data_1IU5
# 
_entry.id   1IU5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1IU5         pdb_00001iu5 10.2210/pdb1iu5/pdb 
RCSB  RCSB005278   ?            ?                   
WWPDB D_1000005278 ?            ?                   
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1IU6 
_pdbx_database_related.details        '1IU6 contains Neutron Crystal Structure of the same protein.' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IU5 
_pdbx_database_status.recvd_initial_deposition_date   2002-02-27 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chatake, T.'   1 
'Kurihara, K.'  2 
'Tanaka, I.'    3 
'Tsyba, I.'     4 
'Bau, R.'       5 
'Jenney, F.E.'  6 
'Adams, M.W.W.' 7 
'Niimura, N.'   8 
# 
_citation.id                        primary 
_citation.title                     'A neutron crystallographic analysis of a rubredoxin mutant at 1.6 A resolution.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            60 
_citation.page_first                1364 
_citation.page_last                 1373 
_citation.year                      2004 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15272158 
_citation.pdbx_database_id_DOI      10.1107/S090744490401176X 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Chatake, T.'  1 ? 
primary 'Kurihara, K.' 2 ? 
primary 'Tanaka, I.'   3 ? 
primary 'Tsyba, I.'    4 ? 
primary 'Bau, R.'      5 ? 
primary 'Jenney, F.E.' 6 ? 
primary 'Adams, M.W.'  7 ? 
primary 'Niimura, N.'  8 ? 
# 
_cell.entry_id           1IU5 
_cell.length_a           34.480 
_cell.length_b           35.700 
_cell.length_c           43.160 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IU5 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man rubredoxin     5863.470 1  ? 'W3Y, I23V, L32I' ? ? 
2 non-polymer syn 'FE (III) ION' 55.845   1  ? ?                 ? ? 
3 water       nat water          18.015   53 ? ?                 ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       AKYVCKICGYIYDEDAGDPDNGVSPGTKFEEIPDDWVCPICGAPKSEFEKLED 
_entity_poly.pdbx_seq_one_letter_code_can   AKYVCKICGYIYDEDAGDPDNGVSPGTKFEEIPDDWVCPICGAPKSEFEKLED 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  LYS n 
1 3  TYR n 
1 4  VAL n 
1 5  CYS n 
1 6  LYS n 
1 7  ILE n 
1 8  CYS n 
1 9  GLY n 
1 10 TYR n 
1 11 ILE n 
1 12 TYR n 
1 13 ASP n 
1 14 GLU n 
1 15 ASP n 
1 16 ALA n 
1 17 GLY n 
1 18 ASP n 
1 19 PRO n 
1 20 ASP n 
1 21 ASN n 
1 22 GLY n 
1 23 VAL n 
1 24 SER n 
1 25 PRO n 
1 26 GLY n 
1 27 THR n 
1 28 LYS n 
1 29 PHE n 
1 30 GLU n 
1 31 GLU n 
1 32 ILE n 
1 33 PRO n 
1 34 ASP n 
1 35 ASP n 
1 36 TRP n 
1 37 VAL n 
1 38 CYS n 
1 39 PRO n 
1 40 ILE n 
1 41 CYS n 
1 42 GLY n 
1 43 ALA n 
1 44 PRO n 
1 45 LYS n 
1 46 SER n 
1 47 GLU n 
1 48 PHE n 
1 49 GLU n 
1 50 LYS n 
1 51 LEU n 
1 52 GLU n 
1 53 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Pyrococcus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pyrococcus furiosus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2261 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RUBR_PYRFU 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   AKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P24297 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1IU5 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 53 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P24297 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  53 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       53 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1IU5 TYR A 3  ? UNP P24297 TRP 3  'engineered mutation' 3  1 
1 1IU5 VAL A 23 ? UNP P24297 ILE 23 'engineered mutation' 23 2 
1 1IU5 ILE A 32 ? UNP P24297 LEU 32 'engineered mutation' 32 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE            ? 'C3 H7 N O2'     89.093  
ASN 'L-peptide linking' y ASPARAGINE         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'    ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE           ? 'C3 H7 N O2 S'   121.158 
DOD non-polymer         . 'DEUTERATED WATER' ? 'D2 O'           20.028  
FE  non-polymer         . 'FE (III) ION'     ? 'Fe 3'           55.845  
GLU 'L-peptide linking' y 'GLUTAMIC ACID'    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE            ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE             ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE      ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE          ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN         ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE             ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1IU5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   45.65 
_exptl_crystal.density_Matthews      2.26 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    'Na/K phosphate, VAPOR DIFFUSION' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAC Science DIP-2000' 
_diffrn_detector.pdbx_collection_date   2001-05-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        MACSCIENCE 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1IU5 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            1.50 
_reflns.number_obs                   8876 
_reflns.number_all                   8876 
_reflns.percent_possible_obs         98.6 
_reflns.pdbx_Rmerge_I_obs            0.077 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        25.2 
_reflns.B_iso_Wilson_estimate        13.9 
_reflns.pdbx_redundancy              4.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.55 
_reflns_shell.percent_possible_all   97.7 
_reflns_shell.Rmerge_I_obs           0.19 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1IU5 
_refine.ls_number_reflns_obs                     8456 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             10 
_refine.ls_d_res_high                            1.50 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.187 
_refine.ls_R_factor_R_free                       0.203 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  909 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               15.9 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1BRF' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1IU5 
_refine_analyze.Luzzati_coordinate_error_obs    0.16 
_refine_analyze.Luzzati_sigma_a_obs             0.06 
_refine_analyze.Luzzati_d_res_low_obs           5 
_refine_analyze.Luzzati_coordinate_error_free   0.18 
_refine_analyze.Luzzati_sigma_a_free            0.11 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        392 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             53 
_refine_hist.number_atoms_total               446 
_refine_hist.d_res_high                       1.50 
_refine_hist.d_res_low                        10 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.4   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.50 
_refine_ls_shell.d_res_low                        1.59 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.243 
_refine_ls_shell.percent_reflns_obs               88.2 
_refine_ls_shell.R_factor_R_free                  0.259 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_obs                1140 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1IU5 
_struct.title                     'X-ray Crystal Structure of the rubredoxin mutant from Pyrococcus Furiosus' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IU5 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSPORT' 
_struct_keywords.text            'rubredoxin, mutant, thermostability, ELECTRON TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 18 ? GLY A 22 ? ASP A 18 GLY A 22 5 ? 5 
HELX_P HELX_P2 2 LYS A 28 ? ILE A 32 ? LYS A 28 ILE A 32 5 ? 5 
HELX_P HELX_P3 3 PRO A 44 ? SER A 46 ? PRO A 44 SER A 46 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A CYS 5  SG ? ? ? 1_555 B FE . FE ? ? A CYS 5  A FE 152 1_555 ? ? ? ? ? ? ? 2.268 ? ? 
metalc2 metalc ? ? A CYS 8  SG ? ? ? 1_555 B FE . FE ? ? A CYS 8  A FE 152 1_555 ? ? ? ? ? ? ? 2.263 ? ? 
metalc3 metalc ? ? A CYS 38 SG ? ? ? 1_555 B FE . FE ? ? A CYS 38 A FE 152 1_555 ? ? ? ? ? ? ? 2.305 ? ? 
metalc4 metalc ? ? A CYS 41 SG ? ? ? 1_555 B FE . FE ? ? A CYS 41 A FE 152 1_555 ? ? ? ? ? ? ? 2.262 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 11 ? ASP A 13 ? ILE A 11 ASP A 13 
A 2 LYS A 2  ? CYS A 5  ? LYS A 2  CYS A 5  
A 3 PHE A 48 ? LYS A 50 ? PHE A 48 LYS A 50 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 12 ? O TYR A 12 N TYR A 3  ? N TYR A 3  
A 2 3 N VAL A 4  ? N VAL A 4  O GLU A 49 ? O GLU A 49 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    FE 
_struct_site.pdbx_auth_seq_id     152 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE FE A 152' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 5  ? CYS A 5  . ? 1_555 ? 
