data_1IW4
# 
_entry.id   1IW4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.323 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IW4         
RCSB  RCSB005328   
WWPDB D_1000005328 
BMRB  5348         
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.db_id          5348 
_pdbx_database_related.details        '5348 is chemical shifts of this protein' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IW4 
_pdbx_database_status.recvd_initial_deposition_date   2002-04-19 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hemmi, H.'     1 
'Yoshida, T.'   2 
'Kumazaki, T.'  3 
'Nemoto, N.'    4 
'Hasegawa, J.'  5 
'Nishioka, F.'  6 
'Kyogoku, Y.'   7 
'Yokosawa, H.'  8 
'Kobayashi, Y.' 9 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of ascidian trypsin inhibitor determined by nuclear magnetic resonance spectroscopy.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            41 
_citation.page_first                10657 
_citation.page_last                 10664 
_citation.year                      2002 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12186551 
_citation.pdbx_database_id_DOI      10.1021/bi026035o 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hemmi, H.'     1 ? 
primary 'Yoshida, T.'   2 ? 
primary 'Kumazaki, T.'  3 ? 
primary 'Nemoto, N.'    4 ? 
primary 'Hasegawa, J.'  5 ? 
primary 'Nishioka, F.'  6 ? 
primary 'Kyogoku, Y.'   7 ? 
primary 'Yokosawa, H.'  8 ? 
primary 'Kobayashi, Y.' 9 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           'trypsin inhibitor' 
_entity.formula_weight             6084.985 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       AHMDCTEFNPLCRCNKMLGDLICAVIGDAKEEHRNMCALCCEHPGGFEYSNGPCE 
_entity_poly.pdbx_seq_one_letter_code_can   AHMDCTEFNPLCRCNKMLGDLICAVIGDAKEEHRNMCALCCEHPGGFEYSNGPCE 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  HIS n 
1 3  MET n 
1 4  ASP n 
1 5  CYS n 
1 6  THR n 
1 7  GLU n 
1 8  PHE n 
1 9  ASN n 
1 10 PRO n 
1 11 LEU n 
1 12 CYS n 
1 13 ARG n 
1 14 CYS n 
1 15 ASN n 
1 16 LYS n 
1 17 MET n 
1 18 LEU n 
1 19 GLY n 
1 20 ASP n 
1 21 LEU n 
1 22 ILE n 
1 23 CYS n 
1 24 ALA n 
1 25 VAL n 
1 26 ILE n 
1 27 GLY n 
1 28 ASP n 
1 29 ALA n 
1 30 LYS n 
1 31 GLU n 
1 32 GLU n 
1 33 HIS n 
1 34 ARG n 
1 35 ASN n 
1 36 MET n 
1 37 CYS n 
1 38 ALA n 
1 39 LEU n 
1 40 CYS n 
1 41 CYS n 
1 42 GLU n 
1 43 HIS n 
1 44 PRO n 
1 45 GLY n 
1 46 GLY n 
1 47 PHE n 
1 48 GLU n 
1 49 TYR n 
1 50 SER n 
1 51 ASN n 
1 52 GLY n 
1 53 PRO n 
1 54 CYS n 
1 55 GLU n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Halocynthia roretzi' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7729 
_entity_src_nat.genus                      Halocynthia 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ITRP_HALRO 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   AHMDCTEFNPLCRCNKMLGDLICAVIGDAKEEHRNMCALCCEHPGGFEYSNGPCE 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P16589 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1IW4 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 55 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P16589 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  55 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       55 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 NOESY    
2 1 1 DQF-COSY 
3 1 1 E-COSY   
4 1 1 TOCSY    
5 2 2 TOCSY    
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 303 ambient 3.7 ? ? K 
2 303 ambient 3.7 ? ? K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1.5-2.0mM ascidian trypsin inhibitor; 90% H2O, 10% D2O' '90% H2O/10% D2O' 
2 '1.5-2.0mM ascidian trypsin inhibitor; D2O'              D2O               
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker AVANCE 500 
2 ? Bruker DRX    600 
3 ? Bruker DMX    750 
4 ? JEOL   A      600 
# 
_pdbx_nmr_refine.entry_id           1IW4 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1IW4 
_pdbx_nmr_details.text       'The structure was determined using standard 2D homonuclear techniques.' 
# 
_pdbx_nmr_ensemble.entry_id                                      1IW4 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1IW4 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XwinNMR 2.6   collection      Bruker   1 
NMRPipe 2.1   processing      Delaglio 2 
NMRPIPP 4.3.2 'data analysis' Garrett  3 
CNS     1.0   refinement      Brunger  4 
# 
_exptl.entry_id          1IW4 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.crystal_id             1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1IW4 
_struct.title                     'Solution structure of ascidian trypsin inhibitor' 
_struct.pdbx_descriptor           'trypsin inhibitor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IW4 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;solution structure, ascidian, trypsin inhibitor, cystine-stabilized alpha-helical motif, disulfide bond, Kazal-type inhibitor, PROTEIN BINDING
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ASN 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        35 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       HIS 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        43 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ASN 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         35 
_struct_conf.end_auth_comp_id        HIS 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         43 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 5  SG ? ? ? 1_555 A CYS 40 SG ? ? A CYS 5  A CYS 40 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf2 disulf ? ? A CYS 12 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 12 A CYS 41 1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf3 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 14 A CYS 37 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf4 disulf ? ? A CYS 23 SG ? ? ? 1_555 A CYS 54 SG ? ? A CYS 23 A CYS 54 1_555 ? ? ? ? ? ? ? 2.030 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 31 ? HIS A 33 ? GLU A 31 HIS A 33 
A 2 ILE A 22 ? VAL A 25 ? ILE A 22 VAL A 25 
A 3 GLU A 48 ? TYR A 49 ? GLU A 48 TYR A 49 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 31 ? O GLU A 31 N ALA A 24 ? N ALA A 24 
A 2 3 N VAL A 25 ? N VAL A 25 O GLU A 48 ? O GLU A 48 
# 
_database_PDB_matrix.entry_id          1IW4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IW4 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ALA A 1 1  ? 10.657  -0.666  -0.105  1.00 0.00 ? 1  ALA A N    1  
ATOM 2     C CA   . ALA A 1 1  ? 10.733  -1.567  -1.285  1.00 0.00 ? 1  ALA A CA   1  
ATOM 3     C C    . ALA A 1 1  ? 9.350   -2.079  -1.672  1.00 0.00 ? 1  ALA A C    1  
ATOM 4     O O    . ALA A 1 1  ? 8.412   -2.019  -0.877  1.00 0.00 ? 1  ALA A O    1  
ATOM 5     C CB   . ALA A 1 1  ? 11.665  -2.734  -0.993  1.00 0.00 ? 1  ALA A CB   1  
ATOM 6     H H1   . ALA A 1 1  ? 9.769   -0.130  -0.172  1.00 0.00 ? 1  ALA A H1   1  
ATOM 7     H H2   . ALA A 1 1  ? 11.482  -0.032  -0.136  1.00 0.00 ? 1  ALA A H2   1  
ATOM 8     H H3   . ALA A 1 1  ? 10.671  -1.260  0.748   1.00 0.00 ? 1  ALA A H3   1  
ATOM 9     H HA   . ALA A 1 1  ? 11.145  -1.009  -2.113  1.00 0.00 ? 1  ALA A HA   1  
ATOM 10    H HB1  . ALA A 1 1  ? 11.081  -3.600  -0.715  1.00 0.00 ? 1  ALA A HB1  1  
ATOM 11    H HB2  . ALA A 1 1  ? 12.328  -2.473  -0.182  1.00 0.00 ? 1  ALA A HB2  1  
ATOM 12    H HB3  . ALA A 1 1  ? 12.246  -2.961  -1.875  1.00 0.00 ? 1  ALA A HB3  1  
ATOM 13    N N    . HIS A 1 2  ? 9.230   -2.588  -2.894  1.00 0.00 ? 2  HIS A N    1  
ATOM 14    C CA   . HIS A 1 2  ? 7.959   -3.117  -3.378  1.00 0.00 ? 2  HIS A CA   1  
ATOM 15    C C    . HIS A 1 2  ? 7.618   -4.403  -2.641  1.00 0.00 ? 2  HIS A C    1  
ATOM 16    O O    . HIS A 1 2  ? 7.924   -5.503  -3.104  1.00 0.00 ? 2  HIS A O    1  
ATOM 17    C CB   . HIS A 1 2  ? 8.027   -3.375  -4.884  1.00 0.00 ? 2  HIS A CB   1  
ATOM 18    C CG   . HIS A 1 2  ? 8.579   -2.223  -5.666  1.00 0.00 ? 2  HIS A CG   1  
ATOM 19    N ND1  . HIS A 1 2  ? 9.929   -1.961  -5.770  1.00 0.00 ? 2  HIS A ND1  1  
ATOM 20    C CD2  . HIS A 1 2  ? 7.954   -1.261  -6.385  1.00 0.00 ? 2  HIS A CD2  1  
ATOM 21    C CE1  . HIS A 1 2  ? 10.111  -0.887  -6.519  1.00 0.00 ? 2  HIS A CE1  1  
ATOM 22    N NE2  . HIS A 1 2  ? 8.929   -0.444  -6.905  1.00 0.00 ? 2  HIS A NE2  1  
ATOM 23    H H    . HIS A 1 2  ? 10.012  -2.615  -3.481  1.00 0.00 ? 2  HIS A H    1  
ATOM 24    H HA   . HIS A 1 2  ? 7.194   -2.382  -3.177  1.00 0.00 ? 2  HIS A HA   1  
ATOM 25    H HB2  . HIS A 1 2  ? 8.656   -4.231  -5.068  1.00 0.00 ? 2  HIS A HB2  1  
ATOM 26    H HB3  . HIS A 1 2  ? 7.032   -3.579  -5.251  1.00 0.00 ? 2  HIS A HB3  1  
ATOM 27    H HD1  . HIS A 1 2  ? 10.647  -2.485  -5.358  1.00 0.00 ? 2  HIS A HD1  1  
ATOM 28    H HD2  . HIS A 1 2  ? 6.888   -1.157  -6.527  1.00 0.00 ? 2  HIS A HD2  1  
ATOM 29    H HE1  . HIS A 1 2  ? 11.064  -0.449  -6.773  1.00 0.00 ? 2  HIS A HE1  1  
ATOM 30    H HE2  . HIS A 1 2  ? 8.772   0.389   -7.396  1.00 0.00 ? 2  HIS A HE2  1  
ATOM 31    N N    . MET A 1 3  ? 7.006   -4.251  -1.474  1.00 0.00 ? 3  MET A N    1  
ATOM 32    C CA   . MET A 1 3  ? 6.643   -5.399  -0.640  1.00 0.00 ? 3  MET A CA   1  
ATOM 33    C C    . MET A 1 3  ? 5.364   -6.090  -1.118  1.00 0.00 ? 3  MET A C    1  
ATOM 34    O O    . MET A 1 3  ? 4.806   -5.747  -2.160  1.00 0.00 ? 3  MET A O    1  
ATOM 35    C CB   . MET A 1 3  ? 6.488   -4.962  0.819   1.00 0.00 ? 3  MET A CB   1  
ATOM 36    C CG   . MET A 1 3  ? 7.657   -5.375  1.698   1.00 0.00 ? 3  MET A CG   1  
ATOM 37    S SD   . MET A 1 3  ? 7.575   -4.661  3.349   1.00 0.00 ? 3  MET A SD   1  
ATOM 38    C CE   . MET A 1 3  ? 7.781   -6.125  4.360   1.00 0.00 ? 3  MET A CE   1  
ATOM 39    H H    . MET A 1 3  ? 6.811   -3.339  -1.156  1.00 0.00 ? 3  MET A H    1  
ATOM 40    H HA   . MET A 1 3  ? 7.453   -6.109  -0.698  1.00 0.00 ? 3  MET A HA   1  
ATOM 41    H HB2  . MET A 1 3  ? 6.399   -3.886  0.854   1.00 0.00 ? 3  MET A HB2  1  
ATOM 42    H HB3  . MET A 1 3  ? 5.589   -5.404  1.224   1.00 0.00 ? 3  MET A HB3  1  
ATOM 43    H HG2  . MET A 1 3  ? 7.659   -6.451  1.787   1.00 0.00 ? 3  MET A HG2  1  
ATOM 44    H HG3  . MET A 1 3  ? 8.575   -5.054  1.226   1.00 0.00 ? 3  MET A HG3  1  
ATOM 45    H HE1  . MET A 1 3  ? 8.712   -6.609  4.105   1.00 0.00 ? 3  MET A HE1  1  
ATOM 46    H HE2  . MET A 1 3  ? 6.961   -6.803  4.182   1.00 0.00 ? 3  MET A HE2  1  
ATOM 47    H HE3  . MET A 1 3  ? 7.796   -5.843  5.402   1.00 0.00 ? 3  MET A HE3  1  
ATOM 48    N N    . ASP A 1 4  ? 4.917   -7.078  -0.334  1.00 0.00 ? 4  ASP A N    1  
ATOM 49    C CA   . ASP A 1 4  ? 3.711   -7.854  -0.640  1.00 0.00 ? 4  ASP A CA   1  
ATOM 50    C C    . ASP A 1 4  ? 2.582   -6.962  -1.147  1.00 0.00 ? 4  ASP A C    1  
ATOM 51    O O    . ASP A 1 4  ? 2.072   -6.117  -0.413  1.00 0.00 ? 4  ASP A O    1  
ATOM 52    C CB   . ASP A 1 4  ? 3.252   -8.612  0.607   1.00 0.00 ? 4  ASP A CB   1  
ATOM 53    C CG   . ASP A 1 4  ? 2.742   -10.004 0.284   1.00 0.00 ? 4  ASP A CG   1  
ATOM 54    O OD1  . ASP A 1 4  ? 3.484   -10.771 -0.364  1.00 0.00 ? 4  ASP A OD1  1  
ATOM 55    O OD2  . ASP A 1 4  ? 1.601   -10.325 0.678   1.00 0.00 ? 4  ASP A OD2  1  
ATOM 56    H H    . ASP A 1 4  ? 5.421   -7.296  0.478   1.00 0.00 ? 4  ASP A H    1  
ATOM 57    H HA   . ASP A 1 4  ? 3.963   -8.568  -1.410  1.00 0.00 ? 4  ASP A HA   1  
ATOM 58    H HB2  . ASP A 1 4  ? 4.082   -8.702  1.293   1.00 0.00 ? 4  ASP A HB2  1  
ATOM 59    H HB3  . ASP A 1 4  ? 2.456   -8.058  1.086   1.00 0.00 ? 4  ASP A HB3  1  
ATOM 60    N N    . CYS A 1 5  ? 2.201   -7.148  -2.411  1.00 0.00 ? 5  CYS A N    1  
ATOM 61    C CA   . CYS A 1 5  ? 1.143   -6.343  -3.015  1.00 0.00 ? 5  CYS A CA   1  
ATOM 62    C C    . CYS A 1 5  ? -0.107  -7.163  -3.327  1.00 0.00 ? 5  CYS A C    1  
ATOM 63    O O    . CYS A 1 5  ? -0.029  -8.366  -3.575  1.00 0.00 ? 5  CYS A O    1  
ATOM 64    C CB   . CYS A 1 5  ? 1.661   -5.681  -4.296  1.00 0.00 ? 5  CYS A CB   1  
ATOM 65    S SG   . CYS A 1 5  ? 1.911   -3.883  -4.161  1.00 0.00 ? 5  CYS A SG   1  
ATOM 66    H H    . CYS A 1 5  ? 2.650   -7.833  -2.951  1.00 0.00 ? 5  CYS A H    1  
ATOM 67    H HA   . CYS A 1 5  ? 0.881   -5.577  -2.308  1.00 0.00 ? 5  CYS A HA   1  
ATOM 68    H HB2  . CYS A 1 5  ? 2.609   -6.123  -4.561  1.00 0.00 ? 5  CYS A HB2  1  
ATOM 69    H HB3  . CYS A 1 5  ? 0.954   -5.855  -5.096  1.00 0.00 ? 5  CYS A HB3  1  
ATOM 70    N N    . THR A 1 6  ? -1.266  -6.493  -3.322  1.00 0.00 ? 6  THR A N    1  
ATOM 71    C CA   . THR A 1 6  ? -2.533  -7.148  -3.613  1.00 0.00 ? 6  THR A CA   1  
ATOM 72    C C    . THR A 1 6  ? -2.594  -7.632  -5.075  1.00 0.00 ? 6  THR A C    1  
ATOM 73    O O    . THR A 1 6  ? -3.512  -8.364  -5.427  1.00 0.00 ? 6  THR A O    1  
ATOM 74    C CB   . THR A 1 6  ? -3.685  -6.176  -3.357  1.00 0.00 ? 6  THR A CB   1  
ATOM 75    O OG1  . THR A 1 6  ? -3.367  -5.295  -2.296  1.00 0.00 ? 6  THR A OG1  1  
ATOM 76    C CG2  . THR A 1 6  ? -4.984  -6.867  -3.005  1.00 0.00 ? 6  THR A CG2  1  
ATOM 77    H H    . THR A 1 6  ? -1.270  -5.526  -3.119  1.00 0.00 ? 6  THR A H    1  
ATOM 78    H HA   . THR A 1 6  ? -2.647  -8.002  -2.934  1.00 0.00 ? 6  THR A HA   1  
ATOM 79    H HB   . THR A 1 6  ? -3.852  -5.589  -4.249  1.00 0.00 ? 6  THR A HB   1  
ATOM 80    H HG1  . THR A 1 6  ? -2.975  -5.791  -1.573  1.00 0.00 ? 6  THR A HG1  1  
ATOM 81    H HG21 . THR A 1 6  ? -4.842  -7.469  -2.120  1.00 0.00 ? 6  THR A HG21 1  
ATOM 82    H HG22 . THR A 1 6  ? -5.290  -7.499  -3.826  1.00 0.00 ? 6  THR A HG22 1  
ATOM 83    H HG23 . THR A 1 6  ? -5.747  -6.125  -2.818  1.00 0.00 ? 6  THR A HG23 1  
ATOM 84    N N    . GLU A 1 7  ? -1.639  -7.204  -5.938  1.00 0.00 ? 7  GLU A N    1  
ATOM 85    C CA   . GLU A 1 7  ? -1.637  -7.597  -7.352  1.00 0.00 ? 7  GLU A CA   1  
ATOM 86    C C    . GLU A 1 7  ? -1.976  -9.077  -7.562  1.00 0.00 ? 7  GLU A C    1  
ATOM 87    O O    . GLU A 1 7  ? -1.094  -9.895  -7.825  1.00 0.00 ? 7  GLU A O    1  
ATOM 88    C CB   . GLU A 1 7  ? -0.274  -7.290  -7.974  1.00 0.00 ? 7  GLU A CB   1  
ATOM 89    C CG   . GLU A 1 7  ? 0.894   -7.883  -7.202  1.00 0.00 ? 7  GLU A CG   1  
ATOM 90    C CD   . GLU A 1 7  ? 1.921   -8.539  -8.105  1.00 0.00 ? 7  GLU A CD   1  
ATOM 91    O OE1  . GLU A 1 7  ? 2.534   -7.823  -8.925  1.00 0.00 ? 7  GLU A OE1  1  
ATOM 92    O OE2  . GLU A 1 7  ? 2.114   -9.768  -7.990  1.00 0.00 ? 7  GLU A OE2  1  
ATOM 93    H H    . GLU A 1 7  ? -0.928  -6.592  -5.633  1.00 0.00 ? 7  GLU A H    1  
ATOM 94    H HA   . GLU A 1 7  ? -2.384  -7.001  -7.854  1.00 0.00 ? 7  GLU A HA   1  
ATOM 95    H HB2  . GLU A 1 7  ? -0.253  -7.685  -8.979  1.00 0.00 ? 7  GLU A HB2  1  
ATOM 96    H HB3  . GLU A 1 7  ? -0.144  -6.219  -8.015  1.00 0.00 ? 7  GLU A HB3  1  
ATOM 97    H HG2  . GLU A 1 7  ? 1.379   -7.095  -6.646  1.00 0.00 ? 7  GLU A HG2  1  
ATOM 98    H HG3  . GLU A 1 7  ? 0.514   -8.626  -6.515  1.00 0.00 ? 7  GLU A HG3  1  
ATOM 99    N N    . PHE A 1 8  ? -3.261  -9.402  -7.475  1.00 0.00 ? 8  PHE A N    1  
ATOM 100   C CA   . PHE A 1 8  ? -3.736  -10.765 -7.683  1.00 0.00 ? 8  PHE A CA   1  
ATOM 101   C C    . PHE A 1 8  ? -5.235  -10.752 -7.994  1.00 0.00 ? 8  PHE A C    1  
ATOM 102   O O    . PHE A 1 8  ? -5.725  -9.810  -8.619  1.00 0.00 ? 8  PHE A O    1  
ATOM 103   C CB   . PHE A 1 8  ? -3.400  -11.665 -6.481  1.00 0.00 ? 8  PHE A CB   1  
ATOM 104   C CG   . PHE A 1 8  ? -3.667  -11.051 -5.136  1.00 0.00 ? 8  PHE A CG   1  
ATOM 105   C CD1  . PHE A 1 8  ? -4.911  -10.533 -4.821  1.00 0.00 ? 8  PHE A CD1  1  
ATOM 106   C CD2  . PHE A 1 8  ? -2.665  -11.009 -4.178  1.00 0.00 ? 8  PHE A CD2  1  
ATOM 107   C CE1  . PHE A 1 8  ? -5.150  -9.982  -3.576  1.00 0.00 ? 8  PHE A CE1  1  
ATOM 108   C CE2  . PHE A 1 8  ? -2.900  -10.458 -2.933  1.00 0.00 ? 8  PHE A CE2  1  
ATOM 109   C CZ   . PHE A 1 8  ? -4.144  -9.944  -2.632  1.00 0.00 ? 8  PHE A CZ   1  
ATOM 110   H H    . PHE A 1 8  ? -3.915  -8.697  -7.284  1.00 0.00 ? 8  PHE A H    1  
ATOM 111   H HA   . PHE A 1 8  ? -3.224  -11.153 -8.552  1.00 0.00 ? 8  PHE A HA   1  
ATOM 112   H HB2  . PHE A 1 8  ? -3.977  -12.572 -6.545  1.00 0.00 ? 8  PHE A HB2  1  
ATOM 113   H HB3  . PHE A 1 8  ? -2.351  -11.917 -6.523  1.00 0.00 ? 8  PHE A HB3  1  
ATOM 114   H HD1  . PHE A 1 8  ? -5.699  -10.560 -5.558  1.00 0.00 ? 8  PHE A HD1  1  
ATOM 115   H HD2  . PHE A 1 8  ? -1.691  -11.410 -4.412  1.00 0.00 ? 8  PHE A HD2  1  
ATOM 116   H HE1  . PHE A 1 8  ? -6.122  -9.581  -3.341  1.00 0.00 ? 8  PHE A HE1  1  
ATOM 117   H HE2  . PHE A 1 8  ? -2.109  -10.431 -2.197  1.00 0.00 ? 8  PHE A HE2  1  
ATOM 118   H HZ   . PHE A 1 8  ? -4.330  -9.514  -1.659  1.00 0.00 ? 8  PHE A HZ   1  
ATOM 119   N N    . ASN A 1 9  ? -5.964  -11.785 -7.585  1.00 0.00 ? 9  ASN A N    1  
ATOM 120   C CA   . ASN A 1 9  ? -7.393  -11.847 -7.862  1.00 0.00 ? 9  ASN A CA   1  
ATOM 121   C C    . ASN A 1 9  ? -8.168  -10.793 -7.062  1.00 0.00 ? 9  ASN A C    1  
ATOM 122   O O    . ASN A 1 9  ? -8.655  -9.822  -7.639  1.00 0.00 ? 9  ASN A O    1  
ATOM 123   C CB   . ASN A 1 9  ? -7.931  -13.255 -7.585  1.00 0.00 ? 9  ASN A CB   1  
ATOM 124   C CG   . ASN A 1 9  ? -7.550  -14.247 -8.667  1.00 0.00 ? 9  ASN A CG   1  
ATOM 125   O OD1  . ASN A 1 9  ? -7.188  -15.388 -8.376  1.00 0.00 ? 9  ASN A OD1  1  
ATOM 126   N ND2  . ASN A 1 9  ? -7.626  -13.821 -9.920  1.00 0.00 ? 9  ASN A ND2  1  
ATOM 127   H H    . ASN A 1 9  ? -5.537  -12.521 -7.110  1.00 0.00 ? 9  ASN A H    1  
ATOM 128   H HA   . ASN A 1 9  ? -7.522  -11.630 -8.911  1.00 0.00 ? 9  ASN A HA   1  
ATOM 129   H HB2  . ASN A 1 9  ? -7.525  -13.611 -6.652  1.00 0.00 ? 9  ASN A HB2  1  
ATOM 130   H HB3  . ASN A 1 9  ? -9.007  -13.217 -7.517  1.00 0.00 ? 9  ASN A HB3  1  
ATOM 131   H HD21 . ASN A 1 9  ? -7.924  -12.902 -10.081 1.00 0.00 ? 9  ASN A HD21 1  
ATOM 132   H HD22 . ASN A 1 9  ? -7.379  -14.442 -10.635 1.00 0.00 ? 9  ASN A HD22 1  
ATOM 133   N N    . PRO A 1 10 ? -8.306  -10.952 -5.730  1.00 0.00 ? 10 PRO A N    1  
ATOM 134   C CA   . PRO A 1 10 ? -9.038  -9.984  -4.906  1.00 0.00 ? 10 PRO A CA   1  
ATOM 135   C C    . PRO A 1 10 ? -8.252  -8.696  -4.667  1.00 0.00 ? 10 PRO A C    1  
ATOM 136   O O    . PRO A 1 10 ? -7.826  -8.417  -3.548  1.00 0.00 ? 10 PRO A O    1  
ATOM 137   C CB   . PRO A 1 10 ? -9.247  -10.734 -3.591  1.00 0.00 ? 10 PRO A CB   1  
ATOM 138   C CG   . PRO A 1 10 ? -8.089  -11.668 -3.507  1.00 0.00 ? 10 PRO A CG   1  
ATOM 139   C CD   . PRO A 1 10 ? -7.779  -12.072 -4.924  1.00 0.00 ? 10 PRO A CD   1  
ATOM 140   H HA   . PRO A 1 10 ? -9.994  -9.740  -5.342  1.00 0.00 ? 10 PRO A HA   1  
ATOM 141   H HB2  . PRO A 1 10 ? -9.251  -10.033 -2.769  1.00 0.00 ? 10 PRO A HB2  1  
ATOM 142   H HB3  . PRO A 1 10 ? -10.184 -11.270 -3.622  1.00 0.00 ? 10 PRO A HB3  1  
ATOM 143   H HG2  . PRO A 1 10 ? -7.244  -11.166 -3.066  1.00 0.00 ? 10 PRO A HG2  1  
ATOM 144   H HG3  . PRO A 1 10 ? -8.360  -12.534 -2.923  1.00 0.00 ? 10 PRO A HG3  1  
ATOM 145   H HD2  . PRO A 1 10 ? -6.714  -12.182 -5.061  1.00 0.00 ? 10 PRO A HD2  1  
ATOM 146   H HD3  . PRO A 1 10 ? -8.289  -12.992 -5.166  1.00 0.00 ? 10 PRO A HD3  1  
ATOM 147   N N    . LEU A 1 11 ? -8.075  -7.907  -5.726  1.00 0.00 ? 11 LEU A N    1  
ATOM 148   C CA   . LEU A 1 11 ? -7.346  -6.639  -5.631  1.00 0.00 ? 11 LEU A CA   1  
ATOM 149   C C    . LEU A 1 11 ? -7.826  -5.821  -4.448  1.00 0.00 ? 11 LEU A C    1  
ATOM 150   O O    . LEU A 1 11 ? -8.801  -6.194  -3.806  1.00 0.00 ? 11 LEU A O    1  
ATOM 151   C CB   . LEU A 1 11 ? -7.475  -5.837  -6.932  1.00 0.00 ? 11 LEU A CB   1  
ATOM 152   C CG   . LEU A 1 11 ? -8.862  -5.245  -7.218  1.00 0.00 ? 11 LEU A CG   1  
ATOM 153   C CD1  . LEU A 1 11 ? -9.955  -6.283  -7.008  1.00 0.00 ? 11 LEU A CD1  1  
ATOM 154   C CD2  . LEU A 1 11 ? -9.112  -4.022  -6.349  1.00 0.00 ? 11 LEU A CD2  1  
ATOM 155   H H    . LEU A 1 11 ? -8.445  -8.182  -6.590  1.00 0.00 ? 11 LEU A H    1  
ATOM 156   H HA   . LEU A 1 11 ? -6.311  -6.871  -5.461  1.00 0.00 ? 11 LEU A HA   1  
ATOM 157   H HB2  . LEU A 1 11 ? -6.763  -5.026  -6.901  1.00 0.00 ? 11 LEU A HB2  1  
ATOM 158   H HB3  . LEU A 1 11 ? -7.214  -6.488  -7.754  1.00 0.00 ? 11 LEU A HB3  1  
ATOM 159   H HG   . LEU A 1 11 ? -8.901  -4.931  -8.252  1.00 0.00 ? 11 LEU A HG   1  
ATOM 160   H HD11 . LEU A 1 11 ? -9.751  -7.149  -7.619  1.00 0.00 ? 11 LEU A HD11 1  
ATOM 161   H HD12 . LEU A 1 11 ? -10.909 -5.862  -7.286  1.00 0.00 ? 11 LEU A HD12 1  
ATOM 162   H HD13 . LEU A 1 11 ? -9.980  -6.574  -5.968  1.00 0.00 ? 11 LEU A HD13 1  
ATOM 163   H HD21 . LEU A 1 11 ? -9.571  -4.329  -5.421  1.00 0.00 ? 11 LEU A HD21 1  
ATOM 164   H HD22 . LEU A 1 11 ? -9.770  -3.340  -6.868  1.00 0.00 ? 11 LEU A HD22 1  
ATOM 165   H HD23 . LEU A 1 11 ? -8.174  -3.529  -6.141  1.00 0.00 ? 11 LEU A HD23 1  
ATOM 166   N N    . CYS A 1 12 ? -7.115  -4.721  -4.150  1.00 0.00 ? 12 CYS A N    1  
ATOM 167   C CA   . CYS A 1 12 ? -7.438  -3.854  -3.017  1.00 0.00 ? 12 CYS A CA   1  
ATOM 168   C C    . CYS A 1 12 ? -8.916  -3.875  -2.653  1.00 0.00 ? 12 CYS A C    1  
ATOM 169   O O    . CYS A 1 12 ? -9.614  -2.863  -2.693  1.00 0.00 ? 12 CYS A O    1  
ATOM 170   C CB   . CYS A 1 12 ? -6.962  -2.429  -3.274  1.00 0.00 ? 12 CYS A CB   1  
ATOM 171   S SG   . CYS A 1 12 ? -8.031  -1.442  -4.380  1.00 0.00 ? 12 CYS A SG   1  
ATOM 172   H H    . CYS A 1 12 ? -6.331  -4.495  -4.697  1.00 0.00 ? 12 CYS A H    1  
ATOM 173   H HA   . CYS A 1 12 ? -6.894  -4.236  -2.170  1.00 0.00 ? 12 CYS A HA   1  
ATOM 174   H HB2  . CYS A 1 12 ? -6.898  -1.914  -2.331  1.00 0.00 ? 12 CYS A HB2  1  
ATOM 175   H HB3  . CYS A 1 12 ? -5.977  -2.471  -3.715  1.00 0.00 ? 12 CYS A HB3  1  
ATOM 176   N N    . ARG A 1 13 ? -9.362  -5.046  -2.255  1.00 0.00 ? 13 ARG A N    1  
ATOM 177   C CA   . ARG A 1 13 ? -10.743 -5.240  -1.829  1.00 0.00 ? 13 ARG A CA   1  
ATOM 178   C C    . ARG A 1 13 ? -10.810 -5.043  -0.325  1.00 0.00 ? 13 ARG A C    1  
ATOM 179   O O    . ARG A 1 13 ? -11.457 -5.802  0.395   1.00 0.00 ? 13 ARG A O    1  
ATOM 180   C CB   . ARG A 1 13 ? -11.240 -6.638  -2.213  1.00 0.00 ? 13 ARG A CB   1  
ATOM 181   C CG   . ARG A 1 13 ? -12.422 -6.625  -3.171  1.00 0.00 ? 13 ARG A CG   1  
ATOM 182   C CD   . ARG A 1 13 ? -13.596 -5.848  -2.599  1.00 0.00 ? 13 ARG A CD   1  
ATOM 183   N NE   . ARG A 1 13 ? -13.996 -6.344  -1.284  1.00 0.00 ? 13 ARG A NE   1  
ATOM 184   C CZ   . ARG A 1 13 ? -14.750 -7.424  -1.097  1.00 0.00 ? 13 ARG A CZ   1  
ATOM 185   N NH1  . ARG A 1 13 ? -15.181 -8.130  -2.136  1.00 0.00 ? 13 ARG A NH1  1  
ATOM 186   N NH2  . ARG A 1 13 ? -15.074 -7.801  0.131   1.00 0.00 ? 13 ARG A NH2  1  
ATOM 187   H H    . ARG A 1 13 ? -8.727  -5.800  -2.224  1.00 0.00 ? 13 ARG A H    1  
ATOM 188   H HA   . ARG A 1 13 ? -11.353 -4.492  -2.314  1.00 0.00 ? 13 ARG A HA   1  
ATOM 189   H HB2  . ARG A 1 13 ? -10.432 -7.178  -2.683  1.00 0.00 ? 13 ARG A HB2  1  
ATOM 190   H HB3  . ARG A 1 13 ? -11.537 -7.163  -1.319  1.00 0.00 ? 13 ARG A HB3  1  
ATOM 191   H HG2  . ARG A 1 13 ? -12.116 -6.165  -4.099  1.00 0.00 ? 13 ARG A HG2  1  
ATOM 192   H HG3  . ARG A 1 13 ? -12.732 -7.643  -3.357  1.00 0.00 ? 13 ARG A HG3  1  
ATOM 193   H HD2  . ARG A 1 13 ? -13.316 -4.809  -2.511  1.00 0.00 ? 13 ARG A HD2  1  
ATOM 194   H HD3  . ARG A 1 13 ? -14.434 -5.937  -3.276  1.00 0.00 ? 13 ARG A HD3  1  
ATOM 195   H HE   . ARG A 1 13 ? -13.688 -5.844  -0.499  1.00 0.00 ? 13 ARG A HE   1  
ATOM 196   H HH11 . ARG A 1 13 ? -14.940 -7.852  -3.066  1.00 0.00 ? 13 ARG A HH11 1  
ATOM 197   H HH12 . ARG A 1 13 ? -15.746 -8.942  -1.988  1.00 0.00 ? 13 ARG A HH12 1  
ATOM 198   H HH21 . ARG A 1 13 ? -14.752 -7.274  0.918   1.00 0.00 ? 13 ARG A HH21 1  
ATOM 199   H HH22 . ARG A 1 13 ? -15.640 -8.614  0.273   1.00 0.00 ? 13 ARG A HH22 1  
ATOM 200   N N    . CYS A 1 14 ? -10.090 -4.028  0.136   1.00 0.00 ? 14 CYS A N    1  
ATOM 201   C CA   . CYS A 1 14 ? -10.002 -3.721  1.548   1.00 0.00 ? 14 CYS A CA   1  
ATOM 202   C C    . CYS A 1 14 ? -10.016 -2.213  1.781   1.00 0.00 ? 14 CYS A C    1  
ATOM 203   O O    . CYS A 1 14 ? -9.062  -1.514  1.438   1.00 0.00 ? 14 CYS A O    1  
ATOM 204   C CB   . CYS A 1 14 ? -8.714  -4.332  2.115   1.00 0.00 ? 14 CYS A CB   1  
ATOM 205   S SG   . CYS A 1 14 ? -7.523  -4.912  0.856   1.00 0.00 ? 14 CYS A SG   1  
ATOM 206   H H    . CYS A 1 14 ? -9.578  -3.485  -0.494  1.00 0.00 ? 14 CYS A H    1  
ATOM 207   H HA   . CYS A 1 14 ? -10.851 -4.165  2.044   1.00 0.00 ? 14 CYS A HA   1  
ATOM 208   H HB2  . CYS A 1 14 ? -8.210  -3.598  2.717   1.00 0.00 ? 14 CYS A HB2  1  
ATOM 209   H HB3  . CYS A 1 14 ? -8.973  -5.181  2.729   1.00 0.00 ? 14 CYS A HB3  1  
ATOM 210   N N    . ASN A 1 15 ? -11.102 -1.715  2.366   1.00 0.00 ? 15 ASN A N    1  
ATOM 211   C CA   . ASN A 1 15 ? -11.231 -0.288  2.639   1.00 0.00 ? 15 ASN A CA   1  
ATOM 212   C C    . ASN A 1 15 ? -10.943 0.015   4.099   1.00 0.00 ? 15 ASN A C    1  
ATOM 213   O O    . ASN A 1 15 ? -10.164 0.912   4.399   1.00 0.00 ? 15 ASN A O    1  
ATOM 214   C CB   . ASN A 1 15 ? -12.633 0.203   2.289   1.00 0.00 ? 15 ASN A CB   1  
ATOM 215   C CG   . ASN A 1 15 ? -12.621 1.277   1.219   1.00 0.00 ? 15 ASN A CG   1  
ATOM 216   O OD1  . ASN A 1 15 ? -13.348 1.192   0.230   1.00 0.00 ? 15 ASN A OD1  1  
ATOM 217   N ND2  . ASN A 1 15 ? -11.792 2.296   1.413   1.00 0.00 ? 15 ASN A ND2  1  
ATOM 218   H H    . ASN A 1 15 ? -11.830 -2.320  2.616   1.00 0.00 ? 15 ASN A H    1  
ATOM 219   H HA   . ASN A 1 15 ? -10.513 0.234   2.028   1.00 0.00 ? 15 ASN A HA   1  
ATOM 220   H HB2  . ASN A 1 15 ? -13.218 -0.625  1.940   1.00 0.00 ? 15 ASN A HB2  1  
ATOM 221   H HB3  . ASN A 1 15 ? -13.097 0.613   3.176   1.00 0.00 ? 15 ASN A HB3  1  
ATOM 222   H HD21 . ASN A 1 15 ? -11.242 2.297   2.225   1.00 0.00 ? 15 ASN A HD21 1  
ATOM 223   H HD22 . ASN A 1 15 ? -11.763 3.005   0.737   1.00 0.00 ? 15 ASN A HD22 1  
ATOM 224   N N    . LYS A 1 16 ? -11.602 -0.739  4.987   1.00 0.00 ? 16 LYS A N    1  
ATOM 225   C CA   . LYS A 1 16 ? -11.476 -0.594  6.447   1.00 0.00 ? 16 LYS A CA   1  
ATOM 226   C C    . LYS A 1 16 ? -10.196 0.125   6.861   1.00 0.00 ? 16 LYS A C    1  
ATOM 227   O O    . LYS A 1 16 ? -9.381  -0.407  7.615   1.00 0.00 ? 16 LYS A O    1  
ATOM 228   C CB   . LYS A 1 16 ? -11.536 -1.970  7.116   1.00 0.00 ? 16 LYS A CB   1  
ATOM 229   C CG   . LYS A 1 16 ? -10.331 -2.850  6.818   1.00 0.00 ? 16 LYS A CG   1  
ATOM 230   C CD   . LYS A 1 16 ? -10.677 -3.966  5.842   1.00 0.00 ? 16 LYS A CD   1  
ATOM 231   C CE   . LYS A 1 16 ? -11.785 -4.859  6.379   1.00 0.00 ? 16 LYS A CE   1  
ATOM 232   N NZ   . LYS A 1 16 ? -11.588 -5.192  7.818   1.00 0.00 ? 16 LYS A NZ   1  
ATOM 233   H H    . LYS A 1 16 ? -12.211 -1.413  4.646   1.00 0.00 ? 16 LYS A H    1  
ATOM 234   H HA   . LYS A 1 16 ? -12.318 -0.012  6.788   1.00 0.00 ? 16 LYS A HA   1  
ATOM 235   H HB2  . LYS A 1 16 ? -11.596 -1.833  8.187   1.00 0.00 ? 16 LYS A HB2  1  
ATOM 236   H HB3  . LYS A 1 16 ? -12.423 -2.482  6.779   1.00 0.00 ? 16 LYS A HB3  1  
ATOM 237   H HG2  . LYS A 1 16 ? -9.549  -2.241  6.388   1.00 0.00 ? 16 LYS A HG2  1  
ATOM 238   H HG3  . LYS A 1 16 ? -9.980  -3.287  7.741   1.00 0.00 ? 16 LYS A HG3  1  
ATOM 239   H HD2  . LYS A 1 16 ? -11.003 -3.528  4.911   1.00 0.00 ? 16 LYS A HD2  1  
ATOM 240   H HD3  . LYS A 1 16 ? -9.795  -4.566  5.670   1.00 0.00 ? 16 LYS A HD3  1  
ATOM 241   H HE2  . LYS A 1 16 ? -12.729 -4.349  6.264   1.00 0.00 ? 16 LYS A HE2  1  
ATOM 242   H HE3  . LYS A 1 16 ? -11.800 -5.774  5.805   1.00 0.00 ? 16 LYS A HE3  1  
ATOM 243   H HZ1  . LYS A 1 16 ? -11.644 -4.329  8.395   1.00 0.00 ? 16 LYS A HZ1  1  
ATOM 244   H HZ2  . LYS A 1 16 ? -10.656 -5.631  7.960   1.00 0.00 ? 16 LYS A HZ2  1  
ATOM 245   H HZ3  . LYS A 1 16 ? -12.324 -5.857  8.134   1.00 0.00 ? 16 LYS A HZ3  1  
ATOM 246   N N    . MET A 1 17 ? -10.031 1.334   6.354   1.00 0.00 ? 17 MET A N    1  
ATOM 247   C CA   . MET A 1 17 ? -8.849  2.133   6.656   1.00 0.00 ? 17 MET A CA   1  
ATOM 248   C C    . MET A 1 17 ? -8.792  2.505   8.129   1.00 0.00 ? 17 MET A C    1  
ATOM 249   O O    . MET A 1 17 ? -9.114  3.628   8.517   1.00 0.00 ? 17 MET A O    1  
ATOM 250   C CB   . MET A 1 17 ? -8.797  3.395   5.804   1.00 0.00 ? 17 MET A CB   1  
ATOM 251   C CG   . MET A 1 17 ? -10.156 3.938   5.372   1.00 0.00 ? 17 MET A CG   1  
