data_1ITB
# 
_entry.id   1ITB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ITB         
WWPDB D_1000174256 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ITB 
_pdbx_database_status.recvd_initial_deposition_date   1997-01-15 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Vigers, G.P.A.'   1 
'Anderson, L.J.'   2 
'Caffes, P.'       3 
'Brandhuber, B.J.' 4 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the type-I interleukin-1 receptor complexed with interleukin-1beta.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            386 
_citation.page_first                190 
_citation.page_last                 194 
_citation.year                      1997 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9062193 
_citation.pdbx_database_id_DOI      10.1038/386190a0 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Vigers, G.P.'     1 
primary 'Anderson, L.J.'   2 
primary 'Caffes, P.'       3 
primary 'Brandhuber, B.J.' 4 
# 
_cell.entry_id           1ITB 
_cell.length_a           146.952 
_cell.length_b           68.452 
_cell.length_c           65.867 
_cell.angle_alpha        90.00 
_cell.angle_beta         108.95 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ITB 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'INTERLEUKIN-1 BETA'            17395.832 1  ? ? ?                      ? 
2 polymer man 'TYPE 1 INTERLEUKIN-1 RECEPTOR' 36223.148 1  ? ? 'EXTRACELLULAR DOMAIN' ? 
3 water   nat water                           18.015    24 ? ? ?                      ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL
QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
;
;APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTL
QLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
;
A ? 
2 'polypeptide(L)' no no 
;LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCV
VRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGV
KDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDI
AYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
;
;LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCV
VRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGV
KDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDI
AYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVT
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   PRO n 
1 3   VAL n 
1 4   ARG n 
1 5   SER n 
1 6   LEU n 
1 7   ASN n 
1 8   CYS n 
1 9   THR n 
1 10  LEU n 
1 11  ARG n 
1 12  ASP n 
1 13  SER n 
1 14  GLN n 
1 15  GLN n 
1 16  LYS n 
1 17  SER n 
1 18  LEU n 
1 19  VAL n 
1 20  MET n 
1 21  SER n 
1 22  GLY n 
1 23  PRO n 
1 24  TYR n 
1 25  GLU n 
1 26  LEU n 
1 27  LYS n 
1 28  ALA n 
1 29  LEU n 
1 30  HIS n 
1 31  LEU n 
1 32  GLN n 
1 33  GLY n 
1 34  GLN n 
1 35  ASP n 
1 36  MET n 
1 37  GLU n 
1 38  GLN n 
1 39  GLN n 
1 40  VAL n 
1 41  VAL n 
1 42  PHE n 
1 43  SER n 
1 44  MET n 
1 45  SER n 
1 46  PHE n 
1 47  VAL n 
1 48  GLN n 
1 49  GLY n 
1 50  GLU n 
1 51  GLU n 
1 52  SER n 
1 53  ASN n 
1 54  ASP n 
1 55  LYS n 
1 56  ILE n 
1 57  PRO n 
1 58  VAL n 
1 59  ALA n 
1 60  LEU n 
1 61  GLY n 
1 62  LEU n 
1 63  LYS n 
1 64  GLU n 
1 65  LYS n 
1 66  ASN n 
1 67  LEU n 
1 68  TYR n 
1 69  LEU n 
1 70  SER n 
1 71  CYS n 
1 72  VAL n 
1 73  LEU n 
1 74  LYS n 
1 75  ASP n 
1 76  ASP n 
1 77  LYS n 
1 78  PRO n 
1 79  THR n 
1 80  LEU n 
1 81  GLN n 
1 82  LEU n 
1 83  GLU n 
1 84  SER n 
1 85  VAL n 
1 86  ASP n 
1 87  PRO n 
1 88  LYS n 
1 89  ASN n 
1 90  TYR n 
1 91  PRO n 
1 92  LYS n 
1 93  LYS n 
1 94  LYS n 
1 95  MET n 
1 96  GLU n 
1 97  LYS n 
1 98  ARG n 
1 99  PHE n 
1 100 VAL n 
1 101 PHE n 
1 102 ASN n 
1 103 LYS n 
1 104 ILE n 
1 105 GLU n 
1 106 ILE n 
1 107 ASN n 
1 108 ASN n 
1 109 LYS n 
1 110 LEU n 
1 111 GLU n 
1 112 PHE n 
1 113 GLU n 
1 114 SER n 
1 115 ALA n 
1 116 GLN n 
1 117 PHE n 
1 118 PRO n 
1 119 ASN n 
1 120 TRP n 
1 121 TYR n 
1 122 ILE n 
1 123 SER n 
1 124 THR n 
1 125 SER n 
1 126 GLN n 
1 127 ALA n 
1 128 GLU n 
1 129 ASN n 
1 130 MET n 
1 131 PRO n 
1 132 VAL n 
1 133 PHE n 
1 134 LEU n 
1 135 GLY n 
1 136 GLY n 
1 137 THR n 
1 138 LYS n 
1 139 GLY n 
1 140 GLY n 
1 141 GLN n 
1 142 ASP n 
1 143 ILE n 
1 144 THR n 
1 145 ASP n 
1 146 PHE n 
1 147 THR n 
1 148 MET n 
1 149 GLN n 
1 150 PHE n 
1 151 VAL n 
1 152 SER n 
1 153 SER n 
2 1   LEU n 
2 2   GLU n 
2 3   ALA n 
2 4   ASP n 
2 5   LYS n 
2 6   CYS n 
2 7   LYS n 
2 8   GLU n 
2 9   ARG n 
2 10  GLU n 
2 11  GLU n 
2 12  LYS n 
2 13  ILE n 
2 14  ILE n 
2 15  LEU n 
2 16  VAL n 
2 17  SER n 
2 18  SER n 
2 19  ALA n 
2 20  ASN n 
2 21  GLU n 
2 22  ILE n 
2 23  ASP n 
2 24  VAL n 
2 25  ARG n 
2 26  PRO n 
2 27  CYS n 
2 28  PRO n 
2 29  LEU n 
2 30  ASN n 
2 31  PRO n 
2 32  ASN n 
2 33  GLU n 
2 34  HIS n 
2 35  LYS n 
2 36  GLY n 
2 37  THR n 
2 38  ILE n 
2 39  THR n 
2 40  TRP n 
2 41  TYR n 
2 42  LYS n 
2 43  ASP n 
2 44  ASP n 
2 45  SER n 
2 46  LYS n 
2 47  THR n 
2 48  PRO n 
2 49  VAL n 
2 50  SER n 
2 51  THR n 
2 52  GLU n 
2 53  GLN n 
2 54  ALA n 
2 55  SER n 
2 56  ARG n 
2 57  ILE n 
2 58  HIS n 
2 59  GLN n 
2 60  HIS n 
2 61  LYS n 
2 62  GLU n 
2 63  LYS n 
2 64  LEU n 
2 65  TRP n 
2 66  PHE n 
2 67  VAL n 
2 68  PRO n 
2 69  ALA n 
2 70  LYS n 
2 71  VAL n 
2 72  GLU n 
2 73  ASP n 
2 74  SER n 
2 75  GLY n 
2 76  HIS n 
2 77  TYR n 
2 78  TYR n 
2 79  CYS n 
2 80  VAL n 
2 81  VAL n 
2 82  ARG n 
2 83  ASN n 
2 84  SER n 
2 85  SER n 
2 86  TYR n 
2 87  CYS n 
2 88  LEU n 
2 89  ARG n 
2 90  ILE n 
2 91  LYS n 
2 92  ILE n 
2 93  SER n 
2 94  ALA n 
2 95  LYS n 
2 96  PHE n 
2 97  VAL n 
2 98  GLU n 
2 99  ASN n 
2 100 GLU n 
2 101 PRO n 
2 102 ASN n 
2 103 LEU n 
2 104 CYS n 
2 105 TYR n 
2 106 ASN n 
2 107 ALA n 
2 108 GLN n 
2 109 ALA n 
2 110 ILE n 
2 111 PHE n 
2 112 LYS n 
2 113 GLN n 
2 114 LYS n 
2 115 LEU n 
2 116 PRO n 
2 117 VAL n 
2 118 ALA n 
2 119 GLY n 
2 120 ASP n 
2 121 GLY n 
2 122 GLY n 
2 123 LEU n 
2 124 VAL n 
2 125 CYS n 
2 126 PRO n 
2 127 TYR n 
2 128 MET n 
2 129 GLU n 
2 130 PHE n 
2 131 PHE n 
2 132 LYS n 
2 133 ASN n 
2 134 GLU n 
2 135 ASN n 
2 136 ASN n 
2 137 GLU n 
2 138 LEU n 
2 139 PRO n 
2 140 LYS n 
2 141 LEU n 
2 142 GLN n 
2 143 TRP n 
2 144 TYR n 
2 145 LYS n 
2 146 ASP n 
2 147 CYS n 
2 148 LYS n 
2 149 PRO n 
2 150 LEU n 
2 151 LEU n 
2 152 LEU n 
2 153 ASP n 
2 154 ASN n 
2 155 ILE n 
2 156 HIS n 
2 157 PHE n 
2 158 SER n 
2 159 GLY n 
2 160 VAL n 
2 161 LYS n 
2 162 ASP n 
2 163 ARG n 
2 164 LEU n 
2 165 ILE n 
2 166 VAL n 
2 167 MET n 
2 168 ASN n 
2 169 VAL n 
2 170 ALA n 
2 171 GLU n 
2 172 LYS n 
2 173 HIS n 
2 174 ARG n 
2 175 GLY n 
2 176 ASN n 
2 177 TYR n 
2 178 THR n 
2 179 CYS n 
2 180 HIS n 
2 181 ALA n 
2 182 SER n 
2 183 TYR n 
2 184 THR n 
2 185 TYR n 
2 186 LEU n 
2 187 GLY n 
2 188 LYS n 
2 189 GLN n 
2 190 TYR n 
2 191 PRO n 
2 192 ILE n 
2 193 THR n 
2 194 ARG n 
2 195 VAL n 
2 196 ILE n 
2 197 GLU n 
2 198 PHE n 
2 199 ILE n 
2 200 THR n 
2 201 LEU n 
2 202 GLU n 
2 203 GLU n 
2 204 ASN n 
2 205 LYS n 
2 206 PRO n 
2 207 THR n 
2 208 ARG n 
2 209 PRO n 
2 210 VAL n 
2 211 ILE n 
2 212 VAL n 
2 213 SER n 
2 214 PRO n 
2 215 ALA n 
2 216 ASN n 
2 217 GLU n 
2 218 THR n 
2 219 MET n 
2 220 GLU n 
2 221 VAL n 
2 222 ASP n 
2 223 LEU n 
2 224 GLY n 
2 225 SER n 
2 226 GLN n 
2 227 ILE n 
2 228 GLN n 
2 229 LEU n 
2 230 ILE n 
2 231 CYS n 
2 232 ASN n 
2 233 VAL n 
2 234 THR n 
2 235 GLY n 
2 236 GLN n 
2 237 LEU n 
2 238 SER n 
2 239 ASP n 
2 240 ILE n 
2 241 ALA n 
2 242 TYR n 
2 243 TRP n 
2 244 LYS n 
2 245 TRP n 
2 246 ASN n 
2 247 GLY n 
2 248 SER n 
2 249 VAL n 
2 250 ILE n 
2 251 ASP n 
2 252 GLU n 
2 253 ASP n 
2 254 ASP n 
2 255 PRO n 
2 256 VAL n 
2 257 LEU n 
2 258 GLY n 
2 259 GLU n 
2 260 ASP n 
2 261 TYR n 
2 262 TYR n 
2 263 SER n 
2 264 VAL n 
2 265 GLU n 
2 266 ASN n 
2 267 PRO n 
2 268 ALA n 
2 269 ASN n 
2 270 LYS n 
2 271 ARG n 
2 272 ARG n 
2 273 SER n 
2 274 THR n 
2 275 LEU n 
2 276 ILE n 
2 277 THR n 
2 278 VAL n 
2 279 LEU n 
2 280 ASN n 
2 281 ILE n 
2 282 SER n 
2 283 GLU n 
2 284 ILE n 
2 285 GLU n 
2 286 SER n 
2 287 ARG n 
2 288 PHE n 
2 289 TYR n 
2 290 LYS n 
2 291 HIS n 
2 292 PRO n 
2 293 PHE n 
2 294 THR n 
2 295 CYS n 
2 296 PHE n 
2 297 ALA n 
2 298 LYS n 
2 299 ASN n 
2 300 THR n 
2 301 HIS n 
2 302 GLY n 
2 303 ILE n 
2 304 ASP n 
2 305 ALA n 
2 306 ALA n 
2 307 TYR n 
2 308 ILE n 
2 309 GLN n 
2 310 LEU n 
2 311 ILE n 
2 312 TYR n 
2 313 PRO n 
2 314 VAL n 
2 315 THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? SECRETED       ? 'Escherichia coli' 562 Escherichia ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? 'CELL SURFACE' ? 'Escherichia coli' 562 Escherichia ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP IL1B_HUMAN  1 P01584 1 
;MAEVPKLASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVP
CPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSM
SFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
;
? 
2 UNP IL1R1_HUMAN 2 P14778 1 
;MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEK
LWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQW
YKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDL
GSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGI
DAAYIQLIYPVTNFQKHMIGICVTLTVIIVCSVFIYKIFKIDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGST
SDCDIFVFKVLPEVLEKQCGYKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQ
DGIKVVLLELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPVQRRSPSSKHQLLSPATKEKL
QREAHVPLG
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1ITB A 1 ? 153 ? P01584 117 ? 269 ? 1 153 
2 2 1ITB B 1 ? 315 ? P14778 18  ? 332 ? 1 315 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1ITB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   2 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.92 
_exptl_crystal.density_percent_sol   52. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'PROTEIN WAS CRYSTALLIZED BY HANGING DROP DIFFUSION AGAINST 2.8M AMMONIUM SULFATE, 100MM MES PH 6.0, vapor diffusion - hanging drop' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   1995-07 
_diffrn_detector.details                COLLIMATOR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1ITB 
_reflns.observed_criterion_sigma_I   2. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             15.0 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   20723 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.4 
_reflns.pdbx_Rmerge_I_obs            0.05 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        28. 
_reflns.B_iso_Wilson_estimate        37.0 
_reflns.pdbx_redundancy              6.4 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.5 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   94.9 
_reflns_shell.Rmerge_I_obs           0.104 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    10.9 
_reflns_shell.pdbx_redundancy        2.7 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1ITB 
_refine.ls_number_reflns_obs                     20723 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               10000. 
_refine.pdbx_data_cutoff_low_absF                0.1 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             15.0 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    96.4 
_refine.ls_R_factor_obs                          0.229 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.229 
_refine.ls_R_factor_R_free                       0.325 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.6 
_refine.ls_number_reflns_R_free                  2061 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               53.7 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT CORRECTION WITH SOLDENSITY = 0.40, SOLRAD = 0.25, B = 50' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1ITB 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             0.44 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3587 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             31 
_refine_hist.number_atoms_total               3618 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        15.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.012 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.98  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      26.2  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.55  ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?   ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     1.5 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   15 
_refine_ls_shell.d_res_high                       2.5 
_refine_ls_shell.d_res_low                        2.56 
_refine_ls_shell.number_reflns_R_work             1246 
_refine_ls_shell.R_factor_R_work                  0.4308 
_refine_ls_shell.percent_reflns_obs               95.5 
_refine_ls_shell.R_factor_R_free                  0.5528 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            8.9 
_refine_ls_shell.number_reflns_R_free             128 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM19.SOL  TOPH19.SOL   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1ITB 
_struct.title                     'TYPE-1 INTERLEUKIN-1 RECEPTOR COMPLEXED WITH INTERLEUKIN-1 BETA' 
_struct.pdbx_descriptor           'INTERLEUKIN-1 BETA, TYPE 1 INTERLEUKIN-1 RECEPTOR' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ITB 
_struct_keywords.pdbx_keywords   'COMPLEX (IMMUNOGLOBULIN/RECEPTOR)' 
_struct_keywords.text            
;IMMUNOGLOBULIN FOLD, TRANSMEMBRANE, GLYCOPROTEIN, RECEPTOR, COMPLEX (IMMUNOGLOBULIN-RECEPTOR), COMPLEX (IMMUNOGLOBULIN-RECEPTOR) complex
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 35  ? GLN A 38  ? ASP A 35  GLN A 38  5 ? 4 
HELX_P HELX_P2 2 LYS A 97  ? PHE A 99  ? LYS A 97  PHE A 99  5 ? 3 
HELX_P HELX_P3 3 VAL B 71  ? ASP B 73  ? VAL B 71  ASP B 73  5 ? 3 
HELX_P HELX_P4 4 ALA B 107 ? ALA B 109 ? ALA B 107 ALA B 109 5 ? 3 
HELX_P HELX_P5 5 GLU B 171 ? HIS B 173 ? GLU B 171 HIS B 173 5 ? 3 
HELX_P HELX_P6 6 SER B 286 ? TYR B 289 ? SER B 286 TYR B 289 5 ? 4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? B CYS 6   SG ? ? ? 1_555 B CYS 87  SG ? ? B CYS 6   B CYS 87  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf2 disulf ? ? B CYS 27  SG ? ? ? 1_555 B CYS 79  SG ? ? B CYS 27  B CYS 79  1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf3 disulf ? ? B CYS 104 SG ? ? ? 1_555 B CYS 147 SG ? ? B CYS 104 B CYS 147 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf4 disulf ? ? B CYS 125 SG ? ? ? 1_555 B CYS 179 SG ? ? B CYS 125 B CYS 179 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf5 disulf ? ? B CYS 231 SG ? ? ? 1_555 B CYS 295 SG ? ? B CYS 231 B CYS 295 1_555 ? ? ? ? ? ? ? 2.009 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           90 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            90 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    91 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     91 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.08 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 3 ? 
G ? 2 ? 
H ? 4 ? 
I ? 3 ? 
J ? 4 ? 
K ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 4   ? CYS A 8   ? ARG A 4   CYS A 8   
A 2 PHE A 42  ? PHE A 46  ? PHE A 42  PHE A 46  
A 3 LYS A 55  ? LEU A 62  ? LYS A 55  LEU A 62  
A 4 PHE A 101 ? GLU A 105 ? PHE A 101 GLU A 105 
A 5 LEU A 110 ? SER A 114 ? LEU A 110 SER A 114 
B 1 SER A 17  ? MET A 20  ? SER A 17  MET A 20  
B 2 LEU A 26  ? LEU A 29  ? LEU A 26  LEU A 29  
C 1 LEU A 67  ? LYS A 74  ? LEU A 67  LYS A 74  
C 2 LYS A 77  ? SER A 84  ? LYS A 77  SER A 84  
D 1 TYR A 121 ? SER A 123 ? TYR A 121 SER A 123 
D 2 PHE A 133 ? GLY A 135 ? PHE A 133 GLY A 135 
E 1 LEU B 15  ? SER B 18  ? LEU B 15  SER B 18  
E 2 ALA B 94  ? VAL B 97  ? ALA B 94  VAL B 97  
F 1 ASP B 23  ? ARG B 25  ? ASP B 23  ARG B 25  
F 2 LYS B 63  ? PHE B 66  ? LYS B 63  PHE B 66  
F 3 ILE B 57  ? HIS B 60  ? ILE B 57  HIS B 60  
G 1 HIS B 76  ? CYS B 79  ? HIS B 76  CYS B 79  
G 2 ILE B 90  ? SER B 93  ? ILE B 90  SER B 93  
H 1 ILE B 110 ? PRO B 116 ? ILE B 110 PRO B 116 
H 2 GLY B 187 ? THR B 200 ? GLY B 187 THR B 200 
H 3 GLY B 175 ? TYR B 185 ? GLY B 175 TYR B 185 
H 4 GLN B 142 ? LYS B 145 ? GLN B 142 LYS B 145 
I 1 GLY B 121 ? VAL B 124 ? GLY B 121 VAL B 124 
I 2 ARG B 163 ? VAL B 166 ? ARG B 163 VAL B 166 
I 3 PHE B 157 ? VAL B 160 ? PHE B 157 VAL B 160 
J 1 GLU B 217 ? GLU B 220 ? GLU B 217 GLU B 220 
J 2 GLY B 302 ? ILE B 311 ? GLY B 302 ILE B 311 
J 3 PHE B 293 ? ASN B 299 ? PHE B 293 ASN B 299 
J 4 ILE B 240 ? TRP B 245 ? ILE B 240 TRP B 245 
K 1 ILE B 227 ? GLY B 235 ? ILE B 227 GLY B 235 
K 2 SER B 273 ? ILE B 281 ? SER B 273 ILE B 281 
K 3 LEU B 257 ? VAL B 264 ? LEU B 257 VAL B 264 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ARG A 4   ? O ARG A 4   N PHE A 46  ? N PHE A 46  
A 2 3 O SER A 43  ? O SER A 43  N GLY A 61  ? N GLY A 61  
A 3 4 O ILE A 56  ? O ILE A 56  N LYS A 103 ? N LYS A 103 
A 4 5 O ASN A 102 ? O ASN A 102 N GLU A 113 ? N GLU A 113 
B 1 2 O SER A 17  ? O SER A 17  N LEU A 29  ? N LEU A 29  
C 1 2 O TYR A 68  ? O TYR A 68  N GLU A 83  ? N GLU A 83  
D 1 2 O TYR A 121 ? O TYR A 121 N GLY A 135 ? N GLY A 135 
E 1 2 O LEU B 15  ? O LEU B 15  N LYS B 95  ? N LYS B 95  
F 1 2 O ASP B 23  ? O ASP B 23  N PHE B 66  ? N PHE B 66  
F 2 3 O LYS B 63  ? O LYS B 63  N HIS B 60  ? N HIS B 60  
G 1 2 O TYR B 77  ? O TYR B 77  N ILE B 92  ? N ILE B 92  
H 1 2 O PHE B 111 ? O PHE B 111 N ARG B 194 ? N ARG B 194 
H 2 3 O GLY B 187 ? O GLY B 187 N TYR B 185 ? N TYR B 185 
H 3 4 O THR B 178 ? O THR B 178 N TYR B 144 ? N TYR B 144 
I 1 2 O GLY B 121 ? O GLY B 121 N VAL B 166 ? N VAL B 166 
I 2 3 O ARG B 163 ? O ARG B 163 N VAL B 160 ? N VAL B 160 
J 1 2 O GLU B 217 ? O GLU B 217 N GLN B 309 ? N GLN B 309 
J 2 3 O GLY B 302 ? O GLY B 302 N ASN B 299 ? N ASN B 299 
J 3 4 O THR B 294 ? O THR B 294 N LYS B 244 ? N LYS B 244 
K 1 2 O ILE B 227 ? O ILE B 227 N ILE B 281 ? N ILE B 281 
K 2 3 O THR B 274 ? O THR B 274 N VAL B 264 ? N VAL B 264 
# 
_database_PDB_matrix.entry_id          1ITB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ITB 
_atom_sites.fract_transf_matrix[1][1]   0.006805 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002336 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014609 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016052 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . ALA A 1 1   ? 57.910 -4.080  27.425 1.00 43.29  ? 1   ALA A N    1 
ATOM   2    C CA   . ALA A 1 1   ? 56.936 -4.559  26.419 1.00 28.26  ? 1   ALA A CA   1 
ATOM   3    C C    . ALA A 1 1   ? 57.680 -4.737  25.118 1.00 27.12  ? 1   ALA A C    1 
ATOM   4    O O    . ALA A 1 1   ? 58.429 -3.858  24.736 1.00 36.80  ? 1   ALA A O    1 
ATOM   5    C CB   . ALA A 1 1   ? 55.852 -3.523  26.244 1.00 32.66  ? 1   ALA A CB   1 
ATOM   6    H H1   . ALA A 1 1   ? 58.329 -3.180  27.114 1.00 37.00  ? 1   ALA A H1   1 
ATOM   7    H H2   . ALA A 1 1   ? 57.425 -3.939  28.333 1.00 37.00  ? 1   ALA A H2   1 
ATOM   8    H H3   . ALA A 1 1   ? 58.666 -4.784  27.547 1.00 37.00  ? 1   ALA A H3   1 
ATOM   9    N N    . PRO A 1 2   ? 57.523 -5.892  24.446 1.00 21.92  ? 2   PRO A N    1 
ATOM   10   C CA   . PRO A 1 2   ? 58.180 -6.193  23.168 1.00 22.65  ? 2   PRO A CA   1 
ATOM   11   C C    . PRO A 1 2   ? 57.714 -5.350  21.989 1.00 27.52  ? 2   PRO A C    1 
ATOM   12   O O    . PRO A 1 2   ? 58.461 -5.159  21.018 1.00 43.50  ? 2   PRO A O    1 
ATOM   13   C CB   . PRO A 1 2   ? 57.870 -7.682  22.953 1.00 26.51  ? 2   PRO A CB   1 
ATOM   14   C CG   . PRO A 1 2   ? 56.661 -7.927  23.771 1.00 26.03  ? 2   PRO A CG   1 
ATOM   15   C CD   . PRO A 1 2   ? 56.935 -7.116  25.008 1.00 29.53  ? 2   PRO A CD   1 
ATOM   16   N N    . VAL A 1 3   ? 56.468 -4.883  22.055 1.00 37.17  ? 3   VAL A N    1 
ATOM   17   C CA   . VAL A 1 3   ? 55.892 -4.039  21.012 1.00 19.99  ? 3   VAL A CA   1 
ATOM   18   C C    . VAL A 1 3   ? 55.252 -2.811  21.671 1.00 26.73  ? 3   VAL A C    1 
ATOM   19   O O    . VAL A 1 3   ? 54.857 -2.832  22.848 1.00 18.81  ? 3   VAL A O    1 
ATOM   20   C CB   . VAL A 1 3   ? 54.870 -4.840  20.115 1.00 41.25  ? 3   VAL A CB   1 
ATOM   21   C CG1  . VAL A 1 3   ? 53.695 -5.325  20.929 1.00 42.74  ? 3   VAL A CG1  1 
ATOM   22   C CG2  . VAL A 1 3   ? 54.389 -4.001  18.934 1.00 43.35  ? 3   VAL A CG2  1 
ATOM   23   H H    . VAL A 1 3   ? 55.913 -5.130  22.822 1.00 37.00  ? 3   VAL A H    1 
ATOM   24   N N    . ARG A 1 4   ? 55.251 -1.706  20.939 1.00 31.24  ? 4   ARG A N    1 
ATOM   25   C CA   . ARG A 1 4   ? 54.670 -0.473  21.446 1.00 29.18  ? 4   ARG A CA   1 
ATOM   26   C C    . ARG A 1 4   ? 53.186 -0.485  21.092 1.00 35.08  ? 4   ARG A C    1 
ATOM   27   O O    . ARG A 1 4   ? 52.834 -0.645  19.922 1.00 23.62  ? 4   ARG A O    1 
ATOM   28   C CB   . ARG A 1 4   ? 55.377 0.715   20.809 1.00 26.83  ? 4   ARG A CB   1 
ATOM   29   C CG   . ARG A 1 4   ? 54.803 2.044   21.149 1.00 20.54  ? 4   ARG A CG   1 
ATOM   30   C CD   . ARG A 1 4   ? 55.021 2.452   22.579 1.00 15.24  ? 4   ARG A CD   1 
ATOM   31   N NE   . ARG A 1 4   ? 54.978 3.907   22.616 1.00 23.35  ? 4   ARG A NE   1 
ATOM   32   C CZ   . ARG A 1 4   ? 54.212 4.612   23.430 1.00 31.34  ? 4   ARG A CZ   1 
ATOM   33   N NH1  . ARG A 1 4   ? 53.406 4.006   24.299 1.00 51.76  ? 4   ARG A NH1  1 
ATOM   34   N NH2  . ARG A 1 4   ? 54.244 5.929   23.363 1.00 39.19  ? 4   ARG A NH2  1 
ATOM   35   H H    . ARG A 1 4   ? 55.631 -1.716  20.035 1.00 37.00  ? 4   ARG A H    1 
ATOM   36   H HE   . ARG A 1 4   ? 55.551 4.401   21.991 1.00 37.00  ? 4   ARG A HE   1 
ATOM   37   H HH11 . ARG A 1 4   ? 53.384 3.007   24.330 1.00 37.00  ? 4   ARG A HH11 1 
ATOM   38   H HH12 . ARG A 1 4   ? 52.824 4.538   24.914 1.00 37.00  ? 4   ARG A HH12 1 
ATOM   39   H HH21 . ARG A 1 4   ? 54.844 6.397   22.713 1.00 37.00  ? 4   ARG A HH21 1 
ATOM   40   H HH22 . ARG A 1 4   ? 53.671 6.462   23.984 1.00 37.00  ? 4   ARG A HH22 1 
ATOM   41   N N    . SER A 1 5   ? 52.337 -0.356  22.116 1.00 37.91  ? 5   SER A N    1 
ATOM   42   C CA   . SER A 1 5   ? 50.882 -0.371  21.959 1.00 36.85  ? 5   SER A CA   1 
ATOM   43   C C    . SER A 1 5   ? 50.177 0.721   22.754 1.00 41.06  ? 5   SER A C    1 
ATOM   44   O O    . SER A 1 5   ? 50.597 1.057   23.862 1.00 41.14  ? 5   SER A O    1 
ATOM   45   C CB   . SER A 1 5   ? 50.321 -1.720  22.411 1.00 37.13  ? 5   SER A CB   1 
ATOM   46   O OG   . SER A 1 5   ? 50.815 -2.774  21.608 1.00 29.22  ? 5   SER A OG   1 
ATOM   47   H H    . SER A 1 5   ? 52.708 -0.270  23.020 1.00 37.00  ? 5   SER A H    1 
ATOM   48   H HG   . SER A 1 5   ? 51.775 -2.730  21.643 1.00 37.00  ? 5   SER A HG   1 
ATOM   49   N N    . LEU A 1 6   ? 49.092 1.248   22.177 1.00 43.72  ? 6   LEU A N    1 
ATOM   50   C CA   . LEU A 1 6   ? 48.267 2.294   22.790 1.00 39.16  ? 6   LEU A CA   1 
ATOM   51   C C    . LEU A 1 6   ? 46.788 1.949   22.624 1.00 43.09  ? 6   LEU A C    1 
ATOM   52   O O    . LEU A 1 6   ? 46.382 1.343   21.627 1.00 51.63  ? 6   LEU A O    1 
ATOM   53   C CB   . LEU A 1 6   ? 48.531 3.664   22.155 1.00 35.68  ? 6   LEU A CB   1 
ATOM   54   C CG   . LEU A 1 6   ? 49.905 4.349   22.290 1.00 44.38  ? 6   LEU A CG   1 
ATOM   55   C CD1  . LEU A 1 6   ? 49.898 5.615   21.427 1.00 28.44  ? 6   LEU A CD1  1 
ATOM   56   C CD2  . LEU A 1 6   ? 50.252 4.681   23.760 1.00 32.61  ? 6   LEU A CD2  1 
ATOM   57   H H    . LEU A 1 6   ? 48.837 0.919   21.291 1.00 37.00  ? 6   LEU A H    1 
ATOM   58   N N    . ASN A 1 7   ? 45.996 2.314   23.628 1.00 43.34  ? 7   ASN A N    1 
ATOM   59   C CA   . ASN A 1 7   ? 44.559 2.072   23.630 1.00 32.25  ? 7   ASN A CA   1 
ATOM   60   C C    . ASN A 1 7   ? 43.841 3.304   23.102 1.00 30.12  ? 7   ASN A C    1 
ATOM   61   O O    . ASN A 1 7   ? 43.990 4.386   23.657 1.00 24.80  ? 7   ASN A O    1 
ATOM   62   C CB   . ASN A 1 7   ? 44.094 1.766   25.048 1.00 35.19  ? 7   ASN A CB   1 
ATOM   63   C CG   . ASN A 1 7   ? 44.818 0.595   25.648 1.00 34.53  ? 7   ASN A CG   1 
ATOM   64   O OD1  . ASN A 1 7   ? 44.856 -0.494  25.068 1.00 39.10  ? 7   ASN A OD1  1 
ATOM   65   N ND2  . ASN A 1 7   ? 45.434 0.817   26.806 1.00 47.48  ? 7   ASN A ND2  1 
ATOM   66   H H    . ASN A 1 7   ? 46.399 2.769   24.398 1.00 37.00  ? 7   ASN A H    1 
ATOM   67   H HD21 . ASN A 1 7   ? 45.907 0.068   27.225 1.00 37.00  ? 7   ASN A HD21 1 
ATOM   68   H HD22 . ASN A 1 7   ? 45.393 1.715   27.200 1.00 37.00  ? 7   ASN A HD22 1 
ATOM   69   N N    . CYS A 1 8   ? 43.060 3.121   22.040 1.00 27.94  ? 8   CYS A N    1 
ATOM   70   C CA   . CYS A 1 8   ? 42.320 4.210   21.395 1.00 29.28  ? 8   CYS A CA   1 
ATOM   71   C C    . CYS A 1 8   ? 40.858 3.834   21.135 1.00 31.82  ? 8   CYS A C    1 
ATOM   72   O O    . CYS A 1 8   ? 40.478 2.653   21.287 1.00 22.71  ? 8   CYS A O    1 
ATOM   73   C CB   . CYS A 1 8   ? 42.988 4.544   20.067 1.00 24.41  ? 8   CYS A CB   1 
ATOM   74   S SG   . CYS A 1 8   ? 43.421 3.069   19.175 1.00 28.76  ? 8   CYS A SG   1 
ATOM   75   H H    . CYS A 1 8   ? 42.991 2.221   21.657 1.00 37.00  ? 8   CYS A H    1 
ATOM   76   N N    . THR A 1 9   ? 40.067 4.812   20.665 1.00 31.87  ? 9   THR A N    1 
ATOM   77   C CA   . THR A 1 9   ? 38.650 4.561   20.405 1.00 39.76  ? 9   THR A CA   1 
ATOM   78   C C    . THR A 1 9   ? 38.139 4.654   18.969 1.00 45.76  ? 9   THR A C    1 
ATOM   79   O O    . THR A 1 9   ? 37.241 3.867   18.585 1.00 63.34  ? 9   THR A O    1 
ATOM   80   C CB   . THR A 1 9   ? 37.698 5.429   21.264 1.00 22.18  ? 9   THR A CB   1 
ATOM   81   O OG1  . THR A 1 9   ? 37.705 6.767   20.765 1.00 47.57  ? 9   THR A OG1  1 
ATOM   82   C CG2  . THR A 1 9   ? 38.104 5.440   22.709 1.00 38.44  ? 9   THR A CG2  1 
ATOM   83   H H    . THR A 1 9   ? 40.430 5.702   20.486 1.00 37.00  ? 9   THR A H    1 
ATOM   84   H HG1  . THR A 1 9   ? 38.614 7.070   20.742 1.00 37.00  ? 9   THR A HG1  1 
ATOM   85   N N    . LEU A 1 10  ? 38.626 5.616   18.188 1.00 28.03  ? 10  LEU A N    1 
ATOM   86   C CA   . LEU A 1 10  ? 38.116 5.756   16.794 1.00 32.26  ? 10  LEU A CA   1 
ATOM   87   C C    . LEU A 1 10  ? 36.616 6.109   16.540 1.00 25.70  ? 10  LEU A C    1 
ATOM   88   O O    . LEU A 1 10  ? 35.695 5.392   16.969 1.00 32.43  ? 10  LEU A O    1 
ATOM   89   C CB   . LEU A 1 10  ? 38.442 4.505   15.966 1.00 20.03  ? 10  LEU A CB   1 
ATOM   90   C CG   . LEU A 1 10  ? 39.879 4.274   15.503 1.00 35.62  ? 10  LEU A CG   1 
ATOM   91   C CD1  . LEU A 1 10  ? 39.937 3.023   14.649 1.00 38.29  ? 10  LEU A CD1  1 
ATOM   92   C CD2  . LEU A 1 10  ? 40.349 5.467   14.678 1.00 44.05  ? 10  LEU A CD2  1 
ATOM   93   H H    . LEU A 1 10  ? 39.316 6.226   18.524 1.00 37.00  ? 10  LEU A H    1 
ATOM   94   N N    . ARG A 1 11  ? 36.392 7.209   15.820 1.00 24.59  ? 11  ARG A N    1 
ATOM   95   C CA   . ARG A 1 11  ? 35.056 7.663   15.421 1.00 26.07  ? 11  ARG A CA   1 
ATOM   96   C C    . ARG A 1 11  ? 35.260 8.097   13.973 1.00 21.50  ? 11  ARG A C    1 
ATOM   97   O O    . ARG A 1 11  ? 36.293 8.660   13.670 1.00 25.75  ? 11  ARG A O    1 
ATOM   98   C CB   . ARG A 1 11  ? 34.594 8.877   16.249 1.00 28.19  ? 11  ARG A CB   1 
ATOM   99   C CG   . ARG A 1 11  ? 33.977 8.536   17.600 1.00 59.51  ? 11  ARG A CG   1 
ATOM   100  C CD   . ARG A 1 11  ? 34.463 9.473   18.736 1.00 78.43  ? 11  ARG A CD   1 
ATOM   101  N NE   . ARG A 1 11  ? 34.147 8.983   20.091 1.00 84.99  ? 11  ARG A NE   1 
ATOM   102  C CZ   . ARG A 1 11  ? 34.642 9.500   21.220 1.00 89.30  ? 11  ARG A CZ   1 
ATOM   103  N NH1  . ARG A 1 11  ? 35.479 10.528  21.176 1.00 93.41  ? 11  ARG A NH1  1 
ATOM   104  N NH2  . ARG A 1 11  ? 34.313 8.989   22.402 1.00 81.19  ? 11  ARG A NH2  1 
ATOM   105  H H    . ARG A 1 11  ? 37.166 7.751   15.556 1.00 37.00  ? 11  ARG A H    1 
ATOM   106  H HE   . ARG A 1 11  ? 33.522 8.234   20.172 1.00 37.00  ? 11  ARG A HE   1 
ATOM   107  H HH11 . ARG A 1 11  ? 35.751 10.922  20.298 1.00 37.00  ? 11  ARG A HH11 1 
ATOM   108  H HH12 . ARG A 1 11  ? 35.846 10.907  22.025 1.00 37.00  ? 11  ARG A HH12 1 
ATOM   109  H HH21 . ARG A 1 11  ? 33.698 8.202   22.465 1.00 37.00  ? 11  ARG A HH21 1 
ATOM   110  H HH22 . ARG A 1 11  ? 34.699 9.389   23.232 1.00 37.00  ? 11  ARG A HH22 1 
ATOM   111  N N    . ASP A 1 12  ? 34.334 7.804   13.059 1.00 25.38  ? 12  ASP A N    1 
ATOM   112  C CA   . ASP A 1 12  ? 34.541 8.259   11.689 1.00 13.93  ? 12  ASP A CA   1 
ATOM   113  C C    . ASP A 1 12  ? 34.394 9.783   11.594 1.00 15.30  ? 12  ASP A C    1 
ATOM   114  O O    . ASP A 1 12  ? 34.180 10.454  12.610 1.00 17.61  ? 12  ASP A O    1 
ATOM   115  C CB   . ASP A 1 12  ? 33.702 7.471   10.662 1.00 20.46  ? 12  ASP A CB   1 
ATOM   116  C CG   . ASP A 1 12  ? 32.195 7.721   10.753 1.00 29.21  ? 12  ASP A CG   1 
ATOM   117  O OD1  . ASP A 1 12  ? 31.746 8.706   11.369 1.00 36.77  ? 12  ASP A OD1  1 
ATOM   118  O OD2  . ASP A 1 12  ? 31.446 6.938   10.137 1.00 20.62  ? 12  ASP A OD2  1 
ATOM   119  H H    . ASP A 1 12  ? 33.533 7.288   13.281 1.00 37.00  ? 12  ASP A H    1 
ATOM   120  N N    . SER A 1 13  ? 34.571 10.345  10.404 1.00 16.24  ? 13  SER A N    1 
ATOM   121  C CA   . SER A 1 13  ? 34.496 11.808  10.253 1.00 20.60  ? 13  SER A CA   1 
ATOM   122  C C    . SER A 1 13  ? 33.089 12.370  10.354 1.00 22.53  ? 13  SER A C    1 
ATOM   123  O O    . SER A 1 13  ? 32.907 13.592  10.441 1.00 18.34  ? 13  SER A O    1 
ATOM   124  C CB   . SER A 1 13  ? 35.123 12.253  8.936  1.00 17.03  ? 13  SER A CB   1 
ATOM   125  O OG   . SER A 1 13  ? 34.378 11.764  7.838  1.00 30.18  ? 13  SER A OG   1 
ATOM   126  H H    . SER A 1 13  ? 34.794 9.782   9.632  1.00 37.00  ? 13  SER A H    1 
ATOM   127  H HG   . SER A 1 13  ? 34.763 12.088  7.022  1.00 37.00  ? 13  SER A HG   1 
ATOM   128  N N    . GLN A 1 14  ? 32.107 11.470  10.285 1.00 23.58  ? 14  GLN A N    1 
ATOM   129  C CA   . GLN A 1 14  ? 30.706 11.824  10.391 1.00 14.76  ? 14  GLN A CA   1 
ATOM   130  C C    . GLN A 1 14  ? 30.170 11.682  11.821 1.00 22.77  ? 14  GLN A C    1 
ATOM   131  O O    . GLN A 1 14  ? 28.978 11.851  12.088 1.00 34.75  ? 14  GLN A O    1 
ATOM   132  C CB   . GLN A 1 14  ? 29.911 11.005  9.412  1.00 17.35  ? 14  GLN A CB   1 
ATOM   133  C CG   . GLN A 1 14  ? 30.176 11.416  7.980  1.00 27.45  ? 14  GLN A CG   1 
ATOM   134  C CD   . GLN A 1 14  ? 29.787 12.861  7.711  1.00 31.90  ? 14  GLN A CD   1 
ATOM   135  O OE1  . GLN A 1 14  ? 30.643 13.747  7.661  1.00 54.73  ? 14  GLN A OE1  1 
ATOM   136  N NE2  . GLN A 1 14  ? 28.490 13.105  7.542  1.00 41.38  ? 14  GLN A NE2  1 
ATOM   137  H H    . GLN A 1 14  ? 32.335 10.526  10.141 1.00 37.00  ? 14  GLN A H    1 
ATOM   138  H HE21 . GLN A 1 14  ? 28.210 14.024  7.348  1.00 37.00  ? 14  GLN A HE21 1 
ATOM   139  H HE22 . GLN A 1 14  ? 27.864 12.354  7.614  1.00 37.00  ? 14  GLN A HE22 1 
ATOM   140  N N    . GLN A 1 15  ? 31.092 11.424  12.737 1.00 18.79  ? 15  GLN A N    1 
ATOM   141  C CA   . GLN A 1 15  ? 30.848 11.292  14.164 1.00 11.25  ? 15  GLN A CA   1 
ATOM   142  C C    . GLN A 1 15  ? 30.297 9.986   14.671 1.00 15.31  ? 15  GLN A C    1 
ATOM   143  O O    . GLN A 1 15  ? 29.996 9.864   15.864 1.00 11.61  ? 15  GLN A O    1 
ATOM   144  C CB   . GLN A 1 15  ? 30.023 12.442  14.675 1.00 20.06  ? 15  GLN A CB   1 
ATOM   145  C CG   . GLN A 1 15  ? 30.667 13.773  14.431 1.00 12.32  ? 15  GLN A CG   1 
ATOM   146  C CD   . GLN A 1 15  ? 31.525 14.179  15.582 1.00 13.55  ? 15  GLN A CD   1 
ATOM   147  O OE1  . GLN A 1 15  ? 31.937 13.354  16.407 1.00 28.59  ? 15  GLN A OE1  1 
ATOM   148  N NE2  . GLN A 1 15  ? 31.782 15.471  15.674 1.00 27.65  ? 15  GLN A NE2  1 
ATOM   149  H H    . GLN A 1 15  ? 32.016 11.304  12.433 1.00 37.00  ? 15  GLN A H    1 
ATOM   150  H HE21 . GLN A 1 15  ? 32.401 15.751  16.381 1.00 37.00  ? 15  GLN A HE21 1 
ATOM   151  H HE22 . GLN A 1 15  ? 31.375 16.097  15.037 1.00 37.00  ? 15  GLN A HE22 1 
ATOM   152  N N    . LYS A 1 16  ? 30.202 9.006   13.775 1.00 11.33  ? 16  LYS A N    1 
ATOM   153  C CA   . LYS A 1 16  ? 29.723 7.683   14.150 1.00 16.58  ? 16  LYS A CA   1 
ATOM   154  C C    . LYS A 1 16  ? 30.816 6.879   14.869 1.00 22.20  ? 16  LYS A C    1 
ATOM   155  O O    . LYS A 1 16  ? 31.991 6.871   14.477 1.00 22.10  ? 16  LYS A O    1 
ATOM   156  C CB   . LYS A 1 16  ? 29.212 6.915   12.932 1.00 6.34   ? 16  LYS A CB   1 
ATOM   157  C CG   . LYS A 1 16  ? 28.174 7.685   12.103 1.00 5.40   ? 16  LYS A CG   1 
ATOM   158  C CD   . LYS A 1 16  ? 27.352 6.772   11.189 1.00 15.94  ? 16  LYS A CD   1 
ATOM   159  C CE   . LYS A 1 16  ? 28.157 5.979   10.148 1.00 17.44  ? 16  LYS A CE   1 
ATOM   160  N NZ   . LYS A 1 16  ? 28.531 6.842   9.020  1.00 21.68  ? 16  LYS A NZ   1 
ATOM   161  H H    . LYS A 1 16  ? 30.483 9.176   12.857 1.00 37.00  ? 16  LYS A H    1 
ATOM   162  H HZ1  . LYS A 1 16  ? 29.038 7.676   9.378  1.00 37.00  ? 16  LYS A HZ1  1 
ATOM   163  H HZ2  . LYS A 1 16  ? 29.157 6.312   8.384  1.00 37.00  ? 16  LYS A HZ2  1 
ATOM   164  H HZ3  . LYS A 1 16  ? 27.684 7.141   8.496  1.00 37.00  ? 16  LYS A HZ3  1 
ATOM   165  N N    . SER A 1 17  ? 30.416 6.247   15.960 1.00 17.87  ? 17  SER A N    1 
ATOM   166  C CA   . SER A 1 17  ? 31.314 5.446   16.752 1.00 12.35  ? 17  SER A CA   1 
ATOM   167  C C    . SER A 1 17  ? 31.259 4.027   16.211 1.00 14.73  ? 17  SER A C    1 
ATOM   168  O O    . SER A 1 17  ? 30.454 3.739   15.323 1.00 27.24  ? 17  SER A O    1 
ATOM   169  C CB   . SER A 1 17  ? 30.895 5.517   18.218 1.00 10.23  ? 17  SER A CB   1 
ATOM   170  O OG   . SER A 1 17  ? 30.548 6.855   18.559 1.00 33.42  ? 17  SER A OG   1 
ATOM   171  H H    . SER A 1 17  ? 29.491 6.368   16.257 1.00 37.00  ? 17  SER A H    1 
ATOM   172  H HG   . SER A 1 17  ? 29.898 7.125   17.902 1.00 37.00  ? 17  SER A HG   1 
ATOM   173  N N    . LEU A 1 18  ? 32.148 3.157   16.690 1.00 15.31  ? 18  LEU A N    1 
ATOM   174  C CA   . LEU A 1 18  ? 32.172 1.779   16.199 1.00 24.03  ? 18  LEU A CA   1 
ATOM   175  C C    . LEU A 1 18  ? 31.867 0.821   17.341 1.00 25.96  ? 18  LEU A C    1 
ATOM   176  O O    . LEU A 1 18  ? 32.287 1.047   18.502 1.00 20.71  ? 18  LEU A O    1 
ATOM   177  C CB   . LEU A 1 18  ? 33.529 1.432   15.569 1.00 14.82  ? 18  LEU A CB   1 
ATOM   178  C CG   . LEU A 1 18  ? 34.319 2.449   14.728 1.00 16.94  ? 18  LEU A CG   1 
ATOM   179  C CD1  . LEU A 1 18  ? 35.559 1.745   14.175 1.00 19.32  ? 18  LEU A CD1  1 
ATOM   180  C CD2  . LEU A 1 18  ? 33.513 3.008   13.566 1.00 5.00   ? 18  LEU A CD2  1 
ATOM   181  H H    . LEU A 1 18  ? 32.760 3.427   17.404 1.00 37.00  ? 18  LEU A H    1 
ATOM   182  N N    . VAL A 1 19  ? 31.135 -0.247  17.027 1.00 24.99  ? 19  VAL A N    1 
ATOM   183  C CA   . VAL A 1 19  ? 30.772 -1.222  18.060 1.00 31.13  ? 19  VAL A CA   1 
ATOM   184  C C    . VAL A 1 19  ? 30.754 -2.623  17.510 1.00 24.20  ? 19  VAL A C    1 
ATOM   185  O O    . VAL A 1 19  ? 30.865 -2.845  16.310 1.00 27.20  ? 19  VAL A O    1 
ATOM   186  C CB   . VAL A 1 19  ? 29.366 -0.956  18.648 1.00 25.56  ? 19  VAL A CB   1 
ATOM   187  C CG1  . VAL A 1 19  ? 29.320 0.388   19.395 1.00 15.02  ? 19  VAL A CG1  1 
ATOM   188  C CG2  . VAL A 1 19  ? 28.348 -0.982  17.514 1.00 25.18  ? 19  VAL A CG2  1 
ATOM   189  H H    . VAL A 1 19  ? 30.892 -0.441  16.116 1.00 37.00  ? 19  VAL A H    1 
ATOM   190  N N    . MET A 1 20  ? 30.586 -3.577  18.400 1.00 32.77  ? 20  MET A N    1 
ATOM   191  C CA   . MET A 1 20  ? 30.536 -4.942  17.956 1.00 45.30  ? 20  MET A CA   1 
ATOM   192  C C    . MET A 1 20  ? 29.139 -5.213  17.439 1.00 44.11  ? 20  MET A C    1 
ATOM   193  O O    . MET A 1 20  ? 28.156 -4.823  18.054 1.00 51.85  ? 20  MET A O    1 
ATOM   194  C CB   . MET A 1 20  ? 30.848 -5.887  19.105 1.00 53.44  ? 20  MET A CB   1 
ATOM   195  C CG   . MET A 1 20  ? 31.647 -7.076  18.671 1.00 58.42  ? 20  MET A CG   1 
ATOM   196  S SD   . MET A 1 20  ? 33.348 -6.604  18.462 1.00 55.08  ? 20  MET A SD   1 
ATOM   197  C CE   . MET A 1 20  ? 34.121 -7.603  19.806 1.00 56.58  ? 20  MET A CE   1 
ATOM   198  H H    . MET A 1 20  ? 30.489 -3.366  19.351 1.00 37.00  ? 20  MET A H    1 
ATOM   199  N N    . SER A 1 21  ? 29.076 -5.812  16.262 1.00 57.50  ? 21  SER A N    1 
ATOM   200  C CA   . SER A 1 21  ? 27.826 -6.198  15.614 1.00 60.51  ? 21  SER A CA   1 
ATOM   201  C C    . SER A 1 21  ? 27.914 -7.729  15.677 1.00 71.24  ? 21  SER A C    1 
ATOM   202  O O    . SER A 1 21  ? 28.014 -8.409  14.646 1.00 78.53  ? 21  SER A O    1 
ATOM   203  C CB   . SER A 1 21  ? 27.835 -5.714  14.151 1.00 59.75  ? 21  SER A CB   1 
ATOM   204  O OG   . SER A 1 21  ? 26.553 -5.765  13.541 1.00 62.75  ? 21  SER A OG   1 
ATOM   205  H H    . SER A 1 21  ? 29.918 -6.004  15.804 1.00 37.00  ? 21  SER A H    1 
ATOM   206  H HG   . SER A 1 21  ? 25.918 -5.328  14.111 1.00 37.00  ? 21  SER A HG   1 
ATOM   207  N N    . GLY A 1 22  ? 27.964 -8.257  16.900 1.00 70.02  ? 22  GLY A N    1 
ATOM   208  C CA   . GLY A 1 22  ? 28.091 -9.694  17.084 1.00 72.61  ? 22  GLY A CA   1 
ATOM   209  C C    . GLY A 1 22  ? 29.520 -10.113 16.780 1.00 73.18  ? 22  GLY A C    1 
ATOM   210  O O    . GLY A 1 22  ? 29.901 -10.128 15.610 1.00 70.19  ? 22  GLY A O    1 
ATOM   211  H H    . GLY A 1 22  ? 27.937 -7.665  17.682 1.00 37.00  ? 22  GLY A H    1 
ATOM   212  N N    . PRO A 1 23  ? 30.322 -10.483 17.803 1.00 76.35  ? 23  PRO A N    1 
ATOM   213  C CA   . PRO A 1 23  ? 31.725 -10.907 17.691 1.00 73.10  ? 23  PRO A CA   1 
ATOM   214  C C    . PRO A 1 23  ? 32.086 -11.534 16.354 1.00 69.24  ? 23  PRO A C    1 
ATOM   215  O O    . PRO A 1 23  ? 31.496 -12.538 15.954 1.00 68.74  ? 23  PRO A O    1 
ATOM   216  C CB   . PRO A 1 23  ? 31.868 -11.877 18.851 1.00 76.33  ? 23  PRO A CB   1 
ATOM   217  C CG   . PRO A 1 23  ? 31.076 -11.171 19.920 1.00 78.95  ? 23  PRO A CG   1 
ATOM   218  C CD   . PRO A 1 23  ? 29.823 -10.723 19.173 1.00 79.17  ? 23  PRO A CD   1 
ATOM   219  N N    . TYR A 1 24  ? 33.020 -10.866 15.673 1.00 65.98  ? 24  TYR A N    1 
ATOM   220  C CA   . TYR A 1 24  ? 33.563 -11.193 14.343 1.00 67.20  ? 24  TYR A CA   1 
ATOM   221  C C    . TYR A 1 24  ? 33.132 -10.202 13.261 1.00 62.01  ? 24  TYR A C    1 
ATOM   222  O O    . TYR A 1 24  ? 33.439 -10.387 12.080 1.00 61.00  ? 24  TYR A O    1 
ATOM   223  C CB   . TYR A 1 24  ? 33.278 -12.633 13.904 1.00 70.67  ? 24  TYR A CB   1 
ATOM   224  C CG   . TYR A 1 24  ? 34.162 -13.658 14.586 1.00 80.89  ? 24  TYR A CG   1 
ATOM   225  C CD1  . TYR A 1 24  ? 35.442 -13.319 15.040 1.00 75.80  ? 24  TYR A CD1  1 
ATOM   226  C CD2  . TYR A 1 24  ? 33.718 -14.965 14.787 1.00 82.43  ? 24  TYR A CD2  1 
ATOM   227  C CE1  . TYR A 1 24  ? 36.259 -14.258 15.678 1.00 75.44  ? 24  TYR A CE1  1 
ATOM   228  C CE2  . TYR A 1 24  ? 34.528 -15.915 15.426 1.00 91.24  ? 24  TYR A CE2  1 
ATOM   229  C CZ   . TYR A 1 24  ? 35.800 -15.555 15.871 1.00 85.99  ? 24  TYR A CZ   1 
ATOM   230  O OH   . TYR A 1 24  ? 36.598 -16.494 16.506 1.00 79.97  ? 24  TYR A OH   1 
ATOM   231  H H    . TYR A 1 24  ? 33.385 -10.069 16.113 1.00 37.00  ? 24  TYR A H    1 
ATOM   232  H HH   . TYR A 1 24  ? 36.116 -17.320 16.591 1.00 37.00  ? 24  TYR A HH   1 
ATOM   233  N N    . GLU A 1 25  ? 32.493 -9.117  13.699 1.00 55.97  ? 25  GLU A N    1 
ATOM   234  C CA   . GLU A 1 25  ? 32.004 -8.044  12.829 1.00 48.54  ? 25  GLU A CA   1 
ATOM   235  C C    . GLU A 1 25  ? 31.855 -6.741  13.616 1.00 38.56  ? 25  GLU A C    1 
ATOM   236  O O    . GLU A 1 25  ? 31.540 -6.747  14.804 1.00 28.25  ? 25  GLU A O    1 
ATOM   237  C CB   . GLU A 1 25  ? 30.651 -8.416  12.233 1.00 61.99  ? 25  GLU A CB   1 
ATOM   238  C CG   . GLU A 1 25  ? 30.095 -7.381  11.268 1.00 72.06  ? 25  GLU A CG   1 
ATOM   239  C CD   . GLU A 1 25  ? 28.828 -7.843  10.572 1.00 84.75  ? 25  GLU A CD   1 
ATOM   240  O OE1  . GLU A 1 25  ? 28.226 -8.851  11.010 1.00 85.96  ? 25  GLU A OE1  1 
ATOM   241  O OE2  . GLU A 1 25  ? 28.435 -7.196  9.577  1.00 91.02  ? 25  GLU A OE2  1 
ATOM   242  H H    . GLU A 1 25  ? 32.334 -9.034  14.661 1.00 37.00  ? 25  GLU A H    1 
ATOM   243  N N    . LEU A 1 26  ? 32.069 -5.620  12.943 1.00 27.07  ? 26  LEU A N    1 
ATOM   244  C CA   . LEU A 1 26  ? 31.976 -4.317  13.585 1.00 15.81  ? 26  LEU A CA   1 
ATOM   245  C C    . LEU A 1 26  ? 31.017 -3.441  12.818 1.00 16.21  ? 26  LEU A C    1 
ATOM   246  O O    . LEU A 1 26  ? 30.738 -3.685  11.644 1.00 19.93  ? 26  LEU A O    1 
ATOM   247  C CB   . LEU A 1 26  ? 33.348 -3.665  13.578 1.00 25.61  ? 26  LEU A CB   1 
ATOM   248  C CG   . LEU A 1 26  ? 34.105 -3.472  14.897 1.00 34.53  ? 26  LEU A CG   1 
ATOM   249  C CD1  . LEU A 1 26  ? 33.797 -4.550  15.921 1.00 37.96  ? 26  LEU A CD1  1 
ATOM   250  C CD2  . LEU A 1 26  ? 35.598 -3.405  14.593 1.00 33.51  ? 26  LEU A CD2  1 
ATOM   251  H H    . LEU A 1 26  ? 32.278 -5.658  11.986 1.00 37.00  ? 26  LEU A H    1 
ATOM   252  N N    . LYS A 1 27  ? 30.470 -2.438  13.484 1.00 20.68  ? 27  LYS A N    1 
ATOM   253  C CA   . LYS A 1 27  ? 29.581 -1.511  12.800 1.00 22.25  ? 27  LYS A CA   1 
ATOM   254  C C    . LYS A 1 27  ? 29.712 -0.127  13.398 1.00 13.16  ? 27  LYS A C    1 
ATOM   255  O O    . LYS A 1 27  ? 30.155 0.035   14.537 1.00 20.82  ? 27  LYS A O    1 
ATOM   256  C CB   . LYS A 1 27  ? 28.122 -2.007  12.781 1.00 41.86  ? 27  LYS A CB   1 
ATOM   257  C CG   . LYS A 1 27  ? 27.410 -2.061  14.132 1.00 65.40  ? 27  LYS A CG   1 
ATOM   258  C CD   . LYS A 1 27  ? 26.046 -2.760  14.005 1.00 73.93  ? 27  LYS A CD   1 
ATOM   259  C CE   . LYS A 1 27  ? 25.373 -3.021  15.370 1.00 68.07  ? 27  LYS A CE   1 
ATOM   260  N NZ   . LYS A 1 27  ? 24.183 -3.932  15.257 1.00 63.73  ? 27  LYS A NZ   1 
ATOM   261  H H    . LYS A 1 27  ? 30.690 -2.296  14.424 1.00 37.00  ? 27  LYS A H    1 
ATOM   262  H HZ1  . LYS A 1 27  ? 24.490 -4.842  14.861 1.00 37.00  ? 27  LYS A HZ1  1 
ATOM   263  H HZ2  . LYS A 1 27  ? 23.758 -4.084  16.194 1.00 37.00  ? 27  LYS A HZ2  1 
ATOM   264  H HZ3  . LYS A 1 27  ? 23.483 -3.500  14.623 1.00 37.00  ? 27  LYS A HZ3  1 
ATOM   265  N N    . ALA A 1 28  ? 29.417 0.869   12.579 1.00 10.33  ? 28  ALA A N    1 
ATOM   266  C CA   . ALA A 1 28  ? 29.491 2.258   12.982 1.00 15.25  ? 28  ALA A CA   1 
ATOM   267  C C    . ALA A 1 28  ? 28.087 2.869   12.962 1.00 20.84  ? 28  ALA A C    1 
ATOM   268  O O    . ALA A 1 28  ? 27.340 2.690   11.998 1.00 15.65  ? 28  ALA A O    1 
ATOM   269  C CB   . ALA A 1 28  ? 30.418 3.039   12.040 1.00 5.95   ? 28  ALA A CB   1 
ATOM   270  H H    . ALA A 1 28  ? 29.160 0.661   11.657 1.00 37.00  ? 28  ALA A H    1 
ATOM   271  N N    . LEU A 1 29  ? 27.760 3.560   14.059 1.00 27.74  ? 29  LEU A N    1 
ATOM   272  C CA   . LEU A 1 29  ? 26.495 4.270   14.278 1.00 26.33  ? 29  LEU A CA   1 
ATOM   273  C C    . LEU A 1 29  ? 26.756 5.387   15.299 1.00 29.44  ? 29  LEU A C    1 
ATOM   274  O O    . LEU A 1 29  ? 27.756 5.371   16.026 1.00 23.63  ? 29  LEU A O    1 
ATOM   275  C CB   . LEU A 1 29  ? 25.441 3.336   14.861 1.00 36.51  ? 29  LEU A CB   1 
ATOM   276  C CG   . LEU A 1 29  ? 25.578 2.927   16.335 1.00 37.93  ? 29  LEU A CG   1 
ATOM   277  C CD1  . LEU A 1 29  ? 24.374 2.093   16.747 1.00 45.02  ? 29  LEU A CD1  1 
ATOM   278  C CD2  . LEU A 1 29  ? 26.863 2.158   16.574 1.00 28.41  ? 29  LEU A CD2  1 
ATOM   279  H H    . LEU A 1 29  ? 28.427 3.606   14.772 1.00 37.00  ? 29  LEU A H    1 
ATOM   280  N N    . HIS A 1 30  ? 25.844 6.343   15.380 1.00 22.38  ? 30  HIS A N    1 
ATOM   281  C CA   . HIS A 1 30  ? 25.992 7.428   16.333 1.00 17.13  ? 30  HIS A CA   1 
ATOM   282  C C    . HIS A 1 30  ? 25.343 6.834   17.578 1.00 25.48  ? 30  HIS A C    1 
ATOM   283  O O    . HIS A 1 30  ? 24.206 6.307   17.498 1.00 23.62  ? 30  HIS A O    1 
ATOM   284  C CB   . HIS A 1 30  ? 25.194 8.673   15.905 1.00 9.27   ? 30  HIS A CB   1 
ATOM   285  C CG   . HIS A 1 30  ? 25.650 9.313   14.623 1.00 13.96  ? 30  HIS A CG   1 
ATOM   286  N ND1  . HIS A 1 30  ? 25.015 9.097   13.416 1.00 21.01  ? 30  HIS A ND1  1 
ATOM   287  C CD2  . HIS A 1 30  ? 26.639 10.204  14.374 1.00 17.42  ? 30  HIS A CD2  1 
ATOM   288  C CE1  . HIS A 1 30  ? 25.596 9.827   12.478 1.00 18.14  ? 30  HIS A CE1  1 
ATOM   289  N NE2  . HIS A 1 30  ? 26.576 10.515  13.033 1.00 12.15  ? 30  HIS A NE2  1 
ATOM   290  H H    . HIS A 1 30  ? 25.002 6.256   14.935 1.00 37.00  ? 30  HIS A H    1 
ATOM   291  H HD1  . HIS A 1 30  ? 24.228 8.537   13.290 1.00 37.00  ? 30  HIS A HD1  1 
ATOM   292  H HE2  . HIS A 1 30  ? 27.119 11.210  12.599 1.00 37.00  ? 30  HIS A HE2  1 
ATOM   293  N N    . LEU A 1 31  ? 26.057 6.915   18.709 1.00 25.18  ? 31  LEU A N    1 
ATOM   294  C CA   . LEU A 1 31  ? 25.584 6.398   19.999 1.00 25.19  ? 31  LEU A CA   1 
ATOM   295  C C    . LEU A 1 31  ? 24.998 7.461   20.939 1.00 33.56  ? 31  LEU A C    1 
ATOM   296  O O    . LEU A 1 31  ? 25.537 8.572   21.049 1.00 25.40  ? 31  LEU A O    1 
ATOM   297  C CB   . LEU A 1 31  ? 26.719 5.648   20.704 1.00 32.71  ? 31  LEU A CB   1 
ATOM   298  C CG   . LEU A 1 31  ? 27.128 4.333   20.028 1.00 44.69  ? 31  LEU A CG   1 
ATOM   299  C CD1  . LEU A 1 31  ? 28.542 3.900   20.448 1.00 44.29  ? 31  LEU A CD1  1 
ATOM   300  C CD2  . LEU A 1 31  ? 26.086 3.253   20.329 1.00 38.75  ? 31  LEU A CD2  1 
ATOM   301  H H    . LEU A 1 31  ? 26.947 7.326   18.658 1.00 37.00  ? 31  LEU A H    1 
ATOM   302  N N    . GLN A 1 32  ? 23.884 7.119   21.594 1.00 35.48  ? 32  GLN A N    1 
ATOM   303  C CA   . GLN A 1 32  ? 23.230 8.038   22.527 1.00 45.24  ? 32  GLN A CA   1 
ATOM   304  C C    . GLN A 1 32  ? 23.991 8.115   23.835 1.00 48.05  ? 32  GLN A C    1 
ATOM   305  O O    . GLN A 1 32  ? 24.555 7.123   24.263 1.00 62.79  ? 32  GLN A O    1 
ATOM   306  C CB   . GLN A 1 32  ? 21.792 7.617   22.775 1.00 36.21  ? 32  GLN A CB   1 
ATOM   307  C CG   . GLN A 1 32  ? 20.806 8.556   22.120 1.00 39.97  ? 32  GLN A CG   1 
ATOM   308  C CD   . GLN A 1 32  ? 19.636 7.837   21.487 1.00 44.86  ? 32  GLN A CD   1 
ATOM   309  O OE1  . GLN A 1 32  ? 19.402 6.655   21.749 1.00 54.19  ? 32  GLN A OE1  1 
ATOM   310  N NE2  . GLN A 1 32  ? 18.900 8.544   20.635 1.00 31.86  ? 32  GLN A NE2  1 
ATOM   311  H H    . GLN A 1 32  ? 23.498 6.228   21.452 1.00 37.00  ? 32  GLN A H    1 
ATOM   312  H HE21 . GLN A 1 32  ? 18.114 8.135   20.214 1.00 37.00  ? 32  GLN A HE21 1 
ATOM   313  H HE22 . GLN A 1 32  ? 19.182 9.469   20.472 1.00 37.00  ? 32  GLN A HE22 1 
ATOM   314  N N    . GLY A 1 33  ? 23.973 9.282   24.475 1.00 55.61  ? 33  GLY A N    1 
ATOM   315  C CA   . GLY A 1 33  ? 24.698 9.508   25.723 1.00 56.26  ? 33  GLY A CA   1 
ATOM   316  C C    . GLY A 1 33  ? 24.713 8.467   26.831 1.00 66.40  ? 33  GLY A C    1 
ATOM   317  O O    . GLY A 1 33  ? 25.390 8.670   27.846 1.00 66.13  ? 33  GLY A O    1 
ATOM   318  H H    . GLY A 1 33  ? 23.459 10.027  24.113 1.00 37.00  ? 33  GLY A H    1 
ATOM   319  N N    . GLN A 1 34  ? 23.944 7.387   26.667 1.00 78.98  ? 34  GLN A N    1 
ATOM   320  C CA   . GLN A 1 34  ? 23.870 6.297   27.653 1.00 84.60  ? 34  GLN A CA   1 
ATOM   321  C C    . GLN A 1 34  ? 24.681 5.070   27.221 1.00 78.62  ? 34  GLN A C    1 
ATOM   322  O O    . GLN A 1 34  ? 25.401 4.489   28.033 1.00 74.92  ? 34  GLN A O    1 
ATOM   323  C CB   . GLN A 1 34  ? 22.396 5.894   27.937 1.00 91.64  ? 34  GLN A CB   1 
ATOM   324  C CG   . GLN A 1 34  ? 21.721 4.944   26.909 1.00 97.71  ? 34  GLN A CG   1 
ATOM   325  C CD   . GLN A 1 34  ? 20.544 5.565   26.134 1.00 99.99  ? 34  GLN A CD   1 
ATOM   326  O OE1  . GLN A 1 34  ? 20.094 6.677   26.428 1.00 87.18  ? 34  GLN A OE1  1 
ATOM   327  N NE2  . GLN A 1 34  ? 20.038 4.828   25.142 1.00 96.29  ? 34  GLN A NE2  1 
ATOM   328  H H    . GLN A 1 34  ? 23.364 7.305   25.885 1.00 37.00  ? 34  GLN A H    1 
ATOM   329  H HE21 . GLN A 1 34  ? 19.299 5.201   24.618 1.00 37.00  ? 34  GLN A HE21 1 
ATOM   330  H HE22 . GLN A 1 34  ? 20.427 3.945   24.979 1.00 37.00  ? 34  GLN A HE22 1 
ATOM   331  N N    . ASP A 1 35  ? 24.574 4.706   25.939 1.00 74.53  ? 35  ASP A N    1 
ATOM   332  C CA   . ASP A 1 35  ? 25.269 3.548   25.367 1.00 67.40  ? 35  ASP A CA   1 
ATOM   333  C C    . ASP A 1 35  ? 26.733 3.816   24.988 1.00 64.47  ? 35  ASP A C    1 
ATOM   334  O O    . ASP A 1 35  ? 27.343 2.982   24.324 1.00 59.10  ? 35  ASP A O    1 
ATOM   335  C CB   . ASP A 1 35  ? 24.559 3.044   24.093 1.00 72.20  ? 35  ASP A CB   1 
ATOM   336  C CG   . ASP A 1 35  ? 23.108 2.668   24.312 1.00 71.46  ? 35  ASP A CG   1 
ATOM   337  O OD1  . ASP A 1 35  ? 22.852 1.549   24.811 1.00 81.26  ? 35  ASP A OD1  1 
ATOM   338  O OD2  . ASP A 1 35  ? 22.225 3.468   23.922 1.00 66.49  ? 35  ASP A OD2  1 
ATOM   339  H H    . ASP A 1 35  ? 24.006 5.241   25.345 1.00 37.00  ? 35  ASP A H    1 
ATOM   340  N N    . MET A 1 36  ? 27.302 4.951   25.393 1.00 65.42  ? 36  MET A N    1 
ATOM   341  C CA   . MET A 1 36  ? 28.690 5.279   25.032 1.00 66.36  ? 36  MET A CA   1 
ATOM   342  C C    . MET A 1 36  ? 29.772 4.253   25.377 1.00 61.28  ? 36  MET A C    1 
ATOM   343  O O    . MET A 1 36  ? 30.858 4.267   24.793 1.00 55.54  ? 36  MET A O    1 
ATOM   344  C CB   . MET A 1 36  ? 29.073 6.670   25.552 1.00 71.26  ? 36  MET A CB   1 
ATOM   345  C CG   . MET A 1 36  ? 28.813 7.778   24.528 1.00 71.49  ? 36  MET A CG   1 
ATOM   346  S SD   . MET A 1 36  ? 29.777 7.563   22.995 1.00 62.38  ? 36  MET A SD   1 
ATOM   347  C CE   . MET A 1 36  ? 30.908 9.000   23.095 1.00 62.03  ? 36  MET A CE   1 
ATOM   348  H H    . MET A 1 36  ? 26.787 5.581   25.940 1.00 37.00  ? 36  MET A H    1 
ATOM   349  N N    . GLU A 1 37  ? 29.443 3.338   26.287 1.00 59.14  ? 37  GLU A N    1 
ATOM   350  C CA   . GLU A 1 37  ? 30.352 2.279   26.728 1.00 59.93  ? 37  GLU A CA   1 
ATOM   351  C C    . GLU A 1 37  ? 30.265 1.028   25.848 1.00 53.03  ? 37  GLU A C    1 
ATOM   352  O O    . GLU A 1 37  ? 30.887 0.010   26.125 1.00 54.05  ? 37  GLU A O    1 
ATOM   353  C CB   . GLU A 1 37  ? 30.056 1.927   28.190 1.00 69.79  ? 37  GLU A CB   1 
ATOM   354  C CG   . GLU A 1 37  ? 30.391 3.052   29.191 1.00 88.49  ? 37  GLU A CG   1 
ATOM   355  C CD   . GLU A 1 37  ? 29.613 4.354   28.948 1.00 98.24  ? 37  GLU A CD   1 
ATOM   356  O OE1  . GLU A 1 37  ? 28.377 4.368   29.155 1.00 98.07  ? 37  GLU A OE1  1 
ATOM   357  O OE2  . GLU A 1 37  ? 30.242 5.367   28.551 1.00 100.00 ? 37  GLU A OE2  1 
ATOM   358  H H    . GLU A 1 37  ? 28.551 3.385   26.688 1.00 37.00  ? 37  GLU A H    1 
ATOM   359  N N    . GLN A 1 38  ? 29.488 1.124   24.780 1.00 56.00  ? 38  GLN A N    1 
ATOM   360  C CA   . GLN A 1 38  ? 29.293 0.034   23.835 1.00 48.16  ? 38  GLN A CA   1 
ATOM   361  C C    . GLN A 1 38  ? 30.394 0.034   22.786 1.00 49.33  ? 38  GLN A C    1 
ATOM   362  O O    . GLN A 1 38  ? 30.504 -0.936  22.017 1.00 49.00  ? 38  GLN A O    1 
ATOM   363  C CB   . GLN A 1 38  ? 27.944 0.188   23.113 1.00 51.19  ? 38  GLN A CB   1 
ATOM   364  C CG   . GLN A 1 38  ? 26.764 -0.467  23.781 1.00 49.49  ? 38  GLN A CG   1 
ATOM   365  C CD   . GLN A 1 38  ? 26.830 -1.966  23.683 1.00 53.02  ? 38  GLN A CD   1 
ATOM   366  O OE1  . GLN A 1 38  ? 26.618 -2.545  22.622 1.00 53.07  ? 38  GLN A OE1  1 
ATOM   367  N NE2  . GLN A 1 38  ? 27.145 -2.606  24.792 1.00 61.05  ? 38  GLN A NE2  1 
ATOM   368  H H    . GLN A 1 38  ? 29.045 1.974   24.595 1.00 37.00  ? 38  GLN A H    1 
ATOM   369  H HE21 . GLN A 1 38  ? 27.195 -3.584  24.755 1.00 37.00  ? 38  GLN A HE21 1 
ATOM   370  H HE22 . GLN A 1 38  ? 27.315 -2.083  25.604 1.00 37.00  ? 38  GLN A HE22 1 
ATOM   371  N N    . GLN A 1 39  ? 31.171 1.127   22.723 1.00 41.86  ? 39  GLN A N    1 
ATOM   372  C CA   . GLN A 1 39  ? 32.245 1.231   21.728 1.00 44.40  ? 39  GLN A CA   1 
ATOM   373  C C    . GLN A 1 39  ? 33.473 0.405   22.050 1.00 45.34  ? 39  GLN A C    1 
ATOM   374  O O    . GLN A 1 39  ? 33.834 0.226   23.221 1.00 48.85  ? 39  GLN A O    1 
ATOM   375  C CB   . GLN A 1 39  ? 32.621 2.676   21.400 1.00 31.76  ? 39  GLN A CB   1 
ATOM   376  C CG   . GLN A 1 39  ? 33.194 3.494   22.523 1.00 40.53  ? 39  GLN A CG   1 
ATOM   377  C CD   . GLN A 1 39  ? 33.565 4.901   22.063 1.00 51.40  ? 39  GLN A CD   1 
ATOM   378  O OE1  . GLN A 1 39  ? 33.552 5.212   20.856 1.00 52.20  ? 39  GLN A OE1  1 
ATOM   379  N NE2  . GLN A 1 39  ? 33.914 5.756   23.016 1.00 50.80  ? 39  GLN A NE2  1 
ATOM   380  H H    . GLN A 1 39  ? 31.029 1.851   23.367 1.00 37.00  ? 39  GLN A H    1 
ATOM   381  H HE21 . GLN A 1 39  ? 34.154 6.664   22.738 1.00 37.00  ? 39  GLN A HE21 1 
ATOM   382  H HE22 . GLN A 1 39  ? 33.922 5.454   23.949 1.00 37.00  ? 39  GLN A HE22 1 
ATOM   383  N N    . VAL A 1 40  ? 34.072 -0.135  20.987 1.00 44.43  ? 40  VAL A N    1 
ATOM   384  C CA   . VAL A 1 40  ? 35.244 -1.003  21.083 1.00 35.35  ? 40  VAL A CA   1 
ATOM   385  C C    . VAL A 1 40  ? 36.542 -0.272  21.316 1.00 31.86  ? 40  VAL A C    1 
ATOM   386  O O    . VAL A 1 40  ? 36.859 0.713   20.647 1.00 32.53  ? 40  VAL A O    1 
ATOM   387  C CB   . VAL A 1 40  ? 35.388 -1.906  19.835 1.00 38.00  ? 40  VAL A CB   1 
ATOM   388  C CG1  . VAL A 1 40  ? 34.319 -2.987  19.841 1.00 33.29  ? 40  VAL A CG1  1 
ATOM   389  C CG2  . VAL A 1 40  ? 35.257 -1.086  18.569 1.00 37.83  ? 40  VAL A CG2  1 
ATOM   390  H H    . VAL A 1 40  ? 33.697 0.069   20.106 1.00 37.00  ? 40  VAL A H    1 
ATOM   391  N N    . VAL A 1 41  ? 37.253 -0.706  22.341 1.00 31.99  ? 41  VAL A N    1 
ATOM   392  C CA   . VAL A 1 41  ? 38.524 -0.094  22.634 1.00 39.20  ? 41  VAL A CA   1 
ATOM   393  C C    . VAL A 1 41  ? 39.532 -0.919  21.860 1.00 41.59  ? 41  VAL A C    1 
ATOM   394  O O    . VAL A 1 41  ? 39.464 -2.152  21.873 1.00 31.78  ? 41  VAL A O    1 
ATOM   395  C CB   . VAL A 1 41  ? 38.836 -0.126  24.127 1.00 42.99  ? 41  VAL A CB   1 
ATOM   396  C CG1  . VAL A 1 41  ? 40.180 0.524   24.379 1.00 47.18  ? 41  VAL A CG1  1 
ATOM   397  C CG2  . VAL A 1 41  ? 37.750 0.619   24.895 1.00 46.31  ? 41  VAL A CG2  1 
ATOM   398  H H    . VAL A 1 41  ? 36.926 -1.447  22.892 1.00 37.00  ? 41  VAL A H    1 
ATOM   399  N N    . PHE A 1 42  ? 40.377 -0.234  21.093 1.00 34.13  ? 42  PHE A N    1 
ATOM   400  C CA   . PHE A 1 42  ? 41.405 -0.900  20.302 1.00 30.74  ? 42  PHE A CA   1 
ATOM   401  C C    . PHE A 1 42  ? 42.755 -0.886  20.973 1.00 31.00  ? 42  PHE A C    1 
ATOM   402  O O    . PHE A 1 42  ? 43.026 -0.074  21.863 1.00 29.17  ? 42  PHE A O    1 
ATOM   403  C CB   . PHE A 1 42  ? 41.572 -0.225  18.945 1.00 32.27  ? 42  PHE A CB   1 
ATOM   404  C CG   . PHE A 1 42  ? 40.417 -0.408  18.047 1.00 21.41  ? 42  PHE A CG   1 
ATOM   405  C CD1  . PHE A 1 42  ? 40.219 -1.623  17.405 1.00 19.81  ? 42  PHE A CD1  1 
ATOM   406  C CD2  . PHE A 1 42  ? 39.508 0.627   17.856 1.00 21.05  ? 42  PHE A CD2  1 
ATOM   407  C CE1  . PHE A 1 42  ? 39.126 -1.805  16.585 1.00 26.61  ? 42  PHE A CE1  1 
ATOM   408  C CE2  . PHE A 1 42  ? 38.409 0.464   17.032 1.00 16.17  ? 42  PHE A CE2  1 
ATOM   409  C CZ   . PHE A 1 42  ? 38.211 -0.751  16.394 1.00 21.61  ? 42  PHE A CZ   1 
ATOM   410  H H    . PHE A 1 42  ? 40.301 0.735   21.064 1.00 37.00  ? 42  PHE A H    1 
ATOM   411  N N    . SER A 1 43  ? 43.618 -1.763  20.486 1.00 35.38  ? 43  SER A N    1 
ATOM   412  C CA   . SER A 1 43  ? 44.972 -1.854  20.978 1.00 30.09  ? 43  SER A CA   1 
ATOM   413  C C    . SER A 1 43  ? 45.782 -1.677  19.709 1.00 25.77  ? 43  SER A C    1 
ATOM   414  O O    . SER A 1 43  ? 45.988 -2.623  18.944 1.00 28.80  ? 43  SER A O    1 
ATOM   415  C CB   . SER A 1 43  ? 45.226 -3.221  21.605 1.00 40.69  ? 43  SER A CB   1 
ATOM   416  O OG   . SER A 1 43  ? 46.485 -3.245  22.244 1.00 49.65  ? 43  SER A OG   1 
ATOM   417  H H    . SER A 1 43  ? 43.353 -2.334  19.744 1.00 37.00  ? 43  SER A H    1 
ATOM   418  H HG   . SER A 1 43  ? 46.526 -2.509  22.860 1.00 37.00  ? 43  SER A HG   1 
ATOM   419  N N    . MET A 1 44  ? 46.113 -0.424  19.425 1.00 23.31  ? 44  MET A N    1 
ATOM   420  C CA   . MET A 1 44  ? 46.888 -0.101  18.242 1.00 22.86  ? 44  MET A CA   1 
ATOM   421  C C    . MET A 1 44  ? 48.363 -0.286  18.518 1.00 30.75  ? 44  MET A C    1 
ATOM   422  O O    . MET A 1 44  ? 48.976 0.473   19.274 1.00 29.75  ? 44  MET A O    1 
ATOM   423  C CB   . MET A 1 44  ? 46.658 1.329   17.788 1.00 15.62  ? 44  MET A CB   1 
ATOM   424  C CG   . MET A 1 44  ? 47.287 1.567   16.448 1.00 17.69  ? 44  MET A CG   1 
ATOM   425  S SD   . MET A 1 44  ? 47.148 3.233   15.943 1.00 27.06  ? 44  MET A SD   1 
ATOM   426  C CE   . MET A 1 44  ? 47.768 4.056   17.341 1.00 6.19   ? 44  MET A CE   1 
ATOM   427  H H    . MET A 1 44  ? 45.825 0.291   20.026 1.00 37.00  ? 44  MET A H    1 
ATOM   428  N N    . SER A 1 45  ? 48.921 -1.312  17.897 1.00 29.55  ? 45  SER A N    1 
ATOM   429  C CA   . SER A 1 45  ? 50.321 -1.629  18.050 1.00 21.11  ? 45  SER A CA   1 