2 AC1 4 CYS A 8  ? CYS A 8  . ? 1_555 ? 
3 AC1 4 CYS A 38 ? CYS A 38 . ? 1_555 ? 
4 AC1 4 CYS A 41 ? CYS A 41 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1IU5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       .000000 
_database_PDB_matrix.origx[1][3]       .000000 
_database_PDB_matrix.origx[2][1]       .000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       .000000 
_database_PDB_matrix.origx[3][1]       .000000 
_database_PDB_matrix.origx[3][2]       .000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   .00000 
_database_PDB_matrix.origx_vector[2]   .00000 
_database_PDB_matrix.origx_vector[3]   .00000 
# 
_atom_sites.entry_id                    1IU5 
_atom_sites.fract_transf_matrix[1][1]   .029002 
_atom_sites.fract_transf_matrix[1][2]   .000000 
_atom_sites.fract_transf_matrix[1][3]   .000000 
_atom_sites.fract_transf_matrix[2][1]   .000000 
_atom_sites.fract_transf_matrix[2][2]   .028011 
_atom_sites.fract_transf_matrix[2][3]   .000000 
_atom_sites.fract_transf_matrix[3][1]   .000000 
_atom_sites.fract_transf_matrix[3][2]   .000000 
_atom_sites.fract_transf_matrix[3][3]   .023170 
_atom_sites.fract_transf_vector[1]      .00000 
_atom_sites.fract_transf_vector[2]      .00000 
_atom_sites.fract_transf_vector[3]      .00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N   . ALA A 1 1  ? 21.694 -3.056  3.124  1.00 16.12 ? 1   ALA A N   1 
ATOM   2   C  CA  . ALA A 1 1  ? 21.532 -1.966  2.103  1.00 15.29 ? 1   ALA A CA  1 
ATOM   3   C  C   . ALA A 1 1  ? 20.818 -0.765  2.701  1.00 14.54 ? 1   ALA A C   1 
ATOM   4   O  O   . ALA A 1 1  ? 20.190 -0.861  3.752  1.00 14.37 ? 1   ALA A O   1 
ATOM   5   C  CB  . ALA A 1 1  ? 20.761 -2.481  0.890  1.00 16.19 ? 1   ALA A CB  1 
ATOM   6   N  N   . LYS A 1 2  ? 20.939 0.373   2.029  1.00 13.65 ? 2   LYS A N   1 
ATOM   7   C  CA  . LYS A 1 2  ? 20.295 1.598   2.474  1.00 12.02 ? 2   LYS A CA  1 
ATOM   8   C  C   . LYS A 1 2  ? 19.355 2.082   1.372  1.00 12.18 ? 2   LYS A C   1 
ATOM   9   O  O   . LYS A 1 2  ? 19.600 1.847   0.184  1.00 11.88 ? 2   LYS A O   1 
ATOM   10  C  CB  . LYS A 1 2  ? 21.333 2.669   2.808  1.00 14.81 ? 2   LYS A CB  1 
ATOM   11  C  CG  . LYS A 1 2  ? 22.183 2.353   4.035  1.00 16.58 ? 2   LYS A CG  1 
ATOM   12  C  CD  . LYS A 1 2  ? 23.197 3.451   4.279  1.00 20.49 ? 2   LYS A CD  1 
ATOM   13  C  CE  . LYS A 1 2  ? 24.146 3.113   5.418  1.00 23.84 ? 2   LYS A CE  1 
ATOM   14  N  NZ  . LYS A 1 2  ? 25.188 4.176   5.547  1.00 26.60 ? 2   LYS A NZ  1 
ATOM   15  N  N   . TYR A 1 3  ? 18.238 2.673   1.795  1.00 9.77  ? 3   TYR A N   1 
ATOM   16  C  CA  . TYR A 1 3  ? 17.226 3.200   0.886  1.00 8.46  ? 3   TYR A CA  1 
ATOM   17  C  C   . TYR A 1 3  ? 16.912 4.634   1.273  1.00 9.76  ? 3   TYR A C   1 
ATOM   18  O  O   . TYR A 1 3  ? 16.767 4.951   2.457  1.00 11.80 ? 3   TYR A O   1 
ATOM   19  C  CB  . TYR A 1 3  ? 15.922 2.395   0.977  1.00 7.91  ? 3   TYR A CB  1 
ATOM   20  C  CG  . TYR A 1 3  ? 15.986 0.989   0.439  1.00 10.22 ? 3   TYR A CG  1 
ATOM   21  C  CD1 . TYR A 1 3  ? 15.316 0.648   -0.723 1.00 13.30 ? 3   TYR A CD1 1 
ATOM   22  C  CD2 . TYR A 1 3  ? 16.707 0.002   1.096  1.00 12.19 ? 3   TYR A CD2 1 
ATOM   23  C  CE1 . TYR A 1 3  ? 15.361 -0.628  -1.220 1.00 15.85 ? 3   TYR A CE1 1 
ATOM   24  C  CE2 . TYR A 1 3  ? 16.760 -1.288  0.593  1.00 15.20 ? 3   TYR A CE2 1 
ATOM   25  C  CZ  . TYR A 1 3  ? 16.080 -1.588  -0.564 1.00 15.31 ? 3   TYR A CZ  1 
ATOM   26  O  OH  . TYR A 1 3  ? 16.107 -2.862  -1.084 1.00 19.41 ? 3   TYR A OH  1 
ATOM   27  N  N   . VAL A 1 4  ? 16.751 5.488   0.271  1.00 8.57  ? 4   VAL A N   1 
ATOM   28  C  CA  . VAL A 1 4  ? 16.448 6.878   0.529  1.00 8.47  ? 4   VAL A CA  1 
ATOM   29  C  C   . VAL A 1 4  ? 15.004 7.223   0.203  1.00 7.19  ? 4   VAL A C   1 
ATOM   30  O  O   . VAL A 1 4  ? 14.454 6.769   -0.804 1.00 8.18  ? 4   VAL A O   1 
ATOM   31  C  CB  . VAL A 1 4  ? 17.393 7.821   -0.256 1.00 8.02  ? 4   VAL A CB  1 
ATOM   32  C  CG1 . VAL A 1 4  ? 17.126 7.751   -1.760 1.00 7.78  ? 4   VAL A CG1 1 
ATOM   33  C  CG2 . VAL A 1 4  ? 17.261 9.238   0.255  1.00 9.54  ? 4   VAL A CG2 1 
ATOM   34  N  N   . CYS A 1 5  ? 14.364 7.953   1.109  1.00 6.19  ? 5   CYS A N   1 
ATOM   35  C  CA  . CYS A 1 5  ? 13.004 8.417   0.865  1.00 6.27  ? 5   CYS A CA  1 
ATOM   36  C  C   . CYS A 1 5  ? 13.196 9.578   -0.117 1.00 7.29  ? 5   CYS A C   1 
ATOM   37  O  O   . CYS A 1 5  ? 13.846 10.570  0.211  1.00 7.50  ? 5   CYS A O   1 
ATOM   38  C  CB  . CYS A 1 5  ? 12.378 8.922   2.159  1.00 7.66  ? 5   CYS A CB  1 
ATOM   39  S  SG  . CYS A 1 5  ? 10.793 9.748   1.858  1.00 6.57  ? 5   CYS A SG  1 
ATOM   40  N  N   . LYS A 1 6  ? 12.625 9.466   -1.310 1.00 7.41  ? 6   LYS A N   1 
ATOM   41  C  CA  . LYS A 1 6  ? 12.806 10.519  -2.308 1.00 10.19 ? 6   LYS A CA  1 
ATOM   42  C  C   . LYS A 1 6  ? 12.137 11.837  -1.970 1.00 10.96 ? 6   LYS A C   1 
ATOM   43  O  O   . LYS A 1 6  ? 12.460 12.867  -2.558 1.00 13.96 ? 6   LYS A O   1 
ATOM   44  C  CB  . LYS A 1 6  ? 12.322 10.038  -3.672 1.00 14.36 ? 6   LYS A CB  1 
ATOM   45  C  CG  . LYS A 1 6  ? 13.083 8.840   -4.210 1.00 19.22 ? 6   LYS A CG  1 
ATOM   46  C  CD  . LYS A 1 6  ? 12.493 8.337   -5.533 1.00 23.24 ? 6   LYS A CD  1 
ATOM   47  C  CE  . LYS A 1 6  ? 10.983 8.090   -5.450 1.00 25.97 ? 6   LYS A CE  1 
ATOM   48  N  NZ  . LYS A 1 6  ? 10.401 7.526   -6.719 1.00 31.13 ? 6   LYS A NZ  1 
ATOM   49  N  N   . ILE A 1 7  ? 11.197 11.795  -1.038 1.00 9.21  ? 7   ILE A N   1 
ATOM   50  C  CA  . ILE A 1 7  ? 10.467 12.984  -0.635 1.00 11.10 ? 7   ILE A CA  1 
ATOM   51  C  C   . ILE A 1 7  ? 11.246 13.853  0.344  1.00 10.99 ? 7   ILE A C   1 
ATOM   52  O  O   . ILE A 1 7  ? 11.423 15.052  0.109  1.00 14.02 ? 7   ILE A O   1 
ATOM   53  C  CB  . ILE A 1 7  ? 9.125  12.613  0.048  1.00 12.52 ? 7   ILE A CB  1 
ATOM   54  C  CG1 . ILE A 1 7  ? 8.304  11.652  -0.828 1.00 16.25 ? 7   ILE A CG1 1 
ATOM   55  C  CG2 . ILE A 1 7  ? 8.345  13.883  0.411  1.00 14.25 ? 7   ILE A CG2 1 
ATOM   56  C  CD1 . ILE A 1 7  ? 7.918  12.214  -2.150 1.00 18.19 ? 7   ILE A CD1 1 
ATOM   57  N  N   . CYS A 1 8  ? 11.758 13.246  1.415  1.00 9.19  ? 8   CYS A N   1 
ATOM   58  C  CA  . CYS A 1 8  ? 12.439 14.017  2.451  1.00 9.45  ? 8   CYS A CA  1 
ATOM   59  C  C   . CYS A 1 8  ? 13.912 13.802  2.705  1.00 8.87  ? 8   CYS A C   1 
ATOM   60  O  O   . CYS A 1 8  ? 14.500 14.561  3.476  1.00 9.79  ? 8   CYS A O   1 
ATOM   61  C  CB  . CYS A 1 8  ? 11.715 13.840  3.788  1.00 8.48  ? 8   CYS A CB  1 