ATOM 252   S SD   . MET A 1 17 ? -11.327 4.079   6.737   1.00 0.00 ? 17 MET A SD   1  
ATOM 253   C CE   . MET A 1 17 ? -12.086 5.659   6.370   1.00 0.00 ? 17 MET A CE   1  
ATOM 254   H H    . MET A 1 17 ? -10.718 1.688   5.746   1.00 0.00 ? 17 MET A H    1  
ATOM 255   H HA   . MET A 1 17 ? -7.985  1.528   6.426   1.00 0.00 ? 17 MET A HA   1  
ATOM 256   H HB2  . MET A 1 17 ? -8.294  4.161   6.369   1.00 0.00 ? 17 MET A HB2  1  
ATOM 257   H HB3  . MET A 1 17 ? -8.223  3.177   4.919   1.00 0.00 ? 17 MET A HB3  1  
ATOM 258   H HG2  . MET A 1 17 ? -10.013 4.916   4.940   1.00 0.00 ? 17 MET A HG2  1  
ATOM 259   H HG3  . MET A 1 17 ? -10.571 3.276   4.626   1.00 0.00 ? 17 MET A HG3  1  
ATOM 260   H HE1  . MET A 1 17 ? -11.350 6.443   6.464   1.00 0.00 ? 17 MET A HE1  1  
ATOM 261   H HE2  . MET A 1 17 ? -12.894 5.840   7.064   1.00 0.00 ? 17 MET A HE2  1  
ATOM 262   H HE3  . MET A 1 17 ? -12.472 5.648   5.362   1.00 0.00 ? 17 MET A HE3  1  
ATOM 263   N N    . LEU A 1 18 ? -8.371  1.553   8.935   1.00 0.00 ? 18 LEU A N    1  
ATOM 264   C CA   . LEU A 1 18 ? -8.254  1.755   10.371  1.00 0.00 ? 18 LEU A CA   1  
ATOM 265   C C    . LEU A 1 18 ? -7.539  0.585   11.036  1.00 0.00 ? 18 LEU A C    1  
ATOM 266   O O    . LEU A 1 18 ? -8.092  -0.077  11.914  1.00 0.00 ? 18 LEU A O    1  
ATOM 267   C CB   . LEU A 1 18 ? -9.639  1.949   10.987  1.00 0.00 ? 18 LEU A CB   1  
ATOM 268   C CG   . LEU A 1 18 ? -10.529 0.702   10.987  1.00 0.00 ? 18 LEU A CG   1  
ATOM 269   C CD1  . LEU A 1 18 ? -10.766 0.213   12.408  1.00 0.00 ? 18 LEU A CD1  1  
ATOM 270   C CD2  . LEU A 1 18 ? -11.853 0.990   10.295  1.00 0.00 ? 18 LEU A CD2  1  
ATOM 271   H H    . LEU A 1 18 ? -8.126  0.693   8.550   1.00 0.00 ? 18 LEU A H    1  
ATOM 272   H HA   . LEU A 1 18 ? -7.670  2.647   10.529  1.00 0.00 ? 18 LEU A HA   1  
ATOM 273   H HB2  . LEU A 1 18 ? -9.510  2.278   12.007  1.00 0.00 ? 18 LEU A HB2  1  
ATOM 274   H HB3  . LEU A 1 18 ? -10.146 2.726   10.435  1.00 0.00 ? 18 LEU A HB3  1  
ATOM 275   H HG   . LEU A 1 18 ? -10.030 -0.086  10.443  1.00 0.00 ? 18 LEU A HG   1  
ATOM 276   H HD11 . LEU A 1 18 ? -9.969  0.562   13.047  1.00 0.00 ? 18 LEU A HD11 1  
ATOM 277   H HD12 . LEU A 1 18 ? -10.789 -0.866  12.418  1.00 0.00 ? 18 LEU A HD12 1  
ATOM 278   H HD13 . LEU A 1 18 ? -11.710 0.597   12.768  1.00 0.00 ? 18 LEU A HD13 1  
ATOM 279   H HD21 . LEU A 1 18 ? -12.640 0.428   10.777  1.00 0.00 ? 18 LEU A HD21 1  
ATOM 280   H HD22 . LEU A 1 18 ? -11.787 0.699   9.257   1.00 0.00 ? 18 LEU A HD22 1  
ATOM 281   H HD23 . LEU A 1 18 ? -12.071 2.045   10.361  1.00 0.00 ? 18 LEU A HD23 1  
ATOM 282   N N    . GLY A 1 19 ? -6.307  0.334   10.614  1.00 0.00 ? 19 GLY A N    1  
ATOM 283   C CA   . GLY A 1 19 ? -5.547  -0.761  11.187  1.00 0.00 ? 19 GLY A CA   1  
ATOM 284   C C    . GLY A 1 19 ? -4.083  -0.750  10.788  1.00 0.00 ? 19 GLY A C    1  
ATOM 285   O O    . GLY A 1 19 ? -3.210  -0.492  11.617  1.00 0.00 ? 19 GLY A O    1  
ATOM 286   H H    . GLY A 1 19 ? -5.917  0.893   9.911   1.00 0.00 ? 19 GLY A H    1  
ATOM 287   H HA2  . GLY A 1 19 ? -5.612  -0.701  12.263  1.00 0.00 ? 19 GLY A HA2  1  
ATOM 288   H HA3  . GLY A 1 19 ? -5.987  -1.694  10.866  1.00 0.00 ? 19 GLY A HA3  1  
ATOM 289   N N    . ASP A 1 20 ? -3.812  -1.047  9.521   1.00 0.00 ? 20 ASP A N    1  
ATOM 290   C CA   . ASP A 1 20 ? -2.445  -1.087  9.018   1.00 0.00 ? 20 ASP A CA   1  
ATOM 291   C C    . ASP A 1 20 ? -1.706  0.216   9.295   1.00 0.00 ? 20 ASP A C    1  
ATOM 292   O O    . ASP A 1 20 ? -2.263  1.159   9.854   1.00 0.00 ? 20 ASP A O    1  
ATOM 293   C CB   . ASP A 1 20 ? -2.435  -1.377  7.517   1.00 0.00 ? 20 ASP A CB   1  
ATOM 294   C CG   . ASP A 1 20 ? -3.454  -2.426  7.112   1.00 0.00 ? 20 ASP A CG   1  
ATOM 295   O OD1  . ASP A 1 20 ? -4.605  -2.048  6.803   1.00 0.00 ? 20 ASP A OD1  1  
ATOM 296   O OD2  . ASP A 1 20 ? -3.102  -3.625  7.104   1.00 0.00 ? 20 ASP A OD2  1  
ATOM 297   H H    . ASP A 1 20 ? -4.548  -1.254  8.910   1.00 0.00 ? 20 ASP A H    1  
ATOM 298   H HA   . ASP A 1 20 ? -1.930  -1.886  9.527   1.00 0.00 ? 20 ASP A HA   1  
ATOM 299   H HB2  . ASP A 1 20 ? -2.647  -0.466  6.982   1.00 0.00 ? 20 ASP A HB2  1  
ATOM 300   H HB3  . ASP A 1 20 ? -1.456  -1.730  7.236   1.00 0.00 ? 20 ASP A HB3  1  
ATOM 301   N N    . LEU A 1 21 ? -0.440  0.247   8.899   1.00 0.00 ? 21 LEU A N    1  
ATOM 302   C CA   . LEU A 1 21 ? 0.408   1.413   9.090   1.00 0.00 ? 21 LEU A CA   1  
ATOM 303   C C    . LEU A 1 21 ? 1.712   1.229   8.326   1.00 0.00 ? 21 LEU A C    1  
ATOM 304   O O    . LEU A 1 21 ? 2.785   1.100   8.916   1.00 0.00 ? 21 LEU A O    1  
ATOM 305   C CB   . LEU A 1 21 ? 0.689   1.618   10.578  1.00 0.00 ? 21 LEU A CB   1  
ATOM 306   C CG   . LEU A 1 21 ? 1.571   2.822   10.923  1.00 0.00 ? 21 LEU A CG   1  
ATOM 307   C CD1  . LEU A 1 21 ? 1.232   4.013   10.037  1.00 0.00 ? 21 LEU A CD1  1  
ATOM 308   C CD2  . LEU A 1 21 ? 1.418   3.189   12.392  1.00 0.00 ? 21 LEU A CD2  1  
ATOM 309   H H    . LEU A 1 21 ? -0.062  -0.543  8.464   1.00 0.00 ? 21 LEU A H    1  
ATOM 310   H HA   . LEU A 1 21 ? -0.112  2.276   8.702   1.00 0.00 ? 21 LEU A HA   1  
ATOM 311   H HB2  . LEU A 1 21 ? -0.258  1.733   11.085  1.00 0.00 ? 21 LEU A HB2  1  
ATOM 312   H HB3  . LEU A 1 21 ? 1.171   0.727   10.953  1.00 0.00 ? 21 LEU A HB3  1  
ATOM 313   H HG   . LEU A 1 21 ? 2.605   2.563   10.749  1.00 0.00 ? 21 LEU A HG   1  
ATOM 314   H HD11 . LEU A 1 21 ? 1.766   3.927   9.101   1.00 0.00 ? 21 LEU A HD11 1  
ATOM 315   H HD12 . LEU A 1 21 ? 1.521   4.927   10.534  1.00 0.00 ? 21 LEU A HD12 1  
ATOM 316   H HD13 . LEU A 1 21 ? 0.169   4.027   9.844   1.00 0.00 ? 21 LEU A HD13 1  
ATOM 317   H HD21 . LEU A 1 21 ? 1.353   4.262   12.492  1.00 0.00 ? 21 LEU A HD21 1  
ATOM 318   H HD22 . LEU A 1 21 ? 2.273   2.826   12.944  1.00 0.00 ? 21 LEU A HD22 1  
ATOM 319   H HD23 . LEU A 1 21 ? 0.519   2.735   12.784  1.00 0.00 ? 21 LEU A HD23 1  
ATOM 320   N N    . ILE A 1 22 ? 1.601   1.197   7.004   1.00 0.00 ? 22 ILE A N    1  
ATOM 321   C CA   . ILE A 1 22 ? 2.754   1.002   6.136   1.00 0.00 ? 22 ILE A CA   1  
ATOM 322   C C    . ILE A 1 22 ? 3.548   2.285   5.950   1.00 0.00 ? 22 ILE A C    1  
ATOM 323   O O    . ILE A 1 22 ? 3.098   3.374   6.301   1.00 0.00 ? 22 ILE A O    1  
ATOM 324   C CB   . ILE A 1 22 ? 2.307   0.487   4.748   1.00 0.00 ? 22 ILE A CB   1  
ATOM 325   C CG1  . ILE A 1 22 ? 3.165   -0.689  4.300   1.00 0.00 ? 22 ILE A CG1  1  
ATOM 326   C CG2  . ILE A 1 22 ? 2.333   1.591   3.705   1.00 0.00 ? 22 ILE A CG2  1  
ATOM 327   C CD1  . ILE A 1 22 ? 2.515   -1.491  3.201   1.00 0.00 ? 22 ILE A CD1  1  
ATOM 328   H H    . ILE A 1 22 ? 0.713   1.289   6.601   1.00 0.00 ? 22 ILE A H    1  
ATOM 329   H HA   . ILE A 1 22 ? 3.390   0.255   6.586   1.00 0.00 ? 22 ILE A HA   1  
ATOM 330   H HB   . ILE A 1 22 ? 1.295   0.154   4.828   1.00 0.00 ? 22 ILE A HB   1  
ATOM 331   H HG12 . ILE A 1 22 ? 4.114   -0.324  3.937   1.00 0.00 ? 22 ILE A HG12 1  
ATOM 332   H HG13 . ILE A 1 22 ? 3.330   -1.345  5.136   1.00 0.00 ? 22 ILE A HG13 1  
ATOM 333   H HG21 . ILE A 1 22 ? 1.812   1.260   2.819   1.00 0.00 ? 22 ILE A HG21 1  
ATOM 334   H HG22 . ILE A 1 22 ? 3.356   1.828   3.456   1.00 0.00 ? 22 ILE A HG22 1  
ATOM 335   H HG23 . ILE A 1 22 ? 1.846   2.468   4.102   1.00 0.00 ? 22 ILE A HG23 1  
ATOM 336   H HD11 . ILE A 1 22 ? 3.093   -2.381  3.015   1.00 0.00 ? 22 ILE A HD11 1  
ATOM 337   H HD12 . ILE A 1 22 ? 2.465   -0.895  2.302   1.00 0.00 ? 22 ILE A HD12 1  
ATOM 338   H HD13 . ILE A 1 22 ? 1.517   -1.767  3.505   1.00 0.00 ? 22 ILE A HD13 1  
ATOM 339   N N    . CYS A 1 23 ? 4.725   2.135   5.360   1.00 0.00 ? 23 CYS A N    1  
ATOM 340   C CA   . CYS A 1 23 ? 5.593   3.275   5.075   1.00 0.00 ? 23 CYS A CA   1  
ATOM 341   C C    . CYS A 1 23 ? 5.907   3.319   3.585   1.00 0.00 ? 23 CYS A C    1  
ATOM 342   O O    . CYS A 1 23 ? 6.894   2.738   3.136   1.00 0.00 ? 23 CYS A O    1  
ATOM 343   C CB   . CYS A 1 23 ? 6.889   3.185   5.879   1.00 0.00 ? 23 CYS A CB   1  
ATOM 344   S SG   . CYS A 1 23 ? 6.640   3.115   7.678   1.00 0.00 ? 23 CYS A SG   1  
ATOM 345   H H    . CYS A 1 23 ? 5.009   1.228   5.090   1.00 0.00 ? 23 CYS A H    1  
ATOM 346   H HA   . CYS A 1 23 ? 5.063   4.175   5.349   1.00 0.00 ? 23 CYS A HA   1  
ATOM 347   H HB2  . CYS A 1 23 ? 7.422   2.296   5.589   1.00 0.00 ? 23 CYS A HB2  1  
ATOM 348   H HB3  . CYS A 1 23 ? 7.497   4.052   5.666   1.00 0.00 ? 23 CYS A HB3  1  
ATOM 349   N N    . ALA A 1 24 ? 5.047   3.982   2.815   1.00 0.00 ? 24 ALA A N    1  
ATOM 350   C CA   . ALA A 1 24 ? 5.231   4.055   1.371   1.00 0.00 ? 24 ALA A CA   1  
ATOM 351   C C    . ALA A 1 24 ? 5.830   5.372   0.905   1.00 0.00 ? 24 ALA A C    1  
ATOM 352   O O    . ALA A 1 24 ? 5.505   6.445   1.412   1.00 0.00 ? 24 ALA A O    1  
ATOM 353   C CB   . ALA A 1 24 ? 3.920   3.796   0.652   1.00 0.00 ? 24 ALA A CB   1  
ATOM 354   H H    . ALA A 1 24 ? 4.263   4.406   3.222   1.00 0.00 ? 24 ALA A H    1  
ATOM 355   H HA   . ALA A 1 24 ? 5.908   3.270   1.098   1.00 0.00 ? 24 ALA A HA   1  
ATOM 356   H HB1  . ALA A 1 24 ? 4.103   3.181   -0.218  1.00 0.00 ? 24 ALA A HB1  1  
ATOM 357   H HB2  . ALA A 1 24 ? 3.489   4.736   0.341   1.00 0.00 ? 24 ALA A HB2  1  
ATOM 358   H HB3  . ALA A 1 24 ? 3.239   3.287   1.316   1.00 0.00 ? 24 ALA A HB3  1  
ATOM 359   N N    . VAL A 1 25 ? 6.706   5.258   -0.085  1.00 0.00 ? 25 VAL A N    1  
ATOM 360   C CA   . VAL A 1 25 ? 7.378   6.396   -0.678  1.00 0.00 ? 25 VAL A CA   1  
ATOM 361   C C    . VAL A 1 25 ? 7.397   6.267   -2.195  1.00 0.00 ? 25 VAL A C    1  
ATOM 362   O O    . VAL A 1 25 ? 7.421   5.157   -2.742  1.00 0.00 ? 25 VAL A O    1  
ATOM 363   C CB   . VAL A 1 25 ? 8.819   6.516   -0.155  1.00 0.00 ? 25 VAL A CB   1  
ATOM 364   C CG1  . VAL A 1 25 ? 9.703   5.415   -0.725  1.00 0.00 ? 25 VAL A CG1  1  
ATOM 365   C CG2  . VAL A 1 25 ? 9.392   7.890   -0.467  1.00 0.00 ? 25 VAL A CG2  1  
ATOM 366   H H    . VAL A 1 25 ? 6.906   4.369   -0.433  1.00 0.00 ? 25 VAL A H    1  
ATOM 367   H HA   . VAL A 1 25 ? 6.838   7.294   -0.409  1.00 0.00 ? 25 VAL A HA   1  
ATOM 368   H HB   . VAL A 1 25 ? 8.789   6.397   0.914   1.00 0.00 ? 25 VAL A HB   1  
ATOM 369   H HG11 . VAL A 1 25 ? 9.813   5.557   -1.790  1.00 0.00 ? 25 VAL A HG11 1  
ATOM 370   H HG12 . VAL A 1 25 ? 9.247   4.454   -0.536  1.00 0.00 ? 25 VAL A HG12 1  
ATOM 371   H HG13 . VAL A 1 25 ? 10.673  5.451   -0.253  1.00 0.00 ? 25 VAL A HG13 1  
ATOM 372   H HG21 . VAL A 1 25 ? 8.586   8.596   -0.598  1.00 0.00 ? 25 VAL A HG21 1  
ATOM 373   H HG22 . VAL A 1 25 ? 9.976   7.839   -1.375  1.00 0.00 ? 25 VAL A HG22 1  
ATOM 374   H HG23 . VAL A 1 25 ? 10.023  8.212   0.349   1.00 0.00 ? 25 VAL A HG23 1  
ATOM 375   N N    . ILE A 1 26 ? 7.380   7.408   -2.866  1.00 0.00 ? 26 ILE A N    1  
ATOM 376   C CA   . ILE A 1 26 ? 7.399   7.432   -4.325  1.00 0.00 ? 26 ILE A CA   1  
ATOM 377   C C    . ILE A 1 26 ? 8.188   8.625   -4.853  1.00 0.00 ? 26 ILE A C    1  
ATOM 378   O O    . ILE A 1 26 ? 7.629   9.689   -5.117  1.00 0.00 ? 26 ILE A O    1  
ATOM 379   C CB   . ILE A 1 26 ? 5.981   7.457   -4.941  1.00 0.00 ? 26 ILE A CB   1  
ATOM 380   C CG1  . ILE A 1 26 ? 4.950   7.999   -3.939  1.00 0.00 ? 26 ILE A CG1  1  
ATOM 381   C CG2  . ILE A 1 26 ? 5.591   6.069   -5.434  1.00 0.00 ? 26 ILE A CG2  1  
ATOM 382   C CD1  . ILE A 1 26 ? 4.571   7.028   -2.839  1.00 0.00 ? 26 ILE A CD1  1  
ATOM 383   H H    . ILE A 1 26 ? 7.353   8.253   -2.365  1.00 0.00 ? 26 ILE A H    1  
ATOM 384   H HA   . ILE A 1 26 ? 7.889   6.527   -4.656  1.00 0.00 ? 26 ILE A HA   1  
ATOM 385   H HB   . ILE A 1 26 ? 6.008   8.110   -5.799  1.00 0.00 ? 26 ILE A HB   1  
ATOM 386   H HG12 . ILE A 1 26 ? 5.353   8.880   -3.470  1.00 0.00 ? 26 ILE A HG12 1  
ATOM 387   H HG13 . ILE A 1 26 ? 4.048   8.263   -4.473  1.00 0.00 ? 26 ILE A HG13 1  
ATOM 388   H HG21 . ILE A 1 26 ? 5.250   5.470   -4.603  1.00 0.00 ? 26 ILE A HG21 1  
ATOM 389   H HG22 . ILE A 1 26 ? 6.448   5.596   -5.890  1.00 0.00 ? 26 ILE A HG22 1  
ATOM 390   H HG23 . ILE A 1 26 ? 4.800   6.157   -6.163  1.00 0.00 ? 26 ILE A HG23 1  
ATOM 391   H HD11 . ILE A 1 26 ? 3.547   7.204   -2.544  1.00 0.00 ? 26 ILE A HD11 1  
ATOM 392   H HD12 . ILE A 1 26 ? 5.217   7.178   -1.989  1.00 0.00 ? 26 ILE A HD12 1  
ATOM 393   H HD13 . ILE A 1 26 ? 4.673   6.015   -3.196  1.00 0.00 ? 26 ILE A HD13 1  
ATOM 394   N N    . GLY A 1 27 ? 9.492   8.428   -5.004  1.00 0.00 ? 27 GLY A N    1  
ATOM 395   C CA   . GLY A 1 27 ? 10.369  9.471   -5.506  1.00 0.00 ? 27 GLY A CA   1  
ATOM 396   C C    . GLY A 1 27 ? 10.553  10.594  -4.515  1.00 0.00 ? 27 GLY A C    1  
ATOM 397   O O    . GLY A 1 27 ? 11.673  10.898  -4.102  1.00 0.00 ? 27 GLY A O    1  
ATOM 398   H H    . GLY A 1 27 ? 9.862   7.564   -4.771  1.00 0.00 ? 27 GLY A H    1  
ATOM 399   H HA2  . GLY A 1 27 ? 11.334  9.039   -5.728  1.00 0.00 ? 27 GLY A HA2  1  
ATOM 400   H HA3  . GLY A 1 27 ? 9.948   9.873   -6.416  1.00 0.00 ? 27 GLY A HA3  1  
ATOM 401   N N    . ASP A 1 28 ? 9.447   11.206  -4.133  1.00 0.00 ? 28 ASP A N    1  
ATOM 402   C CA   . ASP A 1 28 ? 9.465   12.303  -3.180  1.00 0.00 ? 28 ASP A CA   1  
ATOM 403   C C    . ASP A 1 28 ? 8.133   12.396  -2.449  1.00 0.00 ? 28 ASP A C    1  
ATOM 404   O O    . ASP A 1 28 ? 7.763   13.459  -1.951  1.00 0.00 ? 28 ASP A O    1  
ATOM 405   C CB   . ASP A 1 28 ? 9.764   13.623  -3.892  1.00 0.00 ? 28 ASP A CB   1  
ATOM 406   C CG   . ASP A 1 28 ? 9.958   14.772  -2.922  1.00 0.00 ? 28 ASP A CG   1  
ATOM 407   O OD1  . ASP A 1 28 ? 10.793  14.639  -2.004  1.00 0.00 ? 28 ASP A OD1  1  
ATOM 408   O OD2  . ASP A 1 28 ? 9.275   15.806  -3.082  1.00 0.00 ? 28 ASP A OD2  1  
ATOM 409   H H    . ASP A 1 28 ? 8.592   10.906  -4.501  1.00 0.00 ? 28 ASP A H    1  
ATOM 410   H HA   . ASP A 1 28 ? 10.244  12.106  -2.460  1.00 0.00 ? 28 ASP A HA   1  
ATOM 411   H HB2  . ASP A 1 28 ? 10.665  13.513  -4.477  1.00 0.00 ? 28 ASP A HB2  1  
ATOM 412   H HB3  . ASP A 1 28 ? 8.941   13.864  -4.549  1.00 0.00 ? 28 ASP A HB3  1  
ATOM 413   N N    . ALA A 1 29 ? 7.413   11.279  -2.385  1.00 0.00 ? 29 ALA A N    1  
ATOM 414   C CA   . ALA A 1 29 ? 6.125   11.254  -1.707  1.00 0.00 ? 29 ALA A CA   1  
ATOM 415   C C    . ALA A 1 29 ? 6.079   10.131  -0.683  1.00 0.00 ? 29 ALA A C    1  
ATOM 416   O O    . ALA A 1 29 ? 5.561   9.049   -0.954  1.00 0.00 ? 29 ALA A O    1  
ATOM 417   C CB   . ALA A 1 29 ? 4.994   11.115  -2.715  1.00 0.00 ? 29 ALA A CB   1  
ATOM 418   H H    . ALA A 1 29 ? 7.757   10.450  -2.798  1.00 0.00 ? 29 ALA A H    1  
ATOM 419   H HA   . ALA A 1 29 ? 6.003   12.198  -1.194  1.00 0.00 ? 29 ALA A HA   1  
ATOM 420   H HB1  . ALA A 1 29 ? 5.401   10.834  -3.675  1.00 0.00 ? 29 ALA A HB1  1  
ATOM 421   H HB2  . ALA A 1 29 ? 4.474   12.057  -2.806  1.00 0.00 ? 29 ALA A HB2  1  
ATOM 422   H HB3  . ALA A 1 29 ? 4.304   10.354  -2.380  1.00 0.00 ? 29 ALA A HB3  1  
ATOM 423   N N    . LYS A 1 30 ? 6.634   10.396  0.493   1.00 0.00 ? 30 LYS A N    1  
ATOM 424   C CA   . LYS A 1 30 ? 6.666   9.407   1.560   1.00 0.00 ? 30 LYS A CA   1  
ATOM 425   C C    . LYS A 1 30 ? 5.523   9.639   2.548   1.00 0.00 ? 30 LYS A C    1  
ATOM 426   O O    . LYS A 1 30 ? 5.460   10.678  3.208   1.00 0.00 ? 30 LYS A O    1  
ATOM 427   C CB   . LYS A 1 30 ? 8.020   9.459   2.283   1.00 0.00 ? 30 LYS A CB   1  
ATOM 428   C CG   . LYS A 1 30 ? 8.009   8.842   3.674   1.00 0.00 ? 30 LYS A CG   1  
ATOM 429   C CD   . LYS A 1 30 ? 7.922   9.910   4.755   1.00 0.00 ? 30 LYS A CD   1  
ATOM 430   C CE   . LYS A 1 30 ? 9.241   10.068  5.497   1.00 0.00 ? 30 LYS A CE   1  
ATOM 431   N NZ   . LYS A 1 30 ? 9.930   11.339  5.141   1.00 0.00 ? 30 LYS A NZ   1  
ATOM 432   H H    . LYS A 1 30 ? 7.037   11.276  0.645   1.00 0.00 ? 30 LYS A H    1  
ATOM 433   H HA   . LYS A 1 30 ? 6.547   8.433   1.105   1.00 0.00 ? 30 LYS A HA   1  
ATOM 434   H HB2  . LYS A 1 30 ? 8.750   8.932   1.688   1.00 0.00 ? 30 LYS A HB2  1  
ATOM 435   H HB3  . LYS A 1 30 ? 8.324   10.492  2.374   1.00 0.00 ? 30 LYS A HB3  1  
ATOM 436   H HG2  . LYS A 1 30 ? 7.156   8.187   3.761   1.00 0.00 ? 30 LYS A HG2  1  
ATOM 437   H HG3  . LYS A 1 30 ? 8.918   8.274   3.813   1.00 0.00 ? 30 LYS A HG3  1  
ATOM 438   H HD2  . LYS A 1 30 ? 7.665   10.853  4.296   1.00 0.00 ? 30 LYS A HD2  1  
ATOM 439   H HD3  . LYS A 1 30 ? 7.154   9.631   5.460   1.00 0.00 ? 30 LYS A HD3  1  
ATOM 440   H HE2  . LYS A 1 30 ? 9.045   10.062  6.559   1.00 0.00 ? 30 LYS A HE2  1  
ATOM 441   H HE3  . LYS A 1 30 ? 9.884   9.238   5.245   1.00 0.00 ? 30 LYS A HE3  1  
ATOM 442   H HZ1  . LYS A 1 30 ? 9.242   12.026  4.768   1.00 0.00 ? 30 LYS A HZ1  1  
ATOM 443   H HZ2  . LYS A 1 30 ? 10.653  11.163  4.415   1.00 0.00 ? 30 LYS A HZ2  1  
ATOM 444   H HZ3  . LYS A 1 30 ? 10.388  11.746  5.981   1.00 0.00 ? 30 LYS A HZ3  1  
ATOM 445   N N    . GLU A 1 31 ? 4.625   8.665   2.647   1.00 0.00 ? 31 GLU A N    1  
ATOM 446   C CA   . GLU A 1 31 ? 3.488   8.759   3.555   1.00 0.00 ? 31 GLU A CA   1  
ATOM 447   C C    . GLU A 1 31 ? 2.991   7.370   3.942   1.00 0.00 ? 31 GLU A C    1  
ATOM 448   O O    . GLU A 1 31 ? 3.186   6.404   3.204   1.00 0.00 ? 31 GLU A O    1  
ATOM 449   C CB   . GLU A 1 31 ? 2.354   9.558   2.908   1.00 0.00 ? 31 GLU A CB   1  
ATOM 450   C CG   . GLU A 1 31 ? 1.270   9.979   3.887   1.00 0.00 ? 31 GLU A CG   1  
ATOM 451   C CD   . GLU A 1 31 ? -0.009  9.182   3.722   1.00 0.00 ? 31 GLU A CD   1  
ATOM 452   O OE1  . GLU A 1 31 ? -0.294  8.745   2.587   1.00 0.00 ? 31 GLU A OE1  1  
ATOM 453   O OE2  . GLU A 1 31 ? -0.726  8.994   4.727   1.00 0.00 ? 31 GLU A OE2  1  
ATOM 454   H H    . GLU A 1 31 ? 4.731   7.861   2.097   1.00 0.00 ? 31 GLU A H    1  
ATOM 455   H HA   . GLU A 1 31 ? 3.816   9.273   4.446   1.00 0.00 ? 31 GLU A HA   1  
ATOM 456   H HB2  . GLU A 1 31 ? 2.768   10.448  2.458   1.00 0.00 ? 31 GLU A HB2  1  
ATOM 457   H HB3  . GLU A 1 31 ? 1.898   8.954   2.137   1.00 0.00 ? 31 GLU A HB3  1  
ATOM 458   H HG2  . GLU A 1 31 ? 1.637   9.837   4.893   1.00 0.00 ? 31 GLU A HG2  1  
ATOM 459   H HG3  . GLU A 1 31 ? 1.049   11.025  3.731   1.00 0.00 ? 31 GLU A HG3  1  
ATOM 460   N N    . GLU A 1 32 ? 2.352   7.274   5.104   1.00 0.00 ? 32 GLU A N    1  
ATOM 461   C CA   . GLU A 1 32 ? 1.834   5.996   5.581   1.00 0.00 ? 32 GLU A CA   1  
ATOM 462   C C    . GLU A 1 32 ? 0.518   5.655   4.896   1.00 0.00 ? 32 GLU A C    1  
ATOM 463   O O    . GLU A 1 32 ? -0.211  6.543   4.453   1.00 0.00 ? 32 GLU A O    1  
ATOM 464   C CB   . GLU A 1 32 ? 1.633   6.023   7.099   1.00 0.00 ? 32 GLU A CB   1  
ATOM 465   C CG   . GLU A 1 32 ? 2.681   6.830   7.850   1.00 0.00 ? 32 GLU A CG   1  
ATOM 466   C CD   . GLU A 1 32 ? 2.083   7.999   8.610   1.00 0.00 ? 32 GLU A CD   1  
ATOM 467   O OE1  . GLU A 1 32 ? 0.958   7.856   9.133   1.00 0.00 ? 32 GLU A OE1  1  
ATOM 468   O OE2  . GLU A 1 32 ? 2.742   9.058   8.683   1.00 0.00 ? 32 GLU A OE2  1  
ATOM 469   H H    . GLU A 1 32 ? 2.228   8.076   5.651   1.00 0.00 ? 32 GLU A H    1  
ATOM 470   H HA   . GLU A 1 32 ? 2.559   5.236   5.336   1.00 0.00 ? 32 GLU A HA   1  
ATOM 471   H HB2  . GLU A 1 32 ? 0.664   6.447   7.312   1.00 0.00 ? 32 GLU A HB2  1  
ATOM 472   H HB3  . GLU A 1 32 ? 1.661   5.010   7.466   1.00 0.00 ? 32 GLU A HB3  1  
ATOM 473   H HG2  . GLU A 1 32 ? 3.177   6.179   8.555   1.00 0.00 ? 32 GLU A HG2  1  
ATOM 474   H HG3  . GLU A 1 32 ? 3.402   7.209   7.143   1.00 0.00 ? 32 GLU A HG3  1  
ATOM 475   N N    . HIS A 1 33 ? 0.217   4.364   4.812   1.00 0.00 ? 33 HIS A N    1  
ATOM 476   C CA   . HIS A 1 33 ? -1.018  3.910   4.180   1.00 0.00 ? 33 HIS A CA   1  
ATOM 477   C C    . HIS A 1 33 ? -1.649  2.761   4.955   1.00 0.00 ? 33 HIS A C    1  
ATOM 478   O O    . HIS A 1 33 ? -0.996  1.756   5.236   1.00 0.00 ? 33 HIS A O    1  
ATOM 479   C CB   . HIS A 1 33 ? -0.750  3.461   2.744   1.00 0.00 ? 33 HIS A CB   1  
ATOM 480   C CG   . HIS A 1 33 ? 0.011   4.457   1.932   1.00 0.00 ? 33 HIS A CG   1  
ATOM 481   N ND1  . HIS A 1 33 ? -0.581  5.264   0.985   1.00 0.00 ? 33 HIS A ND1  1  
ATOM 482   C CD2  . HIS A 1 33 ? 1.326   4.771   1.923   1.00 0.00 ? 33 HIS A CD2  1  
ATOM 483   C CE1  . HIS A 1 33 ? 0.337   6.030   0.426   1.00 0.00 ? 33 HIS A CE1  1  
ATOM 484   N NE2  . HIS A 1 33 ? 1.504   5.752   0.979   1.00 0.00 ? 33 HIS A NE2  1  
ATOM 485   H H    . HIS A 1 33 ? 0.838   3.701   5.184   1.00 0.00 ? 33 HIS A H    1  
ATOM 486   H HA   . HIS A 1 33 ? -1.707  4.740   4.164   1.00 0.00 ? 33 HIS A HA   1  
ATOM 487   H HB2  . HIS A 1 33 ? -0.180  2.545   2.762   1.00 0.00 ? 33 HIS A HB2  1  
ATOM 488   H HB3  . HIS A 1 33 ? -1.694  3.281   2.250   1.00 0.00 ? 33 HIS A HB3  1  
ATOM 489   H HD1  . HIS A 1 33 ? -1.534  5.274   0.756   1.00 0.00 ? 33 HIS A HD1  1  
ATOM 490   H HD2  . HIS A 1 33 ? 2.095   4.324   2.540   1.00 0.00 ? 33 HIS A HD2  1  
ATOM 491   H HE1  . HIS A 1 33 ? 0.165   6.754   -0.355  1.00 0.00 ? 33 HIS A HE1  1  
ATOM 492   H HE2  . HIS A 1 33 ? 2.325   6.270   0.848   1.00 0.00 ? 33 HIS A HE2  1  
ATOM 493   N N    . ARG A 1 34 ? -2.930  2.905   5.274   1.00 0.00 ? 34 ARG A N    1  
ATOM 494   C CA   . ARG A 1 34 ? -3.654  1.865   5.991   1.00 0.00 ? 34 ARG A CA   1  
ATOM 495   C C    . ARG A 1 34 ? -4.072  0.774   5.016   1.00 0.00 ? 34 ARG A C    1  
ATOM 496   O O    . ARG A 1 34 ? -3.720  -0.395  5.179   1.00 0.00 ? 34 ARG A O    1  
ATOM 497   C CB   . ARG A 1 34 ? -4.887  2.441   6.686   1.00 0.00 ? 34 ARG A CB   1  
ATOM 498   C CG   . ARG A 1 34 ? -4.667  3.821   7.286   1.00 0.00 ? 34 ARG A CG   1  
ATOM 499   C CD   . ARG A 1 34 ? -3.512  3.826   8.275   1.00 0.00 ? 34 ARG A CD   1  
ATOM 500   N NE   . ARG A 1 34 ? -3.859  3.157   9.528   1.00 0.00 ? 34 ARG A NE   1  
ATOM 501   C CZ   . ARG A 1 34 ? -3.357  3.491   10.716  1.00 0.00 ? 34 ARG A CZ   1  
ATOM 502   N NH1  . ARG A 1 34 ? -2.474  4.477   10.823  1.00 0.00 ? 34 ARG A NH1  1  
ATOM 503   N NH2  . ARG A 1 34 ? -3.739  2.832   11.802  1.00 0.00 ? 34 ARG A NH2  1  
ATOM 504   H H    . ARG A 1 34 ? -3.402  3.720   5.007   1.00 0.00 ? 34 ARG A H    1  
ATOM 505   H HA   . ARG A 1 34 ? -2.991  1.443   6.731   1.00 0.00 ? 34 ARG A HA   1  
ATOM 506   H HB2  . ARG A 1 34 ? -5.688  2.509   5.965   1.00 0.00 ? 34 ARG A HB2  1  
ATOM 507   H HB3  . ARG A 1 34 ? -5.183  1.770   7.477   1.00 0.00 ? 34 ARG A HB3  1  
ATOM 508   H HG2  . ARG A 1 34 ? -4.450  4.519   6.492   1.00 0.00 ? 34 ARG A HG2  1  
ATOM 509   H HG3  . ARG A 1 34 ? -5.569  4.127   7.798   1.00 0.00 ? 34 ARG A HG3  1  
ATOM 510   H HD2  . ARG A 1 34 ? -2.670  3.318   7.828   1.00 0.00 ? 34 ARG A HD2  1  
ATOM 511   H HD3  . ARG A 1 34 ? -3.244  4.850   8.486   1.00 0.00 ? 34 ARG A HD3  1  
ATOM 512   H HE   . ARG A 1 34 ? -4.502  2.417   9.481   1.00 0.00 ? 34 ARG A HE   1  
ATOM 513   H HH11 . ARG A 1 34 ? -2.177  4.977   10.011  1.00 0.00 ? 34 ARG A HH11 1  
ATOM 514   H HH12 . ARG A 1 34 ? -2.103  4.719   11.720  1.00 0.00 ? 34 ARG A HH12 1  
ATOM 515   H HH21 . ARG A 1 34 ? -4.400  2.087   11.727  1.00 0.00 ? 34 ARG A HH21 1  
ATOM 516   H HH22 . ARG A 1 34 ? -3.362  3.080   12.694  1.00 0.00 ? 34 ARG A HH22 1  
ATOM 517   N N    . ASN A 1 35 ? -4.811  1.169   3.987   1.00 0.00 ? 35 ASN A N    1  
ATOM 518   C CA   . ASN A 1 35 ? -5.258  0.233   2.969   1.00 0.00 ? 35 ASN A CA   1  
ATOM 519   C C    . ASN A 1 35 ? -4.129  -0.034  1.987   1.00 0.00 ? 35 ASN A C    1  
ATOM 520   O O    . ASN A 1 35 ? -4.222  0.295   0.804   1.00 0.00 ? 35 ASN A O    1  
ATOM 521   C CB   . ASN A 1 35 ? -6.485  0.779   2.239   1.00 0.00 ? 35 ASN A CB   1  
ATOM 522   C CG   . ASN A 1 35 ? -7.652  1.024   3.176   1.00 0.00 ? 35 ASN A CG   1  
ATOM 523   O OD1  . ASN A 1 35 ? -8.387  2.000   3.027   1.00 0.00 ? 35 ASN A OD1  1  
ATOM 524   N ND2  . ASN A 1 35 ? -7.830  0.138   4.150   1.00 0.00 ? 35 ASN A ND2  1  
ATOM 525   H H    . ASN A 1 35 ? -5.046  2.117   3.902   1.00 0.00 ? 35 ASN A H    1  
ATOM 526   H HA   . ASN A 1 35 ? -5.518  -0.693  3.460   1.00 0.00 ? 35 ASN A HA   1  
ATOM 527   H HB2  . ASN A 1 35 ? -6.228  1.714   1.764   1.00 0.00 ? 35 ASN A HB2  1  
ATOM 528   H HB3  . ASN A 1 35 ? -6.794  0.070   1.486   1.00 0.00 ? 35 ASN A HB3  1  
ATOM 529   H HD21 . ASN A 1 35 ? -7.209  -0.616  4.210   1.00 0.00 ? 35 ASN A HD21 1  
ATOM 530   H HD22 . ASN A 1 35 ? -8.575  0.275   4.770   1.00 0.00 ? 35 ASN A HD22 1  
ATOM 531   N N    . MET A 1 36 ? -3.059  -0.635  2.498   1.00 0.00 ? 36 MET A N    1  
ATOM 532   C CA   . MET A 1 36 ? -1.890  -0.958  1.693   1.00 0.00 ? 36 MET A CA   1  
ATOM 533   C C    . MET A 1 36 ? -2.303  -1.581  0.367   1.00 0.00 ? 36 MET A C    1  
ATOM 534   O O    . MET A 1 36 ? -1.619  -1.425  -0.644  1.00 0.00 ? 36 MET A O    1  
ATOM 535   C CB   . MET A 1 36 ? -0.972  -1.902  2.479   1.00 0.00 ? 36 MET A CB   1  
ATOM 536   C CG   . MET A 1 36 ? -0.126  -2.832  1.616   1.00 0.00 ? 36 MET A CG   1  
ATOM 537   S SD   . MET A 1 36 ? -0.853  -4.475  1.454   1.00 0.00 ? 36 MET A SD   1  
ATOM 538   C CE   . MET A 1 36 ? -0.719  -4.734  -0.312  1.00 0.00 ? 36 MET A CE   1  
ATOM 539   H H    . MET A 1 36 ? -3.056  -0.867  3.448   1.00 0.00 ? 36 MET A H    1  
ATOM 540   H HA   . MET A 1 36 ? -1.360  -0.038  1.493   1.00 0.00 ? 36 MET A HA   1  
ATOM 541   H HB2  . MET A 1 36 ? -0.306  -1.307  3.084   1.00 0.00 ? 36 MET A HB2  1  
ATOM 542   H HB3  . MET A 1 36 ? -1.583  -2.510  3.130   1.00 0.00 ? 36 MET A HB3  1  
ATOM 543   H HG2  . MET A 1 36 ? -0.024  -2.399  0.633   1.00 0.00 ? 36 MET A HG2  1  
ATOM 544   H HG3  . MET A 1 36 ? 0.850   -2.930  2.066   1.00 0.00 ? 36 MET A HG3  1  
ATOM 545   H HE1  . MET A 1 36 ? 0.324   -4.746  -0.596  1.00 0.00 ? 36 MET A HE1  1  
ATOM 546   H HE2  . MET A 1 36 ? -1.224  -3.934  -0.834  1.00 0.00 ? 36 MET A HE2  1  
ATOM 547   H HE3  . MET A 1 36 ? -1.173  -5.678  -0.573  1.00 0.00 ? 36 MET A HE3  1  
ATOM 548   N N    . CYS A 1 37 ? -3.431  -2.277  0.374   1.00 0.00 ? 37 CYS A N    1  
ATOM 549   C CA   . CYS A 1 37 ? -3.925  -2.905  -0.838  1.00 0.00 ? 37 CYS A CA   1  
ATOM 550   C C    . CYS A 1 37 ? -4.420  -1.844  -1.814  1.00 0.00 ? 37 CYS A C    1  
ATOM 551   O O    . CYS A 1 37 ? -4.094  -1.884  -3.000  1.00 0.00 ? 37 CYS A O    1  
ATOM 552   C CB   . CYS A 1 37 ? -5.019  -3.927  -0.519  1.00 0.00 ? 37 CYS A CB   1  
ATOM 553   S SG   . CYS A 1 37 ? -6.484  -3.248  0.328   1.00 0.00 ? 37 CYS A SG   1  
ATOM 554   H H    . CYS A 1 37 ? -3.942  -2.363  1.208   1.00 0.00 ? 37 CYS A H    1  
ATOM 555   H HA   . CYS A 1 37 ? -3.093  -3.416  -1.291  1.00 0.00 ? 37 CYS A HA   1  
ATOM 556   H HB2  . CYS A 1 37 ? -5.351  -4.379  -1.438  1.00 0.00 ? 37 CYS A HB2  1  
ATOM 557   H HB3  . CYS A 1 37 ? -4.602  -4.695  0.117   1.00 0.00 ? 37 CYS A HB3  1  
ATOM 558   N N    . ALA A 1 38 ? -5.172  -0.872  -1.304  1.00 0.00 ? 38 ALA A N    1  
ATOM 559   C CA   . ALA A 1 38 ? -5.672  0.224   -2.135  1.00 0.00 ? 38 ALA A CA   1  
ATOM 560   C C    . ALA A 1 38 ? -4.517  0.871   -2.884  1.00 0.00 ? 38 ALA A C    1  
ATOM 561   O O    . ALA A 1 38 ? -4.682  1.414   -3.976  1.00 0.00 ? 38 ALA A O    1  
ATOM 562   C CB   . ALA A 1 38 ? -6.399  1.253   -1.282  1.00 0.00 ? 38 ALA A CB   1  
ATOM 563   H H    . ALA A 1 38 ? -5.371  -0.876  -0.345  1.00 0.00 ? 38 ALA A H    1  
ATOM 564   H HA   . ALA A 1 38 ? -6.367  -0.181  -2.851  1.00 0.00 ? 38 ALA A HA   1  
ATOM 565   H HB1  . ALA A 1 38 ? -7.445  0.994   -1.219  1.00 0.00 ? 38 ALA A HB1  1  
ATOM 566   H HB2  . ALA A 1 38 ? -6.295  2.229   -1.731  1.00 0.00 ? 38 ALA A HB2  1  
ATOM 567   H HB3  . ALA A 1 38 ? -5.970  1.265   -0.291  1.00 0.00 ? 38 ALA A HB3  1  
ATOM 568   N N    . LEU A 1 39 ? -3.342  0.784   -2.279  1.00 0.00 ? 39 LEU A N    1  
ATOM 569   C CA   . LEU A 1 39 ? -2.123  1.325   -2.850  1.00 0.00 ? 39 LEU A CA   1  
ATOM 570   C C    . LEU A 1 39 ? -1.628  0.432   -3.967  1.00 0.00 ? 39 LEU A C    1  
ATOM 571   O O    . LEU A 1 39 ? -1.282  0.892   -5.048  1.00 0.00 ? 39 LEU A O    1  
ATOM 572   C CB   . LEU A 1 39 ? -1.064  1.391   -1.756  1.00 0.00 ? 39 LEU A CB   1  
ATOM 573   C CG   . LEU A 1 39 ? -0.166  2.628   -1.753  1.00 0.00 ? 39 LEU A CG   1  
ATOM 574   C CD1  . LEU A 1 39 ? -0.971  3.890   -2.013  1.00 0.00 ? 39 LEU A CD1  1  
ATOM 575   C CD2  . LEU A 1 39 ? 0.577   2.728   -0.429  1.00 0.00 ? 39 LEU A CD2  1  
ATOM 576   H H    . LEU A 1 39 ? -3.290  0.326   -1.414  1.00 0.00 ? 39 LEU A H    1  