ATOM   430  C C    . SER A 1 45  ? 51.080 -1.050  16.860 1.00 25.99  ? 45  SER A C    1 
ATOM   431  O O    . SER A 1 45  ? 50.567 -1.000  15.743 1.00 26.56  ? 45  SER A O    1 
ATOM   432  C CB   . SER A 1 45  ? 50.527 -3.153  18.089 1.00 22.39  ? 45  SER A CB   1 
ATOM   433  O OG   . SER A 1 45  ? 49.722 -3.781  19.071 1.00 32.50  ? 45  SER A OG   1 
ATOM   434  H H    . SER A 1 45  ? 48.379 -1.880  17.313 1.00 37.00  ? 45  SER A H    1 
ATOM   435  H HG   . SER A 1 45  ? 49.915 -4.723  19.046 1.00 37.00  ? 45  SER A HG   1 
ATOM   436  N N    . PHE A 1 46  ? 52.281 -0.553  17.129 1.00 29.18  ? 46  PHE A N    1 
ATOM   437  C CA   . PHE A 1 46  ? 53.141 -0.018  16.092 1.00 26.14  ? 46  PHE A CA   1 
ATOM   438  C C    . PHE A 1 46  ? 53.984 -1.213  15.655 1.00 31.19  ? 46  PHE A C    1 
ATOM   439  O O    . PHE A 1 46  ? 54.883 -1.671  16.374 1.00 31.75  ? 46  PHE A O    1 
ATOM   440  C CB   . PHE A 1 46  ? 53.996 1.112   16.653 1.00 22.51  ? 46  PHE A CB   1 
ATOM   441  C CG   . PHE A 1 46  ? 53.193 2.288   17.118 1.00 15.70  ? 46  PHE A CG   1 
ATOM   442  C CD1  . PHE A 1 46  ? 52.857 3.303   16.236 1.00 23.00  ? 46  PHE A CD1  1 
ATOM   443  C CD2  . PHE A 1 46  ? 52.728 2.354   18.429 1.00 16.72  ? 46  PHE A CD2  1 
ATOM   444  C CE1  . PHE A 1 46  ? 52.054 4.383   16.652 1.00 27.00  ? 46  PHE A CE1  1 
ATOM   445  C CE2  . PHE A 1 46  ? 51.928 3.418   18.861 1.00 19.04  ? 46  PHE A CE2  1 
ATOM   446  C CZ   . PHE A 1 46  ? 51.588 4.437   17.969 1.00 21.64  ? 46  PHE A CZ   1 
ATOM   447  H H    . PHE A 1 46  ? 52.595 -0.543  18.050 1.00 37.00  ? 46  PHE A H    1 
ATOM   448  N N    . VAL A 1 47  ? 53.544 -1.825  14.564 1.00 26.43  ? 47  VAL A N    1 
ATOM   449  C CA   . VAL A 1 47  ? 54.221 -2.976  14.022 1.00 28.68  ? 47  VAL A CA   1 
ATOM   450  C C    . VAL A 1 47  ? 55.217 -2.476  12.996 1.00 37.32  ? 47  VAL A C    1 
ATOM   451  O O    . VAL A 1 47  ? 55.083 -1.358  12.505 1.00 37.88  ? 47  VAL A O    1 
ATOM   452  C CB   . VAL A 1 47  ? 53.223 -3.955  13.370 1.00 15.29  ? 47  VAL A CB   1 
ATOM   453  C CG1  . VAL A 1 47  ? 52.172 -4.331  14.355 1.00 18.35  ? 47  VAL A CG1  1 
ATOM   454  C CG2  . VAL A 1 47  ? 52.620 -3.379  12.133 1.00 19.14  ? 47  VAL A CG2  1 
ATOM   455  H H    . VAL A 1 47  ? 52.738 -1.487  14.119 1.00 37.00  ? 47  VAL A H    1 
ATOM   456  N N    . GLN A 1 48  ? 56.239 -3.274  12.699 1.00 40.53  ? 48  GLN A N    1 
ATOM   457  C CA   . GLN A 1 48  ? 57.216 -2.838  11.719 1.00 47.53  ? 48  GLN A CA   1 
ATOM   458  C C    . GLN A 1 48  ? 56.849 -3.319  10.305 1.00 41.41  ? 48  GLN A C    1 
ATOM   459  O O    . GLN A 1 48  ? 56.409 -4.446  10.099 1.00 51.35  ? 48  GLN A O    1 
ATOM   460  C CB   . GLN A 1 48  ? 58.654 -3.222  12.141 1.00 57.02  ? 48  GLN A CB   1 
ATOM   461  C CG   . GLN A 1 48  ? 59.122 -2.775  13.607 1.00 56.94  ? 48  GLN A CG   1 
ATOM   462  C CD   . GLN A 1 48  ? 59.418 -1.250  13.850 1.00 46.45  ? 48  GLN A CD   1 
ATOM   463  O OE1  . GLN A 1 48  ? 59.517 -0.437  12.926 1.00 32.90  ? 48  GLN A OE1  1 
ATOM   464  N NE2  . GLN A 1 48  ? 59.550 -0.890  15.119 1.00 23.01  ? 48  GLN A NE2  1 
ATOM   465  H H    . GLN A 1 48  ? 56.346 -4.124  13.139 1.00 37.00  ? 48  GLN A H    1 
ATOM   466  H HE21 . GLN A 1 48  ? 59.752 0.048   15.318 1.00 37.00  ? 48  GLN A HE21 1 
ATOM   467  H HE22 . GLN A 1 48  ? 59.448 -1.588  15.799 1.00 37.00  ? 48  GLN A HE22 1 
ATOM   468  N N    . GLY A 1 49  ? 56.898 -2.383  9.370  1.00 33.57  ? 49  GLY A N    1 
ATOM   469  C CA   . GLY A 1 49  ? 56.587 -2.649  7.984  1.00 28.62  ? 49  GLY A CA   1 
ATOM   470  C C    . GLY A 1 49  ? 57.331 -1.603  7.171  1.00 37.75  ? 49  GLY A C    1 
ATOM   471  O O    . GLY A 1 49  ? 58.454 -1.250  7.511  1.00 43.78  ? 49  GLY A O    1 
ATOM   472  H H    . GLY A 1 49  ? 57.132 -1.470  9.640  1.00 37.00  ? 49  GLY A H    1 
ATOM   473  N N    . GLU A 1 50  ? 56.696 -1.040  6.152  1.00 42.35  ? 50  GLU A N    1 
ATOM   474  C CA   . GLU A 1 50  ? 57.375 -0.053  5.318  1.00 57.74  ? 50  GLU A CA   1 
ATOM   475  C C    . GLU A 1 50  ? 57.238 1.354   5.866  1.00 53.53  ? 50  GLU A C    1 
ATOM   476  O O    . GLU A 1 50  ? 56.390 2.113   5.418  1.00 52.57  ? 50  GLU A O    1 
ATOM   477  C CB   . GLU A 1 50  ? 56.862 -0.094  3.863  1.00 73.47  ? 50  GLU A CB   1 
ATOM   478  C CG   . GLU A 1 50  ? 56.860 -1.483  3.170  1.00 90.89  ? 50  GLU A CG   1 
ATOM   479  C CD   . GLU A 1 50  ? 58.241 -1.984  2.752  1.00 90.48  ? 50  GLU A CD   1 
ATOM   480  O OE1  . GLU A 1 50  ? 58.718 -1.578  1.667  1.00 95.46  ? 50  GLU A OE1  1 
ATOM   481  O OE2  . GLU A 1 50  ? 58.825 -2.812  3.491  1.00 92.58  ? 50  GLU A OE2  1 
ATOM   482  H H    . GLU A 1 50  ? 55.767 -1.283  5.956  1.00 37.00  ? 50  GLU A H    1 
ATOM   483  N N    . GLU A 1 51  ? 58.099 1.710   6.810  1.00 56.61  ? 51  GLU A N    1 
ATOM   484  C CA   . GLU A 1 51  ? 58.064 3.039   7.404  1.00 69.90  ? 51  GLU A CA   1 
ATOM   485  C C    . GLU A 1 51  ? 58.489 4.138   6.425  1.00 74.65  ? 51  GLU A C    1 
ATOM   486  O O    . GLU A 1 51  ? 59.673 4.445   6.237  1.00 69.22  ? 51  GLU A O    1 
ATOM   487  C CB   . GLU A 1 51  ? 58.841 3.051   8.726  1.00 79.61  ? 51  GLU A CB   1 
ATOM   488  C CG   . GLU A 1 51  ? 57.932 2.607   9.890  1.00 77.24  ? 51  GLU A CG   1 
ATOM   489  C CD   . GLU A 1 51  ? 58.565 1.635   10.885 1.00 73.21  ? 51  GLU A CD   1 
ATOM   490  O OE1  . GLU A 1 51  ? 59.007 0.529   10.480 1.00 50.44  ? 51  GLU A OE1  1 
ATOM   491  O OE2  . GLU A 1 51  ? 58.565 1.973   12.087 1.00 51.20  ? 51  GLU A OE2  1 
ATOM   492  H H    . GLU A 1 51  ? 58.770 1.064   7.117  1.00 37.00  ? 51  GLU A H    1 
ATOM   493  N N    . SER A 1 52  ? 57.463 4.693   5.782  1.00 79.92  ? 52  SER A N    1 
ATOM   494  C CA   . SER A 1 52  ? 57.583 5.730   4.766  1.00 69.88  ? 52  SER A CA   1 
ATOM   495  C C    . SER A 1 52  ? 57.556 7.145   5.319  1.00 59.34  ? 52  SER A C    1 
ATOM   496  O O    . SER A 1 52  ? 57.515 8.096   4.547  1.00 57.21  ? 52  SER A O    1 
ATOM   497  C CB   . SER A 1 52  ? 56.460 5.550   3.732  1.00 72.69  ? 52  SER A CB   1 
ATOM   498  O OG   . SER A 1 52  ? 56.594 6.430   2.630  1.00 87.90  ? 52  SER A OG   1 
ATOM   499  H H    . SER A 1 52  ? 56.562 4.375   6.003  1.00 37.00  ? 52  SER A H    1 
ATOM   500  H HG   . SER A 1 52  ? 56.494 7.340   2.918  1.00 37.00  ? 52  SER A HG   1 
ATOM   501  N N    . ASN A 1 53  ? 57.558 7.285   6.641  1.00 50.55  ? 53  ASN A N    1 
ATOM   502  C CA   . ASN A 1 53  ? 57.547 8.605   7.268  1.00 74.78  ? 53  ASN A CA   1 
ATOM   503  C C    . ASN A 1 53  ? 56.151 9.267   7.258  1.00 82.36  ? 53  ASN A C    1 
ATOM   504  O O    . ASN A 1 53  ? 55.654 9.700   8.310  1.00 82.67  ? 53  ASN A O    1 
ATOM   505  C CB   . ASN A 1 53  ? 58.620 9.496   6.611  1.00 83.68  ? 53  ASN A CB   1 
ATOM   506  C CG   . ASN A 1 53  ? 58.585 10.933  7.095  1.00 97.06  ? 53  ASN A CG   1 
ATOM   507  O OD1  . ASN A 1 53  ? 58.601 11.863  6.285  1.00 97.75  ? 53  ASN A OD1  1 
ATOM   508  N ND2  . ASN A 1 53  ? 58.550 11.125  8.416  1.00 100.00 ? 53  ASN A ND2  1 
ATOM   509  H H    . ASN A 1 53  ? 57.561 6.490   7.213  1.00 37.00  ? 53  ASN A H    1 
ATOM   510  H HD21 . ASN A 1 53  ? 58.526 12.050  8.739  1.00 37.00  ? 53  ASN A HD21 1 
ATOM   511  H HD22 . ASN A 1 53  ? 58.546 10.347  9.012  1.00 37.00  ? 53  ASN A HD22 1 
ATOM   512  N N    . ASP A 1 54  ? 55.537 9.363   6.074  1.00 81.60  ? 54  ASP A N    1 
ATOM   513  C CA   . ASP A 1 54  ? 54.192 9.930   5.929  1.00 73.15  ? 54  ASP A CA   1 
ATOM   514  C C    . ASP A 1 54  ? 53.131 8.840   6.187  1.00 68.57  ? 54  ASP A C    1 
ATOM   515  O O    . ASP A 1 54  ? 51.932 9.057   6.009  1.00 69.20  ? 54  ASP A O    1 
ATOM   516  C CB   . ASP A 1 54  ? 54.004 10.559  4.539  1.00 79.05  ? 54  ASP A CB   1 
ATOM   517  C CG   . ASP A 1 54  ? 54.164 9.553   3.402  1.00 92.39  ? 54  ASP A CG   1 
ATOM   518  O OD1  . ASP A 1 54  ? 53.180 8.852   3.077  1.00 95.43  ? 54  ASP A OD1  1 
ATOM   519  O OD2  . ASP A 1 54  ? 55.271 9.474   2.819  1.00 97.53  ? 54  ASP A OD2  1 
ATOM   520  H H    . ASP A 1 54  ? 55.987 9.060   5.266  1.00 37.00  ? 54  ASP A H    1 
ATOM   521  N N    . LYS A 1 55  ? 53.602 7.660   6.583  1.00 56.25  ? 55  LYS A N    1 
ATOM   522  C CA   . LYS A 1 55  ? 52.757 6.520   6.907  1.00 44.51  ? 55  LYS A CA   1 
ATOM   523  C C    . LYS A 1 55  ? 53.419 5.870   8.113  1.00 45.54  ? 55  LYS A C    1 
ATOM   524  O O    . LYS A 1 55  ? 54.636 5.971   8.294  1.00 49.49  ? 55  LYS A O    1 
ATOM   525  C CB   . LYS A 1 55  ? 52.741 5.475   5.783  1.00 38.96  ? 55  LYS A CB   1 
ATOM   526  C CG   . LYS A 1 55  ? 52.333 5.942   4.409  1.00 33.35  ? 55  LYS A CG   1 
ATOM   527  C CD   . LYS A 1 55  ? 52.295 4.751   3.465  1.00 46.98  ? 55  LYS A CD   1 
ATOM   528  C CE   . LYS A 1 55  ? 52.277 5.176   2.003  1.00 61.32  ? 55  LYS A CE   1 
ATOM   529  N NZ   . LYS A 1 55  ? 53.567 5.836   1.611  1.00 70.05  ? 55  LYS A NZ   1 
ATOM   530  H H    . LYS A 1 55  ? 54.570 7.530   6.647  1.00 37.00  ? 55  LYS A H    1 
ATOM   531  H HZ1  . LYS A 1 55  ? 53.716 6.678   2.203  1.00 37.00  ? 55  LYS A HZ1  1 
ATOM   532  H HZ2  . LYS A 1 55  ? 54.357 5.176   1.749  1.00 37.00  ? 55  LYS A HZ2  1 
ATOM   533  H HZ3  . LYS A 1 55  ? 53.520 6.120   0.611  1.00 37.00  ? 55  LYS A HZ3  1 
ATOM   534  N N    . ILE A 1 56  ? 52.618 5.212   8.938  1.00 37.08  ? 56  ILE A N    1 
ATOM   535  C CA   . ILE A 1 56  ? 53.123 4.522   10.106 1.00 30.01  ? 56  ILE A CA   1 
ATOM   536  C C    . ILE A 1 56  ? 52.329 3.218   10.228 1.00 39.94  ? 56  ILE A C    1 
ATOM   537  O O    . ILE A 1 56  ? 51.133 3.229   10.529 1.00 39.91  ? 56  ILE A O    1 
ATOM   538  C CB   . ILE A 1 56  ? 52.960 5.369   11.380 1.00 25.26  ? 56  ILE A CB   1 
ATOM   539  C CG1  . ILE A 1 56  ? 53.827 6.633   11.300 1.00 25.09  ? 56  ILE A CG1  1 
ATOM   540  C CG2  . ILE A 1 56  ? 53.313 4.547   12.615 1.00 29.22  ? 56  ILE A CG2  1 
ATOM   541  C CD1  . ILE A 1 56  ? 53.901 7.453   12.627 1.00 15.96  ? 56  ILE A CD1  1 
ATOM   542  H H    . ILE A 1 56  ? 51.655 5.194   8.753  1.00 37.00  ? 56  ILE A H    1 
ATOM   543  N N    . PRO A 1 57  ? 52.978 2.071   9.948  1.00 36.73  ? 57  PRO A N    1 
ATOM   544  C CA   . PRO A 1 57  ? 52.317 0.767   10.030 1.00 25.17  ? 57  PRO A CA   1 
ATOM   545  C C    . PRO A 1 57  ? 51.769 0.448   11.410 1.00 24.24  ? 57  PRO A C    1 
ATOM   546  O O    . PRO A 1 57  ? 52.418 0.694   12.423 1.00 32.06  ? 57  PRO A O    1 
ATOM   547  C CB   . PRO A 1 57  ? 53.431 -0.196  9.628  1.00 20.12  ? 57  PRO A CB   1 
ATOM   548  C CG   . PRO A 1 57  ? 54.673 0.528   10.028 1.00 22.06  ? 57  PRO A CG   1 
ATOM   549  C CD   . PRO A 1 57  ? 54.385 1.907   9.546  1.00 27.92  ? 57  PRO A CD   1 
ATOM   550  N N    . VAL A 1 58  ? 50.567 -0.109  11.455 1.00 28.31  ? 58  VAL A N    1 
ATOM   551  C CA   . VAL A 1 58  ? 49.957 -0.462  12.728 1.00 22.67  ? 58  VAL A CA   1 
ATOM   552  C C    . VAL A 1 58  ? 49.181 -1.776  12.639 1.00 25.71  ? 58  VAL A C    1 
ATOM   553  O O    . VAL A 1 58  ? 48.992 -2.341  11.556 1.00 23.34  ? 58  VAL A O    1 
ATOM   554  C CB   . VAL A 1 58  ? 48.988 0.670   13.269 1.00 26.56  ? 58  VAL A CB   1 
ATOM   555  C CG1  . VAL A 1 58  ? 49.729 2.022   13.422 1.00 13.95  ? 58  VAL A CG1  1 
ATOM   556  C CG2  . VAL A 1 58  ? 47.754 0.807   12.366 1.00 11.33  ? 58  VAL A CG2  1 
ATOM   557  H H    . VAL A 1 58  ? 50.102 -0.335  10.635 1.00 37.00  ? 58  VAL A H    1 
ATOM   558  N N    . ALA A 1 59  ? 48.816 -2.283  13.813 1.00 25.58  ? 59  ALA A N    1 
ATOM   559  C CA   . ALA A 1 59  ? 48.016 -3.481  13.954 1.00 28.41  ? 59  ALA A CA   1 
ATOM   560  C C    . ALA A 1 59  ? 46.832 -3.013  14.810 1.00 37.66  ? 59  ALA A C    1 
ATOM   561  O O    . ALA A 1 59  ? 47.015 -2.318  15.826 1.00 31.61  ? 59  ALA A O    1 
ATOM   562  C CB   . ALA A 1 59  ? 48.781 -4.580  14.673 1.00 28.18  ? 59  ALA A CB   1 
ATOM   563  H H    . ALA A 1 59  ? 49.103 -1.827  14.628 1.00 37.00  ? 59  ALA A H    1 
ATOM   564  N N    . LEU A 1 60  ? 45.620 -3.342  14.362 1.00 40.32  ? 60  LEU A N    1 
ATOM   565  C CA   . LEU A 1 60  ? 44.420 -2.952  15.085 1.00 28.45  ? 60  LEU A CA   1 
ATOM   566  C C    . LEU A 1 60  ? 43.688 -4.166  15.644 1.00 25.15  ? 60  LEU A C    1 
ATOM   567  O O    . LEU A 1 60  ? 43.138 -4.992  14.906 1.00 17.35  ? 60  LEU A O    1 
ATOM   568  C CB   . LEU A 1 60  ? 43.508 -2.086  14.207 1.00 24.26  ? 60  LEU A CB   1 
ATOM   569  C CG   . LEU A 1 60  ? 44.084 -0.685  13.982 1.00 20.71  ? 60  LEU A CG   1 
ATOM   570  C CD1  . LEU A 1 60  ? 43.394 0.031   12.834 1.00 18.44  ? 60  LEU A CD1  1 
ATOM   571  C CD2  . LEU A 1 60  ? 43.997 0.092   15.280 1.00 5.56   ? 60  LEU A CD2  1 
ATOM   572  H H    . LEU A 1 60  ? 45.536 -3.864  13.536 1.00 37.00  ? 60  LEU A H    1 
ATOM   573  N N    . GLY A 1 61  ? 43.733 -4.279  16.966 1.00 21.76  ? 61  GLY A N    1 
ATOM   574  C CA   . GLY A 1 61  ? 43.085 -5.379  17.631 1.00 30.14  ? 61  GLY A CA   1 
ATOM   575  C C    . GLY A 1 61  ? 42.171 -4.944  18.748 1.00 29.13  ? 61  GLY A C    1 
ATOM   576  O O    . GLY A 1 61  ? 42.399 -3.925  19.411 1.00 22.45  ? 61  GLY A O    1 
ATOM   577  H H    . GLY A 1 61  ? 44.194 -3.596  17.502 1.00 37.00  ? 61  GLY A H    1 
ATOM   578  N N    . LEU A 1 62  ? 41.106 -5.715  18.915 1.00 29.35  ? 62  LEU A N    1 
ATOM   579  C CA   . LEU A 1 62  ? 40.139 -5.469  19.959 1.00 34.70  ? 62  LEU A CA   1 
ATOM   580  C C    . LEU A 1 62  ? 40.842 -5.740  21.298 1.00 41.14  ? 62  LEU A C    1 
ATOM   581  O O    . LEU A 1 62  ? 41.393 -6.821  21.508 1.00 39.00  ? 62  LEU A O    1 
ATOM   582  C CB   . LEU A 1 62  ? 38.919 -6.373  19.743 1.00 38.02  ? 62  LEU A CB   1 
ATOM   583  C CG   . LEU A 1 62  ? 37.888 -5.938  18.686 1.00 24.73  ? 62  LEU A CG   1 
ATOM   584  C CD1  . LEU A 1 62  ? 37.497 -4.527  19.010 1.00 36.40  ? 62  LEU A CD1  1 
ATOM   585  C CD2  . LEU A 1 62  ? 38.394 -6.006  17.259 1.00 28.19  ? 62  LEU A CD2  1 
ATOM   586  H H    . LEU A 1 62  ? 40.978 -6.476  18.312 1.00 37.00  ? 62  LEU A H    1 
ATOM   587  N N    . LYS A 1 63  ? 40.854 -4.712  22.153 1.00 56.61  ? 63  LYS A N    1 
ATOM   588  C CA   . LYS A 1 63  ? 41.497 -4.685  23.483 1.00 68.01  ? 63  LYS A CA   1 
ATOM   589  C C    . LYS A 1 63  ? 41.924 -6.009  24.112 1.00 78.04  ? 63  LYS A C    1 
ATOM   590  O O    . LYS A 1 63  ? 43.032 -6.498  23.854 1.00 91.14  ? 63  LYS A O    1 
ATOM   591  C CB   . LYS A 1 63  ? 40.648 -3.880  24.486 1.00 62.58  ? 63  LYS A CB   1 
ATOM   592  C CG   . LYS A 1 63  ? 41.459 -3.134  25.570 1.00 58.86  ? 63  LYS A CG   1 
ATOM   593  C CD   . LYS A 1 63  ? 40.528 -2.478  26.599 1.00 65.08  ? 63  LYS A CD   1 
ATOM   594  C CE   . LYS A 1 63  ? 41.197 -1.359  27.405 1.00 65.56  ? 63  LYS A CE   1 
ATOM   595  N NZ   . LYS A 1 63  ? 42.350 -1.795  28.253 1.00 72.01  ? 63  LYS A NZ   1 
ATOM   596  H H    . LYS A 1 63  ? 40.388 -3.906  21.860 1.00 37.00  ? 63  LYS A H    1 
ATOM   597  H HZ1  . LYS A 1 63  ? 42.035 -2.536  28.911 1.00 37.00  ? 63  LYS A HZ1  1 
ATOM   598  H HZ2  . LYS A 1 63  ? 43.113 -2.162  27.650 1.00 37.00  ? 63  LYS A HZ2  1 
ATOM   599  H HZ3  . LYS A 1 63  ? 42.704 -0.981  28.796 1.00 37.00  ? 63  LYS A HZ3  1 
ATOM   600  N N    . GLU A 1 64  ? 41.084 -6.539  24.996 1.00 72.19  ? 64  GLU A N    1 
ATOM   601  C CA   . GLU A 1 64  ? 41.366 -7.806  25.659 1.00 70.75  ? 64  GLU A CA   1 
ATOM   602  C C    . GLU A 1 64  ? 40.276 -8.725  25.138 1.00 71.71  ? 64  GLU A C    1 
ATOM   603  O O    . GLU A 1 64  ? 39.488 -9.288  25.905 1.00 74.12  ? 64  GLU A O    1 
ATOM   604  C CB   . GLU A 1 64  ? 41.237 -7.662  27.179 1.00 74.80  ? 64  GLU A CB   1 
ATOM   605  C CG   . GLU A 1 64  ? 41.918 -6.444  27.778 1.00 63.84  ? 64  GLU A CG   1 
ATOM   606  C CD   . GLU A 1 64  ? 41.121 -5.849  28.933 1.00 70.67  ? 64  GLU A CD   1 
ATOM   607  O OE1  . GLU A 1 64  ? 39.869 -5.826  28.862 1.00 74.40  ? 64  GLU A OE1  1 
ATOM   608  O OE2  . GLU A 1 64  ? 41.743 -5.392  29.914 1.00 70.84  ? 64  GLU A OE2  1 
ATOM   609  H H    . GLU A 1 64  ? 40.238 -6.100  25.217 1.00 37.00  ? 64  GLU A H    1 
ATOM   610  N N    . LYS A 1 65  ? 40.191 -8.805  23.815 1.00 74.96  ? 65  LYS A N    1 
ATOM   611  C CA   . LYS A 1 65  ? 39.183 -9.622  23.154 1.00 71.95  ? 65  LYS A CA   1 
ATOM   612  C C    . LYS A 1 65  ? 39.843 -10.596 22.172 1.00 64.77  ? 65  LYS A C    1 
ATOM   613  O O    . LYS A 1 65  ? 39.167 -11.449 21.594 1.00 67.22  ? 65  LYS A O    1 
ATOM   614  C CB   . LYS A 1 65  ? 38.148 -8.707  22.469 1.00 78.27  ? 65  LYS A CB   1 
ATOM   615  C CG   . LYS A 1 65  ? 37.498 -7.693  23.450 1.00 86.23  ? 65  LYS A CG   1 
ATOM   616  C CD   . LYS A 1 65  ? 36.840 -6.481  22.761 1.00 94.24  ? 65  LYS A CD   1 
ATOM   617  C CE   . LYS A 1 65  ? 36.536 -5.339  23.764 1.00 95.51  ? 65  LYS A CE   1 
ATOM   618  N NZ   . LYS A 1 65  ? 35.940 -4.085  23.168 1.00 79.75  ? 65  LYS A NZ   1 
ATOM   619  H H    . LYS A 1 65  ? 40.826 -8.303  23.262 1.00 37.00  ? 65  LYS A H    1 
ATOM   620  H HZ1  . LYS A 1 65  ? 35.036 -4.315  22.707 1.00 37.00  ? 65  LYS A HZ1  1 
ATOM   621  H HZ2  . LYS A 1 65  ? 35.774 -3.390  23.924 1.00 37.00  ? 65  LYS A HZ2  1 
ATOM   622  H HZ3  . LYS A 1 65  ? 36.597 -3.682  22.469 1.00 37.00  ? 65  LYS A HZ3  1 
ATOM   623  N N    . ASN A 1 66  ? 41.173 -10.500 22.055 1.00 62.11  ? 66  ASN A N    1 
ATOM   624  C CA   . ASN A 1 66  ? 41.988 -11.358 21.179 1.00 62.15  ? 66  ASN A CA   1 
ATOM   625  C C    . ASN A 1 66  ? 41.433 -11.494 19.779 1.00 61.46  ? 66  ASN A C    1 
ATOM   626  O O    . ASN A 1 66  ? 41.119 -12.602 19.313 1.00 62.42  ? 66  ASN A O    1 
ATOM   627  C CB   . ASN A 1 66  ? 42.196 -12.745 21.795 1.00 59.94  ? 66  ASN A CB   1 
ATOM   628  C CG   . ASN A 1 66  ? 43.166 -12.721 22.954 1.00 65.81  ? 66  ASN A CG   1 
ATOM   629  O OD1  . ASN A 1 66  ? 44.325 -12.321 22.803 1.00 71.04  ? 66  ASN A OD1  1 
ATOM   630  N ND2  . ASN A 1 66  ? 42.695 -13.130 24.128 1.00 61.43  ? 66  ASN A ND2  1 
ATOM   631  H H    . ASN A 1 66  ? 41.636 -9.819  22.582 1.00 37.00  ? 66  ASN A H    1 
ATOM   632  H HD21 . ASN A 1 66  ? 43.300 -13.140 24.898 1.00 37.00  ? 66  ASN A HD21 1 
ATOM   633  H HD22 . ASN A 1 66  ? 41.756 -13.407 24.171 1.00 37.00  ? 66  ASN A HD22 1 
ATOM   634  N N    . LEU A 1 67  ? 41.265 -10.342 19.142 1.00 50.93  ? 67  LEU A N    1 
ATOM   635  C CA   . LEU A 1 67  ? 40.744 -10.270 17.788 1.00 41.49  ? 67  LEU A CA   1 
ATOM   636  C C    . LEU A 1 67  ? 41.565 -9.218  17.094 1.00 37.37  ? 67  LEU A C    1 
ATOM   637  O O    . LEU A 1 67  ? 41.888 -8.189  17.694 1.00 34.15  ? 67  LEU A O    1 
ATOM   638  C CB   . LEU A 1 67  ? 39.276 -9.843  17.790 1.00 46.42  ? 67  LEU A CB   1 
ATOM   639  C CG   . LEU A 1 67  ? 38.153 -10.864 17.955 1.00 39.79  ? 67  LEU A CG   1 
ATOM   640  C CD1  . LEU A 1 67  ? 36.816 -10.146 17.808 1.00 35.64  ? 67  LEU A CD1  1 
ATOM   641  C CD2  . LEU A 1 67  ? 38.287 -11.942 16.900 1.00 26.66  ? 67  LEU A CD2  1 
ATOM   642  H H    . LEU A 1 67  ? 41.498 -9.508  19.603 1.00 37.00  ? 67  LEU A H    1 
ATOM   643  N N    . TYR A 1 68  ? 41.891 -9.469  15.832 1.00 26.11  ? 68  TYR A N    1 
ATOM   644  C CA   . TYR A 1 68  ? 42.695 -8.540  15.070 1.00 28.89  ? 68  TYR A CA   1 
ATOM   645  C C    . TYR A 1 68  ? 42.091 -8.295  13.707 1.00 28.60  ? 68  TYR A C    1 
ATOM   646  O O    . TYR A 1 68  ? 41.656 -9.223  13.038 1.00 29.69  ? 68  TYR A O    1 
ATOM   647  C CB   . TYR A 1 68  ? 44.163 -9.044  14.971 1.00 37.30  ? 68  TYR A CB   1 
ATOM   648  C CG   . TYR A 1 68  ? 45.079 -8.484  16.065 1.00 26.34  ? 68  TYR A CG   1 
ATOM   649  C CD1  . TYR A 1 68  ? 45.694 -7.248  15.894 1.00 31.28  ? 68  TYR A CD1  1 
ATOM   650  C CD2  . TYR A 1 68  ? 45.196 -9.103  17.322 1.00 30.49  ? 68  TYR A CD2  1 
ATOM   651  C CE1  . TYR A 1 68  ? 46.386 -6.610  16.941 1.00 41.58  ? 68  TYR A CE1  1 
ATOM   652  C CE2  . TYR A 1 68  ? 45.895 -8.466  18.398 1.00 38.27  ? 68  TYR A CE2  1 
ATOM   653  C CZ   . TYR A 1 68  ? 46.481 -7.204  18.192 1.00 35.93  ? 68  TYR A CZ   1 
ATOM   654  O OH   . TYR A 1 68  ? 47.087 -6.469  19.213 1.00 29.68  ? 68  TYR A OH   1 
ATOM   655  H H    . TYR A 1 68  ? 41.570 -10.284 15.403 1.00 37.00  ? 68  TYR A H    1 
ATOM   656  H HH   . TYR A 1 68  ? 47.014 -6.949  20.042 1.00 37.00  ? 68  TYR A HH   1 
ATOM   657  N N    . LEU A 1 69  ? 41.977 -7.024  13.342 1.00 18.46  ? 69  LEU A N    1 
ATOM   658  C CA   . LEU A 1 69  ? 41.445 -6.675  12.045 1.00 29.12  ? 69  LEU A CA   1 
ATOM   659  C C    . LEU A 1 69  ? 42.486 -7.081  11.044 1.00 33.96  ? 69  LEU A C    1 
ATOM   660  O O    . LEU A 1 69  ? 43.647 -6.710  11.192 1.00 41.23  ? 69  LEU A O    1 
ATOM   661  C CB   . LEU A 1 69  ? 41.254 -5.171  11.923 1.00 37.47  ? 69  LEU A CB   1 
ATOM   662  C CG   . LEU A 1 69  ? 40.011 -4.494  12.491 1.00 32.18  ? 69  LEU A CG   1 
ATOM   663  C CD1  . LEU A 1 69  ? 39.665 -5.034  13.864 1.00 33.23  ? 69  LEU A CD1  1 
ATOM   664  C CD2  . LEU A 1 69  ? 40.298 -3.010  12.542 1.00 18.83  ? 69  LEU A CD2  1 
ATOM   665  H H    . LEU A 1 69  ? 42.251 -6.323  13.952 1.00 37.00  ? 69  LEU A H    1 
ATOM   666  N N    . SER A 1 70  ? 42.066 -7.853  10.045 1.00 38.05  ? 70  SER A N    1 
ATOM   667  C CA   . SER A 1 70  ? 42.948 -8.325  8.980  1.00 37.67  ? 70  SER A CA   1 
ATOM   668  C C    . SER A 1 70  ? 42.253 -8.148  7.648  1.00 37.93  ? 70  SER A C    1 
ATOM   669  O O    . SER A 1 70  ? 41.043 -7.937  7.605  1.00 45.78  ? 70  SER A O    1 
ATOM   670  C CB   . SER A 1 70  ? 43.335 -9.799  9.173  1.00 27.29  ? 70  SER A CB   1 
ATOM   671  O OG   . SER A 1 70  ? 42.206 -10.646 9.213  1.00 43.69  ? 70  SER A OG   1 
ATOM   672  H H    . SER A 1 70  ? 41.126 -8.115  10.014 1.00 37.00  ? 70  SER A H    1 
ATOM   673  H HG   . SER A 1 70  ? 41.671 -10.426 9.980  1.00 37.00  ? 70  SER A HG   1 
ATOM   674  N N    . CYS A 1 71  ? 43.035 -8.172  6.571  1.00 43.21  ? 71  CYS A N    1 
ATOM   675  C CA   . CYS A 1 71  ? 42.509 -8.029  5.218  1.00 34.24  ? 71  CYS A CA   1 
ATOM   676  C C    . CYS A 1 71  ? 42.879 -9.260  4.416  1.00 39.10  ? 71  CYS A C    1 
ATOM   677  O O    . CYS A 1 71  ? 44.042 -9.645  4.328  1.00 40.76  ? 71  CYS A O    1 
ATOM   678  C CB   . CYS A 1 71  ? 43.093 -6.808  4.536  1.00 24.36  ? 71  CYS A CB   1 
ATOM   679  S SG   . CYS A 1 71  ? 43.011 -5.336  5.545  1.00 38.62  ? 71  CYS A SG   1 
ATOM   680  H H    . CYS A 1 71  ? 43.998 -8.283  6.685  1.00 37.00  ? 71  CYS A H    1 
ATOM   681  N N    . VAL A 1 72  ? 41.873 -9.891  3.839  1.00 50.50  ? 72  VAL A N    1 
ATOM   682  C CA   . VAL A 1 72  ? 42.097 -11.082 3.043  1.00 43.93  ? 72  VAL A CA   1 
ATOM   683  C C    . VAL A 1 72  ? 41.343 -10.970 1.724  1.00 42.89  ? 72  VAL A C    1 
ATOM   684  O O    . VAL A 1 72  ? 40.530 -10.065 1.509  1.00 41.59  ? 72  VAL A O    1 
ATOM   685  C CB   . VAL A 1 72  ? 41.621 -12.348 3.798  1.00 44.15  ? 72  VAL A CB   1 
ATOM   686  C CG1  . VAL A 1 72  ? 42.243 -12.395 5.199  1.00 36.43  ? 72  VAL A CG1  1 
ATOM   687  C CG2  . VAL A 1 72  ? 40.083 -12.377 3.881  1.00 40.89  ? 72  VAL A CG2  1 
ATOM   688  H H    . VAL A 1 72  ? 40.958 -9.566  3.963  1.00 37.00  ? 72  VAL A H    1 
ATOM   689  N N    . LEU A 1 73  ? 41.668 -11.861 0.810  1.00 43.51  ? 73  LEU A N    1 
ATOM   690  C CA   . LEU A 1 73  ? 40.984 -11.858 -0.451 1.00 38.41  ? 73  LEU A CA   1 
ATOM   691  C C    . LEU A 1 73  ? 39.830 -12.816 -0.233 1.00 33.68  ? 73  LEU A C    1 
ATOM   692  O O    . LEU A 1 73  ? 40.023 -13.950 0.219  1.00 30.30  ? 73  LEU A O    1 
ATOM   693  C CB   . LEU A 1 73  ? 41.899 -12.363 -1.553 1.00 41.26  ? 73  LEU A CB   1 
ATOM   694  C CG   . LEU A 1 73  ? 41.510 -11.833 -2.923 1.00 40.66  ? 73  LEU A CG   1 
ATOM   695  C CD1  . LEU A 1 73  ? 41.961 -10.394 -3.048 1.00 41.11  ? 73  LEU A CD1  1 
ATOM   696  C CD2  . LEU A 1 73  ? 42.150 -12.682 -3.999 1.00 58.40  ? 73  LEU A CD2  1 
ATOM   697  H H    . LEU A 1 73  ? 42.372 -12.519 0.986  1.00 37.00  ? 73  LEU A H    1 
ATOM   698  N N    . LYS A 1 74  ? 38.626 -12.302 -0.432 1.00 39.80  ? 74  LYS A N    1 
ATOM   699  C CA   . LYS A 1 74  ? 37.408 -13.086 -0.291 1.00 42.12  ? 74  LYS A CA   1 
ATOM   700  C C    . LYS A 1 74  ? 36.674 -12.831 -1.596 1.00 37.28  ? 74  LYS A C    1 
ATOM   701  O O    . LYS A 1 74  ? 36.234 -11.712 -1.875 1.00 25.65  ? 74  LYS A O    1 
ATOM   702  C CB   . LYS A 1 74  ? 36.592 -12.600 0.918  1.00 53.08  ? 74  LYS A CB   1 
ATOM   703  C CG   . LYS A 1 74  ? 35.878 -13.707 1.713  1.00 71.91  ? 74  LYS A CG   1 
ATOM   704  C CD   . LYS A 1 74  ? 34.532 -14.155 1.095  1.00 83.56  ? 74  LYS A CD   1 
ATOM   705  C CE   . LYS A 1 74  ? 33.386 -13.157 1.358  1.00 81.23  ? 74  LYS A CE   1 
ATOM   706  N NZ   . LYS A 1 74  ? 32.082 -13.573 0.753  1.00 68.77  ? 74  LYS A NZ   1 
ATOM   707  H H    . LYS A 1 74  ? 38.553 -11.358 -0.676 1.00 37.00  ? 74  LYS A H    1 
ATOM   708  H HZ1  . LYS A 1 74  ? 31.818 -14.506 1.128  1.00 37.00  ? 74  LYS A HZ1  1 
ATOM   709  H HZ2  . LYS A 1 74  ? 31.350 -12.876 0.997  1.00 37.00  ? 74  LYS A HZ2  1 
ATOM   710  H HZ3  . LYS A 1 74  ? 32.185 -13.630 -0.281 1.00 37.00  ? 74  LYS A HZ3  1 
ATOM   711  N N    . ASP A 1 75  ? 36.644 -13.853 -2.442 1.00 46.40  ? 75  ASP A N    1 
ATOM   712  C CA   . ASP A 1 75  ? 35.985 -13.741 -3.737 1.00 47.97  ? 75  ASP A CA   1 
ATOM   713  C C    . ASP A 1 75  ? 36.722 -12.842 -4.708 1.00 45.22  ? 75  ASP A C    1 
ATOM   714  O O    . ASP A 1 75  ? 36.101 -12.149 -5.515 1.00 36.41  ? 75  ASP A O    1 
ATOM   715  C CB   . ASP A 1 75  ? 34.553 -13.246 -3.574 1.00 47.80  ? 75  ASP A CB   1 
ATOM   716  C CG   . ASP A 1 75  ? 33.571 -14.378 -3.486 1.00 55.95  ? 75  ASP A CG   1 
ATOM   717  O OD1  . ASP A 1 75  ? 33.452 -15.002 -2.401 1.00 47.62  ? 75  ASP A OD1  1 
ATOM   718  O OD2  . ASP A 1 75  ? 32.942 -14.658 -4.527 1.00 62.54  ? 75  ASP A OD2  1 
ATOM   719  H H    . ASP A 1 75  ? 37.060 -14.703 -2.191 1.00 37.00  ? 75  ASP A H    1 
ATOM   720  N N    . ASP A 1 76  ? 38.052 -12.869 -4.630 1.00 41.36  ? 76  ASP A N    1 
ATOM   721  C CA   . ASP A 1 76  ? 38.895 -12.072 -5.517 1.00 39.71  ? 76  ASP A CA   1 
ATOM   722  C C    . ASP A 1 76  ? 38.762 -10.562 -5.257 1.00 33.22  ? 76  ASP A C    1 
ATOM   723  O O    . ASP A 1 76  ? 39.179 -9.739  -6.067 1.00 31.94  ? 76  ASP A O    1 
ATOM   724  C CB   . ASP A 1 76  ? 38.581 -12.412 -6.993 1.00 46.94  ? 76  ASP A CB   1 
ATOM   725  C CG   . ASP A 1 76  ? 38.914 -13.876 -7.366 1.00 53.46  ? 76  ASP A CG   1 
ATOM   726  O OD1  . ASP A 1 76  ? 39.581 -14.570 -6.565 1.00 48.77  ? 76  ASP A OD1  1 
ATOM   727  O OD2  . ASP A 1 76  ? 38.507 -14.326 -8.465 1.00 49.53  ? 76  ASP A OD2  1 
ATOM   728  H H    . ASP A 1 76  ? 38.475 -13.454 -3.968 1.00 37.00  ? 76  ASP A H    1 
ATOM   729  N N    . LYS A 1 77  ? 38.238 -10.216 -4.087 1.00 32.98  ? 77  LYS A N    1 
ATOM   730  C CA   . LYS A 1 77  ? 38.025 -8.825  -3.697 1.00 28.91  ? 77  LYS A CA   1 
ATOM   731  C C    . LYS A 1 77  ? 38.612 -8.599  -2.317 1.00 26.25  ? 77  LYS A C    1 
ATOM   732  O O    . LYS A 1 77  ? 38.404 -9.405  -1.414 1.00 28.39  ? 77  LYS A O    1 
ATOM   733  C CB   . LYS A 1 77  ? 36.521 -8.533  -3.642 1.00 47.03  ? 77  LYS A CB   1 
ATOM   734  C CG   . LYS A 1 77  ? 35.960 -7.728  -4.802 1.00 57.58  ? 77  LYS A CG   1 
ATOM   735  C CD   . LYS A 1 77  ? 36.038 -6.212  -4.561 1.00 66.58  ? 77  LYS A CD   1 
ATOM   736  C CE   . LYS A 1 77  ? 35.020 -5.736  -3.515 1.00 59.24  ? 77  LYS A CE   1 
ATOM   737  N NZ   . LYS A 1 77  ? 35.379 -6.138  -2.125 1.00 61.53  ? 77  LYS A NZ   1 
ATOM   738  H H    . LYS A 1 77  ? 37.987 -10.920 -3.455 1.00 37.00  ? 77  LYS A H    1 
ATOM   739  H HZ1  . LYS A 1 77  ? 36.300 -5.732  -1.865 1.00 37.00  ? 77  LYS A HZ1  1 
ATOM   740  H HZ2  . LYS A 1 77  ? 34.649 -5.769  -1.483 1.00 37.00  ? 77  LYS A HZ2  1 
ATOM   741  H HZ3  . LYS A 1 77  ? 35.414 -7.173  -2.032 1.00 37.00  ? 77  LYS A HZ3  1 
ATOM   742  N N    . PRO A 1 78  ? 39.375 -7.510  -2.139 1.00 33.70  ? 78  PRO A N    1 
ATOM   743  C CA   . PRO A 1 78  ? 39.959 -7.252  -0.815 1.00 35.30  ? 78  PRO A CA   1 
ATOM   744  C C    . PRO A 1 78  ? 38.833 -6.992  0.171  1.00 40.16  ? 78  PRO A C    1 
ATOM   745  O O    . PRO A 1 78  ? 37.915 -6.201  -0.102 1.00 40.33  ? 78  PRO A O    1 
ATOM   746  C CB   . PRO A 1 78  ? 40.824 -6.010  -1.050 1.00 34.70  ? 78  PRO A CB   1 
ATOM   747  C CG   . PRO A 1 78  ? 41.190 -6.119  -2.525 1.00 35.34  ? 78  PRO A CG   1 
ATOM   748  C CD   . PRO A 1 78  ? 39.881 -6.557  -3.144 1.00 35.45  ? 78  PRO A CD   1 
ATOM   749  N N    . THR A 1 79  ? 38.872 -7.704  1.292  1.00 39.26  ? 79  THR A N    1 
ATOM   750  C CA   . THR A 1 79  ? 37.835 -7.565  2.303  1.00 44.52  ? 79  THR A CA   1 
ATOM   751  C C    . THR A 1 79  ? 38.359 -7.574  3.742  1.00 43.66  ? 79  THR A C    1 
ATOM   752  O O    . THR A 1 79  ? 39.359 -8.243  4.049  1.00 35.64  ? 79  THR A O    1 
ATOM   753  C CB   . THR A 1 79  ? 36.744 -8.674  2.154  1.00 48.49  ? 79  THR A CB   1 
ATOM   754  O OG1  . THR A 1 79  ? 37.305 -9.966  2.436  1.00 56.51  ? 79  THR A OG1  1 
ATOM   755  C CG2  . THR A 1 79  ? 36.161 -8.675  0.746  1.00 43.87  ? 79  THR A CG2  1 
ATOM   756  H H    . THR A 1 79  ? 39.617 -8.316  1.447  1.00 37.00  ? 79  THR A H    1 
ATOM   757  H HG1  . THR A 1 79  ? 37.634 -9.993  3.338  1.00 37.00  ? 79  THR A HG1  1 
ATOM   758  N N    . LEU A 1 80  ? 37.674 -6.812  4.605  1.00 39.99  ? 80  LEU A N    1 
ATOM   759  C CA   . LEU A 1 80  ? 38.006 -6.719  6.024  1.00 28.70  ? 80  LEU A CA   1 
ATOM   760  C C    . LEU A 1 80  ? 37.336 -7.859  6.769  1.00 27.25  ? 80  LEU A C    1 
ATOM   761  O O    . LEU A 1 80  ? 36.259 -8.305  6.398  1.00 33.28  ? 80  LEU A O    1 
ATOM   762  C CB   . LEU A 1 80  ? 37.546 -5.375  6.628  1.00 25.17  ? 80  LEU A CB   1 
ATOM   763  C CG   . LEU A 1 80  ? 37.902 -5.126  8.118  1.00 18.42  ? 80  LEU A CG   1 
ATOM   764  C CD1  . LEU A 1 80  ? 39.400 -5.170  8.276  1.00 18.18  ? 80  LEU A CD1  1 
ATOM   765  C CD2  . LEU A 1 80  ? 37.398 -3.776  8.639  1.00 7.96   ? 80  LEU A CD2  1 
ATOM   766  H H    . LEU A 1 80  ? 36.918 -6.293  4.264  1.00 37.00  ? 80  LEU A H    1 
ATOM   767  N N    . GLN A 1 81  ? 38.002 -8.352  7.801  1.00 33.33  ? 81  GLN A N    1 
ATOM   768  C CA   . GLN A 1 81  ? 37.454 -9.410  8.625  1.00 30.59  ? 81  GLN A CA   1 
ATOM   769  C C    . GLN A 1 81  ? 38.161 -9.397  9.983  1.00 34.08  ? 81  GLN A C    1 
ATOM   770  O O    . GLN A 1 81  ? 39.251 -8.822  10.126 1.00 36.89  ? 81  GLN A O    1 
ATOM   771  C CB   . GLN A 1 81  ? 37.576 -10.780 7.937  1.00 33.99  ? 81  GLN A CB   1 
ATOM   772  C CG   . GLN A 1 81  ? 38.872 -11.529 8.183  1.00 47.14  ? 81  GLN A CG   1 
ATOM   773  C CD   . GLN A 1 81  ? 38.841 -12.953 7.646  1.00 52.39  ? 81  GLN A CD   1 
ATOM   774  O OE1  . GLN A 1 81  ? 38.644 -13.176 6.451  1.00 54.67  ? 81  GLN A OE1  1 
ATOM   775  N NE2  . GLN A 1 81  ? 39.033 -13.923 8.534  1.00 54.91  ? 81  GLN A NE2  1 
ATOM   776  H H    . GLN A 1 81  ? 38.895 -8.004  8.002  1.00 37.00  ? 81  GLN A H    1 
ATOM   777  H HE21 . GLN A 1 81  ? 39.022 -14.851 8.215  1.00 37.00  ? 81  GLN A HE21 1 
ATOM   778  H HE22 . GLN A 1 81  ? 39.178 -13.667 9.468  1.00 37.00  ? 81  GLN A HE22 1 
ATOM   779  N N    . LEU A 1 82  ? 37.473 -9.916  10.997 1.00 24.27  ? 82  LEU A N    1 
ATOM   780  C CA   . LEU A 1 82  ? 38.027 -9.997  12.332 1.00 12.92  ? 82  LEU A CA   1 
ATOM   781  C C    . LEU A 1 82  ? 38.411 -11.445 12.560 1.00 25.97  ? 82  LEU A C    1 
ATOM   782  O O    . LEU A 1 82  ? 37.616 -12.358 12.310 1.00 23.56  ? 82  LEU A O    1 
ATOM   783  C CB   . LEU A 1 82  ? 37.000 -9.584  13.393 1.00 21.51  ? 82  LEU A CB   1 
ATOM   784  C CG   . LEU A 1 82  ? 36.818 -8.123  13.810 1.00 28.22  ? 82  LEU A CG   1 
ATOM   785  C CD1  . LEU A 1 82  ? 36.341 -7.311  12.644 1.00 26.33  ? 82  LEU A CD1  1 
ATOM   786  C CD2  . LEU A 1 82  ? 35.819 -8.044  14.947 1.00 18.39  ? 82  LEU A CD2  1 
ATOM   787  H H    . LEU A 1 82  ? 36.560 -10.236 10.848 1.00 37.00  ? 82  LEU A H    1 
ATOM   788  N N    . GLU A 1 83  ? 39.643 -11.674 12.997 1.00 32.76  ? 83  GLU A N    1 
ATOM   789  C CA   . GLU A 1 83  ? 40.058 -13.034 13.272 1.00 34.48  ? 83  GLU A CA   1 
ATOM   790  C C    . GLU A 1 83  ? 40.766 -13.112 14.601 1.00 34.94  ? 83  GLU A C    1 
ATOM   791  O O    . GLU A 1 83  ? 41.460 -12.182 15.005 1.00 34.17  ? 83  GLU A O    1 
ATOM   792  C CB   . GLU A 1 83  ? 40.936 -13.585 12.161 1.00 47.88  ? 83  GLU A CB   1 
ATOM   793  C CG   . GLU A 1 83  ? 42.372 -13.210 12.262 1.00 37.81  ? 83  GLU A CG   1 
ATOM   794  C CD   . GLU A 1 83  ? 43.132 -13.728 11.093 1.00 49.79  ? 83  GLU A CD   1 
ATOM   795  O OE1  . GLU A 1 83  ? 42.822 -13.273 9.967  1.00 57.70  ? 83  GLU A OE1  1 
ATOM   796  O OE2  . GLU A 1 83  ? 44.015 -14.596 11.294 1.00 51.71  ? 83  GLU A OE2  1 
ATOM   797  H H    . GLU A 1 83  ? 40.272 -10.935 13.129 1.00 37.00  ? 83  GLU A H    1 
ATOM   798  N N    . SER A 1 84  ? 40.494 -14.191 15.324 1.00 44.05  ? 84  SER A N    1 
ATOM   799  C CA   . SER A 1 84  ? 41.120 -14.395 16.611 1.00 50.77  ? 84  SER A CA   1 
ATOM   800  C C    . SER A 1 84  ? 42.492 -14.981 16.360 1.00 50.27  ? 84  SER A C    1 
ATOM   801  O O    . SER A 1 84  ? 42.770 -15.544 15.292 1.00 42.04  ? 84  SER A O    1 
ATOM   802  C CB   . SER A 1 84  ? 40.278 -15.303 17.505 1.00 50.82  ? 84  SER A CB   1 
ATOM   803  O OG   . SER A 1 84  ? 39.722 -16.350 16.739 1.00 56.93  ? 84  SER A OG   1 
ATOM   804  H H    . SER A 1 84  ? 39.878 -14.868 14.975 1.00 37.00  ? 84  SER A H    1 
ATOM   805  H HG   . SER A 1 84  ? 39.152 -16.882 17.298 1.00 37.00  ? 84  SER A HG   1 
ATOM   806  N N    . VAL A 1 85  ? 43.364 -14.762 17.330 1.00 50.86  ? 85  VAL A N    1 
ATOM   807  C CA   . VAL A 1 85  ? 44.729 -15.226 17.273 1.00 50.74  ? 85  VAL A CA   1 
ATOM   808  C C    . VAL A 1 85  ? 45.076 -15.742 18.664 1.00 60.58  ? 85  VAL A C    1 
ATOM   809  O O    . VAL A 1 85  ? 44.224 -15.779 19.561 1.00 62.38  ? 85  VAL A O    1 
ATOM   810  C CB   . VAL A 1 85  ? 45.666 -14.069 16.861 1.00 47.65  ? 85  VAL A CB   1 
ATOM   811  C CG1  . VAL A 1 85  ? 45.494 -13.768 15.380 1.00 34.51  ? 85  VAL A CG1  1 
ATOM   812  C CG2  . VAL A 1 85  ? 45.352 -12.813 17.683 1.00 43.57  ? 85  VAL A CG2  1 
ATOM   813  H H    . VAL A 1 85  ? 43.074 -14.262 18.123 1.00 37.00  ? 85  VAL A H    1 
ATOM   814  N N    . ASP A 1 86  ? 46.314 -16.180 18.833 1.00 63.40  ? 86  ASP A N    1 
ATOM   815  C CA   . ASP A 1 86  ? 46.750 -16.700 20.118 1.00 64.90  ? 86  ASP A CA   1 
ATOM   816  C C    . ASP A 1 86  ? 47.177 -15.524 20.986 1.00 58.07  ? 86  ASP A C    1 
ATOM   817  O O    . ASP A 1 86  ? 47.988 -14.707 20.566 1.00 65.78  ? 86  ASP A O    1 
ATOM   818  C CB   . ASP A 1 86  ? 47.928 -17.669 19.912 1.00 67.81  ? 86  ASP A CB   1 
ATOM   819  C CG   . ASP A 1 86  ? 47.953 -18.800 20.929 1.00 61.64  ? 86  ASP A CG   1 
ATOM   820  O OD1  . ASP A 1 86  ? 48.346 -18.565 22.095 1.00 53.71  ? 86  ASP A OD1  1 
ATOM   821  O OD2  . ASP A 1 86  ? 47.589 -19.930 20.543 1.00 60.43  ? 86  ASP A OD2  1 
ATOM   822  H H    . ASP A 1 86  ? 46.949 -16.158 18.086 1.00 37.00  ? 86  ASP A H    1 
ATOM   823  N N    . PRO A 1 87  ? 46.602 -15.398 22.189 1.00 56.15  ? 87  PRO A N    1 
ATOM   824  C CA   . PRO A 1 87  ? 46.940 -14.306 23.115 1.00 59.35  ? 87  PRO A CA   1 
ATOM   825  C C    . PRO A 1 87  ? 48.403 -14.282 23.590 1.00 66.88  ? 87  PRO A C    1 
ATOM   826  O O    . PRO A 1 87  ? 48.934 -13.217 23.929 1.00 67.00  ? 87  PRO A O    1 
ATOM   827  C CB   . PRO A 1 87  ? 45.984 -14.542 24.290 1.00 53.53  ? 87  PRO A CB   1 
ATOM   828  C CG   . PRO A 1 87  ? 45.699 -16.033 24.216 1.00 57.12  ? 87  PRO A CG   1 
ATOM   829  C CD   . PRO A 1 87  ? 45.521 -16.235 22.733 1.00 48.22  ? 87  PRO A CD   1 
ATOM   830  N N    . LYS A 1 88  ? 49.049 -15.448 23.622 1.00 77.44  ? 88  LYS A N    1 
ATOM   831  C CA   . LYS A 1 88  ? 50.442 -15.540 24.072 1.00 86.94  ? 88  LYS A CA   1 
ATOM   832  C C    . LYS A 1 88  ? 51.421 -15.015 23.026 1.00 87.17  ? 88  LYS A C    1 
ATOM   833  O O    . LYS A 1 88  ? 52.381 -14.303 23.349 1.00 89.65  ? 88  LYS A O    1 
ATOM   834  C CB   . LYS A 1 88  ? 50.802 -16.985 24.450 1.00 91.15  ? 88  LYS A CB   1 
ATOM   835  C CG   . LYS A 1 88  ? 52.239 -17.136 24.965 1.00 100.00 ? 88  LYS A CG   1 
ATOM   836  C CD   . LYS A 1 88  ? 52.564 -18.557 25.445 1.00 100.00 ? 88  LYS A CD   1 
ATOM   837  C CE   . LYS A 1 88  ? 54.043 -18.683 25.854 1.00 100.00 ? 88  LYS A CE   1 
ATOM   838  N NZ   . LYS A 1 88  ? 54.464 -17.663 26.873 1.00 98.61  ? 88  LYS A NZ   1 
ATOM   839  H H    . LYS A 1 88  ? 48.585 -16.259 23.324 1.00 37.00  ? 88  LYS A H    1 
ATOM   840  H HZ1  . LYS A 1 88  ? 54.317 -16.709 26.484 1.00 37.00  ? 88  LYS A HZ1  1 
ATOM   841  H HZ2  . LYS A 1 88  ? 53.892 -17.781 27.733 1.00 37.00  ? 88  LYS A HZ2  1 
ATOM   842  H HZ3  . LYS A 1 88  ? 55.470 -17.790 27.104 1.00 37.00  ? 88  LYS A HZ3  1 
ATOM   843  N N    . ASN A 1 89  ? 51.163 -15.379 21.774 1.00 80.07  ? 89  ASN A N    1 
ATOM   844  C CA   . ASN A 1 89  ? 51.996 -14.964 20.657 1.00 74.95  ? 89  ASN A CA   1 
ATOM   845  C C    . ASN A 1 89  ? 51.730 -13.505 20.277 1.00 66.78  ? 89  ASN A C    1 
ATOM   846  O O    . ASN A 1 89  ? 52.603 -12.834 19.744 1.00 64.24  ? 89  ASN A O    1 
ATOM   847  C CB   . ASN A 1 89  ? 51.708 -15.837 19.423 1.00 80.59  ? 89  ASN A CB   1 
ATOM   848  C CG   . ASN A 1 89  ? 51.747 -17.329 19.719 1.00 81.25  ? 89  ASN A CG   1 
ATOM   849  O OD1  . ASN A 1 89  ? 51.798 -17.751 20.875 1.00 83.12  ? 89  ASN A OD1  1 
ATOM   850  N ND2  . ASN A 1 89  ? 51.698 -18.138 18.661 1.00 72.29  ? 89  ASN A ND2  1 
ATOM   851  H H    . ASN A 1 89  ? 50.379 -15.942 21.603 1.00 37.00  ? 89  ASN A H    1 
ATOM   852  H HD21 . ASN A 1 89  ? 51.725 -19.105 18.816 1.00 37.00  ? 89  ASN A HD21 1 
ATOM   853  H HD22 . ASN A 1 89  ? 51.639 -17.728 17.773 1.00 37.00  ? 89  ASN A HD22 1 
ATOM   854  N N    . TYR A 1 90  ? 50.532 -13.014 20.574 1.00 54.87  ? 90  TYR A N    1 
ATOM   855  C CA   . TYR A 1 90  ? 50.141 -11.660 20.202 1.00 46.30  ? 90  TYR A CA   1 
ATOM   856  C C    . TYR A 1 90  ? 49.989 -10.618 21.296 1.00 42.01  ? 90  TYR A C    1 
ATOM   857  O O    . TYR A 1 90  ? 49.685 -10.942 22.445 1.00 48.93  ? 90  TYR A O    1 
ATOM   858  C CB   . TYR A 1 90  ? 48.864 -11.727 19.374 1.00 42.09  ? 90  TYR A CB   1 
ATOM   859  C CG   . TYR A 1 90  ? 49.109 -12.278 17.999 1.00 35.35  ? 90  TYR A CG   1 
ATOM   860  C CD1  . TYR A 1 90  ? 49.130 -13.642 17.765 1.00 33.55  ? 90  TYR A CD1  1 
ATOM   861  C CD2  . TYR A 1 90  ? 49.361 -11.426 16.935 1.00 38.79  ? 90  TYR A CD2  1 
ATOM   862  C CE1  . TYR A 1 90  ? 49.403 -14.143 16.502 1.00 37.39  ? 90  TYR A CE1  1 
ATOM   863  C CE2  . TYR A 1 90  ? 49.627 -11.913 15.675 1.00 32.83  ? 90  TYR A CE2  1 
ATOM   864  C CZ   . TYR A 1 90  ? 49.646 -13.267 15.462 1.00 38.69  ? 90  TYR A CZ   1 
ATOM   865  O OH   . TYR A 1 90  ? 49.877 -13.731 14.189 1.00 52.83  ? 90  TYR A OH   1 
ATOM   866  H H    . TYR A 1 90  ? 49.893 -13.578 21.058 1.00 37.00  ? 90  TYR A H    1 
ATOM   867  H HH   . TYR A 1 90  ? 49.808 -14.688 14.177 1.00 37.00  ? 90  TYR A HH   1 
ATOM   868  N N    . PRO A 1 91  ? 50.200 -9.337  20.948 1.00 39.42  ? 91  PRO A N    1 
ATOM   869  C CA   . PRO A 1 91  ? 50.566 -8.796  19.630 1.00 45.53  ? 91  PRO A CA   1 
ATOM   870  C C    . PRO A 1 91  ? 52.070 -8.870  19.364 1.00 54.63  ? 91  PRO A C    1 
ATOM   871  O O    . PRO A 1 91  ? 52.869 -8.798  20.301 1.00 60.69  ? 91  PRO A O    1 
ATOM   872  C CB   . PRO A 1 91  ? 50.131 -7.346  19.744 1.00 31.26  ? 91  PRO A CB   1 
ATOM   873  C CG   . PRO A 1 91  ? 50.491 -7.038  21.164 1.00 30.70  ? 91  PRO A CG   1 
ATOM   874  C CD   . PRO A 1 91  ? 49.967 -8.240  21.904 1.00 36.65  ? 91  PRO A CD   1 
ATOM   875  N N    . LYS A 1 92  ? 52.455 -8.979  18.093 1.00 51.58  ? 92  LYS A N    1 
ATOM   876  C CA   . LYS A 1 92  ? 53.872 -9.046  17.725 1.00 51.52  ? 92  LYS A CA   1 
ATOM   877  C C    . LYS A 1 92  ? 54.266 -7.778  16.962 1.00 57.36  ? 92  LYS A C    1 
ATOM   878  O O    . LYS A 1 92  ? 53.384 -7.103  16.415 1.00 70.00  ? 92  LYS A O    1 
ATOM   879  C CB   . LYS A 1 92  ? 54.123 -10.272 16.843 1.00 48.84  ? 92  LYS A CB   1 
ATOM   880  C CG   . LYS A 1 92  ? 53.625 -11.567 17.448 1.00 53.09  ? 92  LYS A CG   1 
ATOM   881  C CD   . LYS A 1 92  ? 54.101 -12.812 16.694 1.00 64.10  ? 92  LYS A CD   1 
ATOM   882  C CE   . LYS A 1 92  ? 53.315 -13.079 15.418 1.00 48.67  ? 92  LYS A CE   1 
ATOM   883  N NZ   . LYS A 1 92  ? 53.379 -11.948 14.459 1.00 40.54  ? 92  LYS A NZ   1 
ATOM   884  H H    . LYS A 1 92  ? 51.776 -9.022  17.387 1.00 37.00  ? 92  LYS A H    1 
ATOM   885  H HZ1  . LYS A 1 92  ? 54.370 -11.732 14.235 1.00 37.00  ? 92  LYS A HZ1  1 
ATOM   886  H HZ2  . LYS A 1 92  ? 52.866 -12.198 13.589 1.00 37.00  ? 92  LYS A HZ2  1 
ATOM   887  H HZ3  . LYS A 1 92  ? 52.923 -11.118 14.890 1.00 37.00  ? 92  LYS A HZ3  1 
ATOM   888  N N    . LYS A 1 93  ? 55.555 -7.414  16.959 1.00 46.76  ? 93  LYS A N    1 
ATOM   889  C CA   . LYS A 1 93  ? 55.987 -6.231  16.201 1.00 46.07  ? 93  LYS A CA   1 
ATOM   890  C C    . LYS A 1 93  ? 56.190 -6.640  14.745 1.00 45.30  ? 93  LYS A C    1 
ATOM   891  O O    . LYS A 1 93  ? 56.179 -5.797  13.846 1.00 43.06  ? 93  LYS A O    1 
ATOM   892  C CB   . LYS A 1 93  ? 57.260 -5.590  16.782 1.00 52.50  ? 93  LYS A CB   1 
ATOM   893  C CG   . LYS A 1 93  ? 58.494 -6.473  16.773 1.00 43.00  ? 93  LYS A CG   1 
ATOM   894  C CD   . LYS A 1 93  ? 59.675 -5.834  17.508 1.00 50.01  ? 93  LYS A CD   1 
ATOM   895  C CE   . LYS A 1 93  ? 60.320 -4.682  16.726 1.00 57.71  ? 93  LYS A CE   1 
ATOM   896  N NZ   . LYS A 1 93  ? 61.774 -4.454  17.092 1.00 37.60  ? 93  LYS A NZ   1 
ATOM   897  H H    . LYS A 1 93  ? 56.214 -7.931  17.464 1.00 37.00  ? 93  LYS A H    1 
ATOM   898  H HZ1  . LYS A 1 93  ? 61.842 -4.235  18.106 1.00 37.00  ? 93  LYS A HZ1  1 
ATOM   899  H HZ2  . LYS A 1 93  ? 62.328 -5.307  16.875 1.00 37.00  ? 93  LYS A HZ2  1 
ATOM   900  H HZ3  . LYS A 1 93  ? 62.145 -3.655  16.540 1.00 37.00  ? 93  LYS A HZ3  1 
ATOM   901  N N    . LYS A 1 94  ? 56.370 -7.945  14.528 1.00 49.68  ? 94  LYS A N    1 
ATOM   902  C CA   . LYS A 1 94  ? 56.548 -8.510  13.189 1.00 53.18  ? 94  LYS A CA   1 
ATOM   903  C C    . LYS A 1 94  ? 55.232 -9.177  12.849 1.00 50.66  ? 94  LYS A C    1 
ATOM   904  O O    . LYS A 1 94  ? 55.072 -10.388 13.001 1.00 45.07  ? 94  LYS A O    1 
ATOM   905  C CB   . LYS A 1 94  ? 57.699 -9.537  13.137 1.00 54.72  ? 94  LYS A CB   1 
ATOM   906  C CG   . LYS A 1 94  ? 59.076 -8.970  13.479 1.00 64.86  ? 94  LYS A CG   1 
ATOM   907  C CD   . LYS A 1 94  ? 59.347 -7.639  12.757 1.00 64.33  ? 94  LYS A CD   1 
ATOM   908  C CE   . LYS A 1 94  ? 60.370 -6.786  13.496 1.00 47.36  ? 94  LYS A CE   1 
ATOM   909  N NZ   . LYS A 1 94  ? 60.424 -5.420  12.943 1.00 36.55  ? 94  LYS A NZ   1 
ATOM   910  H H    . LYS A 1 94  ? 56.391 -8.556  15.293 1.00 37.00  ? 94  LYS A H    1 
ATOM   911  H HZ1  . LYS A 1 94  ? 60.648 -5.456  11.929 1.00 37.00  ? 94  LYS A HZ1  1 
ATOM   912  H HZ2  . LYS A 1 94  ? 59.474 -5.040  13.093 1.00 37.00  ? 94  LYS A HZ2  1 
ATOM   913  H HZ3  . LYS A 1 94  ? 61.132 -4.853  13.451 1.00 37.00  ? 94  LYS A HZ3  1 
ATOM   914  N N    . MET A 1 95  ? 54.299 -8.363  12.366 1.00 50.51  ? 95  MET A N    1 
ATOM   915  C CA   . MET A 1 95  ? 52.953 -8.816  12.029 1.00 47.43  ? 95  MET A CA   1 
ATOM   916  C C    . MET A 1 95  ? 52.746 -9.221  10.574 1.00 32.79  ? 95  MET A C    1 
ATOM   917  O O    . MET A 1 95  ? 53.221 -8.546  9.664  1.00 34.13  ? 95  MET A O    1 
ATOM   918  C CB   . MET A 1 95  ? 51.958 -7.712  12.396 1.00 51.42  ? 95  MET A CB   1 
ATOM   919  C CG   . MET A 1 95  ? 50.747 -8.205  13.128 1.00 53.31  ? 95  MET A CG   1 
ATOM   920  S SD   . MET A 1 95  ? 51.030 -8.500  14.862 1.00 43.63  ? 95  MET A SD   1 
ATOM   921  C CE   . MET A 1 95  ? 49.333 -8.606  15.389 1.00 49.43  ? 95  MET A CE   1 
ATOM   922  H H    . MET A 1 95  ? 54.523 -7.418  12.227 1.00 37.00  ? 95  MET A H    1 
ATOM   923  N N    . GLU A 1 96  ? 51.998 -10.301 10.368 1.00 23.27  ? 96  GLU A N    1 
ATOM   924  C CA   . GLU A 1 96  ? 51.700 -10.785 9.021  1.00 30.83  ? 96  GLU A CA   1 
ATOM   925  C C    . GLU A 1 96  ? 50.967 -9.679  8.276  1.00 30.50  ? 96  GLU A C    1 
ATOM   926  O O    . GLU A 1 96  ? 50.077 -9.040  8.825  1.00 38.88  ? 96  GLU A O    1 
ATOM   927  C CB   . GLU A 1 96  ? 50.846 -12.059 9.048  1.00 37.57  ? 96  GLU A CB   1 
ATOM   928  C CG   . GLU A 1 96  ? 51.534 -13.310 9.613  1.00 33.83  ? 96  GLU A CG   1 
ATOM   929  C CD   . GLU A 1 96  ? 51.610 -13.347 11.136 1.00 41.12  ? 96  GLU A CD   1 
ATOM   930  O OE1  . GLU A 1 96  ? 51.153 -12.399 11.806 1.00 59.81  ? 96  GLU A OE1  1 
ATOM   931  O OE2  . GLU A 1 96  ? 52.117 -14.350 11.679 1.00 44.53  ? 96  GLU A OE2  1 
ATOM   932  H H    . GLU A 1 96  ? 51.643 -10.703 11.169 1.00 37.00  ? 96  GLU A H    1 
ATOM   933  N N    . LYS A 1 97  ? 51.320 -9.481  7.014  1.00 34.23  ? 97  LYS A N    1 
ATOM   934  C CA   . LYS A 1 97  ? 50.745 -8.406  6.210  1.00 41.38  ? 97  LYS A CA   1 
ATOM   935  C C    . LYS A 1 97  ? 49.232 -8.144  6.280  1.00 43.85  ? 97  LYS A C    1 
ATOM   936  O O    . LYS A 1 97  ? 48.794 -6.989  6.238  1.00 49.99  ? 97  LYS A O    1 
ATOM   937  C CB   . LYS A 1 97  ? 51.230 -8.507  4.753  1.00 45.70  ? 97  LYS A CB   1 
ATOM   938  C CG   . LYS A 1 97  ? 52.043 -7.296  4.261  1.00 51.57  ? 97  LYS A CG   1 
ATOM   939  C CD   . LYS A 1 97  ? 53.368 -7.093  5.048  1.00 78.11  ? 97  LYS A CD   1 
ATOM   940  C CE   . LYS A 1 97  ? 53.217 -6.238  6.338  1.00 81.09  ? 97  LYS A CE   1 
ATOM   941  N NZ   . LYS A 1 97  ? 54.463 -6.073  7.168  1.00 67.95  ? 97  LYS A NZ   1 
ATOM   942  H H    . LYS A 1 97  ? 51.977 -10.084 6.606  1.00 37.00  ? 97  LYS A H    1 
ATOM   943  H HZ1  . LYS A 1 97  ? 54.801 -7.009  7.469  1.00 37.00  ? 97  LYS A HZ1  1 
ATOM   944  H HZ2  . LYS A 1 97  ? 55.199 -5.601  6.603  1.00 37.00  ? 97  LYS A HZ2  1 
ATOM   945  H HZ3  . LYS A 1 97  ? 54.241 -5.495  8.003  1.00 37.00  ? 97  LYS A HZ3  1 
ATOM   946  N N    . ARG A 1 98  ? 48.435 -9.196  6.425  1.00 43.55  ? 98  ARG A N    1 
ATOM   947  C CA   . ARG A 1 98  ? 46.994 -9.028  6.485  1.00 34.01  ? 98  ARG A CA   1 
ATOM   948  C C    . ARG A 1 98  ? 46.497 -8.082  7.591  1.00 33.71  ? 98  ARG A C    1 
ATOM   949  O O    . ARG A 1 98  ? 45.620 -7.250  7.353  1.00 27.76  ? 98  ARG A O    1 
ATOM   950  C CB   . ARG A 1 98  ? 46.326 -10.388 6.582  1.00 36.30  ? 98  ARG A CB   1 
ATOM   951  C CG   . ARG A 1 98  ? 46.745 -11.233 7.762  1.00 32.41  ? 98  ARG A CG   1 
ATOM   952  C CD   . ARG A 1 98  ? 46.047 -12.575 7.645  1.00 21.93  ? 98  ARG A CD   1 
ATOM   953  N NE   . ARG A 1 98  ? 46.333 -13.467 8.761  1.00 38.95  ? 98  ARG A NE   1 
ATOM   954  C CZ   . ARG A 1 98  ? 47.401 -14.254 8.844  1.00 45.78  ? 98  ARG A CZ   1 
ATOM   955  N NH1  . ARG A 1 98  ? 48.315 -14.267 7.877  1.00 60.41  ? 98  ARG A NH1  1 
ATOM   956  N NH2  . ARG A 1 98  ? 47.532 -15.067 9.880  1.00 50.83  ? 98  ARG A NH2  1 
ATOM   957  H H    . ARG A 1 98  ? 48.829 -10.090 6.502  1.00 37.00  ? 98  ARG A H    1 
ATOM   958  H HE   . ARG A 1 98  ? 45.698 -13.483 9.507  1.00 37.00  ? 98  ARG A HE   1 
ATOM   959  H HH11 . ARG A 1 98  ? 48.211 -13.684 7.072  1.00 37.00  ? 98  ARG A HH11 1 
ATOM   960  H HH12 . ARG A 1 98  ? 49.112 -14.865 7.958  1.00 37.00  ? 98  ARG A HH12 1 
ATOM   961  H HH21 . ARG A 1 98  ? 46.836 -15.076 10.597 1.00 37.00  ? 98  ARG A HH21 1 
ATOM   962  H HH22 . ARG A 1 98  ? 48.339 -15.654 9.946  1.00 37.00  ? 98  ARG A HH22 1 
ATOM   963  N N    . PHE A 1 99  ? 47.097 -8.165  8.774  1.00 27.20  ? 99  PHE A N    1 
ATOM   964  C CA   . PHE A 1 99  ? 46.693 -7.306  9.886  1.00 23.68  ? 99  PHE A CA   1 
ATOM   965  C C    . PHE A 1 99  ? 47.341 -5.956  9.837  1.00 20.93  ? 99  PHE A C    1 
ATOM   966  O O    . PHE A 1 99  ? 47.190 -5.179  10.777 1.00 41.14  ? 99  PHE A O    1 
ATOM   967  C CB   . PHE A 1 99  ? 47.137 -7.874  11.225 1.00 24.99  ? 99  PHE A CB   1 
ATOM   968  C CG   . PHE A 1 99  ? 46.894 -9.324  11.386 1.00 31.64  ? 99  PHE A CG   1 
ATOM   969  C CD1  . PHE A 1 99  ? 45.648 -9.784  11.744 1.00 10.19  ? 99  PHE A CD1  1 
ATOM   970  C CD2  . PHE A 1 99  ? 47.939 -10.227 11.273 1.00 34.11  ? 99  PHE A CD2  1 
ATOM   971  C CE1  . PHE A 1 99  ? 45.439 -11.113 11.997 1.00 17.45  ? 99  PHE A CE1  1 
ATOM   972  C CE2  . PHE A 1 99  ? 47.730 -11.567 11.530 1.00 38.15  ? 99  PHE A CE2  1 
ATOM   973  C CZ   . PHE A 1 99  ? 46.466 -12.005 11.897 1.00 26.91  ? 99  PHE A CZ   1 
ATOM   974  H H    . PHE A 1 99  ? 47.831 -8.802  8.895  1.00 37.00  ? 99  PHE A H    1 
ATOM   975  N N    . VAL A 1 100 ? 48.108 -5.684  8.789  1.00 26.51  ? 100 VAL A N    1 
ATOM   976  C CA   . VAL A 1 100 ? 48.823 -4.430  8.718  1.00 15.68  ? 100 VAL A CA   1 
ATOM   977  C C    . VAL A 1 100 ? 48.212 -3.319  7.881  1.00 11.83  ? 100 VAL A C    1 
ATOM   978  O O    . VAL A 1 100 ? 47.942 -3.483  6.699  1.00 16.83  ? 100 VAL A O    1 
ATOM   979  C CB   . VAL A 1 100 ? 50.311 -4.671  8.374  1.00 23.27  ? 100 VAL A CB   1 
ATOM   980  C CG1  . VAL A 1 100 ? 51.080 -3.350  8.367  1.00 15.53  ? 100 VAL A CG1  1 
ATOM   981  C CG2  . VAL A 1 100 ? 50.930 -5.605  9.429  1.00 15.54  ? 100 VAL A CG2  1 
ATOM   982  H H    . VAL A 1 100 ? 48.163 -6.314  8.043  1.00 37.00  ? 100 VAL A H    1 
ATOM   983  N N    . PHE A 1 101 ? 47.999 -2.189  8.554  1.00 17.86  ? 101 PHE A N    1 
ATOM   984  C CA   . PHE A 1 101 ? 47.426 -0.963  7.991  1.00 18.56  ? 101 PHE A CA   1 
ATOM   985  C C    . PHE A 1 101 ? 48.415 0.186   8.206  1.00 18.00  ? 101 PHE A C    1 
ATOM   986  O O    . PHE A 1 101 ? 49.023 0.299   9.262  1.00 26.03  ? 101 PHE A O    1 
ATOM   987  C CB   . PHE A 1 101 ? 46.122 -0.571  8.734  1.00 13.39  ? 101 PHE A CB   1 
ATOM   988  C CG   . PHE A 1 101 ? 45.052 -1.644  8.720  1.00 17.29  ? 101 PHE A CG   1 
ATOM   989  C CD1  . PHE A 1 101 ? 45.081 -2.688  9.642  1.00 8.91   ? 101 PHE A CD1  1 
ATOM   990  C CD2  . PHE A 1 101 ? 44.071 -1.660  7.726  1.00 4.93   ? 101 PHE A CD2  1 
ATOM   991  C CE1  . PHE A 1 101 ? 44.153 -3.727  9.541  1.00 23.01  ? 101 PHE A CE1  1 
ATOM   992  C CE2  . PHE A 1 101 ? 43.174 -2.680  7.639  1.00 11.27  ? 101 PHE A CE2  1 
ATOM   993  C CZ   . PHE A 1 101 ? 43.207 -3.712  8.535  1.00 14.13  ? 101 PHE A CZ   1 
ATOM   994  H H    . PHE A 1 101 ? 48.267 -2.190  9.498  1.00 37.00  ? 101 PHE A H    1 
ATOM   995  N N    . ASN A 1 102 ? 48.567 1.042   7.208  1.00 17.90  ? 102 ASN A N    1 
ATOM   996  C CA   . ASN A 1 102 ? 49.419 2.212   7.341  1.00 21.63  ? 102 ASN A CA   1 
ATOM   997  C C    . ASN A 1 102 ? 48.555 3.384   7.838  1.00 23.14  ? 102 ASN A C    1 
ATOM   998  O O    . ASN A 1 102 ? 47.629 3.811   7.151  1.00 27.68  ? 102 ASN A O    1 
ATOM   999  C CB   . ASN A 1 102 ? 50.015 2.564   5.983  1.00 32.54  ? 102 ASN A CB   1 
ATOM   1000 C CG   . ASN A 1 102 ? 50.823 1.424   5.384  1.00 39.84  ? 102 ASN A CG   1 
ATOM   1001 O OD1  . ASN A 1 102 ? 51.656 0.792   6.061  1.00 34.11  ? 102 ASN A OD1  1 
ATOM   1002 N ND2  . ASN A 1 102 ? 50.602 1.168   4.096  1.00 41.13  ? 102 ASN A ND2  1 
ATOM   1003 H H    . ASN A 1 102 ? 48.136 0.882   6.351  1.00 37.00  ? 102 ASN A H    1 
ATOM   1004 H HD21 . ASN A 1 102 ? 51.111 0.431   3.697  1.00 37.00  ? 102 ASN A HD21 1 
ATOM   1005 H HD22 . ASN A 1 102 ? 49.949 1.709   3.600  1.00 37.00  ? 102 ASN A HD22 1 
ATOM   1006 N N    . LYS A 1 103 ? 48.838 3.877   9.038  1.00 29.72  ? 103 LYS A N    1 
ATOM   1007 C CA   . LYS A 1 103 ? 48.096 4.999   9.636  1.00 22.35  ? 103 LYS A CA   1 
ATOM   1008 C C    . LYS A 1 103 ? 48.579 6.347   9.056  1.00 27.93  ? 103 LYS A C    1 
ATOM   1009 O O    . LYS A 1 103 ? 49.632 6.871   9.435  1.00 42.16  ? 103 LYS A O    1 
ATOM   1010 C CB   . LYS A 1 103 ? 48.260 4.962   11.165 1.00 17.48  ? 103 LYS A CB   1 
ATOM   1011 C CG   . LYS A 1 103 ? 47.431 5.981   11.949 1.00 24.06  ? 103 LYS A CG   1 
ATOM   1012 C CD   . LYS A 1 103 ? 47.720 5.935   13.470 1.00 23.85  ? 103 LYS A CD   1 
ATOM   1013 C CE   . LYS A 1 103 ? 49.159 6.359   13.841 1.00 27.72  ? 103 LYS A CE   1 
ATOM   1014 N NZ   . LYS A 1 103 ? 49.508 7.785   13.587 1.00 27.31  ? 103 LYS A NZ   1 
ATOM   1015 H H    . LYS A 1 103 ? 49.553 3.459   9.543  1.00 37.00  ? 103 LYS A H    1 
ATOM   1016 H HZ1  . LYS A 1 103 ? 48.866 8.401   14.127 1.00 37.00  ? 103 LYS A HZ1  1 
ATOM   1017 H HZ2  . LYS A 1 103 ? 50.486 7.951   13.902 1.00 37.00  ? 103 LYS A HZ2  1 
ATOM   1018 H HZ3  . LYS A 1 103 ? 49.431 8.007   12.573 1.00 37.00  ? 103 LYS A HZ3  1 
ATOM   1019 N N    . ILE A 1 104 ? 47.782 6.900   8.147  1.00 28.41  ? 104 ILE A N    1 
ATOM   1020 C CA   . ILE A 1 104 ? 48.078 8.164   7.461  1.00 28.40  ? 104 ILE A CA   1 
ATOM   1021 C C    . ILE A 1 104 ? 47.305 9.321   8.087  1.00 33.25  ? 104 ILE A C    1 
ATOM   1022 O O    . ILE A 1 104 ? 46.081 9.262   8.172  1.00 32.42  ? 104 ILE A O    1 
ATOM   1023 C CB   . ILE A 1 104 ? 47.629 8.084   5.991  1.00 26.44  ? 104 ILE A CB   1 
ATOM   1024 C CG1  . ILE A 1 104 ? 48.337 6.941   5.277  1.00 24.97  ? 104 ILE A CG1  1 
ATOM   1025 C CG2  . ILE A 1 104 ? 47.849 9.399   5.282  1.00 27.17  ? 104 ILE A CG2  1 
ATOM   1026 C CD1  . ILE A 1 104 ? 47.631 6.508   4.030  1.00 27.45  ? 104 ILE A CD1  1 
ATOM   1027 H H    . ILE A 1 104 ? 46.944 6.439   7.931  1.00 37.00  ? 104 ILE A H    1 
ATOM   1028 N N    . GLU A 1 105 ? 48.016 10.377  8.483  1.00 32.56  ? 105 GLU A N    1 
ATOM   1029 C CA   . GLU A 1 105 ? 47.388 11.548  9.082  1.00 26.48  ? 105 GLU A CA   1 
ATOM   1030 C C    . GLU A 1 105 ? 47.508 12.797  8.223  1.00 36.57  ? 105 GLU A C    1 
ATOM   1031 O O    . GLU A 1 105 ? 48.588 13.373  8.118  1.00 48.23  ? 105 GLU A O    1 
ATOM   1032 C CB   . GLU A 1 105 ? 47.972 11.833  10.454 1.00 20.03  ? 105 GLU A CB   1 
ATOM   1033 C CG   . GLU A 1 105 ? 47.374 13.078  11.129 1.00 32.50  ? 105 GLU A CG   1 
ATOM   1034 C CD   . GLU A 1 105 ? 47.495 13.051  12.654 1.00 46.37  ? 105 GLU A CD   1 
ATOM   1035 O OE1  . GLU A 1 105 ? 47.254 11.988  13.267 1.00 52.81  ? 105 GLU A OE1  1 
ATOM   1036 O OE2  . GLU A 1 105 ? 47.819 14.098  13.248 1.00 59.75  ? 105 GLU A OE2  1 
ATOM   1037 H H    . GLU A 1 105 ? 48.988 10.362  8.376  1.00 37.00  ? 105 GLU A H    1 
ATOM   1038 N N    . ILE A 1 106 ? 46.402 13.220  7.610  1.00 50.79  ? 106 ILE A N    1 
ATOM   1039 C CA   . ILE A 1 106 ? 46.410 14.420  6.776  1.00 60.39  ? 106 ILE A CA   1 
ATOM   1040 C C    . ILE A 1 106 ? 46.157 15.701  7.582  1.00 65.05  ? 106 ILE A C    1 
ATOM   1041 O O    . ILE A 1 106 ? 47.118 16.371  7.977  1.00 71.35  ? 106 ILE A O    1 
ATOM   1042 C CB   . ILE A 1 106 ? 45.417 14.321  5.611  1.00 66.04  ? 106 ILE A CB   1 
ATOM   1043 C CG1  . ILE A 1 106 ? 45.680 13.039  4.800  1.00 68.31  ? 106 ILE A CG1  1 
ATOM   1044 C CG2  . ILE A 1 106 ? 45.515 15.586  4.740  1.00 69.13  ? 106 ILE A CG2  1 
ATOM   1045 C CD1  . ILE A 1 106 ? 47.065 12.955  4.176  1.00 59.89  ? 106 ILE A CD1  1 
ATOM   1046 H H    . ILE A 1 106 ? 45.572 12.711  7.719  1.00 37.00  ? 106 ILE A H    1 
ATOM   1047 N N    . ASN A 1 107 ? 44.888 16.048  7.816  1.00 65.94  ? 107 ASN A N    1 
ATOM   1048 C CA   . ASN A 1 107 ? 44.545 17.249  8.592  1.00 64.65  ? 107 ASN A CA   1 
ATOM   1049 C C    . ASN A 1 107 ? 43.984 16.822  9.913  1.00 61.68  ? 107 ASN A C    1 
ATOM   1050 O O    . ASN A 1 107 ? 42.835 17.117  10.228 1.00 65.73  ? 107 ASN A O    1 
ATOM   1051 C CB   . ASN A 1 107 ? 43.513 18.099  7.870  1.00 66.29  ? 107 ASN A CB   1 
ATOM   1052 C CG   . ASN A 1 107 ? 44.128 19.302  7.220  1.00 75.58  ? 107 ASN A CG   1 
ATOM   1053 O OD1  . ASN A 1 107 ? 44.160 19.406  5.991  1.00 81.27  ? 107 ASN A OD1  1 
ATOM   1054 N ND2  . ASN A 1 107 ? 44.662 20.212  8.039  1.00 68.52  ? 107 ASN A ND2  1 
ATOM   1055 H H    . ASN A 1 107 ? 44.155 15.486  7.489  1.00 37.00  ? 107 ASN A H    1 
ATOM   1056 H HD21 . ASN A 1 107 ? 45.058 21.008  7.631  1.00 37.00  ? 107 ASN A HD21 1 
ATOM   1057 H HD22 . ASN A 1 107 ? 44.636 20.058  9.007  1.00 37.00  ? 107 ASN A HD22 1 
ATOM   1058 N N    . ASN A 1 108 ? 44.828 16.153  10.693 1.00 61.01  ? 108 ASN A N    1 
ATOM   1059 C CA   . ASN A 1 108 ? 44.451 15.589  11.981 1.00 55.49  ? 108 ASN A CA   1 
ATOM   1060 C C    . ASN A 1 108 ? 43.344 14.558  11.672 1.00 57.59  ? 108 ASN A C    1 
ATOM   1061 O O    . ASN A 1 108 ? 42.588 14.131  12.557 1.00 56.16  ? 108 ASN A O    1 
ATOM   1062 C CB   . ASN A 1 108 ? 43.979 16.689  12.937 1.00 51.15  ? 108 ASN A CB   1 
ATOM   1063 C CG   . ASN A 1 108 ? 44.656 16.617  14.311 1.00 59.16  ? 108 ASN A CG   1 
