A 1 85  ? -10.209 8.948   -10.862 1.00 0.00 ? 85  ASN A CA   4  
ATOM 8519  C C    . ASN A 1 85  ? -11.696 8.875   -10.379 1.00 0.00 ? 85  ASN A C    4  
ATOM 8520  O O    . ASN A 1 85  ? -12.575 8.392   -11.100 1.00 0.00 ? 85  ASN A O    4  
ATOM 8521  C CB   . ASN A 1 85  ? -10.025 9.939   -12.058 1.00 0.00 ? 85  ASN A CB   4  
ATOM 8522  C CG   . ASN A 1 85  ? -10.506 9.580   -13.477 1.00 0.00 ? 85  ASN A CG   4  
ATOM 8523  O OD1  . ASN A 1 85  ? -9.721  9.452   -14.409 1.00 0.00 ? 85  ASN A OD1  4  
ATOM 8524  N ND2  . ASN A 1 85  ? -11.787 9.434   -13.708 1.00 0.00 ? 85  ASN A ND2  4  
ATOM 8525  H H    . ASN A 1 85  ? -10.297 6.878   -11.663 1.00 0.00 ? 85  ASN A H    4  
ATOM 8526  H HA   . ASN A 1 85  ? -9.609  9.343   -10.016 1.00 0.00 ? 85  ASN A HA   4  
ATOM 8527  H HB2  . ASN A 1 85  ? -10.452 10.924  -11.794 1.00 0.00 ? 85  ASN A HB2  4  
ATOM 8528  H HB3  . ASN A 1 85  ? -8.941  10.142  -12.149 1.00 0.00 ? 85  ASN A HB3  4  
ATOM 8529  H HD21 . ASN A 1 85  ? -12.360 9.271   -12.869 1.00 0.00 ? 85  ASN A HD21 4  
ATOM 8530  H HD22 . ASN A 1 85  ? -11.985 9.125   -14.663 1.00 0.00 ? 85  ASN A HD22 4  
ATOM 8531  N N    . ILE A 1 86  ? -11.979 9.370   -9.160  1.00 0.00 ? 86  ILE A N    4  
ATOM 8532  C CA   . ILE A 1 86  ? -13.366 9.410   -8.597  1.00 0.00 ? 86  ILE A CA   4  
ATOM 8533  C C    . ILE A 1 86  ? -13.588 10.742  -7.791  1.00 0.00 ? 86  ILE A C    4  
ATOM 8534  O O    . ILE A 1 86  ? -12.671 11.455  -7.368  1.00 0.00 ? 86  ILE A O    4  
ATOM 8535  C CB   . ILE A 1 86  ? -13.666 8.093   -7.780  1.00 0.00 ? 86  ILE A CB   4  
ATOM 8536  C CG1  . ILE A 1 86  ? -15.192 8.011   -7.464  1.00 0.00 ? 86  ILE A CG1  4  
ATOM 8537  C CG2  . ILE A 1 86  ? -12.859 7.978   -6.461  1.00 0.00 ? 86  ILE A CG2  4  
ATOM 8538  C CD1  . ILE A 1 86  ? -15.740 6.638   -7.119  1.00 0.00 ? 86  ILE A CD1  4  
ATOM 8539  H H    . ILE A 1 86  ? -11.185 9.752   -8.637  1.00 0.00 ? 86  ILE A H    4  
ATOM 8540  H HA   . ILE A 1 86  ? -14.102 9.442   -9.425  1.00 0.00 ? 86  ILE A HA   4  
ATOM 8541  H HB   . ILE A 1 86  ? -13.410 7.231   -8.429  1.00 0.00 ? 86  ILE A HB   4  
ATOM 8542  H HG12 . ILE A 1 86  ? -15.456 8.697   -6.638  1.00 0.00 ? 86  ILE A HG12 4  
ATOM 8543  H HG13 . ILE A 1 86  ? -15.785 8.358   -8.334  1.00 0.00 ? 86  ILE A HG13 4  
ATOM 8544  H HG21 . ILE A 1 86  ? -11.772 8.070   -6.634  1.00 0.00 ? 86  ILE A HG21 4  
ATOM 8545  H HG22 . ILE A 1 86  ? -13.143 8.765   -5.739  1.00 0.00 ? 86  ILE A HG22 4  
ATOM 8546  H HG23 . ILE A 1 86  ? -13.016 7.003   -5.964  1.00 0.00 ? 86  ILE A HG23 4  
ATOM 8547  H HD11 . ILE A 1 86  ? -15.585 5.939   -7.958  1.00 0.00 ? 86  ILE A HD11 4  
ATOM 8548  H HD12 . ILE A 1 86  ? -15.263 6.230   -6.212  1.00 0.00 ? 86  ILE A HD12 4  
ATOM 8549  H HD13 . ILE A 1 86  ? -16.829 6.713   -6.935  1.00 0.00 ? 86  ILE A HD13 4  
ATOM 8550  N N    . THR A 1 87  ? -14.876 11.076  -7.672  1.00 0.00 ? 87  THR A N    4  
ATOM 8551  C CA   . THR A 1 87  ? -15.383 12.259  -6.901  1.00 0.00 ? 87  THR A CA   4  
ATOM 8552  C C    . THR A 1 87  ? -16.735 11.952  -6.152  1.00 0.00 ? 87  THR A C    4  
ATOM 8553  O O    . THR A 1 87  ? -16.975 12.549  -5.101  1.00 0.00 ? 87  THR A O    4  
ATOM 8554  C CB   . THR A 1 87  ? -15.497 13.499  -7.849  1.00 0.00 ? 87  THR A CB   4  
ATOM 8555  O OG1  . THR A 1 87  ? -15.801 14.647  -7.065  1.00 0.00 ? 87  THR A OG1  4  
ATOM 8556  C CG2  . THR A 1 87  ? -16.573 13.430  -8.951  1.00 0.00 ? 87  THR A CG2  4  
ATOM 8557  H H    . THR A 1 87  ? -15.488 10.322  -8.026  1.00 0.00 ? 87  THR A H    4  
ATOM 8558  H HA   . THR A 1 87  ? -14.661 12.514  -6.100  1.00 0.00 ? 87  THR A HA   4  
ATOM 8559  H HB   . THR A 1 87  ? -14.505 13.654  -8.320  1.00 0.00 ? 87  THR A HB   4  
ATOM 8560  H HG1  . THR A 1 87  ? -16.663 14.481  -6.669  1.00 0.00 ? 87  THR A HG1  4  
ATOM 8561  H HG21 . THR A 1 87  ? -17.595 13.314  -8.544  1.00 0.00 ? 87  THR A HG21 4  
ATOM 8562  H HG22 . THR A 1 87  ? -16.571 14.347  -9.568  1.00 0.00 ? 87  THR A HG22 4  
ATOM 8563  H HG23 . THR A 1 87  ? -16.402 12.580  -9.638  1.00 0.00 ? 87  THR A HG23 4  
ATOM 8564  N N    . ASP A 1 88  ? -17.548 10.976  -6.608  1.00 0.00 ? 88  ASP A N    4  
ATOM 8565  C CA   . ASP A 1 88  ? -18.812 10.528  -5.953  1.00 0.00 ? 88  ASP A CA   4  
ATOM 8566  C C    . ASP A 1 88  ? -18.618 9.853   -4.545  1.00 0.00 ? 88  ASP A C    4  
ATOM 8567  O O    . ASP A 1 88  ? -19.519 9.931   -3.708  1.00 0.00 ? 88  ASP A O    4  
ATOM 8568  C CB   . ASP A 1 88  ? -19.493 9.509   -6.914  1.00 0.00 ? 88  ASP A CB   4  
ATOM 8569  C CG   . ASP A 1 88  ? -19.761 9.973   -8.349  1.00 0.00 ? 88  ASP A CG   4  
ATOM 8570  O OD1  . ASP A 1 88  ? -18.809 9.946   -9.160  1.00 0.00 ? 88  ASP A OD1  4  
ATOM 8571  O OD2  . ASP A 1 88  ? -20.903 10.370  -8.661  1.00 0.00 ? 88  ASP A OD2  4  
ATOM 8572  H H    . ASP A 1 88  ? -17.305 10.575  -7.521  1.00 0.00 ? 88  ASP A H    4  
ATOM 8573  H HA   . ASP A 1 88  ? -19.482 11.400  -5.815  1.00 0.00 ? 88  ASP A HA   4  
ATOM 8574  H HB2  . ASP A 1 88  ? -18.896 8.580   -6.977  1.00 0.00 ? 88  ASP A HB2  4  
ATOM 8575  H HB3  . ASP A 1 88  ? -20.461 9.193   -6.484  1.00 0.00 ? 88  ASP A HB3  4  
ATOM 8576  N N    . LEU A 1 89  ? -17.460 9.188   -4.307  1.00 0.00 ? 89  LEU A N    4  
ATOM 8577  C CA   . LEU A 1 89  ? -17.072 8.524   -3.020  1.00 0.00 ? 89  LEU A CA   4  
ATOM 8578  C C    . LEU A 1 89  ? -17.790 7.137   -2.889  1.00 0.00 ? 89  LEU A C    4  
ATOM 8579  O O    . LEU A 1 89  ? -18.883 7.015   -2.328  1.00 0.00 ? 89  LEU A O    4  
ATOM 8580  C CB   . LEU A 1 89  ? -17.288 9.419   -1.748  1.00 0.00 ? 89  LEU A CB   4  
ATOM 8581  C CG   . LEU A 1 89  ? -16.761 10.883  -1.756  1.00 0.00 ? 89  LEU A CG   4  
ATOM 8582  C CD1  . LEU A 1 89  ? -16.978 11.541  -0.383  1.00 0.00 ? 89  LEU A CD1  4  
ATOM 8583  C CD2  . LEU A 1 89  ? -15.283 11.016  -2.153  1.00 0.00 ? 89  LEU A CD2  4  
ATOM 8584  H H    . LEU A 1 89  ? -16.836 9.241   -5.127  1.00 0.00 ? 89  LEU A H    4  
ATOM 8585  H HA   . LEU A 1 89  ? -15.988 8.322   -3.080  1.00 0.00 ? 89  LEU A HA   4  
ATOM 8586  H HB2  . LEU A 1 89  ? -18.372 9.456   -1.522  1.00 0.00 ? 89  LEU A HB2  4  
ATOM 8587  H HB3  . LEU A 1 89  ? -16.852 8.887   -0.881  1.00 0.00 ? 89  LEU A HB3  4  
ATOM 8588  H HG   . LEU A 1 89  ? -17.355 11.455  -2.498  1.00 0.00 ? 89  LEU A HG   4  
ATOM 8589  H HD11 . LEU A 1 89  ? -18.042 11.515  -0.083  1.00 0.00 ? 89  LEU A HD11 4  
ATOM 8590  H HD12 . LEU A 1 89  ? -16.397 11.044  0.415   1.00 0.00 ? 89  LEU A HD12 4  
ATOM 8591  H HD13 . LEU A 1 89  ? -16.678 12.606  -0.391  1.00 0.00 ? 89  LEU A HD13 4  
ATOM 8592  H HD21 . LEU A 1 89  ? -14.618 10.467  -1.464  1.00 0.00 ? 89  LEU A HD21 4  
ATOM 8593  H HD22 . LEU A 1 89  ? -15.097 10.640  -3.174  1.00 0.00 ? 89  LEU A HD22 4  
ATOM 8594  H HD23 . LEU A 1 89  ? -14.954 12.072  -2.150  1.00 0.00 ? 89  LEU A HD23 4  
ATOM 8595  N N    . SER A 1 90  ? -17.134 6.070   -3.384  1.00 0.00 ? 90  SER A N    4  
ATOM 8596  C CA   . SER A 1 90  ? -17.700 4.695   -3.375  1.00 0.00 ? 90  SER A CA   4  
ATOM 8597  C C    . SER A 1 90  ? -17.371 3.899   -2.069  1.00 0.00 ? 90  SER A C    4  
ATOM 8598  O O    . SER A 1 90  ? -16.248 3.403   -1.898  1.00 0.00 ? 90  SER A O    4  
ATOM 8599  C CB   . SER A 1 90  ? -17.133 3.969   -4.623  1.00 0.00 ? 90  SER A CB   4  
ATOM 8600  O OG   . SER A 1 90  ? -15.723 3.748   -4.514  1.00 0.00 ? 90  SER A OG   4  
ATOM 8601  H H    . SER A 1 90  ? -16.241 6.269   -3.843  1.00 0.00 ? 90  SER A H    4  
ATOM 8602  H HA   . SER A 1 90  ? -18.802 4.736   -3.499  1.00 0.00 ? 90  SER A HA   4  
ATOM 8603  H HB2  . SER A 1 90  ? -17.643 2.994   -4.752  1.00 0.00 ? 90  SER A HB2  4  
ATOM 8604  H HB3  . SER A 1 90  ? -17.356 4.531   -5.550  1.00 0.00 ? 90  SER A HB3  4  
ATOM 8605  H HG   . SER A 1 90  ? -15.577 3.452   -3.601  1.00 0.00 ? 90  SER A HG   4  
ATOM 8606  N N    . GLU A 1 91  ? -18.367 3.749   -1.179  1.00 0.00 ? 91  GLU A N    4  
ATOM 8607  C CA   . GLU A 1 91  ? -18.230 2.949   0.071   1.00 0.00 ? 91  GLU A CA   4  
ATOM 8608  C C    . GLU A 1 91  ? -18.582 1.454   -0.235  1.00 0.00 ? 91  GLU A C    4  
ATOM 8609  O O    . GLU A 1 91  ? -19.754 1.074   -0.338  1.00 0.00 ? 91  GLU A O    4  
ATOM 8610  C CB   . GLU A 1 91  ? -19.144 3.601   1.152   1.00 0.00 ? 91  GLU A CB   4  
ATOM 8611  C CG   . GLU A 1 91  ? -19.371 2.823   2.484   1.00 0.00 ? 91  GLU A CG   4  
ATOM 8612  C CD   . GLU A 1 91  ? -18.186 2.421   3.357   1.00 0.00 ? 91  GLU A CD   4  
ATOM 8613  O OE1  . GLU A 1 91  ? -17.021 2.753   3.060   1.00 0.00 ? 91  GLU A OE1  4  
ATOM 8614  O OE2  . GLU A 1 91  ? -18.433 1.735   4.374   1.00 0.00 ? 91  GLU A OE2  4  
ATOM 8615  H H    . GLU A 1 91  ? -19.246 4.216   -1.426  1.00 0.00 ? 91  GLU A H    4  
ATOM 8616  H HA   . GLU A 1 91  ? -17.191 3.002   0.456   1.00 0.00 ? 91  GLU A HA   4  
ATOM 8617  H HB2  . GLU A 1 91  ? -18.737 4.601   1.397   1.00 0.00 ? 91  GLU A HB2  4  
ATOM 8618  H HB3  . GLU A 1 91  ? -20.145 3.800   0.720   1.00 0.00 ? 91  GLU A HB3  4  
ATOM 8619  H HG2  . GLU A 1 91  ? -20.042 3.409   3.135   1.00 0.00 ? 91  GLU A HG2  4  
ATOM 8620  H HG3  . GLU A 1 91  ? -19.931 1.894   2.276   1.00 0.00 ? 91  GLU A HG3  4  
ATOM 8621  N N    . ASN A 1 92  ? -17.550 0.607   -0.400  1.00 0.00 ? 92  ASN A N    4  
ATOM 8622  C CA   . ASN A 1 92  ? -17.742 -0.851  -0.666  1.00 0.00 ? 92  ASN A CA   4  
ATOM 8623  C C    . ASN A 1 92  ? -16.767 -1.726  0.197   1.00 0.00 ? 92  ASN A C    4  
ATOM 8624  O O    . ASN A 1 92  ? -16.028 -2.572  -0.313  1.00 0.00 ? 92  ASN A O    4  
ATOM 8625  C CB   . ASN A 1 92  ? -17.603 -1.035  -2.210  1.00 0.00 ? 92  ASN A CB   4  
ATOM 8626  C CG   . ASN A 1 92  ? -18.144 -2.343  -2.798  1.00 0.00 ? 92  ASN A CG   4  
ATOM 8627  O OD1  . ASN A 1 92  ? -17.430 -3.133  -3.407  1.00 0.00 ? 92  ASN A OD1  4  
ATOM 8628  N ND2  . ASN A 1 92  ? -19.431 -2.590  -2.706  1.00 0.00 ? 92  ASN A ND2  4  
ATOM 8629  H H    . ASN A 1 92  ? -16.628 1.045   -0.298  1.00 0.00 ? 92  ASN A H    4  
ATOM 8630  H HA   . ASN A 1 92  ? -18.760 -1.165  -0.357  1.00 0.00 ? 92  ASN A HA   4  
ATOM 8631  H HB2  . ASN A 1 92  ? -18.116 -0.215  -2.749  1.00 0.00 ? 92  ASN A HB2  4  
ATOM 8632  H HB3  . ASN A 1 92  ? -16.541 -0.936  -2.504  1.00 0.00 ? 92  ASN A HB3  4  
ATOM 8633  H HD21 . ASN A 1 92  ? -20.011 -1.854  -2.294  1.00 0.00 ? 92  ASN A HD21 4  
ATOM 8634  H HD22 . ASN A 1 92  ? -19.734 -3.440  -3.185  1.00 0.00 ? 92  ASN A HD22 4  
ATOM 8635  N N    . ARG A 1 93  ? -16.836 -1.571  1.533   1.00 0.00 ? 93  ARG A N    4  
ATOM 8636  C CA   . ARG A 1 93  ? -15.978 -2.334  2.491   1.00 0.00 ? 93  ARG A CA   4  
ATOM 8637  C C    . ARG A 1 93  ? -16.526 -3.766  2.826   1.00 0.00 ? 93  ARG A C    4  
ATOM 8638  O O    . ARG A 1 93  ? -15.735 -4.706  2.923   1.00 0.00 ? 93  ARG A O    4  
ATOM 8639  C CB   . ARG A 1 93  ? -15.826 -1.496  3.788   1.00 0.00 ? 93  ARG A CB   4  
ATOM 8640  C CG   . ARG A 1 93  ? -15.135 -0.105  3.660   1.00 0.00 ? 93  ARG A CG   4  
ATOM 8641  C CD   . ARG A 1 93  ? -14.924 0.680   4.980   1.00 0.00 ? 93  ARG A CD   4  
ATOM 8642  N NE   . ARG A 1 93  ? -16.209 0.938   5.683   1.00 0.00 ? 93  ARG A NE   4  
ATOM 8643  C CZ   . ARG A 1 93  ? -16.742 0.101   6.567   1.00 0.00 ? 93  ARG A CZ   4  
ATOM 8644  N NH1  . ARG A 1 93  ? -16.037 -0.657  7.367   1.00 0.00 ? 93  ARG A NH1  4  
ATOM 8645  N NH2  . ARG A 1 93  ? -18.034 -0.007  6.581   1.00 0.00 ? 93  ARG A NH2  4  
ATOM 8646  H H    . ARG A 1 93  ? -17.468 -0.821  1.838   1.00 0.00 ? 93  ARG A H    4  
ATOM 8647  H HA   . ARG A 1 93  ? -14.974 -2.478  2.054   1.00 0.00 ? 93  ARG A HA   4  
ATOM 8648  H HB2  . ARG A 1 93  ? -16.830 -1.371  4.237   1.00 0.00 ? 93  ARG A HB2  4  
ATOM 8649  H HB3  . ARG A 1 93  ? -15.270 -2.093  4.537   1.00 0.00 ? 93  ARG A HB3  4  
ATOM 8650  H HG2  . ARG A 1 93  ? -14.152 -0.226  3.167   1.00 0.00 ? 93  ARG A HG2  4  
ATOM 8651  H HG3  . ARG A 1 93  ? -15.716 0.535   2.966   1.00 0.00 ? 93  ARG A HG3  4  
ATOM 8652  H HD2  . ARG A 1 93  ? -14.177 0.176   5.620   1.00 0.00 ? 93  ARG A HD2  4  
ATOM 8653  H HD3  . ARG A 1 93  ? -14.454 1.655   4.739   1.00 0.00 ? 93  ARG A HD3  4  
ATOM 8654  H HE   . ARG A 1 93  ? -16.967 1.416   5.134   1.00 0.00 ? 93  ARG A HE   4  
ATOM 8655  H HH11 . ARG A 1 93  ? -15.021 -0.614  7.236   1.00 0.00 ? 93  ARG A HH11 4  
ATOM 8656  H HH12 . ARG A 1 93  ? -16.557 -1.458  7.805   1.00 0.00 ? 93  ARG A HH12 4  
ATOM 8657  H HH21 . ARG A 1 93  ? -18.489 0.548   5.833   1.00 0.00 ? 93  ARG A HH21 4  
ATOM 8658  H HH22 . ARG A 1 93  ? -18.383 -0.866  7.029   1.00 0.00 ? 93  ARG A HH22 4  
ATOM 8659  N N    . LYS A 1 94  ? -17.852 -3.952  2.994   1.00 0.00 ? 94  LYS A N    4  
ATOM 8660  C CA   . LYS A 1 94  ? -18.478 -5.281  3.281   1.00 0.00 ? 94  LYS A CA   4  
ATOM 8661  C C    . LYS A 1 94  ? -18.311 -6.377  2.161   1.00 0.00 ? 94  LYS A C    4  
ATOM 8662  O O    . LYS A 1 94  ? -18.411 -7.565  2.478   1.00 0.00 ? 94  LYS A O    4  
ATOM 8663  C CB   . LYS A 1 94  ? -19.966 -4.938  3.612   1.00 0.00 ? 94  LYS A CB   4  
ATOM 8664  C CG   . LYS A 1 94  ? -20.938 -6.118  3.887   1.00 0.00 ? 94  LYS A CG   4  
ATOM 8665  C CD   . LYS A 1 94  ? -21.770 -6.515  2.644   1.00 0.00 ? 94  LYS A CD   4  
ATOM 8666  C CE   . LYS A 1 94  ? -22.563 -7.819  2.836   1.00 0.00 ? 94  LYS A CE   4  
ATOM 8667  N NZ   . LYS A 1 94  ? -23.457 -8.029  1.664   1.00 0.00 ? 94  LYS A NZ   4  
ATOM 8668  H H    . LYS A 1 94  ? -18.398 -3.090  2.902   1.00 0.00 ? 94  LYS A H    4  
ATOM 8669  H HA   . LYS A 1 94  ? -18.004 -5.717  4.182   1.00 0.00 ? 94  LYS A HA   4  
ATOM 8670  H HB2  . LYS A 1 94  ? -19.952 -4.307  4.527   1.00 0.00 ? 94  LYS A HB2  4  
ATOM 8671  H HB3  . LYS A 1 94  ? -20.402 -4.275  2.839   1.00 0.00 ? 94  LYS A HB3  4  
ATOM 8672  H HG2  . LYS A 1 94  ? -20.374 -6.984  4.290   1.00 0.00 ? 94  LYS A HG2  4  
ATOM 8673  H HG3  . LYS A 1 94  ? -21.630 -5.830  4.703   1.00 0.00 ? 94  LYS A HG3  4  
ATOM 8674  H HD2  . LYS A 1 94  ? -22.446 -5.673  2.392   1.00 0.00 ? 94  LYS A HD2  4  
ATOM 8675  H HD3  . LYS A 1 94  ? -21.102 -6.621  1.766   1.00 0.00 ? 94  LYS A HD3  4  
ATOM 8676  H HE2  . LYS A 1 94  ? -21.852 -8.668  2.955   1.00 0.00 ? 94  LYS A HE2  4  
ATOM 8677  H HE3  . LYS A 1 94  ? -23.145 -7.792  3.784   1.00 0.00 ? 94  LYS A HE3  4  
ATOM 8678  H HZ1  . LYS A 1 94  ? -22.988 -7.805  0.759   1.00 0.00 ? 94  LYS A HZ1  4  
ATOM 8679  H HZ2  . LYS A 1 94  ? -23.812 -8.989  1.568   1.00 0.00 ? 94  LYS A HZ2  4  
ATOM 8680  H HZ3  . LYS A 1 94  ? -24.280 -7.414  1.676   1.00 0.00 ? 94  LYS A HZ3  4  
ATOM 8681  N N    . GLN A 1 95  ? -18.114 -6.014  0.880   1.00 0.00 ? 95  GLN A N    4  
ATOM 8682  C CA   . GLN A 1 95  ? -17.892 -6.991  -0.221  1.00 0.00 ? 95  GLN A CA   4  
ATOM 8683  C C    . GLN A 1 95  ? -16.882 -6.368  -1.239  1.00 0.00 ? 95  GLN A C    4  
ATOM 8684  O O    . GLN A 1 95  ? -17.259 -5.681  -2.192  1.00 0.00 ? 95  GLN A O    4  
ATOM 8685  C CB   . GLN A 1 95  ? -19.258 -7.432  -0.831  1.00 0.00 ? 95  GLN A CB   4  
ATOM 8686  C CG   . GLN A 1 95  ? -20.246 -6.352  -1.358  1.00 0.00 ? 95  GLN A CG   4  
ATOM 8687  C CD   . GLN A 1 95  ? -21.641 -6.905  -1.667  1.00 0.00 ? 95  GLN A CD   4  
ATOM 8688  O OE1  . GLN A 1 95  ? -22.407 -7.259  -0.773  1.00 0.00 ? 95  GLN A OE1  4  
ATOM 8689  N NE2  . GLN A 1 95  ? -22.024 -7.002  -2.917  1.00 0.00 ? 95  GLN A NE2  4  
ATOM 8690  H H    . GLN A 1 95  ? -18.027 -5.000  0.749   1.00 0.00 ? 95  GLN A H    4  
ATOM 8691  H HA   . GLN A 1 95  ? -17.416 -7.911  0.181   1.00 0.00 ? 95  GLN A HA   4  
ATOM 8692  H HB2  . GLN A 1 95  ? -19.059 -8.162  -1.640  1.00 0.00 ? 95  GLN A HB2  4  
ATOM 8693  H HB3  . GLN A 1 95  ? -19.772 -8.030  -0.052  1.00 0.00 ? 95  GLN A HB3  4  
ATOM 8694  H HG2  . GLN A 1 95  ? -20.377 -5.559  -0.599  1.00 0.00 ? 95  GLN A HG2  4  
ATOM 8695  H HG3  . GLN A 1 95  ? -19.814 -5.833  -2.233  1.00 0.00 ? 95  GLN A HG3  4  
ATOM 8696  H HE21 . GLN A 1 95  ? -21.356 -6.721  -3.638  1.00 0.00 ? 95  GLN A HE21 4  
ATOM 8697  H HE22 . GLN A 1 95  ? -22.959 -7.400  -3.045  1.00 0.00 ? 95  GLN A HE22 4  
ATOM 8698  N N    . ASP A 1 96  ? -15.583 -6.648  -1.033  1.00 0.00 ? 96  ASP A N    4  
ATOM 8699  C CA   . ASP A 1 96  ? -14.468 -6.137  -1.880  1.00 0.00 ? 96  ASP A CA   4  
ATOM 8700  C C    . ASP A 1 96  ? -14.344 -6.853  -3.283  1.00 0.00 ? 96  ASP A C    4  
ATOM 8701  O O    . ASP A 1 96  ? -15.181 -7.658  -3.711  1.00 0.00 ? 96  ASP A O    4  
ATOM 8702  C CB   . ASP A 1 96  ? -13.215 -6.342  -0.952  1.00 0.00 ? 96  ASP A CB   4  
ATOM 8703  C CG   . ASP A 1 96  ? -11.853 -5.837  -1.450  1.00 0.00 ? 96  ASP A CG   4  
ATOM 8704  O OD1  . ASP A 1 96  ? -11.819 -4.871  -2.241  1.00 0.00 ? 96  ASP A OD1  4  
ATOM 8705  O OD2  . ASP A 1 96  ? -10.820 -6.461  -1.133  1.00 0.00 ? 96  ASP A OD2  4  
ATOM 8706  H H    . ASP A 1 96  ? -15.388 -7.215  -0.202  1.00 0.00 ? 96  ASP A H    4  
ATOM 8707  H HA   . ASP A 1 96  ? -14.608 -5.053  -2.070  1.00 0.00 ? 96  ASP A HA   4  
ATOM 8708  H HB2  . ASP A 1 96  ? -13.375 -5.853  0.027   1.00 0.00 ? 96  ASP A HB2  4  
ATOM 8709  H HB3  . ASP A 1 96  ? -13.090 -7.417  -0.718  1.00 0.00 ? 96  ASP A HB3  4  
ATOM 8710  N N    . LYS A 1 97  ? -13.334 -6.438  -4.058  1.00 0.00 ? 97  LYS A N    4  
ATOM 8711  C CA   . LYS A 1 97  ? -12.901 -7.135  -5.310  1.00 0.00 ? 97  LYS A CA   4  
ATOM 8712  C C    . LYS A 1 97  ? -11.399 -7.605  -5.145  1.00 0.00 ? 97  LYS A C    4  
ATOM 8713  O O    . LYS A 1 97  ? -10.599 -7.510  -6.078  1.00 0.00 ? 97  LYS A O    4  
ATOM 8714  C CB   . LYS A 1 97  ? -13.117 -6.176  -6.522  1.00 0.00 ? 97  LYS A CB   4  
ATOM 8715  C CG   . LYS A 1 97  ? -14.588 -5.917  -6.933  1.00 0.00 ? 97  LYS A CG   4  
ATOM 8716  C CD   . LYS A 1 97  ? -15.230 -4.681  -6.250  1.00 0.00 ? 97  LYS A CD   4  
ATOM 8717  C CE   . LYS A 1 97  ? -16.761 -4.767  -6.111  1.00 0.00 ? 97  LYS A CE   4  
ATOM 8718  N NZ   . LYS A 1 97  ? -17.114 -5.674  -4.982  1.00 0.00 ? 97  LYS A NZ   4  
ATOM 8719  H H    . LYS A 1 97  ? -12.714 -5.769  -3.554  1.00 0.00 ? 97  LYS A H    4  
ATOM 8720  H HA   . LYS A 1 97  ? -13.489 -8.057  -5.484  1.00 0.00 ? 97  LYS A HA   4  
ATOM 8721  H HB2  . LYS A 1 97  ? -12.576 -5.223  -6.362  1.00 0.00 ? 97  LYS A HB2  4  
ATOM 8722  H HB3  . LYS A 1 97  ? -12.606 -6.622  -7.398  1.00 0.00 ? 97  LYS A HB3  4  
ATOM 8723  H HG2  . LYS A 1 97  ? -14.642 -5.779  -8.031  1.00 0.00 ? 97  LYS A HG2  4  
ATOM 8724  H HG3  . LYS A 1 97  ? -15.177 -6.837  -6.749  1.00 0.00 ? 97  LYS A HG3  4  
ATOM 8725  H HD2  . LYS A 1 97  ? -14.773 -4.479  -5.259  1.00 0.00 ? 97  LYS A HD2  4  
ATOM 8726  H HD3  . LYS A 1 97  ? -14.963 -3.782  -6.840  1.00 0.00 ? 97  LYS A HD3  4  
ATOM 8727  H HE2  . LYS A 1 97  ? -17.180 -3.751  -5.934  1.00 0.00 ? 97  LYS A HE2  4  
ATOM 8728  H HE3  . LYS A 1 97  ? -17.217 -5.101  -7.069  1.00 0.00 ? 97  LYS A HE3  4  
ATOM 8729  H HZ1  . LYS A 1 97  ? -16.430 -6.438  -4.841  1.00 0.00 ? 97  LYS A HZ1  4  
ATOM 8730  H HZ2  . LYS A 1 97  ? -17.103 -5.194  -4.058  1.00 0.00 ? 97  LYS A HZ2  4  
ATOM 8731  H HZ3  . LYS A 1 97  ? -18.038 -6.113  -5.045  1.00 0.00 ? 97  LYS A HZ3  4  
ATOM 8732  N N    . ARG A 1 98  ? -11.054 -8.193  -3.971  1.00 0.00 ? 98  ARG A N    4  
ATOM 8733  C CA   . ARG A 1 98  ? -9.674  -8.583  -3.527  1.00 0.00 ? 98  ARG A CA   4  
ATOM 8734  C C    . ARG A 1 98  ? -8.585  -7.475  -3.803  1.00 0.00 ? 98  ARG A C    4  
ATOM 8735  O O    . ARG A 1 98  ? -7.596  -7.659  -4.514  1.00 0.00 ? 98  ARG A O    4  
ATOM 8736  C CB   . ARG A 1 98  ? -9.380  -10.023 -4.046  1.00 0.00 ? 98  ARG A CB   4  
ATOM 8737  C CG   . ARG A 1 98  ? -8.800  -10.259 -5.469  1.00 0.00 ? 98  ARG A CG   4  
ATOM 8738  C CD   . ARG A 1 98  ? -8.810  -11.722 -5.962  1.00 0.00 ? 98  ARG A CD   4  
ATOM 8739  N NE   . ARG A 1 98  ? -8.115  -12.634 -5.008  1.00 0.00 ? 98  ARG A NE   4  
ATOM 8740  C CZ   . ARG A 1 98  ? -7.740  -13.886 -5.258  1.00 0.00 ? 98  ARG A CZ   4  
ATOM 8741  N NH1  . ARG A 1 98  ? -7.871  -14.467 -6.424  1.00 0.00 ? 98  ARG A NH1  4  
ATOM 8742  N NH2  . ARG A 1 98  ? -7.211  -14.572 -4.287  1.00 0.00 ? 98  ARG A NH2  4  
ATOM 8743  H H    . ARG A 1 98  ? -11.826 -8.170  -3.295  1.00 0.00 ? 98  ARG A H    4  
ATOM 8744  H HA   . ARG A 1 98  ? -9.702  -8.643  -2.419  1.00 0.00 ? 98  ARG A HA   4  
ATOM 8745  H HB2  . ARG A 1 98  ? -8.676  -10.465 -3.319  1.00 0.00 ? 98  ARG A HB2  4  
ATOM 8746  H HB3  . ARG A 1 98  ? -10.291 -10.641 -3.921  1.00 0.00 ? 98  ARG A HB3  4  
ATOM 8747  H HG2  . ARG A 1 98  ? -9.358  -9.641  -6.196  1.00 0.00 ? 98  ARG A HG2  4  
ATOM 8748  H HG3  . ARG A 1 98  ? -7.765  -9.866  -5.523  1.00 0.00 ? 98  ARG A HG3  4  
ATOM 8749  H HD2  . ARG A 1 98  ? -9.859  -12.052 -6.114  1.00 0.00 ? 98  ARG A HD2  4  
ATOM 8750  H HD3  . ARG A 1 98  ? -8.333  -11.747 -6.964  1.00 0.00 ? 98  ARG A HD3  4  
ATOM 8751  H HE   . ARG A 1 98  ? -7.959  -12.340 -4.042  1.00 0.00 ? 98  ARG A HE   4  
ATOM 8752  H HH11 . ARG A 1 98  ? -8.240  -13.853 -7.153  1.00 0.00 ? 98  ARG A HH11 4  
ATOM 8753  H HH12 . ARG A 1 98  ? -7.511  -15.414 -6.544  1.00 0.00 ? 98  ARG A HH12 4  
ATOM 8754  H HH21 . ARG A 1 98  ? -7.092  -14.097 -3.387  1.00 0.00 ? 98  ARG A HH21 4  
ATOM 8755  H HH22 . ARG A 1 98  ? -6.933  -15.531 -4.498  1.00 0.00 ? 98  ARG A HH22 4  
ATOM 8756  N N    . PHE A 1 99  ? -8.785  -6.314  -3.169  1.00 0.00 ? 99  PHE A N    4  
ATOM 8757  C CA   . PHE A 1 99  ? -7.929  -5.100  -3.326  1.00 0.00 ? 99  PHE A CA   4  
ATOM 8758  C C    . PHE A 1 99  ? -7.417  -4.494  -1.976  1.00 0.00 ? 99  PHE A C    4  
ATOM 8759  O O    . PHE A 1 99  ? -7.017  -3.322  -1.975  1.00 0.00 ? 99  PHE A O    4  
ATOM 8760  C CB   . PHE A 1 99  ? -8.840  -4.105  -4.131  1.00 0.00 ? 99  PHE A CB   4  
ATOM 8761  C CG   . PHE A 1 99  ? -9.106  -4.303  -5.648  1.00 0.00 ? 99  PHE A CG   4  
ATOM 8762  C CD1  . PHE A 1 99  ? -8.322  -5.114  -6.482  1.00 0.00 ? 99  PHE A CD1  4  
ATOM 8763  C CD2  . PHE A 1 99  ? -10.142 -3.553  -6.221  1.00 0.00 ? 99  PHE A CD2  4  
ATOM 8764  C CE1  . PHE A 1 99  ? -8.566  -5.171  -7.850  1.00 0.00 ? 99  PHE A CE1  4  
ATOM 8765  C CE2  . PHE A 1 99  ? -10.385 -3.610  -7.592  1.00 0.00 ? 99  PHE A CE2  4  
ATOM 8766  C CZ   . PHE A 1 99  ? -9.594  -4.416  -8.405  1.00 0.00 ? 99  PHE A CZ   4  
ATOM 8767  H H    . PHE A 1 99  ? -9.650  -6.286  -2.591  1.00 0.00 ? 99  PHE A H    4  
ATOM 8768  H HA   . PHE A 1 99  ? -6.987  -5.278  -3.891  1.00 0.00 ? 99  PHE A HA   4  
ATOM 8769  H HB2  . PHE A 1 99  ? -9.815  -4.019  -3.607  1.00 0.00 ? 99  PHE A HB2  4  
ATOM 8770  H HB3  . PHE A 1 99  ? -8.438  -3.084  -4.033  1.00 0.00 ? 99  PHE A HB3  4  
ATOM 8771  H HD1  . PHE A 1 99  ? -7.508  -5.700  -6.087  1.00 0.00 ? 99  PHE A HD1  4  
ATOM 8772  H HD2  . PHE A 1 99  ? -10.753 -2.906  -5.607  1.00 0.00 ? 99  PHE A HD2  4  
ATOM 8773  H HE1  . PHE A 1 99  ? -7.946  -5.789  -8.481  1.00 0.00 ? 99  PHE A HE1  4  
ATOM 8774  H HE2  . PHE A 1 99  ? -11.176 -3.017  -8.028  1.00 0.00 ? 99  PHE A HE2  4  
ATOM 8775  H HZ   . PHE A 1 99  ? -9.764  -4.443  -9.472  1.00 0.00 ? 99  PHE A HZ   4  
ATOM 8776  N N    . ALA A 1 100 ? -7.346  -5.264  -0.864  1.00 0.00 ? 100 ALA A N    4  
ATOM 8777  C CA   . ALA A 1 100 ? -6.927  -4.735  0.455   1.00 0.00 ? 100 ALA A CA   4  
ATOM 8778  C C    . ALA A 1 100 ? -5.598  -5.375  0.949   1.00 0.00 ? 100 ALA A C    4  
ATOM 8779  O O    . ALA A 1 100 ? -5.327  -6.568  0.759   1.00 0.00 ? 100 ALA A O    4  
ATOM 8780  C CB   . ALA A 1 100 ? -8.089  -5.024  1.428   1.00 0.00 ? 100 ALA A CB   4  
ATOM 8781  H H    . ALA A 1 100 ? -7.679  -6.242  -0.956  1.00 0.00 ? 100 ALA A H    4  
ATOM 8782  H HA   . ALA A 1 100 ? -6.797  -3.634  0.413   1.00 0.00 ? 100 ALA A HA   4  
ATOM 8783  H HB1  . ALA A 1 100 ? -9.039  -4.577  1.077   1.00 0.00 ? 100 ALA A HB1  4  
ATOM 8784  H HB2  . ALA A 1 100 ? -8.270  -6.109  1.558   1.00 0.00 ? 100 ALA A HB2  4  
ATOM 8785  H HB3  . ALA A 1 100 ? -7.892  -4.598  2.429   1.00 0.00 ? 100 ALA A HB3  4  
ATOM 8786  N N    . PHE A 1 101 ? -4.762  -4.558  1.610   1.00 0.00 ? 101 PHE A N    4  
ATOM 8787  C CA   . PHE A 1 101 ? -3.479  -5.020  2.197   1.00 0.00 ? 101 PHE A CA   4  
ATOM 8788  C C    . PHE A 1 101 ? -3.715  -5.279  3.717   1.00 0.00 ? 101 PHE A C    4  
ATOM 8789  O O    . PHE A 1 101 ? -4.155  -4.366  4.428   1.00 0.00 ? 101 PHE A O    4  
ATOM 8790  C CB   . PHE A 1 101 ? -2.352  -3.973  1.958   1.00 0.00 ? 101 PHE A CB   4  
ATOM 8791  C CG   . PHE A 1 101 ? -1.836  -3.666  0.529   1.00 0.00 ? 101 PHE A CG   4  
ATOM 8792  C CD1  . PHE A 1 101 ? -2.348  -4.245  -0.642  1.00 0.00 ? 101 PHE A CD1  4  
ATOM 8793  C CD2  . PHE A 1 101 ? -0.792  -2.740  0.418   1.00 0.00 ? 101 PHE A CD2  4  
ATOM 8794  C CE1  . PHE A 1 101 ? -1.827  -3.905  -1.888  1.00 0.00 ? 101 PHE A CE1  4  
ATOM 8795  C CE2  . PHE A 1 101 ? -0.277  -2.392  -0.828  1.00 0.00 ? 101 PHE A CE2  4  
ATOM 8796  C CZ   . PHE A 1 101 ? -0.799  -2.973  -1.979  1.00 0.00 ? 101 PHE A CZ   4  
ATOM 8797  H H    . PHE A 1 101 ? -5.080  -3.583  1.702   1.00 0.00 ? 101 PHE A H    4  
ATOM 8798  H HA   . PHE A 1 101 ? -3.177  -5.955  1.709   1.00 0.00 ? 101 PHE A HA   4  
ATOM 8799  H HB2  . PHE A 1 101 ? -2.645  -3.019  2.436   1.00 0.00 ? 101 PHE A HB2  4  
ATOM 8800  H HB3  . PHE A 1 101 ? -1.472  -4.308  2.543   1.00 0.00 ? 101 PHE A HB3  4  
ATOM 8801  H HD1  . PHE A 1 101 ? -3.144  -4.970  -0.602  1.00 0.00 ? 101 PHE A HD1  4  
ATOM 8802  H HD2  . PHE A 1 101 ? -0.392  -2.264  1.300   1.00 0.00 ? 101 PHE A HD2  4  
ATOM 8803  H HE1  . PHE A 1 101 ? -2.216  -4.369  -2.781  1.00 0.00 ? 101 PHE A HE1  4  
ATOM 8804  H HE2  . PHE A 1 101 ? 0.521   -1.667  -0.900  1.00 0.00 ? 101 PHE A HE2  4  
ATOM 8805  H HZ   . PHE A 1 101 ? -0.412  -2.700  -2.948  1.00 0.00 ? 101 PHE A HZ   4  
ATOM 8806  N N    . ILE A 1 102 ? -3.495  -6.515  4.221   1.00 0.00 ? 102 ILE A N    4  
ATOM 8807  C CA   . ILE A 1 102 ? -3.766  -6.821  5.676   1.00 0.00 ? 102 ILE A CA   4  
ATOM 8808  C C    . ILE A 1 102 ? -2.470  -6.473  6.475   1.00 0.00 ? 102 ILE A C    4  
ATOM 8809  O O    . ILE A 1 102 ? -1.388  -7.001  6.196   1.00 0.00 ? 102 ILE A O    4  
ATOM 8810  C CB   . ILE A 1 102 ? -4.221  -8.299  5.989   1.00 0.00 ? 102 ILE A CB   4  
ATOM 8811  C CG1  . ILE A 1 102 ? -5.397  -8.793  5.084   1.00 0.00 ? 102 ILE A CG1  4  
ATOM 8812  C CG2  . ILE A 1 102 ? -4.671  -8.418  7.478   1.00 0.00 ? 102 ILE A CG2  4  
ATOM 8813  C CD1  . ILE A 1 102 ? -5.835  -10.259 5.257   1.00 0.00 ? 102 ILE A CD1  4  
ATOM 8814  H H    . ILE A 1 102 ? -3.074  -7.174  3.543   1.00 0.00 ? 102 ILE A H    4  
ATOM 8815  H HA   . ILE A 1 102 ? -4.592  -6.176  6.030   1.00 0.00 ? 102 ILE A HA   4  
ATOM 8816  H HB   . ILE A 1 102 ? -3.359  -8.972  5.852   1.00 0.00 ? 102 ILE A HB   4  
ATOM 8817  H HG12 . ILE A 1 102 ? -6.283  -8.160  5.228   1.00 0.00 ? 102 ILE A HG12 4  
ATOM 8818  H HG13 . ILE A 1 102 ? -5.133  -8.650  4.019   1.00 0.00 ? 102 ILE A HG13 4  
ATOM 8819  H HG21 . ILE A 1 102 ? -3.897  -8.073  8.188   1.00 0.00 ? 102 ILE A HG21 4  
ATOM 8820  H HG22 . ILE A 1 102 ? -5.587  -7.835  7.690   1.00 0.00 ? 102 ILE A HG22 4  
ATOM 8821  H HG23 . ILE A 1 102 ? -4.876  -9.464  7.768   1.00 0.00 ? 102 ILE A HG23 4  
ATOM 8822  H HD11 . ILE A 1 102 ? -6.182  -10.486 6.281   1.00 0.00 ? 102 ILE A HD11 4  
ATOM 8823  H HD12 . ILE A 1 102 ? -6.676  -10.507 4.585   1.00 0.00 ? 102 ILE A HD12 4  
ATOM 8824  H HD13 . ILE A 1 102 ? -5.018  -10.964 5.025   1.00 0.00 ? 102 ILE A HD13 4  
ATOM 8825  N N    . ARG A 1 103 ? -2.617  -5.583  7.471   1.00 0.00 ? 103 ARG A N    4  
ATOM 8826  C CA   . ARG A 1 103 ? -1.486  -5.136  8.324   1.00 0.00 ? 103 ARG A CA   4  
ATOM 8827  C C    . ARG A 1 103 ? -1.438  -5.931  9.668   1.00 0.00 ? 103 ARG A C    4  
ATOM 8828  O O    . ARG A 1 103 ? -2.241  -5.708  10.578  1.00 0.00 ? 103 ARG A O    4  
ATOM 8829  C CB   . ARG A 1 103 ? -1.605  -3.589  8.514   1.00 0.00 ? 103 ARG A CB   4  
ATOM 8830  C CG   . ARG A 1 103 ? -2.882  -2.947  9.138   1.00 0.00 ? 103 ARG A CG   4  
ATOM 8831  C CD   . ARG A 1 103 ? -2.763  -2.555  10.627  1.00 0.00 ? 103 ARG A CD   4  
ATOM 8832  N NE   . ARG A 1 103 ? -3.916  -1.696  11.006  1.00 0.00 ? 103 ARG A NE   4  
ATOM 8833  C CZ   . ARG A 1 103 ? -4.171  -1.237  12.233  1.00 0.00 ? 103 ARG A CZ   4  
ATOM 8834  N NH1  . ARG A 1 103 ? -3.463  -1.521  13.299  1.00 0.00 ? 103 ARG A NH1  4  
ATOM 8835  N NH2  . ARG A 1 103 ? -5.197  -0.452  12.386  1.00 0.00 ? 103 ARG A NH2  4  
ATOM 8836  H H    . ARG A 1 103 ? -3.578  -5.240  7.606   1.00 0.00 ? 103 ARG A H    4  
ATOM 8837  H HA   . ARG A 1 103 ? -0.518  -5.301  7.805   1.00 0.00 ? 103 ARG A HA   4  
ATOM 8838  H HB2  . ARG A 1 103 ? -0.706  -3.228  9.053   1.00 0.00 ? 103 ARG A HB2  4  
ATOM 8839  H HB3  . ARG A 1 103 ? -1.475  -3.141  7.509   1.00 0.00 ? 103 ARG A HB3  4  
ATOM 8840  H HG2  . ARG A 1 103 ? -3.121  -2.044  8.543   1.00 0.00 ? 103 ARG A HG2  4  
ATOM 8841  H HG3  . ARG A 1 103 ? -3.759  -3.608  9.000   1.00 0.00 ? 103 ARG A HG3  4  
ATOM 8842  H HD2  . ARG A 1 103 ? -2.730  -3.465  11.257  1.00 0.00 ? 103 ARG A HD2  4  
ATOM 8843  H HD3  . ARG A 1 103 ? -1.806  -2.026  10.820  1.00 0.00 ? 103 ARG A HD3  4  
ATOM 8844  H HE   . ARG A 1 103 ? -4.585  -1.388  10.297  1.00 0.00 ? 103 ARG A HE   4  
ATOM 8845  H HH11 . ARG A 1 103 ? -2.649  -2.189  13.190  1.00 0.00 ? 103 ARG A HH11 4  
ATOM 8846  H HH12 . ARG A 1 103 ? -3.739  -1.119  14.193  1.00 0.00 ? 103 ARG A HH12 4  
ATOM 8847  H HH21 . ARG A 1 103 ? -5.739  -0.226  11.551  1.00 0.00 ? 103 ARG A HH21 4  
ATOM 8848  H HH22 . ARG A 1 103 ? -5.371  -0.107  13.331  1.00 0.00 ? 103 ARG A HH22 4  
ATOM 8849  N N    . SER A 1 104 ? -0.483  -6.873  9.800   1.00 0.00 ? 104 SER A N    4  
ATOM 8850  C CA   . SER A 1 104 ? -0.253  -7.609  11.081  1.00 0.00 ? 104 SER A CA   4  
ATOM 8851  C C    . SER A 1 104 ? 0.883   -6.861  11.857  1.00 0.00 ? 104 SER A C    4  
ATOM 8852  O O    . SER A 1 104 ? 2.068   -7.216  11.778  1.00 0.00 ? 104 SER A O    4  
ATOM 8853  C CB   . SER A 1 104 ? 0.079   -9.086  10.762  1.00 0.00 ? 104 SER A CB   4  
ATOM 8854  O OG   . SER A 1 104 ? 1.367   -9.228  10.163  1.00 0.00 ? 104 SER A OG   4  
ATOM 8855  H H    . SER A 1 104 ? 0.127   -6.996  8.982   1.00 0.00 ? 104 SER A H    4  
ATOM 8856  H HA   . SER A 1 104 ? -1.168  -7.615  11.709  1.00 0.00 ? 104 SER A HA   4  
ATOM 8857  H HB2  . SER A 1 104 ? 0.048   -9.684  11.693  1.00 0.00 ? 104 SER A HB2  4  
ATOM 8858  H HB3  . SER A 1 104 ? -0.692  -9.533  10.104  1.00 0.00 ? 104 SER A HB3  4  
ATOM 8859  H HG   . SER A 1 104 ? 1.957   -8.635  10.654  1.00 0.00 ? 104 SER A HG   4  
ATOM 8860  N N    . ASP A 1 105 ? 0.513   -5.771  12.552  1.00 0.00 ? 105 ASP A N    4  
ATOM 8861  C CA   . ASP A 1 105 ? 1.481   -4.866  13.220  1.00 0.00 ? 105 ASP A CA   4  
ATOM 8862  C C    . ASP A 1 105 ? 1.795   -5.195  14.720  1.00 0.00 ? 105 ASP A C    4  
ATOM 8863  O O    . ASP A 1 105 ? 1.502   -6.252  15.289  1.00 0.00 ? 105 ASP A O    4  
ATOM 8864  C CB   . ASP A 1 105 ? 0.902   -3.427  12.986  1.00 0.00 ? 105 ASP A CB   4  
ATOM 8865  C CG   . ASP A 1 105 ? -0.301  -3.015  13.832  1.00 0.00 ? 105 ASP A CG   4  
ATOM 8866  O OD1  . ASP A 1 105 ? -0.113  -2.547  14.975  1.00 0.00 ? 105 ASP A OD1  4  
ATOM 8867  O OD2  . ASP A 1 105 ? -1.440  -3.174  13.349  1.00 0.00 ? 105 ASP A OD2  4  
ATOM 8868  H H    . ASP A 1 105 ? -0.494  -5.560  12.552  1.00 0.00 ? 105 ASP A H    4  
ATOM 8869  H HA   . ASP A 1 105 ? 2.453   -4.923  12.704  1.00 0.00 ? 105 ASP A HA   4  
ATOM 8870  H HB2  . ASP A 1 105 ? 1.696   -2.680  13.174  1.00 0.00 ? 105 ASP A HB2  4  
ATOM 8871  H HB3  . ASP A 1 105 ? 0.637   -3.256  11.927  1.00 0.00 ? 105 ASP A HB3  4  
ATOM 8872  N N    . SER A 1 106 ? 2.588   -4.295  15.303  1.00 0.00 ? 106 SER A N    4  
ATOM 8873  C CA   . SER A 1 106 ? 2.898   -4.270  16.758  1.00 0.00 ? 106 SER A CA   4  
ATOM 8874  C C    . SER A 1 106 ? 3.112   -2.767  17.157  1.00 0.00 ? 106 SER A C    4  
ATOM 8875  O O    . SER A 1 106 ? 4.141   -2.401  17.732  1.00 0.00 ? 106 SER A O    4  
ATOM 8876  C CB   . SER A 1 106 ? 4.119   -5.187  17.032  1.00 0.00 ? 106 SER A CB   4  
ATOM 8877  O OG   . SER A 1 106 ? 3.899   -6.511  16.532  1.00 0.00 ? 106 SER A OG   4  
ATOM 8878  H H    . SER A 1 106 ? 2.733   -3.463  14.717  1.00 0.00 ? 106 SER A H    4  
ATOM 8879  H HA   . SER A 1 106 ? 2.033   -4.643  17.344  1.00 0.00 ? 106 SER A HA   4  
ATOM 8880  H HB2  . SER A 1 106 ? 5.039   -4.760  16.585  1.00 0.00 ? 106 SER A HB2  4  
ATOM 8881  H HB3  . SER A 1 106 ? 4.318   -5.232  18.120  1.00 0.00 ? 106 SER A HB3  4  
ATOM 8882  H HG   . SER A 1 106 ? 2.951   -6.559  16.300  1.00 0.00 ? 106 SER A HG   4  
ATOM 8883  N N    . GLY A 1 107 ? 2.115   -1.897  16.868  1.00 0.00 ? 107 GLY A N    4  
ATOM 8884  C CA   . GLY A 1 107 ? 2.237   -0.430  17.044  1.00 0.00 ? 107 GLY A CA   4  
ATOM 8885  C C    . GLY A 1 107 ? 2.781   0.226   15.738  1.00 0.00 ? 107 GLY A C    4  
ATOM 8886  O O    . GLY A 1 107 ? 2.023   0.265   14.763  1.00 0.00 ? 107 GLY A O    4  
ATOM 8887  H H    . GLY A 1 107 ? 1.307   -2.307  16.361  1.00 0.00 ? 107 GLY A H    4  
ATOM 8888  H HA2  . GLY A 1 107 ? 1.233   -0.012  17.240  1.00 0.00 ? 107 GLY A HA2  4  
ATOM 8889  H HA3  . GLY A 1 107 ? 2.833   -0.171  17.938  1.00 0.00 ? 107 GLY A HA3  4  
ATOM 8890  N N    . PRO A 1 108 ? 4.058   0.693   15.624  1.00 0.00 ? 108 PRO A N    4  
ATOM 8891  C CA   . PRO A 1 108 ? 4.576   1.315   14.369  1.00 0.00 ? 108 PRO A CA   4  
ATOM 8892  C C    . PRO A 1 108 ? 5.057   0.376   13.204  1.00 0.00 ? 108 PRO A C    4  
ATOM 8893  O O    . PRO A 1 108 ? 5.079   0.837   12.060  1.00 0.00 ? 108 PRO A O    4  
ATOM 8894  C CB   . PRO A 1 108 ? 5.731   2.166   14.940  1.00 0.00 ? 108 PRO A CB   4  
ATOM 8895  C CG   . PRO A 1 108 ? 6.266   1.377   16.138  1.00 0.00 ? 108 PRO A CG   4  
ATOM 8896  C CD   . PRO A 1 108 ? 5.018   0.740   16.748  1.00 0.00 ? 108 PRO A CD   4  
ATOM 8897  H HA   . PRO A 1 108 ? 3.814   1.986   13.922  1.00 0.00 ? 108 PRO A HA   4  
ATOM 8898  H HB2  . PRO A 1 108 ? 6.524   2.390   14.201  1.00 0.00 ? 108 PRO A HB2  4  