ATOM 577   H HA   . LEU A 1 39 ? -2.321  2.312   -3.233  1.00 0.00 ? 39 LEU A HA   1  
ATOM 578   H HB2  . LEU A 1 39 ? -1.577  1.337   -0.814  1.00 0.00 ? 39 LEU A HB2  1  
ATOM 579   H HB3  . LEU A 1 39 ? -0.432  0.520   -1.845  1.00 0.00 ? 39 LEU A HB3  1  
ATOM 580   H HG   . LEU A 1 39 ? 0.568   2.532   -2.540  1.00 0.00 ? 39 LEU A HG   1  
ATOM 581   H HD11 . LEU A 1 39 ? -0.412  4.749   -1.676  1.00 0.00 ? 39 LEU A HD11 1  
ATOM 582   H HD12 . LEU A 1 39 ? -1.906  3.836   -1.477  1.00 0.00 ? 39 LEU A HD12 1  
ATOM 583   H HD13 . LEU A 1 39 ? -1.166  3.979   -3.072  1.00 0.00 ? 39 LEU A HD13 1  
ATOM 584   H HD21 . LEU A 1 39 ? -0.096  2.487   0.381   1.00 0.00 ? 39 LEU A HD21 1  
ATOM 585   H HD22 . LEU A 1 39 ? 0.950   3.732   -0.300  1.00 0.00 ? 39 LEU A HD22 1  
ATOM 586   H HD23 . LEU A 1 39 ? 1.405   2.035   -0.427  1.00 0.00 ? 39 LEU A HD23 1  
ATOM 587   N N    . CYS A 1 40 ? -1.591  -0.853  -3.679  1.00 0.00 ? 40 CYS A N    1  
ATOM 588   C CA   . CYS A 1 40 ? -1.128  -1.835  -4.635  1.00 0.00 ? 40 CYS A CA   1  
ATOM 589   C C    . CYS A 1 40 ? -2.050  -1.916  -5.836  1.00 0.00 ? 40 CYS A C    1  
ATOM 590   O O    . CYS A 1 40 ? -1.617  -2.241  -6.941  1.00 0.00 ? 40 CYS A O    1  
ATOM 591   C CB   . CYS A 1 40 ? -1.007  -3.188  -3.955  1.00 0.00 ? 40 CYS A CB   1  
ATOM 592   S SG   . CYS A 1 40 ? 0.449   -3.301  -2.881  1.00 0.00 ? 40 CYS A SG   1  
ATOM 593   H H    . CYS A 1 40 ? -1.878  -1.148  -2.791  1.00 0.00 ? 40 CYS A H    1  
ATOM 594   H HA   . CYS A 1 40 ? -0.151  -1.530  -4.968  1.00 0.00 ? 40 CYS A HA   1  
ATOM 595   H HB2  . CYS A 1 40 ? -1.885  -3.364  -3.349  1.00 0.00 ? 40 CYS A HB2  1  
ATOM 596   H HB3  . CYS A 1 40 ? -0.928  -3.960  -4.705  1.00 0.00 ? 40 CYS A HB3  1  
ATOM 597   N N    . CYS A 1 41 ? -3.322  -1.621  -5.618  1.00 0.00 ? 41 CYS A N    1  
ATOM 598   C CA   . CYS A 1 41 ? -4.294  -1.666  -6.693  1.00 0.00 ? 41 CYS A CA   1  
ATOM 599   C C    . CYS A 1 41 ? -4.369  -0.335  -7.431  1.00 0.00 ? 41 CYS A C    1  
ATOM 600   O O    . CYS A 1 41 ? -4.616  -0.290  -8.636  1.00 0.00 ? 41 CYS A O    1  
ATOM 601   C CB   . CYS A 1 41 ? -5.656  -2.029  -6.126  1.00 0.00 ? 41 CYS A CB   1  
ATOM 602   S SG   . CYS A 1 41 ? -6.722  -0.618  -5.686  1.00 0.00 ? 41 CYS A SG   1  
ATOM 603   H H    . CYS A 1 41 ? -3.618  -1.372  -4.710  1.00 0.00 ? 41 CYS A H    1  
ATOM 604   H HA   . CYS A 1 41 ? -3.992  -2.440  -7.380  1.00 0.00 ? 41 CYS A HA   1  
ATOM 605   H HB2  . CYS A 1 41 ? -6.183  -2.620  -6.846  1.00 0.00 ? 41 CYS A HB2  1  
ATOM 606   H HB3  . CYS A 1 41 ? -5.503  -2.609  -5.236  1.00 0.00 ? 41 CYS A HB3  1  
ATOM 607   N N    . GLU A 1 42 ? -4.198  0.749   -6.684  1.00 0.00 ? 42 GLU A N    1  
ATOM 608   C CA   . GLU A 1 42 ? -4.295  2.095   -7.261  1.00 0.00 ? 42 GLU A CA   1  
ATOM 609   C C    . GLU A 1 42 ? -2.968  2.867   -7.283  1.00 0.00 ? 42 GLU A C    1  
ATOM 610   O O    . GLU A 1 42 ? -2.974  4.097   -7.307  1.00 0.00 ? 42 GLU A O    1  
ATOM 611   C CB   . GLU A 1 42 ? -5.341  2.910   -6.500  1.00 0.00 ? 42 GLU A CB   1  
ATOM 612   C CG   . GLU A 1 42 ? -5.708  4.218   -7.183  1.00 0.00 ? 42 GLU A CG   1  
ATOM 613   C CD   . GLU A 1 42 ? -7.177  4.560   -7.038  1.00 0.00 ? 42 GLU A CD   1  
ATOM 614   O OE1  . GLU A 1 42 ? -8.013  3.858   -7.645  1.00 0.00 ? 42 GLU A OE1  1  
ATOM 615   O OE2  . GLU A 1 42 ? -7.492  5.531   -6.318  1.00 0.00 ? 42 GLU A OE2  1  
ATOM 616   H H    . GLU A 1 42 ? -4.043  0.638   -5.719  1.00 0.00 ? 42 GLU A H    1  
ATOM 617   H HA   . GLU A 1 42 ? -4.635  1.983   -8.279  1.00 0.00 ? 42 GLU A HA   1  
ATOM 618   H HB2  . GLU A 1 42 ? -6.238  2.318   -6.399  1.00 0.00 ? 42 GLU A HB2  1  
ATOM 619   H HB3  . GLU A 1 42 ? -4.957  3.138   -5.516  1.00 0.00 ? 42 GLU A HB3  1  
ATOM 620   H HG2  . GLU A 1 42 ? -5.124  5.014   -6.744  1.00 0.00 ? 42 GLU A HG2  1  
ATOM 621   H HG3  . GLU A 1 42 ? -5.474  4.138   -8.234  1.00 0.00 ? 42 GLU A HG3  1  
ATOM 622   N N    . HIS A 1 43 ? -1.837  2.167   -7.294  1.00 0.00 ? 43 HIS A N    1  
ATOM 623   C CA   . HIS A 1 43 ? -0.535  2.848   -7.337  1.00 0.00 ? 43 HIS A CA   1  
ATOM 624   C C    . HIS A 1 43 ? -0.147  3.177   -8.776  1.00 0.00 ? 43 HIS A C    1  
ATOM 625   O O    . HIS A 1 43 ? -0.762  2.681   -9.721  1.00 0.00 ? 43 HIS A O    1  
ATOM 626   C CB   . HIS A 1 43 ? 0.564   2.004   -6.680  1.00 0.00 ? 43 HIS A CB   1  
ATOM 627   C CG   . HIS A 1 43 ? 0.622   0.590   -7.161  1.00 0.00 ? 43 HIS A CG   1  
ATOM 628   N ND1  . HIS A 1 43 ? 0.115   0.178   -8.376  1.00 0.00 ? 43 HIS A ND1  1  
ATOM 629   C CD2  . HIS A 1 43 ? 1.148   -0.510  -6.581  1.00 0.00 ? 43 HIS A CD2  1  
ATOM 630   C CE1  . HIS A 1 43 ? 0.328   -1.118  -8.520  1.00 0.00 ? 43 HIS A CE1  1  
ATOM 631   N NE2  . HIS A 1 43 ? 0.954   -1.559  -7.446  1.00 0.00 ? 43 HIS A NE2  1  
ATOM 632   H H    . HIS A 1 43 ? -1.872  1.186   -7.283  1.00 0.00 ? 43 HIS A H    1  
ATOM 633   H HA   . HIS A 1 43 ? -0.630  3.775   -6.792  1.00 0.00 ? 43 HIS A HA   1  
ATOM 634   H HB2  . HIS A 1 43 ? 1.523   2.457   -6.883  1.00 0.00 ? 43 HIS A HB2  1  
ATOM 635   H HB3  . HIS A 1 43 ? 0.406   1.988   -5.612  1.00 0.00 ? 43 HIS A HB3  1  
ATOM 636   H HD1  . HIS A 1 43 ? -0.334  0.749   -9.033  1.00 0.00 ? 43 HIS A HD1  1  
ATOM 637   H HD2  . HIS A 1 43 ? 1.620   -0.557  -5.609  1.00 0.00 ? 43 HIS A HD2  1  
ATOM 638   H HE1  . HIS A 1 43 ? 0.041   -1.714  -9.374  1.00 0.00 ? 43 HIS A HE1  1  
ATOM 639   H HE2  . HIS A 1 43 ? 1.323   -2.461  -7.338  1.00 0.00 ? 43 HIS A HE2  1  
ATOM 640   N N    . PRO A 1 44 ? 0.880   4.022   -8.964  1.00 0.00 ? 44 PRO A N    1  
ATOM 641   C CA   . PRO A 1 44 ? 1.348   4.418   -10.297 1.00 0.00 ? 44 PRO A CA   1  
ATOM 642   C C    . PRO A 1 44 ? 2.039   3.269   -11.020 1.00 0.00 ? 44 PRO A C    1  
ATOM 643   O O    . PRO A 1 44 ? 1.522   2.736   -12.002 1.00 0.00 ? 44 PRO A O    1  
ATOM 644   C CB   . PRO A 1 44 ? 2.346   5.555   -10.018 1.00 0.00 ? 44 PRO A CB   1  
ATOM 645   C CG   . PRO A 1 44 ? 2.178   5.899   -8.573  1.00 0.00 ? 44 PRO A CG   1  
ATOM 646   C CD   . PRO A 1 44 ? 1.670   4.657   -7.903  1.00 0.00 ? 44 PRO A CD   1  
ATOM 647   H HA   . PRO A 1 44 ? 0.535   4.788   -10.905 1.00 0.00 ? 44 PRO A HA   1  
ATOM 648   H HB2  . PRO A 1 44 ? 3.350   5.215   -10.227 1.00 0.00 ? 44 PRO A HB2  1  
ATOM 649   H HB3  . PRO A 1 44 ? 2.114   6.400   -10.651 1.00 0.00 ? 44 PRO A HB3  1  
ATOM 650   H HG2  . PRO A 1 44 ? 3.130   6.189   -8.153  1.00 0.00 ? 44 PRO A HG2  1  
ATOM 651   H HG3  . PRO A 1 44 ? 1.463   6.703   -8.468  1.00 0.00 ? 44 PRO A HG3  1  
ATOM 652   H HD2  . PRO A 1 44 ? 2.492   4.024   -7.601  1.00 0.00 ? 44 PRO A HD2  1  
ATOM 653   H HD3  . PRO A 1 44 ? 1.049   4.906   -7.053  1.00 0.00 ? 44 PRO A HD3  1  
ATOM 654   N N    . GLY A 1 45 ? 3.205   2.886   -10.517 1.00 0.00 ? 45 GLY A N    1  
ATOM 655   C CA   . GLY A 1 45 ? 3.953   1.795   -11.108 1.00 0.00 ? 45 GLY A CA   1  
ATOM 656   C C    . GLY A 1 45 ? 4.525   0.871   -10.053 1.00 0.00 ? 45 GLY A C    1  
ATOM 657   O O    . GLY A 1 45 ? 5.571   0.254   -10.253 1.00 0.00 ? 45 GLY A O    1  
ATOM 658   H H    . GLY A 1 45 ? 3.559   3.343   -9.726  1.00 0.00 ? 45 GLY A H    1  
ATOM 659   H HA2  . GLY A 1 45 ? 3.298   1.229   -11.755 1.00 0.00 ? 45 GLY A HA2  1  
ATOM 660   H HA3  . GLY A 1 45 ? 4.764   2.201   -11.696 1.00 0.00 ? 45 GLY A HA3  1  
ATOM 661   N N    . GLY A 1 46 ? 3.834   0.789   -8.920  1.00 0.00 ? 46 GLY A N    1  
ATOM 662   C CA   . GLY A 1 46 ? 4.285   -0.054  -7.832  1.00 0.00 ? 46 GLY A CA   1  
ATOM 663   C C    . GLY A 1 46 ? 4.811   0.753   -6.663  1.00 0.00 ? 46 GLY A C    1  
ATOM 664   O O    . GLY A 1 46 ? 6.021   0.876   -6.480  1.00 0.00 ? 46 GLY A O    1  
ATOM 665   H H    . GLY A 1 46 ? 3.011   1.311   -8.821  1.00 0.00 ? 46 GLY A H    1  
ATOM 666   H HA2  . GLY A 1 46 ? 3.458   -0.662  -7.494  1.00 0.00 ? 46 GLY A HA2  1  
ATOM 667   H HA3  . GLY A 1 46 ? 5.071   -0.702  -8.192  1.00 0.00 ? 46 GLY A HA3  1  
ATOM 668   N N    . PHE A 1 47 ? 3.899   1.310   -5.867  1.00 0.00 ? 47 PHE A N    1  
ATOM 669   C CA   . PHE A 1 47 ? 4.282   2.112   -4.710  1.00 0.00 ? 47 PHE A CA   1  
ATOM 670   C C    . PHE A 1 47 ? 5.286   1.360   -3.844  1.00 0.00 ? 47 PHE A C    1  
ATOM 671   O O    . PHE A 1 47 ? 5.201   0.142   -3.689  1.00 0.00 ? 47 PHE A O    1  
ATOM 672   C CB   . PHE A 1 47 ? 3.050   2.487   -3.882  1.00 0.00 ? 47 PHE A CB   1  
ATOM 673   C CG   . PHE A 1 47 ? 2.635   3.928   -4.017  1.00 0.00 ? 47 PHE A CG   1  
ATOM 674   C CD1  . PHE A 1 47 ? 2.887   4.637   -5.181  1.00 0.00 ? 47 PHE A CD1  1  
ATOM 675   C CD2  . PHE A 1 47 ? 1.981   4.572   -2.979  1.00 0.00 ? 47 PHE A CD2  1  
ATOM 676   C CE1  . PHE A 1 47 ? 2.495   5.956   -5.306  1.00 0.00 ? 47 PHE A CE1  1  
ATOM 677   C CE2  . PHE A 1 47 ? 1.589   5.890   -3.097  1.00 0.00 ? 47 PHE A CE2  1  
ATOM 678   C CZ   . PHE A 1 47 ? 1.845   6.583   -4.263  1.00 0.00 ? 47 PHE A CZ   1  
ATOM 679   H H    . PHE A 1 47 ? 2.948   1.179   -6.065  1.00 0.00 ? 47 PHE A H    1  
ATOM 680   H HA   . PHE A 1 47 ? 4.750   3.015   -5.075  1.00 0.00 ? 47 PHE A HA   1  
ATOM 681   H HB2  . PHE A 1 47 ? 2.218   1.874   -4.194  1.00 0.00 ? 47 PHE A HB2  1  
ATOM 682   H HB3  . PHE A 1 47 ? 3.254   2.297   -2.837  1.00 0.00 ? 47 PHE A HB3  1  
ATOM 683   H HD1  . PHE A 1 47 ? 3.397   4.147   -5.997  1.00 0.00 ? 47 PHE A HD1  1  
ATOM 684   H HD2  . PHE A 1 47 ? 1.784   4.034   -2.067  1.00 0.00 ? 47 PHE A HD2  1  
ATOM 685   H HE1  . PHE A 1 47 ? 2.698   6.497   -6.219  1.00 0.00 ? 47 PHE A HE1  1  
ATOM 686   H HE2  . PHE A 1 47 ? 1.080   6.379   -2.278  1.00 0.00 ? 47 PHE A HE2  1  
ATOM 687   H HZ   . PHE A 1 47 ? 1.537   7.614   -4.358  1.00 0.00 ? 47 PHE A HZ   1  
ATOM 688   N N    . GLU A 1 48 ? 6.239   2.094   -3.290  1.00 0.00 ? 48 GLU A N    1  
ATOM 689   C CA   . GLU A 1 48 ? 7.271   1.494   -2.445  1.00 0.00 ? 48 GLU A CA   1  
ATOM 690   C C    . GLU A 1 48 ? 6.929   1.632   -0.977  1.00 0.00 ? 48 GLU A C    1  
ATOM 691   O O    . GLU A 1 48 ? 7.201   2.663   -0.370  1.00 0.00 ? 48 GLU A O    1  
ATOM 692   C CB   . GLU A 1 48 ? 8.609   2.172   -2.693  1.00 0.00 ? 48 GLU A CB   1  
ATOM 693   C CG   . GLU A 1 48 ? 9.790   1.404   -2.136  1.00 0.00 ? 48 GLU A CG   1  
ATOM 694   C CD   . GLU A 1 48 ? 11.058  1.615   -2.941  1.00 0.00 ? 48 GLU A CD   1  
ATOM 695   O OE1  . GLU A 1 48 ? 11.587  2.746   -2.930  1.00 0.00 ? 48 GLU A OE1  1  
ATOM 696   O OE2  . GLU A 1 48 ? 11.521  0.650   -3.584  1.00 0.00 ? 48 GLU A OE2  1  
ATOM 697   H H    . GLU A 1 48 ? 6.255   3.067   -3.460  1.00 0.00 ? 48 GLU A H    1  
ATOM 698   H HA   . GLU A 1 48 ? 7.350   0.438   -2.692  1.00 0.00 ? 48 GLU A HA   1  
ATOM 699   H HB2  . GLU A 1 48 ? 8.748   2.292   -3.753  1.00 0.00 ? 48 GLU A HB2  1  
ATOM 700   H HB3  . GLU A 1 48 ? 8.591   3.146   -2.224  1.00 0.00 ? 48 GLU A HB3  1  
ATOM 701   H HG2  . GLU A 1 48 ? 9.966   1.729   -1.122  1.00 0.00 ? 48 GLU A HG2  1  
ATOM 702   H HG3  . GLU A 1 48 ? 9.548   0.353   -2.139  1.00 0.00 ? 48 GLU A HG3  1  
ATOM 703   N N    . TYR A 1 49 ? 6.348   0.592   -0.403  1.00 0.00 ? 49 TYR A N    1  
ATOM 704   C CA   . TYR A 1 49 ? 5.988   0.623   0.999   1.00 0.00 ? 49 TYR A CA   1  
ATOM 705   C C    . TYR A 1 49 ? 6.773   -0.391  1.801   1.00 0.00 ? 49 TYR A C    1  
ATOM 706   O O    . TYR A 1 49 ? 7.289   -1.374  1.270   1.00 0.00 ? 49 TYR A O    1  
ATOM 707   C CB   . TYR A 1 49 ? 4.507   0.354   1.176   1.00 0.00 ? 49 TYR A CB   1  
ATOM 708   C CG   . TYR A 1 49 ? 4.060   -0.876  0.441   1.00 0.00 ? 49 TYR A CG   1  
ATOM 709   C CD1  . TYR A 1 49 ? 4.305   -2.134  0.964   1.00 0.00 ? 49 TYR A CD1  1  
ATOM 710   C CD2  . TYR A 1 49 ? 3.414   -0.781  -0.778  1.00 0.00 ? 49 TYR A CD2  1  
ATOM 711   C CE1  . TYR A 1 49 ? 3.915   -3.270  0.295   1.00 0.00 ? 49 TYR A CE1  1  
ATOM 712   C CE2  . TYR A 1 49 ? 3.023   -1.911  -1.459  1.00 0.00 ? 49 TYR A CE2  1  
ATOM 713   C CZ   . TYR A 1 49 ? 3.273   -3.155  -0.918  1.00 0.00 ? 49 TYR A CZ   1  
ATOM 714   O OH   . TYR A 1 49 ? 2.890   -4.285  -1.594  1.00 0.00 ? 49 TYR A OH   1  
ATOM 715   H H    . TYR A 1 49 ? 6.162   -0.210  -0.932  1.00 0.00 ? 49 TYR A H    1  
ATOM 716   H HA   . TYR A 1 49 ? 6.205   1.599   1.378   1.00 0.00 ? 49 TYR A HA   1  
ATOM 717   H HB2  . TYR A 1 49 ? 4.294   0.212   2.223   1.00 0.00 ? 49 TYR A HB2  1  
ATOM 718   H HB3  . TYR A 1 49 ? 3.947   1.193   0.809   1.00 0.00 ? 49 TYR A HB3  1  
ATOM 719   H HD1  . TYR A 1 49 ? 4.808   -2.218  1.916   1.00 0.00 ? 49 TYR A HD1  1  
ATOM 720   H HD2  . TYR A 1 49 ? 3.216   0.195   -1.196  1.00 0.00 ? 49 TYR A HD2  1  
ATOM 721   H HE1  . TYR A 1 49 ? 4.111   -4.239  0.725   1.00 0.00 ? 49 TYR A HE1  1  
ATOM 722   H HE2  . TYR A 1 49 ? 2.523   -1.817  -2.407  1.00 0.00 ? 49 TYR A HE2  1  
ATOM 723   H HH   . TYR A 1 49 ? 3.604   -4.573  -2.168  1.00 0.00 ? 49 TYR A HH   1  
ATOM 724   N N    . SER A 1 50 ? 6.824   -0.142  3.091   1.00 0.00 ? 50 SER A N    1  
ATOM 725   C CA   . SER A 1 50 ? 7.505   -1.021  4.023   1.00 0.00 ? 50 SER A CA   1  
ATOM 726   C C    . SER A 1 50 ? 6.654   -1.169  5.264   1.00 0.00 ? 50 SER A C    1  
ATOM 727   O O    . SER A 1 50 ? 6.606   -0.277  6.112   1.00 0.00 ? 50 SER A O    1  
ATOM 728   C CB   . SER A 1 50 ? 8.888   -0.489  4.383   1.00 0.00 ? 50 SER A CB   1  
ATOM 729   O OG   . SER A 1 50 ? 8.800   0.690   5.160   1.00 0.00 ? 50 SER A OG   1  
ATOM 730   H H    . SER A 1 50 ? 6.360   0.655   3.432   1.00 0.00 ? 50 SER A H    1  
ATOM 731   H HA   . SER A 1 50 ? 7.606   -1.989  3.552   1.00 0.00 ? 50 SER A HA   1  
ATOM 732   H HB2  . SER A 1 50 ? 9.418   -1.240  4.949   1.00 0.00 ? 50 SER A HB2  1  
ATOM 733   H HB3  . SER A 1 50 ? 9.431   -0.271  3.477   1.00 0.00 ? 50 SER A HB3  1  
ATOM 734   H HG   . SER A 1 50 ? 9.410   0.632   5.900   1.00 0.00 ? 50 SER A HG   1  
ATOM 735   N N    . ASN A 1 51 ? 5.952   -2.284  5.345   1.00 0.00 ? 51 ASN A N    1  
ATOM 736   C CA   . ASN A 1 51 ? 5.062   -2.538  6.463   1.00 0.00 ? 51 ASN A CA   1  
ATOM 737   C C    . ASN A 1 51 ? 5.765   -2.384  7.796   1.00 0.00 ? 51 ASN A C    1  
ATOM 738   O O    . ASN A 1 51 ? 6.827   -2.959  8.037   1.00 0.00 ? 51 ASN A O    1  
ATOM 739   C CB   . ASN A 1 51 ? 4.437   -3.921  6.369   1.00 0.00 ? 51 ASN A CB   1  
ATOM 740   C CG   . ASN A 1 51 ? 3.848   -4.199  5.000   1.00 0.00 ? 51 ASN A CG   1  
ATOM 741   O OD1  . ASN A 1 51 ? 4.522   -4.729  4.117   1.00 0.00 ? 51 ASN A OD1  1  
ATOM 742   N ND2  . ASN A 1 51 ? 2.583   -3.841  4.815   1.00 0.00 ? 51 ASN A ND2  1  
ATOM 743   H H    . ASN A 1 51 ? 6.016   -2.939  4.621   1.00 0.00 ? 51 ASN A H    1  
ATOM 744   H HA   . ASN A 1 51 ? 4.274   -1.806  6.416   1.00 0.00 ? 51 ASN A HA   1  
ATOM 745   H HB2  . ASN A 1 51 ? 5.187   -4.667  6.578   1.00 0.00 ? 51 ASN A HB2  1  
ATOM 746   H HB3  . ASN A 1 51 ? 3.649   -3.986  7.104   1.00 0.00 ? 51 ASN A HB3  1  
ATOM 747   H HD21 . ASN A 1 51 ? 2.107   -3.423  5.563   1.00 0.00 ? 51 ASN A HD21 1  
ATOM 748   H HD22 . ASN A 1 51 ? 2.176   -4.010  3.940   1.00 0.00 ? 51 ASN A HD22 1  
ATOM 749   N N    . GLY A 1 52 ? 5.143   -1.600  8.655   1.00 0.00 ? 52 GLY A N    1  
ATOM 750   C CA   . GLY A 1 52 ? 5.685   -1.358  9.981   1.00 0.00 ? 52 GLY A CA   1  
ATOM 751   C C    . GLY A 1 52 ? 5.582   0.096   10.403  1.00 0.00 ? 52 GLY A C    1  
ATOM 752   O O    . GLY A 1 52 ? 5.595   0.992   9.558   1.00 0.00 ? 52 GLY A O    1  
ATOM 753   H H    . GLY A 1 52 ? 4.297   -1.184  8.380   1.00 0.00 ? 52 GLY A H    1  
ATOM 754   H HA2  . GLY A 1 52 ? 5.148   -1.966  10.692  1.00 0.00 ? 52 GLY A HA2  1  
ATOM 755   H HA3  . GLY A 1 52 ? 6.726   -1.650  9.989   1.00 0.00 ? 52 GLY A HA3  1  
ATOM 756   N N    . PRO A 1 53 ? 5.483   0.365   11.717  1.00 0.00 ? 53 PRO A N    1  
ATOM 757   C CA   . PRO A 1 53 ? 5.387   1.732   12.238  1.00 0.00 ? 53 PRO A CA   1  
ATOM 758   C C    . PRO A 1 53 ? 6.703   2.486   12.093  1.00 0.00 ? 53 PRO A C    1  
ATOM 759   O O    . PRO A 1 53 ? 7.420   2.707   13.069  1.00 0.00 ? 53 PRO A O    1  
ATOM 760   C CB   . PRO A 1 53 ? 5.040   1.527   13.714  1.00 0.00 ? 53 PRO A CB   1  
ATOM 761   C CG   . PRO A 1 53 ? 5.591   0.185   14.049  1.00 0.00 ? 53 PRO A CG   1  
ATOM 762   C CD   . PRO A 1 53 ? 5.468   -0.641  12.796  1.00 0.00 ? 53 PRO A CD   1  
ATOM 763   H HA   . PRO A 1 53 ? 4.598   2.289   11.749  1.00 0.00 ? 53 PRO A HA   1  
ATOM 764   H HB2  . PRO A 1 53 ? 5.501   2.304   14.306  1.00 0.00 ? 53 PRO A HB2  1  
ATOM 765   H HB3  . PRO A 1 53 ? 3.969   1.556   13.842  1.00 0.00 ? 53 PRO A HB3  1  
ATOM 766   H HG2  . PRO A 1 53 ? 6.628   0.275   14.338  1.00 0.00 ? 53 PRO A HG2  1  
ATOM 767   H HG3  . PRO A 1 53 ? 5.015   -0.259  14.847  1.00 0.00 ? 53 PRO A HG3  1  
ATOM 768   H HD2  . PRO A 1 53 ? 6.307   -1.316  12.706  1.00 0.00 ? 53 PRO A HD2  1  
ATOM 769   H HD3  . PRO A 1 53 ? 4.538   -1.191  12.797  1.00 0.00 ? 53 PRO A HD3  1  
ATOM 770   N N    . CYS A 1 54 ? 7.011   2.869   10.862  1.00 0.00 ? 54 CYS A N    1  
ATOM 771   C CA   . CYS A 1 54 ? 8.242   3.596   10.562  1.00 0.00 ? 54 CYS A CA   1  
ATOM 772   C C    . CYS A 1 54 ? 7.954   5.017   10.087  1.00 0.00 ? 54 CYS A C    1  
ATOM 773   O O    . CYS A 1 54 ? 8.853   5.858   10.039  1.00 0.00 ? 54 CYS A O    1  
ATOM 774   C CB   . CYS A 1 54 ? 9.067   2.856   9.501   1.00 0.00 ? 54 CYS A CB   1  
ATOM 775   S SG   . CYS A 1 54 ? 8.093   1.853   8.325   1.00 0.00 ? 54 CYS A SG   1  
ATOM 776   H H    . CYS A 1 54 ? 6.394   2.655   10.135  1.00 0.00 ? 54 CYS A H    1  
ATOM 777   H HA   . CYS A 1 54 ? 8.820   3.649   11.472  1.00 0.00 ? 54 CYS A HA   1  
ATOM 778   H HB2  . CYS A 1 54 ? 9.621   3.579   8.925   1.00 0.00 ? 54 CYS A HB2  1  
ATOM 779   H HB3  . CYS A 1 54 ? 9.759   2.196   9.999   1.00 0.00 ? 54 CYS A HB3  1  
ATOM 780   N N    . GLU A 1 55 ? 6.703   5.280   9.733   1.00 0.00 ? 55 GLU A N    1  
ATOM 781   C CA   . GLU A 1 55 ? 6.306   6.598   9.257   1.00 0.00 ? 55 GLU A CA   1  
ATOM 782   C C    . GLU A 1 55 ? 5.028   7.063   9.948   1.00 0.00 ? 55 GLU A C    1  
ATOM 783   O O    . GLU A 1 55 ? 4.298   6.201   10.482  1.00 0.00 ? 55 GLU A O    1  
ATOM 784   C CB   . GLU A 1 55 ? 6.107   6.571   7.741   1.00 0.00 ? 55 GLU A CB   1  
ATOM 785   C CG   . GLU A 1 55 ? 6.477   7.875   7.054   1.00 0.00 ? 55 GLU A CG   1  
ATOM 786   C CD   . GLU A 1 55 ? 5.561   9.020   7.442   1.00 0.00 ? 55 GLU A CD   1  
ATOM 787   O OE1  . GLU A 1 55 ? 4.478   9.147   6.834   1.00 0.00 ? 55 GLU A OE1  1  
ATOM 788   O OE2  . GLU A 1 55 ? 5.929   9.790   8.355   1.00 0.00 ? 55 GLU A OE2  1  
ATOM 789   O OXT  . GLU A 1 55 ? 4.769   8.285   9.952   1.00 0.00 ? 55 GLU A OXT  1  
ATOM 790   H H    . GLU A 1 55 ? 6.032   4.571   9.788   1.00 0.00 ? 55 GLU A H    1  
ATOM 791   H HA   . GLU A 1 55 ? 7.101   7.289   9.494   1.00 0.00 ? 55 GLU A HA   1  
ATOM 792   H HB2  . GLU A 1 55 ? 6.718   5.785   7.324   1.00 0.00 ? 55 GLU A HB2  1  
ATOM 793   H HB3  . GLU A 1 55 ? 5.071   6.356   7.529   1.00 0.00 ? 55 GLU A HB3  1  
ATOM 794   H HG2  . GLU A 1 55 ? 7.488   8.136   7.326   1.00 0.00 ? 55 GLU A HG2  1  
ATOM 795   H HG3  . GLU A 1 55 ? 6.417   7.732   5.984   1.00 0.00 ? 55 GLU A HG3  1  
ATOM 796   N N    . ALA A 1 1  ? 11.284  -3.461  -6.308  1.00 0.00 ? 1  ALA A N    2  
ATOM 797   C CA   . ALA A 1 1  ? 9.886   -3.857  -5.999  1.00 0.00 ? 1  ALA A CA   2  
ATOM 798   C C    . ALA A 1 1  ? 9.611   -3.782  -4.502  1.00 0.00 ? 1  ALA A C    2  
ATOM 799   O O    . ALA A 1 1  ? 9.813   -4.754  -3.774  1.00 0.00 ? 1  ALA A O    2  
ATOM 800   C CB   . ALA A 1 1  ? 9.610   -5.262  -6.514  1.00 0.00 ? 1  ALA A CB   2  
ATOM 801   H H1   . ALA A 1 1  ? 11.330  -2.421  -6.293  1.00 0.00 ? 1  ALA A H1   2  
ATOM 802   H H2   . ALA A 1 1  ? 11.517  -3.834  -7.251  1.00 0.00 ? 1  ALA A H2   2  
ATOM 803   H H3   . ALA A 1 1  ? 11.900  -3.871  -5.579  1.00 0.00 ? 1  ALA A H3   2  
ATOM 804   H HA   . ALA A 1 1  ? 9.219   -3.178  -6.510  1.00 0.00 ? 1  ALA A HA   2  
ATOM 805   H HB1  . ALA A 1 1  ? 9.741   -5.973  -5.710  1.00 0.00 ? 1  ALA A HB1  2  
ATOM 806   H HB2  . ALA A 1 1  ? 10.297  -5.494  -7.314  1.00 0.00 ? 1  ALA A HB2  2  
ATOM 807   H HB3  . ALA A 1 1  ? 8.596   -5.318  -6.881  1.00 0.00 ? 1  ALA A HB3  2  
ATOM 808   N N    . HIS A 1 2  ? 9.146   -2.622  -4.047  1.00 0.00 ? 2  HIS A N    2  
ATOM 809   C CA   . HIS A 1 2  ? 8.839   -2.424  -2.635  1.00 0.00 ? 2  HIS A CA   2  
ATOM 810   C C    . HIS A 1 2  ? 7.344   -2.191  -2.441  1.00 0.00 ? 2  HIS A C    2  
ATOM 811   O O    . HIS A 1 2  ? 6.917   -1.219  -1.825  1.00 0.00 ? 2  HIS A O    2  
ATOM 812   C CB   . HIS A 1 2  ? 9.645   -1.252  -2.075  1.00 0.00 ? 2  HIS A CB   2  
ATOM 813   C CG   . HIS A 1 2  ? 11.050  -1.608  -1.700  1.00 0.00 ? 2  HIS A CG   2  
ATOM 814   N ND1  . HIS A 1 2  ? 11.985  -2.045  -2.614  1.00 0.00 ? 2  HIS A ND1  2  
ATOM 815   C CD2  . HIS A 1 2  ? 11.682  -1.580  -0.502  1.00 0.00 ? 2  HIS A CD2  2  
ATOM 816   C CE1  . HIS A 1 2  ? 13.131  -2.273  -1.994  1.00 0.00 ? 2  HIS A CE1  2  
ATOM 817   N NE2  . HIS A 1 2  ? 12.972  -1.998  -0.713  1.00 0.00 ? 2  HIS A NE2  2  
ATOM 818   H H    . HIS A 1 2  ? 9.002   -1.885  -4.676  1.00 0.00 ? 2  HIS A H    2  
ATOM 819   H HA   . HIS A 1 2  ? 9.114   -3.326  -2.112  1.00 0.00 ? 2  HIS A HA   2  
ATOM 820   H HB2  . HIS A 1 2  ? 9.690   -0.472  -2.818  1.00 0.00 ? 2  HIS A HB2  2  
ATOM 821   H HB3  . HIS A 1 2  ? 9.151   -0.876  -1.194  1.00 0.00 ? 2  HIS A HB3  2  
ATOM 822   H HD1  . HIS A 1 2  ? 11.833  -2.172  -3.573  1.00 0.00 ? 2  HIS A HD1  2  
ATOM 823   H HD2  . HIS A 1 2  ? 11.250  -1.284  0.444   1.00 0.00 ? 2  HIS A HD2  2  
ATOM 824   H HE1  . HIS A 1 2  ? 14.041  -2.621  -2.457  1.00 0.00 ? 2  HIS A HE1  2  
ATOM 825   H HE2  . HIS A 1 2  ? 13.691  -1.980  -0.047  1.00 0.00 ? 2  HIS A HE2  2  
ATOM 826   N N    . MET A 1 3  ? 6.565   -3.103  -2.988  1.00 0.00 ? 3  MET A N    2  
ATOM 827   C CA   . MET A 1 3  ? 5.107   -3.042  -2.909  1.00 0.00 ? 3  MET A CA   2  
ATOM 828   C C    . MET A 1 3  ? 4.507   -4.447  -2.768  1.00 0.00 ? 3  MET A C    2  
ATOM 829   O O    . MET A 1 3  ? 5.045   -5.419  -3.299  1.00 0.00 ? 3  MET A O    2  
ATOM 830   C CB   . MET A 1 3  ? 4.560   -2.342  -4.162  1.00 0.00 ? 3  MET A CB   2  
ATOM 831   C CG   . MET A 1 3  ? 3.064   -2.523  -4.390  1.00 0.00 ? 3  MET A CG   2  
ATOM 832   S SD   . MET A 1 3  ? 2.685   -3.270  -5.990  1.00 0.00 ? 3  MET A SD   2  
ATOM 833   C CE   . MET A 1 3  ? 3.722   -4.730  -5.953  1.00 0.00 ? 3  MET A CE   2  
ATOM 834   H H    . MET A 1 3  ? 6.985   -3.834  -3.466  1.00 0.00 ? 3  MET A H    2  
ATOM 835   H HA   . MET A 1 3  ? 4.845   -2.461  -2.038  1.00 0.00 ? 3  MET A HA   2  
ATOM 836   H HB2  . MET A 1 3  ? 4.758   -1.284  -4.077  1.00 0.00 ? 3  MET A HB2  2  
ATOM 837   H HB3  . MET A 1 3  ? 5.083   -2.723  -5.025  1.00 0.00 ? 3  MET A HB3  2  
ATOM 838   H HG2  . MET A 1 3  ? 2.662   -3.151  -3.614  1.00 0.00 ? 3  MET A HG2  2  
ATOM 839   H HG3  . MET A 1 3  ? 2.591   -1.553  -4.344  1.00 0.00 ? 3  MET A HG3  2  
ATOM 840   H HE1  . MET A 1 3  ? 4.123   -4.912  -6.939  1.00 0.00 ? 3  MET A HE1  2  
ATOM 841   H HE2  . MET A 1 3  ? 3.134   -5.581  -5.640  1.00 0.00 ? 3  MET A HE2  2  
ATOM 842   H HE3  . MET A 1 3  ? 4.534   -4.579  -5.258  1.00 0.00 ? 3  MET A HE3  2  
ATOM 843   N N    . ASP A 1 4  ? 3.383   -4.542  -2.053  1.00 0.00 ? 4  ASP A N    2  
ATOM 844   C CA   . ASP A 1 4  ? 2.701   -5.820  -1.849  1.00 0.00 ? 4  ASP A CA   2  
ATOM 845   C C    . ASP A 1 4  ? 1.194   -5.668  -2.041  1.00 0.00 ? 4  ASP A C    2  
ATOM 846   O O    . ASP A 1 4  ? 0.511   -5.064  -1.213  1.00 0.00 ? 4  ASP A O    2  
ATOM 847   C CB   . ASP A 1 4  ? 2.984   -6.374  -0.447  1.00 0.00 ? 4  ASP A CB   2  
ATOM 848   C CG   . ASP A 1 4  ? 2.719   -7.863  -0.351  1.00 0.00 ? 4  ASP A CG   2  
ATOM 849   O OD1  . ASP A 1 4  ? 1.881   -8.369  -1.126  1.00 0.00 ? 4  ASP A OD1  2  
ATOM 850   O OD2  . ASP A 1 4  ? 3.352   -8.525  0.500   1.00 0.00 ? 4  ASP A OD2  2  
ATOM 851   H H    . ASP A 1 4  ? 3.000   -3.730  -1.660  1.00 0.00 ? 4  ASP A H    2  
ATOM 852   H HA   . ASP A 1 4  ? 3.076   -6.517  -2.584  1.00 0.00 ? 4  ASP A HA   2  
ATOM 853   H HB2  . ASP A 1 4  ? 4.016   -6.195  -0.195  1.00 0.00 ? 4  ASP A HB2  2  
ATOM 854   H HB3  . ASP A 1 4  ? 2.353   -5.867  0.270   1.00 0.00 ? 4  ASP A HB3  2  
ATOM 855   N N    . CYS A 1 5  ? 0.680   -6.220  -3.134  1.00 0.00 ? 5  CYS A N    2  
ATOM 856   C CA   . CYS A 1 5  ? -0.747  -6.147  -3.430  1.00 0.00 ? 5  CYS A CA   2  
ATOM 857   C C    . CYS A 1 5  ? -1.474  -7.364  -2.864  1.00 0.00 ? 5  CYS A C    2  
ATOM 858   O O    . CYS A 1 5  ? -0.839  -8.293  -2.367  1.00 0.00 ? 5  CYS A O    2  
ATOM 859   C CB   . CYS A 1 5  ? -0.968  -6.053  -4.944  1.00 0.00 ? 5  CYS A CB   2  
ATOM 860   S SG   . CYS A 1 5  ? -2.574  -5.344  -5.440  1.00 0.00 ? 5  CYS A SG   2  
ATOM 861   H H    . CYS A 1 5  ? 1.273   -6.691  -3.757  1.00 0.00 ? 5  CYS A H    2  
ATOM 862   H HA   . CYS A 1 5  ? -1.135  -5.261  -2.957  1.00 0.00 ? 5  CYS A HA   2  
ATOM 863   H HB2  . CYS A 1 5  ? -0.194  -5.434  -5.373  1.00 0.00 ? 5  CYS A HB2  2  
ATOM 864   H HB3  . CYS A 1 5  ? -0.902  -7.045  -5.370  1.00 0.00 ? 5  CYS A HB3  2  
ATOM 865   N N    . THR A 1 6  ? -2.805  -7.356  -2.937  1.00 0.00 ? 6  THR A N    2  
ATOM 866   C CA   . THR A 1 6  ? -3.596  -8.465  -2.429  1.00 0.00 ? 6  THR A CA   2  
ATOM 867   C C    . THR A 1 6  ? -3.235  -9.751  -3.189  1.00 0.00 ? 6  THR A C    2  
ATOM 868   O O    . THR A 1 6  ? -2.088  -10.192 -3.117  1.00 0.00 ? 6  THR A O    2  
ATOM 869   C CB   . THR A 1 6  ? -5.090  -8.153  -2.545  1.00 0.00 ? 6  THR A CB   2  
ATOM 870   O OG1  . THR A 1 6  ? -5.863  -9.317  -2.312  1.00 0.00 ? 6  THR A OG1  2  
ATOM 871   C CG2  . THR A 1 6  ? -5.485  -7.600  -3.899  1.00 0.00 ? 6  THR A CG2  2  
ATOM 872   H H    . THR A 1 6  ? -3.261  -6.595  -3.339  1.00 0.00 ? 6  THR A H    2  
ATOM 873   H HA   . THR A 1 6  ? -3.335  -8.586  -1.377  1.00 0.00 ? 6  THR A HA   2  
ATOM 874   H HB   . THR A 1 6  ? -5.352  -7.417  -1.798  1.00 0.00 ? 6  THR A HB   2  
ATOM 875   H HG1  . THR A 1 6  ? -5.601  -9.713  -1.478  1.00 0.00 ? 6  THR A HG1  2  
ATOM 876   H HG21 . THR A 1 6  ? -6.067  -6.701  -3.765  1.00 0.00 ? 6  THR A HG21 2  
ATOM 877   H HG22 . THR A 1 6  ? -6.072  -8.334  -4.430  1.00 0.00 ? 6  THR A HG22 2  
ATOM 878   H HG23 . THR A 1 6  ? -4.597  -7.371  -4.468  1.00 0.00 ? 6  THR A HG23 2  
ATOM 879   N N    . GLU A 1 7  ? -4.182  -10.362 -3.930  1.00 0.00 ? 7  GLU A N    2  
ATOM 880   C CA   . GLU A 1 7  ? -3.864  -11.573 -4.666  1.00 0.00 ? 7  GLU A CA   2  
ATOM 881   C C    . GLU A 1 7  ? -5.082  -12.101 -5.420  1.00 0.00 ? 7  GLU A C    2  
ATOM 882   O O    . GLU A 1 7  ? -5.178  -13.298 -5.689  1.00 0.00 ? 7  GLU A O    2  
ATOM 883   C CB   . GLU A 1 7  ? -3.304  -12.635 -3.710  1.00 0.00 ? 7  GLU A CB   2  
ATOM 884   C CG   . GLU A 1 7  ? -4.343  -13.593 -3.144  1.00 0.00 ? 7  GLU A CG   2  
ATOM 885   C CD   . GLU A 1 7  ? -3.952  -14.135 -1.782  1.00 0.00 ? 7  GLU A CD   2  
ATOM 886   O OE1  . GLU A 1 7  ? -2.766  -14.479 -1.597  1.00 0.00 ? 7  GLU A OE1  2  
ATOM 887   O OE2  . GLU A 1 7  ? -4.834  -14.217 -0.900  1.00 0.00 ? 7  GLU A OE2  2  
ATOM 888   H H    . GLU A 1 7  ? -5.094  -9.997  -3.993  1.00 0.00 ? 7  GLU A H    2  
ATOM 889   H HA   . GLU A 1 7  ? -3.100  -11.322 -5.388  1.00 0.00 ? 7  GLU A HA   2  
ATOM 890   H HB2  . GLU A 1 7  ? -2.563  -13.212 -4.236  1.00 0.00 ? 7  GLU A HB2  2  
ATOM 891   H HB3  . GLU A 1 7  ? -2.827  -12.131 -2.880  1.00 0.00 ? 7  GLU A HB3  2  
ATOM 892   H HG2  . GLU A 1 7  ? -5.284  -13.072 -3.052  1.00 0.00 ? 7  GLU A HG2  2  
ATOM 893   H HG3  . GLU A 1 7  ? -4.456  -14.423 -3.826  1.00 0.00 ? 7  GLU A HG3  2  
ATOM 894   N N    . PHE A 1 8  ? -6.012  -11.213 -5.765  1.00 0.00 ? 8  PHE A N    2  
ATOM 895   C CA   . PHE A 1 8  ? -7.207  -11.639 -6.491  1.00 0.00 ? 8  PHE A CA   2  
ATOM 896   C C    . PHE A 1 8  ? -7.504  -10.716 -7.666  1.00 0.00 ? 8  PHE A C    2  
ATOM 897   O O    . PHE A 1 8  ? -6.764  -9.767  -7.924  1.00 0.00 ? 8  PHE A O    2  
ATOM 898   C CB   . PHE A 1 8  ? -8.420  -11.718 -5.555  1.00 0.00 ? 8  PHE A CB   2  
ATOM 899   C CG   . PHE A 1 8  ? -8.435  -10.690 -4.456  1.00 0.00 ? 8  PHE A CG   2  
ATOM 900   C CD1  . PHE A 1 8  ? -8.383  -9.336  -4.746  1.00 0.00 ? 8  PHE A CD1  2  