ATOM   1064 O OD1  . ASN A 1 108 ? 44.612 17.581  15.073 1.00 61.06  ? 108 ASN A OD1  1 
ATOM   1065 N ND2  . ASN A 1 108 ? 45.261 15.473  14.636 1.00 42.78  ? 108 ASN A ND2  1 
ATOM   1066 H H    . ASN A 1 108 ? 45.749 16.028  10.383 1.00 37.00  ? 108 ASN A H    1 
ATOM   1067 H HD21 . ASN A 1 108 ? 45.710 15.405  15.496 1.00 37.00  ? 108 ASN A HD21 1 
ATOM   1068 H HD22 . ASN A 1 108 ? 45.253 14.719  14.015 1.00 37.00  ? 108 ASN A HD22 1 
ATOM   1069 N N    . LYS A 1 109 ? 43.317 14.135  10.399 1.00 55.29  ? 109 LYS A N    1 
ATOM   1070 C CA   . LYS A 1 109 ? 42.353 13.177  9.866  1.00 55.03  ? 109 LYS A CA   1 
ATOM   1071 C C    . LYS A 1 109 ? 42.990 11.850  9.448  1.00 40.04  ? 109 LYS A C    1 
ATOM   1072 O O    . LYS A 1 109 ? 43.654 11.764  8.429  1.00 41.71  ? 109 LYS A O    1 
ATOM   1073 C CB   . LYS A 1 109 ? 41.601 13.810  8.685  1.00 60.03  ? 109 LYS A CB   1 
ATOM   1074 C CG   . LYS A 1 109 ? 40.068 13.800  8.843  1.00 64.28  ? 109 LYS A CG   1 
ATOM   1075 C CD   . LYS A 1 109 ? 39.617 14.282  10.230 1.00 71.86  ? 109 LYS A CD   1 
ATOM   1076 C CE   . LYS A 1 109 ? 39.980 15.751  10.486 1.00 72.38  ? 109 LYS A CE   1 
ATOM   1077 N NZ   . LYS A 1 109 ? 39.880 16.135  11.933 1.00 69.54  ? 109 LYS A NZ   1 
ATOM   1078 H H    . LYS A 1 109 ? 43.977 14.476  9.765  1.00 37.00  ? 109 LYS A H    1 
ATOM   1079 H HZ1  . LYS A 1 109 ? 38.905 15.989  12.267 1.00 37.00  ? 109 LYS A HZ1  1 
ATOM   1080 H HZ2  . LYS A 1 109 ? 40.535 15.560  12.502 1.00 37.00  ? 109 LYS A HZ2  1 
ATOM   1081 H HZ3  . LYS A 1 109 ? 40.129 17.141  12.024 1.00 37.00  ? 109 LYS A HZ3  1 
ATOM   1082 N N    . LEU A 1 110 ? 42.672 10.804  10.201 1.00 34.22  ? 110 LEU A N    1 
ATOM   1083 C CA   . LEU A 1 110 ? 43.190 9.461   9.993  1.00 33.55  ? 110 LEU A CA   1 
ATOM   1084 C C    . LEU A 1 110 ? 42.565 8.573   8.928  1.00 34.82  ? 110 LEU A C    1 
ATOM   1085 O O    . LEU A 1 110 ? 41.354 8.397   8.901  1.00 38.10  ? 110 LEU A O    1 
ATOM   1086 C CB   . LEU A 1 110 ? 43.101 8.673   11.297 1.00 26.08  ? 110 LEU A CB   1 
ATOM   1087 C CG   . LEU A 1 110 ? 43.850 9.140   12.527 1.00 31.41  ? 110 LEU A CG   1 
ATOM   1088 C CD1  . LEU A 1 110 ? 43.644 8.107   13.623 1.00 35.06  ? 110 LEU A CD1  1 
ATOM   1089 C CD2  . LEU A 1 110 ? 45.324 9.294   12.217 1.00 26.00  ? 110 LEU A CD2  1 
ATOM   1090 H H    . LEU A 1 110 ? 42.052 10.947  10.947 1.00 37.00  ? 110 LEU A H    1 
ATOM   1091 N N    . GLU A 1 111 ? 43.418 7.940   8.122  1.00 35.53  ? 111 GLU A N    1 
ATOM   1092 C CA   . GLU A 1 111 ? 43.002 6.968   7.106  1.00 26.37  ? 111 GLU A CA   1 
ATOM   1093 C C    . GLU A 1 111 ? 43.827 5.746   7.438  1.00 22.62  ? 111 GLU A C    1 
ATOM   1094 O O    . GLU A 1 111 ? 44.913 5.868   7.999  1.00 28.64  ? 111 GLU A O    1 
ATOM   1095 C CB   . GLU A 1 111 ? 43.385 7.384   5.687  1.00 29.80  ? 111 GLU A CB   1 
ATOM   1096 C CG   . GLU A 1 111 ? 42.586 8.534   5.101  1.00 44.11  ? 111 GLU A CG   1 
ATOM   1097 C CD   . GLU A 1 111 ? 43.027 8.861   3.689  1.00 40.77  ? 111 GLU A CD   1 
ATOM   1098 O OE1  . GLU A 1 111 ? 44.138 9.407   3.521  1.00 46.42  ? 111 GLU A OE1  1 
ATOM   1099 O OE2  . GLU A 1 111 ? 42.269 8.557   2.747  1.00 49.27  ? 111 GLU A OE2  1 
ATOM   1100 H H    . GLU A 1 111 ? 44.374 8.129   8.215  1.00 37.00  ? 111 GLU A H    1 
ATOM   1101 N N    . PHE A 1 112 ? 43.293 4.569   7.170  1.00 16.12  ? 112 PHE A N    1 
ATOM   1102 C CA   . PHE A 1 112 ? 44.036 3.354   7.406  1.00 9.63   ? 112 PHE A CA   1 
ATOM   1103 C C    . PHE A 1 112 ? 44.068 2.547   6.113  1.00 15.43  ? 112 PHE A C    1 
ATOM   1104 O O    . PHE A 1 112 ? 43.099 1.875   5.753  1.00 19.01  ? 112 PHE A O    1 
ATOM   1105 C CB   . PHE A 1 112 ? 43.425 2.519   8.508  1.00 8.87   ? 112 PHE A CB   1 
ATOM   1106 C CG   . PHE A 1 112 ? 43.491 3.142   9.848  1.00 19.34  ? 112 PHE A CG   1 
ATOM   1107 C CD1  . PHE A 1 112 ? 42.530 4.074   10.243 1.00 20.57  ? 112 PHE A CD1  1 
ATOM   1108 C CD2  . PHE A 1 112 ? 44.492 2.786   10.736 1.00 10.07  ? 112 PHE A CD2  1 
ATOM   1109 C CE1  . PHE A 1 112 ? 42.570 4.648   11.519 1.00 15.91  ? 112 PHE A CE1  1 
ATOM   1110 C CE2  . PHE A 1 112 ? 44.553 3.351   12.013 1.00 15.39  ? 112 PHE A CE2  1 
ATOM   1111 C CZ   . PHE A 1 112 ? 43.590 4.284   12.403 1.00 24.64  ? 112 PHE A CZ   1 
ATOM   1112 H H    . PHE A 1 112 ? 42.384 4.505   6.839  1.00 37.00  ? 112 PHE A H    1 
ATOM   1113 N N    . GLU A 1 113 ? 45.174 2.662   5.384  1.00 31.38  ? 113 GLU A N    1 
ATOM   1114 C CA   . GLU A 1 113 ? 45.334 1.932   4.131  1.00 24.87  ? 113 GLU A CA   1 
ATOM   1115 C C    . GLU A 1 113 ? 45.830 0.547   4.469  1.00 20.62  ? 113 GLU A C    1 
ATOM   1116 O O    . GLU A 1 113 ? 46.536 0.360   5.457  1.00 19.26  ? 113 GLU A O    1 
ATOM   1117 C CB   . GLU A 1 113 ? 46.318 2.644   3.218  1.00 27.61  ? 113 GLU A CB   1 
ATOM   1118 C CG   . GLU A 1 113 ? 46.582 1.907   1.927  1.00 40.28  ? 113 GLU A CG   1 
ATOM   1119 C CD   . GLU A 1 113 ? 47.548 2.645   1.038  1.00 42.27  ? 113 GLU A CD   1 
ATOM   1120 O OE1  . GLU A 1 113 ? 48.662 3.004   1.498  1.00 50.25  ? 113 GLU A OE1  1 
ATOM   1121 O OE2  . GLU A 1 113 ? 47.184 2.869   -0.131 1.00 48.34  ? 113 GLU A OE2  1 
ATOM   1122 H H    . GLU A 1 113 ? 45.902 3.236   5.700  1.00 37.00  ? 113 GLU A H    1 
ATOM   1123 N N    . SER A 1 114 ? 45.411 -0.437  3.693  1.00 17.44  ? 114 SER A N    1 
ATOM   1124 C CA   . SER A 1 114 ? 45.825 -1.783  3.975  1.00 25.12  ? 114 SER A CA   1 
ATOM   1125 C C    . SER A 1 114 ? 47.163 -2.003  3.330  1.00 28.69  ? 114 SER A C    1 
ATOM   1126 O O    . SER A 1 114 ? 47.301 -1.771  2.130  1.00 34.33  ? 114 SER A O    1 
ATOM   1127 C CB   . SER A 1 114 ? 44.817 -2.791  3.435  1.00 18.29  ? 114 SER A CB   1 
ATOM   1128 O OG   . SER A 1 114 ? 45.221 -4.096  3.807  1.00 37.49  ? 114 SER A OG   1 
ATOM   1129 H H    . SER A 1 114 ? 44.844 -0.256  2.918  1.00 37.00  ? 114 SER A H    1 
ATOM   1130 H HG   . SER A 1 114 ? 45.296 -4.125  4.765  1.00 37.00  ? 114 SER A HG   1 
ATOM   1131 N N    . ALA A 1 115 ? 48.150 -2.415  4.130  1.00 34.14  ? 115 ALA A N    1 
ATOM   1132 C CA   . ALA A 1 115 ? 49.502 -2.702  3.626  1.00 34.21  ? 115 ALA A CA   1 
ATOM   1133 C C    . ALA A 1 115 ? 49.403 -3.846  2.636  1.00 30.16  ? 115 ALA A C    1 
ATOM   1134 O O    . ALA A 1 115 ? 50.031 -3.824  1.583  1.00 38.72  ? 115 ALA A O    1 
ATOM   1135 C CB   . ALA A 1 115 ? 50.434 -3.084  4.755  1.00 27.17  ? 115 ALA A CB   1 
ATOM   1136 H H    . ALA A 1 115 ? 47.959 -2.505  5.078  1.00 37.00  ? 115 ALA A H    1 
ATOM   1137 N N    . GLN A 1 116 ? 48.595 -4.840  2.979  1.00 30.95  ? 116 GLN A N    1 
ATOM   1138 C CA   . GLN A 1 116 ? 48.383 -5.974  2.099  1.00 32.33  ? 116 GLN A CA   1 
ATOM   1139 C C    . GLN A 1 116 ? 47.764 -5.503  0.795  1.00 33.01  ? 116 GLN A C    1 
ATOM   1140 O O    . GLN A 1 116 ? 48.320 -5.728  -0.275 1.00 47.75  ? 116 GLN A O    1 
ATOM   1141 C CB   . GLN A 1 116 ? 47.431 -6.986  2.744  1.00 40.30  ? 116 GLN A CB   1 
ATOM   1142 C CG   . GLN A 1 116 ? 47.246 -8.243  1.929  1.00 31.59  ? 116 GLN A CG   1 
ATOM   1143 C CD   . GLN A 1 116 ? 48.473 -9.125  1.961  1.00 49.43  ? 116 GLN A CD   1 
ATOM   1144 O OE1  . GLN A 1 116 ? 48.536 -10.081 2.736  1.00 57.59  ? 116 GLN A OE1  1 
ATOM   1145 N NE2  . GLN A 1 116 ? 49.472 -8.790  1.151  1.00 41.78  ? 116 GLN A NE2  1 
ATOM   1146 H H    . GLN A 1 116 ? 48.128 -4.811  3.839  1.00 37.00  ? 116 GLN A H    1 
ATOM   1147 H HE21 . GLN A 1 116 ? 50.276 -9.351  1.174  1.00 37.00  ? 116 GLN A HE21 1 
ATOM   1148 H HE22 . GLN A 1 116 ? 49.381 -8.008  0.570  1.00 37.00  ? 116 GLN A HE22 1 
ATOM   1149 N N    . PHE A 1 117 ? 46.634 -4.808  0.895  1.00 29.10  ? 117 PHE A N    1 
ATOM   1150 C CA   . PHE A 1 117 ? 45.923 -4.344  -0.286 1.00 28.21  ? 117 PHE A CA   1 
ATOM   1151 C C    . PHE A 1 117 ? 45.860 -2.850  -0.468 1.00 29.60  ? 117 PHE A C    1 
ATOM   1152 O O    . PHE A 1 117 ? 44.807 -2.265  -0.283 1.00 33.81  ? 117 PHE A O    1 
ATOM   1153 C CB   . PHE A 1 117 ? 44.502 -4.900  -0.294 1.00 26.72  ? 117 PHE A CB   1 
ATOM   1154 C CG   . PHE A 1 117 ? 44.451 -6.384  -0.304 1.00 27.95  ? 117 PHE A CG   1 
ATOM   1155 C CD1  . PHE A 1 117 ? 44.768 -7.091  -1.464 1.00 32.67  ? 117 PHE A CD1  1 
ATOM   1156 C CD2  . PHE A 1 117 ? 44.109 -7.083  0.847  1.00 35.76  ? 117 PHE A CD2  1 
ATOM   1157 C CE1  . PHE A 1 117 ? 44.750 -8.469  -1.487 1.00 27.32  ? 117 PHE A CE1  1 
ATOM   1158 C CE2  . PHE A 1 117 ? 44.083 -8.465  0.849  1.00 31.82  ? 117 PHE A CE2  1 
ATOM   1159 C CZ   . PHE A 1 117 ? 44.404 -9.165  -0.321 1.00 45.39  ? 117 PHE A CZ   1 
ATOM   1160 H H    . PHE A 1 117 ? 46.288 -4.590  1.785  1.00 37.00  ? 117 PHE A H    1 
ATOM   1161 N N    . PRO A 1 118 ? 46.987 -2.210  -0.837 1.00 35.33  ? 118 PRO A N    1 
ATOM   1162 C CA   . PRO A 1 118 ? 46.998 -0.760  -1.040 1.00 33.40  ? 118 PRO A CA   1 
ATOM   1163 C C    . PRO A 1 118 ? 45.822 -0.285  -1.900 1.00 31.94  ? 118 PRO A C    1 
ATOM   1164 O O    . PRO A 1 118 ? 45.332 -1.025  -2.754 1.00 34.88  ? 118 PRO A O    1 
ATOM   1165 C CB   . PRO A 1 118 ? 48.355 -0.525  -1.715 1.00 32.04  ? 118 PRO A CB   1 
ATOM   1166 C CG   . PRO A 1 118 ? 48.783 -1.904  -2.189 1.00 32.28  ? 118 PRO A CG   1 
ATOM   1167 C CD   . PRO A 1 118 ? 48.329 -2.757  -1.082 1.00 28.05  ? 118 PRO A CD   1 
ATOM   1168 N N    . ASN A 1 119 ? 45.363 0.938   -1.629 1.00 30.84  ? 119 ASN A N    1 
ATOM   1169 C CA   . ASN A 1 119 ? 44.228 1.575   -2.315 1.00 27.20  ? 119 ASN A CA   1 
ATOM   1170 C C    . ASN A 1 119 ? 42.889 1.035   -1.815 1.00 29.61  ? 119 ASN A C    1 
ATOM   1171 O O    . ASN A 1 119 ? 41.866 1.175   -2.480 1.00 40.64  ? 119 ASN A O    1 
ATOM   1172 C CB   . ASN A 1 119 ? 44.323 1.436   -3.842 1.00 32.43  ? 119 ASN A CB   1 
ATOM   1173 C CG   . ASN A 1 119 ? 45.564 2.111   -4.418 1.00 38.76  ? 119 ASN A CG   1 
ATOM   1174 O OD1  . ASN A 1 119 ? 46.332 1.482   -5.148 1.00 45.99  ? 119 ASN A OD1  1 
ATOM   1175 N ND2  . ASN A 1 119 ? 45.771 3.387   -4.082 1.00 34.35  ? 119 ASN A ND2  1 
ATOM   1176 H H    . ASN A 1 119 ? 45.816 1.448   -0.928 1.00 37.00  ? 119 ASN A H    1 
ATOM   1177 H HD21 . ASN A 1 119 ? 46.559 3.845   -4.443 1.00 37.00  ? 119 ASN A HD21 1 
ATOM   1178 H HD22 . ASN A 1 119 ? 45.120 3.817   -3.490 1.00 37.00  ? 119 ASN A HD22 1 
ATOM   1179 N N    . TRP A 1 120 ? 42.931 0.407   -0.642 1.00 28.91  ? 120 TRP A N    1 
ATOM   1180 C CA   . TRP A 1 120 ? 41.779 -0.175  0.038  1.00 25.47  ? 120 TRP A CA   1 
ATOM   1181 C C    . TRP A 1 120 ? 41.940 0.231   1.508  1.00 30.30  ? 120 TRP A C    1 
ATOM   1182 O O    . TRP A 1 120 ? 42.957 -0.089  2.134  1.00 29.93  ? 120 TRP A O    1 
ATOM   1183 C CB   . TRP A 1 120 ? 41.785 -1.703  -0.121 1.00 24.40  ? 120 TRP A CB   1 
ATOM   1184 C CG   . TRP A 1 120 ? 41.330 -2.142  -1.473 1.00 25.66  ? 120 TRP A CG   1 
ATOM   1185 C CD1  . TRP A 1 120 ? 42.051 -2.127  -2.634 1.00 34.24  ? 120 TRP A CD1  1 
ATOM   1186 C CD2  . TRP A 1 120 ? 40.008 -2.533  -1.831 1.00 33.01  ? 120 TRP A CD2  1 
ATOM   1187 N NE1  . TRP A 1 120 ? 41.254 -2.462  -3.697 1.00 19.02  ? 120 TRP A NE1  1 
ATOM   1188 C CE2  . TRP A 1 120 ? 39.989 -2.710  -3.234 1.00 36.21  ? 120 TRP A CE2  1 
ATOM   1189 C CE3  . TRP A 1 120 ? 38.825 -2.740  -1.104 1.00 28.52  ? 120 TRP A CE3  1 
ATOM   1190 C CZ2  . TRP A 1 120 ? 38.827 -3.077  -3.923 1.00 29.56  ? 120 TRP A CZ2  1 
ATOM   1191 C CZ3  . TRP A 1 120 ? 37.682 -3.105  -1.785 1.00 24.01  ? 120 TRP A CZ3  1 
ATOM   1192 C CH2  . TRP A 1 120 ? 37.690 -3.268  -3.180 1.00 28.46  ? 120 TRP A CH2  1 
ATOM   1193 H H    . TRP A 1 120 ? 43.800 0.323   -0.200 1.00 37.00  ? 120 TRP A H    1 
ATOM   1194 H HE1  . TRP A 1 120 ? 41.557 -2.527  -4.610 1.00 37.00  ? 120 TRP A HE1  1 
ATOM   1195 N N    . TYR A 1 121 ? 40.961 0.972   2.036  1.00 31.68  ? 121 TYR A N    1 
ATOM   1196 C CA   . TYR A 1 121 ? 41.028 1.468   3.417  1.00 36.77  ? 121 TYR A CA   1 
ATOM   1197 C C    . TYR A 1 121 ? 39.877 1.049   4.286  1.00 27.18  ? 121 TYR A C    1 
ATOM   1198 O O    . TYR A 1 121 ? 38.827 0.681   3.787  1.00 31.89  ? 121 TYR A O    1 
ATOM   1199 C CB   . TYR A 1 121 ? 41.031 2.999   3.439  1.00 35.73  ? 121 TYR A CB   1 
ATOM   1200 C CG   . TYR A 1 121 ? 42.012 3.651   2.497  1.00 45.55  ? 121 TYR A CG   1 
ATOM   1201 C CD1  . TYR A 1 121 ? 41.801 3.619   1.114  1.00 35.83  ? 121 TYR A CD1  1 
ATOM   1202 C CD2  . TYR A 1 121 ? 43.138 4.338   2.986  1.00 38.40  ? 121 TYR A CD2  1 
ATOM   1203 C CE1  . TYR A 1 121 ? 42.680 4.253   0.241  1.00 46.62  ? 121 TYR A CE1  1 
ATOM   1204 C CE2  . TYR A 1 121 ? 44.022 4.979   2.121  1.00 36.45  ? 121 TYR A CE2  1 
ATOM   1205 C CZ   . TYR A 1 121 ? 43.786 4.934   0.748  1.00 38.97  ? 121 TYR A CZ   1 
ATOM   1206 O OH   . TYR A 1 121 ? 44.629 5.573   -0.134 1.00 41.32  ? 121 TYR A OH   1 
ATOM   1207 H H    . TYR A 1 121 ? 40.188 1.206   1.488  1.00 37.00  ? 121 TYR A H    1 
ATOM   1208 H HH   . TYR A 1 121 ? 45.322 6.029   0.348  1.00 37.00  ? 121 TYR A HH   1 
ATOM   1209 N N    . ILE A 1 122 ? 40.074 1.171   5.595  1.00 23.43  ? 122 ILE A N    1 
ATOM   1210 C CA   . ILE A 1 122 ? 39.033 0.867   6.566  1.00 23.51  ? 122 ILE A CA   1 
ATOM   1211 C C    . ILE A 1 122 ? 37.949 1.931   6.287  1.00 22.92  ? 122 ILE A C    1 
ATOM   1212 O O    . ILE A 1 122 ? 38.225 3.131   6.286  1.00 21.93  ? 122 ILE A O    1 
ATOM   1213 C CB   . ILE A 1 122 ? 39.552 0.997   8.015  1.00 20.04  ? 122 ILE A CB   1 
ATOM   1214 C CG1  . ILE A 1 122 ? 40.646 -0.036  8.285  1.00 21.40  ? 122 ILE A CG1  1 
ATOM   1215 C CG2  . ILE A 1 122 ? 38.412 0.784   8.995  1.00 39.50  ? 122 ILE A CG2  1 
ATOM   1216 C CD1  . ILE A 1 122 ? 41.163 -0.053  9.724  1.00 11.29  ? 122 ILE A CD1  1 
ATOM   1217 H H    . ILE A 1 122 ? 40.937 1.511   5.913  1.00 37.00  ? 122 ILE A H    1 
ATOM   1218 N N    . SER A 1 123 ? 36.727 1.479   6.030  1.00 19.44  ? 123 SER A N    1 
ATOM   1219 C CA   . SER A 1 123 ? 35.641 2.378   5.679  1.00 22.02  ? 123 SER A CA   1 
ATOM   1220 C C    . SER A 1 123 ? 34.360 2.129   6.440  1.00 22.96  ? 123 SER A C    1 
ATOM   1221 O O    . SER A 1 123 ? 34.190 1.097   7.078  1.00 20.64  ? 123 SER A O    1 
ATOM   1222 C CB   . SER A 1 123 ? 35.311 2.246   4.179  1.00 26.24  ? 123 SER A CB   1 
ATOM   1223 O OG   . SER A 1 123 ? 36.414 2.522   3.329  1.00 30.49  ? 123 SER A OG   1 
ATOM   1224 H H    . SER A 1 123 ? 36.547 0.536   6.130  1.00 37.00  ? 123 SER A H    1 
ATOM   1225 H HG   . SER A 1 123 ? 36.731 3.408   3.507  1.00 37.00  ? 123 SER A HG   1 
ATOM   1226 N N    . THR A 1 124 ? 33.461 3.106   6.352  1.00 26.12  ? 124 THR A N    1 
ATOM   1227 C CA   . THR A 1 124 ? 32.135 3.024   6.955  1.00 26.72  ? 124 THR A CA   1 
ATOM   1228 C C    . THR A 1 124 ? 31.200 3.684   5.975  1.00 24.07  ? 124 THR A C    1 
ATOM   1229 O O    . THR A 1 124 ? 31.622 4.458   5.121  1.00 21.09  ? 124 THR A O    1 
ATOM   1230 C CB   . THR A 1 124 ? 31.984 3.773   8.300  1.00 29.02  ? 124 THR A CB   1 
ATOM   1231 O OG1  . THR A 1 124 ? 32.385 5.140   8.151  1.00 32.07  ? 124 THR A OG1  1 
ATOM   1232 C CG2  . THR A 1 124 ? 32.755 3.106   9.386  1.00 22.73  ? 124 THR A CG2  1 
ATOM   1233 H H    . THR A 1 124 ? 33.684 3.913   5.847  1.00 37.00  ? 124 THR A H    1 
ATOM   1234 H HG1  . THR A 1 124 ? 33.316 5.189   7.930  1.00 37.00  ? 124 THR A HG1  1 
ATOM   1235 N N    . SER A 1 125 ? 29.923 3.356   6.089  1.00 30.28  ? 125 SER A N    1 
ATOM   1236 C CA   . SER A 1 125 ? 28.921 3.933   5.213  1.00 24.85  ? 125 SER A CA   1 
ATOM   1237 C C    . SER A 1 125 ? 28.258 5.137   5.867  1.00 20.75  ? 125 SER A C    1 
ATOM   1238 O O    . SER A 1 125 ? 28.279 5.293   7.100  1.00 22.81  ? 125 SER A O    1 
ATOM   1239 C CB   . SER A 1 125 ? 27.868 2.885   4.889  1.00 27.87  ? 125 SER A CB   1 
ATOM   1240 O OG   . SER A 1 125 ? 28.492 1.674   4.530  1.00 33.03  ? 125 SER A OG   1 
ATOM   1241 H H    . SER A 1 125 ? 29.627 2.720   6.759  1.00 37.00  ? 125 SER A H    1 
ATOM   1242 H HG   . SER A 1 125 ? 29.036 1.361   5.257  1.00 37.00  ? 125 SER A HG   1 
ATOM   1243 N N    . GLN A 1 126 ? 27.673 5.988   5.031  1.00 24.29  ? 126 GLN A N    1 
ATOM   1244 C CA   . GLN A 1 126 ? 26.955 7.170   5.490  1.00 27.18  ? 126 GLN A CA   1 
ATOM   1245 C C    . GLN A 1 126 ? 25.778 6.645   6.312  1.00 28.28  ? 126 GLN A C    1 
ATOM   1246 O O    . GLN A 1 126 ? 25.323 7.255   7.279  1.00 39.25  ? 126 GLN A O    1 
ATOM   1247 C CB   . GLN A 1 126 ? 26.443 7.931   4.281  1.00 25.02  ? 126 GLN A CB   1 
ATOM   1248 C CG   . GLN A 1 126 ? 26.601 9.423   4.388  1.00 44.14  ? 126 GLN A CG   1 
ATOM   1249 C CD   . GLN A 1 126 ? 28.046 9.887   4.288  1.00 45.39  ? 126 GLN A CD   1 
ATOM   1250 O OE1  . GLN A 1 126 ? 28.391 10.949  4.805  1.00 51.31  ? 126 GLN A OE1  1 
ATOM   1251 N NE2  . GLN A 1 126 ? 28.888 9.117   3.589  1.00 50.27  ? 126 GLN A NE2  1 
ATOM   1252 H H    . GLN A 1 126 ? 27.732 5.820   4.068  1.00 37.00  ? 126 GLN A H    1 
ATOM   1253 H HE21 . GLN A 1 126 ? 29.826 9.396   3.556  1.00 37.00  ? 126 GLN A HE21 1 
ATOM   1254 H HE22 . GLN A 1 126 ? 28.555 8.306   3.151  1.00 37.00  ? 126 GLN A HE22 1 
ATOM   1255 N N    . ALA A 1 127 ? 25.361 5.441   5.955  1.00 31.07  ? 127 ALA A N    1 
ATOM   1256 C CA   . ALA A 1 127 ? 24.272 4.777   6.620  1.00 23.60  ? 127 ALA A CA   1 
ATOM   1257 C C    . ALA A 1 127 ? 24.572 4.509   8.071  1.00 20.20  ? 127 ALA A C    1 
ATOM   1258 O O    . ALA A 1 127 ? 25.708 4.274   8.469  1.00 38.05  ? 127 ALA A O    1 
ATOM   1259 C CB   . ALA A 1 127 ? 23.965 3.498   5.919  1.00 27.44  ? 127 ALA A CB   1 
ATOM   1260 H H    . ALA A 1 127 ? 25.817 4.965   5.233  1.00 37.00  ? 127 ALA A H    1 
ATOM   1261 N N    . GLU A 1 128 ? 23.511 4.530   8.852  1.00 20.58  ? 128 GLU A N    1 
ATOM   1262 C CA   . GLU A 1 128 ? 23.576 4.287   10.263 1.00 13.60  ? 128 GLU A CA   1 
ATOM   1263 C C    . GLU A 1 128 ? 23.588 2.786   10.460 1.00 15.78  ? 128 GLU A C    1 
ATOM   1264 O O    . GLU A 1 128 ? 23.008 2.036   9.667  1.00 30.81  ? 128 GLU A O    1 
ATOM   1265 C CB   . GLU A 1 128 ? 22.337 4.880   10.907 1.00 15.61  ? 128 GLU A CB   1 
ATOM   1266 C CG   . GLU A 1 128 ? 22.506 5.257   12.319 1.00 24.86  ? 128 GLU A CG   1 
ATOM   1267 C CD   . GLU A 1 128 ? 23.328 6.515   12.502 1.00 26.51  ? 128 GLU A CD   1 
ATOM   1268 O OE1  . GLU A 1 128 ? 23.016 7.577   11.926 1.00 17.99  ? 128 GLU A OE1  1 
ATOM   1269 O OE2  . GLU A 1 128 ? 24.298 6.435   13.260 1.00 28.47  ? 128 GLU A OE2  1 
ATOM   1270 H H    . GLU A 1 128 ? 22.639 4.720   8.450  1.00 37.00  ? 128 GLU A H    1 
ATOM   1271 N N    . ASN A 1 129 ? 24.324 2.346   11.474 1.00 27.39  ? 129 ASN A N    1 
ATOM   1272 C CA   . ASN A 1 129 ? 24.431 0.942   11.849 1.00 22.75  ? 129 ASN A CA   1 
ATOM   1273 C C    . ASN A 1 129 ? 24.828 -0.099  10.806 1.00 23.29  ? 129 ASN A C    1 
ATOM   1274 O O    . ASN A 1 129 ? 24.423 -1.250  10.885 1.00 34.26  ? 129 ASN A O    1 
ATOM   1275 C CB   . ASN A 1 129 ? 23.154 0.519   12.561 1.00 40.96  ? 129 ASN A CB   1 
ATOM   1276 C CG   . ASN A 1 129 ? 23.414 -0.468  13.662 1.00 50.50  ? 129 ASN A CG   1 
ATOM   1277 O OD1  . ASN A 1 129 ? 23.914 -0.111  14.736 1.00 51.09  ? 129 ASN A OD1  1 
ATOM   1278 N ND2  . ASN A 1 129 ? 23.075 -1.727  13.407 1.00 61.08  ? 129 ASN A ND2  1 
ATOM   1279 H H    . ASN A 1 129 ? 24.841 3.007   11.987 1.00 37.00  ? 129 ASN A H    1 
ATOM   1280 H HD21 . ASN A 1 129 ? 23.217 -2.417  14.082 1.00 37.00  ? 129 ASN A HD21 1 
ATOM   1281 H HD22 . ASN A 1 129 ? 22.678 -1.909  12.527 1.00 37.00  ? 129 ASN A HD22 1 
ATOM   1282 N N    . MET A 1 130 ? 25.644 0.289   9.844  1.00 26.89  ? 130 MET A N    1 
ATOM   1283 C CA   . MET A 1 130 ? 26.113 -0.665  8.842  1.00 37.44  ? 130 MET A CA   1 
ATOM   1284 C C    . MET A 1 130 ? 27.511 -1.162  9.274  1.00 38.33  ? 130 MET A C    1 
ATOM   1285 O O    . MET A 1 130 ? 28.181 -0.507  10.067 1.00 44.51  ? 130 MET A O    1 
ATOM   1286 C CB   . MET A 1 130 ? 26.132 -0.009  7.459  1.00 37.72  ? 130 MET A CB   1 
ATOM   1287 C CG   . MET A 1 130 ? 24.743 0.277   6.930  1.00 40.77  ? 130 MET A CG   1 
ATOM   1288 S SD   . MET A 1 130 ? 23.624 -1.160  7.082  1.00 56.39  ? 130 MET A SD   1 
ATOM   1289 C CE   . MET A 1 130 ? 22.441 -0.787  5.742  1.00 57.35  ? 130 MET A CE   1 
ATOM   1290 H H    . MET A 1 130 ? 25.949 1.218   9.809  1.00 37.00  ? 130 MET A H    1 
ATOM   1291 N N    . PRO A 1 131 ? 27.971 -2.318  8.763  1.00 36.18  ? 131 PRO A N    1 
ATOM   1292 C CA   . PRO A 1 131 ? 29.290 -2.807  9.173  1.00 36.66  ? 131 PRO A CA   1 
ATOM   1293 C C    . PRO A 1 131 ? 30.491 -2.001  8.673  1.00 34.77  ? 131 PRO A C    1 
ATOM   1294 O O    . PRO A 1 131 ? 30.386 -1.216  7.717  1.00 35.47  ? 131 PRO A O    1 
ATOM   1295 C CB   . PRO A 1 131 ? 29.302 -4.220  8.617  1.00 31.48  ? 131 PRO A CB   1 
ATOM   1296 C CG   . PRO A 1 131 ? 28.587 -4.039  7.340  1.00 36.56  ? 131 PRO A CG   1 
ATOM   1297 C CD   . PRO A 1 131 ? 27.391 -3.215  7.751  1.00 34.33  ? 131 PRO A CD   1 
ATOM   1298 N N    . VAL A 1 132 ? 31.593 -2.141  9.414  1.00 25.30  ? 132 VAL A N    1 
ATOM   1299 C CA   . VAL A 1 132 ? 32.877 -1.515  9.118  1.00 14.79  ? 132 VAL A CA   1 
ATOM   1300 C C    . VAL A 1 132 ? 33.482 -2.486  8.100  1.00 21.85  ? 132 VAL A C    1 
ATOM   1301 O O    . VAL A 1 132 ? 33.529 -3.689  8.356  1.00 24.50  ? 132 VAL A O    1 
ATOM   1302 C CB   . VAL A 1 132 ? 33.753 -1.485  10.388 1.00 16.38  ? 132 VAL A CB   1 
ATOM   1303 C CG1  . VAL A 1 132 ? 35.150 -1.005  10.061 1.00 27.16  ? 132 VAL A CG1  1 
ATOM   1304 C CG2  . VAL A 1 132 ? 33.114 -0.605  11.446 1.00 11.23  ? 132 VAL A CG2  1 
ATOM   1305 H H    . VAL A 1 132 ? 31.536 -2.676  10.226 1.00 37.00  ? 132 VAL A H    1 
ATOM   1306 N N    . PHE A 1 133 ? 33.889 -1.981  6.935  1.00 21.04  ? 133 PHE A N    1 
ATOM   1307 C CA   . PHE A 1 133 ? 34.454 -2.816  5.866  1.00 24.70  ? 133 PHE A CA   1 
ATOM   1308 C C    . PHE A 1 133 ? 35.727 -2.226  5.222  1.00 26.95  ? 133 PHE A C    1 
ATOM   1309 O O    . PHE A 1 133 ? 36.206 -1.186  5.631  1.00 22.86  ? 133 PHE A O    1 
ATOM   1310 C CB   . PHE A 1 133 ? 33.391 -2.996  4.769  1.00 29.98  ? 133 PHE A CB   1 
ATOM   1311 C CG   . PHE A 1 133 ? 32.902 -1.696  4.179  1.00 22.26  ? 133 PHE A CG   1 
ATOM   1312 C CD1  . PHE A 1 133 ? 32.070 -0.848  4.917  1.00 14.40  ? 133 PHE A CD1  1 
ATOM   1313 C CD2  . PHE A 1 133 ? 33.326 -1.287  2.917  1.00 21.16  ? 133 PHE A CD2  1 
ATOM   1314 C CE1  . PHE A 1 133 ? 31.678 0.387   4.416  1.00 23.28  ? 133 PHE A CE1  1 
ATOM   1315 C CE2  . PHE A 1 133 ? 32.937 -0.035  2.388  1.00 16.99  ? 133 PHE A CE2  1 
ATOM   1316 C CZ   . PHE A 1 133 ? 32.113 0.803   3.143  1.00 25.96  ? 133 PHE A CZ   1 
ATOM   1317 H H    . PHE A 1 133 ? 33.801 -1.019  6.777  1.00 37.00  ? 133 PHE A H    1 
ATOM   1318 N N    . LEU A 1 134 ? 36.291 -2.914  4.234  1.00 27.78  ? 134 LEU A N    1 
ATOM   1319 C CA   . LEU A 1 134 ? 37.456 -2.389  3.534  1.00 20.53  ? 134 LEU A CA   1 
ATOM   1320 C C    . LEU A 1 134 ? 36.873 -1.852  2.241  1.00 23.11  ? 134 LEU A C    1 
ATOM   1321 O O    . LEU A 1 134 ? 36.232 -2.587  1.492  1.00 25.88  ? 134 LEU A O    1 
ATOM   1322 C CB   . LEU A 1 134 ? 38.464 -3.494  3.226  1.00 29.56  ? 134 LEU A CB   1 
ATOM   1323 C CG   . LEU A 1 134 ? 39.939 -3.120  3.373  1.00 19.37  ? 134 LEU A CG   1 
ATOM   1324 C CD1  . LEU A 1 134 ? 40.258 -2.907  4.854  1.00 13.37  ? 134 LEU A CD1  1 
ATOM   1325 C CD2  . LEU A 1 134 ? 40.788 -4.239  2.830  1.00 21.24  ? 134 LEU A CD2  1 
ATOM   1326 H H    . LEU A 1 134 ? 35.909 -3.776  3.965  1.00 37.00  ? 134 LEU A H    1 
ATOM   1327 N N    . GLY A 1 135 ? 37.063 -0.564  1.993  1.00 26.67  ? 135 GLY A N    1 
ATOM   1328 C CA   . GLY A 1 135 ? 36.506 0.051   0.805  1.00 38.61  ? 135 GLY A CA   1 
ATOM   1329 C C    . GLY A 1 135 ? 37.599 0.471   -0.128 1.00 45.64  ? 135 GLY A C    1 
ATOM   1330 O O    . GLY A 1 135 ? 38.598 1.049   0.318  1.00 38.47  ? 135 GLY A O    1 
ATOM   1331 H H    . GLY A 1 135 ? 37.569 -0.018  2.613  1.00 37.00  ? 135 GLY A H    1 
ATOM   1332 N N    . GLY A 1 136 ? 37.374 0.241   -1.423 1.00 52.37  ? 136 GLY A N    1 
ATOM   1333 C CA   . GLY A 1 136 ? 38.383 0.548   -2.426 1.00 61.23  ? 136 GLY A CA   1 
ATOM   1334 C C    . GLY A 1 136 ? 38.334 1.819   -3.247 1.00 59.67  ? 136 GLY A C    1 
ATOM   1335 O O    . GLY A 1 136 ? 39.335 2.181   -3.874 1.00 48.36  ? 136 GLY A O    1 
ATOM   1336 H H    . GLY A 1 136 ? 36.516 -0.135  -1.712 1.00 37.00  ? 136 GLY A H    1 
ATOM   1337 N N    . THR A 1 137 ? 37.185 2.486   -3.275 1.00 72.97  ? 137 THR A N    1 
ATOM   1338 C CA   . THR A 1 137 ? 37.059 3.711   -4.058 1.00 82.49  ? 137 THR A CA   1 
ATOM   1339 C C    . THR A 1 137 ? 37.485 4.941   -3.241 1.00 91.91  ? 137 THR A C    1 
ATOM   1340 O O    . THR A 1 137 ? 37.747 6.019   -3.810 1.00 93.61  ? 137 THR A O    1 
ATOM   1341 C CB   . THR A 1 137 ? 35.624 3.874   -4.613 1.00 73.80  ? 137 THR A CB   1 
ATOM   1342 O OG1  . THR A 1 137 ? 35.143 2.596   -5.040 1.00 77.35  ? 137 THR A OG1  1 
ATOM   1343 C CG2  . THR A 1 137 ? 35.614 4.808   -5.825 1.00 82.11  ? 137 THR A CG2  1 
ATOM   1344 H H    . THR A 1 137 ? 36.416 2.144   -2.774 1.00 37.00  ? 137 THR A H    1 
ATOM   1345 H HG1  . THR A 1 137 ? 34.257 2.689   -5.396 1.00 37.00  ? 137 THR A HG1  1 
ATOM   1346 N N    . LYS A 1 138 ? 37.617 4.744   -1.923 1.00 93.54  ? 138 LYS A N    1 
ATOM   1347 C CA   . LYS A 1 138 ? 38.015 5.794   -0.976 1.00 96.66  ? 138 LYS A CA   1 
ATOM   1348 C C    . LYS A 1 138 ? 36.990 6.938   -0.893 1.00 100.00 ? 138 LYS A C    1 
ATOM   1349 O O    . LYS A 1 138 ? 36.304 7.082   0.122  1.00 100.00 ? 138 LYS A O    1 
ATOM   1350 C CB   . LYS A 1 138 ? 39.436 6.326   -1.286 1.00 95.57  ? 138 LYS A CB   1 
ATOM   1351 C CG   . LYS A 1 138 ? 40.029 7.267   -0.210 1.00 87.81  ? 138 LYS A CG   1 
ATOM   1352 C CD   . LYS A 1 138 ? 41.511 7.618   -0.426 1.00 72.27  ? 138 LYS A CD   1 
ATOM   1353 C CE   . LYS A 1 138 ? 41.759 8.513   -1.637 1.00 82.41  ? 138 LYS A CE   1 
ATOM   1354 N NZ   . LYS A 1 138 ? 41.552 7.831   -2.952 1.00 77.52  ? 138 LYS A NZ   1 
ATOM   1355 H H    . LYS A 1 138 ? 37.442 3.849   -1.565 1.00 37.00  ? 138 LYS A H    1 
ATOM   1356 H HZ1  . LYS A 1 138 ? 42.195 7.015   -3.015 1.00 37.00  ? 138 LYS A HZ1  1 
ATOM   1357 H HZ2  . LYS A 1 138 ? 40.569 7.505   -3.030 1.00 37.00  ? 138 LYS A HZ2  1 
ATOM   1358 H HZ3  . LYS A 1 138 ? 41.751 8.490   -3.732 1.00 37.00  ? 138 LYS A HZ3  1 
ATOM   1359 N N    . GLY A 1 139 ? 36.885 7.742   -1.954 1.00 100.00 ? 139 GLY A N    1 
ATOM   1360 C CA   . GLY A 1 139 ? 35.933 8.844   -1.962 1.00 100.00 ? 139 GLY A CA   1 
ATOM   1361 C C    . GLY A 1 139 ? 34.633 8.580   -2.717 1.00 100.00 ? 139 GLY A C    1 
ATOM   1362 O O    . GLY A 1 139 ? 33.875 9.521   -2.979 1.00 100.00 ? 139 GLY A O    1 
ATOM   1363 H H    . GLY A 1 139 ? 37.459 7.619   -2.734 1.00 37.00  ? 139 GLY A H    1 
ATOM   1364 N N    . GLY A 1 140 ? 34.361 7.310   -3.031 1.00 100.00 ? 140 GLY A N    1 
ATOM   1365 C CA   . GLY A 1 140 ? 33.157 6.937   -3.761 1.00 95.22  ? 140 GLY A CA   1 
ATOM   1366 C C    . GLY A 1 140 ? 31.886 7.469   -3.132 1.00 94.21  ? 140 GLY A C    1 
ATOM   1367 O O    . GLY A 1 140 ? 30.866 7.620   -3.810 1.00 96.71  ? 140 GLY A O    1 
ATOM   1368 H H    . GLY A 1 140 ? 34.990 6.606   -2.765 1.00 37.00  ? 140 GLY A H    1 
ATOM   1369 N N    . GLN A 1 141 ? 31.990 7.779   -1.839 1.00 88.47  ? 141 GLN A N    1 
ATOM   1370 C CA   . GLN A 1 141 ? 30.921 8.315   -0.986 1.00 80.18  ? 141 GLN A CA   1 
ATOM   1371 C C    . GLN A 1 141 ? 31.120 7.683   0.395  1.00 73.88  ? 141 GLN A C    1 
ATOM   1372 O O    . GLN A 1 141 ? 30.541 8.123   1.394  1.00 68.27  ? 141 GLN A O    1 
ATOM   1373 C CB   . GLN A 1 141 ? 29.529 7.950   -1.502 1.00 81.00  ? 141 GLN A CB   1 
ATOM   1374 C CG   . GLN A 1 141 ? 28.408 8.610   -0.730 1.00 90.54  ? 141 GLN A CG   1 
ATOM   1375 C CD   . GLN A 1 141 ? 27.060 7.963   -0.977 1.00 97.31  ? 141 GLN A CD   1 
ATOM   1376 O OE1  . GLN A 1 141 ? 26.926 7.073   -1.827 1.00 93.12  ? 141 GLN A OE1  1 
ATOM   1377 N NE2  . GLN A 1 141 ? 26.049 8.399   -0.223 1.00 94.00  ? 141 GLN A NE2  1 
ATOM   1378 H H    . GLN A 1 141 ? 32.855 7.637   -1.406 1.00 37.00  ? 141 GLN A H    1 
ATOM   1379 H HE21 . GLN A 1 141 ? 25.162 8.004   -0.354 1.00 37.00  ? 141 GLN A HE21 1 
ATOM   1380 H HE22 . GLN A 1 141 ? 26.239 9.101   0.433  1.00 37.00  ? 141 GLN A HE22 1 
ATOM   1381 N N    . ASP A 1 142 ? 31.918 6.617   0.428  1.00 63.35  ? 142 ASP A N    1 
ATOM   1382 C CA   . ASP A 1 142 ? 32.198 5.923   1.666  1.00 49.40  ? 142 ASP A CA   1 
ATOM   1383 C C    . ASP A 1 142 ? 33.283 6.637   2.447  1.00 41.12  ? 142 ASP A C    1 
ATOM   1384 O O    . ASP A 1 142 ? 34.172 7.254   1.879  1.00 44.95  ? 142 ASP A O    1 
ATOM   1385 C CB   . ASP A 1 142 ? 32.523 4.459   1.406  1.00 56.26  ? 142 ASP A CB   1 
ATOM   1386 C CG   . ASP A 1 142 ? 31.281 3.644   1.040  1.00 58.68  ? 142 ASP A CG   1 
ATOM   1387 O OD1  . ASP A 1 142 ? 30.138 4.052   1.368  1.00 61.82  ? 142 ASP A OD1  1 
ATOM   1388 O OD2  . ASP A 1 142 ? 31.448 2.581   0.423  1.00 64.05  ? 142 ASP A OD2  1 
ATOM   1389 H H    . ASP A 1 142 ? 32.330 6.291   -0.399 1.00 37.00  ? 142 ASP A H    1 
ATOM   1390 N N    . ILE A 1 143 ? 33.137 6.602   3.760  1.00 34.23  ? 143 ILE A N    1 
ATOM   1391 C CA   . ILE A 1 143 ? 34.021 7.274   4.686  1.00 33.52  ? 143 ILE A CA   1 
ATOM   1392 C C    . ILE A 1 143 ? 35.277 6.465   4.962  1.00 33.95  ? 143 ILE A C    1 
ATOM   1393 O O    . ILE A 1 143 ? 35.211 5.306   5.365  1.00 37.89  ? 143 ILE A O    1 
ATOM   1394 C CB   . ILE A 1 143 ? 33.263 7.561   6.024  1.00 36.79  ? 143 ILE A CB   1 
ATOM   1395 C CG1  . ILE A 1 143 ? 31.987 8.383   5.759  1.00 25.90  ? 143 ILE A CG1  1 
ATOM   1396 C CG2  . ILE A 1 143 ? 34.175 8.252   7.016  1.00 33.75  ? 143 ILE A CG2  1 
ATOM   1397 C CD1  . ILE A 1 143 ? 30.960 8.286   6.866  1.00 27.44  ? 143 ILE A CD1  1 
ATOM   1398 H H    . ILE A 1 143 ? 32.383 6.095   4.123  1.00 37.00  ? 143 ILE A H    1 
ATOM   1399 N N    . THR A 1 144 ? 36.420 7.106   4.743  1.00 39.95  ? 144 THR A N    1 
ATOM   1400 C CA   . THR A 1 144 ? 37.732 6.502   4.950  1.00 32.30  ? 144 THR A CA   1 
ATOM   1401 C C    . THR A 1 144 ? 38.558 7.352   5.900  1.00 30.31  ? 144 THR A C    1 
ATOM   1402 O O    . THR A 1 144 ? 39.754 7.117   6.041  1.00 43.73  ? 144 THR A O    1 
ATOM   1403 C CB   . THR A 1 144 ? 38.500 6.406   3.633  1.00 35.49  ? 144 THR A CB   1 
ATOM   1404 O OG1  . THR A 1 144 ? 38.611 7.711   3.043  1.00 31.94  ? 144 THR A OG1  1 
ATOM   1405 C CG2  . THR A 1 144 ? 37.774 5.488   2.684  1.00 22.85  ? 144 THR A CG2  1 
ATOM   1406 H H    . THR A 1 144 ? 36.380 8.032   4.426  1.00 37.00  ? 144 THR A H    1 
ATOM   1407 H HG1  . THR A 1 144 ? 39.140 7.662   2.245  1.00 37.00  ? 144 THR A HG1  1 
ATOM   1408 N N    . ASP A 1 145 ? 37.916 8.356   6.507  1.00 29.42  ? 145 ASP A N    1 
ATOM   1409 C CA   . ASP A 1 145 ? 38.539 9.283   7.449  1.00 26.53  ? 145 ASP A CA   1 
ATOM   1410 C C    . ASP A 1 145 ? 37.994 9.058   8.848  1.00 28.80  ? 145 ASP A C    1 
ATOM   1411 O O    . ASP A 1 145 ? 36.791 8.856   9.013  1.00 28.04  ? 145 ASP A O    1 
ATOM   1412 C CB   . ASP A 1 145 ? 38.288 10.728  7.019  1.00 28.80  ? 145 ASP A CB   1 
ATOM   1413 C CG   . ASP A 1 145 ? 39.055 11.098  5.763  1.00 48.21  ? 145 ASP A CG   1 
ATOM   1414 O OD1  . ASP A 1 145 ? 40.315 11.036  5.778  1.00 51.90  ? 145 ASP A OD1  1 
ATOM   1415 O OD2  . ASP A 1 145 ? 38.399 11.433  4.751  1.00 56.73  ? 145 ASP A OD2  1 
ATOM   1416 H H    . ASP A 1 145 ? 36.967 8.496   6.303  1.00 37.00  ? 145 ASP A H    1 
ATOM   1417 N N    . PHE A 1 146 ? 38.887 9.105   9.844  1.00 23.66  ? 146 PHE A N    1 
ATOM   1418 C CA   . PHE A 1 146 ? 38.554 8.875   11.251 1.00 11.90  ? 146 PHE A CA   1 
ATOM   1419 C C    . PHE A 1 146 ? 39.264 9.842   12.206 1.00 19.80  ? 146 PHE A C    1 
ATOM   1420 O O    . PHE A 1 146 ? 40.076 10.664  11.788 1.00 26.04  ? 146 PHE A O    1 
ATOM   1421 C CB   . PHE A 1 146 ? 38.942 7.454   11.641 1.00 23.14  ? 146 PHE A CB   1 
ATOM   1422 C CG   . PHE A 1 146 ? 38.227 6.382   10.856 1.00 28.76  ? 146 PHE A CG   1 
ATOM   1423 C CD1  . PHE A 1 146 ? 38.651 6.040   9.575  1.00 15.06  ? 146 PHE A CD1  1 
ATOM   1424 C CD2  . PHE A 1 146 ? 37.150 5.686   11.420 1.00 15.89  ? 146 PHE A CD2  1 
ATOM   1425 C CE1  . PHE A 1 146 ? 38.021 5.026   8.865  1.00 19.72  ? 146 PHE A CE1  1 
ATOM   1426 C CE2  . PHE A 1 146 ? 36.510 4.664   10.715 1.00 14.66  ? 146 PHE A CE2  1 
ATOM   1427 C CZ   . PHE A 1 146 ? 36.942 4.333   9.441  1.00 13.17  ? 146 PHE A CZ   1 
ATOM   1428 H H    . PHE A 1 146 ? 39.812 9.329   9.629  1.00 37.00  ? 146 PHE A H    1 
ATOM   1429 N N    . THR A 1 147 ? 38.941 9.720   13.496 1.00 24.99  ? 147 THR A N    1 
ATOM   1430 C CA   . THR A 1 147 ? 39.499 10.534  14.598 1.00 11.58  ? 147 THR A CA   1 
ATOM   1431 C C    . THR A 1 147 ? 39.870 9.502   15.634 1.00 9.37   ? 147 THR A C    1 
ATOM   1432 O O    . THR A 1 147 ? 39.269 8.422   15.702 1.00 19.52  ? 147 THR A O    1 
ATOM   1433 C CB   . THR A 1 147 ? 38.430 11.459  15.256 1.00 14.56  ? 147 THR A CB   1 
ATOM   1434 O OG1  . THR A 1 147 ? 37.675 12.118  14.235 1.00 39.68  ? 147 THR A OG1  1 
ATOM   1435 C CG2  . THR A 1 147 ? 39.085 12.521  16.115 1.00 34.40  ? 147 THR A CG2  1 
ATOM   1436 H H    . THR A 1 147 ? 38.303 9.021   13.737 1.00 37.00  ? 147 THR A H    1 
ATOM   1437 H HG1  . THR A 1 147 ? 37.240 11.457  13.689 1.00 37.00  ? 147 THR A HG1  1 
ATOM   1438 N N    . MET A 1 148 ? 40.826 9.831   16.476 1.00 17.76  ? 148 MET A N    1 
ATOM   1439 C CA   . MET A 1 148 ? 41.264 8.876   17.476 1.00 15.84  ? 148 MET A CA   1 
ATOM   1440 C C    . MET A 1 148 ? 41.234 9.527   18.808 1.00 15.34  ? 148 MET A C    1 
ATOM   1441 O O    . MET A 1 148 ? 41.521 10.716  18.956 1.00 21.00  ? 148 MET A O    1 
ATOM   1442 C CB   . MET A 1 148 ? 42.701 8.422   17.173 1.00 32.97  ? 148 MET A CB   1 
ATOM   1443 C CG   . MET A 1 148 ? 43.245 7.309   18.073 1.00 33.56  ? 148 MET A CG   1 
ATOM   1444 S SD   . MET A 1 148 ? 44.854 6.746   17.461 1.00 44.67  ? 148 MET A SD   1 
ATOM   1445 C CE   . MET A 1 148 ? 44.390 5.604   16.187 1.00 31.49  ? 148 MET A CE   1 
ATOM   1446 H H    . MET A 1 148 ? 41.227 10.722  16.438 1.00 37.00  ? 148 MET A H    1 
ATOM   1447 N N    . GLN A 1 149 ? 40.810 8.748   19.775 1.00 24.57  ? 149 GLN A N    1 
ATOM   1448 C CA   . GLN A 1 149 ? 40.775 9.212   21.134 1.00 25.77  ? 149 GLN A CA   1 
ATOM   1449 C C    . GLN A 1 149 ? 41.559 8.163   21.915 1.00 33.23  ? 149 GLN A C    1 
ATOM   1450 O O    . GLN A 1 149 ? 41.363 6.958   21.736 1.00 30.31  ? 149 GLN A O    1 
ATOM   1451 C CB   . GLN A 1 149 ? 39.336 9.316   21.615 1.00 37.58  ? 149 GLN A CB   1 
ATOM   1452 C CG   . GLN A 1 149 ? 38.620 10.527  21.088 1.00 57.02  ? 149 GLN A CG   1 
ATOM   1453 C CD   . GLN A 1 149 ? 39.081 11.788  21.784 1.00 71.89  ? 149 GLN A CD   1 
ATOM   1454 O OE1  . GLN A 1 149 ? 38.756 12.018  22.956 1.00 74.25  ? 149 GLN A OE1  1 
ATOM   1455 N NE2  . GLN A 1 149 ? 39.861 12.609  21.075 1.00 81.12  ? 149 GLN A NE2  1 
ATOM   1456 H H    . GLN A 1 149 ? 40.485 7.851   19.553 1.00 37.00  ? 149 GLN A H    1 
ATOM   1457 H HE21 . GLN A 1 149 ? 40.165 13.443  21.493 1.00 37.00  ? 149 GLN A HE21 1 
ATOM   1458 H HE22 . GLN A 1 149 ? 40.090 12.341  20.161 1.00 37.00  ? 149 GLN A HE22 1 
ATOM   1459 N N    . PHE A 1 150 ? 42.522 8.628   22.697 1.00 29.49  ? 150 PHE A N    1 
ATOM   1460 C CA   . PHE A 1 150 ? 43.343 7.735   23.486 1.00 34.58  ? 150 PHE A CA   1 
ATOM   1461 C C    . PHE A 1 150 ? 42.672 7.466   24.795 1.00 28.44  ? 150 PHE A C    1 
ATOM   1462 O O    . PHE A 1 150 ? 42.059 8.346   25.362 1.00 36.38  ? 150 PHE A O    1 
ATOM   1463 C CB   . PHE A 1 150 ? 44.722 8.356   23.730 1.00 35.72  ? 150 PHE A CB   1 
ATOM   1464 C CG   . PHE A 1 150 ? 45.484 8.632   22.466 1.00 31.51  ? 150 PHE A CG   1 
ATOM   1465 C CD1  . PHE A 1 150 ? 45.956 7.578   21.683 1.00 17.12  ? 150 PHE A CD1  1 
ATOM   1466 C CD2  . PHE A 1 150 ? 45.684 9.943   22.033 1.00 32.72  ? 150 PHE A CD2  1 
ATOM   1467 C CE1  . PHE A 1 150 ? 46.610 7.824   20.485 1.00 33.63  ? 150 PHE A CE1  1 
ATOM   1468 C CE2  . PHE A 1 150 ? 46.340 10.200  20.831 1.00 35.18  ? 150 PHE A CE2  1 
ATOM   1469 C CZ   . PHE A 1 150 ? 46.802 9.138   20.054 1.00 28.51  ? 150 PHE A CZ   1 
ATOM   1470 H H    . PHE A 1 150 ? 42.700 9.591   22.718 1.00 37.00  ? 150 PHE A H    1 
ATOM   1471 N N    . VAL A 1 151 ? 42.780 6.242   25.272 1.00 43.93  ? 151 VAL A N    1 
ATOM   1472 C CA   . VAL A 1 151 ? 42.184 5.893   26.539 1.00 58.14  ? 151 VAL A CA   1 
ATOM   1473 C C    . VAL A 1 151 ? 43.279 5.994   27.611 1.00 77.40  ? 151 VAL A C    1 
ATOM   1474 O O    . VAL A 1 151 ? 43.917 4.997   27.971 1.00 90.18  ? 151 VAL A O    1 
ATOM   1475 C CB   . VAL A 1 151 ? 41.537 4.478   26.492 1.00 56.23  ? 151 VAL A CB   1 
ATOM   1476 C CG1  . VAL A 1 151 ? 40.797 4.174   27.810 1.00 54.21  ? 151 VAL A CG1  1 
ATOM   1477 C CG2  . VAL A 1 151 ? 40.586 4.369   25.287 1.00 34.11  ? 151 VAL A CG2  1 
ATOM   1478 H H    . VAL A 1 151 ? 43.287 5.576   24.801 1.00 37.00  ? 151 VAL A H    1 
ATOM   1479 N N    . SER A 1 152 ? 43.580 7.234   28.006 1.00 86.66  ? 152 SER A N    1 
ATOM   1480 C CA   . SER A 1 152 ? 44.567 7.509   29.054 1.00 92.62  ? 152 SER A CA   1 
ATOM   1481 C C    . SER A 1 152 ? 43.766 7.692   30.345 1.00 96.25  ? 152 SER A C    1 
ATOM   1482 O O    . SER A 1 152 ? 44.335 7.848   31.433 1.00 97.05  ? 152 SER A O    1 
ATOM   1483 C CB   . SER A 1 152 ? 45.393 8.771   28.735 1.00 94.81  ? 152 SER A CB   1 
ATOM   1484 O OG   . SER A 1 152 ? 44.628 9.966   28.825 1.00 92.44  ? 152 SER A OG   1 
ATOM   1485 H H    . SER A 1 152 ? 43.120 7.986   27.577 1.00 37.00  ? 152 SER A H    1 
ATOM   1486 H HG   . SER A 1 152 ? 45.186 10.713  28.599 1.00 37.00  ? 152 SER A HG   1 
ATOM   1487 N N    . SER A 1 153 ? 42.437 7.668   30.181 1.00 99.09  ? 153 SER A N    1 
ATOM   1488 C CA   . SER A 1 153 ? 41.446 7.792   31.254 1.00 97.30  ? 153 SER A CA   1 
ATOM   1489 C C    . SER A 1 153 ? 40.046 7.549   30.684 1.00 92.94  ? 153 SER A C    1 
ATOM   1490 O O    . SER A 1 153 ? 39.713 8.185   29.659 1.00 89.24  ? 153 SER A O    1 
ATOM   1491 C CB   . SER A 1 153 ? 41.495 9.178   31.910 1.00 100.00 ? 153 SER A CB   1 
ATOM   1492 O OG   . SER A 1 153 ? 40.520 9.281   32.940 1.00 100.00 ? 153 SER A OG   1 
ATOM   1493 O OXT  . SER A 1 153 ? 39.302 6.732   31.272 1.00 87.39  ? 153 SER A OXT  1 
ATOM   1494 H H    . SER A 1 153 ? 42.073 7.570   29.279 1.00 37.00  ? 153 SER A H    1 
ATOM   1495 H HG   . SER A 1 153 ? 40.545 10.158  33.331 1.00 37.00  ? 153 SER A HG   1 
ATOM   1496 N N    . CYS B 2 6   ? 12.757 -21.776 13.617 1.00 94.13  ? 6   CYS B N    1 
ATOM   1497 C CA   . CYS B 2 6   ? 13.295 -20.448 14.035 1.00 99.35  ? 6   CYS B CA   1 
ATOM   1498 C C    . CYS B 2 6   ? 14.069 -20.509 15.362 1.00 100.00 ? 6   CYS B C    1 
ATOM   1499 O O    . CYS B 2 6   ? 13.834 -21.390 16.209 1.00 100.00 ? 6   CYS B O    1 
ATOM   1500 C CB   . CYS B 2 6   ? 12.166 -19.411 14.176 1.00 97.15  ? 6   CYS B CB   1 
ATOM   1501 S SG   . CYS B 2 6   ? 11.048 -19.164 12.749 1.00 100.00 ? 6   CYS B SG   1 
ATOM   1502 N N    . LYS B 2 7   ? 14.977 -19.544 15.530 1.00 100.00 ? 7   LYS B N    1 
ATOM   1503 C CA   . LYS B 2 7   ? 15.808 -19.408 16.733 1.00 100.00 ? 7   LYS B CA   1 
ATOM   1504 C C    . LYS B 2 7   ? 15.518 -18.041 17.403 1.00 100.00 ? 7   LYS B C    1 
ATOM   1505 O O    . LYS B 2 7   ? 14.389 -17.790 17.854 1.00 97.49  ? 7   LYS B O    1 
ATOM   1506 C CB   . LYS B 2 7   ? 17.305 -19.521 16.367 1.00 100.00 ? 7   LYS B CB   1 
ATOM   1507 C CG   . LYS B 2 7   ? 17.686 -20.768 15.568 1.00 100.00 ? 7   LYS B CG   1 
ATOM   1508 C CD   . LYS B 2 7   ? 19.116 -20.699 15.018 1.00 99.82  ? 7   LYS B CD   1 
ATOM   1509 C CE   . LYS B 2 7   ? 19.438 -21.907 14.126 1.00 92.78  ? 7   LYS B CE   1 
ATOM   1510 N NZ   . LYS B 2 7   ? 18.516 -22.045 12.953 1.00 85.23  ? 7   LYS B NZ   1 
ATOM   1511 H H    . LYS B 2 7   ? 15.100 -18.892 14.810 1.00 0.00   ? 7   LYS B H    1 
ATOM   1512 H HZ1  . LYS B 2 7   ? 17.540 -22.111 13.306 1.00 0.00   ? 7   LYS B HZ1  1 
ATOM   1513 H HZ2  . LYS B 2 7   ? 18.610 -21.209 12.343 1.00 0.00   ? 7   LYS B HZ2  1 
ATOM   1514 H HZ3  . LYS B 2 7   ? 18.753 -22.904 12.419 1.00 0.00   ? 7   LYS B HZ3  1 
ATOM   1515 N N    . GLU B 2 8   ? 16.530 -17.162 17.434 1.00 100.00 ? 8   GLU B N    1 
ATOM   1516 C CA   . GLU B 2 8   ? 16.433 -15.821 18.031 1.00 100.00 ? 8   GLU B CA   1 
ATOM   1517 C C    . GLU B 2 8   ? 17.641 -14.914 17.690 1.00 98.20  ? 8   GLU B C    1 
ATOM   1518 O O    . GLU B 2 8   ? 18.720 -15.396 17.336 1.00 90.85  ? 8   GLU B O    1 
ATOM   1519 C CB   . GLU B 2 8   ? 16.211 -15.920 19.563 1.00 100.00 ? 8   GLU B CB   1 
ATOM   1520 C CG   . GLU B 2 8   ? 17.126 -16.918 20.308 1.00 100.00 ? 8   GLU B CG   1 
ATOM   1521 C CD   . GLU B 2 8   ? 16.374 -17.855 21.270 1.00 100.00 ? 8   GLU B CD   1 
ATOM   1522 O OE1  . GLU B 2 8   ? 15.419 -18.551 20.840 1.00 100.00 ? 8   GLU B OE1  1 
ATOM   1523 O OE2  . GLU B 2 8   ? 16.761 -17.915 22.459 1.00 100.00 ? 8   GLU B OE2  1 
ATOM   1524 H H    . GLU B 2 8   ? 17.403 -17.357 17.042 1.00 0.00   ? 8   GLU B H    1 
ATOM   1525 N N    . ARG B 2 9   ? 17.417 -13.600 17.745 1.00 99.78  ? 9   ARG B N    1 
ATOM   1526 C CA   . ARG B 2 9   ? 18.434 -12.575 17.466 1.00 98.80  ? 9   ARG B CA   1 
ATOM   1527 C C    . ARG B 2 9   ? 18.210 -11.440 18.489 1.00 100.00 ? 9   ARG B C    1 
ATOM   1528 O O    . ARG B 2 9   ? 17.069 -11.181 18.881 1.00 100.00 ? 9   ARG B O    1 
ATOM   1529 C CB   . ARG B 2 9   ? 18.258 -12.041 16.040 1.00 100.00 ? 9   ARG B CB   1 
ATOM   1530 C CG   . ARG B 2 9   ? 18.349 -13.091 14.913 1.00 100.00 ? 9   ARG B CG   1 
ATOM   1531 C CD   . ARG B 2 9   ? 17.365 -12.765 13.766 1.00 100.00 ? 9   ARG B CD   1 
ATOM   1532 N NE   . ARG B 2 9   ? 17.579 -13.530 12.530 1.00 100.00 ? 9   ARG B NE   1 
ATOM   1533 C CZ   . ARG B 2 9   ? 16.676 -13.669 11.555 1.00 99.14  ? 9   ARG B CZ   1 
ATOM   1534 N NH1  . ARG B 2 9   ? 15.475 -13.105 11.650 1.00 95.06  ? 9   ARG B NH1  1 
ATOM   1535 N NH2  . ARG B 2 9   ? 16.976 -14.374 10.471 1.00 97.90  ? 9   ARG B NH2  1 
ATOM   1536 H H    . ARG B 2 9   ? 16.517 -13.301 17.992 1.00 0.00   ? 9   ARG B H    1 
ATOM   1537 H HE   . ARG B 2 9   ? 18.447 -13.967 12.405 1.00 0.00   ? 9   ARG B HE   1 
ATOM   1538 H HH11 . ARG B 2 9   ? 15.228 -12.564 12.455 1.00 0.00   ? 9   ARG B HH11 1 
ATOM   1539 H HH12 . ARG B 2 9   ? 14.820 -13.221 10.907 1.00 0.00   ? 9   ARG B HH12 1 
ATOM   1540 H HH21 . ARG B 2 9   ? 17.876 -14.801 10.387 1.00 0.00   ? 9   ARG B HH21 1 
ATOM   1541 H HH22 . ARG B 2 9   ? 16.304 -14.475 9.738  1.00 0.00   ? 9   ARG B HH22 1 
ATOM   1542 N N    . GLU B 2 10  ? 19.271 -10.737 18.888 1.00 100.00 ? 10  GLU B N    1 
ATOM   1543 C CA   . GLU B 2 10  ? 19.145 -9.673  19.909 1.00 100.00 ? 10  GLU B CA   1 
ATOM   1544 C C    . GLU B 2 10  ? 18.915 -8.182  19.522 1.00 99.34  ? 10  GLU B C    1 
ATOM   1545 O O    . GLU B 2 10  ? 17.812 -7.828  19.106 1.00 91.26  ? 10  GLU B O    1 
ATOM   1546 C CB   . GLU B 2 10  ? 20.290 -9.806  20.927 1.00 100.00 ? 10  GLU B CB   1 
ATOM   1547 C CG   . GLU B 2 10  ? 20.326 -11.167 21.636 1.00 100.00 ? 10  GLU B CG   1 
ATOM   1548 C CD   . GLU B 2 10  ? 21.615 -11.410 22.419 1.00 100.00 ? 10  GLU B CD   1 
ATOM   1549 O OE1  . GLU B 2 10  ? 21.963 -10.579 23.288 1.00 87.03  ? 10  GLU B OE1  1 
ATOM   1550 O OE2  . GLU B 2 10  ? 22.275 -12.443 22.168 1.00 100.00 ? 10  GLU B OE2  1 
ATOM   1551 H H    . GLU B 2 10  ? 20.150 -10.934 18.501 1.00 0.00   ? 10  GLU B H    1 
ATOM   1552 N N    . GLU B 2 11  ? 19.941 -7.332  19.707 1.00 100.00 ? 11  GLU B N    1 
ATOM   1553 C CA   . GLU B 2 11  ? 19.937 -5.864  19.449 1.00 95.58  ? 11  GLU B CA   1 
ATOM   1554 C C    . GLU B 2 11  ? 19.688 -5.066  20.736 1.00 94.25  ? 11  GLU B C    1 
ATOM   1555 O O    . GLU B 2 11  ? 18.631 -4.452  20.915 1.00 87.57  ? 11  GLU B O    1 
ATOM   1556 C CB   . GLU B 2 11  ? 18.936 -5.437  18.363 1.00 86.76  ? 11  GLU B CB   1 
ATOM   1557 C CG   . GLU B 2 11  ? 19.552 -5.211  16.983 1.00 91.60  ? 11  GLU B CG   1 
ATOM   1558 C CD   . GLU B 2 11  ? 20.447 -3.978  16.907 1.00 90.97  ? 11  GLU B CD   1 
ATOM   1559 O OE1  . GLU B 2 11  ? 20.085 -2.926  17.483 1.00 88.55  ? 11  GLU B OE1  1 
ATOM   1560 O OE2  . GLU B 2 11  ? 21.507 -4.062  16.250 1.00 89.72  ? 11  GLU B OE2  1 
ATOM   1561 H H    . GLU B 2 11  ? 20.794 -7.681  20.032 1.00 0.00   ? 11  GLU B H    1 
ATOM   1562 N N    . LYS B 2 12  ? 20.698 -5.047  21.606 1.00 95.71  ? 12  LYS B N    1 
ATOM   1563 C CA   . LYS B 2 12  ? 20.613 -4.370  22.898 1.00 91.45  ? 12  LYS B CA   1 
ATOM   1564 C C    . LYS B 2 12  ? 20.564 -2.845  22.866 1.00 87.62  ? 12  LYS B C    1 
ATOM   1565 O O    . LYS B 2 12  ? 20.008 -2.227  23.777 1.00 90.05  ? 12  LYS B O    1 
ATOM   1566 C CB   . LYS B 2 12  ? 21.745 -4.836  23.816 1.00 89.36  ? 12  LYS B CB   1 
ATOM   1567 C CG   . LYS B 2 12  ? 23.115 -4.280  23.475 1.00 85.87  ? 12  LYS B CG   1 
ATOM   1568 C CD   . LYS B 2 12  ? 24.133 -4.679  24.533 1.00 87.38  ? 12  LYS B CD   1 
ATOM   1569 C CE   . LYS B 2 12  ? 23.659 -4.324  25.948 1.00 91.02  ? 12  LYS B CE   1 
ATOM   1570 N NZ   . LYS B 2 12  ? 23.374 -2.868  26.141 1.00 100.00 ? 12  LYS B NZ   1 
ATOM   1571 H H    . LYS B 2 12  ? 21.534 -5.496  21.360 1.00 0.00   ? 12  LYS B H    1 
ATOM   1572 H HZ1  . LYS B 2 12  ? 22.639 -2.571  25.467 1.00 0.00   ? 12  LYS B HZ1  1 
ATOM   1573 H HZ2  . LYS B 2 12  ? 23.037 -2.707  27.112 1.00 0.00   ? 12  LYS B HZ2  1 
ATOM   1574 H HZ3  . LYS B 2 12  ? 24.239 -2.313  25.977 1.00 0.00   ? 12  LYS B HZ3  1 
ATOM   1575 N N    . ILE B 2 13  ? 21.160 -2.239  21.841 1.00 83.16  ? 13  ILE B N    1 
ATOM   1576 C CA   . ILE B 2 13  ? 21.153 -0.782  21.721 1.00 77.45  ? 13  ILE B CA   1 
ATOM   1577 C C    . ILE B 2 13  ? 19.733 -0.280  21.401 1.00 72.23  ? 13  ILE B C    1 
ATOM   1578 O O    . ILE B 2 13  ? 19.134 -0.630  20.371 1.00 58.55  ? 13  ILE B O    1 
ATOM   1579 C CB   . ILE B 2 13  ? 22.211 -0.261  20.665 1.00 66.93  ? 13  ILE B CB   1 
ATOM   1580 C CG1  . ILE B 2 13  ? 22.495 1.244   20.861 1.00 68.76  ? 13  ILE B CG1  1 
ATOM   1581 C CG2  . ILE B 2 13  ? 21.766 -0.566  19.235 1.00 68.64  ? 13  ILE B CG2  1 
ATOM   1582 C CD1  . ILE B 2 13  ? 21.506 2.243   20.194 1.00 50.62  ? 13  ILE B CD1  1 
ATOM   1583 H H    . ILE B 2 13  ? 21.607 -2.779  21.156 1.00 0.00   ? 13  ILE B H    1 
ATOM   1584 N N    . ILE B 2 14  ? 19.174 0.476   22.340 1.00 65.21  ? 14  ILE B N    1 
ATOM   1585 C CA   . ILE B 2 14  ? 17.851 1.042   22.155 1.00 65.91  ? 14  ILE B CA   1 
ATOM   1586 C C    . ILE B 2 14  ? 17.954 2.489   21.676 1.00 65.80  ? 14  ILE B C    1 
ATOM   1587 O O    . ILE B 2 14  ? 18.624 3.341   22.297 1.00 59.37  ? 14  ILE B O    1 
ATOM   1588 C CB   . ILE B 2 14  ? 16.990 0.966   23.430 1.00 69.34  ? 14  ILE B CB   1 
ATOM   1589 C CG1  . ILE B 2 14  ? 17.648 1.712   24.602 1.00 82.08  ? 14  ILE B CG1  1 
ATOM   1590 C CG2  . ILE B 2 14  ? 16.742 -0.475  23.781 1.00 78.94  ? 14  ILE B CG2  1 
ATOM   1591 C CD1  . ILE B 2 14  ? 18.772 0.956   25.311 1.00 86.10  ? 14  ILE B CD1  1 
ATOM   1592 H H    . ILE B 2 14  ? 19.694 0.662   23.146 1.00 0.00   ? 14  ILE B H    1 
ATOM   1593 N N    . LEU B 2 15  ? 17.382 2.721   20.499 1.00 52.62  ? 15  LEU B N    1 
ATOM   1594 C CA   . LEU B 2 15  ? 17.361 4.046   19.916 1.00 42.37  ? 15  LEU B CA   1 
ATOM   1595 C C    . LEU B 2 15  ? 16.152 4.777   20.494 1.00 49.85  ? 15  LEU B C    1 
ATOM   1596 O O    . LEU B 2 15  ? 15.008 4.338   20.360 1.00 45.30  ? 15  LEU B O    1 
ATOM   1597 C CB   . LEU B 2 15  ? 17.254 3.976   18.396 1.00 31.49  ? 15  LEU B CB   1 
ATOM   1598 C CG   . LEU B 2 15  ? 16.915 5.316   17.733 1.00 25.74  ? 15  LEU B CG   1 
ATOM   1599 C CD1  . LEU B 2 15  ? 18.025 6.322   17.970 1.00 30.81  ? 15  LEU B CD1  1 
ATOM   1600 C CD2  . LEU B 2 15  ? 16.641 5.142   16.247 1.00 24.74  ? 15  LEU B CD2  1 
ATOM   1601 H H    . LEU B 2 15  ? 16.962 1.977   20.019 1.00 0.00   ? 15  LEU B H    1 
ATOM   1602 N N    . VAL B 2 16  ? 16.431 5.881   21.171 1.00 49.22  ? 16  VAL B N    1 
ATOM   1603 C CA   . VAL B 2 16  ? 15.402 6.700   21.787 1.00 35.74  ? 16  VAL B CA   1 
ATOM   1604 C C    . VAL B 2 16  ? 15.043 7.895   20.894 1.00 37.15  ? 16  VAL B C    1 
ATOM   1605 O O    . VAL B 2 16  ? 15.804 8.866   20.798 1.00 32.21  ? 16  VAL B O    1 
ATOM   1606 C CB   . VAL B 2 16  ? 15.901 7.200   23.136 1.00 39.33  ? 16  VAL B CB   1 
ATOM   1607 C CG1  . VAL B 2 16  ? 14.838 8.000   23.838 1.00 34.64  ? 16  VAL B CG1  1 
ATOM   1608 C CG2  . VAL B 2 16  ? 16.381 6.020   23.972 1.00 27.96  ? 16  VAL B CG2  1 
ATOM   1609 H H    . VAL B 2 16  ? 17.367 6.156   21.249 1.00 0.00   ? 16  VAL B H    1 
ATOM   1610 N N    . SER B 2 17  ? 13.919 7.785   20.186 1.00 37.87  ? 17  SER B N    1 
ATOM   1611 C CA   . SER B 2 17  ? 13.448 8.866   19.323 1.00 35.12  ? 17  SER B CA   1 
ATOM   1612 C C    . SER B 2 17  ? 12.393 9.701   20.069 1.00 34.94  ? 17  SER B C    1 
ATOM   1613 O O    . SER B 2 17  ? 11.885 9.291   21.104 1.00 31.92  ? 17  SER B O    1 
ATOM   1614 C CB   . SER B 2 17  ? 12.862 8.289   18.045 1.00 40.78  ? 17  SER B CB   1 
ATOM   1615 O OG   . SER B 2 17  ? 13.800 7.465   17.384 1.00 40.15  ? 17  SER B OG   1 
ATOM   1616 H H    . SER B 2 17  ? 13.394 6.960   20.242 1.00 0.00   ? 17  SER B H    1 
ATOM   1617 H HG   . SER B 2 17  ? 14.547 7.988   17.082 1.00 0.00   ? 17  SER B HG   1 
ATOM   1618 N N    . SER B 2 18  ? 12.089 10.894  19.583 1.00 43.71  ? 18  SER B N    1 
ATOM   1619 C CA   . SER B 2 18  ? 11.094 11.698  20.282 1.00 50.93  ? 18  SER B CA   1 
ATOM   1620 C C    . SER B 2 18  ? 9.688  11.518  19.698 1.00 61.25  ? 18  SER B C    1 
ATOM   1621 O O    . SER B 2 18  ? 9.520  11.313  18.491 1.00 63.90  ? 18  SER B O    1 
ATOM   1622 C CB   . SER B 2 18  ? 11.501 13.187  20.344 1.00 48.49  ? 18  SER B CB   1 
ATOM   1623 O OG   . SER B 2 18  ? 11.599 13.794  19.069 1.00 31.52  ? 18  SER B OG   1 
ATOM   1624 H H    . SER B 2 18  ? 12.520 11.227  18.768 1.00 0.00   ? 18  SER B H    1 
ATOM   1625 H HG   . SER B 2 18  ? 11.897 14.700  19.178 1.00 0.00   ? 18  SER B HG   1 
ATOM   1626 N N    . ALA B 2 19  ? 8.692  11.494  20.580 1.00 62.98  ? 19  ALA B N    1 
ATOM   1627 C CA   . ALA B 2 19  ? 7.301  11.357  20.173 1.00 57.06  ? 19  ALA B CA   1 
ATOM   1628 C C    . ALA B 2 19  ? 6.865  12.708  19.620 1.00 58.06  ? 19  ALA B C    1 
ATOM   1629 O O    . ALA B 2 19  ? 7.445  13.727  19.999 1.00 61.33  ? 19  ALA B O    1 
ATOM   1630 C CB   . ALA B 2 19  ? 6.465  10.985  21.363 1.00 58.71  ? 19  ALA B CB   1 
ATOM   1631 H H    . ALA B 2 19  ? 8.912  11.551  21.529 1.00 0.00   ? 19  ALA B H    1 
ATOM   1632 N N    . ASN B 2 20  ? 5.875  12.698  18.722 1.00 56.73  ? 20  ASN B N    1 
ATOM   1633 C CA   . ASN B 2 20  ? 5.302  13.895  18.061 1.00 66.72  ? 20  ASN B CA   1 
ATOM   1634 C C    . ASN B 2 20  ? 5.774  13.998  16.609 1.00 66.70  ? 20  ASN B C    1 
ATOM   1635 O O    . ASN B 2 20  ? 5.244  14.807  15.839 1.00 65.58  ? 20  ASN B O    1 
ATOM   1636 C CB   . ASN B 2 20  ? 5.667  15.211  18.800 1.00 71.11  ? 20  ASN B CB   1 
ATOM   1637 C CG   . ASN B 2 20  ? 4.549  16.262  18.769 1.00 70.31  ? 20  ASN B CG   1 
ATOM   1638 O OD1  . ASN B 2 20  ? 3.402  15.963  18.427 1.00 55.67  ? 20  ASN B OD1  1 
ATOM   1639 N ND2  . ASN B 2 20  ? 4.883  17.495  19.163 1.00 50.84  ? 20  ASN B ND2  1 
ATOM   1640 H H    . ASN B 2 20  ? 5.495  11.831  18.480 1.00 0.00   ? 20  ASN B H    1 
ATOM   1641 H HD21 . ASN B 2 20  ? 4.181  18.179  19.152 1.00 0.00   ? 20  ASN B HD21 1 
ATOM   1642 H HD22 . ASN B 2 20  ? 5.805  17.676  19.444 1.00 0.00   ? 20  ASN B HD22 1 
ATOM   1643 N N    . GLU B 2 21  ? 6.728  13.142  16.226 1.00 62.25  ? 21  GLU B N    1 
ATOM   1644 C CA   . GLU B 2 21  ? 7.305  13.162  14.874 1.00 50.62  ? 21  GLU B CA   1 
ATOM   1645 C C    . GLU B 2 21  ? 7.502  11.783  14.257 1.00 45.01  ? 21  GLU B C    1 
ATOM   1646 O O    . GLU B 2 21  ? 7.460  10.776  14.964 1.00 46.51  ? 21  GLU B O    1 
ATOM   1647 C CB   . GLU B 2 21  ? 8.645  13.901  14.926 1.00 54.68  ? 21  GLU B CB   1 
ATOM   1648 C CG   . GLU B 2 21  ? 9.452  13.573  16.167 1.00 56.33  ? 21  GLU B CG   1 
ATOM   1649 C CD   . GLU B 2 21  ? 10.630 14.497  16.390 1.00 61.96  ? 21  GLU B CD   1 
ATOM   1650 O OE1  . GLU B 2 21  ? 10.428 15.705  16.674 1.00 56.15  ? 21  GLU B OE1  1 
ATOM   1651 O OE2  . GLU B 2 21  ? 11.766 13.986  16.315 1.00 66.33  ? 21  GLU B OE2  1 
ATOM   1652 H H    . GLU B 2 21  ? 7.055  12.480  16.869 1.00 0.00   ? 21  GLU B H    1 
ATOM   1653 N N    . ILE B 2 22  ? 7.721  11.743  12.940 1.00 36.59  ? 22  ILE B N    1 
ATOM   1654 C CA   . ILE B 2 22  ? 7.942  10.476  12.226 1.00 34.47  ? 22  ILE B CA   1 
ATOM   1655 C C    . ILE B 2 22  ? 9.172  9.746   12.734 1.00 46.36  ? 22  ILE B C    1 
ATOM   1656 O O    . ILE B 2 22  ? 10.064 10.341  13.344 1.00 50.04  ? 22  ILE B O    1 
ATOM   1657 C CB   . ILE B 2 22  ? 8.247  10.659  10.729 1.00 33.99  ? 22  ILE B CB   1 
ATOM   1658 C CG1  . ILE B 2 22  ? 8.428  12.133  10.408 1.00 41.43  ? 22  ILE B CG1  1 
ATOM   1659 C CG2  . ILE B 2 22  ? 7.244  9.885   9.833  1.00 24.79  ? 22  ILE B CG2  1 
ATOM   1660 C CD1  . ILE B 2 22  ? 9.018  12.361  9.082  1.00 40.54  ? 22  ILE B CD1  1 
ATOM   1661 H H    . ILE B 2 22  ? 7.722  12.615  12.500 1.00 0.00   ? 22  ILE B H    1 
ATOM   1662 N N    . ASP B 2 23  ? 9.216  8.451   12.431 1.00 55.10  ? 23  ASP B N    1 
ATOM   1663 C CA   . ASP B 2 23  ? 10.333 7.584   12.782 1.00 54.26  ? 23  ASP B CA   1 
ATOM   1664 C C    . ASP B 2 23  ? 10.217 6.269   12.036 1.00 59.40  ? 23  ASP B C    1 
ATOM   1665 O O    . ASP B 2 23  ? 9.129  5.717   11.875 1.00 60.70  ? 23  ASP B O    1 
ATOM   1666 C CB   . ASP B 2 23  ? 10.425 7.309   14.285 1.00 51.85  ? 23  ASP B CB   1 
ATOM   1667 C CG   . ASP B 2 23  ? 11.790 6.737   14.686 1.00 58.84  ? 23  ASP B CG   1 
ATOM   1668 O OD1  . ASP B 2 23  ? 12.828 7.329   14.279 1.00 33.52  ? 23  ASP B OD1  1 
ATOM   1669 O OD2  . ASP B 2 23  ? 11.816 5.699   15.396 1.00 46.89  ? 23  ASP B OD2  1 
ATOM   1670 H H    . ASP B 2 23  ? 8.454  8.058   11.955 1.00 0.00   ? 23  ASP B H    1 
ATOM   1671 N N    . VAL B 2 24  ? 11.357 5.800   11.547 1.00 60.82  ? 24  VAL B N    1 
ATOM   1672 C CA   . VAL B 2 24  ? 11.435 4.549   10.818 1.00 47.31  ? 24  VAL B CA   1 
ATOM   1673 C C    . VAL B 2 24  ? 12.391 3.665   11.589 1.00 47.80  ? 24  VAL B C    1 
ATOM   1674 O O    . VAL B 2 24  ? 13.248 4.158   12.320 1.00 47.52  ? 24  VAL B O    1 
ATOM   1675 C CB   . VAL B 2 24  ? 12.022 4.772   9.437  1.00 44.75  ? 24  VAL B CB   1 
ATOM   1676 C CG1  . VAL B 2 24  ? 11.870 3.522   8.594  1.00 40.32  ? 24  VAL B CG1  1 
ATOM   1677 C CG2  . VAL B 2 24  ? 11.388 5.996   8.789  1.00 46.20  ? 24  VAL B CG2  1 
ATOM   1678 H H    . VAL B 2 24  ? 12.176 6.321   11.679 1.00 0.00   ? 24  VAL B H    1 
ATOM   1679 N N    . ARG B 2 25  ? 12.221 2.359   11.461 1.00 47.83  ? 25  ARG B N    1 
ATOM   1680 C CA   . ARG B 2 25  ? 13.105 1.425   12.132 1.00 48.61  ? 25  ARG B CA   1 
ATOM   1681 C C    . ARG B 2 25  ? 13.259 0.213   11.253 1.00 58.49  ? 25  ARG B C    1 
ATOM   1682 O O    . ARG B 2 25  ? 12.406 -0.670  11.259 1.00 66.50  ? 25  ARG B O    1 
ATOM   1683 C CB   . ARG B 2 25  ? 12.553 0.997   13.489 1.00 42.37  ? 25  ARG B CB   1 
ATOM   1684 C CG   . ARG B 2 25  ? 12.384 2.112   14.477 1.00 44.57  ? 25  ARG B CG   1 
ATOM   1685 C CD   . ARG B 2 25  ? 13.494 2.154   15.514 1.00 46.29  ? 25  ARG B CD   1 
ATOM   1686 N NE   . ARG B 2 25  ? 13.206 3.211   16.486 1.00 50.74  ? 25  ARG B NE   1 
ATOM   1687 C CZ   . ARG B 2 25  ? 13.668 3.251   17.732 1.00 51.88  ? 25  ARG B CZ   1 
ATOM   1688 N NH1  . ARG B 2 25  ? 14.472 2.287   18.191 1.00 45.24  ? 25  ARG B NH1  1 
ATOM   1689 N NH2  . ARG B 2 25  ? 13.279 4.244   18.529 1.00 38.82  ? 25  ARG B NH2  1 
ATOM   1690 H H    . ARG B 2 25  ? 11.493 2.016   10.901 1.00 0.00   ? 25  ARG B H    1 
ATOM   1691 H HE   . ARG B 2 25  ? 12.618 3.939   16.206 1.00 0.00   ? 25  ARG B HE   1 
ATOM   1692 H HH11 . ARG B 2 25  ? 14.741 1.521   17.608 1.00 0.00   ? 25  ARG B HH11 1 
ATOM   1693 H HH12 . ARG B 2 25  ? 14.811 2.341   19.130 1.00 0.00   ? 25  ARG B HH12 1 
ATOM   1694 H HH21 . ARG B 2 25  ? 12.649 4.928   18.162 1.00 0.00   ? 25  ARG B HH21 1 
ATOM   1695 H HH22 . ARG B 2 25  ? 13.558 4.301   19.477 1.00 0.00   ? 25  ARG B HH22 1 
ATOM   1696 N N    . PRO B 2 26  ? 14.314 0.188   10.423 1.00 72.69  ? 26  PRO B N    1 
ATOM   1697 C CA   . PRO B 2 26  ? 14.558 -0.948  9.535  1.00 74.82  ? 26  PRO B CA   1 
ATOM   1698 C C    . PRO B 2 26  ? 15.302 -1.984  10.366 1.00 76.10  ? 26  PRO B C    1 
