data_1IU6
# 
_entry.id   1IU6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.302 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IU6         
RCSB  RCSB005279   
WWPDB D_1000005279 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1IU5 
_pdbx_database_related.details        '1IU5 contains X-ray Crystal Structure of the same protein.' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IU6 
_pdbx_database_status.recvd_initial_deposition_date   2002-02-27 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Chatake, T.'   1 ? 
'Kurihara, K.'  2 ? 
'Tanaka, I.'    3 ? 
'Tsyba, I.'     4 ? 
'Bau, R.'       5 ? 
'Jenney, F.E.'  6 ? 
'Adams, M.W.W.' 7 ? 
'Niimura, N.'   8 ? 
# 
_citation.id                        primary 
_citation.title                     'A neutron crystallographic analysis of a rubredoxin mutant at 1.6 A resolution.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            60 
_citation.page_first                1364 
_citation.page_last                 1373 
_citation.year                      2004 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   15272158 
_citation.pdbx_database_id_DOI      10.1107/S090744490401176X 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Chatake, T.'  1 ? 
primary 'Kurihara, K.' 2 ? 
primary 'Tanaka, I.'   3 ? 
primary 'Tsyba, I.'    4 ? 
primary 'Bau, R.'      5 ? 
primary 'Jenney, F.E.' 6 ? 
primary 'Adams, M.W.'  7 ? 
primary 'Niimura, N.'  8 ? 
# 
_cell.entry_id           1IU6 
_cell.length_a           34.480 
_cell.length_b           35.700 
_cell.length_c           43.160 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IU6 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man rubredoxin     5863.470 1  ? 'W3Y, I23V, L32I' ? ? 
2 non-polymer syn 'FE (III) ION' 55.845   1  ? ?                 ? ? 
3 water       nat water          18.015   31 ? ?                 ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       AKYVCKICGYIYDEDAGDPDNGVSPGTKFEEIPDDWVCPICGAPKSEFEKLED 
_entity_poly.pdbx_seq_one_letter_code_can   AKYVCKICGYIYDEDAGDPDNGVSPGTKFEEIPDDWVCPICGAPKSEFEKLED 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  LYS n 
1 3  TYR n 
1 4  VAL n 
1 5  CYS n 
1 6  LYS n 
1 7  ILE n 
1 8  CYS n 
1 9  GLY n 
1 10 TYR n 
1 11 ILE n 
1 12 TYR n 
1 13 ASP n 
1 14 GLU n 
1 15 ASP n 
1 16 ALA n 
1 17 GLY n 
1 18 ASP n 
1 19 PRO n 
1 20 ASP n 
1 21 ASN n 
1 22 GLY n 
1 23 VAL n 
1 24 SER n 
1 25 PRO n 
1 26 GLY n 
1 27 THR n 
1 28 LYS n 
1 29 PHE n 
1 30 GLU n 
1 31 GLU n 
1 32 ILE n 
1 33 PRO n 
1 34 ASP n 
1 35 ASP n 
1 36 TRP n 
1 37 VAL n 
1 38 CYS n 
1 39 PRO n 
1 40 ILE n 
1 41 CYS n 
1 42 GLY n 
1 43 ALA n 
1 44 PRO n 
1 45 LYS n 
1 46 SER n 
1 47 GLU n 
1 48 PHE n 
1 49 GLU n 
1 50 LYS n 
1 51 LEU n 
1 52 GLU n 
1 53 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Pyrococcus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Pyrococcus furiosus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2261 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RUBR_PYRFU 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   AKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P24297 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1IU6 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 53 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P24297 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  53 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       53 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1IU6 TYR A 3  ? UNP P24297 TRP 3  ENGINEERED 3  1 
1 1IU6 VAL A 23 ? UNP P24297 ILE 23 ENGINEERED 23 2 
1 1IU6 ILE A 32 ? UNP P24297 LEU 32 ENGINEERED 32 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE            ? 'C3 H7 N O2'     89.093  
ASN 'L-peptide linking' y ASPARAGINE         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'    ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE           ? 'C3 H7 N O2 S'   121.158 
DOD non-polymer         . 'DEUTERATED WATER' ? 'D2 O'           20.028  
FE  non-polymer         . 'FE (III) ION'     ? 'Fe 3'           55.845  
GLU 'L-peptide linking' y 'GLUTAMIC ACID'    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE            ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE             ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE      ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE             ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE          ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN         ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE             ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1IU6 
_exptl.method            'NEUTRON DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.description           ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    'Na/K phosphate, VAPOR DIFFUSION' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     299 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               DIFFRACTOMETER 
_diffrn_detector.type                   ? 
_diffrn_detector.pdbx_collection_date   2000-11-15 
_diffrn_detector.details                'JAERI BIX-3' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'ELASTICALLY-BENT PERFECT SILICON MONOCHROMATOR' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             neutron 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   2.345 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'NUCLEAR REACTOR' 
_diffrn_source.type                        'JRR-3M BEAMLINE 1G-A' 
_diffrn_source.pdbx_synchrotron_site       JRR-3M 
_diffrn_source.pdbx_synchrotron_beamline   1G-A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        2.345 
# 
_reflns.entry_id                     1IU6 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             100 
_reflns.d_resolution_high            1.6 
_reflns.number_obs                   6584 
_reflns.number_all                   6584 
_reflns.percent_possible_obs         87.5 
_reflns.pdbx_Rmerge_I_obs            0.091 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.5 
_reflns.B_iso_Wilson_estimate        9.1 
_reflns.pdbx_redundancy              2.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.60 
_reflns_shell.d_res_low              1.66 
_reflns_shell.percent_possible_all   66.0 
_reflns_shell.Rmerge_I_obs           0.254 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        1.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1IU6 
_refine.ls_number_reflns_obs                     6308 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          3.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            1.6 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.201 
_refine.ls_R_factor_R_free                       0.228 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  690 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               13.4 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             Istotropic 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'NEUTRON DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1IU6 
_refine_analyze.Luzzati_coordinate_error_obs    0.18 
_refine_analyze.Luzzati_sigma_a_obs             0.18 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.22 
_refine_analyze.Luzzati_sigma_a_free            0.25 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'NEUTRON DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'NEUTRON DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        393 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             29 
_refine_hist.number_atoms_total               423 
_refine_hist.d_res_high                       1.6 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.007 ? ? ? 'NEUTRON DIFFRACTION' ? 
c_angle_deg 1.6   ? ? ? 'NEUTRON DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.6 
_refine_ls_shell.d_res_low                        1.7 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.285 
_refine_ls_shell.percent_reflns_obs               65.0 
_refine_ls_shell.R_factor_R_free                  0.329 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'NEUTRON DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1IU6 
_struct.title                     'Neutron Crystal Structure of the rubredoxin mutant from Pyrococcus Furiosus' 
_struct.pdbx_descriptor           rubredoxin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IU6 
_struct_keywords.pdbx_keywords   'ELECTRON TRANSPORT' 
_struct_keywords.text            'rubredoxin, mutant, hydrogen, hydration, thermostability, ELECTRON TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 18 ? GLY A 22 ? ASP A 18 GLY A 22 5 ? 5 
HELX_P HELX_P2 2 LYS A 28 ? ILE A 32 ? LYS A 28 ILE A 32 5 ? 5 
HELX_P HELX_P3 3 PRO A 44 ? SER A 46 ? PRO A 44 SER A 46 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B FE . FE ? ? ? 1_555 A CYS 5  SG ? ? A FE 153 A CYS 5  1_555 ? ? ? ? ? ? ? 2.314 ? 
metalc2 metalc ? ? B FE . FE ? ? ? 1_555 A CYS 38 SG ? ? A FE 153 A CYS 38 1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc3 metalc ? ? B FE . FE ? ? ? 1_555 A CYS 8  SG ? ? A FE 153 A CYS 8  1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc4 metalc ? ? B FE . FE ? ? ? 1_555 A CYS 41 SG ? ? A FE 153 A CYS 41 1_555 ? ? ? ? ? ? ? 2.324 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 11 ? ASP A 13 ? ILE A 11 ASP A 13 
A 2 LYS A 2  ? CYS A 5  ? LYS A 2  CYS A 5  
A 3 PHE A 48 ? LEU A 51 ? PHE A 48 LEU A 51 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 12 ? O TYR A 12 N TYR A 3  ? N TYR A 3  
A 2 3 N LYS A 2  ? N LYS A 2  O LEU A 51 ? O LEU A 51 
# 
_database_PDB_matrix.entry_id          1IU6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       .000000 
_database_PDB_matrix.origx[1][3]       .000000 
_database_PDB_matrix.origx[2][1]       .000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       .000000 
_database_PDB_matrix.origx[3][1]       .000000 
_database_PDB_matrix.origx[3][2]       .000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   .00000 
_database_PDB_matrix.origx_vector[2]   .00000 
_database_PDB_matrix.origx_vector[3]   .00000 
# 
_atom_sites.entry_id                    1IU6 
_atom_sites.fract_transf_matrix[1][1]   .029002 
_atom_sites.fract_transf_matrix[1][2]   .000000 
_atom_sites.fract_transf_matrix[1][3]   .000000 
_atom_sites.fract_transf_matrix[2][1]   .000000 
_atom_sites.fract_transf_matrix[2][2]   .028011 
_atom_sites.fract_transf_matrix[2][3]   .000000 
_atom_sites.fract_transf_matrix[3][1]   .000000 
_atom_sites.fract_transf_matrix[3][2]   .000000 
_atom_sites.fract_transf_matrix[3][3]   .023170 
_atom_sites.fract_transf_vector[1]      .00000 
_atom_sites.fract_transf_vector[2]      .00000 
_atom_sites.fract_transf_vector[3]      .00000 
# 
loop_
_atom_type.symbol 
C  
D  
FE 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N  N    . ALA A 1 1  ? 21.632 -3.090  3.127  1.00 13.46 ? 1   ALA A N    1 
ATOM   2   C  CA   . ALA A 1 1  ? 21.400 -2.068  2.078  1.00 14.19 ? 1   ALA A CA   1 
ATOM   3   C  C    . ALA A 1 1  ? 20.746 -0.832  2.685  1.00 13.85 ? 1   ALA A C    1 
ATOM   4   O  O    . ALA A 1 1  ? 20.185 -0.874  3.780  1.00 13.81 ? 1   ALA A O    1 
ATOM   5   C  CB   . ALA A 1 1  ? 20.519 -2.640  0.987  1.00 14.59 ? 1   ALA A CB   1 