ATOM 901   C CD2  . PHE A 1 8  ? -8.515  -11.084 -3.128  1.00 0.00 ? 8  PHE A CD2  2  
ATOM 902   C CE1  . PHE A 1 8  ? -8.408  -8.395  -3.734  1.00 0.00 ? 8  PHE A CE1  2  
ATOM 903   C CE2  . PHE A 1 8  ? -8.541  -10.147 -2.114  1.00 0.00 ? 8  PHE A CE2  2  
ATOM 904   C CZ   . PHE A 1 8  ? -8.487  -8.801  -2.416  1.00 0.00 ? 8  PHE A CZ   2  
ATOM 905   H H    . PHE A 1 8  ? -5.892  -10.256 -5.533  1.00 0.00 ? 8  PHE A H    2  
ATOM 906   H HA   . PHE A 1 8  ? -7.010  -12.628 -6.879  1.00 0.00 ? 8  PHE A HA   2  
ATOM 907   H HB2  . PHE A 1 8  ? -9.319  -11.587 -6.137  1.00 0.00 ? 8  PHE A HB2  2  
ATOM 908   H HB3  . PHE A 1 8  ? -8.441  -12.696 -5.094  1.00 0.00 ? 8  PHE A HB3  2  
ATOM 909   H HD1  . PHE A 1 8  ? -8.321  -9.017  -5.777  1.00 0.00 ? 8  PHE A HD1  2  
ATOM 910   H HD2  . PHE A 1 8  ? -8.554  -12.136 -2.890  1.00 0.00 ? 8  PHE A HD2  2  
ATOM 911   H HE1  . PHE A 1 8  ? -8.365  -7.343  -3.972  1.00 0.00 ? 8  PHE A HE1  2  
ATOM 912   H HE2  . PHE A 1 8  ? -8.604  -10.467 -1.084  1.00 0.00 ? 8  PHE A HE2  2  
ATOM 913   H HZ   . PHE A 1 8  ? -8.508  -8.067  -1.624  1.00 0.00 ? 8  PHE A HZ   2  
ATOM 914   N N    . ASN A 1 9  ? -8.592  -11.002 -8.378  1.00 0.00 ? 9  ASN A N    2  
ATOM 915   C CA   . ASN A 1 9  ? -8.979  -10.191 -9.525  1.00 0.00 ? 9  ASN A CA   2  
ATOM 916   C C    . ASN A 1 9  ? -9.444  -8.820  -9.050  1.00 0.00 ? 9  ASN A C    2  
ATOM 917   O O    . ASN A 1 9  ? -8.857  -7.802  -9.416  1.00 0.00 ? 9  ASN A O    2  
ATOM 918   C CB   . ASN A 1 9  ? -10.078 -10.877 -10.350 1.00 0.00 ? 9  ASN A CB   2  
ATOM 919   C CG   . ASN A 1 9  ? -10.077 -12.391 -10.209 1.00 0.00 ? 9  ASN A CG   2  
ATOM 920   O OD1  . ASN A 1 9  ? -11.134 -13.017 -10.120 1.00 0.00 ? 9  ASN A OD1  2  
ATOM 921   N ND2  . ASN A 1 9  ? -8.889  -12.985 -10.187 1.00 0.00 ? 9  ASN A ND2  2  
ATOM 922   H H    . ASN A 1 9  ? -9.144  -11.769 -8.126  1.00 0.00 ? 9  ASN A H    2  
ATOM 923   H HA   . ASN A 1 9  ? -8.103  -10.062 -10.144 1.00 0.00 ? 9  ASN A HA   2  
ATOM 924   H HB2  . ASN A 1 9  ? -11.039 -10.510 -10.034 1.00 0.00 ? 9  ASN A HB2  2  
ATOM 925   H HB3  . ASN A 1 9  ? -9.932  -10.636 -11.391 1.00 0.00 ? 9  ASN A HB3  2  
ATOM 926   H HD21 . ASN A 1 9  ? -8.090  -12.424 -10.260 1.00 0.00 ? 9  ASN A HD21 2  
ATOM 927   H HD22 . ASN A 1 9  ? -8.863  -13.961 -10.096 1.00 0.00 ? 9  ASN A HD22 2  
ATOM 928   N N    . PRO A 1 10 ? -10.485 -8.765  -8.197  1.00 0.00 ? 10 PRO A N    2  
ATOM 929   C CA   . PRO A 1 10 ? -10.976 -7.498  -7.660  1.00 0.00 ? 10 PRO A CA   2  
ATOM 930   C C    . PRO A 1 10 ? -9.937  -6.873  -6.735  1.00 0.00 ? 10 PRO A C    2  
ATOM 931   O O    . PRO A 1 10 ? -9.943  -7.118  -5.531  1.00 0.00 ? 10 PRO A O    2  
ATOM 932   C CB   . PRO A 1 10 ? -12.230 -7.897  -6.876  1.00 0.00 ? 10 PRO A CB   2  
ATOM 933   C CG   . PRO A 1 10 ? -12.017 -9.329  -6.525  1.00 0.00 ? 10 PRO A CG   2  
ATOM 934   C CD   . PRO A 1 10 ? -11.238 -9.920  -7.665  1.00 0.00 ? 10 PRO A CD   2  
ATOM 935   H HA   . PRO A 1 10 ? -11.233 -6.801  -8.445  1.00 0.00 ? 10 PRO A HA   2  
ATOM 936   H HB2  . PRO A 1 10 ? -12.317 -7.283  -5.992  1.00 0.00 ? 10 PRO A HB2  2  
ATOM 937   H HB3  . PRO A 1 10 ? -13.103 -7.770  -7.498  1.00 0.00 ? 10 PRO A HB3  2  
ATOM 938   H HG2  . PRO A 1 10 ? -11.452 -9.401  -5.607  1.00 0.00 ? 10 PRO A HG2  2  
ATOM 939   H HG3  . PRO A 1 10 ? -12.969 -9.828  -6.423  1.00 0.00 ? 10 PRO A HG3  2  
ATOM 940   H HD2  . PRO A 1 10 ? -10.570 -10.687 -7.306  1.00 0.00 ? 10 PRO A HD2  2  
ATOM 941   H HD3  . PRO A 1 10 ? -11.908 -10.321 -8.410  1.00 0.00 ? 10 PRO A HD3  2  
ATOM 942   N N    . LEU A 1 11 ? -9.029  -6.093  -7.319  1.00 0.00 ? 11 LEU A N    2  
ATOM 943   C CA   . LEU A 1 11 ? -7.949  -5.446  -6.568  1.00 0.00 ? 11 LEU A CA   2  
ATOM 944   C C    . LEU A 1 11 ? -8.447  -4.748  -5.309  1.00 0.00 ? 11 LEU A C    2  
ATOM 945   O O    . LEU A 1 11 ? -9.570  -4.969  -4.872  1.00 0.00 ? 11 LEU A O    2  
ATOM 946   C CB   . LEU A 1 11 ? -7.175  -4.481  -7.473  1.00 0.00 ? 11 LEU A CB   2  
ATOM 947   C CG   . LEU A 1 11 ? -8.010  -3.479  -8.287  1.00 0.00 ? 11 LEU A CG   2  
ATOM 948   C CD1  . LEU A 1 11 ? -8.364  -4.061  -9.647  1.00 0.00 ? 11 LEU A CD1  2  
ATOM 949   C CD2  . LEU A 1 11 ? -9.272  -3.068  -7.540  1.00 0.00 ? 11 LEU A CD2  2  
ATOM 950   H H    . LEU A 1 11 ? -9.072  -5.964  -8.289  1.00 0.00 ? 11 LEU A H    2  
ATOM 951   H HA   . LEU A 1 11 ? -7.268  -6.214  -6.250  1.00 0.00 ? 11 LEU A HA   2  
ATOM 952   H HB2  . LEU A 1 11 ? -6.485  -3.927  -6.859  1.00 0.00 ? 11 LEU A HB2  2  
ATOM 953   H HB3  . LEU A 1 11 ? -6.601  -5.079  -8.168  1.00 0.00 ? 11 LEU A HB3  2  
ATOM 954   H HG   . LEU A 1 11 ? -7.420  -2.589  -8.455  1.00 0.00 ? 11 LEU A HG   2  
ATOM 955   H HD11 . LEU A 1 11 ? -9.367  -4.461  -9.617  1.00 0.00 ? 11 LEU A HD11 2  
ATOM 956   H HD12 . LEU A 1 11 ? -7.669  -4.849  -9.893  1.00 0.00 ? 11 LEU A HD12 2  
ATOM 957   H HD13 . LEU A 1 11 ? -8.309  -3.284  -10.396 1.00 0.00 ? 11 LEU A HD13 2  
ATOM 958   H HD21 . LEU A 1 11 ? -9.002  -2.645  -6.583  1.00 0.00 ? 11 LEU A HD21 2  
ATOM 959   H HD22 . LEU A 1 11 ? -9.899  -3.934  -7.386  1.00 0.00 ? 11 LEU A HD22 2  
ATOM 960   H HD23 . LEU A 1 11 ? -9.811  -2.332  -8.119  1.00 0.00 ? 11 LEU A HD23 2  
ATOM 961   N N    . CYS A 1 12 ? -7.566  -3.938  -4.723  1.00 0.00 ? 12 CYS A N    2  
ATOM 962   C CA   . CYS A 1 12 ? -7.825  -3.215  -3.469  1.00 0.00 ? 12 CYS A CA   2  
ATOM 963   C C    . CYS A 1 12 ? -9.298  -3.112  -3.101  1.00 0.00 ? 12 CYS A C    2  
ATOM 964   O O    . CYS A 1 12 ? -9.852  -2.024  -2.942  1.00 0.00 ? 12 CYS A O    2  
ATOM 965   C CB   . CYS A 1 12 ? -7.233  -1.818  -3.532  1.00 0.00 ? 12 CYS A CB   2  
ATOM 966   S SG   . CYS A 1 12 ? -8.140  -0.658  -4.610  1.00 0.00 ? 12 CYS A SG   2  
ATOM 967   H H    . CYS A 1 12 ? -6.678  -3.858  -5.129  1.00 0.00 ? 12 CYS A H    2  
ATOM 968   H HA   . CYS A 1 12 ? -7.321  -3.756  -2.683  1.00 0.00 ? 12 CYS A HA   2  
ATOM 969   H HB2  . CYS A 1 12 ? -7.229  -1.405  -2.536  1.00 0.00 ? 12 CYS A HB2  2  
ATOM 970   H HB3  . CYS A 1 12 ? -6.222  -1.882  -3.891  1.00 0.00 ? 12 CYS A HB3  2  
ATOM 971   N N    . ARG A 1 13 ? -9.910  -4.258  -2.919  1.00 0.00 ? 13 ARG A N    2  
ATOM 972   C CA   . ARG A 1 13 ? -11.302 -4.317  -2.517  1.00 0.00 ? 13 ARG A CA   2  
ATOM 973   C C    . ARG A 1 13 ? -11.374 -4.536  -1.014  1.00 0.00 ? 13 ARG A C    2  
ATOM 974   O O    . ARG A 1 13 ? -12.165 -5.341  -0.522  1.00 0.00 ? 13 ARG A O    2  
ATOM 975   C CB   . ARG A 1 13 ? -12.036 -5.430  -3.266  1.00 0.00 ? 13 ARG A CB   2  
ATOM 976   C CG   . ARG A 1 13 ? -12.392 -5.054  -4.697  1.00 0.00 ? 13 ARG A CG   2  
ATOM 977   C CD   . ARG A 1 13 ? -13.833 -5.409  -5.029  1.00 0.00 ? 13 ARG A CD   2  
ATOM 978   N NE   . ARG A 1 13 ? -14.737 -4.286  -4.794  1.00 0.00 ? 13 ARG A NE   2  
ATOM 979   C CZ   . ARG A 1 13 ? -14.693 -3.143  -5.477  1.00 0.00 ? 13 ARG A CZ   2  
ATOM 980   N NH1  . ARG A 1 13 ? -13.806 -2.977  -6.449  1.00 0.00 ? 13 ARG A NH1  2  
ATOM 981   N NH2  . ARG A 1 13 ? -15.544 -2.167  -5.189  1.00 0.00 ? 13 ARG A NH2  2  
ATOM 982   H H    . ARG A 1 13 ? -9.398  -5.089  -3.033  1.00 0.00 ? 13 ARG A H    2  
ATOM 983   H HA   . ARG A 1 13 ? -11.758 -3.365  -2.755  1.00 0.00 ? 13 ARG A HA   2  
ATOM 984   H HB2  . ARG A 1 13 ? -11.407 -6.307  -3.291  1.00 0.00 ? 13 ARG A HB2  2  
ATOM 985   H HB3  . ARG A 1 13 ? -12.948 -5.664  -2.739  1.00 0.00 ? 13 ARG A HB3  2  
ATOM 986   H HG2  . ARG A 1 13 ? -12.259 -3.990  -4.821  1.00 0.00 ? 13 ARG A HG2  2  
ATOM 987   H HG3  . ARG A 1 13 ? -11.734 -5.581  -5.372  1.00 0.00 ? 13 ARG A HG3  2  
ATOM 988   H HD2  . ARG A 1 13 ? -13.889 -5.694  -6.069  1.00 0.00 ? 13 ARG A HD2  2  
ATOM 989   H HD3  . ARG A 1 13 ? -14.137 -6.241  -4.411  1.00 0.00 ? 13 ARG A HD3  2  
ATOM 990   H HE   . ARG A 1 13 ? -15.409 -4.386  -4.088  1.00 0.00 ? 13 ARG A HE   2  
ATOM 991   H HH11 . ARG A 1 13 ? -13.165 -3.710  -6.674  1.00 0.00 ? 13 ARG A HH11 2  
ATOM 992   H HH12 . ARG A 1 13 ? -13.778 -2.116  -6.958  1.00 0.00 ? 13 ARG A HH12 2  
ATOM 993   H HH21 . ARG A 1 13 ? -16.217 -2.289  -4.460  1.00 0.00 ? 13 ARG A HH21 2  
ATOM 994   H HH22 . ARG A 1 13 ? -15.510 -1.308  -5.699  1.00 0.00 ? 13 ARG A HH22 2  
ATOM 995   N N    . CYS A 1 14 ? -10.519 -3.813  -0.292  1.00 0.00 ? 14 CYS A N    2  
ATOM 996   C CA   . CYS A 1 14 ? -10.452 -3.917  1.151   1.00 0.00 ? 14 CYS A CA   2  
ATOM 997   C C    . CYS A 1 14 ? -10.571 -2.544  1.808   1.00 0.00 ? 14 CYS A C    2  
ATOM 998   O O    . CYS A 1 14 ? -9.676  -1.705  1.712   1.00 0.00 ? 14 CYS A O    2  
ATOM 999   C CB   . CYS A 1 14 ? -9.152  -4.629  1.572   1.00 0.00 ? 14 CYS A CB   2  
ATOM 1000  S SG   . CYS A 1 14 ? -7.712  -3.548  1.907   1.00 0.00 ? 14 CYS A SG   2  
ATOM 1001  H H    . CYS A 1 14 ? -9.914  -3.198  -0.748  1.00 0.00 ? 14 CYS A H    2  
ATOM 1002  H HA   . CYS A 1 14 ? -11.290 -4.518  1.471   1.00 0.00 ? 14 CYS A HA   2  
ATOM 1003  H HB2  . CYS A 1 14 ? -9.344  -5.190  2.472   1.00 0.00 ? 14 CYS A HB2  2  
ATOM 1004  H HB3  . CYS A 1 14 ? -8.868  -5.315  0.788   1.00 0.00 ? 14 CYS A HB3  2  
ATOM 1005  N N    . ASN A 1 15 ? -11.686 -2.333  2.479   1.00 0.00 ? 15 ASN A N    2  
ATOM 1006  C CA   . ASN A 1 15 ? -11.938 -1.077  3.172   1.00 0.00 ? 15 ASN A CA   2  
ATOM 1007  C C    . ASN A 1 15 ? -11.285 -1.119  4.534   1.00 0.00 ? 15 ASN A C    2  
ATOM 1008  O O    . ASN A 1 15 ? -10.708 -0.133  4.982   1.00 0.00 ? 15 ASN A O    2  
ATOM 1009  C CB   . ASN A 1 15 ? -13.439 -0.842  3.328   1.00 0.00 ? 15 ASN A CB   2  
ATOM 1010  C CG   . ASN A 1 15 ? -13.907 0.425   2.637   1.00 0.00 ? 15 ASN A CG   2  
ATOM 1011  O OD1  . ASN A 1 15 ? -14.987 0.459   2.047   1.00 0.00 ? 15 ASN A OD1  2  
ATOM 1012  N ND2  . ASN A 1 15 ? -13.097 1.477   2.709   1.00 0.00 ? 15 ASN A ND2  2  
ATOM 1013  H H    . ASN A 1 15 ? -12.356 -3.044  2.515   1.00 0.00 ? 15 ASN A H    2  
ATOM 1014  H HA   . ASN A 1 15 ? -11.503 -0.275  2.601   1.00 0.00 ? 15 ASN A HA   2  
ATOM 1015  H HB2  . ASN A 1 15 ? -13.969 -1.681  2.912   1.00 0.00 ? 15 ASN A HB2  2  
ATOM 1016  H HB3  . ASN A 1 15 ? -13.677 -0.762  4.380   1.00 0.00 ? 15 ASN A HB3  2  
ATOM 1017  H HD21 . ASN A 1 15 ? -12.253 1.380   3.199   1.00 0.00 ? 15 ASN A HD21 2  
ATOM 1018  H HD22 . ASN A 1 15 ? -13.375 2.305   2.266   1.00 0.00 ? 15 ASN A HD22 2  
ATOM 1019  N N    . LYS A 1 16 ? -11.400 -2.286  5.171   1.00 0.00 ? 16 LYS A N    2  
ATOM 1020  C CA   . LYS A 1 16 ? -10.852 -2.561  6.503   1.00 0.00 ? 16 LYS A CA   2  
ATOM 1021  C C    . LYS A 1 16 ? -9.753  -1.583  6.904   1.00 0.00 ? 16 LYS A C    2  
ATOM 1022  O O    . LYS A 1 16 ? -8.623  -1.977  7.195   1.00 0.00 ? 16 LYS A O    2  
ATOM 1023  C CB   . LYS A 1 16 ? -10.315 -3.993  6.553   1.00 0.00 ? 16 LYS A CB   2  
ATOM 1024  C CG   . LYS A 1 16 ? -9.795  -4.402  7.921   1.00 0.00 ? 16 LYS A CG   2  
ATOM 1025  C CD   . LYS A 1 16 ? -10.541 -5.610  8.464   1.00 0.00 ? 16 LYS A CD   2  
ATOM 1026  C CE   . LYS A 1 16 ? -10.384 -6.819  7.555   1.00 0.00 ? 16 LYS A CE   2  
ATOM 1027  N NZ   . LYS A 1 16 ? -9.946  -8.027  8.306   1.00 0.00 ? 16 LYS A NZ   2  
ATOM 1028  H H    . LYS A 1 16 ? -11.887 -2.999  4.722   1.00 0.00 ? 16 LYS A H    2  
ATOM 1029  H HA   . LYS A 1 16 ? -11.660 -2.474  7.211   1.00 0.00 ? 16 LYS A HA   2  
ATOM 1030  H HB2  . LYS A 1 16 ? -11.109 -4.671  6.274   1.00 0.00 ? 16 LYS A HB2  2  
ATOM 1031  H HB3  . LYS A 1 16 ? -9.507  -4.087  5.842   1.00 0.00 ? 16 LYS A HB3  2  
ATOM 1032  H HG2  . LYS A 1 16 ? -8.747  -4.646  7.839   1.00 0.00 ? 16 LYS A HG2  2  
ATOM 1033  H HG3  . LYS A 1 16 ? -9.921  -3.574  8.604   1.00 0.00 ? 16 LYS A HG3  2  
ATOM 1034  H HD2  . LYS A 1 16 ? -10.150 -5.853  9.440   1.00 0.00 ? 16 LYS A HD2  2  
ATOM 1035  H HD3  . LYS A 1 16 ? -11.590 -5.365  8.546   1.00 0.00 ? 16 LYS A HD3  2  
ATOM 1036  H HE2  . LYS A 1 16 ? -11.334 -7.025  7.084   1.00 0.00 ? 16 LYS A HE2  2  
ATOM 1037  H HE3  . LYS A 1 16 ? -9.649  -6.591  6.795   1.00 0.00 ? 16 LYS A HE3  2  
ATOM 1038  H HZ1  . LYS A 1 16 ? -8.918  -7.997  8.467   1.00 0.00 ? 16 LYS A HZ1  2  
ATOM 1039  H HZ2  . LYS A 1 16 ? -10.175 -8.887  7.768   1.00 0.00 ? 16 LYS A HZ2  2  
ATOM 1040  H HZ3  . LYS A 1 16 ? -10.428 -8.070  9.227   1.00 0.00 ? 16 LYS A HZ3  2  
ATOM 1041  N N    . MET A 1 17 ? -10.103 -0.308  6.916   1.00 0.00 ? 17 MET A N    2  
ATOM 1042  C CA   . MET A 1 17 ? -9.167  0.755   7.280   1.00 0.00 ? 17 MET A CA   2  
ATOM 1043  C C    . MET A 1 17 ? -8.864  0.735   8.769   1.00 0.00 ? 17 MET A C    2  
ATOM 1044  O O    . MET A 1 17 ? -9.021  1.733   9.474   1.00 0.00 ? 17 MET A O    2  
ATOM 1045  C CB   . MET A 1 17 ? -9.745  2.101   6.906   1.00 0.00 ? 17 MET A CB   2  
ATOM 1046  C CG   . MET A 1 17 ? -8.698  3.156   6.596   1.00 0.00 ? 17 MET A CG   2  
ATOM 1047  S SD   . MET A 1 17 ? -9.420  4.771   6.253   1.00 0.00 ? 17 MET A SD   2  
ATOM 1048  C CE   . MET A 1 17 ? -10.386 5.028   7.740   1.00 0.00 ? 17 MET A CE   2  
ATOM 1049  H H    . MET A 1 17 ? -11.025 -0.073  6.660   1.00 0.00 ? 17 MET A H    2  
ATOM 1050  H HA   . MET A 1 17 ? -8.251  0.596   6.735   1.00 0.00 ? 17 MET A HA   2  
ATOM 1051  H HB2  . MET A 1 17 ? -10.370 1.970   6.042   1.00 0.00 ? 17 MET A HB2  2  
ATOM 1052  H HB3  . MET A 1 17 ? -10.345 2.447   7.732   1.00 0.00 ? 17 MET A HB3  2  
ATOM 1053  H HG2  . MET A 1 17 ? -8.037  3.247   7.444   1.00 0.00 ? 17 MET A HG2  2  
ATOM 1054  H HG3  . MET A 1 17 ? -8.131  2.840   5.732   1.00 0.00 ? 17 MET A HG3  2  
ATOM 1055  H HE1  . MET A 1 17 ? -10.702 6.059   7.789   1.00 0.00 ? 17 MET A HE1  2  
ATOM 1056  H HE2  . MET A 1 17 ? -9.782  4.795   8.606   1.00 0.00 ? 17 MET A HE2  2  
ATOM 1057  H HE3  . MET A 1 17 ? -11.253 4.385   7.721   1.00 0.00 ? 17 MET A HE3  2  
ATOM 1058  N N    . LEU A 1 18 ? -8.430  -0.412  9.223   1.00 0.00 ? 18 LEU A N    2  
ATOM 1059  C CA   . LEU A 1 18 ? -8.090  -0.622  10.621  1.00 0.00 ? 18 LEU A CA   2  
ATOM 1060  C C    . LEU A 1 18 ? -7.231  -1.872  10.780  1.00 0.00 ? 18 LEU A C    2  
ATOM 1061  O O    . LEU A 1 18 ? -7.599  -2.811  11.485  1.00 0.00 ? 18 LEU A O    2  
ATOM 1062  C CB   . LEU A 1 18 ? -9.360  -0.743  11.460  1.00 0.00 ? 18 LEU A CB   2  
ATOM 1063  C CG   . LEU A 1 18 ? -10.505 -1.520  10.804  1.00 0.00 ? 18 LEU A CG   2  
ATOM 1064  C CD1  . LEU A 1 18 ? -10.363 -3.009  11.073  1.00 0.00 ? 18 LEU A CD1  2  
ATOM 1065  C CD2  . LEU A 1 18 ? -11.849 -1.013  11.304  1.00 0.00 ? 18 LEU A CD2  2  
ATOM 1066  H H    . LEU A 1 18 ? -8.339  -1.142  8.596   1.00 0.00 ? 18 LEU A H    2  
ATOM 1067  H HA   . LEU A 1 18 ? -7.522  0.232   10.954  1.00 0.00 ? 18 LEU A HA   2  
ATOM 1068  H HB2  . LEU A 1 18 ? -9.107  -1.232  12.388  1.00 0.00 ? 18 LEU A HB2  2  
ATOM 1069  H HB3  . LEU A 1 18 ? -9.713  0.253   11.681  1.00 0.00 ? 18 LEU A HB3  2  
ATOM 1070  H HG   . LEU A 1 18 ? -10.467 -1.369  9.735   1.00 0.00 ? 18 LEU A HG   2  
ATOM 1071  H HD11 . LEU A 1 18 ? -9.516  -3.395  10.526  1.00 0.00 ? 18 LEU A HD11 2  
ATOM 1072  H HD12 . LEU A 1 18 ? -11.259 -3.520  10.756  1.00 0.00 ? 18 LEU A HD12 2  
ATOM 1073  H HD13 . LEU A 1 18 ? -10.211 -3.171  12.130  1.00 0.00 ? 18 LEU A HD13 2  
ATOM 1074  H HD21 . LEU A 1 18 ? -11.842 -0.980  12.384  1.00 0.00 ? 18 LEU A HD21 2  
ATOM 1075  H HD22 . LEU A 1 18 ? -12.632 -1.677  10.969  1.00 0.00 ? 18 LEU A HD22 2  
ATOM 1076  H HD23 . LEU A 1 18 ? -12.029 -0.022  10.915  1.00 0.00 ? 18 LEU A HD23 2  
ATOM 1077  N N    . GLY A 1 19 ? -6.083  -1.870  10.114  1.00 0.00 ? 19 GLY A N    2  
ATOM 1078  C CA   . GLY A 1 19 ? -5.181  -3.004  10.184  1.00 0.00 ? 19 GLY A CA   2  
ATOM 1079  C C    . GLY A 1 19 ? -3.728  -2.587  10.283  1.00 0.00 ? 19 GLY A C    2  
ATOM 1080  O O    . GLY A 1 19 ? -3.333  -1.909  11.231  1.00 0.00 ? 19 GLY A O    2  
ATOM 1081  H H    . GLY A 1 19 ? -5.848  -1.091  9.569   1.00 0.00 ? 19 GLY A H    2  
ATOM 1082  H HA2  . GLY A 1 19 ? -5.434  -3.597  11.051  1.00 0.00 ? 19 GLY A HA2  2  
ATOM 1083  H HA3  . GLY A 1 19 ? -5.311  -3.608  9.298   1.00 0.00 ? 19 GLY A HA3  2  
ATOM 1084  N N    . ASP A 1 20 ? -2.928  -2.998  9.303   1.00 0.00 ? 20 ASP A N    2  
ATOM 1085  C CA   . ASP A 1 20 ? -1.510  -2.669  9.286   1.00 0.00 ? 20 ASP A CA   2  
ATOM 1086  C C    . ASP A 1 20 ? -1.285  -1.224  8.863   1.00 0.00 ? 20 ASP A C    2  
ATOM 1087  O O    . ASP A 1 20 ? -2.213  -0.529  8.451   1.00 0.00 ? 20 ASP A O    2  
ATOM 1088  C CB   . ASP A 1 20 ? -0.758  -3.598  8.333   1.00 0.00 ? 20 ASP A CB   2  
ATOM 1089  C CG   . ASP A 1 20 ? -1.323  -5.006  8.314   1.00 0.00 ? 20 ASP A CG   2  
ATOM 1090  O OD1  . ASP A 1 20 ? -1.326  -5.660  9.378   1.00 0.00 ? 20 ASP A OD1  2  
ATOM 1091  O OD2  . ASP A 1 20 ? -1.760  -5.456  7.234   1.00 0.00 ? 20 ASP A OD2  2  
ATOM 1092  H H    . ASP A 1 20 ? -3.297  -3.539  8.578   1.00 0.00 ? 20 ASP A H    2  
ATOM 1093  H HA   . ASP A 1 20 ? -1.126  -2.805  10.285  1.00 0.00 ? 20 ASP A HA   2  
ATOM 1094  H HB2  . ASP A 1 20 ? -0.810  -3.193  7.335   1.00 0.00 ? 20 ASP A HB2  2  
ATOM 1095  H HB3  . ASP A 1 20 ? 0.271   -3.648  8.638   1.00 0.00 ? 20 ASP A HB3  2  
ATOM 1096  N N    . LEU A 1 21 ? -0.039  -0.786  8.973   1.00 0.00 ? 21 LEU A N    2  
ATOM 1097  C CA   . LEU A 1 21 ? 0.343   0.564   8.612   1.00 0.00 ? 21 LEU A CA   2  
ATOM 1098  C C    . LEU A 1 21 ? 1.574   0.550   7.706   1.00 0.00 ? 21 LEU A C    2  
ATOM 1099  O O    . LEU A 1 21 ? 2.704   0.385   8.163   1.00 0.00 ? 21 LEU A O    2  
ATOM 1100  C CB   . LEU A 1 21 ? 0.597   1.368   9.886   1.00 0.00 ? 21 LEU A CB   2  
ATOM 1101  C CG   . LEU A 1 21 ? 1.960   1.166   10.552  1.00 0.00 ? 21 LEU A CG   2  
ATOM 1102  C CD1  . LEU A 1 21 ? 2.052   1.985   11.827  1.00 0.00 ? 21 LEU A CD1  2  
ATOM 1103  C CD2  . LEU A 1 21 ? 2.198   -0.309  10.847  1.00 0.00 ? 21 LEU A CD2  2  
ATOM 1104  H H    . LEU A 1 21 ? 0.644   -1.387  9.311   1.00 0.00 ? 21 LEU A H    2  
ATOM 1105  H HA   . LEU A 1 21 ? -0.481  1.011   8.072   1.00 0.00 ? 21 LEU A HA   2  
ATOM 1106  H HB2  . LEU A 1 21 ? 0.487   2.409   9.650   1.00 0.00 ? 21 LEU A HB2  2  
ATOM 1107  H HB3  . LEU A 1 21 ? -0.165  1.093   10.602  1.00 0.00 ? 21 LEU A HB3  2  
ATOM 1108  H HG   . LEU A 1 21 ? 2.735   1.507   9.885   1.00 0.00 ? 21 LEU A HG   2  
ATOM 1109  H HD11 . LEU A 1 21 ? 1.375   1.581   12.565  1.00 0.00 ? 21 LEU A HD11 2  
ATOM 1110  H HD12 . LEU A 1 21 ? 1.786   3.010   11.616  1.00 0.00 ? 21 LEU A HD12 2  
ATOM 1111  H HD13 . LEU A 1 21 ? 3.063   1.947   12.207  1.00 0.00 ? 21 LEU A HD13 2  
ATOM 1112  H HD21 . LEU A 1 21 ? 1.261   -0.781  11.101  1.00 0.00 ? 21 LEU A HD21 2  
ATOM 1113  H HD22 . LEU A 1 21 ? 2.886   -0.405  11.674  1.00 0.00 ? 21 LEU A HD22 2  
ATOM 1114  H HD23 . LEU A 1 21 ? 2.617   -0.790  9.975   1.00 0.00 ? 21 LEU A HD23 2  
ATOM 1115  N N    . ILE A 1 22 ? 1.345   0.707   6.412   1.00 0.00 ? 22 ILE A N    2  
ATOM 1116  C CA   . ILE A 1 22 ? 2.430   0.698   5.444   1.00 0.00 ? 22 ILE A CA   2  
ATOM 1117  C C    . ILE A 1 22 ? 2.923   2.109   5.153   1.00 0.00 ? 22 ILE A C    2  
ATOM 1118  O O    . ILE A 1 22 ? 2.133   3.045   5.058   1.00 0.00 ? 22 ILE A O    2  
ATOM 1119  C CB   . ILE A 1 22 ? 2.002   0.017   4.128   1.00 0.00 ? 22 ILE A CB   2  
ATOM 1120  C CG1  . ILE A 1 22 ? 2.985   0.334   3.001   1.00 0.00 ? 22 ILE A CG1  2  
ATOM 1121  C CG2  . ILE A 1 22 ? 0.600   0.440   3.731   1.00 0.00 ? 22 ILE A CG2  2  
ATOM 1122  C CD1  . ILE A 1 22 ? 2.557   1.496   2.122   1.00 0.00 ? 22 ILE A CD1  2  
ATOM 1123  H H    . ILE A 1 22 ? 0.425   0.817   6.098   1.00 0.00 ? 22 ILE A H    2  
ATOM 1124  H HA   . ILE A 1 22 ? 3.244   0.130   5.867   1.00 0.00 ? 22 ILE A HA   2  
ATOM 1125  H HB   . ILE A 1 22 ? 1.991   -1.045  4.299   1.00 0.00 ? 22 ILE A HB   2  
ATOM 1126  H HG12 . ILE A 1 22 ? 3.942   0.584   3.433   1.00 0.00 ? 22 ILE A HG12 2  
ATOM 1127  H HG13 . ILE A 1 22 ? 3.095   -0.537  2.372   1.00 0.00 ? 22 ILE A HG13 2  
ATOM 1128  H HG21 . ILE A 1 22 ? -0.116  -0.032  4.383   1.00 0.00 ? 22 ILE A HG21 2  
ATOM 1129  H HG22 . ILE A 1 22 ? 0.415   0.144   2.710   1.00 0.00 ? 22 ILE A HG22 2  
ATOM 1130  H HG23 . ILE A 1 22 ? 0.515   1.514   3.816   1.00 0.00 ? 22 ILE A HG23 2  
ATOM 1131  H HD11 . ILE A 1 22 ? 2.294   2.340   2.742   1.00 0.00 ? 22 ILE A HD11 2  
ATOM 1132  H HD12 . ILE A 1 22 ? 1.700   1.203   1.532   1.00 0.00 ? 22 ILE A HD12 2  
ATOM 1133  H HD13 . ILE A 1 22 ? 3.369   1.770   1.465   1.00 0.00 ? 22 ILE A HD13 2  
ATOM 1134  N N    . CYS A 1 23 ? 4.236   2.243   4.999   1.00 0.00 ? 23 CYS A N    2  
ATOM 1135  C CA   . CYS A 1 23 ? 4.842   3.536   4.702   1.00 0.00 ? 23 CYS A CA   2  
ATOM 1136  C C    . CYS A 1 23 ? 5.335   3.567   3.262   1.00 0.00 ? 23 CYS A C    2  
ATOM 1137  O O    . CYS A 1 23 ? 6.495   3.264   2.987   1.00 0.00 ? 23 CYS A O    2  
ATOM 1138  C CB   . CYS A 1 23 ? 6.002   3.817   5.659   1.00 0.00 ? 23 CYS A CB   2  
ATOM 1139  S SG   . CYS A 1 23 ? 6.475   5.575   5.754   1.00 0.00 ? 23 CYS A SG   2  
ATOM 1140  H H    . CYS A 1 23 ? 4.811   1.447   5.077   1.00 0.00 ? 23 CYS A H    2  
ATOM 1141  H HA   . CYS A 1 23 ? 4.084   4.296   4.830   1.00 0.00 ? 23 CYS A HA   2  
ATOM 1142  H HB2  . CYS A 1 23 ? 5.726   3.498   6.652   1.00 0.00 ? 23 CYS A HB2  2  
ATOM 1143  H HB3  . CYS A 1 23 ? 6.868   3.261   5.335   1.00 0.00 ? 23 CYS A HB3  2  
ATOM 1144  N N    . ALA A 1 24 ? 4.442   3.919   2.344   1.00 0.00 ? 24 ALA A N    2  
ATOM 1145  C CA   . ALA A 1 24 ? 4.786   3.969   0.933   1.00 0.00 ? 24 ALA A CA   2  
ATOM 1146  C C    . ALA A 1 24 ? 5.531   5.242   0.572   1.00 0.00 ? 24 ALA A C    2  
ATOM 1147  O O    . ALA A 1 24 ? 5.473   6.243   1.285   1.00 0.00 ? 24 ALA A O    2  
ATOM 1148  C CB   . ALA A 1 24 ? 3.539   3.829   0.079   1.00 0.00 ? 24 ALA A CB   2  
ATOM 1149  H H    . ALA A 1 24 ? 3.530   4.137   2.621   1.00 0.00 ? 24 ALA A H    2  
ATOM 1150  H HA   . ALA A 1 24 ? 5.421   3.130   0.722   1.00 0.00 ? 24 ALA A HA   2  
ATOM 1151  H HB1  . ALA A 1 24 ? 3.293   4.783   -0.362  1.00 0.00 ? 24 ALA A HB1  2  
ATOM 1152  H HB2  . ALA A 1 24 ? 2.722   3.496   0.697   1.00 0.00 ? 24 ALA A HB2  2  
ATOM 1153  H HB3  . ALA A 1 24 ? 3.717   3.106   -0.703  1.00 0.00 ? 24 ALA A HB3  2  
ATOM 1154  N N    . VAL A 1 25 ? 6.230   5.181   -0.552  1.00 0.00 ? 25 VAL A N    2  
ATOM 1155  C CA   . VAL A 1 25 ? 7.003   6.310   -1.049  1.00 0.00 ? 25 VAL A CA   2  
ATOM 1156  C C    . VAL A 1 25 ? 7.034   6.312   -2.570  1.00 0.00 ? 25 VAL A C    2  
ATOM 1157  O O    . VAL A 1 25 ? 7.033   5.251   -3.207  1.00 0.00 ? 25 VAL A O    2  
ATOM 1158  C CB   . VAL A 1 25 ? 8.448   6.288   -0.515  1.00 0.00 ? 25 VAL A CB   2  
ATOM 1159  C CG1  . VAL A 1 25 ? 9.155   7.597   -0.833  1.00 0.00 ? 25 VAL A CG1  2  
ATOM 1160  C CG2  . VAL A 1 25 ? 8.463   6.015   0.982   1.00 0.00 ? 25 VAL A CG2  2  
ATOM 1161  H H    . VAL A 1 25 ? 6.223   4.348   -1.064  1.00 0.00 ? 25 VAL A H    2  
ATOM 1162  H HA   . VAL A 1 25 ? 6.528   7.220   -0.711  1.00 0.00 ? 25 VAL A HA   2  
ATOM 1163  H HB   . VAL A 1 25 ? 8.981   5.490   -1.010  1.00 0.00 ? 25 VAL A HB   2  
ATOM 1164  H HG11 . VAL A 1 25 ? 9.332   7.662   -1.896  1.00 0.00 ? 25 VAL A HG11 2  
ATOM 1165  H HG12 . VAL A 1 25 ? 10.099  7.633   -0.307  1.00 0.00 ? 25 VAL A HG12 2  
ATOM 1166  H HG13 . VAL A 1 25 ? 8.537   8.426   -0.519  1.00 0.00 ? 25 VAL A HG13 2  
ATOM 1167  H HG21 . VAL A 1 25 ? 8.285   4.965   1.158   1.00 0.00 ? 25 VAL A HG21 2  
ATOM 1168  H HG22 . VAL A 1 25 ? 7.689   6.597   1.461   1.00 0.00 ? 25 VAL A HG22 2  
ATOM 1169  H HG23 . VAL A 1 25 ? 9.424   6.291   1.389   1.00 0.00 ? 25 VAL A HG23 2  
ATOM 1170  N N    . ILE A 1 26 ? 7.055   7.513   -3.141  1.00 0.00 ? 26 ILE A N    2  
ATOM 1171  C CA   . ILE A 1 26 ? 7.084   7.675   -4.592  1.00 0.00 ? 26 ILE A CA   2  
ATOM 1172  C C    . ILE A 1 26 ? 8.023   8.804   -5.002  1.00 0.00 ? 26 ILE A C    2  
ATOM 1173  O O    . ILE A 1 26 ? 7.601   9.948   -5.177  1.00 0.00 ? 26 ILE A O    2  
ATOM 1174  C CB   . ILE A 1 26 ? 5.685   7.966   -5.178  1.00 0.00 ? 26 ILE A CB   2  
ATOM 1175  C CG1  . ILE A 1 26 ? 4.663   8.230   -4.065  1.00 0.00 ? 26 ILE A CG1  2  
ATOM 1176  C CG2  . ILE A 1 26 ? 5.230   6.818   -6.065  1.00 0.00 ? 26 ILE A CG2  2  
ATOM 1177  C CD1  . ILE A 1 26 ? 4.229   6.985   -3.324  1.00 0.00 ? 26 ILE A CD1  2  
ATOM 1178  H H    . ILE A 1 26 ? 7.050   8.310   -2.570  1.00 0.00 ? 26 ILE A H    2  
ATOM 1179  H HA   . ILE A 1 26 ? 7.445   6.752   -5.020  1.00 0.00 ? 26 ILE A HA   2  
ATOM 1180  H HB   . ILE A 1 26 ? 5.767   8.846   -5.796  1.00 0.00 ? 26 ILE A HB   2  
ATOM 1181  H HG12 . ILE A 1 26 ? 5.094   8.908   -3.345  1.00 0.00 ? 26 ILE A HG12 2  
ATOM 1182  H HG13 . ILE A 1 26 ? 3.782   8.684   -4.497  1.00 0.00 ? 26 ILE A HG13 2  
ATOM 1183  H HG21 . ILE A 1 26 ? 5.573   5.883   -5.647  1.00 0.00 ? 26 ILE A HG21 2  
ATOM 1184  H HG22 . ILE A 1 26 ? 5.643   6.943   -7.054  1.00 0.00 ? 26 ILE A HG22 2  
ATOM 1185  H HG23 . ILE A 1 26 ? 4.153   6.814   -6.122  1.00 0.00 ? 26 ILE A HG23 2  
ATOM 1186  H HD11 . ILE A 1 26 ? 3.169   6.831   -3.467  1.00 0.00 ? 26 ILE A HD11 2  
ATOM 1187  H HD12 . ILE A 1 26 ? 4.438   7.101   -2.272  1.00 0.00 ? 26 ILE A HD12 2  
ATOM 1188  H HD13 . ILE A 1 26 ? 4.771   6.132   -3.706  1.00 0.00 ? 26 ILE A HD13 2  
ATOM 1189  N N    . GLY A 1 27 ? 9.294   8.470   -5.153  1.00 0.00 ? 27 GLY A N    2  
ATOM 1190  C CA   . GLY A 1 27 ? 10.295  9.447   -5.546  1.00 0.00 ? 27 GLY A CA   2  
ATOM 1191  C C    . GLY A 1 27 ? 10.574  10.455  -4.453  1.00 0.00 ? 27 GLY A C    2  
ATOM 1192  O O    . GLY A 1 27 ? 11.707  10.593  -3.992  1.00 0.00 ? 27 GLY A O    2  
ATOM 1193  H H    . GLY A 1 27 ? 9.553   7.552   -4.995  1.00 0.00 ? 27 GLY A H    2  
ATOM 1194  H HA2  . GLY A 1 27 ? 11.212  8.930   -5.787  1.00 0.00 ? 27 GLY A HA2  2  
ATOM 1195  H HA3  . GLY A 1 27 ? 9.947   9.970   -6.423  1.00 0.00 ? 27 GLY A HA3  2  
ATOM 1196  N N    . ASP A 1 28 ? 9.530   11.153  -4.041  1.00 0.00 ? 28 ASP A N    2  
ATOM 1197  C CA   . ASP A 1 28 ? 9.636   12.156  -2.994  1.00 0.00 ? 28 ASP A CA   2  
ATOM 1198  C C    . ASP A 1 28 ? 8.308   12.305  -2.261  1.00 0.00 ? 28 ASP A C    2  
ATOM 1199  O O    . ASP A 1 28 ? 8.032   13.344  -1.661  1.00 0.00 ? 28 ASP A O    2  
ATOM 1200  C CB   . ASP A 1 28 ? 10.060  13.503  -3.583  1.00 0.00 ? 28 ASP A CB   2  
ATOM 1201  C CG   . ASP A 1 28 ? 11.383  13.422  -4.320  1.00 0.00 ? 28 ASP A CG   2  
ATOM 1202  O OD1  . ASP A 1 28 ? 12.390  13.034  -3.691  1.00 0.00 ? 28 ASP A OD1  2  
ATOM 1203  O OD2  . ASP A 1 28 ? 11.412  13.747  -5.526  1.00 0.00 ? 28 ASP A OD2  2  
ATOM 1204  H H    . ASP A 1 28 ? 8.659   10.984  -4.453  1.00 0.00 ? 28 ASP A H    2  
ATOM 1205  H HA   . ASP A 1 28 ? 10.386  11.826  -2.291  1.00 0.00 ? 28 ASP A HA   2  
ATOM 1206  H HB2  . ASP A 1 28 ? 9.304   13.840  -4.277  1.00 0.00 ? 28 ASP A HB2  2  
ATOM 1207  H HB3  . ASP A 1 28 ? 10.157  14.224  -2.784  1.00 0.00 ? 28 ASP A HB3  2  
ATOM 1208  N N    . ALA A 1 29 ? 7.486   11.258  -2.312  1.00 0.00 ? 29 ALA A N    2  
ATOM 1209  C CA   . ALA A 1 29 ? 6.189   11.278  -1.649  1.00 0.00 ? 29 ALA A CA   2  
ATOM 1210  C C    . ALA A 1 29 ? 6.048   10.092  -0.707  1.00 0.00 ? 29 ALA A C    2  
ATOM 1211  O O    . ALA A 1 29 ? 5.385   9.105   -1.028  1.00 0.00 ? 29 ALA A O    2  
ATOM 1212  C CB   . ALA A 1 29 ? 5.067   11.281  -2.676  1.00 0.00 ? 29 ALA A CB   2  
ATOM 1213  H H    . ALA A 1 29 ? 7.760   10.450  -2.804  1.00 0.00 ? 29 ALA A H    2  
ATOM 1214  H HA   . ALA A 1 29 ? 6.122   12.191  -1.073  1.00 0.00 ? 29 ALA A HA   2  
ATOM 1215  H HB1  . ALA A 1 29 ? 4.250   10.670  -2.321  1.00 0.00 ? 29 ALA A HB1  2  
ATOM 1216  H HB2  . ALA A 1 29 ? 5.434   10.883  -3.612  1.00 0.00 ? 29 ALA A HB2  2  
ATOM 1217  H HB3  . ALA A 1 29 ? 4.720   12.292  -2.828  1.00 0.00 ? 29 ALA A HB3  2  
ATOM 1218  N N    . LYS A 1 30 ? 6.683   10.190  0.453   1.00 0.00 ? 30 LYS A N    2  
ATOM 1219  C CA   . LYS A 1 30 ? 6.636   9.120   1.440   1.00 0.00 ? 30 LYS A CA   2  
ATOM 1220  C C    . LYS A 1 30 ? 5.537   9.366   2.468   1.00 0.00 ? 30 LYS A C    2  
ATOM 1221  O O    . LYS A 1 30 ? 5.605   10.313  3.253   1.00 0.00 ? 30 LYS A O    2  
ATOM 1222  C CB   . LYS A 1 30 ? 7.989   8.978   2.143   1.00 0.00 ? 30 LYS A CB   2  
ATOM 1223  C CG   . LYS A 1 30 ? 8.619   10.305  2.535   1.00 0.00 ? 30 LYS A CG   2  
ATOM 1224  C CD   . LYS A 1 30 ? 9.542   10.826  1.445   1.00 0.00 ? 30 LYS A CD   2  
ATOM 1225  C CE   . LYS A 1 30 ? 10.933  10.225  1.560   1.00 0.00 ? 30 LYS A CE   2  