ATOM   1699 O O    . PRO B 2 26  ? 15.843 -1.653  11.424 1.00 71.14  ? 26  PRO B O    1 
ATOM   1700 C CB   . PRO B 2 26  ? 15.450 -0.341  8.463  1.00 74.30  ? 26  PRO B CB   1 
ATOM   1701 C CG   . PRO B 2 26  ? 16.316 0.575   9.272  1.00 77.41  ? 26  PRO B CG   1 
ATOM   1702 C CD   . PRO B 2 26  ? 15.322 1.243   10.211 1.00 77.98  ? 26  PRO B CD   1 
ATOM   1703 N N    . CYS B 2 27  ? 15.302 -3.235  9.917  1.00 85.96  ? 27  CYS B N    1 
ATOM   1704 C CA   . CYS B 2 27  ? 15.988 -4.280  10.659 1.00 85.63  ? 27  CYS B CA   1 
ATOM   1705 C C    . CYS B 2 27  ? 17.464 -4.360  10.294 1.00 86.24  ? 27  CYS B C    1 
ATOM   1706 O O    . CYS B 2 27  ? 17.832 -4.153  9.132  1.00 84.02  ? 27  CYS B O    1 
ATOM   1707 C CB   . CYS B 2 27  ? 15.301 -5.630  10.465 1.00 83.67  ? 27  CYS B CB   1 
ATOM   1708 S SG   . CYS B 2 27  ? 14.985 -6.403  12.079 1.00 92.98  ? 27  CYS B SG   1 
ATOM   1709 H H    . CYS B 2 27  ? 14.839 -3.450  9.080  1.00 0.00   ? 27  CYS B H    1 
ATOM   1710 N N    . PRO B 2 28  ? 18.338 -4.583  11.301 1.00 90.28  ? 28  PRO B N    1 
ATOM   1711 C CA   . PRO B 2 28  ? 19.788 -4.686  11.094 1.00 90.79  ? 28  PRO B CA   1 
ATOM   1712 C C    . PRO B 2 28  ? 20.189 -5.957  10.342 1.00 91.46  ? 28  PRO B C    1 
ATOM   1713 O O    . PRO B 2 28  ? 20.192 -7.060  10.901 1.00 87.98  ? 28  PRO B O    1 
ATOM   1714 C CB   . PRO B 2 28  ? 20.343 -4.674  12.521 1.00 89.11  ? 28  PRO B CB   1 
ATOM   1715 C CG   . PRO B 2 28  ? 19.265 -5.347  13.301 1.00 92.05  ? 28  PRO B CG   1 
ATOM   1716 C CD   . PRO B 2 28  ? 18.013 -4.696  12.736 1.00 87.77  ? 28  PRO B CD   1 
ATOM   1717 N N    . LEU B 2 29  ? 20.432 -5.793  9.043  1.00 94.06  ? 29  LEU B N    1 
ATOM   1718 C CA   . LEU B 2 29  ? 20.857 -6.892  8.186  1.00 93.77  ? 29  LEU B CA   1 
ATOM   1719 C C    . LEU B 2 29  ? 22.308 -6.621  7.809  1.00 95.27  ? 29  LEU B C    1 
ATOM   1720 O O    . LEU B 2 29  ? 22.641 -5.589  7.210  1.00 97.52  ? 29  LEU B O    1 
ATOM   1721 C CB   . LEU B 2 29  ? 19.974 -7.024  6.932  1.00 90.51  ? 29  LEU B CB   1 
ATOM   1722 C CG   . LEU B 2 29  ? 18.488 -7.406  7.049  1.00 76.71  ? 29  LEU B CG   1 
ATOM   1723 C CD1  . LEU B 2 29  ? 18.169 -8.063  8.397  1.00 73.50  ? 29  LEU B CD1  1 
ATOM   1724 C CD2  . LEU B 2 29  ? 17.639 -6.167  6.836  1.00 72.77  ? 29  LEU B CD2  1 
ATOM   1725 H H    . LEU B 2 29  ? 20.324 -4.903  8.650  1.00 0.00   ? 29  LEU B H    1 
ATOM   1726 N N    . ASN B 2 30  ? 23.158 -7.544  8.242  1.00 98.39  ? 30  ASN B N    1 
ATOM   1727 C CA   . ASN B 2 30  ? 24.607 -7.510  8.042  1.00 100.00 ? 30  ASN B CA   1 
ATOM   1728 C C    . ASN B 2 30  ? 25.034 -7.699  6.553  1.00 100.00 ? 30  ASN B C    1 
ATOM   1729 O O    . ASN B 2 30  ? 24.531 -6.958  5.690  1.00 96.41  ? 30  ASN B O    1 
ATOM   1730 C CB   . ASN B 2 30  ? 25.243 -8.510  9.032  1.00 100.00 ? 30  ASN B CB   1 
ATOM   1731 C CG   . ASN B 2 30  ? 24.297 -9.657  9.422  1.00 100.00 ? 30  ASN B CG   1 
ATOM   1732 O OD1  . ASN B 2 30  ? 24.163 -9.975  10.604 1.00 98.46  ? 30  ASN B OD1  1 
ATOM   1733 N ND2  . ASN B 2 30  ? 23.637 -10.270 8.431  1.00 99.44  ? 30  ASN B ND2  1 
ATOM   1734 H H    . ASN B 2 30  ? 22.729 -8.281  8.715  1.00 0.00   ? 30  ASN B H    1 
ATOM   1735 H HD21 . ASN B 2 30  ? 23.026 -11.000 8.663  1.00 0.00   ? 30  ASN B HD21 1 
ATOM   1736 H HD22 . ASN B 2 30  ? 23.788 -9.966  7.512  1.00 0.00   ? 30  ASN B HD22 1 
ATOM   1737 N N    . PRO B 2 31  ? 26.028 -8.578  6.233  1.00 100.00 ? 31  PRO B N    1 
ATOM   1738 C CA   . PRO B 2 31  ? 26.283 -8.632  4.783  1.00 100.00 ? 31  PRO B CA   1 
ATOM   1739 C C    . PRO B 2 31  ? 25.096 -9.204  3.966  1.00 100.00 ? 31  PRO B C    1 
ATOM   1740 O O    . PRO B 2 31  ? 24.815 -8.740  2.852  1.00 95.08  ? 31  PRO B O    1 
ATOM   1741 C CB   . PRO B 2 31  ? 27.539 -9.519  4.686  1.00 100.00 ? 31  PRO B CB   1 
ATOM   1742 C CG   . PRO B 2 31  ? 27.481 -10.360 5.942  1.00 100.00 ? 31  PRO B CG   1 
ATOM   1743 C CD   . PRO B 2 31  ? 27.086 -9.326  6.949  1.00 95.54  ? 31  PRO B CD   1 
ATOM   1744 N N    . ASN B 2 32  ? 24.377 -10.161 4.560  1.00 100.00 ? 32  ASN B N    1 
ATOM   1745 C CA   . ASN B 2 32  ? 23.228 -10.811 3.920  1.00 100.00 ? 32  ASN B CA   1 
ATOM   1746 C C    . ASN B 2 32  ? 21.861 -10.210 4.298  1.00 100.00 ? 32  ASN B C    1 
ATOM   1747 O O    . ASN B 2 32  ? 21.408 -10.307 5.453  1.00 100.00 ? 32  ASN B O    1 
ATOM   1748 C CB   . ASN B 2 32  ? 23.246 -12.318 4.228  1.00 100.00 ? 32  ASN B CB   1 
ATOM   1749 C CG   . ASN B 2 32  ? 22.132 -13.091 3.517  1.00 100.00 ? 32  ASN B CG   1 
ATOM   1750 O OD1  . ASN B 2 32  ? 21.395 -12.543 2.693  1.00 100.00 ? 32  ASN B OD1  1 
ATOM   1751 N ND2  . ASN B 2 32  ? 22.010 -14.376 3.842  1.00 100.00 ? 32  ASN B ND2  1 
ATOM   1752 H H    . ASN B 2 32  ? 24.626 -10.434 5.468  1.00 0.00   ? 32  ASN B H    1 
ATOM   1753 H HD21 . ASN B 2 32  ? 21.310 -14.899 3.400  1.00 0.00   ? 32  ASN B HD21 1 
ATOM   1754 H HD22 . ASN B 2 32  ? 22.626 -14.749 4.508  1.00 0.00   ? 32  ASN B HD22 1 
ATOM   1755 N N    . GLU B 2 33  ? 21.207 -9.619  3.295  1.00 100.00 ? 33  GLU B N    1 
ATOM   1756 C CA   . GLU B 2 33  ? 19.889 -9.010  3.451  1.00 99.49  ? 33  GLU B CA   1 
ATOM   1757 C C    . GLU B 2 33  ? 18.819 -9.820  2.697  1.00 97.03  ? 33  GLU B C    1 
ATOM   1758 O O    . GLU B 2 33  ? 18.034 -10.549 3.324  1.00 90.65  ? 33  GLU B O    1 
ATOM   1759 C CB   . GLU B 2 33  ? 19.896 -7.547  2.954  1.00 97.93  ? 33  GLU B CB   1 
ATOM   1760 C CG   . GLU B 2 33  ? 18.552 -6.805  3.136  1.00 95.69  ? 33  GLU B CG   1 
ATOM   1761 C CD   . GLU B 2 33  ? 18.482 -5.446  2.433  1.00 93.79  ? 33  GLU B CD   1 
ATOM   1762 O OE1  . GLU B 2 33  ? 18.621 -5.391  1.192  1.00 93.86  ? 33  GLU B OE1  1 
ATOM   1763 O OE2  . GLU B 2 33  ? 18.255 -4.429  3.120  1.00 84.62  ? 33  GLU B OE2  1 
ATOM   1764 H H    . GLU B 2 33  ? 21.628 -9.593  2.411  1.00 0.00   ? 33  GLU B H    1 
ATOM   1765 N N    . HIS B 2 34  ? 18.852 -9.729  1.359  1.00 95.55  ? 34  HIS B N    1 
ATOM   1766 C CA   . HIS B 2 34  ? 17.893 -10.382 0.445  1.00 99.75  ? 34  HIS B CA   1 
ATOM   1767 C C    . HIS B 2 34  ? 16.550 -9.618  0.496  1.00 100.00 ? 34  HIS B C    1 
ATOM   1768 O O    . HIS B 2 34  ? 16.016 -9.357  1.579  1.00 100.00 ? 34  HIS B O    1 
ATOM   1769 C CB   . HIS B 2 34  ? 17.697 -11.873 0.789  1.00 99.06  ? 34  HIS B CB   1 
ATOM   1770 C CG   . HIS B 2 34  ? 18.202 -12.824 -0.262 1.00 100.00 ? 34  HIS B CG   1 
ATOM   1771 N ND1  . HIS B 2 34  ? 19.195 -13.751 -0.014 1.00 100.00 ? 34  HIS B ND1  1 
ATOM   1772 C CD2  . HIS B 2 34  ? 17.830 -13.013 -1.553 1.00 100.00 ? 34  HIS B CD2  1 
ATOM   1773 C CE1  . HIS B 2 34  ? 19.412 -14.469 -1.103 1.00 98.93  ? 34  HIS B CE1  1 
ATOM   1774 N NE2  . HIS B 2 34  ? 18.597 -14.041 -2.051 1.00 99.28  ? 34  HIS B NE2  1 
ATOM   1775 H H    . HIS B 2 34  ? 19.571 -9.202  0.953  1.00 0.00   ? 34  HIS B H    1 
ATOM   1776 H HD1  . HIS B 2 34  ? 19.678 -13.856 0.832  1.00 0.00   ? 34  HIS B HD1  1 
ATOM   1777 H HE2  . HIS B 2 34  ? 18.550 -14.394 -2.963 1.00 0.00   ? 34  HIS B HE2  1 
ATOM   1778 N N    . LYS B 2 35  ? 16.015 -9.238  -0.663 1.00 100.00 ? 35  LYS B N    1 
ATOM   1779 C CA   . LYS B 2 35  ? 14.759 -8.481  -0.698 1.00 98.33  ? 35  LYS B CA   1 
ATOM   1780 C C    . LYS B 2 35  ? 13.484 -9.299  -0.968 1.00 100.00 ? 35  LYS B C    1 
ATOM   1781 O O    . LYS B 2 35  ? 12.861 -9.189  -2.030 1.00 97.66  ? 35  LYS B O    1 
ATOM   1782 C CB   . LYS B 2 35  ? 14.882 -7.307  -1.675 1.00 92.93  ? 35  LYS B CB   1 
ATOM   1783 C CG   . LYS B 2 35  ? 16.031 -6.362  -1.342 1.00 84.65  ? 35  LYS B CG   1 
ATOM   1784 C CD   . LYS B 2 35  ? 16.115 -5.211  -2.328 1.00 79.55  ? 35  LYS B CD   1 
ATOM   1785 C CE   . LYS B 2 35  ? 17.335 -4.343  -2.053 1.00 83.89  ? 35  LYS B CE   1 
ATOM   1786 N NZ   . LYS B 2 35  ? 17.333 -3.729  -0.692 1.00 76.58  ? 35  LYS B NZ   1 
ATOM   1787 H H    . LYS B 2 35  ? 16.464 -9.471  -1.503 1.00 0.00   ? 35  LYS B H    1 
ATOM   1788 H HZ1  . LYS B 2 35  ? 17.276 -4.482  0.021  1.00 0.00   ? 35  LYS B HZ1  1 
ATOM   1789 H HZ2  . LYS B 2 35  ? 18.201 -3.176  -0.554 1.00 0.00   ? 35  LYS B HZ2  1 
ATOM   1790 H HZ3  . LYS B 2 35  ? 16.503 -3.108  -0.601 1.00 0.00   ? 35  LYS B HZ3  1 
ATOM   1791 N N    . GLY B 2 36  ? 13.089 -10.084 0.035  1.00 100.00 ? 36  GLY B N    1 
ATOM   1792 C CA   . GLY B 2 36  ? 11.900 -10.918 -0.049 1.00 98.80  ? 36  GLY B CA   1 
ATOM   1793 C C    . GLY B 2 36  ? 11.853 -11.821 1.171  1.00 100.00 ? 36  GLY B C    1 
ATOM   1794 O O    . GLY B 2 36  ? 11.776 -13.047 1.033  1.00 99.87  ? 36  GLY B O    1 
ATOM   1795 H H    . GLY B 2 36  ? 13.620 -10.101 0.859  1.00 0.00   ? 36  GLY B H    1 
ATOM   1796 N N    . THR B 2 37  ? 11.893 -11.202 2.359  1.00 100.00 ? 37  THR B N    1 
ATOM   1797 C CA   . THR B 2 37  ? 11.900 -11.908 3.656  1.00 100.00 ? 37  THR B CA   1 
ATOM   1798 C C    . THR B 2 37  ? 11.412 -11.018 4.804  1.00 98.67  ? 37  THR B C    1 
ATOM   1799 O O    . THR B 2 37  ? 10.969 -11.487 5.859  1.00 100.00 ? 37  THR B O    1 
ATOM   1800 C CB   . THR B 2 37  ? 13.340 -12.330 4.031  1.00 98.38  ? 37  THR B CB   1 
ATOM   1801 O OG1  . THR B 2 37  ? 13.322 -13.021 5.278  1.00 94.29  ? 37  THR B OG1  1 
ATOM   1802 C CG2  . THR B 2 37  ? 14.251 -11.103 4.177  1.00 100.00 ? 37  THR B CG2  1 
ATOM   1803 H H    . THR B 2 37  ? 11.923 -10.223 2.362  1.00 0.00   ? 37  THR B H    1 
ATOM   1804 H HG1  . THR B 2 37  ? 12.738 -13.778 5.191  1.00 0.00   ? 37  THR B HG1  1 
ATOM   1805 N N    . ILE B 2 38  ? 11.585 -9.726  4.584  1.00 95.15  ? 38  ILE B N    1 
ATOM   1806 C CA   . ILE B 2 38  ? 11.241 -8.658  5.514  1.00 91.99  ? 38  ILE B CA   1 
ATOM   1807 C C    . ILE B 2 38  ? 9.778  -8.524  5.987  1.00 87.34  ? 38  ILE B C    1 
ATOM   1808 O O    . ILE B 2 38  ? 8.877  -8.287  5.182  1.00 81.67  ? 38  ILE B O    1 
ATOM   1809 C CB   . ILE B 2 38  ? 11.756 -7.316  4.934  1.00 90.17  ? 38  ILE B CB   1 
ATOM   1810 C CG1  . ILE B 2 38  ? 11.889 -7.408  3.400  1.00 75.48  ? 38  ILE B CG1  1 
ATOM   1811 C CG2  . ILE B 2 38  ? 13.129 -6.990  5.533  1.00 85.99  ? 38  ILE B CG2  1 
ATOM   1812 C CD1  . ILE B 2 38  ? 10.592 -7.611  2.631  1.00 62.32  ? 38  ILE B CD1  1 
ATOM   1813 H H    . ILE B 2 38  ? 12.005 -9.576  3.719  1.00 0.00   ? 38  ILE B H    1 
ATOM   1814 N N    . THR B 2 39  ? 9.573  -8.634  7.305  1.00 92.33  ? 39  THR B N    1 
ATOM   1815 C CA   . THR B 2 39  ? 8.241  -8.534  7.938  1.00 97.04  ? 39  THR B CA   1 
ATOM   1816 C C    . THR B 2 39  ? 8.276  -8.195  9.441  1.00 98.65  ? 39  THR B C    1 
ATOM   1817 O O    . THR B 2 39  ? 8.892  -8.922  10.225 1.00 98.96  ? 39  THR B O    1 
ATOM   1818 C CB   . THR B 2 39  ? 7.446  -9.855  7.805  1.00 100.00 ? 39  THR B CB   1 
ATOM   1819 O OG1  . THR B 2 39  ? 8.323  -10.971 8.024  1.00 100.00 ? 39  THR B OG1  1 
ATOM   1820 C CG2  . THR B 2 39  ? 6.781  -9.963  6.442  1.00 100.00 ? 39  THR B CG2  1 
ATOM   1821 H H    . THR B 2 39  ? 10.349 -8.790  7.883  1.00 0.00   ? 39  THR B H    1 
ATOM   1822 H HG1  . THR B 2 39  ? 9.022  -10.961 7.365  1.00 0.00   ? 39  THR B HG1  1 
ATOM   1823 N N    . TRP B 2 40  ? 7.567  -7.134  9.843  1.00 98.48  ? 40  TRP B N    1 
ATOM   1824 C CA   . TRP B 2 40  ? 7.513  -6.710  11.254 1.00 96.51  ? 40  TRP B CA   1 
ATOM   1825 C C    . TRP B 2 40  ? 6.364  -7.303  12.050 1.00 98.11  ? 40  TRP B C    1 
ATOM   1826 O O    . TRP B 2 40  ? 5.346  -7.694  11.484 1.00 100.00 ? 40  TRP B O    1 
ATOM   1827 C CB   . TRP B 2 40  ? 7.456  -5.185  11.385 1.00 88.42  ? 40  TRP B CB   1 
ATOM   1828 C CG   . TRP B 2 40  ? 8.795  -4.565  11.505 1.00 82.09  ? 40  TRP B CG   1 
ATOM   1829 C CD1  . TRP B 2 40  ? 9.489  -4.287  12.661 1.00 78.23  ? 40  TRP B CD1  1 
ATOM   1830 C CD2  . TRP B 2 40  ? 9.643  -4.193  10.428 1.00 79.51  ? 40  TRP B CD2  1 
ATOM   1831 N NE1  . TRP B 2 40  ? 10.724 -3.771  12.354 1.00 72.92  ? 40  TRP B NE1  1 
ATOM   1832 C CE2  . TRP B 2 40  ? 10.845 -3.703  10.990 1.00 80.44  ? 40  TRP B CE2  1 
ATOM   1833 C CE3  . TRP B 2 40  ? 9.510  -4.232  9.034  1.00 77.92  ? 40  TRP B CE3  1 
ATOM   1834 C CZ2  . TRP B 2 40  ? 11.900 -3.259  10.205 1.00 82.70  ? 40  TRP B CZ2  1 
ATOM   1835 C CZ3  . TRP B 2 40  ? 10.554 -3.795  8.258  1.00 73.57  ? 40  TRP B CZ3  1 
ATOM   1836 C CH2  . TRP B 2 40  ? 11.739 -3.313  8.843  1.00 86.56  ? 40  TRP B CH2  1 
ATOM   1837 H H    . TRP B 2 40  ? 7.072  -6.616  9.177  1.00 0.00   ? 40  TRP B H    1 
ATOM   1838 H HE1  . TRP B 2 40  ? 11.405 -3.501  12.993 1.00 0.00   ? 40  TRP B HE1  1 
ATOM   1839 N N    . TYR B 2 41  ? 6.533  -7.341  13.371 1.00 98.38  ? 41  TYR B N    1 
ATOM   1840 C CA   . TYR B 2 41  ? 5.522  -7.883  14.276 1.00 99.65  ? 41  TYR B CA   1 
ATOM   1841 C C    . TYR B 2 41  ? 5.308  -6.989  15.501 1.00 100.00 ? 41  TYR B C    1 
ATOM   1842 O O    . TYR B 2 41  ? 6.140  -6.135  15.807 1.00 100.00 ? 41  TYR B O    1 
ATOM   1843 C CB   . TYR B 2 41  ? 5.877  -9.339  14.655 1.00 100.00 ? 41  TYR B CB   1 
ATOM   1844 C CG   . TYR B 2 41  ? 5.702  -10.272 13.466 1.00 100.00 ? 41  TYR B CG   1 
ATOM   1845 C CD1  . TYR B 2 41  ? 6.694  -10.372 12.477 1.00 100.00 ? 41  TYR B CD1  1 
ATOM   1846 C CD2  . TYR B 2 41  ? 4.473  -10.901 13.229 1.00 100.00 ? 41  TYR B CD2  1 
ATOM   1847 C CE1  . TYR B 2 41  ? 6.455  -11.051 11.271 1.00 100.00 ? 41  TYR B CE1  1 
ATOM   1848 C CE2  . TYR B 2 41  ? 4.221  -11.584 12.028 1.00 100.00 ? 41  TYR B CE2  1 
ATOM   1849 C CZ   . TYR B 2 41  ? 5.211  -11.649 11.048 1.00 100.00 ? 41  TYR B CZ   1 
ATOM   1850 O OH   . TYR B 2 41  ? 4.935  -12.258 9.833  1.00 100.00 ? 41  TYR B OH   1 
ATOM   1851 H H    . TYR B 2 41  ? 7.365  -6.992  13.753 1.00 0.00   ? 41  TYR B H    1 
ATOM   1852 H HH   . TYR B 2 41  ? 5.717  -12.233 9.275  1.00 0.00   ? 41  TYR B HH   1 
ATOM   1853 N N    . LYS B 2 42  ? 4.168  -7.160  16.167 1.00 100.00 ? 42  LYS B N    1 
ATOM   1854 C CA   . LYS B 2 42  ? 3.796  -6.359  17.344 1.00 100.00 ? 42  LYS B CA   1 
ATOM   1855 C C    . LYS B 2 42  ? 4.418  -6.826  18.673 1.00 96.91  ? 42  LYS B C    1 
ATOM   1856 O O    . LYS B 2 42  ? 5.222  -7.761  18.699 1.00 92.01  ? 42  LYS B O    1 
ATOM   1857 C CB   . LYS B 2 42  ? 2.264  -6.338  17.471 1.00 100.00 ? 42  LYS B CB   1 
ATOM   1858 C CG   . LYS B 2 42  ? 1.534  -6.036  16.158 1.00 100.00 ? 42  LYS B CG   1 
ATOM   1859 C CD   . LYS B 2 42  ? 0.021  -6.158  16.282 1.00 99.78  ? 42  LYS B CD   1 
ATOM   1860 C CE   . LYS B 2 42  ? -0.676 -5.750  14.985 1.00 100.00 ? 42  LYS B CE   1 
ATOM   1861 N NZ   . LYS B 2 42  ? -2.147 -6.020  15.009 1.00 93.56  ? 42  LYS B NZ   1 
ATOM   1862 H H    . LYS B 2 42  ? 3.552  -7.856  15.853 1.00 0.00   ? 42  LYS B H    1 
ATOM   1863 H HZ1  . LYS B 2 42  ? -2.312 -7.037  15.155 1.00 0.00   ? 42  LYS B HZ1  1 
ATOM   1864 H HZ2  . LYS B 2 42  ? -2.583 -5.486  15.787 1.00 0.00   ? 42  LYS B HZ2  1 
ATOM   1865 H HZ3  . LYS B 2 42  ? -2.574 -5.731  14.105 1.00 0.00   ? 42  LYS B HZ3  1 
ATOM   1866 N N    . ASP B 2 43  ? 4.050  -6.156  19.767 1.00 95.42  ? 43  ASP B N    1 
ATOM   1867 C CA   . ASP B 2 43  ? 4.540  -6.511  21.106 1.00 97.36  ? 43  ASP B CA   1 
ATOM   1868 C C    . ASP B 2 43  ? 4.016  -7.923  21.423 1.00 100.00 ? 43  ASP B C    1 
ATOM   1869 O O    . ASP B 2 43  ? 2.951  -8.308  20.925 1.00 100.00 ? 43  ASP B O    1 
ATOM   1870 C CB   . ASP B 2 43  ? 4.012  -5.500  22.140 1.00 100.00 ? 43  ASP B CB   1 
ATOM   1871 C CG   . ASP B 2 43  ? 4.828  -5.488  23.443 1.00 100.00 ? 43  ASP B CG   1 
ATOM   1872 O OD1  . ASP B 2 43  ? 4.918  -6.540  24.122 1.00 97.85  ? 43  ASP B OD1  1 
ATOM   1873 O OD2  . ASP B 2 43  ? 5.368  -4.407  23.792 1.00 100.00 ? 43  ASP B OD2  1 
ATOM   1874 H H    . ASP B 2 43  ? 3.428  -5.404  19.678 1.00 0.00   ? 43  ASP B H    1 
ATOM   1875 N N    . ASP B 2 44  ? 4.744  -8.669  22.264 1.00 100.00 ? 44  ASP B N    1 
ATOM   1876 C CA   . ASP B 2 44  ? 4.400  -10.059 22.644 1.00 100.00 ? 44  ASP B CA   1 
ATOM   1877 C C    . ASP B 2 44  ? 3.902  -10.949 21.485 1.00 100.00 ? 44  ASP B C    1 
ATOM   1878 O O    . ASP B 2 44  ? 2.937  -11.710 21.624 1.00 98.27  ? 44  ASP B O    1 
ATOM   1879 C CB   . ASP B 2 44  ? 3.478  -10.143 23.897 1.00 99.16  ? 44  ASP B CB   1 
ATOM   1880 C CG   . ASP B 2 44  ? 2.087  -9.504  23.702 1.00 100.00 ? 44  ASP B CG   1 
ATOM   1881 O OD1  . ASP B 2 44  ? 1.422  -9.743  22.665 1.00 95.12  ? 44  ASP B OD1  1 
ATOM   1882 O OD2  . ASP B 2 44  ? 1.635  -8.794  24.633 1.00 98.46  ? 44  ASP B OD2  1 
ATOM   1883 H H    . ASP B 2 44  ? 5.555  -8.274  22.646 1.00 0.00   ? 44  ASP B H    1 
ATOM   1884 N N    . SER B 2 45  ? 4.608  -10.843 20.356 1.00 100.00 ? 45  SER B N    1 
ATOM   1885 C CA   . SER B 2 45  ? 4.337  -11.572 19.108 1.00 100.00 ? 45  SER B CA   1 
ATOM   1886 C C    . SER B 2 45  ? 2.858  -11.642 18.705 1.00 100.00 ? 45  SER B C    1 
ATOM   1887 O O    . SER B 2 45  ? 2.103  -12.490 19.194 1.00 100.00 ? 45  SER B O    1 
ATOM   1888 C CB   . SER B 2 45  ? 4.975  -12.972 19.129 1.00 93.73  ? 45  SER B CB   1 
ATOM   1889 O OG   . SER B 2 45  ? 5.112  -13.488 17.812 1.00 70.57  ? 45  SER B OG   1 
ATOM   1890 H H    . SER B 2 45  ? 5.355  -10.213 20.369 1.00 0.00   ? 45  SER B H    1 
ATOM   1891 H HG   . SER B 2 45  ? 5.661  -12.893 17.294 1.00 0.00   ? 45  SER B HG   1 
ATOM   1892 N N    . LYS B 2 46  ? 2.462  -10.724 17.824 1.00 99.89  ? 46  LYS B N    1 
ATOM   1893 C CA   . LYS B 2 46  ? 1.096  -10.629 17.305 1.00 96.94  ? 46  LYS B CA   1 
ATOM   1894 C C    . LYS B 2 46  ? 1.147  -10.700 15.773 1.00 95.31  ? 46  LYS B C    1 
ATOM   1895 O O    . LYS B 2 46  ? 1.900  -11.505 15.215 1.00 92.07  ? 46  LYS B O    1 
ATOM   1896 C CB   . LYS B 2 46  ? 0.452  -9.309  17.750 1.00 100.00 ? 46  LYS B CB   1 
ATOM   1897 C CG   . LYS B 2 46  ? -0.076 -9.266  19.185 1.00 100.00 ? 46  LYS B CG   1 
ATOM   1898 C CD   . LYS B 2 46  ? -1.359 -10.083 19.330 1.00 99.99  ? 46  LYS B CD   1 
ATOM   1899 C CE   . LYS B 2 46  ? -2.235 -9.559  20.460 1.00 94.18  ? 46  LYS B CE   1 
ATOM   1900 N NZ   . LYS B 2 46  ? -1.533 -9.528  21.771 1.00 95.83  ? 46  LYS B NZ   1 
ATOM   1901 H H    . LYS B 2 46  ? 3.121  -10.069 17.511 1.00 0.00   ? 46  LYS B H    1 
ATOM   1902 H HZ1  . LYS B 2 46  ? -0.698 -8.912  21.711 1.00 0.00   ? 46  LYS B HZ1  1 
ATOM   1903 H HZ2  . LYS B 2 46  ? -2.182 -9.160  22.496 1.00 0.00   ? 46  LYS B HZ2  1 
ATOM   1904 H HZ3  . LYS B 2 46  ? -1.239 -10.492 22.027 1.00 0.00   ? 46  LYS B HZ3  1 
ATOM   1905 N N    . THR B 2 47  ? 0.358  -9.860  15.101 1.00 95.92  ? 47  THR B N    1 
ATOM   1906 C CA   . THR B 2 47  ? 0.324  -9.825  13.634 1.00 100.00 ? 47  THR B CA   1 
ATOM   1907 C C    . THR B 2 47  ? 1.279  -8.774  13.034 1.00 100.00 ? 47  THR B C    1 
ATOM   1908 O O    . THR B 2 47  ? 1.774  -7.891  13.748 1.00 98.79  ? 47  THR B O    1 
ATOM   1909 C CB   . THR B 2 47  ? -1.120 -9.601  13.097 1.00 98.95  ? 47  THR B CB   1 
ATOM   1910 O OG1  . THR B 2 47  ? -1.690 -8.422  13.681 1.00 99.36  ? 47  THR B OG1  1 
ATOM   1911 C CG2  . THR B 2 47  ? -1.997 -10.814 13.400 1.00 100.00 ? 47  THR B CG2  1 
ATOM   1912 H H    . THR B 2 47  ? -0.248 -9.238  15.550 1.00 0.00   ? 47  THR B H    1 
ATOM   1913 H HG1  . THR B 2 47  ? -1.194 -7.653  13.396 1.00 0.00   ? 47  THR B HG1  1 
ATOM   1914 N N    . PRO B 2 48  ? 1.553  -8.863  11.710 1.00 100.00 ? 48  PRO B N    1 
ATOM   1915 C CA   . PRO B 2 48  ? 2.450  -7.929  11.015 1.00 100.00 ? 48  PRO B CA   1 
ATOM   1916 C C    . PRO B 2 48  ? 2.009  -6.469  11.020 1.00 97.97  ? 48  PRO B C    1 
ATOM   1917 O O    . PRO B 2 48  ? 1.410  -5.990  10.053 1.00 99.88  ? 48  PRO B O    1 
ATOM   1918 C CB   . PRO B 2 48  ? 2.524  -8.509  9.590  1.00 100.00 ? 48  PRO B CB   1 
ATOM   1919 C CG   . PRO B 2 48  ? 1.190  -9.167  9.420  1.00 100.00 ? 48  PRO B CG   1 
ATOM   1920 C CD   . PRO B 2 48  ? 1.034  -9.869  10.761 1.00 100.00 ? 48  PRO B CD   1 
ATOM   1921 N N    . VAL B 2 49  ? 2.352  -5.782  12.110 1.00 93.92  ? 49  VAL B N    1 
ATOM   1922 C CA   . VAL B 2 49  ? 2.050  -4.367  12.343 1.00 93.37  ? 49  VAL B CA   1 
ATOM   1923 C C    . VAL B 2 49  ? 1.519  -3.593  11.130 1.00 93.59  ? 49  VAL B C    1 
ATOM   1924 O O    . VAL B 2 49  ? 2.248  -2.812  10.510 1.00 94.18  ? 49  VAL B O    1 
ATOM   1925 C CB   . VAL B 2 49  ? 3.300  -3.652  12.898 1.00 92.22  ? 49  VAL B CB   1 
ATOM   1926 C CG1  . VAL B 2 49  ? 3.658  -4.217  14.259 1.00 87.17  ? 49  VAL B CG1  1 
ATOM   1927 C CG2  . VAL B 2 49  ? 4.476  -3.825  11.942 1.00 89.55  ? 49  VAL B CG2  1 
ATOM   1928 H H    . VAL B 2 49  ? 2.849  -6.264  12.803 1.00 0.00   ? 49  VAL B H    1 
ATOM   1929 N N    . SER B 2 50  ? 0.248  -3.833  10.795 1.00 88.08  ? 50  SER B N    1 
ATOM   1930 C CA   . SER B 2 50  ? -0.414 -3.198  9.649  1.00 85.11  ? 50  SER B CA   1 
ATOM   1931 C C    . SER B 2 50  ? 0.395  -3.335  8.349  1.00 80.67  ? 50  SER B C    1 
ATOM   1932 O O    . SER B 2 50  ? 1.499  -3.875  8.346  1.00 80.65  ? 50  SER B O    1 
ATOM   1933 C CB   . SER B 2 50  ? -0.724 -1.725  9.947  1.00 85.48  ? 50  SER B CB   1 
ATOM   1934 O OG   . SER B 2 50  ? -1.533 -1.588  11.109 1.00 86.50  ? 50  SER B OG   1 
ATOM   1935 H H    . SER B 2 50  ? -0.264 -4.461  11.345 1.00 0.00   ? 50  SER B H    1 
ATOM   1936 H HG   . SER B 2 50  ? -2.389 -1.999  10.961 1.00 0.00   ? 50  SER B HG   1 
ATOM   1937 N N    . THR B 2 51  ? -0.172 -2.884  7.239  1.00 76.92  ? 51  THR B N    1 
ATOM   1938 C CA   . THR B 2 51  ? 0.509  -2.961  5.948  1.00 80.27  ? 51  THR B CA   1 
ATOM   1939 C C    . THR B 2 51  ? -0.046 -1.883  5.023  1.00 83.29  ? 51  THR B C    1 
ATOM   1940 O O    . THR B 2 51  ? 0.170  -1.899  3.809  1.00 80.37  ? 51  THR B O    1 
ATOM   1941 C CB   . THR B 2 51  ? 0.342  -4.363  5.290  1.00 83.31  ? 51  THR B CB   1 
ATOM   1942 O OG1  . THR B 2 51  ? -0.969 -4.875  5.562  1.00 87.76  ? 51  THR B OG1  1 
ATOM   1943 C CG2  . THR B 2 51  ? 1.389  -5.349  5.803  1.00 73.14  ? 51  THR B CG2  1 
ATOM   1944 H H    . THR B 2 51  ? -1.072 -2.500  7.282  1.00 0.00   ? 51  THR B H    1 
ATOM   1945 H HG1  . THR B 2 51  ? -1.092 -5.704  5.092  1.00 0.00   ? 51  THR B HG1  1 
ATOM   1946 N N    . GLU B 2 52  ? -0.756 -0.936  5.625  1.00 91.07  ? 52  GLU B N    1 
ATOM   1947 C CA   . GLU B 2 52  ? -1.368 0.175   4.905  1.00 95.71  ? 52  GLU B CA   1 
ATOM   1948 C C    . GLU B 2 52  ? -0.570 1.453   5.172  1.00 92.00  ? 52  GLU B C    1 
ATOM   1949 O O    . GLU B 2 52  ? -0.382 1.849   6.323  1.00 88.24  ? 52  GLU B O    1 
ATOM   1950 C CB   . GLU B 2 52  ? -2.829 0.345   5.369  1.00 99.18  ? 52  GLU B CB   1 
ATOM   1951 C CG   . GLU B 2 52  ? -3.640 1.455   4.672  1.00 99.43  ? 52  GLU B CG   1 
ATOM   1952 C CD   . GLU B 2 52  ? -3.968 1.161   3.203  1.00 100.00 ? 52  GLU B CD   1 
ATOM   1953 O OE1  . GLU B 2 52  ? -4.202 -0.019  2.850  1.00 100.00 ? 52  GLU B OE1  1 
ATOM   1954 O OE2  . GLU B 2 52  ? -4.011 2.124   2.404  1.00 100.00 ? 52  GLU B OE2  1 
ATOM   1955 H H    . GLU B 2 52  ? -0.872 -0.975  6.597  1.00 0.00   ? 52  GLU B H    1 
ATOM   1956 N N    . GLN B 2 53  ? -0.101 2.091   4.105  1.00 90.29  ? 53  GLN B N    1 
ATOM   1957 C CA   . GLN B 2 53  ? 0.668  3.323   4.231  1.00 89.23  ? 53  GLN B CA   1 
ATOM   1958 C C    . GLN B 2 53  ? -0.059 4.378   5.059  1.00 90.83  ? 53  GLN B C    1 
ATOM   1959 O O    . GLN B 2 53  ? 0.576  5.200   5.718  1.00 98.03  ? 53  GLN B O    1 
ATOM   1960 C CB   . GLN B 2 53  ? 0.981  3.903   2.854  1.00 87.88  ? 53  GLN B CB   1 
ATOM   1961 C CG   . GLN B 2 53  ? 1.924  3.068   2.017  1.00 90.35  ? 53  GLN B CG   1 
ATOM   1962 C CD   . GLN B 2 53  ? 2.264  3.731   0.695  1.00 94.23  ? 53  GLN B CD   1 
ATOM   1963 O OE1  . GLN B 2 53  ? 2.688  4.888   0.657  1.00 93.28  ? 53  GLN B OE1  1 
ATOM   1964 N NE2  . GLN B 2 53  ? 2.078  3.000   -0.400 1.00 97.40  ? 53  GLN B NE2  1 
ATOM   1965 H H    . GLN B 2 53  ? -0.278 1.725   3.214  1.00 0.00   ? 53  GLN B H    1 
ATOM   1966 H HE21 . GLN B 2 53  ? 2.295  3.403   -1.267 1.00 0.00   ? 53  GLN B HE21 1 
ATOM   1967 H HE22 . GLN B 2 53  ? 1.735  2.087   -0.303 1.00 0.00   ? 53  GLN B HE22 1 
ATOM   1968 N N    . ALA B 2 54  ? -1.389 4.346   5.030  1.00 90.20  ? 54  ALA B N    1 
ATOM   1969 C CA   . ALA B 2 54  ? -2.193 5.316   5.767  1.00 83.85  ? 54  ALA B CA   1 
ATOM   1970 C C    . ALA B 2 54  ? -2.350 5.049   7.266  1.00 80.76  ? 54  ALA B C    1 
ATOM   1971 O O    . ALA B 2 54  ? -2.498 5.997   8.036  1.00 84.11  ? 54  ALA B O    1 
ATOM   1972 C CB   . ALA B 2 54  ? -3.550 5.486   5.109  1.00 83.20  ? 54  ALA B CB   1 
ATOM   1973 H H    . ALA B 2 54  ? -1.841 3.662   4.493  1.00 0.00   ? 54  ALA B H    1 
ATOM   1974 N N    . SER B 2 55  ? -2.316 3.785   7.694  1.00 73.07  ? 55  SER B N    1 
ATOM   1975 C CA   . SER B 2 55  ? -2.453 3.489   9.124  1.00 71.53  ? 55  SER B CA   1 
ATOM   1976 C C    . SER B 2 55  ? -1.312 4.150   9.882  1.00 75.32  ? 55  SER B C    1 
ATOM   1977 O O    . SER B 2 55  ? -0.453 4.788   9.267  1.00 76.81  ? 55  SER B O    1 
ATOM   1978 C CB   . SER B 2 55  ? -2.506 1.981   9.402  1.00 65.35  ? 55  SER B CB   1 
ATOM   1979 O OG   . SER B 2 55  ? -1.571 1.267   8.623  1.00 67.68  ? 55  SER B OG   1 
ATOM   1980 H H    . SER B 2 55  ? -2.208 3.053   7.051  1.00 0.00   ? 55  SER B H    1 
ATOM   1981 H HG   . SER B 2 55  ? -0.690 1.609   8.794  1.00 0.00   ? 55  SER B HG   1 
ATOM   1982 N N    . ARG B 2 56  ? -1.303 4.038   11.207 1.00 70.41  ? 56  ARG B N    1 
ATOM   1983 C CA   . ARG B 2 56  ? -0.241 4.684   11.967 1.00 68.22  ? 56  ARG B CA   1 
ATOM   1984 C C    . ARG B 2 56  ? 1.030  3.861   12.146 1.00 70.65  ? 56  ARG B C    1 
ATOM   1985 O O    . ARG B 2 56  ? 2.000  4.085   11.429 1.00 77.77  ? 56  ARG B O    1 
ATOM   1986 C CB   . ARG B 2 56  ? -0.762 5.200   13.292 1.00 67.98  ? 56  ARG B CB   1 
ATOM   1987 C CG   . ARG B 2 56  ? -0.460 6.662   13.481 1.00 55.47  ? 56  ARG B CG   1 
ATOM   1988 C CD   . ARG B 2 56  ? -0.598 7.045   14.930 1.00 56.83  ? 56  ARG B CD   1 
ATOM   1989 N NE   . ARG B 2 56  ? 0.092  6.105   15.805 1.00 44.65  ? 56  ARG B NE   1 
ATOM   1990 C CZ   . ARG B 2 56  ? 0.541  6.409   17.012 1.00 47.46  ? 56  ARG B CZ   1 
ATOM   1991 N NH1  . ARG B 2 56  ? 0.389  7.635   17.490 1.00 58.88  ? 56  ARG B NH1  1 
ATOM   1992 N NH2  . ARG B 2 56  ? 1.082  5.470   17.768 1.00 52.66  ? 56  ARG B NH2  1 
ATOM   1993 H H    . ARG B 2 56  ? -2.001 3.527   11.669 1.00 0.00   ? 56  ARG B H    1 
ATOM   1994 H HE   . ARG B 2 56  ? 0.245  5.186   15.507 1.00 0.00   ? 56  ARG B HE   1 
ATOM   1995 H HH11 . ARG B 2 56  ? -0.060 8.356   16.963 1.00 0.00   ? 56  ARG B HH11 1 
ATOM   1996 H HH12 . ARG B 2 56  ? 0.744  7.825   18.398 1.00 0.00   ? 56  ARG B HH12 1 
ATOM   1997 H HH21 . ARG B 2 56  ? 1.160  4.532   17.431 1.00 0.00   ? 56  ARG B HH21 1 
ATOM   1998 H HH22 . ARG B 2 56  ? 1.422  5.705   18.678 1.00 0.00   ? 56  ARG B HH22 1 
ATOM   1999 N N    . ILE B 2 57  ? 1.074  2.973   13.136 1.00 70.40  ? 57  ILE B N    1 
ATOM   2000 C CA   . ILE B 2 57  ? 2.256  2.123   13.304 1.00 66.83  ? 57  ILE B CA   1 
ATOM   2001 C C    . ILE B 2 57  ? 2.128  1.102   12.167 1.00 70.99  ? 57  ILE B C    1 
ATOM   2002 O O    . ILE B 2 57  ? 1.151  0.346   12.117 1.00 80.66  ? 57  ILE B O    1 
ATOM   2003 C CB   . ILE B 2 57  ? 2.280  1.384   14.680 1.00 52.86  ? 57  ILE B CB   1 
ATOM   2004 C CG1  . ILE B 2 57  ? 2.564  2.362   15.824 1.00 56.32  ? 57  ILE B CG1  1 
ATOM   2005 C CG2  . ILE B 2 57  ? 3.359  0.311   14.688 1.00 61.79  ? 57  ILE B CG2  1 
ATOM   2006 C CD1  . ILE B 2 57  ? 2.686  1.689   17.218 1.00 47.62  ? 57  ILE B CD1  1 
ATOM   2007 H H    . ILE B 2 57  ? 0.321  2.877   13.756 1.00 0.00   ? 57  ILE B H    1 
ATOM   2008 N N    . HIS B 2 58  ? 3.076  1.106   11.232 1.00 69.98  ? 58  HIS B N    1 
ATOM   2009 C CA   . HIS B 2 58  ? 2.993  0.188   10.104 1.00 73.81  ? 58  HIS B CA   1 
ATOM   2010 C C    . HIS B 2 58  ? 4.291  -0.080  9.374  1.00 80.58  ? 58  HIS B C    1 
ATOM   2011 O O    . HIS B 2 58  ? 5.257  0.672   9.489  1.00 87.68  ? 58  HIS B O    1 
ATOM   2012 C CB   . HIS B 2 58  ? 1.980  0.709   9.088  1.00 67.86  ? 58  HIS B CB   1 
ATOM   2013 C CG   . HIS B 2 58  ? 2.422  1.945   8.364  1.00 66.66  ? 58  HIS B CG   1 
ATOM   2014 N ND1  . HIS B 2 58  ? 3.271  1.908   7.278  1.00 68.90  ? 58  HIS B ND1  1 
ATOM   2015 C CD2  . HIS B 2 58  ? 2.088  3.247   8.534  1.00 58.92  ? 58  HIS B CD2  1 
ATOM   2016 C CE1  . HIS B 2 58  ? 3.436  3.131   6.807  1.00 65.22  ? 58  HIS B CE1  1 
ATOM   2017 N NE2  . HIS B 2 58  ? 2.728  3.962   7.551  1.00 55.95  ? 58  HIS B NE2  1 
ATOM   2018 H H    . HIS B 2 58  ? 3.832  1.726   11.305 1.00 0.00   ? 58  HIS B H    1 
ATOM   2019 H HD1  . HIS B 2 58  ? 3.691  1.105   6.906  1.00 0.00   ? 58  HIS B HD1  1 
ATOM   2020 H HE2  . HIS B 2 58  ? 2.668  4.932   7.420  1.00 0.00   ? 58  HIS B HE2  1 
ATOM   2021 N N    . GLN B 2 59  ? 4.288  -1.150  8.589  1.00 85.70  ? 59  GLN B N    1 
ATOM   2022 C CA   . GLN B 2 59  ? 5.453  -1.499  7.801  1.00 89.16  ? 59  GLN B CA   1 
ATOM   2023 C C    . GLN B 2 59  ? 5.180  -1.190  6.332  1.00 90.79  ? 59  GLN B C    1 
ATOM   2024 O O    . GLN B 2 59  ? 4.066  -1.399  5.840  1.00 87.30  ? 59  GLN B O    1 
ATOM   2025 C CB   . GLN B 2 59  ? 5.850  -2.966  8.012  1.00 90.80  ? 59  GLN B CB   1 
ATOM   2026 C CG   . GLN B 2 59  ? 4.726  -3.987  7.894  1.00 86.82  ? 59  GLN B CG   1 
ATOM   2027 C CD   . GLN B 2 59  ? 5.229  -5.415  8.052  1.00 84.76  ? 59  GLN B CD   1 
ATOM   2028 O OE1  . GLN B 2 59  ? 6.150  -5.840  7.352  1.00 82.50  ? 59  GLN B OE1  1 
ATOM   2029 N NE2  . GLN B 2 59  ? 4.639  -6.156  8.982  1.00 69.63  ? 59  GLN B NE2  1 
ATOM   2030 H H    . GLN B 2 59  ? 3.487  -1.713  8.550  1.00 0.00   ? 59  GLN B H    1 
ATOM   2031 H HE21 . GLN B 2 59  ? 4.950  -7.075  9.114  1.00 0.00   ? 59  GLN B HE21 1 
ATOM   2032 H HE22 . GLN B 2 59  ? 3.919  -5.744  9.502  1.00 0.00   ? 59  GLN B HE22 1 
ATOM   2033 N N    . HIS B 2 60  ? 6.179  -0.599  5.678  1.00 95.02  ? 60  HIS B N    1 
ATOM   2034 C CA   . HIS B 2 60  ? 6.114  -0.221  4.263  1.00 97.17  ? 60  HIS B CA   1 
ATOM   2035 C C    . HIS B 2 60  ? 7.323  -0.880  3.579  1.00 98.36  ? 60  HIS B C    1 
ATOM   2036 O O    . HIS B 2 60  ? 7.554  -2.075  3.786  1.00 93.05  ? 60  HIS B O    1 
ATOM   2037 C CB   . HIS B 2 60  ? 6.138  1.317   4.126  1.00 99.95  ? 60  HIS B CB   1 
ATOM   2038 C CG   . HIS B 2 60  ? 5.936  1.826   2.725  1.00 98.07  ? 60  HIS B CG   1 
ATOM   2039 N ND1  . HIS B 2 60  ? 5.035  1.266   1.843  1.00 96.90  ? 60  HIS B ND1  1 
ATOM   2040 C CD2  . HIS B 2 60  ? 6.517  2.857   2.061  1.00 98.28  ? 60  HIS B CD2  1 
ATOM   2041 C CE1  . HIS B 2 60  ? 5.070  1.927   0.699  1.00 92.66  ? 60  HIS B CE1  1 
ATOM   2042 N NE2  . HIS B 2 60  ? 5.960  2.897   0.805  1.00 90.37  ? 60  HIS B NE2  1 
ATOM   2043 H H    . HIS B 2 60  ? 7.004  -0.404  6.166  1.00 0.00   ? 60  HIS B H    1 
ATOM   2044 H HD1  . HIS B 2 60  ? 4.460  0.494   2.030  1.00 0.00   ? 60  HIS B HD1  1 
ATOM   2045 H HE2  . HIS B 2 60  ? 6.198  3.532   0.098  1.00 0.00   ? 60  HIS B HE2  1 
ATOM   2046 N N    . LYS B 2 61  ? 8.104  -0.109  2.814  1.00 98.19  ? 61  LYS B N    1 
ATOM   2047 C CA   . LYS B 2 61  ? 9.277  -0.622  2.099  1.00 98.63  ? 61  LYS B CA   1 
ATOM   2048 C C    . LYS B 2 61  ? 10.327 -1.216  3.037  1.00 100.00 ? 61  LYS B C    1 
ATOM   2049 O O    . LYS B 2 61  ? 11.407 -0.641  3.215  1.00 100.00 ? 61  LYS B O    1 
ATOM   2050 C CB   . LYS B 2 61  ? 9.911  0.485   1.239  1.00 95.05  ? 61  LYS B CB   1 
ATOM   2051 C CG   . LYS B 2 61  ? 9.112  0.852   -0.004 1.00 95.72  ? 61  LYS B CG   1 
ATOM   2052 C CD   . LYS B 2 61  ? 9.575  2.174   -0.605 1.00 94.14  ? 61  LYS B CD   1 
ATOM   2053 C CE   . LYS B 2 61  ? 8.641  2.628   -1.723 1.00 89.08  ? 61  LYS B CE   1 
ATOM   2054 N NZ   . LYS B 2 61  ? 8.772  4.088   -2.020 1.00 82.11  ? 61  LYS B NZ   1 
ATOM   2055 H H    . LYS B 2 61  ? 7.955  0.846   2.696  1.00 0.00   ? 61  LYS B H    1 
ATOM   2056 H HZ1  . LYS B 2 61  ? 8.559  4.630   -1.158 1.00 0.00   ? 61  LYS B HZ1  1 
ATOM   2057 H HZ2  . LYS B 2 61  ? 9.743  4.298   -2.328 1.00 0.00   ? 61  LYS B HZ2  1 
ATOM   2058 H HZ3  . LYS B 2 61  ? 8.102  4.351   -2.770 1.00 0.00   ? 61  LYS B HZ3  1 
ATOM   2059 N N    . GLU B 2 62  ? 10.007 -2.381  3.607  1.00 99.22  ? 62  GLU B N    1 
ATOM   2060 C CA   . GLU B 2 62  ? 10.885 -3.099  4.531  1.00 97.64  ? 62  GLU B CA   1 
ATOM   2061 C C    . GLU B 2 62  ? 11.338 -2.243  5.720  1.00 96.17  ? 62  GLU B C    1 
ATOM   2062 O O    . GLU B 2 62  ? 12.456 -2.405  6.216  1.00 100.00 ? 62  GLU B O    1 
ATOM   2063 C CB   . GLU B 2 62  ? 12.098 -3.643  3.764  1.00 95.47  ? 62  GLU B CB   1 
ATOM   2064 C CG   . GLU B 2 62  ? 11.716 -4.361  2.471  1.00 100.00 ? 62  GLU B CG   1 
ATOM   2065 C CD   . GLU B 2 62  ? 12.907 -4.741  1.608  1.00 100.00 ? 62  GLU B CD   1 
ATOM   2066 O OE1  . GLU B 2 62  ? 13.806 -5.476  2.082  1.00 96.20  ? 62  GLU B OE1  1 
ATOM   2067 O OE2  . GLU B 2 62  ? 12.928 -4.311  0.436  1.00 100.00 ? 62  GLU B OE2  1 
ATOM   2068 H H    . GLU B 2 62  ? 9.184  -2.831  3.349  1.00 0.00   ? 62  GLU B H    1 
ATOM   2069 N N    . LYS B 2 63  ? 10.453 -1.362  6.197  1.00 91.66  ? 63  LYS B N    1 
ATOM   2070 C CA   . LYS B 2 63  ? 10.751 -0.463  7.322  1.00 81.29  ? 63  LYS B CA   1 
ATOM   2071 C C    . LYS B 2 63  ? 9.501  -0.192  8.174  1.00 77.65  ? 63  LYS B C    1 
ATOM   2072 O O    . LYS B 2 63  ? 8.395  -0.048  7.651  1.00 77.54  ? 63  LYS B O    1 
ATOM   2073 C CB   . LYS B 2 63  ? 11.322 0.865   6.804  1.00 79.14  ? 63  LYS B CB   1 
ATOM   2074 C CG   . LYS B 2 63  ? 12.630 0.758   6.016  1.00 70.40  ? 63  LYS B CG   1 
ATOM   2075 C CD   . LYS B 2 63  ? 12.927 2.057   5.291  1.00 79.59  ? 63  LYS B CD   1 
ATOM   2076 C CE   . LYS B 2 63  ? 14.078 1.924   4.314  1.00 73.28  ? 63  LYS B CE   1 
ATOM   2077 N NZ   . LYS B 2 63  ? 14.438 3.245   3.707  1.00 82.21  ? 63  LYS B NZ   1 
ATOM   2078 H H    . LYS B 2 63  ? 9.565  -1.320  5.784  1.00 0.00   ? 63  LYS B H    1 
ATOM   2079 H HZ1  . LYS B 2 63  ? 13.621 3.633   3.194  1.00 0.00   ? 63  LYS B HZ1  1 
ATOM   2080 H HZ2  . LYS B 2 63  ? 14.729 3.911   4.449  1.00 0.00   ? 63  LYS B HZ2  1 
ATOM   2081 H HZ3  . LYS B 2 63  ? 15.225 3.105   3.042  1.00 0.00   ? 63  LYS B HZ3  1 
ATOM   2082 N N    . LEU B 2 64  ? 9.694  -0.089  9.484  1.00 67.49  ? 64  LEU B N    1 
ATOM   2083 C CA   . LEU B 2 64  ? 8.603  0.148   10.427 1.00 57.75  ? 64  LEU B CA   1 
ATOM   2084 C C    . LEU B 2 64  ? 8.429  1.641   10.751 1.00 61.18  ? 64  LEU B C    1 
ATOM   2085 O O    . LEU B 2 64  ? 8.976  2.128   11.741 1.00 64.66  ? 64  LEU B O    1 
ATOM   2086 C CB   . LEU B 2 64  ? 8.916  -0.605  11.711 1.00 55.90  ? 64  LEU B CB   1 
ATOM   2087 C CG   . LEU B 2 64  ? 7.868  -1.034  12.726 1.00 58.70  ? 64  LEU B CG   1 
ATOM   2088 C CD1  . LEU B 2 64  ? 8.486  -0.886  14.112 1.00 44.21  ? 64  LEU B CD1  1 
ATOM   2089 C CD2  . LEU B 2 64  ? 6.602  -0.229  12.597 1.00 60.92  ? 64  LEU B CD2  1 
ATOM   2090 H H    . LEU B 2 64  ? 10.608 -0.169  9.830  1.00 0.00   ? 64  LEU B H    1 
ATOM   2091 N N    . TRP B 2 65  ? 7.620  2.345   9.960  1.00 60.46  ? 65  TRP B N    1 
ATOM   2092 C CA   . TRP B 2 65  ? 7.374  3.783   10.158 1.00 57.32  ? 65  TRP B CA   1 
ATOM   2093 C C    . TRP B 2 65  ? 6.346  4.083   11.251 1.00 59.03  ? 65  TRP B C    1 
ATOM   2094 O O    . TRP B 2 65  ? 5.410  3.314   11.459 1.00 48.79  ? 65  TRP B O    1 
ATOM   2095 C CB   . TRP B 2 65  ? 6.895  4.424   8.868  1.00 41.29  ? 65  TRP B CB   1 
ATOM   2096 C CG   . TRP B 2 65  ? 7.692  4.062   7.682  1.00 46.88  ? 65  TRP B CG   1 
ATOM   2097 C CD1  . TRP B 2 65  ? 7.852  2.810   7.141  1.00 40.98  ? 65  TRP B CD1  1 
ATOM   2098 C CD2  . TRP B 2 65  ? 8.343  4.973   6.788  1.00 53.49  ? 65  TRP B CD2  1 
ATOM   2099 N NE1  . TRP B 2 65  ? 8.542  2.892   5.955  1.00 47.91  ? 65  TRP B NE1  1 
ATOM   2100 C CE2  . TRP B 2 65  ? 8.854  4.207   5.710  1.00 52.38  ? 65  TRP B CE2  1 
ATOM   2101 C CE3  . TRP B 2 65  ? 8.533  6.369   6.786  1.00 51.09  ? 65  TRP B CE3  1 
ATOM   2102 C CZ2  . TRP B 2 65  ? 9.540  4.791   4.633  1.00 56.39  ? 65  TRP B CZ2  1 
ATOM   2103 C CZ3  . TRP B 2 65  ? 9.215  6.948   5.718  1.00 52.64  ? 65  TRP B CZ3  1 
ATOM   2104 C CH2  . TRP B 2 65  ? 9.709  6.157   4.654  1.00 59.86  ? 65  TRP B CH2  1 
ATOM   2105 H H    . TRP B 2 65  ? 7.157  1.878   9.235  1.00 0.00   ? 65  TRP B H    1 
ATOM   2106 H HE1  . TRP B 2 65  ? 8.763  2.134   5.375  1.00 0.00   ? 65  TRP B HE1  1 
ATOM   2107 N N    . PHE B 2 66  ? 6.459  5.257   11.869 1.00 63.74  ? 66  PHE B N    1 
ATOM   2108 C CA   . PHE B 2 66  ? 5.557  5.628   12.950 1.00 69.85  ? 66  PHE B CA   1 
ATOM   2109 C C    . PHE B 2 66  ? 4.601  6.789   12.741 1.00 75.77  ? 66  PHE B C    1 
ATOM   2110 O O    . PHE B 2 66  ? 3.833  7.113   13.650 1.00 78.46  ? 66  PHE B O    1 
ATOM   2111 C CB   . PHE B 2 66  ? 6.344  5.838   14.237 1.00 67.70  ? 66  PHE B CB   1 
ATOM   2112 C CG   . PHE B 2 66  ? 6.760  4.558   14.899 1.00 71.83  ? 66  PHE B CG   1 
ATOM   2113 C CD1  . PHE B 2 66  ? 7.775  3.776   14.354 1.00 69.86  ? 66  PHE B CD1  1 
ATOM   2114 C CD2  . PHE B 2 66  ? 6.133  4.128   16.069 1.00 74.18  ? 66  PHE B CD2  1 
ATOM   2115 C CE1  . PHE B 2 66  ? 8.160  2.588   14.960 1.00 70.43  ? 66  PHE B CE1  1 
ATOM   2116 C CE2  . PHE B 2 66  ? 6.512  2.938   16.684 1.00 68.83  ? 66  PHE B CE2  1 
ATOM   2117 C CZ   . PHE B 2 66  ? 7.527  2.170   16.127 1.00 73.18  ? 66  PHE B CZ   1 
ATOM   2118 H H    . PHE B 2 66  ? 7.141  5.898   11.587 1.00 0.00   ? 66  PHE B H    1 
ATOM   2119 N N    . VAL B 2 67  ? 4.597  7.369   11.543 1.00 78.88  ? 67  VAL B N    1 
ATOM   2120 C CA   . VAL B 2 67  ? 3.718  8.500   11.229 1.00 89.44  ? 67  VAL B CA   1 
ATOM   2121 C C    . VAL B 2 67  ? 3.816  9.559   12.366 1.00 91.87  ? 67  VAL B C    1 
ATOM   2122 O O    . VAL B 2 67  ? 4.656  10.456  12.264 1.00 100.00 ? 67  VAL B O    1 
ATOM   2123 C CB   . VAL B 2 67  ? 2.272  8.016   10.866 1.00 96.02  ? 67  VAL B CB   1 
ATOM   2124 C CG1  . VAL B 2 67  ? 1.462  9.139   10.226 1.00 100.00 ? 67  VAL B CG1  1 
ATOM   2125 C CG2  . VAL B 2 67  ? 2.341  6.848   9.898  1.00 100.00 ? 67  VAL B CG2  1 
ATOM   2126 H H    . VAL B 2 67  ? 5.201  7.024   10.853 1.00 0.00   ? 67  VAL B H    1 
ATOM   2127 N N    . PRO B 2 68  ? 2.950  9.530   13.409 1.00 81.67  ? 68  PRO B N    1 
ATOM   2128 C CA   . PRO B 2 68  ? 3.231  10.599  14.379 1.00 75.53  ? 68  PRO B CA   1 
ATOM   2129 C C    . PRO B 2 68  ? 3.928  10.136  15.675 1.00 71.47  ? 68  PRO B C    1 
ATOM   2130 O O    . PRO B 2 68  ? 4.231  10.973  16.525 1.00 79.98  ? 68  PRO B O    1 
ATOM   2131 C CB   . PRO B 2 68  ? 1.842  11.174  14.678 1.00 78.06  ? 68  PRO B CB   1 
ATOM   2132 C CG   . PRO B 2 68  ? 0.972  10.645  13.563 1.00 82.08  ? 68  PRO B CG   1 
ATOM   2133 C CD   . PRO B 2 68  ? 1.510  9.258   13.442 1.00 82.05  ? 68  PRO B CD   1 
ATOM   2134 N N    . ALA B 2 69  ? 4.154  8.824   15.827 1.00 48.43  ? 69  ALA B N    1 
ATOM   2135 C CA   . ALA B 2 69  ? 4.810  8.218   17.006 1.00 41.96  ? 69  ALA B CA   1 
ATOM   2136 C C    . ALA B 2 69  ? 4.493  8.813   18.398 1.00 40.86  ? 69  ALA B C    1 
ATOM   2137 O O    . ALA B 2 69  ? 4.759  9.987   18.654 1.00 37.95  ? 69  ALA B O    1 
ATOM   2138 C CB   . ALA B 2 69  ? 6.312  8.156   16.793 1.00 40.71  ? 69  ALA B CB   1 
ATOM   2139 H H    . ALA B 2 69  ? 3.851  8.235   15.121 1.00 0.00   ? 69  ALA B H    1 
ATOM   2140 N N    . LYS B 2 70  ? 3.949  7.999   19.302 1.00 39.34  ? 70  LYS B N    1 
ATOM   2141 C CA   . LYS B 2 70  ? 3.599  8.467   20.646 1.00 40.68  ? 70  LYS B CA   1 
ATOM   2142 C C    . LYS B 2 70  ? 4.448  7.751   21.667 1.00 45.99  ? 70  LYS B C    1 
ATOM   2143 O O    . LYS B 2 70  ? 5.205  6.854   21.314 1.00 54.04  ? 70  LYS B O    1 
ATOM   2144 C CB   . LYS B 2 70  ? 2.143  8.150   20.968 1.00 52.55  ? 70  LYS B CB   1 
ATOM   2145 C CG   . LYS B 2 70  ? 1.097  8.993   20.285 1.00 69.27  ? 70  LYS B CG   1 
ATOM   2146 C CD   . LYS B 2 70  ? -0.278 8.460   20.670 1.00 79.32  ? 70  LYS B CD   1 
ATOM   2147 C CE   . LYS B 2 70  ? -1.417 9.321   20.146 1.00 91.11  ? 70  LYS B CE   1 
ATOM   2148 N NZ   . LYS B 2 70  ? -2.742 8.747   20.539 1.00 95.66  ? 70  LYS B NZ   1 
ATOM   2149 H H    . LYS B 2 70  ? 3.780  7.074   19.073 1.00 0.00   ? 70  LYS B H    1 
ATOM   2150 H HZ1  . LYS B 2 70  ? -2.832 7.789   20.146 1.00 0.00   ? 70  LYS B HZ1  1 
ATOM   2151 H HZ2  . LYS B 2 70  ? -2.803 8.701   21.576 1.00 0.00   ? 70  LYS B HZ2  1 
ATOM   2152 H HZ3  . LYS B 2 70  ? -3.508 9.347   20.173 1.00 0.00   ? 70  LYS B HZ3  1 
ATOM   2153 N N    . VAL B 2 71  ? 4.279  8.110   22.939 1.00 38.56  ? 71  VAL B N    1 
ATOM   2154 C CA   . VAL B 2 71  ? 5.022  7.472   24.030 1.00 37.96  ? 71  VAL B CA   1 
ATOM   2155 C C    . VAL B 2 71  ? 4.563  6.030   24.266 1.00 53.17  ? 71  VAL B C    1 
ATOM   2156 O O    . VAL B 2 71  ? 5.344  5.175   24.677 1.00 54.52  ? 71  VAL B O    1 
ATOM   2157 C CB   . VAL B 2 71  ? 4.847  8.249   25.353 1.00 33.27  ? 71  VAL B CB   1 
ATOM   2158 C CG1  . VAL B 2 71  ? 5.468  7.500   26.509 1.00 32.26  ? 71  VAL B CG1  1 
ATOM   2159 C CG2  . VAL B 2 71  ? 5.458  9.610   25.241 1.00 25.40  ? 71  VAL B CG2  1 
ATOM   2160 H H    . VAL B 2 71  ? 3.644  8.824   23.155 1.00 0.00   ? 71  VAL B H    1 
ATOM   2161 N N    . GLU B 2 72  ? 3.281  5.777   24.020 1.00 75.63  ? 72  GLU B N    1 
ATOM   2162 C CA   . GLU B 2 72  ? 2.686  4.453   24.213 1.00 84.54  ? 72  GLU B CA   1 
ATOM   2163 C C    . GLU B 2 72  ? 3.276  3.415   23.258 1.00 82.38  ? 72  GLU B C    1 
ATOM   2164 O O    . GLU B 2 72  ? 3.131  2.209   23.461 1.00 86.09  ? 72  GLU B O    1 
ATOM   2165 C CB   . GLU B 2 72  ? 1.162  4.518   24.019 1.00 94.97  ? 72  GLU B CB   1 
ATOM   2166 C CG   . GLU B 2 72  ? 0.429  5.557   24.881 1.00 97.93  ? 72  GLU B CG   1 
ATOM   2167 C CD   . GLU B 2 72  ? -0.128 6.709   24.058 1.00 99.74  ? 72  GLU B CD   1 
ATOM   2168 O OE1  . GLU B 2 72  ? -1.096 6.490   23.293 1.00 100.00 ? 72  GLU B OE1  1 
ATOM   2169 O OE2  . GLU B 2 72  ? 0.409  7.831   24.172 1.00 97.11  ? 72  GLU B OE2  1 
ATOM   2170 H H    . GLU B 2 72  ? 2.714  6.507   23.694 1.00 0.00   ? 72  GLU B H    1 
ATOM   2171 N N    . ASP B 2 73  ? 3.922  3.893   22.204 1.00 75.82  ? 73  ASP B N    1 
ATOM   2172 C CA   . ASP B 2 73  ? 4.527  3.006   21.229 1.00 71.27  ? 73  ASP B CA   1 
ATOM   2173 C C    . ASP B 2 73  ? 5.824  2.441   21.790 1.00 72.77  ? 73  ASP B C    1 
ATOM   2174 O O    . ASP B 2 73  ? 6.266  1.372   21.369 1.00 73.78  ? 73  ASP B O    1 
ATOM   2175 C CB   . ASP B 2 73  ? 4.801  3.764   19.928 1.00 69.15  ? 73  ASP B CB   1 
ATOM   2176 C CG   . ASP B 2 73  ? 3.569  4.487   19.390 1.00 62.99  ? 73  ASP B CG   1 
ATOM   2177 O OD1  . ASP B 2 73  ? 2.457  4.305   19.937 1.00 72.83  ? 73  ASP B OD1  1 
ATOM   2178 O OD2  . ASP B 2 73  ? 3.718  5.241   18.408 1.00 47.89  ? 73  ASP B OD2  1 
ATOM   2179 H H    . ASP B 2 73  ? 3.990  4.863   22.073 1.00 0.00   ? 73  ASP B H    1 
ATOM   2180 N N    . SER B 2 74  ? 6.405  3.162   22.756 1.00 74.17  ? 74  SER B N    1 
ATOM   2181 C CA   . SER B 2 74  ? 7.665  2.800   23.421 1.00 71.14  ? 74  SER B CA   1 
ATOM   2182 C C    . SER B 2 74  ? 7.662  1.360   23.924 1.00 74.15  ? 74  SER B C    1 
ATOM   2183 O O    . SER B 2 74  ? 7.417  1.101   25.105 1.00 80.03  ? 74  SER B O    1 
ATOM   2184 C CB   . SER B 2 74  ? 7.949  3.779   24.579 1.00 69.86  ? 74  SER B CB   1 
ATOM   2185 O OG   . SER B 2 74  ? 8.980  3.329   25.448 1.00 64.02  ? 74  SER B OG   1 
ATOM   2186 H H    . SER B 2 74  ? 5.955  3.983   23.039 1.00 0.00   ? 74  SER B H    1 
ATOM   2187 H HG   . SER B 2 74  ? 9.135  3.982   26.134 1.00 0.00   ? 74  SER B HG   1 
ATOM   2188 N N    . GLY B 2 75  ? 7.975  0.434   23.022 1.00 74.28  ? 75  GLY B N    1 
ATOM   2189 C CA   . GLY B 2 75  ? 7.988  -0.971  23.373 1.00 75.63  ? 75  GLY B CA   1 
ATOM   2190 C C    . GLY B 2 75  ? 8.765  -1.874  22.436 1.00 77.40  ? 75  GLY B C    1 
ATOM   2191 O O    . GLY B 2 75  ? 9.225  -1.464  21.369 1.00 72.58  ? 75  GLY B O    1 
ATOM   2192 H H    . GLY B 2 75  ? 8.225  0.708   22.115 1.00 0.00   ? 75  GLY B H    1 
ATOM   2193 N N    . HIS B 2 76  ? 8.842  -3.138  22.837 1.00 83.28  ? 76  HIS B N    1 
ATOM   2194 C CA   . HIS B 2 76  ? 9.562  -4.198  22.128 1.00 87.91  ? 76  HIS B CA   1 
ATOM   2195 C C    . HIS B 2 76  ? 8.825  -4.680  20.868 1.00 85.60  ? 76  HIS B C    1 
ATOM   2196 O O    . HIS B 2 76  ? 7.635  -4.994  20.926 1.00 86.50  ? 76  HIS B O    1 
ATOM   2197 C CB   . HIS B 2 76  ? 9.808  -5.376  23.098 1.00 92.81  ? 76  HIS B CB   1 
ATOM   2198 C CG   . HIS B 2 76  ? 9.417  -5.087  24.526 1.00 100.00 ? 76  HIS B CG   1 
ATOM   2199 N ND1  . HIS B 2 76  ? 8.118  -5.196  24.984 1.00 100.00 ? 76  HIS B ND1  1 
ATOM   2200 C CD2  . HIS B 2 76  ? 10.148 -4.660  25.586 1.00 100.00 ? 76  HIS B CD2  1 
ATOM   2201 C CE1  . HIS B 2 76  ? 8.065  -4.849  26.259 1.00 100.00 ? 76  HIS B CE1  1 
ATOM   2202 N NE2  . HIS B 2 76  ? 9.284  -4.520  26.648 1.00 100.00 ? 76  HIS B NE2  1 
ATOM   2203 H H    . HIS B 2 76  ? 8.341  -3.337  23.652 1.00 0.00   ? 76  HIS B H    1 
ATOM   2204 H HD1  . HIS B 2 76  ? 7.348  -5.486  24.452 1.00 0.00   ? 76  HIS B HD1  1 
ATOM   2205 H HE2  . HIS B 2 76  ? 9.530  -4.221  27.549 1.00 0.00   ? 76  HIS B HE2  1 
ATOM   2206 N N    . TYR B 2 77  ? 9.516  -4.666  19.723 1.00 82.29  ? 77  TYR B N    1 
ATOM   2207 C CA   . TYR B 2 77  ? 8.944  -5.117  18.439 1.00 86.59  ? 77  TYR B CA   1 
ATOM   2208 C C    . TYR B 2 77  ? 9.850  -6.210  17.840 1.00 91.59  ? 77  TYR B C    1 
ATOM   2209 O O    . TYR B 2 77  ? 10.900 -6.519  18.409 1.00 94.37  ? 77  TYR B O    1 
ATOM   2210 C CB   . TYR B 2 77  ? 8.806  -3.956  17.430 1.00 84.09  ? 77  TYR B CB   1 
ATOM   2211 C CG   . TYR B 2 77  ? 7.890  -2.808  17.840 1.00 86.31  ? 77  TYR B CG   1 
ATOM   2212 C CD1  . TYR B 2 77  ? 7.184  -2.827  19.047 1.00 86.87  ? 77  TYR B CD1  1 
ATOM   2213 C CD2  . TYR B 2 77  ? 7.770  -1.680  17.039 1.00 80.37  ? 77  TYR B CD2  1 
ATOM   2214 C CE1  . TYR B 2 77  ? 6.391  -1.746  19.448 1.00 78.82  ? 77  TYR B CE1  1 
ATOM   2215 C CE2  . TYR B 2 77  ? 6.979  -0.598  17.429 1.00 80.28  ? 77  TYR B CE2  1 
ATOM   2216 C CZ   . TYR B 2 77  ? 6.294  -0.632  18.634 1.00 78.13  ? 77  TYR B CZ   1 
ATOM   2217 O OH   . TYR B 2 77  ? 5.534  0.451   19.028 1.00 68.17  ? 77  TYR B OH   1 
ATOM   2218 H H    . TYR B 2 77  ? 10.442 -4.347  19.734 1.00 0.00   ? 77  TYR B H    1 
ATOM   2219 H HH   . TYR B 2 77  ? 5.119  0.263   19.873 1.00 0.00   ? 77  TYR B HH   1 
ATOM   2220 N N    . TYR B 2 78  ? 9.438  -6.806  16.716 1.00 89.20  ? 78  TYR B N    1 
ATOM   2221 C CA   . TYR B 2 78  ? 10.223 -7.862  16.062 1.00 83.55  ? 78  TYR B CA   1 
ATOM   2222 C C    . TYR B 2 78  ? 10.234 -7.699  14.551 1.00 81.21  ? 78  TYR B C    1 
ATOM   2223 O O    . TYR B 2 78  ? 9.470  -6.925  13.988 1.00 80.00  ? 78  TYR B O    1 
ATOM   2224 C CB   . TYR B 2 78  ? 9.638  -9.262  16.307 1.00 89.01  ? 78  TYR B CB   1 
ATOM   2225 C CG   . TYR B 2 78  ? 9.221  -9.625  17.713 1.00 93.10  ? 78  TYR B CG   1 
ATOM   2226 C CD1  . TYR B 2 78  ? 10.147 -10.104 18.641 1.00 91.11  ? 78  TYR B CD1  1 
ATOM   2227 C CD2  . TYR B 2 78  ? 7.876  -9.556  18.094 1.00 98.27  ? 78  TYR B CD2  1 
ATOM   2228 C CE1  . TYR B 2 78  ? 9.741  -10.509 19.918 1.00 97.75  ? 78  TYR B CE1  1 
ATOM   2229 C CE2  . TYR B 2 78  ? 7.461  -9.955  19.362 1.00 99.98  ? 78  TYR B CE2  1 
ATOM   2230 C CZ   . TYR B 2 78  ? 8.394  -10.432 20.270 1.00 100.00 ? 78  TYR B CZ   1 
ATOM   2231 O OH   . TYR B 2 78  ? 7.972  -10.832 21.521 1.00 100.00 ? 78  TYR B OH   1 
ATOM   2232 H H    . TYR B 2 78  ? 8.591  -6.527  16.311 1.00 0.00   ? 78  TYR B H    1 
ATOM   2233 H HH   . TYR B 2 78  ? 8.721  -11.149 22.031 1.00 0.00   ? 78  TYR B HH   1 
ATOM   2234 N N    . CYS B 2 79  ? 11.067 -8.509  13.909 1.00 79.16  ? 79  CYS B N    1 
ATOM   2235 C CA   . CYS B 2 79  ? 11.185 -8.557  12.454 1.00 89.35  ? 79  CYS B CA   1 
ATOM   2236 C C    . CYS B 2 79  ? 11.698 -9.968  12.141 1.00 93.06  ? 79  CYS B C    1 
ATOM   2237 O O    . CYS B 2 79  ? 12.452 -10.531 12.932 1.00 98.50  ? 79  CYS B O    1 
ATOM   2238 C CB   . CYS B 2 79  ? 12.163 -7.495  11.932 1.00 89.59  ? 79  CYS B CB   1 
ATOM   2239 S SG   . CYS B 2 79  ? 13.882 -8.051  11.667 1.00 92.87  ? 79  CYS B SG   1 
ATOM   2240 H H    . CYS B 2 79  ? 11.630 -9.109  14.440 1.00 0.00   ? 79  CYS B H    1 
ATOM   2241 N N    . VAL B 2 80  ? 11.270 -10.569 11.034 1.00 90.27  ? 80  VAL B N    1 
ATOM   2242 C CA   . VAL B 2 80  ? 11.747 -11.912 10.734 1.00 84.66  ? 80  VAL B CA   1 
ATOM   2243 C C    . VAL B 2 80  ? 12.307 -12.117 9.346  1.00 86.35  ? 80  VAL B C    1 
ATOM   2244 O O    . VAL B 2 80  ? 11.733 -11.687 8.343  1.00 77.04  ? 80  VAL B O    1 
ATOM   2245 C CB   . VAL B 2 80  ? 10.685 -13.004 11.024 1.00 87.60  ? 80  VAL B CB   1 
ATOM   2246 C CG1  . VAL B 2 80  ? 9.479  -12.859 10.100 1.00 85.78  ? 80  VAL B CG1  1 
ATOM   2247 C CG2  . VAL B 2 80  ? 11.313 -14.388 10.883 1.00 78.78  ? 80  VAL B CG2  1 
ATOM   2248 H H    . VAL B 2 80  ? 10.651 -10.118 10.425 1.00 0.00   ? 80  VAL B H    1 
ATOM   2249 N N    . VAL B 2 81  ? 13.475 -12.748 9.321  1.00 88.56  ? 81  VAL B N    1 
ATOM   2250 C CA   . VAL B 2 81  ? 14.153 -13.076 8.087  1.00 93.62  ? 81  VAL B CA   1 
ATOM   2251 C C    . VAL B 2 81  ? 14.187 -14.598 8.008  1.00 96.85  ? 81  VAL B C    1 
ATOM   2252 O O    . VAL B 2 81  ? 14.598 -15.288 8.950  1.00 88.77  ? 81  VAL B O    1 
ATOM   2253 C CB   . VAL B 2 81  ? 15.573 -12.466 8.014  1.00 100.00 ? 81  VAL B CB   1 
ATOM   2254 C CG1  . VAL B 2 81  ? 16.309 -12.964 6.763  1.00 100.00 ? 81  VAL B CG1  1 
ATOM   2255 C CG2  . VAL B 2 81  ? 15.479 -10.937 7.980  1.00 100.00 ? 81  VAL B CG2  1 
ATOM   2256 H H    . VAL B 2 81  ? 13.886 -13.006 10.170 1.00 0.00   ? 81  VAL B H    1 
ATOM   2257 N N    . ARG B 2 82  ? 13.667 -15.093 6.888  1.00 100.00 ? 82  ARG B N    1 
ATOM   2258 C CA   . ARG B 2 82  ? 13.545 -16.510 6.576  1.00 100.00 ? 82  ARG B CA   1 
ATOM   2259 C C    . ARG B 2 82  ? 13.262 -16.542 5.061  1.00 100.00 ? 82  ARG B C    1 
ATOM   2260 O O    . ARG B 2 82  ? 12.102 -16.532 4.628  1.00 94.27  ? 82  ARG B O    1 
ATOM   2261 C CB   . ARG B 2 82  ? 12.347 -17.055 7.355  1.00 100.00 ? 82  ARG B CB   1 
ATOM   2262 C CG   . ARG B 2 82  ? 12.144 -18.554 7.388  1.00 97.15  ? 82  ARG B CG   1 
ATOM   2263 C CD   . ARG B 2 82  ? 10.742 -18.862 7.970  1.00 100.00 ? 82  ARG B CD   1 
ATOM   2264 N NE   . ARG B 2 82  ? 10.207 -17.782 8.821  1.00 100.00 ? 82  ARG B NE   1 
ATOM   2265 C CZ   . ARG B 2 82  ? 8.934  -17.372 8.823  1.00 100.00 ? 82  ARG B CZ   1 
ATOM   2266 N NH1  . ARG B 2 82  ? 8.034  -17.949 8.031  1.00 90.11  ? 82  ARG B NH1  1 
ATOM   2267 N NH2  . ARG B 2 82  ? 8.567  -16.336 9.574  1.00 100.00 ? 82  ARG B NH2  1 
ATOM   2268 H H    . ARG B 2 82  ? 13.296 -14.503 6.234  1.00 0.00   ? 82  ARG B H    1 
ATOM   2269 H HE   . ARG B 2 82  ? 10.814 -17.335 9.445  1.00 0.00   ? 82  ARG B HE   1 
ATOM   2270 H HH11 . ARG B 2 82  ? 8.302  -18.697 7.423  1.00 0.00   ? 82  ARG B HH11 1 
ATOM   2271 H HH12 . ARG B 2 82  ? 7.087  -17.631 8.041  1.00 0.00   ? 82  ARG B HH12 1 
ATOM   2272 H HH21 . ARG B 2 82  ? 9.241  -15.861 10.139 1.00 0.00   ? 82  ARG B HH21 1 
ATOM   2273 H HH22 . ARG B 2 82  ? 7.614  -16.033 9.569  1.00 0.00   ? 82  ARG B HH22 1 
ATOM   2274 N N    . ASN B 2 83  ? 14.332 -16.482 4.269  1.00 100.00 ? 83  ASN B N    1 
ATOM   2275 C CA   . ASN B 2 83  ? 14.243 -16.495 2.799  1.00 100.00 ? 83  ASN B CA   1 
ATOM   2276 C C    . ASN B 2 83  ? 14.044 -17.919 2.266  1.00 100.00 ? 83  ASN B C    1 
ATOM   2277 O O    . ASN B 2 83  ? 13.199 -18.168 1.389  1.00 99.00  ? 83  ASN B O    1 
ATOM   2278 C CB   . ASN B 2 83  ? 15.519 -15.891 2.181  1.00 100.00 ? 83  ASN B CB   1 
ATOM   2279 C CG   . ASN B 2 83  ? 15.713 -14.425 2.541  1.00 100.00 ? 83  ASN B CG   1 
ATOM   2280 O OD1  . ASN B 2 83  ? 16.346 -14.091 3.551  1.00 100.00 ? 83  ASN B OD1  1 
ATOM   2281 N ND2  . ASN B 2 83  ? 15.171 -13.538 1.707  1.00 100.00 ? 83  ASN B ND2  1 
ATOM   2282 H H    . ASN B 2 83  ? 15.218 -16.430 4.685  1.00 0.00   ? 83  ASN B H    1 
ATOM   2283 H HD21 . ASN B 2 83  ? 15.270 -12.585 1.909  1.00 0.00   ? 83  ASN B HD21 1 
ATOM   2284 H HD22 . ASN B 2 83  ? 14.689 -13.879 0.924  1.00 0.00   ? 83  ASN B HD22 1 
ATOM   2285 N N    . SER B 2 84  ? 14.863 -18.832 2.790  1.00 100.00 ? 84  SER B N    1 
ATOM   2286 C CA   . SER B 2 84  ? 14.823 -20.241 2.426  1.00 100.00 ? 84  SER B CA   1 
ATOM   2287 C C    . SER B 2 84  ? 14.345 -21.070 3.629  1.00 100.00 ? 84  SER B C    1 
ATOM   2288 O O    . SER B 2 84  ? 13.424 -21.890 3.494  1.00 100.00 ? 84  SER B O    1 
ATOM   2289 C CB   . SER B 2 84  ? 16.209 -20.711 1.950  1.00 99.45  ? 84  SER B CB   1 
ATOM   2290 O OG   . SER B 2 84  ? 16.592 -20.065 0.743  1.00 91.98  ? 84  SER B OG   1 
ATOM   2291 H H    . SER B 2 84  ? 15.527 -18.543 3.451  1.00 0.00   ? 84  SER B H    1 
ATOM   2292 H HG   . SER B 2 84  ? 16.613 -19.116 0.882  1.00 0.00   ? 84  SER B HG   1 
ATOM   2293 N N    . SER B 2 85  ? 14.925 -20.808 4.806  1.00 100.00 ? 85  SER B N    1 
ATOM   2294 C CA   . SER B 2 85  ? 14.560 -21.538 6.026  1.00 100.00 ? 85  SER B CA   1 
ATOM   2295 C C    . SER B 2 85  ? 15.125 -20.979 7.342  1.00 100.00 ? 85  SER B C    1 
ATOM   2296 O O    . SER B 2 85  ? 14.501 -21.132 8.400  1.00 98.39  ? 85  SER B O    1 
ATOM   2297 C CB   . SER B 2 85  ? 14.962 -23.017 5.893  1.00 100.00 ? 85  SER B CB   1 
ATOM   2298 O OG   . SER B 2 85  ? 16.339 -23.162 5.565  1.00 100.00 ? 85  SER B OG   1 
ATOM   2299 H H    . SER B 2 85  ? 15.613 -20.111 4.852  1.00 0.00   ? 85  SER B H    1 
ATOM   2300 H HG   . SER B 2 85  ? 16.517 -22.719 4.732  1.00 0.00   ? 85  SER B HG   1 
ATOM   2301 N N    . TYR B 2 86  ? 16.306 -20.358 7.263  1.00 100.00 ? 86  TYR B N    1 
ATOM   2302 C CA   . TYR B 2 86  ? 17.021 -19.785 8.422  1.00 100.00 ? 86  TYR B CA   1 
ATOM   2303 C C    . TYR B 2 86  ? 16.302 -18.678 9.208  1.00 100.00 ? 86  TYR B C    1 
ATOM   2304 O O    . TYR B 2 86  ? 16.803 -17.558 9.357  1.00 100.00 ? 86  TYR B O    1 
ATOM   2305 C CB   . TYR B 2 86  ? 18.448 -19.329 8.016  1.00 100.00 ? 86  TYR B CB   1 
ATOM   2306 C CG   . TYR B 2 86  ? 18.537 -18.299 6.887  1.00 100.00 ? 86  TYR B CG   1 
ATOM   2307 C CD1  . TYR B 2 86  ? 17.978 -18.553 5.625  1.00 100.00 ? 86  TYR B CD1  1 
ATOM   2308 C CD2  . TYR B 2 86  ? 19.187 -17.074 7.085  1.00 98.97  ? 86  TYR B CD2  1 
ATOM   2309 C CE1  . TYR B 2 86  ? 18.061 -17.613 4.592  1.00 100.00 ? 86  TYR B CE1  1 
ATOM   2310 C CE2  . TYR B 2 86  ? 19.276 -16.125 6.056  1.00 99.94  ? 86  TYR B CE2  1 
ATOM   2311 C CZ   . TYR B 2 86  ? 18.711 -16.400 4.812  1.00 100.00 ? 86  TYR B CZ   1 
ATOM   2312 O OH   . TYR B 2 86  ? 18.791 -15.471 3.793  1.00 91.16  ? 86  TYR B OH   1 
ATOM   2313 H H    . TYR B 2 86  ? 16.712 -20.311 6.376  1.00 0.00   ? 86  TYR B H    1 
ATOM   2314 H HH   . TYR B 2 86  ? 18.383 -15.825 2.999  1.00 0.00   ? 86  TYR B HH   1 
ATOM   2315 N N    . CYS B 2 87  ? 15.165 -19.029 9.787  1.00 97.20  ? 87  CYS B N    1 
ATOM   2316 C CA   . CYS B 2 87  ? 14.388 -18.079 10.547 1.00 95.85  ? 87  CYS B CA   1 
ATOM   2317 C C    . CYS B 2 87  ? 14.920 -17.957 11.967 1.00 99.34  ? 87  CYS B C    1 
ATOM   2318 O O    . CYS B 2 87  ? 15.295 -18.960 12.587 1.00 94.77  ? 87  CYS B O    1 
ATOM   2319 C CB   . CYS B 2 87  ? 12.938 -18.518 10.545 1.00 94.69  ? 87  CYS B CB   1 
ATOM   2320 S SG   . CYS B 2 87  ? 11.852 -17.630 11.684 1.00 90.70  ? 87  CYS B SG   1 
ATOM   2321 H H    . CYS B 2 87  ? 14.853 -19.948 9.773  1.00 0.00   ? 87  CYS B H    1 
ATOM   2322 N N    . LEU B 2 88  ? 14.999 -16.711 12.446 1.00 100.00 ? 88  LEU B N    1 
ATOM   2323 C CA   . LEU B 2 88  ? 15.487 -16.395 13.796 1.00 100.00 ? 88  LEU B CA   1 
ATOM   2324 C C    . LEU B 2 88  ? 14.817 -15.151 14.446 1.00 100.00 ? 88  LEU B C    1 
ATOM   2325 O O    . LEU B 2 88  ? 15.133 -14.811 15.589 1.00 100.00 ? 88  LEU B O    1 
ATOM   2326 C CB   . LEU B 2 88  ? 17.025 -16.224 13.806 1.00 100.00 ? 88  LEU B CB   1 
ATOM   2327 C CG   . LEU B 2 88  ? 18.065 -17.328 13.507 1.00 100.00 ? 88  LEU B CG   1 
ATOM   2328 C CD1  . LEU B 2 88  ? 18.178 -17.626 12.011 1.00 98.38  ? 88  LEU B CD1  1 
ATOM   2329 C CD2  . LEU B 2 88  ? 19.435 -16.875 14.027 1.00 100.00 ? 88  LEU B CD2  1 
ATOM   2330 H H    . LEU B 2 88  ? 14.719 -15.971 11.867 1.00 0.00   ? 88  LEU B H    1 
ATOM   2331 N N    . ARG B 2 89  ? 13.899 -14.492 13.723 1.00 100.00 ? 89  ARG B N    1 
ATOM   2332 C CA   . ARG B 2 89  ? 13.156 -13.296 14.190 1.00 99.12  ? 89  ARG B CA   1 