ATOM   6   D  D1   . ALA A 1 1  ? 20.738 -3.368  3.520  1.00 15.16 ? 1   ALA A D1   1 
ATOM   7   D  D2   . ALA A 1 1  ? 22.244 -2.699  3.872  1.00 15.12 ? 1   ALA A D2   1 
ATOM   8   D  D3   . ALA A 1 1  ? 22.068 -3.917  2.694  1.00 16.58 ? 1   ALA A D3   1 
ATOM   9   H  HA   . ALA A 1 1  ? 22.352 -1.791  1.645  1.00 13.59 ? 1   ALA A HA   1 
ATOM   10  H  HB1  . ALA A 1 1  ? 20.975 -3.529  0.581  1.00 14.36 ? 1   ALA A HB1  1 
ATOM   11  H  HB2  . ALA A 1 1  ? 20.377 -1.909  0.208  1.00 14.57 ? 1   ALA A HB2  1 
ATOM   12  H  HB3  . ALA A 1 1  ? 19.569 -2.894  1.415  1.00 14.79 ? 1   ALA A HB3  1 
ATOM   13  N  N    . LYS A 1 2  ? 20.809 0.262   1.938  1.00 12.97 ? 2   LYS A N    1 
ATOM   14  C  CA   . LYS A 1 2  ? 20.245 1.533   2.363  1.00 12.37 ? 2   LYS A CA   1 
ATOM   15  C  C    . LYS A 1 2  ? 19.312 2.039   1.270  1.00 11.17 ? 2   LYS A C    1 
ATOM   16  O  O    . LYS A 1 2  ? 19.569 1.840   0.087  1.00 10.42 ? 2   LYS A O    1 
ATOM   17  C  CB   . LYS A 1 2  ? 21.364 2.540   2.630  1.00 12.95 ? 2   LYS A CB   1 
ATOM   18  C  CG   . LYS A 1 2  ? 22.229 2.171   3.842  1.00 16.48 ? 2   LYS A CG   1 
ATOM   19  C  CD   . LYS A 1 2  ? 23.309 3.216   4.101  1.00 18.48 ? 2   LYS A CD   1 
ATOM   20  C  CE   . LYS A 1 2  ? 23.953 3.038   5.477  1.00 20.64 ? 2   LYS A CE   1 
ATOM   21  N  NZ   . LYS A 1 2  ? 25.123 3.962   5.693  1.00 22.09 ? 2   LYS A NZ   1 
ATOM   22  H  H    A LYS A 1 2  ? 21.098 0.080   1.017  0.35 12.97 ? 2   LYS A H    1 
ATOM   23  D  D    B LYS A 1 2  ? 21.098 0.080   1.017  0.65 12.97 ? 2   LYS A D    1 
ATOM   24  H  HA   . LYS A 1 2  ? 19.679 1.384   3.281  1.00 11.21 ? 2   LYS A HA   1 
ATOM   25  H  HB2  . LYS A 1 2  ? 21.998 2.599   1.755  1.00 14.33 ? 2   LYS A HB2  1 
ATOM   26  H  HB3  . LYS A 1 2  ? 20.917 3.511   2.801  1.00 15.11 ? 2   LYS A HB3  1 
ATOM   27  H  HG2  . LYS A 1 2  ? 21.589 2.082   4.703  1.00 16.72 ? 2   LYS A HG2  1 
ATOM   28  H  HG3  . LYS A 1 2  ? 22.699 1.211   3.667  1.00 17.35 ? 2   LYS A HG3  1 
ATOM   29  H  HD2  . LYS A 1 2  ? 24.068 3.131   3.336  1.00 17.60 ? 2   LYS A HD2  1 
ATOM   30  H  HD3  . LYS A 1 2  ? 22.863 4.195   4.040  1.00 18.18 ? 2   LYS A HD3  1 
ATOM   31  H  HE2  . LYS A 1 2  ? 23.212 3.240   6.229  1.00 21.17 ? 2   LYS A HE2  1 
ATOM   32  H  HE3  . LYS A 1 2  ? 24.280 2.021   5.585  1.00 20.93 ? 2   LYS A HE3  1 
ATOM   33  N  N    . TYR A 1 3  ? 18.205 2.647   1.686  1.00 10.39 ? 3   TYR A N    1 
ATOM   34  C  CA   . TYR A 1 3  ? 17.193 3.178   0.783  1.00 9.26  ? 3   TYR A CA   1 
ATOM   35  C  C    . TYR A 1 3  ? 16.915 4.606   1.203  1.00 8.82  ? 3   TYR A C    1 
ATOM   36  O  O    . TYR A 1 3  ? 16.860 4.909   2.393  1.00 11.45 ? 3   TYR A O    1 
ATOM   37  C  CB   . TYR A 1 3  ? 15.878 2.403   0.892  1.00 9.86  ? 3   TYR A CB   1 
ATOM   38  C  CG   . TYR A 1 3  ? 15.927 0.988   0.355  1.00 9.06  ? 3   TYR A CG   1 
ATOM   39  C  CD1  . TYR A 1 3  ? 15.242 0.655   -0.803 1.00 11.99 ? 3   TYR A CD1  1 
ATOM   40  C  CD2  . TYR A 1 3  ? 16.651 -0.002  1.003  1.00 11.01 ? 3   TYR A CD2  1 
ATOM   41  C  CE1  . TYR A 1 3  ? 15.275 -0.624  -1.310 1.00 14.81 ? 3   TYR A CE1  1 
ATOM   42  C  CE2  . TYR A 1 3  ? 16.693 -1.299  0.498  1.00 11.67 ? 3   TYR A CE2  1 
ATOM   43  C  CZ   . TYR A 1 3  ? 15.998 -1.596  -0.661 1.00 14.51 ? 3   TYR A CZ   1 
ATOM   44  O  OH   . TYR A 1 3  ? 16.029 -2.869  -1.187 1.00 18.31 ? 3   TYR A OH   1 
ATOM   45  H  H    A TYR A 1 3  ? 18.211 2.925   2.625  0.34 10.39 ? 3   TYR A H    1 
ATOM   46  D  D    B TYR A 1 3  ? 18.211 2.925   2.625  0.66 10.39 ? 3   TYR A D    1 
ATOM   47  H  HA   . TYR A 1 3  ? 17.548 3.154   -0.241 1.00 9.71  ? 3   TYR A HA   1 
ATOM   48  H  HB2  . TYR A 1 3  ? 15.586 2.377   1.928  1.00 11.12 ? 3   TYR A HB2  1 
ATOM   49  H  HB3  . TYR A 1 3  ? 15.112 2.950   0.340  1.00 11.49 ? 3   TYR A HB3  1 
ATOM   50  H  HD1  . TYR A 1 3  ? 14.681 1.420   -1.329 1.00 12.09 ? 3   TYR A HD1  1 
ATOM   51  H  HD2  . TYR A 1 3  ? 17.202 0.238   1.905  1.00 11.97 ? 3   TYR A HD2  1 
ATOM   52  H  HE1  . TYR A 1 3  ? 14.729 -0.859  -2.212 1.00 15.89 ? 3   TYR A HE1  1 
ATOM   53  H  HE2  . TYR A 1 3  ? 17.262 -2.070  1.013  1.00 14.72 ? 3   TYR A HE2  1 
ATOM   54  D  DH   . TYR A 1 3  ? 15.401 -3.431  -0.718 1.00 22.44 ? 3   TYR A DH   1 
ATOM   55  N  N    . VAL A 1 4  ? 16.714 5.481   0.229  1.00 6.76  ? 4   VAL A N    1 
ATOM   56  C  CA   . VAL A 1 4  ? 16.436 6.867   0.533  1.00 8.34  ? 4   VAL A CA   1 
ATOM   57  C  C    . VAL A 1 4  ? 14.992 7.193   0.195  1.00 7.81  ? 4   VAL A C    1 
ATOM   58  O  O    . VAL A 1 4  ? 14.423 6.653   -0.754 1.00 6.14  ? 4   VAL A O    1 
ATOM   59  C  CB   . VAL A 1 4  ? 17.382 7.814   -0.251 1.00 7.93  ? 4   VAL A CB   1 
ATOM   60  C  CG1  . VAL A 1 4  ? 17.120 7.710   -1.749 1.00 8.13  ? 4   VAL A CG1  1 
ATOM   61  C  CG2  . VAL A 1 4  ? 17.185 9.257   0.211  1.00 8.92  ? 4   VAL A CG2  1 
ATOM   62  H  H    A VAL A 1 4  ? 16.925 5.202   -0.686 0.78 6.76  ? 4   VAL A H    1 
ATOM   63  D  D    B VAL A 1 4  ? 16.925 5.202   -0.686 0.22 6.76  ? 4   VAL A D    1 
ATOM   64  H  HA   . VAL A 1 4  ? 16.593 7.026   1.595  1.00 8.96  ? 4   VAL A HA   1 
ATOM   65  H  HB   . VAL A 1 4  ? 18.403 7.520   -0.057 1.00 8.80  ? 4   VAL A HB   1 
ATOM   66  H  HG11 . VAL A 1 4  ? 17.916 8.196   -2.307 1.00 9.05  ? 4   VAL A HG11 1 
ATOM   67  H  HG12 . VAL A 1 4  ? 16.183 8.197   -1.958 1.00 9.51  ? 4   VAL A HG12 1 
ATOM   68  H  HG13 . VAL A 1 4  ? 17.049 6.668   -2.038 1.00 9.14  ? 4   VAL A HG13 1 
ATOM   69  H  HG21 . VAL A 1 4  ? 16.964 9.270   1.273  1.00 11.10 ? 4   VAL A HG21 1 
ATOM   70  H  HG22 . VAL A 1 4  ? 16.357 9.698   -0.330 1.00 11.71 ? 4   VAL A HG22 1 
ATOM   71  H  HG23 . VAL A 1 4  ? 18.089 9.825   0.025  1.00 10.87 ? 4   VAL A HG23 1 
ATOM   72  N  N    . CYS A 1 5  ? 14.373 7.994   1.049  1.00 7.88  ? 5   CYS A N    1 
ATOM   73  C  CA   . CYS A 1 5  ? 13.019 8.448   0.820  1.00 7.22  ? 5   CYS A CA   1 
ATOM   74  C  C    . CYS A 1 5  ? 13.194 9.618   -0.145 1.00 8.27  ? 5   CYS A C    1 
ATOM   75  O  O    . CYS A 1 5  ? 13.818 10.619  0.211  1.00 8.77  ? 5   CYS A O    1 
ATOM   76  C  CB   . CYS A 1 5  ? 12.422 8.950   2.117  1.00 8.12  ? 5   CYS A CB   1 
ATOM   77  S  SG   . CYS A 1 5  ? 10.856 9.747   1.896  1.00 7.60  ? 5   CYS A SG   1 
ATOM   78  H  H    A CYS A 1 5  ? 14.836 8.239   1.871  0.97 7.88  ? 5   CYS A H    1 
ATOM   79  D  D    B CYS A 1 5  ? 14.836 8.239   1.871  0.03 7.88  ? 5   CYS A D    1 
ATOM   80  H  HA   . CYS A 1 5  ? 12.406 7.658   0.380  1.00 6.83  ? 5   CYS A HA   1 
ATOM   81  H  HB2  . CYS A 1 5  ? 12.308 8.119   2.795  1.00 7.44  ? 5   CYS A HB2  1 
ATOM   82  H  HB3  . CYS A 1 5  ? 13.114 9.657   2.561  1.00 8.83  ? 5   CYS A HB3  1 
ATOM   83  N  N    . LYS A 1 6  ? 12.630 9.504   -1.346 1.00 7.34  ? 6   LYS A N    1 
ATOM   84  C  CA   . LYS A 1 6  ? 12.765 10.540  -2.363 1.00 9.88  ? 6   LYS A CA   1 
ATOM   85  C  C    . LYS A 1 6  ? 12.104 11.860  -2.005 1.00 9.15  ? 6   LYS A C    1 
ATOM   86  O  O    . LYS A 1 6  ? 12.432 12.896  -2.578 1.00 11.79 ? 6   LYS A O    1 
ATOM   87  C  CB   . LYS A 1 6  ? 12.218 10.020  -3.698 1.00 13.03 ? 6   LYS A CB   1 
ATOM   88  C  CG   . LYS A 1 6  ? 13.108 8.934   -4.304 1.00 18.11 ? 6   LYS A CG   1 
ATOM   89  C  CD   . LYS A 1 6  ? 12.773 8.650   -5.770 1.00 22.00 ? 6   LYS A CD   1 
ATOM   90  C  CE   . LYS A 1 6  ? 11.505 7.812   -5.918 1.00 24.12 ? 6   LYS A CE   1 
ATOM   91  N  NZ   . LYS A 1 6  ? 11.124 7.632   -7.361 1.00 23.29 ? 6   LYS A NZ   1 
ATOM   92  H  H    A LYS A 1 6  ? 12.120 8.728   -1.584 0.19 7.34  ? 6   LYS A H    1 
ATOM   93  D  D    B LYS A 1 6  ? 12.120 8.728   -1.584 0.81 7.34  ? 6   LYS A D    1 
ATOM   94  H  HA   . LYS A 1 6  ? 13.819 10.723  -2.495 1.00 9.57  ? 6   LYS A HA   1 
ATOM   95  H  HB2  . LYS A 1 6  ? 11.239 9.599   -3.506 1.00 14.49 ? 6   LYS A HB2  1 
ATOM   96  H  HB3  . LYS A 1 6  ? 12.117 10.845  -4.400 1.00 12.43 ? 6   LYS A HB3  1 
ATOM   97  H  HG2  . LYS A 1 6  ? 14.133 9.243   -4.227 1.00 20.17 ? 6   LYS A HG2  1 
ATOM   98  H  HG3  . LYS A 1 6  ? 12.981 8.032   -3.727 1.00 18.14 ? 6   LYS A HG3  1 
ATOM   99  H  HD2  . LYS A 1 6  ? 12.637 9.589   -6.278 1.00 21.80 ? 6   LYS A HD2  1 
ATOM   100 H  HD3  . LYS A 1 6  ? 13.600 8.122   -6.222 1.00 21.46 ? 6   LYS A HD3  1 
ATOM   101 H  HE2  . LYS A 1 6  ? 11.679 6.845   -5.480 1.00 23.02 ? 6   LYS A HE2  1 
ATOM   102 H  HE3  . LYS A 1 6  ? 10.699 8.294   -5.397 1.00 23.78 ? 6   LYS A HE3  1 
ATOM   103 N  N    . ILE A 1 7  ? 11.181 11.824  -1.052 1.00 7.73  ? 7   ILE A N    1 
ATOM   104 C  CA   . ILE A 1 7  ? 10.478 13.023  -0.648 1.00 9.06  ? 7   ILE A CA   1 
ATOM   105 C  C    . ILE A 1 7  ? 11.260 13.873  0.357  1.00 9.12  ? 7   ILE A C    1 
ATOM   106 O  O    . ILE A 1 7  ? 11.442 15.074  0.135  1.00 9.55  ? 7   ILE A O    1 
ATOM   107 C  CB   . ILE A 1 7  ? 9.106  12.681  -0.001 1.00 11.63 ? 7   ILE A CB   1 
ATOM   108 C  CG1  . ILE A 1 7  ? 8.289  11.716  -0.880 1.00 14.14 ? 7   ILE A CG1  1 
ATOM   109 C  CG2  . ILE A 1 7  ? 8.341  13.950  0.280  1.00 11.90 ? 7   ILE A CG2  1 
ATOM   110 C  CD1  . ILE A 1 7  ? 8.068  12.167  -2.299 1.00 15.04 ? 7   ILE A CD1  1 
ATOM   111 H  H    A ILE A 1 7  ? 10.934 10.994  -0.600 0.35 7.73  ? 7   ILE A H    1 
ATOM   112 D  D    B ILE A 1 7  ? 10.934 10.994  -0.600 0.65 7.73  ? 7   ILE A D    1 
ATOM   113 H  HA   . ILE A 1 7  ? 10.303 13.639  -1.527 1.00 8.78  ? 7   ILE A HA   1 
ATOM   114 H  HB   . ILE A 1 7  ? 9.302  12.192  0.950  1.00 10.64 ? 7   ILE A HB   1 
ATOM   115 H  HG12 . ILE A 1 7  ? 8.806  10.775  -0.910 1.00 14.12 ? 7   ILE A HG12 1 
ATOM   116 H  HG13 . ILE A 1 7  ? 7.324  11.549  -0.414 1.00 13.73 ? 7   ILE A HG13 1 
ATOM   117 H  HG21 . ILE A 1 7  ? 8.813  14.477  1.097  1.00 13.59 ? 7   ILE A HG21 1 
ATOM   118 H  HG22 . ILE A 1 7  ? 7.333  13.704  0.552  1.00 12.77 ? 7   ILE A HG22 1 
ATOM   119 H  HG23 . ILE A 1 7  ? 8.341  14.582  -0.595 1.00 13.08 ? 7   ILE A HG23 1 
ATOM   120 H  HD11 . ILE A 1 7  ? 8.980  12.033  -2.858 1.00 16.25 ? 7   ILE A HD11 1 
ATOM   121 H  HD12 . ILE A 1 7  ? 7.799  13.212  -2.307 1.00 15.67 ? 7   ILE A HD12 1 
ATOM   122 H  HD13 . ILE A 1 7  ? 7.277  11.584  -2.753 1.00 16.06 ? 7   ILE A HD13 1 
ATOM   123 N  N    . CYS A 1 8  ? 11.784 13.262  1.421  1.00 7.46  ? 8   CYS A N    1 
ATOM   124 C  CA   . CYS A 1 8  ? 12.432 14.056  2.458  1.00 6.95  ? 8   CYS A CA   1 
ATOM   125 C  C    . CYS A 1 8  ? 13.923 13.849  2.712  1.00 7.83  ? 8   CYS A C    1 
ATOM   126 O  O    . CYS A 1 8  ? 14.541 14.651  3.408  1.00 9.20  ? 8   CYS A O    1 
ATOM   127 C  CB   . CYS A 1 8  ? 11.669 13.892  3.768  1.00 7.02  ? 8   CYS A CB   1 
ATOM   128 S  SG   . CYS A 1 8  ? 11.922 12.306  4.552  1.00 7.31  ? 8   CYS A SG   1 
ATOM   129 H  H    A CYS A 1 8  ? 11.898 12.284  1.493  0.20 7.46  ? 8   CYS A H    1 
ATOM   130 D  D    B CYS A 1 8  ? 11.898 12.284  1.493  0.80 7.46  ? 8   CYS A D    1 
ATOM   131 H  HA   . CYS A 1 8  ? 12.320 15.078  2.167  1.00 8.16  ? 8   CYS A HA   1 
ATOM   132 H  HB2  . CYS A 1 8  ? 11.998 14.660  4.445  1.00 8.12  ? 8   CYS A HB2  1 
ATOM   133 H  HB3  . CYS A 1 8  ? 10.616 14.042  3.584  1.00 10.45 ? 8   CYS A HB3  1 
ATOM   134 N  N    . GLY A 1 9  ? 14.496 12.789  2.155  1.00 9.30  ? 9   GLY A N    1 
ATOM   135 C  CA   . GLY A 1 9  ? 15.922 12.542  2.333  1.00 8.08  ? 9   GLY A CA   1 