ATOM 1226  N NZ   . LYS A 1 30 ? 11.602  10.113  0.233   1.00 0.00 ? 30 LYS A NZ   2  
ATOM 1227  H H    . LYS A 1 30 ? 7.200   11.000  0.650   1.00 0.00 ? 30 LYS A H    2  
ATOM 1228  H HA   . LYS A 1 30 ? 6.420   8.203   0.913   1.00 0.00 ? 30 LYS A HA   2  
ATOM 1229  H HB2  . LYS A 1 30 ? 7.855   8.390   3.038   1.00 0.00 ? 30 LYS A HB2  2  
ATOM 1230  H HB3  . LYS A 1 30 ? 8.671   8.462   1.483   1.00 0.00 ? 30 LYS A HB3  2  
ATOM 1231  H HG2  . LYS A 1 30 ? 7.836   11.028  2.705   1.00 0.00 ? 30 LYS A HG2  2  
ATOM 1232  H HG3  . LYS A 1 30 ? 9.188   10.168  3.442   1.00 0.00 ? 30 LYS A HG3  2  
ATOM 1233  H HD2  . LYS A 1 30 ? 9.128   10.568  0.481   1.00 0.00 ? 30 LYS A HD2  2  
ATOM 1234  H HD3  . LYS A 1 30 ? 9.614   11.900  1.532   1.00 0.00 ? 30 LYS A HD3  2  
ATOM 1235  H HE2  . LYS A 1 30 ? 11.532  10.855  2.201   1.00 0.00 ? 30 LYS A HE2  2  
ATOM 1236  H HE3  . LYS A 1 30 ? 10.852  9.241   1.996   1.00 0.00 ? 30 LYS A HE3  2  
ATOM 1237  H HZ1  . LYS A 1 30 ? 11.230  10.835  -0.417  1.00 0.00 ? 30 LYS A HZ1  2  
ATOM 1238  H HZ2  . LYS A 1 30 ? 11.428  9.173   -0.176  1.00 0.00 ? 30 LYS A HZ2  2  
ATOM 1239  H HZ3  . LYS A 1 30 ? 12.628  10.250  0.337   1.00 0.00 ? 30 LYS A HZ3  2  
ATOM 1240  N N    . GLU A 1 31 ? 4.527   8.503   2.460   1.00 0.00 ? 31 GLU A N    2  
ATOM 1241  C CA   . GLU A 1 31 ? 3.411   8.616   3.391   1.00 0.00 ? 31 GLU A CA   2  
ATOM 1242  C C    . GLU A 1 31 ? 2.971   7.235   3.871   1.00 0.00 ? 31 GLU A C    2  
ATOM 1243  O O    . GLU A 1 31 ? 3.375   6.218   3.306   1.00 0.00 ? 31 GLU A O    2  
ATOM 1244  C CB   . GLU A 1 31 ? 2.237   9.345   2.732   1.00 0.00 ? 31 GLU A CB   2  
ATOM 1245  C CG   . GLU A 1 31 ? 1.874   10.654  3.415   1.00 0.00 ? 31 GLU A CG   2  
ATOM 1246  C CD   . GLU A 1 31 ? 1.336   10.447  4.817   1.00 0.00 ? 31 GLU A CD   2  
ATOM 1247  O OE1  . GLU A 1 31 ? 0.183   9.984   4.949   1.00 0.00 ? 31 GLU A OE1  2  
ATOM 1248  O OE2  . GLU A 1 31 ? 2.067   10.749  5.785   1.00 0.00 ? 31 GLU A OE2  2  
ATOM 1249  H H    . GLU A 1 31 ? 4.533   7.768   1.812   1.00 0.00 ? 31 GLU A H    2  
ATOM 1250  H HA   . GLU A 1 31 ? 3.746   9.188   4.244   1.00 0.00 ? 31 GLU A HA   2  
ATOM 1251  H HB2  . GLU A 1 31 ? 2.495   9.561   1.705   1.00 0.00 ? 31 GLU A HB2  2  
ATOM 1252  H HB3  . GLU A 1 31 ? 1.369   8.703   2.748   1.00 0.00 ? 31 GLU A HB3  2  
ATOM 1253  H HG2  . GLU A 1 31 ? 2.756   11.273  3.473   1.00 0.00 ? 31 GLU A HG2  2  
ATOM 1254  H HG3  . GLU A 1 31 ? 1.121   11.156  2.827   1.00 0.00 ? 31 GLU A HG3  2  
ATOM 1255  N N    . GLU A 1 32 ? 2.149   7.201   4.913   1.00 0.00 ? 32 GLU A N    2  
ATOM 1256  C CA   . GLU A 1 32 ? 1.667   5.937   5.458   1.00 0.00 ? 32 GLU A CA   2  
ATOM 1257  C C    . GLU A 1 32 ? 0.213   5.690   5.075   1.00 0.00 ? 32 GLU A C    2  
ATOM 1258  O O    . GLU A 1 32 ? -0.546  6.630   4.837   1.00 0.00 ? 32 GLU A O    2  
ATOM 1259  C CB   . GLU A 1 32 ? 1.811   5.922   6.981   1.00 0.00 ? 32 GLU A CB   2  
ATOM 1260  C CG   . GLU A 1 32 ? 3.099   5.275   7.464   1.00 0.00 ? 32 GLU A CG   2  
ATOM 1261  C CD   . GLU A 1 32 ? 2.939   4.585   8.805   1.00 0.00 ? 32 GLU A CD   2  
ATOM 1262  O OE1  . GLU A 1 32 ? 2.383   3.465   8.834   1.00 0.00 ? 32 GLU A OE1  2  
ATOM 1263  O OE2  . GLU A 1 32 ? 3.370   5.161   9.826   1.00 0.00 ? 32 GLU A OE2  2  
ATOM 1264  H H    . GLU A 1 32 ? 1.862   8.042   5.325   1.00 0.00 ? 32 GLU A H    2  
ATOM 1265  H HA   . GLU A 1 32 ? 2.276   5.150   5.043   1.00 0.00 ? 32 GLU A HA   2  
ATOM 1266  H HB2  . GLU A 1 32 ? 1.783   6.938   7.343   1.00 0.00 ? 32 GLU A HB2  2  
ATOM 1267  H HB3  . GLU A 1 32 ? 0.978   5.376   7.403   1.00 0.00 ? 32 GLU A HB3  2  
ATOM 1268  H HG2  . GLU A 1 32 ? 3.414   4.544   6.735   1.00 0.00 ? 32 GLU A HG2  2  
ATOM 1269  H HG3  . GLU A 1 32 ? 3.856   6.039   7.557   1.00 0.00 ? 32 GLU A HG3  2  
ATOM 1270  N N    . HIS A 1 33 ? -0.172  4.418   5.023   1.00 0.00 ? 33 HIS A N    2  
ATOM 1271  C CA   . HIS A 1 33 ? -1.542  4.050   4.678   1.00 0.00 ? 33 HIS A CA   2  
ATOM 1272  C C    . HIS A 1 33 ? -1.921  2.718   5.308   1.00 0.00 ? 33 HIS A C    2  
ATOM 1273  O O    . HIS A 1 33 ? -1.126  1.779   5.325   1.00 0.00 ? 33 HIS A O    2  
ATOM 1274  C CB   . HIS A 1 33 ? -1.735  3.959   3.158   1.00 0.00 ? 33 HIS A CB   2  
ATOM 1275  C CG   . HIS A 1 33 ? -0.704  4.684   2.350   1.00 0.00 ? 33 HIS A CG   2  
ATOM 1276  N ND1  . HIS A 1 33 ? 0.651   4.488   2.501   1.00 0.00 ? 33 HIS A ND1  2  
ATOM 1277  C CD2  . HIS A 1 33 ? -0.840  5.601   1.365   1.00 0.00 ? 33 HIS A CD2  2  
ATOM 1278  C CE1  . HIS A 1 33 ? 1.301   5.252   1.644   1.00 0.00 ? 33 HIS A CE1  2  
ATOM 1279  N NE2  . HIS A 1 33 ? 0.419   5.937   0.943   1.00 0.00 ? 33 HIS A NE2  2  
ATOM 1280  H H    . HIS A 1 33 ? 0.479   3.712   5.229   1.00 0.00 ? 33 HIS A H    2  
ATOM 1281  H HA   . HIS A 1 33 ? -2.195  4.816   5.068   1.00 0.00 ? 33 HIS A HA   2  
ATOM 1282  H HB2  . HIS A 1 33 ? -1.706  2.921   2.863   1.00 0.00 ? 33 HIS A HB2  2  
ATOM 1283  H HB3  . HIS A 1 33 ? -2.702  4.368   2.904   1.00 0.00 ? 33 HIS A HB3  2  
ATOM 1284  H HD1  . HIS A 1 33 ? 1.073   3.876   3.140   1.00 0.00 ? 33 HIS A HD1  2  
ATOM 1285  H HD2  . HIS A 1 33 ? -1.770  5.987   0.978   1.00 0.00 ? 33 HIS A HD2  2  
ATOM 1286  H HE1  . HIS A 1 33 ? 2.370   5.300   1.529   1.00 0.00 ? 33 HIS A HE1  2  
ATOM 1287  H HE2  . HIS A 1 33 ? 0.636   6.657   0.313   1.00 0.00 ? 33 HIS A HE2  2  
ATOM 1288  N N    . ARG A 1 34 ? -3.146  2.636   5.807   1.00 0.00 ? 34 ARG A N    2  
ATOM 1289  C CA   . ARG A 1 34 ? -3.635  1.409   6.418   1.00 0.00 ? 34 ARG A CA   2  
ATOM 1290  C C    . ARG A 1 34 ? -4.196  0.480   5.349   1.00 0.00 ? 34 ARG A C    2  
ATOM 1291  O O    . ARG A 1 34 ? -4.090  -0.741  5.452   1.00 0.00 ? 34 ARG A O    2  
ATOM 1292  C CB   . ARG A 1 34 ? -4.712  1.714   7.456   1.00 0.00 ? 34 ARG A CB   2  
ATOM 1293  C CG   . ARG A 1 34 ? -4.215  2.548   8.625   1.00 0.00 ? 34 ARG A CG   2  
ATOM 1294  C CD   . ARG A 1 34 ? -5.066  2.328   9.865   1.00 0.00 ? 34 ARG A CD   2  
ATOM 1295  N NE   . ARG A 1 34 ? -4.531  1.265   10.712  1.00 0.00 ? 34 ARG A NE   2  
ATOM 1296  C CZ   . ARG A 1 34 ? -3.704  1.470   11.735  1.00 0.00 ? 34 ARG A CZ   2  
ATOM 1297  N NH1  . ARG A 1 34 ? -3.306  2.699   12.045  1.00 0.00 ? 34 ARG A NH1  2  
ATOM 1298  N NH2  . ARG A 1 34 ? -3.271  0.442   12.451  1.00 0.00 ? 34 ARG A NH2  2  
ATOM 1299  H H    . ARG A 1 34 ? -3.738  3.415   5.754   1.00 0.00 ? 34 ARG A H    2  
ATOM 1300  H HA   . ARG A 1 34 ? -2.802  0.923   6.902   1.00 0.00 ? 34 ARG A HA   2  
ATOM 1301  H HB2  . ARG A 1 34 ? -5.516  2.250   6.974   1.00 0.00 ? 34 ARG A HB2  2  
ATOM 1302  H HB3  . ARG A 1 34 ? -5.093  0.781   7.843   1.00 0.00 ? 34 ARG A HB3  2  
ATOM 1303  H HG2  . ARG A 1 34 ? -3.196  2.270   8.846   1.00 0.00 ? 34 ARG A HG2  2  
ATOM 1304  H HG3  . ARG A 1 34 ? -4.254  3.592   8.353   1.00 0.00 ? 34 ARG A HG3  2  
ATOM 1305  H HD2  . ARG A 1 34 ? -5.102  3.246   10.430  1.00 0.00 ? 34 ARG A HD2  2  
ATOM 1306  H HD3  . ARG A 1 34 ? -6.065  2.059   9.555   1.00 0.00 ? 34 ARG A HD3  2  
ATOM 1307  H HE   . ARG A 1 34 ? -4.803  0.345   10.509  1.00 0.00 ? 34 ARG A HE   2  
ATOM 1308  H HH11 . ARG A 1 34 ? -3.625  3.480   11.509  1.00 0.00 ? 34 ARG A HH11 2  
ATOM 1309  H HH12 . ARG A 1 34 ? -2.686  2.843   12.815  1.00 0.00 ? 34 ARG A HH12 2  
ATOM 1310  H HH21 . ARG A 1 34 ? -3.567  -0.486  12.221  1.00 0.00 ? 34 ARG A HH21 2  
ATOM 1311  H HH22 . ARG A 1 34 ? -2.649  0.594   13.219  1.00 0.00 ? 34 ARG A HH22 2  
ATOM 1312  N N    . ASN A 1 35 ? -4.788  1.074   4.316   1.00 0.00 ? 35 ASN A N    2  
ATOM 1313  C CA   . ASN A 1 35 ? -5.360  0.306   3.219   1.00 0.00 ? 35 ASN A CA   2  
ATOM 1314  C C    . ASN A 1 35 ? -4.290  -0.020  2.182   1.00 0.00 ? 35 ASN A C    2  
ATOM 1315  O O    . ASN A 1 35 ? -4.403  0.356   1.014   1.00 0.00 ? 35 ASN A O    2  
ATOM 1316  C CB   . ASN A 1 35 ? -6.512  1.075   2.565   1.00 0.00 ? 35 ASN A CB   2  
ATOM 1317  C CG   . ASN A 1 35 ? -7.769  1.076   3.414   1.00 0.00 ? 35 ASN A CG   2  
ATOM 1318  O OD1  . ASN A 1 35 ? -8.372  2.123   3.647   1.00 0.00 ? 35 ASN A OD1  2  
ATOM 1319  N ND2  . ASN A 1 35 ? -8.174  -0.103  3.877   1.00 0.00 ? 35 ASN A ND2  2  
ATOM 1320  H H    . ASN A 1 35 ? -4.836  2.052   4.291   1.00 0.00 ? 35 ASN A H    2  
ATOM 1321  H HA   . ASN A 1 35 ? -5.740  -0.618  3.628   1.00 0.00 ? 35 ASN A HA   2  
ATOM 1322  H HB2  . ASN A 1 35 ? -6.207  2.099   2.406   1.00 0.00 ? 35 ASN A HB2  2  
ATOM 1323  H HB3  . ASN A 1 35 ? -6.742  0.620   1.613   1.00 0.00 ? 35 ASN A HB3  2  
ATOM 1324  H HD21 . ASN A 1 35 ? -7.649  -0.896  3.649   1.00 0.00 ? 35 ASN A HD21 2  
ATOM 1325  H HD22 . ASN A 1 35 ? -8.984  -0.128  4.429   1.00 0.00 ? 35 ASN A HD22 2  
ATOM 1326  N N    . MET A 1 36 ? -3.253  -0.727  2.621   1.00 0.00 ? 36 MET A N    2  
ATOM 1327  C CA   . MET A 1 36 ? -2.157  -1.117  1.744   1.00 0.00 ? 36 MET A CA   2  
ATOM 1328  C C    . MET A 1 36 ? -2.688  -1.684  0.433   1.00 0.00 ? 36 MET A C    2  
ATOM 1329  O O    . MET A 1 36 ? -2.045  -1.567  -0.610  1.00 0.00 ? 36 MET A O    2  
ATOM 1330  C CB   . MET A 1 36 ? -1.268  -2.143  2.447   1.00 0.00 ? 36 MET A CB   2  
ATOM 1331  C CG   . MET A 1 36 ? -0.116  -2.646  1.593   1.00 0.00 ? 36 MET A CG   2  
ATOM 1332  S SD   . MET A 1 36 ? 0.538   -4.224  2.171   1.00 0.00 ? 36 MET A SD   2  
ATOM 1333  C CE   . MET A 1 36 ? -0.851  -5.305  1.842   1.00 0.00 ? 36 MET A CE   2  
ATOM 1334  H H    . MET A 1 36 ? -3.225  -0.996  3.560   1.00 0.00 ? 36 MET A H    2  
ATOM 1335  H HA   . MET A 1 36 ? -1.570  -0.234  1.525   1.00 0.00 ? 36 MET A HA   2  
ATOM 1336  H HB2  . MET A 1 36 ? -0.858  -1.692  3.339   1.00 0.00 ? 36 MET A HB2  2  
ATOM 1337  H HB3  . MET A 1 36 ? -1.876  -2.990  2.730   1.00 0.00 ? 36 MET A HB3  2  
ATOM 1338  H HG2  . MET A 1 36 ? -0.464  -2.769  0.577   1.00 0.00 ? 36 MET A HG2  2  
ATOM 1339  H HG3  . MET A 1 36 ? 0.677   -1.913  1.614   1.00 0.00 ? 36 MET A HG3  2  
ATOM 1340  H HE1  . MET A 1 36 ? -1.370  -4.966  0.957   1.00 0.00 ? 36 MET A HE1  2  
ATOM 1341  H HE2  . MET A 1 36 ? -1.527  -5.290  2.684   1.00 0.00 ? 36 MET A HE2  2  
ATOM 1342  H HE3  . MET A 1 36 ? -0.493  -6.313  1.685   1.00 0.00 ? 36 MET A HE3  2  
ATOM 1343  N N    . CYS A 1 37 ? -3.875  -2.284  0.485   1.00 0.00 ? 37 CYS A N    2  
ATOM 1344  C CA   . CYS A 1 37 ? -4.478  -2.841  -0.715  1.00 0.00 ? 37 CYS A CA   2  
ATOM 1345  C C    . CYS A 1 37 ? -4.838  -1.716  -1.678  1.00 0.00 ? 37 CYS A C    2  
ATOM 1346  O O    . CYS A 1 37 ? -4.527  -1.780  -2.866  1.00 0.00 ? 37 CYS A O    2  
ATOM 1347  C CB   . CYS A 1 37 ? -5.708  -3.701  -0.375  1.00 0.00 ? 37 CYS A CB   2  
ATOM 1348  S SG   . CYS A 1 37 ? -7.208  -2.774  0.095   1.00 0.00 ? 37 CYS A SG   2  
ATOM 1349  H H    . CYS A 1 37 ? -4.353  -2.339  1.340   1.00 0.00 ? 37 CYS A H    2  
ATOM 1350  H HA   . CYS A 1 37 ? -3.736  -3.465  -1.188  1.00 0.00 ? 37 CYS A HA   2  
ATOM 1351  H HB2  . CYS A 1 37 ? -5.959  -4.302  -1.236  1.00 0.00 ? 37 CYS A HB2  2  
ATOM 1352  H HB3  . CYS A 1 37 ? -5.457  -4.356  0.448   1.00 0.00 ? 37 CYS A HB3  2  
ATOM 1353  N N    . ALA A 1 38 ? -5.460  -0.669  -1.145  1.00 0.00 ? 38 ALA A N    2  
ATOM 1354  C CA   . ALA A 1 38 ? -5.835  0.494   -1.945  1.00 0.00 ? 38 ALA A CA   2  
ATOM 1355  C C    . ALA A 1 38 ? -4.607  1.159   -2.545  1.00 0.00 ? 38 ALA A C    2  
ATOM 1356  O O    . ALA A 1 38 ? -4.708  1.914   -3.512  1.00 0.00 ? 38 ALA A O    2  
ATOM 1357  C CB   . ALA A 1 38 ? -6.625  1.485   -1.103  1.00 0.00 ? 38 ALA A CB   2  
ATOM 1358  H H    . ALA A 1 38 ? -5.653  -0.671  -0.185  1.00 0.00 ? 38 ALA A H    2  
ATOM 1359  H HA   . ALA A 1 38 ? -6.464  0.160   -2.750  1.00 0.00 ? 38 ALA A HA   2  
ATOM 1360  H HB1  . ALA A 1 38 ? -7.437  0.972   -0.610  1.00 0.00 ? 38 ALA A HB1  2  
ATOM 1361  H HB2  . ALA A 1 38 ? -7.025  2.260   -1.741  1.00 0.00 ? 38 ALA A HB2  2  
ATOM 1362  H HB3  . ALA A 1 38 ? -5.976  1.927   -0.362  1.00 0.00 ? 38 ALA A HB3  2  
ATOM 1363  N N    . LEU A 1 39 ? -3.448  0.872   -1.971  1.00 0.00 ? 39 LEU A N    2  
ATOM 1364  C CA   . LEU A 1 39 ? -2.203  1.440   -2.457  1.00 0.00 ? 39 LEU A CA   2  
ATOM 1365  C C    . LEU A 1 39 ? -1.670  0.619   -3.614  1.00 0.00 ? 39 LEU A C    2  
ATOM 1366  O O    . LEU A 1 39 ? -1.236  1.157   -4.627  1.00 0.00 ? 39 LEU A O    2  
ATOM 1367  C CB   . LEU A 1 39 ? -1.172  1.476   -1.326  1.00 0.00 ? 39 LEU A CB   2  
ATOM 1368  C CG   . LEU A 1 39 ? -0.650  2.864   -0.932  1.00 0.00 ? 39 LEU A CG   2  
ATOM 1369  C CD1  . LEU A 1 39 ? 0.806   2.778   -0.512  1.00 0.00 ? 39 LEU A CD1  2  
ATOM 1370  C CD2  . LEU A 1 39 ? -0.817  3.873   -2.064  1.00 0.00 ? 39 LEU A CD2  2  
ATOM 1371  H H    . LEU A 1 39 ? -3.428  0.262   -1.204  1.00 0.00 ? 39 LEU A H    2  
ATOM 1372  H HA   . LEU A 1 39 ? -2.404  2.441   -2.799  1.00 0.00 ? 39 LEU A HA   2  
ATOM 1373  H HB2  . LEU A 1 39 ? -1.624  1.023   -0.459  1.00 0.00 ? 39 LEU A HB2  2  
ATOM 1374  H HB3  . LEU A 1 39 ? -0.325  0.869   -1.614  1.00 0.00 ? 39 LEU A HB3  2  
ATOM 1375  H HG   . LEU A 1 39 ? -1.218  3.217   -0.085  1.00 0.00 ? 39 LEU A HG   2  
ATOM 1376  H HD11 . LEU A 1 39 ? 1.358   3.588   -0.964  1.00 0.00 ? 39 LEU A HD11 2  
ATOM 1377  H HD12 . LEU A 1 39 ? 1.222   1.835   -0.837  1.00 0.00 ? 39 LEU A HD12 2  
ATOM 1378  H HD13 . LEU A 1 39 ? 0.875   2.852   0.562   1.00 0.00 ? 39 LEU A HD13 2  
ATOM 1379  H HD21 . LEU A 1 39 ? -0.059  4.638   -1.981  1.00 0.00 ? 39 LEU A HD21 2  
ATOM 1380  H HD22 . LEU A 1 39 ? -1.795  4.328   -2.000  1.00 0.00 ? 39 LEU A HD22 2  
ATOM 1381  H HD23 . LEU A 1 39 ? -0.717  3.370   -3.015  1.00 0.00 ? 39 LEU A HD23 2  
ATOM 1382  N N    . CYS A 1 40 ? -1.714  -0.690  -3.450  1.00 0.00 ? 40 CYS A N    2  
ATOM 1383  C CA   . CYS A 1 40 ? -1.239  -1.601  -4.476  1.00 0.00 ? 40 CYS A CA   2  
ATOM 1384  C C    . CYS A 1 40 ? -2.082  -1.468  -5.736  1.00 0.00 ? 40 CYS A C    2  
ATOM 1385  O O    . CYS A 1 40 ? -1.583  -1.627  -6.849  1.00 0.00 ? 40 CYS A O    2  
ATOM 1386  C CB   . CYS A 1 40 ? -1.270  -3.043  -3.964  1.00 0.00 ? 40 CYS A CB   2  
ATOM 1387  S SG   . CYS A 1 40 ? -2.897  -3.860  -4.093  1.00 0.00 ? 40 CYS A SG   2  
ATOM 1388  H H    . CYS A 1 40 ? -2.077  -1.052  -2.618  1.00 0.00 ? 40 CYS A H    2  
ATOM 1389  H HA   . CYS A 1 40 ? -0.221  -1.333  -4.709  1.00 0.00 ? 40 CYS A HA   2  
ATOM 1390  H HB2  . CYS A 1 40 ? -0.566  -3.632  -4.531  1.00 0.00 ? 40 CYS A HB2  2  
ATOM 1391  H HB3  . CYS A 1 40 ? -0.981  -3.052  -2.923  1.00 0.00 ? 40 CYS A HB3  2  
ATOM 1392  N N    . CYS A 1 41 ? -3.366  -1.185  -5.554  1.00 0.00 ? 41 CYS A N    2  
ATOM 1393  C CA   . CYS A 1 41 ? -4.269  -1.042  -6.684  1.00 0.00 ? 41 CYS A CA   2  
ATOM 1394  C C    . CYS A 1 41 ? -4.199  0.361   -7.278  1.00 0.00 ? 41 CYS A C    2  
ATOM 1395  O O    . CYS A 1 41 ? -4.329  0.546   -8.489  1.00 0.00 ? 41 CYS A O    2  
ATOM 1396  C CB   . CYS A 1 41 ? -5.697  -1.348  -6.249  1.00 0.00 ? 41 CYS A CB   2  
ATOM 1397  S SG   . CYS A 1 41 ? -6.697  0.110   -5.801  1.00 0.00 ? 41 CYS A SG   2  
ATOM 1398  H H    . CYS A 1 41 ? -3.718  -1.076  -4.637  1.00 0.00 ? 41 CYS A H    2  
ATOM 1399  H HA   . CYS A 1 41 ? -3.978  -1.762  -7.432  1.00 0.00 ? 41 CYS A HA   2  
ATOM 1400  H HB2  . CYS A 1 41 ? -6.201  -1.853  -7.051  1.00 0.00 ? 41 CYS A HB2  2  
ATOM 1401  H HB3  . CYS A 1 41 ? -5.662  -1.998  -5.394  1.00 0.00 ? 41 CYS A HB3  2  
ATOM 1402  N N    . GLU A 1 42 ? -4.042  1.346   -6.404  1.00 0.00 ? 42 GLU A N    2  
ATOM 1403  C CA   . GLU A 1 42 ? -4.009  2.748   -6.823  1.00 0.00 ? 42 GLU A CA   2  
ATOM 1404  C C    . GLU A 1 42 ? -2.592  3.317   -6.911  1.00 0.00 ? 42 GLU A C    2  
ATOM 1405  O O    . GLU A 1 42 ? -2.418  4.534   -6.971  1.00 0.00 ? 42 GLU A O    2  
ATOM 1406  C CB   . GLU A 1 42 ? -4.840  3.595   -5.858  1.00 0.00 ? 42 GLU A CB   2  
ATOM 1407  C CG   . GLU A 1 42 ? -5.585  4.733   -6.536  1.00 0.00 ? 42 GLU A CG   2  
ATOM 1408  C CD   . GLU A 1 42 ? -7.053  4.421   -6.752  1.00 0.00 ? 42 GLU A CD   2  
ATOM 1409  O OE1  . GLU A 1 42 ? -7.831  4.530   -5.782  1.00 0.00 ? 42 GLU A OE1  2  
ATOM 1410  O OE2  . GLU A 1 42 ? -7.423  4.069   -7.892  1.00 0.00 ? 42 GLU A OE2  2  
ATOM 1411  H H    . GLU A 1 42 ? -3.982  1.125   -5.448  1.00 0.00 ? 42 GLU A H    2  
ATOM 1412  H HA   . GLU A 1 42 ? -4.461  2.804   -7.801  1.00 0.00 ? 42 GLU A HA   2  
ATOM 1413  H HB2  . GLU A 1 42 ? -5.564  2.958   -5.371  1.00 0.00 ? 42 GLU A HB2  2  
ATOM 1414  H HB3  . GLU A 1 42 ? -4.184  4.016   -5.111  1.00 0.00 ? 42 GLU A HB3  2  
ATOM 1415  H HG2  . GLU A 1 42 ? -5.508  5.615   -5.917  1.00 0.00 ? 42 GLU A HG2  2  
ATOM 1416  H HG3  . GLU A 1 42 ? -5.127  4.926   -7.494  1.00 0.00 ? 42 GLU A HG3  2  
ATOM 1417  N N    . HIS A 1 43 ? -1.581  2.455   -6.929  1.00 0.00 ? 43 HIS A N    2  
ATOM 1418  C CA   . HIS A 1 43 ? -0.201  2.926   -7.021  1.00 0.00 ? 43 HIS A CA   2  
ATOM 1419  C C    . HIS A 1 43 ? 0.157   3.282   -8.460  1.00 0.00 ? 43 HIS A C    2  
ATOM 1420  O O    . HIS A 1 43 ? -0.510  2.848   -9.400  1.00 0.00 ? 43 HIS A O    2  
ATOM 1421  C CB   . HIS A 1 43 ? 0.780   1.877   -6.494  1.00 0.00 ? 43 HIS A CB   2  
ATOM 1422  C CG   . HIS A 1 43 ? 0.681   0.544   -7.174  1.00 0.00 ? 43 HIS A CG   2  
ATOM 1423  N ND1  . HIS A 1 43 ? 0.203   0.373   -8.459  1.00 0.00 ? 43 HIS A ND1  2  
ATOM 1424  C CD2  . HIS A 1 43 ? 1.024   -0.688  -6.739  1.00 0.00 ? 43 HIS A CD2  2  
ATOM 1425  C CE1  . HIS A 1 43 ? 0.260   -0.906  -8.781  1.00 0.00 ? 43 HIS A CE1  2  
ATOM 1426  N NE2  . HIS A 1 43 ? 0.756   -1.572  -7.756  1.00 0.00 ? 43 HIS A NE2  2  
ATOM 1427  H H    . HIS A 1 43 ? -1.764  1.494   -6.881  1.00 0.00 ? 43 HIS A H    2  
ATOM 1428  H HA   . HIS A 1 43 ? -0.119  3.817   -6.415  1.00 0.00 ? 43 HIS A HA   2  
ATOM 1429  H HB2  . HIS A 1 43 ? 1.788   2.241   -6.636  1.00 0.00 ? 43 HIS A HB2  2  
ATOM 1430  H HB3  . HIS A 1 43 ? 0.607   1.728   -5.440  1.00 0.00 ? 43 HIS A HB3  2  
ATOM 1431  H HD1  . HIS A 1 43 ? -0.133  1.080   -9.046  1.00 0.00 ? 43 HIS A HD1  2  
ATOM 1432  H HD2  . HIS A 1 43 ? 1.428   -0.932  -5.767  1.00 0.00 ? 43 HIS A HD2  2  
ATOM 1433  H HE1  . HIS A 1 43 ? -0.045  -1.334  -9.724  1.00 0.00 ? 43 HIS A HE1  2  
ATOM 1434  H HE2  . HIS A 1 43 ? 0.778   -2.548  -7.680  1.00 0.00 ? 43 HIS A HE2  2  
ATOM 1435  N N    . PRO A 1 44 ? 1.224   4.073   -8.653  1.00 0.00 ? 44 PRO A N    2  
ATOM 1436  C CA   . PRO A 1 44 ? 1.673   4.479   -9.987  1.00 0.00 ? 44 PRO A CA   2  
ATOM 1437  C C    . PRO A 1 44 ? 2.128   3.285   -10.819 1.00 0.00 ? 44 PRO A C    2  
ATOM 1438  O O    . PRO A 1 44 ? 1.954   3.260   -12.037 1.00 0.00 ? 44 PRO A O    2  
ATOM 1439  C CB   . PRO A 1 44 ? 2.857   5.417   -9.709  1.00 0.00 ? 44 PRO A CB   2  
ATOM 1440  C CG   . PRO A 1 44 ? 2.731   5.796   -8.271  1.00 0.00 ? 44 PRO A CG   2  
ATOM 1441  C CD   . PRO A 1 44 ? 2.078   4.629   -7.593  1.00 0.00 ? 44 PRO A CD   2  
ATOM 1442  H HA   . PRO A 1 44 ? 0.901   5.014   -10.518 1.00 0.00 ? 44 PRO A HA   2  
ATOM 1443  H HB2  . PRO A 1 44 ? 3.783   4.894   -9.898  1.00 0.00 ? 44 PRO A HB2  2  
ATOM 1444  H HB3  . PRO A 1 44 ? 2.790   6.282   -10.350 1.00 0.00 ? 44 PRO A HB3  2  
ATOM 1445  H HG2  . PRO A 1 44 ? 3.711   5.973   -7.852  1.00 0.00 ? 44 PRO A HG2  2  
ATOM 1446  H HG3  . PRO A 1 44 ? 2.116   6.678   -8.176  1.00 0.00 ? 44 PRO A HG3  2  
ATOM 1447  H HD2  . PRO A 1 44 ? 2.818   3.909   -7.275  1.00 0.00 ? 44 PRO A HD2  2  
ATOM 1448  H HD3  . PRO A 1 44 ? 1.485   4.960   -6.753  1.00 0.00 ? 44 PRO A HD3  2  
ATOM 1449  N N    . GLY A 1 45 ? 2.712   2.297   -10.148 1.00 0.00 ? 45 GLY A N    2  
ATOM 1450  C CA   . GLY A 1 45 ? 3.186   1.109   -10.833 1.00 0.00 ? 45 GLY A CA   2  
ATOM 1451  C C    . GLY A 1 45 ? 4.126   0.284   -9.977  1.00 0.00 ? 45 GLY A C    2  
ATOM 1452  O O    . GLY A 1 45 ? 5.175   -0.162  -10.446 1.00 0.00 ? 45 GLY A O    2  
ATOM 1453  H H    . GLY A 1 45 ? 2.821   2.375   -9.178  1.00 0.00 ? 45 GLY A H    2  
ATOM 1454  H HA2  . GLY A 1 45 ? 2.335   0.500   -11.104 1.00 0.00 ? 45 GLY A HA2  2  
ATOM 1455  H HA3  . GLY A 1 45 ? 3.703   1.408   -11.733 1.00 0.00 ? 45 GLY A HA3  2  
ATOM 1456  N N    . GLY A 1 46 ? 3.752   0.081   -8.717  1.00 0.00 ? 46 GLY A N    2  
ATOM 1457  C CA   . GLY A 1 46 ? 4.580   -0.693  -7.809  1.00 0.00 ? 46 GLY A CA   2  
ATOM 1458  C C    . GLY A 1 46 ? 5.720   0.115   -7.227  1.00 0.00 ? 46 GLY A C    2  
ATOM 1459  O O    . GLY A 1 46 ? 6.881   -0.286  -7.311  1.00 0.00 ? 46 GLY A O    2  
ATOM 1460  H H    . GLY A 1 46 ? 2.907   0.463   -8.400  1.00 0.00 ? 46 GLY A H    2  
ATOM 1461  H HA2  . GLY A 1 46 ? 3.964   -1.056  -6.998  1.00 0.00 ? 46 GLY A HA2  2  
ATOM 1462  H HA3  . GLY A 1 46 ? 4.988   -1.539  -8.341  1.00 0.00 ? 46 GLY A HA3  2  
ATOM 1463  N N    . PHE A 1 47 ? 5.387   1.255   -6.630  1.00 0.00 ? 47 PHE A N    2  
ATOM 1464  C CA   . PHE A 1 47 ? 6.387   2.125   -6.022  1.00 0.00 ? 47 PHE A CA   2  
ATOM 1465  C C    . PHE A 1 47 ? 7.103   1.388   -4.881  1.00 0.00 ? 47 PHE A C    2  
ATOM 1466  O O    . PHE A 1 47 ? 7.669   0.317   -5.101  1.00 0.00 ? 47 PHE A O    2  
ATOM 1467  C CB   . PHE A 1 47 ? 5.719   3.415   -5.528  1.00 0.00 ? 47 PHE A CB   2  
ATOM 1468  C CG   . PHE A 1 47 ? 4.408   3.193   -4.821  1.00 0.00 ? 47 PHE A CG   2  
ATOM 1469  C CD1  . PHE A 1 47 ? 4.155   2.012   -4.134  1.00 0.00 ? 47 PHE A CD1  2  
ATOM 1470  C CD2  . PHE A 1 47 ? 3.423   4.168   -4.847  1.00 0.00 ? 47 PHE A CD2  2  
ATOM 1471  C CE1  . PHE A 1 47 ? 2.950   1.813   -3.492  1.00 0.00 ? 47 PHE A CE1  2  
ATOM 1472  C CE2  . PHE A 1 47 ? 2.216   3.972   -4.206  1.00 0.00 ? 47 PHE A CE2  2  
ATOM 1473  C CZ   . PHE A 1 47 ? 1.981   2.793   -3.527  1.00 0.00 ? 47 PHE A CZ   2  
ATOM 1474  H H    . PHE A 1 47 ? 4.443   1.515   -6.595  1.00 0.00 ? 47 PHE A H    2  
ATOM 1475  H HA   . PHE A 1 47 ? 7.114   2.373   -6.781  1.00 0.00 ? 47 PHE A HA   2  
ATOM 1476  H HB2  . PHE A 1 47 ? 6.385   3.922   -4.848  1.00 0.00 ? 47 PHE A HB2  2  
ATOM 1477  H HB3  . PHE A 1 47 ? 5.532   4.056   -6.378  1.00 0.00 ? 47 PHE A HB3  2  
ATOM 1478  H HD1  . PHE A 1 47 ? 4.908   1.243   -4.104  1.00 0.00 ? 47 PHE A HD1  2  
ATOM 1479  H HD2  . PHE A 1 47 ? 3.605   5.090   -5.376  1.00 0.00 ? 47 PHE A HD2  2  
ATOM 1480  H HE1  . PHE A 1 47 ? 2.767   0.891   -2.961  1.00 0.00 ? 47 PHE A HE1  2  
ATOM 1481  H HE2  . PHE A 1 47 ? 1.458   4.741   -4.233  1.00 0.00 ? 47 PHE A HE2  2  
ATOM 1482  H HZ   . PHE A 1 47 ? 1.039   2.636   -3.026  1.00 0.00 ? 47 PHE A HZ   2  
ATOM 1483  N N    . GLU A 1 48 ? 7.076   1.937   -3.663  1.00 0.00 ? 48 GLU A N    2  
ATOM 1484  C CA   . GLU A 1 48 ? 7.726   1.276   -2.535  1.00 0.00 ? 48 GLU A CA   2  
ATOM 1485  C C    . GLU A 1 48 ? 6.906   1.441   -1.255  1.00 0.00 ? 48 GLU A C    2  
ATOM 1486  O O    . GLU A 1 48 ? 5.919   2.175   -1.227  1.00 0.00 ? 48 GLU A O    2  
ATOM 1487  C CB   . GLU A 1 48 ? 9.136   1.834   -2.328  1.00 0.00 ? 48 GLU A CB   2  
ATOM 1488  C CG   . GLU A 1 48 ? 9.181   3.350   -2.233  1.00 0.00 ? 48 GLU A CG   2  
ATOM 1489  C CD   . GLU A 1 48 ? 9.769   3.994   -3.474  1.00 0.00 ? 48 GLU A CD   2  
ATOM 1490  O OE1  . GLU A 1 48 ? 11.003  4.186   -3.516  1.00 0.00 ? 48 GLU A OE1  2  
ATOM 1491  O OE2  . GLU A 1 48 ? 8.996   4.307   -4.404  1.00 0.00 ? 48 GLU A OE2  2  
ATOM 1492  H H    . GLU A 1 48 ? 6.611   2.792   -3.518  1.00 0.00 ? 48 GLU A H    2  
ATOM 1493  H HA   . GLU A 1 48 ? 7.798   0.216   -2.773  1.00 0.00 ? 48 GLU A HA   2  
ATOM 1494  H HB2  . GLU A 1 48 ? 9.541   1.426   -1.413  1.00 0.00 ? 48 GLU A HB2  2  
ATOM 1495  H HB3  . GLU A 1 48 ? 9.758   1.526   -3.155  1.00 0.00 ? 48 GLU A HB3  2  
ATOM 1496  H HG2  . GLU A 1 48 ? 8.177   3.719   -2.096  1.00 0.00 ? 48 GLU A HG2  2  
ATOM 1497  H HG3  . GLU A 1 48 ? 9.785   3.627   -1.382  1.00 0.00 ? 48 GLU A HG3  2  
ATOM 1498  N N    . TYR A 1 49 ? 7.326   0.746   -0.200  1.00 0.00 ? 49 TYR A N    2  
ATOM 1499  C CA   . TYR A 1 49 ? 6.643   0.800   1.089   1.00 0.00 ? 49 TYR A CA   2  
ATOM 1500  C C    . TYR A 1 49 ? 7.534   0.331   2.214   1.00 0.00 ? 49 TYR A C    2  
ATOM 1501  O O    . TYR A 1 49 ? 8.601   -0.245  2.003   1.00 0.00 ? 49 TYR A O    2  
ATOM 1502  C CB   . TYR A 1 49 ? 5.363   -0.028  1.070   1.00 0.00 ? 49 TYR A CB   2  
ATOM 1503  C CG   . TYR A 1 49 ? 5.534   -1.492  0.736   1.00 0.00 ? 49 TYR A CG   2  
ATOM 1504  C CD1  . TYR A 1 49 ? 6.787   -2.063  0.548   1.00 0.00 ? 49 TYR A CD1  2  
ATOM 1505  C CD2  . TYR A 1 49 ? 4.421   -2.311  0.626   1.00 0.00 ? 49 TYR A CD2  2  
ATOM 1506  C CE1  . TYR A 1 49 ? 6.922   -3.402  0.259   1.00 0.00 ? 49 TYR A CE1  2  
ATOM 1507  C CE2  . TYR A 1 49 ? 4.547   -3.649  0.334   1.00 0.00 ? 49 TYR A CE2  2  
ATOM 1508  C CZ   . TYR A 1 49 ? 5.802   -4.194  0.151   1.00 0.00 ? 49 TYR A CZ   2  
ATOM 1509  O OH   . TYR A 1 49 ? 5.941   -5.531  -0.137  1.00 0.00 ? 49 TYR A OH   2  
ATOM 1510  H H    . TYR A 1 49 ? 8.117   0.181   -0.292  1.00 0.00 ? 49 TYR A H    2  
ATOM 1511  H HA   . TYR A 1 49 ? 6.371   1.817   1.301   1.00 0.00 ? 49 TYR A HA   2  
ATOM 1512  H HB2  . TYR A 1 49 ? 4.920   0.021   2.044   1.00 0.00 ? 49 TYR A HB2  2  
ATOM 1513  H HB3  . TYR A 1 49 ? 4.681   0.399   0.353   1.00 0.00 ? 49 TYR A HB3  2  
ATOM 1514  H HD1  . TYR A 1 49 ? 7.664   -1.444  0.623   1.00 0.00 ? 49 TYR A HD1  2  
ATOM 1515  H HD2  . TYR A 1 49 ? 3.439   -1.882  0.765   1.00 0.00 ? 49 TYR A HD2  2  
ATOM 1516  H HE1  . TYR A 1 49 ? 7.902   -3.823  0.115   1.00 0.00 ? 49 TYR A HE1  2  
ATOM 1517  H HE2  . TYR A 1 49 ? 3.663   -4.262  0.252   1.00 0.00 ? 49 TYR A HE2  2  
ATOM 1518  H HH   . TYR A 1 49 ? 6.165   -5.638  -1.064  1.00 0.00 ? 49 TYR A HH   2  
ATOM 1519  N N    . SER A 1 50 ? 7.066   0.586   3.414   1.00 0.00 ? 50 SER A N    2  
ATOM 1520  C CA   . SER A 1 50 ? 7.774   0.198   4.613   1.00 0.00 ? 50 SER A CA   2  
ATOM 1521  C C    . SER A 1 50 ? 6.771   -0.208  5.668   1.00 0.00 ? 50 SER A C    2  
ATOM 1522  O O    . SER A 1 50 ? 6.459   0.554   6.583   1.00 0.00 ? 50 SER A O    2  
ATOM 1523  C CB   . SER A 1 50 ? 8.639   1.335   5.122   1.00 0.00 ? 50 SER A CB   2  
ATOM 1524  O OG   . SER A 1 50 ? 8.987   2.225   4.077   1.00 0.00 ? 50 SER A OG   2  
ATOM 1525  H H    . SER A 1 50 ? 6.201   1.046   3.494   1.00 0.00 ? 50 SER A H    2  
ATOM 1526  H HA   . SER A 1 50 ? 8.399   -0.651  4.375   1.00 0.00 ? 50 SER A HA   2  
ATOM 1527  H HB2  . SER A 1 50 ? 8.095   1.877   5.877   1.00 0.00 ? 50 SER A HB2  2  
ATOM 1528  H HB3  . SER A 1 50 ? 9.539   0.923   5.547   1.00 0.00 ? 50 SER A HB3  2  
ATOM 1529  H HG   . SER A 1 50 ? 8.317   2.908   4.000   1.00 0.00 ? 50 SER A HG   2  
ATOM 1530  N N    . ASN A 1 51 ? 6.248   -1.406  5.510   1.00 0.00 ? 51 ASN A N    2  
ATOM 1531  C CA   . ASN A 1 51 ? 5.248   -1.924  6.423   1.00 0.00 ? 51 ASN A CA   2  
ATOM 1532  C C    . ASN A 1 51 ? 5.707   -1.816  7.864   1.00 0.00 ? 51 ASN A C    2  
ATOM 1533  O O    . ASN A 1 51 ? 6.816   -2.220  8.219   1.00 0.00 ? 51 ASN A O    2  
ATOM 1534  C CB   . ASN A 1 51 ? 4.888   -3.367  6.099   1.00 0.00 ? 51 ASN A CB   2  
ATOM 1535  C CG   . ASN A 1 51 ? 4.542   -3.566  4.635   1.00 0.00 ? 51 ASN A CG   2  
ATOM 1536  O OD1  . ASN A 1 51 ? 5.410   -3.855  3.813   1.00 0.00 ? 51 ASN A OD1  2  
ATOM 1537  N ND2  . ASN A 1 51 ? 3.265   -3.409  4.303   1.00 0.00 ? 51 ASN A ND2  2  
ATOM 1538  H H    . ASN A 1 51 ? 6.533   -1.944  4.748   1.00 0.00 ? 51 ASN A H    2  
ATOM 1539  H HA   . ASN A 1 51 ? 4.364   -1.318  6.307   1.00 0.00 ? 51 ASN A HA   2  
ATOM 1540  H HB2  . ASN A 1 51 ? 5.721   -4.007  6.344   1.00 0.00 ? 51 ASN A HB2  2  
ATOM 1541  H HB3  . ASN A 1 51 ? 4.032   -3.645  6.696   1.00 0.00 ? 51 ASN A HB3  2  
ATOM 1542  H HD21 . ASN A 1 51 ? 2.627   -3.179  5.011   1.00 0.00 ? 51 ASN A HD21 2  
ATOM 1543  H HD22 . ASN A 1 51 ? 3.013   -3.533  3.365   1.00 0.00 ? 51 ASN A HD22 2  
ATOM 1544  N N    . GLY A 1 52 ? 4.836   -1.259  8.679   1.00 0.00 ? 52 GLY A N    2  
ATOM 1545  C CA   . GLY A 1 52 ? 5.135   -1.081  10.088  1.00 0.00 ? 52 GLY A CA   2  
ATOM 1546  C C    . GLY A 1 52 ? 5.276   0.382   10.470  1.00 0.00 ? 52 GLY A C    2  
ATOM 1547  O O    . GLY A 1 52 ? 4.920   1.264   9.688   1.00 0.00 ? 52 GLY A O    2  
ATOM 1548  H H    . GLY A 1 52 ? 3.975   -0.963  8.313   1.00 0.00 ? 52 GLY A H    2  
ATOM 1549  H HA2  . GLY A 1 52 ? 4.340   -1.520  10.673  1.00 0.00 ? 52 GLY A HA2  2  