ATOM 8899  H HB3  . PRO A 1 108 ? 5.344   3.147   15.278  1.00 0.00 ? 108 PRO A HB3  4  
ATOM 8900  H HG2  . PRO A 1 108 ? 6.967   0.592   15.796  1.00 0.00 ? 108 PRO A HG2  4  
ATOM 8901  H HG3  . PRO A 1 108 ? 6.817   2.010   16.858  1.00 0.00 ? 108 PRO A HG3  4  
ATOM 8902  H HD2  . PRO A 1 108 ? 5.238   -0.260  17.165  1.00 0.00 ? 108 PRO A HD2  4  
ATOM 8903  H HD3  . PRO A 1 108 ? 4.624   1.370   17.571  1.00 0.00 ? 108 PRO A HD3  4  
ATOM 8904  N N    . THR A 1 109 ? 5.479   -0.883  13.452  1.00 0.00 ? 109 THR A N    4  
ATOM 8905  C CA   . THR A 1 109 ? 6.044   -1.777  12.385  1.00 0.00 ? 109 THR A CA   4  
ATOM 8906  C C    . THR A 1 109 ? 5.100   -2.969  12.015  1.00 0.00 ? 109 THR A C    4  
ATOM 8907  O O    . THR A 1 109 ? 4.542   -3.636  12.895  1.00 0.00 ? 109 THR A O    4  
ATOM 8908  C CB   . THR A 1 109 ? 7.444   -2.334  12.798  1.00 0.00 ? 109 THR A CB   4  
ATOM 8909  O OG1  . THR A 1 109 ? 7.413   -2.951  14.080  1.00 0.00 ? 109 THR A OG1  4  
ATOM 8910  C CG2  . THR A 1 109 ? 8.543   -1.261  12.852  1.00 0.00 ? 109 THR A CG2  4  
ATOM 8911  H H    . THR A 1 109 ? 5.390   -1.157  14.436  1.00 0.00 ? 109 THR A H    4  
ATOM 8912  H HA   . THR A 1 109 ? 6.194   -1.183  11.472  1.00 0.00 ? 109 THR A HA   4  
ATOM 8913  H HB   . THR A 1 109 ? 7.741   -3.081  12.037  1.00 0.00 ? 109 THR A HB   4  
ATOM 8914  H HG1  . THR A 1 109 ? 7.617   -2.247  14.701  1.00 0.00 ? 109 THR A HG1  4  
ATOM 8915  H HG21 . THR A 1 109 ? 8.673   -0.770  11.869  1.00 0.00 ? 109 THR A HG21 4  
ATOM 8916  H HG22 . THR A 1 109 ? 8.328   -0.462  13.586  1.00 0.00 ? 109 THR A HG22 4  
ATOM 8917  H HG23 . THR A 1 109 ? 9.524   -1.700  13.114  1.00 0.00 ? 109 THR A HG23 4  
ATOM 8918  N N    . THR A 1 110 ? 4.976   -3.283  10.703  1.00 0.00 ? 110 THR A N    4  
ATOM 8919  C CA   . THR A 1 110 ? 4.064   -4.365  10.207  1.00 0.00 ? 110 THR A CA   4  
ATOM 8920  C C    . THR A 1 110 ? 4.660   -5.267  9.056   1.00 0.00 ? 110 THR A C    4  
ATOM 8921  O O    . THR A 1 110 ? 5.821   -5.190  8.648   1.00 0.00 ? 110 THR A O    4  
ATOM 8922  C CB   . THR A 1 110 ? 2.701   -3.672  9.807   1.00 0.00 ? 110 THR A CB   4  
ATOM 8923  O OG1  . THR A 1 110 ? 1.644   -4.615  9.927   1.00 0.00 ? 110 THR A OG1  4  
ATOM 8924  C CG2  . THR A 1 110 ? 2.596   -3.174  8.359   1.00 0.00 ? 110 THR A CG2  4  
ATOM 8925  H H    . THR A 1 110 ? 5.500   -2.661  10.063  1.00 0.00 ? 110 THR A H    4  
ATOM 8926  H HA   . THR A 1 110 ? 3.868   -5.079  11.029  1.00 0.00 ? 110 THR A HA   4  
ATOM 8927  H HB   . THR A 1 110 ? 2.498   -2.824  10.494  1.00 0.00 ? 110 THR A HB   4  
ATOM 8928  H HG1  . THR A 1 110 ? 1.398   -4.671  10.860  1.00 0.00 ? 110 THR A HG1  4  
ATOM 8929  H HG21 . THR A 1 110 ? 3.460   -2.548  8.087   1.00 0.00 ? 110 THR A HG21 4  
ATOM 8930  H HG22 . THR A 1 110 ? 2.573   -4.018  7.642   1.00 0.00 ? 110 THR A HG22 4  
ATOM 8931  H HG23 . THR A 1 110 ? 1.662   -2.612  8.201   1.00 0.00 ? 110 THR A HG23 4  
ATOM 8932  N N    . SER A 1 111 ? 3.805   -6.223  8.675   1.00 0.00 ? 111 SER A N    4  
ATOM 8933  C CA   . SER A 1 111 ? 3.985   -7.199  7.556   1.00 0.00 ? 111 SER A CA   4  
ATOM 8934  C C    . SER A 1 111 ? 2.742   -7.063  6.596   1.00 0.00 ? 111 SER A C    4  
ATOM 8935  O O    . SER A 1 111 ? 1.737   -6.452  6.998   1.00 0.00 ? 111 SER A O    4  
ATOM 8936  C CB   . SER A 1 111 ? 4.088   -8.648  8.104   1.00 0.00 ? 111 SER A CB   4  
ATOM 8937  O OG   . SER A 1 111 ? 4.975   -8.789  9.217   1.00 0.00 ? 111 SER A OG   4  
ATOM 8938  H H    . SER A 1 111 ? 2.873   -5.995  9.056   1.00 0.00 ? 111 SER A H    4  
ATOM 8939  H HA   . SER A 1 111 ? 4.906   -6.965  6.988   1.00 0.00 ? 111 SER A HA   4  
ATOM 8940  H HB2  . SER A 1 111 ? 3.092   -9.025  8.402   1.00 0.00 ? 111 SER A HB2  4  
ATOM 8941  H HB3  . SER A 1 111 ? 4.414   -9.330  7.293   1.00 0.00 ? 111 SER A HB3  4  
ATOM 8942  H HG   . SER A 1 111 ? 5.717   -8.159  9.100   1.00 0.00 ? 111 SER A HG   4  
ATOM 8943  N N    . PHE A 1 112 ? 2.736   -7.608  5.350   1.00 0.00 ? 112 PHE A N    4  
ATOM 8944  C CA   . PHE A 1 112 ? 1.556   -7.387  4.450   1.00 0.00 ? 112 PHE A CA   4  
ATOM 8945  C C    . PHE A 1 112 ? 0.989   -8.631  3.701   1.00 0.00 ? 112 PHE A C    4  
ATOM 8946  O O    . PHE A 1 112 ? 1.663   -9.283  2.895   1.00 0.00 ? 112 PHE A O    4  
ATOM 8947  C CB   . PHE A 1 112 ? 1.925   -6.298  3.378   1.00 0.00 ? 112 PHE A CB   4  
ATOM 8948  C CG   . PHE A 1 112 ? 1.585   -4.804  3.599   1.00 0.00 ? 112 PHE A CG   4  
ATOM 8949  C CD1  . PHE A 1 112 ? 0.710   -4.319  4.585   1.00 0.00 ? 112 PHE A CD1  4  
ATOM 8950  C CD2  . PHE A 1 112 ? 2.187   -3.888  2.724   1.00 0.00 ? 112 PHE A CD2  4  
ATOM 8951  C CE1  . PHE A 1 112 ? 0.466   -2.955  4.705   1.00 0.00 ? 112 PHE A CE1  4  
ATOM 8952  C CE2  . PHE A 1 112 ? 1.952   -2.521  2.856   1.00 0.00 ? 112 PHE A CE2  4  
ATOM 8953  C CZ   . PHE A 1 112 ? 1.088   -2.058  3.842   1.00 0.00 ? 112 PHE A CZ   4  
ATOM 8954  H H    . PHE A 1 112 ? 3.565   -8.141  5.036   1.00 0.00 ? 112 PHE A H    4  
ATOM 8955  H HA   . PHE A 1 112 ? 0.706   -6.989  5.027   1.00 0.00 ? 112 PHE A HA   4  
ATOM 8956  H HB2  . PHE A 1 112 ? 3.002   -6.392  3.138   1.00 0.00 ? 112 PHE A HB2  4  
ATOM 8957  H HB3  . PHE A 1 112 ? 1.433   -6.538  2.413   1.00 0.00 ? 112 PHE A HB3  4  
ATOM 8958  H HD1  . PHE A 1 112 ? 0.208   -4.978  5.274   1.00 0.00 ? 112 PHE A HD1  4  
ATOM 8959  H HD2  . PHE A 1 112 ? 2.856   -4.228  1.946   1.00 0.00 ? 112 PHE A HD2  4  
ATOM 8960  H HE1  . PHE A 1 112 ? -0.211  -2.597  5.466   1.00 0.00 ? 112 PHE A HE1  4  
ATOM 8961  H HE2  . PHE A 1 112 ? 2.432   -1.824  2.184   1.00 0.00 ? 112 PHE A HE2  4  
ATOM 8962  H HZ   . PHE A 1 112 ? 0.893   -0.999  3.933   1.00 0.00 ? 112 PHE A HZ   4  
ATOM 8963  N N    . GLU A 1 113 ? -0.325  -8.850  3.908   1.00 0.00 ? 113 GLU A N    4  
ATOM 8964  C CA   . GLU A 1 113 ? -1.143  -9.695  2.990   1.00 0.00 ? 113 GLU A CA   4  
ATOM 8965  C C    . GLU A 1 113 ? -1.657  -8.691  1.871   1.00 0.00 ? 113 GLU A C    4  
ATOM 8966  O O    . GLU A 1 113 ? -1.531  -7.462  1.994   1.00 0.00 ? 113 GLU A O    4  
ATOM 8967  C CB   . GLU A 1 113 ? -2.295  -10.438 3.712   1.00 0.00 ? 113 GLU A CB   4  
ATOM 8968  C CG   . GLU A 1 113 ? -1.975  -11.209 5.025   1.00 0.00 ? 113 GLU A CG   4  
ATOM 8969  C CD   . GLU A 1 113 ? -1.149  -12.471 4.877   1.00 0.00 ? 113 GLU A CD   4  
ATOM 8970  O OE1  . GLU A 1 113 ? -1.707  -13.500 4.446   1.00 0.00 ? 113 GLU A OE1  4  
ATOM 8971  O OE2  . GLU A 1 113 ? 0.054   -12.443 5.208   1.00 0.00 ? 113 GLU A OE2  4  
ATOM 8972  H H    . GLU A 1 113 ? -0.760  -8.242  4.616   1.00 0.00 ? 113 GLU A H    4  
ATOM 8973  H HA   . GLU A 1 113 ? -0.509  -10.462 2.515   1.00 0.00 ? 113 GLU A HA   4  
ATOM 8974  H HB2  . GLU A 1 113 ? -3.105  -9.721  3.897   1.00 0.00 ? 113 GLU A HB2  4  
ATOM 8975  H HB3  . GLU A 1 113 ? -2.741  -11.154 2.995   1.00 0.00 ? 113 GLU A HB3  4  
ATOM 8976  H HG2  . GLU A 1 113 ? -1.462  -10.559 5.755   1.00 0.00 ? 113 GLU A HG2  4  
ATOM 8977  H HG3  . GLU A 1 113 ? -2.906  -11.523 5.524   1.00 0.00 ? 113 GLU A HG3  4  
ATOM 8978  N N    . SER A 1 114 ? -2.205  -9.148  0.737   1.00 0.00 ? 114 SER A N    4  
ATOM 8979  C CA   . SER A 1 114 ? -2.514  -8.267  -0.436  1.00 0.00 ? 114 SER A CA   4  
ATOM 8980  C C    . SER A 1 114 ? -3.410  -9.096  -1.386  1.00 0.00 ? 114 SER A C    4  
ATOM 8981  O O    . SER A 1 114 ? -2.976  -10.059 -2.024  1.00 0.00 ? 114 SER A O    4  
ATOM 8982  C CB   . SER A 1 114 ? -1.220  -7.787  -1.143  1.00 0.00 ? 114 SER A CB   4  
ATOM 8983  O OG   . SER A 1 114 ? -0.534  -6.851  -0.313  1.00 0.00 ? 114 SER A OG   4  
ATOM 8984  H H    . SER A 1 114 ? -2.352  -10.168 0.671   1.00 0.00 ? 114 SER A H    4  
ATOM 8985  H HA   . SER A 1 114 ? -3.055  -7.364  -0.091  1.00 0.00 ? 114 SER A HA   4  
ATOM 8986  H HB2  . SER A 1 114 ? -0.556  -8.641  -1.380  1.00 0.00 ? 114 SER A HB2  4  
ATOM 8987  H HB3  . SER A 1 114 ? -1.451  -7.301  -2.109  1.00 0.00 ? 114 SER A HB3  4  
ATOM 8988  H HG   . SER A 1 114 ? -0.812  -7.045  0.604   1.00 0.00 ? 114 SER A HG   4  
ATOM 8989  N N    . ALA A 1 115 ? -4.667  -8.649  -1.466  1.00 0.00 ? 115 ALA A N    4  
ATOM 8990  C CA   . ALA A 1 115 ? -5.842  -9.350  -2.065  1.00 0.00 ? 115 ALA A CA   4  
ATOM 8991  C C    . ALA A 1 115 ? -6.684  -9.391  -0.782  1.00 0.00 ? 115 ALA A C    4  
ATOM 8992  O O    . ALA A 1 115 ? -7.276  -8.352  -0.437  1.00 0.00 ? 115 ALA A O    4  
ATOM 8993  C CB   . ALA A 1 115 ? -5.589  -10.651 -2.858  1.00 0.00 ? 115 ALA A CB   4  
ATOM 8994  H H    . ALA A 1 115 ? -4.841  -7.840  -0.848  1.00 0.00 ? 115 ALA A H    4  
ATOM 8995  H HA   . ALA A 1 115 ? -6.383  -8.702  -2.719  1.00 0.00 ? 115 ALA A HA   4  
ATOM 8996  H HB1  . ALA A 1 115 ? -5.004  -11.362 -2.257  1.00 0.00 ? 115 ALA A HB1  4  
ATOM 8997  H HB2  . ALA A 1 115 ? -6.522  -11.147 -3.160  1.00 0.00 ? 115 ALA A HB2  4  
ATOM 8998  H HB3  . ALA A 1 115 ? -5.001  -10.447 -3.768  1.00 0.00 ? 115 ALA A HB3  4  
ATOM 8999  N N    . ALA A 1 116 ? -6.732  -10.553 -0.111  1.00 0.00 ? 116 ALA A N    4  
ATOM 9000  C CA   . ALA A 1 116 ? -7.136  -10.558 1.328   1.00 0.00 ? 116 ALA A CA   4  
ATOM 9001  C C    . ALA A 1 116 ? -6.821  -11.925 1.995   1.00 0.00 ? 116 ALA A C    4  
ATOM 9002  O O    . ALA A 1 116 ? -7.723  -12.742 2.176   1.00 0.00 ? 116 ALA A O    4  
ATOM 9003  C CB   . ALA A 1 116 ? -8.631  -10.170 1.523   1.00 0.00 ? 116 ALA A CB   4  
ATOM 9004  H H    . ALA A 1 116 ? -6.175  -11.257 -0.626  1.00 0.00 ? 116 ALA A H    4  
ATOM 9005  H HA   . ALA A 1 116 ? -6.429  -9.827  1.807   1.00 0.00 ? 116 ALA A HA   4  
ATOM 9006  H HB1  . ALA A 1 116 ? -9.305  -10.847 0.965   1.00 0.00 ? 116 ALA A HB1  4  
ATOM 9007  H HB2  . ALA A 1 116 ? -8.927  -10.221 2.587   1.00 0.00 ? 116 ALA A HB2  4  
ATOM 9008  H HB3  . ALA A 1 116 ? -8.857  -9.141  1.192   1.00 0.00 ? 116 ALA A HB3  4  
ATOM 9009  N N    . CYS A 1 117 ? -5.559  -12.115 2.435   1.00 0.00 ? 117 CYS A N    4  
ATOM 9010  C CA   . CYS A 1 117 ? -4.994  -13.394 2.987   1.00 0.00 ? 117 CYS A CA   4  
ATOM 9011  C C    . CYS A 1 117 ? -4.697  -14.217 1.687   1.00 0.00 ? 117 CYS A C    4  
ATOM 9012  O O    . CYS A 1 117 ? -3.626  -13.915 1.144   1.00 0.00 ? 117 CYS A O    4  
ATOM 9013  C CB   . CYS A 1 117 ? -5.796  -14.020 4.157   1.00 0.00 ? 117 CYS A CB   4  
ATOM 9014  S SG   . CYS A 1 117 ? -4.995  -15.570 4.687   1.00 0.00 ? 117 CYS A SG   4  
ATOM 9015  H H    . CYS A 1 117 ? -4.942  -11.344 2.163   1.00 0.00 ? 117 CYS A H    4  
ATOM 9016  H HA   . CYS A 1 117 ? -4.011  -13.173 3.448   1.00 0.00 ? 117 CYS A HA   4  
ATOM 9017  H HB2  . CYS A 1 117 ? -5.802  -13.322 5.014   1.00 0.00 ? 117 CYS A HB2  4  
ATOM 9018  H HB3  . CYS A 1 117 ? -6.857  -14.205 3.932   1.00 0.00 ? 117 CYS A HB3  4  
ATOM 9019  H HG   . CYS A 1 117 ? -5.756  -15.777 5.758   1.00 0.00 ? 117 CYS A HG   4  
ATOM 9020  N N    . PRO A 1 118 ? -5.518  -15.116 1.045   1.00 0.00 ? 118 PRO A N    4  
ATOM 9021  C CA   . PRO A 1 118 ? -5.185  -15.639 -0.301  1.00 0.00 ? 118 PRO A CA   4  
ATOM 9022  C C    . PRO A 1 118 ? -5.082  -14.490 -1.384  1.00 0.00 ? 118 PRO A C    4  
ATOM 9023  O O    . PRO A 1 118 ? -5.695  -13.396 -1.318  1.00 0.00 ? 118 PRO A O    4  
ATOM 9024  C CB   . PRO A 1 118 ? -6.301  -16.668 -0.572  1.00 0.00 ? 118 PRO A CB   4  
ATOM 9025  C CG   . PRO A 1 118 ? -7.463  -16.245 0.323   1.00 0.00 ? 118 PRO A CG   4  
ATOM 9026  C CD   . PRO A 1 118 ? -6.781  -15.677 1.567   1.00 0.00 ? 118 PRO A CD   4  
ATOM 9027  H HA   . PRO A 1 118 ? -4.208  -16.161 -0.234  1.00 0.00 ? 118 PRO A HA   4  
ATOM 9028  H HB2  . PRO A 1 118 ? -6.592  -16.743 -1.637  1.00 0.00 ? 118 PRO A HB2  4  
ATOM 9029  H HB3  . PRO A 1 118 ? -5.954  -17.678 -0.275  1.00 0.00 ? 118 PRO A HB3  4  
ATOM 9030  H HG2  . PRO A 1 118 ? -8.061  -15.454 -0.170  1.00 0.00 ? 118 PRO A HG2  4  
ATOM 9031  H HG3  . PRO A 1 118 ? -8.152  -17.077 0.560   1.00 0.00 ? 118 PRO A HG3  4  
ATOM 9032  H HD2  . PRO A 1 118 ? -7.454  -14.966 2.055   1.00 0.00 ? 118 PRO A HD2  4  
ATOM 9033  H HD3  . PRO A 1 118 ? -6.564  -16.475 2.303   1.00 0.00 ? 118 PRO A HD3  4  
ATOM 9034  N N    . GLY A 1 119 ? -4.244  -14.845 -2.370  1.00 0.00 ? 119 GLY A N    4  
ATOM 9035  C CA   . GLY A 1 119 ? -3.836  -13.972 -3.490  1.00 0.00 ? 119 GLY A CA   4  
ATOM 9036  C C    . GLY A 1 119 ? -2.314  -13.756 -3.467  1.00 0.00 ? 119 GLY A C    4  
ATOM 9037  O O    . GLY A 1 119 ? -1.574  -14.545 -4.058  1.00 0.00 ? 119 GLY A O    4  
ATOM 9038  H H    . GLY A 1 119 ? -3.825  -15.773 -2.240  1.00 0.00 ? 119 GLY A H    4  
ATOM 9039  H HA2  . GLY A 1 119 ? -4.094  -14.461 -4.447  1.00 0.00 ? 119 GLY A HA2  4  
ATOM 9040  H HA3  . GLY A 1 119 ? -4.372  -13.009 -3.514  1.00 0.00 ? 119 GLY A HA3  4  
ATOM 9041  N N    . TRP A 1 120 ? -1.861  -12.720 -2.750  1.00 0.00 ? 120 TRP A N    4  
ATOM 9042  C CA   . TRP A 1 120 ? -0.423  -12.339 -2.669  1.00 0.00 ? 120 TRP A CA   4  
ATOM 9043  C C    . TRP A 1 120 ? -0.095  -11.944 -1.187  1.00 0.00 ? 120 TRP A C    4  
ATOM 9044  O O    . TRP A 1 120 ? -0.816  -11.151 -0.580  1.00 0.00 ? 120 TRP A O    4  
ATOM 9045  C CB   . TRP A 1 120 ? -0.251  -11.195 -3.721  1.00 0.00 ? 120 TRP A CB   4  
ATOM 9046  C CG   . TRP A 1 120 ? 1.042   -11.104 -4.539  1.00 0.00 ? 120 TRP A CG   4  
ATOM 9047  C CD1  . TRP A 1 120 ? 1.690   -9.888  -4.834  1.00 0.00 ? 120 TRP A CD1  4  
ATOM 9048  C CD2  . TRP A 1 120 ? 1.660   -12.052 -5.346  1.00 0.00 ? 120 TRP A CD2  4  
ATOM 9049  N NE1  . TRP A 1 120 ? 2.705   -10.042 -5.799  1.00 0.00 ? 120 TRP A NE1  4  
ATOM 9050  C CE2  . TRP A 1 120 ? 2.674   -11.395 -6.091  1.00 0.00 ? 120 TRP A CE2  4  
ATOM 9051  C CE3  . TRP A 1 120 ? 1.436   -13.444 -5.521  1.00 0.00 ? 120 TRP A CE3  4  
ATOM 9052  C CZ2  . TRP A 1 120 ? 3.492   -12.130 -6.981  1.00 0.00 ? 120 TRP A CZ2  4  
ATOM 9053  C CZ3  . TRP A 1 120 ? 2.254   -14.147 -6.406  1.00 0.00 ? 120 TRP A CZ3  4  
ATOM 9054  C CH2  . TRP A 1 120 ? 3.267   -13.500 -7.124  1.00 0.00 ? 120 TRP A CH2  4  
ATOM 9055  H H    . TRP A 1 120 ? -2.572  -12.120 -2.307  1.00 0.00 ? 120 TRP A H    4  
ATOM 9056  H HA   . TRP A 1 120 ? 0.214   -13.204 -2.935  1.00 0.00 ? 120 TRP A HA   4  
ATOM 9057  H HB2  . TRP A 1 120 ? -1.028  -11.267 -4.510  1.00 0.00 ? 120 TRP A HB2  4  
ATOM 9058  H HB3  . TRP A 1 120 ? -0.484  -10.223 -3.245  1.00 0.00 ? 120 TRP A HB3  4  
ATOM 9059  H HD1  . TRP A 1 120 ? 1.412   -8.942  -4.393  1.00 0.00 ? 120 TRP A HD1  4  
ATOM 9060  H HE1  . TRP A 1 120 ? 3.453   -9.387  -6.052  1.00 0.00 ? 120 TRP A HE1  4  
ATOM 9061  H HE3  . TRP A 1 120 ? 0.659   -13.965 -4.985  1.00 0.00 ? 120 TRP A HE3  4  
ATOM 9062  H HZ2  . TRP A 1 120 ? 4.277   -11.640 -7.538  1.00 0.00 ? 120 TRP A HZ2  4  
ATOM 9063  H HZ3  . TRP A 1 120 ? 2.100   -15.209 -6.537  1.00 0.00 ? 120 TRP A HZ3  4  
ATOM 9064  H HH2  . TRP A 1 120 ? 3.883   -14.072 -7.803  1.00 0.00 ? 120 TRP A HH2  4  
ATOM 9065  N N    . PHE A 1 121 ? 0.975   -12.477 -0.569  1.00 0.00 ? 121 PHE A N    4  
ATOM 9066  C CA   . PHE A 1 121 ? 1.294   -12.211 0.871   1.00 0.00 ? 121 PHE A CA   4  
ATOM 9067  C C    . PHE A 1 121 ? 2.799   -12.451 1.246   1.00 0.00 ? 121 PHE A C    4  
ATOM 9068  O O    . PHE A 1 121 ? 3.302   -13.544 1.005   1.00 0.00 ? 121 PHE A O    4  
ATOM 9069  C CB   . PHE A 1 121 ? 0.363   -13.093 1.770   1.00 0.00 ? 121 PHE A CB   4  
ATOM 9070  C CG   . PHE A 1 121 ? 0.261   -14.622 1.556   1.00 0.00 ? 121 PHE A CG   4  
ATOM 9071  C CD1  . PHE A 1 121 ? -0.684  -15.145 0.665   1.00 0.00 ? 121 PHE A CD1  4  
ATOM 9072  C CD2  . PHE A 1 121 ? 1.047   -15.499 2.309   1.00 0.00 ? 121 PHE A CD2  4  
ATOM 9073  C CE1  . PHE A 1 121 ? -0.843  -16.522 0.533   1.00 0.00 ? 121 PHE A CE1  4  
ATOM 9074  C CE2  . PHE A 1 121 ? 0.891   -16.877 2.174   1.00 0.00 ? 121 PHE A CE2  4  
ATOM 9075  C CZ   . PHE A 1 121 ? -0.052  -17.387 1.284   1.00 0.00 ? 121 PHE A CZ   4  
ATOM 9076  H H    . PHE A 1 121 ? 1.510   -13.157 -1.127  1.00 0.00 ? 121 PHE A H    4  
ATOM 9077  H HA   . PHE A 1 121 ? 1.073   -11.150 1.100   1.00 0.00 ? 121 PHE A HA   4  
ATOM 9078  H HB2  . PHE A 1 121 ? 0.633   -12.904 2.825   1.00 0.00 ? 121 PHE A HB2  4  
ATOM 9079  H HB3  . PHE A 1 121 ? -0.663  -12.680 1.715   1.00 0.00 ? 121 PHE A HB3  4  
ATOM 9080  H HD1  . PHE A 1 121 ? -1.316  -14.481 0.092   1.00 0.00 ? 121 PHE A HD1  4  
ATOM 9081  H HD2  . PHE A 1 121 ? 1.769   -15.110 3.014   1.00 0.00 ? 121 PHE A HD2  4  
ATOM 9082  H HE1  . PHE A 1 121 ? -1.592  -16.915 -0.138  1.00 0.00 ? 121 PHE A HE1  4  
ATOM 9083  H HE2  . PHE A 1 121 ? 1.502   -17.548 2.760   1.00 0.00 ? 121 PHE A HE2  4  
ATOM 9084  H HZ   . PHE A 1 121 ? -0.175  -18.456 1.185   1.00 0.00 ? 121 PHE A HZ   4  
ATOM 9085  N N    . LEU A 1 122 ? 3.518   -11.415 1.746   1.00 0.00 ? 122 LEU A N    4  
ATOM 9086  C CA   . LEU A 1 122 ? 4.911   -11.504 2.316   1.00 0.00 ? 122 LEU A CA   4  
ATOM 9087  C C    . LEU A 1 122 ? 5.277   -10.054 2.877   1.00 0.00 ? 122 LEU A C    4  
ATOM 9088  O O    . LEU A 1 122 ? 4.653   -9.603  3.853   1.00 0.00 ? 122 LEU A O    4  
ATOM 9089  C CB   . LEU A 1 122 ? 6.060   -12.108 1.402   1.00 0.00 ? 122 LEU A CB   4  
ATOM 9090  C CG   . LEU A 1 122 ? 6.227   -13.633 1.137   1.00 0.00 ? 122 LEU A CG   4  
ATOM 9091  C CD1  . LEU A 1 122 ? 7.592   -13.918 0.483   1.00 0.00 ? 122 LEU A CD1  4  
ATOM 9092  C CD2  . LEU A 1 122 ? 6.072   -14.512 2.389   1.00 0.00 ? 122 LEU A CD2  4  
ATOM 9093  H H    . LEU A 1 122 ? 2.941   -10.579 1.923   1.00 0.00 ? 122 LEU A H    4  
ATOM 9094  H HA   . LEU A 1 122 ? 4.847   -12.132 3.217   1.00 0.00 ? 122 LEU A HA   4  
ATOM 9095  H HB2  . LEU A 1 122 ? 6.105   -11.584 0.436   1.00 0.00 ? 122 LEU A HB2  4  
ATOM 9096  H HB3  . LEU A 1 122 ? 7.012   -11.825 1.891   1.00 0.00 ? 122 LEU A HB3  4  
ATOM 9097  H HG   . LEU A 1 122 ? 5.477   -13.960 0.397   1.00 0.00 ? 122 LEU A HG   4  
ATOM 9098  H HD11 . LEU A 1 122 ? 7.734   -13.332 -0.444  1.00 0.00 ? 122 LEU A HD11 4  
ATOM 9099  H HD12 . LEU A 1 122 ? 8.440   -13.680 1.153   1.00 0.00 ? 122 LEU A HD12 4  
ATOM 9100  H HD13 . LEU A 1 122 ? 7.695   -14.983 0.199   1.00 0.00 ? 122 LEU A HD13 4  
ATOM 9101  H HD21 . LEU A 1 122 ? 6.819   -14.275 3.169   1.00 0.00 ? 122 LEU A HD21 4  
ATOM 9102  H HD22 . LEU A 1 122 ? 5.070   -14.404 2.842   1.00 0.00 ? 122 LEU A HD22 4  
ATOM 9103  H HD23 . LEU A 1 122 ? 6.173   -15.586 2.143   1.00 0.00 ? 122 LEU A HD23 4  
ATOM 9104  N N    . CYS A 1 123 ? 6.311   -9.334  2.348   1.00 0.00 ? 123 CYS A N    4  
ATOM 9105  C CA   . CYS A 1 123 ? 6.794   -8.039  2.914   1.00 0.00 ? 123 CYS A CA   4  
ATOM 9106  C C    . CYS A 1 123 ? 7.645   -7.195  1.876   1.00 0.00 ? 123 CYS A C    4  
ATOM 9107  O O    . CYS A 1 123 ? 7.101   -6.616  0.929   1.00 0.00 ? 123 CYS A O    4  
ATOM 9108  C CB   . CYS A 1 123 ? 7.526   -8.362  4.238   1.00 0.00 ? 123 CYS A CB   4  
ATOM 9109  S SG   . CYS A 1 123 ? 8.830   -9.625  4.057   1.00 0.00 ? 123 CYS A SG   4  
ATOM 9110  H H    . CYS A 1 123 ? 6.746   -9.743  1.508   1.00 0.00 ? 123 CYS A H    4  
ATOM 9111  H HA   . CYS A 1 123 ? 5.950   -7.407  3.231   1.00 0.00 ? 123 CYS A HA   4  
ATOM 9112  H HB2  . CYS A 1 123 ? 7.968   -7.432  4.641   1.00 0.00 ? 123 CYS A HB2  4  
ATOM 9113  H HB3  . CYS A 1 123 ? 6.805   -8.709  5.003   1.00 0.00 ? 123 CYS A HB3  4  
ATOM 9114  H HG   . CYS A 1 123 ? 8.042   -10.692 4.165   1.00 0.00 ? 123 CYS A HG   4  
ATOM 9115  N N    . THR A 1 124 ? 8.973   -7.034  2.065   1.00 0.00 ? 124 THR A N    4  
ATOM 9116  C CA   . THR A 1 124 ? 9.860   -6.169  1.217   1.00 0.00 ? 124 THR A CA   4  
ATOM 9117  C C    . THR A 1 124 ? 11.334  -6.673  1.271   1.00 0.00 ? 124 THR A C    4  
ATOM 9118  O O    . THR A 1 124 ? 11.773  -7.265  2.261   1.00 0.00 ? 124 THR A O    4  
ATOM 9119  C CB   . THR A 1 124 ? 9.724   -4.695  1.738   1.00 0.00 ? 124 THR A CB   4  
ATOM 9120  O OG1  . THR A 1 124 ? 8.395   -4.252  1.503   1.00 0.00 ? 124 THR A OG1  4  
ATOM 9121  C CG2  . THR A 1 124 ? 10.625  -3.632  1.080   1.00 0.00 ? 124 THR A CG2  4  
ATOM 9122  H H    . THR A 1 124 ? 9.340   -7.547  2.876   1.00 0.00 ? 124 THR A H    4  
ATOM 9123  H HA   . THR A 1 124 ? 9.533   -6.227  0.163   1.00 0.00 ? 124 THR A HA   4  
ATOM 9124  H HB   . THR A 1 124 ? 9.925   -4.691  2.828   1.00 0.00 ? 124 THR A HB   4  
ATOM 9125  H HG1  . THR A 1 124 ? 7.854   -5.054  1.458   1.00 0.00 ? 124 THR A HG1  4  
ATOM 9126  H HG21 . THR A 1 124 ? 10.537  -3.616  -0.020  1.00 0.00 ? 124 THR A HG21 4  
ATOM 9127  H HG22 . THR A 1 124 ? 10.366  -2.618  1.436   1.00 0.00 ? 124 THR A HG22 4  
ATOM 9128  H HG23 . THR A 1 124 ? 11.693  -3.787  1.325   1.00 0.00 ? 124 THR A HG23 4  
ATOM 9129  N N    . ALA A 1 125 ? 12.132  -6.408  0.219   1.00 0.00 ? 125 ALA A N    4  
ATOM 9130  C CA   . ALA A 1 125 ? 13.564  -6.808  0.188   1.00 0.00 ? 125 ALA A CA   4  
ATOM 9131  C C    . ALA A 1 125 ? 14.465  -6.145  1.296   1.00 0.00 ? 125 ALA A C    4  
ATOM 9132  O O    . ALA A 1 125 ? 14.173  -5.064  1.821   1.00 0.00 ? 125 ALA A O    4  
ATOM 9133  C CB   . ALA A 1 125 ? 14.049  -6.444  -1.220  1.00 0.00 ? 125 ALA A CB   4  
ATOM 9134  H H    . ALA A 1 125 ? 11.695  -5.906  -0.568  1.00 0.00 ? 125 ALA A H    4  
ATOM 9135  H HA   . ALA A 1 125 ? 13.626  -7.908  0.315   1.00 0.00 ? 125 ALA A HA   4  
ATOM 9136  H HB1  . ALA A 1 125 ? 13.432  -6.906  -2.016  1.00 0.00 ? 125 ALA A HB1  4  
ATOM 9137  H HB2  . ALA A 1 125 ? 14.048  -5.350  -1.396  1.00 0.00 ? 125 ALA A HB2  4  
ATOM 9138  H HB3  . ALA A 1 125 ? 15.083  -6.804  -1.379  1.00 0.00 ? 125 ALA A HB3  4  
ATOM 9139  N N    . MET A 1 126 ? 15.567  -6.827  1.656   1.00 0.00 ? 126 MET A N    4  
ATOM 9140  C CA   . MET A 1 126 ? 16.499  -6.373  2.733   1.00 0.00 ? 126 MET A CA   4  
ATOM 9141  C C    . MET A 1 126 ? 17.267  -5.032  2.453   1.00 0.00 ? 126 MET A C    4  
ATOM 9142  O O    . MET A 1 126 ? 17.240  -4.137  3.303   1.00 0.00 ? 126 MET A O    4  
ATOM 9143  C CB   . MET A 1 126 ? 17.478  -7.563  2.972   1.00 0.00 ? 126 MET A CB   4  
ATOM 9144  C CG   . MET A 1 126 ? 18.247  -7.533  4.308   1.00 0.00 ? 126 MET A CG   4  
ATOM 9145  S SD   . MET A 1 126 ? 19.514  -6.247  4.288   1.00 0.00 ? 126 MET A SD   4  
ATOM 9146  C CE   . MET A 1 126 ? 20.104  -6.370  5.984   1.00 0.00 ? 126 MET A CE   4  
ATOM 9147  H H    . MET A 1 126 ? 15.727  -7.704  1.151   1.00 0.00 ? 126 MET A H    4  
ATOM 9148  H HA   . MET A 1 126 ? 15.911  -6.207  3.657   1.00 0.00 ? 126 MET A HA   4  
ATOM 9149  H HB2  . MET A 1 126 ? 16.927  -8.520  2.947   1.00 0.00 ? 126 MET A HB2  4  
ATOM 9150  H HB3  . MET A 1 126 ? 18.202  -7.652  2.137   1.00 0.00 ? 126 MET A HB3  4  
ATOM 9151  H HG2  . MET A 1 126 ? 17.562  -7.388  5.163   1.00 0.00 ? 126 MET A HG2  4  
ATOM 9152  H HG3  . MET A 1 126 ? 18.748  -8.505  4.473   1.00 0.00 ? 126 MET A HG3  4  
ATOM 9153  H HE1  . MET A 1 126 ? 20.493  -7.384  6.188   1.00 0.00 ? 126 MET A HE1  4  
ATOM 9154  H HE2  . MET A 1 126 ? 20.921  -5.647  6.158   1.00 0.00 ? 126 MET A HE2  4  
ATOM 9155  H HE3  . MET A 1 126 ? 19.291  -6.155  6.700   1.00 0.00 ? 126 MET A HE3  4  
ATOM 9156  N N    . GLU A 1 127 ? 17.906  -4.883  1.282   1.00 0.00 ? 127 GLU A N    4  
ATOM 9157  C CA   . GLU A 1 127 ? 18.737  -3.701  0.931   1.00 0.00 ? 127 GLU A CA   4  
ATOM 9158  C C    . GLU A 1 127 ? 17.915  -2.485  0.367   1.00 0.00 ? 127 GLU A C    4  
ATOM 9159  O O    . GLU A 1 127 ? 16.709  -2.552  0.098   1.00 0.00 ? 127 GLU A O    4  
ATOM 9160  C CB   . GLU A 1 127 ? 19.784  -4.206  -0.115  1.00 0.00 ? 127 GLU A CB   4  
ATOM 9161  C CG   . GLU A 1 127 ? 20.864  -5.234  0.337   1.00 0.00 ? 127 GLU A CG   4  
ATOM 9162  C CD   . GLU A 1 127 ? 20.420  -6.672  0.595   1.00 0.00 ? 127 GLU A CD   4  
ATOM 9163  O OE1  . GLU A 1 127 ? 19.595  -7.213  -0.175  1.00 0.00 ? 127 GLU A OE1  4  
ATOM 9164  O OE2  . GLU A 1 127 ? 20.896  -7.265  1.584   1.00 0.00 ? 127 GLU A OE2  4  
ATOM 9165  H H    . GLU A 1 127 ? 17.887  -5.709  0.671   1.00 0.00 ? 127 GLU A H    4  
ATOM 9166  H HA   . GLU A 1 127 ? 19.280  -3.348  1.830   1.00 0.00 ? 127 GLU A HA   4  
ATOM 9167  H HB2  . GLU A 1 127 ? 19.262  -4.591  -1.012  1.00 0.00 ? 127 GLU A HB2  4  
ATOM 9168  H HB3  . GLU A 1 127 ? 20.341  -3.334  -0.510  1.00 0.00 ? 127 GLU A HB3  4  
ATOM 9169  H HG2  . GLU A 1 127 ? 21.643  -5.301  -0.442  1.00 0.00 ? 127 GLU A HG2  4  
ATOM 9170  H HG3  . GLU A 1 127 ? 21.385  -4.873  1.241   1.00 0.00 ? 127 GLU A HG3  4  
ATOM 9171  N N    . ALA A 1 128 ? 18.590  -1.330  0.222   1.00 0.00 ? 128 ALA A N    4  
ATOM 9172  C CA   . ALA A 1 128 ? 17.992  -0.095  -0.362  1.00 0.00 ? 128 ALA A CA   4  
ATOM 9173  C C    . ALA A 1 128 ? 18.154  -0.007  -1.927  1.00 0.00 ? 128 ALA A C    4  
ATOM 9174  O O    . ALA A 1 128 ? 18.686  0.964   -2.474  1.00 0.00 ? 128 ALA A O    4  
ATOM 9175  C CB   . ALA A 1 128 ? 18.702  1.044   0.402   1.00 0.00 ? 128 ALA A CB   4  
ATOM 9176  H H    . ALA A 1 128 ? 19.586  -1.388  0.455   1.00 0.00 ? 128 ALA A H    4  
ATOM 9177  H HA   . ALA A 1 128 ? 16.907  -0.038  -0.150  1.00 0.00 ? 128 ALA A HA   4  
ATOM 9178  H HB1  . ALA A 1 128 ? 19.805  0.992   0.311   1.00 0.00 ? 128 ALA A HB1  4  
ATOM 9179  H HB2  . ALA A 1 128 ? 18.423  2.031   0.001   1.00 0.00 ? 128 ALA A HB2  4  
ATOM 9180  H HB3  . ALA A 1 128 ? 18.453  1.049   1.480   1.00 0.00 ? 128 ALA A HB3  4  
ATOM 9181  N N    . ASP A 1 129 ? 17.640  -1.024  -2.641  1.00 0.00 ? 129 ASP A N    4  
ATOM 9182  C CA   . ASP A 1 129 ? 17.793  -1.168  -4.126  1.00 0.00 ? 129 ASP A CA   4  
ATOM 9183  C C    . ASP A 1 129 ? 16.744  -2.134  -4.768  1.00 0.00 ? 129 ASP A C    4  
ATOM 9184  O O    . ASP A 1 129 ? 16.133  -1.789  -5.780  1.00 0.00 ? 129 ASP A O    4  
ATOM 9185  C CB   . ASP A 1 129 ? 19.259  -1.606  -4.464  1.00 0.00 ? 129 ASP A CB   4  
ATOM 9186  C CG   . ASP A 1 129 ? 19.892  -2.776  -3.683  1.00 0.00 ? 129 ASP A CG   4  
ATOM 9187  O OD1  . ASP A 1 129 ? 19.341  -3.899  -3.694  1.00 0.00 ? 129 ASP A OD1  4  
ATOM 9188  O OD2  . ASP A 1 129 ? 20.941  -2.563  -3.042  1.00 0.00 ? 129 ASP A OD2  4  
ATOM 9189  H H    . ASP A 1 129 ? 17.236  -1.762  -2.054  1.00 0.00 ? 129 ASP A H    4  
ATOM 9190  H HA   . ASP A 1 129 ? 17.565  -0.187  -4.591  1.00 0.00 ? 129 ASP A HA   4  
ATOM 9191  H HB2  . ASP A 1 129 ? 19.346  -1.833  -5.541  1.00 0.00 ? 129 ASP A HB2  4  
ATOM 9192  H HB3  . ASP A 1 129 ? 19.917  -0.729  -4.320  1.00 0.00 ? 129 ASP A HB3  4  
ATOM 9193  N N    . GLN A 1 130 ? 16.509  -3.317  -4.188  1.00 0.00 ? 130 GLN A N    4  
ATOM 9194  C CA   . GLN A 1 130 ? 15.488  -4.296  -4.655  1.00 0.00 ? 130 GLN A CA   4  
ATOM 9195  C C    . GLN A 1 130 ? 14.003  -3.814  -4.363  1.00 0.00 ? 130 GLN A C    4  
ATOM 9196  O O    . GLN A 1 130 ? 13.831  -2.795  -3.689  1.00 0.00 ? 130 GLN A O    4  
ATOM 9197  C CB   . GLN A 1 130 ? 15.891  -5.611  -3.929  1.00 0.00 ? 130 GLN A CB   4  
ATOM 9198  C CG   . GLN A 1 130 ? 17.149  -6.339  -4.483  1.00 0.00 ? 130 GLN A CG   4  
ATOM 9199  C CD   . GLN A 1 130 ? 17.888  -7.145  -3.410  1.00 0.00 ? 130 GLN A CD   4  
ATOM 9200  O OE1  . GLN A 1 130 ? 17.486  -8.243  -3.037  1.00 0.00 ? 130 GLN A OE1  4  
ATOM 9201  N NE2  . GLN A 1 130 ? 18.946  -6.598  -2.860  1.00 0.00 ? 130 GLN A NE2  4  
ATOM 9202  H H    . GLN A 1 130 ? 17.133  -3.499  -3.392  1.00 0.00 ? 130 GLN A H    4  
ATOM 9203  H HA   . GLN A 1 130 ? 15.574  -4.427  -5.751  1.00 0.00 ? 130 GLN A HA   4  
ATOM 9204  H HB2  . GLN A 1 130 ? 16.027  -5.389  -2.851  1.00 0.00 ? 130 GLN A HB2  4  
ATOM 9205  H HB3  . GLN A 1 130 ? 15.061  -6.338  -3.937  1.00 0.00 ? 130 GLN A HB3  4  
ATOM 9206  H HG2  . GLN A 1 130 ? 16.863  -7.023  -5.302  1.00 0.00 ? 130 GLN A HG2  4  
ATOM 9207  H HG3  . GLN A 1 130 ? 17.848  -5.619  -4.955  1.00 0.00 ? 130 GLN A HG3  4  
ATOM 9208  H HE21 . GLN A 1 130 ? 19.144  -5.622  -3.159  1.00 0.00 ? 130 GLN A HE21 4  
ATOM 9209  H HE22 . GLN A 1 130 ? 19.219  -7.011  -1.946  1.00 0.00 ? 130 GLN A HE22 4  
ATOM 9210  N N    . PRO A 1 131 ? 12.890  -4.474  -4.805  1.00 0.00 ? 131 PRO A N    4  
ATOM 9211  C CA   . PRO A 1 131 ? 11.507  -3.947  -4.589  1.00 0.00 ? 131 PRO A CA   4  
ATOM 9212  C C    . PRO A 1 131 ? 10.706  -4.422  -3.322  1.00 0.00 ? 131 PRO A C    4  
ATOM 9213  O O    . PRO A 1 131 ? 11.145  -5.242  -2.504  1.00 0.00 ? 131 PRO A O    4  
ATOM 9214  C CB   . PRO A 1 131 ? 10.881  -4.429  -5.921  1.00 0.00 ? 131 PRO A CB   4  
ATOM 9215  C CG   . PRO A 1 131 ? 11.506  -5.799  -6.193  1.00 0.00 ? 131 PRO A CG   4  
ATOM 9216  C CD   . PRO A 1 131 ? 12.943  -5.656  -5.693  1.00 0.00 ? 131 PRO A CD   4  
ATOM 9217  H HA   . PRO A 1 131 ? 11.506  -2.843  -4.556  1.00 0.00 ? 131 PRO A HA   4  
ATOM 9218  H HB2  . PRO A 1 131 ? 9.774   -4.471  -5.902  1.00 0.00 ? 131 PRO A HB2  4  
ATOM 9219  H HB3  . PRO A 1 131 ? 11.139  -3.722  -6.735  1.00 0.00 ? 131 PRO A HB3  4  
ATOM 9220  H HG2  . PRO A 1 131 ? 10.975  -6.581  -5.615  1.00 0.00 ? 131 PRO A HG2  4  
ATOM 9221  H HG3  . PRO A 1 131 ? 11.451  -6.089  -7.259  1.00 0.00 ? 131 PRO A HG3  4  
ATOM 9222  H HD2  . PRO A 1 131 ? 13.267  -6.570  -5.162  1.00 0.00 ? 131 PRO A HD2  4  
ATOM 9223  H HD3  . PRO A 1 131 ? 13.631  -5.492  -6.545  1.00 0.00 ? 131 PRO A HD3  4  
ATOM 9224  N N    . VAL A 1 132 ? 9.487   -3.852  -3.179  1.00 0.00 ? 132 VAL A N    4  
ATOM 9225  C CA   . VAL A 1 132 ? 8.460   -4.336  -2.186  1.00 0.00 ? 132 VAL A CA   4  
ATOM 9226  C C    . VAL A 1 132 ? 7.810   -5.615  -2.826  1.00 0.00 ? 132 VAL A C    4  
ATOM 9227  O O    . VAL A 1 132 ? 7.457   -5.612  -4.014  1.00 0.00 ? 132 VAL A O    4  
ATOM 9228  C CB   . VAL A 1 132 ? 7.416   -3.225  -1.798  1.00 0.00 ? 132 VAL A CB   4  
ATOM 9229  C CG1  . VAL A 1 132 ? 6.814   -2.424  -2.964  1.00 0.00 ? 132 VAL A CG1  4  
ATOM 9230  C CG2  . VAL A 1 132 ? 6.221   -3.725  -0.948  1.00 0.00 ? 132 VAL A CG2  4  
ATOM 9231  H H    . VAL A 1 132 ? 9.251   -3.188  -3.933  1.00 0.00 ? 132 VAL A H    4  
ATOM 9232  H HA   . VAL A 1 132 ? 8.969   -4.633  -1.254  1.00 0.00 ? 132 VAL A HA   4  
ATOM 9233  H HB   . VAL A 1 132 ? 7.969   -2.497  -1.170  1.00 0.00 ? 132 VAL A HB   4  
ATOM 9234  H HG11 . VAL A 1 132 ? 6.298   -3.074  -3.697  1.00 0.00 ? 132 VAL A HG11 4  
ATOM 9235  H HG12 . VAL A 1 132 ? 6.093   -1.653  -2.631  1.00 0.00 ? 132 VAL A HG12 4  
ATOM 9236  H HG13 . VAL A 1 132 ? 7.617   -1.891  -3.499  1.00 0.00 ? 132 VAL A HG13 4  
ATOM 9237  H HG21 . VAL A 1 132 ? 6.542   -4.277  -0.052  1.00 0.00 ? 132 VAL A HG21 4  
ATOM 9238  H HG22 . VAL A 1 132 ? 5.590   -2.890  -0.591  1.00 0.00 ? 132 VAL A HG22 4  
ATOM 9239  H HG23 . VAL A 1 132 ? 5.559   -4.407  -1.515  1.00 0.00 ? 132 VAL A HG23 4  
ATOM 9240  N N    . SER A 1 133 ? 7.714   -6.732  -2.073  1.00 0.00 ? 133 SER A N    4  
ATOM 9241  C CA   . SER A 1 133 ? 7.250   -8.014  -2.664  1.00 0.00 ? 133 SER A CA   4  
ATOM 9242  C C    . SER A 1 133 ? 6.450   -8.898  -1.667  1.00 0.00 ? 133 SER A C    4  
ATOM 9243  O O    . SER A 1 133 ? 6.893   -9.285  -0.578  1.00 0.00 ? 133 SER A O    4  
ATOM 9244  C CB   . SER A 1 133 ? 8.487   -8.795  -3.164  1.00 0.00 ? 133 SER A CB   4  
ATOM 9245  O OG   . SER A 1 133 ? 8.092   -9.966  -3.882  1.00 0.00 ? 133 SER A OG   4  
ATOM 9246  H H    . SER A 1 133 ? 7.963   -6.654  -1.074  1.00 0.00 ? 133 SER A H    4  
ATOM 9247  H HA   . SER A 1 133 ? 6.618   -7.808  -3.561  1.00 0.00 ? 133 SER A HA   4  
ATOM 9248  H HB2  . SER A 1 133 ? 9.088   -8.151  -3.833  1.00 0.00 ? 133 SER A HB2  4  
ATOM 9249  H HB3  . SER A 1 133 ? 9.137   -9.072  -2.312  1.00 0.00 ? 133 SER A HB3  4  
ATOM 9250  H HG   . SER A 1 133 ? 8.892   -10.438 -4.132  1.00 0.00 ? 133 SER A HG   4  
ATOM 9251  N N    . LEU A 1 134 ? 5.237   -9.200  -2.120  1.00 0.00 ? 134 LEU A N    4  
ATOM 9252  C CA   . LEU A 1 134 ? 4.299   -10.136 -1.459  1.00 0.00 ? 134 LEU A CA   4  
ATOM 9253  C C    . LEU A 1 134 ? 4.285   -11.426 -2.361  1.00 0.00 ? 134 LEU A C    4  
ATOM 9254  O O    . LEU A 1 134 ? 4.444   -11.339 -3.586  1.00 0.00 ? 134 LEU A O    4  
ATOM 9255  C CB   . LEU A 1 134 ? 2.896   -9.483  -1.294  1.00 0.00 ? 134 LEU A CB   4  
ATOM 9256  C CG   . LEU A 1 134 ? 2.700   -8.095  -0.613  1.00 0.00 ? 134 LEU A CG   4  
ATOM 9257  C CD1  . LEU A 1 134 ? 3.627   -7.790  0.572   1.00 0.00 ? 134 LEU A CD1  4  
ATOM 9258  C CD2  . LEU A 1 134 ? 2.797   -6.945  -1.620  1.00 0.00 ? 134 LEU A CD2  4  
ATOM 9259  H H    . LEU A 1 134 ? 5.056   -8.817  -3.051  1.00 0.00 ? 134 LEU A H    4  
ATOM 9260  H HA   . LEU A 1 134 ? 4.652   -10.396 -0.445  1.00 0.00 ? 134 LEU A HA   4  
ATOM 9261  H HB2  . LEU A 1 134 ? 2.376   -9.475  -2.265  1.00 0.00 ? 134 LEU A HB2  4  
ATOM 9262  H HB3  . LEU A 1 134 ? 2.296   -10.188 -0.703  1.00 0.00 ? 134 LEU A HB3  4  
ATOM 9263  H HG   . LEU A 1 134 ? 1.665   -8.079  -0.220  1.00 0.00 ? 134 LEU A HG   4  
ATOM 9264  H HD11 . LEU A 1 134 ? 4.695   -7.828  0.298   1.00 0.00 ? 134 LEU A HD11 4  
ATOM 9265  H HD12 . LEU A 1 134 ? 3.449   -6.779  0.976   1.00 0.00 ? 134 LEU A HD12 4  
ATOM 9266  H HD13 . LEU A 1 134 ? 3.476   -8.499  1.400   1.00 0.00 ? 134 LEU A HD13 4  
ATOM 9267  H HD21 . LEU A 1 134 ? 2.154   -7.124  -2.500  1.00 0.00 ? 134 LEU A HD21 4  
ATOM 9268  H HD22 . LEU A 1 134 ? 2.471   -5.984  -1.179  1.00 0.00 ? 134 LEU A HD22 4  
ATOM 9269  H HD23 . LEU A 1 134 ? 3.832   -6.804  -1.980  1.00 0.00 ? 134 LEU A HD23 4  
ATOM 9270  N N    . THR A 1 135 ? 4.206   -12.657 -1.825  1.00 0.00 ? 135 THR A N    4  
ATOM 9271  C CA   . THR A 1 135 ? 4.221   -13.888 -2.690  1.00 0.00 ? 135 THR A CA   4  
ATOM 9272  C C    . THR A 1 135 ? 3.311   -14.959 -2.023  1.00 0.00 ? 135 THR A C    4  
ATOM 9273  O O    . THR A 1 135 ? 2.109   -14.739 -1.867  1.00 0.00 ? 135 THR A O    4  
ATOM 9274  C CB   . THR A 1 135 ? 5.716   -14.256 -3.043  1.00 0.00 ? 135 THR A CB   4  
ATOM 9275  O OG1  . THR A 1 135 ? 6.410   -13.124 -3.564  1.00 0.00 ? 135 THR A OG1  4  
ATOM 9276  C CG2  . THR A 1 135 ? 5.847   -15.320 -4.148  1.00 0.00 ? 135 THR A CG2  4  
ATOM 9277  H H    . THR A 1 135 ? 4.069   -12.709 -0.803  1.00 0.00 ? 135 THR A H    4  
ATOM 9278  H HA   . THR A 1 135 ? 3.712   -13.725 -3.645  1.00 0.00 ? 135 THR A HA   4  
ATOM 9279  H HB   . THR A 1 135 ? 6.234   -14.593 -2.123  1.00 0.00 ? 135 THR A HB   4  