ATOM   2333 C C    . ARG B 2 89  ? 13.840 -12.297 15.156 1.00 100.00 ? 89  ARG B C    1 
ATOM   2334 O O    . ARG B 2 89  ? 13.889 -12.517 16.375 1.00 99.04  ? 89  ARG B O    1 
ATOM   2335 C CB   . ARG B 2 89  ? 11.768 -13.684 14.739 1.00 97.33  ? 89  ARG B CB   1 
ATOM   2336 C CG   . ARG B 2 89  ? 11.796 -14.802 15.773 1.00 100.00 ? 89  ARG B CG   1 
ATOM   2337 C CD   . ARG B 2 89  ? 10.843 -14.577 16.941 1.00 100.00 ? 89  ARG B CD   1 
ATOM   2338 N NE   . ARG B 2 89  ? 11.229 -15.418 18.078 1.00 99.10  ? 89  ARG B NE   1 
ATOM   2339 C CZ   . ARG B 2 89  ? 12.228 -15.141 18.915 1.00 96.99  ? 89  ARG B CZ   1 
ATOM   2340 N NH1  . ARG B 2 89  ? 12.947 -14.033 18.763 1.00 99.35  ? 89  ARG B NH1  1 
ATOM   2341 N NH2  . ARG B 2 89  ? 12.549 -16.001 19.874 1.00 90.55  ? 89  ARG B NH2  1 
ATOM   2342 H H    . ARG B 2 89  ? 13.701 -14.829 12.824 1.00 0.00   ? 89  ARG B H    1 
ATOM   2343 H HE   . ARG B 2 89  ? 10.726 -16.243 18.236 1.00 0.00   ? 89  ARG B HE   1 
ATOM   2344 H HH11 . ARG B 2 89  ? 12.749 -13.395 18.019 1.00 0.00   ? 89  ARG B HH11 1 
ATOM   2345 H HH12 . ARG B 2 89  ? 13.697 -13.841 19.396 1.00 0.00   ? 89  ARG B HH12 1 
ATOM   2346 H HH21 . ARG B 2 89  ? 12.040 -16.855 19.970 1.00 0.00   ? 89  ARG B HH21 1 
ATOM   2347 H HH22 . ARG B 2 89  ? 13.301 -15.793 20.499 1.00 0.00   ? 89  ARG B HH22 1 
ATOM   2348 N N    . ILE B 2 90  ? 14.304 -11.177 14.589 1.00 100.00 ? 90  ILE B N    1 
ATOM   2349 C CA   . ILE B 2 90  ? 14.985 -10.078 15.304 1.00 97.82  ? 90  ILE B CA   1 
ATOM   2350 C C    . ILE B 2 90  ? 14.121 -9.285  16.306 1.00 94.97  ? 90  ILE B C    1 
ATOM   2351 O O    . ILE B 2 90  ? 13.051 -8.781  15.957 1.00 93.93  ? 90  ILE B O    1 
ATOM   2352 C CB   . ILE B 2 90  ? 15.569 -9.042  14.282 1.00 95.45  ? 90  ILE B CB   1 
ATOM   2353 C CG1  . ILE B 2 90  ? 16.863 -9.555  13.640 1.00 90.99  ? 90  ILE B CG1  1 
ATOM   2354 C CG2  . ILE B 2 90  ? 15.786 -7.677  14.942 1.00 100.00 ? 90  ILE B CG2  1 
ATOM   2355 C CD1  . ILE B 2 90  ? 18.142 -9.181  14.380 1.00 83.83  ? 90  ILE B CD1  1 
ATOM   2356 H H    . ILE B 2 90  ? 14.216 -11.094 13.619 1.00 0.00   ? 90  ILE B H    1 
ATOM   2357 N N    . LYS B 2 91  ? 14.634 -9.138  17.529 1.00 90.69  ? 91  LYS B N    1 
ATOM   2358 C CA   . LYS B 2 91  ? 13.979 -8.371  18.598 1.00 88.88  ? 91  LYS B CA   1 
ATOM   2359 C C    . LYS B 2 91  ? 14.509 -6.933  18.458 1.00 92.74  ? 91  LYS B C    1 
ATOM   2360 O O    . LYS B 2 91  ? 15.696 -6.743  18.201 1.00 99.23  ? 91  LYS B O    1 
ATOM   2361 C CB   . LYS B 2 91  ? 14.373 -8.954  19.968 1.00 83.43  ? 91  LYS B CB   1 
ATOM   2362 C CG   . LYS B 2 91  ? 14.087 -8.067  21.190 1.00 78.40  ? 91  LYS B CG   1 
ATOM   2363 C CD   . LYS B 2 91  ? 14.968 -8.471  22.382 1.00 75.45  ? 91  LYS B CD   1 
ATOM   2364 C CE   . LYS B 2 91  ? 14.778 -7.547  23.572 1.00 75.31  ? 91  LYS B CE   1 
ATOM   2365 N NZ   . LYS B 2 91  ? 15.497 -8.013  24.797 1.00 64.10  ? 91  LYS B NZ   1 
ATOM   2366 H H    . LYS B 2 91  ? 15.493 -9.568  17.727 1.00 0.00   ? 91  LYS B H    1 
ATOM   2367 H HZ1  . LYS B 2 91  ? 16.516 -8.074  24.596 1.00 0.00   ? 91  LYS B HZ1  1 
ATOM   2368 H HZ2  . LYS B 2 91  ? 15.338 -7.337  25.572 1.00 0.00   ? 91  LYS B HZ2  1 
ATOM   2369 H HZ3  . LYS B 2 91  ? 15.143 -8.950  25.077 1.00 0.00   ? 91  LYS B HZ3  1 
ATOM   2370 N N    . ILE B 2 92  ? 13.651 -5.926  18.611 1.00 92.61  ? 92  ILE B N    1 
ATOM   2371 C CA   . ILE B 2 92  ? 14.100 -4.541  18.471 1.00 88.41  ? 92  ILE B CA   1 
ATOM   2372 C C    . ILE B 2 92  ? 14.239 -3.782  19.789 1.00 85.58  ? 92  ILE B C    1 
ATOM   2373 O O    . ILE B 2 92  ? 15.350 -3.630  20.293 1.00 85.77  ? 92  ILE B O    1 
ATOM   2374 C CB   . ILE B 2 92  ? 13.213 -3.737  17.461 1.00 93.36  ? 92  ILE B CB   1 
ATOM   2375 C CG1  . ILE B 2 92  ? 13.440 -4.254  16.034 1.00 99.08  ? 92  ILE B CG1  1 
ATOM   2376 C CG2  . ILE B 2 92  ? 13.539 -2.239  17.513 1.00 93.18  ? 92  ILE B CG2  1 
ATOM   2377 C CD1  . ILE B 2 92  ? 12.637 -3.517  14.968 1.00 94.40  ? 92  ILE B CD1  1 
ATOM   2378 H H    . ILE B 2 92  ? 12.723 -6.112  18.837 1.00 0.00   ? 92  ILE B H    1 
ATOM   2379 N N    . SER B 2 93  ? 13.116 -3.323  20.342 1.00 83.62  ? 93  SER B N    1 
ATOM   2380 C CA   . SER B 2 93  ? 13.083 -2.546  21.587 1.00 83.38  ? 93  SER B CA   1 
ATOM   2381 C C    . SER B 2 93  ? 13.357 -1.043  21.363 1.00 80.36  ? 93  SER B C    1 
ATOM   2382 O O    . SER B 2 93  ? 14.507 -0.582  21.370 1.00 81.59  ? 93  SER B O    1 
ATOM   2383 C CB   . SER B 2 93  ? 14.035 -3.124  22.646 1.00 81.12  ? 93  SER B CB   1 
ATOM   2384 O OG   . SER B 2 93  ? 13.689 -4.457  22.978 1.00 86.76  ? 93  SER B OG   1 
ATOM   2385 H H    . SER B 2 93  ? 12.261 -3.519  19.906 1.00 0.00   ? 93  SER B H    1 
ATOM   2386 H HG   . SER B 2 93  ? 14.292 -4.782  23.650 1.00 0.00   ? 93  SER B HG   1 
ATOM   2387 N N    . ALA B 2 94  ? 12.276 -0.291  21.171 1.00 72.00  ? 94  ALA B N    1 
ATOM   2388 C CA   . ALA B 2 94  ? 12.342 1.148   20.944 1.00 63.82  ? 94  ALA B CA   1 
ATOM   2389 C C    . ALA B 2 94  ? 11.800 1.950   22.137 1.00 61.67  ? 94  ALA B C    1 
ATOM   2390 O O    . ALA B 2 94  ? 11.179 1.392   23.047 1.00 60.49  ? 94  ALA B O    1 
ATOM   2391 C CB   . ALA B 2 94  ? 11.549 1.495   19.684 1.00 55.90  ? 94  ALA B CB   1 
ATOM   2392 H H    . ALA B 2 94  ? 11.397 -0.726  21.179 1.00 0.00   ? 94  ALA B H    1 
ATOM   2393 N N    . LYS B 2 95  ? 12.097 3.249   22.160 1.00 55.88  ? 95  LYS B N    1 
ATOM   2394 C CA   . LYS B 2 95  ? 11.582 4.136   23.204 1.00 48.53  ? 95  LYS B CA   1 
ATOM   2395 C C    . LYS B 2 95  ? 11.312 5.541   22.679 1.00 50.77  ? 95  LYS B C    1 
ATOM   2396 O O    . LYS B 2 95  ? 12.120 6.112   21.950 1.00 58.64  ? 95  LYS B O    1 
ATOM   2397 C CB   . LYS B 2 95  ? 12.467 4.199   24.445 1.00 35.08  ? 95  LYS B CB   1 
ATOM   2398 C CG   . LYS B 2 95  ? 11.918 5.200   25.453 1.00 23.51  ? 95  LYS B CG   1 
ATOM   2399 C CD   . LYS B 2 95  ? 12.525 5.085   26.825 1.00 23.35  ? 95  LYS B CD   1 
ATOM   2400 C CE   . LYS B 2 95  ? 12.027 6.218   27.697 1.00 24.47  ? 95  LYS B CE   1 
ATOM   2401 N NZ   . LYS B 2 95  ? 12.297 6.003   29.152 1.00 43.37  ? 95  LYS B NZ   1 
ATOM   2402 H H    . LYS B 2 95  ? 12.675 3.618   21.460 1.00 0.00   ? 95  LYS B H    1 
ATOM   2403 H HZ1  . LYS B 2 95  ? 11.856 5.107   29.443 1.00 0.00   ? 95  LYS B HZ1  1 
ATOM   2404 H HZ2  . LYS B 2 95  ? 13.321 5.957   29.324 1.00 0.00   ? 95  LYS B HZ2  1 
ATOM   2405 H HZ3  . LYS B 2 95  ? 11.887 6.779   29.711 1.00 0.00   ? 95  LYS B HZ3  1 
ATOM   2406 N N    . PHE B 2 96  ? 10.134 6.061   23.015 1.00 54.76  ? 96  PHE B N    1 
ATOM   2407 C CA   . PHE B 2 96  ? 9.709  7.387   22.587 1.00 47.61  ? 96  PHE B CA   1 
ATOM   2408 C C    . PHE B 2 96  ? 9.524  8.270   23.810 1.00 48.27  ? 96  PHE B C    1 
ATOM   2409 O O    . PHE B 2 96  ? 8.925  7.847   24.805 1.00 55.94  ? 96  PHE B O    1 
ATOM   2410 C CB   . PHE B 2 96  ? 8.410  7.290   21.769 1.00 45.04  ? 96  PHE B CB   1 
ATOM   2411 C CG   . PHE B 2 96  ? 8.560  6.508   20.491 1.00 48.05  ? 96  PHE B CG   1 
ATOM   2412 C CD1  . PHE B 2 96  ? 8.652  5.114   20.516 1.00 50.55  ? 96  PHE B CD1  1 
ATOM   2413 C CD2  . PHE B 2 96  ? 8.684  7.163   19.270 1.00 48.75  ? 96  PHE B CD2  1 
ATOM   2414 C CE1  . PHE B 2 96  ? 8.875  4.384   19.341 1.00 49.15  ? 96  PHE B CE1  1 
ATOM   2415 C CE2  . PHE B 2 96  ? 8.907  6.444   18.093 1.00 46.88  ? 96  PHE B CE2  1 
ATOM   2416 C CZ   . PHE B 2 96  ? 9.005  5.053   18.130 1.00 45.26  ? 96  PHE B CZ   1 
ATOM   2417 H H    . PHE B 2 96  ? 9.522  5.530   23.563 1.00 0.00   ? 96  PHE B H    1 
ATOM   2418 N N    . VAL B 2 97  ? 10.097 9.470   23.754 1.00 42.01  ? 97  VAL B N    1 
ATOM   2419 C CA   . VAL B 2 97  ? 10.003 10.408  24.857 1.00 39.90  ? 97  VAL B CA   1 
ATOM   2420 C C    . VAL B 2 97  ? 9.389  11.740  24.502 1.00 43.66  ? 97  VAL B C    1 
ATOM   2421 O O    . VAL B 2 97  ? 9.259  12.117  23.335 1.00 45.52  ? 97  VAL B O    1 
ATOM   2422 C CB   . VAL B 2 97  ? 11.356 10.689  25.485 1.00 36.41  ? 97  VAL B CB   1 
ATOM   2423 C CG1  . VAL B 2 97  ? 11.801 9.513   26.290 1.00 37.45  ? 97  VAL B CG1  1 
ATOM   2424 C CG2  . VAL B 2 97  ? 12.368 11.016  24.410 1.00 52.08  ? 97  VAL B CG2  1 
ATOM   2425 H H    . VAL B 2 97  ? 10.581 9.733   22.944 1.00 0.00   ? 97  VAL B H    1 
ATOM   2426 N N    . GLU B 2 98  ? 9.050  12.471  25.549 1.00 44.69  ? 98  GLU B N    1 
ATOM   2427 C CA   . GLU B 2 98  ? 8.440  13.775  25.409 1.00 50.59  ? 98  GLU B CA   1 
ATOM   2428 C C    . GLU B 2 98  ? 9.510  14.798  25.736 1.00 43.03  ? 98  GLU B C    1 
ATOM   2429 O O    . GLU B 2 98  ? 10.383 14.540  26.564 1.00 49.34  ? 98  GLU B O    1 
ATOM   2430 C CB   . GLU B 2 98  ? 7.298  13.905  26.428 1.00 55.84  ? 98  GLU B CB   1 
ATOM   2431 C CG   . GLU B 2 98  ? 6.142  14.775  25.972 1.00 65.08  ? 98  GLU B CG   1 
ATOM   2432 C CD   . GLU B 2 98  ? 5.295  14.088  24.911 1.00 69.81  ? 98  GLU B CD   1 
ATOM   2433 O OE1  . GLU B 2 98  ? 4.712  13.023  25.221 1.00 71.03  ? 98  GLU B OE1  1 
ATOM   2434 O OE2  . GLU B 2 98  ? 5.220  14.602  23.769 1.00 62.32  ? 98  GLU B OE2  1 
ATOM   2435 H H    . GLU B 2 98  ? 9.211  12.125  26.450 1.00 0.00   ? 98  GLU B H    1 
ATOM   2436 N N    . ASN B 2 99  ? 9.450  15.961  25.108 1.00 30.47  ? 99  ASN B N    1 
ATOM   2437 C CA   . ASN B 2 99  ? 10.431 16.992  25.422 1.00 32.78  ? 99  ASN B CA   1 
ATOM   2438 C C    . ASN B 2 99  ? 10.334 17.344  26.883 1.00 36.86  ? 99  ASN B C    1 
ATOM   2439 O O    . ASN B 2 99  ? 9.233  17.503  27.405 1.00 59.93  ? 99  ASN B O    1 
ATOM   2440 C CB   . ASN B 2 99  ? 10.145 18.262  24.648 1.00 22.69  ? 99  ASN B CB   1 
ATOM   2441 C CG   . ASN B 2 99  ? 10.497 18.139  23.211 1.00 19.78  ? 99  ASN B CG   1 
ATOM   2442 O OD1  . ASN B 2 99  ? 11.079 17.141  22.790 1.00 25.59  ? 99  ASN B OD1  1 
ATOM   2443 N ND2  . ASN B 2 99  ? 10.150 19.160  22.432 1.00 27.60  ? 99  ASN B ND2  1 
ATOM   2444 H H    . ASN B 2 99  ? 8.744  16.134  24.451 1.00 0.00   ? 99  ASN B H    1 
ATOM   2445 H HD21 . ASN B 2 99  ? 10.374 19.116  21.480 1.00 0.00   ? 99  ASN B HD21 1 
ATOM   2446 H HD22 . ASN B 2 99  ? 9.685  19.920  22.843 1.00 0.00   ? 99  ASN B HD22 1 
ATOM   2447 N N    . GLU B 2 100 ? 11.468 17.475  27.551 1.00 38.64  ? 100 GLU B N    1 
ATOM   2448 C CA   . GLU B 2 100 ? 11.443 17.858  28.949 1.00 39.31  ? 100 GLU B CA   1 
ATOM   2449 C C    . GLU B 2 100 ? 10.841 19.266  29.096 1.00 40.65  ? 100 GLU B C    1 
ATOM   2450 O O    . GLU B 2 100 ? 10.748 20.017  28.121 1.00 38.46  ? 100 GLU B O    1 
ATOM   2451 C CB   . GLU B 2 100 ? 12.852 17.789  29.511 1.00 37.55  ? 100 GLU B CB   1 
ATOM   2452 C CG   . GLU B 2 100 ? 13.349 16.363  29.594 1.00 42.29  ? 100 GLU B CG   1 
ATOM   2453 C CD   . GLU B 2 100 ? 14.852 16.277  29.713 1.00 44.66  ? 100 GLU B CD   1 
ATOM   2454 O OE1  . GLU B 2 100 ? 15.548 16.783  28.816 1.00 48.15  ? 100 GLU B OE1  1 
ATOM   2455 O OE2  . GLU B 2 100 ? 15.344 15.690  30.694 1.00 56.89  ? 100 GLU B OE2  1 
ATOM   2456 H H    . GLU B 2 100 ? 12.321 17.300  27.104 1.00 0.00   ? 100 GLU B H    1 
ATOM   2457 N N    . PRO B 2 101 ? 10.362 19.613  30.305 1.00 49.44  ? 101 PRO B N    1 
ATOM   2458 C CA   . PRO B 2 101 ? 9.768  20.925  30.558 1.00 45.65  ? 101 PRO B CA   1 
ATOM   2459 C C    . PRO B 2 101 ? 10.631 22.100  30.114 1.00 50.01  ? 101 PRO B C    1 
ATOM   2460 O O    . PRO B 2 101 ? 11.784 22.222  30.537 1.00 55.77  ? 101 PRO B O    1 
ATOM   2461 C CB   . PRO B 2 101 ? 9.589  20.924  32.082 1.00 45.59  ? 101 PRO B CB   1 
ATOM   2462 C CG   . PRO B 2 101 ? 10.620 19.970  32.568 1.00 46.75  ? 101 PRO B CG   1 
ATOM   2463 C CD   . PRO B 2 101 ? 10.450 18.858  31.568 1.00 51.00  ? 101 PRO B CD   1 
ATOM   2464 N N    . ASN B 2 102 ? 10.055 22.961  29.272 1.00 55.56  ? 102 ASN B N    1 
ATOM   2465 C CA   . ASN B 2 102 ? 10.727 24.162  28.758 1.00 59.31  ? 102 ASN B CA   1 
ATOM   2466 C C    . ASN B 2 102 ? 11.777 23.953  27.688 1.00 60.23  ? 102 ASN B C    1 
ATOM   2467 O O    . ASN B 2 102 ? 12.160 24.898  26.995 1.00 61.21  ? 102 ASN B O    1 
ATOM   2468 C CB   . ASN B 2 102 ? 11.354 24.952  29.896 1.00 70.27  ? 102 ASN B CB   1 
ATOM   2469 C CG   . ASN B 2 102 ? 10.324 25.496  30.839 1.00 76.09  ? 102 ASN B CG   1 
ATOM   2470 O OD1  . ASN B 2 102 ? 9.389  26.178  30.405 1.00 79.71  ? 102 ASN B OD1  1 
ATOM   2471 N ND2  . ASN B 2 102 ? 10.464 25.184  32.137 1.00 72.39  ? 102 ASN B ND2  1 
ATOM   2472 H H    . ASN B 2 102 ? 9.132  22.783  28.990 1.00 0.00   ? 102 ASN B H    1 
ATOM   2473 H HD21 . ASN B 2 102 ? 9.801  25.548  32.759 1.00 0.00   ? 102 ASN B HD21 1 
ATOM   2474 H HD22 . ASN B 2 102 ? 11.212 24.616  32.418 1.00 0.00   ? 102 ASN B HD22 1 
ATOM   2475 N N    . LEU B 2 103 ? 12.286 22.731  27.594 1.00 54.25  ? 103 LEU B N    1 
ATOM   2476 C CA   . LEU B 2 103 ? 13.290 22.420  26.604 1.00 40.25  ? 103 LEU B CA   1 
ATOM   2477 C C    . LEU B 2 103 ? 12.597 22.010  25.333 1.00 28.78  ? 103 LEU B C    1 
ATOM   2478 O O    . LEU B 2 103 ? 11.393 21.787  25.308 1.00 38.33  ? 103 LEU B O    1 
ATOM   2479 C CB   . LEU B 2 103 ? 14.212 21.301  27.104 1.00 38.38  ? 103 LEU B CB   1 
ATOM   2480 C CG   . LEU B 2 103 ? 15.046 21.715  28.316 1.00 28.30  ? 103 LEU B CG   1 
ATOM   2481 C CD1  . LEU B 2 103 ? 15.892 20.563  28.784 1.00 32.76  ? 103 LEU B CD1  1 
ATOM   2482 C CD2  . LEU B 2 103 ? 15.903 22.915  27.967 1.00 18.60  ? 103 LEU B CD2  1 
ATOM   2483 H H    . LEU B 2 103 ? 11.968 22.012  28.174 1.00 0.00   ? 103 LEU B H    1 
ATOM   2484 N N    . CYS B 2 104 ? 13.368 22.006  24.261 1.00 35.40  ? 104 CYS B N    1 
ATOM   2485 C CA   . CYS B 2 104 ? 12.897 21.604  22.952 1.00 35.10  ? 104 CYS B CA   1 
ATOM   2486 C C    . CYS B 2 104 ? 13.536 20.228  22.632 1.00 33.52  ? 104 CYS B C    1 
ATOM   2487 O O    . CYS B 2 104 ? 13.751 19.841  21.471 1.00 35.44  ? 104 CYS B O    1 
ATOM   2488 C CB   . CYS B 2 104 ? 13.248 22.689  21.923 1.00 39.61  ? 104 CYS B CB   1 
ATOM   2489 S SG   . CYS B 2 104 ? 15.018 23.019  21.666 1.00 24.89  ? 104 CYS B SG   1 
ATOM   2490 H H    . CYS B 2 104 ? 14.301 22.285  24.363 1.00 0.00   ? 104 CYS B H    1 
ATOM   2491 N N    . TYR B 2 105 ? 13.798 19.479  23.700 1.00 26.93  ? 105 TYR B N    1 
ATOM   2492 C CA   . TYR B 2 105 ? 14.384 18.160  23.608 1.00 26.75  ? 105 TYR B CA   1 
ATOM   2493 C C    . TYR B 2 105 ? 14.353 17.467  24.967 1.00 27.72  ? 105 TYR B C    1 
ATOM   2494 O O    . TYR B 2 105 ? 14.042 18.069  25.996 1.00 28.17  ? 105 TYR B O    1 
ATOM   2495 C CB   . TYR B 2 105 ? 15.850 18.255  23.118 1.00 26.11  ? 105 TYR B CB   1 
ATOM   2496 C CG   . TYR B 2 105 ? 16.789 19.105  24.002 1.00 18.99  ? 105 TYR B CG   1 
ATOM   2497 C CD1  . TYR B 2 105 ? 17.359 18.583  25.164 1.00 11.57  ? 105 TYR B CD1  1 
ATOM   2498 C CD2  . TYR B 2 105 ? 17.050 20.445  23.687 1.00 15.46  ? 105 TYR B CD2  1 
ATOM   2499 C CE1  . TYR B 2 105 ? 18.154 19.387  25.998 1.00 19.78  ? 105 TYR B CE1  1 
ATOM   2500 C CE2  . TYR B 2 105 ? 17.831 21.241  24.505 1.00 8.76   ? 105 TYR B CE2  1 
ATOM   2501 C CZ   . TYR B 2 105 ? 18.380 20.716  25.658 1.00 19.49  ? 105 TYR B CZ   1 
ATOM   2502 O OH   . TYR B 2 105 ? 19.119 21.538  26.485 1.00 30.79  ? 105 TYR B OH   1 
ATOM   2503 H H    . TYR B 2 105 ? 13.611 19.841  24.590 1.00 0.00   ? 105 TYR B H    1 
ATOM   2504 H HH   . TYR B 2 105 ? 18.951 22.461  26.277 1.00 0.00   ? 105 TYR B HH   1 
ATOM   2505 N N    . ASN B 2 106 ? 14.736 16.196  24.939 1.00 40.78  ? 106 ASN B N    1 
ATOM   2506 C CA   . ASN B 2 106 ? 14.858 15.345  26.116 1.00 33.67  ? 106 ASN B CA   1 
ATOM   2507 C C    . ASN B 2 106 ? 16.316 14.834  26.058 1.00 37.65  ? 106 ASN B C    1 
ATOM   2508 O O    . ASN B 2 106 ? 16.789 14.393  25.000 1.00 35.34  ? 106 ASN B O    1 
ATOM   2509 C CB   . ASN B 2 106 ? 13.883 14.170  26.020 1.00 24.01  ? 106 ASN B CB   1 
ATOM   2510 C CG   . ASN B 2 106 ? 13.776 13.398  27.315 1.00 44.12  ? 106 ASN B CG   1 
ATOM   2511 O OD1  . ASN B 2 106 ? 14.783 13.076  27.952 1.00 41.22  ? 106 ASN B OD1  1 
ATOM   2512 N ND2  . ASN B 2 106 ? 12.547 13.096  27.718 1.00 37.59  ? 106 ASN B ND2  1 
ATOM   2513 H H    . ASN B 2 106 ? 14.951 15.804  24.065 1.00 0.00   ? 106 ASN B H    1 
ATOM   2514 H HD21 . ASN B 2 106 ? 12.439 12.605  28.559 1.00 0.00   ? 106 ASN B HD21 1 
ATOM   2515 H HD22 . ASN B 2 106 ? 11.802 13.371  27.152 1.00 0.00   ? 106 ASN B HD22 1 
ATOM   2516 N N    . ALA B 2 107 ? 17.031 14.923  27.177 1.00 38.69  ? 107 ALA B N    1 
ATOM   2517 C CA   . ALA B 2 107 ? 18.424 14.484  27.251 1.00 31.19  ? 107 ALA B CA   1 
ATOM   2518 C C    . ALA B 2 107 ? 18.578 12.974  27.045 1.00 27.97  ? 107 ALA B C    1 
ATOM   2519 O O    . ALA B 2 107 ? 19.646 12.488  26.701 1.00 39.99  ? 107 ALA B O    1 
ATOM   2520 C CB   . ALA B 2 107 ? 19.027 14.910  28.575 1.00 31.99  ? 107 ALA B CB   1 
ATOM   2521 H H    . ALA B 2 107 ? 16.610 15.271  27.984 1.00 0.00   ? 107 ALA B H    1 
ATOM   2522 N N    . GLN B 2 108 ? 17.492 12.242  27.253 1.00 40.28  ? 108 GLN B N    1 
ATOM   2523 C CA   . GLN B 2 108 ? 17.463 10.792  27.073 1.00 39.64  ? 108 GLN B CA   1 
ATOM   2524 C C    . GLN B 2 108 ? 17.749 10.431  25.610 1.00 36.08  ? 108 GLN B C    1 
ATOM   2525 O O    . GLN B 2 108 ? 18.115 9.298   25.287 1.00 37.42  ? 108 GLN B O    1 
ATOM   2526 C CB   . GLN B 2 108 ? 16.087 10.239  27.509 1.00 49.69  ? 108 GLN B CB   1 
ATOM   2527 C CG   . GLN B 2 108 ? 15.835 10.306  29.040 1.00 58.03  ? 108 GLN B CG   1 
ATOM   2528 C CD   . GLN B 2 108 ? 14.397 9.955   29.461 1.00 64.06  ? 108 GLN B CD   1 
ATOM   2529 O OE1  . GLN B 2 108 ? 13.882 8.883   29.137 1.00 49.65  ? 108 GLN B OE1  1 
ATOM   2530 N NE2  . GLN B 2 108 ? 13.759 10.859  30.215 1.00 69.14  ? 108 GLN B NE2  1 
ATOM   2531 H H    . GLN B 2 108 ? 16.681 12.692  27.551 1.00 0.00   ? 108 GLN B H    1 
ATOM   2532 H HE21 . GLN B 2 108 ? 12.840 10.659  30.490 1.00 0.00   ? 108 GLN B HE21 1 
ATOM   2533 H HE22 . GLN B 2 108 ? 14.232 11.682  30.458 1.00 0.00   ? 108 GLN B HE22 1 
ATOM   2534 N N    . ALA B 2 109 ? 17.659 11.428  24.741 1.00 31.55  ? 109 ALA B N    1 
ATOM   2535 C CA   . ALA B 2 109 ? 17.875 11.216  23.324 1.00 32.82  ? 109 ALA B CA   1 
ATOM   2536 C C    . ALA B 2 109 ? 19.115 11.913  22.740 1.00 32.01  ? 109 ALA B C    1 
ATOM   2537 O O    . ALA B 2 109 ? 19.282 11.928  21.524 1.00 30.32  ? 109 ALA B O    1 
ATOM   2538 C CB   . ALA B 2 109 ? 16.597 11.623  22.548 1.00 24.52  ? 109 ALA B CB   1 
ATOM   2539 H H    . ALA B 2 109 ? 17.427 12.326  25.049 1.00 0.00   ? 109 ALA B H    1 
ATOM   2540 N N    . ILE B 2 110 ? 19.983 12.482  23.580 1.00 32.29  ? 110 ILE B N    1 
ATOM   2541 C CA   . ILE B 2 110 ? 21.178 13.145  23.042 1.00 36.13  ? 110 ILE B CA   1 
ATOM   2542 C C    . ILE B 2 110 ? 22.185 12.149  22.505 1.00 32.88  ? 110 ILE B C    1 
ATOM   2543 O O    . ILE B 2 110 ? 22.250 10.993  22.938 1.00 24.46  ? 110 ILE B O    1 
ATOM   2544 C CB   . ILE B 2 110 ? 21.985 13.986  24.068 1.00 25.53  ? 110 ILE B CB   1 
ATOM   2545 C CG1  . ILE B 2 110 ? 22.424 13.106  25.235 1.00 49.76  ? 110 ILE B CG1  1 
ATOM   2546 C CG2  . ILE B 2 110 ? 21.236 15.222  24.479 1.00 35.27  ? 110 ILE B CG2  1 
ATOM   2547 C CD1  . ILE B 2 110 ? 23.465 13.740  26.166 1.00 64.55  ? 110 ILE B CD1  1 
ATOM   2548 H H    . ILE B 2 110 ? 19.831 12.447  24.547 1.00 0.00   ? 110 ILE B H    1 
ATOM   2549 N N    . PHE B 2 111 ? 22.939 12.636  21.528 1.00 30.85  ? 111 PHE B N    1 
ATOM   2550 C CA   . PHE B 2 111 ? 24.035 11.917  20.903 1.00 20.73  ? 111 PHE B CA   1 
ATOM   2551 C C    . PHE B 2 111 ? 25.247 12.806  21.235 1.00 19.13  ? 111 PHE B C    1 
ATOM   2552 O O    . PHE B 2 111 ? 25.268 13.998  20.887 1.00 14.94  ? 111 PHE B O    1 
ATOM   2553 C CB   . PHE B 2 111 ? 23.863 11.859  19.384 1.00 24.23  ? 111 PHE B CB   1 
ATOM   2554 C CG   . PHE B 2 111 ? 22.725 10.990  18.914 1.00 35.80  ? 111 PHE B CG   1 
ATOM   2555 C CD1  . PHE B 2 111 ? 22.859 9.602   18.872 1.00 32.49  ? 111 PHE B CD1  1 
ATOM   2556 C CD2  . PHE B 2 111 ? 21.533 11.561  18.463 1.00 46.25  ? 111 PHE B CD2  1 
ATOM   2557 C CE1  . PHE B 2 111 ? 21.832 8.784   18.386 1.00 22.67  ? 111 PHE B CE1  1 
ATOM   2558 C CE2  . PHE B 2 111 ? 20.488 10.750  17.972 1.00 36.23  ? 111 PHE B CE2  1 
ATOM   2559 C CZ   . PHE B 2 111 ? 20.645 9.360   17.935 1.00 30.80  ? 111 PHE B CZ   1 
ATOM   2560 H H    . PHE B 2 111 ? 22.740 13.530  21.187 1.00 0.00   ? 111 PHE B H    1 
ATOM   2561 N N    . LYS B 2 112 ? 26.212 12.257  21.977 1.00 28.85  ? 112 LYS B N    1 
ATOM   2562 C CA   . LYS B 2 112 ? 27.421 13.012  22.336 1.00 26.79  ? 112 LYS B CA   1 
ATOM   2563 C C    . LYS B 2 112 ? 28.410 13.150  21.154 1.00 24.26  ? 112 LYS B C    1 
ATOM   2564 O O    . LYS B 2 112 ? 28.831 12.146  20.570 1.00 19.57  ? 112 LYS B O    1 
ATOM   2565 C CB   . LYS B 2 112 ? 28.135 12.369  23.538 1.00 27.25  ? 112 LYS B CB   1 
ATOM   2566 C CG   . LYS B 2 112 ? 27.479 12.590  24.916 1.00 26.47  ? 112 LYS B CG   1 
ATOM   2567 C CD   . LYS B 2 112 ? 28.407 12.069  26.029 1.00 35.81  ? 112 LYS B CD   1 
ATOM   2568 C CE   . LYS B 2 112 ? 27.848 12.246  27.440 1.00 41.15  ? 112 LYS B CE   1 
ATOM   2569 N NZ   . LYS B 2 112 ? 26.802 11.245  27.825 1.00 66.67  ? 112 LYS B NZ   1 
ATOM   2570 H H    . LYS B 2 112 ? 26.097 11.339  22.301 1.00 0.00   ? 112 LYS B H    1 
ATOM   2571 H HZ1  . LYS B 2 112 ? 27.192 10.286  27.737 1.00 0.00   ? 112 LYS B HZ1  1 
ATOM   2572 H HZ2  . LYS B 2 112 ? 26.501 11.408  28.806 1.00 0.00   ? 112 LYS B HZ2  1 
ATOM   2573 H HZ3  . LYS B 2 112 ? 25.984 11.352  27.192 1.00 0.00   ? 112 LYS B HZ3  1 
ATOM   2574 N N    . GLN B 2 113 ? 28.703 14.394  20.762 1.00 17.80  ? 113 GLN B N    1 
ATOM   2575 C CA   . GLN B 2 113 ? 29.647 14.693  19.678 1.00 14.96  ? 113 GLN B CA   1 
ATOM   2576 C C    . GLN B 2 113 ? 30.663 15.734  20.116 1.00 21.12  ? 113 GLN B C    1 
ATOM   2577 O O    . GLN B 2 113 ? 30.299 16.736  20.736 1.00 22.26  ? 113 GLN B O    1 
ATOM   2578 C CB   . GLN B 2 113 ? 28.936 15.123  18.395 1.00 9.65   ? 113 GLN B CB   1 
ATOM   2579 C CG   . GLN B 2 113 ? 28.117 13.961  17.830 1.00 18.85  ? 113 GLN B CG   1 
ATOM   2580 C CD   . GLN B 2 113 ? 27.352 14.274  16.571 1.00 12.89  ? 113 GLN B CD   1 
ATOM   2581 O OE1  . GLN B 2 113 ? 27.588 15.285  15.918 1.00 16.43  ? 113 GLN B OE1  1 
ATOM   2582 N NE2  . GLN B 2 113 ? 26.437 13.386  16.211 1.00 6.55   ? 113 GLN B NE2  1 
ATOM   2583 H H    . GLN B 2 113 ? 28.241 15.137  21.200 1.00 0.00   ? 113 GLN B H    1 
ATOM   2584 H HE21 . GLN B 2 113 ? 25.936 13.554  15.390 1.00 0.00   ? 113 GLN B HE21 1 
ATOM   2585 H HE22 . GLN B 2 113 ? 26.297 12.600  16.779 1.00 0.00   ? 113 GLN B HE22 1 
ATOM   2586 N N    . LYS B 2 114 ? 31.939 15.467  19.795 1.00 30.82  ? 114 LYS B N    1 
ATOM   2587 C CA   . LYS B 2 114 ? 33.071 16.323  20.172 1.00 22.83  ? 114 LYS B CA   1 
ATOM   2588 C C    . LYS B 2 114 ? 33.894 16.899  19.006 1.00 23.58  ? 114 LYS B C    1 
ATOM   2589 O O    . LYS B 2 114 ? 33.969 16.315  17.926 1.00 22.66  ? 114 LYS B O    1 
ATOM   2590 C CB   . LYS B 2 114 ? 33.991 15.542  21.126 1.00 29.62  ? 114 LYS B CB   1 
ATOM   2591 C CG   . LYS B 2 114 ? 33.281 14.607  22.166 1.00 24.75  ? 114 LYS B CG   1 
ATOM   2592 C CD   . LYS B 2 114 ? 34.296 13.731  22.923 1.00 38.40  ? 114 LYS B CD   1 
ATOM   2593 C CE   . LYS B 2 114 ? 33.682 12.421  23.459 1.00 49.86  ? 114 LYS B CE   1 
ATOM   2594 N NZ   . LYS B 2 114 ? 34.717 11.349  23.760 1.00 43.64  ? 114 LYS B NZ   1 
ATOM   2595 H H    . LYS B 2 114 ? 32.123 14.646  19.294 1.00 0.00   ? 114 LYS B H    1 
ATOM   2596 H HZ1  . LYS B 2 114 ? 35.367 11.728  24.477 1.00 0.00   ? 114 LYS B HZ1  1 
ATOM   2597 H HZ2  . LYS B 2 114 ? 34.233 10.514  24.147 1.00 0.00   ? 114 LYS B HZ2  1 
ATOM   2598 H HZ3  . LYS B 2 114 ? 35.258 11.075  22.924 1.00 0.00   ? 114 LYS B HZ3  1 
ATOM   2599 N N    . LEU B 2 115 ? 34.484 18.071  19.225 1.00 27.94  ? 115 LEU B N    1 
ATOM   2600 C CA   . LEU B 2 115 ? 35.316 18.746  18.216 1.00 23.22  ? 115 LEU B CA   1 
ATOM   2601 C C    . LEU B 2 115 ? 36.376 19.590  18.904 1.00 27.30  ? 115 LEU B C    1 
ATOM   2602 O O    . LEU B 2 115 ? 36.067 20.388  19.791 1.00 24.54  ? 115 LEU B O    1 
ATOM   2603 C CB   . LEU B 2 115 ? 34.519 19.681  17.314 1.00 24.01  ? 115 LEU B CB   1 
ATOM   2604 C CG   . LEU B 2 115 ? 33.513 19.273  16.246 1.00 22.51  ? 115 LEU B CG   1 
ATOM   2605 C CD1  . LEU B 2 115 ? 33.054 20.546  15.567 1.00 4.34   ? 115 LEU B CD1  1 
ATOM   2606 C CD2  . LEU B 2 115 ? 34.109 18.346  15.236 1.00 14.31  ? 115 LEU B CD2  1 
ATOM   2607 H H    . LEU B 2 115 ? 34.365 18.505  20.095 1.00 0.00   ? 115 LEU B H    1 
ATOM   2608 N N    . PRO B 2 116 ? 37.632 19.479  18.438 1.00 36.54  ? 116 PRO B N    1 
ATOM   2609 C CA   . PRO B 2 116 ? 38.776 20.208  18.977 1.00 34.39  ? 116 PRO B CA   1 
ATOM   2610 C C    . PRO B 2 116 ? 38.701 21.700  18.707 1.00 33.79  ? 116 PRO B C    1 
ATOM   2611 O O    . PRO B 2 116 ? 38.348 22.137  17.602 1.00 27.74  ? 116 PRO B O    1 
ATOM   2612 C CB   . PRO B 2 116 ? 39.953 19.556  18.259 1.00 36.68  ? 116 PRO B CB   1 
ATOM   2613 C CG   . PRO B 2 116 ? 39.384 19.237  16.928 1.00 37.34  ? 116 PRO B CG   1 
ATOM   2614 C CD   . PRO B 2 116 ? 38.040 18.669  17.274 1.00 40.19  ? 116 PRO B CD   1 
ATOM   2615 N N    . VAL B 2 117 ? 39.049 22.466  19.739 1.00 32.55  ? 117 VAL B N    1 
ATOM   2616 C CA   . VAL B 2 117 ? 39.047 23.921  19.704 1.00 29.70  ? 117 VAL B CA   1 
ATOM   2617 C C    . VAL B 2 117 ? 39.972 24.473  18.617 1.00 31.49  ? 117 VAL B C    1 
ATOM   2618 O O    . VAL B 2 117 ? 40.801 23.752  18.071 1.00 39.07  ? 117 VAL B O    1 
ATOM   2619 C CB   . VAL B 2 117 ? 39.486 24.475  21.074 1.00 29.61  ? 117 VAL B CB   1 
ATOM   2620 C CG1  . VAL B 2 117 ? 39.273 25.980  21.145 1.00 50.08  ? 117 VAL B CG1  1 
ATOM   2621 C CG2  . VAL B 2 117 ? 38.713 23.790  22.188 1.00 24.86  ? 117 VAL B CG2  1 
ATOM   2622 H H    . VAL B 2 117 ? 39.338 22.025  20.554 1.00 0.00   ? 117 VAL B H    1 
ATOM   2623 N N    . ALA B 2 118 ? 39.802 25.750  18.302 1.00 32.38  ? 118 ALA B N    1 
ATOM   2624 C CA   . ALA B 2 118 ? 40.600 26.461  17.308 1.00 37.99  ? 118 ALA B CA   1 
ATOM   2625 C C    . ALA B 2 118 ? 40.594 25.963  15.869 1.00 44.90  ? 118 ALA B C    1 
ATOM   2626 O O    . ALA B 2 118 ? 41.418 26.396  15.061 1.00 54.58  ? 118 ALA B O    1 
ATOM   2627 C CB   . ALA B 2 118 ? 42.009 26.626  17.791 1.00 43.78  ? 118 ALA B CB   1 
ATOM   2628 H H    . ALA B 2 118 ? 39.119 26.272  18.753 1.00 0.00   ? 118 ALA B H    1 
ATOM   2629 N N    . GLY B 2 119 ? 39.634 25.114  15.525 1.00 49.51  ? 119 GLY B N    1 
ATOM   2630 C CA   . GLY B 2 119 ? 39.561 24.612  14.166 1.00 40.44  ? 119 GLY B CA   1 
ATOM   2631 C C    . GLY B 2 119 ? 38.144 24.269  13.751 1.00 45.89  ? 119 GLY B C    1 
ATOM   2632 O O    . GLY B 2 119 ? 37.332 23.873  14.598 1.00 51.91  ? 119 GLY B O    1 
ATOM   2633 H H    . GLY B 2 119 ? 38.976 24.822  16.189 1.00 0.00   ? 119 GLY B H    1 
ATOM   2634 N N    . ASP B 2 120 ? 37.871 24.421  12.448 1.00 39.92  ? 120 ASP B N    1 
ATOM   2635 C CA   . ASP B 2 120 ? 36.577 24.140  11.807 1.00 38.55  ? 120 ASP B CA   1 
ATOM   2636 C C    . ASP B 2 120 ? 36.181 22.658  11.873 1.00 45.44  ? 120 ASP B C    1 
ATOM   2637 O O    . ASP B 2 120 ? 36.877 21.802  11.322 1.00 53.55  ? 120 ASP B O    1 
ATOM   2638 C CB   . ASP B 2 120 ? 36.621 24.527  10.323 1.00 24.76  ? 120 ASP B CB   1 
ATOM   2639 C CG   . ASP B 2 120 ? 36.789 26.021  10.099 1.00 46.74  ? 120 ASP B CG   1 
ATOM   2640 O OD1  . ASP B 2 120 ? 37.198 26.743  11.038 1.00 50.10  ? 120 ASP B OD1  1 
ATOM   2641 O OD2  . ASP B 2 120 ? 36.511 26.478  8.965  1.00 41.78  ? 120 ASP B OD2  1 
ATOM   2642 H H    . ASP B 2 120 ? 38.593 24.752  11.876 1.00 0.00   ? 120 ASP B H    1 
ATOM   2643 N N    . GLY B 2 121 ? 35.042 22.355  12.490 1.00 34.76  ? 121 GLY B N    1 
ATOM   2644 C CA   . GLY B 2 121 ? 34.622 20.971  12.553 1.00 30.75  ? 121 GLY B CA   1 
ATOM   2645 C C    . GLY B 2 121 ? 33.183 20.798  12.146 1.00 22.55  ? 121 GLY B C    1 
ATOM   2646 O O    . GLY B 2 121 ? 32.507 21.766  11.849 1.00 29.80  ? 121 GLY B O    1 
ATOM   2647 H H    . GLY B 2 121 ? 34.502 23.053  12.916 1.00 0.00   ? 121 GLY B H    1 
ATOM   2648 N N    . GLY B 2 122 ? 32.697 19.568  12.182 1.00 33.92  ? 122 GLY B N    1 
ATOM   2649 C CA   . GLY B 2 122 ? 31.320 19.334  11.812 1.00 29.51  ? 122 GLY B CA   1 
ATOM   2650 C C    . GLY B 2 122 ? 30.528 18.427  12.733 1.00 33.84  ? 122 GLY B C    1 
ATOM   2651 O O    . GLY B 2 122 ? 31.004 17.364  13.145 1.00 33.56  ? 122 GLY B O    1 
ATOM   2652 H H    . GLY B 2 122 ? 33.265 18.822  12.467 1.00 0.00   ? 122 GLY B H    1 
ATOM   2653 N N    . LEU B 2 123 ? 29.352 18.899  13.137 1.00 34.02  ? 123 LEU B N    1 
ATOM   2654 C CA   . LEU B 2 123 ? 28.443 18.097  13.959 1.00 29.52  ? 123 LEU B CA   1 
ATOM   2655 C C    . LEU B 2 123 ? 27.483 17.460  12.950 1.00 22.39  ? 123 LEU B C    1 
ATOM   2656 O O    . LEU B 2 123 ? 27.112 18.099  11.964 1.00 21.36  ? 123 LEU B O    1 
ATOM   2657 C CB   . LEU B 2 123 ? 27.678 18.965  14.958 1.00 27.09  ? 123 LEU B CB   1 
ATOM   2658 C CG   . LEU B 2 123 ? 28.567 19.675  15.977 1.00 25.93  ? 123 LEU B CG   1 
ATOM   2659 C CD1  . LEU B 2 123 ? 27.665 20.416  16.942 1.00 16.97  ? 123 LEU B CD1  1 
ATOM   2660 C CD2  . LEU B 2 123 ? 29.484 18.684  16.699 1.00 4.16   ? 123 LEU B CD2  1 
ATOM   2661 H H    . LEU B 2 123 ? 29.068 19.791  12.908 1.00 0.00   ? 123 LEU B H    1 
ATOM   2662 N N    . VAL B 2 124 ? 27.126 16.198  13.177 1.00 21.02  ? 124 VAL B N    1 
ATOM   2663 C CA   . VAL B 2 124 ? 26.256 15.453  12.272 1.00 19.99  ? 124 VAL B CA   1 
ATOM   2664 C C    . VAL B 2 124 ? 24.921 15.059  12.905 1.00 26.94  ? 124 VAL B C    1 
ATOM   2665 O O    . VAL B 2 124 ? 24.878 14.495  14.009 1.00 31.00  ? 124 VAL B O    1 
ATOM   2666 C CB   . VAL B 2 124 ? 27.001 14.212  11.728 1.00 12.26  ? 124 VAL B CB   1 
ATOM   2667 C CG1  . VAL B 2 124 ? 26.107 13.376  10.837 1.00 19.33  ? 124 VAL B CG1  1 
ATOM   2668 C CG2  . VAL B 2 124 ? 28.205 14.669  10.947 1.00 17.30  ? 124 VAL B CG2  1 
ATOM   2669 H H    . VAL B 2 124 ? 27.453 15.740  13.971 1.00 0.00   ? 124 VAL B H    1 
ATOM   2670 N N    . CYS B 2 125 ? 23.838 15.423  12.213 1.00 25.25  ? 125 CYS B N    1 
ATOM   2671 C CA   . CYS B 2 125 ? 22.465 15.142  12.622 1.00 19.18  ? 125 CYS B CA   1 
ATOM   2672 C C    . CYS B 2 125 ? 22.253 13.681  12.337 1.00 13.66  ? 125 CYS B C    1 
ATOM   2673 O O    . CYS B 2 125 ? 22.083 13.314  11.181 1.00 28.56  ? 125 CYS B O    1 
ATOM   2674 C CB   . CYS B 2 125 ? 21.513 15.960  11.747 1.00 35.12  ? 125 CYS B CB   1 
ATOM   2675 S SG   . CYS B 2 125 ? 19.776 16.102  12.304 1.00 18.09  ? 125 CYS B SG   1 
ATOM   2676 H H    . CYS B 2 125 ? 23.991 15.899  11.375 1.00 0.00   ? 125 CYS B H    1 
ATOM   2677 N N    . PRO B 2 126 ? 22.185 12.829  13.383 1.00 12.45  ? 126 PRO B N    1 
ATOM   2678 C CA   . PRO B 2 126 ? 21.994 11.390  13.151 1.00 2.00   ? 126 PRO B CA   1 
ATOM   2679 C C    . PRO B 2 126 ? 20.710 10.900  12.447 1.00 19.54  ? 126 PRO B C    1 
ATOM   2680 O O    . PRO B 2 126 ? 19.788 11.665  12.172 1.00 25.24  ? 126 PRO B O    1 
ATOM   2681 C CB   . PRO B 2 126 ? 22.132 10.791  14.562 1.00 5.88   ? 126 PRO B CB   1 
ATOM   2682 C CG   . PRO B 2 126 ? 22.908 11.878  15.362 1.00 5.98   ? 126 PRO B CG   1 
ATOM   2683 C CD   . PRO B 2 126 ? 22.296 13.132  14.826 1.00 4.78   ? 126 PRO B CD   1 
ATOM   2684 N N    . TYR B 2 127 ? 20.721 9.613   12.110 1.00 23.52  ? 127 TYR B N    1 
ATOM   2685 C CA   . TYR B 2 127 ? 19.622 8.883   11.480 1.00 26.98  ? 127 TYR B CA   1 
ATOM   2686 C C    . TYR B 2 127 ? 18.744 9.622   10.491 1.00 33.62  ? 127 TYR B C    1 
ATOM   2687 O O    . TYR B 2 127 ? 17.519 9.486   10.518 1.00 26.33  ? 127 TYR B O    1 
ATOM   2688 C CB   . TYR B 2 127 ? 18.731 8.238   12.549 1.00 28.27  ? 127 TYR B CB   1 
ATOM   2689 C CG   . TYR B 2 127 ? 19.433 7.258   13.460 1.00 23.26  ? 127 TYR B CG   1 
ATOM   2690 C CD1  . TYR B 2 127 ? 20.297 7.703   14.440 1.00 21.44  ? 127 TYR B CD1  1 
ATOM   2691 C CD2  . TYR B 2 127 ? 19.187 5.886   13.374 1.00 30.07  ? 127 TYR B CD2  1 
ATOM   2692 C CE1  . TYR B 2 127 ? 20.890 6.821   15.320 1.00 27.34  ? 127 TYR B CE1  1 
ATOM   2693 C CE2  . TYR B 2 127 ? 19.788 4.979   14.261 1.00 23.16  ? 127 TYR B CE2  1 
ATOM   2694 C CZ   . TYR B 2 127 ? 20.634 5.465   15.237 1.00 18.75  ? 127 TYR B CZ   1 
ATOM   2695 O OH   . TYR B 2 127 ? 21.193 4.631   16.180 1.00 28.17  ? 127 TYR B OH   1 
ATOM   2696 H H    . TYR B 2 127 ? 21.558 9.128   12.274 1.00 0.00   ? 127 TYR B H    1 
ATOM   2697 H HH   . TYR B 2 127 ? 20.856 3.732   16.138 1.00 0.00   ? 127 TYR B HH   1 
ATOM   2698 N N    . MET B 2 128 ? 19.360 10.403  9.617  1.00 30.60  ? 128 MET B N    1 
ATOM   2699 C CA   . MET B 2 128 ? 18.597 11.124  8.597  1.00 31.26  ? 128 MET B CA   1 
ATOM   2700 C C    . MET B 2 128 ? 18.599 10.330  7.287  1.00 21.91  ? 128 MET B C    1 
ATOM   2701 O O    . MET B 2 128 ? 18.158 10.834  6.258  1.00 28.38  ? 128 MET B O    1 
ATOM   2702 C CB   . MET B 2 128 ? 19.196 12.514  8.339  1.00 27.93  ? 128 MET B CB   1 
ATOM   2703 C CG   . MET B 2 128 ? 19.192 13.447  9.529  1.00 32.97  ? 128 MET B CG   1 
ATOM   2704 S SD   . MET B 2 128 ? 17.539 13.662  10.170 1.00 44.19  ? 128 MET B SD   1 
ATOM   2705 C CE   . MET B 2 128 ? 16.834 14.686  8.925  1.00 33.09  ? 128 MET B CE   1 
ATOM   2706 H H    . MET B 2 128 ? 20.336 10.476  9.633  1.00 0.00   ? 128 MET B H    1 
ATOM   2707 N N    . GLU B 2 129 ? 19.038 9.073   7.339  1.00 30.37  ? 129 GLU B N    1 
ATOM   2708 C CA   . GLU B 2 129 ? 19.145 8.249   6.138  1.00 36.18  ? 129 GLU B CA   1 
ATOM   2709 C C    . GLU B 2 129 ? 17.854 7.862   5.389  1.00 46.08  ? 129 GLU B C    1 
ATOM   2710 O O    . GLU B 2 129 ? 17.886 7.658   4.173  1.00 56.66  ? 129 GLU B O    1 
ATOM   2711 C CB   . GLU B 2 129 ? 20.064 7.041   6.429  1.00 41.28  ? 129 GLU B CB   1 
ATOM   2712 C CG   . GLU B 2 129 ? 19.414 5.661   6.548  1.00 44.96  ? 129 GLU B CG   1 
ATOM   2713 C CD   . GLU B 2 129 ? 20.129 4.747   7.558  1.00 53.11  ? 129 GLU B CD   1 
ATOM   2714 O OE1  . GLU B 2 129 ? 20.290 5.179   8.730  1.00 44.73  ? 129 GLU B OE1  1 
ATOM   2715 O OE2  . GLU B 2 129 ? 20.497 3.596   7.196  1.00 48.28  ? 129 GLU B OE2  1 
ATOM   2716 H H    . GLU B 2 129 ? 19.300 8.689   8.201  1.00 0.00   ? 129 GLU B H    1 
ATOM   2717 N N    . PHE B 2 130 ? 16.722 7.848   6.096  1.00 55.65  ? 130 PHE B N    1 
ATOM   2718 C CA   . PHE B 2 130 ? 15.410 7.487   5.530  1.00 52.09  ? 130 PHE B CA   1 
ATOM   2719 C C    . PHE B 2 130 ? 14.610 8.673   5.043  1.00 50.15  ? 130 PHE B C    1 
ATOM   2720 O O    . PHE B 2 130 ? 13.900 8.597   4.039  1.00 56.05  ? 130 PHE B O    1 
ATOM   2721 C CB   . PHE B 2 130 ? 14.582 6.790   6.587  1.00 50.70  ? 130 PHE B CB   1 
ATOM   2722 C CG   . PHE B 2 130 ? 15.340 5.777   7.338  1.00 57.25  ? 130 PHE B CG   1 
ATOM   2723 C CD1  . PHE B 2 130 ? 15.710 4.580   6.721  1.00 53.74  ? 130 PHE B CD1  1 
ATOM   2724 C CD2  . PHE B 2 130 ? 15.718 6.023   8.655  1.00 54.07  ? 130 PHE B CD2  1 
ATOM   2725 C CE1  . PHE B 2 130 ? 16.447 3.632   7.404  1.00 57.33  ? 130 PHE B CE1  1 
ATOM   2726 C CE2  . PHE B 2 130 ? 16.455 5.087   9.355  1.00 68.12  ? 130 PHE B CE2  1 
ATOM   2727 C CZ   . PHE B 2 130 ? 16.824 3.880   8.726  1.00 65.65  ? 130 PHE B CZ   1 
ATOM   2728 H H    . PHE B 2 130 ? 16.762 8.089   7.044  1.00 0.00   ? 130 PHE B H    1 
ATOM   2729 N N    . PHE B 2 131 ? 14.680 9.744   5.818  1.00 44.15  ? 131 PHE B N    1 
ATOM   2730 C CA   . PHE B 2 131 ? 13.985 10.983  5.522  1.00 45.68  ? 131 PHE B CA   1 
ATOM   2731 C C    . PHE B 2 131 ? 14.647 11.687  4.356  1.00 50.74  ? 131 PHE B C    1 
ATOM   2732 O O    . PHE B 2 131 ? 14.127 12.678  3.822  1.00 46.92  ? 131 PHE B O    1 
ATOM   2733 C CB   . PHE B 2 131 ? 13.974 11.827  6.788  1.00 43.27  ? 131 PHE B CB   1 
ATOM   2734 C CG   . PHE B 2 131 ? 13.528 11.056  7.982  1.00 40.43  ? 131 PHE B CG   1 
ATOM   2735 C CD1  . PHE B 2 131 ? 12.297 10.400  7.970  1.00 35.28  ? 131 PHE B CD1  1 
ATOM   2736 C CD2  . PHE B 2 131 ? 14.362 10.901  9.079  1.00 48.75  ? 131 PHE B CD2  1 
ATOM   2737 C CE1  . PHE B 2 131 ? 11.908 9.597   9.026  1.00 41.94  ? 131 PHE B CE1  1 
ATOM   2738 C CE2  . PHE B 2 131 ? 13.980 10.095  10.149 1.00 54.03  ? 131 PHE B CE2  1 
ATOM   2739 C CZ   . PHE B 2 131 ? 12.751 9.439   10.122 1.00 50.03  ? 131 PHE B CZ   1 
ATOM   2740 H H    . PHE B 2 131 ? 15.231 9.695   6.628  1.00 0.00   ? 131 PHE B H    1 
ATOM   2741 N N    . LYS B 2 132 ? 15.802 11.137  3.978  1.00 65.51  ? 132 LYS B N    1 
ATOM   2742 C CA   . LYS B 2 132 ? 16.628 11.592  2.863  1.00 72.93  ? 132 LYS B CA   1 
ATOM   2743 C C    . LYS B 2 132 ? 15.733 11.539  1.640  1.00 71.84  ? 132 LYS B C    1 
ATOM   2744 O O    . LYS B 2 132 ? 15.485 12.552  0.982  1.00 64.10  ? 132 LYS B O    1 
ATOM   2745 C CB   . LYS B 2 132 ? 17.815 10.616  2.686  1.00 80.20  ? 132 LYS B CB   1 
ATOM   2746 C CG   . LYS B 2 132 ? 18.715 10.798  1.444  1.00 79.58  ? 132 LYS B CG   1 
ATOM   2747 C CD   . LYS B 2 132 ? 19.773 9.678   1.374  1.00 81.06  ? 132 LYS B CD   1 
ATOM   2748 C CE   . LYS B 2 132 ? 20.847 9.932   0.305  1.00 89.20  ? 132 LYS B CE   1 
ATOM   2749 N NZ   . LYS B 2 132 ? 20.381 9.767   -1.107 1.00 91.48  ? 132 LYS B NZ   1 
ATOM   2750 H H    . LYS B 2 132 ? 16.155 10.381  4.491  1.00 0.00   ? 132 LYS B H    1 
ATOM   2751 H HZ1  . LYS B 2 132 ? 20.043 8.794   -1.245 1.00 0.00   ? 132 LYS B HZ1  1 
ATOM   2752 H HZ2  . LYS B 2 132 ? 19.608 10.434  -1.305 1.00 0.00   ? 132 LYS B HZ2  1 
ATOM   2753 H HZ3  . LYS B 2 132 ? 21.174 9.957   -1.753 1.00 0.00   ? 132 LYS B HZ3  1 
ATOM   2754 N N    . ASN B 2 133 ? 15.195 10.350  1.397  1.00 77.81  ? 133 ASN B N    1 
ATOM   2755 C CA   . ASN B 2 133 ? 14.328 10.128  0.262  1.00 91.93  ? 133 ASN B CA   1 
ATOM   2756 C C    . ASN B 2 133 ? 13.238 11.175  0.136  1.00 97.48  ? 133 ASN B C    1 
ATOM   2757 O O    . ASN B 2 133 ? 12.250 11.181  0.874  1.00 100.00 ? 133 ASN B O    1 
ATOM   2758 C CB   . ASN B 2 133 ? 13.752 8.712   0.280  1.00 93.11  ? 133 ASN B CB   1 
ATOM   2759 C CG   . ASN B 2 133 ? 14.709 7.700   -0.309 1.00 95.18  ? 133 ASN B CG   1 
ATOM   2760 O OD1  . ASN B 2 133 ? 15.176 7.866   -1.436 1.00 88.84  ? 133 ASN B OD1  1 
ATOM   2761 N ND2  . ASN B 2 133 ? 15.025 6.654   0.456  1.00 100.00 ? 133 ASN B ND2  1 
ATOM   2762 H H    . ASN B 2 133 ? 15.391 9.602   1.999  1.00 0.00   ? 133 ASN B H    1 
ATOM   2763 H HD21 . ASN B 2 133 ? 15.643 5.981   0.102  1.00 0.00   ? 133 ASN B HD21 1 
ATOM   2764 H HD22 . ASN B 2 133 ? 14.620 6.605   1.347  1.00 0.00   ? 133 ASN B HD22 1 
ATOM   2765 N N    . GLU B 2 134 ? 13.541 12.141  -0.719 1.00 94.54  ? 134 GLU B N    1 
ATOM   2766 C CA   . GLU B 2 134 ? 12.669 13.247  -1.073 1.00 96.69  ? 134 GLU B CA   1 
ATOM   2767 C C    . GLU B 2 134 ? 13.339 13.514  -2.406 1.00 95.54  ? 134 GLU B C    1 
ATOM   2768 O O    . GLU B 2 134 ? 13.899 14.591  -2.646 1.00 87.62  ? 134 GLU B O    1 
ATOM   2769 C CB   . GLU B 2 134 ? 12.845 14.430  -0.110 1.00 99.72  ? 134 GLU B CB   1 
ATOM   2770 C CG   . GLU B 2 134 ? 11.672 15.434  -0.109 1.00 100.00 ? 134 GLU B CG   1 
ATOM   2771 C CD   . GLU B 2 134 ? 10.639 15.184  0.997  1.00 99.95  ? 134 GLU B CD   1 
ATOM   2772 O OE1  . GLU B 2 134 ? 10.014 14.100  1.007  1.00 95.62  ? 134 GLU B OE1  1 
ATOM   2773 O OE2  . GLU B 2 134 ? 10.443 16.086  1.848  1.00 89.37  ? 134 GLU B OE2  1 
ATOM   2774 H H    . GLU B 2 134 ? 14.430 12.096  -1.132 1.00 0.00   ? 134 GLU B H    1 
ATOM   2775 N N    . ASN B 2 135 ? 13.368 12.439  -3.203 1.00 97.93  ? 135 ASN B N    1 
ATOM   2776 C CA   . ASN B 2 135 ? 13.992 12.388  -4.526 1.00 100.00 ? 135 ASN B CA   1 
ATOM   2777 C C    . ASN B 2 135 ? 15.513 12.305  -4.312 1.00 100.00 ? 135 ASN B C    1 
ATOM   2778 O O    . ASN B 2 135 ? 16.308 12.840  -5.098 1.00 99.84  ? 135 ASN B O    1 
ATOM   2779 C CB   . ASN B 2 135 ? 13.600 13.611  -5.375 1.00 100.00 ? 135 ASN B CB   1 
ATOM   2780 C CG   . ASN B 2 135 ? 12.108 13.634  -5.736 1.00 100.00 ? 135 ASN B CG   1 
ATOM   2781 O OD1  . ASN B 2 135 ? 11.726 14.194  -6.767 1.00 100.00 ? 135 ASN B OD1  1 
ATOM   2782 N ND2  . ASN B 2 135 ? 11.265 13.033  -4.888 1.00 100.00 ? 135 ASN B ND2  1 
ATOM   2783 H H    . ASN B 2 135 ? 12.947 11.618  -2.873 1.00 0.00   ? 135 ASN B H    1 
ATOM   2784 H HD21 . ASN B 2 135 ? 10.320 13.054  -5.148 1.00 0.00   ? 135 ASN B HD21 1 
ATOM   2785 H HD22 . ASN B 2 135 ? 11.566 12.601  -4.068 1.00 0.00   ? 135 ASN B HD22 1 
ATOM   2786 N N    . ASN B 2 136 ? 15.881 11.602  -3.233 1.00 100.00 ? 136 ASN B N    1 
ATOM   2787 C CA   . ASN B 2 136 ? 17.268 11.394  -2.791 1.00 98.90  ? 136 ASN B CA   1 
ATOM   2788 C C    . ASN B 2 136 ? 17.980 12.663  -2.340 1.00 95.45  ? 136 ASN B C    1 
ATOM   2789 O O    . ASN B 2 136 ? 19.204 12.780  -2.415 1.00 95.02  ? 136 ASN B O    1 
ATOM   2790 C CB   . ASN B 2 136 ? 18.073 10.645  -3.843 1.00 97.19  ? 136 ASN B CB   1 
ATOM   2791 C CG   . ASN B 2 136 ? 17.701 9.193   -3.902 1.00 100.00 ? 136 ASN B CG   1 
ATOM   2792 O OD1  . ASN B 2 136 ? 18.236 8.377   -3.142 1.00 95.99  ? 136 ASN B OD1  1 
ATOM   2793 N ND2  . ASN B 2 136 ? 16.741 8.857   -4.770 1.00 100.00 ? 136 ASN B ND2  1 
ATOM   2794 H H    . ASN B 2 136 ? 15.173 11.189  -2.694 1.00 0.00   ? 136 ASN B H    1 
ATOM   2795 H HD21 . ASN B 2 136 ? 16.478 7.915   -4.825 1.00 0.00   ? 136 ASN B HD21 1 
ATOM   2796 H HD22 . ASN B 2 136 ? 16.337 9.564   -5.316 1.00 0.00   ? 136 ASN B HD22 1 
ATOM   2797 N N    . GLU B 2 137 ? 17.183 13.581  -1.807 1.00 93.97  ? 137 GLU B N    1 
ATOM   2798 C CA   . GLU B 2 137 ? 17.658 14.859  -1.318 1.00 90.63  ? 137 GLU B CA   1 
ATOM   2799 C C    . GLU B 2 137 ? 17.375 14.976  0.175  1.00 90.61  ? 137 GLU B C    1 
ATOM   2800 O O    . GLU B 2 137 ? 16.206 15.047  0.578  1.00 99.26  ? 137 GLU B O    1 
ATOM   2801 C CB   . GLU B 2 137 ? 16.924 15.989  -2.052 1.00 91.94  ? 137 GLU B CB   1 
ATOM   2802 C CG   . GLU B 2 137 ? 17.389 16.252  -3.473 1.00 96.91  ? 137 GLU B CG   1 
ATOM   2803 C CD   . GLU B 2 137 ? 18.645 17.106  -3.522 1.00 100.00 ? 137 GLU B CD   1 
ATOM   2804 O OE1  . GLU B 2 137 ? 19.762 16.540  -3.490 1.00 100.00 ? 137 GLU B OE1  1 
ATOM   2805 O OE2  . GLU B 2 137 ? 18.513 18.348  -3.586 1.00 100.00 ? 137 GLU B OE2  1 
ATOM   2806 H H    . GLU B 2 137 ? 16.225 13.383  -1.742 1.00 0.00   ? 137 GLU B H    1 
ATOM   2807 N N    . LEU B 2 138 ? 18.428 14.955  0.996  1.00 82.12  ? 138 LEU B N    1 
ATOM   2808 C CA   . LEU B 2 138 ? 18.272 15.115  2.446  1.00 69.28  ? 138 LEU B CA   1 
ATOM   2809 C C    . LEU B 2 138 ? 17.594 16.474  2.627  1.00 65.62  ? 138 LEU B C    1 
ATOM   2810 O O    . LEU B 2 138 ? 17.998 17.459  2.012  1.00 60.93  ? 138 LEU B O    1 
ATOM   2811 C CB   . LEU B 2 138 ? 19.636 15.116  3.148  1.00 70.07  ? 138 LEU B CB   1 
ATOM   2812 C CG   . LEU B 2 138 ? 20.325 13.789  3.498  1.00 63.40  ? 138 LEU B CG   1 
ATOM   2813 C CD1  . LEU B 2 138 ? 21.832 13.973  3.566  1.00 57.26  ? 138 LEU B CD1  1 
ATOM   2814 C CD2  . LEU B 2 138 ? 19.795 13.267  4.821  1.00 61.44  ? 138 LEU B CD2  1 
ATOM   2815 H H    . LEU B 2 138 ? 19.324 14.823  0.621  1.00 0.00   ? 138 LEU B H    1 
ATOM   2816 N N    . PRO B 2 139 ? 16.534 16.537  3.447  1.00 64.44  ? 139 PRO B N    1 
ATOM   2817 C CA   . PRO B 2 139 ? 15.789 17.776  3.700  1.00 62.37  ? 139 PRO B CA   1 
ATOM   2818 C C    . PRO B 2 139 ? 16.626 18.939  4.244  1.00 60.45  ? 139 PRO B C    1 
ATOM   2819 O O    . PRO B 2 139 ? 17.703 18.740  4.800  1.00 74.84  ? 139 PRO B O    1 
ATOM   2820 C CB   . PRO B 2 139 ? 14.727 17.325  4.696  1.00 68.09  ? 139 PRO B CB   1 
ATOM   2821 C CG   . PRO B 2 139 ? 15.432 16.236  5.448  1.00 64.42  ? 139 PRO B CG   1 
ATOM   2822 C CD   . PRO B 2 139 ? 16.069 15.461  4.337  1.00 61.29  ? 139 PRO B CD   1 
ATOM   2823 N N    . LYS B 2 140 ? 16.119 20.153  4.070  1.00 50.31  ? 140 LYS B N    1 
ATOM   2824 C CA   . LYS B 2 140 ? 16.802 21.352  4.529  1.00 49.32  ? 140 LYS B CA   1 
ATOM   2825 C C    . LYS B 2 140 ? 16.776 21.371  6.041  1.00 46.73  ? 140 LYS B C    1 
ATOM   2826 O O    . LYS B 2 140 ? 15.703 21.404  6.641  1.00 56.25  ? 140 LYS B O    1 
ATOM   2827 C CB   . LYS B 2 140 ? 16.128 22.627  3.981  1.00 58.69  ? 140 LYS B CB   1 
ATOM   2828 C CG   . LYS B 2 140 ? 16.066 22.742  2.437  1.00 81.33  ? 140 LYS B CG   1 
ATOM   2829 C CD   . LYS B 2 140 ? 15.059 21.760  1.816  1.00 84.08  ? 140 LYS B CD   1 
ATOM   2830 C CE   . LYS B 2 140 ? 15.404 21.384  0.381  1.00 86.11  ? 140 LYS B CE   1 
ATOM   2831 N NZ   . LYS B 2 140 ? 14.672 20.143  -0.013 1.00 83.93  ? 140 LYS B NZ   1 
ATOM   2832 H H    . LYS B 2 140 ? 15.240 20.220  3.646  1.00 0.00   ? 140 LYS B H    1 
ATOM   2833 H HZ1  . LYS B 2 140 ? 13.650 20.310  0.084  1.00 0.00   ? 140 LYS B HZ1  1 
ATOM   2834 H HZ2  . LYS B 2 140 ? 14.897 19.898  -0.998 1.00 0.00   ? 140 LYS B HZ2  1 
ATOM   2835 H HZ3  . LYS B 2 140 ? 14.959 19.364  0.615  1.00 0.00   ? 140 LYS B HZ3  1 
ATOM   2836 N N    . LEU B 2 141 ? 17.956 21.312  6.658  1.00 48.84  ? 141 LEU B N    1 
ATOM   2837 C CA   . LEU B 2 141 ? 18.050 21.337  8.117  1.00 40.25  ? 141 LEU B CA   1 
ATOM   2838 C C    . LEU B 2 141 ? 18.178 22.738  8.726  1.00 35.04  ? 141 LEU B C    1 
ATOM   2839 O O    . LEU B 2 141 ? 18.867 23.605  8.193  1.00 35.93  ? 141 LEU B O    1 
ATOM   2840 C CB   . LEU B 2 141 ? 19.216 20.477  8.611  1.00 29.40  ? 141 LEU B CB   1 
ATOM   2841 C CG   . LEU B 2 141 ? 19.035 18.971  8.764  1.00 29.48  ? 141 LEU B CG   1 
ATOM   2842 C CD1  . LEU B 2 141 ? 19.171 18.303  7.419  1.00 42.53  ? 141 LEU B CD1  1 
ATOM   2843 C CD2  . LEU B 2 141 ? 20.117 18.445  9.699  1.00 35.69  ? 141 LEU B CD2  1 
ATOM   2844 H H    . LEU B 2 141 ? 18.773 21.249  6.121  1.00 0.00   ? 141 LEU B H    1 
ATOM   2845 N N    . GLN B 2 142 ? 17.471 22.961  9.827  1.00 23.84  ? 142 GLN B N    1 
ATOM   2846 C CA   . GLN B 2 142 ? 17.548 24.223  10.539 1.00 22.01  ? 142 GLN B CA   1 
ATOM   2847 C C    . GLN B 2 142 ? 18.322 23.838  11.800 1.00 18.23  ? 142 GLN B C    1 
ATOM   2848 O O    . GLN B 2 142 ? 18.107 22.748  12.344 1.00 16.77  ? 142 GLN B O    1 
ATOM   2849 C CB   . GLN B 2 142 ? 16.145 24.725  10.906 1.00 35.23  ? 142 GLN B CB   1 
ATOM   2850 C CG   . GLN B 2 142 ? 15.096 24.570  9.809  1.00 42.70  ? 142 GLN B CG   1 
ATOM   2851 C CD   . GLN B 2 142 ? 13.708 24.940  10.290 1.00 50.82  ? 142 GLN B CD   1 
ATOM   2852 O OE1  . GLN B 2 142 ? 13.336 24.685  11.445 1.00 49.07  ? 142 GLN B OE1  1 
ATOM   2853 N NE2  . GLN B 2 142 ? 12.931 25.551  9.409  1.00 56.17  ? 142 GLN B NE2  1 
ATOM   2854 H H    . GLN B 2 142 ? 16.883 22.258  10.163 1.00 0.00   ? 142 GLN B H    1 
ATOM   2855 H HE21 . GLN B 2 142 ? 12.022 25.806  9.684  1.00 0.00   ? 142 GLN B HE21 1 
ATOM   2856 H HE22 . GLN B 2 142 ? 13.294 25.724  8.517  1.00 0.00   ? 142 GLN B HE22 1 
ATOM   2857 N N    . TRP B 2 143 ? 19.209 24.708  12.289 1.00 18.73  ? 143 TRP B N    1 
ATOM   2858 C CA   . TRP B 2 143 ? 19.981 24.337  13.474 1.00 10.95  ? 143 TRP B CA   1 
ATOM   2859 C C    . TRP B 2 143 ? 19.804 25.300  14.618 1.00 13.15  ? 143 TRP B C    1 
ATOM   2860 O O    . TRP B 2 143 ? 19.698 26.507  14.408 1.00 17.03  ? 143 TRP B O    1 
ATOM   2861 C CB   . TRP B 2 143 ? 21.472 24.179  13.128 1.00 13.66  ? 143 TRP B CB   1 
ATOM   2862 C CG   . TRP B 2 143 ? 21.814 22.975  12.231 1.00 4.07   ? 143 TRP B CG   1 
ATOM   2863 C CD1  . TRP B 2 143 ? 21.684 22.890  10.858 1.00 12.42  ? 143 TRP B CD1  1 
ATOM   2864 C CD2  . TRP B 2 143 ? 22.333 21.709  12.661 1.00 4.29   ? 143 TRP B CD2  1 
ATOM   2865 N NE1  . TRP B 2 143 ? 22.078 21.634  10.418 1.00 10.34  ? 143 TRP B NE1  1 
ATOM   2866 C CE2  . TRP B 2 143 ? 22.489 20.899  11.499 1.00 2.00   ? 143 TRP B CE2  1 
ATOM   2867 C CE3  . TRP B 2 143 ? 22.688 21.175  13.910 1.00 11.97  ? 143 TRP B CE3  1 
ATOM   2868 C CZ2  . TRP B 2 143 ? 22.977 19.594  11.556 1.00 2.00   ? 143 TRP B CZ2  1 
ATOM   2869 C CZ3  . TRP B 2 143 ? 23.184 19.867  13.964 1.00 7.44   ? 143 TRP B CZ3  1 
ATOM   2870 C CH2  . TRP B 2 143 ? 23.320 19.096  12.788 1.00 5.08   ? 143 TRP B CH2  1 
ATOM   2871 H H    . TRP B 2 143 ? 19.341 25.584  11.867 1.00 0.00   ? 143 TRP B H    1 
ATOM   2872 H HE1  . TRP B 2 143 ? 21.784 21.204  9.563  1.00 0.00   ? 143 TRP B HE1  1 
ATOM   2873 N N    . TYR B 2 144 ? 19.818 24.761  15.834 1.00 18.21  ? 144 TYR B N    1 
ATOM   2874 C CA   . TYR B 2 144 ? 19.618 25.541  17.064 1.00 17.46  ? 144 TYR B CA   1 
ATOM   2875 C C    . TYR B 2 144 ? 20.583 25.067  18.134 1.00 14.23  ? 144 TYR B C    1 
ATOM   2876 O O    . TYR B 2 144 ? 20.897 23.887  18.198 1.00 29.03  ? 144 TYR B O    1 
ATOM   2877 C CB   . TYR B 2 144 ? 18.199 25.261  17.663 1.00 20.00  ? 144 TYR B CB   1 
ATOM   2878 C CG   . TYR B 2 144 ? 17.005 25.502  16.749 1.00 18.93  ? 144 TYR B CG   1 
ATOM   2879 C CD1  . TYR B 2 144 ? 16.621 24.556  15.796 1.00 17.67  ? 144 TYR B CD1  1 
ATOM   2880 C CD2  . TYR B 2 144 ? 16.327 26.725  16.772 1.00 27.62  ? 144 TYR B CD2  1 
ATOM   2881 C CE1  . TYR B 2 144 ? 15.600 24.833  14.873 1.00 26.00  ? 144 TYR B CE1  1 
ATOM   2882 C CE2  . TYR B 2 144 ? 15.311 27.010  15.861 1.00 20.82  ? 144 TYR B CE2  1 
ATOM   2883 C CZ   . TYR B 2 144 ? 14.951 26.070  14.914 1.00 27.00  ? 144 TYR B CZ   1 
ATOM   2884 O OH   . TYR B 2 144 ? 13.948 26.384  14.011 1.00 27.65  ? 144 TYR B OH   1 
ATOM   2885 H H    . TYR B 2 144 ? 19.970 23.802  15.919 1.00 0.00   ? 144 TYR B H    1 
ATOM   2886 H HH   . TYR B 2 144 ? 13.725 25.619  13.474 1.00 0.00   ? 144 TYR B HH   1 
ATOM   2887 N N    . LYS B 2 145 ? 21.004 25.949  19.025 1.00 16.98  ? 145 LYS B N    1 
ATOM   2888 C CA   . LYS B 2 145 ? 21.842 25.507  20.146 1.00 21.92  ? 145 LYS B CA   1 
ATOM   2889 C C    . LYS B 2 145 ? 21.133 26.106  21.342 1.00 17.45  ? 145 LYS B C    1 
ATOM   2890 O O    . LYS B 2 145 ? 20.906 27.326  21.381 1.00 13.36  ? 145 LYS B O    1 
ATOM   2891 C CB   . LYS B 2 145 ? 23.279 26.037  20.056 1.00 33.92  ? 145 LYS B CB   1 
ATOM   2892 C CG   . LYS B 2 145 ? 24.102 25.883  21.353 1.00 21.35  ? 145 LYS B CG   1 
ATOM   2893 C CD   . LYS B 2 145 ? 25.245 26.873  21.313 1.00 34.10  ? 145 LYS B CD   1 
ATOM   2894 C CE   . LYS B 2 145 ? 25.927 27.075  22.638 1.00 35.81  ? 145 LYS B CE   1 
ATOM   2895 N NZ   . LYS B 2 145 ? 27.044 28.048  22.422 1.00 46.52  ? 145 LYS B NZ   1 
ATOM   2896 H H    . LYS B 2 145 ? 20.753 26.889  18.942 1.00 0.00   ? 145 LYS B H    1 
ATOM   2897 H HZ1  . LYS B 2 145 ? 27.710 27.664  21.717 1.00 0.00   ? 145 LYS B HZ1  1 
ATOM   2898 H HZ2  . LYS B 2 145 ? 26.635 28.940  22.070 1.00 0.00   ? 145 LYS B HZ2  1 
ATOM   2899 H HZ3  . LYS B 2 145 ? 27.553 28.232  23.312 1.00 0.00   ? 145 LYS B HZ3  1 
ATOM   2900 N N    . ASP B 2 146 ? 20.768 25.243  22.289 1.00 18.44  ? 146 ASP B N    1 
ATOM   2901 C CA   . ASP B 2 146 ? 20.033 25.644  23.490 1.00 31.30  ? 146 ASP B CA   1 
ATOM   2902 C C    . ASP B 2 146 ? 18.651 26.226  23.083 1.00 28.37  ? 146 ASP B C    1 
ATOM   2903 O O    . ASP B 2 146 ? 18.189 27.244  23.596 1.00 30.14  ? 146 ASP B O    1 
ATOM   2904 C CB   . ASP B 2 146 ? 20.851 26.655  24.307 1.00 43.77  ? 146 ASP B CB   1 
ATOM   2905 C CG   . ASP B 2 146 ? 22.240 26.144  24.657 1.00 53.26  ? 146 ASP B CG   1 
ATOM   2906 O OD1  . ASP B 2 146 ? 22.409 24.912  24.826 1.00 45.85  ? 146 ASP B OD1  1 
ATOM   2907 O OD2  . ASP B 2 146 ? 23.160 26.986  24.756 1.00 58.25  ? 146 ASP B OD2  1 
ATOM   2908 H H    . ASP B 2 146 ? 20.969 24.313  22.149 1.00 0.00   ? 146 ASP B H    1 
ATOM   2909 N N    . CYS B 2 147 ? 18.068 25.620  22.064 1.00 16.77  ? 147 CYS B N    1 
ATOM   2910 C CA   . CYS B 2 147 ? 16.775 26.002  21.554 1.00 18.52  ? 147 CYS B CA   1 
ATOM   2911 C C    . CYS B 2 147 ? 16.649 27.346  20.839 1.00 19.24  ? 147 CYS B C    1 
ATOM   2912 O O    . CYS B 2 147 ? 15.545 27.765  20.476 1.00 27.10  ? 147 CYS B O    1 
ATOM   2913 C CB   . CYS B 2 147 ? 15.724 25.827  22.650 1.00 23.77  ? 147 CYS B CB   1 
ATOM   2914 S SG   . CYS B 2 147 ? 15.656 24.108  23.263 1.00 29.79  ? 147 CYS B SG   1 
ATOM   2915 H H    . CYS B 2 147 ? 18.594 24.927  21.657 1.00 0.00   ? 147 CYS B H    1 
ATOM   2916 N N    . LYS B 2 148 ? 17.765 28.033  20.640 1.00 26.92  ? 148 LYS B N    1 
ATOM   2917 C CA   . LYS B 2 148 ? 17.767 29.299  19.900 1.00 16.30  ? 148 LYS B CA   1 
ATOM   2918 C C    . LYS B 2 148 ? 18.345 29.008  18.504 1.00 20.86  ? 148 LYS B C    1 
ATOM   2919 O O    . LYS B 2 148 ? 19.230 28.171  18.347 1.00 26.55  ? 148 LYS B O    1 
ATOM   2920 C CB   . LYS B 2 148 ? 18.531 30.383  20.665 1.00 26.50  ? 148 LYS B CB   1 
ATOM   2921 C CG   . LYS B 2 148 ? 17.724 30.957  21.868 1.00 25.65  ? 148 LYS B CG   1 
ATOM   2922 C CD   . LYS B 2 148 ? 18.427 30.785  23.191 1.00 28.51  ? 148 LYS B CD   1 
ATOM   2923 C CE   . LYS B 2 148 ? 19.723 31.602  23.230 1.00 41.67  ? 148 LYS B CE   1 
ATOM   2924 N NZ   . LYS B 2 148 ? 20.559 31.380  24.470 1.00 34.11  ? 148 LYS B NZ   1 
ATOM   2925 H H    . LYS B 2 148 ? 18.617 27.693  20.987 1.00 0.00   ? 148 LYS B H    1 
ATOM   2926 H HZ1  . LYS B 2 148 ? 20.771 30.365  24.531 1.00 0.00   ? 148 LYS B HZ1  1 
ATOM   2927 H HZ2  . LYS B 2 148 ? 21.442 31.918  24.377 1.00 0.00   ? 148 LYS B HZ2  1 
ATOM   2928 H HZ3  . LYS B 2 148 ? 20.043 31.684  25.319 1.00 0.00   ? 148 LYS B HZ3  1 
ATOM   2929 N N    . PRO B 2 149 ? 17.857 29.699  17.473 1.00 17.50  ? 149 PRO B N    1 
ATOM   2930 C CA   . PRO B 2 149 ? 18.326 29.473  16.108 1.00 22.97  ? 149 PRO B CA   1 
ATOM   2931 C C    . PRO B 2 149 ? 19.699 30.016  15.652 1.00 28.49  ? 149 PRO B C    1 
ATOM   2932 O O    . PRO B 2 149 ? 20.055 31.188  15.832 1.00 25.85  ? 149 PRO B O    1 
ATOM   2933 C CB   . PRO B 2 149 ? 17.161 30.029  15.275 1.00 20.94  ? 149 PRO B CB   1 
ATOM   2934 C CG   . PRO B 2 149 ? 16.825 31.290  16.019 1.00 14.75  ? 149 PRO B CG   1 
ATOM   2935 C CD   . PRO B 2 149 ? 16.943 30.854  17.523 1.00 20.77  ? 149 PRO B CD   1 
ATOM   2936 N N    . LEU B 2 150 ? 20.440 29.141  14.992 1.00 25.78  ? 150 LEU B N    1 
ATOM   2937 C CA   . LEU B 2 150 ? 21.741 29.509  14.489 1.00 24.15  ? 150 LEU B CA   1 
ATOM   2938 C C    . LEU B 2 150 ? 21.624 30.055  13.076 1.00 23.85  ? 150 LEU B C    1 
ATOM   2939 O O    . LEU B 2 150 ? 20.894 29.523  12.211 1.00 17.50  ? 150 LEU B O    1 
ATOM   2940 C CB   . LEU B 2 150 ? 22.716 28.316  14.522 1.00 16.75  ? 150 LEU B CB   1 
ATOM   2941 C CG   . LEU B 2 150 ? 22.818 27.602  15.862 1.00 10.18  ? 150 LEU B CG   1 
ATOM   2942 C CD1  . LEU B 2 150 ? 23.631 26.363  15.718 1.00 19.23  ? 150 LEU B CD1  1 
ATOM   2943 C CD2  . LEU B 2 150 ? 23.381 28.508  16.911 1.00 18.34  ? 150 LEU B CD2  1 
ATOM   2944 H H    . LEU B 2 150 ? 20.091 28.244  14.868 1.00 0.00   ? 150 LEU B H    1 
ATOM   2945 N N    . LEU B 2 151 ? 22.349 31.144  12.864 1.00 18.87  ? 151 LEU B N    1 
ATOM   2946 C CA   . LEU B 2 151 ? 22.403 31.792  11.572 1.00 21.28  ? 151 LEU B CA   1 
ATOM   2947 C C    . LEU B 2 151 ? 23.474 31.042  10.736 1.00 20.00  ? 151 LEU B C    1 
ATOM   2948 O O    . LEU B 2 151 ? 24.632 30.948  11.146 1.00 27.90  ? 151 LEU B O    1 
ATOM   2949 C CB   . LEU B 2 151 ? 22.789 33.260  11.782 1.00 19.21  ? 151 LEU B CB   1 
ATOM   2950 C CG   . LEU B 2 151 ? 22.457 34.293  10.708 1.00 41.43  ? 151 LEU B CG   1 
ATOM   2951 C CD1  . LEU B 2 151 ? 23.667 35.209  10.537 1.00 34.95  ? 151 LEU B CD1  1 
ATOM   2952 C CD2  . LEU B 2 151 ? 22.079 33.627  9.379  1.00 36.24  ? 151 LEU B CD2  1 
ATOM   2953 H H    . LEU B 2 151 ? 22.867 31.527  13.601 1.00 0.00   ? 151 LEU B H    1 
ATOM   2954 N N    . LEU B 2 152 ? 23.082 30.468  9.599  1.00 23.26  ? 152 LEU B N    1 
ATOM   2955 C CA   . LEU B 2 152 ? 24.040 29.746  8.758  1.00 31.70  ? 152 LEU B CA   1 
ATOM   2956 C C    . LEU B 2 152 ? 24.679 30.681  7.711  1.00 32.62  ? 152 LEU B C    1 
ATOM   2957 O O    . LEU B 2 152 ? 24.549 30.487  6.504  1.00 35.99  ? 152 LEU B O    1 
ATOM   2958 C CB   . LEU B 2 152 ? 23.365 28.524  8.118  1.00 27.96  ? 152 LEU B CB   1 
ATOM   2959 C CG   . LEU B 2 152 ? 22.806 27.461  9.083  1.00 27.97  ? 152 LEU B CG   1 
ATOM   2960 C CD1  . LEU B 2 152 ? 22.340 26.280  8.273  1.00 26.52  ? 152 LEU B CD1  1 
ATOM   2961 C CD2  . LEU B 2 152 ? 23.836 26.998  10.133 1.00 23.02  ? 152 LEU B CD2  1 
ATOM   2962 H H    . LEU B 2 152 ? 22.140 30.506  9.339  1.00 0.00   ? 152 LEU B H    1 
ATOM   2963 N N    . ASP B 2 153 ? 25.430 31.653  8.219  1.00 27.07  ? 153 ASP B N    1 
ATOM   2964 C CA   . ASP B 2 153 ? 26.087 32.695  7.436  1.00 31.26  ? 153 ASP B CA   1 
ATOM   2965 C C    . ASP B 2 153 ? 27.381 32.356  6.702  1.00 35.72  ? 153 ASP B C    1 
ATOM   2966 O O    . ASP B 2 153 ? 27.810 33.114  5.832  1.00 39.53  ? 153 ASP B O    1 