ATOM   136 C  C    . GLY A 1 9  ? 16.294 11.574  3.449  1.00 8.69  ? 9   GLY A C    1 
ATOM   137 O  O    . GLY A 1 9  ? 17.484 11.351  3.699  1.00 8.23  ? 9   GLY A O    1 
ATOM   138 H  H    A GLY A 1 9  ? 13.947 12.237  1.559  0.07 9.30  ? 9   GLY A H    1 
ATOM   139 D  D    B GLY A 1 9  ? 13.947 12.237  1.559  0.93 9.30  ? 9   GLY A D    1 
ATOM   140 H  HA2  . GLY A 1 9  ? 16.327 12.161  1.403  1.00 10.22 ? 9   GLY A HA2  1 
ATOM   141 H  HA3  . GLY A 1 9  ? 16.406 13.483  2.526  1.00 9.40  ? 9   GLY A HA3  1 
ATOM   142 N  N    . TYR A 1 10 ? 15.300 11.051  4.161  1.00 7.10  ? 10  TYR A N    1 
ATOM   143 C  CA   . TYR A 1 10 ? 15.528 10.078  5.228  1.00 7.43  ? 10  TYR A CA   1 
ATOM   144 C  C    . TYR A 1 10 ? 16.129 8.815   4.616  1.00 6.50  ? 10  TYR A C    1 
ATOM   145 O  O    . TYR A 1 10 ? 15.725 8.396   3.535  1.00 5.28  ? 10  TYR A O    1 
ATOM   146 C  CB   . TYR A 1 10 ? 14.194 9.735   5.923  1.00 9.05  ? 10  TYR A CB   1 
ATOM   147 C  CG   . TYR A 1 10 ? 14.235 8.495   6.802  1.00 8.15  ? 10  TYR A CG   1 
ATOM   148 C  CD1  . TYR A 1 10 ? 14.750 8.539   8.089  1.00 10.93 ? 10  TYR A CD1  1 
ATOM   149 C  CD2  . TYR A 1 10 ? 13.747 7.287   6.337  1.00 10.12 ? 10  TYR A CD2  1 
ATOM   150 C  CE1  . TYR A 1 10 ? 14.779 7.411   8.890  1.00 7.81  ? 10  TYR A CE1  1 
ATOM   151 C  CE2  . TYR A 1 10 ? 13.768 6.158   7.120  1.00 10.68 ? 10  TYR A CE2  1 
ATOM   152 C  CZ   . TYR A 1 10 ? 14.284 6.224   8.397  1.00 9.65  ? 10  TYR A CZ   1 
ATOM   153 O  OH   . TYR A 1 10 ? 14.295 5.087   9.169  1.00 10.72 ? 10  TYR A OH   1 
ATOM   154 H  H    A TYR A 1 10 ? 14.346 11.301  4.096  0.25 7.10  ? 10  TYR A H    1 
ATOM   155 D  D    B TYR A 1 10 ? 14.346 11.301  4.096  0.75 7.10  ? 10  TYR A D    1 
ATOM   156 H  HA   . TYR A 1 10 ? 16.216 10.491  5.956  1.00 6.13  ? 10  TYR A HA   1 
ATOM   157 H  HB2  . TYR A 1 10 ? 13.898 10.571  6.528  1.00 7.41  ? 10  TYR A HB2  1 
ATOM   158 H  HB3  . TYR A 1 10 ? 13.429 9.586   5.173  1.00 9.02  ? 10  TYR A HB3  1 
ATOM   159 H  HD1  . TYR A 1 10 ? 15.135 9.465   8.470  1.00 10.43 ? 10  TYR A HD1  1 
ATOM   160 H  HD2  . TYR A 1 10 ? 13.343 7.232   5.342  1.00 9.61  ? 10  TYR A HD2  1 
ATOM   161 H  HE1  . TYR A 1 10 ? 15.199 7.466   9.894  1.00 10.23 ? 10  TYR A HE1  1 
ATOM   162 H  HE2  . TYR A 1 10 ? 13.382 5.224   6.746  1.00 11.71 ? 10  TYR A HE2  1 
ATOM   163 D  DH   . TYR A 1 10 ? 14.636 5.305   10.043 1.00 12.62 ? 10  TYR A DH   1 
ATOM   164 N  N    . ILE A 1 11 ? 17.102 8.221   5.308  1.00 5.59  ? 11  ILE A N    1 
ATOM   165 C  CA   . ILE A 1 11 ? 17.750 7.007   4.841  1.00 8.36  ? 11  ILE A CA   1 
ATOM   166 C  C    . ILE A 1 11 ? 17.366 5.793   5.694  1.00 6.07  ? 11  ILE A C    1 
ATOM   167 O  O    . ILE A 1 11 ? 17.650 5.754   6.892  1.00 6.95  ? 11  ILE A O    1 
ATOM   168 C  CB   . ILE A 1 11 ? 19.293 7.149   4.923  1.00 12.10 ? 11  ILE A CB   1 
ATOM   169 C  CG1  . ILE A 1 11 ? 19.756 8.424   4.193  1.00 13.15 ? 11  ILE A CG1  1 
ATOM   170 C  CG2  . ILE A 1 11 ? 19.976 5.883   4.397  1.00 12.50 ? 11  ILE A CG2  1 
ATOM   171 C  CD1  . ILE A 1 11 ? 20.038 8.248   2.729  1.00 15.24 ? 11  ILE A CD1  1 
ATOM   172 H  H    A ILE A 1 11 ? 17.488 8.653   6.088  0.33 5.59  ? 11  ILE A H    1 
ATOM   173 D  D    B ILE A 1 11 ? 17.488 8.653   6.088  0.67 5.59  ? 11  ILE A D    1 
ATOM   174 H  HA   . ILE A 1 11 ? 17.461 6.826   3.808  1.00 6.98  ? 11  ILE A HA   1 
ATOM   175 H  HB   . ILE A 1 11 ? 19.558 7.256   5.964  1.00 11.45 ? 11  ILE A HB   1 
ATOM   176 H  HG12 . ILE A 1 11 ? 18.986 9.175   4.303  1.00 14.33 ? 11  ILE A HG12 1 
ATOM   177 H  HG13 . ILE A 1 11 ? 20.648 8.791   4.677  1.00 14.50 ? 11  ILE A HG13 1 
ATOM   178 H  HG21 . ILE A 1 11 ? 21.021 5.914   4.657  1.00 13.47 ? 11  ILE A HG21 1 
ATOM   179 H  HG22 . ILE A 1 11 ? 19.894 5.828   3.323  1.00 13.97 ? 11  ILE A HG22 1 
ATOM   180 H  HG23 . ILE A 1 11 ? 19.526 5.010   4.852  1.00 14.05 ? 11  ILE A HG23 1 
ATOM   181 H  HD11 . ILE A 1 11 ? 20.428 9.172   2.322  1.00 13.22 ? 11  ILE A HD11 1 
ATOM   182 H  HD12 . ILE A 1 11 ? 19.125 7.989   2.227  1.00 13.94 ? 11  ILE A HD12 1 
ATOM   183 H  HD13 . ILE A 1 11 ? 20.754 7.457   2.589  1.00 14.64 ? 11  ILE A HD13 1 
ATOM   184 N  N    . TYR A 1 12 ? 16.696 4.821   5.088  1.00 7.08  ? 12  TYR A N    1 
ATOM   185 C  CA   . TYR A 1 12 ? 16.368 3.596   5.803  1.00 6.06  ? 12  TYR A CA   1 
ATOM   186 C  C    . TYR A 1 12 ? 17.581 2.670   5.683  1.00 6.23  ? 12  TYR A C    1 
ATOM   187 O  O    . TYR A 1 12 ? 17.956 2.285   4.584  1.00 6.39  ? 12  TYR A O    1 
ATOM   188 C  CB   . TYR A 1 12 ? 15.149 2.864   5.215  1.00 6.07  ? 12  TYR A CB   1 
ATOM   189 C  CG   . TYR A 1 12 ? 14.912 1.578   5.972  1.00 5.09  ? 12  TYR A CG   1 
ATOM   190 C  CD1  . TYR A 1 12 ? 14.343 1.599   7.235  1.00 5.90  ? 12  TYR A CD1  1 
ATOM   191 C  CD2  . TYR A 1 12 ? 15.350 0.355   5.463  1.00 4.65  ? 12  TYR A CD2  1 
ATOM   192 C  CE1  . TYR A 1 12 ? 14.214 0.440   7.989  1.00 7.92  ? 12  TYR A CE1  1 
ATOM   193 C  CE2  . TYR A 1 12 ? 15.206 -0.819  6.203  1.00 7.17  ? 12  TYR A CE2  1 
ATOM   194 C  CZ   . TYR A 1 12 ? 14.642 -0.759  7.469  1.00 7.71  ? 12  TYR A CZ   1 
ATOM   195 O  OH   . TYR A 1 12 ? 14.522 -1.885  8.240  1.00 7.62  ? 12  TYR A OH   1 
ATOM   196 H  H    A TYR A 1 12 ? 16.381 4.968   4.184  0.97 7.08  ? 12  TYR A H    1 
ATOM   197 D  D    B TYR A 1 12 ? 16.381 4.968   4.184  0.03 7.08  ? 12  TYR A D    1 
ATOM   198 H  HA   . TYR A 1 12 ? 16.192 3.822   6.854  1.00 7.13  ? 12  TYR A HA   1 
ATOM   199 H  HB2  . TYR A 1 12 ? 14.257 3.497   5.275  1.00 6.50  ? 12  TYR A HB2  1 
ATOM   200 H  HB3  . TYR A 1 12 ? 15.368 2.629   4.177  1.00 6.72  ? 12  TYR A HB3  1 
ATOM   201 H  HD1  . TYR A 1 12 ? 13.984 2.530   7.638  1.00 6.82  ? 12  TYR A HD1  1 
ATOM   202 H  HD2  . TYR A 1 12 ? 15.797 0.325   4.473  1.00 8.47  ? 12  TYR A HD2  1 
ATOM   203 H  HE1  . TYR A 1 12 ? 13.759 0.475   8.977  1.00 9.02  ? 12  TYR A HE1  1 
ATOM   204 H  HE2  . TYR A 1 12 ? 15.538 -1.770  5.800  1.00 10.07 ? 12  TYR A HE2  1 
ATOM   205 D  DH   . TYR A 1 12 ? 14.912 -2.645  7.797  1.00 12.25 ? 12  TYR A DH   1 
ATOM   206 N  N    . ASP A 1 13 ? 18.199 2.343   6.812  1.00 6.51  ? 13  ASP A N    1 
ATOM   207 C  CA   . ASP A 1 13 ? 19.349 1.460   6.830  1.00 8.83  ? 13  ASP A CA   1 
ATOM   208 C  C    . ASP A 1 13 ? 18.866 0.133   7.406  1.00 6.20  ? 13  ASP A C    1 
ATOM   209 O  O    . ASP A 1 13 ? 18.368 0.089   8.534  1.00 9.33  ? 13  ASP A O    1 
ATOM   210 C  CB   . ASP A 1 13 ? 20.449 2.068   7.708  1.00 11.28 ? 13  ASP A CB   1 
ATOM   211 C  CG   . ASP A 1 13 ? 21.731 1.248   7.716  1.00 11.70 ? 13  ASP A CG   1 
ATOM   212 O  OD1  . ASP A 1 13 ? 21.785 0.165   7.098  1.00 13.62 ? 13  ASP A OD1  1 
ATOM   213 O  OD2  . ASP A 1 13 ? 22.704 1.703   8.355  1.00 16.71 ? 13  ASP A OD2  1 
ATOM   214 H  H    A ASP A 1 13 ? 17.877 2.581   7.714  0.15 6.51  ? 13  ASP A H    1 
ATOM   215 D  D    B ASP A 1 13 ? 17.877 2.581   7.714  0.85 6.51  ? 13  ASP A D    1 
ATOM   216 H  HA   . ASP A 1 13 ? 19.711 1.310   5.824  1.00 9.30  ? 13  ASP A HA   1 
ATOM   217 H  HB2  . ASP A 1 13 ? 20.677 3.063   7.349  1.00 10.16 ? 13  ASP A HB2  1 
ATOM   218 H  HB3  . ASP A 1 13 ? 20.083 2.149   8.721  1.00 12.39 ? 13  ASP A HB3  1 
ATOM   219 N  N    . GLU A 1 14 ? 18.982 -0.933  6.622  1.00 6.27  ? 14  GLU A N    1 
ATOM   220 C  CA   . GLU A 1 14 ? 18.559 -2.257  7.062  1.00 9.13  ? 14  GLU A CA   1 
ATOM   221 C  C    . GLU A 1 14 ? 19.266 -2.694  8.346  1.00 9.28  ? 14  GLU A C    1 
ATOM   222 O  O    . GLU A 1 14 ? 18.684 -3.418  9.152  1.00 8.73  ? 14  GLU A O    1 
ATOM   223 C  CB   . GLU A 1 14 ? 18.770 -3.275  5.944  1.00 10.34 ? 14  GLU A CB   1 
ATOM   224 C  CG   . GLU A 1 14 ? 17.859 -3.011  4.749  1.00 10.76 ? 14  GLU A CG   1 
ATOM   225 C  CD   . GLU A 1 14 ? 18.072 -3.970  3.584  1.00 12.19 ? 14  GLU A CD   1 
ATOM   226 O  OE1  . GLU A 1 14 ? 19.183 -4.517  3.430  1.00 12.85 ? 14  GLU A OE1  1 
ATOM   227 O  OE2  . GLU A 1 14 ? 17.119 -4.168  2.804  1.00 12.27 ? 14  GLU A OE2  1 
ATOM   228 H  H    A GLU A 1 14 ? 19.227 -0.900  5.694  0.21 6.27  ? 14  GLU A H    1 
ATOM   229 D  D    B GLU A 1 14 ? 19.227 -0.900  5.694  0.79 6.27  ? 14  GLU A D    1 
ATOM   230 H  HA   . GLU A 1 14 ? 17.505 -2.218  7.264  1.00 8.46  ? 14  GLU A HA   1 
ATOM   231 H  HB2  . GLU A 1 14 ? 19.795 -3.236  5.627  1.00 11.85 ? 14  GLU A HB2  1 
ATOM   232 H  HB3  . GLU A 1 14 ? 18.573 -4.259  6.317  1.00 10.16 ? 14  GLU A HB3  1 
ATOM   233 H  HG2  . GLU A 1 14 ? 16.828 -3.076  5.068  1.00 13.35 ? 14  GLU A HG2  1 
ATOM   234 H  HG3  . GLU A 1 14 ? 18.051 -2.005  4.413  1.00 10.58 ? 14  GLU A HG3  1 
ATOM   235 N  N    . ASP A 1 15 ? 20.492 -2.226  8.563  1.00 9.71  ? 15  ASP A N    1 
ATOM   236 C  CA   . ASP A 1 15 ? 21.234 -2.580  9.778  1.00 11.13 ? 15  ASP A CA   1 
ATOM   237 C  C    . ASP A 1 15 ? 20.696 -1.864  11.026 1.00 10.43 ? 15  ASP A C    1 
ATOM   238 O  O    . ASP A 1 15 ? 20.916 -2.323  12.146 1.00 9.87  ? 15  ASP A O    1 
ATOM   239 C  CB   . ASP A 1 15 ? 22.722 -2.235  9.633  1.00 12.75 ? 15  ASP A CB   1 
ATOM   240 C  CG   . ASP A 1 15 ? 23.433 -3.101  8.609  1.00 12.89 ? 15  ASP A CG   1 
ATOM   241 O  OD1  . ASP A 1 15 ? 23.109 -4.305  8.493  1.00 15.11 ? 15  ASP A OD1  1 
ATOM   242 O  OD2  . ASP A 1 15 ? 24.336 -2.578  7.926  1.00 15.66 ? 15  ASP A OD2  1 
ATOM   243 H  H    A ASP A 1 15 ? 20.958 -1.683  7.906  0.21 9.71  ? 15  ASP A H    1 
ATOM   244 D  D    B ASP A 1 15 ? 20.958 -1.683  7.906  0.79 9.71  ? 15  ASP A D    1 
ATOM   245 H  HA   . ASP A 1 15 ? 21.144 -3.648  9.943  1.00 10.65 ? 15  ASP A HA   1 
ATOM   246 H  HB2  . ASP A 1 15 ? 22.813 -1.200  9.332  1.00 11.77 ? 15  ASP A HB2  1 
ATOM   247 H  HB3  . ASP A 1 15 ? 23.203 -2.376  10.592 1.00 13.01 ? 15  ASP A HB3  1 
ATOM   248 N  N    . ALA A 1 16 ? 20.010 -0.742  10.835 1.00 9.02  ? 16  ALA A N    1 
ATOM   249 C  CA   . ALA A 1 16 ? 19.479 0.027   11.949 1.00 10.39 ? 16  ALA A CA   1 
ATOM   250 C  C    . ALA A 1 16 ? 18.003 -0.233  12.192 1.00 8.73  ? 16  ALA A C    1 
ATOM   251 O  O    . ALA A 1 16 ? 17.525 -0.135  13.323 1.00 9.21  ? 16  ALA A O    1 
ATOM   252 C  CB   . ALA A 1 16 ? 19.701 1.504   11.693 1.00 12.02 ? 16  ALA A CB   1 
ATOM   253 H  H    A ALA A 1 16 ? 19.856 -0.403  9.931  0.17 9.02  ? 16  ALA A H    1 
ATOM   254 D  D    B ALA A 1 16 ? 19.856 -0.403  9.931  0.83 9.02  ? 16  ALA A D    1 
ATOM   255 H  HA   . ALA A 1 16 ? 20.025 -0.242  12.840 1.00 8.20  ? 16  ALA A HA   1 
ATOM   256 H  HB1  . ALA A 1 16 ? 19.337 2.080   12.527 1.00 13.36 ? 16  ALA A HB1  1 
ATOM   257 H  HB2  . ALA A 1 16 ? 19.177 1.798   10.795 1.00 13.19 ? 16  ALA A HB2  1 
ATOM   258 H  HB3  . ALA A 1 16 ? 20.753 1.680   11.571 1.00 13.10 ? 16  ALA A HB3  1 
ATOM   259 N  N    . GLY A 1 17 ? 17.281 -0.557  11.126 1.00 9.08  ? 17  GLY A N    1 
ATOM   260 C  CA   . GLY A 1 17 ? 15.852 -0.787  11.241 1.00 9.48  ? 17  GLY A CA   1 
ATOM   261 C  C    . GLY A 1 17 ? 15.147 0.502   11.624 1.00 8.57  ? 17  GLY A C    1 
ATOM   262 O  O    . GLY A 1 17 ? 15.662 1.595   11.398 1.00 8.03  ? 17  GLY A O    1 
ATOM   263 H  H    A GLY A 1 17 ? 17.759 -0.791  10.315 0.08 9.08  ? 17  GLY A H    1 
ATOM   264 D  D    B GLY A 1 17 ? 17.759 -0.791  10.315 0.92 9.08  ? 17  GLY A D    1 
ATOM   265 H  HA2  . GLY A 1 17 ? 15.474 -1.154  10.286 1.00 9.74  ? 17  GLY A HA2  1 