ATOM 9280  H HG1  . THR A 1 135 ? 5.741   -12.424 -3.664  1.00 0.00 ? 135 THR A HG1  4  
ATOM 9281  H HG21 . THR A 1 135 ? 5.366   -16.283 -3.901  1.00 0.00 ? 135 THR A HG21 4  
ATOM 9282  H HG22 . THR A 1 135 ? 5.400   -14.972 -5.099  1.00 0.00 ? 135 THR A HG22 4  
ATOM 9283  H HG23 . THR A 1 135 ? 6.910   -15.540 -4.359  1.00 0.00 ? 135 THR A HG23 4  
ATOM 9284  N N    . ASN A 1 136 ? 3.854   -16.121 -1.677  1.00 0.00 ? 136 ASN A N    4  
ATOM 9285  C CA   . ASN A 1 136 ? 3.096   -17.235 -1.035  1.00 0.00 ? 136 ASN A CA   4  
ATOM 9286  C C    . ASN A 1 136 ? 4.021   -17.995 -0.026  1.00 0.00 ? 136 ASN A C    4  
ATOM 9287  O O    . ASN A 1 136 ? 3.709   -18.035 1.166   1.00 0.00 ? 136 ASN A O    4  
ATOM 9288  C CB   . ASN A 1 136 ? 2.489   -18.188 -2.117  1.00 0.00 ? 136 ASN A CB   4  
ATOM 9289  C CG   . ASN A 1 136 ? 1.488   -17.590 -3.122  1.00 0.00 ? 136 ASN A CG   4  
ATOM 9290  O OD1  . ASN A 1 136 ? 1.780   -17.432 -4.302  1.00 0.00 ? 136 ASN A OD1  4  
ATOM 9291  N ND2  . ASN A 1 136 ? 0.299   -17.225 -2.706  1.00 0.00 ? 136 ASN A ND2  4  
ATOM 9292  H H    . ASN A 1 136 ? 4.847   -16.106 -1.917  1.00 0.00 ? 136 ASN A H    4  
ATOM 9293  H HA   . ASN A 1 136 ? 2.268   -16.816 -0.428  1.00 0.00 ? 136 ASN A HA   4  
ATOM 9294  H HB2  . ASN A 1 136 ? 3.302   -18.648 -2.708  1.00 0.00 ? 136 ASN A HB2  4  
ATOM 9295  H HB3  . ASN A 1 136 ? 1.994   -19.042 -1.619  1.00 0.00 ? 136 ASN A HB3  4  
ATOM 9296  H HD21 . ASN A 1 136 ? 0.205   -17.139 -1.691  1.00 0.00 ? 136 ASN A HD21 4  
ATOM 9297  H HD22 . ASN A 1 136 ? -0.211  -16.685 -3.413  1.00 0.00 ? 136 ASN A HD22 4  
ATOM 9298  N N    . MET A 1 137 ? 5.140   -18.604 -0.473  1.00 0.00 ? 137 MET A N    4  
ATOM 9299  C CA   . MET A 1 137 ? 6.087   -19.326 0.422   1.00 0.00 ? 137 MET A CA   4  
ATOM 9300  C C    . MET A 1 137 ? 7.185   -18.357 1.015   1.00 0.00 ? 137 MET A C    4  
ATOM 9301  O O    . MET A 1 137 ? 7.798   -17.615 0.236   1.00 0.00 ? 137 MET A O    4  
ATOM 9302  C CB   . MET A 1 137 ? 6.711   -20.511 -0.375  1.00 0.00 ? 137 MET A CB   4  
ATOM 9303  C CG   . MET A 1 137 ? 7.616   -20.201 -1.592  1.00 0.00 ? 137 MET A CG   4  
ATOM 9304  S SD   . MET A 1 137 ? 8.188   -21.734 -2.355  1.00 0.00 ? 137 MET A SD   4  
ATOM 9305  C CE   . MET A 1 137 ? 6.846   -22.057 -3.514  1.00 0.00 ? 137 MET A CE   4  
ATOM 9306  H H    . MET A 1 137 ? 5.317   -18.512 -1.477  1.00 0.00 ? 137 MET A H    4  
ATOM 9307  H HA   . MET A 1 137 ? 5.517   -19.774 1.257   1.00 0.00 ? 137 MET A HA   4  
ATOM 9308  H HB2  . MET A 1 137 ? 7.299   -21.128 0.331   1.00 0.00 ? 137 MET A HB2  4  
ATOM 9309  H HB3  . MET A 1 137 ? 5.896   -21.184 -0.703  1.00 0.00 ? 137 MET A HB3  4  
ATOM 9310  H HG2  . MET A 1 137 ? 7.102   -19.576 -2.344  1.00 0.00 ? 137 MET A HG2  4  
ATOM 9311  H HG3  . MET A 1 137 ? 8.506   -19.625 -1.275  1.00 0.00 ? 137 MET A HG3  4  
ATOM 9312  H HE1  . MET A 1 137 ? 5.882   -22.158 -2.985  1.00 0.00 ? 137 MET A HE1  4  
ATOM 9313  H HE2  . MET A 1 137 ? 6.756   -21.237 -4.248  1.00 0.00 ? 137 MET A HE2  4  
ATOM 9314  H HE3  . MET A 1 137 ? 7.033   -22.994 -4.068  1.00 0.00 ? 137 MET A HE3  4  
ATOM 9315  N N    . PRO A 1 138 ? 7.495   -18.322 2.348   1.00 0.00 ? 138 PRO A N    4  
ATOM 9316  C CA   . PRO A 1 138 ? 8.542   -17.420 2.907   1.00 0.00 ? 138 PRO A CA   4  
ATOM 9317  C C    . PRO A 1 138 ? 10.018  -17.891 2.670   1.00 0.00 ? 138 PRO A C    4  
ATOM 9318  O O    . PRO A 1 138 ? 10.301  -19.077 2.473   1.00 0.00 ? 138 PRO A O    4  
ATOM 9319  C CB   . PRO A 1 138 ? 8.142   -17.391 4.397   1.00 0.00 ? 138 PRO A CB   4  
ATOM 9320  C CG   . PRO A 1 138 ? 7.550   -18.776 4.672   1.00 0.00 ? 138 PRO A CG   4  
ATOM 9321  C CD   . PRO A 1 138 ? 6.814   -19.133 3.380   1.00 0.00 ? 138 PRO A CD   4  
ATOM 9322  H HA   . PRO A 1 138 ? 8.437   -16.405 2.474   1.00 0.00 ? 138 PRO A HA   4  
ATOM 9323  H HB2  . PRO A 1 138 ? 8.985   -17.148 5.073   1.00 0.00 ? 138 PRO A HB2  4  
ATOM 9324  H HB3  . PRO A 1 138 ? 7.373   -16.612 4.564   1.00 0.00 ? 138 PRO A HB3  4  
ATOM 9325  H HG2  . PRO A 1 138 ? 8.365   -19.503 4.857   1.00 0.00 ? 138 PRO A HG2  4  
ATOM 9326  H HG3  . PRO A 1 138 ? 6.892   -18.792 5.560   1.00 0.00 ? 138 PRO A HG3  4  
ATOM 9327  H HD2  . PRO A 1 138 ? 6.874   -20.219 3.171   1.00 0.00 ? 138 PRO A HD2  4  
ATOM 9328  H HD3  . PRO A 1 138 ? 5.743   -18.854 3.448   1.00 0.00 ? 138 PRO A HD3  4  
ATOM 9329  N N    . ASP A 1 139 ? 10.957  -16.930 2.723   1.00 0.00 ? 139 ASP A N    4  
ATOM 9330  C CA   . ASP A 1 139 ? 12.411  -17.200 2.524   1.00 0.00 ? 139 ASP A CA   4  
ATOM 9331  C C    . ASP A 1 139 ? 13.134  -17.612 3.871   1.00 0.00 ? 139 ASP A C    4  
ATOM 9332  O O    . ASP A 1 139 ? 12.487  -17.960 4.867   1.00 0.00 ? 139 ASP A O    4  
ATOM 9333  C CB   . ASP A 1 139 ? 12.945  -15.904 1.837   1.00 0.00 ? 139 ASP A CB   4  
ATOM 9334  C CG   . ASP A 1 139 ? 14.188  -16.119 0.978   1.00 0.00 ? 139 ASP A CG   4  
ATOM 9335  O OD1  . ASP A 1 139 ? 15.267  -16.393 1.543   1.00 0.00 ? 139 ASP A OD1  4  
ATOM 9336  O OD2  . ASP A 1 139 ? 14.095  -15.991 -0.260  1.00 0.00 ? 139 ASP A OD2  4  
ATOM 9337  H H    . ASP A 1 139 ? 10.605  -15.985 2.891   1.00 0.00 ? 139 ASP A H    4  
ATOM 9338  H HA   . ASP A 1 139 ? 12.540  -18.056 1.830   1.00 0.00 ? 139 ASP A HA   4  
ATOM 9339  H HB2  . ASP A 1 139 ? 12.194  -15.450 1.161   1.00 0.00 ? 139 ASP A HB2  4  
ATOM 9340  H HB3  . ASP A 1 139 ? 13.162  -15.125 2.589   1.00 0.00 ? 139 ASP A HB3  4  
ATOM 9341  N N    . GLU A 1 140 ? 14.481  -17.617 3.916   1.00 0.00 ? 140 GLU A N    4  
ATOM 9342  C CA   . GLU A 1 140 ? 15.262  -18.019 5.135   1.00 0.00 ? 140 GLU A CA   4  
ATOM 9343  C C    . GLU A 1 140 ? 15.618  -16.809 6.076   1.00 0.00 ? 140 GLU A C    4  
ATOM 9344  O O    . GLU A 1 140 ? 16.741  -16.668 6.570   1.00 0.00 ? 140 GLU A O    4  
ATOM 9345  C CB   . GLU A 1 140 ? 16.511  -18.812 4.636   1.00 0.00 ? 140 GLU A CB   4  
ATOM 9346  C CG   . GLU A 1 140 ? 17.573  -18.073 3.772   1.00 0.00 ? 140 GLU A CG   4  
ATOM 9347  C CD   . GLU A 1 140 ? 18.812  -18.903 3.467   1.00 0.00 ? 140 GLU A CD   4  
ATOM 9348  O OE1  . GLU A 1 140 ? 18.770  -19.731 2.533   1.00 0.00 ? 140 GLU A OE1  4  
ATOM 9349  O OE2  . GLU A 1 140 ? 19.839  -18.721 4.154   1.00 0.00 ? 140 GLU A OE2  4  
ATOM 9350  H H    . GLU A 1 140 ? 14.935  -17.260 3.046   1.00 0.00 ? 140 GLU A H    4  
ATOM 9351  H HA   . GLU A 1 140 ? 14.672  -18.718 5.761   1.00 0.00 ? 140 GLU A HA   4  
ATOM 9352  H HB2  . GLU A 1 140 ? 17.021  -19.225 5.527   1.00 0.00 ? 140 GLU A HB2  4  
ATOM 9353  H HB3  . GLU A 1 140 ? 16.170  -19.709 4.082   1.00 0.00 ? 140 GLU A HB3  4  
ATOM 9354  H HG2  . GLU A 1 140 ? 17.143  -17.752 2.806   1.00 0.00 ? 140 GLU A HG2  4  
ATOM 9355  H HG3  . GLU A 1 140 ? 17.912  -17.148 4.272   1.00 0.00 ? 140 GLU A HG3  4  
ATOM 9356  N N    . GLY A 1 141 ? 14.617  -15.970 6.408   1.00 0.00 ? 141 GLY A N    4  
ATOM 9357  C CA   . GLY A 1 141 ? 14.840  -14.713 7.187   1.00 0.00 ? 141 GLY A CA   4  
ATOM 9358  C C    . GLY A 1 141 ? 15.603  -13.592 6.427   1.00 0.00 ? 141 GLY A C    4  
ATOM 9359  O O    . GLY A 1 141 ? 16.395  -12.861 7.021   1.00 0.00 ? 141 GLY A O    4  
ATOM 9360  H H    . GLY A 1 141 ? 13.753  -16.197 5.900   1.00 0.00 ? 141 GLY A H    4  
ATOM 9361  H HA2  . GLY A 1 141 ? 13.868  -14.305 7.518   1.00 0.00 ? 141 GLY A HA2  4  
ATOM 9362  H HA3  . GLY A 1 141 ? 15.390  -14.940 8.121   1.00 0.00 ? 141 GLY A HA3  4  
ATOM 9363  N N    . VAL A 1 142 ? 15.298  -13.437 5.130   1.00 0.00 ? 142 VAL A N    4  
ATOM 9364  C CA   . VAL A 1 142 ? 16.005  -12.501 4.206   1.00 0.00 ? 142 VAL A CA   4  
ATOM 9365  C C    . VAL A 1 142 ? 15.248  -11.137 4.093   1.00 0.00 ? 142 VAL A C    4  
ATOM 9366  O O    . VAL A 1 142 ? 15.812  -10.079 4.373   1.00 0.00 ? 142 VAL A O    4  
ATOM 9367  C CB   . VAL A 1 142 ? 16.198  -13.295 2.845   1.00 0.00 ? 142 VAL A CB   4  
ATOM 9368  C CG1  . VAL A 1 142 ? 15.324  -12.941 1.614   1.00 0.00 ? 142 VAL A CG1  4  
ATOM 9369  C CG2  . VAL A 1 142 ? 17.655  -13.156 2.345   1.00 0.00 ? 142 VAL A CG2  4  
ATOM 9370  H H    . VAL A 1 142 ? 14.642  -14.150 4.795   1.00 0.00 ? 142 VAL A H    4  
ATOM 9371  H HA   . VAL A 1 142 ? 16.998  -12.252 4.635   1.00 0.00 ? 142 VAL A HA   4  
ATOM 9372  H HB   . VAL A 1 142 ? 15.945  -14.365 3.019   1.00 0.00 ? 142 VAL A HB   4  
ATOM 9373  H HG11 . VAL A 1 142 ? 15.438  -11.889 1.291   1.00 0.00 ? 142 VAL A HG11 4  
ATOM 9374  H HG12 . VAL A 1 142 ? 15.570  -13.576 0.740   1.00 0.00 ? 142 VAL A HG12 4  
ATOM 9375  H HG13 . VAL A 1 142 ? 14.254  -13.121 1.809   1.00 0.00 ? 142 VAL A HG13 4  
ATOM 9376  H HG21 . VAL A 1 142 ? 18.379  -13.507 3.104   1.00 0.00 ? 142 VAL A HG21 4  
ATOM 9377  H HG22 . VAL A 1 142 ? 17.846  -13.768 1.442   1.00 0.00 ? 142 VAL A HG22 4  
ATOM 9378  H HG23 . VAL A 1 142 ? 17.920  -12.110 2.098   1.00 0.00 ? 142 VAL A HG23 4  
ATOM 9379  N N    . MET A 1 143 ? 13.945  -11.191 3.776   1.00 0.00 ? 143 MET A N    4  
ATOM 9380  C CA   . MET A 1 143 ? 13.093  -9.983  3.585   1.00 0.00 ? 143 MET A CA   4  
ATOM 9381  C C    . MET A 1 143 ? 12.719  -9.289  4.942   1.00 0.00 ? 143 MET A C    4  
ATOM 9382  O O    . MET A 1 143 ? 12.556  -9.929  5.988   1.00 0.00 ? 143 MET A O    4  
ATOM 9383  C CB   . MET A 1 143 ? 11.790  -10.414 2.849   1.00 0.00 ? 143 MET A CB   4  
ATOM 9384  C CG   . MET A 1 143 ? 11.917  -10.807 1.366   1.00 0.00 ? 143 MET A CG   4  
ATOM 9385  S SD   . MET A 1 143 ? 10.263  -11.076 0.699   1.00 0.00 ? 143 MET A SD   4  
ATOM 9386  C CE   . MET A 1 143 ? 10.680  -11.632 -0.961  1.00 0.00 ? 143 MET A CE   4  
ATOM 9387  H H    . MET A 1 143 ? 13.705  -12.168 3.550   1.00 0.00 ? 143 MET A H    4  
ATOM 9388  H HA   . MET A 1 143 ? 13.636  -9.252  2.952   1.00 0.00 ? 143 MET A HA   4  
ATOM 9389  H HB2  . MET A 1 143 ? 11.276  -11.221 3.408   1.00 0.00 ? 143 MET A HB2  4  
ATOM 9390  H HB3  . MET A 1 143 ? 11.077  -9.570  2.874   1.00 0.00 ? 143 MET A HB3  4  
ATOM 9391  H HG2  . MET A 1 143 ? 12.416  -10.010 0.783   1.00 0.00 ? 143 MET A HG2  4  
ATOM 9392  H HG3  . MET A 1 143 ? 12.518  -11.725 1.239   1.00 0.00 ? 143 MET A HG3  4  
ATOM 9393  H HE1  . MET A 1 143 ? 11.282  -10.873 -1.492  1.00 0.00 ? 143 MET A HE1  4  
ATOM 9394  H HE2  . MET A 1 143 ? 11.260  -12.573 -0.923  1.00 0.00 ? 143 MET A HE2  4  
ATOM 9395  H HE3  . MET A 1 143 ? 9.762   -11.818 -1.545  1.00 0.00 ? 143 MET A HE3  4  
ATOM 9396  N N    . VAL A 1 144 ? 12.597  -7.947  4.916   1.00 0.00 ? 144 VAL A N    4  
ATOM 9397  C CA   . VAL A 1 144 ? 12.259  -7.135  6.122   1.00 0.00 ? 144 VAL A CA   4  
ATOM 9398  C C    . VAL A 1 144 ? 10.709  -7.171  6.378   1.00 0.00 ? 144 VAL A C    4  
ATOM 9399  O O    . VAL A 1 144 ? 9.943   -6.304  5.949   1.00 0.00 ? 144 VAL A O    4  
ATOM 9400  C CB   . VAL A 1 144 ? 12.884  -5.698  5.963   1.00 0.00 ? 144 VAL A CB   4  
ATOM 9401  C CG1  . VAL A 1 144 ? 12.392  -4.818  4.786   1.00 0.00 ? 144 VAL A CG1  4  
ATOM 9402  C CG2  . VAL A 1 144 ? 12.769  -4.864  7.260   1.00 0.00 ? 144 VAL A CG2  4  
ATOM 9403  H H    . VAL A 1 144 ? 12.715  -7.519  3.986   1.00 0.00 ? 144 VAL A H    4  
ATOM 9404  H HA   . VAL A 1 144 ? 12.748  -7.585  7.012   1.00 0.00 ? 144 VAL A HA   4  
ATOM 9405  H HB   . VAL A 1 144 ? 13.970  -5.849  5.799   1.00 0.00 ? 144 VAL A HB   4  
ATOM 9406  H HG11 . VAL A 1 144 ? 12.516  -5.321  3.811   1.00 0.00 ? 144 VAL A HG11 4  
ATOM 9407  H HG12 . VAL A 1 144 ? 11.325  -4.547  4.878   1.00 0.00 ? 144 VAL A HG12 4  
ATOM 9408  H HG13 . VAL A 1 144 ? 12.951  -3.867  4.718   1.00 0.00 ? 144 VAL A HG13 4  
ATOM 9409  H HG21 . VAL A 1 144 ? 13.190  -5.393  8.135   1.00 0.00 ? 144 VAL A HG21 4  
ATOM 9410  H HG22 . VAL A 1 144 ? 13.310  -3.901  7.185   1.00 0.00 ? 144 VAL A HG22 4  
ATOM 9411  H HG23 . VAL A 1 144 ? 11.718  -4.614  7.503   1.00 0.00 ? 144 VAL A HG23 4  
ATOM 9412  N N    . THR A 1 145 ? 10.259  -8.179  7.149   1.00 0.00 ? 145 THR A N    4  
ATOM 9413  C CA   . THR A 1 145 ? 8.813   -8.347  7.515   1.00 0.00 ? 145 THR A CA   4  
ATOM 9414  C C    . THR A 1 145 ? 8.293   -7.438  8.692   1.00 0.00 ? 145 THR A C    4  
ATOM 9415  O O    . THR A 1 145 ? 7.149   -7.615  9.117   1.00 0.00 ? 145 THR A O    4  
ATOM 9416  C CB   . THR A 1 145 ? 8.597   -9.881  7.750   1.00 0.00 ? 145 THR A CB   4  
ATOM 9417  O OG1  . THR A 1 145 ? 7.202   -10.156 7.754   1.00 0.00 ? 145 THR A OG1  4  
ATOM 9418  C CG2  . THR A 1 145 ? 9.154   -10.461 9.064   1.00 0.00 ? 145 THR A CG2  4  
ATOM 9419  H H    . THR A 1 145 ? 10.982  -8.856  7.420   1.00 0.00 ? 145 THR A H    4  
ATOM 9420  H HA   . THR A 1 145 ? 8.169   -8.047  6.663   1.00 0.00 ? 145 THR A HA   4  
ATOM 9421  H HB   . THR A 1 145 ? 9.040   -10.428 6.892   1.00 0.00 ? 145 THR A HB   4  
ATOM 9422  H HG1  . THR A 1 145 ? 6.875   -9.907  8.624   1.00 0.00 ? 145 THR A HG1  4  
ATOM 9423  H HG21 . THR A 1 145 ? 8.704   -9.997  9.960   1.00 0.00 ? 145 THR A HG21 4  
ATOM 9424  H HG22 . THR A 1 145 ? 8.959   -11.548 9.130   1.00 0.00 ? 145 THR A HG22 4  
ATOM 9425  H HG23 . THR A 1 145 ? 10.249  -10.331 9.139   1.00 0.00 ? 145 THR A HG23 4  
ATOM 9426  N N    . LYS A 1 146 ? 9.091   -6.495  9.224   1.00 0.00 ? 146 LYS A N    4  
ATOM 9427  C CA   . LYS A 1 146 ? 8.645   -5.509  10.249  1.00 0.00 ? 146 LYS A CA   4  
ATOM 9428  C C    . LYS A 1 146 ? 9.105   -4.089  9.770   1.00 0.00 ? 146 LYS A C    4  
ATOM 9429  O O    . LYS A 1 146 ? 10.038  -3.487  10.307  1.00 0.00 ? 146 LYS A O    4  
ATOM 9430  C CB   . LYS A 1 146 ? 9.172   -5.928  11.655  1.00 0.00 ? 146 LYS A CB   4  
ATOM 9431  C CG   . LYS A 1 146 ? 8.547   -7.210  12.279  1.00 0.00 ? 146 LYS A CG   4  
ATOM 9432  C CD   . LYS A 1 146 ? 7.024   -7.175  12.569  1.00 0.00 ? 146 LYS A CD   4  
ATOM 9433  C CE   . LYS A 1 146 ? 6.645   -6.370  13.827  1.00 0.00 ? 146 LYS A CE   4  
ATOM 9434  N NZ   . LYS A 1 146 ? 5.170   -6.198  13.907  1.00 0.00 ? 146 LYS A NZ   4  
ATOM 9435  H H    . LYS A 1 146 ? 10.011  -6.450  8.772   1.00 0.00 ? 146 LYS A H    4  
ATOM 9436  H HA   . LYS A 1 146 ? 7.544   -5.463  10.313  1.00 0.00 ? 146 LYS A HA   4  
ATOM 9437  H HB2  . LYS A 1 146 ? 10.272  -6.051  11.603  1.00 0.00 ? 146 LYS A HB2  4  
ATOM 9438  H HB3  . LYS A 1 146 ? 9.033   -5.086  12.359  1.00 0.00 ? 146 LYS A HB3  4  
ATOM 9439  H HG2  . LYS A 1 146 ? 8.753   -8.060  11.600  1.00 0.00 ? 146 LYS A HG2  4  
ATOM 9440  H HG3  . LYS A 1 146 ? 9.099   -7.473  13.203  1.00 0.00 ? 146 LYS A HG3  4  
ATOM 9441  H HD2  . LYS A 1 146 ? 6.481   -6.810  11.675  1.00 0.00 ? 146 LYS A HD2  4  
ATOM 9442  H HD3  . LYS A 1 146 ? 6.670   -8.218  12.691  1.00 0.00 ? 146 LYS A HD3  4  
ATOM 9443  H HE2  . LYS A 1 146 ? 7.037   -6.884  14.733  1.00 0.00 ? 146 LYS A HE2  4  
ATOM 9444  H HE3  . LYS A 1 146 ? 7.149   -5.381  13.824  1.00 0.00 ? 146 LYS A HE3  4  
ATOM 9445  H HZ1  . LYS A 1 146 ? 4.645   -6.928  13.410  1.00 0.00 ? 146 LYS A HZ1  4  
ATOM 9446  H HZ2  . LYS A 1 146 ? 4.798   -6.199  14.876  1.00 0.00 ? 146 LYS A HZ2  4  
ATOM 9447  H HZ3  . LYS A 1 146 ? 4.859   -5.290  13.504  1.00 0.00 ? 146 LYS A HZ3  4  
ATOM 9448  N N    . PHE A 1 147 ? 8.416   -3.567  8.738   1.00 0.00 ? 147 PHE A N    4  
ATOM 9449  C CA   . PHE A 1 147 ? 8.682   -2.224  8.138   1.00 0.00 ? 147 PHE A CA   4  
ATOM 9450  C C    . PHE A 1 147 ? 7.736   -1.143  8.762   1.00 0.00 ? 147 PHE A C    4  
ATOM 9451  O O    . PHE A 1 147 ? 6.648   -1.451  9.257   1.00 0.00 ? 147 PHE A O    4  
ATOM 9452  C CB   . PHE A 1 147 ? 8.542   -2.329  6.585   1.00 0.00 ? 147 PHE A CB   4  
ATOM 9453  C CG   . PHE A 1 147 ? 7.197   -2.824  6.017   1.00 0.00 ? 147 PHE A CG   4  
ATOM 9454  C CD1  . PHE A 1 147 ? 6.102   -1.957  5.916   1.00 0.00 ? 147 PHE A CD1  4  
ATOM 9455  C CD2  . PHE A 1 147 ? 7.041   -4.172  5.675   1.00 0.00 ? 147 PHE A CD2  4  
ATOM 9456  C CE1  . PHE A 1 147 ? 4.858   -2.445  5.529   1.00 0.00 ? 147 PHE A CE1  4  
ATOM 9457  C CE2  . PHE A 1 147 ? 5.797   -4.656  5.286   1.00 0.00 ? 147 PHE A CE2  4  
ATOM 9458  C CZ   . PHE A 1 147 ? 4.706   -3.797  5.238   1.00 0.00 ? 147 PHE A CZ   4  
ATOM 9459  H H    . PHE A 1 147 ? 7.654   -4.169  8.391   1.00 0.00 ? 147 PHE A H    4  
ATOM 9460  H HA   . PHE A 1 147 ? 9.724   -1.917  8.358   1.00 0.00 ? 147 PHE A HA   4  
ATOM 9461  H HB2  . PHE A 1 147 ? 8.774   -1.343  6.136   1.00 0.00 ? 147 PHE A HB2  4  
ATOM 9462  H HB3  . PHE A 1 147 ? 9.361   -2.973  6.206   1.00 0.00 ? 147 PHE A HB3  4  
ATOM 9463  H HD1  . PHE A 1 147 ? 6.206   -0.913  6.179   1.00 0.00 ? 147 PHE A HD1  4  
ATOM 9464  H HD2  . PHE A 1 147 ? 7.873   -4.856  5.752   1.00 0.00 ? 147 PHE A HD2  4  
ATOM 9465  H HE1  . PHE A 1 147 ? 4.005   -1.783  5.486   1.00 0.00 ? 147 PHE A HE1  4  
ATOM 9466  H HE2  . PHE A 1 147 ? 5.672   -5.703  5.054   1.00 0.00 ? 147 PHE A HE2  4  
ATOM 9467  H HZ   . PHE A 1 147 ? 3.734   -4.190  5.004   1.00 0.00 ? 147 PHE A HZ   4  
ATOM 9468  N N    . TYR A 1 148 ? 8.138   0.137   8.730   1.00 0.00 ? 148 TYR A N    4  
ATOM 9469  C CA   . TYR A 1 148 ? 7.389   1.244   9.388   1.00 0.00 ? 148 TYR A CA   4  
ATOM 9470  C C    . TYR A 1 148 ? 6.121   1.684   8.570   1.00 0.00 ? 148 TYR A C    4  
ATOM 9471  O O    . TYR A 1 148 ? 6.177   2.167   7.434   1.00 0.00 ? 148 TYR A O    4  
ATOM 9472  C CB   . TYR A 1 148 ? 8.395   2.419   9.593   1.00 0.00 ? 148 TYR A CB   4  
ATOM 9473  C CG   . TYR A 1 148 ? 8.114   3.509   10.653  1.00 0.00 ? 148 TYR A CG   4  
ATOM 9474  C CD1  . TYR A 1 148 ? 6.913   3.631   11.365  1.00 0.00 ? 148 TYR A CD1  4  
ATOM 9475  C CD2  . TYR A 1 148 ? 9.155   4.405   10.932  1.00 0.00 ? 148 TYR A CD2  4  
ATOM 9476  C CE1  . TYR A 1 148 ? 6.764   4.608   12.344  1.00 0.00 ? 148 TYR A CE1  4  
ATOM 9477  C CE2  . TYR A 1 148 ? 9.007   5.380   11.916  1.00 0.00 ? 148 TYR A CE2  4  
ATOM 9478  C CZ   . TYR A 1 148 ? 7.814   5.473   12.626  1.00 0.00 ? 148 TYR A CZ   4  
ATOM 9479  O OH   . TYR A 1 148 ? 7.664   6.405   13.616  1.00 0.00 ? 148 TYR A OH   4  
ATOM 9480  H H    . TYR A 1 148 ? 9.021   0.312   8.234   1.00 0.00 ? 148 TYR A H    4  
ATOM 9481  H HA   . TYR A 1 148 ? 7.081   0.896   10.396  1.00 0.00 ? 148 TYR A HA   4  
ATOM 9482  H HB2  . TYR A 1 148 ? 9.374   1.988   9.880   1.00 0.00 ? 148 TYR A HB2  4  
ATOM 9483  H HB3  . TYR A 1 148 ? 8.590   2.911   8.620   1.00 0.00 ? 148 TYR A HB3  4  
ATOM 9484  H HD1  . TYR A 1 148 ? 6.081   2.972   11.183  1.00 0.00 ? 148 TYR A HD1  4  
ATOM 9485  H HD2  . TYR A 1 148 ? 10.087  4.351   10.385  1.00 0.00 ? 148 TYR A HD2  4  
ATOM 9486  H HE1  . TYR A 1 148 ? 5.837   4.688   12.893  1.00 0.00 ? 148 TYR A HE1  4  
ATOM 9487  H HE2  . TYR A 1 148 ? 9.823   6.055   12.126  1.00 0.00 ? 148 TYR A HE2  4  
ATOM 9488  H HH   . TYR A 1 148 ? 8.411   7.007   13.596  1.00 0.00 ? 148 TYR A HH   4  
ATOM 9489  N N    . PHE A 1 149 ? 4.968   1.483   9.217   1.00 0.00 ? 149 PHE A N    4  
ATOM 9490  C CA   . PHE A 1 149 ? 3.615   1.807   8.700   1.00 0.00 ? 149 PHE A CA   4  
ATOM 9491  C C    . PHE A 1 149 ? 3.130   3.090   9.454   1.00 0.00 ? 149 PHE A C    4  
ATOM 9492  O O    . PHE A 1 149 ? 2.736   2.993   10.621  1.00 0.00 ? 149 PHE A O    4  
ATOM 9493  C CB   . PHE A 1 149 ? 2.823   0.487   8.964   1.00 0.00 ? 149 PHE A CB   4  
ATOM 9494  C CG   . PHE A 1 149 ? 1.359   0.385   8.519   1.00 0.00 ? 149 PHE A CG   4  
ATOM 9495  C CD1  . PHE A 1 149 ? 1.037   0.132   7.181   1.00 0.00 ? 149 PHE A CD1  4  
ATOM 9496  C CD2  . PHE A 1 149 ? 0.333   0.465   9.467   1.00 0.00 ? 149 PHE A CD2  4  
ATOM 9497  C CE1  . PHE A 1 149 ? -0.296  0.032   6.788   1.00 0.00 ? 149 PHE A CE1  4  
ATOM 9498  C CE2  . PHE A 1 149 ? -0.998  0.353   9.073   1.00 0.00 ? 149 PHE A CE2  4  
ATOM 9499  C CZ   . PHE A 1 149 ? -1.311  0.145   7.732   1.00 0.00 ? 149 PHE A CZ   4  
ATOM 9500  H H    . PHE A 1 149 ? 5.071   1.084   10.163  1.00 0.00 ? 149 PHE A H    4  
ATOM 9501  H HA   . PHE A 1 149 ? 3.629   2.008   7.610   1.00 0.00 ? 149 PHE A HA   4  
ATOM 9502  H HB2  . PHE A 1 149 ? 3.365   -0.344  8.474   1.00 0.00 ? 149 PHE A HB2  4  
ATOM 9503  H HB3  . PHE A 1 149 ? 2.883   0.229   10.042  1.00 0.00 ? 149 PHE A HB3  4  
ATOM 9504  H HD1  . PHE A 1 149 ? 1.816   0.022   6.443   1.00 0.00 ? 149 PHE A HD1  4  
ATOM 9505  H HD2  . PHE A 1 149 ? 0.563   0.640   10.510  1.00 0.00 ? 149 PHE A HD2  4  
ATOM 9506  H HE1  . PHE A 1 149 ? -0.544  -0.125  5.749   1.00 0.00 ? 149 PHE A HE1  4  
ATOM 9507  H HE2  . PHE A 1 149 ? -1.787  0.440   9.806   1.00 0.00 ? 149 PHE A HE2  4  
ATOM 9508  H HZ   . PHE A 1 149 ? -2.342  0.073   7.423   1.00 0.00 ? 149 PHE A HZ   4  
ATOM 9509  N N    . GLN A 1 150 ? 3.203   4.294   8.833   1.00 0.00 ? 150 GLN A N    4  
ATOM 9510  C CA   . GLN A 1 150 ? 2.904   5.573   9.557   1.00 0.00 ? 150 GLN A CA   4  
ATOM 9511  C C    . GLN A 1 150 ? 1.979   6.583   8.794   1.00 0.00 ? 150 GLN A C    4  
ATOM 9512  O O    . GLN A 1 150 ? 1.931   6.631   7.561   1.00 0.00 ? 150 GLN A O    4  
ATOM 9513  C CB   . GLN A 1 150 ? 4.303   6.225   9.823   1.00 0.00 ? 150 GLN A CB   4  
ATOM 9514  C CG   . GLN A 1 150 ? 4.348   7.320   10.924  1.00 0.00 ? 150 GLN A CG   4  
ATOM 9515  C CD   . GLN A 1 150 ? 5.589   8.222   10.932  1.00 0.00 ? 150 GLN A CD   4  
ATOM 9516  O OE1  . GLN A 1 150 ? 6.096   8.657   9.901   1.00 0.00 ? 150 GLN A OE1  4  
ATOM 9517  N NE2  . GLN A 1 150 ? 6.056   8.602   12.095  1.00 0.00 ? 150 GLN A NE2  4  
ATOM 9518  H H    . GLN A 1 150 ? 3.524   4.296   7.852   1.00 0.00 ? 150 GLN A H    4  
ATOM 9519  H HA   . GLN A 1 150 ? 2.418   5.358   10.531  1.00 0.00 ? 150 GLN A HA   4  
ATOM 9520  H HB2  . GLN A 1 150 ? 5.041   5.451   10.111  1.00 0.00 ? 150 GLN A HB2  4  
ATOM 9521  H HB3  . GLN A 1 150 ? 4.688   6.631   8.867   1.00 0.00 ? 150 GLN A HB3  4  
ATOM 9522  H HG2  . GLN A 1 150 ? 3.505   8.022   10.815  1.00 0.00 ? 150 GLN A HG2  4  
ATOM 9523  H HG3  . GLN A 1 150 ? 4.197   6.840   11.910  1.00 0.00 ? 150 GLN A HG3  4  
ATOM 9524  H HE21 . GLN A 1 150 ? 5.552   8.241   12.908  1.00 0.00 ? 150 GLN A HE21 4  
ATOM 9525  H HE22 . GLN A 1 150 ? 6.552   9.516   12.078  1.00 0.00 ? 150 GLN A HE22 4  
ATOM 9526  N N    . GLU A 1 151 ? 1.295   7.453   9.565   1.00 0.00 ? 151 GLU A N    4  
ATOM 9527  C CA   . GLU A 1 151 ? 0.502   8.596   9.023   1.00 0.00 ? 151 GLU A CA   4  
ATOM 9528  C C    . GLU A 1 151 ? 1.498   9.747   8.597   1.00 0.00 ? 151 GLU A C    4  
ATOM 9529  O O    . GLU A 1 151 ? 2.593   9.893   9.160   1.00 0.00 ? 151 GLU A O    4  
ATOM 9530  C CB   . GLU A 1 151 ? -0.498  9.018   10.138  1.00 0.00 ? 151 GLU A CB   4  
ATOM 9531  C CG   . GLU A 1 151 ? -1.670  9.950   9.717   1.00 0.00 ? 151 GLU A CG   4  
ATOM 9532  C CD   . GLU A 1 151 ? -2.916  9.321   9.088   1.00 0.00 ? 151 GLU A CD   4  
ATOM 9533  O OE1  . GLU A 1 151 ? -3.252  8.153   9.382   1.00 0.00 ? 151 GLU A OE1  4  
ATOM 9534  O OE2  . GLU A 1 151 ? -3.614  10.037  8.339   1.00 0.00 ? 151 GLU A OE2  4  
ATOM 9535  H H    . GLU A 1 151 ? 1.407   7.324   10.574  1.00 0.00 ? 151 GLU A H    4  
ATOM 9536  H HA   . GLU A 1 151 ? -0.077  8.264   8.141   1.00 0.00 ? 151 GLU A HA   4  
ATOM 9537  H HB2  . GLU A 1 151 ? -0.947  8.121   10.611  1.00 0.00 ? 151 GLU A HB2  4  
ATOM 9538  H HB3  . GLU A 1 151 ? 0.067   9.508   10.955  1.00 0.00 ? 151 GLU A HB3  4  
ATOM 9539  H HG2  . GLU A 1 151 ? -2.043  10.482  10.608  1.00 0.00 ? 151 GLU A HG2  4  
ATOM 9540  H HG3  . GLU A 1 151 ? -1.320  10.750  9.041   1.00 0.00 ? 151 GLU A HG3  4  
ATOM 9541  N N    . ASP A 1 152 ? 1.140   10.564  7.592   1.00 0.00 ? 152 ASP A N    4  
ATOM 9542  C CA   . ASP A 1 152 ? 2.067   11.573  7.013   1.00 0.00 ? 152 ASP A CA   4  
ATOM 9543  C C    . ASP A 1 152 ? 2.380   12.832  7.905   1.00 0.00 ? 152 ASP A C    4  
ATOM 9544  O O    . ASP A 1 152 ? 1.600   13.782  8.025   1.00 0.00 ? 152 ASP A O    4  
ATOM 9545  C CB   . ASP A 1 152 ? 1.520   12.000  5.614   1.00 0.00 ? 152 ASP A CB   4  
ATOM 9546  C CG   . ASP A 1 152 ? 2.063   11.192  4.429   1.00 0.00 ? 152 ASP A CG   4  
ATOM 9547  O OD1  . ASP A 1 152 ? 3.306   11.042  4.317   1.00 0.00 ? 152 ASP A OD1  4  
ATOM 9548  O OD2  . ASP A 1 152 ? 1.261   10.738  3.589   1.00 0.00 ? 152 ASP A OD2  4  
ATOM 9549  H H    . ASP A 1 152 ? 0.213   10.370  7.173   1.00 0.00 ? 152 ASP A H    4  
ATOM 9550  H HA   . ASP A 1 152 ? 3.026   11.059  6.850   1.00 0.00 ? 152 ASP A HA   4  
ATOM 9551  H HB2  . ASP A 1 152 ? 0.415   12.012  5.591   1.00 0.00 ? 152 ASP A HB2  4  
ATOM 9552  H HB3  . ASP A 1 152 ? 1.801   13.045  5.392   1.00 0.00 ? 152 ASP A HB3  4  
ATOM 9553  N N    . GLU A 1 153 ? 3.604   12.807  8.456   1.00 0.00 ? 153 GLU A N    4  
ATOM 9554  C CA   . GLU A 1 153 ? 4.247   13.926  9.191   1.00 0.00 ? 153 GLU A CA   4  
ATOM 9555  C C    . GLU A 1 153 ? 5.533   14.347  8.397   1.00 0.00 ? 153 GLU A C    4  
ATOM 9556  O O    . GLU A 1 153 ? 5.796   15.567  8.314   1.00 0.00 ? 153 GLU A O    4  
ATOM 9557  C CB   . GLU A 1 153 ? 4.548   13.524  10.669  1.00 0.00 ? 153 GLU A CB   4  
ATOM 9558  C CG   . GLU A 1 153 ? 5.543   12.355  10.924  1.00 0.00 ? 153 GLU A CG   4  
ATOM 9559  C CD   . GLU A 1 153 ? 5.966   12.036  12.353  1.00 0.00 ? 153 GLU A CD   4  
ATOM 9560  O OE1  . GLU A 1 153 ? 5.360   12.520  13.331  1.00 0.00 ? 153 GLU A OE1  4  
ATOM 9561  O OE2  . GLU A 1 153 ? 6.920   11.237  12.484  1.00 0.00 ? 153 GLU A OE2  4  
ATOM 9562  O OXT  . GLU A 1 153 ? 6.275   13.486  7.845   1.00 0.00 ? 153 GLU A OXT  4  
ATOM 9563  H H    . GLU A 1 153 ? 4.120   11.942  8.286   1.00 0.00 ? 153 GLU A H    4  
ATOM 9564  H HA   . GLU A 1 153 ? 3.578   14.808  9.210   1.00 0.00 ? 153 GLU A HA   4  
ATOM 9565  H HB2  . GLU A 1 153 ? 4.931   14.422  11.191  1.00 0.00 ? 153 GLU A HB2  4  
ATOM 9566  H HB3  . GLU A 1 153 ? 3.593   13.298  11.180  1.00 0.00 ? 153 GLU A HB3  4  
ATOM 9567  H HG2  . GLU A 1 153 ? 5.132   11.423  10.504  1.00 0.00 ? 153 GLU A HG2  4  
ATOM 9568  H HG3  . GLU A 1 153 ? 6.480   12.560  10.379  1.00 0.00 ? 153 GLU A HG3  4  
ATOM 9569  N N    . MET A 1 1   ? -8.184  3.769   -2.544  1.00 0.00 ? 1   MET A N    5  
ATOM 9570  C CA   . MET A 1 1   ? -9.443  4.167   -3.236  1.00 0.00 ? 1   MET A CA   5  
ATOM 9571  C C    . MET A 1 1   ? -10.522 4.662   -2.197  1.00 0.00 ? 1   MET A C    5  
ATOM 9572  O O    . MET A 1 1   ? -11.539 4.007   -1.966  1.00 0.00 ? 1   MET A O    5  
ATOM 9573  C CB   . MET A 1 1   ? -9.843  2.938   -4.106  1.00 0.00 ? 1   MET A CB   5  
ATOM 9574  C CG   . MET A 1 1   ? -11.009 3.160   -5.082  1.00 0.00 ? 1   MET A CG   5  
ATOM 9575  S SD   . MET A 1 1   ? -11.507 1.576   -5.782  1.00 0.00 ? 1   MET A SD   5  
ATOM 9576  C CE   . MET A 1 1   ? -12.780 2.150   -6.916  1.00 0.00 ? 1   MET A CE   5  
ATOM 9577  H H1   . MET A 1 1   ? -8.325  3.038   -1.841  1.00 0.00 ? 1   MET A H1   5  
ATOM 9578  H H2   . MET A 1 1   ? -7.437  3.443   -3.169  1.00 0.00 ? 1   MET A H2   5  
ATOM 9579  H H3   . MET A 1 1   ? -7.791  4.597   -2.010  1.00 0.00 ? 1   MET A H3   5  
ATOM 9580  H HA   . MET A 1 1   ? -9.243  5.026   -3.912  1.00 0.00 ? 1   MET A HA   5  
ATOM 9581  H HB2  . MET A 1 1   ? -8.984  2.575   -4.707  1.00 0.00 ? 1   MET A HB2  5  
ATOM 9582  H HB3  . MET A 1 1   ? -10.109 2.083   -3.463  1.00 0.00 ? 1   MET A HB3  5  
ATOM 9583  H HG2  . MET A 1 1   ? -11.890 3.606   -4.580  1.00 0.00 ? 1   MET A HG2  5  
ATOM 9584  H HG3  . MET A 1 1   ? -10.716 3.838   -5.905  1.00 0.00 ? 1   MET A HG3  5  
ATOM 9585  H HE1  . MET A 1 1   ? -12.360 2.849   -7.661  1.00 0.00 ? 1   MET A HE1  5  
ATOM 9586  H HE2  . MET A 1 1   ? -13.223 1.296   -7.458  1.00 0.00 ? 1   MET A HE2  5  
ATOM 9587  H HE3  . MET A 1 1   ? -13.590 2.662   -6.366  1.00 0.00 ? 1   MET A HE3  5  
ATOM 9588  N N    . ARG A 1 2   ? -10.305 5.857   -1.611  1.00 0.00 ? 2   ARG A N    5  
ATOM 9589  C CA   . ARG A 1 2   ? -11.219 6.489   -0.607  1.00 0.00 ? 2   ARG A CA   5  
ATOM 9590  C C    . ARG A 1 2   ? -11.661 7.929   -1.088  1.00 0.00 ? 2   ARG A C    5  
ATOM 9591  O O    . ARG A 1 2   ? -10.812 8.660   -1.620  1.00 0.00 ? 2   ARG A O    5  
ATOM 9592  C CB   . ARG A 1 2   ? -10.433 6.533   0.746   1.00 0.00 ? 2   ARG A CB   5  
ATOM 9593  C CG   . ARG A 1 2   ? -11.073 7.206   1.996   1.00 0.00 ? 2   ARG A CG   5  
ATOM 9594  C CD   . ARG A 1 2   ? -12.125 6.385   2.779   1.00 0.00 ? 2   ARG A CD   5  
ATOM 9595  N NE   . ARG A 1 2   ? -11.513 5.513   3.825   1.00 0.00 ? 2   ARG A NE   5  
ATOM 9596  C CZ   . ARG A 1 2   ? -12.194 4.726   4.658   1.00 0.00 ? 2   ARG A CZ   5  
ATOM 9597  N NH1  . ARG A 1 2   ? -13.495 4.703   4.750   1.00 0.00 ? 2   ARG A NH1  5  
ATOM 9598  N NH2  . ARG A 1 2   ? -11.535 3.937   5.441   1.00 0.00 ? 2   ARG A NH2  5  
ATOM 9599  H H    . ARG A 1 2   ? -9.403  6.304   -1.843  1.00 0.00 ? 2   ARG A H    5  
ATOM 9600  H HA   . ARG A 1 2   ? -12.121 5.865   -0.465  1.00 0.00 ? 2   ARG A HA   5  
ATOM 9601  H HB2  . ARG A 1 2   ? -10.151 5.501   1.020   1.00 0.00 ? 2   ARG A HB2  5  
ATOM 9602  H HB3  . ARG A 1 2   ? -9.465  7.045   0.562   1.00 0.00 ? 2   ARG A HB3  5  
ATOM 9603  H HG2  . ARG A 1 2   ? -10.264 7.517   2.687   1.00 0.00 ? 2   ARG A HG2  5  
ATOM 9604  H HG3  . ARG A 1 2   ? -11.516 8.176   1.696   1.00 0.00 ? 2   ARG A HG3  5  
ATOM 9605  H HD2  . ARG A 1 2   ? -12.827 7.097   3.261   1.00 0.00 ? 2   ARG A HD2  5  
ATOM 9606  H HD3  . ARG A 1 2   ? -12.742 5.783   2.082   1.00 0.00 ? 2   ARG A HD3  5  
ATOM 9607  H HE   . ARG A 1 2   ? -10.498 5.414   3.919   1.00 0.00 ? 2   ARG A HE   5  
ATOM 9608  H HH11 . ARG A 1 2   ? -13.996 5.419   4.206   1.00 0.00 ? 2   ARG A HH11 5  
ATOM 9609  H HH12 . ARG A 1 2   ? -13.914 4.012   5.379   1.00 0.00 ? 2   ARG A HH12 5  
ATOM 9610  H HH21 . ARG A 1 2   ? -10.501 3.998   5.448   1.00 0.00 ? 2   ARG A HH21 5  
ATOM 9611  H HH22 . ARG A 1 2   ? -12.082 3.292   6.037   1.00 0.00 ? 2   ARG A HH22 5  
ATOM 9612  N N    . PRO A 1 3   ? -12.932 8.414   -0.894  1.00 0.00 ? 3   PRO A N    5  
ATOM 9613  C CA   . PRO A 1 3   ? -13.337 9.799   -1.282  1.00 0.00 ? 3   PRO A CA   5  
ATOM 9614  C C    . PRO A 1 3   ? -12.825 10.893  -0.270  1.00 0.00 ? 3   PRO A C    5  
ATOM 9615  O O    . PRO A 1 3   ? -11.815 10.698  0.419   1.00 0.00 ? 3   PRO A O    5  
ATOM 9616  C CB   . PRO A 1 3   ? -14.870 9.611   -1.398  1.00 0.00 ? 3   PRO A CB   5  
ATOM 9617  C CG   . PRO A 1 3   ? -15.234 8.580   -0.330  1.00 0.00 ? 3   PRO A CG   5  
ATOM 9618  C CD   . PRO A 1 3   ? -14.039 7.627   -0.310  1.00 0.00 ? 3   PRO A CD   5  
ATOM 9619  H HA   . PRO A 1 3   ? -12.924 10.071  -2.272  1.00 0.00 ? 3   PRO A HA   5  
ATOM 9620  H HB2  . PRO A 1 3   ? -15.455 10.544  -1.302  1.00 0.00 ? 3   PRO A HB2  5  
ATOM 9621  H HB3  . PRO A 1 3   ? -15.124 9.203   -2.398  1.00 0.00 ? 3   PRO A HB3  5  
ATOM 9622  H HG2  . PRO A 1 3   ? -15.352 9.071   0.655   1.00 0.00 ? 3   PRO A HG2  5  
ATOM 9623  H HG3  . PRO A 1 3   ? -16.185 8.059   -0.555  1.00 0.00 ? 3   PRO A HG3  5  
ATOM 9624  H HD2  . PRO A 1 3   ? -13.824 7.297   0.721   1.00 0.00 ? 3   PRO A HD2  5  
ATOM 9625  H HD3  . PRO A 1 3   ? -14.243 6.723   -0.915  1.00 0.00 ? 3   PRO A HD3  5  
ATOM 9626  N N    . SER A 1 4   ? -13.439 12.093  -0.207  1.00 0.00 ? 4   SER A N    5  
ATOM 9627  C CA   . SER A 1 4   ? -12.995 13.165  0.740   1.00 0.00 ? 4   SER A CA   5  
ATOM 9628  C C    . SER A 1 4   ? -14.192 14.097  1.121   1.00 0.00 ? 4   SER A C    5  
ATOM 9629  O O    . SER A 1 4   ? -14.902 13.774  2.083   1.00 0.00 ? 4   SER A O    5  
ATOM 9630  C CB   . SER A 1 4   ? -11.754 13.881  0.127   1.00 0.00 ? 4   SER A CB   5  
ATOM 9631  O OG   . SER A 1 4   ? -10.622 13.009  0.135   1.00 0.00 ? 4   SER A OG   5  
ATOM 9632  H H    . SER A 1 4   ? -14.265 12.181  -0.808  1.00 0.00 ? 4   SER A H    5  
ATOM 9633  H HA   . SER A 1 4   ? -12.679 12.716  1.703   1.00 0.00 ? 4   SER A HA   5  
ATOM 9634  H HB2  . SER A 1 4   ? -11.949 14.230  -0.906  1.00 0.00 ? 4   SER A HB2  5  
ATOM 9635  H HB3  . SER A 1 4   ? -11.499 14.788  0.707   1.00 0.00 ? 4   SER A HB3  5  
ATOM 9636  H HG   . SER A 1 4   ? -10.972 12.098  0.161   1.00 0.00 ? 4   SER A HG   5  
ATOM 9637  N N    . GLY A 1 5   ? -14.432 15.224  0.417   1.00 0.00 ? 5   GLY A N    5  
ATOM 9638  C CA   . GLY A 1 5   ? -15.537 16.165  0.751   1.00 0.00 ? 5   GLY A CA   5  
ATOM 9639  C C    . GLY A 1 5   ? -15.240 17.187  1.880   1.00 0.00 ? 5   GLY A C    5  
ATOM 9640  O O    . GLY A 1 5   ? -14.498 16.904  2.827   1.00 0.00 ? 5   GLY A O    5  
ATOM 9641  H H    . GLY A 1 5   ? -13.774 15.391  -0.353  1.00 0.00 ? 5   GLY A H    5  
ATOM 9642  H HA2  . GLY A 1 5   ? -15.810 16.704  -0.176  1.00 0.00 ? 5   GLY A HA2  5  
ATOM 9643  H HA3  . GLY A 1 5   ? -16.450 15.605  1.027   1.00 0.00 ? 5   GLY A HA3  5  
ATOM 9644  N N    . ARG A 1 6   ? -15.870 18.373  1.805   1.00 0.00 ? 6   ARG A N    5  
ATOM 9645  C CA   . ARG A 1 6   ? -15.692 19.447  2.830   1.00 0.00 ? 6   ARG A CA   5  
ATOM 9646  C C    . ARG A 1 6   ? -16.626 19.193  4.069   1.00 0.00 ? 6   ARG A C    5  
ATOM 9647  O O    . ARG A 1 6   ? -17.723 19.745  4.197   1.00 0.00 ? 6   ARG A O    5  
ATOM 9648  C CB   . ARG A 1 6   ? -15.933 20.804  2.106   1.00 0.00 ? 6   ARG A CB   5  
ATOM 9649  C CG   . ARG A 1 6   ? -15.682 22.055  2.986   1.00 0.00 ? 6   ARG A CG   5  
ATOM 9650  C CD   . ARG A 1 6   ? -15.790 23.380  2.206   1.00 0.00 ? 6   ARG A CD   5  
ATOM 9651  N NE   . ARG A 1 6   ? -15.693 24.549  3.128   1.00 0.00 ? 6   ARG A NE   5  
ATOM 9652  C CZ   . ARG A 1 6   ? -14.564 25.129  3.544   1.00 0.00 ? 6   ARG A CZ   5  
ATOM 9653  N NH1  . ARG A 1 6   ? -13.369 24.742  3.172   1.00 0.00 ? 6   ARG A NH1  5  
ATOM 9654  N NH2  . ARG A 1 6   ? -14.655 26.129  4.373   1.00 0.00 ? 6   ARG A NH2  5  
ATOM 9655  H H    . ARG A 1 6   ? -16.465 18.498  0.980   1.00 0.00 ? 6   ARG A H    5  
ATOM 9656  H HA   . ARG A 1 6   ? -14.643 19.455  3.194   1.00 0.00 ? 6   ARG A HA   5  
ATOM 9657  H HB2  . ARG A 1 6   ? -15.271 20.859  1.218   1.00 0.00 ? 6   ARG A HB2  5  
ATOM 9658  H HB3  . ARG A 1 6   ? -16.966 20.840  1.704   1.00 0.00 ? 6   ARG A HB3  5  
ATOM 9659  H HG2  . ARG A 1 6   ? -16.412 22.060  3.821   1.00 0.00 ? 6   ARG A HG2  5  