ATOM   2967 C CB   . ASP B 2 153 ? 26.354 33.877  8.349  1.00 19.25  ? 153 ASP B CB   1 
ATOM   2968 C CG   . ASP B 2 153 ? 27.014 33.467  9.643  1.00 23.43  ? 153 ASP B CG   1 
ATOM   2969 O OD1  . ASP B 2 153 ? 27.408 32.291  9.785  1.00 38.29  ? 153 ASP B OD1  1 
ATOM   2970 O OD2  . ASP B 2 153 ? 27.132 34.320  10.539 1.00 37.63  ? 153 ASP B OD2  1 
ATOM   2971 H H    . ASP B 2 153 ? 25.529 31.640  9.190  1.00 0.00   ? 153 ASP B H    1 
ATOM   2972 N N    . ASN B 2 154 ? 27.999 31.236  7.067  1.00 33.52  ? 154 ASN B N    1 
ATOM   2973 C CA   . ASN B 2 154 ? 29.259 30.780  6.477  1.00 29.17  ? 154 ASN B CA   1 
ATOM   2974 C C    . ASN B 2 154 ? 30.427 31.582  7.003  1.00 33.89  ? 154 ASN B C    1 
ATOM   2975 O O    . ASN B 2 154 ? 31.488 31.653  6.380  1.00 35.10  ? 154 ASN B O    1 
ATOM   2976 C CB   . ASN B 2 154 ? 29.213 30.846  4.966  1.00 22.19  ? 154 ASN B CB   1 
ATOM   2977 C CG   . ASN B 2 154 ? 28.086 30.061  4.405  1.00 16.80  ? 154 ASN B CG   1 
ATOM   2978 O OD1  . ASN B 2 154 ? 27.966 28.865  4.654  1.00 27.27  ? 154 ASN B OD1  1 
ATOM   2979 N ND2  . ASN B 2 154 ? 27.225 30.728  3.659  1.00 28.46  ? 154 ASN B ND2  1 
ATOM   2980 H H    . ASN B 2 154 ? 27.565 30.707  7.763  1.00 0.00   ? 154 ASN B H    1 
ATOM   2981 H HD21 . ASN B 2 154 ? 26.488 30.227  3.252  1.00 0.00   ? 154 ASN B HD21 1 
ATOM   2982 H HD22 . ASN B 2 154 ? 27.364 31.681  3.538  1.00 0.00   ? 154 ASN B HD22 1 
ATOM   2983 N N    . ILE B 2 155 ? 30.174 32.240  8.131  1.00 37.21  ? 155 ILE B N    1 
ATOM   2984 C CA   . ILE B 2 155 ? 31.155 33.034  8.847  1.00 34.71  ? 155 ILE B CA   1 
ATOM   2985 C C    . ILE B 2 155 ? 31.265 32.303  10.177 1.00 37.75  ? 155 ILE B C    1 
ATOM   2986 O O    . ILE B 2 155 ? 32.323 31.771  10.510 1.00 53.10  ? 155 ILE B O    1 
ATOM   2987 C CB   . ILE B 2 155 ? 30.691 34.493  9.084  1.00 35.53  ? 155 ILE B CB   1 
ATOM   2988 C CG1  . ILE B 2 155 ? 30.464 35.227  7.756  1.00 32.20  ? 155 ILE B CG1  1 
ATOM   2989 C CG2  . ILE B 2 155 ? 31.747 35.251  9.851  1.00 42.52  ? 155 ILE B CG2  1 
ATOM   2990 C CD1  . ILE B 2 155 ? 29.878 36.642  7.956  1.00 25.66  ? 155 ILE B CD1  1 
ATOM   2991 H H    . ILE B 2 155 ? 29.276 32.187  8.514  1.00 0.00   ? 155 ILE B H    1 
ATOM   2992 N N    . HIS B 2 156 ? 30.159 32.215  10.911 1.00 35.26  ? 156 HIS B N    1 
ATOM   2993 C CA   . HIS B 2 156 ? 30.185 31.504  12.188 1.00 31.78  ? 156 HIS B CA   1 
ATOM   2994 C C    . HIS B 2 156 ? 29.757 30.033  12.061 1.00 30.53  ? 156 HIS B C    1 
ATOM   2995 O O    . HIS B 2 156 ? 30.280 29.185  12.781 1.00 26.58  ? 156 HIS B O    1 
ATOM   2996 C CB   . HIS B 2 156 ? 29.339 32.226  13.239 1.00 32.85  ? 156 HIS B CB   1 
ATOM   2997 C CG   . HIS B 2 156 ? 29.738 33.654  13.465 1.00 31.09  ? 156 HIS B CG   1 
ATOM   2998 N ND1  . HIS B 2 156 ? 29.385 34.671  12.604 1.00 28.51  ? 156 HIS B ND1  1 
ATOM   2999 C CD2  . HIS B 2 156 ? 30.457 34.236  14.454 1.00 40.67  ? 156 HIS B CD2  1 
ATOM   3000 C CE1  . HIS B 2 156 ? 29.869 35.816  13.049 1.00 32.00  ? 156 HIS B CE1  1 
ATOM   3001 N NE2  . HIS B 2 156 ? 30.525 35.580  14.172 1.00 42.81  ? 156 HIS B NE2  1 
ATOM   3002 H H    . HIS B 2 156 ? 29.333 32.637  10.606 1.00 0.00   ? 156 HIS B H    1 
ATOM   3003 H HD1  . HIS B 2 156 ? 28.868 34.557  11.783 1.00 0.00   ? 156 HIS B HD1  1 
ATOM   3004 H HE2  . HIS B 2 156 ? 31.001 36.251  14.706 1.00 0.00   ? 156 HIS B HE2  1 
ATOM   3005 N N    . PHE B 2 157 ? 28.859 29.730  11.118 1.00 19.15  ? 157 PHE B N    1 
ATOM   3006 C CA   . PHE B 2 157 ? 28.364 28.366  10.915 1.00 16.04  ? 157 PHE B CA   1 
ATOM   3007 C C    . PHE B 2 157 ? 28.026 28.128  9.471  1.00 14.56  ? 157 PHE B C    1 
ATOM   3008 O O    . PHE B 2 157 ? 27.676 29.055  8.761  1.00 29.82  ? 157 PHE B O    1 
ATOM   3009 C CB   . PHE B 2 157 ? 27.038 28.139  11.666 1.00 14.39  ? 157 PHE B CB   1 
ATOM   3010 C CG   . PHE B 2 157 ? 27.171 28.064  13.153 1.00 11.38  ? 157 PHE B CG   1 
ATOM   3011 C CD1  . PHE B 2 157 ? 27.640 26.899  13.767 1.00 11.17  ? 157 PHE B CD1  1 
ATOM   3012 C CD2  . PHE B 2 157 ? 26.828 29.151  13.946 1.00 13.59  ? 157 PHE B CD2  1 
ATOM   3013 C CE1  . PHE B 2 157 ? 27.776 26.810  15.162 1.00 3.33   ? 157 PHE B CE1  1 
ATOM   3014 C CE2  . PHE B 2 157 ? 26.957 29.071  15.341 1.00 22.66  ? 157 PHE B CE2  1 
ATOM   3015 C CZ   . PHE B 2 157 ? 27.437 27.891  15.942 1.00 9.02   ? 157 PHE B CZ   1 
ATOM   3016 H H    . PHE B 2 157 ? 28.524 30.442  10.536 1.00 0.00   ? 157 PHE B H    1 
ATOM   3017 N N    . SER B 2 158 ? 28.039 26.861  9.071  1.00 19.92  ? 158 SER B N    1 
ATOM   3018 C CA   . SER B 2 158 ? 27.653 26.450  7.717  1.00 20.47  ? 158 SER B CA   1 
ATOM   3019 C C    . SER B 2 158 ? 26.834 25.165  7.800  1.00 19.49  ? 158 SER B C    1 
ATOM   3020 O O    . SER B 2 158 ? 27.143 24.273  8.584  1.00 14.97  ? 158 SER B O    1 
ATOM   3021 C CB   . SER B 2 158 ? 28.862 26.217  6.813  1.00 17.19  ? 158 SER B CB   1 
ATOM   3022 O OG   . SER B 2 158 ? 29.497 27.443  6.513  1.00 36.50  ? 158 SER B OG   1 
ATOM   3023 H H    . SER B 2 158 ? 28.357 26.172  9.690  1.00 0.00   ? 158 SER B H    1 
ATOM   3024 H HG   . SER B 2 158 ? 29.793 27.836  7.338  1.00 0.00   ? 158 SER B HG   1 
ATOM   3025 N N    . GLY B 2 159 ? 25.777 25.089  6.995  1.00 21.24  ? 159 GLY B N    1 
ATOM   3026 C CA   . GLY B 2 159 ? 24.928 23.916  6.995  1.00 11.93  ? 159 GLY B CA   1 
ATOM   3027 C C    . GLY B 2 159 ? 25.007 23.267  5.632  1.00 24.91  ? 159 GLY B C    1 
ATOM   3028 O O    . GLY B 2 159 ? 24.752 23.923  4.623  1.00 23.00  ? 159 GLY B O    1 
ATOM   3029 H H    . GLY B 2 159 ? 25.583 25.826  6.378  1.00 0.00   ? 159 GLY B H    1 
ATOM   3030 N N    . VAL B 2 160 ? 25.429 22.001  5.596  1.00 29.25  ? 160 VAL B N    1 
ATOM   3031 C CA   . VAL B 2 160 ? 25.543 21.261  4.347  1.00 30.11  ? 160 VAL B CA   1 
ATOM   3032 C C    . VAL B 2 160 ? 25.071 19.828  4.559  1.00 34.17  ? 160 VAL B C    1 
ATOM   3033 O O    . VAL B 2 160 ? 25.709 19.046  5.272  1.00 37.99  ? 160 VAL B O    1 
ATOM   3034 C CB   . VAL B 2 160 ? 26.985 21.303  3.794  1.00 39.09  ? 160 VAL B CB   1 
ATOM   3035 C CG1  . VAL B 2 160 ? 27.145 20.286  2.657  1.00 27.76  ? 160 VAL B CG1  1 
ATOM   3036 C CG2  . VAL B 2 160 ? 27.300 22.736  3.292  1.00 28.00  ? 160 VAL B CG2  1 
ATOM   3037 H H    . VAL B 2 160 ? 25.689 21.557  6.428  1.00 0.00   ? 160 VAL B H    1 
ATOM   3038 N N    . LYS B 2 161 ? 23.937 19.497  3.945  1.00 25.98  ? 161 LYS B N    1 
ATOM   3039 C CA   . LYS B 2 161 ? 23.362 18.179  4.110  1.00 27.21  ? 161 LYS B CA   1 
ATOM   3040 C C    . LYS B 2 161 ? 23.117 17.962  5.628  1.00 24.44  ? 161 LYS B C    1 
ATOM   3041 O O    . LYS B 2 161 ? 22.650 18.873  6.332  1.00 27.86  ? 161 LYS B O    1 
ATOM   3042 C CB   . LYS B 2 161 ? 24.330 17.134  3.531  1.00 41.33  ? 161 LYS B CB   1 
ATOM   3043 C CG   . LYS B 2 161 ? 24.743 17.392  2.086  1.00 44.57  ? 161 LYS B CG   1 
ATOM   3044 C CD   . LYS B 2 161 ? 25.633 16.280  1.535  1.00 55.53  ? 161 LYS B CD   1 
ATOM   3045 C CE   . LYS B 2 161 ? 25.935 16.487  0.036  1.00 70.59  ? 161 LYS B CE   1 
ATOM   3046 N NZ   . LYS B 2 161 ? 26.579 15.300  -0.632 1.00 72.95  ? 161 LYS B NZ   1 
ATOM   3047 H H    . LYS B 2 161 ? 23.487 20.147  3.366  1.00 0.00   ? 161 LYS B H    1 
ATOM   3048 H HZ1  . LYS B 2 161 ? 25.947 14.478  -0.538 1.00 0.00   ? 161 LYS B HZ1  1 
ATOM   3049 H HZ2  . LYS B 2 161 ? 26.731 15.502  -1.641 1.00 0.00   ? 161 LYS B HZ2  1 
ATOM   3050 H HZ3  . LYS B 2 161 ? 27.493 15.089  -0.181 1.00 0.00   ? 161 LYS B HZ3  1 
ATOM   3051 N N    . ASP B 2 162 ? 23.472 16.785  6.138  1.00 21.20  ? 162 ASP B N    1 
ATOM   3052 C CA   . ASP B 2 162 ? 23.301 16.462  7.545  1.00 12.58  ? 162 ASP B CA   1 
ATOM   3053 C C    . ASP B 2 162 ? 24.323 17.082  8.509  1.00 25.00  ? 162 ASP B C    1 
ATOM   3054 O O    . ASP B 2 162 ? 24.367 16.716  9.682  1.00 35.32  ? 162 ASP B O    1 
ATOM   3055 C CB   . ASP B 2 162 ? 23.224 14.927  7.746  1.00 16.13  ? 162 ASP B CB   1 
ATOM   3056 C CG   . ASP B 2 162 ? 24.459 14.141  7.184  1.00 23.22  ? 162 ASP B CG   1 
ATOM   3057 O OD1  . ASP B 2 162 ? 25.257 14.658  6.364  1.00 20.23  ? 162 ASP B OD1  1 
ATOM   3058 O OD2  . ASP B 2 162 ? 24.604 12.948  7.555  1.00 31.83  ? 162 ASP B OD2  1 
ATOM   3059 H H    . ASP B 2 162 ? 23.842 16.083  5.568  1.00 0.00   ? 162 ASP B H    1 
ATOM   3060 N N    . ARG B 2 163 ? 25.117 18.051  8.072  1.00 28.11  ? 163 ARG B N    1 
ATOM   3061 C CA   . ARG B 2 163 ? 26.077 18.589  9.018  1.00 20.51  ? 163 ARG B CA   1 
ATOM   3062 C C    . ARG B 2 163 ? 26.113 20.077  9.296  1.00 20.63  ? 163 ARG B C    1 
ATOM   3063 O O    . ARG B 2 163 ? 25.647 20.906  8.511  1.00 21.41  ? 163 ARG B O    1 
ATOM   3064 C CB   . ARG B 2 163 ? 27.483 18.028  8.754  1.00 35.96  ? 163 ARG B CB   1 
ATOM   3065 C CG   . ARG B 2 163 ? 28.103 18.335  7.404  1.00 36.23  ? 163 ARG B CG   1 
ATOM   3066 C CD   . ARG B 2 163 ? 29.029 17.190  6.937  1.00 38.78  ? 163 ARG B CD   1 
ATOM   3067 N NE   . ARG B 2 163 ? 30.046 16.880  7.937  1.00 45.70  ? 163 ARG B NE   1 
ATOM   3068 C CZ   . ARG B 2 163 ? 31.211 17.516  8.051  1.00 48.40  ? 163 ARG B CZ   1 
ATOM   3069 N NH1  . ARG B 2 163 ? 31.512 18.493  7.210  1.00 40.36  ? 163 ARG B NH1  1 
ATOM   3070 N NH2  . ARG B 2 163 ? 32.059 17.199  9.032  1.00 39.08  ? 163 ARG B NH2  1 
ATOM   3071 H H    . ARG B 2 163 ? 25.069 18.392  7.159  1.00 0.00   ? 163 ARG B H    1 
ATOM   3072 H HE   . ARG B 2 163 ? 29.855 16.173  8.587  1.00 0.00   ? 163 ARG B HE   1 
ATOM   3073 H HH11 . ARG B 2 163 ? 30.888 18.771  6.477  1.00 0.00   ? 163 ARG B HH11 1 
ATOM   3074 H HH12 . ARG B 2 163 ? 32.380 18.957  7.338  1.00 0.00   ? 163 ARG B HH12 1 
ATOM   3075 H HH21 . ARG B 2 163 ? 31.828 16.471  9.675  1.00 0.00   ? 163 ARG B HH21 1 
ATOM   3076 H HH22 . ARG B 2 163 ? 32.936 17.674  9.112  1.00 0.00   ? 163 ARG B HH22 1 
ATOM   3077 N N    . LEU B 2 164 ? 26.613 20.376  10.490 1.00 17.07  ? 164 LEU B N    1 
ATOM   3078 C CA   . LEU B 2 164 ? 26.759 21.725  10.996 1.00 19.32  ? 164 LEU B CA   1 
ATOM   3079 C C    . LEU B 2 164 ? 28.262 21.961  11.120 1.00 23.90  ? 164 LEU B C    1 
ATOM   3080 O O    . LEU B 2 164 ? 28.938 21.340  11.960 1.00 14.66  ? 164 LEU B O    1 
ATOM   3081 C CB   . LEU B 2 164 ? 26.142 21.823  12.396 1.00 8.55   ? 164 LEU B CB   1 
ATOM   3082 C CG   . LEU B 2 164 ? 25.593 23.112  13.023 1.00 9.60   ? 164 LEU B CG   1 
ATOM   3083 C CD1  . LEU B 2 164 ? 26.201 23.418  14.380 1.00 13.80  ? 164 LEU B CD1  1 
ATOM   3084 C CD2  . LEU B 2 164 ? 25.630 24.280  12.068 1.00 4.57   ? 164 LEU B CD2  1 
ATOM   3085 H H    . LEU B 2 164 ? 26.888 19.656  11.069 1.00 0.00   ? 164 LEU B H    1 
ATOM   3086 N N    . ILE B 2 165 ? 28.781 22.823  10.251 1.00 18.83  ? 165 ILE B N    1 
ATOM   3087 C CA   . ILE B 2 165 ? 30.186 23.172  10.285 1.00 22.25  ? 165 ILE B CA   1 
ATOM   3088 C C    . ILE B 2 165 ? 30.297 24.321  11.272 1.00 22.93  ? 165 ILE B C    1 
ATOM   3089 O O    . ILE B 2 165 ? 29.746 25.408  11.048 1.00 20.61  ? 165 ILE B O    1 
ATOM   3090 C CB   . ILE B 2 165 ? 30.762 23.661  8.917  1.00 22.71  ? 165 ILE B CB   1 
ATOM   3091 C CG1  . ILE B 2 165 ? 30.386 22.719  7.762  1.00 14.16  ? 165 ILE B CG1  1 
ATOM   3092 C CG2  . ILE B 2 165 ? 32.267 23.754  9.012  1.00 16.98  ? 165 ILE B CG2  1 
ATOM   3093 C CD1  . ILE B 2 165 ? 30.719 21.317  8.048  1.00 21.04  ? 165 ILE B CD1  1 
ATOM   3094 H H    . ILE B 2 165 ? 28.221 23.197  9.564  1.00 0.00   ? 165 ILE B H    1 
ATOM   3095 N N    . VAL B 2 166 ? 30.903 24.031  12.417 1.00 16.98  ? 166 VAL B N    1 
ATOM   3096 C CA   . VAL B 2 166 ? 31.114 25.045  13.428 1.00 15.64  ? 166 VAL B CA   1 
ATOM   3097 C C    . VAL B 2 166 ? 32.489 25.608  13.040 1.00 25.08  ? 166 VAL B C    1 
ATOM   3098 O O    . VAL B 2 166 ? 33.470 24.860  12.904 1.00 27.32  ? 166 VAL B O    1 
ATOM   3099 C CB   . VAL B 2 166 ? 31.187 24.412  14.831 1.00 8.48   ? 166 VAL B CB   1 
ATOM   3100 C CG1  . VAL B 2 166 ? 31.293 25.470  15.888 1.00 8.13   ? 166 VAL B CG1  1 
ATOM   3101 C CG2  . VAL B 2 166 ? 30.009 23.498  15.070 1.00 7.63   ? 166 VAL B CG2  1 
ATOM   3102 H H    . VAL B 2 166 ? 31.240 23.130  12.578 1.00 0.00   ? 166 VAL B H    1 
ATOM   3103 N N    . MET B 2 167 ? 32.539 26.904  12.768 1.00 23.08  ? 167 MET B N    1 
ATOM   3104 C CA   . MET B 2 167 ? 33.792 27.546  12.392 1.00 28.72  ? 167 MET B CA   1 
ATOM   3105 C C    . MET B 2 167 ? 34.583 28.005  13.623 1.00 37.03  ? 167 MET B C    1 
ATOM   3106 O O    . MET B 2 167 ? 34.034 28.644  14.525 1.00 40.10  ? 167 MET B O    1 
ATOM   3107 C CB   . MET B 2 167 ? 33.514 28.673  11.398 1.00 27.17  ? 167 MET B CB   1 
ATOM   3108 C CG   . MET B 2 167 ? 32.868 28.114  10.128 1.00 25.59  ? 167 MET B CG   1 
ATOM   3109 S SD   . MET B 2 167 ? 32.340 29.306  8.902  1.00 62.61  ? 167 MET B SD   1 
ATOM   3110 C CE   . MET B 2 167 ? 33.061 28.565  7.356  1.00 54.35  ? 167 MET B CE   1 
ATOM   3111 H H    . MET B 2 167 ? 31.715 27.431  12.827 1.00 0.00   ? 167 MET B H    1 
ATOM   3112 N N    . ASN B 2 168 ? 35.844 27.566  13.692 1.00 33.55  ? 168 ASN B N    1 
ATOM   3113 C CA   . ASN B 2 168 ? 36.754 27.875  14.793 1.00 33.43  ? 168 ASN B CA   1 
ATOM   3114 C C    . ASN B 2 168 ? 36.171 27.599  16.143 1.00 30.74  ? 168 ASN B C    1 
ATOM   3115 O O    . ASN B 2 168 ? 35.946 28.503  16.942 1.00 40.96  ? 168 ASN B O    1 
ATOM   3116 C CB   . ASN B 2 168 ? 37.249 29.307  14.717 1.00 46.57  ? 168 ASN B CB   1 
ATOM   3117 C CG   . ASN B 2 168 ? 38.109 29.528  13.512 1.00 68.78  ? 168 ASN B CG   1 
ATOM   3118 O OD1  . ASN B 2 168 ? 39.297 29.174  13.512 1.00 77.18  ? 168 ASN B OD1  1 
ATOM   3119 N ND2  . ASN B 2 168 ? 37.504 30.038  12.436 1.00 67.33  ? 168 ASN B ND2  1 
ATOM   3120 H H    . ASN B 2 168 ? 36.172 27.002  12.961 1.00 0.00   ? 168 ASN B H    1 
ATOM   3121 H HD21 . ASN B 2 168 ? 38.041 30.203  11.633 1.00 0.00   ? 168 ASN B HD21 1 
ATOM   3122 H HD22 . ASN B 2 168 ? 36.545 30.226  12.497 1.00 0.00   ? 168 ASN B HD22 1 
ATOM   3123 N N    . VAL B 2 169 ? 35.955 26.318  16.385 1.00 31.24  ? 169 VAL B N    1 
ATOM   3124 C CA   . VAL B 2 169 ? 35.385 25.815  17.625 1.00 24.82  ? 169 VAL B CA   1 
ATOM   3125 C C    . VAL B 2 169 ? 36.042 26.418  18.867 1.00 28.34  ? 169 VAL B C    1 
ATOM   3126 O O    . VAL B 2 169 ? 37.259 26.530  18.928 1.00 43.36  ? 169 VAL B O    1 
ATOM   3127 C CB   . VAL B 2 169 ? 35.494 24.278  17.623 1.00 14.03  ? 169 VAL B CB   1 
ATOM   3128 C CG1  . VAL B 2 169 ? 35.195 23.703  18.966 1.00 14.18  ? 169 VAL B CG1  1 
ATOM   3129 C CG2  . VAL B 2 169 ? 34.580 23.695  16.550 1.00 3.38   ? 169 VAL B CG2  1 
ATOM   3130 H H    . VAL B 2 169 ? 36.192 25.678  15.682 1.00 0.00   ? 169 VAL B H    1 
ATOM   3131 N N    . ALA B 2 170 ? 35.228 26.836  19.836 1.00 29.31  ? 170 ALA B N    1 
ATOM   3132 C CA   . ALA B 2 170 ? 35.714 27.427  21.087 1.00 28.60  ? 170 ALA B CA   1 
ATOM   3133 C C    . ALA B 2 170 ? 35.034 26.757  22.259 1.00 30.63  ? 170 ALA B C    1 
ATOM   3134 O O    . ALA B 2 170 ? 34.176 25.901  22.075 1.00 45.77  ? 170 ALA B O    1 
ATOM   3135 C CB   . ALA B 2 170 ? 35.426 28.907  21.118 1.00 19.30  ? 170 ALA B CB   1 
ATOM   3136 H H    . ALA B 2 170 ? 34.275 26.685  19.727 1.00 0.00   ? 170 ALA B H    1 
ATOM   3137 N N    . GLU B 2 171 ? 35.427 27.116  23.471 1.00 33.19  ? 171 GLU B N    1 
ATOM   3138 C CA   . GLU B 2 171 ? 34.789 26.534  24.640 1.00 40.37  ? 171 GLU B CA   1 
ATOM   3139 C C    . GLU B 2 171 ? 33.321 26.981  24.593 1.00 43.41  ? 171 GLU B C    1 
ATOM   3140 O O    . GLU B 2 171 ? 32.413 26.207  24.886 1.00 44.81  ? 171 GLU B O    1 
ATOM   3141 C CB   . GLU B 2 171 ? 35.450 27.050  25.921 1.00 43.97  ? 171 GLU B CB   1 
ATOM   3142 C CG   . GLU B 2 171 ? 35.091 26.259  27.169 1.00 59.27  ? 171 GLU B CG   1 
ATOM   3143 C CD   . GLU B 2 171 ? 35.960 25.030  27.334 1.00 73.54  ? 171 GLU B CD   1 
ATOM   3144 O OE1  . GLU B 2 171 ? 35.915 24.127  26.470 1.00 74.75  ? 171 GLU B OE1  1 
ATOM   3145 O OE2  . GLU B 2 171 ? 36.710 24.975  28.328 1.00 82.32  ? 171 GLU B OE2  1 
ATOM   3146 H H    . GLU B 2 171 ? 36.165 27.748  23.583 1.00 0.00   ? 171 GLU B H    1 
ATOM   3147 N N    . LYS B 2 172 ? 33.107 28.211  24.127 1.00 41.87  ? 172 LYS B N    1 
ATOM   3148 C CA   . LYS B 2 172 ? 31.781 28.807  24.023 1.00 38.86  ? 172 LYS B CA   1 
ATOM   3149 C C    . LYS B 2 172 ? 30.866 28.208  22.961 1.00 34.36  ? 172 LYS B C    1 
ATOM   3150 O O    . LYS B 2 172 ? 29.881 28.822  22.592 1.00 39.40  ? 172 LYS B O    1 
ATOM   3151 C CB   . LYS B 2 172 ? 31.897 30.318  23.775 1.00 50.37  ? 172 LYS B CB   1 
ATOM   3152 C CG   . LYS B 2 172 ? 32.365 30.686  22.373 1.00 61.31  ? 172 LYS B CG   1 
ATOM   3153 C CD   . LYS B 2 172 ? 32.465 32.197  22.172 1.00 72.45  ? 172 LYS B CD   1 
ATOM   3154 C CE   . LYS B 2 172 ? 32.949 32.525  20.752 1.00 66.47  ? 172 LYS B CE   1 
ATOM   3155 N NZ   . LYS B 2 172 ? 33.011 33.994  20.475 1.00 57.16  ? 172 LYS B NZ   1 
ATOM   3156 H H    . LYS B 2 172 ? 33.880 28.739  23.835 1.00 0.00   ? 172 LYS B H    1 
ATOM   3157 H HZ1  . LYS B 2 172 ? 33.664 34.462  21.135 1.00 0.00   ? 172 LYS B HZ1  1 
ATOM   3158 H HZ2  . LYS B 2 172 ? 33.351 34.130  19.501 1.00 0.00   ? 172 LYS B HZ2  1 
ATOM   3159 H HZ3  . LYS B 2 172 ? 32.064 34.411  20.568 1.00 0.00   ? 172 LYS B HZ3  1 
ATOM   3160 N N    . HIS B 2 173 ? 31.191 27.040  22.436 1.00 27.47  ? 173 HIS B N    1 
ATOM   3161 C CA   . HIS B 2 173 ? 30.332 26.437  21.428 1.00 28.50  ? 173 HIS B CA   1 
ATOM   3162 C C    . HIS B 2 173 ? 29.669 25.255  22.078 1.00 24.10  ? 173 HIS B C    1 
ATOM   3163 O O    . HIS B 2 173 ? 28.803 24.625  21.505 1.00 25.70  ? 173 HIS B O    1 
ATOM   3164 C CB   . HIS B 2 173 ? 31.123 26.006  20.175 1.00 31.46  ? 173 HIS B CB   1 
ATOM   3165 C CG   . HIS B 2 173 ? 31.460 27.135  19.242 1.00 30.74  ? 173 HIS B CG   1 
ATOM   3166 N ND1  . HIS B 2 173 ? 30.596 27.577  18.264 1.00 42.82  ? 173 HIS B ND1  1 
ATOM   3167 C CD2  . HIS B 2 173 ? 32.560 27.915  19.143 1.00 26.87  ? 173 HIS B CD2  1 
ATOM   3168 C CE1  . HIS B 2 173 ? 31.147 28.581  17.604 1.00 34.37  ? 173 HIS B CE1  1 
ATOM   3169 N NE2  . HIS B 2 173 ? 32.339 28.804  18.119 1.00 38.04  ? 173 HIS B NE2  1 
ATOM   3170 H H    . HIS B 2 173 ? 31.999 26.562  22.704 1.00 0.00   ? 173 HIS B H    1 
ATOM   3171 H HD1  . HIS B 2 173 ? 29.710 27.207  18.074 1.00 0.00   ? 173 HIS B HD1  1 
ATOM   3172 H HE2  . HIS B 2 173 ? 32.980 29.481  17.813 1.00 0.00   ? 173 HIS B HE2  1 
ATOM   3173 N N    . ARG B 2 174 ? 30.081 24.966  23.300 1.00 32.46  ? 174 ARG B N    1 
ATOM   3174 C CA   . ARG B 2 174 ? 29.515 23.854  24.045 1.00 39.61  ? 174 ARG B CA   1 
ATOM   3175 C C    . ARG B 2 174 ? 28.039 24.117  24.254 1.00 33.55  ? 174 ARG B C    1 
ATOM   3176 O O    . ARG B 2 174 ? 27.606 25.268  24.367 1.00 35.12  ? 174 ARG B O    1 
ATOM   3177 C CB   . ARG B 2 174 ? 30.194 23.709  25.416 1.00 50.74  ? 174 ARG B CB   1 
ATOM   3178 C CG   . ARG B 2 174 ? 31.590 23.097  25.383 1.00 70.76  ? 174 ARG B CG   1 
ATOM   3179 C CD   . ARG B 2 174 ? 32.208 23.061  26.782 1.00 78.48  ? 174 ARG B CD   1 
ATOM   3180 N NE   . ARG B 2 174 ? 33.453 22.293  26.821 1.00 83.13  ? 174 ARG B NE   1 
ATOM   3181 C CZ   . ARG B 2 174 ? 33.530 20.997  27.119 1.00 82.00  ? 174 ARG B CZ   1 
ATOM   3182 N NH1  . ARG B 2 174 ? 32.434 20.307  27.402 1.00 80.38  ? 174 ARG B NH1  1 
ATOM   3183 N NH2  . ARG B 2 174 ? 34.710 20.393  27.166 1.00 85.31  ? 174 ARG B NH2  1 
ATOM   3184 H H    . ARG B 2 174 ? 30.786 25.498  23.719 1.00 0.00   ? 174 ARG B H    1 
ATOM   3185 H HE   . ARG B 2 174 ? 34.284 22.752  26.591 1.00 0.00   ? 174 ARG B HE   1 
ATOM   3186 H HH11 . ARG B 2 174 ? 31.534 20.743  27.401 1.00 0.00   ? 174 ARG B HH11 1 
ATOM   3187 H HH12 . ARG B 2 174 ? 32.517 19.335  27.620 1.00 0.00   ? 174 ARG B HH12 1 
ATOM   3188 H HH21 . ARG B 2 174 ? 35.550 20.907  26.993 1.00 0.00   ? 174 ARG B HH21 1 
ATOM   3189 H HH22 . ARG B 2 174 ? 34.755 19.420  27.396 1.00 0.00   ? 174 ARG B HH22 1 
ATOM   3190 N N    . GLY B 2 175 ? 27.272 23.035  24.288 1.00 32.02  ? 175 GLY B N    1 
ATOM   3191 C CA   . GLY B 2 175 ? 25.846 23.128  24.494 1.00 31.00  ? 175 GLY B CA   1 
ATOM   3192 C C    . GLY B 2 175 ? 25.116 22.061  23.727 1.00 29.16  ? 175 GLY B C    1 
ATOM   3193 O O    . GLY B 2 175 ? 25.736 21.310  22.973 1.00 29.69  ? 175 GLY B O    1 
ATOM   3194 H H    . GLY B 2 175 ? 27.679 22.155  24.158 1.00 0.00   ? 175 GLY B H    1 
ATOM   3195 N N    . ASN B 2 176 ? 23.796 22.016  23.904 1.00 33.62  ? 176 ASN B N    1 
ATOM   3196 C CA   . ASN B 2 176 ? 22.946 21.056  23.219 1.00 22.49  ? 176 ASN B CA   1 
ATOM   3197 C C    . ASN B 2 176 ? 22.320 21.651  21.977 1.00 24.78  ? 176 ASN B C    1 
ATOM   3198 O O    . ASN B 2 176 ? 21.545 22.604  22.030 1.00 18.72  ? 176 ASN B O    1 
ATOM   3199 C CB   . ASN B 2 176 ? 21.883 20.504  24.146 1.00 34.00  ? 176 ASN B CB   1 
ATOM   3200 C CG   . ASN B 2 176 ? 22.435 19.473  25.107 1.00 39.07  ? 176 ASN B CG   1 
ATOM   3201 O OD1  . ASN B 2 176 ? 23.575 19.572  25.563 1.00 41.20  ? 176 ASN B OD1  1 
ATOM   3202 N ND2  . ASN B 2 176 ? 21.628 18.461  25.408 1.00 61.87  ? 176 ASN B ND2  1 
ATOM   3203 H H    . ASN B 2 176 ? 23.377 22.669  24.504 1.00 0.00   ? 176 ASN B H    1 
ATOM   3204 H HD21 . ASN B 2 176 ? 21.962 17.765  26.008 1.00 0.00   ? 176 ASN B HD21 1 
ATOM   3205 H HD22 . ASN B 2 176 ? 20.732 18.447  25.011 1.00 0.00   ? 176 ASN B HD22 1 
ATOM   3206 N N    . TYR B 2 177 ? 22.736 21.084  20.850 1.00 23.65  ? 177 TYR B N    1 
ATOM   3207 C CA   . TYR B 2 177 ? 22.301 21.489  19.533 1.00 17.68  ? 177 TYR B CA   1 
ATOM   3208 C C    . TYR B 2 177 ? 21.173 20.580  19.050 1.00 22.01  ? 177 TYR B C    1 
ATOM   3209 O O    . TYR B 2 177 ? 21.062 19.403  19.455 1.00 17.06  ? 177 TYR B O    1 
ATOM   3210 C CB   . TYR B 2 177 ? 23.485 21.394  18.541 1.00 7.43   ? 177 TYR B CB   1 
ATOM   3211 C CG   . TYR B 2 177 ? 24.601 22.399  18.785 1.00 26.47  ? 177 TYR B CG   1 
ATOM   3212 C CD1  . TYR B 2 177 ? 25.348 22.400  19.986 1.00 24.16  ? 177 TYR B CD1  1 
ATOM   3213 C CD2  . TYR B 2 177 ? 24.893 23.379  17.830 1.00 35.19  ? 177 TYR B CD2  1 
ATOM   3214 C CE1  . TYR B 2 177 ? 26.350 23.364  20.218 1.00 15.13  ? 177 TYR B CE1  1 
ATOM   3215 C CE2  . TYR B 2 177 ? 25.899 24.349  18.057 1.00 24.17  ? 177 TYR B CE2  1 
ATOM   3216 C CZ   . TYR B 2 177 ? 26.608 24.326  19.238 1.00 15.94  ? 177 TYR B CZ   1 
ATOM   3217 O OH   . TYR B 2 177 ? 27.590 25.259  19.403 1.00 33.06  ? 177 TYR B OH   1 
ATOM   3218 H H    . TYR B 2 177 ? 23.377 20.361  20.923 1.00 0.00   ? 177 TYR B H    1 
ATOM   3219 H HH   . TYR B 2 177 ? 27.684 25.784  18.604 1.00 0.00   ? 177 TYR B HH   1 
ATOM   3220 N N    . THR B 2 178 ? 20.350 21.134  18.163 1.00 12.54  ? 178 THR B N    1 
ATOM   3221 C CA   . THR B 2 178 ? 19.266 20.393  17.561 1.00 12.52  ? 178 THR B CA   1 
ATOM   3222 C C    . THR B 2 178 ? 19.210 20.770  16.118 1.00 5.09   ? 178 THR B C    1 
ATOM   3223 O O    . THR B 2 178 ? 19.436 21.921  15.733 1.00 10.90  ? 178 THR B O    1 
ATOM   3224 C CB   . THR B 2 178 ? 17.851 20.658  18.220 1.00 24.01  ? 178 THR B CB   1 
ATOM   3225 O OG1  . THR B 2 178 ? 17.679 22.058  18.466 1.00 35.14  ? 178 THR B OG1  1 
ATOM   3226 C CG2  . THR B 2 178 ? 17.686 19.906  19.532 1.00 29.51  ? 178 THR B CG2  1 
ATOM   3227 H H    . THR B 2 178 ? 20.494 22.061  17.884 1.00 0.00   ? 178 THR B H    1 
ATOM   3228 H HG1  . THR B 2 178 ? 18.387 22.351  19.039 1.00 0.00   ? 178 THR B HG1  1 
ATOM   3229 N N    . CYS B 2 179 ? 18.947 19.751  15.320 1.00 8.65   ? 179 CYS B N    1 
ATOM   3230 C CA   . CYS B 2 179 ? 18.791 19.883  13.884 1.00 16.98  ? 179 CYS B CA   1 
ATOM   3231 C C    . CYS B 2 179 ? 17.316 19.554  13.582 1.00 28.38  ? 179 CYS B C    1 
ATOM   3232 O O    . CYS B 2 179 ? 16.730 18.577  14.120 1.00 15.60  ? 179 CYS B O    1 
ATOM   3233 C CB   . CYS B 2 179 ? 19.727 18.908  13.172 1.00 14.89  ? 179 CYS B CB   1 
ATOM   3234 S SG   . CYS B 2 179 ? 19.870 17.269  13.950 1.00 18.09  ? 179 CYS B SG   1 
ATOM   3235 H H    . CYS B 2 179 ? 18.797 18.866  15.713 1.00 0.00   ? 179 CYS B H    1 
ATOM   3236 N N    . HIS B 2 180 ? 16.714 20.385  12.739 1.00 27.93  ? 180 HIS B N    1 
ATOM   3237 C CA   . HIS B 2 180 ? 15.312 20.219  12.396 1.00 35.16  ? 180 HIS B CA   1 
ATOM   3238 C C    . HIS B 2 180 ? 15.005 20.055  10.918 1.00 31.41  ? 180 HIS B C    1 
ATOM   3239 O O    . HIS B 2 180 ? 15.448 20.846  10.080 1.00 34.46  ? 180 HIS B O    1 
ATOM   3240 C CB   . HIS B 2 180 ? 14.501 21.408  12.937 1.00 45.91  ? 180 HIS B CB   1 
ATOM   3241 C CG   . HIS B 2 180 ? 14.516 21.533  14.432 1.00 59.94  ? 180 HIS B CG   1 
ATOM   3242 N ND1  . HIS B 2 180 ? 13.664 22.372  15.113 1.00 71.17  ? 180 HIS B ND1  1 
ATOM   3243 C CD2  . HIS B 2 180 ? 15.273 20.925  15.379 1.00 68.29  ? 180 HIS B CD2  1 
ATOM   3244 C CE1  . HIS B 2 180 ? 13.893 22.276  16.413 1.00 67.54  ? 180 HIS B CE1  1 
ATOM   3245 N NE2  . HIS B 2 180 ? 14.865 21.404  16.600 1.00 65.71  ? 180 HIS B NE2  1 
ATOM   3246 H H    . HIS B 2 180 ? 17.212 21.111  12.334 1.00 0.00   ? 180 HIS B H    1 
ATOM   3247 H HD1  . HIS B 2 180 ? 12.988 22.948  14.697 1.00 0.00   ? 180 HIS B HD1  1 
ATOM   3248 H HE2  . HIS B 2 180 ? 15.230 21.144  17.476 1.00 0.00   ? 180 HIS B HE2  1 
ATOM   3249 N N    . ALA B 2 181 ? 14.215 19.032  10.612 1.00 30.85  ? 181 ALA B N    1 
ATOM   3250 C CA   . ALA B 2 181 ? 13.767 18.791  9.241  1.00 42.43  ? 181 ALA B CA   1 
ATOM   3251 C C    . ALA B 2 181 ? 12.243 18.520  9.213  1.00 48.30  ? 181 ALA B C    1 
ATOM   3252 O O    . ALA B 2 181 ? 11.615 18.275  10.253 1.00 38.40  ? 181 ALA B O    1 
ATOM   3253 C CB   . ALA B 2 181 ? 14.541 17.643  8.597  1.00 39.40  ? 181 ALA B CB   1 
ATOM   3254 H H    . ALA B 2 181 ? 13.935 18.411  11.313 1.00 0.00   ? 181 ALA B H    1 
ATOM   3255 N N    . SER B 2 182 ? 11.659 18.614  8.018  1.00 50.65  ? 182 SER B N    1 
ATOM   3256 C CA   . SER B 2 182 ? 10.229 18.394  7.803  1.00 42.47  ? 182 SER B CA   1 
ATOM   3257 C C    . SER B 2 182 ? 10.077 17.423  6.632  1.00 37.92  ? 182 SER B C    1 
ATOM   3258 O O    . SER B 2 182 ? 10.299 17.800  5.475  1.00 48.52  ? 182 SER B O    1 
ATOM   3259 C CB   . SER B 2 182 ? 9.537  19.717  7.470  1.00 36.66  ? 182 SER B CB   1 
ATOM   3260 O OG   . SER B 2 182 ? 8.135  19.531  7.375  1.00 52.21  ? 182 SER B OG   1 
ATOM   3261 H H    . SER B 2 182 ? 12.218 18.812  7.240  1.00 0.00   ? 182 SER B H    1 
ATOM   3262 H HG   . SER B 2 182 ? 7.798  19.206  8.214  1.00 0.00   ? 182 SER B HG   1 
ATOM   3263 N N    . TYR B 2 183 ? 9.707  16.180  6.941  1.00 35.83  ? 183 TYR B N    1 
ATOM   3264 C CA   . TYR B 2 183 ? 9.553  15.128  5.939  1.00 42.57  ? 183 TYR B CA   1 
ATOM   3265 C C    . TYR B 2 183 ? 8.128  14.952  5.427  1.00 58.17  ? 183 TYR B C    1 
ATOM   3266 O O    . TYR B 2 183 ? 7.192  14.718  6.203  1.00 66.68  ? 183 TYR B O    1 
ATOM   3267 C CB   . TYR B 2 183 ? 10.065 13.807  6.499  1.00 31.15  ? 183 TYR B CB   1 
ATOM   3268 C CG   . TYR B 2 183 ? 10.060 12.653  5.529  1.00 33.03  ? 183 TYR B CG   1 
ATOM   3269 C CD1  . TYR B 2 183 ? 10.732 12.742  4.299  1.00 41.23  ? 183 TYR B CD1  1 
ATOM   3270 C CD2  . TYR B 2 183 ? 9.453  11.442  5.869  1.00 29.20  ? 183 TYR B CD2  1 
ATOM   3271 C CE1  . TYR B 2 183 ? 10.802 11.644  3.438  1.00 39.89  ? 183 TYR B CE1  1 
ATOM   3272 C CE2  . TYR B 2 183 ? 9.518  10.339  5.022  1.00 32.07  ? 183 TYR B CE2  1 
ATOM   3273 C CZ   . TYR B 2 183 ? 10.194 10.445  3.811  1.00 42.27  ? 183 TYR B CZ   1 
ATOM   3274 O OH   . TYR B 2 183 ? 10.284 9.348   2.987  1.00 46.41  ? 183 TYR B OH   1 
ATOM   3275 H H    . TYR B 2 183 ? 9.542  15.950  7.876  1.00 0.00   ? 183 TYR B H    1 
ATOM   3276 H HH   . TYR B 2 183 ? 9.889  8.586   3.418  1.00 0.00   ? 183 TYR B HH   1 
ATOM   3277 N N    . THR B 2 184 ? 7.984  15.044  4.105  1.00 68.96  ? 184 THR B N    1 
ATOM   3278 C CA   . THR B 2 184 ? 6.696  14.900  3.439  1.00 63.52  ? 184 THR B CA   1 
ATOM   3279 C C    . THR B 2 184 ? 6.401  13.411  3.221  1.00 61.21  ? 184 THR B C    1 
ATOM   3280 O O    . THR B 2 184 ? 7.101  12.739  2.457  1.00 65.55  ? 184 THR B O    1 
ATOM   3281 C CB   . THR B 2 184 ? 6.701  15.656  2.086  1.00 63.89  ? 184 THR B CB   1 
ATOM   3282 O OG1  . THR B 2 184 ? 7.264  16.968  2.262  1.00 57.28  ? 184 THR B OG1  1 
ATOM   3283 C CG2  . THR B 2 184 ? 5.281  15.792  1.549  1.00 67.74  ? 184 THR B CG2  1 
ATOM   3284 H H    . THR B 2 184 ? 8.776  15.219  3.558  1.00 0.00   ? 184 THR B H    1 
ATOM   3285 H HG1  . THR B 2 184 ? 7.312  17.418  1.415  1.00 0.00   ? 184 THR B HG1  1 
ATOM   3286 N N    . TYR B 2 185 ? 5.412  12.889  3.948  1.00 56.48  ? 185 TYR B N    1 
ATOM   3287 C CA   . TYR B 2 185 ? 5.025  11.486  3.824  1.00 58.65  ? 185 TYR B CA   1 
ATOM   3288 C C    . TYR B 2 185 ? 3.534  11.360  3.568  1.00 65.01  ? 185 TYR B C    1 
ATOM   3289 O O    . TYR B 2 185 ? 2.725  11.451  4.505  1.00 64.03  ? 185 TYR B O    1 
ATOM   3290 C CB   . TYR B 2 185 ? 5.367  10.722  5.086  1.00 54.73  ? 185 TYR B CB   1 
ATOM   3291 C CG   . TYR B 2 185 ? 5.135  9.234   4.964  1.00 54.89  ? 185 TYR B CG   1 
ATOM   3292 C CD1  . TYR B 2 185 ? 5.790  8.484   3.975  1.00 52.32  ? 185 TYR B CD1  1 
ATOM   3293 C CD2  . TYR B 2 185 ? 4.317  8.559   5.878  1.00 54.12  ? 185 TYR B CD2  1 
ATOM   3294 C CE1  . TYR B 2 185 ? 5.648  7.086   3.904  1.00 55.36  ? 185 TYR B CE1  1 
ATOM   3295 C CE2  . TYR B 2 185 ? 4.164  7.163   5.821  1.00 57.73  ? 185 TYR B CE2  1 
ATOM   3296 C CZ   . TYR B 2 185 ? 4.836  6.426   4.834  1.00 61.88  ? 185 TYR B CZ   1 
ATOM   3297 O OH   . TYR B 2 185 ? 4.725  5.040   4.808  1.00 42.95  ? 185 TYR B OH   1 
ATOM   3298 H H    . TYR B 2 185 ? 4.934  13.468  4.578  1.00 0.00   ? 185 TYR B H    1 
ATOM   3299 H HH   . TYR B 2 185 ? 5.251  4.686   4.088  1.00 0.00   ? 185 TYR B HH   1 
ATOM   3300 N N    . LEU B 2 186 ? 3.193  11.060  2.312  1.00 69.82  ? 186 LEU B N    1 
ATOM   3301 C CA   . LEU B 2 186 ? 1.804  10.930  1.857  1.00 75.59  ? 186 LEU B CA   1 
ATOM   3302 C C    . LEU B 2 186 ? 1.166  12.331  1.793  1.00 79.99  ? 186 LEU B C    1 
ATOM   3303 O O    . LEU B 2 186 ? 0.091  12.577  2.366  1.00 80.31  ? 186 LEU B O    1 
ATOM   3304 C CB   . LEU B 2 186 ? 0.978  10.013  2.786  1.00 68.92  ? 186 LEU B CB   1 
ATOM   3305 C CG   . LEU B 2 186 ? 1.394  8.563   3.068  1.00 74.78  ? 186 LEU B CG   1 
ATOM   3306 C CD1  . LEU B 2 186 ? 0.534  7.984   4.194  1.00 64.16  ? 186 LEU B CD1  1 
ATOM   3307 C CD2  . LEU B 2 186 ? 1.303  7.712   1.806  1.00 61.23  ? 186 LEU B CD2  1 
ATOM   3308 H H    . LEU B 2 186 ? 3.911  10.908  1.661  1.00 0.00   ? 186 LEU B H    1 
ATOM   3309 N N    . GLY B 2 187 ? 1.866  13.259  1.137  1.00 80.97  ? 187 GLY B N    1 
ATOM   3310 C CA   . GLY B 2 187 ? 1.374  14.622  1.004  1.00 77.51  ? 187 GLY B CA   1 
ATOM   3311 C C    . GLY B 2 187 ? 1.463  15.464  2.263  1.00 76.14  ? 187 GLY B C    1 
ATOM   3312 O O    . GLY B 2 187 ? 1.673  16.672  2.179  1.00 79.72  ? 187 GLY B O    1 
ATOM   3313 H H    . GLY B 2 187 ? 2.728  13.015  0.737  1.00 0.00   ? 187 GLY B H    1 
ATOM   3314 N N    . LYS B 2 188 ? 1.294  14.827  3.420  1.00 75.23  ? 188 LYS B N    1 
ATOM   3315 C CA   . LYS B 2 188 ? 1.354  15.486  4.725  1.00 76.55  ? 188 LYS B CA   1 
ATOM   3316 C C    . LYS B 2 188 ? 2.770  15.450  5.335  1.00 79.47  ? 188 LYS B C    1 
ATOM   3317 O O    . LYS B 2 188 ? 3.323  14.373  5.594  1.00 77.32  ? 188 LYS B O    1 
ATOM   3318 C CB   . LYS B 2 188 ? 0.323  14.848  5.668  1.00 74.87  ? 188 LYS B CB   1 
ATOM   3319 C CG   . LYS B 2 188 ? 0.258  13.330  5.592  1.00 77.93  ? 188 LYS B CG   1 
ATOM   3320 C CD   . LYS B 2 188 ? -0.953 12.790  6.318  1.00 81.54  ? 188 LYS B CD   1 
ATOM   3321 C CE   . LYS B 2 188 ? -1.019 11.266  6.238  1.00 84.51  ? 188 LYS B CE   1 
ATOM   3322 N NZ   . LYS B 2 188 ? -1.154 10.758  4.854  1.00 82.08  ? 188 LYS B NZ   1 
ATOM   3323 H H    . LYS B 2 188 ? 1.146  13.869  3.419  1.00 0.00   ? 188 LYS B H    1 
ATOM   3324 H HZ1  . LYS B 2 188 ? -0.353 11.110  4.295  1.00 0.00   ? 188 LYS B HZ1  1 
ATOM   3325 H HZ2  . LYS B 2 188 ? -1.156 9.718   4.854  1.00 0.00   ? 188 LYS B HZ2  1 
ATOM   3326 H HZ3  . LYS B 2 188 ? -2.040 11.104  4.432  1.00 0.00   ? 188 LYS B HZ3  1 
ATOM   3327 N N    . GLN B 2 189 ? 3.352  16.635  5.546  1.00 75.39  ? 189 GLN B N    1 
ATOM   3328 C CA   . GLN B 2 189 ? 4.704  16.751  6.101  1.00 63.10  ? 189 GLN B CA   1 
ATOM   3329 C C    . GLN B 2 189 ? 4.812  16.793  7.613  1.00 56.91  ? 189 GLN B C    1 
ATOM   3330 O O    . GLN B 2 189 ? 4.228  17.657  8.264  1.00 47.52  ? 189 GLN B O    1 
ATOM   3331 C CB   . GLN B 2 189 ? 5.454  17.934  5.493  1.00 61.90  ? 189 GLN B CB   1 
ATOM   3332 C CG   . GLN B 2 189 ? 4.659  19.205  5.360  1.00 55.67  ? 189 GLN B CG   1 
ATOM   3333 C CD   . GLN B 2 189 ? 4.850  19.838  3.991  1.00 64.00  ? 189 GLN B CD   1 
ATOM   3334 O OE1  . GLN B 2 189 ? 4.782  21.062  3.834  1.00 65.62  ? 189 GLN B OE1  1 
ATOM   3335 N NE2  . GLN B 2 189 ? 5.088  18.998  2.983  1.00 66.32  ? 189 GLN B NE2  1 
ATOM   3336 H H    . GLN B 2 189 ? 2.845  17.443  5.326  1.00 0.00   ? 189 GLN B H    1 
ATOM   3337 H HE21 . GLN B 2 189 ? 5.220  19.402  2.099  1.00 0.00   ? 189 GLN B HE21 1 
ATOM   3338 H HE22 . GLN B 2 189 ? 5.126  18.032  3.130  1.00 0.00   ? 189 GLN B HE22 1 
ATOM   3339 N N    . TYR B 2 190 ? 5.582  15.847  8.146  1.00 47.76  ? 190 TYR B N    1 
ATOM   3340 C CA   . TYR B 2 190 ? 5.816  15.710  9.579  1.00 55.84  ? 190 TYR B CA   1 
ATOM   3341 C C    . TYR B 2 190 ? 7.178  16.281  9.954  1.00 51.75  ? 190 TYR B C    1 
ATOM   3342 O O    . TYR B 2 190 ? 8.043  16.442  9.105  1.00 54.84  ? 190 TYR B O    1 
ATOM   3343 C CB   . TYR B 2 190 ? 5.779  14.233  9.997  1.00 58.33  ? 190 TYR B CB   1 
ATOM   3344 C CG   . TYR B 2 190 ? 4.529  13.499  9.599  1.00 65.13  ? 190 TYR B CG   1 
ATOM   3345 C CD1  . TYR B 2 190 ? 4.302  13.144  8.268  1.00 72.20  ? 190 TYR B CD1  1 
ATOM   3346 C CD2  . TYR B 2 190 ? 3.554  13.187  10.541 1.00 68.14  ? 190 TYR B CD2  1 
ATOM   3347 C CE1  . TYR B 2 190 ? 3.132  12.503  7.881  1.00 73.72  ? 190 TYR B CE1  1 
ATOM   3348 C CE2  . TYR B 2 190 ? 2.376  12.545  10.164 1.00 75.87  ? 190 TYR B CE2  1 
ATOM   3349 C CZ   . TYR B 2 190 ? 2.173  12.209  8.831  1.00 71.47  ? 190 TYR B CZ   1 
ATOM   3350 O OH   . TYR B 2 190 ? 1.012  11.589  8.447  1.00 68.24  ? 190 TYR B OH   1 
ATOM   3351 H H    . TYR B 2 190 ? 5.993  15.194  7.558  1.00 0.00   ? 190 TYR B H    1 
ATOM   3352 H HH   . TYR B 2 190 ? 1.059  11.433  7.503  1.00 0.00   ? 190 TYR B HH   1 
ATOM   3353 N N    . PRO B 2 191 ? 7.366  16.633  11.230 1.00 45.58  ? 191 PRO B N    1 
ATOM   3354 C CA   . PRO B 2 191 ? 8.640  17.183  11.684 1.00 47.38  ? 191 PRO B CA   1 
ATOM   3355 C C    . PRO B 2 191 ? 9.616  16.095  12.162 1.00 45.08  ? 191 PRO B C    1 
ATOM   3356 O O    . PRO B 2 191 ? 9.232  14.930  12.310 1.00 42.16  ? 191 PRO B O    1 
ATOM   3357 C CB   . PRO B 2 191 ? 8.207  18.112  12.809 1.00 51.05  ? 191 PRO B CB   1 
ATOM   3358 C CG   . PRO B 2 191 ? 7.085  17.358  13.426 1.00 53.20  ? 191 PRO B CG   1 
ATOM   3359 C CD   . PRO B 2 191 ? 6.313  16.846  12.239 1.00 48.66  ? 191 PRO B CD   1 
ATOM   3360 N N    . ILE B 2 192 ? 10.878 16.494  12.360 1.00 47.55  ? 192 ILE B N    1 
ATOM   3361 C CA   . ILE B 2 192 ? 11.979 15.619  12.804 1.00 40.70  ? 192 ILE B CA   1 
ATOM   3362 C C    . ILE B 2 192 ? 13.081 16.434  13.515 1.00 31.49  ? 192 ILE B C    1 
ATOM   3363 O O    . ILE B 2 192 ? 13.481 17.490  13.032 1.00 34.79  ? 192 ILE B O    1 
ATOM   3364 C CB   . ILE B 2 192 ? 12.666 14.896  11.587 1.00 36.08  ? 192 ILE B CB   1 
ATOM   3365 C CG1  . ILE B 2 192 ? 11.748 13.877  10.937 1.00 32.21  ? 192 ILE B CG1  1 
ATOM   3366 C CG2  . ILE B 2 192 ? 13.894 14.146  12.024 1.00 44.62  ? 192 ILE B CG2  1 
ATOM   3367 C CD1  . ILE B 2 192 ? 12.269 13.448  9.623  1.00 35.05  ? 192 ILE B CD1  1 
ATOM   3368 H H    . ILE B 2 192 ? 11.081 17.438  12.192 1.00 0.00   ? 192 ILE B H    1 
ATOM   3369 N N    . THR B 2 193 ? 13.531 15.954  14.678 1.00 28.81  ? 193 THR B N    1 
ATOM   3370 C CA   . THR B 2 193 ? 14.632 16.577  15.432 1.00 26.80  ? 193 THR B CA   1 
ATOM   3371 C C    . THR B 2 193 ? 15.611 15.544  16.070 1.00 33.51  ? 193 THR B C    1 
ATOM   3372 O O    . THR B 2 193 ? 15.253 14.380  16.315 1.00 21.99  ? 193 THR B O    1 
ATOM   3373 C CB   . THR B 2 193 ? 14.154 17.522  16.579 1.00 14.82  ? 193 THR B CB   1 
ATOM   3374 O OG1  . THR B 2 193 ? 13.677 16.755  17.685 1.00 22.77  ? 193 THR B OG1  1 
ATOM   3375 C CG2  . THR B 2 193 ? 13.083 18.450  16.113 1.00 22.52  ? 193 THR B CG2  1 
ATOM   3376 H H    . THR B 2 193 ? 13.100 15.156  15.045 1.00 0.00   ? 193 THR B H    1 
ATOM   3377 H HG1  . THR B 2 193 ? 12.918 16.232  17.416 1.00 0.00   ? 193 THR B HG1  1 
ATOM   3378 N N    . ARG B 2 194 ? 16.871 15.968  16.239 1.00 34.89  ? 194 ARG B N    1 
ATOM   3379 C CA   . ARG B 2 194 ? 17.915 15.187  16.922 1.00 21.17  ? 194 ARG B CA   1 
ATOM   3380 C C    . ARG B 2 194 ? 18.699 16.194  17.755 1.00 11.52  ? 194 ARG B C    1 
ATOM   3381 O O    . ARG B 2 194 ? 18.901 17.325  17.325 1.00 18.93  ? 194 ARG B O    1 
ATOM   3382 C CB   . ARG B 2 194 ? 18.884 14.477  15.962 1.00 24.07  ? 194 ARG B CB   1 
ATOM   3383 C CG   . ARG B 2 194 ? 18.409 13.151  15.400 1.00 18.71  ? 194 ARG B CG   1 
ATOM   3384 C CD   . ARG B 2 194 ? 17.394 13.453  14.326 1.00 29.80  ? 194 ARG B CD   1 
ATOM   3385 N NE   . ARG B 2 194 ? 17.021 12.296  13.518 1.00 36.67  ? 194 ARG B NE   1 
ATOM   3386 C CZ   . ARG B 2 194 ? 15.907 11.590  13.692 1.00 29.27  ? 194 ARG B CZ   1 
ATOM   3387 N NH1  . ARG B 2 194 ? 15.058 11.913  14.659 1.00 32.70  ? 194 ARG B NH1  1 
ATOM   3388 N NH2  . ARG B 2 194 ? 15.628 10.586  12.879 1.00 18.89  ? 194 ARG B NH2  1 
ATOM   3389 H H    . ARG B 2 194 ? 17.101 16.854  15.890 1.00 0.00   ? 194 ARG B H    1 
ATOM   3390 H HE   . ARG B 2 194 ? 17.634 12.023  12.804 1.00 0.00   ? 194 ARG B HE   1 
ATOM   3391 H HH11 . ARG B 2 194 ? 15.254 12.684  15.260 1.00 0.00   ? 194 ARG B HH11 1 
ATOM   3392 H HH12 . ARG B 2 194 ? 14.228 11.371  14.787 1.00 0.00   ? 194 ARG B HH12 1 
ATOM   3393 H HH21 . ARG B 2 194 ? 16.261 10.367  12.133 1.00 0.00   ? 194 ARG B HH21 1 
ATOM   3394 H HH22 . ARG B 2 194 ? 14.799 10.044  13.001 1.00 0.00   ? 194 ARG B HH22 1 
ATOM   3395 N N    . VAL B 2 195 ? 19.086 15.797  18.966 1.00 19.28  ? 195 VAL B N    1 
ATOM   3396 C CA   . VAL B 2 195 ? 19.875 16.650  19.851 1.00 18.86  ? 195 VAL B CA   1 
ATOM   3397 C C    . VAL B 2 195 ? 21.236 16.039  19.902 1.00 20.57  ? 195 VAL B C    1 
ATOM   3398 O O    . VAL B 2 195 ? 21.385 14.822  20.088 1.00 19.62  ? 195 VAL B O    1 
ATOM   3399 C CB   . VAL B 2 195 ? 19.460 16.648  21.337 1.00 23.72  ? 195 VAL B CB   1 
ATOM   3400 C CG1  . VAL B 2 195 ? 19.404 18.065  21.846 1.00 3.66   ? 195 VAL B CG1  1 
ATOM   3401 C CG2  . VAL B 2 195 ? 18.201 15.840  21.580 1.00 39.09  ? 195 VAL B CG2  1 
ATOM   3402 H H    . VAL B 2 195 ? 18.858 14.911  19.269 1.00 0.00   ? 195 VAL B H    1 
ATOM   3403 N N    . ILE B 2 196 ? 22.206 16.939  19.940 1.00 25.40  ? 196 ILE B N    1 
ATOM   3404 C CA   . ILE B 2 196 ? 23.611 16.610  19.960 1.00 22.88  ? 196 ILE B CA   1 
ATOM   3405 C C    . ILE B 2 196 ? 24.244 17.420  21.087 1.00 22.30  ? 196 ILE B C    1 
ATOM   3406 O O    . ILE B 2 196 ? 24.157 18.653  21.101 1.00 11.36  ? 196 ILE B O    1 
ATOM   3407 C CB   . ILE B 2 196 ? 24.242 17.042  18.614 1.00 27.77  ? 196 ILE B CB   1 
ATOM   3408 C CG1  . ILE B 2 196 ? 23.587 16.307  17.451 1.00 10.50  ? 196 ILE B CG1  1 
ATOM   3409 C CG2  . ILE B 2 196 ? 25.737 16.844  18.636 1.00 39.75  ? 196 ILE B CG2  1 
ATOM   3410 C CD1  . ILE B 2 196 ? 23.794 17.011  16.137 1.00 14.90  ? 196 ILE B CD1  1 
ATOM   3411 H H    . ILE B 2 196 ? 21.984 17.880  19.924 1.00 0.00   ? 196 ILE B H    1 
ATOM   3412 N N    . GLU B 2 197 ? 24.817 16.740  22.072 1.00 22.27  ? 197 GLU B N    1 
ATOM   3413 C CA   . GLU B 2 197 ? 25.469 17.470  23.143 1.00 25.17  ? 197 GLU B CA   1 
ATOM   3414 C C    . GLU B 2 197 ? 26.873 17.686  22.639 1.00 28.53  ? 197 GLU B C    1 
ATOM   3415 O O    . GLU B 2 197 ? 27.599 16.726  22.427 1.00 39.03  ? 197 GLU B O    1 
ATOM   3416 C CB   . GLU B 2 197 ? 25.475 16.673  24.438 1.00 27.47  ? 197 GLU B CB   1 
ATOM   3417 C CG   . GLU B 2 197 ? 26.100 17.431  25.607 1.00 44.97  ? 197 GLU B CG   1 
ATOM   3418 C CD   . GLU B 2 197 ? 25.903 16.726  26.948 1.00 58.78  ? 197 GLU B CD   1 
ATOM   3419 O OE1  . GLU B 2 197 ? 26.542 15.672  27.159 1.00 52.87  ? 197 GLU B OE1  1 
ATOM   3420 O OE2  . GLU B 2 197 ? 25.110 17.223  27.789 1.00 68.52  ? 197 GLU B OE2  1 
ATOM   3421 H H    . GLU B 2 197 ? 24.821 15.761  22.072 1.00 0.00   ? 197 GLU B H    1 
ATOM   3422 N N    . PHE B 2 198 ? 27.226 18.937  22.365 1.00 37.70  ? 198 PHE B N    1 
ATOM   3423 C CA   . PHE B 2 198 ? 28.546 19.270  21.835 1.00 31.84  ? 198 PHE B CA   1 
ATOM   3424 C C    . PHE B 2 198 ? 29.624 19.533  22.901 1.00 40.10  ? 198 PHE B C    1 
ATOM   3425 O O    . PHE B 2 198 ? 29.553 20.508  23.664 1.00 32.72  ? 198 PHE B O    1 
ATOM   3426 C CB   . PHE B 2 198 ? 28.417 20.445  20.859 1.00 22.93  ? 198 PHE B CB   1 
ATOM   3427 C CG   . PHE B 2 198 ? 29.722 20.941  20.307 1.00 33.30  ? 198 PHE B CG   1 
ATOM   3428 C CD1  . PHE B 2 198 ? 30.738 20.060  19.957 1.00 41.37  ? 198 PHE B CD1  1 
ATOM   3429 C CD2  . PHE B 2 198 ? 29.922 22.293  20.093 1.00 35.32  ? 198 PHE B CD2  1 
ATOM   3430 C CE1  . PHE B 2 198 ? 31.926 20.519  19.399 1.00 25.16  ? 198 PHE B CE1  1 
ATOM   3431 C CE2  . PHE B 2 198 ? 31.109 22.755  19.535 1.00 44.87  ? 198 PHE B CE2  1 
ATOM   3432 C CZ   . PHE B 2 198 ? 32.110 21.863  19.188 1.00 27.52  ? 198 PHE B CZ   1 
ATOM   3433 H H    . PHE B 2 198 ? 26.590 19.654  22.538 1.00 0.00   ? 198 PHE B H    1 
ATOM   3434 N N    . ILE B 2 199 ? 30.631 18.654  22.916 1.00 36.85  ? 199 ILE B N    1 
ATOM   3435 C CA   . ILE B 2 199 ? 31.756 18.738  23.847 1.00 31.53  ? 199 ILE B CA   1 
ATOM   3436 C C    . ILE B 2 199 ? 33.076 19.070  23.121 1.00 35.38  ? 199 ILE B C    1 
ATOM   3437 O O    . ILE B 2 199 ? 33.532 18.309  22.262 1.00 35.44  ? 199 ILE B O    1 
ATOM   3438 C CB   . ILE B 2 199 ? 31.930 17.408  24.586 1.00 38.44  ? 199 ILE B CB   1 
ATOM   3439 C CG1  . ILE B 2 199 ? 30.606 16.983  25.229 1.00 31.67  ? 199 ILE B CG1  1 
ATOM   3440 C CG2  . ILE B 2 199 ? 33.044 17.528  25.619 1.00 27.83  ? 199 ILE B CG2  1 
ATOM   3441 C CD1  . ILE B 2 199 ? 30.538 15.489  25.524 1.00 39.10  ? 199 ILE B CD1  1 
ATOM   3442 H H    . ILE B 2 199 ? 30.616 17.911  22.281 1.00 0.00   ? 199 ILE B H    1 
ATOM   3443 N N    . THR B 2 200 ? 33.710 20.181  23.487 1.00 36.55  ? 200 THR B N    1 
ATOM   3444 C CA   . THR B 2 200 ? 34.969 20.581  22.845 1.00 37.49  ? 200 THR B CA   1 
ATOM   3445 C C    . THR B 2 200 ? 36.189 19.839  23.380 1.00 39.33  ? 200 THR B C    1 
ATOM   3446 O O    . THR B 2 200 ? 36.306 19.565  24.581 1.00 41.86  ? 200 THR B O    1 
ATOM   3447 C CB   . THR B 2 200 ? 35.243 22.094  22.986 1.00 31.97  ? 200 THR B CB   1 
ATOM   3448 O OG1  . THR B 2 200 ? 35.539 22.402  24.354 1.00 35.36  ? 200 THR B OG1  1 
ATOM   3449 C CG2  . THR B 2 200 ? 34.040 22.903  22.535 1.00 28.65  ? 200 THR B CG2  1 
ATOM   3450 H H    . THR B 2 200 ? 33.328 20.743  24.193 1.00 0.00   ? 200 THR B H    1 
ATOM   3451 H HG1  . THR B 2 200 ? 34.791 22.153  24.900 1.00 0.00   ? 200 THR B HG1  1 
ATOM   3452 N N    . LEU B 2 201 ? 37.090 19.502  22.469 1.00 43.98  ? 201 LEU B N    1 
ATOM   3453 C CA   . LEU B 2 201 ? 38.329 18.816  22.828 1.00 44.58  ? 201 LEU B CA   1 
ATOM   3454 C C    . LEU B 2 201 ? 39.456 19.854  22.762 1.00 50.12  ? 201 LEU B C    1 
ATOM   3455 O O    . LEU B 2 201 ? 39.360 20.849  22.026 1.00 40.33  ? 201 LEU B O    1 
ATOM   3456 C CB   . LEU B 2 201 ? 38.631 17.690  21.832 1.00 42.96  ? 201 LEU B CB   1 
ATOM   3457 C CG   . LEU B 2 201 ? 37.511 16.727  21.422 1.00 47.86  ? 201 LEU B CG   1 
ATOM   3458 C CD1  . LEU B 2 201 ? 37.963 15.913  20.226 1.00 46.53  ? 201 LEU B CD1  1 
ATOM   3459 C CD2  . LEU B 2 201 ? 37.112 15.820  22.572 1.00 53.25  ? 201 LEU B CD2  1 
ATOM   3460 H H    . LEU B 2 201 ? 36.926 19.707  21.527 1.00 0.00   ? 201 LEU B H    1 
ATOM   3461 N N    . GLU B 2 202 ? 40.522 19.616  23.524 1.00 58.00  ? 202 GLU B N    1 
ATOM   3462 C CA   . GLU B 2 202 ? 41.667 20.520  23.529 1.00 59.01  ? 202 GLU B CA   1 
ATOM   3463 C C    . GLU B 2 202 ? 42.317 20.533  22.160 1.00 52.53  ? 202 GLU B C    1 
ATOM   3464 O O    . GLU B 2 202 ? 42.430 19.487  21.505 1.00 39.62  ? 202 GLU B O    1 
ATOM   3465 C CB   . GLU B 2 202 ? 42.705 20.094  24.561 1.00 72.19  ? 202 GLU B CB   1 
ATOM   3466 C CG   . GLU B 2 202 ? 43.869 21.071  24.672 1.00 75.62  ? 202 GLU B CG   1 
ATOM   3467 C CD   . GLU B 2 202 ? 44.646 20.904  25.951 1.00 75.13  ? 202 GLU B CD   1 
ATOM   3468 O OE1  . GLU B 2 202 ? 44.607 19.787  26.522 1.00 67.58  ? 202 GLU B OE1  1 
ATOM   3469 O OE2  . GLU B 2 202 ? 45.285 21.895  26.376 1.00 68.78  ? 202 GLU B OE2  1 
ATOM   3470 H H    . GLU B 2 202 ? 40.543 18.818  24.092 1.00 0.00   ? 202 GLU B H    1 
ATOM   3471 N N    . GLU B 2 203 ? 42.757 21.717  21.746 1.00 52.37  ? 203 GLU B N    1 
ATOM   3472 C CA   . GLU B 2 203 ? 43.390 21.866  20.451 1.00 57.13  ? 203 GLU B CA   1 
ATOM   3473 C C    . GLU B 2 203 ? 44.545 20.898  20.304 1.00 64.68  ? 203 GLU B C    1 
ATOM   3474 O O    . GLU B 2 203 ? 45.284 20.634  21.261 1.00 63.90  ? 203 GLU B O    1 
ATOM   3475 C CB   . GLU B 2 203 ? 43.901 23.280  20.234 1.00 51.74  ? 203 GLU B CB   1 
ATOM   3476 C CG   . GLU B 2 203 ? 44.639 23.398  18.909 1.00 46.63  ? 203 GLU B CG   1 
ATOM   3477 C CD   . GLU B 2 203 ? 45.145 24.790  18.610 1.00 48.97  ? 203 GLU B CD   1 
ATOM   3478 O OE1  . GLU B 2 203 ? 45.019 25.683  19.484 1.00 41.56  ? 203 GLU B OE1  1 
ATOM   3479 O OE2  . GLU B 2 203 ? 45.657 24.981  17.480 1.00 44.44  ? 203 GLU B OE2  1 
ATOM   3480 H H    . GLU B 2 203 ? 42.665 22.497  22.333 1.00 0.00   ? 203 GLU B H    1 
ATOM   3481 N N    . ASN B 2 204 ? 44.669 20.347  19.104 1.00 72.17  ? 204 ASN B N    1 
ATOM   3482 C CA   . ASN B 2 204 ? 45.731 19.405  18.808 1.00 75.80  ? 204 ASN B CA   1 
ATOM   3483 C C    . ASN B 2 204 ? 46.876 20.158  18.148 1.00 73.05  ? 204 ASN B C    1 
ATOM   3484 O O    . ASN B 2 204 ? 46.835 20.470  16.958 1.00 69.15  ? 204 ASN B O    1 
ATOM   3485 C CB   . ASN B 2 204 ? 45.210 18.293  17.900 1.00 80.63  ? 204 ASN B CB   1 
ATOM   3486 C CG   . ASN B 2 204 ? 45.736 16.927  18.295 1.00 86.48  ? 204 ASN B CG   1 
ATOM   3487 O OD1  . ASN B 2 204 ? 46.020 16.668  19.473 1.00 82.97  ? 204 ASN B OD1  1 
ATOM   3488 N ND2  . ASN B 2 204 ? 45.862 16.039  17.313 1.00 79.76  ? 204 ASN B ND2  1 
ATOM   3489 H H    . ASN B 2 204 ? 44.029 20.583  18.400 1.00 0.00   ? 204 ASN B H    1 
ATOM   3490 H HD21 . ASN B 2 204 ? 46.203 15.140  17.497 1.00 0.00   ? 204 ASN B HD21 1 
ATOM   3491 H HD22 . ASN B 2 204 ? 45.599 16.358  16.434 1.00 0.00   ? 204 ASN B HD22 1 
ATOM   3492 N N    . LYS B 2 205 ? 47.839 20.546  18.974 1.00 76.69  ? 205 LYS B N    1 
ATOM   3493 C CA   . LYS B 2 205 ? 49.015 21.266  18.518 1.00 78.59  ? 205 LYS B CA   1 
ATOM   3494 C C    . LYS B 2 205 ? 50.057 20.215  18.122 1.00 81.70  ? 205 LYS B C    1 
ATOM   3495 O O    . LYS B 2 205 ? 50.272 19.235  18.846 1.00 75.31  ? 205 LYS B O    1 
ATOM   3496 C CB   . LYS B 2 205 ? 49.564 22.152  19.647 1.00 83.48  ? 205 LYS B CB   1 
ATOM   3497 C CG   . LYS B 2 205 ? 48.591 23.215  20.184 1.00 85.68  ? 205 LYS B CG   1 
ATOM   3498 C CD   . LYS B 2 205 ? 48.946 23.648  21.630 1.00 92.26  ? 205 LYS B CD   1 
ATOM   3499 C CE   . LYS B 2 205 ? 48.591 22.559  22.681 1.00 100.00 ? 205 LYS B CE   1 
ATOM   3500 N NZ   . LYS B 2 205 ? 49.068 22.806  24.098 1.00 90.36  ? 205 LYS B NZ   1 
ATOM   3501 H H    . LYS B 2 205 ? 47.746 20.347  19.929 1.00 0.00   ? 205 LYS B H    1 
ATOM   3502 H HZ1  . LYS B 2 205 ? 50.101 22.919  24.090 1.00 0.00   ? 205 LYS B HZ1  1 
ATOM   3503 H HZ2  . LYS B 2 205 ? 48.627 23.670  24.474 1.00 0.00   ? 205 LYS B HZ2  1 
ATOM   3504 H HZ3  . LYS B 2 205 ? 48.814 21.997  24.701 1.00 0.00   ? 205 LYS B HZ3  1 
ATOM   3505 N N    . PRO B 2 206 ? 50.635 20.350  16.914 1.00 80.91  ? 206 PRO B N    1 
ATOM   3506 C CA   . PRO B 2 206 ? 51.651 19.422  16.409 1.00 75.27  ? 206 PRO B CA   1 
ATOM   3507 C C    . PRO B 2 206 ? 53.032 19.778  16.963 1.00 73.25  ? 206 PRO B C    1 
ATOM   3508 O O    . PRO B 2 206 ? 53.474 20.915  16.845 1.00 79.04  ? 206 PRO B O    1 
ATOM   3509 C CB   . PRO B 2 206 ? 51.579 19.644  14.900 1.00 73.61  ? 206 PRO B CB   1 
ATOM   3510 C CG   . PRO B 2 206 ? 51.262 21.095  14.789 1.00 74.81  ? 206 PRO B CG   1 
ATOM   3511 C CD   . PRO B 2 206 ? 50.214 21.295  15.858 1.00 80.99  ? 206 PRO B CD   1 
ATOM   3512 N N    . THR B 2 207 ? 53.691 18.822  17.610 1.00 77.63  ? 207 THR B N    1 
ATOM   3513 C CA   . THR B 2 207 ? 55.024 19.054  18.173 1.00 77.34  ? 207 THR B CA   1 
ATOM   3514 C C    . THR B 2 207 ? 55.941 17.859  17.977 1.00 77.34  ? 207 THR B C    1 
ATOM   3515 O O    . THR B 2 207 ? 55.605 16.736  18.369 1.00 78.97  ? 207 THR B O    1 
ATOM   3516 C CB   . THR B 2 207 ? 54.986 19.366  19.693 1.00 76.62  ? 207 THR B CB   1 
ATOM   3517 O OG1  . THR B 2 207 ? 53.931 18.619  20.315 1.00 77.23  ? 207 THR B OG1  1 
ATOM   3518 C CG2  . THR B 2 207 ? 54.813 20.861  19.954 1.00 82.71  ? 207 THR B CG2  1 
ATOM   3519 H H    . THR B 2 207 ? 53.277 17.941  17.714 1.00 0.00   ? 207 THR B H    1 
ATOM   3520 H HG1  . THR B 2 207 ? 53.094 18.877  19.921 1.00 0.00   ? 207 THR B HG1  1 
ATOM   3521 N N    . ARG B 2 208 ? 57.095 18.111  17.363 1.00 78.52  ? 208 ARG B N    1 
ATOM   3522 C CA   . ARG B 2 208 ? 58.096 17.075  17.132 1.00 71.56  ? 208 ARG B CA   1 
ATOM   3523 C C    . ARG B 2 208 ? 58.693 16.675  18.491 1.00 62.89  ? 208 ARG B C    1 
ATOM   3524 O O    . ARG B 2 208 ? 58.880 17.520  19.375 1.00 54.12  ? 208 ARG B O    1 
ATOM   3525 C CB   . ARG B 2 208 ? 59.183 17.591  16.190 1.00 78.45  ? 208 ARG B CB   1 
ATOM   3526 C CG   . ARG B 2 208 ? 59.732 18.953  16.587 1.00 93.55  ? 208 ARG B CG   1 
ATOM   3527 C CD   . ARG B 2 208 ? 60.876 19.381  15.684 1.00 99.94  ? 208 ARG B CD   1 
ATOM   3528 N NE   . ARG B 2 208 ? 61.153 20.811  15.814 1.00 100.00 ? 208 ARG B NE   1 
ATOM   3529 C CZ   . ARG B 2 208 ? 62.356 21.362  15.682 1.00 100.00 ? 208 ARG B CZ   1 
ATOM   3530 N NH1  . ARG B 2 208 ? 63.418 20.605  15.419 1.00 92.44  ? 208 ARG B NH1  1 
ATOM   3531 N NH2  . ARG B 2 208 ? 62.491 22.678  15.799 1.00 98.35  ? 208 ARG B NH2  1 
ATOM   3532 H H    . ARG B 2 208 ? 57.261 19.023  17.048 1.00 0.00   ? 208 ARG B H    1 
ATOM   3533 H HE   . ARG B 2 208 ? 60.400 21.410  16.002 1.00 0.00   ? 208 ARG B HE   1 
ATOM   3534 H HH11 . ARG B 2 208 ? 63.317 19.615  15.320 1.00 0.00   ? 208 ARG B HH11 1 
ATOM   3535 H HH12 . ARG B 2 208 ? 64.319 21.026  15.319 1.00 0.00   ? 208 ARG B HH12 1 
ATOM   3536 H HH21 . ARG B 2 208 ? 61.693 23.251  15.986 1.00 0.00   ? 208 ARG B HH21 1 
ATOM   3537 H HH22 . ARG B 2 208 ? 63.395 23.093  15.697 1.00 0.00   ? 208 ARG B HH22 1 
ATOM   3538 N N    . PRO B 2 209 ? 58.960 15.371  18.684 1.00 54.72  ? 209 PRO B N    1 
ATOM   3539 C CA   . PRO B 2 209 ? 59.522 14.882  19.940 1.00 44.33  ? 209 PRO B CA   1 
ATOM   3540 C C    . PRO B 2 209 ? 60.985 15.250  20.080 1.00 44.02  ? 209 PRO B C    1 
ATOM   3541 O O    . PRO B 2 209 ? 61.657 15.546  19.097 1.00 50.31  ? 209 PRO B O    1 
ATOM   3542 C CB   . PRO B 2 209 ? 59.309 13.374  19.833 1.00 45.19  ? 209 PRO B CB   1 
ATOM   3543 C CG   . PRO B 2 209 ? 59.464 13.115  18.378 1.00 42.42  ? 209 PRO B CG   1 
ATOM   3544 C CD   . PRO B 2 209 ? 58.758 14.263  17.724 1.00 54.41  ? 209 PRO B CD   1 
ATOM   3545 N N    . VAL B 2 210 ? 61.466 15.238  21.315 1.00 44.66  ? 210 VAL B N    1 
ATOM   3546 C CA   . VAL B 2 210 ? 62.849 15.576  21.625 1.00 32.27  ? 210 VAL B CA   1 
ATOM   3547 C C    . VAL B 2 210 ? 63.626 14.353  22.109 1.00 27.46  ? 210 VAL B C    1 
ATOM   3548 O O    . VAL B 2 210 ? 63.329 13.832  23.175 1.00 20.46  ? 210 VAL B O    1 
ATOM   3549 C CB   . VAL B 2 210 ? 62.900 16.658  22.759 1.00 46.22  ? 210 VAL B CB   1 
ATOM   3550 C CG1  . VAL B 2 210 ? 64.343 16.986  23.159 1.00 38.82  ? 210 VAL B CG1  1 
ATOM   3551 C CG2  . VAL B 2 210 ? 62.146 17.920  22.342 1.00 37.85  ? 210 VAL B CG2  1 
ATOM   3552 H H    . VAL B 2 210 ? 60.864 14.997  22.047 1.00 0.00   ? 210 VAL B H    1 
ATOM   3553 N N    . ILE B 2 211 ? 64.611 13.893  21.330 1.00 29.37  ? 211 ILE B N    1 
ATOM   3554 C CA   . ILE B 2 211 ? 65.462 12.766  21.752 1.00 22.81  ? 211 ILE B CA   1 
ATOM   3555 C C    . ILE B 2 211 ? 66.435 13.336  22.773 1.00 23.41  ? 211 ILE B C    1 
ATOM   3556 O O    . ILE B 2 211 ? 67.155 14.284  22.502 1.00 31.46  ? 211 ILE B O    1 
ATOM   3557 C CB   . ILE B 2 211 ? 66.281 12.184  20.626 1.00 16.92  ? 211 ILE B CB   1 
ATOM   3558 C CG1  . ILE B 2 211 ? 65.357 11.702  19.522 1.00 5.66   ? 211 ILE B CG1  1 
ATOM   3559 C CG2  . ILE B 2 211 ? 67.102 11.041  21.148 1.00 24.30  ? 211 ILE B CG2  1 
ATOM   3560 C CD1  . ILE B 2 211 ? 66.059 11.033  18.391 1.00 16.91  ? 211 ILE B CD1  1 
ATOM   3561 H H    . ILE B 2 211 ? 64.802 14.350  20.486 1.00 0.00   ? 211 ILE B H    1 
ATOM   3562 N N    . VAL B 2 212 ? 66.372 12.824  23.983 1.00 29.36  ? 212 VAL B N    1 
ATOM   3563 C CA   . VAL B 2 212 ? 67.226 13.321  25.030 1.00 33.78  ? 212 VAL B CA   1 
ATOM   3564 C C    . VAL B 2 212 ? 68.600 12.647  25.106 1.00 45.10  ? 212 VAL B C    1 
ATOM   3565 O O    . VAL B 2 212 ? 69.626 13.339  25.091 1.00 42.37  ? 212 VAL B O    1 
ATOM   3566 C CB   . VAL B 2 212 ? 66.533 13.205  26.422 1.00 31.64  ? 212 VAL B CB   1 
ATOM   3567 C CG1  . VAL B 2 212 ? 67.422 13.782  27.515 1.00 43.37  ? 212 VAL B CG1  1 
ATOM   3568 C CG2  . VAL B 2 212 ? 65.220 13.921  26.427 1.00 21.95  ? 212 VAL B CG2  1 
ATOM   3569 H H    . VAL B 2 212 ? 65.661 12.204  24.143 1.00 0.00   ? 212 VAL B H    1 
ATOM   3570 N N    . SER B 2 213 ? 68.634 11.311  25.079 1.00 50.37  ? 213 SER B N    1 
ATOM   3571 C CA   . SER B 2 213 ? 69.904 10.637  25.281 1.00 47.68  ? 213 SER B CA   1 
ATOM   3572 C C    . SER B 2 213 ? 70.814 10.087  24.206 1.00 57.45  ? 213 SER B C    1 
ATOM   3573 O O    . SER B 2 213 ? 72.028 10.055  24.415 1.00 84.46  ? 213 SER B O    1 
ATOM   3574 C CB   . SER B 2 213 ? 69.795 9.626   26.401 1.00 43.83  ? 213 SER B CB   1 
ATOM   3575 O OG   . SER B 2 213 ? 71.071 9.440   26.967 1.00 35.20  ? 213 SER B OG   1 
ATOM   3576 H H    . SER B 2 213 ? 67.816 10.794  24.934 1.00 0.00   ? 213 SER B H    1 
ATOM   3577 H HG   . SER B 2 213 ? 71.377 10.281  27.308 1.00 0.00   ? 213 SER B HG   1 
ATOM   3578 N N    . PRO B 2 214 ? 70.281 9.523   23.122 1.00 41.10  ? 214 PRO B N    1 
ATOM   3579 C CA   . PRO B 2 214 ? 71.299 9.049   22.171 1.00 28.09  ? 214 PRO B CA   1 
ATOM   3580 C C    . PRO B 2 214 ? 71.830 10.195  21.320 1.00 39.31  ? 214 PRO B C    1 
ATOM   3581 O O    . PRO B 2 214 ? 71.930 10.059  20.112 1.00 69.02  ? 214 PRO B O    1 
ATOM   3582 C CB   . PRO B 2 214 ? 70.538 8.037   21.325 1.00 21.77  ? 214 PRO B CB   1 
ATOM   3583 C CG   . PRO B 2 214 ? 69.561 7.522   22.266 1.00 34.81  ? 214 PRO B CG   1 
ATOM   3584 C CD   . PRO B 2 214 ? 69.041 8.765   22.971 1.00 27.13  ? 214 PRO B CD   1 
ATOM   3585 N N    . ALA B 2 215 ? 72.244 11.284  21.962 1.00 28.66  ? 215 ALA B N    1 
ATOM   3586 C CA   . ALA B 2 215 ? 72.767 12.493  21.312 1.00 32.51  ? 215 ALA B CA   1 
ATOM   3587 C C    . ALA B 2 215 ? 74.046 12.458  20.467 1.00 34.31  ? 215 ALA B C    1 
ATOM   3588 O O    . ALA B 2 215 ? 75.002 13.171  20.768 1.00 37.60  ? 215 ALA B O    1 
ATOM   3589 C CB   . ALA B 2 215 ? 72.905 13.589  22.349 1.00 33.05  ? 215 ALA B CB   1 
ATOM   3590 H H    . ALA B 2 215 ? 72.235 11.314  22.934 1.00 0.00   ? 215 ALA B H    1 
ATOM   3591 N N    . ASN B 2 216 ? 74.046 11.684  19.389 1.00 36.55  ? 216 ASN B N    1 
ATOM   3592 C CA   . ASN B 2 216 ? 75.189 11.604  18.468 1.00 45.47  ? 216 ASN B CA   1 
ATOM   3593 C C    . ASN B 2 216 ? 76.593 11.524  19.091 1.00 42.24  ? 216 ASN B C    1 
ATOM   3594 O O    . ASN B 2 216 ? 77.418 12.419  18.889 1.00 40.50  ? 216 ASN B O    1 
ATOM   3595 C CB   . ASN B 2 216 ? 75.117 12.773  17.482 1.00 39.60  ? 216 ASN B CB   1 
ATOM   3596 C CG   . ASN B 2 216 ? 73.700 12.993  16.931 1.00 47.66  ? 216 ASN B CG   1 
ATOM   3597 O OD1  . ASN B 2 216 ? 73.213 12.240  16.075 1.00 37.99  ? 216 ASN B OD1  1 
ATOM   3598 N ND2  . ASN B 2 216 ? 73.034 14.024  17.433 1.00 36.72  ? 216 ASN B ND2  1 
ATOM   3599 H H    . ASN B 2 216 ? 73.256 11.152  19.177 1.00 0.00   ? 216 ASN B H    1 
ATOM   3600 H HD21 . ASN B 2 216 ? 72.126 14.181  17.097 1.00 0.00   ? 216 ASN B HD21 1 