ATOM   62  S  SG  . CYS A 1 8  ? 11.928 12.186  4.512  1.00 8.26  ? 8   CYS A SG  1 
ATOM   63  N  N   . GLY A 1 9  ? 14.489 12.736  2.159  1.00 7.57  ? 9   GLY A N   1 
ATOM   64  C  CA  . GLY A 1 9  ? 15.904 12.490  2.375  1.00 8.38  ? 9   GLY A CA  1 
ATOM   65  C  C   . GLY A 1 9  ? 16.244 11.555  3.521  1.00 8.43  ? 9   GLY A C   1 
ATOM   66  O  O   . GLY A 1 9  ? 17.423 11.315  3.778  1.00 9.13  ? 9   GLY A O   1 
ATOM   67  N  N   . TYR A 1 10 ? 15.238 11.049  4.228  1.00 7.32  ? 10  TYR A N   1 
ATOM   68  C  CA  . TYR A 1 10 ? 15.473 10.083  5.307  1.00 7.21  ? 10  TYR A CA  1 
ATOM   69  C  C   . TYR A 1 10 ? 16.078 8.822   4.681  1.00 7.76  ? 10  TYR A C   1 
ATOM   70  O  O   . TYR A 1 10 ? 15.657 8.386   3.612  1.00 10.01 ? 10  TYR A O   1 
ATOM   71  C  CB  . TYR A 1 10 ? 14.142 9.721   5.981  1.00 6.36  ? 10  TYR A CB  1 
ATOM   72  C  CG  . TYR A 1 10 ? 14.194 8.488   6.841  1.00 9.24  ? 10  TYR A CG  1 
ATOM   73  C  CD1 . TYR A 1 10 ? 14.745 8.531   8.114  1.00 8.31  ? 10  TYR A CD1 1 
ATOM   74  C  CD2 . TYR A 1 10 ? 13.709 7.286   6.369  1.00 9.27  ? 10  TYR A CD2 1 
ATOM   75  C  CE1 . TYR A 1 10 ? 14.813 7.396   8.892  1.00 9.96  ? 10  TYR A CE1 1 
ATOM   76  C  CE2 . TYR A 1 10 ? 13.765 6.153   7.136  1.00 10.66 ? 10  TYR A CE2 1 
ATOM   77  C  CZ  . TYR A 1 10 ? 14.322 6.219   8.395  1.00 10.50 ? 10  TYR A CZ  1 
ATOM   78  O  OH  . TYR A 1 10 ? 14.379 5.062   9.139  1.00 12.34 ? 10  TYR A OH  1 
ATOM   79  N  N   . ILE A 1 11 ? 17.061 8.245   5.355  1.00 8.47  ? 11  ILE A N   1 
ATOM   80  C  CA  . ILE A 1 11 ? 17.706 7.038   4.867  1.00 9.18  ? 11  ILE A CA  1 
ATOM   81  C  C   . ILE A 1 11 ? 17.332 5.841   5.722  1.00 9.38  ? 11  ILE A C   1 
ATOM   82  O  O   . ILE A 1 11 ? 17.554 5.868   6.939  1.00 12.06 ? 11  ILE A O   1 
ATOM   83  C  CB  . ILE A 1 11 ? 19.244 7.153   4.923  1.00 10.35 ? 11  ILE A CB  1 
ATOM   84  C  CG1 . ILE A 1 11 ? 19.735 8.395   4.173  1.00 14.87 ? 11  ILE A CG1 1 
ATOM   85  C  CG2 . ILE A 1 11 ? 19.884 5.857   4.415  1.00 13.15 ? 11  ILE A CG2 1 
ATOM   86  C  CD1 . ILE A 1 11 ? 19.711 8.275   2.697  1.00 16.32 ? 11  ILE A CD1 1 
ATOM   87  N  N   . TYR A 1 12 ? 16.671 4.856   5.125  1.00 8.93  ? 12  TYR A N   1 
ATOM   88  C  CA  . TYR A 1 12 ? 16.379 3.633   5.870  1.00 8.06  ? 12  TYR A CA  1 
ATOM   89  C  C   . TYR A 1 12 ? 17.613 2.740   5.714  1.00 9.21  ? 12  TYR A C   1 
ATOM   90  O  O   . TYR A 1 12 ? 18.048 2.445   4.593  1.00 10.18 ? 12  TYR A O   1 
ATOM   91  C  CB  . TYR A 1 12 ? 15.150 2.888   5.334  1.00 7.83  ? 12  TYR A CB  1 
ATOM   92  C  CG  . TYR A 1 12 ? 14.942 1.576   6.055  1.00 6.43  ? 12  TYR A CG  1 
ATOM   93  C  CD1 . TYR A 1 12 ? 14.384 1.548   7.320  1.00 8.10  ? 12  TYR A CD1 1 
ATOM   94  C  CD2 . TYR A 1 12 ? 15.380 0.376   5.500  1.00 8.33  ? 12  TYR A CD2 1 
ATOM   95  C  CE1 . TYR A 1 12 ? 14.274 0.370   8.020  1.00 9.59  ? 12  TYR A CE1 1 
ATOM   96  C  CE2 . TYR A 1 12 ? 15.251 -0.820  6.190  1.00 9.24  ? 12  TYR A CE2 1 
ATOM   97  C  CZ  . TYR A 1 12 ? 14.705 -0.804  7.452  1.00 9.46  ? 12  TYR A CZ  1 
ATOM   98  O  OH  . TYR A 1 12 ? 14.609 -1.969  8.173  1.00 11.62 ? 12  TYR A OH  1 
ATOM   99  N  N   . ASP A 1 13 ? 18.202 2.351   6.834  1.00 7.38  ? 13  ASP A N   1 
ATOM   100 C  CA  . ASP A 1 13 ? 19.374 1.489   6.830  1.00 9.99  ? 13  ASP A CA  1 
ATOM   101 C  C   . ASP A 1 13 ? 18.894 0.179   7.415  1.00 9.56  ? 13  ASP A C   1 
ATOM   102 O  O   . ASP A 1 13 ? 18.391 0.155   8.536  1.00 10.10 ? 13  ASP A O   1 
ATOM   103 C  CB  . ASP A 1 13 ? 20.449 2.107   7.729  1.00 11.17 ? 13  ASP A CB  1 
ATOM   104 C  CG  . ASP A 1 13 ? 21.731 1.300   7.781  1.00 13.38 ? 13  ASP A CG  1 
ATOM   105 O  OD1 . ASP A 1 13 ? 21.810 0.202   7.202  1.00 13.73 ? 13  ASP A OD1 1 
ATOM   106 O  OD2 . ASP A 1 13 ? 22.676 1.805   8.425  1.00 20.59 ? 13  ASP A OD2 1 
ATOM   107 N  N   . GLU A 1 14 ? 19.043 -0.899  6.652  1.00 9.47  ? 14  GLU A N   1 
ATOM   108 C  CA  . GLU A 1 14 ? 18.611 -2.211  7.123  1.00 10.24 ? 14  GLU A CA  1 
ATOM   109 C  C   . GLU A 1 14 ? 19.314 -2.627  8.413  1.00 12.40 ? 14  GLU A C   1 
ATOM   110 O  O   . GLU A 1 14 ? 18.728 -3.323  9.238  1.00 13.77 ? 14  GLU A O   1 
ATOM   111 C  CB  . GLU A 1 14 ? 18.800 -3.254  6.028  1.00 10.76 ? 14  GLU A CB  1 
ATOM   112 C  CG  . GLU A 1 14 ? 17.827 -3.053  4.876  1.00 12.60 ? 14  GLU A CG  1 
ATOM   113 C  CD  . GLU A 1 14 ? 18.107 -3.940  3.677  1.00 14.75 ? 14  GLU A CD  1 
ATOM   114 O  OE1 . GLU A 1 14 ? 19.240 -4.463  3.547  1.00 17.15 ? 14  GLU A OE1 1 
ATOM   115 O  OE2 . GLU A 1 14 ? 17.188 -4.117  2.855  1.00 14.08 ? 14  GLU A OE2 1 
ATOM   116 N  N   . ASP A 1 15 ? 20.537 -2.146  8.622  1.00 13.23 ? 15  ASP A N   1 
ATOM   117 C  CA  . ASP A 1 15 ? 21.281 -2.490  9.844  1.00 14.47 ? 15  ASP A CA  1 
ATOM   118 C  C   . ASP A 1 15 ? 20.704 -1.808  11.085 1.00 15.16 ? 15  ASP A C   1 
ATOM   119 O  O   . ASP A 1 15 ? 20.829 -2.322  12.196 1.00 15.89 ? 15  ASP A O   1 
ATOM   120 C  CB  . ASP A 1 15 ? 22.759 -2.100  9.717  1.00 18.29 ? 15  ASP A CB  1 
ATOM   121 C  CG  . ASP A 1 15 ? 23.518 -2.947  8.715  1.00 20.72 ? 15  ASP A CG  1 
ATOM   122 O  OD1 . ASP A 1 15 ? 23.085 -4.076  8.394  1.00 23.27 ? 15  ASP A OD1 1 
ATOM   123 O  OD2 . ASP A 1 15 ? 24.581 -2.475  8.257  1.00 24.88 ? 15  ASP A OD2 1 
ATOM   124 N  N   . ALA A 1 16 ? 20.065 -0.659  10.894 1.00 12.27 ? 16  ALA A N   1 
ATOM   125 C  CA  . ALA A 1 16 ? 19.480 0.109   11.985 1.00 12.30 ? 16  ALA A CA  1 
ATOM   126 C  C   . ALA A 1 16 ? 18.000 -0.181  12.209 1.00 11.99 ? 16  ALA A C   1 
ATOM   127 O  O   . ALA A 1 16 ? 17.497 -0.051  13.329 1.00 12.63 ? 16  ALA A O   1 
ATOM   128 C  CB  . ALA A 1 16 ? 19.665 1.600   11.706 1.00 13.50 ? 16  ALA A CB  1 
ATOM   129 N  N   . GLY A 1 17 ? 17.297 -0.548  11.142 1.00 11.71 ? 17  GLY A N   1 
ATOM   130 C  CA  . GLY A 1 17 ? 15.870 -0.794  11.249 1.00 11.10 ? 17  GLY A CA  1 
ATOM   131 C  C   . GLY A 1 17 ? 15.163 0.512   11.606 1.00 10.61 ? 17  GLY A C   1 
ATOM   132 O  O   . GLY A 1 17 ? 15.658 1.607   11.317 1.00 11.60 ? 17  GLY A O   1 
ATOM   133 N  N   . ASP A 1 18 ? 14.002 0.393   12.236 1.00 10.40 ? 18  ASP A N   1 
ATOM   134 C  CA  . ASP A 1 18 ? 13.214 1.542   12.684 1.00 9.72  ? 18  ASP A CA  1 
ATOM   135 C  C   . ASP A 1 18 ? 12.467 0.988   13.892 1.00 10.04 ? 18  ASP A C   1 
ATOM   136 O  O   . ASP A 1 18 ? 11.265 0.770   13.846 1.00 10.63 ? 18  ASP A O   1 
ATOM   137 C  CB  . ASP A 1 18 ? 12.240 1.974   11.578 1.00 11.08 ? 18  ASP A CB  1 