ATOM 9660  H HG3  . ARG A 1 6   ? -14.690 21.982  3.472   1.00 0.00 ? 6   ARG A HG3  5  
ATOM 9661  H HD2  . ARG A 1 6   ? -15.049 23.430  1.381   1.00 0.00 ? 6   ARG A HD2  5  
ATOM 9662  H HD3  . ARG A 1 6   ? -16.770 23.420  1.687   1.00 0.00 ? 6   ARG A HD3  5  
ATOM 9663  H HE   . ARG A 1 6   ? -16.541 24.964  3.526   1.00 0.00 ? 6   ARG A HE   5  
ATOM 9664  H HH11 . ARG A 1 6   ? -13.374 23.945  2.533   1.00 0.00 ? 6   ARG A HH11 5  
ATOM 9665  H HH12 . ARG A 1 6   ? -12.554 25.231  3.545   1.00 0.00 ? 6   ARG A HH12 5  
ATOM 9666  H HH21 . ARG A 1 6   ? -15.595 26.412  4.656   1.00 0.00 ? 6   ARG A HH21 5  
ATOM 9667  H HH22 . ARG A 1 6   ? -13.781 26.554  4.689   1.00 0.00 ? 6   ARG A HH22 5  
ATOM 9668  N N    . LYS A 1 7   ? -16.135 18.355  4.993   1.00 0.00 ? 7   LYS A N    5  
ATOM 9669  C CA   . LYS A 1 7   ? -16.859 17.943  6.230   1.00 0.00 ? 7   LYS A CA   5  
ATOM 9670  C C    . LYS A 1 7   ? -15.859 17.664  7.408   1.00 0.00 ? 7   LYS A C    5  
ATOM 9671  O O    . LYS A 1 7   ? -14.645 17.525  7.213   1.00 0.00 ? 7   LYS A O    5  
ATOM 9672  C CB   . LYS A 1 7   ? -17.737 16.685  5.909   1.00 0.00 ? 7   LYS A CB   5  
ATOM 9673  C CG   . LYS A 1 7   ? -17.030 15.458  5.272   1.00 0.00 ? 7   LYS A CG   5  
ATOM 9674  C CD   . LYS A 1 7   ? -17.808 14.129  5.422   1.00 0.00 ? 7   LYS A CD   5  
ATOM 9675  C CE   . LYS A 1 7   ? -17.423 13.004  4.437   1.00 0.00 ? 7   LYS A CE   5  
ATOM 9676  N NZ   . LYS A 1 7   ? -15.967 12.680  4.459   1.00 0.00 ? 7   LYS A NZ   5  
ATOM 9677  H H    . LYS A 1 7   ? -15.221 17.952  4.748   1.00 0.00 ? 7   LYS A H    5  
ATOM 9678  H HA   . LYS A 1 7   ? -17.522 18.768  6.564   1.00 0.00 ? 7   LYS A HA   5  
ATOM 9679  H HB2  . LYS A 1 7   ? -18.252 16.373  6.838   1.00 0.00 ? 7   LYS A HB2  5  
ATOM 9680  H HB3  . LYS A 1 7   ? -18.563 16.998  5.241   1.00 0.00 ? 7   LYS A HB3  5  
ATOM 9681  H HG2  . LYS A 1 7   ? -16.839 15.679  4.203   1.00 0.00 ? 7   LYS A HG2  5  
ATOM 9682  H HG3  . LYS A 1 7   ? -16.023 15.338  5.717   1.00 0.00 ? 7   LYS A HG3  5  
ATOM 9683  H HD2  . LYS A 1 7   ? -17.713 13.770  6.467   1.00 0.00 ? 7   LYS A HD2  5  
ATOM 9684  H HD3  . LYS A 1 7   ? -18.892 14.327  5.299   1.00 0.00 ? 7   LYS A HD3  5  
ATOM 9685  H HE2  . LYS A 1 7   ? -18.026 12.099  4.673   1.00 0.00 ? 7   LYS A HE2  5  
ATOM 9686  H HE3  . LYS A 1 7   ? -17.740 13.283  3.407   1.00 0.00 ? 7   LYS A HE3  5  
ATOM 9687  H HZ1  . LYS A 1 7   ? -15.495 13.006  5.326   1.00 0.00 ? 7   LYS A HZ1  5  
ATOM 9688  H HZ2  . LYS A 1 7   ? -15.749 11.679  4.373   1.00 0.00 ? 7   LYS A HZ2  5  
ATOM 9689  H HZ3  . LYS A 1 7   ? -15.459 13.145  3.679   1.00 0.00 ? 7   LYS A HZ3  5  
ATOM 9690  N N    . SER A 1 8   ? -16.380 17.537  8.647   1.00 0.00 ? 8   SER A N    5  
ATOM 9691  C CA   . SER A 1 8   ? -15.547 17.234  9.852   1.00 0.00 ? 8   SER A CA   5  
ATOM 9692  C C    . SER A 1 8   ? -15.119 15.722  9.941   1.00 0.00 ? 8   SER A C    5  
ATOM 9693  O O    . SER A 1 8   ? -15.570 14.960  10.803  1.00 0.00 ? 8   SER A O    5  
ATOM 9694  C CB   . SER A 1 8   ? -16.378 17.698  11.074  1.00 0.00 ? 8   SER A CB   5  
ATOM 9695  O OG   . SER A 1 8   ? -15.678 17.426  12.288  1.00 0.00 ? 8   SER A OG   5  
ATOM 9696  H H    . SER A 1 8   ? -17.394 17.673  8.712   1.00 0.00 ? 8   SER A H    5  
ATOM 9697  H HA   . SER A 1 8   ? -14.616 17.836  9.840   1.00 0.00 ? 8   SER A HA   5  
ATOM 9698  H HB2  . SER A 1 8   ? -16.586 18.785  11.016  1.00 0.00 ? 8   SER A HB2  5  
ATOM 9699  H HB3  . SER A 1 8   ? -17.367 17.199  11.107  1.00 0.00 ? 8   SER A HB3  5  
ATOM 9700  H HG   . SER A 1 8   ? -15.554 16.468  12.320  1.00 0.00 ? 8   SER A HG   5  
ATOM 9701  N N    . SER A 1 9   ? -14.182 15.331  9.064   1.00 0.00 ? 9   SER A N    5  
ATOM 9702  C CA   . SER A 1 9   ? -13.642 13.949  8.971   1.00 0.00 ? 9   SER A CA   5  
ATOM 9703  C C    . SER A 1 9   ? -12.172 14.007  8.460   1.00 0.00 ? 9   SER A C    5  
ATOM 9704  O O    . SER A 1 9   ? -11.926 14.597  7.399   1.00 0.00 ? 9   SER A O    5  
ATOM 9705  C CB   . SER A 1 9   ? -14.504 13.111  7.987   1.00 0.00 ? 9   SER A CB   5  
ATOM 9706  O OG   . SER A 1 9   ? -14.383 13.577  6.637   1.00 0.00 ? 9   SER A OG   5  
ATOM 9707  H H    . SER A 1 9   ? -13.923 16.072  8.396   1.00 0.00 ? 9   SER A H    5  
ATOM 9708  H HA   . SER A 1 9   ? -13.670 13.466  9.969   1.00 0.00 ? 9   SER A HA   5  
ATOM 9709  H HB2  . SER A 1 9   ? -14.192 12.049  8.035   1.00 0.00 ? 9   SER A HB2  5  
ATOM 9710  H HB3  . SER A 1 9   ? -15.567 13.118  8.300   1.00 0.00 ? 9   SER A HB3  5  
ATOM 9711  H HG   . SER A 1 9   ? -13.524 14.034  6.600   1.00 0.00 ? 9   SER A HG   5  
ATOM 9712  N N    . LYS A 1 10  ? -11.210 13.370  9.153   1.00 0.00 ? 10  LYS A N    5  
ATOM 9713  C CA   . LYS A 1 10  ? -9.785  13.375  8.708   1.00 0.00 ? 10  LYS A CA   5  
ATOM 9714  C C    . LYS A 1 10  ? -9.566  12.507  7.418   1.00 0.00 ? 10  LYS A C    5  
ATOM 9715  O O    . LYS A 1 10  ? -10.079 11.388  7.305   1.00 0.00 ? 10  LYS A O    5  
ATOM 9716  C CB   . LYS A 1 10  ? -8.894  12.841  9.870   1.00 0.00 ? 10  LYS A CB   5  
ATOM 9717  C CG   . LYS A 1 10  ? -7.393  13.218  9.729   1.00 0.00 ? 10  LYS A CG   5  
ATOM 9718  C CD   . LYS A 1 10  ? -6.401  12.387  10.574  1.00 0.00 ? 10  LYS A CD   5  
ATOM 9719  C CE   . LYS A 1 10  ? -6.217  10.954  10.038  1.00 0.00 ? 10  LYS A CE   5  
ATOM 9720  N NZ   . LYS A 1 10  ? -4.943  10.336  10.486  1.00 0.00 ? 10  LYS A NZ   5  
ATOM 9721  H H    . LYS A 1 10  ? -11.515 12.902  10.012  1.00 0.00 ? 10  LYS A H    5  
ATOM 9722  H HA   . LYS A 1 10  ? -9.496  14.425  8.492   1.00 0.00 ? 10  LYS A HA   5  
ATOM 9723  H HB2  . LYS A 1 10  ? -9.247  13.228  10.846  1.00 0.00 ? 10  LYS A HB2  5  
ATOM 9724  H HB3  . LYS A 1 10  ? -9.016  11.742  9.945   1.00 0.00 ? 10  LYS A HB3  5  
ATOM 9725  H HG2  . LYS A 1 10  ? -7.069  13.159  8.669   1.00 0.00 ? 10  LYS A HG2  5  
ATOM 9726  H HG3  . LYS A 1 10  ? -7.273  14.289  9.984   1.00 0.00 ? 10  LYS A HG3  5  
ATOM 9727  H HD2  . LYS A 1 10  ? -5.426  12.917  10.558  1.00 0.00 ? 10  LYS A HD2  5  
ATOM 9728  H HD3  . LYS A 1 10  ? -6.702  12.376  11.640  1.00 0.00 ? 10  LYS A HD3  5  
ATOM 9729  H HE2  . LYS A 1 10  ? -7.080  10.306  10.297  1.00 0.00 ? 10  LYS A HE2  5  
ATOM 9730  H HE3  . LYS A 1 10  ? -6.219  10.959  8.924   1.00 0.00 ? 10  LYS A HE3  5  
ATOM 9731  H HZ1  . LYS A 1 10  ? -4.083  10.889  10.289  1.00 0.00 ? 10  LYS A HZ1  5  
ATOM 9732  H HZ2  . LYS A 1 10  ? -4.885  10.061  11.470  1.00 0.00 ? 10  LYS A HZ2  5  
ATOM 9733  H HZ3  . LYS A 1 10  ? -4.793  9.445   9.931   1.00 0.00 ? 10  LYS A HZ3  5  
ATOM 9734  N N    . MET A 1 11  ? -8.778  13.027  6.459   1.00 0.00 ? 11  MET A N    5  
ATOM 9735  C CA   . MET A 1 11  ? -8.414  12.285  5.215   1.00 0.00 ? 11  MET A CA   5  
ATOM 9736  C C    . MET A 1 11  ? -7.514  11.043  5.548   1.00 0.00 ? 11  MET A C    5  
ATOM 9737  O O    . MET A 1 11  ? -6.763  11.066  6.530   1.00 0.00 ? 11  MET A O    5  
ATOM 9738  C CB   . MET A 1 11  ? -7.684  13.259  4.245   1.00 0.00 ? 11  MET A CB   5  
ATOM 9739  C CG   . MET A 1 11  ? -8.457  14.528  3.815   1.00 0.00 ? 11  MET A CG   5  
ATOM 9740  S SD   . MET A 1 11  ? -10.114 14.104  3.236   1.00 0.00 ? 11  MET A SD   5  
ATOM 9741  C CE   . MET A 1 11  ? -10.936 15.696  3.432   1.00 0.00 ? 11  MET A CE   5  
ATOM 9742  H H    . MET A 1 11  ? -8.400  13.960  6.644   1.00 0.00 ? 11  MET A H    5  
ATOM 9743  H HA   . MET A 1 11  ? -9.343  11.923  4.730   1.00 0.00 ? 11  MET A HA   5  
ATOM 9744  H HB2  . MET A 1 11  ? -6.710  13.562  4.681   1.00 0.00 ? 11  MET A HB2  5  
ATOM 9745  H HB3  . MET A 1 11  ? -7.412  12.705  3.326   1.00 0.00 ? 11  MET A HB3  5  
ATOM 9746  H HG2  . MET A 1 11  ? -8.532  15.239  4.659   1.00 0.00 ? 11  MET A HG2  5  
ATOM 9747  H HG3  . MET A 1 11  ? -7.917  15.065  3.013   1.00 0.00 ? 11  MET A HG3  5  
ATOM 9748  H HE1  . MET A 1 11  ? -10.788 16.094  4.453   1.00 0.00 ? 11  MET A HE1  5  
ATOM 9749  H HE2  . MET A 1 11  ? -10.539 16.433  2.711   1.00 0.00 ? 11  MET A HE2  5  
ATOM 9750  H HE3  . MET A 1 11  ? -12.023 15.598  3.261   1.00 0.00 ? 11  MET A HE3  5  
ATOM 9751  N N    . GLN A 1 12  ? -7.625  9.943   4.779   1.00 0.00 ? 12  GLN A N    5  
ATOM 9752  C CA   . GLN A 1 12  ? -6.853  8.707   5.074   1.00 0.00 ? 12  GLN A CA   5  
ATOM 9753  C C    . GLN A 1 12  ? -5.932  8.329   3.882   1.00 0.00 ? 12  GLN A C    5  
ATOM 9754  O O    . GLN A 1 12  ? -6.232  7.449   3.071   1.00 0.00 ? 12  GLN A O    5  
ATOM 9755  C CB   . GLN A 1 12  ? -7.897  7.627   5.468   1.00 0.00 ? 12  GLN A CB   5  
ATOM 9756  C CG   . GLN A 1 12  ? -7.279  6.290   5.950   1.00 0.00 ? 12  GLN A CG   5  
ATOM 9757  C CD   . GLN A 1 12  ? -8.282  5.351   6.610   1.00 0.00 ? 12  GLN A CD   5  
ATOM 9758  O OE1  . GLN A 1 12  ? -8.918  4.534   5.956   1.00 0.00 ? 12  GLN A OE1  5  
ATOM 9759  N NE2  . GLN A 1 12  ? -8.463  5.423   7.906   1.00 0.00 ? 12  GLN A NE2  5  
ATOM 9760  H H    . GLN A 1 12  ? -8.241  9.990   3.962   1.00 0.00 ? 12  GLN A H    5  
ATOM 9761  H HA   . GLN A 1 12  ? -6.187  8.834   5.956   1.00 0.00 ? 12  GLN A HA   5  
ATOM 9762  H HB2  . GLN A 1 12  ? -8.522  8.036   6.289   1.00 0.00 ? 12  GLN A HB2  5  
ATOM 9763  H HB3  . GLN A 1 12  ? -8.594  7.436   4.631   1.00 0.00 ? 12  GLN A HB3  5  
ATOM 9764  H HG2  . GLN A 1 12  ? -6.816  5.760   5.100   1.00 0.00 ? 12  GLN A HG2  5  
ATOM 9765  H HG3  . GLN A 1 12  ? -6.439  6.482   6.638   1.00 0.00 ? 12  GLN A HG3  5  
ATOM 9766  H HE21 . GLN A 1 12  ? -7.761  5.989   8.436   1.00 0.00 ? 12  GLN A HE21 5  
ATOM 9767  H HE22 . GLN A 1 12  ? -9.124  4.747   8.293   1.00 0.00 ? 12  GLN A HE22 5  
ATOM 9768  N N    . ALA A 1 13  ? -4.783  9.008   3.818   1.00 0.00 ? 13  ALA A N    5  
ATOM 9769  C CA   . ALA A 1 13  ? -3.698  8.717   2.864   1.00 0.00 ? 13  ALA A CA   5  
ATOM 9770  C C    . ALA A 1 13  ? -2.519  8.189   3.742   1.00 0.00 ? 13  ALA A C    5  
ATOM 9771  O O    . ALA A 1 13  ? -1.999  8.847   4.652   1.00 0.00 ? 13  ALA A O    5  
ATOM 9772  C CB   . ALA A 1 13  ? -3.419  9.992   2.055   1.00 0.00 ? 13  ALA A CB   5  
ATOM 9773  H H    . ALA A 1 13  ? -4.640  9.752   4.536   1.00 0.00 ? 13  ALA A H    5  
ATOM 9774  H HA   . ALA A 1 13  ? -4.000  7.927   2.149   1.00 0.00 ? 13  ALA A HA   5  
ATOM 9775  H HB1  . ALA A 1 13  ? -3.183  10.853  2.706   1.00 0.00 ? 13  ALA A HB1  5  
ATOM 9776  H HB2  . ALA A 1 13  ? -2.584  9.845   1.346   1.00 0.00 ? 13  ALA A HB2  5  
ATOM 9777  H HB3  . ALA A 1 13  ? -4.301  10.280  1.453   1.00 0.00 ? 13  ALA A HB3  5  
ATOM 9778  N N    . PHE A 1 14  ? -2.154  6.934   3.495   1.00 0.00 ? 14  PHE A N    5  
ATOM 9779  C CA   . PHE A 1 14  ? -1.170  6.191   4.304   1.00 0.00 ? 14  PHE A CA   5  
ATOM 9780  C C    . PHE A 1 14  ? 0.311   6.324   3.790   1.00 0.00 ? 14  PHE A C    5  
ATOM 9781  O O    . PHE A 1 14  ? 0.613   6.595   2.613   1.00 0.00 ? 14  PHE A O    5  
ATOM 9782  C CB   . PHE A 1 14  ? -1.761  4.746   4.284   1.00 0.00 ? 14  PHE A CB   5  
ATOM 9783  C CG   . PHE A 1 14  ? -1.329  3.845   5.432   1.00 0.00 ? 14  PHE A CG   5  
ATOM 9784  C CD1  . PHE A 1 14  ? -2.075  3.823   6.613   1.00 0.00 ? 14  PHE A CD1  5  
ATOM 9785  C CD2  . PHE A 1 14  ? -0.229  2.999   5.296   1.00 0.00 ? 14  PHE A CD2  5  
ATOM 9786  C CE1  . PHE A 1 14  ? -1.691  3.003   7.667   1.00 0.00 ? 14  PHE A CE1  5  
ATOM 9787  C CE2  . PHE A 1 14  ? 0.136   2.156   6.342   1.00 0.00 ? 14  PHE A CE2  5  
ATOM 9788  C CZ   . PHE A 1 14  ? -0.571  2.192   7.538   1.00 0.00 ? 14  PHE A CZ   5  
ATOM 9789  H H    . PHE A 1 14  ? -2.626  6.504   2.689   1.00 0.00 ? 14  PHE A H    5  
ATOM 9790  H HA   . PHE A 1 14  ? -1.200  6.570   5.349   1.00 0.00 ? 14  PHE A HA   5  
ATOM 9791  H HB2  . PHE A 1 14  ? -2.872  4.758   4.311   1.00 0.00 ? 14  PHE A HB2  5  
ATOM 9792  H HB3  . PHE A 1 14  ? -1.561  4.245   3.324   1.00 0.00 ? 14  PHE A HB3  5  
ATOM 9793  H HD1  . PHE A 1 14  ? -2.953  4.443   6.705   1.00 0.00 ? 14  PHE A HD1  5  
ATOM 9794  H HD2  . PHE A 1 14  ? 0.323   2.997   4.369   1.00 0.00 ? 14  PHE A HD2  5  
ATOM 9795  H HE1  . PHE A 1 14  ? -2.252  3.010   8.588   1.00 0.00 ? 14  PHE A HE1  5  
ATOM 9796  H HE2  . PHE A 1 14  ? 0.948   1.462   6.221   1.00 0.00 ? 14  PHE A HE2  5  
ATOM 9797  H HZ   . PHE A 1 14  ? -0.240  1.618   8.383   1.00 0.00 ? 14  PHE A HZ   5  
ATOM 9798  N N    . ARG A 1 15  ? 1.236   6.122   4.745   1.00 0.00 ? 15  ARG A N    5  
ATOM 9799  C CA   . ARG A 1 15  ? 2.704   6.153   4.519   1.00 0.00 ? 15  ARG A CA   5  
ATOM 9800  C C    . ARG A 1 15  ? 3.385   5.039   5.391   1.00 0.00 ? 15  ARG A C    5  
ATOM 9801  O O    . ARG A 1 15  ? 2.995   4.799   6.539   1.00 0.00 ? 15  ARG A O    5  
ATOM 9802  C CB   . ARG A 1 15  ? 3.245   7.579   4.871   1.00 0.00 ? 15  ARG A CB   5  
ATOM 9803  C CG   . ARG A 1 15  ? 4.424   8.078   3.997   1.00 0.00 ? 15  ARG A CG   5  
ATOM 9804  C CD   . ARG A 1 15  ? 3.953   8.504   2.584   1.00 0.00 ? 15  ARG A CD   5  
ATOM 9805  N NE   . ARG A 1 15  ? 5.025   8.707   1.567   1.00 0.00 ? 15  ARG A NE   5  
ATOM 9806  C CZ   . ARG A 1 15  ? 5.700   7.736   0.955   1.00 0.00 ? 15  ARG A CZ   5  
ATOM 9807  N NH1  . ARG A 1 15  ? 5.628   6.484   1.312   1.00 0.00 ? 15  ARG A NH1  5  
ATOM 9808  N NH2  . ARG A 1 15  ? 6.462   8.040   -0.053  1.00 0.00 ? 15  ARG A NH2  5  
ATOM 9809  H H    . ARG A 1 15  ? 0.858   5.930   5.685   1.00 0.00 ? 15  ARG A H    5  
ATOM 9810  H HA   . ARG A 1 15  ? 2.898   5.922   3.453   1.00 0.00 ? 15  ARG A HA   5  
ATOM 9811  H HB2  . ARG A 1 15  ? 2.437   8.337   4.818   1.00 0.00 ? 15  ARG A HB2  5  
ATOM 9812  H HB3  . ARG A 1 15  ? 3.541   7.611   5.938   1.00 0.00 ? 15  ARG A HB3  5  
ATOM 9813  H HG2  . ARG A 1 15  ? 4.901   8.950   4.490   1.00 0.00 ? 15  ARG A HG2  5  
ATOM 9814  H HG3  . ARG A 1 15  ? 5.229   7.318   3.972   1.00 0.00 ? 15  ARG A HG3  5  
ATOM 9815  H HD2  . ARG A 1 15  ? 3.195   7.800   2.185   1.00 0.00 ? 15  ARG A HD2  5  
ATOM 9816  H HD3  . ARG A 1 15  ? 3.399   9.457   2.692   1.00 0.00 ? 15  ARG A HD3  5  
ATOM 9817  H HE   . ARG A 1 15  ? 5.130   9.606   1.070   1.00 0.00 ? 15  ARG A HE   5  
ATOM 9818  H HH11 . ARG A 1 15  ? 5.003   6.328   2.100   1.00 0.00 ? 15  ARG A HH11 5  
ATOM 9819  H HH12 . ARG A 1 15  ? 6.152   5.785   0.749   1.00 0.00 ? 15  ARG A HH12 5  
ATOM 9820  H HH21 . ARG A 1 15  ? 6.427   9.016   -0.376  1.00 0.00 ? 15  ARG A HH21 5  
ATOM 9821  H HH22 . ARG A 1 15  ? 6.961   7.263   -0.489  1.00 0.00 ? 15  ARG A HH22 5  
ATOM 9822  N N    . ILE A 1 16  ? 4.411   4.357   4.851   1.00 0.00 ? 16  ILE A N    5  
ATOM 9823  C CA   . ILE A 1 16  ? 5.147   3.274   5.579   1.00 0.00 ? 16  ILE A CA   5  
ATOM 9824  C C    . ILE A 1 16  ? 6.690   3.509   5.391   1.00 0.00 ? 16  ILE A C    5  
ATOM 9825  O O    . ILE A 1 16  ? 7.193   3.751   4.283   1.00 0.00 ? 16  ILE A O    5  
ATOM 9826  C CB   . ILE A 1 16  ? 4.780   1.791   5.142   1.00 0.00 ? 16  ILE A CB   5  
ATOM 9827  C CG1  . ILE A 1 16  ? 4.194   1.561   3.712   1.00 0.00 ? 16  ILE A CG1  5  
ATOM 9828  C CG2  . ILE A 1 16  ? 3.840   1.179   6.206   1.00 0.00 ? 16  ILE A CG2  5  
ATOM 9829  C CD1  . ILE A 1 16  ? 2.751   1.961   3.348   1.00 0.00 ? 16  ILE A CD1  5  
ATOM 9830  H H    . ILE A 1 16  ? 4.667   4.610   3.894   1.00 0.00 ? 16  ILE A H    5  
ATOM 9831  H HA   . ILE A 1 16  ? 4.921   3.371   6.666   1.00 0.00 ? 16  ILE A HA   5  
ATOM 9832  H HB   . ILE A 1 16  ? 5.699   1.171   5.153   1.00 0.00 ? 16  ILE A HB   5  
ATOM 9833  H HG12 . ILE A 1 16  ? 4.856   2.071   3.003   1.00 0.00 ? 16  ILE A HG12 5  
ATOM 9834  H HG13 . ILE A 1 16  ? 4.308   0.488   3.463   1.00 0.00 ? 16  ILE A HG13 5  
ATOM 9835  H HG21 . ILE A 1 16  ? 2.993   1.850   6.420   1.00 0.00 ? 16  ILE A HG21 5  
ATOM 9836  H HG22 . ILE A 1 16  ? 3.437   0.194   5.907   1.00 0.00 ? 16  ILE A HG22 5  
ATOM 9837  H HG23 . ILE A 1 16  ? 4.367   1.021   7.166   1.00 0.00 ? 16  ILE A HG23 5  
ATOM 9838  H HD11 . ILE A 1 16  ? 2.012   1.445   3.979   1.00 0.00 ? 16  ILE A HD11 5  
ATOM 9839  H HD12 . ILE A 1 16  ? 2.566   3.044   3.439   1.00 0.00 ? 16  ILE A HD12 5  
ATOM 9840  H HD13 . ILE A 1 16  ? 2.521   1.690   2.300   1.00 0.00 ? 16  ILE A HD13 5  
ATOM 9841  N N    . TRP A 1 17  ? 7.424   3.415   6.514   1.00 0.00 ? 17  TRP A N    5  
ATOM 9842  C CA   . TRP A 1 17  ? 8.913   3.580   6.564   1.00 0.00 ? 17  TRP A CA   5  
ATOM 9843  C C    . TRP A 1 17  ? 9.608   2.242   7.018   1.00 0.00 ? 17  TRP A C    5  
ATOM 9844  O O    . TRP A 1 17  ? 8.940   1.247   7.313   1.00 0.00 ? 17  TRP A O    5  
ATOM 9845  C CB   . TRP A 1 17  ? 9.250   4.754   7.540   1.00 0.00 ? 17  TRP A CB   5  
ATOM 9846  C CG   . TRP A 1 17  ? 8.722   6.164   7.226   1.00 0.00 ? 17  TRP A CG   5  
ATOM 9847  C CD1  . TRP A 1 17  ? 7.390   6.587   7.439   1.00 0.00 ? 17  TRP A CD1  5  
ATOM 9848  C CD2  . TRP A 1 17  ? 9.430   7.319   6.922   1.00 0.00 ? 17  TRP A CD2  5  
ATOM 9849  N NE1  . TRP A 1 17  ? 7.240   7.969   7.246   1.00 0.00 ? 17  TRP A NE1  5  
ATOM 9850  C CE2  . TRP A 1 17  ? 8.519   8.407   6.952   1.00 0.00 ? 17  TRP A CE2  5  
ATOM 9851  C CE3  . TRP A 1 17  ? 10.810  7.548   6.670   1.00 0.00 ? 17  TRP A CE3  5  
ATOM 9852  C CZ2  . TRP A 1 17  ? 8.981   9.727   6.752   1.00 0.00 ? 17  TRP A CZ2  5  
ATOM 9853  C CZ3  . TRP A 1 17  ? 11.241  8.861   6.469   1.00 0.00 ? 17  TRP A CZ3  5  
ATOM 9854  C CH2  . TRP A 1 17  ? 10.342  9.934   6.514   1.00 0.00 ? 17  TRP A CH2  5  
ATOM 9855  H H    . TRP A 1 17  ? 6.879   3.208   7.363   1.00 0.00 ? 17  TRP A H    5  
ATOM 9856  H HA   . TRP A 1 17  ? 9.316   3.826   5.569   1.00 0.00 ? 17  TRP A HA   5  
ATOM 9857  H HB2  . TRP A 1 17  ? 8.915   4.497   8.559   1.00 0.00 ? 17  TRP A HB2  5  
ATOM 9858  H HB3  . TRP A 1 17  ? 10.349  4.826   7.643   1.00 0.00 ? 17  TRP A HB3  5  
ATOM 9859  H HD1  . TRP A 1 17  ? 6.594   5.939   7.781   1.00 0.00 ? 17  TRP A HD1  5  
ATOM 9860  H HE1  . TRP A 1 17  ? 6.391   8.534   7.426   1.00 0.00 ? 17  TRP A HE1  5  
ATOM 9861  H HE3  . TRP A 1 17  ? 11.505  6.730   6.545   1.00 0.00 ? 17  TRP A HE3  5  
ATOM 9862  H HZ2  . TRP A 1 17  ? 8.294   10.560  6.791   1.00 0.00 ? 17  TRP A HZ2  5  
ATOM 9863  H HZ3  . TRP A 1 17  ? 12.284  9.051   6.255   1.00 0.00 ? 17  TRP A HZ3  5  
ATOM 9864  H HH2  . TRP A 1 17  ? 10.706  10.939  6.354   1.00 0.00 ? 17  TRP A HH2  5  
ATOM 9865  N N    . ASP A 1 18  ? 10.953  2.186   7.097   1.00 0.00 ? 18  ASP A N    5  
ATOM 9866  C CA   . ASP A 1 18  ? 11.687  0.980   7.588   1.00 0.00 ? 18  ASP A CA   5  
ATOM 9867  C C    . ASP A 1 18  ? 13.132  1.355   8.093   1.00 0.00 ? 18  ASP A C    5  
ATOM 9868  O O    . ASP A 1 18  ? 13.695  2.418   7.786   1.00 0.00 ? 18  ASP A O    5  
ATOM 9869  C CB   . ASP A 1 18  ? 11.679  -0.143  6.502   1.00 0.00 ? 18  ASP A CB   5  
ATOM 9870  C CG   . ASP A 1 18  ? 12.485  0.070   5.227   1.00 0.00 ? 18  ASP A CG   5  
ATOM 9871  O OD1  . ASP A 1 18  ? 11.959  0.622   4.237   1.00 0.00 ? 18  ASP A OD1  5  
ATOM 9872  O OD2  . ASP A 1 18  ? 13.670  -0.323  5.215   1.00 0.00 ? 18  ASP A OD2  5  
ATOM 9873  H H    . ASP A 1 18  ? 11.458  3.038   6.805   1.00 0.00 ? 18  ASP A H    5  
ATOM 9874  H HA   . ASP A 1 18  ? 11.146  0.594   8.477   1.00 0.00 ? 18  ASP A HA   5  
ATOM 9875  H HB2  . ASP A 1 18  ? 12.037  -1.081  6.961   1.00 0.00 ? 18  ASP A HB2  5  
ATOM 9876  H HB3  . ASP A 1 18  ? 10.641  -0.379  6.207   1.00 0.00 ? 18  ASP A HB3  5  
ATOM 9877  N N    . VAL A 1 19  ? 13.692  0.457   8.942   1.00 0.00 ? 19  VAL A N    5  
ATOM 9878  C CA   . VAL A 1 19  ? 15.057  0.544   9.567   1.00 0.00 ? 19  VAL A CA   5  
ATOM 9879  C C    . VAL A 1 19  ? 15.098  1.804   10.506  1.00 0.00 ? 19  VAL A C    5  
ATOM 9880  O O    . VAL A 1 19  ? 14.770  1.707   11.692  1.00 0.00 ? 19  VAL A O    5  
ATOM 9881  C CB   . VAL A 1 19  ? 16.203  0.385   8.486   1.00 0.00 ? 19  VAL A CB   5  
ATOM 9882  C CG1  . VAL A 1 19  ? 17.624  0.446   9.100   1.00 0.00 ? 19  VAL A CG1  5  
ATOM 9883  C CG2  . VAL A 1 19  ? 16.126  -0.951  7.706   1.00 0.00 ? 19  VAL A CG2  5  
ATOM 9884  H H    . VAL A 1 19  ? 13.109  -0.364  9.087   1.00 0.00 ? 19  VAL A H    5  
ATOM 9885  H HA   . VAL A 1 19  ? 15.156  -0.307  10.268  1.00 0.00 ? 19  VAL A HA   5  
ATOM 9886  H HB   . VAL A 1 19  ? 16.110  1.205   7.748   1.00 0.00 ? 19  VAL A HB   5  
ATOM 9887  H HG11 . VAL A 1 19  ? 17.820  1.396   9.630   1.00 0.00 ? 19  VAL A HG11 5  
ATOM 9888  H HG12 . VAL A 1 19  ? 17.793  -0.362  9.838   1.00 0.00 ? 19  VAL A HG12 5  
ATOM 9889  H HG13 . VAL A 1 19  ? 18.416  0.356   8.334   1.00 0.00 ? 19  VAL A HG13 5  
ATOM 9890  H HG21 . VAL A 1 19  ? 16.180  -1.831  8.374   1.00 0.00 ? 19  VAL A HG21 5  
ATOM 9891  H HG22 . VAL A 1 19  ? 15.178  -1.037  7.140   1.00 0.00 ? 19  VAL A HG22 5  
ATOM 9892  H HG23 . VAL A 1 19  ? 16.936  -1.056  6.961   1.00 0.00 ? 19  VAL A HG23 5  
ATOM 9893  N N    . ASN A 1 20  ? 15.580  2.936   9.990   1.00 0.00 ? 20  ASN A N    5  
ATOM 9894  C CA   . ASN A 1 20  ? 15.613  4.248   10.712  1.00 0.00 ? 20  ASN A CA   5  
ATOM 9895  C C    . ASN A 1 20  ? 15.338  5.478   9.768   1.00 0.00 ? 20  ASN A C    5  
ATOM 9896  O O    . ASN A 1 20  ? 14.808  6.482   10.248  1.00 0.00 ? 20  ASN A O    5  
ATOM 9897  C CB   . ASN A 1 20  ? 17.005  4.439   11.392  1.00 0.00 ? 20  ASN A CB   5  
ATOM 9898  C CG   . ASN A 1 20  ? 17.376  3.460   12.514  1.00 0.00 ? 20  ASN A CG   5  
ATOM 9899  O OD1  . ASN A 1 20  ? 18.142  2.522   12.325  1.00 0.00 ? 20  ASN A OD1  5  
ATOM 9900  N ND2  . ASN A 1 20  ? 16.859  3.638   13.706  1.00 0.00 ? 20  ASN A ND2  5  
ATOM 9901  H H    . ASN A 1 20  ? 15.716  2.791   8.985   1.00 0.00 ? 20  ASN A H    5  
ATOM 9902  H HA   . ASN A 1 20  ? 14.823  4.273   11.490  1.00 0.00 ? 20  ASN A HA   5  
ATOM 9903  H HB2  . ASN A 1 20  ? 17.805  4.384   10.630  1.00 0.00 ? 20  ASN A HB2  5  
ATOM 9904  H HB3  . ASN A 1 20  ? 17.091  5.465   11.800  1.00 0.00 ? 20  ASN A HB3  5  
ATOM 9905  H HD21 . ASN A 1 20  ? 16.158  4.375   13.808  1.00 0.00 ? 20  ASN A HD21 5  
ATOM 9906  H HD22 . ASN A 1 20  ? 17.102  2.898   14.370  1.00 0.00 ? 20  ASN A HD22 5  
ATOM 9907  N N    . GLN A 1 21  ? 15.661  5.407   8.458   1.00 0.00 ? 21  GLN A N    5  
ATOM 9908  C CA   . GLN A 1 21  ? 15.383  6.467   7.438   1.00 0.00 ? 21  GLN A CA   5  
ATOM 9909  C C    . GLN A 1 21  ? 15.219  5.835   5.998   1.00 0.00 ? 21  GLN A C    5  
ATOM 9910  O O    . GLN A 1 21  ? 15.691  6.377   5.001   1.00 0.00 ? 21  GLN A O    5  
ATOM 9911  C CB   . GLN A 1 21  ? 16.520  7.546   7.462   1.00 0.00 ? 21  GLN A CB   5  
ATOM 9912  C CG   . GLN A 1 21  ? 16.502  8.601   8.601   1.00 0.00 ? 21  GLN A CG   5  
ATOM 9913  C CD   . GLN A 1 21  ? 15.281  9.530   8.619   1.00 0.00 ? 21  GLN A CD   5  
ATOM 9914  O OE1  . GLN A 1 21  ? 15.199  10.515  7.895   1.00 0.00 ? 21  GLN A OE1  5  
ATOM 9915  N NE2  . GLN A 1 21  ? 14.297  9.250   9.439   1.00 0.00 ? 21  GLN A NE2  5  
ATOM 9916  H H    . GLN A 1 21  ? 16.074  4.511   8.188   1.00 0.00 ? 21  GLN A H    5  
ATOM 9917  H HA   . GLN A 1 21  ? 14.412  6.953   7.657   1.00 0.00 ? 21  GLN A HA   5  
ATOM 9918  H HB2  . GLN A 1 21  ? 17.507  7.045   7.444   1.00 0.00 ? 21  GLN A HB2  5  
ATOM 9919  H HB3  . GLN A 1 21  ? 16.497  8.121   6.516   1.00 0.00 ? 21  GLN A HB3  5  
ATOM 9920  H HG2  . GLN A 1 21  ? 16.642  8.116   9.584   1.00 0.00 ? 21  GLN A HG2  5  
ATOM 9921  H HG3  . GLN A 1 21  ? 17.391  9.249   8.493   1.00 0.00 ? 21  GLN A HG3  5  
ATOM 9922  H HE21 . GLN A 1 21  ? 14.364  8.342   9.924   1.00 0.00 ? 21  GLN A HE21 5  
ATOM 9923  H HE22 . GLN A 1 21  ? 13.495  9.881   9.370   1.00 0.00 ? 21  GLN A HE22 5  
ATOM 9924  N N    . LYS A 1 22  ? 14.559  4.676   5.863   1.00 0.00 ? 22  LYS A N    5  
ATOM 9925  C CA   . LYS A 1 22  ? 14.256  3.986   4.601   1.00 0.00 ? 22  LYS A CA   5  
ATOM 9926  C C    . LYS A 1 22  ? 12.669  4.098   4.502   1.00 0.00 ? 22  LYS A C    5  
ATOM 9927  O O    . LYS A 1 22  ? 11.916  4.305   5.464   1.00 0.00 ? 22  LYS A O    5  
ATOM 9928  C CB   . LYS A 1 22  ? 14.962  2.593   4.746   1.00 0.00 ? 22  LYS A CB   5  
ATOM 9929  C CG   . LYS A 1 22  ? 16.434  2.535   4.237   1.00 0.00 ? 22  LYS A CG   5  
ATOM 9930  C CD   . LYS A 1 22  ? 17.059  1.122   4.339   1.00 0.00 ? 22  LYS A CD   5  
ATOM 9931  C CE   . LYS A 1 22  ? 18.455  0.882   3.704   1.00 0.00 ? 22  LYS A CE   5  
ATOM 9932  N NZ   . LYS A 1 22  ? 18.422  0.819   2.211   1.00 0.00 ? 22  LYS A NZ   5  
ATOM 9933  H H    . LYS A 1 22  ? 14.127  4.230   6.677   1.00 0.00 ? 22  LYS A H    5  
ATOM 9934  H HA   . LYS A 1 22  ? 14.699  4.498   3.691   1.00 0.00 ? 22  LYS A HA   5  
ATOM 9935  H HB2  . LYS A 1 22  ? 14.932  2.215   5.783   1.00 0.00 ? 22  LYS A HB2  5  
ATOM 9936  H HB3  . LYS A 1 22  ? 14.375  1.816   4.248   1.00 0.00 ? 22  LYS A HB3  5  
ATOM 9937  H HG2  . LYS A 1 22  ? 16.459  2.876   3.191   1.00 0.00 ? 22  LYS A HG2  5  
ATOM 9938  H HG3  . LYS A 1 22  ? 17.049  3.268   4.796   1.00 0.00 ? 22  LYS A HG3  5  
ATOM 9939  H HD2  . LYS A 1 22  ? 17.116  0.861   5.414   1.00 0.00 ? 22  LYS A HD2  5  
ATOM 9940  H HD3  . LYS A 1 22  ? 16.344  0.386   3.936   1.00 0.00 ? 22  LYS A HD3  5  
ATOM 9941  H HE2  . LYS A 1 22  ? 19.182  1.645   4.058   1.00 0.00 ? 22  LYS A HE2  5  
ATOM 9942  H HE3  . LYS A 1 22  ? 18.856  -0.079  4.098   1.00 0.00 ? 22  LYS A HE3  5  
ATOM 9943  H HZ1  . LYS A 1 22  ? 17.516  0.460   1.840   1.00 0.00 ? 22  LYS A HZ1  5  
ATOM 9944  H HZ2  . LYS A 1 22  ? 18.567  1.712   1.730   1.00 0.00 ? 22  LYS A HZ2  5  
ATOM 9945  H HZ3  . LYS A 1 22  ? 19.074  0.144   1.732   1.00 0.00 ? 22  LYS A HZ3  5  
ATOM 9946  N N    . THR A 1 23  ? 12.196  4.126   3.266   1.00 0.00 ? 23  THR A N    5  
ATOM 9947  C CA   . THR A 1 23  ? 10.797  4.475   2.865   1.00 0.00 ? 23  THR A CA   5  
ATOM 9948  C C    . THR A 1 23  ? 10.172  3.544   1.770   1.00 0.00 ? 23  THR A C    5  
ATOM 9949  O O    . THR A 1 23  ? 10.862  2.969   0.929   1.00 0.00 ? 23  THR A O    5  
ATOM 9950  C CB   . THR A 1 23  ? 10.819  5.941   2.283   1.00 0.00 ? 23  THR A CB   5  
ATOM 9951  O OG1  . THR A 1 23  ? 11.702  6.035   1.167   1.00 0.00 ? 23  THR A OG1  5  
ATOM 9952  C CG2  . THR A 1 23  ? 11.271  7.029   3.271   1.00 0.00 ? 23  THR A CG2  5  
ATOM 9953  H H    . THR A 1 23  ? 12.942  3.882   2.618   1.00 0.00 ? 23  THR A H    5  
ATOM 9954  H HA   . THR A 1 23  ? 10.129  4.460   3.743   1.00 0.00 ? 23  THR A HA   5  
ATOM 9955  H HB   . THR A 1 23  ? 9.794   6.197   1.948   1.00 0.00 ? 23  THR A HB   5  
ATOM 9956  H HG1  . THR A 1 23  ? 12.523  5.606   1.431   1.00 0.00 ? 23  THR A HG1  5  
ATOM 9957  H HG21 . THR A 1 23  ? 12.267  6.830   3.715   1.00 0.00 ? 23  THR A HG21 5  
ATOM 9958  H HG22 . THR A 1 23  ? 11.336  8.021   2.791   1.00 0.00 ? 23  THR A HG22 5  
ATOM 9959  H HG23 . THR A 1 23  ? 10.553  7.112   4.100   1.00 0.00 ? 23  THR A HG23 5  
ATOM 9960  N N    . PHE A 1 24  ? 8.830   3.482   1.707   1.00 0.00 ? 24  PHE A N    5  
ATOM 9961  C CA   . PHE A 1 24  ? 8.092   2.776   0.612   1.00 0.00 ? 24  PHE A CA   5  
ATOM 9962  C C    . PHE A 1 24  ? 7.772   3.846   -0.493  1.00 0.00 ? 24  PHE A C    5  
ATOM 9963  O O    . PHE A 1 24  ? 6.984   4.766   -0.245  1.00 0.00 ? 24  PHE A O    5  
ATOM 9964  C CB   . PHE A 1 24  ? 6.839   2.155   1.277   1.00 0.00 ? 24  PHE A CB   5  
ATOM 9965  C CG   . PHE A 1 24  ? 5.990   1.140   0.488   1.00 0.00 ? 24  PHE A CG   5  
ATOM 9966  C CD1  . PHE A 1 24  ? 5.182   1.552   -0.578  1.00 0.00 ? 24  PHE A CD1  5  
ATOM 9967  C CD2  . PHE A 1 24  ? 5.891   -0.180  0.947   1.00 0.00 ? 24  PHE A CD2  5  
ATOM 9968  C CE1  . PHE A 1 24  ? 4.305   0.654   -1.184  1.00 0.00 ? 24  PHE A CE1  5  
ATOM 9969  C CE2  . PHE A 1 24  ? 4.995   -1.067  0.355   1.00 0.00 ? 24  PHE A CE2  5  
ATOM 9970  C CZ   . PHE A 1 24  ? 4.209   -0.652  -0.715  1.00 0.00 ? 24  PHE A CZ   5  
ATOM 9971  H H    . PHE A 1 24  ? 8.332   3.951   2.479   1.00 0.00 ? 24  PHE A H    5  
ATOM 9972  H HA   . PHE A 1 24  ? 8.705   1.958   0.179   1.00 0.00 ? 24  PHE A HA   5  
ATOM 9973  H HB2  . PHE A 1 24  ? 7.146   1.680   2.232   1.00 0.00 ? 24  PHE A HB2  5  
ATOM 9974  H HB3  . PHE A 1 24  ? 6.180   2.982   1.600   1.00 0.00 ? 24  PHE A HB3  5  
ATOM 9975  H HD1  . PHE A 1 24  ? 5.210   2.574   -0.926  1.00 0.00 ? 24  PHE A HD1  5  
ATOM 9976  H HD2  . PHE A 1 24  ? 6.483   -0.519  1.786   1.00 0.00 ? 24  PHE A HD2  5  
ATOM 9977  H HE1  . PHE A 1 24  ? 3.686   0.974   -2.010  1.00 0.00 ? 24  PHE A HE1  5  
ATOM 9978  H HE2  . PHE A 1 24  ? 4.912   -2.078  0.727   1.00 0.00 ? 24  PHE A HE2  5  
ATOM 9979  H HZ   . PHE A 1 24  ? 3.519   -1.344  -1.177  1.00 0.00 ? 24  PHE A HZ   5  
ATOM 9980  N N    . TYR A 1 25  ? 8.371   3.778   -1.697  1.00 0.00 ? 25  TYR A N    5  
ATOM 9981  C CA   . TYR A 1 25  ? 8.222   4.855   -2.732  1.00 0.00 ? 25  TYR A CA   5  
ATOM 9982  C C    . TYR A 1 25  ? 8.425   4.352   -4.197  1.00 0.00 ? 25  TYR A C    5  
ATOM 9983  O O    . TYR A 1 25  ? 8.990   3.286   -4.450  1.00 0.00 ? 25  TYR A O    5  
ATOM 9984  C CB   . TYR A 1 25  ? 9.208   6.024   -2.380  1.00 0.00 ? 25  TYR A CB   5  
ATOM 9985  C CG   . TYR A 1 25  ? 10.745  5.853   -2.492  1.00 0.00 ? 25  TYR A CG   5  
ATOM 9986  C CD1  . TYR A 1 25  ? 11.416  4.803   -1.852  1.00 0.00 ? 25  TYR A CD1  5  
ATOM 9987  C CD2  . TYR A 1 25  ? 11.500  6.851   -3.123  1.00 0.00 ? 25  TYR A CD2  5  
ATOM 9988  C CE1  . TYR A 1 25  ? 12.802  4.758   -1.825  1.00 0.00 ? 25  TYR A CE1  5  
ATOM 9989  C CE2  . TYR A 1 25  ? 12.894  6.816   -3.079  1.00 0.00 ? 25  TYR A CE2  5  
ATOM 9990  C CZ   . TYR A 1 25  ? 13.537  5.772   -2.420  1.00 0.00 ? 25  TYR A CZ   5  
ATOM 9991  O OH   . TYR A 1 25  ? 14.893  5.729   -2.308  1.00 0.00 ? 25  TYR A OH   5  
ATOM 9992  H H    . TYR A 1 25  ? 9.013   2.983   -1.839  1.00 0.00 ? 25  TYR A H    5  
ATOM 9993  H HA   . TYR A 1 25  ? 7.184   5.251   -2.694  1.00 0.00 ? 25  TYR A HA   5  
ATOM 9994  H HB2  . TYR A 1 25  ? 8.899   6.893   -2.990  1.00 0.00 ? 25  TYR A HB2  5  
ATOM 9995  H HB3  . TYR A 1 25  ? 9.004   6.364   -1.348  1.00 0.00 ? 25  TYR A HB3  5  
ATOM 9996  H HD1  . TYR A 1 25  ? 10.887  4.027   -1.329  1.00 0.00 ? 25  TYR A HD1  5  
ATOM 9997  H HD2  . TYR A 1 25  ? 11.011  7.674   -3.623  1.00 0.00 ? 25  TYR A HD2  5  
ATOM 9998  H HE1  . TYR A 1 25  ? 13.300  3.955   -1.304  1.00 0.00 ? 25  TYR A HE1  5  
ATOM 9999  H HE2  . TYR A 1 25  ? 13.467  7.610   -3.536  1.00 0.00 ? 25  TYR A HE2  5  
ATOM 10000 H HH   . TYR A 1 25  ? 15.291  6.606   -2.494  1.00 0.00 ? 25  TYR A HH   5  
ATOM 10001 N N    . LEU A 1 26  ? 7.956   5.139   -5.181  1.00 0.00 ? 26  LEU A N    5  
ATOM 10002 C CA   . LEU A 1 26  ? 8.030   4.764   -6.618  1.00 0.00 ? 26  LEU A CA   5  
ATOM 10003 C C    . LEU A 1 26  ? 9.313   5.240   -7.385  1.00 0.00 ? 26  LEU A C    5  
ATOM 10004 O O    . LEU A 1 26  ? 9.977   6.220   -7.035  1.00 0.00 ? 26  LEU A O    5  
ATOM 10005 C CB   . LEU A 1 26  ? 6.743   5.319   -7.313  1.00 0.00 ? 26  LEU A CB   5  
ATOM 10006 C CG   . LEU A 1 26  ? 6.630   6.834   -7.668  1.00 0.00 ? 26  LEU A CG   5  
ATOM 10007 C CD1  . LEU A 1 26  ? 5.511   7.054   -8.698  1.00 0.00 ? 26  LEU A CD1  5  
ATOM 10008 C CD2  . LEU A 1 26  ? 6.375   7.721   -6.440  1.00 0.00 ? 26  LEU A CD2  5  
ATOM 10009 H H    . LEU A 1 26  ? 7.502   6.010   -4.891  1.00 0.00 ? 26  LEU A H    5  
ATOM 10010 H HA   . LEU A 1 26  ? 7.996   3.663   -6.686  1.00 0.00 ? 26  LEU A HA   5  
ATOM 10011 H HB2  . LEU A 1 26  ? 6.643   4.751   -8.257  1.00 0.00 ? 26  LEU A HB2  5  
ATOM 10012 H HB3  . LEU A 1 26  ? 5.844   5.012   -6.743  1.00 0.00 ? 26  LEU A HB3  5  
ATOM 10013 H HG   . LEU A 1 26  ? 7.567   7.181   -8.145  1.00 0.00 ? 26  LEU A HG   5  
ATOM 10014 H HD11 . LEU A 1 26  ? 4.549   6.633   -8.358  1.00 0.00 ? 26  LEU A HD11 5  
ATOM 10015 H HD12 . LEU A 1 26  ? 5.338   8.128   -8.907  1.00 0.00 ? 26  LEU A HD12 5  
ATOM 10016 H HD13 . LEU A 1 26  ? 5.746   6.577   -9.666  1.00 0.00 ? 26  LEU A HD13 5  
ATOM 10017 H HD21 . LEU A 1 26  ? 5.503   7.379   -5.854  1.00 0.00 ? 26  LEU A HD21 5  
ATOM 10018 H HD22 . LEU A 1 26  ? 7.252   7.755   -5.770  1.00 0.00 ? 26  LEU A HD22 5  
ATOM 10019 H HD23 . LEU A 1 26  ? 6.177   8.770   -6.733  1.00 0.00 ? 26  LEU A HD23 5  
ATOM 10020 N N    . ARG A 1 27  ? 9.601   4.532   -8.492  1.00 0.00 ? 27  ARG A N    5  
ATOM 10021 C CA   . ARG A 1 27  ? 10.662  4.920   -9.470  1.00 0.00 ? 27  ARG A CA   5  
ATOM 10022 C C    . ARG A 1 27  ? 9.968   5.696   -10.652 1.00 0.00 ? 27  ARG A C    5  
ATOM 10023 O O    . ARG A 1 27  ? 10.181  6.896   -10.832 1.00 0.00 ? 27  ARG A O    5  
ATOM 10024 C CB   . ARG A 1 27  ? 11.408  3.615   -9.877  1.00 0.00 ? 27  ARG A CB   5  
ATOM 10025 C CG   . ARG A 1 27  ? 12.564  3.777   -10.895 1.00 0.00 ? 27  ARG A CG   5  
ATOM 10026 C CD   . ARG A 1 27  ? 12.917  2.436   -11.562 1.00 0.00 ? 27  ARG A CD   5  
ATOM 10027 N NE   . ARG A 1 27  ? 14.066  2.615   -12.485 1.00 0.00 ? 27  ARG A NE   5  
ATOM 10028 C CZ   . ARG A 1 27  ? 14.454  1.738   -13.413 1.00 0.00 ? 27  ARG A CZ   5  
ATOM 10029 N NH1  . ARG A 1 27  ? 13.832  0.612   -13.672 1.00 0.00 ? 27  ARG A NH1  5  
ATOM 10030 N NH2  . ARG A 1 27  ? 15.516  2.019   -14.111 1.00 0.00 ? 27  ARG A NH2  5  
ATOM 10031 H H    . ARG A 1 27  ? 8.965   3.734   -8.648  1.00 0.00 ? 27  ARG A H    5  
ATOM 10032 H HA   . ARG A 1 27  ? 11.394  5.612   -9.006  1.00 0.00 ? 27  ARG A HA   5  
ATOM 10033 H HB2  . ARG A 1 27  ? 11.817  3.134   -8.969  1.00 0.00 ? 27  ARG A HB2  5  
ATOM 10034 H HB3  . ARG A 1 27  ? 10.670  2.885   -10.264 1.00 0.00 ? 27  ARG A HB3  5  
ATOM 10035 H HG2  . ARG A 1 27  ? 12.286  4.507   -11.682 1.00 0.00 ? 27  ARG A HG2  5  
ATOM 10036 H HG3  . ARG A 1 27  ? 13.445  4.215   -10.383 1.00 0.00 ? 27  ARG A HG3  5  
ATOM 10037 H HD2  . ARG A 1 27  ? 13.155  1.669   -10.796 1.00 0.00 ? 27  ARG A HD2  5  
ATOM 10038 H HD3  . ARG A 1 27  ? 12.024  2.066   -12.107 1.00 0.00 ? 27  ARG A HD3  5  
ATOM 10039 H HE   . ARG A 1 27  ? 14.659  3.448   -12.422 1.00 0.00 ? 27  ARG A HE   5  
ATOM 10040 H HH11 . ARG A 1 27  ? 12.971  0.429   -13.129 1.00 0.00 ? 27  ARG A HH11 5  