ATOM   266 H  HA3  . GLY A 1 17 ? 15.667 -1.534  12.006 1.00 9.17  ? 17  GLY A HA3  1 
ATOM   267 N  N    . ASP A 1 18 ? 13.954 0.362   12.189 1.00 9.55  ? 18  ASP A N    1 
ATOM   268 C  CA   . ASP A 1 18 ? 13.133 1.481   12.650 1.00 10.02 ? 18  ASP A CA   1 
ATOM   269 C  C    . ASP A 1 18 ? 12.372 0.956   13.878 1.00 9.07  ? 18  ASP A C    1 
ATOM   270 O  O    . ASP A 1 18 ? 11.149 0.788   13.846 1.00 10.57 ? 18  ASP A O    1 
ATOM   271 C  CB   . ASP A 1 18 ? 12.160 1.912   11.538 1.00 10.40 ? 18  ASP A CB   1 
ATOM   272 C  CG   . ASP A 1 18 ? 11.403 3.181   11.874 1.00 11.52 ? 18  ASP A CG   1 
ATOM   273 O  OD1  . ASP A 1 18 ? 11.865 3.960   12.736 1.00 10.93 ? 18  ASP A OD1  1 
ATOM   274 O  OD2  . ASP A 1 18 ? 10.337 3.402   11.262 1.00 11.31 ? 18  ASP A OD2  1 
ATOM   275 H  H    A ASP A 1 18 ? 13.652 -0.567  12.312 0.28 9.55  ? 18  ASP A H    1 
ATOM   276 D  D    B ASP A 1 18 ? 13.652 -0.567  12.312 0.72 9.55  ? 18  ASP A D    1 
ATOM   277 H  HA   . ASP A 1 18 ? 13.767 2.306   12.935 1.00 10.36 ? 18  ASP A HA   1 
ATOM   278 H  HB2  . ASP A 1 18 ? 12.715 2.069   10.619 1.00 12.16 ? 18  ASP A HB2  1 
ATOM   279 H  HB3  . ASP A 1 18 ? 11.446 1.121   11.373 1.00 13.88 ? 18  ASP A HB3  1 
ATOM   280 N  N    . PRO A 1 19 ? 13.099 0.674   14.979 1.00 11.58 ? 19  PRO A N    1 
ATOM   281 C  CA   . PRO A 1 19 ? 12.541 0.149   16.236 1.00 11.94 ? 19  PRO A CA   1 
ATOM   282 C  C    . PRO A 1 19 ? 11.342 0.884   16.823 1.00 10.46 ? 19  PRO A C    1 
ATOM   283 O  O    . PRO A 1 19 ? 10.410 0.248   17.313 1.00 10.90 ? 19  PRO A O    1 
ATOM   284 C  CB   . PRO A 1 19 ? 13.737 0.161   17.201 1.00 14.66 ? 19  PRO A CB   1 
ATOM   285 C  CG   . PRO A 1 19 ? 14.787 0.981   16.530 1.00 14.19 ? 19  PRO A CG   1 
ATOM   286 C  CD   . PRO A 1 19 ? 14.562 0.824   15.071 1.00 12.47 ? 19  PRO A CD   1 
ATOM   287 H  HA   . PRO A 1 19 ? 12.247 -0.879  16.068 1.00 12.34 ? 19  PRO A HA   1 
ATOM   288 H  HB2  . PRO A 1 19 ? 13.455 0.612   18.142 1.00 14.90 ? 19  PRO A HB2  1 
ATOM   289 H  HB3  . PRO A 1 19 ? 14.090 -0.842  17.365 1.00 16.27 ? 19  PRO A HB3  1 
ATOM   290 H  HG2  . PRO A 1 19 ? 14.667 2.016   16.807 1.00 14.36 ? 19  PRO A HG2  1 
ATOM   291 H  HG3  . PRO A 1 19 ? 15.770 0.634   16.794 1.00 14.03 ? 19  PRO A HG3  1 
ATOM   292 H  HD2  . PRO A 1 19 ? 14.876 1.699   14.527 1.00 14.88 ? 19  PRO A HD2  1 
ATOM   293 H  HD3  . PRO A 1 19 ? 15.063 -0.060  14.701 1.00 14.02 ? 19  PRO A HD3  1 
ATOM   294 N  N    . ASP A 1 20 ? 11.352 2.212   16.773 1.00 11.02 ? 20  ASP A N    1 
ATOM   295 C  CA   . ASP A 1 20 ? 10.230 2.980   17.306 1.00 12.81 ? 20  ASP A CA   1 
ATOM   296 C  C    . ASP A 1 20 ? 8.928  2.661   16.576 1.00 11.87 ? 20  ASP A C    1 
ATOM   297 O  O    . ASP A 1 20 ? 7.843  2.852   17.134 1.00 11.90 ? 20  ASP A O    1 
ATOM   298 C  CB   . ASP A 1 20 ? 10.502 4.483   17.215 1.00 16.79 ? 20  ASP A CB   1 
ATOM   299 C  CG   . ASP A 1 20 ? 11.668 4.925   18.090 1.00 18.34 ? 20  ASP A CG   1 
ATOM   300 O  OD1  . ASP A 1 20 ? 11.759 4.468   19.251 1.00 20.48 ? 20  ASP A OD1  1 
ATOM   301 O  OD2  . ASP A 1 20 ? 12.485 5.741   17.613 1.00 18.72 ? 20  ASP A OD2  1 
ATOM   302 H  H    A ASP A 1 20 ? 12.105 2.665   16.370 0.19 11.02 ? 20  ASP A H    1 
ATOM   303 D  D    B ASP A 1 20 ? 12.105 2.665   16.370 0.81 11.02 ? 20  ASP A D    1 
ATOM   304 H  HA   . ASP A 1 20 ? 10.108 2.714   18.345 1.00 13.02 ? 20  ASP A HA   1 
ATOM   305 H  HB2  . ASP A 1 20 ? 10.713 4.729   16.194 1.00 16.44 ? 20  ASP A HB2  1 
ATOM   306 H  HB3  . ASP A 1 20 ? 9.620  5.012   17.523 1.00 17.28 ? 20  ASP A HB3  1 
ATOM   307 N  N    . ASN A 1 21 ? 9.020  2.136   15.355 1.00 11.22 ? 21  ASN A N    1 
ATOM   308 C  CA   . ASN A 1 21 ? 7.816  1.813   14.601 1.00 11.63 ? 21  ASN A CA   1 
ATOM   309 C  C    . ASN A 1 21 ? 7.649  0.319   14.290 1.00 10.05 ? 21  ASN A C    1 
ATOM   310 O  O    . ASN A 1 21 ? 7.046  -0.048  13.286 1.00 12.19 ? 21  ASN A O    1 
ATOM   311 C  CB   . ASN A 1 21 ? 7.747  2.657   13.327 1.00 13.80 ? 21  ASN A CB   1 
ATOM   312 C  CG   . ASN A 1 21 ? 7.603  4.143   13.626 1.00 14.76 ? 21  ASN A CG   1 
ATOM   313 O  OD1  . ASN A 1 21 ? 6.542  4.603   14.048 1.00 18.37 ? 21  ASN A OD1  1 
ATOM   314 N  ND2  . ASN A 1 21 ? 8.672  4.894   13.415 1.00 19.11 ? 21  ASN A ND2  1 
ATOM   315 H  H    A ASN A 1 21 ? 9.885  1.916   14.939 0.32 11.22 ? 21  ASN A H    1 
ATOM   316 D  D    B ASN A 1 21 ? 9.885  1.916   14.939 0.68 11.22 ? 21  ASN A D    1 
ATOM   317 H  HA   . ASN A 1 21 ? 6.974  2.094   15.217 1.00 12.77 ? 21  ASN A HA   1 
ATOM   318 H  HB2  . ASN A 1 21 ? 8.642  2.493   12.742 1.00 11.51 ? 21  ASN A HB2  1 
ATOM   319 H  HB3  . ASN A 1 21 ? 6.893  2.338   12.749 1.00 12.58 ? 21  ASN A HB3  1 
ATOM   320 D  DD21 . ASN A 1 21 ? 8.666  5.824   13.731 1.00 19.70 ? 21  ASN A DD21 1 
ATOM   321 D  DD22 . ASN A 1 21 ? 9.454  4.475   12.994 1.00 21.48 ? 21  ASN A DD22 1 
ATOM   322 N  N    . GLY A 1 22 ? 8.228  -0.528  15.143 1.00 8.98  ? 22  GLY A N    1 
ATOM   323 C  CA   . GLY A 1 22 ? 8.080  -1.971  15.014 1.00 9.12  ? 22  GLY A CA   1 
ATOM   324 C  C    . GLY A 1 22 ? 8.980  -2.716  14.055 1.00 8.53  ? 22  GLY A C    1 
ATOM   325 O  O    . GLY A 1 22 ? 8.681  -3.860  13.708 1.00 11.12 ? 22  GLY A O    1 
ATOM   326 H  H    A GLY A 1 22 ? 8.921  -0.150  15.713 0.18 8.98  ? 22  GLY A H    1 
ATOM   327 D  D    B GLY A 1 22 ? 8.921  -0.150  15.713 0.82 8.98  ? 22  GLY A D    1 
ATOM   328 H  HA2  . GLY A 1 22 ? 8.223  -2.405  15.994 1.00 10.10 ? 22  GLY A HA2  1 
ATOM   329 H  HA3  . GLY A 1 22 ? 7.058  -2.164  14.722 1.00 10.64 ? 22  GLY A HA3  1 
ATOM   330 N  N    . VAL A 1 23 ? 10.078 -2.096  13.628 1.00 8.16  ? 23  VAL A N    1 
ATOM   331 C  CA   . VAL A 1 23 ? 11.001 -2.734  12.699 1.00 8.65  ? 23  VAL A CA   1 
ATOM   332 C  C    . VAL A 1 23 ? 12.348 -2.899  13.397 1.00 7.27  ? 23  VAL A C    1 
ATOM   333 O  O    . VAL A 1 23 ? 13.050 -1.919  13.636 1.00 8.05  ? 23  VAL A O    1 
ATOM   334 C  CB   . VAL A 1 23 ? 11.172 -1.878  11.418 1.00 8.76  ? 23  VAL A CB   1 
ATOM   335 C  CG1  . VAL A 1 23 ? 12.114 -2.560  10.447 1.00 9.78  ? 23  VAL A CG1  1 
ATOM   336 C  CG2  . VAL A 1 23 ? 9.826  -1.656  10.762 1.00 9.11  ? 23  VAL A CG2  1 
ATOM   337 H  H    A VAL A 1 23 ? 10.373 -1.214  13.941 0.19 8.16  ? 23  VAL A H    1 
ATOM   338 D  D    B VAL A 1 23 ? 10.373 -1.214  13.941 0.81 8.16  ? 23  VAL A D    1 
ATOM   339 H  HA   . VAL A 1 23 ? 10.623 -3.705  12.423 1.00 6.76  ? 23  VAL A HA   1 
ATOM   340 H  HB   . VAL A 1 23 ? 11.585 -0.925  11.702 1.00 9.77  ? 23  VAL A HB   1 
ATOM   341 H  HG11 . VAL A 1 23 ? 13.068 -2.697  10.923 1.00 9.85  ? 23  VAL A HG11 1 
ATOM   342 H  HG12 . VAL A 1 23 ? 12.239 -1.958  9.558  1.00 9.94  ? 23  VAL A HG12 1 
ATOM   343 H  HG13 . VAL A 1 23 ? 11.712 -3.526  10.177 1.00 10.38 ? 23  VAL A HG13 1 
ATOM   344 H  HG21 . VAL A 1 23 ? 9.204  -1.047  11.400 1.00 10.82 ? 23  VAL A HG21 1 
ATOM   345 H  HG22 . VAL A 1 23 ? 9.342  -2.613  10.605 1.00 10.90 ? 23  VAL A HG22 1 
ATOM   346 H  HG23 . VAL A 1 23 ? 9.970  -1.152  9.817  1.00 10.24 ? 23  VAL A HG23 1 
ATOM   347 N  N    . SER A 1 24 ? 12.711 -4.141  13.710 1.00 8.42  ? 24  SER A N    1 
ATOM   348 C  CA   . SER A 1 24 ? 13.967 -4.414  14.393 1.00 8.81  ? 24  SER A CA   1 
ATOM   349 C  C    . SER A 1 24 ? 15.155 -4.353  13.440 1.00 7.81  ? 24  SER A C    1 
ATOM   350 O  O    . SER A 1 24 ? 14.993 -4.429  12.225 1.00 7.26  ? 24  SER A O    1 
ATOM   351 C  CB   . SER A 1 24 ? 13.915 -5.787  15.084 1.00 10.22 ? 24  SER A CB   1 
ATOM   352 O  OG   . SER A 1 24 ? 13.618 -6.823  14.163 1.00 10.86 ? 24  SER A OG   1 
ATOM   353 H  H    A SER A 1 24 ? 12.262 -4.887  13.276 0.06 8.42  ? 24  SER A H    1 
ATOM   354 D  D    B SER A 1 24 ? 12.262 -4.887  13.276 0.94 8.42  ? 24  SER A D    1 
ATOM   355 H  HA   . SER A 1 24 ? 14.097 -3.658  15.161 1.00 9.53  ? 24  SER A HA   1 
ATOM   356 H  HB2  . SER A 1 24 ? 14.862 -5.988  15.562 1.00 10.02 ? 24  SER A HB2  1 
ATOM   357 H  HB3  . SER A 1 24 ? 13.145 -5.760  15.832 1.00 10.24 ? 24  SER A HB3  1 
ATOM   358 D  DG   . SER A 1 24 ? 14.321 -6.884  13.531 1.00 17.75 ? 24  SER A DG   1 
ATOM   359 N  N    . PRO A 1 25 ? 16.356 -4.112  13.985 1.00 9.08  ? 25  PRO A N    1 
ATOM   360 C  CA   . PRO A 1 25 ? 17.565 -4.037  13.161 1.00 8.96  ? 25  PRO A CA   1 
ATOM   361 C  C    . PRO A 1 25 ? 17.811 -5.322  12.391 1.00 8.35  ? 25  PRO A C    1 
ATOM   362 O  O    . PRO A 1 25 ? 17.674 -6.424  12.932 1.00 8.16  ? 25  PRO A O    1 
ATOM   363 C  CB   . PRO A 1 25 ? 18.671 -3.761  14.178 1.00 9.79  ? 25  PRO A CB   1 
ATOM   364 C  CG   . PRO A 1 25 ? 17.982 -3.079  15.296 1.00 10.16 ? 25  PRO A CG   1 
ATOM   365 C  CD   . PRO A 1 25 ? 16.624 -3.712  15.377 1.00 11.32 ? 25  PRO A CD   1 
ATOM   366 H  HA   . PRO A 1 25 ? 17.480 -3.215  12.481 1.00 8.74  ? 25  PRO A HA   1 
ATOM   367 H  HB2  . PRO A 1 25 ? 19.113 -4.688  14.508 1.00 9.90  ? 25  PRO A HB2  1 
ATOM   368 H  HB3  . PRO A 1 25 ? 19.422 -3.105  13.761 1.00 10.78 ? 25  PRO A HB3  1 
ATOM   369 H  HG2  . PRO A 1 25 ? 18.533 -3.201  16.224 1.00 8.94  ? 25  PRO A HG2  1 
ATOM   370 H  HG3  . PRO A 1 25 ? 17.872 -2.034  15.059 1.00 10.92 ? 25  PRO A HG3  1 
ATOM   371 H  HD2  . PRO A 1 25 ? 16.630 -4.579  16.017 1.00 10.88 ? 25  PRO A HD2  1 
ATOM   372 H  HD3  . PRO A 1 25 ? 15.896 -2.991  15.720 1.00 14.08 ? 25  PRO A HD3  1 
ATOM   373 N  N    . GLY A 1 26 ? 18.163 -5.172  11.120 1.00 7.82  ? 26  GLY A N    1 
ATOM   374 C  CA   . GLY A 1 26 ? 18.419 -6.323  10.275 1.00 8.90  ? 26  GLY A CA   1 
ATOM   375 C  C    . GLY A 1 26 ? 17.278 -6.636  9.333  1.00 10.26 ? 26  GLY A C    1 
ATOM   376 O  O    . GLY A 1 26 ? 17.443 -7.428  8.404  1.00 10.93 ? 26  GLY A O    1 
ATOM   377 H  H    A GLY A 1 26 ? 18.336 -4.276  10.790 0.19 7.82  ? 26  GLY A H    1 
ATOM   378 D  D    B GLY A 1 26 ? 18.336 -4.276  10.790 0.81 7.82  ? 26  GLY A D    1 
ATOM   379 H  HA2  . GLY A 1 26 ? 19.291 -6.116  9.673  1.00 9.66  ? 26  GLY A HA2  1 
ATOM   380 H  HA3  . GLY A 1 26 ? 18.624 -7.181  10.904 1.00 9.56  ? 26  GLY A HA3  1 
ATOM   381 N  N    . THR A 1 27 ? 16.136 -5.982  9.527  1.00 9.51  ? 27  THR A N    1 
ATOM   382 C  CA   . THR A 1 27 ? 14.983 -6.223  8.673  1.00 9.19  ? 27  THR A CA   1 
ATOM   383 C  C    . THR A 1 27 ? 15.183 -5.638  7.277  1.00 10.09 ? 27  THR A C    1 
ATOM   384 O  O    . THR A 1 27 ? 15.397 -4.435  7.123  1.00 10.65 ? 27  THR A O    1 
ATOM   385 C  CB   . THR A 1 27 ? 13.722 -5.631  9.292  1.00 9.99  ? 27  THR A CB   1 
ATOM   386 O  OG1  . THR A 1 27 ? 13.533 -6.139  10.598 1.00 12.80 ? 27  THR A OG1  1 
ATOM   387 C  CG2  . THR A 1 27 ? 12.479 -5.982  8.506  1.00 8.65  ? 27  THR A CG2  1 
ATOM   388 H  H    A THR A 1 27 ? 16.078 -5.414  10.336 0.12 9.51  ? 27  THR A H    1 
ATOM   389 D  D    B THR A 1 27 ? 16.078 -5.414  10.336 0.88 9.51  ? 27  THR A D    1 
ATOM   390 H  HA   . THR A 1 27 ? 14.841 -7.292  8.583  1.00 8.32  ? 27  THR A HA   1 
ATOM   391 H  HB   . THR A 1 27 ? 13.823 -4.554  9.338  1.00 9.02  ? 27  THR A HB   1 
ATOM   392 D  DG1  . THR A 1 27 ? 13.827 -5.500  11.227 1.00 13.90 ? 27  THR A DG1  1 
ATOM   393 H  HG21 . THR A 1 27 ? 12.584 -5.650  7.486  1.00 11.91 ? 27  THR A HG21 1 
ATOM   394 H  HG22 . THR A 1 27 ? 11.616 -5.510  8.950  1.00 12.18 ? 27  THR A HG22 1 
ATOM   395 H  HG23 . THR A 1 27 ? 12.350 -7.051  8.520  1.00 11.89 ? 27  THR A HG23 1 