ATOM   3601 H HD22 . ASN B 2 216 ? 73.471 14.580  18.111 1.00 0.00   ? 216 ASN B HD22 1 
ATOM   3602 N N    . GLU B 2 217 ? 76.869 10.418  19.790 1.00 41.42  ? 217 GLU B N    1 
ATOM   3603 C CA   . GLU B 2 217 ? 78.156 10.206  20.455 1.00 44.91  ? 217 GLU B CA   1 
ATOM   3604 C C    . GLU B 2 217 ? 78.814 8.840   20.210 1.00 35.56  ? 217 GLU B C    1 
ATOM   3605 O O    . GLU B 2 217 ? 78.442 8.135   19.280 1.00 33.00  ? 217 GLU B O    1 
ATOM   3606 C CB   . GLU B 2 217 ? 78.013 10.441  21.957 1.00 45.75  ? 217 GLU B CB   1 
ATOM   3607 C CG   . GLU B 2 217 ? 76.959 9.593   22.620 1.00 56.72  ? 217 GLU B CG   1 
ATOM   3608 C CD   . GLU B 2 217 ? 75.927 10.444  23.320 1.00 66.46  ? 217 GLU B CD   1 
ATOM   3609 O OE1  . GLU B 2 217 ? 76.228 10.957  24.419 1.00 71.41  ? 217 GLU B OE1  1 
ATOM   3610 O OE2  . GLU B 2 217 ? 74.829 10.622  22.759 1.00 59.26  ? 217 GLU B OE2  1 
ATOM   3611 H H    . GLU B 2 217 ? 76.184 9.720   19.855 1.00 0.00   ? 217 GLU B H    1 
ATOM   3612 N N    . THR B 2 218 ? 79.839 8.526   21.014 1.00 29.67  ? 218 THR B N    1 
ATOM   3613 C CA   . THR B 2 218 ? 80.586 7.255   20.942 1.00 29.16  ? 218 THR B CA   1 
ATOM   3614 C C    . THR B 2 218 ? 80.613 6.560   22.298 1.00 21.42  ? 218 THR B C    1 
ATOM   3615 O O    . THR B 2 218 ? 80.524 7.210   23.340 1.00 15.18  ? 218 THR B O    1 
ATOM   3616 C CB   . THR B 2 218 ? 82.102 7.430   20.500 1.00 39.44  ? 218 THR B CB   1 
ATOM   3617 O OG1  . THR B 2 218 ? 82.810 8.292   21.411 1.00 34.80  ? 218 THR B OG1  1 
ATOM   3618 C CG2  . THR B 2 218 ? 82.216 7.962   19.079 1.00 33.55  ? 218 THR B CG2  1 
ATOM   3619 H H    . THR B 2 218 ? 80.135 9.179   21.681 1.00 0.00   ? 218 THR B H    1 
ATOM   3620 H HG1  . THR B 2 218 ? 82.880 7.888   22.277 1.00 0.00   ? 218 THR B HG1  1 
ATOM   3621 N N    . MET B 2 219 ? 80.804 5.247   22.286 1.00 12.72  ? 219 MET B N    1 
ATOM   3622 C CA   . MET B 2 219 ? 80.855 4.502   23.536 1.00 25.09  ? 219 MET B CA   1 
ATOM   3623 C C    . MET B 2 219 ? 81.892 3.390   23.441 1.00 26.24  ? 219 MET B C    1 
ATOM   3624 O O    . MET B 2 219 ? 81.919 2.669   22.456 1.00 30.02  ? 219 MET B O    1 
ATOM   3625 C CB   . MET B 2 219 ? 79.474 3.893   23.829 1.00 32.00  ? 219 MET B CB   1 
ATOM   3626 C CG   . MET B 2 219 ? 79.364 3.198   25.175 1.00 37.61  ? 219 MET B CG   1 
ATOM   3627 S SD   . MET B 2 219 ? 77.790 2.336   25.412 1.00 41.76  ? 219 MET B SD   1 
ATOM   3628 C CE   . MET B 2 219 ? 76.771 3.680   26.117 1.00 50.44  ? 219 MET B CE   1 
ATOM   3629 H H    . MET B 2 219 ? 80.880 4.760   21.443 1.00 0.00   ? 219 MET B H    1 
ATOM   3630 N N    . GLU B 2 220 ? 82.725 3.239   24.472 1.00 36.40  ? 220 GLU B N    1 
ATOM   3631 C CA   . GLU B 2 220 ? 83.747 2.195   24.489 1.00 27.68  ? 220 GLU B CA   1 
ATOM   3632 C C    . GLU B 2 220 ? 83.140 0.919   25.025 1.00 32.29  ? 220 GLU B C    1 
ATOM   3633 O O    . GLU B 2 220 ? 82.580 0.901   26.124 1.00 35.63  ? 220 GLU B O    1 
ATOM   3634 C CB   . GLU B 2 220 ? 84.936 2.606   25.354 1.00 28.91  ? 220 GLU B CB   1 
ATOM   3635 C CG   . GLU B 2 220 ? 85.771 3.755   24.785 1.00 43.32  ? 220 GLU B CG   1 
ATOM   3636 C CD   . GLU B 2 220 ? 86.868 4.228   25.746 1.00 50.98  ? 220 GLU B CD   1 
ATOM   3637 O OE1  . GLU B 2 220 ? 87.411 3.385   26.511 1.00 50.58  ? 220 GLU B OE1  1 
ATOM   3638 O OE2  . GLU B 2 220 ? 87.176 5.446   25.734 1.00 43.51  ? 220 GLU B OE2  1 
ATOM   3639 H H    . GLU B 2 220 ? 82.624 3.823   25.251 1.00 0.00   ? 220 GLU B H    1 
ATOM   3640 N N    . VAL B 2 221 ? 83.266 -0.154  24.251 1.00 32.27  ? 221 VAL B N    1 
ATOM   3641 C CA   . VAL B 2 221 ? 82.705 -1.449  24.627 1.00 25.68  ? 221 VAL B CA   1 
ATOM   3642 C C    . VAL B 2 221 ? 83.643 -2.602  24.317 1.00 26.49  ? 221 VAL B C    1 
ATOM   3643 O O    . VAL B 2 221 ? 84.318 -2.606  23.305 1.00 33.43  ? 221 VAL B O    1 
ATOM   3644 C CB   . VAL B 2 221 ? 81.356 -1.721  23.874 1.00 15.36  ? 221 VAL B CB   1 
ATOM   3645 C CG1  . VAL B 2 221 ? 80.288 -0.745  24.342 1.00 19.15  ? 221 VAL B CG1  1 
ATOM   3646 C CG2  . VAL B 2 221 ? 81.554 -1.627  22.351 1.00 3.23   ? 221 VAL B CG2  1 
ATOM   3647 H H    . VAL B 2 221 ? 83.762 -0.071  23.410 1.00 0.00   ? 221 VAL B H    1 
ATOM   3648 N N    . ASP B 2 222 ? 83.647 -3.610  25.168 1.00 25.15  ? 222 ASP B N    1 
ATOM   3649 C CA   . ASP B 2 222 ? 84.498 -4.750  24.921 1.00 22.01  ? 222 ASP B CA   1 
ATOM   3650 C C    . ASP B 2 222 ? 83.857 -5.634  23.865 1.00 27.78  ? 222 ASP B C    1 
ATOM   3651 O O    . ASP B 2 222 ? 82.658 -5.908  23.903 1.00 30.04  ? 222 ASP B O    1 
ATOM   3652 C CB   . ASP B 2 222 ? 84.788 -5.503  26.219 1.00 25.59  ? 222 ASP B CB   1 
ATOM   3653 C CG   . ASP B 2 222 ? 85.624 -4.683  27.205 1.00 22.54  ? 222 ASP B CG   1 
ATOM   3654 O OD1  . ASP B 2 222 ? 86.140 -3.601  26.840 1.00 45.09  ? 222 ASP B OD1  1 
ATOM   3655 O OD2  . ASP B 2 222 ? 85.765 -5.123  28.362 1.00 39.01  ? 222 ASP B OD2  1 
ATOM   3656 H H    . ASP B 2 222 ? 83.070 -3.590  25.960 1.00 0.00   ? 222 ASP B H    1 
ATOM   3657 N N    . LEU B 2 223 ? 84.671 -6.085  22.917 1.00 39.36  ? 223 LEU B N    1 
ATOM   3658 C CA   . LEU B 2 223 ? 84.185 -6.893  21.807 1.00 36.35  ? 223 LEU B CA   1 
ATOM   3659 C C    . LEU B 2 223 ? 83.405 -8.169  22.104 1.00 42.14  ? 223 LEU B C    1 
ATOM   3660 O O    . LEU B 2 223 ? 82.763 -8.708  21.210 1.00 57.31  ? 223 LEU B O    1 
ATOM   3661 C CB   . LEU B 2 223 ? 85.319 -7.177  20.830 1.00 28.94  ? 223 LEU B CB   1 
ATOM   3662 C CG   . LEU B 2 223 ? 85.071 -8.098  19.630 1.00 31.90  ? 223 LEU B CG   1 
ATOM   3663 C CD1  . LEU B 2 223 ? 83.964 -7.569  18.759 1.00 35.54  ? 223 LEU B CD1  1 
ATOM   3664 C CD2  . LEU B 2 223 ? 86.358 -8.262  18.816 1.00 44.58  ? 223 LEU B CD2  1 
ATOM   3665 H H    . LEU B 2 223 ? 85.625 -5.867  22.972 1.00 0.00   ? 223 LEU B H    1 
ATOM   3666 N N    . GLY B 2 224 ? 83.411 -8.657  23.332 1.00 41.24  ? 224 GLY B N    1 
ATOM   3667 C CA   . GLY B 2 224 ? 82.661 -9.880  23.574 1.00 50.43  ? 224 GLY B CA   1 
ATOM   3668 C C    . GLY B 2 224 ? 81.349 -9.710  24.313 1.00 43.55  ? 224 GLY B C    1 
ATOM   3669 O O    . GLY B 2 224 ? 80.325 -10.278 23.933 1.00 37.70  ? 224 GLY B O    1 
ATOM   3670 H H    . GLY B 2 224 ? 83.885 -8.209  24.063 1.00 0.00   ? 224 GLY B H    1 
ATOM   3671 N N    . SER B 2 225 ? 81.406 -8.876  25.346 1.00 42.33  ? 225 SER B N    1 
ATOM   3672 C CA   . SER B 2 225 ? 80.310 -8.572  26.258 1.00 45.65  ? 225 SER B CA   1 
ATOM   3673 C C    . SER B 2 225 ? 78.931 -8.183  25.715 1.00 49.29  ? 225 SER B C    1 
ATOM   3674 O O    . SER B 2 225 ? 78.669 -8.203  24.502 1.00 41.37  ? 225 SER B O    1 
ATOM   3675 C CB   . SER B 2 225 ? 80.768 -7.495  27.249 1.00 47.14  ? 225 SER B CB   1 
ATOM   3676 O OG   . SER B 2 225 ? 80.958 -6.247  26.592 1.00 51.66  ? 225 SER B OG   1 
ATOM   3677 H H    . SER B 2 225 ? 82.261 -8.425  25.510 1.00 0.00   ? 225 SER B H    1 
ATOM   3678 H HG   . SER B 2 225 ? 80.146 -5.980  26.153 1.00 0.00   ? 225 SER B HG   1 
ATOM   3679 N N    . GLN B 2 226 ? 78.053 -7.836  26.659 1.00 43.59  ? 226 GLN B N    1 
ATOM   3680 C CA   . GLN B 2 226 ? 76.701 -7.428  26.353 1.00 35.09  ? 226 GLN B CA   1 
ATOM   3681 C C    . GLN B 2 226 ? 76.442 -6.085  26.987 1.00 27.39  ? 226 GLN B C    1 
ATOM   3682 O O    . GLN B 2 226 ? 76.941 -5.808  28.074 1.00 26.39  ? 226 GLN B O    1 
ATOM   3683 C CB   . GLN B 2 226 ? 75.703 -8.454  26.885 1.00 53.41  ? 226 GLN B CB   1 
ATOM   3684 C CG   . GLN B 2 226 ? 75.654 -8.577  28.387 1.00 69.27  ? 226 GLN B CG   1 
ATOM   3685 C CD   . GLN B 2 226 ? 74.277 -8.994  28.868 1.00 79.44  ? 226 GLN B CD   1 
ATOM   3686 O OE1  . GLN B 2 226 ? 73.985 -10.186 28.993 1.00 86.96  ? 226 GLN B OE1  1 
ATOM   3687 N NE2  . GLN B 2 226 ? 73.412 -8.008  29.119 1.00 74.00  ? 226 GLN B NE2  1 
ATOM   3688 H H    . GLN B 2 226 ? 78.321 -7.851  27.600 1.00 0.00   ? 226 GLN B H    1 
ATOM   3689 H HE21 . GLN B 2 226 ? 72.512 -8.251  29.422 1.00 0.00   ? 226 GLN B HE21 1 
ATOM   3690 H HE22 . GLN B 2 226 ? 73.707 -7.082  28.988 1.00 0.00   ? 226 GLN B HE22 1 
ATOM   3691 N N    . ILE B 2 227 ? 75.705 -5.228  26.284 1.00 15.35  ? 227 ILE B N    1 
ATOM   3692 C CA   . ILE B 2 227 ? 75.378 -3.904  26.816 1.00 22.84  ? 227 ILE B CA   1 
ATOM   3693 C C    . ILE B 2 227 ? 73.921 -3.576  26.586 1.00 14.36  ? 227 ILE B C    1 
ATOM   3694 O O    . ILE B 2 227 ? 73.250 -4.253  25.814 1.00 21.66  ? 227 ILE B O    1 
ATOM   3695 C CB   . ILE B 2 227 ? 76.201 -2.785  26.141 1.00 23.99  ? 227 ILE B CB   1 
ATOM   3696 C CG1  . ILE B 2 227 ? 76.045 -2.888  24.628 1.00 12.45  ? 227 ILE B CG1  1 
ATOM   3697 C CG2  . ILE B 2 227 ? 77.661 -2.840  26.602 1.00 37.83  ? 227 ILE B CG2  1 
ATOM   3698 C CD1  . ILE B 2 227 ? 76.626 -1.760  23.881 1.00 28.36  ? 227 ILE B CD1  1 
ATOM   3699 H H    . ILE B 2 227 ? 75.373 -5.489  25.398 1.00 0.00   ? 227 ILE B H    1 
ATOM   3700 N N    . GLN B 2 228 ? 73.477 -2.485  27.207 1.00 17.78  ? 228 GLN B N    1 
ATOM   3701 C CA   . GLN B 2 228 ? 72.110 -1.974  27.087 1.00 18.26  ? 228 GLN B CA   1 
ATOM   3702 C C    . GLN B 2 228 ? 72.191 -0.532  26.644 1.00 19.92  ? 228 GLN B C    1 
ATOM   3703 O O    . GLN B 2 228 ? 72.784 0.287   27.337 1.00 25.08  ? 228 GLN B O    1 
ATOM   3704 C CB   . GLN B 2 228 ? 71.410 -1.974  28.442 1.00 23.44  ? 228 GLN B CB   1 
ATOM   3705 C CG   . GLN B 2 228 ? 70.242 -2.923  28.569 1.00 36.57  ? 228 GLN B CG   1 
ATOM   3706 C CD   . GLN B 2 228 ? 69.571 -2.859  29.940 1.00 40.74  ? 228 GLN B CD   1 
ATOM   3707 O OE1  . GLN B 2 228 ? 69.740 -1.887  30.702 1.00 35.66  ? 228 GLN B OE1  1 
ATOM   3708 N NE2  . GLN B 2 228 ? 68.808 -3.903  30.264 1.00 41.52  ? 228 GLN B NE2  1 
ATOM   3709 H H    . GLN B 2 228 ? 74.107 -1.979  27.764 1.00 0.00   ? 228 GLN B H    1 
ATOM   3710 H HE21 . GLN B 2 228 ? 68.355 -3.910  31.132 1.00 0.00   ? 228 GLN B HE21 1 
ATOM   3711 H HE22 . GLN B 2 228 ? 68.728 -4.630  29.610 1.00 0.00   ? 228 GLN B HE22 1 
ATOM   3712 N N    . LEU B 2 229 ? 71.611 -0.222  25.490 1.00 26.81  ? 229 LEU B N    1 
ATOM   3713 C CA   . LEU B 2 229 ? 71.586 1.149   24.957 1.00 25.87  ? 229 LEU B CA   1 
ATOM   3714 C C    . LEU B 2 229 ? 70.162 1.667   25.147 1.00 29.79  ? 229 LEU B C    1 
ATOM   3715 O O    . LEU B 2 229 ? 69.208 1.045   24.680 1.00 34.79  ? 229 LEU B O    1 
ATOM   3716 C CB   . LEU B 2 229 ? 71.932 1.155   23.460 1.00 28.35  ? 229 LEU B CB   1 
ATOM   3717 C CG   . LEU B 2 229 ? 73.360 1.491   23.012 1.00 24.36  ? 229 LEU B CG   1 
ATOM   3718 C CD1  . LEU B 2 229 ? 74.382 0.926   23.966 1.00 15.21  ? 229 LEU B CD1  1 
ATOM   3719 C CD2  . LEU B 2 229 ? 73.582 0.985   21.609 1.00 17.45  ? 229 LEU B CD2  1 
ATOM   3720 H H    . LEU B 2 229 ? 71.205 -0.937  24.971 1.00 0.00   ? 229 LEU B H    1 
ATOM   3721 N N    . ILE B 2 230 ? 70.024 2.819   25.791 1.00 23.76  ? 230 ILE B N    1 
ATOM   3722 C CA   . ILE B 2 230 ? 68.704 3.377   26.055 1.00 19.87  ? 230 ILE B CA   1 
ATOM   3723 C C    . ILE B 2 230 ? 68.367 4.706   25.364 1.00 22.26  ? 230 ILE B C    1 
ATOM   3724 O O    . ILE B 2 230 ? 69.101 5.690   25.487 1.00 23.58  ? 230 ILE B O    1 
ATOM   3725 C CB   . ILE B 2 230 ? 68.485 3.531   27.578 1.00 23.24  ? 230 ILE B CB   1 
ATOM   3726 C CG1  . ILE B 2 230 ? 68.755 2.201   28.308 1.00 12.69  ? 230 ILE B CG1  1 
ATOM   3727 C CG2  . ILE B 2 230 ? 67.083 4.029   27.864 1.00 34.56  ? 230 ILE B CG2  1 
ATOM   3728 C CD1  . ILE B 2 230 ? 68.772 2.328   29.827 1.00 2.00   ? 230 ILE B CD1  1 
ATOM   3729 H H    . ILE B 2 230 ? 70.828 3.296   26.091 1.00 0.00   ? 230 ILE B H    1 
ATOM   3730 N N    . CYS B 2 231 ? 67.254 4.732   24.628 1.00 17.82  ? 231 CYS B N    1 
ATOM   3731 C CA   . CYS B 2 231 ? 66.818 5.954   23.963 1.00 2.87   ? 231 CYS B CA   1 
ATOM   3732 C C    . CYS B 2 231 ? 65.740 6.613   24.819 1.00 26.91  ? 231 CYS B C    1 
ATOM   3733 O O    . CYS B 2 231 ? 64.712 6.004   25.131 1.00 26.12  ? 231 CYS B O    1 
ATOM   3734 C CB   . CYS B 2 231 ? 66.252 5.647   22.597 1.00 5.79   ? 231 CYS B CB   1 
ATOM   3735 S SG   . CYS B 2 231 ? 66.030 7.150   21.608 1.00 16.70  ? 231 CYS B SG   1 
ATOM   3736 H H    . CYS B 2 231 ? 66.709 3.919   24.559 1.00 0.00   ? 231 CYS B H    1 
ATOM   3737 N N    . ASN B 2 232 ? 66.003 7.847   25.225 1.00 27.95  ? 232 ASN B N    1 
ATOM   3738 C CA   . ASN B 2 232 ? 65.075 8.614   26.037 1.00 15.81  ? 232 ASN B CA   1 
ATOM   3739 C C    . ASN B 2 232 ? 64.507 9.761   25.202 1.00 23.97  ? 232 ASN B C    1 
ATOM   3740 O O    . ASN B 2 232 ? 65.254 10.608  24.729 1.00 29.09  ? 232 ASN B O    1 
ATOM   3741 C CB   . ASN B 2 232 ? 65.802 9.189   27.251 1.00 24.69  ? 232 ASN B CB   1 
ATOM   3742 C CG   . ASN B 2 232 ? 64.883 9.973   28.193 1.00 28.38  ? 232 ASN B CG   1 
ATOM   3743 O OD1  . ASN B 2 232 ? 63.722 10.221  27.892 1.00 39.40  ? 232 ASN B OD1  1 
ATOM   3744 N ND2  . ASN B 2 232 ? 65.420 10.370  29.345 1.00 22.53  ? 232 ASN B ND2  1 
ATOM   3745 H H    . ASN B 2 232 ? 66.848 8.267   24.954 1.00 0.00   ? 232 ASN B H    1 
ATOM   3746 H HD21 . ASN B 2 232 ? 64.824 10.836  29.963 1.00 0.00   ? 232 ASN B HD21 1 
ATOM   3747 H HD22 . ASN B 2 232 ? 66.365 10.172  29.519 1.00 0.00   ? 232 ASN B HD22 1 
ATOM   3748 N N    . VAL B 2 233 ? 63.192 9.754   24.997 1.00 31.98  ? 233 VAL B N    1 
ATOM   3749 C CA   . VAL B 2 233 ? 62.496 10.795  24.245 1.00 19.88  ? 233 VAL B CA   1 
ATOM   3750 C C    . VAL B 2 233 ? 61.490 11.543  25.106 1.00 13.56  ? 233 VAL B C    1 
ATOM   3751 O O    . VAL B 2 233 ? 60.852 10.971  25.976 1.00 18.54  ? 233 VAL B O    1 
ATOM   3752 C CB   . VAL B 2 233 ? 61.758 10.213  23.071 1.00 22.27  ? 233 VAL B CB   1 
ATOM   3753 C CG1  . VAL B 2 233 ? 60.931 11.303  22.381 1.00 16.27  ? 233 VAL B CG1  1 
ATOM   3754 C CG2  . VAL B 2 233 ? 62.763 9.596   22.110 1.00 7.61   ? 233 VAL B CG2  1 
ATOM   3755 H H    . VAL B 2 233 ? 62.671 9.009   25.357 1.00 0.00   ? 233 VAL B H    1 
ATOM   3756 N N    . THR B 2 234 ? 61.401 12.844  24.887 1.00 26.64  ? 234 THR B N    1 
ATOM   3757 C CA   . THR B 2 234 ? 60.481 13.717  25.617 1.00 34.25  ? 234 THR B CA   1 
ATOM   3758 C C    . THR B 2 234 ? 59.452 14.300  24.650 1.00 32.54  ? 234 THR B C    1 
ATOM   3759 O O    . THR B 2 234 ? 59.743 15.190  23.846 1.00 33.81  ? 234 THR B O    1 
ATOM   3760 C CB   . THR B 2 234 ? 61.234 14.842  26.365 1.00 30.59  ? 234 THR B CB   1 
ATOM   3761 O OG1  . THR B 2 234 ? 62.033 14.261  27.406 1.00 52.15  ? 234 THR B OG1  1 
ATOM   3762 C CG2  . THR B 2 234 ? 60.269 15.834  26.977 1.00 30.61  ? 234 THR B CG2  1 
ATOM   3763 H H    . THR B 2 234 ? 61.949 13.240  24.197 1.00 0.00   ? 234 THR B H    1 
ATOM   3764 H HG1  . THR B 2 234 ? 61.476 13.830  28.056 1.00 0.00   ? 234 THR B HG1  1 
ATOM   3765 N N    . GLY B 2 235 ? 58.265 13.710  24.685 1.00 39.00  ? 235 GLY B N    1 
ATOM   3766 C CA   . GLY B 2 235 ? 57.182 14.145  23.830 1.00 36.76  ? 235 GLY B CA   1 
ATOM   3767 C C    . GLY B 2 235 ? 55.888 13.536  24.321 1.00 34.81  ? 235 GLY B C    1 
ATOM   3768 O O    . GLY B 2 235 ? 55.789 13.139  25.475 1.00 28.06  ? 235 GLY B O    1 
ATOM   3769 H H    . GLY B 2 235 ? 58.130 12.942  25.274 1.00 0.00   ? 235 GLY B H    1 
ATOM   3770 N N    . GLN B 2 236 ? 54.908 13.455  23.430 1.00 30.00  ? 236 GLN B N    1 
ATOM   3771 C CA   . GLN B 2 236 ? 53.607 12.905  23.743 1.00 37.16  ? 236 GLN B CA   1 
ATOM   3772 C C    . GLN B 2 236 ? 53.668 11.386  23.752 1.00 32.02  ? 236 GLN B C    1 
ATOM   3773 O O    . GLN B 2 236 ? 54.643 10.813  23.294 1.00 42.32  ? 236 GLN B O    1 
ATOM   3774 C CB   . GLN B 2 236 ? 52.611 13.380  22.684 1.00 53.66  ? 236 GLN B CB   1 
ATOM   3775 C CG   . GLN B 2 236 ? 52.738 14.862  22.349 1.00 56.02  ? 236 GLN B CG   1 
ATOM   3776 C CD   . GLN B 2 236 ? 51.411 15.484  21.976 1.00 55.36  ? 236 GLN B CD   1 
ATOM   3777 O OE1  . GLN B 2 236 ? 50.394 15.236  22.621 1.00 55.63  ? 236 GLN B OE1  1 
ATOM   3778 N NE2  . GLN B 2 236 ? 51.417 16.312  20.944 1.00 63.69  ? 236 GLN B NE2  1 
ATOM   3779 H H    . GLN B 2 236 ? 55.064 13.820  22.543 1.00 0.00   ? 236 GLN B H    1 
ATOM   3780 H HE21 . GLN B 2 236 ? 50.567 16.725  20.685 1.00 0.00   ? 236 GLN B HE21 1 
ATOM   3781 H HE22 . GLN B 2 236 ? 52.263 16.482  20.481 1.00 0.00   ? 236 GLN B HE22 1 
ATOM   3782 N N    . LEU B 2 237 ? 52.633 10.727  24.269 1.00 26.78  ? 237 LEU B N    1 
ATOM   3783 C CA   . LEU B 2 237 ? 52.623 9.260   24.269 1.00 26.58  ? 237 LEU B CA   1 
ATOM   3784 C C    . LEU B 2 237 ? 52.304 8.660   22.907 1.00 28.08  ? 237 LEU B C    1 
ATOM   3785 O O    . LEU B 2 237 ? 52.521 7.470   22.699 1.00 29.42  ? 237 LEU B O    1 
ATOM   3786 C CB   . LEU B 2 237 ? 51.671 8.688   25.306 1.00 19.48  ? 237 LEU B CB   1 
ATOM   3787 C CG   . LEU B 2 237 ? 51.976 9.166   26.712 1.00 34.74  ? 237 LEU B CG   1 
ATOM   3788 C CD1  . LEU B 2 237 ? 51.378 10.572  26.924 1.00 38.50  ? 237 LEU B CD1  1 
ATOM   3789 C CD2  . LEU B 2 237 ? 51.380 8.178   27.683 1.00 38.50  ? 237 LEU B CD2  1 
ATOM   3790 H H    . LEU B 2 237 ? 51.874 11.232  24.626 1.00 0.00   ? 237 LEU B H    1 
ATOM   3791 N N    . SER B 2 238 ? 51.760 9.472   21.993 1.00 34.15  ? 238 SER B N    1 
ATOM   3792 C CA   . SER B 2 238 ? 51.452 9.014   20.630 1.00 35.29  ? 238 SER B CA   1 
ATOM   3793 C C    . SER B 2 238 ? 52.694 9.122   19.731 1.00 37.55  ? 238 SER B C    1 
ATOM   3794 O O    . SER B 2 238 ? 52.648 8.795   18.539 1.00 41.58  ? 238 SER B O    1 
ATOM   3795 C CB   . SER B 2 238 ? 50.263 9.781   20.040 1.00 26.99  ? 238 SER B CB   1 
ATOM   3796 O OG   . SER B 2 238 ? 50.335 11.152  20.354 1.00 28.02  ? 238 SER B OG   1 
ATOM   3797 H H    . SER B 2 238 ? 51.534 10.390  22.250 1.00 0.00   ? 238 SER B H    1 
ATOM   3798 H HG   . SER B 2 238 ? 50.487 11.244  21.297 1.00 0.00   ? 238 SER B HG   1 
ATOM   3799 N N    . ASP B 2 239 ? 53.783 9.617   20.331 1.00 46.97  ? 239 ASP B N    1 
ATOM   3800 C CA   . ASP B 2 239 ? 55.103 9.748   19.706 1.00 34.60  ? 239 ASP B CA   1 
ATOM   3801 C C    . ASP B 2 239 ? 55.790 8.424   19.975 1.00 30.39  ? 239 ASP B C    1 
ATOM   3802 O O    . ASP B 2 239 ? 55.641 7.871   21.063 1.00 34.36  ? 239 ASP B O    1 
ATOM   3803 C CB   . ASP B 2 239 ? 55.919 10.835  20.407 1.00 29.03  ? 239 ASP B CB   1 
ATOM   3804 C CG   . ASP B 2 239 ? 55.531 12.224  19.982 1.00 34.14  ? 239 ASP B CG   1 
ATOM   3805 O OD1  . ASP B 2 239 ? 55.078 12.386  18.826 1.00 32.15  ? 239 ASP B OD1  1 
ATOM   3806 O OD2  . ASP B 2 239 ? 55.695 13.161  20.792 1.00 34.74  ? 239 ASP B OD2  1 
ATOM   3807 H H    . ASP B 2 239 ? 53.705 9.928   21.256 1.00 0.00   ? 239 ASP B H    1 
ATOM   3808 N N    . ILE B 2 240 ? 56.519 7.901   18.996 1.00 31.98  ? 240 ILE B N    1 
ATOM   3809 C CA   . ILE B 2 240 ? 57.230 6.632   19.183 1.00 32.54  ? 240 ILE B CA   1 
ATOM   3810 C C    . ILE B 2 240 ? 58.772 6.771   19.222 1.00 37.91  ? 240 ILE B C    1 
ATOM   3811 O O    . ILE B 2 240 ? 59.319 7.811   18.844 1.00 36.67  ? 240 ILE B O    1 
ATOM   3812 C CB   . ILE B 2 240 ? 56.808 5.598   18.131 1.00 28.58  ? 240 ILE B CB   1 
ATOM   3813 C CG1  . ILE B 2 240 ? 56.977 6.151   16.714 1.00 28.60  ? 240 ILE B CG1  1 
ATOM   3814 C CG2  . ILE B 2 240 ? 55.376 5.208   18.369 1.00 19.89  ? 240 ILE B CG2  1 
ATOM   3815 C CD1  . ILE B 2 240 ? 56.640 5.134   15.630 1.00 14.89  ? 240 ILE B CD1  1 
ATOM   3816 H H    . ILE B 2 240 ? 56.573 8.367   18.136 1.00 0.00   ? 240 ILE B H    1 
ATOM   3817 N N    . ALA B 2 241 ? 59.455 5.744   19.732 1.00 30.70  ? 241 ALA B N    1 
ATOM   3818 C CA   . ALA B 2 241 ? 60.922 5.741   19.816 1.00 20.36  ? 241 ALA B CA   1 
ATOM   3819 C C    . ALA B 2 241 ? 61.460 4.359   19.516 1.00 27.06  ? 241 ALA B C    1 
ATOM   3820 O O    . ALA B 2 241 ? 61.171 3.388   20.223 1.00 27.13  ? 241 ALA B O    1 
ATOM   3821 C CB   . ALA B 2 241 ? 61.376 6.165   21.170 1.00 20.59  ? 241 ALA B CB   1 
ATOM   3822 H H    . ALA B 2 241 ? 58.964 4.962   20.049 1.00 0.00   ? 241 ALA B H    1 
ATOM   3823 N N    . TYR B 2 242 ? 62.253 4.263   18.460 1.00 27.10  ? 242 TYR B N    1 
ATOM   3824 C CA   . TYR B 2 242 ? 62.809 2.978   18.087 1.00 26.17  ? 242 TYR B CA   1 
ATOM   3825 C C    . TYR B 2 242 ? 64.201 3.038   17.511 1.00 24.78  ? 242 TYR B C    1 
ATOM   3826 O O    . TYR B 2 242 ? 64.647 4.053   16.986 1.00 21.85  ? 242 TYR B O    1 
ATOM   3827 C CB   . TYR B 2 242 ? 61.879 2.263   17.105 1.00 22.50  ? 242 TYR B CB   1 
ATOM   3828 C CG   . TYR B 2 242 ? 61.582 3.066   15.868 1.00 20.27  ? 242 TYR B CG   1 
ATOM   3829 C CD1  . TYR B 2 242 ? 60.793 4.213   15.929 1.00 29.02  ? 242 TYR B CD1  1 
ATOM   3830 C CD2  . TYR B 2 242 ? 62.094 2.687   14.637 1.00 24.22  ? 242 TYR B CD2  1 
ATOM   3831 C CE1  . TYR B 2 242 ? 60.526 4.958   14.792 1.00 20.53  ? 242 TYR B CE1  1 
ATOM   3832 C CE2  . TYR B 2 242 ? 61.835 3.419   13.499 1.00 22.71  ? 242 TYR B CE2  1 
ATOM   3833 C CZ   . TYR B 2 242 ? 61.051 4.552   13.581 1.00 26.76  ? 242 TYR B CZ   1 
ATOM   3834 O OH   . TYR B 2 242 ? 60.811 5.285   12.438 1.00 52.78  ? 242 TYR B OH   1 
ATOM   3835 H H    . TYR B 2 242 ? 62.471 5.055   17.926 1.00 0.00   ? 242 TYR B H    1 
ATOM   3836 H HH   . TYR B 2 242 ? 60.361 6.099   12.669 1.00 0.00   ? 242 TYR B HH   1 
ATOM   3837 N N    . TRP B 2 243 ? 64.862 1.897   17.582 1.00 34.62  ? 243 TRP B N    1 
ATOM   3838 C CA   . TRP B 2 243 ? 66.202 1.762   17.069 1.00 34.13  ? 243 TRP B CA   1 
ATOM   3839 C C    . TRP B 2 243 ? 66.257 1.123   15.696 1.00 34.73  ? 243 TRP B C    1 
ATOM   3840 O O    . TRP B 2 243 ? 65.428 0.288   15.313 1.00 37.97  ? 243 TRP B O    1 
ATOM   3841 C CB   . TRP B 2 243 ? 67.056 0.928   18.023 1.00 31.16  ? 243 TRP B CB   1 
ATOM   3842 C CG   . TRP B 2 243 ? 67.317 1.553   19.353 1.00 17.21  ? 243 TRP B CG   1 
ATOM   3843 C CD1  . TRP B 2 243 ? 66.630 1.343   20.509 1.00 7.24   ? 243 TRP B CD1  1 
ATOM   3844 C CD2  . TRP B 2 243 ? 68.378 2.447   19.670 1.00 17.11  ? 243 TRP B CD2  1 
ATOM   3845 N NE1  . TRP B 2 243 ? 67.204 2.050   21.538 1.00 16.18  ? 243 TRP B NE1  1 
ATOM   3846 C CE2  . TRP B 2 243 ? 68.283 2.736   21.048 1.00 20.09  ? 243 TRP B CE2  1 
ATOM   3847 C CE3  . TRP B 2 243 ? 69.407 3.036   18.922 1.00 14.43  ? 243 TRP B CE3  1 
ATOM   3848 C CZ2  . TRP B 2 243 ? 69.187 3.591   21.697 1.00 30.69  ? 243 TRP B CZ2  1 
ATOM   3849 C CZ3  . TRP B 2 243 ? 70.294 3.884   19.559 1.00 4.79   ? 243 TRP B CZ3  1 
ATOM   3850 C CH2  . TRP B 2 243 ? 70.183 4.154   20.933 1.00 6.82   ? 243 TRP B CH2  1 
ATOM   3851 H H    . TRP B 2 243 ? 64.440 1.129   18.016 1.00 0.00   ? 243 TRP B H    1 
ATOM   3852 H HE1  . TRP B 2 243 ? 66.898 2.056   22.469 1.00 0.00   ? 243 TRP B HE1  1 
ATOM   3853 N N    . LYS B 2 244 ? 67.281 1.530   14.973 1.00 37.03  ? 244 LYS B N    1 
ATOM   3854 C CA   . LYS B 2 244 ? 67.591 1.017   13.662 1.00 35.07  ? 244 LYS B CA   1 
ATOM   3855 C C    . LYS B 2 244 ? 69.109 1.013   13.718 1.00 36.73  ? 244 LYS B C    1 
ATOM   3856 O O    . LYS B 2 244 ? 69.713 1.855   14.379 1.00 39.13  ? 244 LYS B O    1 
ATOM   3857 C CB   . LYS B 2 244 ? 67.082 1.959   12.560 1.00 41.88  ? 244 LYS B CB   1 
ATOM   3858 C CG   . LYS B 2 244 ? 65.825 1.466   11.812 1.00 37.76  ? 244 LYS B CG   1 
ATOM   3859 C CD   . LYS B 2 244 ? 65.343 2.445   10.732 1.00 32.68  ? 244 LYS B CD   1 
ATOM   3860 C CE   . LYS B 2 244 ? 66.157 2.368   9.448  1.00 37.87  ? 244 LYS B CE   1 
ATOM   3861 N NZ   . LYS B 2 244 ? 66.349 3.712   8.784  1.00 37.83  ? 244 LYS B NZ   1 
ATOM   3862 H H    . LYS B 2 244 ? 67.859 2.227   15.350 1.00 0.00   ? 244 LYS B H    1 
ATOM   3863 H HZ1  . LYS B 2 244 ? 65.420 4.116   8.549  1.00 0.00   ? 244 LYS B HZ1  1 
ATOM   3864 H HZ2  . LYS B 2 244 ? 66.850 4.343   9.443  1.00 0.00   ? 244 LYS B HZ2  1 
ATOM   3865 H HZ3  . LYS B 2 244 ? 66.913 3.587   7.918  1.00 0.00   ? 244 LYS B HZ3  1 
ATOM   3866 N N    . TRP B 2 245 ? 69.721 -0.015  13.159 1.00 44.62  ? 245 TRP B N    1 
ATOM   3867 C CA   . TRP B 2 245 ? 71.167 -0.091  13.134 1.00 43.52  ? 245 TRP B CA   1 
ATOM   3868 C C    . TRP B 2 245 ? 71.620 -0.414  11.722 1.00 50.44  ? 245 TRP B C    1 
ATOM   3869 O O    . TRP B 2 245 ? 71.211 -1.450  11.170 1.00 43.57  ? 245 TRP B O    1 
ATOM   3870 C CB   . TRP B 2 245 ? 71.679 -1.169  14.084 1.00 38.88  ? 245 TRP B CB   1 
ATOM   3871 C CG   . TRP B 2 245 ? 73.135 -1.466  13.858 1.00 39.39  ? 245 TRP B CG   1 
ATOM   3872 C CD1  . TRP B 2 245 ? 74.210 -0.728  14.281 1.00 38.10  ? 245 TRP B CD1  1 
ATOM   3873 C CD2  . TRP B 2 245 ? 73.673 -2.552  13.094 1.00 44.85  ? 245 TRP B CD2  1 
ATOM   3874 N NE1  . TRP B 2 245 ? 75.382 -1.288  13.822 1.00 32.87  ? 245 TRP B NE1  1 
ATOM   3875 C CE2  . TRP B 2 245 ? 75.081 -2.407  13.091 1.00 36.90  ? 245 TRP B CE2  1 
ATOM   3876 C CE3  . TRP B 2 245 ? 73.098 -3.636  12.405 1.00 47.67  ? 245 TRP B CE3  1 
ATOM   3877 C CZ2  . TRP B 2 245 ? 75.921 -3.300  12.431 1.00 45.50  ? 245 TRP B CZ2  1 
ATOM   3878 C CZ3  . TRP B 2 245 ? 73.930 -4.522  11.751 1.00 49.87  ? 245 TRP B CZ3  1 
ATOM   3879 C CH2  . TRP B 2 245 ? 75.330 -4.350  11.767 1.00 52.68  ? 245 TRP B CH2  1 
ATOM   3880 H H    . TRP B 2 245 ? 69.219 -0.751  12.777 1.00 0.00   ? 245 TRP B H    1 
ATOM   3881 H HE1  . TRP B 2 245 ? 76.283 -0.946  13.995 1.00 0.00   ? 245 TRP B HE1  1 
ATOM   3882 N N    . ASN B 2 246 ? 72.443 0.471   11.140 1.00 55.57  ? 246 ASN B N    1 
ATOM   3883 C CA   . ASN B 2 246 ? 72.979 0.256   9.792  1.00 54.01  ? 246 ASN B CA   1 
ATOM   3884 C C    . ASN B 2 246 ? 71.824 0.151   8.778  1.00 55.35  ? 246 ASN B C    1 
ATOM   3885 O O    . ASN B 2 246 ? 71.587 -0.896  8.165  1.00 49.68  ? 246 ASN B O    1 
ATOM   3886 C CB   . ASN B 2 246 ? 73.894 -0.997  9.833  1.00 55.33  ? 246 ASN B CB   1 
ATOM   3887 C CG   . ASN B 2 246 ? 74.080 -1.676  8.483  1.00 61.03  ? 246 ASN B CG   1 
ATOM   3888 O OD1  . ASN B 2 246 ? 73.505 -2.744  8.238  1.00 64.12  ? 246 ASN B OD1  1 
ATOM   3889 N ND2  . ASN B 2 246 ? 74.893 -1.080  7.616  1.00 47.56  ? 246 ASN B ND2  1 
ATOM   3890 H H    . ASN B 2 246 ? 72.679 1.291   11.622 1.00 0.00   ? 246 ASN B H    1 
ATOM   3891 H HD21 . ASN B 2 246 ? 75.038 -1.496  6.740  1.00 0.00   ? 246 ASN B HD21 1 
ATOM   3892 H HD22 . ASN B 2 246 ? 75.310 -0.242  7.904  1.00 0.00   ? 246 ASN B HD22 1 
ATOM   3893 N N    . GLY B 2 247 ? 71.062 1.240   8.673  1.00 58.33  ? 247 GLY B N    1 
ATOM   3894 C CA   . GLY B 2 247 ? 69.925 1.292   7.765  1.00 54.50  ? 247 GLY B CA   1 
ATOM   3895 C C    . GLY B 2 247 ? 68.757 0.327   7.980  1.00 51.50  ? 247 GLY B C    1 
ATOM   3896 O O    . GLY B 2 247 ? 67.834 0.338   7.174  1.00 59.79  ? 247 GLY B O    1 
ATOM   3897 H H    . GLY B 2 247 ? 71.268 2.024   9.223  1.00 0.00   ? 247 GLY B H    1 
ATOM   3898 N N    . SER B 2 248 ? 68.755 -0.466  9.057  1.00 49.61  ? 248 SER B N    1 
ATOM   3899 C CA   . SER B 2 248 ? 67.681 -1.443  9.313  1.00 52.65  ? 248 SER B CA   1 
ATOM   3900 C C    . SER B 2 248 ? 67.135 -1.555  10.734 1.00 54.07  ? 248 SER B C    1 
ATOM   3901 O O    . SER B 2 248 ? 67.863 -1.455  11.715 1.00 57.21  ? 248 SER B O    1 
ATOM   3902 C CB   . SER B 2 248 ? 68.107 -2.851  8.870  1.00 49.23  ? 248 SER B CB   1 
ATOM   3903 O OG   . SER B 2 248 ? 67.690 -3.135  7.542  1.00 58.99  ? 248 SER B OG   1 
ATOM   3904 H H    . SER B 2 248 ? 69.496 -0.396  9.693  1.00 0.00   ? 248 SER B H    1 
ATOM   3905 H HG   . SER B 2 248 ? 68.060 -2.465  6.961  1.00 0.00   ? 248 SER B HG   1 
ATOM   3906 N N    . VAL B 2 249 ? 65.846 -1.856  10.821 1.00 53.44  ? 249 VAL B N    1 
ATOM   3907 C CA   . VAL B 2 249 ? 65.173 -2.016  12.105 1.00 49.27  ? 249 VAL B CA   1 
ATOM   3908 C C    . VAL B 2 249 ? 65.632 -3.307  12.778 1.00 37.70  ? 249 VAL B C    1 
ATOM   3909 O O    . VAL B 2 249 ? 66.174 -4.222  12.133 1.00 36.93  ? 249 VAL B O    1 
ATOM   3910 C CB   . VAL B 2 249 ? 63.614 -2.089  11.956 1.00 49.40  ? 249 VAL B CB   1 
ATOM   3911 C CG1  . VAL B 2 249 ? 62.950 -1.758  13.289 1.00 63.93  ? 249 VAL B CG1  1 
ATOM   3912 C CG2  . VAL B 2 249 ? 63.119 -1.154  10.868 1.00 46.60  ? 249 VAL B CG2  1 
ATOM   3913 H H    . VAL B 2 249 ? 65.347 -1.983  9.986  1.00 0.00   ? 249 VAL B H    1 
ATOM   3914 N N    . ILE B 2 250 ? 65.442 -3.350  14.090 1.00 25.39  ? 250 ILE B N    1 
ATOM   3915 C CA   . ILE B 2 250 ? 65.793 -4.520  14.860 1.00 27.04  ? 250 ILE B CA   1 
ATOM   3916 C C    . ILE B 2 250 ? 64.658 -5.539  14.700 1.00 36.56  ? 250 ILE B C    1 
ATOM   3917 O O    . ILE B 2 250 ? 63.488 -5.243  14.991 1.00 47.07  ? 250 ILE B O    1 
ATOM   3918 C CB   . ILE B 2 250 ? 66.061 -4.178  16.367 1.00 15.94  ? 250 ILE B CB   1 
ATOM   3919 C CG1  . ILE B 2 250 ? 67.403 -3.455  16.516 1.00 21.16  ? 250 ILE B CG1  1 
ATOM   3920 C CG2  . ILE B 2 250 ? 66.133 -5.463  17.210 1.00 6.74   ? 250 ILE B CG2  1 
ATOM   3921 C CD1  . ILE B 2 250 ? 67.326 -1.972  16.544 1.00 25.28  ? 250 ILE B CD1  1 
ATOM   3922 H H    . ILE B 2 250 ? 65.079 -2.567  14.555 1.00 0.00   ? 250 ILE B H    1 
ATOM   3923 N N    . ASP B 2 251 ? 65.003 -6.709  14.165 1.00 43.28  ? 251 ASP B N    1 
ATOM   3924 C CA   . ASP B 2 251 ? 64.036 -7.773  13.953 1.00 36.76  ? 251 ASP B CA   1 
ATOM   3925 C C    . ASP B 2 251 ? 63.680 -8.462  15.261 1.00 39.59  ? 251 ASP B C    1 
ATOM   3926 O O    . ASP B 2 251 ? 64.487 -8.548  16.184 1.00 39.75  ? 251 ASP B O    1 
ATOM   3927 C CB   . ASP B 2 251 ? 64.561 -8.787  12.937 1.00 47.03  ? 251 ASP B CB   1 
ATOM   3928 C CG   . ASP B 2 251 ? 63.452 -9.654  12.339 1.00 49.82  ? 251 ASP B CG   1 
ATOM   3929 O OD1  . ASP B 2 251 ? 62.701 -9.156  11.465 1.00 43.20  ? 251 ASP B OD1  1 
ATOM   3930 O OD2  . ASP B 2 251 ? 63.350 -10.838 12.728 1.00 49.91  ? 251 ASP B OD2  1 
ATOM   3931 H H    . ASP B 2 251 ? 65.939 -6.855  13.914 1.00 0.00   ? 251 ASP B H    1 
ATOM   3932 N N    . GLU B 2 252 ? 62.434 -8.904  15.338 1.00 45.31  ? 252 GLU B N    1 
ATOM   3933 C CA   . GLU B 2 252 ? 61.903 -9.570  16.509 1.00 44.28  ? 252 GLU B CA   1 
ATOM   3934 C C    . GLU B 2 252 ? 62.609 -10.902 16.624 1.00 41.99  ? 252 GLU B C    1 
ATOM   3935 O O    . GLU B 2 252 ? 62.882 -11.377 17.721 1.00 32.64  ? 252 GLU B O    1 
ATOM   3936 C CB   . GLU B 2 252 ? 60.400 -9.770  16.308 1.00 54.85  ? 252 GLU B CB   1 
ATOM   3937 C CG   . GLU B 2 252 ? 59.591 -10.123 17.543 1.00 63.18  ? 252 GLU B CG   1 
ATOM   3938 C CD   . GLU B 2 252 ? 58.088 -10.131 17.271 1.00 62.88  ? 252 GLU B CD   1 
ATOM   3939 O OE1  . GLU B 2 252 ? 57.667 -10.546 16.166 1.00 59.47  ? 252 GLU B OE1  1 
ATOM   3940 O OE2  . GLU B 2 252 ? 57.325 -9.719  18.171 1.00 69.25  ? 252 GLU B OE2  1 
ATOM   3941 H H    . GLU B 2 252 ? 61.851 -8.777  14.562 1.00 0.00   ? 252 GLU B H    1 
ATOM   3942 N N    . ASP B 2 253 ? 62.902 -11.491 15.468 1.00 50.78  ? 253 ASP B N    1 
ATOM   3943 C CA   . ASP B 2 253 ? 63.586 -12.782 15.391 1.00 58.20  ? 253 ASP B CA   1 
ATOM   3944 C C    . ASP B 2 253 ? 65.112 -12.649 15.225 1.00 52.33  ? 253 ASP B C    1 
ATOM   3945 O O    . ASP B 2 253 ? 65.747 -13.487 14.577 1.00 55.05  ? 253 ASP B O    1 
ATOM   3946 C CB   . ASP B 2 253 ? 62.985 -13.649 14.261 1.00 68.33  ? 253 ASP B CB   1 
ATOM   3947 C CG   . ASP B 2 253 ? 61.547 -14.124 14.557 1.00 72.46  ? 253 ASP B CG   1 
ATOM   3948 O OD1  . ASP B 2 253 ? 61.380 -15.033 15.407 1.00 75.49  ? 253 ASP B OD1  1 
ATOM   3949 O OD2  . ASP B 2 253 ? 60.592 -13.613 13.917 1.00 65.10  ? 253 ASP B OD2  1 
ATOM   3950 H H    . ASP B 2 253 ? 62.618 -11.053 14.642 1.00 0.00   ? 253 ASP B H    1 
ATOM   3951 N N    . ASP B 2 254 ? 65.679 -11.585 15.799 1.00 49.59  ? 254 ASP B N    1 
ATOM   3952 C CA   . ASP B 2 254 ? 67.121 -11.319 15.774 1.00 38.93  ? 254 ASP B CA   1 
ATOM   3953 C C    . ASP B 2 254 ? 67.671 -11.963 17.045 1.00 43.98  ? 254 ASP B C    1 
ATOM   3954 O O    . ASP B 2 254 ? 67.091 -11.826 18.131 1.00 35.33  ? 254 ASP B O    1 
ATOM   3955 C CB   . ASP B 2 254 ? 67.406 -9.801  15.796 1.00 43.43  ? 254 ASP B CB   1 
ATOM   3956 C CG   . ASP B 2 254 ? 68.892 -9.435  15.483 1.00 48.55  ? 254 ASP B CG   1 
ATOM   3957 O OD1  . ASP B 2 254 ? 69.811 -9.804  16.254 1.00 37.17  ? 254 ASP B OD1  1 
ATOM   3958 O OD2  . ASP B 2 254 ? 69.134 -8.721  14.480 1.00 38.57  ? 254 ASP B OD2  1 
ATOM   3959 H H    . ASP B 2 254 ? 65.104 -10.942 16.264 1.00 0.00   ? 254 ASP B H    1 
ATOM   3960 N N    . PRO B 2 255 ? 68.755 -12.745 16.905 1.00 47.08  ? 255 PRO B N    1 
ATOM   3961 C CA   . PRO B 2 255 ? 69.424 -13.446 18.011 1.00 39.91  ? 255 PRO B CA   1 
ATOM   3962 C C    . PRO B 2 255 ? 70.317 -12.653 18.989 1.00 32.78  ? 255 PRO B C    1 
ATOM   3963 O O    . PRO B 2 255 ? 70.653 -13.178 20.060 1.00 18.41  ? 255 PRO B O    1 
ATOM   3964 C CB   . PRO B 2 255 ? 70.198 -14.557 17.291 1.00 58.93  ? 255 PRO B CB   1 
ATOM   3965 C CG   . PRO B 2 255 ? 70.460 -13.977 15.908 1.00 54.34  ? 255 PRO B CG   1 
ATOM   3966 C CD   . PRO B 2 255 ? 69.158 -13.301 15.593 1.00 43.86  ? 255 PRO B CD   1 
ATOM   3967 N N    . VAL B 2 256 ? 70.731 -11.430 18.635 1.00 23.57  ? 256 VAL B N    1 
ATOM   3968 C CA   . VAL B 2 256 ? 71.564 -10.636 19.555 1.00 34.66  ? 256 VAL B CA   1 
ATOM   3969 C C    . VAL B 2 256 ? 70.972 -9.271  19.892 1.00 29.93  ? 256 VAL B C    1 
ATOM   3970 O O    . VAL B 2 256 ? 71.280 -8.682  20.931 1.00 34.76  ? 256 VAL B O    1 
ATOM   3971 C CB   . VAL B 2 256 ? 73.087 -10.461 19.088 1.00 30.80  ? 256 VAL B CB   1 
ATOM   3972 C CG1  . VAL B 2 256 ? 73.773 -11.808 18.968 1.00 31.36  ? 256 VAL B CG1  1 
ATOM   3973 C CG2  . VAL B 2 256 ? 73.192 -9.718  17.799 1.00 29.72  ? 256 VAL B CG2  1 
ATOM   3974 H H    . VAL B 2 256 ? 70.494 -11.071 17.759 1.00 0.00   ? 256 VAL B H    1 
ATOM   3975 N N    . LEU B 2 257 ? 70.113 -8.776  19.013 1.00 29.97  ? 257 LEU B N    1 
ATOM   3976 C CA   . LEU B 2 257 ? 69.475 -7.485  19.225 1.00 32.60  ? 257 LEU B CA   1 
ATOM   3977 C C    . LEU B 2 257 ? 68.012 -7.640  19.628 1.00 29.01  ? 257 LEU B C    1 
ATOM   3978 O O    . LEU B 2 257 ? 67.288 -8.449  19.058 1.00 36.25  ? 257 LEU B O    1 
ATOM   3979 C CB   . LEU B 2 257 ? 69.595 -6.616  17.966 1.00 30.26  ? 257 LEU B CB   1 
ATOM   3980 C CG   . LEU B 2 257 ? 71.033 -6.326  17.506 1.00 21.59  ? 257 LEU B CG   1 
ATOM   3981 C CD1  . LEU B 2 257 ? 71.027 -5.451  16.270 1.00 14.83  ? 257 LEU B CD1  1 
ATOM   3982 C CD2  . LEU B 2 257 ? 71.838 -5.690  18.613 1.00 24.00  ? 257 LEU B CD2  1 
ATOM   3983 H H    . LEU B 2 257 ? 69.896 -9.291  18.213 1.00 0.00   ? 257 LEU B H    1 
ATOM   3984 N N    . GLY B 2 258 ? 67.591 -6.847  20.611 1.00 34.11  ? 258 GLY B N    1 
ATOM   3985 C CA   . GLY B 2 258 ? 66.220 -6.889  21.084 1.00 30.08  ? 258 GLY B CA   1 
ATOM   3986 C C    . GLY B 2 258 ? 65.758 -5.605  21.763 1.00 29.28  ? 258 GLY B C    1 
ATOM   3987 O O    . GLY B 2 258 ? 66.469 -5.056  22.610 1.00 30.11  ? 258 GLY B O    1 
ATOM   3988 H H    . GLY B 2 258 ? 68.211 -6.201  21.006 1.00 0.00   ? 258 GLY B H    1 
ATOM   3989 N N    . GLU B 2 259 ? 64.559 -5.131  21.404 1.00 28.96  ? 259 GLU B N    1 
ATOM   3990 C CA   . GLU B 2 259 ? 63.993 -3.922  22.015 1.00 23.65  ? 259 GLU B CA   1 
ATOM   3991 C C    . GLU B 2 259 ? 62.981 -4.199  23.130 1.00 22.76  ? 259 GLU B C    1 
ATOM   3992 O O    . GLU B 2 259 ? 62.336 -5.238  23.181 1.00 24.50  ? 259 GLU B O    1 
ATOM   3993 C CB   . GLU B 2 259 ? 63.356 -3.025  20.965 1.00 20.35  ? 259 GLU B CB   1 
ATOM   3994 C CG   . GLU B 2 259 ? 64.263 -2.746  19.805 1.00 13.62  ? 259 GLU B CG   1 
ATOM   3995 C CD   . GLU B 2 259 ? 63.830 -1.570  18.981 1.00 19.08  ? 259 GLU B CD   1 
ATOM   3996 O OE1  . GLU B 2 259 ? 64.217 -0.444  19.359 1.00 24.27  ? 259 GLU B OE1  1 
ATOM   3997 O OE2  . GLU B 2 259 ? 63.154 -1.764  17.943 1.00 17.83  ? 259 GLU B OE2  1 
ATOM   3998 H H    . GLU B 2 259 ? 64.032 -5.608  20.727 1.00 0.00   ? 259 GLU B H    1 
ATOM   3999 N N    . ASP B 2 260 ? 62.857 -3.234  24.018 1.00 24.76  ? 260 ASP B N    1 
ATOM   4000 C CA   . ASP B 2 260 ? 61.949 -3.309  25.138 1.00 22.48  ? 260 ASP B CA   1 
ATOM   4001 C C    . ASP B 2 260 ? 61.374 -1.889  25.232 1.00 21.91  ? 260 ASP B C    1 
ATOM   4002 O O    . ASP B 2 260 ? 62.102 -0.963  25.535 1.00 27.66  ? 260 ASP B O    1 
ATOM   4003 C CB   . ASP B 2 260 ? 62.764 -3.662  26.387 1.00 34.32  ? 260 ASP B CB   1 
ATOM   4004 C CG   . ASP B 2 260 ? 61.938 -4.306  27.486 1.00 42.37  ? 260 ASP B CG   1 
ATOM   4005 O OD1  . ASP B 2 260 ? 60.756 -4.632  27.245 1.00 50.57  ? 260 ASP B OD1  1 
ATOM   4006 O OD2  . ASP B 2 260 ? 62.485 -4.500  28.596 1.00 41.99  ? 260 ASP B OD2  1 
ATOM   4007 H H    . ASP B 2 260 ? 63.409 -2.431  23.926 1.00 0.00   ? 260 ASP B H    1 
ATOM   4008 N N    . TYR B 2 261 ? 60.102 -1.701  24.878 1.00 24.12  ? 261 TYR B N    1 
ATOM   4009 C CA   . TYR B 2 261 ? 59.476 -0.366  24.933 1.00 28.38  ? 261 TYR B CA   1 
ATOM   4010 C C    . TYR B 2 261 ? 58.641 -0.037  26.195 1.00 20.46  ? 261 TYR B C    1 
ATOM   4011 O O    . TYR B 2 261 ? 57.840 -0.848  26.646 1.00 28.05  ? 261 TYR B O    1 
ATOM   4012 C CB   . TYR B 2 261 ? 58.621 -0.103  23.690 1.00 24.33  ? 261 TYR B CB   1 
ATOM   4013 C CG   . TYR B 2 261 ? 59.237 -0.469  22.361 1.00 16.06  ? 261 TYR B CG   1 
ATOM   4014 C CD1  . TYR B 2 261 ? 59.191 -1.784  21.891 1.00 26.38  ? 261 TYR B CD1  1 
ATOM   4015 C CD2  . TYR B 2 261 ? 59.757 0.516   21.508 1.00 32.43  ? 261 TYR B CD2  1 
ATOM   4016 C CE1  . TYR B 2 261 ? 59.629 -2.125  20.580 1.00 16.33  ? 261 TYR B CE1  1 
ATOM   4017 C CE2  . TYR B 2 261 ? 60.207 0.191   20.200 1.00 21.05  ? 261 TYR B CE2  1 
ATOM   4018 C CZ   . TYR B 2 261 ? 60.124 -1.132  19.754 1.00 14.64  ? 261 TYR B CZ   1 
ATOM   4019 O OH   . TYR B 2 261 ? 60.452 -1.458  18.466 1.00 27.62  ? 261 TYR B OH   1 
ATOM   4020 H H    . TYR B 2 261 ? 59.598 -2.445  24.521 1.00 0.00   ? 261 TYR B H    1 
ATOM   4021 H HH   . TYR B 2 261 ? 60.168 -2.354  18.275 1.00 0.00   ? 261 TYR B HH   1 
ATOM   4022 N N    . TYR B 2 262 ? 58.813 1.191   26.687 1.00 16.25  ? 262 TYR B N    1 
ATOM   4023 C CA   . TYR B 2 262 ? 58.154 1.746   27.875 1.00 19.41  ? 262 TYR B CA   1 
ATOM   4024 C C    . TYR B 2 262 ? 57.657 3.188   27.616 1.00 20.92  ? 262 TYR B C    1 
ATOM   4025 O O    . TYR B 2 262 ? 58.105 3.847   26.686 1.00 21.67  ? 262 TYR B O    1 
ATOM   4026 C CB   . TYR B 2 262 ? 59.115 1.792   29.078 1.00 19.73  ? 262 TYR B CB   1 
ATOM   4027 C CG   . TYR B 2 262 ? 59.624 0.456   29.540 1.00 26.55  ? 262 TYR B CG   1 
ATOM   4028 C CD1  . TYR B 2 262 ? 58.847 -0.365  30.360 1.00 21.72  ? 262 TYR B CD1  1 
ATOM   4029 C CD2  . TYR B 2 262 ? 60.855 -0.029  29.095 1.00 25.66  ? 262 TYR B CD2  1 
ATOM   4030 C CE1  . TYR B 2 262 ? 59.278 -1.648  30.708 1.00 19.27  ? 262 TYR B CE1  1 
ATOM   4031 C CE2  . TYR B 2 262 ? 61.303 -1.308  29.444 1.00 19.33  ? 262 TYR B CE2  1 
ATOM   4032 C CZ   . TYR B 2 262 ? 60.511 -2.116  30.242 1.00 23.46  ? 262 TYR B CZ   1 
ATOM   4033 O OH   . TYR B 2 262 ? 60.938 -3.394  30.537 1.00 28.09  ? 262 TYR B OH   1 
ATOM   4034 H H    . TYR B 2 262 ? 59.416 1.785   26.198 1.00 0.00   ? 262 TYR B H    1 
ATOM   4035 H HH   . TYR B 2 262 ? 61.851 -3.488  30.259 1.00 0.00   ? 262 TYR B HH   1 
ATOM   4036 N N    . SER B 2 263 ? 56.737 3.658   28.463 1.00 24.95  ? 263 SER B N    1 
ATOM   4037 C CA   . SER B 2 263 ? 56.159 5.006   28.381 1.00 16.50  ? 263 SER B CA   1 
ATOM   4038 C C    . SER B 2 263 ? 55.748 5.463   29.760 1.00 18.63  ? 263 SER B C    1 
ATOM   4039 O O    . SER B 2 263 ? 55.337 4.658   30.603 1.00 24.74  ? 263 SER B O    1 
ATOM   4040 C CB   . SER B 2 263 ? 54.935 5.025   27.485 1.00 27.49  ? 263 SER B CB   1 
ATOM   4041 O OG   . SER B 2 263 ? 55.323 5.263   26.155 1.00 51.71  ? 263 SER B OG   1 
ATOM   4042 H H    . SER B 2 263 ? 56.448 3.073   29.195 1.00 0.00   ? 263 SER B H    1 
ATOM   4043 H HG   . SER B 2 263 ? 55.903 4.562   25.851 1.00 0.00   ? 263 SER B HG   1 
ATOM   4044 N N    . VAL B 2 264 ? 55.880 6.755   30.013 1.00 20.28  ? 264 VAL B N    1 
ATOM   4045 C CA   . VAL B 2 264 ? 55.526 7.279   31.327 1.00 25.95  ? 264 VAL B CA   1 
ATOM   4046 C C    . VAL B 2 264 ? 54.942 8.658   31.105 1.00 29.72  ? 264 VAL B C    1 
ATOM   4047 O O    . VAL B 2 264 ? 55.656 9.586   30.724 1.00 26.85  ? 264 VAL B O    1 
ATOM   4048 C CB   . VAL B 2 264 ? 56.748 7.370   32.283 1.00 18.29  ? 264 VAL B CB   1 
ATOM   4049 C CG1  . VAL B 2 264 ? 56.279 7.343   33.733 1.00 16.80  ? 264 VAL B CG1  1 
ATOM   4050 C CG2  . VAL B 2 264 ? 57.681 6.209   32.062 1.00 23.73  ? 264 VAL B CG2  1 
ATOM   4051 H H    . VAL B 2 264 ? 56.189 7.370   29.316 1.00 0.00   ? 264 VAL B H    1 
ATOM   4052 N N    . GLU B 2 265 ? 53.633 8.769   31.331 1.00 35.27  ? 265 GLU B N    1 
ATOM   4053 C CA   . GLU B 2 265 ? 52.918 10.021  31.135 1.00 32.77  ? 265 GLU B CA   1 
ATOM   4054 C C    . GLU B 2 265 ? 53.260 11.045  32.196 1.00 34.94  ? 265 GLU B C    1 
ATOM   4055 O O    . GLU B 2 265 ? 53.281 10.719  33.387 1.00 29.70  ? 265 GLU B O    1 
ATOM   4056 C CB   . GLU B 2 265 ? 51.407 9.785   31.137 1.00 38.88  ? 265 GLU B CB   1 
ATOM   4057 C CG   . GLU B 2 265 ? 50.620 10.984  30.616 1.00 62.24  ? 265 GLU B CG   1 
ATOM   4058 C CD   . GLU B 2 265 ? 49.129 10.886  30.854 1.00 62.27  ? 265 GLU B CD   1 
ATOM   4059 O OE1  . GLU B 2 265 ? 48.697 11.118  32.003 1.00 70.20  ? 265 GLU B OE1  1 
ATOM   4060 O OE2  . GLU B 2 265 ? 48.391 10.603  29.887 1.00 66.88  ? 265 GLU B OE2  1 
ATOM   4061 H H    . GLU B 2 265 ? 53.138 7.985   31.651 1.00 0.00   ? 265 GLU B H    1 
ATOM   4062 N N    . ASN B 2 266 ? 53.555 12.272  31.757 1.00 29.25  ? 266 ASN B N    1 
ATOM   4063 C CA   . ASN B 2 266 ? 53.869 13.356  32.684 1.00 29.17  ? 266 ASN B CA   1 
ATOM   4064 C C    . ASN B 2 266 ? 52.542 13.993  33.092 1.00 37.36  ? 266 ASN B C    1 
ATOM   4065 O O    . ASN B 2 266 ? 51.844 14.582  32.264 1.00 44.18  ? 266 ASN B O    1 
ATOM   4066 C CB   . ASN B 2 266 ? 54.764 14.400  32.014 1.00 30.07  ? 266 ASN B CB   1 
ATOM   4067 C CG   . ASN B 2 266 ? 55.207 15.513  32.965 1.00 34.64  ? 266 ASN B CG   1 
ATOM   4068 O OD1  . ASN B 2 266 ? 54.938 15.485  34.170 1.00 29.05  ? 266 ASN B OD1  1 
ATOM   4069 N ND2  . ASN B 2 266 ? 55.902 16.503  32.413 1.00 32.51  ? 266 ASN B ND2  1 
ATOM   4070 H H    . ASN B 2 266 ? 53.555 12.453  30.795 1.00 0.00   ? 266 ASN B H    1 
ATOM   4071 H HD21 . ASN B 2 266 ? 56.238 17.223  32.986 1.00 0.00   ? 266 ASN B HD21 1 
ATOM   4072 H HD22 . ASN B 2 266 ? 56.055 16.469  31.446 1.00 0.00   ? 266 ASN B HD22 1 
ATOM   4073 N N    . PRO B 2 267 ? 52.146 13.813  34.360 1.00 33.68  ? 267 PRO B N    1 
ATOM   4074 C CA   . PRO B 2 267 ? 50.916 14.344  34.937 1.00 41.17  ? 267 PRO B CA   1 
ATOM   4075 C C    . PRO B 2 267 ? 50.738 15.864  34.754 1.00 47.16  ? 267 PRO B C    1 
ATOM   4076 O O    . PRO B 2 267 ? 49.618 16.344  34.538 1.00 59.61  ? 267 PRO B O    1 
ATOM   4077 C CB   . PRO B 2 267 ? 51.078 13.978  36.408 1.00 29.40  ? 267 PRO B CB   1 
ATOM   4078 C CG   . PRO B 2 267 ? 51.777 12.701  36.339 1.00 25.56  ? 267 PRO B CG   1 
ATOM   4079 C CD   . PRO B 2 267 ? 52.854 13.003  35.365 1.00 37.28  ? 267 PRO B CD   1 
ATOM   4080 N N    . ALA B 2 268 ? 51.842 16.605  34.832 1.00 49.84  ? 268 ALA B N    1 
ATOM   4081 C CA   . ALA B 2 268 ? 51.842 18.066  34.703 1.00 42.96  ? 268 ALA B CA   1 
ATOM   4082 C C    . ALA B 2 268 ? 51.724 18.616  33.271 1.00 37.96  ? 268 ALA B C    1 
ATOM   4083 O O    . ALA B 2 268 ? 51.203 19.708  33.056 1.00 44.27  ? 268 ALA B O    1 
ATOM   4084 C CB   . ALA B 2 268 ? 53.076 18.625  35.380 1.00 39.18  ? 268 ALA B CB   1 
ATOM   4085 H H    . ALA B 2 268 ? 52.695 16.143  34.974 1.00 0.00   ? 268 ALA B H    1 
ATOM   4086 N N    . ASN B 2 269 ? 52.212 17.862  32.298 1.00 37.20  ? 269 ASN B N    1 
ATOM   4087 C CA   . ASN B 2 269 ? 52.155 18.281  30.910 1.00 38.13  ? 269 ASN B CA   1 
ATOM   4088 C C    . ASN B 2 269 ? 52.394 17.044  30.042 1.00 43.24  ? 269 ASN B C    1 
ATOM   4089 O O    . ASN B 2 269 ? 53.532 16.650  29.805 1.00 42.48  ? 269 ASN B O    1 
ATOM   4090 C CB   . ASN B 2 269 ? 53.216 19.354  30.655 1.00 39.78  ? 269 ASN B CB   1 
ATOM   4091 C CG   . ASN B 2 269 ? 53.146 19.939  29.252 1.00 54.89  ? 269 ASN B CG   1 
ATOM   4092 O OD1  . ASN B 2 269 ? 52.196 19.696  28.498 1.00 54.76  ? 269 ASN B OD1  1 
ATOM   4093 N ND2  . ASN B 2 269 ? 54.158 20.731  28.898 1.00 60.49  ? 269 ASN B ND2  1 
ATOM   4094 H H    . ASN B 2 269 ? 52.624 17.001  32.518 1.00 0.00   ? 269 ASN B H    1 
ATOM   4095 H HD21 . ASN B 2 269 ? 54.146 21.127  28.002 1.00 0.00   ? 269 ASN B HD21 1 
ATOM   4096 H HD22 . ASN B 2 269 ? 54.876 20.890  29.547 1.00 0.00   ? 269 ASN B HD22 1 
ATOM   4097 N N    . LYS B 2 270 ? 51.304 16.426  29.591 1.00 45.95  ? 270 LYS B N    1 
ATOM   4098 C CA   . LYS B 2 270 ? 51.366 15.226  28.769 1.00 49.84  ? 270 LYS B CA   1 
ATOM   4099 C C    . LYS B 2 270 ? 52.142 15.353  27.444 1.00 49.34  ? 270 LYS B C    1 
ATOM   4100 O O    . LYS B 2 270 ? 52.399 14.345  26.781 1.00 43.37  ? 270 LYS B O    1 
ATOM   4101 C CB   . LYS B 2 270 ? 49.947 14.715  28.497 1.00 57.12  ? 270 LYS B CB   1 
ATOM   4102 C CG   . LYS B 2 270 ? 49.070 15.612  27.580 1.00 78.99  ? 270 LYS B CG   1 
ATOM   4103 C CD   . LYS B 2 270 ? 49.407 15.577  26.051 1.00 78.98  ? 270 LYS B CD   1 
ATOM   4104 C CE   . LYS B 2 270 ? 49.164 14.213  25.363 1.00 82.41  ? 270 LYS B CE   1 
ATOM   4105 N NZ   . LYS B 2 270 ? 50.251 13.185  25.545 1.00 76.51  ? 270 LYS B NZ   1 
ATOM   4106 H H    . LYS B 2 270 ? 50.428 16.798  29.824 1.00 0.00   ? 270 LYS B H    1 
ATOM   4107 H HZ1  . LYS B 2 270 ? 50.372 12.987  26.559 1.00 0.00   ? 270 LYS B HZ1  1 
ATOM   4108 H HZ2  . LYS B 2 270 ? 49.986 12.313  25.045 1.00 0.00   ? 270 LYS B HZ2  1 
ATOM   4109 H HZ3  . LYS B 2 270 ? 51.145 13.548  25.156 1.00 0.00   ? 270 LYS B HZ3  1 
ATOM   4110 N N    . ARG B 2 271 ? 52.429 16.587  27.023 1.00 51.64  ? 271 ARG B N    1 
ATOM   4111 C CA   . ARG B 2 271 ? 53.163 16.849  25.779 1.00 49.04  ? 271 ARG B CA   1 
ATOM   4112 C C    . ARG B 2 271 ? 54.657 16.794  26.090 1.00 50.91  ? 271 ARG B C    1 
ATOM   4113 O O    . ARG B 2 271 ? 55.504 17.051  25.221 1.00 53.35  ? 271 ARG B O    1 
ATOM   4114 C CB   . ARG B 2 271 ? 52.822 18.233  25.205 1.00 61.28  ? 271 ARG B CB   1 
ATOM   4115 C CG   . ARG B 2 271 ? 51.429 18.746  25.520 1.00 69.49  ? 271 ARG B CG   1 
ATOM   4116 C CD   . ARG B 2 271 ? 51.090 19.977  24.692 1.00 77.42  ? 271 ARG B CD   1 
ATOM   4117 N NE   . ARG B 2 271 ? 50.802 19.636  23.297 1.00 82.41  ? 271 ARG B NE   1 
ATOM   4118 C CZ   . ARG B 2 271 ? 49.780 18.873  22.902 1.00 83.91  ? 271 ARG B CZ   1 
ATOM   4119 N NH1  . ARG B 2 271 ? 48.937 18.359  23.795 1.00 86.51  ? 271 ARG B NH1  1 
ATOM   4120 N NH2  . ARG B 2 271 ? 49.576 18.651  21.606 1.00 71.34  ? 271 ARG B NH2  1 
ATOM   4121 H H    . ARG B 2 271 ? 52.134 17.344  27.571 1.00 0.00   ? 271 ARG B H    1 
ATOM   4122 H HE   . ARG B 2 271 ? 51.397 19.987  22.602 1.00 0.00   ? 271 ARG B HE   1 
ATOM   4123 H HH11 . ARG B 2 271 ? 49.046 18.531  24.773 1.00 0.00   ? 271 ARG B HH11 1 
ATOM   4124 H HH12 . ARG B 2 271 ? 48.181 17.789  23.473 1.00 0.00   ? 271 ARG B HH12 1 
ATOM   4125 H HH21 . ARG B 2 271 ? 50.190 19.057  20.931 1.00 0.00   ? 271 ARG B HH21 1 
ATOM   4126 H HH22 . ARG B 2 271 ? 48.811 18.078  21.309 1.00 0.00   ? 271 ARG B HH22 1 
ATOM   4127 N N    . ARG B 2 272 ? 54.951 16.526  27.362 1.00 42.91  ? 272 ARG B N    1 
ATOM   4128 C CA   . ARG B 2 272 ? 56.301 16.394  27.863 1.00 32.47  ? 272 ARG B CA   1 
ATOM   4129 C C    . ARG B 2 272 ? 56.427 15.121  28.713 1.00 36.89  ? 272 ARG B C    1 
ATOM   4130 O O    . ARG B 2 272 ? 56.881 15.161  29.857 1.00 37.41  ? 272 ARG B O    1 
ATOM   4131 C CB   . ARG B 2 272 ? 56.699 17.619  28.672 1.00 42.46  ? 272 ARG B CB   1 
ATOM   4132 C CG   . ARG B 2 272 ? 57.231 18.802  27.848 1.00 59.59  ? 272 ARG B CG   1 
ATOM   4133 C CD   . ARG B 2 272 ? 57.834 19.824  28.818 1.00 82.45  ? 272 ARG B CD   1 
ATOM   4134 N NE   . ARG B 2 272 ? 58.395 21.031  28.205 1.00 91.34  ? 272 ARG B NE   1 
ATOM   4135 C CZ   . ARG B 2 272 ? 59.090 21.954  28.877 1.00 94.05  ? 272 ARG B CZ   1 
ATOM   4136 N NH1  . ARG B 2 272 ? 59.321 21.812  30.183 1.00 83.78  ? 272 ARG B NH1  1 
ATOM   4137 N NH2  . ARG B 2 272 ? 59.522 23.045  28.254 1.00 90.19  ? 272 ARG B NH2  1 
ATOM   4138 H H    . ARG B 2 272 ? 54.229 16.407  28.002 1.00 0.00   ? 272 ARG B H    1 
ATOM   4139 H HE   . ARG B 2 272 ? 58.263 21.164  27.243 1.00 0.00   ? 272 ARG B HE   1 
ATOM   4140 H HH11 . ARG B 2 272 ? 58.972 21.009  30.667 1.00 0.00   ? 272 ARG B HH11 1 
ATOM   4141 H HH12 . ARG B 2 272 ? 59.848 22.503  30.679 1.00 0.00   ? 272 ARG B HH12 1 
ATOM   4142 H HH21 . ARG B 2 272 ? 59.321 23.182  27.285 1.00 0.00   ? 272 ARG B HH21 1 
ATOM   4143 H HH22 . ARG B 2 272 ? 60.044 23.731  28.762 1.00 0.00   ? 272 ARG B HH22 1 
ATOM   4144 N N    . SER B 2 273 ? 55.976 14.002  28.145 1.00 30.03  ? 273 SER B N    1 
ATOM   4145 C CA   . SER B 2 273 ? 56.053 12.680  28.779 1.00 33.63  ? 273 SER B CA   1 
ATOM   4146 C C    . SER B 2 273 ? 57.299 11.993  28.191 1.00 28.39  ? 273 SER B C    1 
ATOM   4147 O O    . SER B 2 273 ? 57.798 12.425  27.158 1.00 25.92  ? 273 SER B O    1 
ATOM   4148 C CB   . SER B 2 273 ? 54.810 11.848  28.424 1.00 35.32  ? 273 SER B CB   1 
ATOM   4149 O OG   . SER B 2 273 ? 53.609 12.520  28.753 1.00 33.13  ? 273 SER B OG   1 
ATOM   4150 H H    . SER B 2 273 ? 55.555 14.083  27.265 1.00 0.00   ? 273 SER B H    1 
ATOM   4151 H HG   . SER B 2 273 ? 53.581 13.346  28.265 1.00 0.00   ? 273 SER B HG   1 
ATOM   4152 N N    . THR B 2 274 ? 57.751 10.887  28.784 1.00 31.79  ? 274 THR B N    1 
ATOM   4153 C CA   . THR B 2 274 ? 58.954 10.206  28.287 1.00 22.00  ? 274 THR B CA   1 
ATOM   4154 C C    . THR B 2 274 ? 58.783 8.785   27.714 1.00 18.38  ? 274 THR B C    1 
ATOM   4155 O O    . THR B 2 274 ? 58.170 7.922   28.308 1.00 16.23  ? 274 THR B O    1 
ATOM   4156 C CB   . THR B 2 274 ? 60.124 10.178  29.362 1.00 30.16  ? 274 THR B CB   1 
ATOM   4157 O OG1  . THR B 2 274 ? 59.901 9.129   30.300 1.00 30.31  ? 274 THR B OG1  1 
ATOM   4158 C CG2  . THR B 2 274 ? 60.246 11.503  30.125 1.00 8.53   ? 274 THR B CG2  1 
ATOM   4159 H H    . THR B 2 274 ? 57.289 10.544  29.576 1.00 0.00   ? 274 THR B H    1 
ATOM   4160 H HG1  . THR B 2 274 ? 59.018 9.225   30.667 1.00 0.00   ? 274 THR B HG1  1 
ATOM   4161 N N    . LEU B 2 275 ? 59.327 8.571   26.530 1.00 18.07  ? 275 LEU B N    1 
ATOM   4162 C CA   . LEU B 2 275 ? 59.304 7.272   25.884 1.00 22.60  ? 275 LEU B CA   1 
ATOM   4163 C C    . LEU B 2 275 ? 60.682 6.663   26.210 1.00 32.65  ? 275 LEU B C    1 
ATOM   4164 O O    . LEU B 2 275 ? 61.685 7.376   26.222 1.00 34.68  ? 275 LEU B O    1 
ATOM   4165 C CB   . LEU B 2 275 ? 59.157 7.468   24.378 1.00 21.19  ? 275 LEU B CB   1 
ATOM   4166 C CG   . LEU B 2 275 ? 58.017 8.447   24.099 1.00 27.39  ? 275 LEU B CG   1 
ATOM   4167 C CD1  . LEU B 2 275 ? 58.065 8.956   22.712 1.00 22.38  ? 275 LEU B CD1  1 
ATOM   4168 C CD2  . LEU B 2 275 ? 56.692 7.773   24.375 1.00 28.94  ? 275 LEU B CD2  1 
ATOM   4169 H H    . LEU B 2 275 ? 59.748 9.317   26.063 1.00 0.00   ? 275 LEU B H    1 
ATOM   4170 N N    . ILE B 2 276 ? 60.728 5.378   26.539 1.00 25.05  ? 276 ILE B N    1 
ATOM   4171 C CA   . ILE B 2 276 ? 61.984 4.735   26.852 1.00 17.33  ? 276 ILE B CA   1 
ATOM   4172 C C    . ILE B 2 276 ? 62.064 3.466   26.044 1.00 22.63  ? 276 ILE B C    1 
ATOM   4173 O O    . ILE B 2 276 ? 61.244 2.601   26.217 1.00 22.86  ? 276 ILE B O    1 
ATOM   4174 C CB   . ILE B 2 276 ? 62.098 4.358   28.338 1.00 22.00  ? 276 ILE B CB   1 
ATOM   4175 C CG1  . ILE B 2 276 ? 62.139 5.612   29.237 1.00 22.12  ? 276 ILE B CG1  1 
ATOM   4176 C CG2  . ILE B 2 276 ? 63.303 3.454   28.551 1.00 15.25  ? 276 ILE B CG2  1 
ATOM   4177 C CD1  . ILE B 2 276 ? 63.276 6.599   28.954 1.00 27.37  ? 276 ILE B CD1  1 
ATOM   4178 H H    . ILE B 2 276 ? 59.903 4.854   26.537 1.00 0.00   ? 276 ILE B H    1 
ATOM   4179 N N    . THR B 2 277 ? 63.056 3.368   25.163 1.00 29.05  ? 277 THR B N    1 
ATOM   4180 C CA   . THR B 2 277 ? 63.253 2.186   24.339 1.00 19.15  ? 277 THR B CA   1 
ATOM   4181 C C    . THR B 2 277 ? 64.624 1.588   24.623 1.00 29.17  ? 277 THR B C    1 
ATOM   4182 O O    . THR B 2 277 ? 65.656 2.175   24.294 1.00 38.54  ? 277 THR B O    1 
ATOM   4183 C CB   . THR B 2 277 ? 63.224 2.542   22.903 1.00 21.10  ? 277 THR B CB   1 
ATOM   4184 O OG1  . THR B 2 277 ? 62.163 3.466   22.684 1.00 38.68  ? 277 THR B OG1  1 
ATOM   4185 C CG2  . THR B 2 277 ? 63.005 1.304   22.072 1.00 10.54  ? 277 THR B CG2  1 
ATOM   4186 H H    . THR B 2 277 ? 63.680 4.117   25.073 1.00 0.00   ? 277 THR B H    1 
ATOM   4187 H HG1  . THR B 2 277 ? 61.316 3.029   22.810 1.00 0.00   ? 277 THR B HG1  1 
ATOM   4188 N N    . VAL B 2 278 ? 64.633 0.389   25.181 1.00 32.58  ? 278 VAL B N    1 
ATOM   4189 C CA   . VAL B 2 278 ? 65.874 -0.279  25.522 1.00 21.24  ? 278 VAL B CA   1 
ATOM   4190 C C    . VAL B 2 278 ? 66.325 -1.288  24.469 1.00 29.13  ? 278 VAL B C    1 
ATOM   4191 O O    . VAL B 2 278 ? 65.571 -2.188  24.083 1.00 26.81  ? 278 VAL B O    1 
ATOM   4192 C CB   . VAL B 2 278 ? 65.755 -0.980  26.892 1.00 13.56  ? 278 VAL B CB   1 
ATOM   4193 C CG1  . VAL B 2 278 ? 67.074 -1.614  27.298 1.00 2.00   ? 278 VAL B CG1  1 
ATOM   4194 C CG2  . VAL B 2 278 ? 65.283 0.009   27.951 1.00 4.20   ? 278 VAL B CG2  1 
ATOM   4195 H H    . VAL B 2 278 ? 63.787 -0.057  25.356 1.00 0.00   ? 278 VAL B H    1 
ATOM   4196 N N    . LEU B 2 279 ? 67.560 -1.108  24.011 1.00 26.02  ? 279 LEU B N    1 
ATOM   4197 C CA   . LEU B 2 279 ? 68.205 -1.996  23.037 1.00 26.04  ? 279 LEU B CA   1 
ATOM   4198 C C    . LEU B 2 279 ? 69.178 -2.884  23.829 1.00 23.43  ? 279 LEU B C    1 
ATOM   4199 O O    . LEU B 2 279 ? 70.081 -2.383  24.501 1.00 21.26  ? 279 LEU B O    1 
ATOM   4200 C CB   . LEU B 2 279 ? 69.018 -1.164  22.046 1.00 34.07  ? 279 LEU B CB   1 
ATOM   4201 C CG   . LEU B 2 279 ? 69.319 -1.608  20.618 1.00 31.53  ? 279 LEU B CG   1 
ATOM   4202 C CD1  . LEU B 2 279 ? 70.808 -1.423  20.383 1.00 21.97  ? 279 LEU B CD1  1 
ATOM   4203 C CD2  . LEU B 2 279 ? 68.829 -3.027  20.314 1.00 8.54   ? 279 LEU B CD2  1 
ATOM   4204 H H    . LEU B 2 279 ? 68.045 -0.346  24.357 1.00 0.00   ? 279 LEU B H    1 
ATOM   4205 N N    . ASN B 2 280 ? 68.976 -4.196  23.778 1.00 24.50  ? 280 ASN B N    1 
ATOM   4206 C CA   . ASN B 2 280 ? 69.844 -5.116  24.485 1.00 23.34  ? 280 ASN B CA   1 
ATOM   4207 C C    . ASN B 2 280 ? 70.677 -5.872  23.474 1.00 27.33  ? 280 ASN B C    1 
ATOM   4208 O O    . ASN B 2 280 ? 70.119 -6.489  22.569 1.00 17.52  ? 280 ASN B O    1 
ATOM   4209 C CB   . ASN B 2 280 ? 69.028 -6.109  25.314 1.00 38.76  ? 280 ASN B CB   1 
ATOM   4210 C CG   . ASN B 2 280 ? 68.144 -5.421  26.367 1.00 56.42  ? 280 ASN B CG   1 
ATOM   4211 O OD1  . ASN B 2 280 ? 68.590 -5.163  27.498 1.00 46.72  ? 280 ASN B OD1  1 
ATOM   4212 N ND2  . ASN B 2 280 ? 66.881 -5.141  26.004 1.00 53.27  ? 280 ASN B ND2  1 
ATOM   4213 H H    . ASN B 2 280 ? 68.238 -4.556  23.252 1.00 0.00   ? 280 ASN B H    1 
ATOM   4214 H HD21 . ASN B 2 280 ? 66.296 -4.696  26.655 1.00 0.00   ? 280 ASN B HD21 1 
ATOM   4215 H HD22 . ASN B 2 280 ? 66.597 -5.392  25.101 1.00 0.00   ? 280 ASN B HD22 1 
ATOM   4216 N N    . ILE B 2 281 ? 72.006 -5.708  23.566 1.00 28.12  ? 281 ILE B N    1 
ATOM   4217 C CA   . ILE B 2 281 ? 72.962 -6.398  22.690 1.00 18.55  ? 281 ILE B CA   1 
ATOM   4218 C C    . ILE B 2 281 ? 73.568 -7.460  23.595 1.00 21.43  ? 281 ILE B C    1 
ATOM   4219 O O    . ILE B 2 281 ? 74.207 -7.156  24.605 1.00 23.95  ? 281 ILE B O    1 
ATOM   4220 C CB   . ILE B 2 281 ? 74.023 -5.441  22.141 1.00 14.96  ? 281 ILE B CB   1 
ATOM   4221 C CG1  . ILE B 2 281 ? 73.339 -4.136  21.706 1.00 22.98  ? 281 ILE B CG1  1 
ATOM   4222 C CG2  . ILE B 2 281 ? 74.650 -6.029  20.908 1.00 13.71  ? 281 ILE B CG2  1 
ATOM   4223 C CD1  . ILE B 2 281 ? 74.246 -3.100  21.088 1.00 28.07  ? 281 ILE B CD1  1 
ATOM   4224 H H    . ILE B 2 281 ? 72.349 -5.068  24.220 1.00 0.00   ? 281 ILE B H    1 
ATOM   4225 N N    . SER B 2 282 ? 73.226 -8.710  23.304 1.00 21.20  ? 282 SER B N    1 
ATOM   4226 C CA   . SER B 2 282 ? 73.670 -9.843  24.102 1.00 25.68  ? 282 SER B CA   1 
ATOM   4227 C C    . SER B 2 282 ? 75.152 -10.159 23.947 1.00 38.19  ? 282 SER B C    1 
ATOM   4228 O O    . SER B 2 282 ? 75.809 -10.586 24.912 1.00 39.18  ? 282 SER B O    1 
ATOM   4229 C CB   . SER B 2 282 ? 72.846 -11.067 23.737 1.00 13.64  ? 282 SER B CB   1 
ATOM   4230 O OG   . SER B 2 282 ? 72.830 -11.275 22.333 1.00 20.12  ? 282 SER B OG   1 
ATOM   4231 H H    . SER B 2 282 ? 72.653 -8.878  22.526 1.00 0.00   ? 282 SER B H    1 
ATOM   4232 H HG   . SER B 2 282 ? 73.709 -11.517 22.027 1.00 0.00   ? 282 SER B HG   1 
ATOM   4233 N N    . GLU B 2 283 ? 75.642 -9.983  22.717 1.00 37.74  ? 283 GLU B N    1 
ATOM   4234 C CA   . GLU B 2 283 ? 77.030 -10.224 22.351 1.00 43.40  ? 283 GLU B CA   1 