ATOM 10041 H HH12 . ARG A 1 27  ? 14.202  0.018   -14.414 1.00 0.00 ? 27  ARG A HH12 5  
ATOM 10042 H HH21 . ARG A 1 27  ? 15.991  2.897   -13.896 1.00 0.00 ? 27  ARG A HH21 5  
ATOM 10043 H HH22 . ARG A 1 27  ? 15.803  1.339   -14.817 1.00 0.00 ? 27  ARG A HH22 5  
ATOM 10044 N N    . ASN A 1 28  ? 9.161   4.985   -11.459 1.00 0.00 ? 28  ASN A N    5  
ATOM 10045 C CA   . ASN A 1 28  ? 8.322   5.551   -12.549 1.00 0.00 ? 28  ASN A CA   5  
ATOM 10046 C C    . ASN A 1 28  ? 6.989   4.734   -12.439 1.00 0.00 ? 28  ASN A C    5  
ATOM 10047 O O    . ASN A 1 28  ? 6.068   5.175   -11.749 1.00 0.00 ? 28  ASN A O    5  
ATOM 10048 C CB   . ASN A 1 28  ? 9.116   5.492   -13.887 1.00 0.00 ? 28  ASN A CB   5  
ATOM 10049 C CG   . ASN A 1 28  ? 8.342   5.990   -15.109 1.00 0.00 ? 28  ASN A CG   5  
ATOM 10050 O OD1  . ASN A 1 28  ? 7.632   5.237   -15.766 1.00 0.00 ? 28  ASN A OD1  5  
ATOM 10051 N ND2  . ASN A 1 28  ? 8.438   7.253   -15.446 1.00 0.00 ? 28  ASN A ND2  5  
ATOM 10052 H H    . ASN A 1 28  ? 9.085   4.005   -11.173 1.00 0.00 ? 28  ASN A H    5  
ATOM 10053 H HA   . ASN A 1 28  ? 8.068   6.608   -12.329 1.00 0.00 ? 28  ASN A HA   5  
ATOM 10054 H HB2  . ASN A 1 28  ? 10.058  6.065   -13.783 1.00 0.00 ? 28  ASN A HB2  5  
ATOM 10055 H HB3  . ASN A 1 28  ? 9.447   4.459   -14.099 1.00 0.00 ? 28  ASN A HB3  5  
ATOM 10056 H HD21 . ASN A 1 28  ? 9.017   7.857   -14.856 1.00 0.00 ? 28  ASN A HD21 5  
ATOM 10057 H HD22 . ASN A 1 28  ? 7.884   7.512   -16.268 1.00 0.00 ? 28  ASN A HD22 5  
ATOM 10058 N N    . ASN A 1 29  ? 6.901   3.531   -13.039 1.00 0.00 ? 29  ASN A N    5  
ATOM 10059 C CA   . ASN A 1 29  ? 5.741   2.607   -12.842 1.00 0.00 ? 29  ASN A CA   5  
ATOM 10060 C C    . ASN A 1 29  ? 6.215   1.317   -12.063 1.00 0.00 ? 29  ASN A C    5  
ATOM 10061 O O    . ASN A 1 29  ? 5.939   0.185   -12.466 1.00 0.00 ? 29  ASN A O    5  
ATOM 10062 C CB   . ASN A 1 29  ? 5.126   2.316   -14.243 1.00 0.00 ? 29  ASN A CB   5  
ATOM 10063 C CG   . ASN A 1 29  ? 4.235   3.430   -14.806 1.00 0.00 ? 29  ASN A CG   5  
ATOM 10064 O OD1  . ASN A 1 29  ? 3.041   3.490   -14.538 1.00 0.00 ? 29  ASN A OD1  5  
ATOM 10065 N ND2  . ASN A 1 29  ? 4.755   4.341   -15.593 1.00 0.00 ? 29  ASN A ND2  5  
ATOM 10066 H H    . ASN A 1 29  ? 7.717   3.272   -13.602 1.00 0.00 ? 29  ASN A H    5  
ATOM 10067 H HA   . ASN A 1 29  ? 4.951   3.063   -12.210 1.00 0.00 ? 29  ASN A HA   5  
ATOM 10068 H HB2  . ASN A 1 29  ? 5.902   2.022   -14.976 1.00 0.00 ? 29  ASN A HB2  5  
ATOM 10069 H HB3  . ASN A 1 29  ? 4.474   1.426   -14.171 1.00 0.00 ? 29  ASN A HB3  5  
ATOM 10070 H HD21 . ASN A 1 29  ? 5.781   4.398   -15.635 1.00 0.00 ? 29  ASN A HD21 5  
ATOM 10071 H HD22 . ASN A 1 29  ? 4.086   5.073   -15.848 1.00 0.00 ? 29  ASN A HD22 5  
ATOM 10072 N N    . GLN A 1 30  ? 6.923   1.495   -10.924 1.00 0.00 ? 30  GLN A N    5  
ATOM 10073 C CA   . GLN A 1 30  ? 7.475   0.387   -10.093 1.00 0.00 ? 30  GLN A CA   5  
ATOM 10074 C C    . GLN A 1 30  ? 7.604   0.884   -8.618  1.00 0.00 ? 30  GLN A C    5  
ATOM 10075 O O    . GLN A 1 30  ? 8.067   2.005   -8.379  1.00 0.00 ? 30  GLN A O    5  
ATOM 10076 C CB   . GLN A 1 30  ? 8.901   -0.050  -10.553 1.00 0.00 ? 30  GLN A CB   5  
ATOM 10077 C CG   . GLN A 1 30  ? 9.062   -0.628  -11.981 1.00 0.00 ? 30  GLN A CG   5  
ATOM 10078 C CD   . GLN A 1 30  ? 10.491  -1.095  -12.284 1.00 0.00 ? 30  GLN A CD   5  
ATOM 10079 O OE1  . GLN A 1 30  ? 11.381  -0.315  -12.610 1.00 0.00 ? 30  GLN A OE1  5  
ATOM 10080 N NE2  . GLN A 1 30  ? 10.763  -2.373  -12.172 1.00 0.00 ? 30  GLN A NE2  5  
ATOM 10081 H H    . GLN A 1 30  ? 7.094   2.478   -10.681 1.00 0.00 ? 30  GLN A H    5  
ATOM 10082 H HA   . GLN A 1 30  ? 6.797   -0.490  -10.142 1.00 0.00 ? 30  GLN A HA   5  
ATOM 10083 H HB2  . GLN A 1 30  ? 9.595   0.802   -10.429 1.00 0.00 ? 30  GLN A HB2  5  
ATOM 10084 H HB3  . GLN A 1 30  ? 9.276   -0.811  -9.838  1.00 0.00 ? 30  GLN A HB3  5  
ATOM 10085 H HG2  . GLN A 1 30  ? 8.334   -1.444  -12.150 1.00 0.00 ? 30  GLN A HG2  5  
ATOM 10086 H HG3  . GLN A 1 30  ? 8.798   0.142   -12.729 1.00 0.00 ? 30  GLN A HG3  5  
ATOM 10087 H HE21 . GLN A 1 30  ? 9.995   -2.982  -11.880 1.00 0.00 ? 30  GLN A HE21 5  
ATOM 10088 H HE22 . GLN A 1 30  ? 11.737  -2.627  -12.355 1.00 0.00 ? 30  GLN A HE22 5  
ATOM 10089 N N    . LEU A 1 31  ? 7.246   0.038   -7.640  1.00 0.00 ? 31  LEU A N    5  
ATOM 10090 C CA   . LEU A 1 31  ? 7.377   0.372   -6.191  1.00 0.00 ? 31  LEU A CA   5  
ATOM 10091 C C    . LEU A 1 31  ? 8.698   -0.240  -5.619  1.00 0.00 ? 31  LEU A C    5  
ATOM 10092 O O    . LEU A 1 31  ? 8.877   -1.463  -5.579  1.00 0.00 ? 31  LEU A O    5  
ATOM 10093 C CB   . LEU A 1 31  ? 6.126   -0.156  -5.428  1.00 0.00 ? 31  LEU A CB   5  
ATOM 10094 C CG   . LEU A 1 31  ? 4.840   0.706   -5.553  1.00 0.00 ? 31  LEU A CG   5  
ATOM 10095 C CD1  . LEU A 1 31  ? 3.609   -0.084  -5.077  1.00 0.00 ? 31  LEU A CD1  5  
ATOM 10096 C CD2  . LEU A 1 31  ? 4.952   2.022   -4.757  1.00 0.00 ? 31  LEU A CD2  5  
ATOM 10097 H H    . LEU A 1 31  ? 6.886   -0.866  -7.959  1.00 0.00 ? 31  LEU A H    5  
ATOM 10098 H HA   . LEU A 1 31  ? 7.413   1.470   -6.045  1.00 0.00 ? 31  LEU A HA   5  
ATOM 10099 H HB2  . LEU A 1 31  ? 5.924   -1.202  -5.732  1.00 0.00 ? 31  LEU A HB2  5  
ATOM 10100 H HB3  . LEU A 1 31  ? 6.362   -0.240  -4.350  1.00 0.00 ? 31  LEU A HB3  5  
ATOM 10101 H HG   . LEU A 1 31  ? 4.674   0.956   -6.620  1.00 0.00 ? 31  LEU A HG   5  
ATOM 10102 H HD11 . LEU A 1 31  ? 3.706   -0.421  -4.028  1.00 0.00 ? 31  LEU A HD11 5  
ATOM 10103 H HD12 . LEU A 1 31  ? 2.684   0.517   -5.148  1.00 0.00 ? 31  LEU A HD12 5  
ATOM 10104 H HD13 . LEU A 1 31  ? 3.443   -0.986  -5.695  1.00 0.00 ? 31  LEU A HD13 5  
ATOM 10105 H HD21 . LEU A 1 31  ? 5.223   1.854   -3.699  1.00 0.00 ? 31  LEU A HD21 5  
ATOM 10106 H HD22 . LEU A 1 31  ? 5.718   2.697   -5.181  1.00 0.00 ? 31  LEU A HD22 5  
ATOM 10107 H HD23 . LEU A 1 31  ? 4.005   2.594   -4.766  1.00 0.00 ? 31  LEU A HD23 5  
ATOM 10108 N N    . VAL A 1 32  ? 9.631   0.631   -5.203  1.00 0.00 ? 32  VAL A N    5  
ATOM 10109 C CA   . VAL A 1 32  ? 10.943  0.233   -4.606  1.00 0.00 ? 32  VAL A CA   5  
ATOM 10110 C C    . VAL A 1 32  ? 10.883  0.477   -3.059  1.00 0.00 ? 32  VAL A C    5  
ATOM 10111 O O    . VAL A 1 32  ? 10.074  1.243   -2.514  1.00 0.00 ? 32  VAL A O    5  
ATOM 10112 C CB   . VAL A 1 32  ? 12.177  0.997   -5.238  1.00 0.00 ? 32  VAL A CB   5  
ATOM 10113 C CG1  . VAL A 1 32  ? 13.459  0.133   -5.175  1.00 0.00 ? 32  VAL A CG1  5  
ATOM 10114 C CG2  . VAL A 1 32  ? 12.039  1.458   -6.709  1.00 0.00 ? 32  VAL A CG2  5  
ATOM 10115 H H    . VAL A 1 32  ? 9.366   1.626   -5.250  1.00 0.00 ? 32  VAL A H    5  
ATOM 10116 H HA   . VAL A 1 32  ? 11.095  -0.851  -4.771  1.00 0.00 ? 32  VAL A HA   5  
ATOM 10117 H HB   . VAL A 1 32  ? 12.394  1.902   -4.632  1.00 0.00 ? 32  VAL A HB   5  
ATOM 10118 H HG11 . VAL A 1 32  ? 13.341  -0.834  -5.696  1.00 0.00 ? 32  VAL A HG11 5  
ATOM 10119 H HG12 . VAL A 1 32  ? 14.320  0.638   -5.639  1.00 0.00 ? 32  VAL A HG12 5  
ATOM 10120 H HG13 . VAL A 1 32  ? 13.775  -0.092  -4.139  1.00 0.00 ? 32  VAL A HG13 5  
ATOM 10121 H HG21 . VAL A 1 32  ? 11.182  2.146   -6.833  1.00 0.00 ? 32  VAL A HG21 5  
ATOM 10122 H HG22 . VAL A 1 32  ? 12.931  2.011   -7.056  1.00 0.00 ? 32  VAL A HG22 5  
ATOM 10123 H HG23 . VAL A 1 32  ? 11.879  0.607   -7.396  1.00 0.00 ? 32  VAL A HG23 5  
ATOM 10124 N N    . ALA A 1 33  ? 11.766  -0.224  -2.346  1.00 0.00 ? 33  ALA A N    5  
ATOM 10125 C CA   . ALA A 1 33  ? 11.865  -0.144  -0.881  1.00 0.00 ? 33  ALA A CA   5  
ATOM 10126 C C    . ALA A 1 33  ? 13.062  0.661   -0.377  1.00 0.00 ? 33  ALA A C    5  
ATOM 10127 O O    . ALA A 1 33  ? 14.125  0.743   -0.993  1.00 0.00 ? 33  ALA A O    5  
ATOM 10128 C CB   . ALA A 1 33  ? 12.072  -1.582  -0.392  1.00 0.00 ? 33  ALA A CB   5  
ATOM 10129 H H    . ALA A 1 33  ? 12.420  -0.810  -2.883  1.00 0.00 ? 33  ALA A H    5  
ATOM 10130 H HA   . ALA A 1 33  ? 10.941  0.286   -0.428  1.00 0.00 ? 33  ALA A HA   5  
ATOM 10131 H HB1  . ALA A 1 33  ? 11.269  -2.249  -0.721  1.00 0.00 ? 33  ALA A HB1  5  
ATOM 10132 H HB2  . ALA A 1 33  ? 13.037  -1.992  -0.761  1.00 0.00 ? 33  ALA A HB2  5  
ATOM 10133 H HB3  . ALA A 1 33  ? 12.118  -1.616  0.714   1.00 0.00 ? 33  ALA A HB3  5  
ATOM 10134 N N    . GLY A 1 34  ? 12.885  1.086   0.867   1.00 0.00 ? 34  GLY A N    5  
ATOM 10135 C CA   . GLY A 1 34  ? 13.898  1.753   1.660   1.00 0.00 ? 34  GLY A CA   5  
ATOM 10136 C C    . GLY A 1 34  ? 14.607  2.968   1.081   1.00 0.00 ? 34  GLY A C    5  
ATOM 10137 O O    . GLY A 1 34  ? 14.193  4.105   1.313   1.00 0.00 ? 34  GLY A O    5  
ATOM 10138 H H    . GLY A 1 34  ? 11.912  1.037   1.211   1.00 0.00 ? 34  GLY A H    5  
ATOM 10139 H HA2  . GLY A 1 34  ? 13.340  2.062   2.542   1.00 0.00 ? 34  GLY A HA2  5  
ATOM 10140 H HA3  . GLY A 1 34  ? 14.605  1.021   2.077   1.00 0.00 ? 34  GLY A HA3  5  
ATOM 10141 N N    . TYR A 1 35  ? 15.749  2.723   0.444   1.00 0.00 ? 35  TYR A N    5  
ATOM 10142 C CA   . TYR A 1 35  ? 16.525  3.855   -0.139  1.00 0.00 ? 35  TYR A CA   5  
ATOM 10143 C C    . TYR A 1 35  ? 17.304  3.475   -1.455  1.00 0.00 ? 35  TYR A C    5  
ATOM 10144 O O    . TYR A 1 35  ? 18.540  3.490   -1.473  1.00 0.00 ? 35  TYR A O    5  
ATOM 10145 C CB   . TYR A 1 35  ? 17.468  4.502   0.948   1.00 0.00 ? 35  TYR A CB   5  
ATOM 10146 C CG   . TYR A 1 35  ? 17.076  5.828   1.665   1.00 0.00 ? 35  TYR A CG   5  
ATOM 10147 C CD1  . TYR A 1 35  ? 15.985  6.655   1.326   1.00 0.00 ? 35  TYR A CD1  5  
ATOM 10148 C CD2  . TYR A 1 35  ? 17.984  6.287   2.626   1.00 0.00 ? 35  TYR A CD2  5  
ATOM 10149 C CE1  . TYR A 1 35  ? 15.834  7.904   1.924   1.00 0.00 ? 35  TYR A CE1  5  
ATOM 10150 C CE2  . TYR A 1 35  ? 17.843  7.546   3.205   1.00 0.00 ? 35  TYR A CE2  5  
ATOM 10151 C CZ   . TYR A 1 35  ? 16.764  8.353   2.849   1.00 0.00 ? 35  TYR A CZ   5  
ATOM 10152 O OH   . TYR A 1 35  ? 16.604  9.580   3.435   1.00 0.00 ? 35  TYR A OH   5  
ATOM 10153 H H    . TYR A 1 35  ? 15.827  1.697   0.268   1.00 0.00 ? 35  TYR A H    5  
ATOM 10154 H HA   . TYR A 1 35  ? 15.802  4.634   -0.406  1.00 0.00 ? 35  TYR A HA   5  
ATOM 10155 H HB2  . TYR A 1 35  ? 17.758  3.746   1.696   1.00 0.00 ? 35  TYR A HB2  5  
ATOM 10156 H HB3  . TYR A 1 35  ? 18.443  4.748   0.487   1.00 0.00 ? 35  TYR A HB3  5  
ATOM 10157 H HD1  . TYR A 1 35  ? 15.237  6.368   0.606   1.00 0.00 ? 35  TYR A HD1  5  
ATOM 10158 H HD2  . TYR A 1 35  ? 18.820  5.673   2.928   1.00 0.00 ? 35  TYR A HD2  5  
ATOM 10159 H HE1  . TYR A 1 35  ? 14.990  8.531   1.666   1.00 0.00 ? 35  TYR A HE1  5  
ATOM 10160 H HE2  . TYR A 1 35  ? 18.558  7.880   3.940   1.00 0.00 ? 35  TYR A HE2  5  
ATOM 10161 H HH   . TYR A 1 35  ? 17.228  9.665   4.157   1.00 0.00 ? 35  TYR A HH   5  
ATOM 10162 N N    . LEU A 1 36  ? 16.623  3.211   -2.596  1.00 0.00 ? 36  LEU A N    5  
ATOM 10163 C CA   . LEU A 1 36  ? 17.341  3.081   -3.923  1.00 0.00 ? 36  LEU A CA   5  
ATOM 10164 C C    . LEU A 1 36  ? 17.715  4.458   -4.596  1.00 0.00 ? 36  LEU A C    5  
ATOM 10165 O O    . LEU A 1 36  ? 18.732  4.587   -5.281  1.00 0.00 ? 36  LEU A O    5  
ATOM 10166 C CB   . LEU A 1 36  ? 16.499  2.160   -4.855  1.00 0.00 ? 36  LEU A CB   5  
ATOM 10167 C CG   . LEU A 1 36  ? 17.057  1.943   -6.303  1.00 0.00 ? 36  LEU A CG   5  
ATOM 10168 C CD1  . LEU A 1 36  ? 17.136  0.467   -6.726  1.00 0.00 ? 36  LEU A CD1  5  
ATOM 10169 C CD2  . LEU A 1 36  ? 16.250  2.738   -7.347  1.00 0.00 ? 36  LEU A CD2  5  
ATOM 10170 H H    . LEU A 1 36  ? 15.597  3.156   -2.502  1.00 0.00 ? 36  LEU A H    5  
ATOM 10171 H HA   . LEU A 1 36  ? 18.311  2.629   -3.756  1.00 0.00 ? 36  LEU A HA   5  
ATOM 10172 H HB2  . LEU A 1 36  ? 16.412  1.180   -4.347  1.00 0.00 ? 36  LEU A HB2  5  
ATOM 10173 H HB3  . LEU A 1 36  ? 15.456  2.530   -4.898  1.00 0.00 ? 36  LEU A HB3  5  
ATOM 10174 H HG   . LEU A 1 36  ? 18.101  2.313   -6.347  1.00 0.00 ? 36  LEU A HG   5  
ATOM 10175 H HD11 . LEU A 1 36  ? 16.162  -0.051  -6.686  1.00 0.00 ? 36  LEU A HD11 5  
ATOM 10176 H HD12 . LEU A 1 36  ? 17.529  0.350   -7.753  1.00 0.00 ? 36  LEU A HD12 5  
ATOM 10177 H HD13 . LEU A 1 36  ? 17.828  -0.093  -6.071  1.00 0.00 ? 36  LEU A HD13 5  
ATOM 10178 H HD21 . LEU A 1 36  ? 16.210  3.813   -7.096  1.00 0.00 ? 36  LEU A HD21 5  
ATOM 10179 H HD22 . LEU A 1 36  ? 16.701  2.665   -8.354  1.00 0.00 ? 36  LEU A HD22 5  
ATOM 10180 H HD23 . LEU A 1 36  ? 15.208  2.380   -7.426  1.00 0.00 ? 36  LEU A HD23 5  
ATOM 10181 N N    . GLN A 1 37  ? 16.832  5.430   -4.442  1.00 0.00 ? 37  GLN A N    5  
ATOM 10182 C CA   . GLN A 1 37  ? 16.976  6.826   -4.943  1.00 0.00 ? 37  GLN A CA   5  
ATOM 10183 C C    . GLN A 1 37  ? 17.028  7.835   -3.752  1.00 0.00 ? 37  GLN A C    5  
ATOM 10184 O O    . GLN A 1 37  ? 16.272  7.714   -2.780  1.00 0.00 ? 37  GLN A O    5  
ATOM 10185 C CB   . GLN A 1 37  ? 15.774  7.149   -5.891  1.00 0.00 ? 37  GLN A CB   5  
ATOM 10186 C CG   . GLN A 1 37  ? 16.120  7.118   -7.400  1.00 0.00 ? 37  GLN A CG   5  
ATOM 10187 C CD   . GLN A 1 37  ? 16.929  8.329   -7.896  1.00 0.00 ? 37  GLN A CD   5  
ATOM 10188 O OE1  . GLN A 1 37  ? 18.014  8.639   -7.413  1.00 0.00 ? 37  GLN A OE1  5  
ATOM 10189 N NE2  . GLN A 1 37  ? 16.439  9.048   -8.876  1.00 0.00 ? 37  GLN A NE2  5  
ATOM 10190 H H    . GLN A 1 37  ? 16.141  5.044   -3.790  1.00 0.00 ? 37  GLN A H    5  
ATOM 10191 H HA   . GLN A 1 37  ? 17.927  6.922   -5.507  1.00 0.00 ? 37  GLN A HA   5  
ATOM 10192 H HB2  . GLN A 1 37  ? 14.923  6.464   -5.702  1.00 0.00 ? 37  GLN A HB2  5  
ATOM 10193 H HB3  . GLN A 1 37  ? 15.339  8.144   -5.662  1.00 0.00 ? 37  GLN A HB3  5  
ATOM 10194 H HG2  . GLN A 1 37  ? 16.688  6.201   -7.641  1.00 0.00 ? 37  GLN A HG2  5  
ATOM 10195 H HG3  . GLN A 1 37  ? 15.177  7.026   -7.971  1.00 0.00 ? 37  GLN A HG3  5  
ATOM 10196 H HE21 . GLN A 1 37  ? 15.527  8.772   -9.247  1.00 0.00 ? 37  GLN A HE21 5  
ATOM 10197 H HE22 . GLN A 1 37  ? 17.028  9.839   -9.151  1.00 0.00 ? 37  GLN A HE22 5  
ATOM 10198 N N    . GLY A 1 38  ? 17.898  8.855   -3.837  1.00 0.00 ? 38  GLY A N    5  
ATOM 10199 C CA   . GLY A 1 38  ? 18.018  9.883   -2.764  1.00 0.00 ? 38  GLY A CA   5  
ATOM 10200 C C    . GLY A 1 38  ? 16.773  10.797  -2.524  1.00 0.00 ? 38  GLY A C    5  
ATOM 10201 O O    . GLY A 1 38  ? 16.053  11.064  -3.493  1.00 0.00 ? 38  GLY A O    5  
ATOM 10202 H H    . GLY A 1 38  ? 18.465  8.869   -4.694  1.00 0.00 ? 38  GLY A H    5  
ATOM 10203 H HA2  . GLY A 1 38  ? 18.310  9.371   -1.829  1.00 0.00 ? 38  GLY A HA2  5  
ATOM 10204 H HA3  . GLY A 1 38  ? 18.868  10.547  -3.005  1.00 0.00 ? 38  GLY A HA3  5  
ATOM 10205 N N    . PRO A 1 39  ? 16.481  11.320  -1.293  1.00 0.00 ? 39  PRO A N    5  
ATOM 10206 C CA   . PRO A 1 39  ? 15.297  12.199  -1.052  1.00 0.00 ? 39  PRO A CA   5  
ATOM 10207 C C    . PRO A 1 39  ? 15.389  13.579  -1.789  1.00 0.00 ? 39  PRO A C    5  
ATOM 10208 O O    . PRO A 1 39  ? 16.463  14.192  -1.852  1.00 0.00 ? 39  PRO A O    5  
ATOM 10209 C CB   . PRO A 1 39  ? 15.277  12.301  0.485   1.00 0.00 ? 39  PRO A CB   5  
ATOM 10210 C CG   . PRO A 1 39  ? 16.733  12.105  0.914   1.00 0.00 ? 39  PRO A CG   5  
ATOM 10211 C CD   . PRO A 1 39  ? 17.278  11.072  -0.073  1.00 0.00 ? 39  PRO A CD   5  
ATOM 10212 H HA   . PRO A 1 39  ? 14.384  11.677  -1.400  1.00 0.00 ? 39  PRO A HA   5  
ATOM 10213 H HB2  . PRO A 1 39  ? 14.842  13.249  0.856   1.00 0.00 ? 39  PRO A HB2  5  
ATOM 10214 H HB3  . PRO A 1 39  ? 14.649  11.489  0.903   1.00 0.00 ? 39  PRO A HB3  5  
ATOM 10215 H HG2  . PRO A 1 39  ? 17.286  13.059  0.809   1.00 0.00 ? 39  PRO A HG2  5  
ATOM 10216 H HG3  . PRO A 1 39  ? 16.833  11.784  1.968   1.00 0.00 ? 39  PRO A HG3  5  
ATOM 10217 H HD2  . PRO A 1 39  ? 18.366  11.205  -0.230  1.00 0.00 ? 39  PRO A HD2  5  
ATOM 10218 H HD3  . PRO A 1 39  ? 17.109  10.040  0.294   1.00 0.00 ? 39  PRO A HD3  5  
ATOM 10219 N N    . ASN A 1 40  ? 14.271  14.051  -2.374  1.00 0.00 ? 40  ASN A N    5  
ATOM 10220 C CA   . ASN A 1 40  ? 14.289  15.279  -3.230  1.00 0.00 ? 40  ASN A CA   5  
ATOM 10221 C C    . ASN A 1 40  ? 13.041  16.226  -3.194  1.00 0.00 ? 40  ASN A C    5  
ATOM 10222 O O    . ASN A 1 40  ? 13.251  17.414  -3.445  1.00 0.00 ? 40  ASN A O    5  
ATOM 10223 C CB   . ASN A 1 40  ? 14.532  14.756  -4.684  1.00 0.00 ? 40  ASN A CB   5  
ATOM 10224 C CG   . ASN A 1 40  ? 15.111  15.772  -5.672  1.00 0.00 ? 40  ASN A CG   5  
ATOM 10225 O OD1  . ASN A 1 40  ? 14.431  16.309  -6.537  1.00 0.00 ? 40  ASN A OD1  5  
ATOM 10226 N ND2  . ASN A 1 40  ? 16.392  16.045  -5.593  1.00 0.00 ? 40  ASN A ND2  5  
ATOM 10227 H H    . ASN A 1 40  ? 13.432  13.449  -2.229  1.00 0.00 ? 40  ASN A H    5  
ATOM 10228 H HA   . ASN A 1 40  ? 15.136  15.928  -2.924  1.00 0.00 ? 40  ASN A HA   5  
ATOM 10229 H HB2  . ASN A 1 40  ? 15.214  13.881  -4.693  1.00 0.00 ? 40  ASN A HB2  5  
ATOM 10230 H HB3  . ASN A 1 40  ? 13.588  14.360  -5.103  1.00 0.00 ? 40  ASN A HB3  5  
ATOM 10231 H HD21 . ASN A 1 40  ? 16.912  15.585  -4.840  1.00 0.00 ? 40  ASN A HD21 5  
ATOM 10232 H HD22 . ASN A 1 40  ? 16.714  16.751  -6.260  1.00 0.00 ? 40  ASN A HD22 5  
ATOM 10233 N N    . VAL A 1 41  ? 11.798  15.766  -2.908  1.00 0.00 ? 41  VAL A N    5  
ATOM 10234 C CA   . VAL A 1 41  ? 10.524  16.576  -2.969  1.00 0.00 ? 41  VAL A CA   5  
ATOM 10235 C C    . VAL A 1 41  ? 10.059  16.511  -4.471  1.00 0.00 ? 41  VAL A C    5  
ATOM 10236 O O    . VAL A 1 41  ? 10.791  16.876  -5.396  1.00 0.00 ? 41  VAL A O    5  
ATOM 10237 C CB   . VAL A 1 41  ? 10.571  18.054  -2.417  1.00 0.00 ? 41  VAL A CB   5  
ATOM 10238 C CG1  . VAL A 1 41  ? 9.192   18.757  -2.442  1.00 0.00 ? 41  VAL A CG1  5  
ATOM 10239 C CG2  . VAL A 1 41  ? 11.084  18.145  -0.961  1.00 0.00 ? 41  VAL A CG2  5  
ATOM 10240 H H    . VAL A 1 41  ? 11.739  14.750  -2.721  1.00 0.00 ? 41  VAL A H    5  
ATOM 10241 H HA   . VAL A 1 41  ? 9.788   16.022  -2.355  1.00 0.00 ? 41  VAL A HA   5  
ATOM 10242 H HB   . VAL A 1 41  ? 11.246  18.652  -3.059  1.00 0.00 ? 41  VAL A HB   5  
ATOM 10243 H HG11 . VAL A 1 41  ? 8.779   18.821  -3.466  1.00 0.00 ? 41  VAL A HG11 5  
ATOM 10244 H HG12 . VAL A 1 41  ? 8.443   18.231  -1.820  1.00 0.00 ? 41  VAL A HG12 5  
ATOM 10245 H HG13 . VAL A 1 41  ? 9.252   19.797  -2.071  1.00 0.00 ? 41  VAL A HG13 5  
ATOM 10246 H HG21 . VAL A 1 41  ? 12.108  17.738  -0.866  1.00 0.00 ? 41  VAL A HG21 5  
ATOM 10247 H HG22 . VAL A 1 41  ? 11.131  19.189  -0.601  1.00 0.00 ? 41  VAL A HG22 5  
ATOM 10248 H HG23 . VAL A 1 41  ? 10.446  17.579  -0.257  1.00 0.00 ? 41  VAL A HG23 5  
ATOM 10249 N N    . ASN A 1 42  ? 8.806   16.060  -4.700  1.00 0.00 ? 42  ASN A N    5  
ATOM 10250 C CA   . ASN A 1 42  ? 8.234   15.771  -6.066  1.00 0.00 ? 42  ASN A CA   5  
ATOM 10251 C C    . ASN A 1 42  ? 8.975   14.541  -6.746  1.00 0.00 ? 42  ASN A C    5  
ATOM 10252 O O    . ASN A 1 42  ? 9.384   14.569  -7.911  1.00 0.00 ? 42  ASN A O    5  
ATOM 10253 C CB   . ASN A 1 42  ? 8.211   17.073  -6.932  1.00 0.00 ? 42  ASN A CB   5  
ATOM 10254 C CG   . ASN A 1 42  ? 7.206   17.076  -8.087  1.00 0.00 ? 42  ASN A CG   5  
ATOM 10255 O OD1  . ASN A 1 42  ? 6.109   17.615  -7.993  1.00 0.00 ? 42  ASN A OD1  5  
ATOM 10256 N ND2  . ASN A 1 42  ? 7.539   16.485  -9.208  1.00 0.00 ? 42  ASN A ND2  5  
ATOM 10257 H H    . ASN A 1 42  ? 8.309   15.792  -3.844  1.00 0.00 ? 42  ASN A H    5  
ATOM 10258 H HA   . ASN A 1 42  ? 7.187   15.437  -5.918  1.00 0.00 ? 42  ASN A HA   5  
ATOM 10259 H HB2  . ASN A 1 42  ? 7.952   17.940  -6.296  1.00 0.00 ? 42  ASN A HB2  5  
ATOM 10260 H HB3  . ASN A 1 42  ? 9.222   17.306  -7.315  1.00 0.00 ? 42  ASN A HB3  5  
ATOM 10261 H HD21 . ASN A 1 42  ? 8.364   15.873  -9.139  1.00 0.00 ? 42  ASN A HD21 5  
ATOM 10262 H HD22 . ASN A 1 42  ? 6.777   16.438  -9.890  1.00 0.00 ? 42  ASN A HD22 5  
ATOM 10263 N N    . LEU A 1 43  ? 9.078   13.438  -5.986  1.00 0.00 ? 43  LEU A N    5  
ATOM 10264 C CA   . LEU A 1 43  ? 9.751   12.163  -6.370  1.00 0.00 ? 43  LEU A CA   5  
ATOM 10265 C C    . LEU A 1 43  ? 9.090   11.028  -5.511  1.00 0.00 ? 43  LEU A C    5  
ATOM 10266 O O    . LEU A 1 43  ? 8.489   10.101  -6.056  1.00 0.00 ? 43  LEU A O    5  
ATOM 10267 C CB   . LEU A 1 43  ? 11.296  12.319  -6.165  1.00 0.00 ? 43  LEU A CB   5  
ATOM 10268 C CG   . LEU A 1 43  ? 12.236  11.206  -6.710  1.00 0.00 ? 43  LEU A CG   5  
ATOM 10269 C CD1  . LEU A 1 43  ? 13.697  11.693  -6.661  1.00 0.00 ? 43  LEU A CD1  5  
ATOM 10270 C CD2  . LEU A 1 43  ? 12.154  9.875   -5.935  1.00 0.00 ? 43  LEU A CD2  5  
ATOM 10271 H H    . LEU A 1 43  ? 8.715   13.568  -5.035  1.00 0.00 ? 43  LEU A H    5  
ATOM 10272 H HA   . LEU A 1 43  ? 9.547   11.941  -7.436  1.00 0.00 ? 43  LEU A HA   5  
ATOM 10273 H HB2  . LEU A 1 43  ? 11.594  13.267  -6.655  1.00 0.00 ? 43  LEU A HB2  5  
ATOM 10274 H HB3  . LEU A 1 43  ? 11.517  12.498  -5.093  1.00 0.00 ? 43  LEU A HB3  5  
ATOM 10275 H HG   . LEU A 1 43  ? 11.978  11.013  -7.770  1.00 0.00 ? 43  LEU A HG   5  
ATOM 10276 H HD11 . LEU A 1 43  ? 13.835  12.643  -7.210  1.00 0.00 ? 43  LEU A HD11 5  
ATOM 10277 H HD12 . LEU A 1 43  ? 14.041  11.864  -5.622  1.00 0.00 ? 43  LEU A HD12 5  
ATOM 10278 H HD13 . LEU A 1 43  ? 14.394  10.963  -7.112  1.00 0.00 ? 43  LEU A HD13 5  
ATOM 10279 H HD21 . LEU A 1 43  ? 12.294  10.022  -4.847  1.00 0.00 ? 43  LEU A HD21 5  
ATOM 10280 H HD22 . LEU A 1 43  ? 11.179  9.374   -6.075  1.00 0.00 ? 43  LEU A HD22 5  
ATOM 10281 H HD23 . LEU A 1 43  ? 12.917  9.148   -6.269  1.00 0.00 ? 43  LEU A HD23 5  
ATOM 10282 N N    . GLU A 1 44  ? 9.196   11.113  -4.170  1.00 0.00 ? 44  GLU A N    5  
ATOM 10283 C CA   . GLU A 1 44  ? 8.597   10.179  -3.196  1.00 0.00 ? 44  GLU A CA   5  
ATOM 10284 C C    . GLU A 1 44  ? 7.146   10.662  -2.839  1.00 0.00 ? 44  GLU A C    5  
ATOM 10285 O O    . GLU A 1 44  ? 6.950   11.506  -1.959  1.00 0.00 ? 44  GLU A O    5  
ATOM 10286 C CB   . GLU A 1 44  ? 9.592   10.107  -1.985  1.00 0.00 ? 44  GLU A CB   5  
ATOM 10287 C CG   . GLU A 1 44  ? 9.988   11.393  -1.180  1.00 0.00 ? 44  GLU A CG   5  
ATOM 10288 C CD   . GLU A 1 44  ? 10.874  12.429  -1.877  1.00 0.00 ? 44  GLU A CD   5  
ATOM 10289 O OE1  . GLU A 1 44  ? 10.355  13.207  -2.707  1.00 0.00 ? 44  GLU A OE1  5  
ATOM 10290 O OE2  . GLU A 1 44  ? 12.087  12.482  -1.604  1.00 0.00 ? 44  GLU A OE2  5  
ATOM 10291 H H    . GLU A 1 44  ? 9.722   11.931  -3.807  1.00 0.00 ? 44  GLU A H    5  
ATOM 10292 H HA   . GLU A 1 44  ? 8.531   9.163   -3.634  1.00 0.00 ? 44  GLU A HA   5  
ATOM 10293 H HB2  . GLU A 1 44  ? 9.184   9.376   -1.264  1.00 0.00 ? 44  GLU A HB2  5  
ATOM 10294 H HB3  . GLU A 1 44  ? 10.531  9.633   -2.332  1.00 0.00 ? 44  GLU A HB3  5  
ATOM 10295 H HG2  . GLU A 1 44  ? 9.088   11.924  -0.826  1.00 0.00 ? 44  GLU A HG2  5  
ATOM 10296 H HG3  . GLU A 1 44  ? 10.522  11.099  -0.260  1.00 0.00 ? 44  GLU A HG3  5  
ATOM 10297 N N    . GLU A 1 45  ? 6.109   10.077  -3.476  1.00 0.00 ? 45  GLU A N    5  
ATOM 10298 C CA   . GLU A 1 45  ? 4.697   10.534  -3.296  1.00 0.00 ? 45  GLU A CA   5  
ATOM 10299 C C    . GLU A 1 45  ? 4.041   10.032  -1.950  1.00 0.00 ? 45  GLU A C    5  
ATOM 10300 O O    . GLU A 1 45  ? 4.563   10.250  -0.851  1.00 0.00 ? 45  GLU A O    5  
ATOM 10301 C CB   . GLU A 1 45  ? 3.962   10.115  -4.624  1.00 0.00 ? 45  GLU A CB   5  
ATOM 10302 C CG   . GLU A 1 45  ? 4.183   10.997  -5.877  1.00 0.00 ? 45  GLU A CG   5  
ATOM 10303 C CD   . GLU A 1 45  ? 3.323   10.606  -7.080  1.00 0.00 ? 45  GLU A CD   5  
ATOM 10304 O OE1  . GLU A 1 45  ? 2.080   10.493  -6.963  1.00 0.00 ? 45  GLU A OE1  5  
ATOM 10305 O OE2  . GLU A 1 45  ? 3.901   10.437  -8.173  1.00 0.00 ? 45  GLU A OE2  5  
ATOM 10306 H H    . GLU A 1 45  ? 6.373   9.417   -4.214  1.00 0.00 ? 45  GLU A H    5  
ATOM 10307 H HA   . GLU A 1 45  ? 4.624   11.629  -3.223  1.00 0.00 ? 45  GLU A HA   5  
ATOM 10308 H HB2  . GLU A 1 45  ? 4.156   9.050   -4.864  1.00 0.00 ? 45  GLU A HB2  5  
ATOM 10309 H HB3  . GLU A 1 45  ? 2.869   10.151  -4.463  1.00 0.00 ? 45  GLU A HB3  5  
ATOM 10310 H HG2  . GLU A 1 45  ? 3.956   12.054  -5.659  1.00 0.00 ? 45  GLU A HG2  5  
ATOM 10311 H HG3  . GLU A 1 45  ? 5.242   10.973  -6.190  1.00 0.00 ? 45  GLU A HG3  5  
ATOM 10312 N N    . LYS A 1 46  ? 2.886   9.369   -2.038  1.00 0.00 ? 46  LYS A N    5  
ATOM 10313 C CA   . LYS A 1 46  ? 2.059   8.887   -0.897  1.00 0.00 ? 46  LYS A CA   5  
ATOM 10314 C C    . LYS A 1 46  ? 1.094   7.756   -1.404  1.00 0.00 ? 46  LYS A C    5  
ATOM 10315 O O    . LYS A 1 46  ? 0.936   7.532   -2.618  1.00 0.00 ? 46  LYS A O    5  
ATOM 10316 C CB   . LYS A 1 46  ? 1.312   10.140  -0.326  1.00 0.00 ? 46  LYS A CB   5  
ATOM 10317 C CG   . LYS A 1 46  ? 0.658   10.002  1.068   1.00 0.00 ? 46  LYS A CG   5  
ATOM 10318 C CD   . LYS A 1 46  ? 0.195   11.369  1.622   1.00 0.00 ? 46  LYS A CD   5  
ATOM 10319 C CE   . LYS A 1 46  ? -0.228  11.289  3.099   1.00 0.00 ? 46  LYS A CE   5  
ATOM 10320 N NZ   . LYS A 1 46  ? -0.912  12.541  3.518   1.00 0.00 ? 46  LYS A NZ   5  
ATOM 10321 H H    . LYS A 1 46  ? 2.596   9.293   -3.018  1.00 0.00 ? 46  LYS A H    5  
ATOM 10322 H HA   . LYS A 1 46  ? 2.722   8.450   -0.128  1.00 0.00 ? 46  LYS A HA   5  
ATOM 10323 H HB2  . LYS A 1 46  ? 2.031   10.982  -0.263  1.00 0.00 ? 46  LYS A HB2  5  
ATOM 10324 H HB3  . LYS A 1 46  ? 0.555   10.483  -1.059  1.00 0.00 ? 46  LYS A HB3  5  
ATOM 10325 H HG2  . LYS A 1 46  ? -0.205  9.309   1.015   1.00 0.00 ? 46  LYS A HG2  5  
ATOM 10326 H HG3  . LYS A 1 46  ? 1.364   9.527   1.771   1.00 0.00 ? 46  LYS A HG3  5  
ATOM 10327 H HD2  . LYS A 1 46  ? 1.002   12.123  1.517   1.00 0.00 ? 46  LYS A HD2  5  
ATOM 10328 H HD3  . LYS A 1 46  ? -0.637  11.739  0.990   1.00 0.00 ? 46  LYS A HD3  5  
ATOM 10329 H HE2  . LYS A 1 46  ? -0.901  10.425  3.256   1.00 0.00 ? 46  LYS A HE2  5  
ATOM 10330 H HE3  . LYS A 1 46  ? 0.643   11.076  3.756   1.00 0.00 ? 46  LYS A HE3  5  
ATOM 10331 H HZ1  . LYS A 1 46  ? -1.640  12.855  2.868   1.00 0.00 ? 46  LYS A HZ1  5  
ATOM 10332 H HZ2  . LYS A 1 46  ? -1.458  12.435  4.438   1.00 0.00 ? 46  LYS A HZ2  5  
ATOM 10333 H HZ3  . LYS A 1 46  ? -0.289  13.337  3.686   1.00 0.00 ? 46  LYS A HZ3  5  
ATOM 10334 N N    . ILE A 1 47  ? 0.439   7.010   -0.490  1.00 0.00 ? 47  ILE A N    5  
ATOM 10335 C CA   . ILE A 1 47  ? -0.533  5.955   -0.915  1.00 0.00 ? 47  ILE A CA   5  
ATOM 10336 C C    . ILE A 1 47  ? -1.957  6.358   -0.355  1.00 0.00 ? 47  ILE A C    5  
ATOM 10337 O O    . ILE A 1 47  ? -2.084  6.968   0.706   1.00 0.00 ? 47  ILE A O    5  
ATOM 10338 C CB   . ILE A 1 47  ? 0.110   4.563   -0.517  1.00 0.00 ? 47  ILE A CB   5  
ATOM 10339 C CG1  . ILE A 1 47  ? 0.013   3.528   -1.675  1.00 0.00 ? 47  ILE A CG1  5  
ATOM 10340 C CG2  . ILE A 1 47  ? -0.540  3.941   0.737   1.00 0.00 ? 47  ILE A CG2  5  
ATOM 10341 C CD1  . ILE A 1 47  ? 1.133   2.471   -1.661  1.00 0.00 ? 47  ILE A CD1  5  
ATOM 10342 H H    . ILE A 1 47  ? 0.592   7.200   0.516   1.00 0.00 ? 47  ILE A H    5  
ATOM 10343 H HA   . ILE A 1 47  ? -0.654  5.972   -2.013  1.00 0.00 ? 47  ILE A HA   5  
ATOM 10344 H HB   . ILE A 1 47  ? 1.191   4.691   -0.297  1.00 0.00 ? 47  ILE A HB   5  
ATOM 10345 H HG12 . ILE A 1 47  ? -0.987  3.055   -1.711  1.00 0.00 ? 47  ILE A HG12 5  
ATOM 10346 H HG13 . ILE A 1 47  ? 0.113   4.040   -2.651  1.00 0.00 ? 47  ILE A HG13 5  
ATOM 10347 H HG21 . ILE A 1 47  ? -0.528  4.673   1.555   1.00 0.00 ? 47  ILE A HG21 5  
ATOM 10348 H HG22 . ILE A 1 47  ? -1.602  3.663   0.572   1.00 0.00 ? 47  ILE A HG22 5  
ATOM 10349 H HG23 . ILE A 1 47  ? -0.006  3.043   1.091   1.00 0.00 ? 47  ILE A HG23 5  
ATOM 10350 H HD11 . ILE A 1 47  ? 1.208   1.940   -0.695  1.00 0.00 ? 47  ILE A HD11 5  
ATOM 10351 H HD12 . ILE A 1 47  ? 0.979   1.708   -2.445  1.00 0.00 ? 47  ILE A HD12 5  
ATOM 10352 H HD13 . ILE A 1 47  ? 2.121   2.933   -1.846  1.00 0.00 ? 47  ILE A HD13 5  
ATOM 10353 N N    . ASP A 1 48  ? -3.035  6.084   -1.101  1.00 0.00 ? 48  ASP A N    5  
ATOM 10354 C CA   . ASP A 1 48  ? -4.445  6.380   -0.675  1.00 0.00 ? 48  ASP A CA   5  
ATOM 10355 C C    . ASP A 1 48  ? -4.989  5.132   0.076   1.00 0.00 ? 48  ASP A C    5  
ATOM 10356 O O    . ASP A 1 48  ? -4.851  3.999   -0.385  1.00 0.00 ? 48  ASP A O    5  
ATOM 10357 C CB   . ASP A 1 48  ? -5.269  6.815   -1.929  1.00 0.00 ? 48  ASP A CB   5  
ATOM 10358 C CG   . ASP A 1 48  ? -6.780  6.645   -2.080  1.00 0.00 ? 48  ASP A CG   5  
ATOM 10359 O OD1  . ASP A 1 48  ? -7.435  5.952   -1.278  1.00 0.00 ? 48  ASP A OD1  5  
ATOM 10360 O OD2  . ASP A 1 48  ? -7.327  7.129   -3.096  1.00 0.00 ? 48  ASP A OD2  5  
ATOM 10361 H H    . ASP A 1 48  ? -2.800  5.544   -1.944  1.00 0.00 ? 48  ASP A H    5  
ATOM 10362 H HA   . ASP A 1 48  ? -4.460  7.241   0.022   1.00 0.00 ? 48  ASP A HA   5  
ATOM 10363 H HB2  . ASP A 1 48  ? -5.107  7.896   -2.039  1.00 0.00 ? 48  ASP A HB2  5  
ATOM 10364 H HB3  . ASP A 1 48  ? -4.855  6.370   -2.840  1.00 0.00 ? 48  ASP A HB3  5  
ATOM 10365 N N    . VAL A 1 49  ? -5.587  5.339   1.258   1.00 0.00 ? 49  VAL A N    5  
ATOM 10366 C CA   . VAL A 1 49  ? -6.144  4.261   2.132   1.00 0.00 ? 49  VAL A CA   5  
ATOM 10367 C C    . VAL A 1 49  ? -5.140  3.050   2.359   1.00 0.00 ? 49  VAL A C    5  
ATOM 10368 O O    . VAL A 1 49  ? -3.933  3.276   2.451   1.00 0.00 ? 49  VAL A O    5  
ATOM 10369 C CB   . VAL A 1 49  ? -7.632  3.989   1.652   1.00 0.00 ? 49  VAL A CB   5  
ATOM 10370 C CG1  . VAL A 1 49  ? -7.906  2.854   0.654   1.00 0.00 ? 49  VAL A CG1  5  
ATOM 10371 C CG2  . VAL A 1 49  ? -8.583  3.791   2.849   1.00 0.00 ? 49  VAL A CG2  5  
ATOM 10372 H H    . VAL A 1 49  ? -5.681  6.326   1.559   1.00 0.00 ? 49  VAL A H    5  
ATOM 10373 H HA   . VAL A 1 49  ? -6.177  4.714   3.142   1.00 0.00 ? 49  VAL A HA   5  
ATOM 10374 H HB   . VAL A 1 49  ? -7.998  4.909   1.153   1.00 0.00 ? 49  VAL A HB   5  
ATOM 10375 H HG11 . VAL A 1 49  ? -7.110  2.777   -0.109  1.00 0.00 ? 49  VAL A HG11 5  
ATOM 10376 H HG12 . VAL A 1 49  ? -7.990  1.873   1.151   1.00 0.00 ? 49  VAL A HG12 5  
ATOM 10377 H HG13 . VAL A 1 49  ? -8.872  3.007   0.140   1.00 0.00 ? 49  VAL A HG13 5  
ATOM 10378 H HG21 . VAL A 1 49  ? -8.559  4.674   3.510   1.00 0.00 ? 49  VAL A HG21 5  
ATOM 10379 H HG22 . VAL A 1 49  ? -9.634  3.650   2.534   1.00 0.00 ? 49  VAL A HG22 5  
ATOM 10380 H HG23 . VAL A 1 49  ? -8.321  2.914   3.471   1.00 0.00 ? 49  VAL A HG23 5  
ATOM 10381 N N    . VAL A 1 50  ? -5.692  2.069   3.064   1.00 0.00 ? 50  VAL A N    5  
ATOM 10382 C CA   . VAL A 1 50  ? -5.079  0.804   3.553   1.00 0.00 ? 50  VAL A CA   5  
ATOM 10383 C C    . VAL A 1 50  ? -6.334  0.142   4.267   1.00 0.00 ? 50  VAL A C    5  
ATOM 10384 O O    . VAL A 1 50  ? -6.781  -0.874  3.736   1.00 0.00 ? 50  VAL A O    5  
ATOM 10385 C CB   . VAL A 1 50  ? -3.741  0.934   4.388   1.00 0.00 ? 50  VAL A CB   5  
ATOM 10386 C CG1  . VAL A 1 50  ? -3.556  -0.074  5.545   1.00 0.00 ? 50  VAL A CG1  5  
ATOM 10387 C CG2  . VAL A 1 50  ? -2.480  0.750   3.505   1.00 0.00 ? 50  VAL A CG2  5  
ATOM 10388 H H    . VAL A 1 50  ? -6.618  1.932   2.622   1.00 0.00 ? 50  VAL A H    5  
ATOM 10389 H HA   . VAL A 1 50  ? -4.854  0.160   2.683   1.00 0.00 ? 50  VAL A HA   5  
ATOM 10390 H HB   . VAL A 1 50  ? -3.692  1.953   4.819   1.00 0.00 ? 50  VAL A HB   5  
ATOM 10391 H HG11 . VAL A 1 50  ? -4.379  -0.052  6.280   1.00 0.00 ? 50  VAL A HG11 5  
ATOM 10392 H HG12 . VAL A 1 50  ? -3.489  -1.115  5.179   1.00 0.00 ? 50  VAL A HG12 5  
ATOM 10393 H HG13 . VAL A 1 50  ? -2.640  0.152   6.116   1.00 0.00 ? 50  VAL A HG13 5  
ATOM 10394 H HG21 . VAL A 1 50  ? -2.449  -0.242  3.015   1.00 0.00 ? 50  VAL A HG21 5  
ATOM 10395 H HG22 . VAL A 1 50  ? -2.408  1.498   2.699   1.00 0.00 ? 50  VAL A HG22 5  
ATOM 10396 H HG23 . VAL A 1 50  ? -1.543  0.850   4.082   1.00 0.00 ? 50  VAL A HG23 5  
ATOM 10397 N N    . PRO A 1 51  ? -6.957  0.667   5.395   1.00 0.00 ? 51  PRO A N    5  
ATOM 10398 C CA   . PRO A 1 51  ? -8.067  -0.008  6.128   1.00 0.00 ? 51  PRO A CA   5  
ATOM 10399 C C    . PRO A 1 51  ? -9.548  0.432   5.835   1.00 0.00 ? 51  PRO A C    5  
ATOM 10400 O O    . PRO A 1 51  ? -9.804  1.571   5.440   1.00 0.00 ? 51  PRO A O    5  
ATOM 10401 C CB   . PRO A 1 51  ? -7.649  0.363   7.567   1.00 0.00 ? 51  PRO A CB   5  
ATOM 10402 C CG   . PRO A 1 51  ? -7.167  1.812   7.479   1.00 0.00 ? 51  PRO A CG   5  
ATOM 10403 C CD   . PRO A 1 51  ? -6.502  1.892   6.105   1.00 0.00 ? 51  PRO A CD   5  
ATOM 10404 H HA   . PRO A 1 51  ? -8.004  -1.098  5.995   1.00 0.00 ? 51  PRO A HA   5  
ATOM 10405 H HB2  . PRO A 1 51  ? -8.466  0.244   8.305   1.00 0.00 ? 51  PRO A HB2  5  
ATOM 10406 H HB3  . PRO A 1 51  ? -6.819  -0.289  7.900   1.00 0.00 ? 51  PRO A HB3  5  
ATOM 10407 H HG2  . PRO A 1 51  ? -8.033  2.499   7.519   1.00 0.00 ? 51  PRO A HG2  5  
ATOM 10408 H HG3  . PRO A 1 51  ? -6.492  2.099   8.305   1.00 0.00 ? 51  PRO A HG3  5  
ATOM 10409 H HD2  . PRO A 1 51  ? -6.811  2.807   5.564   1.00 0.00 ? 51  PRO A HD2  5  
ATOM 10410 H HD3  . PRO A 1 51  ? -5.409  1.945   6.227   1.00 0.00 ? 51  PRO A HD3  5  
ATOM 10411 N N    . ILE A 1 52  ? -10.531 -0.424  6.202   1.00 0.00 ? 52  ILE A N    5  
ATOM 10412 C CA   . ILE A 1 52  ? -12.000 -0.124  6.031   1.00 0.00 ? 52  ILE A CA   5  
ATOM 10413 C C    . ILE A 1 52  ? -12.521 0.876   7.119   1.00 0.00 ? 52  ILE A C    5  
ATOM 10414 O O    . ILE A 1 52  ? -12.928 2.009   6.841   1.00 0.00 ? 52  ILE A O    5  
ATOM 10415 C CB   . ILE A 1 52  ? -12.797 -1.495  5.884   1.00 0.00 ? 52  ILE A CB   5  
ATOM 10416 C CG1  . ILE A 1 52  ? -14.318 -1.293  5.618   1.00 0.00 ? 52  ILE A CG1  5  
ATOM 10417 C CG2  . ILE A 1 52  ? -12.705 -2.458  7.102   1.00 0.00 ? 52  ILE A CG2  5  
ATOM 10418 C CD1  . ILE A 1 52  ? -14.665 -0.658  4.266   1.00 0.00 ? 52  ILE A CD1  5  
ATOM 10419 H H    . ILE A 1 52  ? -10.208 -1.383  6.412   1.00 0.00 ? 52  ILE A H    5  
ATOM 10420 H HA   . ILE A 1 52  ? -12.147 0.427   5.120   1.00 0.00 ? 52  ILE A HA   5  
ATOM 10421 H HB   . ILE A 1 52  ? -12.392 -2.049  5.018   1.00 0.00 ? 52  ILE A HB   5  