ATOM   396 N  N    . LYS A 1 28 ? 15.120 -6.508  6.270  1.00 10.63 ? 28  LYS A N    1 
ATOM   397 C  CA   . LYS A 1 28 ? 15.271 -6.091  4.885  1.00 13.27 ? 28  LYS A CA   1 
ATOM   398 C  C    . LYS A 1 28 ? 14.063 -5.261  4.465  1.00 11.20 ? 28  LYS A C    1 
ATOM   399 O  O    . LYS A 1 28 ? 12.947 -5.477  4.942  1.00 9.05  ? 28  LYS A O    1 
ATOM   400 C  CB   . LYS A 1 28 ? 15.449 -7.317  3.992  1.00 15.06 ? 28  LYS A CB   1 
ATOM   401 C  CG   . LYS A 1 28 ? 16.827 -7.948  4.163  1.00 19.79 ? 28  LYS A CG   1 
ATOM   402 C  CD   . LYS A 1 28 ? 17.000 -9.176  3.285  1.00 23.94 ? 28  LYS A CD   1 
ATOM   403 C  CE   . LYS A 1 28 ? 18.264 -9.952  3.664  1.00 25.24 ? 28  LYS A CE   1 
ATOM   404 N  NZ   . LYS A 1 28 ? 19.504 -9.133  3.483  1.00 28.62 ? 28  LYS A NZ   1 
ATOM   405 H  H    A LYS A 1 28 ? 14.826 -7.441  6.426  0.21 10.63 ? 28  LYS A H    1 
ATOM   406 D  D    B LYS A 1 28 ? 14.826 -7.441  6.426  0.79 10.63 ? 28  LYS A D    1 
ATOM   407 H  HA   . LYS A 1 28 ? 16.154 -5.475  4.808  1.00 13.15 ? 28  LYS A HA   1 
ATOM   408 H  HB2  . LYS A 1 28 ? 14.693 -8.044  4.244  1.00 17.58 ? 28  LYS A HB2  1 
ATOM   409 H  HB3  . LYS A 1 28 ? 15.325 -7.027  2.963  1.00 15.72 ? 28  LYS A HB3  1 
ATOM   410 H  HG2  . LYS A 1 28 ? 17.579 -7.219  3.901  1.00 20.73 ? 28  LYS A HG2  1 
ATOM   411 H  HG3  . LYS A 1 28 ? 16.955 -8.234  5.192  1.00 20.57 ? 28  LYS A HG3  1 
ATOM   412 H  HD2  . LYS A 1 28 ? 16.139 -9.813  3.401  1.00 22.47 ? 28  LYS A HD2  1 
ATOM   413 H  HD3  . LYS A 1 28 ? 17.074 -8.869  2.260  1.00 23.22 ? 28  LYS A HD3  1 
ATOM   414 H  HE2  . LYS A 1 28 ? 18.190 -10.243 4.694  1.00 26.53 ? 28  LYS A HE2  1 
ATOM   415 H  HE3  . LYS A 1 28 ? 18.329 -10.832 3.055  1.00 26.79 ? 28  LYS A HE3  1 
ATOM   416 N  N    . PHE A 1 29 ? 14.296 -4.305  3.576  1.00 11.73 ? 29  PHE A N    1 
ATOM   417 C  CA   . PHE A 1 29 ? 13.247 -3.404  3.118  1.00 12.36 ? 29  PHE A CA   1 
ATOM   418 C  C    . PHE A 1 29 ? 12.014 -4.144  2.593  1.00 12.13 ? 29  PHE A C    1 
ATOM   419 O  O    . PHE A 1 29 ? 10.881 -3.752  2.883  1.00 12.27 ? 29  PHE A O    1 
ATOM   420 C  CB   . PHE A 1 29 ? 13.804 -2.458  2.049  1.00 13.16 ? 29  PHE A CB   1 
ATOM   421 C  CG   . PHE A 1 29 ? 12.864 -1.344  1.680  1.00 11.28 ? 29  PHE A CG   1 
ATOM   422 C  CD1  . PHE A 1 29 ? 12.760 -0.212  2.479  1.00 13.01 ? 29  PHE A CD1  1 
ATOM   423 C  CD2  . PHE A 1 29 ? 12.078 -1.434  0.548  1.00 14.04 ? 29  PHE A CD2  1 
ATOM   424 C  CE1  . PHE A 1 29 ? 11.885 0.799   2.149  1.00 14.27 ? 29  PHE A CE1  1 
ATOM   425 C  CE2  . PHE A 1 29 ? 11.204 -0.423  0.215  1.00 14.17 ? 29  PHE A CE2  1 
ATOM   426 C  CZ   . PHE A 1 29 ? 11.107 0.689   1.016  1.00 12.27 ? 29  PHE A CZ   1 
ATOM   427 H  H    A PHE A 1 29 ? 15.170 -4.259  3.156  0.25 11.73 ? 29  PHE A H    1 
ATOM   428 D  D    B PHE A 1 29 ? 15.170 -4.259  3.156  0.75 11.73 ? 29  PHE A D    1 
ATOM   429 H  HA   . PHE A 1 29 ? 12.941 -2.808  3.965  1.00 11.62 ? 29  PHE A HA   1 
ATOM   430 H  HB2  . PHE A 1 29 ? 14.721 -2.023  2.423  1.00 13.95 ? 29  PHE A HB2  1 
ATOM   431 H  HB3  . PHE A 1 29 ? 14.034 -3.038  1.167  1.00 14.25 ? 29  PHE A HB3  1 
ATOM   432 H  HD1  . PHE A 1 29 ? 13.371 -0.121  3.366  1.00 15.29 ? 29  PHE A HD1  1 
ATOM   433 H  HD2  . PHE A 1 29 ? 12.150 -2.307  -0.083 1.00 14.79 ? 29  PHE A HD2  1 
ATOM   434 H  HE1  . PHE A 1 29 ? 11.809 1.682   2.764  1.00 16.47 ? 29  PHE A HE1  1 
ATOM   435 H  HE2  . PHE A 1 29 ? 10.585 -0.502  -0.673 1.00 15.79 ? 29  PHE A HE2  1 
ATOM   436 H  HZ   . PHE A 1 29 ? 10.418 1.474   0.753  1.00 13.12 ? 29  PHE A HZ   1 
ATOM   437 N  N    . GLU A 1 30 ? 12.239 -5.234  1.865  1.00 14.38 ? 30  GLU A N    1 
ATOM   438 C  CA   . GLU A 1 30 ? 11.155 -6.034  1.291  1.00 16.91 ? 30  GLU A CA   1 
ATOM   439 C  C    . GLU A 1 30 ? 10.274 -6.687  2.360  1.00 15.28 ? 30  GLU A C    1 
ATOM   440 O  O    . GLU A 1 30 ? 9.081  -6.918  2.130  1.00 14.62 ? 30  GLU A O    1 
ATOM   441 C  CB   . GLU A 1 30 ? 11.731 -7.136  0.389  1.00 19.99 ? 30  GLU A CB   1 
ATOM   442 C  CG   . GLU A 1 30 ? 12.805 -6.659  -0.598 1.00 23.23 ? 30  GLU A CG   1 
ATOM   443 C  CD   . GLU A 1 30 ? 14.167 -6.454  0.057  1.00 26.13 ? 30  GLU A CD   1 
ATOM   444 O  OE1  . GLU A 1 30 ? 14.790 -7.453  0.472  1.00 26.04 ? 30  GLU A OE1  1 
ATOM   445 O  OE2  . GLU A 1 30 ? 14.608 -5.290  0.162  1.00 26.57 ? 30  GLU A OE2  1 
ATOM   446 H  H    A GLU A 1 30 ? 13.138 -5.559  1.799  0.18 14.38 ? 30  GLU A H    1 
ATOM   447 D  D    B GLU A 1 30 ? 13.138 -5.559  1.799  0.82 14.38 ? 30  GLU A D    1 
ATOM   448 H  HA   . GLU A 1 30 ? 10.534 -5.383  0.692  1.00 16.95 ? 30  GLU A HA   1 
ATOM   449 H  HB2  . GLU A 1 30 ? 12.157 -7.902  1.016  1.00 21.62 ? 30  GLU A HB2  1 
ATOM   450 H  HB3  . GLU A 1 30 ? 10.916 -7.562  -0.181 1.00 20.87 ? 30  GLU A HB3  1 
ATOM   451 H  HG2  . GLU A 1 30 ? 12.909 -7.383  -1.385 1.00 24.61 ? 30  GLU A HG2  1 
ATOM   452 H  HG3  . GLU A 1 30 ? 12.482 -5.721  -1.023 1.00 24.98 ? 30  GLU A HG3  1 
ATOM   453 N  N    . GLU A 1 31 ? 10.855 -6.969  3.526  1.00 14.16 ? 31  GLU A N    1 
ATOM   454 C  CA   . GLU A 1 31 ? 10.134 -7.617  4.627  1.00 14.50 ? 31  GLU A CA   1 
ATOM   455 C  C    . GLU A 1 31 ? 9.369  -6.653  5.537  1.00 12.58 ? 31  GLU A C    1 
ATOM   456 O  O    . GLU A 1 31 ? 8.576  -7.088  6.376  1.00 14.00 ? 31  GLU A O    1 
ATOM   457 C  CB   . GLU A 1 31 ? 11.107 -8.443  5.469  1.00 17.25 ? 31  GLU A CB   1 
ATOM   458 C  CG   . GLU A 1 31 ? 11.834 -9.527  4.676  1.00 22.12 ? 31  GLU A CG   1 
ATOM   459 C  CD   . GLU A 1 31 ? 10.883 -10.558 4.065  1.00 27.30 ? 31  GLU A CD   1 
ATOM   460 O  OE1  . GLU A 1 31 ? 9.943  -11.009 4.762  1.00 28.13 ? 31  GLU A OE1  1 
ATOM   461 O  OE2  . GLU A 1 31 ? 11.083 -10.921 2.883  1.00 28.86 ? 31  GLU A OE2  1 
ATOM   462 H  H    A GLU A 1 31 ? 11.801 -6.729  3.634  0.13 14.16 ? 31  GLU A H    1 
ATOM   463 D  D    B GLU A 1 31 ? 11.801 -6.729  3.634  0.87 14.16 ? 31  GLU A D    1 
ATOM   464 H  HA   . GLU A 1 31 ? 9.411  -8.303  4.194  1.00 14.65 ? 31  GLU A HA   1 
ATOM   465 H  HB2  . GLU A 1 31 ? 11.848 -7.778  5.894  1.00 16.12 ? 31  GLU A HB2  1 
ATOM   466 H  HB3  . GLU A 1 31 ? 10.558 -8.912  6.278  1.00 18.62 ? 31  GLU A HB3  1 
ATOM   467 H  HG2  . GLU A 1 31 ? 12.396 -9.056  3.881  1.00 22.04 ? 31  GLU A HG2  1 
ATOM   468 H  HG3  . GLU A 1 31 ? 12.522 -10.024 5.328  1.00 23.71 ? 31  GLU A HG3  1 
ATOM   469 N  N    . ILE A 1 32 ? 9.602  -5.352  5.378  1.00 12.46 ? 32  ILE A N    1 
ATOM   470 C  CA   . ILE A 1 32 ? 8.902  -4.352  6.178  1.00 12.14 ? 32  ILE A CA   1 
ATOM   471 C  C    . ILE A 1 32 ? 7.426  -4.409  5.770  1.00 11.63 ? 32  ILE A C    1 
ATOM   472 O  O    . ILE A 1 32 ? 7.119  -4.545  4.584  1.00 13.65 ? 32  ILE A O    1 
ATOM   473 C  CB   . ILE A 1 32 ? 9.452  -2.942  5.892  1.00 12.40 ? 32  ILE A CB   1 
ATOM   474 C  CG1  . ILE A 1 32 ? 10.898 -2.817  6.378  1.00 14.36 ? 32  ILE A CG1  1 
ATOM   475 C  CG2  . ILE A 1 32 ? 8.618  -1.902  6.587  1.00 13.52 ? 32  ILE A CG2  1 
ATOM   476 C  CD1  . ILE A 1 32 ? 11.559 -1.536  5.916  1.00 14.03 ? 32  ILE A CD1  1 
ATOM   477 H  H    A ILE A 1 32 ? 10.196 -5.069  4.658  0.23 12.46 ? 32  ILE A H    1 
ATOM   478 D  D    B ILE A 1 32 ? 10.196 -5.069  4.658  0.77 12.46 ? 32  ILE A D    1 
ATOM   479 H  HA   . ILE A 1 32 ? 9.007  -4.585  7.235  1.00 11.53 ? 32  ILE A HA   1 
ATOM   480 H  HB   . ILE A 1 32 ? 9.427  -2.752  4.828  1.00 11.92 ? 32  ILE A HB   1 
ATOM   481 H  HG12 . ILE A 1 32 ? 10.905 -2.828  7.461  1.00 15.47 ? 32  ILE A HG12 1 
ATOM   482 H  HG13 . ILE A 1 32 ? 11.472 -3.658  6.015  1.00 15.67 ? 32  ILE A HG13 1 
ATOM   483 H  HG21 . ILE A 1 32 ? 8.539  -2.149  7.634  1.00 13.74 ? 32  ILE A HG21 1 
ATOM   484 H  HG22 . ILE A 1 32 ? 7.630  -1.858  6.148  1.00 14.45 ? 32  ILE A HG22 1 
ATOM   485 H  HG23 . ILE A 1 32 ? 9.098  -0.943  6.492  1.00 13.83 ? 32  ILE A HG23 1 
ATOM   486 H  HD11 . ILE A 1 32 ? 12.346 -1.279  6.600  1.00 16.32 ? 32  ILE A HD11 1 
ATOM   487 H  HD12 . ILE A 1 32 ? 10.829 -0.734  5.881  1.00 16.97 ? 32  ILE A HD12 1 
ATOM   488 H  HD13 . ILE A 1 32 ? 11.975 -1.686  4.931  1.00 17.11 ? 32  ILE A HD13 1 
ATOM   489 N  N    . PRO A 1 33 ? 6.497  -4.339  6.739  1.00 14.30 ? 33  PRO A N    1 
ATOM   490 C  CA   . PRO A 1 33 ? 5.069  -4.391  6.391  1.00 16.16 ? 33  PRO A CA   1 
ATOM   491 C  C    . PRO A 1 33 ? 4.693  -3.350  5.344  1.00 17.20 ? 33  PRO A C    1 
ATOM   492 O  O    . PRO A 1 33 ? 5.222  -2.238  5.345  1.00 17.49 ? 33  PRO A O    1 
ATOM   493 C  CB   . PRO A 1 33 ? 4.368  -4.136  7.726  1.00 17.00 ? 33  PRO A CB   1 
ATOM   494 C  CG   . PRO A 1 33 ? 5.341  -4.625  8.746  1.00 17.55 ? 33  PRO A CG   1 
ATOM   495 C  CD   . PRO A 1 33 ? 6.700  -4.289  8.197  1.00 15.28 ? 33  PRO A CD   1 
ATOM   496 H  HA   . PRO A 1 33 ? 4.818  -5.379  6.025  1.00 16.99 ? 33  PRO A HA   1 
ATOM   497 H  HB2  . PRO A 1 33 ? 4.167  -3.078  7.852  1.00 17.10 ? 33  PRO A HB2  1 
ATOM   498 H  HB3  . PRO A 1 33 ? 3.455  -4.707  7.795  1.00 17.15 ? 33  PRO A HB3  1 
ATOM   499 H  HG2  . PRO A 1 33 ? 5.168  -4.138  9.695  1.00 17.46 ? 33  PRO A HG2  1 
ATOM   500 H  HG3  . PRO A 1 33 ? 5.257  -5.692  8.864  1.00 19.32 ? 33  PRO A HG3  1 
ATOM   501 H  HD2  . PRO A 1 33 ? 6.999  -3.295  8.498  1.00 15.40 ? 33  PRO A HD2  1 
ATOM   502 H  HD3  . PRO A 1 33 ? 7.428  -5.029  8.513  1.00 15.86 ? 33  PRO A HD3  1 
ATOM   503 N  N    . ASP A 1 34 ? 3.757  -3.710  4.472  1.00 17.60 ? 34  ASP A N    1 
ATOM   504 C  CA   . ASP A 1 34 ? 3.324  -2.829  3.391  1.00 19.52 ? 34  ASP A CA   1 
ATOM   505 C  C    . ASP A 1 34 ? 2.744  -1.500  3.866  1.00 18.41 ? 34  ASP A C    1 
ATOM   506 O  O    . ASP A 1 34 ? 2.768  -0.518  3.125  1.00 19.07 ? 34  ASP A O    1 
ATOM   507 C  CB   . ASP A 1 34 ? 2.305  -3.549  2.500  1.00 21.82 ? 34  ASP A CB   1 
ATOM   508 C  CG   . ASP A 1 34 ? 2.939  -4.651  1.660  1.00 24.93 ? 34  ASP A CG   1 
ATOM   509 O  OD1  . ASP A 1 34 ? 4.038  -4.424  1.098  1.00 27.04 ? 34  ASP A OD1  1 
ATOM   510 O  OD2  . ASP A 1 34 ? 2.339  -5.742  1.558  1.00 25.14 ? 34  ASP A OD2  1 
ATOM   511 H  H    A ASP A 1 34 ? 3.266  -4.542  4.630  0.47 17.60 ? 34  ASP A H    1 
ATOM   512 D  D    B ASP A 1 34 ? 3.266  -4.542  4.630  0.53 17.60 ? 34  ASP A D    1 
ATOM   513 H  HA   . ASP A 1 34 ? 4.192  -2.607  2.789  1.00 18.94 ? 34  ASP A HA   1 
ATOM   514 H  HB2  . ASP A 1 34 ? 1.541  -3.988  3.123  1.00 24.12 ? 34  ASP A HB2  1 
ATOM   515 H  HB3  . ASP A 1 34 ? 1.850  -2.823  1.839  1.00 22.40 ? 34  ASP A HB3  1 
ATOM   516 N  N    . ASP A 1 35 ? 2.264  -1.469  5.105  1.00 17.67 ? 35  ASP A N    1 
ATOM   517 C  CA   . ASP A 1 35 ? 1.663  -0.274  5.696  1.00 18.75 ? 35  ASP A CA   1 
ATOM   518 C  C    . ASP A 1 35 ? 2.663  0.660   6.399  1.00 15.23 ? 35  ASP A C    1 
ATOM   519 O  O    . ASP A 1 35 ? 2.282  1.721   6.894  1.00 14.11 ? 35  ASP A O    1 
ATOM   520 C  CB   . ASP A 1 35 ? 0.557  -0.691  6.673  1.00 20.79 ? 35  ASP A CB   1 
ATOM   521 C  CG   . ASP A 1 35 ? 1.051  -1.662  7.730  1.00 23.55 ? 35  ASP A CG   1 
ATOM   522 O  OD1  . ASP A 1 35 ? 1.078  -2.883  7.450  1.00 25.01 ? 35  ASP A OD1  1 
ATOM   523 O  OD2  . ASP A 1 35 ? 1.413  -1.209  8.840  1.00 23.63 ? 35  ASP A OD2  1 
ATOM   524 H  H    A ASP A 1 35 ? 2.295  -2.264  5.686  0.25 17.67 ? 35  ASP A H    1 
ATOM   525 D  D    B ASP A 1 35 ? 2.295  -2.264  5.686  0.75 17.67 ? 35  ASP A D    1 