ATOM   138 C  CG  . ASP A 1 18 ? 11.456 3.234   11.933 1.00 13.62 ? 18  ASP A CG  1 
ATOM   139 O  OD1 . ASP A 1 18 ? 11.916 4.034   12.784 1.00 16.44 ? 18  ASP A OD1 1 
ATOM   140 O  OD2 . ASP A 1 18 ? 10.382 3.423   11.333 1.00 12.87 ? 18  ASP A OD2 1 
ATOM   141 N  N   . PRO A 1 19 ? 13.201 0.728   14.985 1.00 11.92 ? 19  PRO A N   1 
ATOM   142 C  CA  . PRO A 1 19 ? 12.604 0.171   16.205 1.00 13.12 ? 19  PRO A CA  1 
ATOM   143 C  C   . PRO A 1 19 ? 11.394 0.879   16.800 1.00 15.10 ? 19  PRO A C   1 
ATOM   144 O  O   . PRO A 1 19 ? 10.498 0.217   17.325 1.00 16.62 ? 19  PRO A O   1 
ATOM   145 C  CB  . PRO A 1 19 ? 13.780 0.088   17.189 1.00 14.43 ? 19  PRO A CB  1 
ATOM   146 C  CG  . PRO A 1 19 ? 14.848 0.950   16.620 1.00 15.51 ? 19  PRO A CG  1 
ATOM   147 C  CD  . PRO A 1 19 ? 14.649 0.958   15.131 1.00 12.93 ? 19  PRO A CD  1 
ATOM   148 N  N   . ASP A 1 20 ? 11.356 2.206   16.708 1.00 16.73 ? 20  ASP A N   1 
ATOM   149 C  CA  . ASP A 1 20 ? 10.238 2.969   17.255 1.00 18.75 ? 20  ASP A CA  1 
ATOM   150 C  C   . ASP A 1 20 ? 8.937  2.693   16.511 1.00 18.19 ? 20  ASP A C   1 
ATOM   151 O  O   . ASP A 1 20 ? 7.844  2.940   17.035 1.00 19.83 ? 20  ASP A O   1 
ATOM   152 C  CB  . ASP A 1 20 ? 10.545 4.470   17.236 1.00 22.14 ? 20  ASP A CB  1 
ATOM   153 C  CG  . ASP A 1 20 ? 11.736 4.845   18.116 1.00 25.71 ? 20  ASP A CG  1 
ATOM   154 O  OD1 . ASP A 1 20 ? 12.157 4.024   18.964 1.00 29.90 ? 20  ASP A OD1 1 
ATOM   155 O  OD2 . ASP A 1 20 ? 12.261 5.966   17.951 1.00 29.88 ? 20  ASP A OD2 1 
ATOM   156 N  N   . ASN A 1 21 ? 9.044  2.149   15.304 1.00 16.09 ? 21  ASN A N   1 
ATOM   157 C  CA  . ASN A 1 21 ? 7.858  1.838   14.532 1.00 14.30 ? 21  ASN A CA  1 
ATOM   158 C  C   . ASN A 1 21 ? 7.685  0.356   14.245 1.00 13.94 ? 21  ASN A C   1 
ATOM   159 O  O   . ASN A 1 21 ? 7.079  -0.037  13.246 1.00 16.42 ? 21  ASN A O   1 
ATOM   160 C  CB  . ASN A 1 21 ? 7.808  2.686   13.269 1.00 16.46 ? 21  ASN A CB  1 
ATOM   161 C  CG  . ASN A 1 21 ? 7.643  4.158   13.584 1.00 17.85 ? 21  ASN A CG  1 
ATOM   162 O  OD1 . ASN A 1 21 ? 6.575  4.585   14.029 1.00 20.27 ? 21  ASN A OD1 1 
ATOM   163 N  ND2 . ASN A 1 21 ? 8.713  4.931   13.416 1.00 19.64 ? 21  ASN A ND2 1 
ATOM   164 N  N   . GLY A 1 22 ? 8.261  -0.461  15.124 1.00 12.30 ? 22  GLY A N   1 
ATOM   165 C  CA  . GLY A 1 22 ? 8.121  -1.897  15.025 1.00 12.36 ? 22  GLY A CA  1 
ATOM   166 C  C   . GLY A 1 22 ? 8.978  -2.675  14.056 1.00 10.80 ? 22  GLY A C   1 
ATOM   167 O  O   . GLY A 1 22 ? 8.647  -3.820  13.736 1.00 13.74 ? 22  GLY A O   1 
ATOM   168 N  N   . VAL A 1 23 ? 10.101 -2.094  13.641 1.00 9.96  ? 23  VAL A N   1 
ATOM   169 C  CA  . VAL A 1 23 ? 11.007 -2.743  12.698 1.00 10.28 ? 23  VAL A CA  1 
ATOM   170 C  C   . VAL A 1 23 ? 12.365 -2.947  13.373 1.00 10.50 ? 23  VAL A C   1 
ATOM   171 O  O   . VAL A 1 23 ? 13.112 -2.004  13.599 1.00 11.24 ? 23  VAL A O   1 
ATOM   172 C  CB  . VAL A 1 23 ? 11.137 -1.884  11.414 1.00 11.21 ? 23  VAL A CB  1 
ATOM   173 C  CG1 . VAL A 1 23 ? 12.074 -2.547  10.410 1.00 10.99 ? 23  VAL A CG1 1 
ATOM   174 C  CG2 . VAL A 1 23 ? 9.750  -1.673  10.800 1.00 12.31 ? 23  VAL A CG2 1 
ATOM   175 N  N   . SER A 1 24 ? 12.697 -4.191  13.686 1.00 10.49 ? 24  SER A N   1 
ATOM   176 C  CA  . SER A 1 24 ? 13.962 -4.470  14.356 1.00 10.44 ? 24  SER A CA  1 
ATOM   177 C  C   . SER A 1 24 ? 15.186 -4.343  13.451 1.00 9.51  ? 24  SER A C   1 
ATOM   178 O  O   . SER A 1 24 ? 15.081 -4.465  12.233 1.00 8.86  ? 24  SER A O   1 
ATOM   179 C  CB  . SER A 1 24 ? 13.933 -5.881  14.957 1.00 10.61 ? 24  SER A CB  1 
ATOM   180 O  OG  . SER A 1 24 ? 13.764 -6.868  13.949 1.00 13.43 ? 24  SER A OG  1 
ATOM   181 N  N   . PRO A 1 25 ? 16.351 -4.030  14.033 1.00 11.12 ? 25  PRO A N   1 
ATOM   182 C  CA  . PRO A 1 25 ? 17.565 -3.910  13.213 1.00 10.42 ? 25  PRO A CA  1 
ATOM   183 C  C   . PRO A 1 25 ? 17.805 -5.218  12.456 1.00 11.67 ? 25  PRO A C   1 
ATOM   184 O  O   . PRO A 1 25 ? 17.633 -6.307  13.007 1.00 11.41 ? 25  PRO A O   1 
ATOM   185 C  CB  . PRO A 1 25 ? 18.668 -3.660  14.247 1.00 12.81 ? 25  PRO A CB  1 
ATOM   186 C  CG  . PRO A 1 25 ? 17.971 -3.011  15.364 1.00 12.70 ? 25  PRO A CG  1 
ATOM   187 C  CD  . PRO A 1 25 ? 16.597 -3.619  15.428 1.00 12.97 ? 25  PRO A CD  1 
ATOM   188 N  N   . GLY A 1 26 ? 18.195 -5.116  11.192 1.00 12.06 ? 26  GLY A N   1 
ATOM   189 C  CA  . GLY A 1 26 ? 18.430 -6.299  10.399 1.00 12.88 ? 26  GLY A CA  1 
ATOM   190 C  C   . GLY A 1 26 ? 17.263 -6.639  9.488  1.00 13.28 ? 26  GLY A C   1 
ATOM   191 O  O   . GLY A 1 26 ? 17.340 -7.591  8.713  1.00 17.36 ? 26  GLY A O   1 
ATOM   192 N  N   . THR A 1 27 ? 16.164 -5.899  9.590  1.00 12.19 ? 27  THR A N   1 
ATOM   193 C  CA  . THR A 1 27 ? 15.008 -6.177  8.742  1.00 11.13 ? 27  THR A CA  1 
ATOM   194 C  C   . THR A 1 27 ? 15.211 -5.625  7.330  1.00 11.66 ? 27  THR A C   1 
ATOM   195 O  O   . THR A 1 27 ? 15.378 -4.422  7.153  1.00 11.02 ? 27  THR A O   1 
ATOM   196 C  CB  . THR A 1 27 ? 13.727 -5.586  9.346  1.00 11.20 ? 27  THR A CB  1 
ATOM   197 O  OG1 . THR A 1 27 ? 13.546 -6.039  10.677 1.00 12.84 ? 27  THR A OG1 1 
ATOM   198 C  CG2 . THR A 1 27 ? 12.473 -5.992  8.559  1.00 11.48 ? 27  THR A CG2 1 
ATOM   199 N  N   . LYS A 1 28 ? 15.183 -6.509  6.330  1.00 12.94 ? 28  LYS A N   1 
ATOM   200 C  CA  . LYS A 1 28 ? 15.337 -6.089  4.937  1.00 14.72 ? 28  LYS A CA  1 
ATOM   201 C  C   . LYS A 1 28 ? 14.139 -5.249  4.523  1.00 13.85 ? 28  LYS A C   1 
ATOM   202 O  O   . LYS A 1 28 ? 13.025 -5.467  4.996  1.00 13.41 ? 28  LYS A O   1 
ATOM   203 C  CB  . LYS A 1 28 ? 15.461 -7.300  4.017  1.00 16.99 ? 28  LYS A CB  1 
ATOM   204 C  CG  . LYS A 1 28 ? 16.664 -8.180  4.333  1.00 20.30 ? 28  LYS A CG  1 
ATOM   205 C  CD  . LYS A 1 28 ? 16.825 -9.303  3.308  1.00 24.46 ? 28  LYS A CD  1 
ATOM   206 C  CE  . LYS A 1 28 ? 17.953 -10.246 3.710  1.00 26.94 ? 28  LYS A CE  1 
ATOM   207 N  NZ  . LYS A 1 28 ? 19.240 -9.524  3.950  1.00 29.27 ? 28  LYS A NZ  1 
ATOM   208 N  N   . PHE A 1 29 ? 14.373 -4.282  3.641  1.00 13.06 ? 29  PHE A N   1 
ATOM   209 C  CA  . PHE A 1 29 ? 13.310 -3.387  3.175  1.00 14.36 ? 29  PHE A CA  1 
ATOM   210 C  C   . PHE A 1 29 ? 12.066 -4.122  2.668  1.00 14.09 ? 29  PHE A C   1 
ATOM   211 O  O   . PHE A 1 29 ? 10.943 -3.740  2.988  1.00 13.48 ? 29  PHE A O   1 
ATOM   212 C  CB  . PHE A 1 29 ? 13.861 -2.446  2.092  1.00 14.76 ? 29  PHE A CB  1 
ATOM   213 C  CG  . PHE A 1 29 ? 12.939 -1.302  1.749  1.00 13.27 ? 29  PHE A CG  1 
ATOM   214 C  CD1 . PHE A 1 29 ? 12.795 -0.228  2.611  1.00 16.01 ? 29  PHE A CD1 1 