ATOM 10422 H HG12 . ILE A 1 52  ? -14.837 -2.272  5.650   1.00 0.00 ? 52  ILE A HG12 5  
ATOM 10423 H HG13 . ILE A 1 52  ? -14.784 -0.703  6.431   1.00 0.00 ? 52  ILE A HG13 5  
ATOM 10424 H HG21 . ILE A 1 52  ? -11.678 -2.552  7.495   1.00 0.00 ? 52  ILE A HG21 5  
ATOM 10425 H HG22 . ILE A 1 52  ? -13.350 -2.161  7.944   1.00 0.00 ? 52  ILE A HG22 5  
ATOM 10426 H HG23 . ILE A 1 52  ? -13.010 -3.485  6.823   1.00 0.00 ? 52  ILE A HG23 5  
ATOM 10427 H HD11 . ILE A 1 52  ? -14.238 -1.218  3.417   1.00 0.00 ? 52  ILE A HD11 5  
ATOM 10428 H HD12 . ILE A 1 52  ? -15.754 -0.673  4.119   1.00 0.00 ? 52  ILE A HD12 5  
ATOM 10429 H HD13 . ILE A 1 52  ? -14.335 0.394   4.189   1.00 0.00 ? 52  ILE A HD13 5  
ATOM 10430 N N    . GLU A 1 53  ? -12.485 0.387   8.337   1.00 0.00 ? 53  GLU A N    5  
ATOM 10431 C CA   . GLU A 1 53  ? -12.854 1.089   9.589   1.00 0.00 ? 53  GLU A CA   5  
ATOM 10432 C C    . GLU A 1 53  ? -12.070 0.282   10.693  1.00 0.00 ? 53  GLU A C    5  
ATOM 10433 O O    . GLU A 1 53  ? -10.960 0.745   10.989  1.00 0.00 ? 53  GLU A O    5  
ATOM 10434 C CB   . GLU A 1 53  ? -14.399 1.241   9.663   1.00 0.00 ? 53  GLU A CB   5  
ATOM 10435 C CG   . GLU A 1 53  ? -14.951 1.947   10.920  1.00 0.00 ? 53  GLU A CG   5  
ATOM 10436 C CD   . GLU A 1 53  ? -16.463 2.016   10.887  1.00 0.00 ? 53  GLU A CD   5  
ATOM 10437 O OE1  . GLU A 1 53  ? -17.125 1.053   11.326  1.00 0.00 ? 53  GLU A OE1  5  
ATOM 10438 O OE2  . GLU A 1 53  ? -17.022 3.003   10.375  1.00 0.00 ? 53  GLU A OE2  5  
ATOM 10439 H H    . GLU A 1 53  ? -12.096 -0.551  8.215   1.00 0.00 ? 53  GLU A H    5  
ATOM 10440 H HA   . GLU A 1 53  ? -12.418 2.108   9.581   1.00 0.00 ? 53  GLU A HA   5  
ATOM 10441 H HB2  . GLU A 1 53  ? -14.722 1.837   8.786   1.00 0.00 ? 53  GLU A HB2  5  
ATOM 10442 H HB3  . GLU A 1 53  ? -14.904 0.270   9.510   1.00 0.00 ? 53  GLU A HB3  5  
ATOM 10443 H HG2  . GLU A 1 53  ? -14.652 1.433   11.850  1.00 0.00 ? 53  GLU A HG2  5  
ATOM 10444 H HG3  . GLU A 1 53  ? -14.564 2.979   10.998  1.00 0.00 ? 53  GLU A HG3  5  
ATOM 10445 N N    . PRO A 1 54  ? -12.445 -0.915  11.261  1.00 0.00 ? 54  PRO A N    5  
ATOM 10446 C CA   . PRO A 1 54  ? -11.567 -1.665  12.210  1.00 0.00 ? 54  PRO A CA   5  
ATOM 10447 C C    . PRO A 1 54  ? -10.413 -2.492  11.514  1.00 0.00 ? 54  PRO A C    5  
ATOM 10448 O O    . PRO A 1 54  ? -10.311 -3.712  11.674  1.00 0.00 ? 54  PRO A O    5  
ATOM 10449 C CB   . PRO A 1 54  ? -12.621 -2.520  12.948  1.00 0.00 ? 54  PRO A CB   5  
ATOM 10450 C CG   . PRO A 1 54  ? -13.660 -2.854  11.875  1.00 0.00 ? 54  PRO A CG   5  
ATOM 10451 C CD   . PRO A 1 54  ? -13.752 -1.568  11.054  1.00 0.00 ? 54  PRO A CD   5  
ATOM 10452 H HA   . PRO A 1 54  ? -11.081 -0.983  12.936  1.00 0.00 ? 54  PRO A HA   5  
ATOM 10453 H HB2  . PRO A 1 54  ? -12.197 -3.424  13.425  1.00 0.00 ? 54  PRO A HB2  5  
ATOM 10454 H HB3  . PRO A 1 54  ? -13.091 -1.930  13.761  1.00 0.00 ? 54  PRO A HB3  5  
ATOM 10455 H HG2  . PRO A 1 54  ? -13.298 -3.689  11.243  1.00 0.00 ? 54  PRO A HG2  5  
ATOM 10456 H HG3  . PRO A 1 54  ? -14.634 -3.161  12.298  1.00 0.00 ? 54  PRO A HG3  5  
ATOM 10457 H HD2  . PRO A 1 54  ? -13.964 -1.779  9.992   1.00 0.00 ? 54  PRO A HD2  5  
ATOM 10458 H HD3  . PRO A 1 54  ? -14.572 -0.933  11.444  1.00 0.00 ? 54  PRO A HD3  5  
ATOM 10459 N N    . HIS A 1 55  ? -9.524  -1.790  10.777  1.00 0.00 ? 55  HIS A N    5  
ATOM 10460 C CA   . HIS A 1 55  ? -8.339  -2.351  10.037  1.00 0.00 ? 55  HIS A CA   5  
ATOM 10461 C C    . HIS A 1 55  ? -8.713  -3.184  8.748   1.00 0.00 ? 55  HIS A C    5  
ATOM 10462 O O    . HIS A 1 55  ? -9.806  -3.739  8.628   1.00 0.00 ? 55  HIS A O    5  
ATOM 10463 C CB   . HIS A 1 55  ? -7.405  -3.201  10.963  1.00 0.00 ? 55  HIS A CB   5  
ATOM 10464 C CG   . HIS A 1 55  ? -6.892  -2.516  12.234  1.00 0.00 ? 55  HIS A CG   5  
ATOM 10465 N ND1  . HIS A 1 55  ? -6.178  -1.320  12.265  1.00 0.00 ? 55  HIS A ND1  5  
ATOM 10466 C CD2  . HIS A 1 55  ? -7.126  -2.993  13.533  1.00 0.00 ? 55  HIS A CD2  5  
ATOM 10467 C CE1  . HIS A 1 55  ? -6.057  -1.182  13.629  1.00 0.00 ? 55  HIS A CE1  5  
ATOM 10468 N NE2  . HIS A 1 55  ? -6.575  -2.134  14.464  1.00 0.00 ? 55  HIS A NE2  5  
ATOM 10469 H H    . HIS A 1 55  ? -9.779  -0.790  10.756  1.00 0.00 ? 55  HIS A H    5  
ATOM 10470 H HA   . HIS A 1 55  ? -7.758  -1.481  9.688   1.00 0.00 ? 55  HIS A HA   5  
ATOM 10471 H HB2  . HIS A 1 55  ? -7.917  -4.144  11.233  1.00 0.00 ? 55  HIS A HB2  5  
ATOM 10472 H HB3  . HIS A 1 55  ? -6.521  -3.537  10.391  1.00 0.00 ? 55  HIS A HB3  5  
ATOM 10473 H HD2  . HIS A 1 55  ? -7.685  -3.889  13.766  1.00 0.00 ? 55  HIS A HD2  5  
ATOM 10474 H HE1  . HIS A 1 55  ? -5.556  -0.317  14.043  1.00 0.00 ? 55  HIS A HE1  5  
ATOM 10475 H HE2  . HIS A 1 55  ? -6.585  -2.180  15.489  1.00 0.00 ? 55  HIS A HE2  5  
ATOM 10476 N N    . ALA A 1 56  ? -7.760  -3.260  7.783   1.00 0.00 ? 56  ALA A N    5  
ATOM 10477 C CA   . ALA A 1 56  ? -7.844  -4.049  6.504   1.00 0.00 ? 56  ALA A CA   5  
ATOM 10478 C C    . ALA A 1 56  ? -8.848  -3.535  5.413   1.00 0.00 ? 56  ALA A C    5  
ATOM 10479 O O    . ALA A 1 56  ? -10.036 -3.352  5.682   1.00 0.00 ? 56  ALA A O    5  
ATOM 10480 C CB   . ALA A 1 56  ? -8.172  -5.527  6.816   1.00 0.00 ? 56  ALA A CB   5  
ATOM 10481 H H    . ALA A 1 56  ? -6.905  -2.753  8.025   1.00 0.00 ? 56  ALA A H    5  
ATOM 10482 H HA   . ALA A 1 56  ? -6.833  -4.021  6.052   1.00 0.00 ? 56  ALA A HA   5  
ATOM 10483 H HB1  . ALA A 1 56  ? -7.517  -5.936  7.603   1.00 0.00 ? 56  ALA A HB1  5  
ATOM 10484 H HB2  . ALA A 1 56  ? -9.213  -5.661  7.167   1.00 0.00 ? 56  ALA A HB2  5  
ATOM 10485 H HB3  . ALA A 1 56  ? -8.058  -6.161  5.919   1.00 0.00 ? 56  ALA A HB3  5  
ATOM 10486 N N    . LEU A 1 57  ? -8.352  -3.257  4.189   1.00 0.00 ? 57  LEU A N    5  
ATOM 10487 C CA   . LEU A 1 57  ? -9.205  -2.860  3.021   1.00 0.00 ? 57  LEU A CA   5  
ATOM 10488 C C    . LEU A 1 57  ? -8.341  -3.008  1.738   1.00 0.00 ? 57  LEU A C    5  
ATOM 10489 O O    . LEU A 1 57  ? -8.262  -4.097  1.199   1.00 0.00 ? 57  LEU A O    5  
ATOM 10490 C CB   . LEU A 1 57  ? -9.948  -1.489  3.140   1.00 0.00 ? 57  LEU A CB   5  
ATOM 10491 C CG   . LEU A 1 57  ? -10.886 -1.067  1.970   1.00 0.00 ? 57  LEU A CG   5  
ATOM 10492 C CD1  . LEU A 1 57  ? -11.987 -2.098  1.658   1.00 0.00 ? 57  LEU A CD1  5  
ATOM 10493 C CD2  . LEU A 1 57  ? -11.506 0.319   2.203   1.00 0.00 ? 57  LEU A CD2  5  
ATOM 10494 H H    . LEU A 1 57  ? -7.349  -3.482  4.072   1.00 0.00 ? 57  LEU A H    5  
ATOM 10495 H HA   . LEU A 1 57  ? -10.006 -3.565  2.920   1.00 0.00 ? 57  LEU A HA   5  
ATOM 10496 H HB2  . LEU A 1 57  ? -10.586 -1.569  4.018   1.00 0.00 ? 57  LEU A HB2  5  
ATOM 10497 H HB3  . LEU A 1 57  ? -9.230  -0.680  3.355   1.00 0.00 ? 57  LEU A HB3  5  
ATOM 10498 H HG   . LEU A 1 57  ? -10.276 -0.969  1.061   1.00 0.00 ? 57  LEU A HG   5  
ATOM 10499 H HD11 . LEU A 1 57  ? -12.563 -2.387  2.554   1.00 0.00 ? 57  LEU A HD11 5  
ATOM 10500 H HD12 . LEU A 1 57  ? -12.707 -1.725  0.905   1.00 0.00 ? 57  LEU A HD12 5  
ATOM 10501 H HD13 . LEU A 1 57  ? -11.561 -3.029  1.238   1.00 0.00 ? 57  LEU A HD13 5  
ATOM 10502 H HD21 . LEU A 1 57  ? -10.747 1.073   2.482   1.00 0.00 ? 57  LEU A HD21 5  
ATOM 10503 H HD22 . LEU A 1 57  ? -12.011 0.693   1.293   1.00 0.00 ? 57  LEU A HD22 5  
ATOM 10504 H HD23 . LEU A 1 57  ? -12.269 0.304   2.995   1.00 0.00 ? 57  LEU A HD23 5  
ATOM 10505 N N    . PHE A 1 58  ? -7.822  -1.912  1.202   1.00 0.00 ? 58  PHE A N    5  
ATOM 10506 C CA   . PHE A 1 58  ? -7.025  -1.840  -0.066  1.00 0.00 ? 58  PHE A CA   5  
ATOM 10507 C C    . PHE A 1 58  ? -6.240  -0.477  -0.165  1.00 0.00 ? 58  PHE A C    5  
ATOM 10508 O O    . PHE A 1 58  ? -6.257  0.351   0.770   1.00 0.00 ? 58  PHE A O    5  
ATOM 10509 C CB   . PHE A 1 58  ? -7.939  -2.142  -1.313  1.00 0.00 ? 58  PHE A CB   5  
ATOM 10510 C CG   . PHE A 1 58  ? -9.291  -1.423  -1.517  1.00 0.00 ? 58  PHE A CG   5  
ATOM 10511 C CD1  . PHE A 1 58  ? -9.432  -0.041  -1.340  1.00 0.00 ? 58  PHE A CD1  5  
ATOM 10512 C CD2  . PHE A 1 58  ? -10.420 -2.187  -1.839  1.00 0.00 ? 58  PHE A CD2  5  
ATOM 10513 C CE1  . PHE A 1 58  ? -10.689 0.553   -1.421  1.00 0.00 ? 58  PHE A CE1  5  
ATOM 10514 C CE2  . PHE A 1 58  ? -11.669 -1.583  -1.956  1.00 0.00 ? 58  PHE A CE2  5  
ATOM 10515 C CZ   . PHE A 1 58  ? -11.800 -0.215  -1.746  1.00 0.00 ? 58  PHE A CZ   5  
ATOM 10516 H H    . PHE A 1 58  ? -7.994  -1.190  1.914   1.00 0.00 ? 58  PHE A H    5  
ATOM 10517 H HA   . PHE A 1 58  ? -6.237  -2.617  -0.024  1.00 0.00 ? 58  PHE A HA   5  
ATOM 10518 H HB2  . PHE A 1 58  ? -7.356  -2.038  -2.247  1.00 0.00 ? 58  PHE A HB2  5  
ATOM 10519 H HB3  . PHE A 1 58  ? -8.125  -3.230  -1.285  1.00 0.00 ? 58  PHE A HB3  5  
ATOM 10520 H HD1  . PHE A 1 58  ? -8.582  0.569   -1.085  1.00 0.00 ? 58  PHE A HD1  5  
ATOM 10521 H HD2  . PHE A 1 58  ? -10.340 -3.258  -1.971  1.00 0.00 ? 58  PHE A HD2  5  
ATOM 10522 H HE1  . PHE A 1 58  ? -10.810 1.608   -1.224  1.00 0.00 ? 58  PHE A HE1  5  
ATOM 10523 H HE2  . PHE A 1 58  ? -12.543 -2.172  -2.180  1.00 0.00 ? 58  PHE A HE2  5  
ATOM 10524 H HZ   . PHE A 1 58  ? -12.768 0.251   -1.835  1.00 0.00 ? 58  PHE A HZ   5  
ATOM 10525 N N    . LEU A 1 59  ? -5.530  -0.253  -1.307  1.00 0.00 ? 59  LEU A N    5  
ATOM 10526 C CA   . LEU A 1 59  ? -4.648  0.941   -1.461  1.00 0.00 ? 59  LEU A CA   5  
ATOM 10527 C C    . LEU A 1 59  ? -4.975  1.816   -2.733  1.00 0.00 ? 59  LEU A C    5  
ATOM 10528 O O    . LEU A 1 59  ? -5.796  1.482   -3.595  1.00 0.00 ? 59  LEU A O    5  
ATOM 10529 C CB   . LEU A 1 59  ? -3.180  0.379   -1.468  1.00 0.00 ? 59  LEU A CB   5  
ATOM 10530 C CG   . LEU A 1 59  ? -2.587  -0.099  -0.107  1.00 0.00 ? 59  LEU A CG   5  
ATOM 10531 C CD1  . LEU A 1 59  ? -2.816  -1.591  0.181   1.00 0.00 ? 59  LEU A CD1  5  
ATOM 10532 C CD2  . LEU A 1 59  ? -1.072  0.142   -0.036  1.00 0.00 ? 59  LEU A CD2  5  
ATOM 10533 H H    . LEU A 1 59  ? -5.570  -0.969  -2.058  1.00 0.00 ? 59  LEU A H    5  
ATOM 10534 H HA   . LEU A 1 59  ? -4.746  1.622   -0.594  1.00 0.00 ? 59  LEU A HA   5  
ATOM 10535 H HB2  . LEU A 1 59  ? -3.068  -0.419  -2.225  1.00 0.00 ? 59  LEU A HB2  5  
ATOM 10536 H HB3  . LEU A 1 59  ? -2.521  1.180   -1.851  1.00 0.00 ? 59  LEU A HB3  5  
ATOM 10537 H HG   . LEU A 1 59  ? -3.058  0.490   0.704   1.00 0.00 ? 59  LEU A HG   5  
ATOM 10538 H HD11 . LEU A 1 59  ? -2.389  -2.237  -0.610  1.00 0.00 ? 59  LEU A HD11 5  
ATOM 10539 H HD12 . LEU A 1 59  ? -2.357  -1.907  1.137   1.00 0.00 ? 59  LEU A HD12 5  
ATOM 10540 H HD13 . LEU A 1 59  ? -3.885  -1.841  0.261   1.00 0.00 ? 59  LEU A HD13 5  
ATOM 10541 H HD21 . LEU A 1 59  ? -0.525  -0.362  -0.855  1.00 0.00 ? 59  LEU A HD21 5  
ATOM 10542 H HD22 . LEU A 1 59  ? -0.854  1.218   -0.104  1.00 0.00 ? 59  LEU A HD22 5  
ATOM 10543 H HD23 . LEU A 1 59  ? -0.631  -0.203  0.919   1.00 0.00 ? 59  LEU A HD23 5  
ATOM 10544 N N    . GLY A 1 60  ? -4.260  2.948   -2.868  1.00 0.00 ? 60  GLY A N    5  
ATOM 10545 C CA   . GLY A 1 60  ? -4.332  3.857   -4.042  1.00 0.00 ? 60  GLY A CA   5  
ATOM 10546 C C    . GLY A 1 60  ? -3.131  4.838   -4.190  1.00 0.00 ? 60  GLY A C    5  
ATOM 10547 O O    . GLY A 1 60  ? -2.109  4.699   -3.523  1.00 0.00 ? 60  GLY A O    5  
ATOM 10548 H H    . GLY A 1 60  ? -3.687  3.162   -2.037  1.00 0.00 ? 60  GLY A H    5  
ATOM 10549 H HA2  . GLY A 1 60  ? -4.361  3.245   -4.961  1.00 0.00 ? 60  GLY A HA2  5  
ATOM 10550 H HA3  . GLY A 1 60  ? -5.284  4.419   -4.020  1.00 0.00 ? 60  GLY A HA3  5  
ATOM 10551 N N    . ILE A 1 61  ? -3.293  5.889   -5.015  1.00 0.00 ? 61  ILE A N    5  
ATOM 10552 C CA   . ILE A 1 61  ? -2.253  6.939   -5.348  1.00 0.00 ? 61  ILE A CA   5  
ATOM 10553 C C    . ILE A 1 61  ? -0.986  6.248   -5.949  1.00 0.00 ? 61  ILE A C    5  
ATOM 10554 O O    . ILE A 1 61  ? -1.090  5.919   -7.135  1.00 0.00 ? 61  ILE A O    5  
ATOM 10555 C CB   . ILE A 1 61  ? -2.014  8.023   -4.221  1.00 0.00 ? 61  ILE A CB   5  
ATOM 10556 C CG1  . ILE A 1 61  ? -3.289  8.890   -3.982  1.00 0.00 ? 61  ILE A CG1  5  
ATOM 10557 C CG2  . ILE A 1 61  ? -0.887  9.040   -4.595  1.00 0.00 ? 61  ILE A CG2  5  
ATOM 10558 C CD1  . ILE A 1 61  ? -3.285  9.728   -2.686  1.00 0.00 ? 61  ILE A CD1  5  
ATOM 10559 H H    . ILE A 1 61  ? -4.183  5.837   -5.528  1.00 0.00 ? 61  ILE A H    5  
ATOM 10560 H HA   . ILE A 1 61  ? -2.620  7.501   -6.212  1.00 0.00 ? 61  ILE A HA   5  
ATOM 10561 H HB   . ILE A 1 61  ? -1.737  7.503   -3.287  1.00 0.00 ? 61  ILE A HB   5  
ATOM 10562 H HG12 . ILE A 1 61  ? -3.469  9.561   -4.844  1.00 0.00 ? 61  ILE A HG12 5  
ATOM 10563 H HG13 . ILE A 1 61  ? -4.179  8.239   -3.976  1.00 0.00 ? 61  ILE A HG13 5  
ATOM 10564 H HG21 . ILE A 1 61  ? 0.087   8.569   -4.811  1.00 0.00 ? 61  ILE A HG21 5  
ATOM 10565 H HG22 . ILE A 1 61  ? -1.133  9.648   -5.486  1.00 0.00 ? 61  ILE A HG22 5  
ATOM 10566 H HG23 . ILE A 1 61  ? -0.674  9.744   -3.771  1.00 0.00 ? 61  ILE A HG23 5  
ATOM 10567 H HD11 . ILE A 1 61  ? -3.043  9.114   -1.798  1.00 0.00 ? 61  ILE A HD11 5  
ATOM 10568 H HD12 . ILE A 1 61  ? -2.549  10.551  -2.725  1.00 0.00 ? 61  ILE A HD12 5  
ATOM 10569 H HD13 . ILE A 1 61  ? -4.272  10.191  -2.501  1.00 0.00 ? 61  ILE A HD13 5  
ATOM 10570 N N    . HIS A 1 62  ? 0.147   6.004   -5.233  1.00 0.00 ? 62  HIS A N    5  
ATOM 10571 C CA   . HIS A 1 62  ? 1.411   5.445   -5.834  1.00 0.00 ? 62  HIS A CA   5  
ATOM 10572 C C    . HIS A 1 62  ? 2.023   6.507   -6.827  1.00 0.00 ? 62  HIS A C    5  
ATOM 10573 O O    . HIS A 1 62  ? 3.009   7.150   -6.468  1.00 0.00 ? 62  HIS A O    5  
ATOM 10574 C CB   . HIS A 1 62  ? 1.176   3.987   -6.384  1.00 0.00 ? 62  HIS A CB   5  
ATOM 10575 C CG   . HIS A 1 62  ? 2.117   3.422   -7.461  1.00 0.00 ? 62  HIS A CG   5  
ATOM 10576 N ND1  . HIS A 1 62  ? 3.499   3.559   -7.457  1.00 0.00 ? 62  HIS A ND1  5  
ATOM 10577 C CD2  . HIS A 1 62  ? 1.692   2.791   -8.647  1.00 0.00 ? 62  HIS A CD2  5  
ATOM 10578 C CE1  . HIS A 1 62  ? 3.785   3.002   -8.677  1.00 0.00 ? 62  HIS A CE1  5  
ATOM 10579 N NE2  . HIS A 1 62  ? 2.778   2.494   -9.452  1.00 0.00 ? 62  HIS A NE2  5  
ATOM 10580 H H    . HIS A 1 62  ? 0.126   6.354   -4.260  1.00 0.00 ? 62  HIS A H    5  
ATOM 10581 H HA   . HIS A 1 62  ? 2.165   5.368   -5.027  1.00 0.00 ? 62  HIS A HA   5  
ATOM 10582 H HB2  . HIS A 1 62  ? 1.216   3.302   -5.519  1.00 0.00 ? 62  HIS A HB2  5  
ATOM 10583 H HB3  . HIS A 1 62  ? 0.141   3.868   -6.751  1.00 0.00 ? 62  HIS A HB3  5  
ATOM 10584 H HD2  . HIS A 1 62  ? 0.661   2.618   -8.921  1.00 0.00 ? 62  HIS A HD2  5  
ATOM 10585 H HE1  . HIS A 1 62  ? 4.804   3.012   -9.041  1.00 0.00 ? 62  HIS A HE1  5  
ATOM 10586 H HE2  . HIS A 1 62  ? 2.804   2.128   -10.410 1.00 0.00 ? 62  HIS A HE2  5  
ATOM 10587 N N    . GLY A 1 63  ? 1.470   6.652   -8.045  1.00 0.00 ? 63  GLY A N    5  
ATOM 10588 C CA   . GLY A 1 63  ? 1.914   7.651   -9.045  1.00 0.00 ? 63  GLY A CA   5  
ATOM 10589 C C    . GLY A 1 63  ? 0.713   8.335   -9.719  1.00 0.00 ? 63  GLY A C    5  
ATOM 10590 O O    . GLY A 1 63  ? 0.232   7.853   -10.747 1.00 0.00 ? 63  GLY A O    5  
ATOM 10591 H H    . GLY A 1 63  ? 0.632   6.067   -8.170  1.00 0.00 ? 63  GLY A H    5  
ATOM 10592 H HA2  . GLY A 1 63  ? 2.590   8.409   -8.611  1.00 0.00 ? 63  GLY A HA2  5  
ATOM 10593 H HA3  . GLY A 1 63  ? 2.512   7.148   -9.826  1.00 0.00 ? 63  GLY A HA3  5  
ATOM 10594 N N    . GLY A 1 64  ? 0.197   9.419   -9.117  1.00 0.00 ? 64  GLY A N    5  
ATOM 10595 C CA   . GLY A 1 64  ? -0.957  10.171  -9.692  1.00 0.00 ? 64  GLY A CA   5  
ATOM 10596 C C    . GLY A 1 64  ? -2.388  9.589   -9.566  1.00 0.00 ? 64  GLY A C    5  
ATOM 10597 O O    . GLY A 1 64  ? -3.087  9.446   -10.569 1.00 0.00 ? 64  GLY A O    5  
ATOM 10598 H H    . GLY A 1 64  ? 0.734   9.722   -8.281  1.00 0.00 ? 64  GLY A H    5  
ATOM 10599 H HA2  . GLY A 1 64  ? -0.970  11.181  -9.246  1.00 0.00 ? 64  GLY A HA2  5  
ATOM 10600 H HA3  . GLY A 1 64  ? -0.771  10.352  -10.768 1.00 0.00 ? 64  GLY A HA3  5  
ATOM 10601 N N    . LYS A 1 65  ? -2.846  9.331   -8.329  1.00 0.00 ? 65  LYS A N    5  
ATOM 10602 C CA   . LYS A 1 65  ? -4.222  8.813   -8.009  1.00 0.00 ? 65  LYS A CA   5  
ATOM 10603 C C    . LYS A 1 65  ? -4.613  7.447   -8.703  1.00 0.00 ? 65  LYS A C    5  
ATOM 10604 O O    . LYS A 1 65  ? -5.681  7.289   -9.301  1.00 0.00 ? 65  LYS A O    5  
ATOM 10605 C CB   . LYS A 1 65  ? -5.261  9.965   -8.246  1.00 0.00 ? 65  LYS A CB   5  
ATOM 10606 C CG   . LYS A 1 65  ? -6.273  10.201  -7.091  1.00 0.00 ? 65  LYS A CG   5  
ATOM 10607 C CD   . LYS A 1 65  ? -7.246  9.030   -6.815  1.00 0.00 ? 65  LYS A CD   5  
ATOM 10608 C CE   . LYS A 1 65  ? -8.401  9.342   -5.839  1.00 0.00 ? 65  LYS A CE   5  
ATOM 10609 N NZ   . LYS A 1 65  ? -7.973  9.310   -4.408  1.00 0.00 ? 65  LYS A NZ   5  
ATOM 10610 H H    . LYS A 1 65  ? -2.131  9.487   -7.612  1.00 0.00 ? 65  LYS A H    5  
ATOM 10611 H HA   . LYS A 1 65  ? -4.251  8.578   -6.932  1.00 0.00 ? 65  LYS A HA   5  
ATOM 10612 H HB2  . LYS A 1 65  ? -4.746  10.932  -8.411  1.00 0.00 ? 65  LYS A HB2  5  
ATOM 10613 H HB3  . LYS A 1 65  ? -5.793  9.811   -9.206  1.00 0.00 ? 65  LYS A HB3  5  
ATOM 10614 H HG2  . LYS A 1 65  ? -5.719  10.464  -6.169  1.00 0.00 ? 65  LYS A HG2  5  
ATOM 10615 H HG3  . LYS A 1 65  ? -6.858  11.109  -7.339  1.00 0.00 ? 65  LYS A HG3  5  
ATOM 10616 H HD2  . LYS A 1 65  ? -7.690  8.742   -7.786  1.00 0.00 ? 65  LYS A HD2  5  
ATOM 10617 H HD3  . LYS A 1 65  ? -6.694  8.124   -6.494  1.00 0.00 ? 65  LYS A HD3  5  
ATOM 10618 H HE2  . LYS A 1 65  ? -8.855  10.323  -6.104  1.00 0.00 ? 65  LYS A HE2  5  
ATOM 10619 H HE3  . LYS A 1 65  ? -9.226  8.617   -6.012  1.00 0.00 ? 65  LYS A HE3  5  
ATOM 10620 H HZ1  . LYS A 1 65  ? -7.157  9.900   -4.214  1.00 0.00 ? 65  LYS A HZ1  5  
ATOM 10621 H HZ2  . LYS A 1 65  ? -8.700  9.596   -3.739  1.00 0.00 ? 65  LYS A HZ2  5  
ATOM 10622 H HZ3  . LYS A 1 65  ? -7.690  8.359   -4.031  1.00 0.00 ? 65  LYS A HZ3  5  
ATOM 10623 N N    . MET A 1 66  ? -3.795  6.397   -8.524  1.00 0.00 ? 66  MET A N    5  
ATOM 10624 C CA   . MET A 1 66  ? -4.105  5.039   -9.063  1.00 0.00 ? 66  MET A CA   5  
ATOM 10625 C C    . MET A 1 66  ? -4.999  4.210   -8.062  1.00 0.00 ? 66  MET A C    5  
ATOM 10626 O O    . MET A 1 66  ? -5.072  4.503   -6.866  1.00 0.00 ? 66  MET A O    5  
ATOM 10627 C CB   . MET A 1 66  ? -2.763  4.298   -9.345  1.00 0.00 ? 66  MET A CB   5  
ATOM 10628 C CG   . MET A 1 66  ? -1.728  4.969   -10.281 1.00 0.00 ? 66  MET A CG   5  
ATOM 10629 S SD   . MET A 1 66  ? -2.365  5.243   -11.946 1.00 0.00 ? 66  MET A SD   5  
ATOM 10630 C CE   . MET A 1 66  ? -2.014  3.645   -12.699 1.00 0.00 ? 66  MET A CE   5  
ATOM 10631 H H    . MET A 1 66  ? -2.898  6.598   -8.056  1.00 0.00 ? 66  MET A H    5  
ATOM 10632 H HA   . MET A 1 66  ? -4.652  5.126   -10.018 1.00 0.00 ? 66  MET A HA   5  
ATOM 10633 H HB2  . MET A 1 66  ? -2.258  4.092   -8.384  1.00 0.00 ? 66  MET A HB2  5  
ATOM 10634 H HB3  . MET A 1 66  ? -2.989  3.295   -9.756  1.00 0.00 ? 66  MET A HB3  5  
ATOM 10635 H HG2  . MET A 1 66  ? -1.412  5.946   -9.873  1.00 0.00 ? 66  MET A HG2  5  
ATOM 10636 H HG3  . MET A 1 66  ? -0.803  4.365   -10.334 1.00 0.00 ? 66  MET A HG3  5  
ATOM 10637 H HE1  . MET A 1 66  ? -0.963  3.345   -12.535 1.00 0.00 ? 66  MET A HE1  5  
ATOM 10638 H HE2  . MET A 1 66  ? -2.669  2.874   -12.259 1.00 0.00 ? 66  MET A HE2  5  
ATOM 10639 H HE3  . MET A 1 66  ? -2.196  3.672   -13.787 1.00 0.00 ? 66  MET A HE3  5  
ATOM 10640 N N    . CYS A 1 67  ? -5.713  3.184   -8.550  1.00 0.00 ? 67  CYS A N    5  
ATOM 10641 C CA   . CYS A 1 67  ? -6.471  2.217   -7.706  1.00 0.00 ? 67  CYS A CA   5  
ATOM 10642 C C    . CYS A 1 67  ? -5.577  0.941   -7.546  1.00 0.00 ? 67  CYS A C    5  
ATOM 10643 O O    . CYS A 1 67  ? -5.219  0.329   -8.561  1.00 0.00 ? 67  CYS A O    5  
ATOM 10644 C CB   . CYS A 1 67  ? -7.819  1.929   -8.395  1.00 0.00 ? 67  CYS A CB   5  
ATOM 10645 S SG   . CYS A 1 67  ? -8.883  0.898   -7.328  1.00 0.00 ? 67  CYS A SG   5  
ATOM 10646 H H    . CYS A 1 67  ? -5.605  3.023   -9.561  1.00 0.00 ? 67  CYS A H    5  
ATOM 10647 H HA   . CYS A 1 67  ? -6.690  2.651   -6.710  1.00 0.00 ? 67  CYS A HA   5  
ATOM 10648 H HB2  . CYS A 1 67  ? -8.361  2.867   -8.616  1.00 0.00 ? 67  CYS A HB2  5  
ATOM 10649 H HB3  . CYS A 1 67  ? -7.677  1.424   -9.369  1.00 0.00 ? 67  CYS A HB3  5  
ATOM 10650 H HG   . CYS A 1 67  ? -8.151  -0.212  -7.354  1.00 0.00 ? 67  CYS A HG   5  
ATOM 10651 N N    . LEU A 1 68  ? -5.221  0.550   -6.299  1.00 0.00 ? 68  LEU A N    5  
ATOM 10652 C CA   . LEU A 1 68  ? -4.246  -0.553  -6.026  1.00 0.00 ? 68  LEU A CA   5  
ATOM 10653 C C    . LEU A 1 68  ? -4.872  -1.809  -5.283  1.00 0.00 ? 68  LEU A C    5  
ATOM 10654 O O    . LEU A 1 68  ? -5.301  -1.764  -4.113  1.00 0.00 ? 68  LEU A O    5  
ATOM 10655 C CB   . LEU A 1 68  ? -3.071  0.085   -5.215  1.00 0.00 ? 68  LEU A CB   5  
ATOM 10656 C CG   . LEU A 1 68  ? -1.803  0.525   -5.994  1.00 0.00 ? 68  LEU A CG   5  
ATOM 10657 C CD1  . LEU A 1 68  ? -2.070  1.588   -7.070  1.00 0.00 ? 68  LEU A CD1  5  
ATOM 10658 C CD2  . LEU A 1 68  ? -0.742  1.070   -5.020  1.00 0.00 ? 68  LEU A CD2  5  
ATOM 10659 H H    . LEU A 1 68  ? -5.575  1.127   -5.522  1.00 0.00 ? 68  LEU A H    5  
ATOM 10660 H HA   . LEU A 1 68  ? -3.804  -0.904  -6.980  1.00 0.00 ? 68  LEU A HA   5  
ATOM 10661 H HB2  . LEU A 1 68  ? -3.410  0.943   -4.617  1.00 0.00 ? 68  LEU A HB2  5  
ATOM 10662 H HB3  . LEU A 1 68  ? -2.748  -0.631  -4.442  1.00 0.00 ? 68  LEU A HB3  5  
ATOM 10663 H HG   . LEU A 1 68  ? -1.376  -0.365  -6.493  1.00 0.00 ? 68  LEU A HG   5  
ATOM 10664 H HD11 . LEU A 1 68  ? -2.532  2.500   -6.648  1.00 0.00 ? 68  LEU A HD11 5  
ATOM 10665 H HD12 . LEU A 1 68  ? -1.143  1.893   -7.586  1.00 0.00 ? 68  LEU A HD12 5  
ATOM 10666 H HD13 . LEU A 1 68  ? -2.746  1.215   -7.860  1.00 0.00 ? 68  LEU A HD13 5  
ATOM 10667 H HD21 . LEU A 1 68  ? -0.545  0.381   -4.178  1.00 0.00 ? 68  LEU A HD21 5  
ATOM 10668 H HD22 . LEU A 1 68  ? 0.226   1.219   -5.530  1.00 0.00 ? 68  LEU A HD22 5  
ATOM 10669 H HD23 . LEU A 1 68  ? -1.039  2.040   -4.576  1.00 0.00 ? 68  LEU A HD23 5  
ATOM 10670 N N    . SER A 1 69  ? -4.817  -2.920  -6.054  1.00 0.00 ? 69  SER A N    5  
ATOM 10671 C CA   . SER A 1 69  ? -5.304  -4.300  -5.748  1.00 0.00 ? 69  SER A CA   5  
ATOM 10672 C C    . SER A 1 69  ? -4.194  -5.389  -6.004  1.00 0.00 ? 69  SER A C    5  
ATOM 10673 O O    . SER A 1 69  ? -3.050  -5.092  -6.367  1.00 0.00 ? 69  SER A O    5  
ATOM 10674 C CB   . SER A 1 69  ? -6.506  -4.521  -6.697  1.00 0.00 ? 69  SER A CB   5  
ATOM 10675 O OG   . SER A 1 69  ? -6.146  -4.864  -8.039  1.00 0.00 ? 69  SER A OG   5  
ATOM 10676 H H    . SER A 1 69  ? -4.422  -2.756  -6.988  1.00 0.00 ? 69  SER A H    5  
ATOM 10677 H HA   . SER A 1 69  ? -5.721  -4.447  -4.725  1.00 0.00 ? 69  SER A HA   5  
ATOM 10678 H HB2  . SER A 1 69  ? -7.094  -5.359  -6.309  1.00 0.00 ? 69  SER A HB2  5  
ATOM 10679 H HB3  . SER A 1 69  ? -7.197  -3.661  -6.677  1.00 0.00 ? 69  SER A HB3  5  
ATOM 10680 H HG   . SER A 1 69  ? -5.326  -4.386  -8.284  1.00 0.00 ? 69  SER A HG   5  
ATOM 10681 N N    . CYS A 1 70  ? -4.541  -6.672  -5.809  1.00 0.00 ? 70  CYS A N    5  
ATOM 10682 C CA   . CYS A 1 70  ? -3.666  -7.817  -6.172  1.00 0.00 ? 70  CYS A CA   5  
ATOM 10683 C C    . CYS A 1 70  ? -4.003  -8.254  -7.643  1.00 0.00 ? 70  CYS A C    5  
ATOM 10684 O O    . CYS A 1 70  ? -4.884  -9.093  -7.862  1.00 0.00 ? 70  CYS A O    5  
ATOM 10685 C CB   . CYS A 1 70  ? -3.943  -8.904  -5.112  1.00 0.00 ? 70  CYS A CB   5  
ATOM 10686 S SG   . CYS A 1 70  ? -2.838  -10.329 -5.357  1.00 0.00 ? 70  CYS A SG   5  
ATOM 10687 H H    . CYS A 1 70  ? -5.510  -6.820  -5.517  1.00 0.00 ? 70  CYS A H    5  
ATOM 10688 H HA   . CYS A 1 70  ? -2.594  -7.538  -6.111  1.00 0.00 ? 70  CYS A HA   5  
ATOM 10689 H HB2  . CYS A 1 70  ? -3.799  -8.516  -4.087  1.00 0.00 ? 70  CYS A HB2  5  
ATOM 10690 H HB3  . CYS A 1 70  ? -4.990  -9.259  -5.164  1.00 0.00 ? 70  CYS A HB3  5  
ATOM 10691 H HG   . CYS A 1 70  ? -1.730  -9.740  -4.919  1.00 0.00 ? 70  CYS A HG   5  
ATOM 10692 N N    . VAL A 1 71  ? -3.342  -7.654  -8.657  1.00 0.00 ? 71  VAL A N    5  
ATOM 10693 C CA   . VAL A 1 71  ? -3.655  -7.923  -10.103 1.00 0.00 ? 71  VAL A CA   5  
ATOM 10694 C C    . VAL A 1 71  ? -2.459  -8.640  -10.808 1.00 0.00 ? 71  VAL A C    5  
ATOM 10695 O O    . VAL A 1 71  ? -1.301  -8.289  -10.562 1.00 0.00 ? 71  VAL A O    5  
ATOM 10696 C CB   . VAL A 1 71  ? -4.063  -6.558  -10.775 1.00 0.00 ? 71  VAL A CB   5  
ATOM 10697 C CG1  . VAL A 1 71  ? -2.914  -5.578  -11.119 1.00 0.00 ? 71  VAL A CG1  5  
ATOM 10698 C CG2  . VAL A 1 71  ? -4.927  -6.740  -12.040 1.00 0.00 ? 71  VAL A CG2  5  
ATOM 10699 H H    . VAL A 1 71  ? -2.608  -6.983  -8.376  1.00 0.00 ? 71  VAL A H    5  
ATOM 10700 H HA   . VAL A 1 71  ? -4.529  -8.602  -10.177 1.00 0.00 ? 71  VAL A HA   5  
ATOM 10701 H HB   . VAL A 1 71  ? -4.724  -6.029  -10.059 1.00 0.00 ? 71  VAL A HB   5  
ATOM 10702 H HG11 . VAL A 1 71  ? -2.290  -5.356  -10.233 1.00 0.00 ? 71  VAL A HG11 5  
ATOM 10703 H HG12 . VAL A 1 71  ? -2.240  -5.967  -11.903 1.00 0.00 ? 71  VAL A HG12 5  
ATOM 10704 H HG13 . VAL A 1 71  ? -3.304  -4.608  -11.483 1.00 0.00 ? 71  VAL A HG13 5  
ATOM 10705 H HG21 . VAL A 1 71  ? -5.838  -7.330  -11.834 1.00 0.00 ? 71  VAL A HG21 5  
ATOM 10706 H HG22 . VAL A 1 71  ? -5.277  -5.766  -12.436 1.00 0.00 ? 71  VAL A HG22 5  
ATOM 10707 H HG23 . VAL A 1 71  ? -4.378  -7.242  -12.858 1.00 0.00 ? 71  VAL A HG23 5  
ATOM 10708 N N    . LYS A 1 72  ? -2.710  -9.630  -11.695 1.00 0.00 ? 72  LYS A N    5  
ATOM 10709 C CA   . LYS A 1 72  ? -1.607  -10.356 -12.395 1.00 0.00 ? 72  LYS A CA   5  
ATOM 10710 C C    . LYS A 1 72  ? -1.745  -10.361 -13.953 1.00 0.00 ? 72  LYS A C    5  
ATOM 10711 O O    . LYS A 1 72  ? -2.840  -10.531 -14.503 1.00 0.00 ? 72  LYS A O    5  
ATOM 10712 C CB   . LYS A 1 72  ? -1.494  -11.792 -11.774 1.00 0.00 ? 72  LYS A CB   5  
ATOM 10713 C CG   . LYS A 1 72  ? -2.122  -13.030 -12.452 1.00 0.00 ? 72  LYS A CG   5  
ATOM 10714 C CD   . LYS A 1 72  ? -3.657  -13.109 -12.414 1.00 0.00 ? 72  LYS A CD   5  
ATOM 10715 C CE   . LYS A 1 72  ? -4.149  -14.345 -13.187 1.00 0.00 ? 72  LYS A CE   5  
ATOM 10716 N NZ   . LYS A 1 72  ? -5.628  -14.454 -13.071 1.00 0.00 ? 72  LYS A NZ   5  
ATOM 10717 H H    . LYS A 1 72  ? -3.699  -9.851  -11.844 1.00 0.00 ? 72  LYS A H    5  
ATOM 10718 H HA   . LYS A 1 72  ? -0.661  -9.823  -12.198 1.00 0.00 ? 72  LYS A HA   5  
ATOM 10719 H HB2  . LYS A 1 72  ? -0.414  -12.021 -11.754 1.00 0.00 ? 72  LYS A HB2  5  
ATOM 10720 H HB3  . LYS A 1 72  ? -1.756  -11.784 -10.697 1.00 0.00 ? 72  LYS A HB3  5  
ATOM 10721 H HG2  . LYS A 1 72  ? -1.761  -13.075 -13.496 1.00 0.00 ? 72  LYS A HG2  5  
ATOM 10722 H HG3  . LYS A 1 72  ? -1.691  -13.938 -11.981 1.00 0.00 ? 72  LYS A HG3  5  
ATOM 10723 H HD2  . LYS A 1 72  ? -3.993  -13.128 -11.358 1.00 0.00 ? 72  LYS A HD2  5  
ATOM 10724 H HD3  . LYS A 1 72  ? -4.083  -12.184 -12.852 1.00 0.00 ? 72  LYS A HD3  5  
ATOM 10725 H HE2  . LYS A 1 72  ? -3.835  -14.276 -14.253 1.00 0.00 ? 72  LYS A HE2  5  
ATOM 10726 H HE3  . LYS A 1 72  ? -3.648  -15.266 -12.811 1.00 0.00 ? 72  LYS A HE3  5  
ATOM 10727 H HZ1  . LYS A 1 72  ? -6.110  -13.619 -13.429 1.00 0.00 ? 72  LYS A HZ1  5  
ATOM 10728 H HZ2  . LYS A 1 72  ? -6.021  -15.256 -13.582 1.00 0.00 ? 72  LYS A HZ2  5  
ATOM 10729 H HZ3  . LYS A 1 72  ? -5.936  -14.556 -12.096 1.00 0.00 ? 72  LYS A HZ3  5  
ATOM 10730 N N    . SER A 1 73  ? -0.600  -10.256 -14.663 1.00 0.00 ? 73  SER A N    5  
ATOM 10731 C CA   . SER A 1 73  ? -0.558  -10.307 -16.160 1.00 0.00 ? 73  SER A CA   5  
ATOM 10732 C C    . SER A 1 73  ? -0.383  -11.809 -16.595 1.00 0.00 ? 73  SER A C    5  
ATOM 10733 O O    . SER A 1 73  ? 0.666   -12.230 -17.094 1.00 0.00 ? 73  SER A O    5  
ATOM 10734 C CB   . SER A 1 73  ? 0.581   -9.388  -16.717 1.00 0.00 ? 73  SER A CB   5  
ATOM 10735 O OG   . SER A 1 73  ? 0.902   -8.256  -15.895 1.00 0.00 ? 73  SER A OG   5  
ATOM 10736 H H    . SER A 1 73  ? 0.253   -10.118 -14.101 1.00 0.00 ? 73  SER A H    5  
ATOM 10737 H HA   . SER A 1 73  ? -1.511  -9.931  -16.583 1.00 0.00 ? 73  SER A HA   5  
ATOM 10738 H HB2  . SER A 1 73  ? 1.509   -9.958  -16.925 1.00 0.00 ? 73  SER A HB2  5  
ATOM 10739 H HB3  . SER A 1 73  ? 0.276   -9.000  -17.707 1.00 0.00 ? 73  SER A HB3  5  
ATOM 10740 H HG   . SER A 1 73  ? 1.834   -8.372  -15.539 1.00 0.00 ? 73  SER A HG   5  
ATOM 10741 N N    . GLY A 1 74  ? -1.429  -12.638 -16.397 1.00 0.00 ? 74  GLY A N    5  
ATOM 10742 C CA   . GLY A 1 74  ? -1.329  -14.108 -16.629 1.00 0.00 ? 74  GLY A CA   5  
ATOM 10743 C C    . GLY A 1 74  ? -0.762  -14.858 -15.395 1.00 0.00 ? 74  GLY A C    5  
ATOM 10744 O O    . GLY A 1 74  ? -1.515  -15.497 -14.655 1.00 0.00 ? 74  GLY A O    5  
ATOM 10745 H H    . GLY A 1 74  ? -2.236  -12.170 -15.963 1.00 0.00 ? 74  GLY A H    5  
ATOM 10746 H HA2  . GLY A 1 74  ? -2.331  -14.511 -16.863 1.00 0.00 ? 74  GLY A HA2  5  
ATOM 10747 H HA3  . GLY A 1 74  ? -0.716  -14.335 -17.524 1.00 0.00 ? 74  GLY A HA3  5  
ATOM 10748 N N    . ASP A 1 75  ? 0.554   -14.725 -15.175 1.00 0.00 ? 75  ASP A N    5  
ATOM 10749 C CA   . ASP A 1 75  ? 1.299   -15.331 -14.029 1.00 0.00 ? 75  ASP A CA   5  
ATOM 10750 C C    . ASP A 1 75  ? 1.883   -14.278 -13.007 1.00 0.00 ? 75  ASP A C    5  
ATOM 10751 O O    . ASP A 1 75  ? 1.648   -14.381 -11.797 1.00 0.00 ? 75  ASP A O    5  
ATOM 10752 C CB   . ASP A 1 75  ? 2.416   -16.233 -14.645 1.00 0.00 ? 75  ASP A CB   5  
ATOM 10753 C CG   . ASP A 1 75  ? 3.571   -15.587 -15.436 1.00 0.00 ? 75  ASP A CG   5  
ATOM 10754 O OD1  . ASP A 1 75  ? 3.384   -14.505 -16.039 1.00 0.00 ? 75  ASP A OD1  5  
ATOM 10755 O OD2  . ASP A 1 75  ? 4.675   -16.170 -15.445 1.00 0.00 ? 75  ASP A OD2  5  
ATOM 10756 H H    . ASP A 1 75  ? 1.060   -14.170 -15.881 1.00 0.00 ? 75  ASP A H    5  
ATOM 10757 H HA   . ASP A 1 75  ? 0.629   -15.986 -13.439 1.00 0.00 ? 75  ASP A HA   5  
ATOM 10758 H HB2  . ASP A 1 75  ? 2.874   -16.820 -13.829 1.00 0.00 ? 75  ASP A HB2  5  
ATOM 10759 H HB3  . ASP A 1 75  ? 1.959   -16.994 -15.303 1.00 0.00 ? 75  ASP A HB3  5  
ATOM 10760 N N    . GLU A 1 76  ? 2.535   -13.209 -13.501 1.00 0.00 ? 76  GLU A N    5  
ATOM 10761 C CA   . GLU A 1 76  ? 3.244   -12.185 -12.687 1.00 0.00 ? 76  GLU A CA   5  
ATOM 10762 C C    . GLU A 1 76  ? 2.268   -11.227 -11.925 1.00 0.00 ? 76  GLU A C    5  
ATOM 10763 O O    . GLU A 1 76  ? 1.572   -10.399 -12.517 1.00 0.00 ? 76  GLU A O    5  
ATOM 10764 C CB   . GLU A 1 76  ? 4.170   -11.401 -13.672 1.00 0.00 ? 76  GLU A CB   5  
ATOM 10765 C CG   . GLU A 1 76  ? 3.557   -10.806 -14.983 1.00 0.00 ? 76  GLU A CG   5  
ATOM 10766 C CD   . GLU A 1 76  ? 3.924   -9.363  -15.252 1.00 0.00 ? 76  GLU A CD   5  
ATOM 10767 O OE1  . GLU A 1 76  ? 5.083   -9.084  -15.617 1.00 0.00 ? 76  GLU A OE1  5  
ATOM 10768 O OE2  . GLU A 1 76  ? 3.098   -8.468  -14.977 1.00 0.00 ? 76  GLU A OE2  5  
ATOM 10769 H H    . GLU A 1 76  ? 2.692   -13.287 -14.519 1.00 0.00 ? 76  GLU A H    5  
ATOM 10770 H HA   . GLU A 1 76  ? 3.899   -12.693 -11.952 1.00 0.00 ? 76  GLU A HA   5  
ATOM 10771 H HB2  . GLU A 1 76  ? 4.666   -10.599 -13.093 1.00 0.00 ? 76  GLU A HB2  5  
ATOM 10772 H HB3  . GLU A 1 76  ? 5.010   -12.057 -13.970 1.00 0.00 ? 76  GLU A HB3  5  
ATOM 10773 H HG2  . GLU A 1 76  ? 3.860   -11.406 -15.861 1.00 0.00 ? 76  GLU A HG2  5  
ATOM 10774 H HG3  . GLU A 1 76  ? 2.456   -10.884 -14.968 1.00 0.00 ? 76  GLU A HG3  5  
ATOM 10775 N N    . THR A 1 77  ? 2.213   -11.373 -10.584 1.00 0.00 ? 77  THR A N    5  
ATOM 10776 C CA   . THR A 1 77  ? 1.259   -10.615 -9.714  1.00 0.00 ? 77  THR A CA   5  
ATOM 10777 C C    . THR A 1 77  ? 1.901   -9.290  -9.179  1.00 0.00 ? 77  THR A C    5  
ATOM 10778 O O    . THR A 1 77  ? 2.996   -9.283  -8.607  1.00 0.00 ? 77  THR A O    5  
ATOM 10779 C CB   . THR A 1 77  ? 0.777   -11.572 -8.579  1.00 0.00 ? 77  THR A CB   5  
ATOM 10780 O OG1  . THR A 1 77  ? 0.319   -12.812 -9.124  1.00 0.00 ? 77  THR A OG1  5  
ATOM 10781 C CG2  . THR A 1 77  ? -0.420  -11.017 -7.789  1.00 0.00 ? 77  THR A CG2  5  
ATOM 10782 H H    . THR A 1 77  ? 2.853   -12.083 -10.213 1.00 0.00 ? 77  THR A H    5  
ATOM 10783 H HA   . THR A 1 77  ? 0.362   -10.344 -10.296 1.00 0.00 ? 77  THR A HA   5  
ATOM 10784 H HB   . THR A 1 77  ? 1.620   -11.768 -7.885  1.00 0.00 ? 77  THR A HB   5  
ATOM 10785 H HG1  . THR A 1 77  ? 0.928   -13.046 -9.835  1.00 0.00 ? 77  THR A HG1  5  
ATOM 10786 H HG21 . THR A 1 77  ? -0.225  -10.012 -7.374  1.00 0.00 ? 77  THR A HG21 5  
ATOM 10787 H HG22 . THR A 1 77  ? -1.328  -10.934 -8.414  1.00 0.00 ? 77  THR A HG22 5  
ATOM 10788 H HG23 . THR A 1 77  ? -0.676  -11.680 -6.942  1.00 0.00 ? 77  THR A HG23 5  
ATOM 10789 N N    . ARG A 1 78  ? 1.210   -8.162  -9.417  1.00 0.00 ? 78  ARG A N    5  
ATOM 10790 C CA   . ARG A 1 78  ? 1.668   -6.789  -9.062  1.00 0.00 ? 78  ARG A CA   5  
ATOM 10791 C C    . ARG A 1 78  ? 0.631   -6.049  -8.146  1.00 0.00 ? 78  ARG A C    5  
ATOM 10792 O O    . ARG A 1 78  ? -0.576  -6.337  -8.136  1.00 0.00 ? 78  ARG A O    5  
ATOM 10793 C CB   . ARG A 1 78  ? 1.861   -5.993  -10.398 1.00 0.00 ? 78  ARG A CB   5  
ATOM 10794 C CG   . ARG A 1 78  ? 3.188   -6.162  -11.181 1.00 0.00 ? 78  ARG A CG   5  
ATOM 10795 C CD   . ARG A 1 78  ? 3.467   -7.585  -11.695 1.00 0.00 ? 78  ARG A CD   5  
ATOM 10796 N NE   . ARG A 1 78  ? 4.494   -7.630  -12.760 1.00 0.00 ? 78  ARG A NE   5  
ATOM 10797 C CZ   . ARG A 1 78  ? 5.805   -7.771  -12.586 1.00 0.00 ? 78  ARG A CZ   5  
ATOM 10798 N NH1  . ARG A 1 78  ? 6.401   -7.594  -11.435 1.00 0.00 ? 78  ARG A NH1  5  
ATOM 10799 N NH2  . ARG A 1 78  ? 6.522   -8.103  -13.617 1.00 0.00 ? 78  ARG A NH2  5  
ATOM 10800 H H    . ARG A 1 78  ? 0.296   -8.293  -9.889  1.00 0.00 ? 78  ARG A H    5  
ATOM 10801 H HA   . ARG A 1 78  ? 2.637   -6.828  -8.524  1.00 0.00 ? 78  ARG A HA   5  
ATOM 10802 H HB2  . ARG A 1 78  ? 1.005   -6.182  -11.079 1.00 0.00 ? 78  ARG A HB2  5  