ATOM   526 H  HA   . ASP A 1 35 ? 1.197  0.291   4.910  1.00 18.50 ? 35  ASP A HA   1 
ATOM   527 H  HB2  . ASP A 1 35 ? 0.166  0.190   7.156  1.00 22.33 ? 35  ASP A HB2  1 
ATOM   528 H  HB3  . ASP A 1 35 ? -0.236 -1.159  6.111  1.00 22.10 ? 35  ASP A HB3  1 
ATOM   529 N  N    . TRP A 1 36 ? 3.928  0.251   6.475  1.00 14.34 ? 36  TRP A N    1 
ATOM   530 C  CA   . TRP A 1 36 ? 4.962  1.079   7.087  1.00 12.83 ? 36  TRP A CA   1 
ATOM   531 C  C    . TRP A 1 36 ? 5.224  2.258   6.160  1.00 10.95 ? 36  TRP A C    1 
ATOM   532 O  O    . TRP A 1 36 ? 5.245  2.108   4.937  1.00 9.20  ? 36  TRP A O    1 
ATOM   533 C  CB   . TRP A 1 36 ? 6.245  0.267   7.251  1.00 14.06 ? 36  TRP A CB   1 
ATOM   534 C  CG   . TRP A 1 36 ? 7.422  1.027   7.790  1.00 11.50 ? 36  TRP A CG   1 
ATOM   535 C  CD1  . TRP A 1 36 ? 7.763  1.182   9.103  1.00 11.29 ? 36  TRP A CD1  1 
ATOM   536 C  CD2  . TRP A 1 36 ? 8.446  1.692   7.027  1.00 11.29 ? 36  TRP A CD2  1 
ATOM   537 N  NE1  . TRP A 1 36 ? 8.929  1.893   9.198  1.00 10.38 ? 36  TRP A NE1  1 
ATOM   538 C  CE2  . TRP A 1 36 ? 9.369  2.227   7.946  1.00 11.06 ? 36  TRP A CE2  1 
ATOM   539 C  CE3  . TRP A 1 36 ? 8.666  1.889   5.660  1.00 11.56 ? 36  TRP A CE3  1 
ATOM   540 C  CZ2  . TRP A 1 36 ? 10.503 2.944   7.542  1.00 10.34 ? 36  TRP A CZ2  1 
ATOM   541 C  CZ3  . TRP A 1 36 ? 9.786  2.602   5.258  1.00 10.79 ? 36  TRP A CZ3  1 
ATOM   542 C  CH2  . TRP A 1 36 ? 10.692 3.121   6.198  1.00 10.06 ? 36  TRP A CH2  1 
ATOM   543 H  H    A TRP A 1 36 ? 4.257  -0.618  6.173  0.18 14.34 ? 36  TRP A H    1 
ATOM   544 D  D    B TRP A 1 36 ? 4.257  -0.618  6.173  0.82 14.34 ? 36  TRP A D    1 
ATOM   545 H  HA   . TRP A 1 36 ? 4.626  1.442   8.053  1.00 13.54 ? 36  TRP A HA   1 
ATOM   546 H  HB2  . TRP A 1 36 ? 6.046  -0.545  7.925  1.00 14.98 ? 36  TRP A HB2  1 
ATOM   547 H  HB3  . TRP A 1 36 ? 6.519  -0.152  6.292  1.00 15.36 ? 36  TRP A HB3  1 
ATOM   548 H  HD1  . TRP A 1 36 ? 7.211  0.782   9.948  1.00 13.63 ? 36  TRP A HD1  1 
ATOM   549 D  DE1  . TRP A 1 36 ? 9.361  2.144   10.027 1.00 12.06 ? 36  TRP A DE1  1 
ATOM   550 H  HE3  . TRP A 1 36 ? 7.971  1.496   4.932  1.00 12.85 ? 36  TRP A HE3  1 
ATOM   551 H  HZ2  . TRP A 1 36 ? 11.204 3.335   8.269  1.00 12.18 ? 36  TRP A HZ2  1 
ATOM   552 H  HZ3  . TRP A 1 36 ? 9.965  2.763   4.199  1.00 11.00 ? 36  TRP A HZ3  1 
ATOM   553 H  HH2  . TRP A 1 36 ? 11.547 3.668   5.844  1.00 11.18 ? 36  TRP A HH2  1 
ATOM   554 N  N    . VAL A 1 37 ? 5.460  3.422   6.751  1.00 7.75  ? 37  VAL A N    1 
ATOM   555 C  CA   . VAL A 1 37 ? 5.724  4.635   5.986  1.00 8.86  ? 37  VAL A CA   1 
ATOM   556 C  C    . VAL A 1 37 ? 6.972  5.324   6.529  1.00 7.45  ? 37  VAL A C    1 
ATOM   557 O  O    . VAL A 1 37 ? 7.477  4.979   7.597  1.00 7.49  ? 37  VAL A O    1 
ATOM   558 C  CB   . VAL A 1 37 ? 4.533  5.624   6.058  1.00 11.30 ? 37  VAL A CB   1 
ATOM   559 C  CG1  . VAL A 1 37 ? 3.284  4.981   5.474  1.00 12.03 ? 37  VAL A CG1  1 
ATOM   560 C  CG2  . VAL A 1 37 ? 4.286  6.066   7.505  1.00 10.06 ? 37  VAL A CG2  1 
ATOM   561 H  H    A VAL A 1 37 ? 5.463  3.428   7.716  0.14 7.75  ? 37  VAL A H    1 
ATOM   562 D  D    B VAL A 1 37 ? 5.463  3.428   7.716  0.86 7.75  ? 37  VAL A D    1 
ATOM   563 H  HA   . VAL A 1 37 ? 5.889  4.370   4.940  1.00 8.92  ? 37  VAL A HA   1 
ATOM   564 H  HB   . VAL A 1 37 ? 4.777  6.493   5.468  1.00 9.32  ? 37  VAL A HB   1 
ATOM   565 H  HG11 . VAL A 1 37 ? 3.523  4.513   4.525  1.00 13.23 ? 37  VAL A HG11 1 
ATOM   566 H  HG12 . VAL A 1 37 ? 2.524  5.736   5.328  1.00 12.80 ? 37  VAL A HG12 1 
ATOM   567 H  HG13 . VAL A 1 37 ? 2.908  4.231   6.156  1.00 13.36 ? 37  VAL A HG13 1 
ATOM   568 H  HG21 . VAL A 1 37 ? 5.105  6.692   7.819  1.00 12.10 ? 37  VAL A HG21 1 
ATOM   569 H  HG22 . VAL A 1 37 ? 4.226  5.200   8.152  1.00 11.40 ? 37  VAL A HG22 1 
ATOM   570 H  HG23 . VAL A 1 37 ? 3.362  6.629   7.564  1.00 11.37 ? 37  VAL A HG23 1 
ATOM   571 N  N    . CYS A 1 38 ? 7.492  6.264   5.757  1.00 6.43  ? 38  CYS A N    1 
ATOM   572 C  CA   . CYS A 1 38 ? 8.665  7.028   6.158  1.00 7.64  ? 38  CYS A CA   1 
ATOM   573 C  C    . CYS A 1 38 ? 8.365  7.646   7.519  1.00 6.61  ? 38  CYS A C    1 
ATOM   574 O  O    . CYS A 1 38 ? 7.343  8.306   7.695  1.00 5.52  ? 38  CYS A O    1 
ATOM   575 C  CB   . CYS A 1 38 ? 8.907  8.116   5.136  1.00 8.03  ? 38  CYS A CB   1 
ATOM   576 S  SG   . CYS A 1 38 ? 10.248 9.160   5.549  1.00 8.20  ? 38  CYS A SG   1 
ATOM   577 H  H    A CYS A 1 38 ? 7.130  6.433   4.864  0.77 6.43  ? 38  CYS A H    1 
ATOM   578 D  D    B CYS A 1 38 ? 7.130  6.433   4.864  0.23 6.43  ? 38  CYS A D    1 
ATOM   579 H  HA   . CYS A 1 38 ? 9.529  6.379   6.227  1.00 7.44  ? 38  CYS A HA   1 
ATOM   580 H  HB2  . CYS A 1 38 ? 9.088  7.666   4.173  1.00 10.17 ? 38  CYS A HB2  1 
ATOM   581 H  HB3  . CYS A 1 38 ? 8.006  8.710   5.078  1.00 10.00 ? 38  CYS A HB3  1 
ATOM   582 N  N    . PRO A 1 39 ? 9.244  7.427   8.508  1.00 7.69  ? 39  PRO A N    1 
ATOM   583 C  CA   . PRO A 1 39 ? 8.971  8.001   9.833  1.00 7.36  ? 39  PRO A CA   1 
ATOM   584 C  C    . PRO A 1 39 ? 9.040  9.527   9.921  1.00 8.16  ? 39  PRO A C    1 
ATOM   585 O  O    . PRO A 1 39 ? 8.558  10.123  10.883 1.00 10.49 ? 39  PRO A O    1 
ATOM   586 C  CB   . PRO A 1 39 ? 10.013 7.318   10.734 1.00 9.41  ? 39  PRO A CB   1 
ATOM   587 C  CG   . PRO A 1 39 ? 11.122 6.959   9.822  1.00 9.77  ? 39  PRO A CG   1 
ATOM   588 C  CD   . PRO A 1 39 ? 10.466 6.597   8.511  1.00 9.10  ? 39  PRO A CD   1 
ATOM   589 H  HA   . PRO A 1 39 ? 7.987  7.682   10.131 1.00 6.37  ? 39  PRO A HA   1 
ATOM   590 H  HB2  . PRO A 1 39 ? 10.347 7.984   11.517 1.00 12.33 ? 39  PRO A HB2  1 
ATOM   591 H  HB3  . PRO A 1 39 ? 9.605  6.417   11.171 1.00 10.88 ? 39  PRO A HB3  1 
ATOM   592 H  HG2  . PRO A 1 39 ? 11.772 7.814   9.686  1.00 11.28 ? 39  PRO A HG2  1 
ATOM   593 H  HG3  . PRO A 1 39 ? 11.685 6.116   10.201 1.00 11.50 ? 39  PRO A HG3  1 
ATOM   594 H  HD2  . PRO A 1 39 ? 11.107 6.848   7.678  1.00 9.26  ? 39  PRO A HD2  1 
ATOM   595 H  HD3  . PRO A 1 39 ? 10.218 5.542   8.491  1.00 11.31 ? 39  PRO A HD3  1 
ATOM   596 N  N    . ILE A 1 40 ? 9.642  10.155  8.923  1.00 6.83  ? 40  ILE A N    1 
ATOM   597 C  CA   . ILE A 1 40 ? 9.779  11.602  8.905  1.00 9.01  ? 40  ILE A CA   1 
ATOM   598 C  C    . ILE A 1 40 ? 8.618  12.275  8.168  1.00 9.35  ? 40  ILE A C    1 
ATOM   599 O  O    . ILE A 1 40 ? 7.926  13.115  8.752  1.00 10.44 ? 40  ILE A O    1 
ATOM   600 C  CB   . ILE A 1 40 ? 11.110 12.014  8.211  1.00 12.39 ? 40  ILE A CB   1 
ATOM   601 C  CG1  . ILE A 1 40 ? 12.312 11.358  8.915  1.00 14.14 ? 40  ILE A CG1  1 
ATOM   602 C  CG2  . ILE A 1 40 ? 11.250 13.520  8.156  1.00 14.55 ? 40  ILE A CG2  1 
ATOM   603 C  CD1  . ILE A 1 40 ? 12.356 11.575  10.383 1.00 15.18 ? 40  ILE A CD1  1 
ATOM   604 H  H    A ILE A 1 40 ? 9.913  9.645   8.149  0.14 6.83  ? 40  ILE A H    1 
ATOM   605 D  D    B ILE A 1 40 ? 9.913  9.645   8.149  0.86 6.83  ? 40  ILE A D    1 
ATOM   606 H  HA   . ILE A 1 40 ? 9.808  11.975  9.933  1.00 8.26  ? 40  ILE A HA   1 
ATOM   607 H  HB   . ILE A 1 40 ? 11.078 11.641  7.204  1.00 12.99 ? 40  ILE A HB   1 
ATOM   608 H  HG12 . ILE A 1 40 ? 12.266 10.295  8.746  1.00 14.28 ? 40  ILE A HG12 1 
ATOM   609 H  HG13 . ILE A 1 40 ? 13.225 11.727  8.471  1.00 16.28 ? 40  ILE A HG13 1 
ATOM   610 H  HG21 . ILE A 1 40 ? 12.013 13.792  7.438  1.00 15.67 ? 40  ILE A HG21 1 
ATOM   611 H  HG22 . ILE A 1 40 ? 11.545 13.891  9.121  1.00 14.64 ? 40  ILE A HG22 1 
ATOM   612 H  HG23 . ILE A 1 40 ? 10.311 13.964  7.865  1.00 15.19 ? 40  ILE A HG23 1 
ATOM   613 H  HD11 . ILE A 1 40 ? 13.372 11.542  10.731 1.00 14.47 ? 40  ILE A HD11 1 
ATOM   614 H  HD12 . ILE A 1 40 ? 11.792 10.793  10.858 1.00 14.56 ? 40  ILE A HD12 1 
ATOM   615 H  HD13 . ILE A 1 40 ? 11.920 12.524  10.622 1.00 14.34 ? 40  ILE A HD13 1 
ATOM   616 N  N    . CYS A 1 41 ? 8.355  11.865  6.923  1.00 7.97  ? 41  CYS A N    1 
ATOM   617 C  CA   . CYS A 1 41 ? 7.318  12.524  6.127  1.00 6.89  ? 41  CYS A CA   1 
ATOM   618 C  C    . CYS A 1 41 ? 6.032  11.768  5.825  1.00 6.79  ? 41  CYS A C    1 
ATOM   619 O  O    . CYS A 1 41 ? 5.103  12.351  5.265  1.00 7.91  ? 41  CYS A O    1 
ATOM   620 C  CB   . CYS A 1 41 ? 7.926  13.012  4.819  1.00 8.87  ? 41  CYS A CB   1 
ATOM   621 S  SG   . CYS A 1 41 ? 8.203  11.711  3.624  1.00 8.60  ? 41  CYS A SG   1 
ATOM   622 H  H    A CYS A 1 41 ? 8.698  11.021  6.549  0.29 7.97  ? 41  CYS A H    1 
ATOM   623 D  D    B CYS A 1 41 ? 8.698  11.021  6.549  0.71 7.97  ? 41  CYS A D    1 
ATOM   624 H  HA   . CYS A 1 41 ? 7.027  13.401  6.665  1.00 6.20  ? 41  CYS A HA   1 
ATOM   625 H  HB2  . CYS A 1 41 ? 7.255  13.720  4.376  1.00 8.46  ? 41  CYS A HB2  1 
ATOM   626 H  HB3  . CYS A 1 41 ? 8.857  13.508  5.033  1.00 8.02  ? 41  CYS A HB3  1 
ATOM   627 N  N    . GLY A 1 42 ? 5.968  10.486  6.167  1.00 7.25  ? 42  GLY A N    1 
ATOM   628 C  CA   . GLY A 1 42 ? 4.759  9.717   5.920  1.00 7.86  ? 42  GLY A CA   1 
ATOM   629 C  C    . GLY A 1 42 ? 4.625  9.110   4.532  1.00 8.02  ? 42  GLY A C    1 
ATOM   630 O  O    . GLY A 1 42 ? 3.572  8.564   4.207  1.00 6.90  ? 42  GLY A O    1 
ATOM   631 H  H    A GLY A 1 42 ? 6.741  10.031  6.544  0.16 7.25  ? 42  GLY A H    1 
ATOM   632 D  D    B GLY A 1 42 ? 6.741  10.031  6.544  0.84 7.25  ? 42  GLY A D    1 
ATOM   633 H  HA2  . GLY A 1 42 ? 4.711  8.922   6.637  1.00 8.76  ? 42  GLY A HA2  1 
ATOM   634 H  HA3  . GLY A 1 42 ? 3.904  10.362  6.068  1.00 7.83  ? 42  GLY A HA3  1 
ATOM   635 N  N    . ALA A 1 43 ? 5.666  9.229   3.709  1.00 7.14  ? 43  ALA A N    1 
ATOM   636 C  CA   . ALA A 1 43 ? 5.653  8.688   2.350  1.00 9.09  ? 43  ALA A CA   1 
ATOM   637 C  C    . ALA A 1 43 ? 5.581  7.171   2.364  1.00 8.56  ? 43  ALA A C    1 
ATOM   638 O  O    . ALA A 1 43 ? 6.180  6.523   3.212  1.00 6.43  ? 43  ALA A O    1 
ATOM   639 C  CB   . ALA A 1 43 ? 6.908  9.110   1.604  1.00 9.38  ? 43  ALA A CB   1 
ATOM   640 H  H    A ALA A 1 43 ? 6.351  9.901   3.925  1.00 7.14  ? 43  ALA A H    1 
ATOM   641 D  D    B ALA A 1 43 ? 6.351  9.901   3.925  0.00 7.14  ? 43  ALA A D    1 
ATOM   642 H  HA   . ALA A 1 43 ? 4.787  9.083   1.826  1.00 9.32  ? 43  ALA A HA   1 
ATOM   643 H  HB1  . ALA A 1 43 ? 7.753  8.534   1.974  1.00 11.17 ? 43  ALA A HB1  1 
ATOM   644 H  HB2  . ALA A 1 43 ? 7.082  10.160  1.770  1.00 11.52 ? 43  ALA A HB2  1 
ATOM   645 H  HB3  . ALA A 1 43 ? 6.782  8.922   0.541  1.00 12.02 ? 43  ALA A HB3  1 
ATOM   646 N  N    . PRO A 1 44 ? 4.794  6.591   1.449  1.00 8.47  ? 44  PRO A N    1 
ATOM   647 C  CA   . PRO A 1 44 ? 4.699  5.130   1.403  1.00 8.46  ? 44  PRO A CA   1 
ATOM   648 C  C    . PRO A 1 44 ? 5.993  4.526   0.864  1.00 4.49  ? 44  PRO A C    1 
ATOM   649 O  O    . PRO A 1 44 ? 6.839  5.234   0.319  1.00 6.16  ? 44  PRO A O    1 
ATOM   650 C  CB   . PRO A 1 44 ? 3.498  4.868   0.490  1.00 10.39 ? 44  PRO A CB   1 
ATOM   651 C  CG   . PRO A 1 44 ? 3.307  6.114   -0.291 1.00 12.57 ? 44  PRO A CG   1 
ATOM   652 C  CD   . PRO A 1 44 ? 3.879  7.251   0.505  1.00 11.27 ? 44  PRO A CD   1 
ATOM   653 H  HA   . PRO A 1 44 ? 4.509  4.742   2.390  1.00 7.60  ? 44  PRO A HA   1 
ATOM   654 H  HB2  . PRO A 1 44 ? 3.706  4.030   -0.156 1.00 12.78 ? 44  PRO A HB2  1 
ATOM   655 H  HB3  . PRO A 1 44 ? 2.626  4.668   1.087  1.00 14.97 ? 44  PRO A HB3  1 