ATOM   215 C  CD2 . PHE A 1 29 ? 12.205 -1.316  0.576  1.00 15.73 ? 29  PHE A CD2 1 
ATOM   216 C  CE1 . PHE A 1 29 ? 11.927 0.816   2.311  1.00 15.10 ? 29  PHE A CE1 1 
ATOM   217 C  CE2 . PHE A 1 29 ? 11.339 -0.280  0.272  1.00 16.40 ? 29  PHE A CE2 1 
ATOM   218 C  CZ  . PHE A 1 29 ? 11.201 0.784   1.134  1.00 15.27 ? 29  PHE A CZ  1 
ATOM   219 N  N   . GLU A 1 30 ? 12.269 -5.206  1.922  1.00 16.10 ? 30  GLU A N   1 
ATOM   220 C  CA  . GLU A 1 30 ? 11.157 -5.979  1.364  1.00 19.70 ? 30  GLU A CA  1 
ATOM   221 C  C   . GLU A 1 30 ? 10.310 -6.652  2.441  1.00 20.17 ? 30  GLU A C   1 
ATOM   222 O  O   . GLU A 1 30 ? 9.131  -6.929  2.218  1.00 20.99 ? 30  GLU A O   1 
ATOM   223 C  CB  . GLU A 1 30 ? 11.670 -7.055  0.393  1.00 22.43 ? 30  GLU A CB  1 
ATOM   224 C  CG  . GLU A 1 30 ? 12.698 -6.567  -0.605 1.00 27.56 ? 30  GLU A CG  1 
ATOM   225 C  CD  . GLU A 1 30 ? 13.994 -6.157  0.071  1.00 28.69 ? 30  GLU A CD  1 
ATOM   226 O  OE1 . GLU A 1 30 ? 14.709 -7.036  0.592  1.00 30.73 ? 30  GLU A OE1 1 
ATOM   227 O  OE2 . GLU A 1 30 ? 14.273 -4.944  0.120  1.00 33.05 ? 30  GLU A OE2 1 
ATOM   228 N  N   . GLU A 1 31 ? 10.925 -6.906  3.598  1.00 19.65 ? 31  GLU A N   1 
ATOM   229 C  CA  . GLU A 1 31 ? 10.280 -7.562  4.742  1.00 20.28 ? 31  GLU A CA  1 
ATOM   230 C  C   . GLU A 1 31 ? 9.486  -6.615  5.635  1.00 18.74 ? 31  GLU A C   1 
ATOM   231 O  O   . GLU A 1 31 ? 8.773  -7.055  6.539  1.00 19.31 ? 31  GLU A O   1 
ATOM   232 C  CB  . GLU A 1 31 ? 11.330 -8.279  5.595  1.00 23.17 ? 31  GLU A CB  1 
ATOM   233 C  CG  . GLU A 1 31 ? 12.285 -9.157  4.805  1.00 29.07 ? 31  GLU A CG  1 
ATOM   234 C  CD  . GLU A 1 31 ? 11.565 -10.163 3.936  1.00 32.78 ? 31  GLU A CD  1 
ATOM   235 O  OE1 . GLU A 1 31 ? 10.695 -10.890 4.468  1.00 36.90 ? 31  GLU A OE1 1 
ATOM   236 O  OE2 . GLU A 1 31 ? 11.867 -10.225 2.723  1.00 35.05 ? 31  GLU A OE2 1 
ATOM   237 N  N   . ILE A 1 32 ? 9.654  -5.315  5.417  1.00 15.06 ? 32  ILE A N   1 
ATOM   238 C  CA  . ILE A 1 32 ? 8.931  -4.318  6.188  1.00 15.46 ? 32  ILE A CA  1 
ATOM   239 C  C   . ILE A 1 32 ? 7.458  -4.371  5.771  1.00 16.28 ? 32  ILE A C   1 
ATOM   240 O  O   . ILE A 1 32 ? 7.149  -4.445  4.581  1.00 16.73 ? 32  ILE A O   1 
ATOM   241 C  CB  . ILE A 1 32 ? 9.470  -2.901  5.905  1.00 14.44 ? 32  ILE A CB  1 
ATOM   242 C  CG1 . ILE A 1 32 ? 10.901 -2.751  6.420  1.00 15.97 ? 32  ILE A CG1 1 
ATOM   243 C  CG2 . ILE A 1 32 ? 8.572  -1.869  6.550  1.00 14.68 ? 32  ILE A CG2 1 
ATOM   244 C  CD1 . ILE A 1 32 ? 11.515 -1.418  6.062  1.00 16.31 ? 32  ILE A CD1 1 
ATOM   245 N  N   . PRO A 1 33 ? 6.535  -4.346  6.747  1.00 18.23 ? 33  PRO A N   1 
ATOM   246 C  CA  . PRO A 1 33 ? 5.101  -4.391  6.438  1.00 19.29 ? 33  PRO A CA  1 
ATOM   247 C  C   . PRO A 1 33 ? 4.718  -3.355  5.391  1.00 21.06 ? 33  PRO A C   1 
ATOM   248 O  O   . PRO A 1 33 ? 5.267  -2.254  5.374  1.00 19.03 ? 33  PRO A O   1 
ATOM   249 C  CB  . PRO A 1 33 ? 4.441  -4.087  7.779  1.00 19.96 ? 33  PRO A CB  1 
ATOM   250 C  CG  . PRO A 1 33 ? 5.424  -4.552  8.790  1.00 20.78 ? 33  PRO A CG  1 
ATOM   251 C  CD  . PRO A 1 33 ? 6.790  -4.351  8.199  1.00 18.65 ? 33  PRO A CD  1 
ATOM   252 N  N   . ASP A 1 34 ? 3.766  -3.716  4.532  1.00 22.09 ? 34  ASP A N   1 
ATOM   253 C  CA  . ASP A 1 34 ? 3.301  -2.852  3.450  1.00 24.53 ? 34  ASP A CA  1 
ATOM   254 C  C   . ASP A 1 34 ? 2.704  -1.535  3.912  1.00 23.93 ? 34  ASP A C   1 
ATOM   255 O  O   . ASP A 1 34 ? 2.611  -0.593  3.126  1.00 25.39 ? 34  ASP A O   1 
ATOM   256 C  CB  . ASP A 1 34 ? 2.267  -3.584  2.583  1.00 27.83 ? 34  ASP A CB  1 
ATOM   257 C  CG  . ASP A 1 34 ? 2.839  -4.808  1.888  1.00 30.58 ? 34  ASP A CG  1 
ATOM   258 O  OD1 . ASP A 1 34 ? 3.979  -4.737  1.369  1.00 32.82 ? 34  ASP A OD1 1 
ATOM   259 O  OD2 . ASP A 1 34 ? 2.136  -5.840  1.840  1.00 33.00 ? 34  ASP A OD2 1 
ATOM   260 N  N   . ASP A 1 35 ? 2.292  -1.473  5.174  1.00 22.50 ? 35  ASP A N   1 
ATOM   261 C  CA  . ASP A 1 35 ? 1.685  -0.268  5.735  1.00 22.80 ? 35  ASP A CA  1 
ATOM   262 C  C   . ASP A 1 35 ? 2.663  0.656   6.472  1.00 20.78 ? 35  ASP A C   1 
ATOM   263 O  O   . ASP A 1 35 ? 2.250  1.647   7.077  1.00 21.08 ? 35  ASP A O   1 
ATOM   264 C  CB  . ASP A 1 35 ? 0.543  -0.646  6.679  1.00 26.11 ? 35  ASP A CB  1 
ATOM   265 C  CG  . ASP A 1 35 ? 1.032  -1.350  7.921  1.00 29.14 ? 35  ASP A CG  1 
ATOM   266 O  OD1 . ASP A 1 35 ? 1.683  -2.403  7.788  1.00 30.43 ? 35  ASP A OD1 1 
ATOM   267 O  OD2 . ASP A 1 35 ? 0.795  -0.831  9.031  1.00 32.81 ? 35  ASP A OD2 1 
ATOM   268 N  N   . TRP A 1 36 ? 3.940  0.286   6.499  1.00 17.56 ? 36  TRP A N   1 
ATOM   269 C  CA  . TRP A 1 36 ? 4.942  1.131   7.155  1.00 14.69 ? 36  TRP A CA  1 
ATOM   270 C  C   . TRP A 1 36 ? 5.191  2.294   6.203  1.00 12.73 ? 36  TRP A C   1 
ATOM   271 O  O   . TRP A 1 36 ? 5.138  2.119   4.984  1.00 12.78 ? 36  TRP A O   1 
ATOM   272 C  CB  . TRP A 1 36 ? 6.240  0.340   7.364  1.00 12.84 ? 36  TRP A CB  1 
ATOM   273 C  CG  . TRP A 1 36 ? 7.453  1.109   7.878  1.00 12.77 ? 36  TRP A CG  1 
ATOM   274 C  CD1 . TRP A 1 36 ? 7.842  1.273   9.178  1.00 13.45 ? 36  TRP A CD1 1 
ATOM   275 C  CD2 . TRP A 1 36 ? 8.449  1.758   7.080  1.00 12.22 ? 36  TRP A CD2 1 
ATOM   276 N  NE1 . TRP A 1 36 ? 9.027  1.975   9.238  1.00 11.56 ? 36  TRP A NE1 1 
ATOM   277 C  CE2 . TRP A 1 36 ? 9.415  2.294   7.960  1.00 11.94 ? 36  TRP A CE2 1 
ATOM   278 C  CE3 . TRP A 1 36 ? 8.617  1.941   5.701  1.00 14.05 ? 36  TRP A CE3 1 
ATOM   279 C  CZ2 . TRP A 1 36 ? 10.536 2.995   7.508  1.00 11.30 ? 36  TRP A CZ2 1 
ATOM   280 C  CZ3 . TRP A 1 36 ? 9.721  2.637   5.252  1.00 12.96 ? 36  TRP A CZ3 1 
ATOM   281 C  CH2 . TRP A 1 36 ? 10.669 3.157   6.154  1.00 11.92 ? 36  TRP A CH2 1 
ATOM   282 N  N   . VAL A 1 37 ? 5.432  3.477   6.761  1.00 11.94 ? 37  VAL A N   1 
ATOM   283 C  CA  . VAL A 1 37 ? 5.700  4.671   5.964  1.00 10.29 ? 37  VAL A CA  1 
ATOM   284 C  C   . VAL A 1 37 ? 6.946  5.391   6.475  1.00 8.69  ? 37  VAL A C   1 
ATOM   285 O  O   . VAL A 1 37 ? 7.411  5.143   7.591  1.00 9.55  ? 37  VAL A O   1 
ATOM   286 C  CB  . VAL A 1 37 ? 4.512  5.666   5.999  1.00 10.55 ? 37  VAL A CB  1 
ATOM   287 C  CG1 . VAL A 1 37 ? 3.288  5.040   5.340  1.00 12.04 ? 37  VAL A CG1 1 
ATOM   288 C  CG2 . VAL A 1 37 ? 4.190  6.082   7.420  1.00 12.28 ? 37  VAL A CG2 1 
ATOM   289 N  N   . CYS A 1 38 ? 7.498  6.288   5.661  1.00 7.93  ? 38  CYS A N   1 
ATOM   290 C  CA  . CYS A 1 38 ? 8.667  7.043   6.089  1.00 9.23  ? 38  CYS A CA  1 