ATOM   4235 C C    . GLU B 2 283 ? 77.422 -9.170  21.305 1.00 43.81  ? 283 GLU B C    1 
ATOM   4236 O O    . GLU B 2 283 ? 76.852 -9.128  20.207 1.00 40.32  ? 283 GLU B O    1 
ATOM   4237 C CB   . GLU B 2 283 ? 77.180 -11.635 21.757 1.00 43.27  ? 283 GLU B CB   1 
ATOM   4238 C CG   . GLU B 2 283 ? 78.604 -12.012 21.370 1.00 49.64  ? 283 GLU B CG   1 
ATOM   4239 C CD   . GLU B 2 283 ? 78.678 -13.126 20.330 1.00 59.37  ? 283 GLU B CD   1 
ATOM   4240 O OE1  . GLU B 2 283 ? 77.627 -13.558 19.807 1.00 65.33  ? 283 GLU B OE1  1 
ATOM   4241 O OE2  . GLU B 2 283 ? 79.803 -13.561 20.016 1.00 59.53  ? 283 GLU B OE2  1 
ATOM   4242 H H    . GLU B 2 283 ? 75.024 -9.680  22.020 1.00 0.00   ? 283 GLU B H    1 
ATOM   4243 N N    . ILE B 2 284 ? 78.361 -8.297  21.665 1.00 35.31  ? 284 ILE B N    1 
ATOM   4244 C CA   . ILE B 2 284 ? 78.826 -7.265  20.748 1.00 27.76  ? 284 ILE B CA   1 
ATOM   4245 C C    . ILE B 2 284 ? 79.706 -7.931  19.718 1.00 29.91  ? 284 ILE B C    1 
ATOM   4246 O O    . ILE B 2 284 ? 80.618 -8.664  20.057 1.00 33.92  ? 284 ILE B O    1 
ATOM   4247 C CB   . ILE B 2 284 ? 79.569 -6.172  21.487 1.00 22.34  ? 284 ILE B CB   1 
ATOM   4248 C CG1  . ILE B 2 284 ? 78.591 -5.539  22.465 1.00 11.28  ? 284 ILE B CG1  1 
ATOM   4249 C CG2  . ILE B 2 284 ? 80.117 -5.123  20.514 1.00 15.28  ? 284 ILE B CG2  1 
ATOM   4250 C CD1  . ILE B 2 284 ? 79.251 -4.781  23.580 1.00 37.40  ? 284 ILE B CD1  1 
ATOM   4251 H H    . ILE B 2 284 ? 78.764 -8.366  22.551 1.00 0.00   ? 284 ILE B H    1 
ATOM   4252 N N    . GLU B 2 285 ? 79.354 -7.740  18.454 1.00 30.86  ? 285 GLU B N    1 
ATOM   4253 C CA   . GLU B 2 285 ? 80.064 -8.342  17.348 1.00 19.55  ? 285 GLU B CA   1 
ATOM   4254 C C    . GLU B 2 285 ? 80.913 -7.335  16.593 1.00 27.61  ? 285 GLU B C    1 
ATOM   4255 O O    . GLU B 2 285 ? 80.748 -6.127  16.770 1.00 33.48  ? 285 GLU B O    1 
ATOM   4256 C CB   . GLU B 2 285 ? 79.061 -9.055  16.437 1.00 19.36  ? 285 GLU B CB   1 
ATOM   4257 C CG   . GLU B 2 285 ? 78.328 -10.193 17.168 1.00 21.64  ? 285 GLU B CG   1 
ATOM   4258 C CD   . GLU B 2 285 ? 77.330 -10.965 16.298 1.00 29.00  ? 285 GLU B CD   1 
ATOM   4259 O OE1  . GLU B 2 285 ? 76.858 -10.419 15.284 1.00 28.99  ? 285 GLU B OE1  1 
ATOM   4260 O OE2  . GLU B 2 285 ? 77.011 -12.124 16.646 1.00 30.37  ? 285 GLU B OE2  1 
ATOM   4261 H H    . GLU B 2 285 ? 78.577 -7.179  18.269 1.00 0.00   ? 285 GLU B H    1 
ATOM   4262 N N    . SER B 2 286 ? 81.847 -7.847  15.786 1.00 36.43  ? 286 SER B N    1 
ATOM   4263 C CA   . SER B 2 286 ? 82.788 -7.033  15.001 1.00 35.35  ? 286 SER B CA   1 
ATOM   4264 C C    . SER B 2 286 ? 82.100 -5.936  14.230 1.00 30.86  ? 286 SER B C    1 
ATOM   4265 O O    . SER B 2 286 ? 82.576 -4.806  14.177 1.00 37.62  ? 286 SER B O    1 
ATOM   4266 C CB   . SER B 2 286 ? 83.544 -7.900  13.981 1.00 37.13  ? 286 SER B CB   1 
ATOM   4267 O OG   . SER B 2 286 ? 84.288 -8.940  14.586 1.00 51.39  ? 286 SER B OG   1 
ATOM   4268 H H    . SER B 2 286 ? 81.904 -8.822  15.704 1.00 0.00   ? 286 SER B H    1 
ATOM   4269 H HG   . SER B 2 286 ? 83.700 -9.502  15.098 1.00 0.00   ? 286 SER B HG   1 
ATOM   4270 N N    . ARG B 2 287 ? 80.987 -6.307  13.615 1.00 34.12  ? 287 ARG B N    1 
ATOM   4271 C CA   . ARG B 2 287 ? 80.199 -5.414  12.799 1.00 31.77  ? 287 ARG B CA   1 
ATOM   4272 C C    . ARG B 2 287 ? 79.636 -4.168  13.494 1.00 41.46  ? 287 ARG B C    1 
ATOM   4273 O O    . ARG B 2 287 ? 79.592 -3.107  12.868 1.00 50.65  ? 287 ARG B O    1 
ATOM   4274 C CB   . ARG B 2 287 ? 79.090 -6.204  12.105 1.00 35.09  ? 287 ARG B CB   1 
ATOM   4275 C CG   . ARG B 2 287 ? 78.216 -7.033  13.038 1.00 37.58  ? 287 ARG B CG   1 
ATOM   4276 C CD   . ARG B 2 287 ? 77.142 -7.777  12.242 1.00 46.11  ? 287 ARG B CD   1 
ATOM   4277 N NE   . ARG B 2 287 ? 76.225 -8.533  13.097 1.00 56.62  ? 287 ARG B NE   1 
ATOM   4278 C CZ   . ARG B 2 287 ? 74.894 -8.510  12.996 1.00 64.31  ? 287 ARG B CZ   1 
ATOM   4279 N NH1  . ARG B 2 287 ? 74.301 -7.764  12.068 1.00 57.40  ? 287 ARG B NH1  1 
ATOM   4280 N NH2  . ARG B 2 287 ? 74.145 -9.218  13.841 1.00 57.89  ? 287 ARG B NH2  1 
ATOM   4281 H H    . ARG B 2 287 ? 80.686 -7.231  13.735 1.00 0.00   ? 287 ARG B H    1 
ATOM   4282 H HE   . ARG B 2 287 ? 76.622 -9.082  13.795 1.00 0.00   ? 287 ARG B HE   1 
ATOM   4283 H HH11 . ARG B 2 287 ? 74.837 -7.203  11.438 1.00 0.00   ? 287 ARG B HH11 1 
ATOM   4284 H HH12 . ARG B 2 287 ? 73.301 -7.761  12.010 1.00 0.00   ? 287 ARG B HH12 1 
ATOM   4285 H HH21 . ARG B 2 287 ? 74.584 -9.766  14.552 1.00 0.00   ? 287 ARG B HH21 1 
ATOM   4286 H HH22 . ARG B 2 287 ? 73.147 -9.205  13.763 1.00 0.00   ? 287 ARG B HH22 1 
ATOM   4287 N N    . PHE B 2 288 ? 79.265 -4.260  14.781 1.00 34.53  ? 288 PHE B N    1 
ATOM   4288 C CA   . PHE B 2 288 ? 78.692 -3.102  15.518 1.00 26.65  ? 288 PHE B CA   1 
ATOM   4289 C C    . PHE B 2 288 ? 79.617 -1.887  15.699 1.00 26.97  ? 288 PHE B C    1 
ATOM   4290 O O    . PHE B 2 288 ? 79.173 -0.814  16.120 1.00 47.41  ? 288 PHE B O    1 
ATOM   4291 C CB   . PHE B 2 288 ? 78.123 -3.530  16.885 1.00 21.54  ? 288 PHE B CB   1 
ATOM   4292 C CG   . PHE B 2 288 ? 77.070 -4.611  16.801 1.00 20.78  ? 288 PHE B CG   1 
ATOM   4293 C CD1  . PHE B 2 288 ? 76.249 -4.727  15.677 1.00 18.95  ? 288 PHE B CD1  1 
ATOM   4294 C CD2  . PHE B 2 288 ? 76.959 -5.570  17.802 1.00 9.05   ? 288 PHE B CD2  1 
ATOM   4295 C CE1  . PHE B 2 288 ? 75.352 -5.782  15.555 1.00 12.43  ? 288 PHE B CE1  1 
ATOM   4296 C CE2  . PHE B 2 288 ? 76.062 -6.632  17.674 1.00 14.31  ? 288 PHE B CE2  1 
ATOM   4297 C CZ   . PHE B 2 288 ? 75.263 -6.734  16.547 1.00 11.34  ? 288 PHE B CZ   1 
ATOM   4298 H H    . PHE B 2 288 ? 79.387 -5.116  15.247 1.00 0.00   ? 288 PHE B H    1 
ATOM   4299 N N    . TYR B 2 289 ? 80.895 -2.060  15.383 1.00 33.50  ? 289 TYR B N    1 
ATOM   4300 C CA   . TYR B 2 289 ? 81.882 -0.989  15.480 1.00 29.91  ? 289 TYR B CA   1 
ATOM   4301 C C    . TYR B 2 289 ? 81.987 -0.196  14.182 1.00 32.57  ? 289 TYR B C    1 
ATOM   4302 O O    . TYR B 2 289 ? 82.598 0.878   14.166 1.00 41.83  ? 289 TYR B O    1 
ATOM   4303 C CB   . TYR B 2 289 ? 83.256 -1.561  15.822 1.00 24.29  ? 289 TYR B CB   1 
ATOM   4304 C CG   . TYR B 2 289 ? 83.330 -2.232  17.180 1.00 12.84  ? 289 TYR B CG   1 
ATOM   4305 C CD1  . TYR B 2 289 ? 83.064 -3.593  17.332 1.00 13.80  ? 289 TYR B CD1  1 
ATOM   4306 C CD2  . TYR B 2 289 ? 83.696 -1.510  18.297 1.00 15.96  ? 289 TYR B CD2  1 
ATOM   4307 C CE1  . TYR B 2 289 ? 83.163 -4.209  18.566 1.00 2.48   ? 289 TYR B CE1  1 
ATOM   4308 C CE2  . TYR B 2 289 ? 83.805 -2.116  19.529 1.00 15.78  ? 289 TYR B CE2  1 
ATOM   4309 C CZ   . TYR B 2 289 ? 83.541 -3.461  19.658 1.00 14.38  ? 289 TYR B CZ   1 
ATOM   4310 O OH   . TYR B 2 289 ? 83.691 -4.042  20.891 1.00 24.32  ? 289 TYR B OH   1 
ATOM   4311 H H    . TYR B 2 289 ? 81.199 -2.941  15.081 1.00 0.00   ? 289 TYR B H    1 
ATOM   4312 H HH   . TYR B 2 289 ? 83.951 -3.370  21.522 1.00 0.00   ? 289 TYR B HH   1 
ATOM   4313 N N    . LYS B 2 290 ? 81.414 -0.737  13.101 1.00 41.31  ? 290 LYS B N    1 
ATOM   4314 C CA   . LYS B 2 290 ? 81.431 -0.102  11.768 1.00 53.43  ? 290 LYS B CA   1 
ATOM   4315 C C    . LYS B 2 290 ? 80.351 0.970   11.559 1.00 57.47  ? 290 LYS B C    1 
ATOM   4316 O O    . LYS B 2 290 ? 80.612 2.043   10.978 1.00 53.01  ? 290 LYS B O    1 
ATOM   4317 C CB   . LYS B 2 290 ? 81.283 -1.161  10.670 1.00 57.98  ? 290 LYS B CB   1 
ATOM   4318 C CG   . LYS B 2 290 ? 82.415 -2.174  10.592 1.00 69.08  ? 290 LYS B CG   1 
ATOM   4319 C CD   . LYS B 2 290 ? 82.167 -3.188  9.480  1.00 80.60  ? 290 LYS B CD   1 
ATOM   4320 C CE   . LYS B 2 290 ? 81.903 -2.492  8.138  1.00 87.01  ? 290 LYS B CE   1 
ATOM   4321 N NZ   . LYS B 2 290 ? 81.889 -3.442  6.978  1.00 92.47  ? 290 LYS B NZ   1 
ATOM   4322 H H    . LYS B 2 290 ? 80.983 -1.609  13.205 1.00 0.00   ? 290 LYS B H    1 
ATOM   4323 H HZ1  . LYS B 2 290 ? 82.804 -3.933  6.924  1.00 0.00   ? 290 LYS B HZ1  1 
ATOM   4324 H HZ2  . LYS B 2 290 ? 81.126 -4.141  7.103  1.00 0.00   ? 290 LYS B HZ2  1 
ATOM   4325 H HZ3  . LYS B 2 290 ? 81.729 -2.914  6.096  1.00 0.00   ? 290 LYS B HZ3  1 
ATOM   4326 N N    . HIS B 2 291 ? 79.137 0.653   12.012 1.00 55.30  ? 291 HIS B N    1 
ATOM   4327 C CA   . HIS B 2 291 ? 78.001 1.557   11.891 1.00 49.92  ? 291 HIS B CA   1 
ATOM   4328 C C    . HIS B 2 291 ? 77.311 1.860   13.218 1.00 44.15  ? 291 HIS B C    1 
ATOM   4329 O O    . HIS B 2 291 ? 77.206 1.004   14.109 1.00 51.39  ? 291 HIS B O    1 
ATOM   4330 C CB   . HIS B 2 291 ? 77.023 1.022   10.860 1.00 54.23  ? 291 HIS B CB   1 
ATOM   4331 C CG   . HIS B 2 291 ? 77.594 0.964   9.480  1.00 56.31  ? 291 HIS B CG   1 
ATOM   4332 N ND1  . HIS B 2 291 ? 77.963 -0.220  8.875  1.00 49.54  ? 291 HIS B ND1  1 
ATOM   4333 C CD2  . HIS B 2 291 ? 77.879 1.948   8.593  1.00 53.98  ? 291 HIS B CD2  1 
ATOM   4334 C CE1  . HIS B 2 291 ? 78.450 0.037   7.674  1.00 51.91  ? 291 HIS B CE1  1 
ATOM   4335 N NE2  . HIS B 2 291 ? 78.409 1.344   7.479  1.00 58.00  ? 291 HIS B NE2  1 
ATOM   4336 H H    . HIS B 2 291 ? 79.004 -0.206  12.464 1.00 0.00   ? 291 HIS B H    1 
ATOM   4337 H HD1  . HIS B 2 291 ? 77.894 -1.114  9.267  1.00 0.00   ? 291 HIS B HD1  1 
ATOM   4338 H HE2  . HIS B 2 291 ? 78.705 1.804   6.667  1.00 0.00   ? 291 HIS B HE2  1 
ATOM   4339 N N    . PRO B 2 292 ? 76.823 3.096   13.364 1.00 32.46  ? 292 PRO B N    1 
ATOM   4340 C CA   . PRO B 2 292 ? 76.165 3.454   14.613 1.00 34.36  ? 292 PRO B CA   1 
ATOM   4341 C C    . PRO B 2 292 ? 74.718 2.994   14.750 1.00 31.51  ? 292 PRO B C    1 
ATOM   4342 O O    . PRO B 2 292 ? 74.030 2.698   13.764 1.00 30.17  ? 292 PRO B O    1 
ATOM   4343 C CB   . PRO B 2 292 ? 76.291 4.976   14.628 1.00 26.16  ? 292 PRO B CB   1 
ATOM   4344 C CG   . PRO B 2 292 ? 76.076 5.322   13.179 1.00 20.81  ? 292 PRO B CG   1 
ATOM   4345 C CD   . PRO B 2 292 ? 76.841 4.237   12.424 1.00 30.64  ? 292 PRO B CD   1 
ATOM   4346 N N    . PHE B 2 293 ? 74.308 2.882   16.010 1.00 30.81  ? 293 PHE B N    1 
ATOM   4347 C CA   . PHE B 2 293 ? 72.964 2.505   16.372 1.00 28.68  ? 293 PHE B CA   1 
ATOM   4348 C C    . PHE B 2 293 ? 72.215 3.813   16.458 1.00 21.28  ? 293 PHE B C    1 
ATOM   4349 O O    . PHE B 2 293 ? 72.524 4.627   17.311 1.00 25.23  ? 293 PHE B O    1 
ATOM   4350 C CB   . PHE B 2 293 ? 72.984 1.814   17.725 1.00 18.81  ? 293 PHE B CB   1 
ATOM   4351 C CG   . PHE B 2 293 ? 73.433 0.390   17.660 1.00 28.25  ? 293 PHE B CG   1 
ATOM   4352 C CD1  . PHE B 2 293 ? 72.546 -0.607  17.254 1.00 16.68  ? 293 PHE B CD1  1 
ATOM   4353 C CD2  . PHE B 2 293 ? 74.738 0.033   18.008 1.00 24.01  ? 293 PHE B CD2  1 
ATOM   4354 C CE1  . PHE B 2 293 ? 72.950 -1.951  17.196 1.00 26.87  ? 293 PHE B CE1  1 
ATOM   4355 C CE2  . PHE B 2 293 ? 75.151 -1.306  17.955 1.00 22.55  ? 293 PHE B CE2  1 
ATOM   4356 C CZ   . PHE B 2 293 ? 74.254 -2.304  17.548 1.00 16.10  ? 293 PHE B CZ   1 
ATOM   4357 H H    . PHE B 2 293 ? 74.948 3.040   16.731 1.00 0.00   ? 293 PHE B H    1 
ATOM   4358 N N    . THR B 2 294 ? 71.305 4.060   15.518 1.00 25.09  ? 294 THR B N    1 
ATOM   4359 C CA   . THR B 2 294 ? 70.539 5.302   15.528 1.00 32.16  ? 294 THR B CA   1 
ATOM   4360 C C    . THR B 2 294 ? 69.164 5.120   16.186 1.00 30.70  ? 294 THR B C    1 
ATOM   4361 O O    . THR B 2 294 ? 68.581 4.042   16.146 1.00 25.48  ? 294 THR B O    1 
ATOM   4362 C CB   . THR B 2 294 ? 70.372 5.901   14.114 1.00 33.27  ? 294 THR B CB   1 
ATOM   4363 O OG1  . THR B 2 294 ? 71.435 5.449   13.256 1.00 25.75  ? 294 THR B OG1  1 
ATOM   4364 C CG2  . THR B 2 294 ? 70.410 7.424   14.191 1.00 42.33  ? 294 THR B CG2  1 
ATOM   4365 H H    . THR B 2 294 ? 71.134 3.388   14.823 1.00 0.00   ? 294 THR B H    1 
ATOM   4366 H HG1  . THR B 2 294 ? 71.357 5.888   12.409 1.00 0.00   ? 294 THR B HG1  1 
ATOM   4367 N N    . CYS B 2 295 ? 68.699 6.165   16.862 1.00 30.33  ? 295 CYS B N    1 
ATOM   4368 C CA   . CYS B 2 295 ? 67.407 6.150   17.538 1.00 25.81  ? 295 CYS B CA   1 
ATOM   4369 C C    . CYS B 2 295 ? 66.475 7.184   16.916 1.00 34.18  ? 295 CYS B C    1 
ATOM   4370 O O    . CYS B 2 295 ? 66.829 8.362   16.819 1.00 31.05  ? 295 CYS B O    1 
ATOM   4371 C CB   . CYS B 2 295 ? 67.536 6.468   19.023 1.00 30.85  ? 295 CYS B CB   1 
ATOM   4372 S SG   . CYS B 2 295 ? 65.872 6.441   19.735 1.00 23.89  ? 295 CYS B SG   1 
ATOM   4373 H H    . CYS B 2 295 ? 69.225 6.978   16.864 1.00 0.00   ? 295 CYS B H    1 
ATOM   4374 N N    . PHE B 2 296 ? 65.249 6.763   16.601 1.00 32.96  ? 296 PHE B N    1 
ATOM   4375 C CA   . PHE B 2 296 ? 64.279 7.640   15.953 1.00 28.76  ? 296 PHE B CA   1 
ATOM   4376 C C    . PHE B 2 296 ? 63.053 8.024   16.746 1.00 31.47  ? 296 PHE B C    1 
ATOM   4377 O O    . PHE B 2 296 ? 62.382 7.175   17.317 1.00 36.53  ? 296 PHE B O    1 
ATOM   4378 C CB   . PHE B 2 296 ? 63.839 7.021   14.636 1.00 27.82  ? 296 PHE B CB   1 
ATOM   4379 C CG   . PHE B 2 296 ? 64.974 6.801   13.671 1.00 33.10  ? 296 PHE B CG   1 
ATOM   4380 C CD1  . PHE B 2 296 ? 65.411 7.831   12.842 1.00 30.74  ? 296 PHE B CD1  1 
ATOM   4381 C CD2  . PHE B 2 296 ? 65.605 5.566   13.587 1.00 32.34  ? 296 PHE B CD2  1 
ATOM   4382 C CE1  . PHE B 2 296 ? 66.452 7.632   11.947 1.00 26.99  ? 296 PHE B CE1  1 
ATOM   4383 C CE2  . PHE B 2 296 ? 66.649 5.363   12.690 1.00 24.72  ? 296 PHE B CE2  1 
ATOM   4384 C CZ   . PHE B 2 296 ? 67.065 6.393   11.875 1.00 22.21  ? 296 PHE B CZ   1 
ATOM   4385 H H    . PHE B 2 296 ? 64.982 5.862   16.838 1.00 0.00   ? 296 PHE B H    1 
ATOM   4386 N N    . ALA B 2 297 ? 62.797 9.327   16.817 1.00 36.03  ? 297 ALA B N    1 
ATOM   4387 C CA   . ALA B 2 297 ? 61.623 9.852   17.502 1.00 30.45  ? 297 ALA B CA   1 
ATOM   4388 C C    . ALA B 2 297 ? 60.684 10.275  16.360 1.00 38.79  ? 297 ALA B C    1 
ATOM   4389 O O    . ALA B 2 297 ? 61.005 11.177  15.578 1.00 38.41  ? 297 ALA B O    1 
ATOM   4390 C CB   . ALA B 2 297 ? 62.003 11.025  18.372 1.00 24.89  ? 297 ALA B CB   1 
ATOM   4391 H H    . ALA B 2 297 ? 63.430 9.959   16.426 1.00 0.00   ? 297 ALA B H    1 
ATOM   4392 N N    . LYS B 2 298 ? 59.555 9.581   16.229 1.00 31.42  ? 298 LYS B N    1 
ATOM   4393 C CA   . LYS B 2 298 ? 58.641 9.867   15.139 1.00 27.47  ? 298 LYS B CA   1 
ATOM   4394 C C    . LYS B 2 298 ? 57.190 10.056  15.504 1.00 28.99  ? 298 LYS B C    1 
ATOM   4395 O O    . LYS B 2 298 ? 56.703 9.512   16.488 1.00 26.15  ? 298 LYS B O    1 
ATOM   4396 C CB   . LYS B 2 298 ? 58.745 8.764   14.064 1.00 21.62  ? 298 LYS B CB   1 
ATOM   4397 C CG   . LYS B 2 298 ? 57.712 8.873   12.922 1.00 19.99  ? 298 LYS B CG   1 
ATOM   4398 C CD   . LYS B 2 298 ? 57.951 7.901   11.744 1.00 25.94  ? 298 LYS B CD   1 
ATOM   4399 C CE   . LYS B 2 298 ? 57.943 6.422   12.183 1.00 43.87  ? 298 LYS B CE   1 
ATOM   4400 N NZ   . LYS B 2 298 ? 58.087 5.431   11.059 1.00 30.56  ? 298 LYS B NZ   1 
ATOM   4401 H H    . LYS B 2 298 ? 59.344 8.868   16.867 1.00 0.00   ? 298 LYS B H    1 
ATOM   4402 H HZ1  . LYS B 2 298 ? 57.299 5.546   10.388 1.00 0.00   ? 298 LYS B HZ1  1 
ATOM   4403 H HZ2  . LYS B 2 298 ? 58.993 5.576   10.578 1.00 0.00   ? 298 LYS B HZ2  1 
ATOM   4404 H HZ3  . LYS B 2 298 ? 58.066 4.474   11.462 1.00 0.00   ? 298 LYS B HZ3  1 
ATOM   4405 N N    . ASN B 2 299 ? 56.537 10.872  14.683 1.00 33.30  ? 299 ASN B N    1 
ATOM   4406 C CA   . ASN B 2 299 ? 55.109 11.153  14.741 1.00 45.73  ? 299 ASN B CA   1 
ATOM   4407 C C    . ASN B 2 299 ? 54.703 11.642  13.335 1.00 49.65  ? 299 ASN B C    1 
ATOM   4408 O O    . ASN B 2 299 ? 55.559 11.739  12.455 1.00 50.03  ? 299 ASN B O    1 
ATOM   4409 C CB   . ASN B 2 299 ? 54.752 12.145  15.852 1.00 35.63  ? 299 ASN B CB   1 
ATOM   4410 C CG   . ASN B 2 299 ? 55.270 13.519  15.602 1.00 36.34  ? 299 ASN B CG   1 
ATOM   4411 O OD1  . ASN B 2 299 ? 55.727 13.844  14.502 1.00 40.50  ? 299 ASN B OD1  1 
ATOM   4412 N ND2  . ASN B 2 299 ? 55.185 14.363  16.625 1.00 25.89  ? 299 ASN B ND2  1 
ATOM   4413 H H    . ASN B 2 299 ? 57.059 11.315  13.981 1.00 0.00   ? 299 ASN B H    1 
ATOM   4414 H HD21 . ASN B 2 299 ? 55.505 15.283  16.502 1.00 0.00   ? 299 ASN B HD21 1 
ATOM   4415 H HD22 . ASN B 2 299 ? 54.804 14.044  17.467 1.00 0.00   ? 299 ASN B HD22 1 
ATOM   4416 N N    . THR B 2 300 ? 53.429 11.966  13.117 1.00 59.80  ? 300 THR B N    1 
ATOM   4417 C CA   . THR B 2 300 ? 52.973 12.397  11.782 1.00 57.21  ? 300 THR B CA   1 
ATOM   4418 C C    . THR B 2 300 ? 53.622 13.671  11.233 1.00 51.99  ? 300 THR B C    1 
ATOM   4419 O O    . THR B 2 300 ? 53.687 13.858  10.019 1.00 44.61  ? 300 THR B O    1 
ATOM   4420 C CB   . THR B 2 300 ? 51.419 12.535  11.707 1.00 51.46  ? 300 THR B CB   1 
ATOM   4421 O OG1  . THR B 2 300 ? 50.983 13.636  12.510 1.00 51.05  ? 300 THR B OG1  1 
ATOM   4422 C CG2  . THR B 2 300 ? 50.752 11.275  12.226 1.00 47.97  ? 300 THR B CG2  1 
ATOM   4423 H H    . THR B 2 300 ? 52.790 11.931  13.859 1.00 0.00   ? 300 THR B H    1 
ATOM   4424 H HG1  . THR B 2 300 ? 51.427 14.445  12.244 1.00 0.00   ? 300 THR B HG1  1 
ATOM   4425 N N    . HIS B 2 301 ? 54.171 14.490  12.130 1.00 58.69  ? 301 HIS B N    1 
ATOM   4426 C CA   . HIS B 2 301 ? 54.798 15.760  11.764 1.00 63.88  ? 301 HIS B CA   1 
ATOM   4427 C C    . HIS B 2 301 ? 56.322 15.719  11.642 1.00 68.40  ? 301 HIS B C    1 
ATOM   4428 O O    . HIS B 2 301 ? 56.984 16.746  11.822 1.00 70.69  ? 301 HIS B O    1 
ATOM   4429 C CB   . HIS B 2 301 ? 54.409 16.837  12.781 1.00 66.24  ? 301 HIS B CB   1 
ATOM   4430 C CG   . HIS B 2 301 ? 52.968 16.792  13.180 1.00 76.98  ? 301 HIS B CG   1 
ATOM   4431 N ND1  . HIS B 2 301 ? 52.556 16.409  14.439 1.00 80.67  ? 301 HIS B ND1  1 
ATOM   4432 C CD2  . HIS B 2 301 ? 51.839 17.045  12.477 1.00 76.56  ? 301 HIS B CD2  1 
ATOM   4433 C CE1  . HIS B 2 301 ? 51.237 16.423  14.494 1.00 75.29  ? 301 HIS B CE1  1 
ATOM   4434 N NE2  . HIS B 2 301 ? 50.778 16.806  13.317 1.00 73.46  ? 301 HIS B NE2  1 
ATOM   4435 H H    . HIS B 2 301 ? 54.151 14.232  13.075 1.00 0.00   ? 301 HIS B H    1 
ATOM   4436 H HD1  . HIS B 2 301 ? 53.144 16.157  15.181 1.00 0.00   ? 301 HIS B HD1  1 
ATOM   4437 H HE2  . HIS B 2 301 ? 49.832 16.900  13.079 1.00 0.00   ? 301 HIS B HE2  1 
ATOM   4438 N N    . GLY B 2 302 ? 56.886 14.545  11.370 1.00 71.28  ? 302 GLY B N    1 
ATOM   4439 C CA   . GLY B 2 302 ? 58.335 14.451  11.234 1.00 70.34  ? 302 GLY B CA   1 
ATOM   4440 C C    . GLY B 2 302 ? 59.117 13.662  12.278 1.00 60.65  ? 302 GLY B C    1 
ATOM   4441 O O    . GLY B 2 302 ? 58.769 13.613  13.463 1.00 60.28  ? 302 GLY B O    1 
ATOM   4442 H H    . GLY B 2 302 ? 56.329 13.747  11.256 1.00 0.00   ? 302 GLY B H    1 
ATOM   4443 N N    . ILE B 2 303 ? 60.238 13.120  11.819 1.00 53.56  ? 303 ILE B N    1 
ATOM   4444 C CA   . ILE B 2 303 ? 61.135 12.304  12.626 1.00 51.49  ? 303 ILE B CA   1 
ATOM   4445 C C    . ILE B 2 303 ? 62.267 13.112  13.305 1.00 54.36  ? 303 ILE B C    1 
ATOM   4446 O O    . ILE B 2 303 ? 62.418 14.326  13.094 1.00 48.55  ? 303 ILE B O    1 
ATOM   4447 C CB   . ILE B 2 303 ? 61.749 11.192  11.730 1.00 47.82  ? 303 ILE B CB   1 
ATOM   4448 C CG1  . ILE B 2 303 ? 60.690 10.685  10.757 1.00 53.68  ? 303 ILE B CG1  1 
ATOM   4449 C CG2  . ILE B 2 303 ? 62.187 10.000  12.551 1.00 47.56  ? 303 ILE B CG2  1 
ATOM   4450 C CD1  . ILE B 2 303 ? 61.078 9.414   10.018 1.00 75.90  ? 303 ILE B CD1  1 
ATOM   4451 H H    . ILE B 2 303 ? 60.481 13.290  10.885 1.00 0.00   ? 303 ILE B H    1 
ATOM   4452 N N    . ASP B 2 304 ? 63.027 12.421  14.153 1.00 49.88  ? 304 ASP B N    1 
ATOM   4453 C CA   . ASP B 2 304 ? 64.166 12.990  14.861 1.00 47.29  ? 304 ASP B CA   1 
ATOM   4454 C C    . ASP B 2 304 ? 65.191 11.862  15.002 1.00 44.63  ? 304 ASP B C    1 
ATOM   4455 O O    . ASP B 2 304 ? 64.810 10.728  15.272 1.00 43.47  ? 304 ASP B O    1 
ATOM   4456 C CB   . ASP B 2 304 ? 63.737 13.475  16.237 1.00 54.38  ? 304 ASP B CB   1 
ATOM   4457 C CG   . ASP B 2 304 ? 64.250 14.867  16.552 1.00 68.84  ? 304 ASP B CG   1 
ATOM   4458 O OD1  . ASP B 2 304 ? 63.753 15.837  15.922 1.00 60.37  ? 304 ASP B OD1  1 
ATOM   4459 O OD2  . ASP B 2 304 ? 65.133 14.985  17.439 1.00 63.47  ? 304 ASP B OD2  1 
ATOM   4460 H H    . ASP B 2 304 ? 62.819 11.484  14.332 1.00 0.00   ? 304 ASP B H    1 
ATOM   4461 N N    . ALA B 2 305 ? 66.472 12.154  14.767 1.00 41.72  ? 305 ALA B N    1 
ATOM   4462 C CA   . ALA B 2 305 ? 67.525 11.129  14.878 1.00 34.64  ? 305 ALA B CA   1 
ATOM   4463 C C    . ALA B 2 305 ? 68.723 11.499  15.745 1.00 32.41  ? 305 ALA B C    1 
ATOM   4464 O O    . ALA B 2 305 ? 69.116 12.678  15.873 1.00 34.77  ? 305 ALA B O    1 
ATOM   4465 C CB   . ALA B 2 305 ? 67.992 10.661  13.513 1.00 28.05  ? 305 ALA B CB   1 
ATOM   4466 H H    . ALA B 2 305 ? 66.719 13.070  14.522 1.00 0.00   ? 305 ALA B H    1 
ATOM   4467 N N    . ALA B 2 306 ? 69.286 10.466  16.358 1.00 25.79  ? 306 ALA B N    1 
ATOM   4468 C CA   . ALA B 2 306 ? 70.430 10.613  17.242 1.00 27.05  ? 306 ALA B CA   1 
ATOM   4469 C C    . ALA B 2 306 ? 71.099 9.242   17.361 1.00 28.44  ? 306 ALA B C    1 
ATOM   4470 O O    . ALA B 2 306 ? 70.424 8.241   17.553 1.00 28.53  ? 306 ALA B O    1 
ATOM   4471 C CB   . ALA B 2 306 ? 69.967 11.122  18.579 1.00 15.20  ? 306 ALA B CB   1 
ATOM   4472 H H    . ALA B 2 306 ? 68.910 9.573   16.209 1.00 0.00   ? 306 ALA B H    1 
ATOM   4473 N N    . TYR B 2 307 ? 72.426 9.194   17.246 1.00 33.31  ? 307 TYR B N    1 
ATOM   4474 C CA   . TYR B 2 307 ? 73.112 7.907   17.287 1.00 33.76  ? 307 TYR B CA   1 
ATOM   4475 C C    . TYR B 2 307 ? 74.094 7.669   18.432 1.00 38.25  ? 307 TYR B C    1 
ATOM   4476 O O    . TYR B 2 307 ? 74.435 8.576   19.200 1.00 27.55  ? 307 TYR B O    1 
ATOM   4477 C CB   . TYR B 2 307 ? 73.824 7.648   15.945 1.00 41.85  ? 307 TYR B CB   1 
ATOM   4478 C CG   . TYR B 2 307 ? 75.101 8.456   15.728 1.00 56.32  ? 307 TYR B CG   1 
ATOM   4479 C CD1  . TYR B 2 307 ? 76.200 8.315   16.581 1.00 64.45  ? 307 TYR B CD1  1 
ATOM   4480 C CD2  . TYR B 2 307 ? 75.204 9.376   14.688 1.00 65.83  ? 307 TYR B CD2  1 
ATOM   4481 C CE1  . TYR B 2 307 ? 77.350 9.062   16.417 1.00 72.26  ? 307 TYR B CE1  1 
ATOM   4482 C CE2  . TYR B 2 307 ? 76.364 10.132  14.513 1.00 65.68  ? 307 TYR B CE2  1 
ATOM   4483 C CZ   . TYR B 2 307 ? 77.429 9.966   15.384 1.00 70.99  ? 307 TYR B CZ   1 
ATOM   4484 O OH   . TYR B 2 307 ? 78.584 10.694  15.233 1.00 82.93  ? 307 TYR B OH   1 
ATOM   4485 H H    . TYR B 2 307 ? 72.942 10.022  17.136 1.00 0.00   ? 307 TYR B H    1 
ATOM   4486 H HH   . TYR B 2 307 ? 79.265 10.359  15.820 1.00 0.00   ? 307 TYR B HH   1 
ATOM   4487 N N    . ILE B 2 308 ? 74.525 6.410   18.527 1.00 36.52  ? 308 ILE B N    1 
ATOM   4488 C CA   . ILE B 2 308 ? 75.524 5.961   19.486 1.00 33.21  ? 308 ILE B CA   1 
ATOM   4489 C C    . ILE B 2 308 ? 76.465 5.088   18.652 1.00 32.50  ? 308 ILE B C    1 
ATOM   4490 O O    . ILE B 2 308 ? 76.041 4.088   18.058 1.00 25.40  ? 308 ILE B O    1 
ATOM   4491 C CB   . ILE B 2 308 ? 74.940 5.118   20.638 1.00 32.97  ? 308 ILE B CB   1 
ATOM   4492 C CG1  . ILE B 2 308 ? 73.823 5.883   21.340 1.00 36.85  ? 308 ILE B CG1  1 
ATOM   4493 C CG2  . ILE B 2 308 ? 76.029 4.827   21.658 1.00 21.91  ? 308 ILE B CG2  1 
ATOM   4494 C CD1  . ILE B 2 308 ? 74.243 7.237   21.857 1.00 48.12  ? 308 ILE B CD1  1 
ATOM   4495 H H    . ILE B 2 308 ? 74.158 5.745   17.910 1.00 0.00   ? 308 ILE B H    1 
ATOM   4496 N N    . GLN B 2 309 ? 77.696 5.563   18.480 1.00 34.96  ? 309 GLN B N    1 
ATOM   4497 C CA   . GLN B 2 309 ? 78.708 4.825   17.730 1.00 31.68  ? 309 GLN B CA   1 
ATOM   4498 C C    . GLN B 2 309 ? 79.584 4.054   18.694 1.00 26.37  ? 309 GLN B C    1 
ATOM   4499 O O    . GLN B 2 309 ? 80.231 4.639   19.566 1.00 26.35  ? 309 GLN B O    1 
ATOM   4500 C CB   . GLN B 2 309 ? 79.578 5.759   16.904 1.00 37.77  ? 309 GLN B CB   1 
ATOM   4501 C CG   . GLN B 2 309 ? 80.713 5.043   16.182 1.00 29.45  ? 309 GLN B CG   1 
ATOM   4502 C CD   . GLN B 2 309 ? 80.239 3.881   15.323 1.00 31.04  ? 309 GLN B CD   1 
ATOM   4503 O OE1  . GLN B 2 309 ? 79.782 4.071   14.190 1.00 31.45  ? 309 GLN B OE1  1 
ATOM   4504 N NE2  . GLN B 2 309 ? 80.338 2.669   15.863 1.00 20.31  ? 309 GLN B NE2  1 
ATOM   4505 H H    . GLN B 2 309 ? 77.921 6.417   18.876 1.00 0.00   ? 309 GLN B H    1 
ATOM   4506 H HE21 . GLN B 2 309 ? 80.101 1.898   15.305 1.00 0.00   ? 309 GLN B HE21 1 
ATOM   4507 H HE22 . GLN B 2 309 ? 80.646 2.613   16.776 1.00 0.00   ? 309 GLN B HE22 1 
ATOM   4508 N N    . LEU B 2 310 ? 79.533 2.733   18.580 1.00 33.58  ? 310 LEU B N    1 
ATOM   4509 C CA   . LEU B 2 310 ? 80.325 1.863   19.437 1.00 33.61  ? 310 LEU B CA   1 
ATOM   4510 C C    . LEU B 2 310 ? 81.769 1.875   18.928 1.00 34.98  ? 310 LEU B C    1 
ATOM   4511 O O    . LEU B 2 310 ? 82.015 1.883   17.720 1.00 43.87  ? 310 LEU B O    1 
ATOM   4512 C CB   . LEU B 2 310 ? 79.755 0.432   19.435 1.00 29.14  ? 310 LEU B CB   1 
ATOM   4513 C CG   . LEU B 2 310 ? 78.390 0.191   20.093 1.00 22.60  ? 310 LEU B CG   1 
ATOM   4514 C CD1  . LEU B 2 310 ? 78.175 -1.294  20.329 1.00 14.13  ? 310 LEU B CD1  1 
ATOM   4515 C CD2  . LEU B 2 310 ? 78.316 0.894   21.422 1.00 10.91  ? 310 LEU B CD2  1 
ATOM   4516 H H    . LEU B 2 310 ? 78.943 2.345   17.898 1.00 0.00   ? 310 LEU B H    1 
ATOM   4517 N N    . ILE B 2 311 ? 82.718 1.933   19.856 1.00 27.91  ? 311 ILE B N    1 
ATOM   4518 C CA   . ILE B 2 311 ? 84.144 1.949   19.529 1.00 25.52  ? 311 ILE B CA   1 
ATOM   4519 C C    . ILE B 2 311 ? 84.864 1.043   20.534 1.00 28.24  ? 311 ILE B C    1 
ATOM   4520 O O    . ILE B 2 311 ? 84.365 0.865   21.652 1.00 32.16  ? 311 ILE B O    1 
ATOM   4521 C CB   . ILE B 2 311 ? 84.732 3.389   19.640 1.00 23.02  ? 311 ILE B CB   1 
ATOM   4522 C CG1  . ILE B 2 311 ? 84.786 3.837   21.105 1.00 27.59  ? 311 ILE B CG1  1 
ATOM   4523 C CG2  . ILE B 2 311 ? 83.892 4.374   18.848 1.00 11.02  ? 311 ILE B CG2  1 
ATOM   4524 C CD1  . ILE B 2 311 ? 85.480 5.169   21.326 1.00 25.34  ? 311 ILE B CD1  1 
ATOM   4525 H H    . ILE B 2 311 ? 82.447 1.914   20.790 1.00 0.00   ? 311 ILE B H    1 
ATOM   4526 N N    . TYR B 2 312 ? 86.011 0.461   20.151 1.00 24.97  ? 312 TYR B N    1 
ATOM   4527 C CA   . TYR B 2 312 ? 86.778 -0.393  21.077 1.00 13.94  ? 312 TYR B CA   1 
ATOM   4528 C C    . TYR B 2 312 ? 87.451 0.483   22.128 1.00 13.36  ? 312 TYR B C    1 
ATOM   4529 O O    . TYR B 2 312 ? 87.721 1.669   21.898 1.00 18.67  ? 312 TYR B O    1 
ATOM   4530 C CB   . TYR B 2 312 ? 87.869 -1.192  20.371 1.00 15.49  ? 312 TYR B CB   1 
ATOM   4531 C CG   . TYR B 2 312 ? 87.409 -2.095  19.268 1.00 8.61   ? 312 TYR B CG   1 
ATOM   4532 C CD1  . TYR B 2 312 ? 87.196 -1.599  17.989 1.00 11.23  ? 312 TYR B CD1  1 
ATOM   4533 C CD2  . TYR B 2 312 ? 87.215 -3.451  19.486 1.00 7.38   ? 312 TYR B CD2  1 
ATOM   4534 C CE1  . TYR B 2 312 ? 86.802 -2.424  16.958 1.00 10.99  ? 312 TYR B CE1  1 
ATOM   4535 C CE2  . TYR B 2 312 ? 86.816 -4.300  18.445 1.00 8.55   ? 312 TYR B CE2  1 
ATOM   4536 C CZ   . TYR B 2 312 ? 86.611 -3.770  17.191 1.00 6.53   ? 312 TYR B CZ   1 
ATOM   4537 O OH   . TYR B 2 312 ? 86.197 -4.566  16.147 1.00 24.72  ? 312 TYR B OH   1 
ATOM   4538 H H    . TYR B 2 312 ? 86.350 0.622   19.245 1.00 0.00   ? 312 TYR B H    1 
ATOM   4539 H HH   . TYR B 2 312 ? 86.214 -4.057  15.334 1.00 0.00   ? 312 TYR B HH   1 
ATOM   4540 N N    . PRO B 2 313 ? 87.714 -0.078  23.308 1.00 18.17  ? 313 PRO B N    1 
ATOM   4541 C CA   . PRO B 2 313 ? 88.363 0.748   24.328 1.00 25.20  ? 313 PRO B CA   1 
ATOM   4542 C C    . PRO B 2 313 ? 89.778 1.211   23.956 1.00 42.68  ? 313 PRO B C    1 
ATOM   4543 O O    . PRO B 2 313 ? 90.471 0.595   23.135 1.00 42.59  ? 313 PRO B O    1 
ATOM   4544 C CB   . PRO B 2 313 ? 88.330 -0.144  25.576 1.00 22.17  ? 313 PRO B CB   1 
ATOM   4545 C CG   . PRO B 2 313 ? 88.195 -1.547  25.036 1.00 26.97  ? 313 PRO B CG   1 
ATOM   4546 C CD   . PRO B 2 313 ? 87.300 -1.389  23.843 1.00 28.17  ? 313 PRO B CD   1 
ATOM   4547 N N    . VAL B 2 314 ? 90.164 2.352   24.515 1.00 57.74  ? 314 VAL B N    1 
ATOM   4548 C CA   . VAL B 2 314 ? 91.483 2.927   24.271 1.00 68.16  ? 314 VAL B CA   1 
ATOM   4549 C C    . VAL B 2 314 ? 92.568 2.232   25.104 1.00 73.60  ? 314 VAL B C    1 
ATOM   4550 O O    . VAL B 2 314 ? 92.440 2.094   26.325 1.00 63.93  ? 314 VAL B O    1 
ATOM   4551 C CB   . VAL B 2 314 ? 91.488 4.447   24.561 1.00 65.84  ? 314 VAL B CB   1 
ATOM   4552 C CG1  . VAL B 2 314 ? 92.856 5.052   24.244 1.00 71.32  ? 314 VAL B CG1  1 
ATOM   4553 C CG2  . VAL B 2 314 ? 90.394 5.131   23.748 1.00 64.50  ? 314 VAL B CG2  1 
ATOM   4554 H H    . VAL B 2 314 ? 89.536 2.823   25.102 1.00 0.00   ? 314 VAL B H    1 
ATOM   4555 N N    . THR B 2 315 ? 93.623 1.781   24.421 1.00 87.48  ? 315 THR B N    1 
ATOM   4556 C CA   . THR B 2 315 ? 94.758 1.104   25.060 1.00 97.03  ? 315 THR B CA   1 
ATOM   4557 C C    . THR B 2 315 ? 95.494 2.087   25.985 1.00 100.00 ? 315 THR B C    1 
ATOM   4558 O O    . THR B 2 315 ? 95.389 3.317   25.749 1.00 100.00 ? 315 THR B O    1 
ATOM   4559 C CB   . THR B 2 315 ? 95.782 0.551   24.006 1.00 97.72  ? 315 THR B CB   1 
ATOM   4560 O OG1  . THR B 2 315 ? 95.082 0.050   22.861 1.00 99.95  ? 315 THR B OG1  1 
ATOM   4561 C CG2  . THR B 2 315 ? 96.612 -0.592  24.600 1.00 90.88  ? 315 THR B CG2  1 
ATOM   4562 H H    . THR B 2 315 ? 93.642 1.906   23.449 1.00 0.00   ? 315 THR B H    1 
ATOM   4563 H HG1  . THR B 2 315 ? 95.710 -0.252  22.202 1.00 0.00   ? 315 THR B HG1  1 
HETATM 4564 O O    . HOH C 3 .   ? 58.135 1.399   14.315 1.00 22.82  ? 154 HOH A O    1 
HETATM 4565 H H1   . HOH C 3 .   ? 57.882 2.322   14.298 1.00 37.00  ? 154 HOH A H1   1 
HETATM 4566 H H2   . HOH C 3 .   ? 59.093 1.428   14.299 1.00 37.00  ? 154 HOH A H2   1 
HETATM 4567 O O    . HOH C 3 .   ? 51.500 9.890   8.589  1.00 45.94  ? 155 HOH A O    1 
HETATM 4568 H H1   . HOH C 3 .   ? 51.126 10.403  7.873  1.00 37.00  ? 155 HOH A H1   1 
HETATM 4569 H H2   . HOH C 3 .   ? 50.793 9.296   8.844  1.00 37.00  ? 155 HOH A H2   1 
HETATM 4570 O O    . HOH C 3 .   ? 40.615 4.537   6.173  1.00 19.98  ? 156 HOH A O    1 
HETATM 4571 H H1   . HOH C 3 .   ? 40.268 4.478   7.063  1.00 37.00  ? 156 HOH A H1   1 
HETATM 4572 H H2   . HOH C 3 .   ? 39.841 4.583   5.613  1.00 37.00  ? 156 HOH A H2   1 
HETATM 4573 O O    . HOH C 3 .   ? 34.706 14.289  13.299 1.00 30.11  ? 157 HOH A O    1 
HETATM 4574 H H1   . HOH C 3 .   ? 33.936 14.662  13.728 1.00 37.00  ? 157 HOH A H1   1 
HETATM 4575 H H2   . HOH C 3 .   ? 34.351 13.597  12.739 1.00 37.00  ? 157 HOH A H2   1 
HETATM 4576 O O    . HOH C 3 .   ? 27.263 9.098   8.826  1.00 29.54  ? 158 HOH A O    1 
HETATM 4577 H H1   . HOH C 3 .   ? 26.853 9.923   9.083  1.00 37.00  ? 158 HOH A H1   1 
HETATM 4578 H H2   . HOH C 3 .   ? 27.856 8.889   9.547  1.00 37.00  ? 158 HOH A H2   1 
HETATM 4579 O O    . HOH C 3 .   ? 29.471 1.336   8.060  1.00 18.47  ? 159 HOH A O    1 
HETATM 4580 H H1   . HOH C 3 .   ? 29.369 2.241   8.353  1.00 37.00  ? 159 HOH A H1   1 
HETATM 4581 H H2   . HOH C 3 .   ? 29.369 0.805   8.848  1.00 37.00  ? 159 HOH A H2   1 
HETATM 4582 O O    . HOH C 3 .   ? 55.541 0.997   13.043 1.00 18.78  ? 160 HOH A O    1 
HETATM 4583 H H1   . HOH C 3 .   ? 55.661 1.792   12.522 1.00 37.00  ? 160 HOH A H1   1 
HETATM 4584 H H2   . HOH C 3 .   ? 54.595 0.860   13.068 1.00 37.00  ? 160 HOH A H2   1 
HETATM 4585 O O    . HOH C 3 .   ? 31.538 10.454  19.534 1.00 20.78  ? 161 HOH A O    1 
HETATM 4586 H H1   . HOH C 3 .   ? 31.325 9.586   19.873 1.00 37.00  ? 161 HOH A H1   1 
HETATM 4587 H H2   . HOH C 3 .   ? 31.894 10.939  20.279 1.00 37.00  ? 161 HOH A H2   1 
HETATM 4588 O O    . HOH D 3 .   ? 12.482 14.425  22.890 1.00 45.97  ? 316 HOH B O    1 
HETATM 4589 H H1   . HOH D 3 .   ? 11.666 14.244  23.357 1.00 37.00  ? 316 HOH B H1   1 
HETATM 4590 H H2   . HOH D 3 .   ? 12.827 15.217  23.302 1.00 37.00  ? 316 HOH B H2   1 
HETATM 4591 O O    . HOH D 3 .   ? 18.572 23.461  20.650 1.00 19.75  ? 317 HOH B O    1 
HETATM 4592 H H1   . HOH D 3 .   ? 18.247 24.080  19.999 1.00 37.00  ? 317 HOH B H1   1 
HETATM 4593 H H2   . HOH D 3 .   ? 19.525 23.529  20.620 1.00 37.00  ? 317 HOH B H2   1 
HETATM 4594 O O    . HOH D 3 .   ? 18.307 13.182  19.470 1.00 18.05  ? 318 HOH B O    1 
HETATM 4595 H H1   . HOH D 3 .   ? 17.711 13.929  19.512 1.00 37.00  ? 318 HOH B H1   1 
HETATM 4596 H H2   . HOH D 3 .   ? 19.084 13.516  19.021 1.00 37.00  ? 318 HOH B H2   1 
HETATM 4597 O O    . HOH D 3 .   ? 59.330 3.640   23.831 1.00 20.93  ? 319 HOH B O    1 
HETATM 4598 H H1   . HOH D 3 .   ? 59.971 4.352   23.870 1.00 37.00  ? 319 HOH B H1   1 
HETATM 4599 H H2   . HOH D 3 .   ? 59.430 3.197   24.674 1.00 37.00  ? 319 HOH B H2   1 
HETATM 4600 O O    . HOH D 3 .   ? 27.684 9.859   19.636 1.00 35.29  ? 320 HOH B O    1 
HETATM 4601 H H1   . HOH D 3 .   ? 27.104 10.378  20.193 1.00 37.00  ? 320 HOH B H1   1 
HETATM 4602 H H2   . HOH D 3 .   ? 27.121 9.169   19.282 1.00 37.00  ? 320 HOH B H2   1 
HETATM 4603 O O    . HOH D 3 .   ? 16.651 10.816  18.355 1.00 27.03  ? 321 HOH B O    1 
HETATM 4604 H H1   . HOH D 3 .   ? 15.745 11.026  18.128 1.00 37.00  ? 321 HOH B H1   1 
HETATM 4605 H H2   . HOH D 3 .   ? 16.583 10.025  18.891 1.00 37.00  ? 321 HOH B H2   1 
HETATM 4606 O O    . HOH D 3 .   ? 48.428 10.912  24.365 1.00 31.30  ? 322 HOH B O    1 
HETATM 4607 H H1   . HOH D 3 .   ? 48.517 11.141  23.438 1.00 37.00  ? 322 HOH B H1   1 
HETATM 4608 H H2   . HOH D 3 .   ? 49.324 10.980  24.703 1.00 37.00  ? 322 HOH B H2   1 
HETATM 4609 O O    . HOH D 3 .   ? 59.839 6.206   9.125  1.00 57.88  ? 323 HOH B O    1 
HETATM 4610 H H1   . HOH D 3 .   ? 59.006 6.013   8.692  1.00 37.00  ? 323 HOH B H1   1 
HETATM 4611 H H2   . HOH D 3 .   ? 59.632 6.926   9.720  1.00 37.00  ? 323 HOH B H2   1 
HETATM 4612 O O    . HOH D 3 .   ? 53.333 21.352  22.974 1.00 49.05  ? 324 HOH B O    1 
HETATM 4613 H H1   . HOH D 3 .   ? 52.536 21.607  22.509 1.00 37.00  ? 324 HOH B H1   1 
HETATM 4614 H H2   . HOH D 3 .   ? 53.467 20.434  22.737 1.00 37.00  ? 324 HOH B H2   1 
HETATM 4615 O O    . HOH D 3 .   ? 58.143 2.583   19.220 1.00 25.78  ? 325 HOH B O    1 
HETATM 4616 H H1   . HOH D 3 .   ? 58.703 3.343   19.370 1.00 37.00  ? 325 HOH B H1   1 
HETATM 4617 H H2   . HOH D 3 .   ? 57.890 2.285   20.093 1.00 37.00  ? 325 HOH B H2   1 
HETATM 4618 O O    . HOH D 3 .   ? 24.516 29.058  3.702  1.00 33.96  ? 326 HOH B O    1 
HETATM 4619 H H1   . HOH D 3 .   ? 25.101 29.156  2.949  1.00 37.00  ? 326 HOH B H1   1 
HETATM 4620 H H2   . HOH D 3 .   ? 24.977 29.494  4.418  1.00 37.00  ? 326 HOH B H2   1 
HETATM 4621 O O    . HOH D 3 .   ? 10.237 9.702   16.471 1.00 27.43  ? 327 HOH B O    1 
HETATM 4622 H H1   . HOH D 3 .   ? 10.106 10.586  16.125 1.00 37.00  ? 327 HOH B H1   1 
HETATM 4623 H H2   . HOH D 3 .   ? 9.354  9.337   16.524 1.00 37.00  ? 327 HOH B H2   1 
HETATM 4624 O O    . HOH D 3 .   ? 58.010 4.018   21.531 1.00 31.04  ? 328 HOH B O    1 
HETATM 4625 H H1   . HOH D 3 .   ? 57.740 3.108   21.639 1.00 37.00  ? 328 HOH B H1   1 
HETATM 4626 H H2   . HOH D 3 .   ? 57.300 4.425   21.031 1.00 37.00  ? 328 HOH B H2   1 
HETATM 4627 O O    . HOH D 3 .   ? 58.594 13.598  31.474 1.00 22.02  ? 329 HOH B O    1 
HETATM 4628 H H1   . HOH D 3 .   ? 57.741 13.232  31.232 1.00 37.00  ? 329 HOH B H1   1 
HETATM 4629 H H2   . HOH D 3 .   ? 58.522 14.524  31.244 1.00 37.00  ? 329 HOH B H2   1 
HETATM 4630 O O    . HOH D 3 .   ? 34.508 17.770  10.776 1.00 36.89  ? 330 HOH B O    1 
HETATM 4631 H H1   . HOH D 3 .   ? 34.011 17.765  11.593 1.00 37.00  ? 330 HOH B H1   1 
HETATM 4632 H H2   . HOH D 3 .   ? 33.970 18.281  10.168 1.00 37.00  ? 330 HOH B H2   1 
HETATM 4633 O O    . HOH D 3 .   ? 21.452 22.811  6.833  1.00 34.77  ? 331 HOH B O    1 
HETATM 4634 H H1   . HOH D 3 .   ? 22.034 23.527  7.088  1.00 37.00  ? 331 HOH B H1   1 
HETATM 4635 H H2   . HOH D 3 .   ? 21.254 22.358  7.653  1.00 37.00  ? 331 HOH B H2   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   1   ALA ALA A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   VAL 3   3   3   VAL VAL A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   ASN 7   7   7   ASN ASN A . n 
A 1 8   CYS 8   8   8   CYS CYS A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  GLN 14  14  14  GLN GLN A . n 
A 1 15  GLN 15  15  15  GLN GLN A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  SER 17  17  17  SER SER A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  MET 20  20  20  MET MET A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  PRO 23  23  23  PRO PRO A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  ALA 28  28  28  ALA ALA A . n 
A 1 29  LEU 29  29  29  LEU LEU A . n 
A 1 30  HIS 30  30  30  HIS HIS A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  GLN 34  34  34  GLN GLN A . n 
A 1 35  ASP 35  35  35  ASP ASP A . n 
A 1 36  MET 36  36  36  MET MET A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  GLN 39  39  39  GLN GLN A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  PHE 42  42  42  PHE PHE A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  MET 44  44  44  MET MET A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  GLN 48  48  48  GLN GLN A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  ASN 53  53  53  ASN ASN A . n 
A 1 54  ASP 54  54  54  ASP ASP A . n 
A 1 55  LYS 55  55  55  LYS LYS A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  PRO 57  57  57  PRO PRO A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  ALA 59  59  59  ALA ALA A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  LYS 65  65  65  LYS LYS A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  TYR 68  68  68  TYR TYR A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  SER 70  70  70  SER SER A . n 
A 1 71  CYS 71  71  71  CYS CYS A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  LYS 77  77  77  LYS LYS A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  THR 79  79  79  THR THR A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  GLN 81  81  81  GLN GLN A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  GLU 83  83  83  GLU GLU A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  PRO 87  87  87  PRO PRO A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  PRO 91  91  91  PRO PRO A . n 
A 1 92  LYS 92  92  92  LYS LYS A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  MET 95  95  95  MET MET A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  PHE 99  99  99  PHE PHE A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 ASN 107 107 107 ASN ASN A . n 
A 1 108 ASN 108 108 108 ASN ASN A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 GLU 113 113 113 GLU GLU A . n 
A 1 114 SER 114 114 114 SER SER A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 GLN 116 116 116 GLN GLN A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 PRO 118 118 118 PRO PRO A . n 
A 1 119 ASN 119 119 119 ASN ASN A . n 
A 1 120 TRP 120 120 120 TRP TRP A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 ILE 122 122 122 ILE ILE A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 THR 124 124 124 THR THR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLN 126 126 126 GLN GLN A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 MET 130 130 130 MET MET A . n 
A 1 131 PRO 131 131 131 PRO PRO A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 PHE 133 133 133 PHE PHE A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 THR 137 137 137 THR THR A . n 
A 1 138 LYS 138 138 138 LYS LYS A . n 
A 1 139 GLY 139 139 139 GLY GLY A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 GLN 141 141 141 GLN GLN A . n 
A 1 142 ASP 142 142 142 ASP ASP A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 THR 144 144 144 THR THR A . n 
A 1 145 ASP 145 145 145 ASP ASP A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 THR 147 147 147 THR THR A . n 
A 1 148 MET 148 148 148 MET MET A . n 
A 1 149 GLN 149 149 149 GLN GLN A . n 
A 1 150 PHE 150 150 150 PHE PHE A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 SER 152 152 152 SER SER A . n 
A 1 153 SER 153 153 153 SER SER A . n 
B 2 1   LEU 1   1   ?   ?   ?   B . n 
B 2 2   GLU 2   2   ?   ?   ?   B . n 
B 2 3   ALA 3   3   ?   ?   ?   B . n 
B 2 4   ASP 4   4   ?   ?   ?   B . n 
B 2 5   LYS 5   5   ?   ?   ?   B . n 
B 2 6   CYS 6   6   6   CYS CYS B . n 
B 2 7   LYS 7   7   7   LYS LYS B . n 
B 2 8   GLU 8   8   8   GLU GLU B . n 
B 2 9   ARG 9   9   9   ARG ARG B . n 
B 2 10  GLU 10  10  10  GLU GLU B . n 
B 2 11  GLU 11  11  11  GLU GLU B . n 
B 2 12  LYS 12  12  12  LYS LYS B . n 
B 2 13  ILE 13  13  13  ILE ILE B . n 
B 2 14  ILE 14  14  14  ILE ILE B . n 
B 2 15  LEU 15  15  15  LEU LEU B . n 
B 2 16  VAL 16  16  16  VAL VAL B . n 
B 2 17  SER 17  17  17  SER SER B . n 
B 2 18  SER 18  18  18  SER SER B . n 
B 2 19  ALA 19  19  19  ALA ALA B . n 
B 2 20  ASN 20  20  20  ASN ASN B . n 
B 2 21  GLU 21  21  21  GLU GLU B . n 
B 2 22  ILE 22  22  22  ILE ILE B . n 
B 2 23  ASP 23  23  23  ASP ASP B . n 
B 2 24  VAL 24  24  24  VAL VAL B . n 
B 2 25  ARG 25  25  25  ARG ARG B . n 
B 2 26  PRO 26  26  26  PRO PRO B . n 
B 2 27  CYS 27  27  27  CYS CYS B . n 
B 2 28  PRO 28  28  28  PRO PRO B . n 
B 2 29  LEU 29  29  29  LEU LEU B . n 
B 2 30  ASN 30  30  30  ASN ASN B . n 
B 2 31  PRO 31  31  31  PRO PRO B . n 
B 2 32  ASN 32  32  32  ASN ASN B . n 
B 2 33  GLU 33  33  33  GLU GLU B . n 
B 2 34  HIS 34  34  34  HIS HIS B . n 
B 2 35  LYS 35  35  35  LYS LYS B . n 
B 2 36  GLY 36  36  36  GLY GLY B . n 
B 2 37  THR 37  37  37  THR THR B . n 
B 2 38  ILE 38  38  38  ILE ILE B . n 
B 2 39  THR 39  39  39  THR THR B . n 
B 2 40  TRP 40  40  40  TRP TRP B . n 
B 2 41  TYR 41  41  41  TYR TYR B . n 
B 2 42  LYS 42  42  42  LYS LYS B . n 
B 2 43  ASP 43  43  43  ASP ASP B . n 
B 2 44  ASP 44  44  44  ASP ASP B . n 
B 2 45  SER 45  45  45  SER SER B . n 
B 2 46  LYS 46  46  46  LYS LYS B . n 
B 2 47  THR 47  47  47  THR THR B . n 
B 2 48  PRO 48  48  48  PRO PRO B . n 
B 2 49  VAL 49  49  49  VAL VAL B . n 
B 2 50  SER 50  50  50  SER SER B . n 
B 2 51  THR 51  51  51  THR THR B . n 
B 2 52  GLU 52  52  52  GLU GLU B . n 
B 2 53  GLN 53  53  53  GLN GLN B . n 
B 2 54  ALA 54  54  54  ALA ALA B . n 
B 2 55  SER 55  55  55  SER SER B . n 
B 2 56  ARG 56  56  56  ARG ARG B . n 
B 2 57  ILE 57  57  57  ILE ILE B . n 
B 2 58  HIS 58  58  58  HIS HIS B . n 
B 2 59  GLN 59  59  59  GLN GLN B . n 
B 2 60  HIS 60  60  60  HIS HIS B . n 
B 2 61  LYS 61  61  61  LYS LYS B . n 
B 2 62  GLU 62  62  62  GLU GLU B . n 
B 2 63  LYS 63  63  63  LYS LYS B . n 
B 2 64  LEU 64  64  64  LEU LEU B . n 
B 2 65  TRP 65  65  65  TRP TRP B . n 
B 2 66  PHE 66  66  66  PHE PHE B . n 
B 2 67  VAL 67  67  67  VAL VAL B . n 
B 2 68  PRO 68  68  68  PRO PRO B . n 
B 2 69  ALA 69  69  69  ALA ALA B . n 
B 2 70  LYS 70  70  70  LYS LYS B . n 
B 2 71  VAL 71  71  71  VAL VAL B . n 
B 2 72  GLU 72  72  72  GLU GLU B . n 
B 2 73  ASP 73  73  73  ASP ASP B . n 
B 2 74  SER 74  74  74  SER SER B . n 
B 2 75  GLY 75  75  75  GLY GLY B . n 
B 2 76  HIS 76  76  76  HIS HIS B . n 
B 2 77  TYR 77  77  77  TYR TYR B . n 
B 2 78  TYR 78  78  78  TYR TYR B . n 
B 2 79  CYS 79  79  79  CYS CYS B . n 
B 2 80  VAL 80  80  80  VAL VAL B . n 
B 2 81  VAL 81  81  81  VAL VAL B . n 
B 2 82  ARG 82  82  82  ARG ARG B . n 
B 2 83  ASN 83  83  83  ASN ASN B . n 
B 2 84  SER 84  84  84  SER SER B . n 
B 2 85  SER 85  85  85  SER SER B . n 
B 2 86  TYR 86  86  86  TYR TYR B . n 
B 2 87  CYS 87  87  87  CYS CYS B . n 
B 2 88  LEU 88  88  88  LEU LEU B . n 
B 2 89  ARG 89  89  89  ARG ARG B . n 
B 2 90  ILE 90  90  90  ILE ILE B . n 
B 2 91  LYS 91  91  91  LYS LYS B . n 
B 2 92  ILE 92  92  92  ILE ILE B . n 
B 2 93  SER 93  93  93  SER SER B . n 
B 2 94  ALA 94  94  94  ALA ALA B . n 
B 2 95  LYS 95  95  95  LYS LYS B . n 
B 2 96  PHE 96  96  96  PHE PHE B . n 
B 2 97  VAL 97  97  97  VAL VAL B . n 
B 2 98  GLU 98  98  98  GLU GLU B . n 
B 2 99  ASN 99  99  99  ASN ASN B . n 
B 2 100 GLU 100 100 100 GLU GLU B . n 
B 2 101 PRO 101 101 101 PRO PRO B . n 
B 2 102 ASN 102 102 102 ASN ASN B . n 
B 2 103 LEU 103 103 103 LEU LEU B . n 
B 2 104 CYS 104 104 104 CYS CYS B . n 
B 2 105 TYR 105 105 105 TYR TYR B . n 
B 2 106 ASN 106 106 106 ASN ASN B . n 
B 2 107 ALA 107 107 107 ALA ALA B . n 
B 2 108 GLN 108 108 108 GLN GLN B . n 
B 2 109 ALA 109 109 109 ALA ALA B . n 
B 2 110 ILE 110 110 110 ILE ILE B . n 
B 2 111 PHE 111 111 111 PHE PHE B . n 
B 2 112 LYS 112 112 112 LYS LYS B . n 
B 2 113 GLN 113 113 113 GLN GLN B . n 
B 2 114 LYS 114 114 114 LYS LYS B . n 
B 2 115 LEU 115 115 115 LEU LEU B . n 
B 2 116 PRO 116 116 116 PRO PRO B . n 
B 2 117 VAL 117 117 117 VAL VAL B . n 
B 2 118 ALA 118 118 118 ALA ALA B . n 
B 2 119 GLY 119 119 119 GLY GLY B . n 
B 2 120 ASP 120 120 120 ASP ASP B . n 
B 2 121 GLY 121 121 121 GLY GLY B . n 
B 2 122 GLY 122 122 122 GLY GLY B . n 
B 2 123 LEU 123 123 123 LEU LEU B . n 
B 2 124 VAL 124 124 124 VAL VAL B . n 
B 2 125 CYS 125 125 125 CYS CYS B . n 
B 2 126 PRO 126 126 126 PRO PRO B . n 
B 2 127 TYR 127 127 127 TYR TYR B . n 
B 2 128 MET 128 128 128 MET MET B . n 
B 2 129 GLU 129 129 129 GLU GLU B . n 
B 2 130 PHE 130 130 130 PHE PHE B . n 
B 2 131 PHE 131 131 131 PHE PHE B . n 
B 2 132 LYS 132 132 132 LYS LYS B . n 
B 2 133 ASN 133 133 133 ASN ASN B . n 
B 2 134 GLU 134 134 134 GLU GLU B . n 
B 2 135 ASN 135 135 135 ASN ASN B . n 
B 2 136 ASN 136 136 136 ASN ASN B . n 
B 2 137 GLU 137 137 137 GLU GLU B . n 
B 2 138 LEU 138 138 138 LEU LEU B . n 
B 2 139 PRO 139 139 139 PRO PRO B . n 
B 2 140 LYS 140 140 140 LYS LYS B . n 
B 2 141 LEU 141 141 141 LEU LEU B . n 
B 2 142 GLN 142 142 142 GLN GLN B . n 
B 2 143 TRP 143 143 143 TRP TRP B . n 
B 2 144 TYR 144 144 144 TYR TYR B . n 
B 2 145 LYS 145 145 145 LYS LYS B . n 
B 2 146 ASP 146 146 146 ASP ASP B . n 
B 2 147 CYS 147 147 147 CYS CYS B . n 
B 2 148 LYS 148 148 148 LYS LYS B . n 
B 2 149 PRO 149 149 149 PRO PRO B . n 
B 2 150 LEU 150 150 150 LEU LEU B . n 
B 2 151 LEU 151 151 151 LEU LEU B . n 
B 2 152 LEU 152 152 152 LEU LEU B . n 
B 2 153 ASP 153 153 153 ASP ASP B . n 
B 2 154 ASN 154 154 154 ASN ASN B . n 
B 2 155 ILE 155 155 155 ILE ILE B . n 
B 2 156 HIS 156 156 156 HIS HIS B . n 
B 2 157 PHE 157 157 157 PHE PHE B . n 
B 2 158 SER 158 158 158 SER SER B . n 
B 2 159 GLY 159 159 159 GLY GLY B . n 
B 2 160 VAL 160 160 160 VAL VAL B . n 
B 2 161 LYS 161 161 161 LYS LYS B . n 
B 2 162 ASP 162 162 162 ASP ASP B . n 
B 2 163 ARG 163 163 163 ARG ARG B . n 
B 2 164 LEU 164 164 164 LEU LEU B . n 
B 2 165 ILE 165 165 165 ILE ILE B . n 
B 2 166 VAL 166 166 166 VAL VAL B . n 
B 2 167 MET 167 167 167 MET MET B . n 
B 2 168 ASN 168 168 168 ASN ASN B . n 
B 2 169 VAL 169 169 169 VAL VAL B . n 
B 2 170 ALA 170 170 170 ALA ALA B . n 
B 2 171 GLU 171 171 171 GLU GLU B . n 
B 2 172 LYS 172 172 172 LYS LYS B . n 
B 2 173 HIS 173 173 173 HIS HIS B . n 
B 2 174 ARG 174 174 174 ARG ARG B . n 
B 2 175 GLY 175 175 175 GLY GLY B . n 
B 2 176 ASN 176 176 176 ASN ASN B . n 
B 2 177 TYR 177 177 177 TYR TYR B . n 
B 2 178 THR 178 178 178 THR THR B . n 
B 2 179 CYS 179 179 179 CYS CYS B . n 
B 2 180 HIS 180 180 180 HIS HIS B . n 
B 2 181 ALA 181 181 181 ALA ALA B . n 
B 2 182 SER 182 182 182 SER SER B . n 
B 2 183 TYR 183 183 183 TYR TYR B . n 
B 2 184 THR 184 184 184 THR THR B . n 
B 2 185 TYR 185 185 185 TYR TYR B . n 
B 2 186 LEU 186 186 186 LEU LEU B . n 
B 2 187 GLY 187 187 187 GLY GLY B . n 
B 2 188 LYS 188 188 188 LYS LYS B . n 
B 2 189 GLN 189 189 189 GLN GLN B . n 
B 2 190 TYR 190 190 190 TYR TYR B . n 
B 2 191 PRO 191 191 191 PRO PRO B . n 
B 2 192 ILE 192 192 192 ILE ILE B . n 
B 2 193 THR 193 193 193 THR THR B . n 
B 2 194 ARG 194 194 194 ARG ARG B . n 
B 2 195 VAL 195 195 195 VAL VAL B . n 
B 2 196 ILE 196 196 196 ILE ILE B . n 
B 2 197 GLU 197 197 197 GLU GLU B . n 
B 2 198 PHE 198 198 198 PHE PHE B . n 
B 2 199 ILE 199 199 199 ILE ILE B . n 
B 2 200 THR 200 200 200 THR THR B . n 
B 2 201 LEU 201 201 201 LEU LEU B . n 
B 2 202 GLU 202 202 202 GLU GLU B . n 
B 2 203 GLU 203 203 203 GLU GLU B . n 
B 2 204 ASN 204 204 204 ASN ASN B . n 
B 2 205 LYS 205 205 205 LYS LYS B . n 
B 2 206 PRO 206 206 206 PRO PRO B . n 
B 2 207 THR 207 207 207 THR THR B . n 
B 2 208 ARG 208 208 208 ARG ARG B . n 
B 2 209 PRO 209 209 209 PRO PRO B . n 
B 2 210 VAL 210 210 210 VAL VAL B . n 
B 2 211 ILE 211 211 211 ILE ILE B . n 
B 2 212 VAL 212 212 212 VAL VAL B . n 
B 2 213 SER 213 213 213 SER SER B . n 
B 2 214 PRO 214 214 214 PRO PRO B . n 
B 2 215 ALA 215 215 215 ALA ALA B . n 
B 2 216 ASN 216 216 216 ASN ASN B . n 
B 2 217 GLU 217 217 217 GLU GLU B . n 
B 2 218 THR 218 218 218 THR THR B . n 
B 2 219 MET 219 219 219 MET MET B . n 
B 2 220 GLU 220 220 220 GLU GLU B . n 
B 2 221 VAL 221 221 221 VAL VAL B . n 
B 2 222 ASP 222 222 222 ASP ASP B . n 
B 2 223 LEU 223 223 223 LEU LEU B . n 
B 2 224 GLY 224 224 224 GLY GLY B . n 
B 2 225 SER 225 225 225 SER SER B . n 
B 2 226 GLN 226 226 226 GLN GLN B . n 
B 2 227 ILE 227 227 227 ILE ILE B . n 
B 2 228 GLN 228 228 228 GLN GLN B . n 
B 2 229 LEU 229 229 229 LEU LEU B . n 
B 2 230 ILE 230 230 230 ILE ILE B . n 
B 2 231 CYS 231 231 231 CYS CYS B . n 
B 2 232 ASN 232 232 232 ASN ASN B . n 
B 2 233 VAL 233 233 233 VAL VAL B . n 
B 2 234 THR 234 234 234 THR THR B . n 
B 2 235 GLY 235 235 235 GLY GLY B . n 
B 2 236 GLN 236 236 236 GLN GLN B . n 
B 2 237 LEU 237 237 237 LEU LEU B . n 
B 2 238 SER 238 238 238 SER SER B . n 
B 2 239 ASP 239 239 239 ASP ASP B . n 
B 2 240 ILE 240 240 240 ILE ILE B . n 
B 2 241 ALA 241 241 241 ALA ALA B . n 
B 2 242 TYR 242 242 242 TYR TYR B . n 
B 2 243 TRP 243 243 243 TRP TRP B . n 
B 2 244 LYS 244 244 244 LYS LYS B . n 
B 2 245 TRP 245 245 245 TRP TRP B . n 
B 2 246 ASN 246 246 246 ASN ASN B . n 
B 2 247 GLY 247 247 247 GLY GLY B . n 
B 2 248 SER 248 248 248 SER SER B . n 
B 2 249 VAL 249 249 249 VAL VAL B . n 
B 2 250 ILE 250 250 250 ILE ILE B . n 
B 2 251 ASP 251 251 251 ASP ASP B . n 
B 2 252 GLU 252 252 252 GLU GLU B . n 
B 2 253 ASP 253 253 253 ASP ASP B . n 
B 2 254 ASP 254 254 254 ASP ASP B . n 
B 2 255 PRO 255 255 255 PRO PRO B . n 
B 2 256 VAL 256 256 256 VAL VAL B . n 
B 2 257 LEU 257 257 257 LEU LEU B . n 
B 2 258 GLY 258 258 258 GLY GLY B . n 
B 2 259 GLU 259 259 259 GLU GLU B . n 
B 2 260 ASP 260 260 260 ASP ASP B . n 
B 2 261 TYR 261 261 261 TYR TYR B . n 
B 2 262 TYR 262 262 262 TYR TYR B . n 
B 2 263 SER 263 263 263 SER SER B . n 
B 2 264 VAL 264 264 264 VAL VAL B . n 
B 2 265 GLU 265 265 265 GLU GLU B . n 
B 2 266 ASN 266 266 266 ASN ASN B . n 
B 2 267 PRO 267 267 267 PRO PRO B . n 
B 2 268 ALA 268 268 268 ALA ALA B . n 
B 2 269 ASN 269 269 269 ASN ASN B . n 
B 2 270 LYS 270 270 270 LYS LYS B . n 
B 2 271 ARG 271 271 271 ARG ARG B . n 
B 2 272 ARG 272 272 272 ARG ARG B . n 
B 2 273 SER 273 273 273 SER SER B . n 
B 2 274 THR 274 274 274 THR THR B . n 
B 2 275 LEU 275 275 275 LEU LEU B . n 
B 2 276 ILE 276 276 276 ILE ILE B . n 
B 2 277 THR 277 277 277 THR THR B . n 
B 2 278 VAL 278 278 278 VAL VAL B . n 
B 2 279 LEU 279 279 279 LEU LEU B . n 
B 2 280 ASN 280 280 280 ASN ASN B . n 
B 2 281 ILE 281 281 281 ILE ILE B . n 
B 2 282 SER 282 282 282 SER SER B . n 
B 2 283 GLU 283 283 283 GLU GLU B . n 
B 2 284 ILE 284 284 284 ILE ILE B . n 
B 2 285 GLU 285 285 285 GLU GLU B . n 
B 2 286 SER 286 286 286 SER SER B . n 
B 2 287 ARG 287 287 287 ARG ARG B . n 
B 2 288 PHE 288 288 288 PHE PHE B . n 
B 2 289 TYR 289 289 289 TYR TYR B . n 
B 2 290 LYS 290 290 290 LYS LYS B . n 
B 2 291 HIS 291 291 291 HIS HIS B . n 
B 2 292 PRO 292 292 292 PRO PRO B . n 
B 2 293 PHE 293 293 293 PHE PHE B . n 
B 2 294 THR 294 294 294 THR THR B . n 
B 2 295 CYS 295 295 295 CYS CYS B . n 
B 2 296 PHE 296 296 296 PHE PHE B . n 
B 2 297 ALA 297 297 297 ALA ALA B . n 
B 2 298 LYS 298 298 298 LYS LYS B . n 
B 2 299 ASN 299 299 299 ASN ASN B . n 
B 2 300 THR 300 300 300 THR THR B . n 
B 2 301 HIS 301 301 301 HIS HIS B . n 
B 2 302 GLY 302 302 302 GLY GLY B . n 
B 2 303 ILE 303 303 303 ILE ILE B . n 
B 2 304 ASP 304 304 304 ASP ASP B . n 
B 2 305 ALA 305 305 305 ALA ALA B . n 
B 2 306 ALA 306 306 306 ALA ALA B . n 
B 2 307 TYR 307 307 307 TYR TYR B . n 
B 2 308 ILE 308 308 308 ILE ILE B . n 
B 2 309 GLN 309 309 309 GLN GLN B . n 
B 2 310 LEU 310 310 310 LEU LEU B . n 
B 2 311 ILE 311 311 311 ILE ILE B . n 
B 2 312 TYR 312 312 312 TYR TYR B . n 
B 2 313 PRO 313 313 313 PRO PRO B . n 
B 2 314 VAL 314 314 314 VAL VAL B . n 
B 2 315 THR 315 315 315 THR THR B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-02-04 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
X-PLOR    'model building' . ? 3 
X-PLOR    refinement       . ? 4 
X-PLOR    phasing          . ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HH12 A ARG 11  ? ? HZ3  B LYS 114 ? ? 1.09 
2 1 HH12 B ARG 9   ? ? H    B VAL 81  ? ? 1.21 
3 1 HZ3  A LYS 27  ? ? HD21 A ASN 129 ? ? 1.24 
4 1 HD21 A ASN 108 ? ? HD22 B ASN 204 ? ? 1.34 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             N 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             GLU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              134 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             GLU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              134 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             C 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             GLU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              134 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                94.77 
_pdbx_validate_rmsd_angle.angle_target_value         111.00 
_pdbx_validate_rmsd_angle.angle_deviation            -16.23 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.70 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 10  ? ? 63.25   122.74  
2  1 SER A 21  ? ? -111.86 61.59   
3  1 PRO A 23  ? ? -27.39  118.27  
4  1 TYR A 24  ? ? 110.04  8.41    
5  1 GLU A 51  ? ? -68.90  93.34   
6  1 ASN A 53  ? ? 77.74   -53.54  
7  1 LYS A 63  ? ? -14.89  -97.66  
8  1 GLU A 64  ? ? -114.66 54.53   
9  1 ASP A 75  ? ? 70.38   34.99   
10 1 ILE A 106 ? ? -87.14  -85.02  
11 1 ASN A 107 ? ? -109.42 63.36   
12 1 PHE A 117 ? ? -114.44 72.51   
13 1 LYS A 138 ? ? 63.97   -70.07  
14 1 GLN A 141 ? ? 143.62  -15.97  
15 1 LYS B 7   ? ? -119.05 -115.18 
16 1 GLU B 10  ? ? -93.06  -108.69 
17 1 GLU B 11  ? ? 97.78   71.97   
18 1 ASN B 20  ? ? 105.31  -8.51   
19 1 PRO B 28  ? ? -69.55  100.00  
20 1 ASN B 30  ? ? -68.09  -132.73 
21 1 GLU B 33  ? ? -111.05 -72.32  
22 1 HIS B 34  ? ? 74.57   128.58  
23 1 THR B 37  ? ? -157.88 -25.55  
24 1 SER B 45  ? ? 43.32   96.52   
25 1 LYS B 46  ? ? -124.01 -137.85 
26 1 PRO B 48  ? ? -61.75  84.14   
27 1 VAL B 49  ? ? -11.03  75.25   
28 1 SER B 50  ? ? 51.34   174.87  
29 1 THR B 51  ? ? -155.42 14.94   
30 1 ARG B 56  ? ? -87.00  -83.66  
31 1 HIS B 60  ? ? -125.24 -129.74 
32 1 LYS B 61  ? ? -60.24  71.52   
33 1 VAL B 67  ? ? 47.89   -92.40  
34 1 ALA B 69  ? ? 37.86   120.20  
35 1 SER B 74  ? ? -50.35  83.23   
36 1 ARG B 82  ? ? -164.85 84.01   
37 1 SER B 85  ? ? -169.99 -30.42  
38 1 TYR B 86  ? ? -60.41  62.29   
39 1 LEU B 88  ? ? -147.62 -1.02   
40 1 ARG B 89  ? ? 32.38   101.42  
41 1 ILE B 92  ? ? -105.19 -78.59  
42 1 SER B 93  ? ? 83.33   92.02   
43 1 ASN B 102 ? ? 75.12   -19.72  
44 1 TYR B 127 ? ? 34.44   43.35   
45 1 ASN B 133 ? ? -48.78  97.08   
46 1 GLU B 134 ? ? -156.78 56.05   
47 1 ASN B 135 ? ? 75.96   34.67   
48 1 LYS B 161 ? ? 57.83   -135.53 
49 1 LYS B 172 ? ? -69.69  15.08   
50 1 LEU B 186 ? ? 72.36   50.05   
51 1 ALA B 215 ? ? -62.51  61.49   
52 1 SER B 225 ? ? -49.71  -175.28 
53 1 ASN B 246 ? ? 60.07   61.89   
54 1 ASP B 253 ? ? -94.58  31.75   
55 1 ASN B 269 ? ? -162.96 95.96   
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 TYR A 68 ? ? 0.074 'SIDE CHAIN' 
2 1 TYR B 41 ? ? 0.075 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B LEU 1 ? B LEU 1 
2 1 Y 1 B GLU 2 ? B GLU 2 
3 1 Y 1 B ALA 3 ? B ALA 3 
4 1 Y 1 B ASP 4 ? B ASP 4 
5 1 Y 1 B LYS 5 ? B LYS 5 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  154 2  HOH HOH A . 
C 3 HOH 2  155 4  HOH HOH A . 
C 3 HOH 3  156 14 HOH HOH A . 
C 3 HOH 4  157 15 HOH HOH A . 
C 3 HOH 5  158 16 HOH HOH A . 
C 3 HOH 6  159 17 HOH HOH A . 
C 3 HOH 7  160 22 HOH HOH A . 
C 3 HOH 8  161 23 HOH HOH A . 
D 3 HOH 1  316 1  HOH HOH B . 
D 3 HOH 2  317 3  HOH HOH B . 
D 3 HOH 3  318 5  HOH HOH B . 
D 3 HOH 4  319 6  HOH HOH B . 
D 3 HOH 5  320 7  HOH HOH B . 
D 3 HOH 6  321 8  HOH HOH B . 
D 3 HOH 7  322 9  HOH HOH B . 
D 3 HOH 8  323 10 HOH HOH B . 
D 3 HOH 9  324 11 HOH HOH B . 
D 3 HOH 10 325 12 HOH HOH B . 
D 3 HOH 11 326 13 HOH HOH B . 
D 3 HOH 12 327 18 HOH HOH B . 
D 3 HOH 13 328 19 HOH HOH B . 
D 3 HOH 14 329 20 HOH HOH B . 
D 3 HOH 15 330 21 HOH HOH B . 
D 3 HOH 16 331 24 HOH HOH B . 
#