ATOM   656 H  HG2  . PRO A 1 44 ? 3.834  6.022   -1.230 1.00 13.23 ? 44  PRO A HG2  1 
ATOM   657 H  HG3  . PRO A 1 44 ? 2.260  6.294   -0.475 1.00 13.69 ? 44  PRO A HG3  1 
ATOM   658 H  HD2  . PRO A 1 44 ? 4.437  7.905   -0.140 1.00 10.75 ? 44  PRO A HD2  1 
ATOM   659 H  HD3  . PRO A 1 44 ? 3.109  7.800   1.033  1.00 8.87  ? 44  PRO A HD3  1 
ATOM   660 N  N    . LYS A 1 45 ? 6.142  3.210   1.022  1.00 6.24  ? 45  LYS A N    1 
ATOM   661 C  CA   . LYS A 1 45 ? 7.345  2.497   0.579  1.00 7.28  ? 45  LYS A CA   1 
ATOM   662 C  C    . LYS A 1 45 ? 7.696  2.699   -0.903 1.00 7.89  ? 45  LYS A C    1 
ATOM   663 O  O    . LYS A 1 45 ? 8.868  2.620   -1.270 1.00 6.30  ? 45  LYS A O    1 
ATOM   664 C  CB   . LYS A 1 45 ? 7.204  1.003   0.864  1.00 8.74  ? 45  LYS A CB   1 
ATOM   665 C  CG   . LYS A 1 45 ? 7.302  0.645   2.348  1.00 12.52 ? 45  LYS A CG   1 
ATOM   666 C  CD   . LYS A 1 45 ? 7.158  -0.861  2.586  1.00 15.65 ? 45  LYS A CD   1 
ATOM   667 C  CE   . LYS A 1 45 ? 8.360  -1.644  2.078  1.00 19.46 ? 45  LYS A CE   1 
ATOM   668 N  NZ   . LYS A 1 45 ? 8.127  -3.120  2.104  1.00 19.50 ? 45  LYS A NZ   1 
ATOM   669 H  H    A LYS A 1 45 ? 5.388  2.782   1.451  0.18 6.24  ? 45  LYS A H    1 
ATOM   670 D  D    B LYS A 1 45 ? 5.388  2.782   1.451  0.82 6.24  ? 45  LYS A D    1 
ATOM   671 H  HA   . LYS A 1 45 ? 8.182  2.867   1.161  1.00 8.30  ? 45  LYS A HA   1 
ATOM   672 H  HB2  . LYS A 1 45 ? 6.247  0.683   0.484  1.00 9.18  ? 45  LYS A HB2  1 
ATOM   673 H  HB3  . LYS A 1 45 ? 7.982  0.482   0.326  1.00 7.55  ? 45  LYS A HB3  1 
ATOM   674 H  HG2  . LYS A 1 45 ? 8.255  0.971   2.732  1.00 12.86 ? 45  LYS A HG2  1 
ATOM   675 H  HG3  . LYS A 1 45 ? 6.523  1.154   2.879  1.00 13.42 ? 45  LYS A HG3  1 
ATOM   676 H  HD2  . LYS A 1 45 ? 7.040  -1.045  3.643  1.00 14.79 ? 45  LYS A HD2  1 
ATOM   677 H  HD3  . LYS A 1 45 ? 6.279  -1.204  2.074  1.00 14.14 ? 45  LYS A HD3  1 
ATOM   678 H  HE2  . LYS A 1 45 ? 8.569  -1.348  1.061  1.00 18.83 ? 45  LYS A HE2  1 
ATOM   679 H  HE3  . LYS A 1 45 ? 9.213  -1.413  2.697  1.00 20.35 ? 45  LYS A HE3  1 
ATOM   680 D  DZ1  . LYS A 1 45 ? 7.310  -3.337  1.499  1.00 23.83 ? 45  LYS A DZ1  1 
ATOM   681 D  DZ2  . LYS A 1 45 ? 7.931  -3.463  3.070  1.00 20.83 ? 45  LYS A DZ2  1 
ATOM   682 D  DZ3  . LYS A 1 45 ? 8.971  -3.604  1.727  1.00 21.72 ? 45  LYS A DZ3  1 
ATOM   683 N  N    . SER A 1 46 ? 6.692  2.974   -1.737 1.00 7.45  ? 46  SER A N    1 
ATOM   684 C  CA   . SER A 1 46 ? 6.884  3.199   -3.170 1.00 8.50  ? 46  SER A CA   1 
ATOM   685 C  C    . SER A 1 46 ? 7.792  4.385   -3.491 1.00 7.25  ? 46  SER A C    1 
ATOM   686 O  O    . SER A 1 46 ? 8.346  4.470   -4.589 1.00 6.65  ? 46  SER A O    1 
ATOM   687 C  CB   . SER A 1 46 ? 5.534  3.443   -3.853 1.00 9.13  ? 46  SER A CB   1 
ATOM   688 O  OG   . SER A 1 46 ? 4.827  4.508   -3.249 1.00 12.13 ? 46  SER A OG   1 
ATOM   689 H  H    A SER A 1 46 ? 5.754  3.033   -1.511 0.10 7.45  ? 46  SER A H    1 
ATOM   690 D  D    B SER A 1 46 ? 5.754  3.033   -1.511 0.90 7.45  ? 46  SER A D    1 
ATOM   691 H  HA   . SER A 1 46 ? 7.303  2.306   -3.601 1.00 8.02  ? 46  SER A HA   1 
ATOM   692 H  HB2  . SER A 1 46 ? 5.713  3.672   -4.893 1.00 10.06 ? 46  SER A HB2  1 
ATOM   693 H  HB3  . SER A 1 46 ? 4.941  2.554   -3.802 1.00 7.60  ? 46  SER A HB3  1 
ATOM   694 D  DG   . SER A 1 46 ? 5.073  5.326   -3.652 1.00 11.78 ? 46  SER A DG   1 
ATOM   695 N  N    . GLU A 1 47 ? 7.938  5.290   -2.525 1.00 6.38  ? 47  GLU A N    1 
ATOM   696 C  CA   . GLU A 1 47 ? 8.730  6.497   -2.706 1.00 8.17  ? 47  GLU A CA   1 
ATOM   697 C  C    . GLU A 1 47 ? 10.180 6.395   -2.223 1.00 6.33  ? 47  GLU A C    1 
ATOM   698 O  O    . GLU A 1 47 ? 10.844 7.409   -2.019 1.00 9.02  ? 47  GLU A O    1 
ATOM   699 C  CB   . GLU A 1 47 ? 8.014  7.671   -2.040 1.00 9.10  ? 47  GLU A CB   1 
ATOM   700 C  CG   . GLU A 1 47 ? 6.567  7.835   -2.524 1.00 7.77  ? 47  GLU A CG   1 
ATOM   701 C  CD   . GLU A 1 47 ? 6.489  7.821   -4.035 1.00 8.51  ? 47  GLU A CD   1 
ATOM   702 O  OE1  . GLU A 1 47 ? 7.006  8.766   -4.671 1.00 8.19  ? 47  GLU A OE1  1 
ATOM   703 O  OE2  . GLU A 1 47 ? 5.950  6.841   -4.597 1.00 9.87  ? 47  GLU A OE2  1 
ATOM   704 H  H    A GLU A 1 47 ? 7.487  5.186   -1.669 0.10 6.38  ? 47  GLU A H    1 
ATOM   705 D  D    B GLU A 1 47 ? 7.487  5.186   -1.669 0.90 6.38  ? 47  GLU A D    1 
ATOM   706 H  HA   . GLU A 1 47 ? 8.766  6.689   -3.768 1.00 6.20  ? 47  GLU A HA   1 
ATOM   707 H  HB2  . GLU A 1 47 ? 8.003  7.522   -0.974 1.00 8.93  ? 47  GLU A HB2  1 
ATOM   708 H  HB3  . GLU A 1 47 ? 8.553  8.573   -2.267 1.00 11.44 ? 47  GLU A HB3  1 
ATOM   709 H  HG2  . GLU A 1 47 ? 5.965  7.019   -2.122 1.00 7.51  ? 47  GLU A HG2  1 
ATOM   710 H  HG3  . GLU A 1 47 ? 6.168  8.775   -2.167 1.00 8.92  ? 47  GLU A HG3  1 
ATOM   711 N  N    . PHE A 1 48 ? 10.645 5.173   -2.002 1.00 7.24  ? 48  PHE A N    1 
ATOM   712 C  CA   . PHE A 1 48 ? 12.023 4.927   -1.580 1.00 7.47  ? 48  PHE A CA   1 
ATOM   713 C  C    . PHE A 1 48 ? 12.765 4.365   -2.785 1.00 8.99  ? 48  PHE A C    1 
ATOM   714 O  O    . PHE A 1 48 ? 12.171 3.746   -3.662 1.00 9.24  ? 48  PHE A O    1 
ATOM   715 C  CB   . PHE A 1 48 ? 12.078 3.916   -0.428 1.00 5.86  ? 48  PHE A CB   1 
ATOM   716 C  CG   . PHE A 1 48 ? 11.767 4.511   0.919  1.00 5.92  ? 48  PHE A CG   1 
ATOM   717 C  CD1  . PHE A 1 48 ? 10.468 4.800   1.270  1.00 4.43  ? 48  PHE A CD1  1 
ATOM   718 C  CD2  . PHE A 1 48 ? 12.772 4.779   1.828  1.00 3.56  ? 48  PHE A CD2  1 
ATOM   719 C  CE1  . PHE A 1 48 ? 10.172 5.345   2.499  1.00 6.49  ? 48  PHE A CE1  1 
ATOM   720 C  CE2  . PHE A 1 48 ? 12.480 5.328   3.068  1.00 5.04  ? 48  PHE A CE2  1 
ATOM   721 C  CZ   . PHE A 1 48 ? 11.182 5.610   3.398  1.00 7.79  ? 48  PHE A CZ   1 
ATOM   722 H  H    A PHE A 1 48 ? 10.015 4.414   -1.986 0.16 7.24  ? 48  PHE A H    1 
ATOM   723 D  D    B PHE A 1 48 ? 10.015 4.414   -1.986 0.84 7.24  ? 48  PHE A D    1 
ATOM   724 H  HA   . PHE A 1 48 ? 12.482 5.871   -1.259 1.00 7.39  ? 48  PHE A HA   1 
ATOM   725 H  HB2  . PHE A 1 48 ? 11.339 3.151   -0.632 1.00 6.68  ? 48  PHE A HB2  1 
ATOM   726 H  HB3  . PHE A 1 48 ? 13.061 3.449   -0.402 1.00 7.31  ? 48  PHE A HB3  1 
ATOM   727 H  HD1  . PHE A 1 48 ? 9.677  4.598   0.572  1.00 7.28  ? 48  PHE A HD1  1 
ATOM   728 H  HD2  . PHE A 1 48 ? 13.786 4.548   1.574  1.00 3.93  ? 48  PHE A HD2  1 
ATOM   729 H  HE1  . PHE A 1 48 ? 9.149  5.579   2.743  1.00 5.98  ? 48  PHE A HE1  1 
ATOM   730 H  HE2  . PHE A 1 48 ? 13.268 5.542   3.778  1.00 6.05  ? 48  PHE A HE2  1 
ATOM   731 H  HZ   . PHE A 1 48 ? 10.955 6.037   4.364  1.00 6.81  ? 48  PHE A HZ   1 
ATOM   732 N  N    . GLU A 1 49 ? 14.069 4.591   -2.804 1.00 9.45  ? 49  GLU A N    1 
ATOM   733 C  CA   . GLU A 1 49 ? 14.937 4.143   -3.875 1.00 11.50 ? 49  GLU A CA   1 
ATOM   734 C  C    . GLU A 1 49 ? 16.185 3.548   -3.234 1.00 8.61  ? 49  GLU A C    1 
ATOM   735 O  O    . GLU A 1 49 ? 16.727 4.106   -2.290 1.00 10.07 ? 49  GLU A O    1 
ATOM   736 C  CB   . GLU A 1 49 ? 15.300 5.347   -4.753 1.00 14.40 ? 49  GLU A CB   1 
ATOM   737 C  CG   . GLU A 1 49 ? 16.015 4.994   -6.040 1.00 19.41 ? 49  GLU A CG   1 
ATOM   738 C  CD   . GLU A 1 49 ? 16.195 6.205   -6.945 1.00 22.24 ? 49  GLU A CD   1 
ATOM   739 O  OE1  . GLU A 1 49 ? 17.336 6.704   -7.052 1.00 25.27 ? 49  GLU A OE1  1 
ATOM   740 O  OE2  . GLU A 1 49 ? 15.193 6.663   -7.540 1.00 23.53 ? 49  GLU A OE2  1 
ATOM   741 H  H    A GLU A 1 49 ? 14.370 5.239   -2.126 0.17 9.45  ? 49  GLU A H    1 
ATOM   742 D  D    B GLU A 1 49 ? 14.370 5.239   -2.126 0.83 9.45  ? 49  GLU A D    1 
ATOM   743 H  HA   . GLU A 1 49 ? 14.427 3.393   -4.462 1.00 10.18 ? 49  GLU A HA   1 
ATOM   744 H  HB2  . GLU A 1 49 ? 14.399 5.879   -4.996 1.00 17.47 ? 49  GLU A HB2  1 
ATOM   745 H  HB3  . GLU A 1 49 ? 15.937 5.999   -4.173 1.00 16.26 ? 49  GLU A HB3  1 
ATOM   746 H  HG2  . GLU A 1 49 ? 16.978 4.583   -5.799 1.00 18.50 ? 49  GLU A HG2  1 
ATOM   747 H  HG3  . GLU A 1 49 ? 15.446 4.247   -6.556 1.00 18.20 ? 49  GLU A HG3  1 
ATOM   748 N  N    . LYS A 1 50 ? 16.599 2.380   -3.714 1.00 10.27 ? 50  LYS A N    1 
ATOM   749 C  CA   . LYS A 1 50 ? 17.774 1.712   -3.176 1.00 10.89 ? 50  LYS A CA   1 
ATOM   750 C  C    . LYS A 1 50 ? 19.056 2.425   -3.588 1.00 10.15 ? 50  LYS A C    1 
ATOM   751 O  O    . LYS A 1 50 ? 19.231 2.783   -4.751 1.00 10.31 ? 50  LYS A O    1 
ATOM   752 C  CB   . LYS A 1 50 ? 17.823 0.265   -3.668 1.00 13.19 ? 50  LYS A CB   1 
ATOM   753 C  CG   . LYS A 1 50 ? 18.816 -0.612  -2.922 1.00 17.53 ? 50  LYS A CG   1 
ATOM   754 C  CD   . LYS A 1 50 ? 18.870 -2.009  -3.531 1.00 20.18 ? 50  LYS A CD   1 
ATOM   755 C  CE   . LYS A 1 50 ? 19.783 -2.913  -2.718 1.00 23.90 ? 50  LYS A CE   1 
ATOM   756 N  NZ   . LYS A 1 50 ? 19.831 -4.293  -3.289 1.00 25.65 ? 50  LYS A NZ   1 
ATOM   757 H  H    A LYS A 1 50 ? 16.098 1.985   -4.449 0.21 10.27 ? 50  LYS A H    1 
ATOM   758 D  D    B LYS A 1 50 ? 16.098 1.985   -4.449 0.79 10.27 ? 50  LYS A D    1 
ATOM   759 H  HA   . LYS A 1 50 ? 17.704 1.712   -2.096 1.00 11.19 ? 50  LYS A HA   1 
ATOM   760 H  HB2  . LYS A 1 50 ? 16.841 -0.168  -3.565 1.00 12.09 ? 50  LYS A HB2  1 
ATOM   761 H  HB3  . LYS A 1 50 ? 18.091 0.275   -4.716 1.00 13.60 ? 50  LYS A HB3  1 
ATOM   762 H  HG2  . LYS A 1 50 ? 19.803 -0.168  -2.977 1.00 17.24 ? 50  LYS A HG2  1 
ATOM   763 H  HG3  . LYS A 1 50 ? 18.507 -0.690  -1.889 1.00 17.17 ? 50  LYS A HG3  1 
ATOM   764 H  HD2  . LYS A 1 50 ? 17.873 -2.436  -3.554 1.00 22.01 ? 50  LYS A HD2  1 
ATOM   765 H  HD3  . LYS A 1 50 ? 19.254 -1.938  -4.542 1.00 22.14 ? 50  LYS A HD3  1 
ATOM   766 H  HE2  . LYS A 1 50 ? 20.777 -2.497  -2.708 1.00 23.35 ? 50  LYS A HE2  1 
ATOM   767 H  HE3  . LYS A 1 50 ? 19.416 -2.968  -1.704 1.00 23.79 ? 50  LYS A HE3  1 
ATOM   768 N  N    . LEU A 1 51 ? 19.946 2.628   -2.622 1.00 10.59 ? 51  LEU A N    1 
ATOM   769 C  CA   . LEU A 1 51 ? 21.232 3.263   -2.867 1.00 12.58 ? 51  LEU A CA   1 
ATOM   770 C  C    . LEU A 1 51 ? 22.254 2.157   -3.128 1.00 14.66 ? 51  LEU A C    1 
ATOM   771 O  O    . LEU A 1 51 ? 22.447 1.264   -2.300 1.00 16.90 ? 51  LEU A O    1 
ATOM   772 C  CB   . LEU A 1 51 ? 21.650 4.118   -1.660 1.00 13.15 ? 51  LEU A CB   1 
ATOM   773 C  CG   . LEU A 1 51 ? 20.630 5.189   -1.247 1.00 14.65 ? 51  LEU A CG   1 
ATOM   774 C  CD1  . LEU A 1 51 ? 21.176 5.988   -0.070 1.00 14.41 ? 51  LEU A CD1  1 
ATOM   775 C  CD2  . LEU A 1 51 ? 20.309 6.108   -2.412 1.00 15.31 ? 51  LEU A CD2  1 
ATOM   776 H  H    A LEU A 1 51 ? 19.738 2.373   -1.710 0.23 10.59 ? 51  LEU A H    1 
ATOM   777 D  D    B LEU A 1 51 ? 19.738 2.373   -1.710 0.77 10.59 ? 51  LEU A D    1 
ATOM   778 H  HA   . LEU A 1 51 ? 21.171 3.886   -3.753 1.00 12.89 ? 51  LEU A HA   1 
ATOM   779 H  HB2  . LEU A 1 51 ? 21.811 3.462   -0.808 1.00 12.48 ? 51  LEU A HB2  1 
ATOM   780 H  HB3  . LEU A 1 51 ? 22.585 4.610   -1.906 1.00 11.40 ? 51  LEU A HB3  1 
ATOM   781 H  HG   . LEU A 1 51 ? 19.716 4.705   -0.942 1.00 14.54 ? 51  LEU A HG   1 
ATOM   782 H  HD11 . LEU A 1 51 ? 21.929 6.669   -0.422 1.00 14.95 ? 51  LEU A HD11 1 
ATOM   783 H  HD12 . LEU A 1 51 ? 21.610 5.308   0.647  1.00 14.86 ? 51  LEU A HD12 1 
ATOM   784 H  HD13 . LEU A 1 51 ? 20.375 6.547   0.400  1.00 14.94 ? 51  LEU A HD13 1 
ATOM   785 H  HD21 . LEU A 1 51 ? 21.184 6.217   -3.035 1.00 16.52 ? 51  LEU A HD21 1 