ATOM 1550  H HA3  . GLY A 1 52 ? 6.058   -1.591  10.316  1.00 0.00 ? 52 GLY A HA3  2  
ATOM 1551  N N    . PRO A 1 53 ? 5.799   0.674   11.672  1.00 0.00 ? 53 PRO A N    2  
ATOM 1552  C CA   . PRO A 1 53 ? 5.983   2.051   12.142  1.00 0.00 ? 53 PRO A CA   2  
ATOM 1553  C C    . PRO A 1 53 ? 6.833   2.878   11.184  1.00 0.00 ? 53 PRO A C    2  
ATOM 1554  O O    . PRO A 1 53 ? 7.857   2.413   10.686  1.00 0.00 ? 53 PRO A O    2  
ATOM 1555  C CB   . PRO A 1 53 ? 6.697   1.890   13.493  1.00 0.00 ? 53 PRO A CB   2  
ATOM 1556  C CG   . PRO A 1 53 ? 7.211   0.490   13.505  1.00 0.00 ? 53 PRO A CG   2  
ATOM 1557  C CD   . PRO A 1 53 ? 6.255   -0.308  12.666  1.00 0.00 ? 53 PRO A CD   2  
ATOM 1558  H HA   . PRO A 1 53 ? 5.033   2.544   12.292  1.00 0.00 ? 53 PRO A HA   2  
ATOM 1559  H HB2  . PRO A 1 53 ? 7.503   2.605   13.563  1.00 0.00 ? 53 PRO A HB2  2  
ATOM 1560  H HB3  . PRO A 1 53 ? 5.992   2.055   14.295  1.00 0.00 ? 53 PRO A HB3  2  
ATOM 1561  H HG2  . PRO A 1 53 ? 8.202   0.459   13.076  1.00 0.00 ? 53 PRO A HG2  2  
ATOM 1562  H HG3  . PRO A 1 53 ? 7.227   0.113   14.517  1.00 0.00 ? 53 PRO A HG3  2  
ATOM 1563  H HD2  . PRO A 1 53 ? 6.765   -1.133  12.191  1.00 0.00 ? 53 PRO A HD2  2  
ATOM 1564  H HD3  . PRO A 1 53 ? 5.431   -0.664  13.265  1.00 0.00 ? 53 PRO A HD3  2  
ATOM 1565  N N    . CYS A 1 54 ? 6.398   4.107   10.930  1.00 0.00 ? 54 CYS A N    2  
ATOM 1566  C CA   . CYS A 1 54 ? 7.114   5.005   10.031  1.00 0.00 ? 54 CYS A CA   2  
ATOM 1567  C C    . CYS A 1 54 ? 6.642   6.444   10.212  1.00 0.00 ? 54 CYS A C    2  
ATOM 1568  O O    . CYS A 1 54 ? 7.352   7.275   10.777  1.00 0.00 ? 54 CYS A O    2  
ATOM 1569  C CB   . CYS A 1 54 ? 6.919   4.567   8.578   1.00 0.00 ? 54 CYS A CB   2  
ATOM 1570  S SG   . CYS A 1 54 ? 7.721   5.654   7.354   1.00 0.00 ? 54 CYS A SG   2  
ATOM 1571  H H    . CYS A 1 54 ? 5.574   4.421   11.358  1.00 0.00 ? 54 CYS A H    2  
ATOM 1572  H HA   . CYS A 1 54 ? 8.165   4.950   10.277  1.00 0.00 ? 54 CYS A HA   2  
ATOM 1573  H HB2  . CYS A 1 54 ? 7.329   3.575   8.451   1.00 0.00 ? 54 CYS A HB2  2  
ATOM 1574  H HB3  . CYS A 1 54 ? 5.863   4.544   8.355   1.00 0.00 ? 54 CYS A HB3  2  
ATOM 1575  N N    . GLU A 1 55 ? 5.437   6.732   9.729   1.00 0.00 ? 55 GLU A N    2  
ATOM 1576  C CA   . GLU A 1 55 ? 4.870   8.071   9.840   1.00 0.00 ? 55 GLU A CA   2  
ATOM 1577  C C    . GLU A 1 55 ? 4.615   8.433   11.300  1.00 0.00 ? 55 GLU A C    2  
ATOM 1578  O O    . GLU A 1 55 ? 5.034   9.534   11.717  1.00 0.00 ? 55 GLU A O    2  
ATOM 1579  C CB   . GLU A 1 55 ? 3.567   8.166   9.042   1.00 0.00 ? 55 GLU A CB   2  
ATOM 1580  C CG   . GLU A 1 55 ? 2.900   9.529   9.123   1.00 0.00 ? 55 GLU A CG   2  
ATOM 1581  C CD   . GLU A 1 55 ? 1.757   9.562   10.120  1.00 0.00 ? 55 GLU A CD   2  
ATOM 1582  O OE1  . GLU A 1 55 ? 0.909   8.645   10.080  1.00 0.00 ? 55 GLU A OE1  2  
ATOM 1583  O OE2  . GLU A 1 55 ? 1.709   10.505  10.937  1.00 0.00 ? 55 GLU A OE2  2  
ATOM 1584  O OXT  . GLU A 1 55 ? 4.000   7.613   12.013  1.00 0.00 ? 55 GLU A OXT  2  
ATOM 1585  H H    . GLU A 1 55 ? 4.916   6.027   9.289   1.00 0.00 ? 55 GLU A H    2  
ATOM 1586  H HA   . GLU A 1 55 ? 5.586   8.768   9.428   1.00 0.00 ? 55 GLU A HA   2  
ATOM 1587  H HB2  . GLU A 1 55 ? 3.778   7.955   8.004   1.00 0.00 ? 55 GLU A HB2  2  
ATOM 1588  H HB3  . GLU A 1 55 ? 2.873   7.426   9.416   1.00 0.00 ? 55 GLU A HB3  2  
ATOM 1589  H HG2  . GLU A 1 55 ? 3.638   10.259  9.423   1.00 0.00 ? 55 GLU A HG2  2  
ATOM 1590  H HG3  . GLU A 1 55 ? 2.516   9.787   8.147   1.00 0.00 ? 55 GLU A HG3  2  
ATOM 1591  N N    . ALA A 1 1  ? 9.968   -0.824  -0.273  1.00 0.00 ? 1  ALA A N    3  
ATOM 1592  C CA   . ALA A 1 1  ? 10.112  -1.468  -1.605  1.00 0.00 ? 1  ALA A CA   3  
ATOM 1593  C C    . ALA A 1 1  ? 8.774   -1.515  -2.337  1.00 0.00 ? 1  ALA A C    3  
ATOM 1594  O O    . ALA A 1 1  ? 7.793   -2.057  -1.826  1.00 0.00 ? 1  ALA A O    3  
ATOM 1595  C CB   . ALA A 1 1  ? 10.682  -2.871  -1.452  1.00 0.00 ? 1  ALA A CB   3  
ATOM 1596  H H1   . ALA A 1 1  ? 10.890  -0.877  0.206   1.00 0.00 ? 1  ALA A H1   3  
ATOM 1597  H H2   . ALA A 1 1  ? 9.240   -1.347  0.255   1.00 0.00 ? 1  ALA A H2   3  
ATOM 1598  H H3   . ALA A 1 1  ? 9.683   0.163   -0.427  1.00 0.00 ? 1  ALA A H3   3  
ATOM 1599  H HA   . ALA A 1 1  ? 10.809  -0.885  -2.189  1.00 0.00 ? 1  ALA A HA   3  
ATOM 1600  H HB1  . ALA A 1 1  ? 10.307  -3.501  -2.245  1.00 0.00 ? 1  ALA A HB1  3  
ATOM 1601  H HB2  . ALA A 1 1  ? 10.387  -3.277  -0.496  1.00 0.00 ? 1  ALA A HB2  3  
ATOM 1602  H HB3  . ALA A 1 1  ? 11.761  -2.828  -1.507  1.00 0.00 ? 1  ALA A HB3  3  
ATOM 1603  N N    . HIS A 1 2  ? 8.742   -0.939  -3.535  1.00 0.00 ? 2  HIS A N    3  
ATOM 1604  C CA   . HIS A 1 2  ? 7.523   -0.907  -4.341  1.00 0.00 ? 2  HIS A CA   3  
ATOM 1605  C C    . HIS A 1 2  ? 7.166   -2.294  -4.860  1.00 0.00 ? 2  HIS A C    3  
ATOM 1606  O O    . HIS A 1 2  ? 7.311   -2.579  -6.049  1.00 0.00 ? 2  HIS A O    3  
ATOM 1607  C CB   . HIS A 1 2  ? 7.681   0.064   -5.516  1.00 0.00 ? 2  HIS A CB   3  
ATOM 1608  C CG   . HIS A 1 2  ? 9.002   -0.037  -6.216  1.00 0.00 ? 2  HIS A CG   3  
ATOM 1609  N ND1  . HIS A 1 2  ? 9.489   0.945   -7.052  1.00 0.00 ? 2  HIS A ND1  3  
ATOM 1610  C CD2  . HIS A 1 2  ? 9.941   -1.013  -6.199  1.00 0.00 ? 2  HIS A CD2  3  
ATOM 1611  C CE1  . HIS A 1 2  ? 10.669  0.577   -7.521  1.00 0.00 ? 2  HIS A CE1  3  
ATOM 1612  N NE2  . HIS A 1 2  ? 10.965  -0.606  -7.017  1.00 0.00 ? 2  HIS A NE2  3  
ATOM 1613  H H    . HIS A 1 2  ? 9.556   -0.520  -3.881  1.00 0.00 ? 2  HIS A H    3  
ATOM 1614  H HA   . HIS A 1 2  ? 6.722   -0.561  -3.708  1.00 0.00 ? 2  HIS A HA   3  
ATOM 1615  H HB2  . HIS A 1 2  ? 6.909   -0.136  -6.243  1.00 0.00 ? 2  HIS A HB2  3  
ATOM 1616  H HB3  . HIS A 1 2  ? 7.574   1.077   -5.155  1.00 0.00 ? 2  HIS A HB3  3  
ATOM 1617  H HD1  . HIS A 1 2  ? 9.037   1.786   -7.271  1.00 0.00 ? 2  HIS A HD1  3  
ATOM 1618  H HD2  . HIS A 1 2  ? 9.894   -1.934  -5.638  1.00 0.00 ? 2  HIS A HD2  3  
ATOM 1619  H HE1  . HIS A 1 2  ? 11.286  1.148   -8.198  1.00 0.00 ? 2  HIS A HE1  3  
ATOM 1620  H HE2  . HIS A 1 2  ? 11.755  -1.138  -7.249  1.00 0.00 ? 2  HIS A HE2  3  
ATOM 1621  N N    . MET A 1 3  ? 6.695   -3.155  -3.964  1.00 0.00 ? 3  MET A N    3  
ATOM 1622  C CA   . MET A 1 3  ? 6.317   -4.516  -4.356  1.00 0.00 ? 3  MET A CA   3  
ATOM 1623  C C    . MET A 1 3  ? 5.594   -5.277  -3.239  1.00 0.00 ? 3  MET A C    3  
ATOM 1624  O O    . MET A 1 3  ? 6.227   -5.769  -2.306  1.00 0.00 ? 3  MET A O    3  
ATOM 1625  C CB   . MET A 1 3  ? 7.558   -5.299  -4.787  1.00 0.00 ? 3  MET A CB   3  
ATOM 1626  C CG   . MET A 1 3  ? 7.241   -6.658  -5.388  1.00 0.00 ? 3  MET A CG   3  
ATOM 1627  S SD   . MET A 1 3  ? 6.778   -6.556  -7.128  1.00 0.00 ? 3  MET A SD   3  
ATOM 1628  C CE   . MET A 1 3  ? 8.245   -7.226  -7.909  1.00 0.00 ? 3  MET A CE   3  
ATOM 1629  H H    . MET A 1 3  ? 6.599   -2.866  -3.030  1.00 0.00 ? 3  MET A H    3  
ATOM 1630  H HA   . MET A 1 3  ? 5.651   -4.436  -5.202  1.00 0.00 ? 3  MET A HA   3  
ATOM 1631  H HB2  . MET A 1 3  ? 8.097   -4.720  -5.521  1.00 0.00 ? 3  MET A HB2  3  
ATOM 1632  H HB3  . MET A 1 3  ? 8.192   -5.450  -3.924  1.00 0.00 ? 3  MET A HB3  3  
ATOM 1633  H HG2  . MET A 1 3  ? 8.112   -7.289  -5.298  1.00 0.00 ? 3  MET A HG2  3  
ATOM 1634  H HG3  . MET A 1 3  ? 6.422   -7.098  -4.837  1.00 0.00 ? 3  MET A HG3  3  
ATOM 1635  H HE1  . MET A 1 3  ? 9.043   -7.285  -7.184  1.00 0.00 ? 3  MET A HE1  3  
ATOM 1636  H HE2  . MET A 1 3  ? 8.545   -6.584  -8.723  1.00 0.00 ? 3  MET A HE2  3  
ATOM 1637  H HE3  . MET A 1 3  ? 8.030   -8.214  -8.289  1.00 0.00 ? 3  MET A HE3  3  
ATOM 1638  N N    . ASP A 1 4  ? 4.270   -5.400  -3.361  1.00 0.00 ? 4  ASP A N    3  
ATOM 1639  C CA   . ASP A 1 4  ? 3.469   -6.137  -2.377  1.00 0.00 ? 4  ASP A CA   3  
ATOM 1640  C C    . ASP A 1 4  ? 1.978   -6.127  -2.730  1.00 0.00 ? 4  ASP A C    3  
ATOM 1641  O O    . ASP A 1 4  ? 1.126   -6.172  -1.844  1.00 0.00 ? 4  ASP A O    3  
ATOM 1642  C CB   . ASP A 1 4  ? 3.672   -5.573  -0.966  1.00 0.00 ? 4  ASP A CB   3  
ATOM 1643  C CG   . ASP A 1 4  ? 3.353   -6.591  0.111   1.00 0.00 ? 4  ASP A CG   3  
ATOM 1644  O OD1  . ASP A 1 4  ? 2.159   -6.746  0.446   1.00 0.00 ? 4  ASP A OD1  3  
ATOM 1645  O OD2  . ASP A 1 4  ? 4.295   -7.234  0.618   1.00 0.00 ? 4  ASP A OD2  3  
ATOM 1646  H H    . ASP A 1 4  ? 3.825   -5.006  -4.139  1.00 0.00 ? 4  ASP A H    3  
ATOM 1647  H HA   . ASP A 1 4  ? 3.813   -7.161  -2.388  1.00 0.00 ? 4  ASP A HA   3  
ATOM 1648  H HB2  . ASP A 1 4  ? 4.699   -5.266  -0.848  1.00 0.00 ? 4  ASP A HB2  3  
ATOM 1649  H HB3  . ASP A 1 4  ? 3.026   -4.719  -0.828  1.00 0.00 ? 4  ASP A HB3  3  
ATOM 1650  N N    . CYS A 1 5  ? 1.668   -6.078  -4.025  1.00 0.00 ? 5  CYS A N    3  
ATOM 1651  C CA   . CYS A 1 5  ? 0.277   -6.073  -4.481  1.00 0.00 ? 5  CYS A CA   3  
ATOM 1652  C C    . CYS A 1 5  ? -0.225  -7.504  -4.637  1.00 0.00 ? 5  CYS A C    3  
ATOM 1653  O O    . CYS A 1 5  ? 0.543   -8.450  -4.467  1.00 0.00 ? 5  CYS A O    3  
ATOM 1654  C CB   . CYS A 1 5  ? 0.159   -5.328  -5.814  1.00 0.00 ? 5  CYS A CB   3  
ATOM 1655  S SG   . CYS A 1 5  ? -1.492  -4.628  -6.144  1.00 0.00 ? 5  CYS A SG   3  
ATOM 1656  H H    . CYS A 1 5  ? 2.387   -6.051  -4.689  1.00 0.00 ? 5  CYS A H    3  
ATOM 1657  H HA   . CYS A 1 5  ? -0.319  -5.569  -3.736  1.00 0.00 ? 5  CYS A HA   3  
ATOM 1658  H HB2  . CYS A 1 5  ? 0.866   -4.512  -5.825  1.00 0.00 ? 5  CYS A HB2  3  
ATOM 1659  H HB3  . CYS A 1 5  ? 0.393   -6.009  -6.619  1.00 0.00 ? 5  CYS A HB3  3  
ATOM 1660  N N    . THR A 1 6  ? -1.510  -7.671  -4.961  1.00 0.00 ? 6  THR A N    3  
ATOM 1661  C CA   . THR A 1 6  ? -2.065  -9.007  -5.135  1.00 0.00 ? 6  THR A CA   3  
ATOM 1662  C C    . THR A 1 6  ? -1.342  -9.713  -6.301  1.00 0.00 ? 6  THR A C    3  
ATOM 1663  O O    . THR A 1 6  ? -0.116  -9.806  -6.278  1.00 0.00 ? 6  THR A O    3  
ATOM 1664  C CB   . THR A 1 6  ? -3.576  -8.933  -5.382  1.00 0.00 ? 6  THR A CB   3  
ATOM 1665  O OG1  . THR A 1 6  ? -4.090  -10.206 -5.729  1.00 0.00 ? 6  THR A OG1  3  
ATOM 1666  C CG2  . THR A 1 6  ? -3.956  -7.967  -6.483  1.00 0.00 ? 6  THR A CG2  3  
ATOM 1667  H H    . THR A 1 6  ? -2.089  -6.889  -5.085  1.00 0.00 ? 6  THR A H    3  
ATOM 1668  H HA   . THR A 1 6  ? -1.874  -9.551  -4.203  1.00 0.00 ? 6  THR A HA   3  
ATOM 1669  H HB   . THR A 1 6  ? -4.062  -8.607  -4.473  1.00 0.00 ? 6  THR A HB   3  
ATOM 1670  H HG1  . THR A 1 6  ? -4.394  -10.656 -4.939  1.00 0.00 ? 6  THR A HG1  3  
ATOM 1671  H HG21 . THR A 1 6  ? -4.348  -8.517  -7.325  1.00 0.00 ? 6  THR A HG21 3  
ATOM 1672  H HG22 . THR A 1 6  ? -3.084  -7.410  -6.790  1.00 0.00 ? 6  THR A HG22 3  
ATOM 1673  H HG23 . THR A 1 6  ? -4.710  -7.284  -6.118  1.00 0.00 ? 6  THR A HG23 3  
ATOM 1674  N N    . GLU A 1 7  ? -2.064  -10.203 -7.336  1.00 0.00 ? 7  GLU A N    3  
ATOM 1675  C CA   . GLU A 1 7  ? -1.392  -10.858 -8.454  1.00 0.00 ? 7  GLU A CA   3  
ATOM 1676  C C    . GLU A 1 7  ? -2.387  -11.357 -9.504  1.00 0.00 ? 7  GLU A C    3  
ATOM 1677  O O    . GLU A 1 7  ? -2.094  -12.288 -10.254 1.00 0.00 ? 7  GLU A O    3  
ATOM 1678  C CB   . GLU A 1 7  ? -0.503  -12.006 -7.938  1.00 0.00 ? 7  GLU A CB   3  
ATOM 1679  C CG   . GLU A 1 7  ? -1.144  -13.388 -7.980  1.00 0.00 ? 7  GLU A CG   3  
ATOM 1680  C CD   . GLU A 1 7  ? -0.593  -14.253 -9.098  1.00 0.00 ? 7  GLU A CD   3  
ATOM 1681  O OE1  . GLU A 1 7  ? 0.627   -14.519 -9.096  1.00 0.00 ? 7  GLU A OE1  3  
ATOM 1682  O OE2  . GLU A 1 7  ? -1.382  -14.663 -9.975  1.00 0.00 ? 7  GLU A OE2  3  
ATOM 1683  H H    . GLU A 1 7  ? -3.045  -10.111 -7.362  1.00 0.00 ? 7  GLU A H    3  
ATOM 1684  H HA   . GLU A 1 7  ? -0.755  -10.120 -8.919  1.00 0.00 ? 7  GLU A HA   3  
ATOM 1685  H HB2  . GLU A 1 7  ? 0.396   -12.036 -8.531  1.00 0.00 ? 7  GLU A HB2  3  
ATOM 1686  H HB3  . GLU A 1 7  ? -0.233  -11.796 -6.912  1.00 0.00 ? 7  GLU A HB3  3  
ATOM 1687  H HG2  . GLU A 1 7  ? -0.957  -13.885 -7.039  1.00 0.00 ? 7  GLU A HG2  3  
ATOM 1688  H HG3  . GLU A 1 7  ? -2.208  -13.276 -8.119  1.00 0.00 ? 7  GLU A HG3  3  
ATOM 1689  N N    . PHE A 1 8  ? -3.564  -10.739 -9.557  1.00 0.00 ? 8  PHE A N    3  
ATOM 1690  C CA   . PHE A 1 8  ? -4.586  -11.139 -10.520 1.00 0.00 ? 8  PHE A CA   3  
ATOM 1691  C C    . PHE A 1 8  ? -5.352  -9.929  -11.048 1.00 0.00 ? 8  PHE A C    3  
ATOM 1692  O O    . PHE A 1 8  ? -4.931  -8.787  -10.870 1.00 0.00 ? 8  PHE A O    3  
ATOM 1693  C CB   . PHE A 1 8  ? -5.567  -12.124 -9.877  1.00 0.00 ? 8  PHE A CB   3  
ATOM 1694  C CG   . PHE A 1 8  ? -4.909  -13.175 -9.030  1.00 0.00 ? 8  PHE A CG   3  
ATOM 1695  C CD1  . PHE A 1 8  ? -4.385  -14.319 -9.608  1.00 0.00 ? 8  PHE A CD1  3  
ATOM 1696  C CD2  . PHE A 1 8  ? -4.823  -13.022 -7.655  1.00 0.00 ? 8  PHE A CD2  3  
ATOM 1697  C CE1  . PHE A 1 8  ? -3.784  -15.292 -8.831  1.00 0.00 ? 8  PHE A CE1  3  
ATOM 1698  C CE2  . PHE A 1 8  ? -4.225  -13.992 -6.873  1.00 0.00 ? 8  PHE A CE2  3  
ATOM 1699  C CZ   . PHE A 1 8  ? -3.706  -15.128 -7.462  1.00 0.00 ? 8  PHE A CZ   3  
ATOM 1700  H H    . PHE A 1 8  ? -3.749  -10.001 -8.938  1.00 0.00 ? 8  PHE A H    3  
ATOM 1701  H HA   . PHE A 1 8  ? -4.091  -11.626 -11.346 1.00 0.00 ? 8  PHE A HA   3  
ATOM 1702  H HB2  . PHE A 1 8  ? -6.253  -11.577 -9.249  1.00 0.00 ? 8  PHE A HB2  3  
ATOM 1703  H HB3  . PHE A 1 8  ? -6.122  -12.625 -10.656 1.00 0.00 ? 8  PHE A HB3  3  
ATOM 1704  H HD1  . PHE A 1 8  ? -4.445  -14.447 -10.678 1.00 0.00 ? 8  PHE A HD1  3  
ATOM 1705  H HD2  . PHE A 1 8  ? -5.229  -12.133 -7.195  1.00 0.00 ? 8  PHE A HD2  3  
ATOM 1706  H HE1  . PHE A 1 8  ? -3.378  -16.179 -9.295  1.00 0.00 ? 8  PHE A HE1  3  
ATOM 1707  H HE2  . PHE A 1 8  ? -4.163  -13.861 -5.803  1.00 0.00 ? 8  PHE A HE2  3  
ATOM 1708  H HZ   . PHE A 1 8  ? -3.238  -15.888 -6.852  1.00 0.00 ? 8  PHE A HZ   3  
ATOM 1709  N N    . ASN A 1 9  ? -6.486  -10.195 -11.692 1.00 0.00 ? 9  ASN A N    3  
ATOM 1710  C CA   . ASN A 1 9  ? -7.322  -9.138  -12.239 1.00 0.00 ? 9  ASN A CA   3  
ATOM 1711  C C    . ASN A 1 9  ? -7.979  -8.338  -11.116 1.00 0.00 ? 9  ASN A C    3  
ATOM 1712  O O    . ASN A 1 9  ? -7.884  -7.112  -11.085 1.00 0.00 ? 9  ASN A O    3  
ATOM 1713  C CB   . ASN A 1 9  ? -8.397  -9.729  -13.153 1.00 0.00 ? 9  ASN A CB   3  
ATOM 1714  C CG   . ASN A 1 9  ? -7.854  -10.110 -14.516 1.00 0.00 ? 9  ASN A CG   3  
ATOM 1715  O OD1  . ASN A 1 9  ? -7.089  -9.362  -15.124 1.00 0.00 ? 9  ASN A OD1  3  
ATOM 1716  N ND2  . ASN A 1 9  ? -8.248  -11.281 -15.003 1.00 0.00 ? 9  ASN A ND2  3  
ATOM 1717  H H    . ASN A 1 9  ? -6.768  -11.128 -11.796 1.00 0.00 ? 9  ASN A H    3  
ATOM 1718  H HA   . ASN A 1 9  ? -6.692  -8.478  -12.816 1.00 0.00 ? 9  ASN A HA   3  
ATOM 1719  H HB2  . ASN A 1 9  ? -8.807  -10.615 -12.690 1.00 0.00 ? 9  ASN A HB2  3  
ATOM 1720  H HB3  . ASN A 1 9  ? -9.184  -9.002  -13.291 1.00 0.00 ? 9  ASN A HB3  3  
ATOM 1721  H HD21 . ASN A 1 9  ? -8.858  -11.826 -14.463 1.00 0.00 ? 9  ASN A HD21 3  
ATOM 1722  H HD22 . ASN A 1 9  ? -7.912  -11.555 -15.882 1.00 0.00 ? 9  ASN A HD22 3  
ATOM 1723  N N    . PRO A 1 10 ? -8.657  -9.021  -10.172 1.00 0.00 ? 10 PRO A N    3  
ATOM 1724  C CA   . PRO A 1 10 ? -9.320  -8.350  -9.051  1.00 0.00 ? 10 PRO A CA   3  
ATOM 1725  C C    . PRO A 1 10 ? -8.322  -7.700  -8.097  1.00 0.00 ? 10 PRO A C    3  
ATOM 1726  O O    . PRO A 1 10 ? -8.118  -8.171  -6.979  1.00 0.00 ? 10 PRO A O    3  
ATOM 1727  C CB   . PRO A 1 10 ? -10.083 -9.477  -8.349  1.00 0.00 ? 10 PRO A CB   3  
ATOM 1728  C CG   . PRO A 1 10 ? -9.368  -10.724 -8.735  1.00 0.00 ? 10 PRO A CG   3  
ATOM 1729  C CD   . PRO A 1 10 ? -8.828  -10.487 -10.117 1.00 0.00 ? 10 PRO A CD   3  
ATOM 1730  H HA   . PRO A 1 10 ? -10.018 -7.603  -9.400  1.00 0.00 ? 10 PRO A HA   3  
ATOM 1731  H HB2  . PRO A 1 10 ? -10.058 -9.321  -7.281  1.00 0.00 ? 10 PRO A HB2  3  
ATOM 1732  H HB3  . PRO A 1 10 ? -11.108 -9.489  -8.693  1.00 0.00 ? 10 PRO A HB3  3  
ATOM 1733  H HG2  . PRO A 1 10 ? -8.558  -10.911 -8.044  1.00 0.00 ? 10 PRO A HG2  3  
ATOM 1734  H HG3  . PRO A 1 10 ? -10.056 -11.556 -8.740  1.00 0.00 ? 10 PRO A HG3  3  
ATOM 1735  H HD2  . PRO A 1 10 ? -7.885  -10.993 -10.239 1.00 0.00 ? 10 PRO A HD2  3  
ATOM 1736  H HD3  . PRO A 1 10 ? -9.537  -10.819 -10.861 1.00 0.00 ? 10 PRO A HD3  3  
ATOM 1737  N N    . LEU A 1 11 ? -7.710  -6.611  -8.552  1.00 0.00 ? 11 LEU A N    3  
ATOM 1738  C CA   . LEU A 1 11 ? -6.736  -5.876  -7.750  1.00 0.00 ? 11 LEU A CA   3  
ATOM 1739  C C    . LEU A 1 11 ? -7.324  -5.478  -6.413  1.00 0.00 ? 11 LEU A C    3  
ATOM 1740  O O    . LEU A 1 11 ? -8.403  -5.934  -6.051  1.00 0.00 ? 11 LEU A O    3  
ATOM 1741  C CB   . LEU A 1 11 ? -6.237  -4.637  -8.510  1.00 0.00 ? 11 LEU A CB   3  
ATOM 1742  C CG   . LEU A 1 11 ? -7.307  -3.801  -9.232  1.00 0.00 ? 11 LEU A CG   3  
ATOM 1743  C CD1  . LEU A 1 11 ? -7.505  -4.298  -10.657 1.00 0.00 ? 11 LEU A CD1  3  
ATOM 1744  C CD2  . LEU A 1 11 ? -8.627  -3.809  -8.471  1.00 0.00 ? 11 LEU A CD2  3  
ATOM 1745  H H    . LEU A 1 11 ? -7.924  -6.290  -9.451  1.00 0.00 ? 11 LEU A H    3  
ATOM 1746  H HA   . LEU A 1 11 ? -5.900  -6.521  -7.553  1.00 0.00 ? 11 LEU A HA   3  
ATOM 1747  H HB2  . LEU A 1 11 ? -5.729  -3.995  -7.809  1.00 0.00 ? 11 LEU A HB2  3  
ATOM 1748  H HB3  . LEU A 1 11 ? -5.519  -4.966  -9.247  1.00 0.00 ? 11 LEU A HB3  3  
ATOM 1749  H HG   . LEU A 1 11 ? -6.964  -2.777  -9.289  1.00 0.00 ? 11 LEU A HG   3  
ATOM 1750  H HD11 . LEU A 1 11 ? -7.531  -3.455  -11.331 1.00 0.00 ? 11 LEU A HD11 3  
ATOM 1751  H HD12 . LEU A 1 11 ? -8.438  -4.839  -10.724 1.00 0.00 ? 11 LEU A HD12 3  
ATOM 1752  H HD13 . LEU A 1 11 ? -6.689  -4.952  -10.928 1.00 0.00 ? 11 LEU A HD13 3  
ATOM 1753  H HD21 . LEU A 1 11 ? -9.301  -3.090  -8.913  1.00 0.00 ? 11 LEU A HD21 3  
ATOM 1754  H HD22 . LEU A 1 11 ? -8.450  -3.547  -7.439  1.00 0.00 ? 11 LEU A HD22 3  
ATOM 1755  H HD23 . LEU A 1 11 ? -9.069  -4.793  -8.522  1.00 0.00 ? 11 LEU A HD23 3  
ATOM 1756  N N    . CYS A 1 12 ? -6.585  -4.639  -5.689  1.00 0.00 ? 12 CYS A N    3  
ATOM 1757  C CA   . CYS A 1 12 ? -6.973  -4.161  -4.363  1.00 0.00 ? 12 CYS A CA   3  
ATOM 1758  C C    . CYS A 1 12 ? -8.459  -4.355  -4.085  1.00 0.00 ? 12 CYS A C    3  
ATOM 1759  O O    . CYS A 1 12 ? -9.224  -3.403  -3.938  1.00 0.00 ? 12 CYS A O    3  
ATOM 1760  C CB   . CYS A 1 12 ? -6.602  -2.692  -4.230  1.00 0.00 ? 12 CYS A CB   3  
ATOM 1761  S SG   . CYS A 1 12 ? -7.627  -1.561  -5.235  1.00 0.00 ? 12 CYS A SG   3  
ATOM 1762  H H    . CYS A 1 12 ? -5.726  -4.348  -6.053  1.00 0.00 ? 12 CYS A H    3  
ATOM 1763  H HA   . CYS A 1 12 ? -6.410  -4.725  -3.635  1.00 0.00 ? 12 CYS A HA   3  
ATOM 1764  H HB2  . CYS A 1 12 ? -6.699  -2.399  -3.199  1.00 0.00 ? 12 CYS A HB2  3  
ATOM 1765  H HB3  . CYS A 1 12 ? -5.575  -2.566  -4.535  1.00 0.00 ? 12 CYS A HB3  3  
ATOM 1766  N N    . ARG A 1 13 ? -8.843  -5.614  -4.012  1.00 0.00 ? 13 ARG A N    3  
ATOM 1767  C CA   . ARG A 1 13 ? -10.229 -5.991  -3.754  1.00 0.00 ? 13 ARG A CA   3  
ATOM 1768  C C    . ARG A 1 13 ? -10.558 -5.902  -2.266  1.00 0.00 ? 13 ARG A C    3  
ATOM 1769  O O    . ARG A 1 13 ? -11.399 -6.647  -1.761  1.00 0.00 ? 13 ARG A O    3  
ATOM 1770  C CB   . ARG A 1 13 ? -10.496 -7.409  -4.266  1.00 0.00 ? 13 ARG A CB   3  
ATOM 1771  C CG   . ARG A 1 13 ? -11.491 -7.463  -5.412  1.00 0.00 ? 13 ARG A CG   3  
ATOM 1772  C CD   . ARG A 1 13 ? -12.873 -7.003  -4.973  1.00 0.00 ? 13 ARG A CD   3  
ATOM 1773  N NE   . ARG A 1 13 ? -13.033 -5.555  -5.096  1.00 0.00 ? 13 ARG A NE   3  
ATOM 1774  C CZ   . ARG A 1 13 ? -13.991 -4.860  -4.489  1.00 0.00 ? 13 ARG A CZ   3  
ATOM 1775  N NH1  . ARG A 1 13 ? -14.883 -5.475  -3.720  1.00 0.00 ? 13 ARG A NH1  3  
ATOM 1776  N NH2  . ARG A 1 13 ? -14.062 -3.546  -4.651  1.00 0.00 ? 13 ARG A NH2  3  
ATOM 1777  H H    . ARG A 1 13 ? -8.165  -6.313  -4.147  1.00 0.00 ? 13 ARG A H    3  
ATOM 1778  H HA   . ARG A 1 13 ? -10.862 -5.302  -4.291  1.00 0.00 ? 13 ARG A HA   3  
ATOM 1779  H HB2  . ARG A 1 13 ? -9.564  -7.836  -4.607  1.00 0.00 ? 13 ARG A HB2  3  
ATOM 1780  H HB3  . ARG A 1 13 ? -10.880 -8.009  -3.454  1.00 0.00 ? 13 ARG A HB3  3  
ATOM 1781  H HG2  . ARG A 1 13 ? -11.146 -6.821  -6.207  1.00 0.00 ? 13 ARG A HG2  3  
ATOM 1782  H HG3  . ARG A 1 13 ? -11.558 -8.480  -5.771  1.00 0.00 ? 13 ARG A HG3  3  
ATOM 1783  H HD2  . ARG A 1 13 ? -13.613 -7.490  -5.589  1.00 0.00 ? 13 ARG A HD2  3  
ATOM 1784  H HD3  . ARG A 1 13 ? -13.021 -7.286  -3.942  1.00 0.00 ? 13 ARG A HD3  3  
ATOM 1785  H HE   . ARG A 1 13 ? -12.390 -5.076  -5.660  1.00 0.00 ? 13 ARG A HE   3  
ATOM 1786  H HH11 . ARG A 1 13 ? -14.837 -6.466  -3.594  1.00 0.00 ? 13 ARG A HH11 3  
ATOM 1787  H HH12 . ARG A 1 13 ? -15.601 -4.947  -3.266  1.00 0.00 ? 13 ARG A HH12 3  
ATOM 1788  H HH21 . ARG A 1 13 ? -13.393 -3.077  -5.230  1.00 0.00 ? 13 ARG A HH21 3  
ATOM 1789  H HH22 . ARG A 1 13 ? -14.781 -3.022  -4.195  1.00 0.00 ? 13 ARG A HH22 3  
ATOM 1790  N N    . CYS A 1 14 ? -9.898  -4.982  -1.572  1.00 0.00 ? 14 CYS A N    3  
ATOM 1791  C CA   . CYS A 1 14 ? -10.113 -4.782  -0.165  1.00 0.00 ? 14 CYS A CA   3  
ATOM 1792  C C    . CYS A 1 14 ? -10.551 -3.351  0.089   1.00 0.00 ? 14 CYS A C    3  
ATOM 1793  O O    . CYS A 1 14 ? -10.803 -2.581  -0.837  1.00 0.00 ? 14 CYS A O    3  
ATOM 1794  C CB   . CYS A 1 14 ? -8.830  -5.119  0.611   1.00 0.00 ? 14 CYS A CB   3  
ATOM 1795  S SG   . CYS A 1 14 ? -7.682  -3.720  0.871   1.00 0.00 ? 14 CYS A SG   3  
ATOM 1796  H H    . CYS A 1 14 ? -9.251  -4.416  -2.016  1.00 0.00 ? 14 CYS A H    3  
ATOM 1797  H HA   . CYS A 1 14 ? -10.902 -5.444  0.157   1.00 0.00 ? 14 CYS A HA   3  
ATOM 1798  H HB2  . CYS A 1 14 ? -9.101  -5.500  1.583   1.00 0.00 ? 14 CYS A HB2  3  
ATOM 1799  H HB3  . CYS A 1 14 ? -8.292  -5.887  0.071   1.00 0.00 ? 14 CYS A HB3  3  
ATOM 1800  N N    . ASN A 1 15 ? -10.632 -3.018  1.349   1.00 0.00 ? 15 ASN A N    3  
ATOM 1801  C CA   . ASN A 1 15 ? -11.036 -1.683  1.773   1.00 0.00 ? 15 ASN A CA   3  
ATOM 1802  C C    . ASN A 1 15 ? -10.606 -1.411  3.202   1.00 0.00 ? 15 ASN A C    3  
ATOM 1803  O O    . ASN A 1 15 ? -9.967  -0.402  3.472   1.00 0.00 ? 15 ASN A O    3  
ATOM 1804  C CB   . ASN A 1 15 ? -12.550 -1.522  1.671   1.00 0.00 ? 15 ASN A CB   3  
ATOM 1805  C CG   . ASN A 1 15 ? -12.956 -0.410  0.726   1.00 0.00 ? 15 ASN A CG   3  
ATOM 1806  O OD1  . ASN A 1 15 ? -13.370 -0.660  -0.406  1.00 0.00 ? 15 ASN A OD1  3  
ATOM 1807  N ND2  . ASN A 1 15 ? -12.838 0.830   1.187   1.00 0.00 ? 15 ASN A ND2  3  
ATOM 1808  H H    . ASN A 1 15 ? -10.413 -3.692  2.012   1.00 0.00 ? 15 ASN A H    3  
ATOM 1809  H HA   . ASN A 1 15 ? -10.561 -0.967  1.123   1.00 0.00 ? 15 ASN A HA   3  
ATOM 1810  H HB2  . ASN A 1 15 ? -12.975 -2.443  1.323   1.00 0.00 ? 15 ASN A HB2  3  
ATOM 1811  H HB3  . ASN A 1 15 ? -12.947 -1.300  2.650   1.00 0.00 ? 15 ASN A HB3  3  
ATOM 1812  H HD21 . ASN A 1 15 ? -12.502 0.954   2.100   1.00 0.00 ? 15 ASN A HD21 3  
ATOM 1813  H HD22 . ASN A 1 15 ? -13.094 1.570   0.599   1.00 0.00 ? 15 ASN A HD22 3  
ATOM 1814  N N    . LYS A 1 16 ? -10.993 -2.322  4.101   1.00 0.00 ? 16 LYS A N    3  
ATOM 1815  C CA   . LYS A 1 16 ? -10.701 -2.240  5.540   1.00 0.00 ? 16 LYS A CA   3  
ATOM 1816  C C    . LYS A 1 16 ? -9.538  -1.305  5.850   1.00 0.00 ? 16 LYS A C    3  
ATOM 1817  O O    . LYS A 1 16 ? -8.538  -1.707  6.447   1.00 0.00 ? 16 LYS A O    3  
ATOM 1818  C CB   . LYS A 1 16 ? -10.402 -3.636  6.091   1.00 0.00 ? 16 LYS A CB   3  
ATOM 1819  C CG   . LYS A 1 16 ? -10.143 -3.659  7.589   1.00 0.00 ? 16 LYS A CG   3  
ATOM 1820  C CD   . LYS A 1 16 ? -8.699  -4.024  7.904   1.00 0.00 ? 16 LYS A CD   3  
ATOM 1821  C CE   . LYS A 1 16 ? -8.609  -4.978  9.084   1.00 0.00 ? 16 LYS A CE   3  
ATOM 1822  N NZ   . LYS A 1 16 ? -7.210  -5.123  9.576   1.00 0.00 ? 16 LYS A NZ   3  
ATOM 1823  H H    . LYS A 1 16 ? -11.516 -3.077  3.784   1.00 0.00 ? 16 LYS A H    3  
ATOM 1824  H HA   . LYS A 1 16 ? -11.584 -1.860  6.030   1.00 0.00 ? 16 LYS A HA   3  
ATOM 1825  H HB2  . LYS A 1 16 ? -11.245 -4.278  5.883   1.00 0.00 ? 16 LYS A HB2  3  
ATOM 1826  H HB3  . LYS A 1 16 ? -9.530  -4.028  5.588   1.00 0.00 ? 16 LYS A HB3  3  
ATOM 1827  H HG2  . LYS A 1 16 ? -10.352 -2.682  7.996   1.00 0.00 ? 16 LYS A HG2  3  
ATOM 1828  H HG3  . LYS A 1 16 ? -10.796 -4.389  8.045   1.00 0.00 ? 16 LYS A HG3  3  
ATOM 1829  H HD2  . LYS A 1 16 ? -8.260  -4.496  7.038   1.00 0.00 ? 16 LYS A HD2  3  
ATOM 1830  H HD3  . LYS A 1 16 ? -8.153  -3.122  8.138   1.00 0.00 ? 16 LYS A HD3  3  
ATOM 1831  H HE2  . LYS A 1 16 ? -9.225  -4.600  9.885   1.00 0.00 ? 16 LYS A HE2  3  
ATOM 1832  H HE3  . LYS A 1 16 ? -8.975  -5.947  8.776   1.00 0.00 ? 16 LYS A HE3  3  
ATOM 1833  H HZ1  . LYS A 1 16 ? -7.062  -4.523  10.413  1.00 0.00 ? 16 LYS A HZ1  3  
ATOM 1834  H HZ2  . LYS A 1 16 ? -6.538  -4.836  8.836   1.00 0.00 ? 16 LYS A HZ2  3  
ATOM 1835  H HZ3  . LYS A 1 16 ? -7.023  -6.112  9.835   1.00 0.00 ? 16 LYS A HZ3  3  
ATOM 1836  N N    . MET A 1 17 ? -9.678  -0.058  5.433   1.00 0.00 ? 17 MET A N    3  
ATOM 1837  C CA   . MET A 1 17 ? -8.639  0.943   5.654   1.00 0.00 ? 17 MET A CA   3  
ATOM 1838  C C    . MET A 1 17 ? -8.590  1.381   7.105   1.00 0.00 ? 17 MET A C    3  
ATOM 1839  O O    . MET A 1 17 ? -8.839  2.540   7.440   1.00 0.00 ? 17 MET A O    3  
ATOM 1840  C CB   . MET A 1 17 ? -8.846  2.149   4.766   1.00 0.00 ? 17 MET A CB   3  
ATOM 1841  C CG   . MET A 1 17 ? -10.282 2.649   4.719   1.00 0.00 ? 17 MET A CG   3  
ATOM 1842  S SD   . MET A 1 17 ? -10.448 4.350   5.297   1.00 0.00 ? 17 MET A SD   3  
ATOM 1843  C CE   . MET A 1 17 ? -10.741 5.208   3.751   1.00 0.00 ? 17 MET A CE   3  
ATOM 1844  H H    . MET A 1 17 ? -10.501 0.187   4.948   1.00 0.00 ? 17 MET A H    3  
ATOM 1845  H HA   . MET A 1 17 ? -7.693  0.489   5.404   1.00 0.00 ? 17 MET A HA   3  
ATOM 1846  H HB2  . MET A 1 17 ? -8.217  2.944   5.135   1.00 0.00 ? 17 MET A HB2  3  
ATOM 1847  H HB3  . MET A 1 17 ? -8.540  1.887   3.768   1.00 0.00 ? 17 MET A HB3  3  
ATOM 1848  H HG2  . MET A 1 17 ? -10.634 2.595   3.699   1.00 0.00 ? 17 MET A HG2  3  
ATOM 1849  H HG3  . MET A 1 17 ? -10.892 2.012   5.342   1.00 0.00 ? 17 MET A HG3  3  
ATOM 1850  H HE1  . MET A 1 17 ? -11.539 4.718   3.214   1.00 0.00 ? 17 MET A HE1  3  
ATOM 1851  H HE2  . MET A 1 17 ? -9.842  5.192   3.153   1.00 0.00 ? 17 MET A HE2  3  
ATOM 1852  H HE3  . MET A 1 17 ? -11.020 6.231   3.955   1.00 0.00 ? 17 MET A HE3  3  
ATOM 1853  N N    . LEU A 1 18 ? -8.259  0.435   7.950   1.00 0.00 ? 18 LEU A N    3  
ATOM 1854  C CA   . LEU A 1 18 ? -8.154  0.667   9.379   1.00 0.00 ? 18 LEU A CA   3  
ATOM 1855  C C    . LEU A 1 18 ? -7.547  -0.544  10.079  1.00 0.00 ? 18 LEU A C    3  
ATOM 1856  O O    . LEU A 1 18 ? -8.200  -1.187  10.902  1.00 0.00 ? 18 LEU A O    3  
ATOM 1857  C CB   . LEU A 1 18 ? -9.531  0.976   9.955   1.00 0.00 ? 18 LEU A CB   3  
ATOM 1858  C CG   . LEU A 1 18 ? -10.650 0.037   9.497   1.00 0.00 ? 18 LEU A CG   3  
ATOM 1859  C CD1  . LEU A 1 18 ? -10.941 -1.010  10.562  1.00 0.00 ? 18 LEU A CD1  3  
ATOM 1860  C CD2  . LEU A 1 18 ? -11.907 0.827   9.166   1.00 0.00 ? 18 LEU A CD2  3  
ATOM 1861  H H    . LEU A 1 18 ? -8.074  -0.446  7.596   1.00 0.00 ? 18 LEU A H    3  
ATOM 1862  H HA   . LEU A 1 18 ? -7.507  1.517   9.531   1.00 0.00 ? 18 LEU A HA   3  
ATOM 1863  H HB2  . LEU A 1 18 ? -9.464  0.927   11.031  1.00 0.00 ? 18 LEU A HB2  3  
ATOM 1864  H HB3  . LEU A 1 18 ? -9.796  1.980   9.669   1.00 0.00 ? 18 LEU A HB3  3  
ATOM 1865  H HG   . LEU A 1 18 ? -10.332 -0.479  8.601   1.00 0.00 ? 18 LEU A HG   3  
ATOM 1866  H HD11 . LEU A 1 18 ? -10.286 -1.858  10.422  1.00 0.00 ? 18 LEU A HD11 3  
ATOM 1867  H HD12 . LEU A 1 18 ? -11.968 -1.331  10.480  1.00 0.00 ? 18 LEU A HD12 3  
ATOM 1868  H HD13 . LEU A 1 18 ? -10.773 -0.584  11.540  1.00 0.00 ? 18 LEU A HD13 3  
ATOM 1869  H HD21 . LEU A 1 18 ? -11.633 1.819   8.836   1.00 0.00 ? 18 LEU A HD21 3  
ATOM 1870  H HD22 . LEU A 1 18 ? -12.528 0.899   10.046  1.00 0.00 ? 18 LEU A HD22 3  
ATOM 1871  H HD23 . LEU A 1 18 ? -12.453 0.324   8.380   1.00 0.00 ? 18 LEU A HD23 3  
ATOM 1872  N N    . GLY A 1 19 ? -6.302  -0.860  9.744   1.00 0.00 ? 19 GLY A N    3  
ATOM 1873  C CA   . GLY A 1 19 ? -5.650  -2.003  10.355  1.00 0.00 ? 19 GLY A CA   3  
ATOM 1874  C C    . GLY A 1 19 ? -4.138  -1.968  10.242  1.00 0.00 ? 19 GLY A C    3  