ATOM 10803 H HB3  . ARG A 1 78  ? 1.779   -4.908  -10.190 1.00 0.00 ? 78  ARG A HB3  5  
ATOM 10804 H HG2  . ARG A 1 78  ? 3.157   -5.473  -12.050 1.00 0.00 ? 78  ARG A HG2  5  
ATOM 10805 H HG3  . ARG A 1 78  ? 4.039   -5.807  -10.572 1.00 0.00 ? 78  ARG A HG3  5  
ATOM 10806 H HD2  . ARG A 1 78  ? 3.720   -8.277  -10.871 1.00 0.00 ? 78  ARG A HD2  5  
ATOM 10807 H HD3  . ARG A 1 78  ? 2.533   -8.006  -12.125 1.00 0.00 ? 78  ARG A HD3  5  
ATOM 10808 H HE   . ARG A 1 78  ? 4.169   -7.864  -13.729 1.00 0.00 ? 78  ARG A HE   5  
ATOM 10809 H HH11 . ARG A 1 78  ? 5.756   -7.353  -10.680 1.00 0.00 ? 78  ARG A HH11 5  
ATOM 10810 H HH12 . ARG A 1 78  ? 7.411   -7.727  -11.385 1.00 0.00 ? 78  ARG A HH12 5  
ATOM 10811 H HH21 . ARG A 1 78  ? 5.959   -8.401  -14.460 1.00 0.00 ? 78  ARG A HH21 5  
ATOM 10812 H HH22 . ARG A 1 78  ? 7.521   -8.260  -13.493 1.00 0.00 ? 78  ARG A HH22 5  
ATOM 10813 N N    . LEU A 1 79  ? 1.126   -5.050  -7.383  1.00 0.00 ? 79  LEU A N    5  
ATOM 10814 C CA   . LEU A 1 79  ? 0.263   -4.192  -6.519  1.00 0.00 ? 79  LEU A CA   5  
ATOM 10815 C C    . LEU A 1 79  ? -0.280  -2.998  -7.391  1.00 0.00 ? 79  LEU A C    5  
ATOM 10816 O O    . LEU A 1 79  ? 0.338   -1.938  -7.541  1.00 0.00 ? 79  LEU A O    5  
ATOM 10817 C CB   . LEU A 1 79  ? 1.094   -3.693  -5.307  1.00 0.00 ? 79  LEU A CB   5  
ATOM 10818 C CG   . LEU A 1 79  ? 0.359   -3.413  -3.967  1.00 0.00 ? 79  LEU A CG   5  
ATOM 10819 C CD1  . LEU A 1 79  ? 1.228   -2.541  -3.040  1.00 0.00 ? 79  LEU A CD1  5  
ATOM 10820 C CD2  . LEU A 1 79  ? -1.012  -2.738  -4.096  1.00 0.00 ? 79  LEU A CD2  5  
ATOM 10821 H H    . LEU A 1 79  ? 2.134   -4.886  -7.465  1.00 0.00 ? 79  LEU A H    5  
ATOM 10822 H HA   . LEU A 1 79  ? -0.582  -4.790  -6.123  1.00 0.00 ? 79  LEU A HA   5  
ATOM 10823 H HB2  . LEU A 1 79  ? 1.921   -4.393  -5.075  1.00 0.00 ? 79  LEU A HB2  5  
ATOM 10824 H HB3  . LEU A 1 79  ? 1.596   -2.784  -5.656  1.00 0.00 ? 79  LEU A HB3  5  
ATOM 10825 H HG   . LEU A 1 79  ? 0.195   -4.389  -3.475  1.00 0.00 ? 79  LEU A HG   5  
ATOM 10826 H HD11 . LEU A 1 79  ? 2.255   -2.931  -2.933  1.00 0.00 ? 79  LEU A HD11 5  
ATOM 10827 H HD12 . LEU A 1 79  ? 1.323   -1.504  -3.413  1.00 0.00 ? 79  LEU A HD12 5  
ATOM 10828 H HD13 . LEU A 1 79  ? 0.804   -2.482  -2.020  1.00 0.00 ? 79  LEU A HD13 5  
ATOM 10829 H HD21 . LEU A 1 79  ? -0.922  -1.806  -4.672  1.00 0.00 ? 79  LEU A HD21 5  
ATOM 10830 H HD22 . LEU A 1 79  ? -1.747  -3.375  -4.621  1.00 0.00 ? 79  LEU A HD22 5  
ATOM 10831 H HD23 . LEU A 1 79  ? -1.458  -2.494  -3.113  1.00 0.00 ? 79  LEU A HD23 5  
ATOM 10832 N N    . GLN A 1 80  ? -1.402  -3.259  -8.057  1.00 0.00 ? 80  GLN A N    5  
ATOM 10833 C CA   . GLN A 1 80  ? -2.057  -2.311  -9.012  1.00 0.00 ? 80  GLN A CA   5  
ATOM 10834 C C    . GLN A 1 80  ? -3.547  -2.722  -9.316  1.00 0.00 ? 80  GLN A C    5  
ATOM 10835 O O    . GLN A 1 80  ? -4.067  -3.734  -8.838  1.00 0.00 ? 80  GLN A O    5  
ATOM 10836 C CB   . GLN A 1 80  ? -1.179  -2.254  -10.324 1.00 0.00 ? 80  GLN A CB   5  
ATOM 10837 C CG   . GLN A 1 80  ? -0.741  -0.833  -10.766 1.00 0.00 ? 80  GLN A CG   5  
ATOM 10838 C CD   . GLN A 1 80  ? -1.868  0.079   -11.257 1.00 0.00 ? 80  GLN A CD   5  
ATOM 10839 O OE1  . GLN A 1 80  ? -2.488  0.802   -10.488 1.00 0.00 ? 80  GLN A OE1  5  
ATOM 10840 N NE2  . GLN A 1 80  ? -2.221  0.033   -12.519 1.00 0.00 ? 80  GLN A NE2  5  
ATOM 10841 H H    . GLN A 1 80  ? -1.755  -4.173  -7.758  1.00 0.00 ? 80  GLN A H    5  
ATOM 10842 H HA   . GLN A 1 80  ? -2.098  -1.309  -8.542  1.00 0.00 ? 80  GLN A HA   5  
ATOM 10843 H HB2  . GLN A 1 80  ? -0.246  -2.842  -10.209 1.00 0.00 ? 80  GLN A HB2  5  
ATOM 10844 H HB3  . GLN A 1 80  ? -1.681  -2.768  -11.167 1.00 0.00 ? 80  GLN A HB3  5  
ATOM 10845 H HG2  . GLN A 1 80  ? -0.235  -0.328  -9.921  1.00 0.00 ? 80  GLN A HG2  5  
ATOM 10846 H HG3  . GLN A 1 80  ? 0.040   -0.908  -11.546 1.00 0.00 ? 80  GLN A HG3  5  
ATOM 10847 H HE21 . GLN A 1 80  ? -1.738  -0.640  -13.119 1.00 0.00 ? 80  GLN A HE21 5  
ATOM 10848 H HE22 . GLN A 1 80  ? -3.041  0.606   -12.739 1.00 0.00 ? 80  GLN A HE22 5  
ATOM 10849 N N    . LEU A 1 81  ? -4.250  -1.918  -10.125 1.00 0.00 ? 81  LEU A N    5  
ATOM 10850 C CA   . LEU A 1 81  ? -5.619  -2.223  -10.653 1.00 0.00 ? 81  LEU A CA   5  
ATOM 10851 C C    . LEU A 1 81  ? -5.886  -1.325  -11.897 1.00 0.00 ? 81  LEU A C    5  
ATOM 10852 O O    . LEU A 1 81  ? -5.997  -1.796  -13.031 1.00 0.00 ? 81  LEU A O    5  
ATOM 10853 C CB   . LEU A 1 81  ? -6.781  -2.117  -9.591  1.00 0.00 ? 81  LEU A CB   5  
ATOM 10854 C CG   . LEU A 1 81  ? -8.062  -2.978  -9.830  1.00 0.00 ? 81  LEU A CG   5  
ATOM 10855 C CD1  . LEU A 1 81  ? -9.144  -2.660  -8.780  1.00 0.00 ? 81  LEU A CD1  5  
ATOM 10856 C CD2  . LEU A 1 81  ? -8.729  -2.817  -11.210 1.00 0.00 ? 81  LEU A CD2  5  
ATOM 10857 H H    . LEU A 1 81  ? -3.729  -1.089  -10.441 1.00 0.00 ? 81  LEU A H    5  
ATOM 10858 H HA   . LEU A 1 81  ? -5.613  -3.226  -11.047 1.00 0.00 ? 81  LEU A HA   5  
ATOM 10859 H HB2  . LEU A 1 81  ? -6.379  -2.380  -8.597  1.00 0.00 ? 81  LEU A HB2  5  
ATOM 10860 H HB3  . LEU A 1 81  ? -7.088  -1.065  -9.458  1.00 0.00 ? 81  LEU A HB3  5  
ATOM 10861 H HG   . LEU A 1 81  ? -7.784  -4.045  -9.725  1.00 0.00 ? 81  LEU A HG   5  
ATOM 10862 H HD11 . LEU A 1 81  ? -8.771  -2.722  -7.746  1.00 0.00 ? 81  LEU A HD11 5  
ATOM 10863 H HD12 . LEU A 1 81  ? -9.558  -1.641  -8.907  1.00 0.00 ? 81  LEU A HD12 5  
ATOM 10864 H HD13 . LEU A 1 81  ? -9.994  -3.366  -8.846  1.00 0.00 ? 81  LEU A HD13 5  
ATOM 10865 H HD21 . LEU A 1 81  ? -9.035  -1.772  -11.402 1.00 0.00 ? 81  LEU A HD21 5  
ATOM 10866 H HD22 . LEU A 1 81  ? -8.062  -3.122  -12.035 1.00 0.00 ? 81  LEU A HD22 5  
ATOM 10867 H HD23 . LEU A 1 81  ? -9.637  -3.441  -11.306 1.00 0.00 ? 81  LEU A HD23 5  
ATOM 10868 N N    . GLU A 1 82  ? -6.004  -0.032  -11.620 1.00 0.00 ? 82  GLU A N    5  
ATOM 10869 C CA   . GLU A 1 82  ? -6.433  1.008   -12.611 1.00 0.00 ? 82  GLU A CA   5  
ATOM 10870 C C    . GLU A 1 82  ? -5.868  2.442   -12.296 1.00 0.00 ? 82  GLU A C    5  
ATOM 10871 O O    . GLU A 1 82  ? -5.187  2.679   -11.298 1.00 0.00 ? 82  GLU A O    5  
ATOM 10872 C CB   . GLU A 1 82  ? -8.004  0.942   -12.578 1.00 0.00 ? 82  GLU A CB   5  
ATOM 10873 C CG   . GLU A 1 82  ? -8.839  1.810   -13.556 1.00 0.00 ? 82  GLU A CG   5  
ATOM 10874 C CD   . GLU A 1 82  ? -10.338 1.586   -13.425 1.00 0.00 ? 82  GLU A CD   5  
ATOM 10875 O OE1  . GLU A 1 82  ? -10.959 2.207   -12.536 1.00 0.00 ? 82  GLU A OE1  5  
ATOM 10876 O OE2  . GLU A 1 82  ? -10.900 0.803   -14.218 1.00 0.00 ? 82  GLU A OE2  5  
ATOM 10877 H H    . GLU A 1 82  ? -5.841  0.008   -10.604 1.00 0.00 ? 82  GLU A H    5  
ATOM 10878 H HA   . GLU A 1 82  ? -6.076  0.734   -13.624 1.00 0.00 ? 82  GLU A HA   5  
ATOM 10879 H HB2  . GLU A 1 82  ? -8.310  -0.105  -12.771 1.00 0.00 ? 82  GLU A HB2  5  
ATOM 10880 H HB3  . GLU A 1 82  ? -8.361  1.151   -11.550 1.00 0.00 ? 82  GLU A HB3  5  
ATOM 10881 H HG2  . GLU A 1 82  ? -8.692  2.887   -13.374 1.00 0.00 ? 82  GLU A HG2  5  
ATOM 10882 H HG3  . GLU A 1 82  ? -8.562  1.617   -14.606 1.00 0.00 ? 82  GLU A HG3  5  
ATOM 10883 N N    . ALA A 1 83  ? -6.099  3.401   -13.209 1.00 0.00 ? 83  ALA A N    5  
ATOM 10884 C CA   . ALA A 1 83  ? -5.808  4.846   -12.993 1.00 0.00 ? 83  ALA A CA   5  
ATOM 10885 C C    . ALA A 1 83  ? -7.182  5.538   -12.709 1.00 0.00 ? 83  ALA A C    5  
ATOM 10886 O O    . ALA A 1 83  ? -8.043  5.542   -13.597 1.00 0.00 ? 83  ALA A O    5  
ATOM 10887 C CB   . ALA A 1 83  ? -5.104  5.396   -14.247 1.00 0.00 ? 83  ALA A CB   5  
ATOM 10888 H H    . ALA A 1 83  ? -6.685  3.089   -13.990 1.00 0.00 ? 83  ALA A H    5  
ATOM 10889 H HA   . ALA A 1 83  ? -5.129  4.998   -12.136 1.00 0.00 ? 83  ALA A HA   5  
ATOM 10890 H HB1  . ALA A 1 83  ? -4.160  4.862   -14.453 1.00 0.00 ? 83  ALA A HB1  5  
ATOM 10891 H HB2  . ALA A 1 83  ? -5.733  5.313   -15.154 1.00 0.00 ? 83  ALA A HB2  5  
ATOM 10892 H HB3  . ALA A 1 83  ? -4.848  6.465   -14.126 1.00 0.00 ? 83  ALA A HB3  5  
ATOM 10893 N N    . VAL A 1 84  ? -7.433  6.070   -11.491 1.00 0.00 ? 84  VAL A N    5  
ATOM 10894 C CA   . VAL A 1 84  ? -8.785  6.614   -11.133 1.00 0.00 ? 84  VAL A CA   5  
ATOM 10895 C C    . VAL A 1 84  ? -8.752  8.149   -10.831 1.00 0.00 ? 84  VAL A C    5  
ATOM 10896 O O    . VAL A 1 84  ? -7.819  8.702   -10.248 1.00 0.00 ? 84  VAL A O    5  
ATOM 10897 C CB   . VAL A 1 84  ? -9.359  5.741   -9.957  1.00 0.00 ? 84  VAL A CB   5  
ATOM 10898 C CG1  . VAL A 1 84  ? -8.692  5.886   -8.569  1.00 0.00 ? 84  VAL A CG1  5  
ATOM 10899 C CG2  . VAL A 1 84  ? -10.885 5.906   -9.774  1.00 0.00 ? 84  VAL A CG2  5  
ATOM 10900 H H    . VAL A 1 84  ? -6.668  6.077   -10.799 1.00 0.00 ? 84  VAL A H    5  
ATOM 10901 H HA   . VAL A 1 84  ? -9.481  6.477   -11.988 1.00 0.00 ? 84  VAL A HA   5  
ATOM 10902 H HB   . VAL A 1 84  ? -9.216  4.690   -10.272 1.00 0.00 ? 84  VAL A HB   5  
ATOM 10903 H HG11 . VAL A 1 84  ? -7.598  5.746   -8.622  1.00 0.00 ? 84  VAL A HG11 5  
ATOM 10904 H HG12 . VAL A 1 84  ? -8.877  6.881   -8.131  1.00 0.00 ? 84  VAL A HG12 5  
ATOM 10905 H HG13 . VAL A 1 84  ? -9.071  5.137   -7.849  1.00 0.00 ? 84  VAL A HG13 5  
ATOM 10906 H HG21 . VAL A 1 84  ? -11.434 5.689   -10.710 1.00 0.00 ? 84  VAL A HG21 5  
ATOM 10907 H HG22 . VAL A 1 84  ? -11.289 5.213   -9.012  1.00 0.00 ? 84  VAL A HG22 5  
ATOM 10908 H HG23 . VAL A 1 84  ? -11.164 6.930   -9.461  1.00 0.00 ? 84  VAL A HG23 5  
ATOM 10909 N N    . ASN A 1 85  ? -9.822  8.843   -11.235 1.00 0.00 ? 85  ASN A N    5  
ATOM 10910 C CA   . ASN A 1 85  ? -9.979  10.310  -11.019 1.00 0.00 ? 85  ASN A CA   5  
ATOM 10911 C C    . ASN A 1 85  ? -11.058 10.596  -9.925  1.00 0.00 ? 85  ASN A C    5  
ATOM 10912 O O    . ASN A 1 85  ? -12.127 9.977   -9.910  1.00 0.00 ? 85  ASN A O    5  
ATOM 10913 C CB   . ASN A 1 85  ? -10.317 10.987  -12.382 1.00 0.00 ? 85  ASN A CB   5  
ATOM 10914 C CG   . ASN A 1 85  ? -11.645 10.628  -13.074 1.00 0.00 ? 85  ASN A CG   5  
ATOM 10915 O OD1  . ASN A 1 85  ? -11.868 9.501   -13.504 1.00 0.00 ? 85  ASN A OD1  5  
ATOM 10916 N ND2  . ASN A 1 85  ? -12.559 11.556  -13.216 1.00 0.00 ? 85  ASN A ND2  5  
ATOM 10917 H H    . ASN A 1 85  ? -10.534 8.267   -11.700 1.00 0.00 ? 85  ASN A H    5  
ATOM 10918 H HA   . ASN A 1 85  ? -9.021  10.752  -10.675 1.00 0.00 ? 85  ASN A HA   5  
ATOM 10919 H HB2  . ASN A 1 85  ? -10.242 12.084  -12.257 1.00 0.00 ? 85  ASN A HB2  5  
ATOM 10920 H HB3  . ASN A 1 85  ? -9.512  10.753  -13.104 1.00 0.00 ? 85  ASN A HB3  5  
ATOM 10921 H HD21 . ASN A 1 85  ? -12.391 12.462  -12.770 1.00 0.00 ? 85  ASN A HD21 5  
ATOM 10922 H HD22 . ASN A 1 85  ? -13.409 11.227  -13.681 1.00 0.00 ? 85  ASN A HD22 5  
ATOM 10923 N N    . ILE A 1 86  ? -10.801 11.570  -9.028  1.00 0.00 ? 86  ILE A N    5  
ATOM 10924 C CA   . ILE A 1 86  ? -11.779 11.961  -7.966  1.00 0.00 ? 86  ILE A CA   5  
ATOM 10925 C C    . ILE A 1 86  ? -13.051 12.666  -8.590  1.00 0.00 ? 86  ILE A C    5  
ATOM 10926 O O    . ILE A 1 86  ? -13.009 13.753  -9.172  1.00 0.00 ? 86  ILE A O    5  
ATOM 10927 C CB   . ILE A 1 86  ? -11.036 12.807  -6.864  1.00 0.00 ? 86  ILE A CB   5  
ATOM 10928 C CG1  . ILE A 1 86  ? -11.939 13.046  -5.617  1.00 0.00 ? 86  ILE A CG1  5  
ATOM 10929 C CG2  . ILE A 1 86  ? -10.537 14.197  -7.347  1.00 0.00 ? 86  ILE A CG2  5  
ATOM 10930 C CD1  . ILE A 1 86  ? -12.231 11.802  -4.760  1.00 0.00 ? 86  ILE A CD1  5  
ATOM 10931 H H    . ILE A 1 86  ? -9.880  12.010  -9.100  1.00 0.00 ? 86  ILE A H    5  
ATOM 10932 H HA   . ILE A 1 86  ? -12.114 11.028  -7.473  1.00 0.00 ? 86  ILE A HA   5  
ATOM 10933 H HB   . ILE A 1 86  ? -10.149 12.241  -6.524  1.00 0.00 ? 86  ILE A HB   5  
ATOM 10934 H HG12 . ILE A 1 86  ? -11.463 13.790  -4.951  1.00 0.00 ? 86  ILE A HG12 5  
ATOM 10935 H HG13 . ILE A 1 86  ? -12.896 13.516  -5.919  1.00 0.00 ? 86  ILE A HG13 5  
ATOM 10936 H HG21 . ILE A 1 86  ? -9.892  14.125  -8.241  1.00 0.00 ? 86  ILE A HG21 5  
ATOM 10937 H HG22 . ILE A 1 86  ? -11.368 14.879  -7.607  1.00 0.00 ? 86  ILE A HG22 5  
ATOM 10938 H HG23 . ILE A 1 86  ? -9.939  14.708  -6.569  1.00 0.00 ? 86  ILE A HG23 5  
ATOM 10939 H HD11 . ILE A 1 86  ? -11.305 11.301  -4.424  1.00 0.00 ? 86  ILE A HD11 5  
ATOM 10940 H HD12 . ILE A 1 86  ? -12.795 12.078  -3.850  1.00 0.00 ? 86  ILE A HD12 5  
ATOM 10941 H HD13 . ILE A 1 86  ? -12.846 11.055  -5.295  1.00 0.00 ? 86  ILE A HD13 5  
ATOM 10942 N N    . THR A 1 87  ? -14.173 11.946  -8.487  1.00 0.00 ? 87  THR A N    5  
ATOM 10943 C CA   . THR A 1 87  ? -15.533 12.369  -8.965  1.00 0.00 ? 87  THR A CA   5  
ATOM 10944 C C    . THR A 1 87  ? -16.679 11.465  -8.358  1.00 0.00 ? 87  THR A C    5  
ATOM 10945 O O    . THR A 1 87  ? -17.801 11.955  -8.216  1.00 0.00 ? 87  THR A O    5  
ATOM 10946 C CB   . THR A 1 87  ? -15.617 12.385  -10.532 1.00 0.00 ? 87  THR A CB   5  
ATOM 10947 O OG1  . THR A 1 87  ? -16.879 12.917  -10.921 1.00 0.00 ? 87  THR A OG1  5  
ATOM 10948 C CG2  . THR A 1 87  ? -15.484 11.026  -11.247 1.00 0.00 ? 87  THR A CG2  5  
ATOM 10949 H H    . THR A 1 87  ? -14.024 11.087  -7.955  1.00 0.00 ? 87  THR A H    5  
ATOM 10950 H HA   . THR A 1 87  ? -15.729 13.397  -8.601  1.00 0.00 ? 87  THR A HA   5  
ATOM 10951 H HB   . THR A 1 87  ? -14.826 13.066  -10.905 1.00 0.00 ? 87  THR A HB   5  
ATOM 10952 H HG1  . THR A 1 87  ? -17.547 12.389  -10.469 1.00 0.00 ? 87  THR A HG1  5  
ATOM 10953 H HG21 . THR A 1 87  ? -16.268 10.307  -10.948 1.00 0.00 ? 87  THR A HG21 5  
ATOM 10954 H HG22 . THR A 1 87  ? -15.562 11.148  -12.342 1.00 0.00 ? 87  THR A HG22 5  
ATOM 10955 H HG23 . THR A 1 87  ? -14.505 10.552  -11.043 1.00 0.00 ? 87  THR A HG23 5  
ATOM 10956 N N    . ASP A 1 88  ? -16.404 10.197  -7.986  1.00 0.00 ? 88  ASP A N    5  
ATOM 10957 C CA   . ASP A 1 88  ? -17.348 9.288   -7.290  1.00 0.00 ? 88  ASP A CA   5  
ATOM 10958 C C    . ASP A 1 88  ? -16.546 8.670   -6.096  1.00 0.00 ? 88  ASP A C    5  
ATOM 10959 O O    . ASP A 1 88  ? -16.713 9.116   -4.957  1.00 0.00 ? 88  ASP A O    5  
ATOM 10960 C CB   . ASP A 1 88  ? -17.946 8.251   -8.291  1.00 0.00 ? 88  ASP A CB   5  
ATOM 10961 C CG   . ASP A 1 88  ? -18.842 7.180   -7.648  1.00 0.00 ? 88  ASP A CG   5  
ATOM 10962 O OD1  . ASP A 1 88  ? -20.043 7.437   -7.444  1.00 0.00 ? 88  ASP A OD1  5  
ATOM 10963 O OD2  . ASP A 1 88  ? -18.334 6.083   -7.313  1.00 0.00 ? 88  ASP A OD2  5  
ATOM 10964 H H    . ASP A 1 88  ? -15.445 9.906   -8.185  1.00 0.00 ? 88  ASP A H    5  
ATOM 10965 H HA   . ASP A 1 88  ? -18.189 9.862   -6.850  1.00 0.00 ? 88  ASP A HA   5  
ATOM 10966 H HB2  . ASP A 1 88  ? -18.544 8.779   -9.057  1.00 0.00 ? 88  ASP A HB2  5  
ATOM 10967 H HB3  . ASP A 1 88  ? -17.146 7.737   -8.853  1.00 0.00 ? 88  ASP A HB3  5  
ATOM 10968 N N    . LEU A 1 89  ? -15.654 7.676   -6.351  1.00 0.00 ? 89  LEU A N    5  
ATOM 10969 C CA   . LEU A 1 89  ? -14.909 6.902   -5.297  1.00 0.00 ? 89  LEU A CA   5  
ATOM 10970 C C    . LEU A 1 89  ? -15.873 6.351   -4.172  1.00 0.00 ? 89  LEU A C    5  
ATOM 10971 O O    . LEU A 1 89  ? -15.580 6.410   -2.974  1.00 0.00 ? 89  LEU A O    5  
ATOM 10972 C CB   . LEU A 1 89  ? -13.726 7.785   -4.766  1.00 0.00 ? 89  LEU A CB   5  
ATOM 10973 C CG   . LEU A 1 89  ? -12.403 7.847   -5.584  1.00 0.00 ? 89  LEU A CG   5  
ATOM 10974 C CD1  . LEU A 1 89  ? -11.624 6.528   -5.509  1.00 0.00 ? 89  LEU A CD1  5  
ATOM 10975 C CD2  . LEU A 1 89  ? -12.567 8.246   -7.060  1.00 0.00 ? 89  LEU A CD2  5  
ATOM 10976 H H    . LEU A 1 89  ? -15.627 7.418   -7.343  1.00 0.00 ? 89  LEU A H    5  
ATOM 10977 H HA   . LEU A 1 89  ? -14.486 5.992   -5.763  1.00 0.00 ? 89  LEU A HA   5  
ATOM 10978 H HB2  . LEU A 1 89  ? -14.086 8.815   -4.583  1.00 0.00 ? 89  LEU A HB2  5  
ATOM 10979 H HB3  . LEU A 1 89  ? -13.449 7.439   -3.752  1.00 0.00 ? 89  LEU A HB3  5  
ATOM 10980 H HG   . LEU A 1 89  ? -11.775 8.621   -5.101  1.00 0.00 ? 89  LEU A HG   5  
ATOM 10981 H HD11 . LEU A 1 89  ? -11.451 6.225   -4.462  1.00 0.00 ? 89  LEU A HD11 5  
ATOM 10982 H HD12 . LEU A 1 89  ? -12.174 5.703   -6.001  1.00 0.00 ? 89  LEU A HD12 5  
ATOM 10983 H HD13 . LEU A 1 89  ? -10.636 6.593   -6.000  1.00 0.00 ? 89  LEU A HD13 5  
ATOM 10984 H HD21 . LEU A 1 89  ? -13.208 9.136   -7.169  1.00 0.00 ? 89  LEU A HD21 5  
ATOM 10985 H HD22 . LEU A 1 89  ? -11.599 8.473   -7.542  1.00 0.00 ? 89  LEU A HD22 5  
ATOM 10986 H HD23 . LEU A 1 89  ? -13.043 7.446   -7.658  1.00 0.00 ? 89  LEU A HD23 5  
ATOM 10987 N N    . SER A 1 90  ? -16.996 5.727   -4.583  1.00 0.00 ? 90  SER A N    5  
ATOM 10988 C CA   . SER A 1 90  ? -18.070 5.269   -3.662  1.00 0.00 ? 90  SER A CA   5  
ATOM 10989 C C    . SER A 1 90  ? -17.822 3.894   -2.957  1.00 0.00 ? 90  SER A C    5  
ATOM 10990 O O    . SER A 1 90  ? -18.604 2.945   -3.080  1.00 0.00 ? 90  SER A O    5  
ATOM 10991 C CB   . SER A 1 90  ? -19.381 5.305   -4.503  1.00 0.00 ? 90  SER A CB   5  
ATOM 10992 O OG   . SER A 1 90  ? -19.310 4.562   -5.728  1.00 0.00 ? 90  SER A OG   5  
ATOM 10993 H H    . SER A 1 90  ? -17.154 5.766   -5.602  1.00 0.00 ? 90  SER A H    5  
ATOM 10994 H HA   . SER A 1 90  ? -18.197 6.000   -2.839  1.00 0.00 ? 90  SER A HA   5  
ATOM 10995 H HB2  . SER A 1 90  ? -20.232 4.932   -3.904  1.00 0.00 ? 90  SER A HB2  5  
ATOM 10996 H HB3  . SER A 1 90  ? -19.646 6.355   -4.743  1.00 0.00 ? 90  SER A HB3  5  
ATOM 10997 H HG   . SER A 1 90  ? -18.953 5.192   -6.425  1.00 0.00 ? 90  SER A HG   5  
ATOM 10998 N N    . GLU A 1 91  ? -16.748 3.816   -2.150  1.00 0.00 ? 91  GLU A N    5  
ATOM 10999 C CA   . GLU A 1 91  ? -16.449 2.631   -1.294  1.00 0.00 ? 91  GLU A CA   5  
ATOM 11000 C C    . GLU A 1 91  ? -15.817 3.170   0.035   1.00 0.00 ? 91  GLU A C    5  
ATOM 11001 O O    . GLU A 1 91  ? -14.603 3.135   0.265   1.00 0.00 ? 91  GLU A O    5  
ATOM 11002 C CB   . GLU A 1 91  ? -15.579 1.508   -1.966  1.00 0.00 ? 91  GLU A CB   5  
ATOM 11003 C CG   . GLU A 1 91  ? -15.139 1.579   -3.456  1.00 0.00 ? 91  GLU A CG   5  
ATOM 11004 C CD   . GLU A 1 91  ? -14.956 0.219   -4.109  1.00 0.00 ? 91  GLU A CD   5  
ATOM 11005 O OE1  . GLU A 1 91  ? -15.971 -0.378  -4.533  1.00 0.00 ? 91  GLU A OE1  5  
ATOM 11006 O OE2  . GLU A 1 91  ? -13.820 -0.288  -4.204  1.00 0.00 ? 91  GLU A OE2  5  
ATOM 11007 H H    . GLU A 1 91  ? -16.171 4.671   -2.159  1.00 0.00 ? 91  GLU A H    5  
ATOM 11008 H HA   . GLU A 1 91  ? -17.405 2.151   -1.005  1.00 0.00 ? 91  GLU A HA   5  
ATOM 11009 H HB2  . GLU A 1 91  ? -14.674 1.302   -1.366  1.00 0.00 ? 91  GLU A HB2  5  
ATOM 11010 H HB3  . GLU A 1 91  ? -16.154 0.575   -1.821  1.00 0.00 ? 91  GLU A HB3  5  
ATOM 11011 H HG2  . GLU A 1 91  ? -15.869 2.130   -4.070  1.00 0.00 ? 91  GLU A HG2  5  
ATOM 11012 H HG3  . GLU A 1 91  ? -14.196 2.147   -3.546  1.00 0.00 ? 91  GLU A HG3  5  
ATOM 11013 N N    . ASN A 1 92  ? -16.691 3.664   0.932   1.00 0.00 ? 92  ASN A N    5  
ATOM 11014 C CA   . ASN A 1 92  ? -16.294 4.152   2.282   1.00 0.00 ? 92  ASN A CA   5  
ATOM 11015 C C    . ASN A 1 92  ? -16.539 3.027   3.350   1.00 0.00 ? 92  ASN A C    5  
ATOM 11016 O O    . ASN A 1 92  ? -15.610 2.687   4.085   1.00 0.00 ? 92  ASN A O    5  
ATOM 11017 C CB   . ASN A 1 92  ? -17.059 5.483   2.530   1.00 0.00 ? 92  ASN A CB   5  
ATOM 11018 C CG   . ASN A 1 92  ? -16.542 6.284   3.728   1.00 0.00 ? 92  ASN A CG   5  
ATOM 11019 O OD1  . ASN A 1 92  ? -15.369 6.639   3.804   1.00 0.00 ? 92  ASN A OD1  5  
ATOM 11020 N ND2  . ASN A 1 92  ? -17.371 6.589   4.696   1.00 0.00 ? 92  ASN A ND2  5  
ATOM 11021 H H    . ASN A 1 92  ? -17.662 3.652   0.605   1.00 0.00 ? 92  ASN A H    5  
ATOM 11022 H HA   . ASN A 1 92  ? -15.206 4.369   2.299   1.00 0.00 ? 92  ASN A HA   5  
ATOM 11023 H HB2  . ASN A 1 92  ? -16.936 6.150   1.655   1.00 0.00 ? 92  ASN A HB2  5  
ATOM 11024 H HB3  . ASN A 1 92  ? -18.149 5.304   2.599   1.00 0.00 ? 92  ASN A HB3  5  
ATOM 11025 H HD21 . ASN A 1 92  ? -18.348 6.301   4.590   1.00 0.00 ? 92  ASN A HD21 5  
ATOM 11026 H HD22 . ASN A 1 92  ? -16.950 7.116   5.466   1.00 0.00 ? 92  ASN A HD22 5  
ATOM 11027 N N    . ARG A 1 93  ? -17.765 2.469   3.457   1.00 0.00 ? 93  ARG A N    5  
ATOM 11028 C CA   . ARG A 1 93  ? -18.063 1.315   4.360   1.00 0.00 ? 93  ARG A CA   5  
ATOM 11029 C C    . ARG A 1 93  ? -18.690 0.154   3.497   1.00 0.00 ? 93  ARG A C    5  
ATOM 11030 O O    . ARG A 1 93  ? -19.860 -0.205  3.657   1.00 0.00 ? 93  ARG A O    5  
ATOM 11031 C CB   . ARG A 1 93  ? -18.986 1.790   5.523   1.00 0.00 ? 93  ARG A CB   5  
ATOM 11032 C CG   . ARG A 1 93  ? -18.387 2.859   6.476   1.00 0.00 ? 93  ARG A CG   5  
ATOM 11033 C CD   . ARG A 1 93  ? -19.297 3.261   7.657   1.00 0.00 ? 93  ARG A CD   5  
ATOM 11034 N NE   . ARG A 1 93  ? -19.097 2.372   8.836   1.00 0.00 ? 93  ARG A NE   5  
ATOM 11035 C CZ   . ARG A 1 93  ? -19.889 1.381   9.234   1.00 0.00 ? 93  ARG A CZ   5  
ATOM 11036 N NH1  . ARG A 1 93  ? -21.005 1.056   8.632   1.00 0.00 ? 93  ARG A NH1  5  
ATOM 11037 N NH2  . ARG A 1 93  ? -19.532 0.696   10.280  1.00 0.00 ? 93  ARG A NH2  5  
ATOM 11038 H H    . ARG A 1 93  ? -18.455 2.829   2.792   1.00 0.00 ? 93  ARG A H    5  
ATOM 11039 H HA   . ARG A 1 93  ? -17.138 0.913   4.821   1.00 0.00 ? 93  ARG A HA   5  
ATOM 11040 H HB2  . ARG A 1 93  ? -19.945 2.155   5.107   1.00 0.00 ? 93  ARG A HB2  5  
ATOM 11041 H HB3  . ARG A 1 93  ? -19.255 0.900   6.125   1.00 0.00 ? 93  ARG A HB3  5  
ATOM 11042 H HG2  . ARG A 1 93  ? -17.392 2.537   6.846   1.00 0.00 ? 93  ARG A HG2  5  
ATOM 11043 H HG3  . ARG A 1 93  ? -18.166 3.769   5.886   1.00 0.00 ? 93  ARG A HG3  5  
ATOM 11044 H HD2  . ARG A 1 93  ? -19.007 4.282   7.978   1.00 0.00 ? 93  ARG A HD2  5  
ATOM 11045 H HD3  . ARG A 1 93  ? -20.355 3.375   7.351   1.00 0.00 ? 93  ARG A HD3  5  
ATOM 11046 H HE   . ARG A 1 93  ? -18.267 2.533   9.472   1.00 0.00 ? 93  ARG A HE   5  
ATOM 11047 H HH11 . ARG A 1 93  ? -21.218 1.631   7.817   1.00 0.00 ? 93  ARG A HH11 5  
ATOM 11048 H HH12 . ARG A 1 93  ? -21.547 0.278   9.010   1.00 0.00 ? 93  ARG A HH12 5  
ATOM 11049 H HH21 . ARG A 1 93  ? -18.589 0.935   10.695  1.00 0.00 ? 93  ARG A HH21 5  
ATOM 11050 H HH22 . ARG A 1 93  ? -20.128 -0.071  10.586  1.00 0.00 ? 93  ARG A HH22 5  
ATOM 11051 N N    . LYS A 1 94  ? -17.903 -0.422  2.561   1.00 0.00 ? 94  LYS A N    5  
ATOM 11052 C CA   . LYS A 1 94  ? -18.342 -1.526  1.655   1.00 0.00 ? 94  LYS A CA   5  
ATOM 11053 C C    . LYS A 1 94  ? -17.630 -2.877  2.018   1.00 0.00 ? 94  LYS A C    5  
ATOM 11054 O O    . LYS A 1 94  ? -16.500 -2.904  2.516   1.00 0.00 ? 94  LYS A O    5  
ATOM 11055 C CB   . LYS A 1 94  ? -18.030 -1.059  0.198   1.00 0.00 ? 94  LYS A CB   5  
ATOM 11056 C CG   . LYS A 1 94  ? -18.643 -1.926  -0.939  1.00 0.00 ? 94  LYS A CG   5  
ATOM 11057 C CD   . LYS A 1 94  ? -18.313 -1.463  -2.378  1.00 0.00 ? 94  LYS A CD   5  
ATOM 11058 C CE   . LYS A 1 94  ? -19.017 -0.164  -2.822  1.00 0.00 ? 94  LYS A CE   5  
ATOM 11059 N NZ   . LYS A 1 94  ? -18.482 0.306   -4.127  1.00 0.00 ? 94  LYS A NZ   5  
ATOM 11060 H H    . LYS A 1 94  ? -16.950 -0.044  2.524   1.00 0.00 ? 94  LYS A H    5  
ATOM 11061 H HA   . LYS A 1 94  ? -19.437 -1.679  1.746   1.00 0.00 ? 94  LYS A HA   5  
ATOM 11062 H HB2  . LYS A 1 94  ? -18.391 -0.020  0.075   1.00 0.00 ? 94  LYS A HB2  5  
ATOM 11063 H HB3  . LYS A 1 94  ? -16.932 -0.995  0.062   1.00 0.00 ? 94  LYS A HB3  5  
ATOM 11064 H HG2  . LYS A 1 94  ? -18.260 -2.961  -0.836  1.00 0.00 ? 94  LYS A HG2  5  
ATOM 11065 H HG3  . LYS A 1 94  ? -19.740 -2.015  -0.809  1.00 0.00 ? 94  LYS A HG3  5  
ATOM 11066 H HD2  . LYS A 1 94  ? -17.213 -1.373  -2.475  1.00 0.00 ? 94  LYS A HD2  5  
ATOM 11067 H HD3  . LYS A 1 94  ? -18.584 -2.277  -3.080  1.00 0.00 ? 94  LYS A HD3  5  
ATOM 11068 H HE2  . LYS A 1 94  ? -20.119 -0.304  -2.863  1.00 0.00 ? 94  LYS A HE2  5  
ATOM 11069 H HE3  . LYS A 1 94  ? -18.867 0.624   -2.056  1.00 0.00 ? 94  LYS A HE3  5  
ATOM 11070 H HZ1  . LYS A 1 94  ? -17.458 0.060   -4.260  1.00 0.00 ? 94  LYS A HZ1  5  
ATOM 11071 H HZ2  . LYS A 1 94  ? -18.958 -0.068  -4.955  1.00 0.00 ? 94  LYS A HZ2  5  
ATOM 11072 H HZ3  . LYS A 1 94  ? -18.510 1.340   -4.192  1.00 0.00 ? 94  LYS A HZ3  5  
ATOM 11073 N N    . GLN A 1 95  ? -18.295 -4.008  1.718   1.00 0.00 ? 95  GLN A N    5  
ATOM 11074 C CA   . GLN A 1 95  ? -17.762 -5.378  1.989   1.00 0.00 ? 95  GLN A CA   5  
ATOM 11075 C C    . GLN A 1 95  ? -16.464 -5.758  1.183   1.00 0.00 ? 95  GLN A C    5  
ATOM 11076 O O    . GLN A 1 95  ? -16.113 -5.139  0.170   1.00 0.00 ? 95  GLN A O    5  
ATOM 11077 C CB   . GLN A 1 95  ? -18.923 -6.374  1.666   1.00 0.00 ? 95  GLN A CB   5  
ATOM 11078 C CG   . GLN A 1 95  ? -20.136 -6.386  2.639   1.00 0.00 ? 95  GLN A CG   5  
ATOM 11079 C CD   . GLN A 1 95  ? -19.832 -6.845  4.070   1.00 0.00 ? 95  GLN A CD   5  
ATOM 11080 O OE1  . GLN A 1 95  ? -19.538 -6.053  4.957   1.00 0.00 ? 95  GLN A OE1  5  
ATOM 11081 N NE2  . GLN A 1 95  ? -19.888 -8.126  4.349   1.00 0.00 ? 95  GLN A NE2  5  
ATOM 11082 H H    . GLN A 1 95  ? -19.225 -3.869  1.315   1.00 0.00 ? 95  GLN A H    5  
ATOM 11083 H HA   . GLN A 1 95  ? -17.503 -5.447  3.066   1.00 0.00 ? 95  GLN A HA   5  
ATOM 11084 H HB2  . GLN A 1 95  ? -19.285 -6.201  0.633   1.00 0.00 ? 95  GLN A HB2  5  
ATOM 11085 H HB3  . GLN A 1 95  ? -18.524 -7.407  1.627   1.00 0.00 ? 95  GLN A HB3  5  
ATOM 11086 H HG2  . GLN A 1 95  ? -20.580 -5.376  2.700   1.00 0.00 ? 95  GLN A HG2  5  
ATOM 11087 H HG3  . GLN A 1 95  ? -20.943 -7.012  2.214   1.00 0.00 ? 95  GLN A HG3  5  
ATOM 11088 H HE21 . GLN A 1 95  ? -20.090 -8.767  3.578   1.00 0.00 ? 95  GLN A HE21 5  
ATOM 11089 H HE22 . GLN A 1 95  ? -19.651 -8.350  5.319   1.00 0.00 ? 95  GLN A HE22 5  
ATOM 11090 N N    . ASP A 1 96  ? -15.769 -6.816  1.650   1.00 0.00 ? 96  ASP A N    5  
ATOM 11091 C CA   . ASP A 1 96  ? -14.497 -7.305  1.046   1.00 0.00 ? 96  ASP A CA   5  
ATOM 11092 C C    . ASP A 1 96  ? -14.629 -7.865  -0.424  1.00 0.00 ? 96  ASP A C    5  
ATOM 11093 O O    . ASP A 1 96  ? -15.713 -8.183  -0.929  1.00 0.00 ? 96  ASP A O    5  
ATOM 11094 C CB   . ASP A 1 96  ? -13.956 -8.362  2.055   1.00 0.00 ? 96  ASP A CB   5  
ATOM 11095 C CG   . ASP A 1 96  ? -12.502 -8.802  1.851   1.00 0.00 ? 96  ASP A CG   5  
ATOM 11096 O OD1  . ASP A 1 96  ? -11.711 -8.036  1.259   1.00 0.00 ? 96  ASP A OD1  5  
ATOM 11097 O OD2  . ASP A 1 96  ? -12.152 -9.919  2.283   1.00 0.00 ? 96  ASP A OD2  5  
ATOM 11098 H H    . ASP A 1 96  ? -16.148 -7.251  2.496   1.00 0.00 ? 96  ASP A H    5  
ATOM 11099 H HA   . ASP A 1 96  ? -13.792 -6.449  1.010   1.00 0.00 ? 96  ASP A HA   5  
ATOM 11100 H HB2  . ASP A 1 96  ? -13.994 -7.973  3.090   1.00 0.00 ? 96  ASP A HB2  5  
ATOM 11101 H HB3  . ASP A 1 96  ? -14.597 -9.263  2.054   1.00 0.00 ? 96  ASP A HB3  5  
ATOM 11102 N N    . LYS A 1 97  ? -13.489 -7.876  -1.136  1.00 0.00 ? 97  LYS A N    5  
ATOM 11103 C CA   . LYS A 1 97  ? -13.388 -8.305  -2.563  1.00 0.00 ? 97  LYS A CA   5  
ATOM 11104 C C    . LYS A 1 97  ? -12.014 -9.010  -2.851  1.00 0.00 ? 97  LYS A C    5  
ATOM 11105 O O    . LYS A 1 97  ? -11.062 -8.909  -2.069  1.00 0.00 ? 97  LYS A O    5  
ATOM 11106 C CB   . LYS A 1 97  ? -13.514 -7.032  -3.467  1.00 0.00 ? 97  LYS A CB   5  
ATOM 11107 C CG   . LYS A 1 97  ? -14.888 -6.314  -3.493  1.00 0.00 ? 97  LYS A CG   5  
ATOM 11108 C CD   . LYS A 1 97  ? -14.956 -5.109  -4.457  1.00 0.00 ? 97  LYS A CD   5  
ATOM 11109 C CE   . LYS A 1 97  ? -14.244 -3.846  -3.930  1.00 0.00 ? 97  LYS A CE   5  
ATOM 11110 N NZ   . LYS A 1 97  ? -14.332 -2.759  -4.939  1.00 0.00 ? 97  LYS A NZ   5  
ATOM 11111 H H    . LYS A 1 97  ? -12.662 -7.644  -0.560  1.00 0.00 ? 97  LYS A H    5  
ATOM 11112 H HA   . LYS A 1 97  ? -14.198 -9.021  -2.806  1.00 0.00 ? 97  LYS A HA   5  
ATOM 11113 H HB2  . LYS A 1 97  ? -12.722 -6.313  -3.177  1.00 0.00 ? 97  LYS A HB2  5  
ATOM 11114 H HB3  . LYS A 1 97  ? -13.268 -7.307  -4.511  1.00 0.00 ? 97  LYS A HB3  5  
ATOM 11115 H HG2  . LYS A 1 97  ? -15.665 -7.052  -3.777  1.00 0.00 ? 97  LYS A HG2  5  
ATOM 11116 H HG3  . LYS A 1 97  ? -15.180 -5.997  -2.471  1.00 0.00 ? 97  LYS A HG3  5  
ATOM 11117 H HD2  . LYS A 1 97  ? -14.562 -5.409  -5.449  1.00 0.00 ? 97  LYS A HD2  5  
ATOM 11118 H HD3  . LYS A 1 97  ? -16.025 -4.877  -4.637  1.00 0.00 ? 97  LYS A HD3  5  
ATOM 11119 H HE2  . LYS A 1 97  ? -14.698 -3.526  -2.965  1.00 0.00 ? 97  LYS A HE2  5  
ATOM 11120 H HE3  . LYS A 1 97  ? -13.182 -4.064  -3.685  1.00 0.00 ? 97  LYS A HE3  5  
ATOM 11121 H HZ1  . LYS A 1 97  ? -15.297 -2.526  -5.209  1.00 0.00 ? 97  LYS A HZ1  5  
ATOM 11122 H HZ2  . LYS A 1 97  ? -14.028 -1.801  -4.588  1.00 0.00 ? 97  LYS A HZ2  5  
ATOM 11123 H HZ3  . LYS A 1 97  ? -13.804 -2.915  -5.804  1.00 0.00 ? 97  LYS A HZ3  5  
ATOM 11124 N N    . ARG A 1 98  ? -11.847 -9.654  -4.033  1.00 0.00 ? 98  ARG A N    5  
ATOM 11125 C CA   . ARG A 1 98  ? -10.526 -10.250 -4.462  1.00 0.00 ? 98  ARG A CA   5  
ATOM 11126 C C    . ARG A 1 98  ? -9.465  -9.177  -4.966  1.00 0.00 ? 98  ARG A C    5  
ATOM 11127 O O    . ARG A 1 98  ? -8.800  -9.306  -5.995  1.00 0.00 ? 98  ARG A O    5  
ATOM 11128 C CB   . ARG A 1 98  ? -10.855 -11.342 -5.527  1.00 0.00 ? 98  ARG A CB   5  
ATOM 11129 C CG   . ARG A 1 98  ? -11.501 -10.903 -6.873  1.00 0.00 ? 98  ARG A CG   5  
ATOM 11130 C CD   . ARG A 1 98  ? -11.777 -12.100 -7.804  1.00 0.00 ? 98  ARG A CD   5  
ATOM 11131 N NE   . ARG A 1 98  ? -12.398 -11.665 -9.089  1.00 0.00 ? 98  ARG A NE   5  
ATOM 11132 C CZ   . ARG A 1 98  ? -13.707 -11.591 -9.342  1.00 0.00 ? 98  ARG A CZ   5  
ATOM 11133 N NH1  . ARG A 1 98  ? -14.635 -11.832 -8.450  1.00 0.00 ? 98  ARG A NH1  5  
ATOM 11134 N NH2  . ARG A 1 98  ? -14.083 -11.256 -10.543 1.00 0.00 ? 98  ARG A NH2  5  
ATOM 11135 H H    . ARG A 1 98  ? -12.683 -9.698  -4.622  1.00 0.00 ? 98  ARG A H    5  
ATOM 11136 H HA   . ARG A 1 98  ? -10.048 -10.757 -3.598  1.00 0.00 ? 98  ARG A HA   5  
ATOM 11137 H HB2  . ARG A 1 98  ? -9.912  -11.877 -5.752  1.00 0.00 ? 98  ARG A HB2  5  
ATOM 11138 H HB3  . ARG A 1 98  ? -11.490 -12.113 -5.047  1.00 0.00 ? 98  ARG A HB3  5  
ATOM 11139 H HG2  . ARG A 1 98  ? -12.439 -10.348 -6.685  1.00 0.00 ? 98  ARG A HG2  5  
ATOM 11140 H HG3  . ARG A 1 98  ? -10.839 -10.175 -7.384  1.00 0.00 ? 98  ARG A HG3  5  
ATOM 11141 H HD2  . ARG A 1 98  ? -10.817 -12.609 -8.030  1.00 0.00 ? 98  ARG A HD2  5  
ATOM 11142 H HD3  . ARG A 1 98  ? -12.376 -12.881 -7.292  1.00 0.00 ? 98  ARG A HD3  5  
ATOM 11143 H HE   . ARG A 1 98  ? -11.808 -11.422 -9.890  1.00 0.00 ? 98  ARG A HE   5  
ATOM 11144 H HH11 . ARG A 1 98  ? -14.273 -12.070 -7.525  1.00 0.00 ? 98  ARG A HH11 5  
ATOM 11145 H HH12 . ARG A 1 98  ? -15.615 -11.756 -8.730  1.00 0.00 ? 98  ARG A HH12 5  
ATOM 11146 H HH21 . ARG A 1 98  ? -13.345 -11.079 -11.227 1.00 0.00 ? 98  ARG A HH21 5  
ATOM 11147 H HH22 . ARG A 1 98  ? -15.088 -11.210 -10.721 1.00 0.00 ? 98  ARG A HH22 5  
ATOM 11148 N N    . PHE A 1 99  ? -9.319  -8.129  -4.150  1.00 0.00 ? 99  PHE A N    5  
ATOM 11149 C CA   . PHE A 1 99  ? -8.496  -6.901  -4.357  1.00 0.00 ? 99  PHE A CA   5  
ATOM 11150 C C    . PHE A 1 99  ? -8.006  -6.306  -2.988  1.00 0.00 ? 99  PHE A C    5  
ATOM 11151 O O    . PHE A 1 99  ? -7.621  -5.131  -2.977  1.00 0.00 ? 99  PHE A O    5  
ATOM 11152 C CB   . PHE A 1 99  ? -9.435  -5.854  -5.068  1.00 0.00 ? 99  PHE A CB   5  
ATOM 11153 C CG   . PHE A 1 99  ? -10.079 -6.148  -6.446  1.00 0.00 ? 99  PHE A CG   5  
ATOM 11154 C CD1  . PHE A 1 99  ? -9.340  -6.645  -7.527  1.00 0.00 ? 99  PHE A CD1  5  
ATOM 11155 C CD2  . PHE A 1 99  ? -11.443 -5.883  -6.622  1.00 0.00 ? 99  PHE A CD2  5  
ATOM 11156 C CE1  . PHE A 1 99  ? -9.957  -6.890  -8.752  1.00 0.00 ? 99  PHE A CE1  5  
ATOM 11157 C CE2  . PHE A 1 99  ? -12.061 -6.134  -7.844  1.00 0.00 ? 99  PHE A CE2  5  
ATOM 11158 C CZ   . PHE A 1 99  ? -11.317 -6.637  -8.908  1.00 0.00 ? 99  PHE A CZ   5  
ATOM 11159 H H    . PHE A 1 99  ? -9.954  -8.211  -3.339  1.00 0.00 ? 99  PHE A H    5  
ATOM 11160 H HA   . PHE A 1 99  ? -7.578  -7.045  -4.968  1.00 0.00 ? 99  PHE A HA   5  
ATOM 11161 H HB2  . PHE A 1 99  ? -10.237 -5.598  -4.346  1.00 0.00 ? 99  PHE A HB2  5  
ATOM 11162 H HB3  . PHE A 1 99  ? -8.902  -4.891  -5.167  1.00 0.00 ? 99  PHE A HB3  5  
ATOM 11163 H HD1  . PHE A 1 99  ? -8.291  -6.879  -7.422  1.00 0.00 ? 99  PHE A HD1  5  
ATOM 11164 H HD2  . PHE A 1 99  ? -12.029 -5.476  -5.813  1.00 0.00 ? 99  PHE A HD2  5  
ATOM 11165 H HE1  . PHE A 1 99  ? -9.379  -7.278  -9.578  1.00 0.00 ? 99  PHE A HE1  5  
ATOM 11166 H HE2  . PHE A 1 99  ? -13.115 -5.934  -7.971  1.00 0.00 ? 99  PHE A HE2  5  
ATOM 11167 H HZ   . PHE A 1 99  ? -11.795 -6.826  -9.859  1.00 0.00 ? 99  PHE A HZ   5  
ATOM 11168 N N    . ALA A 1 100 ? -8.000  -7.044  -1.846  1.00 0.00 ? 100 ALA A N    5  
ATOM 11169 C CA   . ALA A 1 100 ? -7.749  -6.439  -0.527  1.00 0.00 ? 100 ALA A CA   5  
ATOM 11170 C C    . ALA A 1 100 ? -6.355  -6.717  0.089   1.00 0.00 ? 100 ALA A C    5  
ATOM 11171 O O    . ALA A 1 100 ? -5.592  -7.585  -0.349  1.00 0.00 ? 100 ALA A O    5  
ATOM 11172 C CB   . ALA A 1 100 ? -8.911  -6.957  0.353   1.00 0.00 ? 100 ALA A CB   5  
ATOM 11173 H H    . ALA A 1 100 ? -8.284  -8.039  -1.875  1.00 0.00 ? 100 ALA A H    5  
ATOM 11174 H HA   . ALA A 1 100 ? -7.833  -5.346  -0.623  1.00 0.00 ? 100 ALA A HA   5  
ATOM 11175 H HB1  . ALA A 1 100 ? -9.902  -6.684  -0.057  1.00 0.00 ? 100 ALA A HB1  5  
ATOM 11176 H HB2  . ALA A 1 100 ? -8.917  -8.053  0.480   1.00 0.00 ? 100 ALA A HB2  5  
ATOM 11177 H HB3  . ALA A 1 100 ? -8.883  -6.537  1.374   1.00 0.00 ? 100 ALA A HB3  5  
ATOM 11178 N N    . PHE A 1 101 ? -6.027  -5.894  1.103   1.00 0.00 ? 101 PHE A N    5  
ATOM 11179 C CA   . PHE A 1 101 ? -4.749  -5.979  1.847   1.00 0.00 ? 101 PHE A CA   5  
ATOM 11180 C C    . PHE A 1 101 ? -5.010  -5.830  3.379   1.00 0.00 ? 101 PHE A C    5  
ATOM 11181 O O    . PHE A 1 101 ? -5.778  -4.961  3.828   1.00 0.00 ? 101 PHE A O    5  
ATOM 11182 C CB   . PHE A 1 101 ? -3.740  -4.895  1.362   1.00 0.00 ? 101 PHE A CB   5  