ATOM   786 H  HD22 . LEU A 1 51 ? 19.999 7.077   -2.039 1.00 16.96 ? 51  LEU A HD22 1 
ATOM   787 H  HD23 . LEU A 1 51 ? 19.507 5.674   -2.992 1.00 16.72 ? 51  LEU A HD23 1 
ATOM   788 N  N    . GLU A 1 52 ? 22.836 2.170   -4.322 1.00 18.15 ? 52  GLU A N    1 
ATOM   789 H  H    A GLU A 1 52 ? 22.372 2.657   -5.056 0.33 18.15 ? 52  GLU A H    1 
ATOM   790 D  D    B GLU A 1 52 ? 22.372 2.657   -5.056 0.67 18.15 ? 52  GLU A D    1 
HETATM 791 FE FE   . FE  B 2 .  ? 10.307 10.763  3.901  1.00 7.22  ? 153 FE  A FE   1 
HETATM 792 O  O    . DOD C 3 .  ? 11.266 -6.574  12.086 1.00 22.50 ? 54  DOD A O    1 
HETATM 793 D  D1   . DOD C 3 .  ? 11.655 -6.473  11.215 1.00 22.43 ? 54  DOD A D1   1 
HETATM 794 D  D2   . DOD C 3 .  ? 10.401 -6.157  12.025 1.00 22.50 ? 54  DOD A D2   1 
HETATM 795 O  O    . DOD C 3 .  ? 12.091 -8.771  14.362 1.00 39.12 ? 55  DOD A O    1 
HETATM 796 O  O    . DOD C 3 .  ? 7.520  5.894   -6.992 1.00 51.58 ? 56  DOD A O    1 
HETATM 797 O  O    . DOD C 3 .  ? 2.060  4.814   -3.577 1.00 16.49 ? 57  DOD A O    1 
HETATM 798 D  D1   . DOD C 3 .  ? 1.644  5.252   -2.837 1.00 16.48 ? 57  DOD A D1   1 
HETATM 799 D  D2   . DOD C 3 .  ? 2.965  4.675   -3.288 1.00 16.62 ? 57  DOD A D2   1 
HETATM 800 O  O    . DOD C 3 .  ? 10.257 0.978   -3.279 1.00 45.10 ? 58  DOD A O    1 
HETATM 801 O  O    . DOD C 3 .  ? 1.451  2.323   -1.849 1.00 22.59 ? 59  DOD A O    1 
HETATM 802 D  D1   . DOD C 3 .  ? 0.954  1.656   -2.350 1.00 22.66 ? 59  DOD A D1   1 
HETATM 803 D  D2   . DOD C 3 .  ? 1.299  3.152   -2.321 1.00 22.47 ? 59  DOD A D2   1 
HETATM 804 O  O    . DOD C 3 .  ? 4.209  1.577   -1.190 1.00 19.76 ? 60  DOD A O    1 
HETATM 805 D  D1   . DOD C 3 .  ? 3.494  2.191   -1.348 1.00 19.83 ? 60  DOD A D1   1 
HETATM 806 D  D2   . DOD C 3 .  ? 3.759  0.748   -1.016 1.00 20.04 ? 60  DOD A D2   1 
HETATM 807 O  O    . DOD C 3 .  ? 16.267 12.341  -1.283 1.00 48.06 ? 61  DOD A O    1 
HETATM 808 O  O    . DOD C 3 .  ? 23.156 0.565   0.342  1.00 38.11 ? 62  DOD A O    1 
HETATM 809 D  D1   . DOD C 3 .  ? 22.891 0.423   -0.581 1.00 37.94 ? 62  DOD A D1   1 
HETATM 810 O  O    . DOD C 3 .  ? 3.945  2.094   2.434  1.00 16.97 ? 63  DOD A O    1 
HETATM 811 D  D1   . DOD C 3 .  ? 3.403  1.349   2.174  1.00 17.30 ? 63  DOD A D1   1 
HETATM 812 D  D2   . DOD C 3 .  ? 4.202  1.900   3.334  1.00 16.85 ? 63  DOD A D2   1 
HETATM 813 O  O    . DOD C 3 .  ? 13.766 16.868  4.751  1.00 51.39 ? 64  DOD A O    1 
HETATM 814 O  O    . DOD C 3 .  ? 18.381 9.681   7.889  1.00 29.97 ? 65  DOD A O    1 
HETATM 815 O  O    . DOD C 3 .  ? 5.314  9.235   9.219  1.00 25.34 ? 66  DOD A O    1 
HETATM 816 D  D1   . DOD C 3 .  ? 5.743  8.392   9.376  1.00 25.31 ? 66  DOD A D1   1 
HETATM 817 D  D2   . DOD C 3 .  ? 5.859  9.866   9.687  1.00 25.30 ? 66  DOD A D2   1 
HETATM 818 O  O    . DOD C 3 .  ? 16.935 3.359   9.156  1.00 14.88 ? 67  DOD A O    1 
HETATM 819 D  D1   . DOD C 3 .  ? 16.096 3.798   9.321  1.00 14.95 ? 67  DOD A D1   1 
HETATM 820 D  D2   . DOD C 3 .  ? 17.094 2.836   9.939  1.00 14.97 ? 67  DOD A D2   1 
HETATM 821 D  D1   . DOD C 3 .  ? 6.803  4.807   10.052 1.00 31.72 ? 68  DOD A D1   1 
HETATM 822 D  D2   . DOD C 3 .  ? 8.158  4.298   10.481 1.00 31.44 ? 68  DOD A D2   1 
HETATM 823 O  O    . DOD C 3 .  ? 13.240 4.165   15.211 1.00 25.79 ? 69  DOD A O    1 
HETATM 824 D  D1   . DOD C 3 .  ? 12.745 3.922   14.422 1.00 25.60 ? 69  DOD A D1   1 
HETATM 825 O  O    . DOD C 3 .  ? 16.411 17.415  3.097  1.00 46.41 ? 70  DOD A O    1 
HETATM 826 O  O    . DOD C 3 .  ? 18.969 0.936   15.410 1.00 29.40 ? 71  DOD A O    1 
HETATM 827 D  D1   . DOD C 3 .  ? 18.303 1.317   14.835 1.00 29.34 ? 71  DOD A D1   1 
HETATM 828 D  D2   . DOD C 3 .  ? 18.713 0.018   15.486 1.00 29.28 ? 71  DOD A D2   1 
HETATM 829 O  O    . DOD C 3 .  ? 22.907 -1.453  5.745  1.00 49.42 ? 72  DOD A O    1 
HETATM 830 O  O    . DOD C 3 .  ? 14.108 -9.439  6.654  1.00 35.90 ? 73  DOD A O    1 
HETATM 831 D  D1   . DOD C 3 .  ? 14.894 -9.524  7.217  1.00 35.94 ? 73  DOD A D1   1 
HETATM 832 D  D1   . DOD C 3 .  ? 15.123 5.806   12.150 1.00 32.31 ? 74  DOD A D1   1 
HETATM 833 D  D2   . DOD C 3 .  ? 13.613 5.504   12.153 1.00 32.28 ? 74  DOD A D2   1 
HETATM 834 O  O    . DOD C 3 .  ? 0.932  8.353   5.324  1.00 45.86 ? 75  DOD A O    1 
HETATM 835 O  O    . DOD C 3 .  ? 1.410  3.394   2.870  1.00 45.94 ? 76  DOD A O    1 
HETATM 836 O  O    . DOD C 3 .  ? 17.053 -4.871  0.330  1.00 29.48 ? 77  DOD A O    1 
HETATM 837 D  D1   . DOD C 3 .  ? 17.009 -4.913  1.295  1.00 29.60 ? 77  DOD A D1   1 
HETATM 838 D  D2   . DOD C 3 .  ? 16.223 -5.245  0.032  1.00 29.44 ? 77  DOD A D2   1 
HETATM 839 O  O    . DOD C 3 .  ? 4.769  3.651   10.409 1.00 44.13 ? 78  DOD A O    1 
HETATM 840 O  O    . DOD C 3 .  ? 16.557 3.776   12.936 1.00 34.50 ? 79  DOD A O    1 
HETATM 841 D  D1   . DOD C 3 .  ? 15.629 3.627   12.744 1.00 34.21 ? 79  DOD A D1   1 
HETATM 842 O  O    . DOD C 3 .  ? 10.662 4.925   -5.813 1.00 32.11 ? 80  DOD A O    1 
HETATM 843 D  D1   . DOD C 3 .  ? 9.896  5.205   -6.315 1.00 32.38 ? 80  DOD A D1   1 
HETATM 844 O  O    . DOD C 3 .  ? 20.375 -6.390  4.934  1.00 44.65 ? 81  DOD A O    1 
HETATM 845 O  O    . DOD C 3 .  ? 17.101 14.581  -0.237 1.00 43.96 ? 82  DOD A O    1 
HETATM 846 O  O    . DOD C 3 .  ? 21.257 -5.990  7.997  1.00 56.02 ? 83  DOD A O    1 
HETATM 847 O  O    . DOD C 3 .  ? 0.994  6.339   3.161  1.00 43.61 ? 84  DOD A O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  1  1  ALA ALA A . n 
A 1 2  LYS 2  2  2  LYS LYS A . n 
A 1 3  TYR 3  3  3  TYR TYR A . n 
A 1 4  VAL 4  4  4  VAL VAL A . n 
A 1 5  CYS 5  5  5  CYS CYS A . n 
A 1 6  LYS 6  6  6  LYS LYS A . n 
A 1 7  ILE 7  7  7  ILE ILE A . n 
A 1 8  CYS 8  8  8  CYS CYS A . n 
A 1 9  GLY 9  9  9  GLY GLY A . n 
A 1 10 TYR 10 10 10 TYR TYR A . n 
A 1 11 ILE 11 11 11 ILE ILE A . n 
A 1 12 TYR 12 12 12 TYR TYR A . n 
A 1 13 ASP 13 13 13 ASP ASP A . n 
A 1 14 GLU 14 14 14 GLU GLU A . n 
A 1 15 ASP 15 15 15 ASP ASP A . n 
A 1 16 ALA 16 16 16 ALA ALA A . n 
A 1 17 GLY 17 17 17 GLY GLY A . n 
A 1 18 ASP 18 18 18 ASP ASP A . n 
A 1 19 PRO 19 19 19 PRO PRO A . n 
A 1 20 ASP 20 20 20 ASP ASP A . n 
A 1 21 ASN 21 21 21 ASN ASN A . n 
A 1 22 GLY 22 22 22 GLY GLY A . n 
A 1 23 VAL 23 23 23 VAL VAL A . n 
A 1 24 SER 24 24 24 SER SER A . n 
A 1 25 PRO 25 25 25 PRO PRO A . n 
A 1 26 GLY 26 26 26 GLY GLY A . n 
A 1 27 THR 27 27 27 THR THR A . n 
A 1 28 LYS 28 28 28 LYS LYS A . n 
A 1 29 PHE 29 29 29 PHE PHE A . n 
A 1 30 GLU 30 30 30 GLU GLU A . n 
A 1 31 GLU 31 31 31 GLU GLU A . n 
A 1 32 ILE 32 32 32 ILE ILE A . n 
A 1 33 PRO 33 33 33 PRO PRO A . n 
A 1 34 ASP 34 34 34 ASP ASP A . n 
A 1 35 ASP 35 35 35 ASP ASP A . n 
A 1 36 TRP 36 36 36 TRP TRP A . n 
A 1 37 VAL 37 37 37 VAL VAL A . n 
A 1 38 CYS 38 38 38 CYS CYS A . n 
A 1 39 PRO 39 39 39 PRO PRO A . n 
A 1 40 ILE 40 40 40 ILE ILE A . n 
A 1 41 CYS 41 41 41 CYS CYS A . n 
A 1 42 GLY 42 42 42 GLY GLY A . n 
A 1 43 ALA 43 43 43 ALA ALA A . n 
A 1 44 PRO 44 44 44 PRO PRO A . n 
A 1 45 LYS 45 45 45 LYS LYS A . n 
A 1 46 SER 46 46 46 SER SER A . n 
A 1 47 GLU 47 47 47 GLU GLU A . n 
A 1 48 PHE 48 48 48 PHE PHE A . n 
A 1 49 GLU 49 49 49 GLU GLU A . n 
A 1 50 LYS 50 50 50 LYS LYS A . n 
A 1 51 LEU 51 51 51 LEU LEU A . n 
A 1 52 GLU 52 52 52 GLU GLU A . n 
A 1 53 ASP 53 53 ?  ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 FE  1  153 53 FE  FE  A . 
C 3 DOD 1  54  54 DOD DOD A . 
C 3 DOD 2  55  55 DOD DOD A . 
C 3 DOD 3  56  56 DOD DOD A . 
C 3 DOD 4  57  57 DOD DOD A . 
C 3 DOD 5  58  58 DOD DOD A . 
C 3 DOD 6  59  59 DOD DOD A . 
C 3 DOD 7  60  60 DOD DOD A . 
C 3 DOD 8  61  61 DOD DOD A . 
C 3 DOD 9  62  62 DOD DOD A . 
C 3 DOD 10 63  63 DOD DOD A . 
C 3 DOD 11 64  64 DOD DOD A . 
C 3 DOD 12 65  65 DOD DOD A . 
C 3 DOD 13 66  66 DOD DOD A . 
C 3 DOD 14 67  67 DOD DOD A . 
C 3 DOD 15 68  68 DOD DOD A . 
C 3 DOD 16 69  69 DOD DOD A . 
C 3 DOD 17 70  70 DOD DOD A . 
C 3 DOD 18 71  71 DOD DOD A . 
C 3 DOD 19 72  72 DOD DOD A . 
C 3 DOD 20 73  73 DOD DOD A . 
C 3 DOD 21 74  74 DOD DOD A . 
C 3 DOD 22 75  75 DOD DOD A . 
C 3 DOD 23 76  76 DOD DOD A . 
C 3 DOD 24 77  77 DOD DOD A . 
C 3 DOD 25 78  78 DOD DOD A . 
C 3 DOD 26 79  79 DOD DOD A . 
C 3 DOD 27 80  80 DOD DOD A . 
C 3 DOD 28 81  81 DOD DOD A . 
C 3 DOD 29 82  82 DOD DOD A . 
C 3 DOD 30 83  83 DOD DOD A . 
C 3 DOD 31 84  84 DOD DOD A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 SG ? A CYS 5  ? A CYS 5  ? 1_555 FE ? B FE . ? A FE 153 ? 1_555 SG ? A CYS 38 ? A CYS 38 ? 1_555 108.7 ? 
2 SG ? A CYS 5  ? A CYS 5  ? 1_555 FE ? B FE . ? A FE 153 ? 1_555 SG ? A CYS 8  ? A CYS 8  ? 1_555 111.7 ? 
3 SG ? A CYS 38 ? A CYS 38 ? 1_555 FE ? B FE . ? A FE 153 ? 1_555 SG ? A CYS 8  ? A CYS 8  ? 1_555 106.2 ? 
4 SG ? A CYS 5  ? A CYS 5  ? 1_555 FE ? B FE . ? A FE 153 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 106.9 ? 
5 SG ? A CYS 38 ? A CYS 38 ? 1_555 FE ? B FE . ? A FE 153 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 110.3 ? 
6 SG ? A CYS 8  ? A CYS 8  ? 1_555 FE ? B FE . ? A FE 153 ? 1_555 SG ? A CYS 41 ? A CYS 41 ? 1_555 113.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-08-27 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-03-07 
5 'Structure model' 1 4 2018-11-28 
6 'Structure model' 1 5 2018-12-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Data collection'           
5 5 'Structure model' 'Data collection'           
6 6 'Structure model' 'Data collection'           
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' diffrn_detector  
2 5 'Structure model' diffrn_detector  
3 5 'Structure model' diffrn_source    
4 6 'Structure model' diffrn_radiation 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_diffrn_detector.detector'                
2 5 'Structure model' '_diffrn_detector.details'                 
3 5 'Structure model' '_diffrn_detector.detector'                
4 5 'Structure model' '_diffrn_detector.type'                    
5 5 'Structure model' '_diffrn_source.pdbx_synchrotron_beamline' 
6 5 'Structure model' '_diffrn_source.pdbx_synchrotron_site'     
7 5 'Structure model' '_diffrn_source.type'                      
8 6 'Structure model' '_diffrn_radiation.pdbx_scattering_type'   
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
DENZO     'data reduction' . ? 1 ? ? ? ? 
SCALEPACK 'data scaling'   . ? 2 ? ? ? ? 
CNS       refinement       . ? 3 ? ? ? ? 
CNS       phasing          . ? 4 ? ? ? ? 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 52 ? CA  ? A GLU 52 CA  
2  1 Y 1 A GLU 52 ? C   ? A GLU 52 C   
3  1 Y 1 A GLU 52 ? O   ? A GLU 52 O   
4  1 Y 1 A GLU 52 ? CB  ? A GLU 52 CB  
5  1 Y 1 A GLU 52 ? CG  ? A GLU 52 CG  
6  1 Y 1 A GLU 52 ? CD  ? A GLU 52 CD  
7  1 Y 1 A GLU 52 ? OE1 ? A GLU 52 OE1 
8  1 Y 1 A GLU 52 ? OE2 ? A GLU 52 OE2 
9  1 N 1 A DOD 68 ? O   ? C DOD 15 O   
10 1 N 1 A DOD 74 ? O   ? C DOD 21 O   
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     A 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     ASP 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      53 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    A 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    ASP 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     53 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'FE (III) ION' FE  
3 water          DOD 
#