ATOM   291 C  C   . CYS A 1 38 ? 8.350  7.675   7.455  1.00 8.06  ? 38  CYS A C   1 
ATOM   292 O  O   . CYS A 1 38 ? 7.346  8.374   7.603  1.00 8.52  ? 38  CYS A O   1 
ATOM   293 C  CB  . CYS A 1 38 ? 8.984  8.123   5.056  1.00 7.65  ? 38  CYS A CB  1 
ATOM   294 S  SG  . CYS A 1 38 ? 10.356 9.155   5.550  1.00 6.97  ? 38  CYS A SG  1 
ATOM   295 N  N   . PRO A 1 39 ? 9.201  7.431   8.472  1.00 9.32  ? 39  PRO A N   1 
ATOM   296 C  CA  . PRO A 1 39 ? 8.950  7.997   9.804  1.00 9.54  ? 39  PRO A CA  1 
ATOM   297 C  C   . PRO A 1 39 ? 9.011  9.519   9.883  1.00 11.35 ? 39  PRO A C   1 
ATOM   298 O  O   . PRO A 1 39 ? 8.504  10.126  10.836 1.00 14.32 ? 39  PRO A O   1 
ATOM   299 C  CB  . PRO A 1 39 ? 10.012 7.331   10.684 1.00 10.41 ? 39  PRO A CB  1 
ATOM   300 C  CG  . PRO A 1 39 ? 11.078 6.890   9.744  1.00 10.67 ? 39  PRO A CG  1 
ATOM   301 C  CD  . PRO A 1 39 ? 10.398 6.575   8.450  1.00 9.11  ? 39  PRO A CD  1 
ATOM   302 N  N   . ILE A 1 40 ? 9.626  10.136  8.882  1.00 10.80 ? 40  ILE A N   1 
ATOM   303 C  CA  . ILE A 1 40 ? 9.737  11.587  8.858  1.00 9.88  ? 40  ILE A CA  1 
ATOM   304 C  C   . ILE A 1 40 ? 8.594  12.259  8.094  1.00 10.52 ? 40  ILE A C   1 
ATOM   305 O  O   . ILE A 1 40 ? 7.922  13.127  8.632  1.00 13.26 ? 40  ILE A O   1 
ATOM   306 C  CB  . ILE A 1 40 ? 11.072 12.048  8.194  1.00 10.69 ? 40  ILE A CB  1 
ATOM   307 C  CG1 . ILE A 1 40 ? 12.275 11.330  8.816  1.00 13.09 ? 40  ILE A CG1 1 
ATOM   308 C  CG2 . ILE A 1 40 ? 11.204 13.555  8.279  1.00 15.08 ? 40  ILE A CG2 1 
ATOM   309 C  CD1 . ILE A 1 40 ? 12.374 11.462  10.316 1.00 14.57 ? 40  ILE A CD1 1 
ATOM   310 N  N   . CYS A 1 41 ? 8.365  11.863  6.846  1.00 8.68  ? 41  CYS A N   1 
ATOM   311 C  CA  . CYS A 1 41 ? 7.342  12.536  6.046  1.00 8.52  ? 41  CYS A CA  1 
ATOM   312 C  C   . CYS A 1 41 ? 6.047  11.781  5.775  1.00 7.27  ? 41  CYS A C   1 
ATOM   313 O  O   . CYS A 1 41 ? 5.121  12.349  5.218  1.00 9.10  ? 41  CYS A O   1 
ATOM   314 C  CB  . CYS A 1 41 ? 7.946  12.994  4.721  1.00 7.80  ? 41  CYS A CB  1 
ATOM   315 S  SG  . CYS A 1 41 ? 8.279  11.619  3.575  1.00 7.71  ? 41  CYS A SG  1 
ATOM   316 N  N   . GLY A 1 42 ? 5.997  10.506  6.138  1.00 7.27  ? 42  GLY A N   1 
ATOM   317 C  CA  . GLY A 1 42 ? 4.810  9.704   5.921  1.00 8.95  ? 42  GLY A CA  1 
ATOM   318 C  C   . GLY A 1 42 ? 4.645  9.107   4.538  1.00 8.07  ? 42  GLY A C   1 
ATOM   319 O  O   . GLY A 1 42 ? 3.594  8.541   4.247  1.00 9.48  ? 42  GLY A O   1 
ATOM   320 N  N   . ALA A 1 43 ? 5.680  9.191   3.704  1.00 7.19  ? 43  ALA A N   1 
ATOM   321 C  CA  . ALA A 1 43 ? 5.624  8.646   2.346  1.00 8.38  ? 43  ALA A CA  1 
ATOM   322 C  C   . ALA A 1 43 ? 5.565  7.125   2.338  1.00 7.95  ? 43  ALA A C   1 
ATOM   323 O  O   . ALA A 1 43 ? 6.259  6.460   3.110  1.00 8.49  ? 43  ALA A O   1 
ATOM   324 C  CB  . ALA A 1 43 ? 6.844  9.077   1.555  1.00 9.70  ? 43  ALA A CB  1 
ATOM   325 N  N   . PRO A 1 44 ? 4.775  6.550   1.428  1.00 7.86  ? 44  PRO A N   1 
ATOM   326 C  CA  . PRO A 1 44 ? 4.696  5.083   1.367  1.00 7.43  ? 44  PRO A CA  1 
ATOM   327 C  C   . PRO A 1 44 ? 6.016  4.492   0.866  1.00 8.02  ? 44  PRO A C   1 
ATOM   328 O  O   . PRO A 1 44 ? 6.864  5.210   0.329  1.00 7.85  ? 44  PRO A O   1 
ATOM   329 C  CB  . PRO A 1 44 ? 3.566  4.801   0.366  1.00 8.35  ? 44  PRO A CB  1 
ATOM   330 C  CG  . PRO A 1 44 ? 3.204  6.092   -0.240 1.00 11.42 ? 44  PRO A CG  1 
ATOM   331 C  CD  . PRO A 1 44 ? 3.829  7.223   0.514  1.00 8.71  ? 44  PRO A CD  1 
ATOM   332 N  N   . LYS A 1 45 ? 6.167  3.179   1.021  1.00 7.90  ? 45  LYS A N   1 
ATOM   333 C  CA  . LYS A 1 45 ? 7.374  2.464   0.593  1.00 9.51  ? 45  LYS A CA  1 
ATOM   334 C  C   . LYS A 1 45 ? 7.697  2.699   -0.888 1.00 8.61  ? 45  LYS A C   1 
ATOM   335 O  O   . LYS A 1 45 ? 8.866  2.674   -1.292 1.00 9.71  ? 45  LYS A O   1 
ATOM   336 C  CB  . LYS A 1 45 ? 7.223  0.954   0.839  1.00 11.45 ? 45  LYS A CB  1 
ATOM   337 C  CG  . LYS A 1 45 ? 7.273  0.535   2.302  1.00 12.69 ? 45  LYS A CG  1 
ATOM   338 C  CD  . LYS A 1 45 ? 7.159  -0.997  2.494  1.00 15.37 ? 45  LYS A CD  1 
ATOM   339 C  CE  . LYS A 1 45 ? 8.402  -1.740  2.010  1.00 16.25 ? 45  LYS A CE  1 
ATOM   340 N  NZ  . LYS A 1 45 ? 8.278  -3.227  2.225  1.00 16.67 ? 45  LYS A NZ  1 
ATOM   341 N  N   . SER A 1 46 ? 6.655  2.961   -1.685 1.00 8.94  ? 46  SER A N   1 
ATOM   342 C  CA  . SER A 1 46 ? 6.822  3.188   -3.118 1.00 9.41  ? 46  SER A CA  1 
ATOM   343 C  C   . SER A 1 46 ? 7.758  4.348   -3.442 1.00 9.22  ? 46  SER A C   1 
ATOM   344 O  O   . SER A 1 46 ? 8.339  4.397   -4.532 1.00 10.58 ? 46  SER A O   1 
ATOM   345 C  CB  . SER A 1 46 ? 5.454  3.435   -3.786 1.00 9.09  ? 46  SER A CB  1 
ATOM   346 O  OG  . SER A 1 46 ? 4.875  4.664   -3.380 1.00 10.38 ? 46  SER A OG  1 
ATOM   347 N  N   . GLU A 1 47 ? 7.911  5.272   -2.487 1.00 9.26  ? 47  GLU A N   1 
ATOM   348 C  CA  . GLU A 1 47 ? 8.739  6.463   -2.672 1.00 9.70  ? 47  GLU A CA  1 
ATOM   349 C  C   . GLU A 1 47 ? 10.192 6.356   -2.221 1.00 9.38  ? 47  GLU A C   1 
ATOM   350 O  O   . GLU A 1 47 ? 10.892 7.372   -2.135 1.00 9.76  ? 47  GLU A O   1 
ATOM   351 C  CB  . GLU A 1 47 ? 8.068  7.663   -2.000 1.00 10.34 ? 47  GLU A CB  1 
ATOM   352 C  CG  . GLU A 1 47 ? 6.630  7.859   -2.456 1.00 9.85  ? 47  GLU A CG  1 
ATOM   353 C  CD  . GLU A 1 47 ? 6.511  7.888   -3.967 1.00 12.91 ? 47  GLU A CD  1 
ATOM   354 O  OE1 . GLU A 1 47 ? 6.969  8.864   -4.591 1.00 15.15 ? 47  GLU A OE1 1 
ATOM   355 O  OE2 . GLU A 1 47 ? 5.975  6.916   -4.538 1.00 14.81 ? 47  GLU A OE2 1 
ATOM   356 N  N   . PHE A 1 48 ? 10.638 5.132   -1.961 1.00 9.54  ? 48  PHE A N   1 
ATOM   357 C  CA  . PHE A 1 48 ? 12.011 4.875   -1.553 1.00 9.93  ? 48  PHE A CA  1 
ATOM   358 C  C   . PHE A 1 48 ? 12.790 4.325   -2.733 1.00 12.00 ? 48  PHE A C   1 
ATOM   359 O  O   . PHE A 1 48 ? 12.242 3.601   -3.570 1.00 13.39 ? 48  PHE A O   1 
ATOM   360 C  CB  . PHE A 1 48 ? 12.050 3.875   -0.400 1.00 8.93  ? 48  PHE A CB  1 
ATOM   361 C  CG  . PHE A 1 48 ? 11.756 4.488   0.933  1.00 7.76  ? 48  PHE A CG  1 
ATOM   362 C  CD1 . PHE A 1 48 ? 10.457 4.792   1.302  1.00 8.57  ? 48  PHE A CD1 1 
ATOM   363 C  CD2 . PHE A 1 48 ? 12.785 4.764   1.818  1.00 6.92  ? 48  PHE A CD2 1 
ATOM   364 C  CE1 . PHE A 1 48 ? 10.198 5.358   2.528  1.00 9.38  ? 48  PHE A CE1 1 
ATOM   365 C  CE2 . PHE A 1 48 ? 12.532 5.336   3.061  1.00 7.69  ? 48  PHE A CE2 1 
ATOM   366 C  CZ  . PHE A 1 48 ? 11.243 5.629   3.415  1.00 9.46  ? 48  PHE A CZ  1 
ATOM   367 N  N   . GLU A 1 49 ? 14.079 4.638   -2.764 1.00 11.01 ? 49  GLU A N   1 