ATOM 11183 C CG   . PHE A 1 101 ? -3.147  -5.128  -0.042  1.00 0.00 ? 101 PHE A CG   5  
ATOM 11184 C CD1  . PHE A 1 101 ? -3.864  -4.754  -1.184  1.00 0.00 ? 101 PHE A CD1  5  
ATOM 11185 C CD2  . PHE A 1 101 ? -1.900  -5.745  -0.191  1.00 0.00 ? 101 PHE A CD2  5  
ATOM 11186 C CE1  . PHE A 1 101 ? -3.369  -5.042  -2.449  1.00 0.00 ? 101 PHE A CE1  5  
ATOM 11187 C CE2  . PHE A 1 101 ? -1.397  -6.014  -1.462  1.00 0.00 ? 101 PHE A CE2  5  
ATOM 11188 C CZ   . PHE A 1 101 ? -2.143  -5.685  -2.590  1.00 0.00 ? 101 PHE A CZ   5  
ATOM 11189 H H    . PHE A 1 101 ? -6.771  -5.225  1.355   1.00 0.00 ? 101 PHE A H    5  
ATOM 11190 H HA   . PHE A 1 101 ? -4.335  -6.980  1.666   1.00 0.00 ? 101 PHE A HA   5  
ATOM 11191 H HB2  . PHE A 1 101 ? -4.206  -3.895  1.426   1.00 0.00 ? 101 PHE A HB2  5  
ATOM 11192 H HB3  . PHE A 1 101 ? -2.901  -4.839  2.085   1.00 0.00 ? 101 PHE A HB3  5  
ATOM 11193 H HD1  . PHE A 1 101 ? -4.826  -4.269  -1.096  1.00 0.00 ? 101 PHE A HD1  5  
ATOM 11194 H HD2  . PHE A 1 101 ? -1.328  -6.038  0.677   1.00 0.00 ? 101 PHE A HD2  5  
ATOM 11195 H HE1  . PHE A 1 101 ? -3.937  -4.759  -3.317  1.00 0.00 ? 101 PHE A HE1  5  
ATOM 11196 H HE2  . PHE A 1 101 ? -0.439  -6.500  -1.571  1.00 0.00 ? 101 PHE A HE2  5  
ATOM 11197 H HZ   . PHE A 1 101 ? -1.766  -5.909  -3.578  1.00 0.00 ? 101 PHE A HZ   5  
ATOM 11198 N N    . ILE A 1 102 ? -4.334  -6.688  4.173   1.00 0.00 ? 102 ILE A N    5  
ATOM 11199 C CA   . ILE A 1 102 ? -4.502  -6.698  5.670   1.00 0.00 ? 102 ILE A CA   5  
ATOM 11200 C C    . ILE A 1 102 ? -3.161  -6.179  6.286   1.00 0.00 ? 102 ILE A C    5  
ATOM 11201 O O    . ILE A 1 102 ? -2.109  -6.809  6.159   1.00 0.00 ? 102 ILE A O    5  
ATOM 11202 C CB   . ILE A 1 102 ? -4.894  -8.117  6.229   1.00 0.00 ? 102 ILE A CB   5  
ATOM 11203 C CG1  . ILE A 1 102 ? -6.164  -8.715  5.538   1.00 0.00 ? 102 ILE A CG1  5  
ATOM 11204 C CG2  . ILE A 1 102 ? -5.154  -8.063  7.761   1.00 0.00 ? 102 ILE A CG2  5  
ATOM 11205 C CD1  . ILE A 1 102 ? -6.431  -10.206 5.799   1.00 0.00 ? 102 ILE A CD1  5  
ATOM 11206 H H    . ILE A 1 102 ? -3.718  -7.343  3.658   1.00 0.00 ? 102 ILE A H    5  
ATOM 11207 H HA   . ILE A 1 102 ? -5.322  -6.014  5.966   1.00 0.00 ? 102 ILE A HA   5  
ATOM 11208 H HB   . ILE A 1 102 ? -4.048  -8.804  6.078   1.00 0.00 ? 102 ILE A HB   5  
ATOM 11209 H HG12 . ILE A 1 102 ? -7.063  -8.136  5.813   1.00 0.00 ? 102 ILE A HG12 5  
ATOM 11210 H HG13 . ILE A 1 102 ? -6.088  -8.603  4.440   1.00 0.00 ? 102 ILE A HG13 5  
ATOM 11211 H HG21 . ILE A 1 102 ? -4.309  -7.620  8.321   1.00 0.00 ? 102 ILE A HG21 5  
ATOM 11212 H HG22 . ILE A 1 102 ? -6.061  -7.496  8.027   1.00 0.00 ? 102 ILE A HG22 5  
ATOM 11213 H HG23 . ILE A 1 102 ? -5.275  -9.080  8.179   1.00 0.00 ? 102 ILE A HG23 5  
ATOM 11214 H HD11 . ILE A 1 102 ? -5.563  -10.827 5.511   1.00 0.00 ? 102 ILE A HD11 5  
ATOM 11215 H HD12 . ILE A 1 102 ? -6.634  -10.417 6.864   1.00 0.00 ? 102 ILE A HD12 5  
ATOM 11216 H HD13 . ILE A 1 102 ? -7.300  -10.573 5.222   1.00 0.00 ? 102 ILE A HD13 5  
ATOM 11217 N N    . ARG A 1 103 ? -3.214  -5.040  6.991   1.00 0.00 ? 103 ARG A N    5  
ATOM 11218 C CA   . ARG A 1 103 ? -2.010  -4.394  7.583   1.00 0.00 ? 103 ARG A CA   5  
ATOM 11219 C C    . ARG A 1 103 ? -1.860  -4.697  9.112   1.00 0.00 ? 103 ARG A C    5  
ATOM 11220 O O    . ARG A 1 103 ? -2.522  -4.063  9.942   1.00 0.00 ? 103 ARG A O    5  
ATOM 11221 C CB   . ARG A 1 103 ? -2.196  -2.889  7.224   1.00 0.00 ? 103 ARG A CB   5  
ATOM 11222 C CG   . ARG A 1 103 ? -1.065  -1.904  7.610   1.00 0.00 ? 103 ARG A CG   5  
ATOM 11223 C CD   . ARG A 1 103 ? -1.153  -1.264  9.012   1.00 0.00 ? 103 ARG A CD   5  
ATOM 11224 N NE   . ARG A 1 103 ? -2.308  -0.327  9.143   1.00 0.00 ? 103 ARG A NE   5  
ATOM 11225 C CZ   . ARG A 1 103 ? -3.369  -0.496  9.931   1.00 0.00 ? 103 ARG A CZ   5  
ATOM 11226 N NH1  . ARG A 1 103 ? -3.630  -1.597  10.587  1.00 0.00 ? 103 ARG A NH1  5  
ATOM 11227 N NH2  . ARG A 1 103 ? -4.210  0.489   10.049  1.00 0.00 ? 103 ARG A NH2  5  
ATOM 11228 H H    . ARG A 1 103 ? -4.140  -4.607  7.029   1.00 0.00 ? 103 ARG A H    5  
ATOM 11229 H HA   . ARG A 1 103 ? -1.083  -4.734  7.077   1.00 0.00 ? 103 ARG A HA   5  
ATOM 11230 H HB2  . ARG A 1 103 ? -2.292  -2.827  6.121   1.00 0.00 ? 103 ARG A HB2  5  
ATOM 11231 H HB3  . ARG A 1 103 ? -3.163  -2.507  7.604   1.00 0.00 ? 103 ARG A HB3  5  
ATOM 11232 H HG2  . ARG A 1 103 ? -0.092  -2.413  7.481   1.00 0.00 ? 103 ARG A HG2  5  
ATOM 11233 H HG3  . ARG A 1 103 ? -1.012  -1.091  6.863   1.00 0.00 ? 103 ARG A HG3  5  
ATOM 11234 H HD2  . ARG A 1 103 ? -1.108  -2.028  9.809   1.00 0.00 ? 103 ARG A HD2  5  
ATOM 11235 H HD3  . ARG A 1 103 ? -0.226  -0.684  9.181   1.00 0.00 ? 103 ARG A HD3  5  
ATOM 11236 H HE   . ARG A 1 103 ? -2.290  0.584   8.677   1.00 0.00 ? 103 ARG A HE   5  
ATOM 11237 H HH11 . ARG A 1 103 ? -3.019  -2.406  10.385  1.00 0.00 ? 103 ARG A HH11 5  
ATOM 11238 H HH12 . ARG A 1 103 ? -4.478  -1.612  11.173  1.00 0.00 ? 103 ARG A HH12 5  
ATOM 11239 H HH21 . ARG A 1 103 ? -3.983  1.354   9.556   1.00 0.00 ? 103 ARG A HH21 5  
ATOM 11240 H HH22 . ARG A 1 103 ? -5.005  0.338   10.676  1.00 0.00 ? 103 ARG A HH22 5  
ATOM 11241 N N    . SER A 1 104 ? -0.966  -5.633  9.500   1.00 0.00 ? 104 SER A N    5  
ATOM 11242 C CA   . SER A 1 104 ? -0.697  -5.952  10.939  1.00 0.00 ? 104 SER A CA   5  
ATOM 11243 C C    . SER A 1 104 ? 0.663   -6.691  11.154  1.00 0.00 ? 104 SER A C    5  
ATOM 11244 O O    . SER A 1 104 ? 0.986   -7.627  10.417  1.00 0.00 ? 104 SER A O    5  
ATOM 11245 C CB   . SER A 1 104 ? -1.820  -6.864  11.506  1.00 0.00 ? 104 SER A CB   5  
ATOM 11246 O OG   . SER A 1 104 ? -1.645  -7.099  12.910  1.00 0.00 ? 104 SER A OG   5  
ATOM 11247 H H    . SER A 1 104 ? -0.476  -6.114  8.730   1.00 0.00 ? 104 SER A H    5  
ATOM 11248 H HA   . SER A 1 104 ? -0.692  -5.014  11.529  1.00 0.00 ? 104 SER A HA   5  
ATOM 11249 H HB2  . SER A 1 104 ? -2.811  -6.395  11.351  1.00 0.00 ? 104 SER A HB2  5  
ATOM 11250 H HB3  . SER A 1 104 ? -1.866  -7.831  10.964  1.00 0.00 ? 104 SER A HB3  5  
ATOM 11251 H HG   . SER A 1 104 ? -0.831  -7.609  13.044  1.00 0.00 ? 104 SER A HG   5  
ATOM 11252 N N    . ASP A 1 105 ? 1.447   -6.282  12.181  1.00 0.00 ? 105 ASP A N    5  
ATOM 11253 C CA   . ASP A 1 105 ? 2.628   -7.079  12.641  1.00 0.00 ? 105 ASP A CA   5  
ATOM 11254 C C    . ASP A 1 105 ? 2.097   -7.794  13.968  1.00 0.00 ? 105 ASP A C    5  
ATOM 11255 O O    . ASP A 1 105 ? 0.941   -8.234  14.062  1.00 0.00 ? 105 ASP A O    5  
ATOM 11256 C CB   . ASP A 1 105 ? 3.904   -6.196  12.806  1.00 0.00 ? 105 ASP A CB   5  
ATOM 11257 C CG   . ASP A 1 105 ? 5.201   -6.904  13.188  1.00 0.00 ? 105 ASP A CG   5  
ATOM 11258 O OD1  . ASP A 1 105 ? 5.917   -7.411  12.302  1.00 0.00 ? 105 ASP A OD1  5  
ATOM 11259 O OD2  . ASP A 1 105 ? 5.510   -6.952  14.398  1.00 0.00 ? 105 ASP A OD2  5  
ATOM 11260 H H    . ASP A 1 105 ? 1.087   -5.499  12.737  1.00 0.00 ? 105 ASP A H    5  
ATOM 11261 H HA   . ASP A 1 105 ? 2.912   -7.787  11.863  1.00 0.00 ? 105 ASP A HA   5  
ATOM 11262 H HB2  . ASP A 1 105 ? 4.162   -5.741  11.847  1.00 0.00 ? 105 ASP A HB2  5  
ATOM 11263 H HB3  . ASP A 1 105 ? 3.725   -5.376  13.523  1.00 0.00 ? 105 ASP A HB3  5  
ATOM 11264 N N    . SER A 1 106 ? 2.937   -7.871  15.007  1.00 0.00 ? 106 SER A N    5  
ATOM 11265 C CA   . SER A 1 106 ? 2.569   -8.318  16.380  1.00 0.00 ? 106 SER A CA   5  
ATOM 11266 C C    . SER A 1 106 ? 2.868   -7.196  17.456  1.00 0.00 ? 106 SER A C    5  
ATOM 11267 O O    . SER A 1 106 ? 3.262   -7.511  18.586  1.00 0.00 ? 106 SER A O    5  
ATOM 11268 C CB   . SER A 1 106 ? 3.352   -9.629  16.634  1.00 0.00 ? 106 SER A CB   5  
ATOM 11269 O OG   . SER A 1 106 ? 3.132   -10.090 17.966  1.00 0.00 ? 106 SER A OG   5  
ATOM 11270 H H    . SER A 1 106 ? 3.875   -7.490  14.763  1.00 0.00 ? 106 SER A H    5  
ATOM 11271 H HA   . SER A 1 106 ? 1.486   -8.541  16.457  1.00 0.00 ? 106 SER A HA   5  
ATOM 11272 H HB2  . SER A 1 106 ? 3.040   -10.414 15.917  1.00 0.00 ? 106 SER A HB2  5  
ATOM 11273 H HB3  . SER A 1 106 ? 4.439   -9.484  16.471  1.00 0.00 ? 106 SER A HB3  5  
ATOM 11274 H HG   . SER A 1 106 ? 3.239   -9.307  18.531  1.00 0.00 ? 106 SER A HG   5  
ATOM 11275 N N    . GLY A 1 107 ? 2.634   -5.904  17.141  1.00 0.00 ? 107 GLY A N    5  
ATOM 11276 C CA   . GLY A 1 107 ? 2.901   -4.762  18.056  1.00 0.00 ? 107 GLY A CA   5  
ATOM 11277 C C    . GLY A 1 107 ? 3.043   -3.397  17.308  1.00 0.00 ? 107 GLY A C    5  
ATOM 11278 O O    . GLY A 1 107 ? 2.293   -3.183  16.348  1.00 0.00 ? 107 GLY A O    5  
ATOM 11279 H H    . GLY A 1 107 ? 2.316   -5.768  16.173  1.00 0.00 ? 107 GLY A H    5  
ATOM 11280 H HA2  . GLY A 1 107 ? 2.069   -4.671  18.779  1.00 0.00 ? 107 GLY A HA2  5  
ATOM 11281 H HA3  . GLY A 1 107 ? 3.800   -4.974  18.662  1.00 0.00 ? 107 GLY A HA3  5  
ATOM 11282 N N    . PRO A 1 108 ? 3.968   -2.447  17.653  1.00 0.00 ? 108 PRO A N    5  
ATOM 11283 C CA   . PRO A 1 108 ? 4.084   -1.134  16.938  1.00 0.00 ? 108 PRO A CA   5  
ATOM 11284 C C    . PRO A 1 108 ? 4.880   -1.162  15.581  1.00 0.00 ? 108 PRO A C    5  
ATOM 11285 O O    . PRO A 1 108 ? 5.895   -0.484  15.386  1.00 0.00 ? 108 PRO A O    5  
ATOM 11286 C CB   . PRO A 1 108 ? 4.734   -0.283  18.050  1.00 0.00 ? 108 PRO A CB   5  
ATOM 11287 C CG   . PRO A 1 108 ? 5.649   -1.247  18.811  1.00 0.00 ? 108 PRO A CG   5  
ATOM 11288 C CD   . PRO A 1 108 ? 4.888   -2.575  18.804  1.00 0.00 ? 108 PRO A CD   5  
ATOM 11289 H HA   . PRO A 1 108 ? 3.086   -0.716  16.703  1.00 0.00 ? 108 PRO A HA   5  
ATOM 11290 H HB2  . PRO A 1 108 ? 5.276   0.603   17.665  1.00 0.00 ? 108 PRO A HB2  5  
ATOM 11291 H HB3  . PRO A 1 108 ? 3.950   0.109   18.727  1.00 0.00 ? 108 PRO A HB3  5  
ATOM 11292 H HG2  . PRO A 1 108 ? 6.612   -1.357  18.275  1.00 0.00 ? 108 PRO A HG2  5  
ATOM 11293 H HG3  . PRO A 1 108 ? 5.885   -0.894  19.832  1.00 0.00 ? 108 PRO A HG3  5  
ATOM 11294 H HD2  . PRO A 1 108 ? 5.580   -3.433  18.699  1.00 0.00 ? 108 PRO A HD2  5  
ATOM 11295 H HD3  . PRO A 1 108 ? 4.322   -2.706  19.748  1.00 0.00 ? 108 PRO A HD3  5  
ATOM 11296 N N    . THR A 1 109 ? 4.436   -1.999  14.635  1.00 0.00 ? 109 THR A N    5  
ATOM 11297 C CA   . THR A 1 109 ? 5.045   -2.168  13.274  1.00 0.00 ? 109 THR A CA   5  
ATOM 11298 C C    . THR A 1 109 ? 3.962   -2.868  12.357  1.00 0.00 ? 109 THR A C    5  
ATOM 11299 O O    . THR A 1 109 ? 2.819   -3.117  12.771  1.00 0.00 ? 109 THR A O    5  
ATOM 11300 C CB   . THR A 1 109 ? 6.409   -2.959  13.367  1.00 0.00 ? 109 THR A CB   5  
ATOM 11301 O OG1  . THR A 1 109 ? 7.202   -2.545  14.478  1.00 0.00 ? 109 THR A OG1  5  
ATOM 11302 C CG2  . THR A 1 109 ? 7.349   -2.749  12.174  1.00 0.00 ? 109 THR A CG2  5  
ATOM 11303 H H    . THR A 1 109 ? 3.587   -2.514  14.916  1.00 0.00 ? 109 THR A H    5  
ATOM 11304 H HA   . THR A 1 109 ? 5.233   -1.165  12.843  1.00 0.00 ? 109 THR A HA   5  
ATOM 11305 H HB   . THR A 1 109 ? 6.177   -4.037  13.467  1.00 0.00 ? 109 THR A HB   5  
ATOM 11306 H HG1  . THR A 1 109 ? 6.776   -1.736  14.817  1.00 0.00 ? 109 THR A HG1  5  
ATOM 11307 H HG21 . THR A 1 109 ? 7.531   -1.677  11.971  1.00 0.00 ? 109 THR A HG21 5  
ATOM 11308 H HG22 . THR A 1 109 ? 8.338   -3.204  12.363  1.00 0.00 ? 109 THR A HG22 5  
ATOM 11309 H HG23 . THR A 1 109 ? 6.969   -3.211  11.249  1.00 0.00 ? 109 THR A HG23 5  
ATOM 11310 N N    . THR A 1 110 ? 4.268   -3.176  11.080  1.00 0.00 ? 110 THR A N    5  
ATOM 11311 C CA   . THR A 1 110 ? 3.316   -3.900  10.178  1.00 0.00 ? 110 THR A CA   5  
ATOM 11312 C C    . THR A 1 110 ? 4.017   -4.780  9.079   1.00 0.00 ? 110 THR A C    5  
ATOM 11313 O O    . THR A 1 110 ? 5.227   -4.988  9.025   1.00 0.00 ? 110 THR A O    5  
ATOM 11314 C CB   . THR A 1 110 ? 2.277   -2.848  9.635   1.00 0.00 ? 110 THR A CB   5  
ATOM 11315 O OG1  . THR A 1 110 ? 1.075   -3.533  9.338   1.00 0.00 ? 110 THR A OG1  5  
ATOM 11316 C CG2  . THR A 1 110 ? 2.675   -2.121  8.346   1.00 0.00 ? 110 THR A CG2  5  
ATOM 11317 H H    . THR A 1 110 ? 5.225   -2.925  10.804  1.00 0.00 ? 110 THR A H    5  
ATOM 11318 H HA   . THR A 1 110 ? 2.792   -4.688  10.780  1.00 0.00 ? 110 THR A HA   5  
ATOM 11319 H HB   . THR A 1 110 ? 2.055   -2.098  10.422  1.00 0.00 ? 110 THR A HB   5  
ATOM 11320 H HG1  . THR A 1 110 ? 0.758   -3.917  10.161  1.00 0.00 ? 110 THR A HG1  5  
ATOM 11321 H HG21 . THR A 1 110 ? 3.651   -1.626  8.464   1.00 0.00 ? 110 THR A HG21 5  
ATOM 11322 H HG22 . THR A 1 110 ? 2.751   -2.825  7.493   1.00 0.00 ? 110 THR A HG22 5  
ATOM 11323 H HG23 . THR A 1 110 ? 1.927   -1.365  8.065   1.00 0.00 ? 110 THR A HG23 5  
ATOM 11324 N N    . SER A 1 111 ? 3.116   -5.411  8.328   1.00 0.00 ? 111 SER A N    5  
ATOM 11325 C CA   . SER A 1 111 ? 3.348   -6.399  7.238   1.00 0.00 ? 111 SER A CA   5  
ATOM 11326 C C    . SER A 1 111 ? 2.029   -6.447  6.394   1.00 0.00 ? 111 SER A C    5  
ATOM 11327 O O    . SER A 1 111 ? 0.945   -6.244  6.967   1.00 0.00 ? 111 SER A O    5  
ATOM 11328 C CB   . SER A 1 111 ? 3.661   -7.783  7.852   1.00 0.00 ? 111 SER A CB   5  
ATOM 11329 O OG   . SER A 1 111 ? 3.811   -8.781  6.841   1.00 0.00 ? 111 SER A OG   5  
ATOM 11330 H H    . SER A 1 111 ? 2.188   -4.990  8.492   1.00 0.00 ? 111 SER A H    5  
ATOM 11331 H HA   . SER A 1 111 ? 4.195   -6.073  6.602   1.00 0.00 ? 111 SER A HA   5  
ATOM 11332 H HB2  . SER A 1 111 ? 4.588   -7.725  8.455   1.00 0.00 ? 111 SER A HB2  5  
ATOM 11333 H HB3  . SER A 1 111 ? 2.866   -8.090  8.562   1.00 0.00 ? 111 SER A HB3  5  
ATOM 11334 H HG   . SER A 1 111 ? 2.940   -8.931  6.458   1.00 0.00 ? 111 SER A HG   5  
ATOM 11335 N N    . PHE A 1 112 ? 2.043   -6.754  5.072   1.00 0.00 ? 112 PHE A N    5  
ATOM 11336 C CA   . PHE A 1 112 ? 0.770   -6.660  4.292   1.00 0.00 ? 112 PHE A CA   5  
ATOM 11337 C C    . PHE A 1 112 ? 0.266   -8.030  3.767   1.00 0.00 ? 112 PHE A C    5  
ATOM 11338 O O    . PHE A 1 112 ? 0.926   -8.627  2.929   1.00 0.00 ? 112 PHE A O    5  
ATOM 11339 C CB   . PHE A 1 112 ? 1.043   -5.647  3.139   1.00 0.00 ? 112 PHE A CB   5  
ATOM 11340 C CG   . PHE A 1 112 ? 1.123   -4.168  3.561   1.00 0.00 ? 112 PHE A CG   5  
ATOM 11341 C CD1  . PHE A 1 112 ? -0.047  -3.427  3.752   1.00 0.00 ? 112 PHE A CD1  5  
ATOM 11342 C CD2  . PHE A 1 112 ? 2.365   -3.567  3.799   1.00 0.00 ? 112 PHE A CD2  5  
ATOM 11343 C CE1  . PHE A 1 112 ? 0.024   -2.107  4.187   1.00 0.00 ? 112 PHE A CE1  5  
ATOM 11344 C CE2  . PHE A 1 112 ? 2.433   -2.248  4.240   1.00 0.00 ? 112 PHE A CE2  5  
ATOM 11345 C CZ   . PHE A 1 112 ? 1.262   -1.522  4.440   1.00 0.00 ? 112 PHE A CZ   5  
ATOM 11346 H H    . PHE A 1 112 ? 2.937   -6.945  4.575   1.00 0.00 ? 112 PHE A H    5  
ATOM 11347 H HA   . PHE A 1 112 ? -0.070  -6.223  4.870   1.00 0.00 ? 112 PHE A HA   5  
ATOM 11348 H HB2  . PHE A 1 112 ? 1.973   -5.930  2.614   1.00 0.00 ? 112 PHE A HB2  5  
ATOM 11349 H HB3  . PHE A 1 112 ? 0.259   -5.745  2.366   1.00 0.00 ? 112 PHE A HB3  5  
ATOM 11350 H HD1  . PHE A 1 112 ? -1.014  -3.878  3.580   1.00 0.00 ? 112 PHE A HD1  5  
ATOM 11351 H HD2  . PHE A 1 112 ? 3.280   -4.126  3.659   1.00 0.00 ? 112 PHE A HD2  5  
ATOM 11352 H HE1  . PHE A 1 112 ? -0.882  -1.543  4.343   1.00 0.00 ? 112 PHE A HE1  5  
ATOM 11353 H HE2  . PHE A 1 112 ? 3.396   -1.795  4.431   1.00 0.00 ? 112 PHE A HE2  5  
ATOM 11354 H HZ   . PHE A 1 112 ? 1.309   -0.506  4.798   1.00 0.00 ? 112 PHE A HZ   5  
ATOM 11355 N N    . GLU A 1 113 ? -0.899  -8.553  4.202   1.00 0.00 ? 113 GLU A N    5  
ATOM 11356 C CA   . GLU A 1 113 ? -1.516  -9.753  3.535   1.00 0.00 ? 113 GLU A CA   5  
ATOM 11357 C C    . GLU A 1 113 ? -2.225  -9.238  2.221   1.00 0.00 ? 113 GLU A C    5  
ATOM 11358 O O    . GLU A 1 113 ? -2.414  -8.028  2.049   1.00 0.00 ? 113 GLU A O    5  
ATOM 11359 C CB   . GLU A 1 113 ? -2.485  -10.531 4.459   1.00 0.00 ? 113 GLU A CB   5  
ATOM 11360 C CG   . GLU A 1 113 ? -1.947  -10.902 5.868   1.00 0.00 ? 113 GLU A CG   5  
ATOM 11361 C CD   . GLU A 1 113 ? -2.882  -11.766 6.691   1.00 0.00 ? 113 GLU A CD   5  
ATOM 11362 O OE1  . GLU A 1 113 ? -3.738  -11.215 7.412   1.00 0.00 ? 113 GLU A OE1  5  
ATOM 11363 O OE2  . GLU A 1 113 ? -2.753  -13.004 6.632   1.00 0.00 ? 113 GLU A OE2  5  
ATOM 11364 H H    . GLU A 1 113 ? -1.396  -8.001  4.915   1.00 0.00 ? 113 GLU A H    5  
ATOM 11365 H HA   . GLU A 1 113 ? -0.720  -10.462 3.236   1.00 0.00 ? 113 GLU A HA   5  
ATOM 11366 H HB2  . GLU A 1 113 ? -3.444  -9.995  4.534   1.00 0.00 ? 113 GLU A HB2  5  
ATOM 11367 H HB3  . GLU A 1 113 ? -2.754  -11.471 3.941   1.00 0.00 ? 113 GLU A HB3  5  
ATOM 11368 H HG2  . GLU A 1 113 ? -0.986  -11.436 5.796   1.00 0.00 ? 113 GLU A HG2  5  
ATOM 11369 H HG3  . GLU A 1 113 ? -1.740  -9.994  6.460   1.00 0.00 ? 113 GLU A HG3  5  
ATOM 11370 N N    . SER A 1 114 ? -2.544  -10.114 1.251   1.00 0.00 ? 114 SER A N    5  
ATOM 11371 C CA   . SER A 1 114 ? -2.994  -9.697  -0.106  1.00 0.00 ? 114 SER A CA   5  
ATOM 11372 C C    . SER A 1 114 ? -3.958  -10.753 -0.708  1.00 0.00 ? 114 SER A C    5  
ATOM 11373 O O    . SER A 1 114 ? -3.799  -11.962 -0.505  1.00 0.00 ? 114 SER A O    5  
ATOM 11374 C CB   . SER A 1 114 ? -1.755  -9.502  -1.002  1.00 0.00 ? 114 SER A CB   5  
ATOM 11375 O OG   . SER A 1 114 ? -2.137  -8.888  -2.230  1.00 0.00 ? 114 SER A OG   5  
ATOM 11376 H H    . SER A 1 114 ? -2.474  -11.119 1.462   1.00 0.00 ? 114 SER A H    5  
ATOM 11377 H HA   . SER A 1 114 ? -3.523  -8.729  -0.032  1.00 0.00 ? 114 SER A HA   5  
ATOM 11378 H HB2  . SER A 1 114 ? -0.994  -8.872  -0.499  1.00 0.00 ? 114 SER A HB2  5  
ATOM 11379 H HB3  . SER A 1 114 ? -1.256  -10.466 -1.205  1.00 0.00 ? 114 SER A HB3  5  
ATOM 11380 H HG   . SER A 1 114 ? -2.387  -7.978  -2.025  1.00 0.00 ? 114 SER A HG   5  
ATOM 11381 N N    . ALA A 1 115 ? -4.929  -10.265 -1.514  1.00 0.00 ? 115 ALA A N    5  
ATOM 11382 C CA   . ALA A 1 115 ? -6.147  -11.031 -1.942  1.00 0.00 ? 115 ALA A CA   5  
ATOM 11383 C C    . ALA A 1 115 ? -7.011  -10.827 -0.681  1.00 0.00 ? 115 ALA A C    5  
ATOM 11384 O O    . ALA A 1 115 ? -7.688  -9.792  -0.628  1.00 0.00 ? 115 ALA A O    5  
ATOM 11385 C CB   . ALA A 1 115 ? -5.899  -12.429 -2.541  1.00 0.00 ? 115 ALA A CB   5  
ATOM 11386 H H    . ALA A 1 115 ? -4.938  -9.234  -1.531  1.00 0.00 ? 115 ALA A H    5  
ATOM 11387 H HA   . ALA A 1 115 ? -6.690  -10.492 -2.694  1.00 0.00 ? 115 ALA A HA   5  
ATOM 11388 H HB1  . ALA A 1 115 ? -5.385  -13.084 -1.835  1.00 0.00 ? 115 ALA A HB1  5  
ATOM 11389 H HB2  . ALA A 1 115 ? -6.845  -12.928 -2.819  1.00 0.00 ? 115 ALA A HB2  5  
ATOM 11390 H HB3  . ALA A 1 115 ? -5.271  -12.370 -3.449  1.00 0.00 ? 115 ALA A HB3  5  
ATOM 11391 N N    . ALA A 1 116 ? -6.962  -11.765 0.279   1.00 0.00 ? 116 ALA A N    5  
ATOM 11392 C CA   . ALA A 1 116 ? -7.350  -11.424 1.690   1.00 0.00 ? 116 ALA A CA   5  
ATOM 11393 C C    . ALA A 1 116 ? -6.965  -12.533 2.721   1.00 0.00 ? 116 ALA A C    5  
ATOM 11394 O O    . ALA A 1 116 ? -7.840  -13.256 3.199   1.00 0.00 ? 116 ALA A O    5  
ATOM 11395 C CB   . ALA A 1 116 ? -8.866  -11.078 1.803   1.00 0.00 ? 116 ALA A CB   5  
ATOM 11396 H H    . ALA A 1 116 ? -6.326  -12.505 -0.068  1.00 0.00 ? 116 ALA A H    5  
ATOM 11397 H HA   . ALA A 1 116 ? -6.672  -10.568 1.956   1.00 0.00 ? 116 ALA A HA   5  
ATOM 11398 H HB1  . ALA A 1 116 ? -9.176  -10.215 1.191   1.00 0.00 ? 116 ALA A HB1  5  
ATOM 11399 H HB2  . ALA A 1 116 ? -9.504  -11.927 1.493   1.00 0.00 ? 116 ALA A HB2  5  
ATOM 11400 H HB3  . ALA A 1 116 ? -9.155  -10.825 2.839   1.00 0.00 ? 116 ALA A HB3  5  
ATOM 11401 N N    . CYS A 1 117 ? -5.681  -12.590 3.144   1.00 0.00 ? 117 CYS A N    5  
ATOM 11402 C CA   . CYS A 1 117 ? -5.086  -13.669 4.012   1.00 0.00 ? 117 CYS A CA   5  
ATOM 11403 C C    . CYS A 1 117 ? -4.783  -14.804 2.973   1.00 0.00 ? 117 CYS A C    5  
ATOM 11404 O O    . CYS A 1 117 ? -3.652  -14.737 2.472   1.00 0.00 ? 117 CYS A O    5  
ATOM 11405 C CB   . CYS A 1 117 ? -5.851  -14.002 5.324   1.00 0.00 ? 117 CYS A CB   5  
ATOM 11406 S SG   . CYS A 1 117 ? -5.198  -15.527 6.089   1.00 0.00 ? 117 CYS A SG   5  
ATOM 11407 H H    . CYS A 1 117 ? -5.079  -11.939 2.631   1.00 0.00 ? 117 CYS A H    5  
ATOM 11408 H HA   . CYS A 1 117 ? -4.106  -13.317 4.385   1.00 0.00 ? 117 CYS A HA   5  
ATOM 11409 H HB2  . CYS A 1 117 ? -5.720  -13.174 6.046   1.00 0.00 ? 117 CYS A HB2  5  
ATOM 11410 H HB3  . CYS A 1 117 ? -6.940  -14.103 5.198   1.00 0.00 ? 117 CYS A HB3  5  
ATOM 11411 H HG   . CYS A 1 117 ? -3.970  -15.082 6.336   1.00 0.00 ? 117 CYS A HG   5  
ATOM 11412 N N    . PRO A 1 118 ? -5.644  -15.775 2.509   1.00 0.00 ? 118 PRO A N    5  
ATOM 11413 C CA   . PRO A 1 118 ? -5.312  -16.619 1.336   1.00 0.00 ? 118 PRO A CA   5  
ATOM 11414 C C    . PRO A 1 118 ? -5.082  -15.759 0.033   1.00 0.00 ? 118 PRO A C    5  
ATOM 11415 O O    . PRO A 1 118 ? -5.652  -14.663 -0.161  1.00 0.00 ? 118 PRO A O    5  
ATOM 11416 C CB   . PRO A 1 118 ? -6.519  -17.576 1.224   1.00 0.00 ? 118 PRO A CB   5  
ATOM 11417 C CG   . PRO A 1 118 ? -7.170  -17.536 2.606   1.00 0.00 ? 118 PRO A CG   5  
ATOM 11418 C CD   . PRO A 1 118 ? -6.988  -16.082 3.033   1.00 0.00 ? 118 PRO A CD   5  
ATOM 11419 H HA   . PRO A 1 118 ? -4.395  -17.193 1.577   1.00 0.00 ? 118 PRO A HA   5  
ATOM 11420 H HB2  . PRO A 1 118 ? -7.247  -17.223 0.466   1.00 0.00 ? 118 PRO A HB2  5  
ATOM 11421 H HB3  . PRO A 1 118 ? -6.221  -18.598 0.927   1.00 0.00 ? 118 PRO A HB3  5  
ATOM 11422 H HG2  . PRO A 1 118 ? -8.233  -17.842 2.591   1.00 0.00 ? 118 PRO A HG2  5  
ATOM 11423 H HG3  . PRO A 1 118 ? -6.644  -18.213 3.309   1.00 0.00 ? 118 PRO A HG3  5  
ATOM 11424 H HD2  . PRO A 1 118 ? -7.758  -15.463 2.539   1.00 0.00 ? 118 PRO A HD2  5  
ATOM 11425 H HD3  . PRO A 1 118 ? -7.092  -15.984 4.125   1.00 0.00 ? 118 PRO A HD3  5  
ATOM 11426 N N    . GLY A 1 119 ? -4.203  -16.320 -0.811  1.00 0.00 ? 119 GLY A N    5  
ATOM 11427 C CA   . GLY A 1 119 ? -3.755  -15.698 -2.077  1.00 0.00 ? 119 GLY A CA   5  
ATOM 11428 C C    . GLY A 1 119 ? -2.254  -15.363 -2.049  1.00 0.00 ? 119 GLY A C    5  
ATOM 11429 O O    . GLY A 1 119 ? -1.447  -16.178 -2.501  1.00 0.00 ? 119 GLY A O    5  
ATOM 11430 H H    . GLY A 1 119 ? -3.828  -17.217 -0.487  1.00 0.00 ? 119 GLY A H    5  
ATOM 11431 H HA2  . GLY A 1 119 ? -3.925  -16.412 -2.902  1.00 0.00 ? 119 GLY A HA2  5  
ATOM 11432 H HA3  . GLY A 1 119 ? -4.344  -14.813 -2.362  1.00 0.00 ? 119 GLY A HA3  5  
ATOM 11433 N N    . TRP A 1 120 ? -1.883  -14.168 -1.559  1.00 0.00 ? 120 TRP A N    5  
ATOM 11434 C CA   . TRP A 1 120 ? -0.454  -13.729 -1.501  1.00 0.00 ? 120 TRP A CA   5  
ATOM 11435 C C    . TRP A 1 120 ? -0.146  -12.900 -0.204  1.00 0.00 ? 120 TRP A C    5  
ATOM 11436 O O    . TRP A 1 120 ? -1.031  -12.425 0.516   1.00 0.00 ? 120 TRP A O    5  
ATOM 11437 C CB   . TRP A 1 120 ? -0.140  -12.900 -2.791  1.00 0.00 ? 120 TRP A CB   5  
ATOM 11438 C CG   . TRP A 1 120 ? 0.060   -13.702 -4.085  1.00 0.00 ? 120 TRP A CG   5  
ATOM 11439 C CD1  . TRP A 1 120 ? 1.265   -14.303 -4.511  1.00 0.00 ? 120 TRP A CD1  5  
ATOM 11440 C CD2  . TRP A 1 120 ? -0.863  -13.978 -5.079  1.00 0.00 ? 120 TRP A CD2  5  
ATOM 11441 N NE1  . TRP A 1 120 ? 1.117   -14.949 -5.754  1.00 0.00 ? 120 TRP A NE1  5  
ATOM 11442 C CE2  . TRP A 1 120 ? -0.213  -14.740 -6.082  1.00 0.00 ? 120 TRP A CE2  5  
ATOM 11443 C CE3  . TRP A 1 120 ? -2.237  -13.646 -5.207  1.00 0.00 ? 120 TRP A CE3  5  
ATOM 11444 C CZ2  . TRP A 1 120 ? -0.932  -15.177 -7.219  1.00 0.00 ? 120 TRP A CZ2  5  
ATOM 11445 C CZ3  . TRP A 1 120 ? -2.924  -14.083 -6.340  1.00 0.00 ? 120 TRP A CZ3  5  
ATOM 11446 C CH2  . TRP A 1 120 ? -2.282  -14.836 -7.332  1.00 0.00 ? 120 TRP A CH2  5  
ATOM 11447 H H    . TRP A 1 120 ? -2.647  -13.581 -1.191  1.00 0.00 ? 120 TRP A H    5  
ATOM 11448 H HA   . TRP A 1 120 ? 0.214   -14.616 -1.464  1.00 0.00 ? 120 TRP A HA   5  
ATOM 11449 H HB2  . TRP A 1 120 ? -0.915  -12.126 -2.952  1.00 0.00 ? 120 TRP A HB2  5  
ATOM 11450 H HB3  . TRP A 1 120 ? 0.789   -12.319 -2.642  1.00 0.00 ? 120 TRP A HB3  5  
ATOM 11451 H HD1  . TRP A 1 120 ? 2.191   -14.267 -3.955  1.00 0.00 ? 120 TRP A HD1  5  
ATOM 11452 H HE1  . TRP A 1 120 ? 1.820   -15.459 -6.300  1.00 0.00 ? 120 TRP A HE1  5  
ATOM 11453 H HE3  . TRP A 1 120 ? -2.743  -13.077 -4.441  1.00 0.00 ? 120 TRP A HE3  5  
ATOM 11454 H HZ2  . TRP A 1 120 ? -0.444  -15.759 -7.987  1.00 0.00 ? 120 TRP A HZ2  5  
ATOM 11455 H HZ3  . TRP A 1 120 ? -3.971  -13.840 -6.450  1.00 0.00 ? 120 TRP A HZ3  5  
ATOM 11456 H HH2  . TRP A 1 120 ? -2.841  -15.164 -8.196  1.00 0.00 ? 120 TRP A HH2  5  
ATOM 11457 N N    . PHE A 1 121 ? 1.156   -12.688 0.057   1.00 0.00 ? 121 PHE A N    5  
ATOM 11458 C CA   . PHE A 1 121 ? 1.655   -11.908 1.226   1.00 0.00 ? 121 PHE A CA   5  
ATOM 11459 C C    . PHE A 1 121 ? 2.697   -10.866 0.709   1.00 0.00 ? 121 PHE A C    5  
ATOM 11460 O O    . PHE A 1 121 ? 3.748   -11.225 0.166   1.00 0.00 ? 121 PHE A O    5  
ATOM 11461 C CB   . PHE A 1 121 ? 2.289   -12.862 2.284   1.00 0.00 ? 121 PHE A CB   5  
ATOM 11462 C CG   . PHE A 1 121 ? 1.330   -13.909 2.882   1.00 0.00 ? 121 PHE A CG   5  
ATOM 11463 C CD1  . PHE A 1 121 ? 0.335   -13.532 3.789   1.00 0.00 ? 121 PHE A CD1  5  
ATOM 11464 C CD2  . PHE A 1 121 ? 1.386   -15.234 2.436   1.00 0.00 ? 121 PHE A CD2  5  
ATOM 11465 C CE1  . PHE A 1 121 ? -0.602  -14.464 4.230   1.00 0.00 ? 121 PHE A CE1  5  
ATOM 11466 C CE2  . PHE A 1 121 ? 0.450   -16.165 2.879   1.00 0.00 ? 121 PHE A CE2  5  
ATOM 11467 C CZ   . PHE A 1 121 ? -0.544  -15.779 3.775   1.00 0.00 ? 121 PHE A CZ   5  
ATOM 11468 H H    . PHE A 1 121 ? 1.806   -13.162 -0.586  1.00 0.00 ? 121 PHE A H    5  
ATOM 11469 H HA   . PHE A 1 121 ? 0.822   -11.367 1.720   1.00 0.00 ? 121 PHE A HA   5  
ATOM 11470 H HB2  . PHE A 1 121 ? 3.176   -13.363 1.847   1.00 0.00 ? 121 PHE A HB2  5  
ATOM 11471 H HB3  . PHE A 1 121 ? 2.704   -12.257 3.113   1.00 0.00 ? 121 PHE A HB3  5  
ATOM 11472 H HD1  . PHE A 1 121 ? 0.264   -12.510 4.128   1.00 0.00 ? 121 PHE A HD1  5  
ATOM 11473 H HD2  . PHE A 1 121 ? 2.132   -15.533 1.714   1.00 0.00 ? 121 PHE A HD2  5  
ATOM 11474 H HE1  . PHE A 1 121 ? -1.386  -14.163 4.909   1.00 0.00 ? 121 PHE A HE1  5  
ATOM 11475 H HE2  . PHE A 1 121 ? 0.487   -17.180 2.510   1.00 0.00 ? 121 PHE A HE2  5  
ATOM 11476 H HZ   . PHE A 1 121 ? -1.283  -16.494 4.107   1.00 0.00 ? 121 PHE A HZ   5  
ATOM 11477 N N    . LEU A 1 122 ? 2.382   -9.569  0.825   1.00 0.00 ? 122 LEU A N    5  
ATOM 11478 C CA   . LEU A 1 122 ? 3.268   -8.464  0.392   1.00 0.00 ? 122 LEU A CA   5  
ATOM 11479 C C    . LEU A 1 122 ? 4.284   -8.031  1.517   1.00 0.00 ? 122 LEU A C    5  
ATOM 11480 O O    . LEU A 1 122 ? 3.953   -7.658  2.667   1.00 0.00 ? 122 LEU A O    5  
ATOM 11481 C CB   . LEU A 1 122 ? 2.388   -7.277  -0.080  1.00 0.00 ? 122 LEU A CB   5  
ATOM 11482 C CG   . LEU A 1 122 ? 3.186   -6.126  -0.768  1.00 0.00 ? 122 LEU A CG   5  
ATOM 11483 C CD1  . LEU A 1 122 ? 2.532   -5.681  -2.077  1.00 0.00 ? 122 LEU A CD1  5  
ATOM 11484 C CD2  . LEU A 1 122 ? 3.381   -4.907  0.149   1.00 0.00 ? 122 LEU A CD2  5  
ATOM 11485 H H    . LEU A 1 122 ? 1.504   -9.372  1.325   1.00 0.00 ? 122 LEU A H    5  
ATOM 11486 H HA   . LEU A 1 122 ? 3.817   -8.813  -0.502  1.00 0.00 ? 122 LEU A HA   5  
ATOM 11487 H HB2  . LEU A 1 122 ? 1.635   -7.676  -0.783  1.00 0.00 ? 122 LEU A HB2  5  
ATOM 11488 H HB3  . LEU A 1 122 ? 1.759   -6.897  0.740   1.00 0.00 ? 122 LEU A HB3  5  
ATOM 11489 H HG   . LEU A 1 122 ? 4.197   -6.487  -1.044  1.00 0.00 ? 122 LEU A HG   5  
ATOM 11490 H HD11 . LEU A 1 122 ? 2.375   -6.528  -2.767  1.00 0.00 ? 122 LEU A HD11 5  
ATOM 11491 H HD12 . LEU A 1 122 ? 1.552   -5.210  -1.896  1.00 0.00 ? 122 LEU A HD12 5  
ATOM 11492 H HD13 . LEU A 1 122 ? 3.168   -4.956  -2.617  1.00 0.00 ? 122 LEU A HD13 5  
ATOM 11493 H HD21 . LEU A 1 122 ? 2.419   -4.488  0.498   1.00 0.00 ? 122 LEU A HD21 5  
ATOM 11494 H HD22 . LEU A 1 122 ? 3.975   -5.160  1.047   1.00 0.00 ? 122 LEU A HD22 5  
ATOM 11495 H HD23 . LEU A 1 122 ? 3.921   -4.092  -0.367  1.00 0.00 ? 122 LEU A HD23 5  
ATOM 11496 N N    . CYS A 1 123 ? 5.546   -8.098  1.048   1.00 0.00 ? 123 CYS A N    5  
ATOM 11497 C CA   . CYS A 1 123 ? 6.775   -7.756  1.798   1.00 0.00 ? 123 CYS A CA   5  
ATOM 11498 C C    . CYS A 1 123 ? 7.880   -7.256  0.794   1.00 0.00 ? 123 CYS A C    5  
ATOM 11499 O O    . CYS A 1 123 ? 7.728   -7.277  -0.439  1.00 0.00 ? 123 CYS A O    5  
ATOM 11500 C CB   . CYS A 1 123 ? 7.206   -9.019  2.588   1.00 0.00 ? 123 CYS A CB   5  
ATOM 11501 S SG   . CYS A 1 123 ? 7.446   -10.478 1.510   1.00 0.00 ? 123 CYS A SG   5  
ATOM 11502 H H    . CYS A 1 123 ? 5.619   -8.408  0.065   1.00 0.00 ? 123 CYS A H    5  
ATOM 11503 H HA   . CYS A 1 123 ? 6.576   -6.942  2.518   1.00 0.00 ? 123 CYS A HA   5  
ATOM 11504 H HB2  . CYS A 1 123 ? 8.142   -8.839  3.148   1.00 0.00 ? 123 CYS A HB2  5  
ATOM 11505 H HB3  . CYS A 1 123 ? 6.442   -9.270  3.347   1.00 0.00 ? 123 CYS A HB3  5  
ATOM 11506 H HG   . CYS A 1 123 ? 8.523   -10.048 0.857   1.00 0.00 ? 123 CYS A HG   5  
ATOM 11507 N N    . THR A 1 124 ? 9.025   -6.785  1.320   1.00 0.00 ? 124 THR A N    5  
ATOM 11508 C CA   . THR A 1 124 ? 10.165  -6.343  0.461   1.00 0.00 ? 124 THR A CA   5  
ATOM 11509 C C    . THR A 1 124 ? 10.994  -7.576  -0.016  1.00 0.00 ? 124 THR A C    5  
ATOM 11510 O O    . THR A 1 124 ? 11.281  -8.491  0.758   1.00 0.00 ? 124 THR A O    5  
ATOM 11511 C CB   . THR A 1 124 ? 11.066  -5.350  1.236   1.00 0.00 ? 124 THR A CB   5  
ATOM 11512 O OG1  . THR A 1 124 ? 10.327  -4.191  1.602   1.00 0.00 ? 124 THR A OG1  5  
ATOM 11513 C CG2  . THR A 1 124 ? 12.271  -4.834  0.441   1.00 0.00 ? 124 THR A CG2  5  
ATOM 11514 H H    . THR A 1 124 ? 9.091   -6.784  2.345   1.00 0.00 ? 124 THR A H    5  
ATOM 11515 H HA   . THR A 1 124 ? 9.781   -5.801  -0.413  1.00 0.00 ? 124 THR A HA   5  
ATOM 11516 H HB   . THR A 1 124 ? 11.433  -5.872  2.129   1.00 0.00 ? 124 THR A HB   5  
ATOM 11517 H HG1  . THR A 1 124 ? 10.793  -3.795  2.344   1.00 0.00 ? 124 THR A HG1  5  
ATOM 11518 H HG21 . THR A 1 124 ? 11.975  -4.404  -0.533  1.00 0.00 ? 124 THR A HG21 5  
ATOM 11519 H HG22 . THR A 1 124 ? 12.819  -4.060  1.001   1.00 0.00 ? 124 THR A HG22 5  
ATOM 11520 H HG23 . THR A 1 124 ? 13.001  -5.635  0.219   1.00 0.00 ? 124 THR A HG23 5  
ATOM 11521 N N    . ALA A 1 125 ? 11.389  -7.577  -1.293  1.00 0.00 ? 125 ALA A N    5  
ATOM 11522 C CA   . ALA A 1 125 ? 12.236  -8.645  -1.878  1.00 0.00 ? 125 ALA A CA   5  
ATOM 11523 C C    . ALA A 1 125 ? 13.701  -8.176  -2.057  1.00 0.00 ? 125 ALA A C    5  
ATOM 11524 O O    . ALA A 1 125 ? 13.959  -7.033  -2.446  1.00 0.00 ? 125 ALA A O    5  
ATOM 11525 C CB   . ALA A 1 125 ? 11.659  -9.005  -3.241  1.00 0.00 ? 125 ALA A CB   5  
ATOM 11526 H H    . ALA A 1 125 ? 11.113  -6.745  -1.832  1.00 0.00 ? 125 ALA A H    5  
ATOM 11527 H HA   . ALA A 1 125 ? 12.210  -9.558  -1.248  1.00 0.00 ? 125 ALA A HA   5  
ATOM 11528 H HB1  . ALA A 1 125 ? 10.619  -9.354  -3.144  1.00 0.00 ? 125 ALA A HB1  5  
ATOM 11529 H HB2  . ALA A 1 125 ? 11.689  -8.132  -3.920  1.00 0.00 ? 125 ALA A HB2  5  
ATOM 11530 H HB3  . ALA A 1 125 ? 12.257  -9.813  -3.701  1.00 0.00 ? 125 ALA A HB3  5  
ATOM 11531 N N    . MET A 1 126 ? 14.668  -9.076  -1.791  1.00 0.00 ? 126 MET A N    5  
ATOM 11532 C CA   . MET A 1 126 ? 16.143  -8.770  -1.869  1.00 0.00 ? 126 MET A CA   5  
ATOM 11533 C C    . MET A 1 126 ? 16.628  -7.516  -1.026  1.00 0.00 ? 126 MET A C    5  
ATOM 11534 O O    . MET A 1 126 ? 17.665  -6.915  -1.312  1.00 0.00 ? 126 MET A O    5  
ATOM 11535 C CB   . MET A 1 126 ? 16.557  -8.684  -3.369  1.00 0.00 ? 126 MET A CB   5  
ATOM 11536 C CG   . MET A 1 126 ? 16.632  -10.023 -4.135  1.00 0.00 ? 126 MET A CG   5  
ATOM 11537 S SD   . MET A 1 126 ? 14.993  -10.746 -4.366  1.00 0.00 ? 126 MET A SD   5  
ATOM 11538 C CE   . MET A 1 126 ? 15.454  -12.413 -4.869  1.00 0.00 ? 126 MET A CE   5  
ATOM 11539 H H    . MET A 1 126 ? 14.328  -9.993  -1.484  1.00 0.00 ? 126 MET A H    5  
ATOM 11540 H HA   . MET A 1 126 ? 16.694  -9.612  -1.408  1.00 0.00 ? 126 MET A HA   5  
ATOM 11541 H HB2  . MET A 1 126 ? 15.902  -7.971  -3.903  1.00 0.00 ? 126 MET A HB2  5  
ATOM 11542 H HB3  . MET A 1 126 ? 17.567  -8.235  -3.422  1.00 0.00 ? 126 MET A HB3  5  
ATOM 11543 H HG2  . MET A 1 126 ? 17.085  -9.870  -5.132  1.00 0.00 ? 126 MET A HG2  5  
ATOM 11544 H HG3  . MET A 1 126 ? 17.288  -10.740 -3.606  1.00 0.00 ? 126 MET A HG3  5  
ATOM 11545 H HE1  . MET A 1 126 ? 16.072  -12.392 -5.785  1.00 0.00 ? 126 MET A HE1  5  
ATOM 11546 H HE2  . MET A 1 126 ? 16.031  -12.918 -4.072  1.00 0.00 ? 126 MET A HE2  5  
ATOM 11547 H HE3  . MET A 1 126 ? 14.554  -13.018 -5.075  1.00 0.00 ? 126 MET A HE3  5  
ATOM 11548 N N    . GLU A 1 127 ? 15.915  -7.259  0.085   1.00 0.00 ? 127 GLU A N    5  
ATOM 11549 C CA   . GLU A 1 127 ? 16.191  -6.207  1.126   1.00 0.00 ? 127 GLU A CA   5  
ATOM 11550 C C    . GLU A 1 127 ? 15.768  -4.748  0.709   1.00 0.00 ? 127 GLU A C    5  
ATOM 11551 O O    . GLU A 1 127 ? 15.345  -4.456  -0.414  1.00 0.00 ? 127 GLU A O    5  
ATOM 11552 C CB   . GLU A 1 127 ? 17.664  -6.278  1.663   1.00 0.00 ? 127 GLU A CB   5  
ATOM 11553 C CG   . GLU A 1 127 ? 17.965  -7.523  2.536   1.00 0.00 ? 127 GLU A CG   5  
ATOM 11554 C CD   . GLU A 1 127 ? 19.235  -7.409  3.361   1.00 0.00 ? 127 GLU A CD   5  
ATOM 11555 O OE1  . GLU A 1 127 ? 19.197  -6.750  4.422   1.00 0.00 ? 127 GLU A OE1  5  
ATOM 11556 O OE2  . GLU A 1 127 ? 20.265  -7.996  2.967   1.00 0.00 ? 127 GLU A OE2  5  
ATOM 11557 H H    . GLU A 1 127 ? 15.058  -7.838  0.017   1.00 0.00 ? 127 GLU A H    5  
ATOM 11558 H HA   . GLU A 1 127 ? 15.513  -6.440  1.966   1.00 0.00 ? 127 GLU A HA   5  
ATOM 11559 H HB2  . GLU A 1 127 ? 18.409  -6.186  0.851   1.00 0.00 ? 127 GLU A HB2  5  
ATOM 11560 H HB3  . GLU A 1 127 ? 17.869  -5.392  2.294   1.00 0.00 ? 127 GLU A HB3  5  
ATOM 11561 H HG2  . GLU A 1 127 ? 17.148  -7.717  3.250   1.00 0.00 ? 127 GLU A HG2  5  
ATOM 11562 H HG3  . GLU A 1 127 ? 18.033  -8.430  1.911   1.00 0.00 ? 127 GLU A HG3  5  
ATOM 11563 N N    . ALA A 1 128 ? 15.829  -3.827  1.696   1.00 0.00 ? 128 ALA A N    5  
ATOM 11564