ATOM 1875  O O    . GLY A 1 19 ? -3.450  -1.565  11.180  1.00 0.00 ? 19 GLY A O    3  
ATOM 1876  H H    . GLY A 1 19 ? -5.828  -0.318  9.078   1.00 0.00 ? 19 GLY A H    3  
ATOM 1877  H HA2  . GLY A 1 19 ? -5.917  -2.034  11.401  1.00 0.00 ? 19 GLY A HA2  3  
ATOM 1878  H HA3  . GLY A 1 19 ? -6.013  -2.902  9.879   1.00 0.00 ? 19 GLY A HA3  3  
ATOM 1879  N N    . ASP A 1 20 ? -3.618  -2.408  9.100   1.00 0.00 ? 20 ASP A N    3  
ATOM 1880  C CA   . ASP A 1 20 ? -2.180  -2.443  8.881   1.00 0.00 ? 20 ASP A CA   3  
ATOM 1881  C C    . ASP A 1 20 ? -1.596  -1.040  8.769   1.00 0.00 ? 20 ASP A C    3  
ATOM 1882  O O    . ASP A 1 20 ? -2.323  -0.048  8.728   1.00 0.00 ? 20 ASP A O    3  
ATOM 1883  C CB   . ASP A 1 20 ? -1.845  -3.237  7.620   1.00 0.00 ? 20 ASP A CB   3  
ATOM 1884  C CG   . ASP A 1 20 ? -2.784  -4.409  7.390   1.00 0.00 ? 20 ASP A CG   3  
ATOM 1885  O OD1  . ASP A 1 20 ? -3.180  -5.055  8.384   1.00 0.00 ? 20 ASP A OD1  3  
ATOM 1886  O OD2  . ASP A 1 20 ? -3.122  -4.678  6.219   1.00 0.00 ? 20 ASP A OD2  3  
ATOM 1887  H H    . ASP A 1 20 ? -4.213  -2.729  8.393   1.00 0.00 ? 20 ASP A H    3  
ATOM 1888  H HA   . ASP A 1 20 ? -1.731  -2.936  9.730   1.00 0.00 ? 20 ASP A HA   3  
ATOM 1889  H HB2  . ASP A 1 20 ? -1.906  -2.580  6.768   1.00 0.00 ? 20 ASP A HB2  3  
ATOM 1890  H HB3  . ASP A 1 20 ? -0.843  -3.617  7.703   1.00 0.00 ? 20 ASP A HB3  3  
ATOM 1891  N N    . LEU A 1 21 ? -0.271  -0.976  8.736   1.00 0.00 ? 21 LEU A N    3  
ATOM 1892  C CA   . LEU A 1 21 ? 0.444   0.278   8.645   1.00 0.00 ? 21 LEU A CA   3  
ATOM 1893  C C    . LEU A 1 21 ? 1.609   0.180   7.658   1.00 0.00 ? 21 LEU A C    3  
ATOM 1894  O O    . LEU A 1 21 ? 2.653   -0.397  7.959   1.00 0.00 ? 21 LEU A O    3  
ATOM 1895  C CB   . LEU A 1 21 ? 0.933   0.658   10.038  1.00 0.00 ? 21 LEU A CB   3  
ATOM 1896  C CG   . LEU A 1 21 ? 2.129   -0.134  10.575  1.00 0.00 ? 21 LEU A CG   3  
ATOM 1897  C CD1  . LEU A 1 21 ? 2.497   0.340   11.971  1.00 0.00 ? 21 LEU A CD1  3  
ATOM 1898  C CD2  . LEU A 1 21 ? 1.824   -1.625  10.581  1.00 0.00 ? 21 LEU A CD2  3  
ATOM 1899  H H    . LEU A 1 21 ? 0.241   -1.795  8.789   1.00 0.00 ? 21 LEU A H    3  
ATOM 1900  H HA   . LEU A 1 21 ? -0.245  1.033   8.295   1.00 0.00 ? 21 LEU A HA   3  
ATOM 1901  H HB2  . LEU A 1 21 ? 1.194   1.699   10.027  1.00 0.00 ? 21 LEU A HB2  3  
ATOM 1902  H HB3  . LEU A 1 21 ? 0.109   0.514   10.720  1.00 0.00 ? 21 LEU A HB3  3  
ATOM 1903  H HG   . LEU A 1 21 ? 2.979   0.033   9.935   1.00 0.00 ? 21 LEU A HG   3  
ATOM 1904  H HD11 . LEU A 1 21 ? 3.268   -0.299  12.376  1.00 0.00 ? 21 LEU A HD11 3  
ATOM 1905  H HD12 . LEU A 1 21 ? 1.626   0.300   12.607  1.00 0.00 ? 21 LEU A HD12 3  
ATOM 1906  H HD13 . LEU A 1 21 ? 2.860   1.356   11.921  1.00 0.00 ? 21 LEU A HD13 3  
ATOM 1907  H HD21 . LEU A 1 21 ? 2.352   -2.098  11.396  1.00 0.00 ? 21 LEU A HD21 3  
ATOM 1908  H HD22 . LEU A 1 21 ? 2.141   -2.062  9.646   1.00 0.00 ? 21 LEU A HD22 3  
ATOM 1909  H HD23 . LEU A 1 21 ? 0.761   -1.775  10.706  1.00 0.00 ? 21 LEU A HD23 3  
ATOM 1910  N N    . ILE A 1 22 ? 1.413   0.739   6.472   1.00 0.00 ? 22 ILE A N    3  
ATOM 1911  C CA   . ILE A 1 22 ? 2.429   0.719   5.432   1.00 0.00 ? 22 ILE A CA   3  
ATOM 1912  C C    . ILE A 1 22 ? 3.162   2.056   5.352   1.00 0.00 ? 22 ILE A C    3  
ATOM 1913  O O    . ILE A 1 22 ? 2.613   3.098   5.710   1.00 0.00 ? 22 ILE A O    3  
ATOM 1914  C CB   . ILE A 1 22 ? 1.799   0.393   4.059   1.00 0.00 ? 22 ILE A CB   3  
ATOM 1915  C CG1  . ILE A 1 22 ? 2.771   0.662   2.922   1.00 0.00 ? 22 ILE A CG1  3  
ATOM 1916  C CG2  . ILE A 1 22 ? 0.522   1.183   3.845   1.00 0.00 ? 22 ILE A CG2  3  
ATOM 1917  C CD1  . ILE A 1 22 ? 2.693   2.071   2.374   1.00 0.00 ? 22 ILE A CD1  3  
ATOM 1918  H H    . ILE A 1 22 ? 0.556   1.171   6.286   1.00 0.00 ? 22 ILE A H    3  
ATOM 1919  H HA   . ILE A 1 22 ? 3.140   -0.058  5.673   1.00 0.00 ? 22 ILE A HA   3  
ATOM 1920  H HB   . ILE A 1 22 ? 1.549   -0.648  4.056   1.00 0.00 ? 22 ILE A HB   3  
ATOM 1921  H HG12 . ILE A 1 22 ? 3.776   0.494   3.270   1.00 0.00 ? 22 ILE A HG12 3  
ATOM 1922  H HG13 . ILE A 1 22 ? 2.557   -0.020  2.112   1.00 0.00 ? 22 ILE A HG13 3  
ATOM 1923  H HG21 . ILE A 1 22 ? 0.294   1.214   2.788   1.00 0.00 ? 22 ILE A HG21 3  
ATOM 1924  H HG22 . ILE A 1 22 ? 0.658   2.191   4.211   1.00 0.00 ? 22 ILE A HG22 3  
ATOM 1925  H HG23 . ILE A 1 22 ? -0.288  0.710   4.375   1.00 0.00 ? 22 ILE A HG23 3  
ATOM 1926  H HD11 . ILE A 1 22 ? 1.986   2.101   1.559   1.00 0.00 ? 22 ILE A HD11 3  
ATOM 1927  H HD12 . ILE A 1 22 ? 3.663   2.370   2.017   1.00 0.00 ? 22 ILE A HD12 3  
ATOM 1928  H HD13 . ILE A 1 22 ? 2.373   2.746   3.153   1.00 0.00 ? 22 ILE A HD13 3  
ATOM 1929  N N    . CYS A 1 23 ? 4.396   2.018   4.862   1.00 0.00 ? 23 CYS A N    3  
ATOM 1930  C CA   . CYS A 1 23 ? 5.198   3.228   4.712   1.00 0.00 ? 23 CYS A CA   3  
ATOM 1931  C C    . CYS A 1 23 ? 5.530   3.436   3.242   1.00 0.00 ? 23 CYS A C    3  
ATOM 1932  O O    . CYS A 1 23 ? 6.533   2.924   2.747   1.00 0.00 ? 23 CYS A O    3  
ATOM 1933  C CB   . CYS A 1 23 ? 6.483   3.126   5.536   1.00 0.00 ? 23 CYS A CB   3  
ATOM 1934  S SG   . CYS A 1 23 ? 7.548   4.602   5.439   1.00 0.00 ? 23 CYS A SG   3  
ATOM 1935  H H    . CYS A 1 23 ? 4.774   1.151   4.576   1.00 0.00 ? 23 CYS A H    3  
ATOM 1936  H HA   . CYS A 1 23 ? 4.614   4.065   5.064   1.00 0.00 ? 23 CYS A HA   3  
ATOM 1937  H HB2  . CYS A 1 23 ? 6.227   2.975   6.573   1.00 0.00 ? 23 CYS A HB2  3  
ATOM 1938  H HB3  . CYS A 1 23 ? 7.060   2.282   5.187   1.00 0.00 ? 23 CYS A HB3  3  
ATOM 1939  N N    . ALA A 1 24 ? 4.660   4.154   2.536   1.00 0.00 ? 24 ALA A N    3  
ATOM 1940  C CA   . ALA A 1 24 ? 4.854   4.373   1.109   1.00 0.00 ? 24 ALA A CA   3  
ATOM 1941  C C    . ALA A 1 24 ? 5.581   5.668   0.796   1.00 0.00 ? 24 ALA A C    3  
ATOM 1942  O O    . ALA A 1 24 ? 5.410   6.682   1.466   1.00 0.00 ? 24 ALA A O    3  
ATOM 1943  C CB   . ALA A 1 24 ? 3.523   4.337   0.379   1.00 0.00 ? 24 ALA A CB   3  
ATOM 1944  H H    . ALA A 1 24 ? 3.858   4.513   2.976   1.00 0.00 ? 24 ALA A H    3  
ATOM 1945  H HA   . ALA A 1 24 ? 5.447   3.556   0.739   1.00 0.00 ? 24 ALA A HA   3  
ATOM 1946  H HB1  . ALA A 1 24 ? 3.585   4.949   -0.509  1.00 0.00 ? 24 ALA A HB1  3  
ATOM 1947  H HB2  . ALA A 1 24 ? 2.748   4.719   1.026   1.00 0.00 ? 24 ALA A HB2  3  
ATOM 1948  H HB3  . ALA A 1 24 ? 3.294   3.320   0.099   1.00 0.00 ? 24 ALA A HB3  3  
ATOM 1949  N N    . VAL A 1 25 ? 6.387   5.609   -0.254  1.00 0.00 ? 25 VAL A N    3  
ATOM 1950  C CA   . VAL A 1 25 ? 7.155   6.745   -0.721  1.00 0.00 ? 25 VAL A CA   3  
ATOM 1951  C C    . VAL A 1 25 ? 7.121   6.816   -2.242  1.00 0.00 ? 25 VAL A C    3  
ATOM 1952  O O    . VAL A 1 25 ? 6.995   5.792   -2.928  1.00 0.00 ? 25 VAL A O    3  
ATOM 1953  C CB   . VAL A 1 25 ? 8.612   6.665   -0.236  1.00 0.00 ? 25 VAL A CB   3  
ATOM 1954  C CG1  . VAL A 1 25 ? 9.388   5.606   -1.005  1.00 0.00 ? 25 VAL A CG1  3  
ATOM 1955  C CG2  . VAL A 1 25 ? 9.288   8.024   -0.344  1.00 0.00 ? 25 VAL A CG2  3  
ATOM 1956  H H    . VAL A 1 25 ? 6.463   4.765   -0.737  1.00 0.00 ? 25 VAL A H    3  
ATOM 1957  H HA   . VAL A 1 25 ? 6.710   7.646   -0.321  1.00 0.00 ? 25 VAL A HA   3  
ATOM 1958  H HB   . VAL A 1 25 ? 8.595   6.377   0.801   1.00 0.00 ? 25 VAL A HB   3  
ATOM 1959  H HG11 . VAL A 1 25 ? 8.836   4.678   -0.994  1.00 0.00 ? 25 VAL A HG11 3  
ATOM 1960  H HG12 . VAL A 1 25 ? 10.351  5.457   -0.539  1.00 0.00 ? 25 VAL A HG12 3  
ATOM 1961  H HG13 . VAL A 1 25 ? 9.529   5.931   -2.025  1.00 0.00 ? 25 VAL A HG13 3  
ATOM 1962  H HG21 . VAL A 1 25 ? 9.660   8.160   -1.349  1.00 0.00 ? 25 VAL A HG21 3  
ATOM 1963  H HG22 . VAL A 1 25 ? 10.109  8.075   0.355   1.00 0.00 ? 25 VAL A HG22 3  
ATOM 1964  H HG23 . VAL A 1 25 ? 8.573   8.801   -0.117  1.00 0.00 ? 25 VAL A HG23 3  
ATOM 1965  N N    . ILE A 1 26 ? 7.225   8.031   -2.758  1.00 0.00 ? 26 ILE A N    3  
ATOM 1966  C CA   . ILE A 1 26 ? 7.201   8.252   -4.199  1.00 0.00 ? 26 ILE A CA   3  
ATOM 1967  C C    . ILE A 1 26 ? 8.164   9.362   -4.604  1.00 0.00 ? 26 ILE A C    3  
ATOM 1968  O O    . ILE A 1 26 ? 7.786   10.529  -4.696  1.00 0.00 ? 26 ILE A O    3  
ATOM 1969  C CB   . ILE A 1 26 ? 5.790   8.605   -4.719  1.00 0.00 ? 26 ILE A CB   3  
ATOM 1970  C CG1  . ILE A 1 26 ? 4.849   8.985   -3.565  1.00 0.00 ? 26 ILE A CG1  3  
ATOM 1971  C CG2  . ILE A 1 26 ? 5.219   7.452   -5.534  1.00 0.00 ? 26 ILE A CG2  3  
ATOM 1972  C CD1  . ILE A 1 26 ? 4.406   7.814   -2.711  1.00 0.00 ? 26 ILE A CD1  3  
ATOM 1973  H H    . ILE A 1 26 ? 7.312   8.799   -2.151  1.00 0.00 ? 26 ILE A H    3  
ATOM 1974  H HA   . ILE A 1 26 ? 7.515   7.334   -4.675  1.00 0.00 ? 26 ILE A HA   3  
ATOM 1975  H HB   . ILE A 1 26 ? 5.889   9.452   -5.381  1.00 0.00 ? 26 ILE A HB   3  
ATOM 1976  H HG12 . ILE A 1 26 ? 5.355   9.685   -2.920  1.00 0.00 ? 26 ILE A HG12 3  
ATOM 1977  H HG13 . ILE A 1 26 ? 3.964   9.453   -3.971  1.00 0.00 ? 26 ILE A HG13 3  
ATOM 1978  H HG21 . ILE A 1 26 ? 6.025   6.821   -5.879  1.00 0.00 ? 26 ILE A HG21 3  
ATOM 1979  H HG22 . ILE A 1 26 ? 4.680   7.844   -6.384  1.00 0.00 ? 26 ILE A HG22 3  
ATOM 1980  H HG23 . ILE A 1 26 ? 4.546   6.871   -4.920  1.00 0.00 ? 26 ILE A HG23 3  
ATOM 1981  H HD11 . ILE A 1 26 ? 4.642   6.888   -3.216  1.00 0.00 ? 26 ILE A HD11 3  
ATOM 1982  H HD12 . ILE A 1 26 ? 3.341   7.872   -2.545  1.00 0.00 ? 26 ILE A HD12 3  
ATOM 1983  H HD13 . ILE A 1 26 ? 4.919   7.846   -1.762  1.00 0.00 ? 26 ILE A HD13 3  
ATOM 1984  N N    . GLY A 1 27 ? 9.411   8.980   -4.845  1.00 0.00 ? 27 GLY A N    3  
ATOM 1985  C CA   . GLY A 1 27 ? 10.434  9.929   -5.244  1.00 0.00 ? 27 GLY A CA   3  
ATOM 1986  C C    . GLY A 1 27 ? 10.829  10.852  -4.115  1.00 0.00 ? 27 GLY A C    3  
ATOM 1987  O O    . GLY A 1 27 ? 11.995  10.910  -3.721  1.00 0.00 ? 27 GLY A O    3  
ATOM 1988  H H    . GLY A 1 27 ? 9.637   8.043   -4.747  1.00 0.00 ? 27 GLY A H    3  
ATOM 1989  H HA2  . GLY A 1 27 ? 11.307  9.385   -5.573  1.00 0.00 ? 27 GLY A HA2  3  
ATOM 1990  H HA3  . GLY A 1 27 ? 10.061  10.522  -6.065  1.00 0.00 ? 27 GLY A HA3  3  
ATOM 1991  N N    . ASP A 1 28 ? 9.849   11.566  -3.592  1.00 0.00 ? 28 ASP A N    3  
ATOM 1992  C CA   . ASP A 1 28 ? 10.070  12.492  -2.493  1.00 0.00 ? 28 ASP A CA   3  
ATOM 1993  C C    . ASP A 1 28 ? 8.784   12.696  -1.703  1.00 0.00 ? 28 ASP A C    3  
ATOM 1994  O O    . ASP A 1 28 ? 8.607   13.718  -1.039  1.00 0.00 ? 28 ASP A O    3  
ATOM 1995  C CB   . ASP A 1 28 ? 10.578  13.834  -3.022  1.00 0.00 ? 28 ASP A CB   3  
ATOM 1996  C CG   . ASP A 1 28 ? 9.713   14.381  -4.139  1.00 0.00 ? 28 ASP A CG   3  
ATOM 1997  O OD1  . ASP A 1 28 ? 8.482   14.176  -4.091  1.00 0.00 ? 28 ASP A OD1  3  
ATOM 1998  O OD2  . ASP A 1 28 ? 10.265  15.015  -5.063  1.00 0.00 ? 28 ASP A OD2  3  
ATOM 1999  H H    . ASP A 1 28 ? 8.946   11.463  -3.952  1.00 0.00 ? 28 ASP A H    3  
ATOM 2000  H HA   . ASP A 1 28 ? 10.816  12.063  -1.842  1.00 0.00 ? 28 ASP A HA   3  
ATOM 2001  H HB2  . ASP A 1 28 ? 10.589  14.551  -2.215  1.00 0.00 ? 28 ASP A HB2  3  
ATOM 2002  H HB3  . ASP A 1 28 ? 11.583  13.708  -3.399  1.00 0.00 ? 28 ASP A HB3  3  
ATOM 2003  N N    . ALA A 1 29 ? 7.885   11.714  -1.771  1.00 0.00 ? 29 ALA A N    3  
ATOM 2004  C CA   . ALA A 1 29 ? 6.620   11.794  -1.052  1.00 0.00 ? 29 ALA A CA   3  
ATOM 2005  C C    . ALA A 1 29 ? 6.433   10.573  -0.166  1.00 0.00 ? 29 ALA A C    3  
ATOM 2006  O O    . ALA A 1 29 ? 5.733   9.629   -0.530  1.00 0.00 ? 29 ALA A O    3  
ATOM 2007  C CB   . ALA A 1 29 ? 5.460   11.932  -2.028  1.00 0.00 ? 29 ALA A CB   3  
ATOM 2008  H H    . ALA A 1 29 ? 8.080   10.911  -2.312  1.00 0.00 ? 29 ALA A H    3  
ATOM 2009  H HA   . ALA A 1 29 ? 6.645   12.678  -0.429  1.00 0.00 ? 29 ALA A HA   3  
ATOM 2010  H HB1  . ALA A 1 29 ? 5.128   12.960  -2.048  1.00 0.00 ? 29 ALA A HB1  3  
ATOM 2011  H HB2  . ALA A 1 29 ? 4.645   11.297  -1.713  1.00 0.00 ? 29 ALA A HB2  3  
ATOM 2012  H HB3  . ALA A 1 29 ? 5.784   11.639  -3.015  1.00 0.00 ? 29 ALA A HB3  3  
ATOM 2013  N N    . LYS A 1 30 ? 7.078   10.594  0.994   1.00 0.00 ? 30 LYS A N    3  
ATOM 2014  C CA   . LYS A 1 30 ? 6.997   9.483   1.929   1.00 0.00 ? 30 LYS A CA   3  
ATOM 2015  C C    . LYS A 1 30 ? 5.880   9.696   2.947   1.00 0.00 ? 30 LYS A C    3  
ATOM 2016  O O    . LYS A 1 30 ? 5.961   10.577  3.802   1.00 0.00 ? 30 LYS A O    3  
ATOM 2017  C CB   . LYS A 1 30 ? 8.333   9.302   2.653   1.00 0.00 ? 30 LYS A CB   3  
ATOM 2018  C CG   . LYS A 1 30 ? 8.342   8.135   3.628   1.00 0.00 ? 30 LYS A CG   3  
ATOM 2019  C CD   . LYS A 1 30 ? 8.633   8.595   5.048   1.00 0.00 ? 30 LYS A CD   3  
ATOM 2020  C CE   . LYS A 1 30 ? 10.002  9.248   5.151   1.00 0.00 ? 30 LYS A CE   3  
ATOM 2021  N NZ   . LYS A 1 30 ? 9.914   10.735  5.116   1.00 0.00 ? 30 LYS A NZ   3  
ATOM 2022  H H    . LYS A 1 30 ? 7.630   11.371  1.222   1.00 0.00 ? 30 LYS A H    3  
ATOM 2023  H HA   . LYS A 1 30 ? 6.785   8.591   1.358   1.00 0.00 ? 30 LYS A HA   3  
ATOM 2024  H HB2  . LYS A 1 30 ? 9.106   9.136   1.918   1.00 0.00 ? 30 LYS A HB2  3  
ATOM 2025  H HB3  . LYS A 1 30 ? 8.557   10.205  3.201   1.00 0.00 ? 30 LYS A HB3  3  
ATOM 2026  H HG2  . LYS A 1 30 ? 7.376   7.652   3.608   1.00 0.00 ? 30 LYS A HG2  3  
ATOM 2027  H HG3  . LYS A 1 30 ? 9.104   7.431   3.325   1.00 0.00 ? 30 LYS A HG3  3  
ATOM 2028  H HD2  . LYS A 1 30 ? 7.880   9.310   5.346   1.00 0.00 ? 30 LYS A HD2  3  
ATOM 2029  H HD3  . LYS A 1 30 ? 8.601   7.740   5.707   1.00 0.00 ? 30 LYS A HD3  3  
ATOM 2030  H HE2  . LYS A 1 30 ? 10.461  8.947   6.081   1.00 0.00 ? 30 LYS A HE2  3  
ATOM 2031  H HE3  . LYS A 1 30 ? 10.610  8.912   4.325   1.00 0.00 ? 30 LYS A HE3  3  
ATOM 2032  H HZ1  . LYS A 1 30 ? 10.074  11.080  4.148   1.00 0.00 ? 30 LYS A HZ1  3  
ATOM 2033  H HZ2  . LYS A 1 30 ? 10.632  11.150  5.743   1.00 0.00 ? 30 LYS A HZ2  3  
ATOM 2034  H HZ3  . LYS A 1 30 ? 8.973   11.045  5.432   1.00 0.00 ? 30 LYS A HZ3  3  
ATOM 2035  N N    . GLU A 1 31 ? 4.844   8.872   2.850   1.00 0.00 ? 31 GLU A N    3  
ATOM 2036  C CA   . GLU A 1 31 ? 3.709   8.948   3.759   1.00 0.00 ? 31 GLU A CA   3  
ATOM 2037  C C    . GLU A 1 31 ? 3.147   7.555   4.018   1.00 0.00 ? 31 GLU A C    3  
ATOM 2038  O O    . GLU A 1 31 ? 3.037   6.743   3.101   1.00 0.00 ? 31 GLU A O    3  
ATOM 2039  C CB   . GLU A 1 31 ? 2.617   9.848   3.180   1.00 0.00 ? 31 GLU A CB   3  
ATOM 2040  C CG   . GLU A 1 31 ? 2.213   9.480   1.762   1.00 0.00 ? 31 GLU A CG   3  
ATOM 2041  C CD   . GLU A 1 31 ? 2.172   10.680  0.837   1.00 0.00 ? 31 GLU A CD   3  
ATOM 2042  O OE1  . GLU A 1 31 ? 1.415   11.630  1.130   1.00 0.00 ? 31 GLU A OE1  3  
ATOM 2043  O OE2  . GLU A 1 31 ? 2.898   10.672  -0.180  1.00 0.00 ? 31 GLU A OE2  3  
ATOM 2044  H H    . GLU A 1 31 ? 4.846   8.186   2.150   1.00 0.00 ? 31 GLU A H    3  
ATOM 2045  H HA   . GLU A 1 31 ? 4.055   9.366   4.693   1.00 0.00 ? 31 GLU A HA   3  
ATOM 2046  H HB2  . GLU A 1 31 ? 1.742   9.781   3.810   1.00 0.00 ? 31 GLU A HB2  3  
ATOM 2047  H HB3  . GLU A 1 31 ? 2.972   10.868  3.179   1.00 0.00 ? 31 GLU A HB3  3  
ATOM 2048  H HG2  . GLU A 1 31 ? 2.926   8.768   1.371   1.00 0.00 ? 31 GLU A HG2  3  
ATOM 2049  H HG3  . GLU A 1 31 ? 1.232   9.029   1.787   1.00 0.00 ? 31 GLU A HG3  3  
ATOM 2050  N N    . GLU A 1 32 ? 2.797   7.282   5.269   1.00 0.00 ? 32 GLU A N    3  
ATOM 2051  C CA   . GLU A 1 32 ? 2.252   5.978   5.628   1.00 0.00 ? 32 GLU A CA   3  
ATOM 2052  C C    . GLU A 1 32 ? 0.862   5.791   5.054   1.00 0.00 ? 32 GLU A C    3  
ATOM 2053  O O    . GLU A 1 32 ? 0.270   6.718   4.501   1.00 0.00 ? 32 GLU A O    3  
ATOM 2054  C CB   . GLU A 1 32 ? 2.184   5.810   7.145   1.00 0.00 ? 32 GLU A CB   3  
ATOM 2055  C CG   . GLU A 1 32 ? 3.493   5.361   7.772   1.00 0.00 ? 32 GLU A CG   3  
ATOM 2056  C CD   . GLU A 1 32 ? 3.299   4.253   8.788   1.00 0.00 ? 32 GLU A CD   3  
ATOM 2057  O OE1  . GLU A 1 32 ? 2.409   4.388   9.653   1.00 0.00 ? 32 GLU A OE1  3  
ATOM 2058  O OE2  . GLU A 1 32 ? 4.039   3.248   8.720   1.00 0.00 ? 32 GLU A OE2  3  
ATOM 2059  H H    . GLU A 1 32 ? 2.907   7.965   5.963   1.00 0.00 ? 32 GLU A H    3  
ATOM 2060  H HA   . GLU A 1 32 ? 2.905   5.222   5.220   1.00 0.00 ? 32 GLU A HA   3  
ATOM 2061  H HB2  . GLU A 1 32 ? 1.895   6.750   7.587   1.00 0.00 ? 32 GLU A HB2  3  
ATOM 2062  H HB3  . GLU A 1 32 ? 1.427   5.070   7.373   1.00 0.00 ? 32 GLU A HB3  3  
ATOM 2063  H HG2  . GLU A 1 32 ? 4.146   5.001   6.992   1.00 0.00 ? 32 GLU A HG2  3  
ATOM 2064  H HG3  . GLU A 1 32 ? 3.951   6.206   8.264   1.00 0.00 ? 32 GLU A HG3  3  
ATOM 2065  N N    . HIS A 1 33 ? 0.344   4.583   5.203   1.00 0.00 ? 33 HIS A N    3  
ATOM 2066  C CA   . HIS A 1 33 ? -0.986  4.261   4.718   1.00 0.00 ? 33 HIS A CA   3  
ATOM 2067  C C    . HIS A 1 33 ? -1.528  3.021   5.414   1.00 0.00 ? 33 HIS A C    3  
ATOM 2068  O O    . HIS A 1 33 ? -0.771  2.202   5.931   1.00 0.00 ? 33 HIS A O    3  
ATOM 2069  C CB   . HIS A 1 33 ? -0.970  4.049   3.203   1.00 0.00 ? 33 HIS A CB   3  
ATOM 2070  C CG   . HIS A 1 33 ? -2.154  4.646   2.508   1.00 0.00 ? 33 HIS A CG   3  
ATOM 2071  N ND1  . HIS A 1 33 ? -3.385  4.026   2.450   1.00 0.00 ? 33 HIS A ND1  3  
ATOM 2072  C CD2  . HIS A 1 33 ? -2.293  5.817   1.843   1.00 0.00 ? 33 HIS A CD2  3  
ATOM 2073  C CE1  . HIS A 1 33 ? -4.229  4.791   1.779   1.00 0.00 ? 33 HIS A CE1  3  
ATOM 2074  N NE2  . HIS A 1 33 ? -3.591  5.883   1.401   1.00 0.00 ? 33 HIS A NE2  3  
ATOM 2075  H H    . HIS A 1 33 ? 0.869   3.892   5.662   1.00 0.00 ? 33 HIS A H    3  
ATOM 2076  H HA   . HIS A 1 33 ? -1.632  5.095   4.947   1.00 0.00 ? 33 HIS A HA   3  
ATOM 2077  H HB2  . HIS A 1 33 ? -0.080  4.500   2.791   1.00 0.00 ? 33 HIS A HB2  3  
ATOM 2078  H HB3  . HIS A 1 33 ? -0.961  2.989   2.994   1.00 0.00 ? 33 HIS A HB3  3  
ATOM 2079  H HD1  . HIS A 1 33 ? -3.606  3.156   2.842   1.00 0.00 ? 33 HIS A HD1  3  
ATOM 2080  H HD2  . HIS A 1 33 ? -1.524  6.562   1.688   1.00 0.00 ? 33 HIS A HD2  3  
ATOM 2081  H HE1  . HIS A 1 33 ? -5.264  4.561   1.576   1.00 0.00 ? 33 HIS A HE1  3  
ATOM 2082  H HE2  . HIS A 1 33 ? -4.007  6.658   0.968   1.00 0.00 ? 33 HIS A HE2  3  
ATOM 2083  N N    . ARG A 1 34 ? -2.844  2.891   5.423   1.00 0.00 ? 34 ARG A N    3  
ATOM 2084  C CA   . ARG A 1 34 ? -3.493  1.748   6.050   1.00 0.00 ? 34 ARG A CA   3  
ATOM 2085  C C    . ARG A 1 34 ? -3.841  0.689   5.011   1.00 0.00 ? 34 ARG A C    3  
ATOM 2086  O O    . ARG A 1 34 ? -3.374  -0.448  5.087   1.00 0.00 ? 34 ARG A O    3  
ATOM 2087  C CB   . ARG A 1 34 ? -4.759  2.183   6.781   1.00 0.00 ? 34 ARG A CB   3  
ATOM 2088  C CG   . ARG A 1 34 ? -4.586  3.446   7.611   1.00 0.00 ? 34 ARG A CG   3  
ATOM 2089  C CD   . ARG A 1 34 ? -3.404  3.335   8.562   1.00 0.00 ? 34 ARG A CD   3  
ATOM 2090  N NE   . ARG A 1 34 ? -3.629  2.336   9.603   1.00 0.00 ? 34 ARG A NE   3  
ATOM 2091  C CZ   . ARG A 1 34 ? -4.363  2.552   10.693  1.00 0.00 ? 34 ARG A CZ   3  
ATOM 2092  N NH1  . ARG A 1 34 ? -4.948  3.728   10.885  1.00 0.00 ? 34 ARG A NH1  3  
ATOM 2093  N NH2  . ARG A 1 34 ? -4.511  1.590   11.593  1.00 0.00 ? 34 ARG A NH2  3  
ATOM 2094  H H    . ARG A 1 34 ? -3.389  3.583   4.998   1.00 0.00 ? 34 ARG A H    3  
ATOM 2095  H HA   . ARG A 1 34 ? -2.803  1.323   6.763   1.00 0.00 ? 34 ARG A HA   3  
ATOM 2096  H HB2  . ARG A 1 34 ? -5.535  2.358   6.052   1.00 0.00 ? 34 ARG A HB2  3  
ATOM 2097  H HB3  . ARG A 1 34 ? -5.069  1.384   7.438   1.00 0.00 ? 34 ARG A HB3  3  
ATOM 2098  H HG2  . ARG A 1 34 ? -4.422  4.282   6.947   1.00 0.00 ? 34 ARG A HG2  3  
ATOM 2099  H HG3  . ARG A 1 34 ? -5.485  3.613   8.187   1.00 0.00 ? 34 ARG A HG3  3  
ATOM 2100  H HD2  . ARG A 1 34 ? -2.528  3.056   7.994   1.00 0.00 ? 34 ARG A HD2  3  
ATOM 2101  H HD3  . ARG A 1 34 ? -3.240  4.296   9.027   1.00 0.00 ? 34 ARG A HD3  3  
ATOM 2102  H HE   . ARG A 1 34 ? -3.210  1.457   9.486   1.00 0.00 ? 34 ARG A HE   3  
ATOM 2103  H HH11 . ARG A 1 34 ? -4.840  4.458   10.210  1.00 0.00 ? 34 ARG A HH11 3  
ATOM 2104  H HH12 . ARG A 1 34 ? -5.497  3.885   11.705  1.00 0.00 ? 34 ARG A HH12 3  
ATOM 2105  H HH21 . ARG A 1 34 ? -4.074  0.702   11.453  1.00 0.00 ? 34 ARG A HH21 3  
ATOM 2106  H HH22 . ARG A 1 34 ? -5.062  1.753   12.413  1.00 0.00 ? 34 ARG A HH22 3  
ATOM 2107  N N    . ASN A 1 35 ? -4.664  1.068   4.037   1.00 0.00 ? 35 ASN A N    3  
ATOM 2108  C CA   . ASN A 1 35 ? -5.070  0.147   2.985   1.00 0.00 ? 35 ASN A CA   3  
ATOM 2109  C C    . ASN A 1 35 ? -3.985  0.021   1.926   1.00 0.00 ? 35 ASN A C    3  
ATOM 2110  O O    . ASN A 1 35 ? -4.141  0.469   0.788   1.00 0.00 ? 35 ASN A O    3  
ATOM 2111  C CB   . ASN A 1 35 ? -6.388  0.594   2.351   1.00 0.00 ? 35 ASN A CB   3  
ATOM 2112  C CG   . ASN A 1 35 ? -7.475  -0.456  2.483   1.00 0.00 ? 35 ASN A CG   3  
ATOM 2113  O OD1  . ASN A 1 35 ? -8.264  -0.667  1.562   1.00 0.00 ? 35 ASN A OD1  3  
ATOM 2114  N ND2  . ASN A 1 35 ? -7.525  -1.122  3.633   1.00 0.00 ? 35 ASN A ND2  3  
ATOM 2115  H H    . ASN A 1 35 ? -5.004  1.988   4.028   1.00 0.00 ? 35 ASN A H    3  
ATOM 2116  H HA   . ASN A 1 35 ? -5.213  -0.822  3.439   1.00 0.00 ? 35 ASN A HA   3  
ATOM 2117  H HB2  . ASN A 1 35 ? -6.726  1.496   2.838   1.00 0.00 ? 35 ASN A HB2  3  
ATOM 2118  H HB3  . ASN A 1 35 ? -6.232  0.794   1.301   1.00 0.00 ? 35 ASN A HB3  3  
ATOM 2119  H HD21 . ASN A 1 35 ? -6.868  -0.903  4.325   1.00 0.00 ? 35 ASN A HD21 3  
ATOM 2120  H HD22 . ASN A 1 35 ? -8.217  -1.808  3.740   1.00 0.00 ? 35 ASN A HD22 3  
ATOM 2121  N N    . MET A 1 36 ? -2.886  -0.607  2.316   1.00 0.00 ? 36 MET A N    3  
ATOM 2122  C CA   . MET A 1 36 ? -1.764  -0.819  1.420   1.00 0.00 ? 36 MET A CA   3  
ATOM 2123  C C    . MET A 1 36 ? -2.203  -1.563  0.158   1.00 0.00 ? 36 MET A C    3  
ATOM 2124  O O    . MET A 1 36 ? -1.512  -1.533  -0.860  1.00 0.00 ? 36 MET A O    3  
ATOM 2125  C CB   . MET A 1 36 ? -0.671  -1.598  2.152   1.00 0.00 ? 36 MET A CB   3  
ATOM 2126  C CG   . MET A 1 36 ? 0.508   -1.983  1.273   1.00 0.00 ? 36 MET A CG   3  
ATOM 2127  S SD   . MET A 1 36 ? 0.551   -3.746  0.897   1.00 0.00 ? 36 MET A SD   3  
ATOM 2128  C CE   . MET A 1 36 ? 0.472   -4.447  2.543   1.00 0.00 ? 36 MET A CE   3  
ATOM 2129  H H    . MET A 1 36 ? -2.831  -0.944  3.234   1.00 0.00 ? 36 MET A H    3  
ATOM 2130  H HA   . MET A 1 36 ? -1.376  0.148   1.138   1.00 0.00 ? 36 MET A HA   3  
ATOM 2131  H HB2  . MET A 1 36 ? -0.303  -0.991  2.968   1.00 0.00 ? 36 MET A HB2  3  
ATOM 2132  H HB3  . MET A 1 36 ? -1.104  -2.500  2.559   1.00 0.00 ? 36 MET A HB3  3  
ATOM 2133  H HG2  . MET A 1 36 ? 0.442   -1.434  0.345   1.00 0.00 ? 36 MET A HG2  3  
ATOM 2134  H HG3  . MET A 1 36 ? 1.423   -1.716  1.784   1.00 0.00 ? 36 MET A HG3  3  
ATOM 2135  H HE1  . MET A 1 36 ? 0.508   -3.654  3.275   1.00 0.00 ? 36 MET A HE1  3  
ATOM 2136  H HE2  . MET A 1 36 ? 1.310   -5.113  2.691   1.00 0.00 ? 36 MET A HE2  3  
ATOM 2137  H HE3  . MET A 1 36 ? -0.449  -5.001  2.656   1.00 0.00 ? 36 MET A HE3  3  
ATOM 2138  N N    . CYS A 1 37 ? -3.360  -2.226  0.226   1.00 0.00 ? 37 CYS A N    3  
ATOM 2139  C CA   . CYS A 1 37 ? -3.879  -2.966  -0.918  1.00 0.00 ? 37 CYS A CA   3  
ATOM 2140  C C    . CYS A 1 37 ? -4.411  -2.007  -1.981  1.00 0.00 ? 37 CYS A C    3  
ATOM 2141  O O    . CYS A 1 37 ? -4.048  -2.103  -3.153  1.00 0.00 ? 37 CYS A O    3  
ATOM 2142  C CB   . CYS A 1 37 ? -4.952  -3.979  -0.462  1.00 0.00 ? 37 CYS A CB   3  
ATOM 2143  S SG   . CYS A 1 37 ? -6.682  -3.562  -0.889  1.00 0.00 ? 37 CYS A SG   3  
ATOM 2144  H H    . CYS A 1 37 ? -3.872  -2.217  1.060   1.00 0.00 ? 37 CYS A H    3  
ATOM 2145  H HA   . CYS A 1 37 ? -3.053  -3.508  -1.347  1.00 0.00 ? 37 CYS A HA   3  
ATOM 2146  H HB2  . CYS A 1 37 ? -4.736  -4.936  -0.911  1.00 0.00 ? 37 CYS A HB2  3  
ATOM 2147  H HB3  . CYS A 1 37 ? -4.898  -4.078  0.613   1.00 0.00 ? 37 CYS A HB3  3  
ATOM 2148  N N    . ALA A 1 38 ? -5.254  -1.070  -1.565  1.00 0.00 ? 38 ALA A N    3  
ATOM 2149  C CA   . ALA A 1 38 ? -5.815  -0.083  -2.483  1.00 0.00 ? 38 ALA A CA   3  
ATOM 2150  C C    . ALA A 1 38 ? -4.729  0.843   -3.013  1.00 0.00 ? 38 ALA A C    3  
ATOM 2151  O O    . ALA A 1 38 ? -4.920  1.539   -4.009  1.00 0.00 ? 38 ALA A O    3  
ATOM 2152  C CB   . ALA A 1 38 ? -6.912  0.719   -1.799  1.00 0.00 ? 38 ALA A CB   3  
ATOM 2153  H H    . ALA A 1 38 ? -5.494  -1.034  -0.616  1.00 0.00 ? 38 ALA A H    3  
ATOM 2154  H HA   . ALA A 1 38 ? -6.249  -0.608  -3.314  1.00 0.00 ? 38 ALA A HA   3  
ATOM 2155  H HB1  . ALA A 1 38 ? -7.455  0.079   -1.121  1.00 0.00 ? 38 ALA A HB1  3  
ATOM 2156  H HB2  . ALA A 1 38 ? -7.588  1.111   -2.544  1.00 0.00 ? 38 ALA A HB2  3  
ATOM 2157  H HB3  . ALA A 1 38 ? -6.470  1.535   -1.248  1.00 0.00 ? 38 ALA A HB3  3  
ATOM 2158  N N    . LEU A 1 39 ? -3.590  0.841   -2.337  1.00 0.00 ? 39 LEU A N    3  
ATOM 2159  C CA   . LEU A 1 39 ? -2.461  1.672   -2.722  1.00 0.00 ? 39 LEU A CA   3  
ATOM 2160  C C    . LEU A 1 39 ? -1.691  1.034   -3.865  1.00 0.00 ? 39 LEU A C    3  
ATOM 2161  O O    . LEU A 1 39 ? -1.278  1.707   -4.807  1.00 0.00 ? 39 LEU A O    3  
ATOM 2162  C CB   . LEU A 1 39 ? -1.538  1.834   -1.524  1.00 0.00 ? 39 LEU A CB   3  
ATOM 2163  C CG   . LEU A 1 39 ? -1.338  3.270   -1.035  1.00 0.00 ? 39 LEU A CG   3  
ATOM 2164  C CD1  . LEU A 1 39 ? -2.678  3.951   -0.800  1.00 0.00 ? 39 LEU A CD1  3  
ATOM 2165  C CD2  . LEU A 1 39 ? -0.501  3.285   0.234   1.00 0.00 ? 39 LEU A CD2  3  
ATOM 2166  H H    . LEU A 1 39 ? -3.505  0.264   -1.549  1.00 0.00 ? 39 LEU A H    3  
ATOM 2167  H HA   . LEU A 1 39 ? -2.828  2.634   -3.031  1.00 0.00 ? 39 LEU A HA   3  
ATOM 2168  H HB2  . LEU A 1 39 ? -1.947  1.245   -0.721  1.00 0.00 ? 39 LEU A HB2  3  
ATOM 2169  H HB3  . LEU A 1 39 ? -0.571  1.430   -1.782  1.00 0.00 ? 39 LEU A HB3  3  
ATOM 2170  H HG   . LEU A 1 39 ? -0.808  3.828   -1.791  1.00 0.00 ? 39 LEU A HG   3  
ATOM 2171  H HD11 . LEU A 1 39 ? -2.513  4.967   -0.475  1.00 0.00 ? 39 LEU A HD11 3  
ATOM 2172  H HD12 . LEU A 1 39 ? -3.226  3.414   -0.039  1.00 0.00 ? 39 LEU A HD12 3  
ATOM 2173  H HD13 . LEU A 1 39 ? -3.247  3.956   -1.717  1.00 0.00 ? 39 LEU A HD13 3  
ATOM 2174  H HD21 . LEU A 1 39 ? 0.506   2.968   0.006   1.00 0.00 ? 39 LEU A HD21 3  
ATOM 2175  H HD22 . LEU A 1 39 ? -0.934  2.611   0.959   1.00 0.00 ? 39 LEU A HD22 3  
ATOM 2176  H HD23 . LEU A 1 39 ? -0.480  4.285   0.641   1.00 0.00 ? 39 LEU A HD23 3  
ATOM 2177  N N    . CYS A 1 40 ? -1.497  -0.273  -3.762  1.00 0.00 ? 40 CYS A N    3  
ATOM 2178  C CA   . CYS A 1 40 ? -0.766  -1.015  -4.773  1.00 0.00 ? 40 CYS A CA   3  
ATOM 2179  C C    . CYS A 1 40 ? -1.528  -1.018  -6.088  1.00 0.00 ? 40 CYS A C    3  
ATOM 2180  O O    . CYS A 1 40 ? -0.934  -0.949  -7.164  1.00 0.00 ? 40 CYS A O    3  
ATOM 2181  C CB   . CYS A 1 40 ? -0.498  -2.446  -4.297  1.00 0.00 ? 40 CYS A CB   3  
ATOM 2182  S SG   . CYS A 1 40 ? -1.918  -3.579  -4.460  1.00 0.00 ? 40 CYS A SG   3  
ATOM 2183  H H    . CYS A 1 40 ? -1.850  -0.747  -2.982  1.00 0.00 ? 40 CYS A H    3  
ATOM 2184  H HA   . CYS A 1 40 ? 0.176   -0.515  -4.923  1.00 0.00 ? 40 CYS A HA   3  
ATOM 2185  H HB2  . CYS A 1 40 ? 0.316   -2.860  -4.872  1.00 0.00 ? 40 CYS A HB2  3  
ATOM 2186  H HB3  . CYS A 1 40 ? -0.216  -2.422  -3.254  1.00 0.00 ? 40 CYS A HB3  3  
ATOM 2187  N N    . CYS A 1 41 ? -2.849  -1.099  -5.996  1.00 0.00 ? 41 CYS A N    3  
ATOM 2188  C CA   . CYS A 1 41 ? -3.688  -1.111  -7.184  1.00 0.00 ? 41 CYS A CA   3  
ATOM 2189  C C    . CYS A 1 41 ? -3.814  0.287   -7.779  1.00 0.00 ? 41 CYS A C    3  
ATOM 2190  O O    . CYS A 1 41 ? -3.816  0.463   -8.997  1.00 0.00 ? 41 CYS A O    3  
ATOM 2191  C CB   . CYS A 1 41 ? -5.066  -1.664  -6.833  1.00 0.00 ? 41 CYS A CB   3  
ATOM 2192  S SG   . CYS A 1 41 ? -6.270  -0.434  -6.232  1.00 0.00 ? 41 CYS A SG   3  
ATOM 2193  H H    . CYS A 1 41 ? -3.273  -1.155  -5.105  1.00 0.00 ? 41 CYS A H    3  
ATOM 2194  H HA   . CYS A 1 41 ? -3.227  -1.762  -7.910  1.00 0.00 ? 41 CYS A HA   3  
ATOM 2195  H HB2  . CYS A 1 41 ? -5.487  -2.131  -7.704  1.00 0.00 ? 41 CYS A HB2  3  
ATOM 2196  H HB3  . CYS A 1 41 ? -4.945  -2.400  -6.060  1.00 0.00 ? 41 CYS A HB3  3  
ATOM 2197  N N    . GLU A 1 42 ? -3.941  1.270   -6.900  1.00 0.00 ? 42 GLU A N    3  
ATOM 2198  C CA   . GLU A 1 42 ? -4.095  2.663   -7.316  1.00 0.00 ? 42 GLU A CA   3  
ATOM 2199  C C    . GLU A 1 42 ? -2.762  3.309   -7.693  1.00 0.00 ? 42 GLU A C    3  