ATOM   368 C  CA  . GLU A 1 49 ? 14.964 4.190   -3.829 1.00 12.96 ? 49  GLU A CA  1 
ATOM   369 C  C   . GLU A 1 49 ? 16.186 3.569   -3.170 1.00 11.60 ? 49  GLU A C   1 
ATOM   370 O  O   . GLU A 1 49 ? 16.742 4.135   -2.230 1.00 10.15 ? 49  GLU A O   1 
ATOM   371 C  CB  . GLU A 1 49 ? 15.379 5.389   -4.682 1.00 16.61 ? 49  GLU A CB  1 
ATOM   372 C  CG  . GLU A 1 49 ? 16.262 5.056   -5.868 1.00 23.31 ? 49  GLU A CG  1 
ATOM   373 C  CD  . GLU A 1 49 ? 16.633 6.297   -6.670 1.00 26.93 ? 49  GLU A CD  1 
ATOM   374 O  OE1 . GLU A 1 49 ? 17.822 6.688   -6.643 1.00 29.45 ? 49  GLU A OE1 1 
ATOM   375 O  OE2 . GLU A 1 49 ? 15.736 6.879   -7.320 1.00 29.37 ? 49  GLU A OE2 1 
ATOM   376 N  N   . LYS A 1 50 ? 16.597 2.406   -3.664 1.00 12.28 ? 50  LYS A N   1 
ATOM   377 C  CA  . LYS A 1 50 ? 17.759 1.725   -3.128 1.00 12.07 ? 50  LYS A CA  1 
ATOM   378 C  C   . LYS A 1 50 ? 19.041 2.464   -3.531 1.00 12.23 ? 50  LYS A C   1 
ATOM   379 O  O   . LYS A 1 50 ? 19.199 2.864   -4.683 1.00 13.75 ? 50  LYS A O   1 
ATOM   380 C  CB  . LYS A 1 50 ? 17.796 0.284   -3.650 1.00 13.69 ? 50  LYS A CB  1 
ATOM   381 C  CG  . LYS A 1 50 ? 18.819 -0.596  -2.967 1.00 15.76 ? 50  LYS A CG  1 
ATOM   382 C  CD  . LYS A 1 50 ? 18.750 -2.038  -3.458 1.00 19.07 ? 50  LYS A CD  1 
ATOM   383 C  CE  . LYS A 1 50 ? 19.700 -2.909  -2.660 1.00 21.88 ? 50  LYS A CE  1 
ATOM   384 N  NZ  . LYS A 1 50 ? 19.616 -4.350  -3.037 1.00 24.90 ? 50  LYS A NZ  1 
ATOM   385 N  N   . LEU A 1 51 ? 19.960 2.624   -2.585 1.00 11.55 ? 51  LEU A N   1 
ATOM   386 C  CA  . LEU A 1 51 ? 21.230 3.296   -2.866 1.00 12.50 ? 51  LEU A CA  1 
ATOM   387 C  C   . LEU A 1 51 ? 22.325 2.306   -3.271 1.00 16.61 ? 51  LEU A C   1 
ATOM   388 O  O   . LEU A 1 51 ? 22.497 1.272   -2.628 1.00 19.48 ? 51  LEU A O   1 
ATOM   389 C  CB  . LEU A 1 51 ? 21.677 4.102   -1.646 1.00 12.26 ? 51  LEU A CB  1 
ATOM   390 C  CG  . LEU A 1 51 ? 20.682 5.180   -1.221 1.00 12.92 ? 51  LEU A CG  1 
ATOM   391 C  CD1 . LEU A 1 51 ? 21.214 5.900   0.005  1.00 13.20 ? 51  LEU A CD1 1 
ATOM   392 C  CD2 . LEU A 1 51 ? 20.443 6.154   -2.364 1.00 12.76 ? 51  LEU A CD2 1 
HETATM 393 FE FE  . FE  B 2 .  ? 10.335 10.718  3.856  1.00 8.51  ? 152 FE  A FE  1 
HETATM 394 O  O   . DOD C 3 .  ? 11.016 -6.403  11.964 1.00 23.04 ? 153 DOD A O   1 
HETATM 395 O  O   . DOD C 3 .  ? 22.190 -0.909  14.327 1.00 33.25 ? 154 DOD A O   1 
HETATM 396 O  O   . DOD C 3 .  ? 11.636 -8.722  14.306 1.00 22.80 ? 155 DOD A O   1 
HETATM 397 O  O   . DOD C 3 .  ? 7.501  6.264   -6.823 1.00 26.14 ? 156 DOD A O   1 
HETATM 398 O  O   . DOD C 3 .  ? 19.924 4.860   -6.649 1.00 27.76 ? 157 DOD A O   1 
HETATM 399 O  O   . DOD C 3 .  ? 2.169  4.585   -3.304 1.00 14.94 ? 158 DOD A O   1 
HETATM 400 O  O   . DOD C 3 .  ? 10.144 0.990   -3.259 1.00 27.31 ? 159 DOD A O   1 
HETATM 401 O  O   . DOD C 3 .  ? 1.371  2.432   -1.981 1.00 23.16 ? 160 DOD A O   1 
HETATM 402 O  O   . DOD C 3 .  ? 3.987  1.518   -1.072 1.00 15.46 ? 161 DOD A O   1 
HETATM 403 O  O   . DOD C 3 .  ? 16.019 12.432  -1.153 1.00 28.88 ? 162 DOD A O   1 
HETATM 404 O  O   . DOD C 3 .  ? 23.115 0.324   0.131  1.00 29.07 ? 163 DOD A O   1 
HETATM 405 O  O   . DOD C 3 .  ? 3.961  1.965   2.677  1.00 15.87 ? 164 DOD A O   1 
HETATM 406 O  O   . DOD C 3 .  ? 27.293 2.808   4.143  1.00 40.26 ? 165 DOD A O   1 
HETATM 407 O  O   . DOD C 3 .  ? 13.869 16.983  4.633  1.00 30.15 ? 166 DOD A O   1 
HETATM 408 O  O   . DOD C 3 .  ? 16.108 -8.357  13.782 1.00 13.08 ? 167 DOD A O   1 
HETATM 409 O  O   . DOD C 3 .  ? 5.312  9.193   9.410  1.00 21.56 ? 168 DOD A O   1 
HETATM 410 O  O   . DOD C 3 .  ? 16.880 3.263   9.385  1.00 14.08 ? 169 DOD A O   1 
HETATM 411 O  O   . DOD C 3 .  ? 7.686  4.551   10.244 1.00 21.58 ? 170 DOD A O   1 
HETATM 412 O  O   . DOD C 3 .  ? 13.392 -9.045  10.966 1.00 29.05 ? 171 DOD A O   1 
HETATM 413 O  O   . DOD C 3 .  ? 13.134 4.096   15.222 1.00 20.90 ? 172 DOD A O   1 
HETATM 414 O  O   . DOD C 3 .  ? 16.618 17.191  3.179  1.00 36.38 ? 173 DOD A O   1 
HETATM 415 O  O   . DOD C 3 .  ? 18.656 0.894   15.628 1.00 30.81 ? 174 DOD A O   1 
HETATM 416 O  O   . DOD C 3 .  ? 22.903 -1.736  5.450  1.00 27.36 ? 175 DOD A O   1 
HETATM 417 O  O   . DOD C 3 .  ? 14.479 -9.369  6.965  1.00 28.28 ? 176 DOD A O   1 
HETATM 418 O  O   . DOD C 3 .  ? 25.131 0.255   7.970  1.00 30.98 ? 177 DOD A O   1 
HETATM 419 O  O   . DOD C 3 .  ? 18.653 7.032   8.970  1.00 20.60 ? 178 DOD A O   1 
HETATM 420 O  O   . DOD C 3 .  ? 14.430 5.425   11.851 1.00 24.38 ? 179 DOD A O   1 
HETATM 421 O  O   . DOD C 3 .  ? 1.136  8.506   5.159  1.00 35.08 ? 180 DOD A O   1 
HETATM 422 O  O   . DOD C 3 .  ? 1.294  3.167   2.932  1.00 40.08 ? 181 DOD A O   1 
HETATM 423 O  O   . DOD C 3 .  ? 16.969 -5.056  0.302  1.00 26.19 ? 182 DOD A O   1 
HETATM 424 O  O   . DOD C 3 .  ? 21.578 6.250   7.671  1.00 35.26 ? 183 DOD A O   1 
HETATM 425 O  O   . DOD C 3 .  ? 4.931  3.084   10.700 1.00 40.25 ? 184 DOD A O   1 
HETATM 426 O  O   . DOD C 3 .  ? 5.594  6.536   11.358 1.00 33.98 ? 185 DOD A O   1 
HETATM 427 O  O   . DOD C 3 .  ? 16.613 3.670   12.995 1.00 23.67 ? 186 DOD A O   1 
HETATM 428 O  O   . DOD C 3 .  ? 20.198 -9.594  8.595  1.00 37.84 ? 187 DOD A O   1 
HETATM 429 O  O   . DOD C 3 .  ? 10.824 4.925   -5.917 1.00 27.50 ? 188 DOD A O   1 
HETATM 430 O  O   . DOD C 3 .  ? 17.248 14.739  -0.319 1.00 34.07 ? 189 DOD A O   1 
HETATM 431 O  O   . DOD C 3 .  ? 20.187 -6.410  1.581  1.00 40.05 ? 190 DOD A O   1 
HETATM 432 O  O   . DOD C 3 .  ? 2.890  -6.735  4.853  1.00 36.48 ? 191 DOD A O   1 
HETATM 433 O  O   . DOD C 3 .  ? 21.048 -6.056  7.849  1.00 37.08 ? 192 DOD A O   1 
HETATM 434 O  O   . DOD C 3 .  ? 5.691  -1.551  11.060 1.00 42.10 ? 193 DOD A O   1 
HETATM 435 O  O   . DOD C 3 .  ? 19.176 4.754   10.550 1.00 37.55 ? 194 DOD A O   1 
HETATM 436 O  O   . DOD C 3 .  ? 8.654  -10.875 6.399  1.00 38.00 ? 195 DOD A O   1 
HETATM 437 O  O   . DOD C 3 .  ? 23.857 -4.868  2.209  1.00 43.45 ? 196 DOD A O   1 
HETATM 438 O  O   . DOD C 3 .  ? 0.099  6.218   3.583  1.00 43.57 ? 197 DOD A O   1 
HETATM 439 O  O   . DOD C 3 .  ? 14.513 15.430  -0.729 1.00 39.40 ? 198 DOD A O   1 
HETATM 440 O  O   . DOD C 3 .  ? 22.937 -7.665  1.382  1.00 42.07 ? 199 DOD A O   1 
HETATM 441 O  O   . DOD C 3 .  ? 7.896  13.998  11.493 1.00 44.16 ? 200 DOD A O   1 
HETATM 442 O  O   . DOD C 3 .  ? 22.015 5.273   -8.805 1.00 42.60 ? 201 DOD A O   1 
HETATM 443 O  O   . DOD C 3 .  ? 12.163 -14.401 4.804  1.00 42.99 ? 202 DOD A O   1 
HETATM 444 O  O   . DOD C 3 .  ? 18.024 2.265   -7.273 1.00 34.27 ? 203 DOD A O   1 
HETATM 445 O  O   . DOD C 3 .  ? 6.106  -6.694  3.237  1.00 36.38 ? 204 DOD A O   1 
HETATM 446 O  O   . DOD C 3 .  ? 6.106  10.041  12.588 1.00 34.29 ? 205 DOD A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  1  1  ALA ALA A . n 
A 1 2  LYS 2  2  2  LYS LYS A . n 
A 1 3  TYR 3  3  3  TYR TYR A . n 
A 1 4  VAL 4  4  4  VAL VAL A . n 
A 1 5  CYS 5  5  5  CYS CYS A . n 
A 1 6  LYS 6  6  6  LYS LYS A . n 
A 1 7  ILE 7  7  7  ILE ILE A . n 
A 1 8  CYS 8  8  8  CYS CYS A . n 
A 1 9  GLY 9  9  9  GLY GLY A . n 
A 1 10 TYR 10 10 10 TYR TYR A . n 
A 1 11 ILE 11 11 11 ILE ILE A . n 
A 1 12 TYR 12 12 12 TYR TYR A . n 
A 1 13 ASP 13 13 13 ASP ASP A . n 
A 1 14 GLU 14 14 14 GLU GLU A . n 
A 1 15 ASP 15 15 15 ASP ASP A . n 
A 1 16 ALA 16 16 16 ALA ALA A . n 
A 1 17 GLY 17 17 17 GLY GLY A . n 
A 1 18 ASP 18 18 18 ASP ASP A . n 
A 1 19 PRO 19 19 19 PRO PRO A . n 
A 1 20 ASP 20 20 20 ASP ASP A . n 
A 1 21 ASN 21 21 21 ASN ASN A . n 
A 1 22 GLY 22 22 22 GLY GLY A . n 
A 1 23 VAL 23 23 23 VAL VAL A . n 
A 1 24 SER 24 24 24 SER SER A . n 
A 1 25 PRO 25 25 25 PRO PRO A . n 
A 1 26 GLY 26 26 26 GLY GLY A . n 
A 1 27 THR 27 27 27 THR THR A . n 
A 1 28 LYS 28 28 28 LYS LYS A . n 
A 1 29 PHE 29 29 29 PHE PHE A . n 
A 1 30 GLU 30 30 30 GLU GLU A . n 
A 1 31 GLU 31 31 31 GLU GLU A . n 
A 1 32 ILE 32 32 32 ILE ILE A . n 
A 1 33 PRO 33 33 33 PRO PRO A . n 
A 1 34 ASP 34 34 34 ASP ASP A . n 
A 1 35 ASP 35 35 35 ASP ASP A . n 
A 1 36 TRP 36 36 36 TRP TRP A . n 
A 1 37 VAL 37 37 37 VAL VAL A . n 
A 1 38 CYS 38 38 38 CYS CYS A . n 
A 1 39 PRO 39 39 39 PRO PRO A . n 
A 1 40 ILE 40 40 40 ILE ILE A . n 
A 1 41 CYS 41 41 41 CYS CYS A . n 
A 1 42 GLY 42 42 42 GLY GLY A . n 
A 1 43 ALA 43 43 43 ALA ALA A . n 
A 1 44 PRO 44 44 44 PRO PRO A . n 
A 1 45 LYS 45 45 45 LYS LYS A . n 
A 1 46 SER 46 46 46 SER SER A . n 
A 1 47 GLU 47 47 47 GLU GLU A . n 
A 1 48 PHE 48 48 48 PHE PHE A . n 
A 1 49 GLU 49 49 49 GLU GLU A . n 
A 1 50 LYS 50 50 50 LYS LYS A . n 
A 1 51 LEU 51 51 51 LEU LEU A . n 
A 1 52 GLU 52 52 ?  ?   ?   A . n 
A 1 53 ASP 53 53 ?  ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FE  1  152 52  FE  FE  A . 
C 3 DOD 1  153 53  DOD DOD A . 
C 3 DOD 2  154 54  DOD DOD A . 
C 3 DOD 3  155 55  DOD DOD A . 
C 3 DOD 4  156 56  DOD DOD A . 
C 3 DOD 5  157 57  DOD DOD A . 
C 3 DOD 6  158 58  DOD DOD A . 
C 3 DOD 7  159 59  DOD DOD A . 
C 3 DOD 8  160 60  DOD DOD A . 
C 3 DOD 9  161 61  DOD DOD A . 
C 3 DOD 10 162 62  DOD DOD A . 
C 3 DOD 11 163 63  DOD DOD A . 
C 3 DOD 12 164 64  DOD DOD A . 
C 3 DOD 13 165 65  DOD DOD A . 
C 3 DOD 14 166 66  DOD DOD A . 
C 3 DOD 15 167 67  DOD DOD A . 
C 3 DOD 16 168 68  DOD DOD A . 
C 3 DOD 17 169 69  DOD DOD A . 
C 3 DOD 18 170 70  DOD DOD A . 
C 3 DOD 19 171 71  DOD DOD A . 
C 3 DOD 20 172 72  DOD DOD A . 
C 3 DOD 21 173 73  DOD DOD A . 
C 3 DOD 22 174 74  DOD DOD A . 
C 3 DOD 23 175 75  DOD DOD A . 
C 3 DOD 24 176 76  DOD DOD A . 
C 3 DOD 25 177 77  DOD DOD A . 
C 3 DOD 26 178 78  DOD DOD A . 
C 3 DOD 27 179 79  DOD DOD A . 
C 3 DOD 28 180 80  DOD DOD A . 
C 3 DOD 29 181 81  DOD DOD A . 
C 3 DOD 30 182 82  DOD DOD A . 
C 3 DOD 31 183 83  DOD DOD A . 
C 3 DOD 32 184 84  DOD DOD A . 
C 3 DOD 33 185 85  DOD DOD A . 
C 3 DOD 34 186 86  DOD DOD A . 
C 3 DOD 35 187 87  DOD DOD A . 
C 3 DOD 36 188 88  DOD DOD A . 
C 3 DOD 37 189 89  DOD DOD A . 
C 3 DOD 38 190 90  DOD DOD A . 
C 3 DOD 39 191 91  DOD DOD A . 
C 3 DOD 40 192 92  DOD DOD A . 
C 3 DOD 41 193 93  DOD DOD A . 
C 3 DOD 42 194 94  DOD DOD A . 
C 3 DOD 43 195 95  DOD DOD A . 
C 3 DOD 44 196 96  DOD DOD A . 
C 3 DOD 45 197 97  DOD DOD A . 
C 3 DOD 46 198 98  DOD DOD A . 
C 3 DOD 47 199 99  DOD DOD A . 
C 3 DOD 48 200 100 DOD DOD A . 
C 3 DOD 49 201 101 DOD DOD A . 
C 3 DOD 50 202 102 DOD DOD A . 
C 3 DOD 51 203 103 DOD DOD A . 
C 3 DOD 52 204 104 DOD DOD A . 
C 3 DOD 53 205 105 DOD DOD A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? A CYS 5  ? A CYS 5  ? 1_555 FE ? B FE . ? A FE 152 ? 1_555 SG ? A CYS 8  ? A CYS 8  ? 1_555 113.0 ? 
2 SG ? A CYS 5  ? A CYS 5  ? 1_555 FE ? B FE . ? A FE 152 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 110.8 ? 
3 SG ? A CYS 8  ? A CYS 8  ? 1_555 FE ? B FE . ? A FE 152 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 102.7 ? 
4 SG ? A CYS 5  ? A CYS 5  ? 1_555 FE ? B FE . ? A FE 152 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 104.2 ? 
5 SG ? A CYS 8  ? A CYS 8  ? 1_555 FE ? B FE . ? A FE 152 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 114.7 ? 
6 SG ? A CYS 38 ? A CYS 38 ? 1_555 FE ? B FE . ? A FE 152 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 111.7 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-08-27 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-11-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_conn        
3 4 'Structure model' struct_ref_seq_dif 
4 4 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                
2  4 'Structure model' '_database_2.pdbx_database_accession' 
3  4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'     
4  4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'      
5  4 'Structure model' '_struct_conn.ptnr1_label_asym_id'    
6  4 'Structure model' '_struct_conn.ptnr1_label_atom_id'    
7  4 'Structure model' '_struct_conn.ptnr1_label_comp_id'    
8  4 'Structure model' '_struct_conn.ptnr1_label_seq_id'     
9  4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'     
10 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'      
11 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'    
12 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'    
13 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'    
14 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'     
15 4 'Structure model' '_struct_ref_seq_dif.details'         
16 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
17 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
18 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
AMoRE     phasing          . ? 3 
CNS       refinement       . ? 4 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASP 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     18 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -151.39 
_pdbx_validate_torsion.psi             70.14 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLU 52 ? A GLU 52 
2 1 Y 1 A ASP 53 ? A ASP 53 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE (III) ION' FE  
3 water          DOD 
#