ATOM 2200  O O    . GLU A 1 42 ? -2.734  4.425   -8.209  1.00 0.00 ? 42 GLU A O    3  
ATOM 2201  C CB   . GLU A 1 42 ? -4.762  3.470   -6.201  1.00 0.00 ? 42 GLU A CB   3  
ATOM 2202  C CG   . GLU A 1 42 ? -5.482  4.714   -6.696  1.00 0.00 ? 42 GLU A CG   3  
ATOM 2203  C CD   . GLU A 1 42 ? -6.938  4.751   -6.273  1.00 0.00 ? 42 GLU A CD   3  
ATOM 2204  O OE1  . GLU A 1 42 ? -7.244  4.274   -5.160  1.00 0.00 ? 42 GLU A OE1  3  
ATOM 2205  O OE2  . GLU A 1 42 ? -7.771  5.256   -7.053  1.00 0.00 ? 42 GLU A OE2  3  
ATOM 2206  H H    . GLU A 1 42 ? -3.946  1.047   -5.942  1.00 0.00 ? 42 GLU A H    3  
ATOM 2207  H HA   . GLU A 1 42 ? -4.739  2.676   -8.182  1.00 0.00 ? 42 GLU A HA   3  
ATOM 2208  H HB2  . GLU A 1 42 ? -5.481  2.841   -5.699  1.00 0.00 ? 42 GLU A HB2  3  
ATOM 2209  H HB3  . GLU A 1 42 ? -4.006  3.776   -5.493  1.00 0.00 ? 42 GLU A HB3  3  
ATOM 2210  H HG2  . GLU A 1 42 ? -4.985  5.586   -6.295  1.00 0.00 ? 42 GLU A HG2  3  
ATOM 2211  H HG3  . GLU A 1 42 ? -5.435  4.738   -7.775  1.00 0.00 ? 42 GLU A HG3  3  
ATOM 2212  N N    . HIS A 1 43 ? -1.658  2.618   -7.425  1.00 0.00 ? 43 HIS A N    3  
ATOM 2213  C CA   . HIS A 1 43 ? -0.335  3.154   -7.735  1.00 0.00 ? 43 HIS A CA   3  
ATOM 2214  C C    . HIS A 1 43 ? 0.320   2.408   -8.896  1.00 0.00 ? 43 HIS A C    3  
ATOM 2215  O O    . HIS A 1 43 ? -0.159  1.355   -9.320  1.00 0.00 ? 43 HIS A O    3  
ATOM 2216  C CB   . HIS A 1 43 ? 0.547   3.099   -6.488  1.00 0.00 ? 43 HIS A CB   3  
ATOM 2217  C CG   . HIS A 1 43 ? 0.137   4.094   -5.448  1.00 0.00 ? 43 HIS A CG   3  
ATOM 2218  N ND1  . HIS A 1 43 ? -0.320  5.358   -5.760  1.00 0.00 ? 43 HIS A ND1  3  
ATOM 2219  C CD2  . HIS A 1 43 ? 0.100   4.007   -4.097  1.00 0.00 ? 43 HIS A CD2  3  
ATOM 2220  C CE1  . HIS A 1 43 ? -0.621  6.003   -4.647  1.00 0.00 ? 43 HIS A CE1  3  
ATOM 2221  N NE2  . HIS A 1 43 ? -0.376  5.207   -3.624  1.00 0.00 ? 43 HIS A NE2  3  
ATOM 2222  H H    . HIS A 1 43 ? -1.731  1.737   -7.003  1.00 0.00 ? 43 HIS A H    3  
ATOM 2223  H HA   . HIS A 1 43 ? -0.455  4.188   -8.023  1.00 0.00 ? 43 HIS A HA   3  
ATOM 2224  H HB2  . HIS A 1 43 ? 0.483   2.114   -6.053  1.00 0.00 ? 43 HIS A HB2  3  
ATOM 2225  H HB3  . HIS A 1 43 ? 1.569   3.302   -6.764  1.00 0.00 ? 43 HIS A HB3  3  
ATOM 2226  H HD1  . HIS A 1 43 ? -0.409  5.727   -6.663  1.00 0.00 ? 43 HIS A HD1  3  
ATOM 2227  H HD2  . HIS A 1 43 ? 0.386   3.152   -3.502  1.00 0.00 ? 43 HIS A HD2  3  
ATOM 2228  H HE1  . HIS A 1 43 ? -1.006  7.010   -4.586  1.00 0.00 ? 43 HIS A HE1  3  
ATOM 2229  H HE2  . HIS A 1 43 ? -0.370  5.487   -2.685  1.00 0.00 ? 43 HIS A HE2  3  
ATOM 2230  N N    . PRO A 1 44 ? 1.429   2.953   -9.426  1.00 0.00 ? 44 PRO A N    3  
ATOM 2231  C CA   . PRO A 1 44 ? 2.161   2.352   -10.545 1.00 0.00 ? 44 PRO A CA   3  
ATOM 2232  C C    . PRO A 1 44 ? 2.892   1.089   -10.116 1.00 0.00 ? 44 PRO A C    3  
ATOM 2233  O O    . PRO A 1 44 ? 3.942   1.156   -9.479  1.00 0.00 ? 44 PRO A O    3  
ATOM 2234  C CB   . PRO A 1 44 ? 3.165   3.443   -10.959 1.00 0.00 ? 44 PRO A CB   3  
ATOM 2235  C CG   . PRO A 1 44 ? 2.741   4.676   -10.227 1.00 0.00 ? 44 PRO A CG   3  
ATOM 2236  C CD   . PRO A 1 44 ? 2.063   4.196   -8.979  1.00 0.00 ? 44 PRO A CD   3  
ATOM 2237  H HA   . PRO A 1 44 ? 1.506   2.126   -11.373 1.00 0.00 ? 44 PRO A HA   3  
ATOM 2238  H HB2  . PRO A 1 44 ? 4.162   3.142   -10.674 1.00 0.00 ? 44 PRO A HB2  3  
ATOM 2239  H HB3  . PRO A 1 44 ? 3.122   3.586   -12.027 1.00 0.00 ? 44 PRO A HB3  3  
ATOM 2240  H HG2  . PRO A 1 44 ? 3.605   5.274   -9.980  1.00 0.00 ? 44 PRO A HG2  3  
ATOM 2241  H HG3  . PRO A 1 44 ? 2.051   5.244   -10.833 1.00 0.00 ? 44 PRO A HG3  3  
ATOM 2242  H HD2  . PRO A 1 44 ? 2.790   4.000   -8.205  1.00 0.00 ? 44 PRO A HD2  3  
ATOM 2243  H HD3  . PRO A 1 44 ? 1.327   4.909   -8.639  1.00 0.00 ? 44 PRO A HD3  3  
ATOM 2244  N N    . GLY A 1 45 ? 2.321   -0.065  -10.448 1.00 0.00 ? 45 GLY A N    3  
ATOM 2245  C CA   . GLY A 1 45 ? 2.931   -1.321  -10.059 1.00 0.00 ? 45 GLY A CA   3  
ATOM 2246  C C    . GLY A 1 45 ? 3.161   -1.387  -8.562  1.00 0.00 ? 45 GLY A C    3  
ATOM 2247  O O    . GLY A 1 45 ? 4.008   -2.143  -8.085  1.00 0.00 ? 45 GLY A O    3  
ATOM 2248  H H    . GLY A 1 45 ? 1.474   -0.062  -10.942 1.00 0.00 ? 45 GLY A H    3  
ATOM 2249  H HA2  . GLY A 1 45 ? 2.283   -2.133  -10.355 1.00 0.00 ? 45 GLY A HA2  3  
ATOM 2250  H HA3  . GLY A 1 45 ? 3.880   -1.424  -10.566 1.00 0.00 ? 45 GLY A HA3  3  
ATOM 2251  N N    . GLY A 1 46 ? 2.402   -0.581  -7.821  1.00 0.00 ? 46 GLY A N    3  
ATOM 2252  C CA   . GLY A 1 46 ? 2.532   -0.546  -6.380  1.00 0.00 ? 46 GLY A CA   3  
ATOM 2253  C C    . GLY A 1 46 ? 3.566   0.460   -5.916  1.00 0.00 ? 46 GLY A C    3  
ATOM 2254  O O    . GLY A 1 46 ? 4.764   0.250   -6.094  1.00 0.00 ? 46 GLY A O    3  
ATOM 2255  H H    . GLY A 1 46 ? 1.748   0.000   -8.261  1.00 0.00 ? 46 GLY A H    3  
ATOM 2256  H HA2  . GLY A 1 46 ? 1.579   -0.288  -5.951  1.00 0.00 ? 46 GLY A HA2  3  
ATOM 2257  H HA3  . GLY A 1 46 ? 2.820   -1.528  -6.030  1.00 0.00 ? 46 GLY A HA3  3  
ATOM 2258  N N    . PHE A 1 47 ? 3.106   1.556   -5.308  1.00 0.00 ? 47 PHE A N    3  
ATOM 2259  C CA   . PHE A 1 47 ? 4.014   2.589   -4.810  1.00 0.00 ? 47 PHE A CA   3  
ATOM 2260  C C    . PHE A 1 47 ? 5.124   1.950   -3.992  1.00 0.00 ? 47 PHE A C    3  
ATOM 2261  O O    . PHE A 1 47 ? 5.037   0.777   -3.632  1.00 0.00 ? 47 PHE A O    3  
ATOM 2262  C CB   . PHE A 1 47 ? 3.257   3.611   -3.947  1.00 0.00 ? 47 PHE A CB   3  
ATOM 2263  C CG   . PHE A 1 47 ? 2.913   4.905   -4.647  1.00 0.00 ? 47 PHE A CG   3  
ATOM 2264  C CD1  . PHE A 1 47 ? 3.087   5.054   -6.015  1.00 0.00 ? 47 PHE A CD1  3  
ATOM 2265  C CD2  . PHE A 1 47 ? 2.409   5.975   -3.924  1.00 0.00 ? 47 PHE A CD2  3  
ATOM 2266  C CE1  . PHE A 1 47 ? 2.766   6.242   -6.646  1.00 0.00 ? 47 PHE A CE1  3  
ATOM 2267  C CE2  . PHE A 1 47 ? 2.088   7.166   -4.551  1.00 0.00 ? 47 PHE A CE2  3  
ATOM 2268  C CZ   . PHE A 1 47 ? 2.267   7.298   -5.913  1.00 0.00 ? 47 PHE A CZ   3  
ATOM 2269  H H    . PHE A 1 47 ? 2.141   1.668   -5.186  1.00 0.00 ? 47 PHE A H    3  
ATOM 2270  H HA   . PHE A 1 47 ? 4.452   3.089   -5.659  1.00 0.00 ? 47 PHE A HA   3  
ATOM 2271  H HB2  . PHE A 1 47 ? 2.335   3.165   -3.611  1.00 0.00 ? 47 PHE A HB2  3  
ATOM 2272  H HB3  . PHE A 1 47 ? 3.862   3.854   -3.085  1.00 0.00 ? 47 PHE A HB3  3  
ATOM 2273  H HD1  . PHE A 1 47 ? 3.477   4.232   -6.590  1.00 0.00 ? 47 PHE A HD1  3  
ATOM 2274  H HD2  . PHE A 1 47 ? 2.268   5.875   -2.858  1.00 0.00 ? 47 PHE A HD2  3  
ATOM 2275  H HE1  . PHE A 1 47 ? 2.907   6.342   -7.713  1.00 0.00 ? 47 PHE A HE1  3  
ATOM 2276  H HE2  . PHE A 1 47 ? 1.696   7.991   -3.974  1.00 0.00 ? 47 PHE A HE2  3  
ATOM 2277  H HZ   . PHE A 1 47 ? 2.016   8.227   -6.404  1.00 0.00 ? 47 PHE A HZ   3  
ATOM 2278  N N    . GLU A 1 48 ? 6.162   2.716   -3.694  1.00 0.00 ? 48 GLU A N    3  
ATOM 2279  C CA   . GLU A 1 48 ? 7.272   2.186   -2.913  1.00 0.00 ? 48 GLU A CA   3  
ATOM 2280  C C    . GLU A 1 48 ? 6.931   2.173   -1.445  1.00 0.00 ? 48 GLU A C    3  
ATOM 2281  O O    . GLU A 1 48 ? 7.224   3.124   -0.722  1.00 0.00 ? 48 GLU A O    3  
ATOM 2282  C CB   . GLU A 1 48 ? 8.525   3.019   -3.113  1.00 0.00 ? 48 GLU A CB   3  
ATOM 2283  C CG   . GLU A 1 48 ? 9.724   2.502   -2.337  1.00 0.00 ? 48 GLU A CG   3  
ATOM 2284  C CD   . GLU A 1 48 ? 10.910  2.189   -3.229  1.00 0.00 ? 48 GLU A CD   3  
ATOM 2285  O OE1  . GLU A 1 48 ? 10.989  2.764   -4.335  1.00 0.00 ? 48 GLU A OE1  3  
ATOM 2286  O OE2  . GLU A 1 48 ? 11.759  1.369   -2.821  1.00 0.00 ? 48 GLU A OE2  3  
ATOM 2287  H H    . GLU A 1 48 ? 6.182   3.655   -4.002  1.00 0.00 ? 48 GLU A H    3  
ATOM 2288  H HA   . GLU A 1 48 ? 7.460   1.169   -3.234  1.00 0.00 ? 48 GLU A HA   3  
ATOM 2289  H HB2  . GLU A 1 48 ? 8.771   3.029   -4.159  1.00 0.00 ? 48 GLU A HB2  3  
ATOM 2290  H HB3  . GLU A 1 48 ? 8.320   4.025   -2.782  1.00 0.00 ? 48 GLU A HB3  3  
ATOM 2291  H HG2  . GLU A 1 48 ? 10.020  3.252   -1.620  1.00 0.00 ? 48 GLU A HG2  3  
ATOM 2292  H HG3  . GLU A 1 48 ? 9.435   1.602   -1.815  1.00 0.00 ? 48 GLU A HG3  3  
ATOM 2293  N N    . TYR A 1 49 ? 6.319   1.097   -0.999  1.00 0.00 ? 49 TYR A N    3  
ATOM 2294  C CA   . TYR A 1 49 ? 5.958   0.992   0.390   1.00 0.00 ? 49 TYR A CA   3  
ATOM 2295  C C    . TYR A 1 49 ? 6.820   -0.008  1.125   1.00 0.00 ? 49 TYR A C    3  
ATOM 2296  O O    . TYR A 1 49 ? 7.505   -0.838  0.526   1.00 0.00 ? 49 TYR A O    3  
ATOM 2297  C CB   . TYR A 1 49 ? 4.497   0.627   0.554   1.00 0.00 ? 49 TYR A CB   3  
ATOM 2298  C CG   . TYR A 1 49 ? 4.013   -0.491  -0.318  1.00 0.00 ? 49 TYR A CG   3  
ATOM 2299  C CD1  . TYR A 1 49 ? 4.786   -1.618  -0.541  1.00 0.00 ? 49 TYR A CD1  3  
ATOM 2300  C CD2  . TYR A 1 49 ? 2.764   -0.420  -0.905  1.00 0.00 ? 49 TYR A CD2  3  
ATOM 2301  C CE1  . TYR A 1 49 ? 4.330   -2.643  -1.332  1.00 0.00 ? 49 TYR A CE1  3  
ATOM 2302  C CE2  . TYR A 1 49 ? 2.295   -1.438  -1.696  1.00 0.00 ? 49 TYR A CE2  3  
ATOM 2303  C CZ   . TYR A 1 49 ? 3.080   -2.550  -1.911  1.00 0.00 ? 49 TYR A CZ   3  
ATOM 2304  O OH   . TYR A 1 49 ? 2.614   -3.568  -2.707  1.00 0.00 ? 49 TYR A OH   3  
ATOM 2305  H H    . TYR A 1 49 ? 6.112   0.363   -1.614  1.00 0.00 ? 49 TYR A H    3  
ATOM 2306  H HA   . TYR A 1 49 ? 6.108   1.953   0.840   1.00 0.00 ? 49 TYR A HA   3  
ATOM 2307  H HB2  . TYR A 1 49 ? 4.340   0.327   1.570   1.00 0.00 ? 49 TYR A HB2  3  
ATOM 2308  H HB3  . TYR A 1 49 ? 3.894   1.496   0.342   1.00 0.00 ? 49 TYR A HB3  3  
ATOM 2309  H HD1  . TYR A 1 49 ? 5.758   -1.690  -0.088  1.00 0.00 ? 49 TYR A HD1  3  
ATOM 2310  H HD2  . TYR A 1 49 ? 2.153   0.454   -0.737  1.00 0.00 ? 49 TYR A HD2  3  
ATOM 2311  H HE1  . TYR A 1 49 ? 4.950   -3.509  -1.489  1.00 0.00 ? 49 TYR A HE1  3  
ATOM 2312  H HE2  . TYR A 1 49 ? 1.318   -1.364  -2.135  1.00 0.00 ? 49 TYR A HE2  3  
ATOM 2313  H HH   . TYR A 1 49 ? 2.800   -3.365  -3.627  1.00 0.00 ? 49 TYR A HH   3  
ATOM 2314  N N    . SER A 1 50 ? 6.757   0.079   2.433   1.00 0.00 ? 50 SER A N    3  
ATOM 2315  C CA   . SER A 1 50 ? 7.492   -0.813  3.301   1.00 0.00 ? 50 SER A CA   3  
ATOM 2316  C C    . SER A 1 50 ? 6.665   -1.074  4.537   1.00 0.00 ? 50 SER A C    3  
ATOM 2317  O O    . SER A 1 50 ? 6.577   -0.231  5.430   1.00 0.00 ? 50 SER A O    3  
ATOM 2318  C CB   . SER A 1 50 ? 8.846   -0.223  3.673   1.00 0.00 ? 50 SER A CB   3  
ATOM 2319  O OG   . SER A 1 50 ? 8.698   0.965   4.433   1.00 0.00 ? 50 SER A OG   3  
ATOM 2320  H H    . SER A 1 50 ? 6.177   0.763   2.835   1.00 0.00 ? 50 SER A H    3  
ATOM 2321  H HA   . SER A 1 50 ? 7.641   -1.745  2.774   1.00 0.00 ? 50 SER A HA   3  
ATOM 2322  H HB2  . SER A 1 50 ? 9.396   -0.945  4.257   1.00 0.00 ? 50 SER A HB2  3  
ATOM 2323  H HB3  . SER A 1 50 ? 9.392   0.004   2.770   1.00 0.00 ? 50 SER A HB3  3  
ATOM 2324  H HG   . SER A 1 50 ? 8.843   1.726   3.867   1.00 0.00 ? 50 SER A HG   3  
ATOM 2325  N N    . ASN A 1 51 ? 6.025   -2.231  4.563   1.00 0.00 ? 51 ASN A N    3  
ATOM 2326  C CA   . ASN A 1 51 ? 5.164   -2.590  5.675   1.00 0.00 ? 51 ASN A CA   3  
ATOM 2327  C C    . ASN A 1 51 ? 5.833   -2.285  7.008   1.00 0.00 ? 51 ASN A C    3  
ATOM 2328  O O    . ASN A 1 51 ? 7.001   -2.613  7.223   1.00 0.00 ? 51 ASN A O    3  
ATOM 2329  C CB   . ASN A 1 51 ? 4.778   -4.060  5.617   1.00 0.00 ? 51 ASN A CB   3  
ATOM 2330  C CG   . ASN A 1 51 ? 4.198   -4.450  4.273   1.00 0.00 ? 51 ASN A CG   3  
ATOM 2331  O OD1  . ASN A 1 51 ? 4.577   -5.466  3.690   1.00 0.00 ? 51 ASN A OD1  3  
ATOM 2332  N ND2  . ASN A 1 51 ? 3.274   -3.639  3.770   1.00 0.00 ? 51 ASN A ND2  3  
ATOM 2333  H H    . ASN A 1 51 ? 6.116   -2.845  3.805   1.00 0.00 ? 51 ASN A H    3  
ATOM 2334  H HA   . ASN A 1 51 ? 4.266   -1.994  5.588   1.00 0.00 ? 51 ASN A HA   3  
ATOM 2335  H HB2  . ASN A 1 51 ? 5.652   -4.665  5.804   1.00 0.00 ? 51 ASN A HB2  3  
ATOM 2336  H HB3  . ASN A 1 51 ? 4.038   -4.250  6.380   1.00 0.00 ? 51 ASN A HB3  3  
ATOM 2337  H HD21 . ASN A 1 51 ? 3.024   -2.846  4.288   1.00 0.00 ? 51 ASN A HD21 3  
ATOM 2338  H HD22 . ASN A 1 51 ? 2.883   -3.864  2.901   1.00 0.00 ? 51 ASN A HD22 3  
ATOM 2339  N N    . GLY A 1 52 ? 5.083   -1.654  7.892   1.00 0.00 ? 52 GLY A N    3  
ATOM 2340  C CA   . GLY A 1 52 ? 5.611   -1.304  9.200   1.00 0.00 ? 52 GLY A CA   3  
ATOM 2341  C C    . GLY A 1 52 ? 5.356   0.147   9.565   1.00 0.00 ? 52 GLY A C    3  
ATOM 2342  O O    . GLY A 1 52 ? 4.705   0.873   8.812   1.00 0.00 ? 52 GLY A O    3  
ATOM 2343  H H    . GLY A 1 52 ? 4.161   -1.424  7.654   1.00 0.00 ? 52 GLY A H    3  
ATOM 2344  H HA2  . GLY A 1 52 ? 5.148   -1.936  9.943   1.00 0.00 ? 52 GLY A HA2  3  
ATOM 2345  H HA3  . GLY A 1 52 ? 6.676   -1.482  9.205   1.00 0.00 ? 52 GLY A HA3  3  
ATOM 2346  N N    . PRO A 1 53 ? 5.858   0.599   10.727  1.00 0.00 ? 53 PRO A N    3  
ATOM 2347  C CA   . PRO A 1 53 ? 5.671   1.981   11.191  1.00 0.00 ? 53 PRO A CA   3  
ATOM 2348  C C    . PRO A 1 53 ? 6.402   2.996   10.320  1.00 0.00 ? 53 PRO A C    3  
ATOM 2349  O O    . PRO A 1 53 ? 7.235   2.635   9.489   1.00 0.00 ? 53 PRO A O    3  
ATOM 2350  C CB   . PRO A 1 53 ? 6.264   1.969   12.603  1.00 0.00 ? 53 PRO A CB   3  
ATOM 2351  C CG   . PRO A 1 53 ? 7.226   0.832   12.603  1.00 0.00 ? 53 PRO A CG   3  
ATOM 2352  C CD   . PRO A 1 53 ? 6.643   -0.203  11.683  1.00 0.00 ? 53 PRO A CD   3  
ATOM 2353  H HA   . PRO A 1 53 ? 4.625   2.241   11.240  1.00 0.00 ? 53 PRO A HA   3  
ATOM 2354  H HB2  . PRO A 1 53 ? 6.761   2.908   12.796  1.00 0.00 ? 53 PRO A HB2  3  
ATOM 2355  H HB3  . PRO A 1 53 ? 5.476   1.817   13.326  1.00 0.00 ? 53 PRO A HB3  3  
ATOM 2356  H HG2  . PRO A 1 53 ? 8.186   1.163   12.234  1.00 0.00 ? 53 PRO A HG2  3  
ATOM 2357  H HG3  . PRO A 1 53 ? 7.324   0.433   13.602  1.00 0.00 ? 53 PRO A HG3  3  
ATOM 2358  H HD2  . PRO A 1 53 ? 7.429   -0.745  11.178  1.00 0.00 ? 53 PRO A HD2  3  
ATOM 2359  H HD3  . PRO A 1 53 ? 6.006   -0.880  12.232  1.00 0.00 ? 53 PRO A HD3  3  
ATOM 2360  N N    . CYS A 1 54 ? 6.085   4.273   10.522  1.00 0.00 ? 54 CYS A N    3  
ATOM 2361  C CA   . CYS A 1 54 ? 6.709   5.351   9.760   1.00 0.00 ? 54 CYS A CA   3  
ATOM 2362  C C    . CYS A 1 54 ? 6.110   6.703   10.143  1.00 0.00 ? 54 CYS A C    3  
ATOM 2363  O O    . CYS A 1 54 ? 6.813   7.712   10.196  1.00 0.00 ? 54 CYS A O    3  
ATOM 2364  C CB   . CYS A 1 54 ? 6.545   5.111   8.258   1.00 0.00 ? 54 CYS A CB   3  
ATOM 2365  S SG   . CYS A 1 54 ? 8.120   4.910   7.362   1.00 0.00 ? 54 CYS A SG   3  
ATOM 2366  H H    . CYS A 1 54 ? 5.414   4.495   11.201  1.00 0.00 ? 54 CYS A H    3  
ATOM 2367  H HA   . CYS A 1 54 ? 7.762   5.359   10.002  1.00 0.00 ? 54 CYS A HA   3  
ATOM 2368  H HB2  . CYS A 1 54 ? 5.966   4.213   8.105   1.00 0.00 ? 54 CYS A HB2  3  
ATOM 2369  H HB3  . CYS A 1 54 ? 6.022   5.948   7.819   1.00 0.00 ? 54 CYS A HB3  3  
ATOM 2370  N N    . GLU A 1 55 ? 4.806   6.715   10.407  1.00 0.00 ? 55 GLU A N    3  
ATOM 2371  C CA   . GLU A 1 55 ? 4.113   7.942   10.785  1.00 0.00 ? 55 GLU A CA   3  
ATOM 2372  C C    . GLU A 1 55 ? 3.553   7.836   12.200  1.00 0.00 ? 55 GLU A C    3  
ATOM 2373  O O    . GLU A 1 55 ? 4.032   6.968   12.961  1.00 0.00 ? 55 GLU A O    3  
ATOM 2374  C CB   . GLU A 1 55 ? 2.983   8.239   9.796   1.00 0.00 ? 55 GLU A CB   3  
ATOM 2375  C CG   . GLU A 1 55 ? 3.356   9.273   8.743   1.00 0.00 ? 55 GLU A CG   3  
ATOM 2376  C CD   . GLU A 1 55 ? 2.335   10.388  8.629   1.00 0.00 ? 55 GLU A CD   3  
ATOM 2377  O OE1  . GLU A 1 55 ? 1.131   10.112  8.814   1.00 0.00 ? 55 GLU A OE1  3  
ATOM 2378  O OE2  . GLU A 1 55 ? 2.739   11.537  8.356   1.00 0.00 ? 55 GLU A OE2  3  
ATOM 2379  O OXT  . GLU A 1 55 ? 2.642   8.621   12.537  1.00 0.00 ? 55 GLU A OXT  3  
ATOM 2380  H H    . GLU A 1 55 ? 4.299   5.880   10.349  1.00 0.00 ? 55 GLU A H    3  
ATOM 2381  H HA   . GLU A 1 55 ? 4.828   8.750   10.753  1.00 0.00 ? 55 GLU A HA   3  
ATOM 2382  H HB2  . GLU A 1 55 ? 2.712   7.324   9.291   1.00 0.00 ? 55 GLU A HB2  3  
ATOM 2383  H HB3  . GLU A 1 55 ? 2.127   8.605   10.341  1.00 0.00 ? 55 GLU A HB3  3  
ATOM 2384  H HG2  . GLU A 1 55 ? 4.310   9.706   9.005   1.00 0.00 ? 55 GLU A HG2  3  
ATOM 2385  H HG3  . GLU A 1 55 ? 3.437   8.779   7.785   1.00 0.00 ? 55 GLU A HG3  3  
ATOM 2386  N N    . ALA A 1 1  ? 11.182  -4.529  1.920   1.00 0.00 ? 1  ALA A N    4  
ATOM 2387  C CA   . ALA A 1 1  ? 10.522  -4.758  0.609   1.00 0.00 ? 1  ALA A CA   4  
ATOM 2388  C C    . ALA A 1 1  ? 9.855   -3.484  0.100   1.00 0.00 ? 1  ALA A C    4  
ATOM 2389  O O    . ALA A 1 1  ? 9.232   -2.749  0.865   1.00 0.00 ? 1  ALA A O    4  
ATOM 2390  C CB   . ALA A 1 1  ? 9.499   -5.879  0.722   1.00 0.00 ? 1  ALA A CB   4  
ATOM 2391  H H1   . ALA A 1 1  ? 10.449  -4.571  2.656   1.00 0.00 ? 1  ALA A H1   4  
ATOM 2392  H H2   . ALA A 1 1  ? 11.630  -3.591  1.888   1.00 0.00 ? 1  ALA A H2   4  
ATOM 2393  H H3   . ALA A 1 1  ? 11.889  -5.279  2.054   1.00 0.00 ? 1  ALA A H3   4  
ATOM 2394  H HA   . ALA A 1 1  ? 11.276  -5.064  -0.102  1.00 0.00 ? 1  ALA A HA   4  
ATOM 2395  H HB1  . ALA A 1 1  ? 8.971   -5.790  1.660   1.00 0.00 ? 1  ALA A HB1  4  
ATOM 2396  H HB2  . ALA A 1 1  ? 10.004  -6.832  0.683   1.00 0.00 ? 1  ALA A HB2  4  
ATOM 2397  H HB3  . ALA A 1 1  ? 8.796   -5.809  -0.095  1.00 0.00 ? 1  ALA A HB3  4  
ATOM 2398  N N    . HIS A 1 2  ? 9.991   -3.229  -1.198  1.00 0.00 ? 2  HIS A N    4  
ATOM 2399  C CA   . HIS A 1 2  ? 9.404   -2.045  -1.814  1.00 0.00 ? 2  HIS A CA   4  
ATOM 2400  C C    . HIS A 1 2  ? 8.567   -2.432  -3.028  1.00 0.00 ? 2  HIS A C    4  
ATOM 2401  O O    . HIS A 1 2  ? 8.769   -1.926  -4.132  1.00 0.00 ? 2  HIS A O    4  
ATOM 2402  C CB   . HIS A 1 2  ? 10.506  -1.066  -2.217  1.00 0.00 ? 2  HIS A CB   4  
ATOM 2403  C CG   . HIS A 1 2  ? 11.230  -0.466  -1.051  1.00 0.00 ? 2  HIS A CG   4  
ATOM 2404  N ND1  . HIS A 1 2  ? 12.581  -0.636  -0.835  1.00 0.00 ? 2  HIS A ND1  4  
ATOM 2405  C CD2  . HIS A 1 2  ? 10.782  0.304   -0.030  1.00 0.00 ? 2  HIS A CD2  4  
ATOM 2406  C CE1  . HIS A 1 2  ? 12.933  0.002   0.267   1.00 0.00 ? 2  HIS A CE1  4  
ATOM 2407  N NE2  . HIS A 1 2  ? 11.861  0.580   0.775   1.00 0.00 ? 2  HIS A NE2  4  
ATOM 2408  H H    . HIS A 1 2  ? 10.500  -3.853  -1.756  1.00 0.00 ? 2  HIS A H    4  
ATOM 2409  H HA   . HIS A 1 2  ? 8.760   -1.579  -1.086  1.00 0.00 ? 2  HIS A HA   4  
ATOM 2410  H HB2  . HIS A 1 2  ? 11.232  -1.585  -2.824  1.00 0.00 ? 2  HIS A HB2  4  
ATOM 2411  H HB3  . HIS A 1 2  ? 10.072  -0.264  -2.791  1.00 0.00 ? 2  HIS A HB3  4  
ATOM 2412  H HD1  . HIS A 1 2  ? 13.191  -1.150  -1.405  1.00 0.00 ? 2  HIS A HD1  4  
ATOM 2413  H HD2  . HIS A 1 2  ? 9.767   0.640   0.122   1.00 0.00 ? 2  HIS A HD2  4  
ATOM 2414  H HE1  . HIS A 1 2  ? 13.929  0.044   0.681   1.00 0.00 ? 2  HIS A HE1  4  
ATOM 2415  H HE2  . HIS A 1 2  ? 11.815  1.009   1.655   1.00 0.00 ? 2  HIS A HE2  4  
ATOM 2416  N N    . MET A 1 3  ? 7.630   -3.339  -2.800  1.00 0.00 ? 3  MET A N    4  
ATOM 2417  C CA   . MET A 1 3  ? 6.742   -3.824  -3.856  1.00 0.00 ? 3  MET A CA   4  
ATOM 2418  C C    . MET A 1 3  ? 5.628   -4.711  -3.292  1.00 0.00 ? 3  MET A C    4  
ATOM 2419  O O    . MET A 1 3  ? 4.445   -4.394  -3.420  1.00 0.00 ? 3  MET A O    4  
ATOM 2420  C CB   . MET A 1 3  ? 7.544   -4.599  -4.904  1.00 0.00 ? 3  MET A CB   4  
ATOM 2421  C CG   . MET A 1 3  ? 7.460   -4.002  -6.300  1.00 0.00 ? 3  MET A CG   4  
ATOM 2422  S SD   . MET A 1 3  ? 8.068   -5.126  -7.572  1.00 0.00 ? 3  MET A SD   4  
ATOM 2423  C CE   . MET A 1 3  ? 7.576   -4.252  -9.055  1.00 0.00 ? 3  MET A CE   4  
ATOM 2424  H H    . MET A 1 3  ? 7.528   -3.682  -1.895  1.00 0.00 ? 3  MET A H    4  
ATOM 2425  H HA   . MET A 1 3  ? 6.293   -2.963  -4.327  1.00 0.00 ? 3  MET A HA   4  
ATOM 2426  H HB2  . MET A 1 3  ? 8.581   -4.616  -4.606  1.00 0.00 ? 3  MET A HB2  4  
ATOM 2427  H HB3  . MET A 1 3  ? 7.175   -5.614  -4.949  1.00 0.00 ? 3  MET A HB3  4  
ATOM 2428  H HG2  . MET A 1 3  ? 6.429   -3.763  -6.514  1.00 0.00 ? 3  MET A HG2  4  
ATOM 2429  H HG3  . MET A 1 3  ? 8.051   -3.098  -6.326  1.00 0.00 ? 3  MET A HG3  4  
ATOM 2430  H HE1  . MET A 1 3  ? 7.469   -4.955  -9.868  1.00 0.00 ? 3  MET A HE1  4  
ATOM 2431  H HE2  . MET A 1 3  ? 8.329   -3.519  -9.308  1.00 0.00 ? 3  MET A HE2  4  
ATOM 2432  H HE3  . MET A 1 3  ? 6.633   -3.754  -8.884  1.00 0.00 ? 3  MET A HE3  4  
ATOM 2433  N N    . ASP A 1 4  ? 6.032   -5.839  -2.690  1.00 0.00 ? 4  ASP A N    4  
ATOM 2434  C CA   . ASP A 1 4  ? 5.104   -6.826  -2.111  1.00 0.00 ? 4  ASP A CA   4  
ATOM 2435  C C    . ASP A 1 4  ? 3.748   -6.219  -1.741  1.00 0.00 ? 4  ASP A C    4  
ATOM 2436  O O    . ASP A 1 4  ? 3.664   -5.327  -0.901  1.00 0.00 ? 4  ASP A O    4  
ATOM 2437  C CB   . ASP A 1 4  ? 5.736   -7.479  -0.874  1.00 0.00 ? 4  ASP A CB   4  
ATOM 2438  C CG   . ASP A 1 4  ? 6.229   -8.885  -1.153  1.00 0.00 ? 4  ASP A CG   4  
ATOM 2439  O OD1  . ASP A 1 4  ? 7.254   -9.026  -1.853  1.00 0.00 ? 4  ASP A OD1  4  
ATOM 2440  O OD2  . ASP A 1 4  ? 5.589   -9.844  -0.674  1.00 0.00 ? 4  ASP A OD2  4  
ATOM 2441  H H    . ASP A 1 4  ? 6.994   -6.023  -2.647  1.00 0.00 ? 4  ASP A H    4  
ATOM 2442  H HA   . ASP A 1 4  ? 4.941   -7.590  -2.854  1.00 0.00 ? 4  ASP A HA   4  
ATOM 2443  H HB2  . ASP A 1 4  ? 6.576   -6.881  -0.546  1.00 0.00 ? 4  ASP A HB2  4  
ATOM 2444  H HB3  . ASP A 1 4  ? 5.002   -7.523  -0.079  1.00 0.00 ? 4  ASP A HB3  4  
ATOM 2445  N N    . CYS A 1 5  ? 2.688   -6.707  -2.375  1.00 0.00 ? 5  CYS A N    4  
ATOM 2446  C CA   . CYS A 1 5  ? 1.348   -6.204  -2.099  1.00 0.00 ? 5  CYS A CA   4  
ATOM 2447  C C    . CYS A 1 5  ? 0.270   -7.194  -2.559  1.00 0.00 ? 5  CYS A C    4  
ATOM 2448  O O    . CYS A 1 5  ? 0.546   -8.381  -2.731  1.00 0.00 ? 5  CYS A O    4  
ATOM 2449  C CB   . CYS A 1 5  ? 1.164   -4.842  -2.767  1.00 0.00 ? 5  CYS A CB   4  
ATOM 2450  S SG   . CYS A 1 5  ? 1.184   -4.890  -4.587  1.00 0.00 ? 5  CYS A SG   4  
ATOM 2451  H H    . CYS A 1 5  ? 2.808   -7.419  -3.038  1.00 0.00 ? 5  CYS A H    4  
ATOM 2452  H HA   . CYS A 1 5  ? 1.263   -6.079  -1.030  1.00 0.00 ? 5  CYS A HA   4  
ATOM 2453  H HB2  . CYS A 1 5  ? 0.224   -4.425  -2.455  1.00 0.00 ? 5  CYS A HB2  4  
ATOM 2454  H HB3  . CYS A 1 5  ? 1.962   -4.187  -2.447  1.00 0.00 ? 5  CYS A HB3  4  
ATOM 2455  N N    . THR A 1 6  ? -0.959  -6.702  -2.752  1.00 0.00 ? 6  THR A N    4  
ATOM 2456  C CA   . THR A 1 6  ? -2.072  -7.546  -3.185  1.00 0.00 ? 6  THR A CA   4  
ATOM 2457  C C    . THR A 1 6  ? -1.763  -8.284  -4.505  1.00 0.00 ? 6  THR A C    4  
ATOM 2458  O O    . THR A 1 6  ? -2.519  -9.177  -4.882  1.00 0.00 ? 6  THR A O    4  
ATOM 2459  C CB   . THR A 1 6  ? -3.326  -6.686  -3.367  1.00 0.00 ? 6  THR A CB   4  
ATOM 2460  O OG1  . THR A 1 6  ? -3.712  -6.096  -2.138  1.00 0.00 ? 6  THR A OG1  4  
ATOM 2461  C CG2  . THR A 1 6  ? -4.515  -7.461  -3.897  1.00 0.00 ? 6  THR A CG2  4  
ATOM 2462  H H    . THR A 1 6  ? -1.128  -5.746  -2.596  1.00 0.00 ? 6  THR A H    4  
ATOM 2463  H HA   . THR A 1 6  ? -2.276  -8.281  -2.395  1.00 0.00 ? 6  THR A HA   4  
ATOM 2464  H HB   . THR A 1 6  ? -3.109  -5.893  -4.068  1.00 0.00 ? 6  THR A HB   4  
ATOM 2465  H HG1  . THR A 1 6  ? -2.971  -5.611  -1.767  1.00 0.00 ? 6  THR A HG1  4  
ATOM 2466  H HG21 . THR A 1 6  ? -4.371  -7.667  -4.947  1.00 0.00 ? 6  THR A HG21 4  
ATOM 2467  H HG22 . THR A 1 6  ? -5.414  -6.876  -3.765  1.00 0.00 ? 6  THR A HG22 4  
ATOM 2468  H HG23 . THR A 1 6  ? -4.609  -8.390  -3.357  1.00 0.00 ? 6  THR A HG23 4  
ATOM 2469  N N    . GLU A 1 7  ? -0.674  -7.906  -5.221  1.00 0.00 ? 7  GLU A N    4  
ATOM 2470  C CA   . GLU A 1 7  ? -0.321  -8.543  -6.496  1.00 0.00 ? 7  GLU A CA   4  
ATOM 2471  C C    . GLU A 1 7  ? -0.661  -10.033 -6.516  1.00 0.00 ? 7  GLU A C    4  
ATOM 2472  O O    . GLU A 1 7  ? 0.161   -10.875 -6.154  1.00 0.00 ? 7  GLU A O    4  
ATOM 2473  C CB   . GLU A 1 7  ? 1.167   -8.346  -6.787  1.00 0.00 ? 7  GLU A CB   4  
ATOM 2474  C CG   . GLU A 1 7  ? 1.454   -7.191  -7.732  1.00 0.00 ? 7  GLU A CG   4  
ATOM 2475  C CD   . GLU A 1 7  ? 2.856   -6.638  -7.569  1.00 0.00 ? 7  GLU A CD   4  
ATOM 2476  O OE1  . GLU A 1 7  ? 3.300   -6.476  -6.412  1.00 0.00 ? 7  GLU A OE1  4  
ATOM 2477  O OE2  . GLU A 1 7  ? 3.511   -6.367  -8.597  1.00 0.00 ? 7  GLU A OE2  4  
ATOM 2478  H H    . GLU A 1 7  ? -0.098  -7.177  -4.901  1.00 0.00 ? 7  GLU A H    4  
ATOM 2479  H HA   . GLU A 1 7  ? -0.890  -8.053  -7.272  1.00 0.00 ? 7  GLU A HA   4  
ATOM 2480  H HB2  . GLU A 1 7  ? 1.682   -8.158  -5.856  1.00 0.00 ? 7  GLU A HB2  4  
ATOM 2481  H HB3  . GLU A 1 7  ? 1.560   -9.250  -7.228  1.00 0.00 ? 7  GLU A HB3  4  
ATOM 2482  H HG2  . GLU A 1 7  ? 1.336   -7.537  -8.749  1.00 0.00 ? 7  GLU A HG2  4  
ATOM 2483  H HG3  . GLU A 1 7  ? 0.746   -6.399  -7.537  1.00 0.00 ? 7  GLU A HG3  4  
ATOM 2484  N N    . PHE A 1 8  ? -1.879  -10.341 -6.948  1.00 0.00 ? 8  PHE A N    4  
ATOM 2485  C CA   . PHE A 1 8  ? -2.346  -11.720 -7.028  1.00 0.00 ? 8  PHE A CA   4  
ATOM 2486  C C    . PHE A 1 8  ? -3.533  -11.811 -7.989  1.00 0.00 ? 8  PHE A C    4  
ATOM 2487  O O    . PHE A 1 8  ? -3.682  -10.966 -8.871  1.00 0.00 ? 8  PHE A O    4  
ATOM 2488  C CB   . PHE A 1 8  ? -2.734  -12.223 -5.632  1.00 0.00 ? 8  PHE A CB   4  
ATOM 2489  C CG   . PHE A 1 8  ? -1.557  -12.419 -4.718  1.00 0.00 ? 8  PHE A CG   4  
ATOM 2490  C CD1  . PHE A 1 8  ? -0.639  -13.429 -4.956  1.00 0.00 ? 8  PHE A CD1  4  
ATOM 2491  C CD2  . PHE A 1 8  ? -1.368  -11.592 -3.622  1.00 0.00 ? 8  PHE A CD2  4  
ATOM 2492  C CE1  . PHE A 1 8  ? 0.444   -13.612 -4.119  1.00 0.00 ? 8  PHE A CE1  4  
ATOM 2493  C CE2  . PHE A 1 8  ? -0.287  -11.771 -2.780  1.00 0.00 ? 8  PHE A CE2  4  
ATOM 2494  C CZ   . PHE A 1 8  ? 0.621   -12.782 -3.029  1.00 0.00 ? 8  PHE A CZ   4  
ATOM 2495  H H    . PHE A 1 8  ? -2.483  -9.617  -7.222  1.00 0.00 ? 8  PHE A H    4  
ATOM 2496  H HA   . PHE A 1 8  ? -1.538  -12.324 -7.412  1.00 0.00 ? 8  PHE A HA   4  
ATOM 2497  H HB2  . PHE A 1 8  ? -3.397  -11.508 -5.170  1.00 0.00 ? 8  PHE A HB2  4  
ATOM 2498  H HB3  . PHE A 1 8  ? -3.242  -13.170 -5.723  1.00 0.00 ? 8  PHE A HB3  4  
ATOM 2499  H HD1  . PHE A 1 8  ? -0.776  -14.079 -5.808  1.00 0.00 ? 8  PHE A HD1  4  
ATOM 2500  H HD2  . PHE A 1 8  ? -2.077  -10.802 -3.426  1.00 0.00 ? 8  PHE A HD2  4  
ATOM 2501  H HE1  . PHE A 1 8  ? 1.152   -14.404 -4.316  1.00 0.00 ? 8  PHE A HE1  4  
ATOM 2502  H HE2  . PHE A 1 8  ? -0.150  -11.120 -1.929  1.00 0.00 ? 8  PHE A HE2  4  
ATOM 2503  H HZ   . PHE A 1 8  ? 1.467   -12.923 -2.373  1.00 0.00 ? 8  PHE A HZ   4  
ATOM 2504  N N    . ASN A 1 9  ? -4.377  -12.826 -7.824  1.00 0.00 ? 9  ASN A N    4  
ATOM 2505  C CA   . ASN A 1 9  ? -5.535  -12.986 -8.693  1.00 0.00 ? 9  ASN A CA   4  
ATOM 2506  C C    . ASN A 1 9  ? -6.558  -11.885 -8.423  1.00 0.00 ? 9  ASN A C    4  
ATOM 2507  O O    . ASN A 1 9  ? -6.976  -11.177 -9.339  1.00 0.00 ? 9  ASN A O    4  
ATOM 2508  C CB   . ASN A 1 9  ? -6.173  -14.363 -8.488  1.00 0.00 ? 9  ASN A CB   4  
ATOM 2509  C CG   . ASN A 1 9  ? -5.824  -15.332 -9.600  1.00 0.00 ? 9  ASN A CG   4  
ATOM 2510  O OD1  . ASN A 1 9  ? -6.264  -15.173 -10.739 1.00 0.00 ? 9  ASN A OD1  4  
ATOM 2511  N ND2  . ASN A 1 9  ? -5.031  -16.346 -9.274  1.00 0.00 ? 9  ASN A ND2  4  
ATOM 2512  H H    . ASN A 1 9  ? -4.222  -13.475 -7.110  1.00 0.00 ? 9  ASN A H    4  
ATOM 2513  H HA   . ASN A 1 9  ? -5.196  -12.903 -9.715  1.00 0.00 ? 9  ASN A HA   4  
ATOM 2514  H HB2  . ASN A 1 9  ? -5.825  -14.777 -7.554  1.00 0.00 ? 9  ASN A HB2  4  
ATOM 2515  H HB3  . ASN A 1 9  ? -7.247  -14.254 -8.452  1.00 0.00 ? 9  ASN A HB3  4  
ATOM 2516  H HD21 . ASN A 1 9  ? -4.719  -16.411 -8.348  1.00 0.00 ? 9  ASN A HD21 4  
ATOM 2517  H HD22 . ASN A 1 9  ? -4.790  -16.988 -9.974  1.00 0.00 ? 9  ASN A HD22 4  
ATOM 2518  N N    . PRO A 1 10 ? -6.971  -11.721 -7.154  1.00 0.00 ? 10 PRO A N    4  
ATOM 2519  C CA   . PRO A 1 10 ? -7.938  -10.704 -6.760  1.00 0.00 ? 10 PRO A CA   4  
ATOM 2520  C C    . PRO A 1 10 ? -7.265  -9.396  -6.351  1.00 0.00 ? 10 PRO A C    4  
ATOM 2521  O O    . PRO A 1 10 ? -6.762  -9.272  -5.235  1.00 0.00 ? 10 PRO A O    4  
ATOM 2522  C CB   . PRO A 1 10 ? -8.608  -11.356 -5.556  1.00 0.00 ? 10 PRO A CB   4  
ATOM 2523  C CG   . PRO A 1 10 ? -7.516  -12.141 -4.903  1.00 0.00 ? 10 PRO A CG   4  
ATOM 2524  C CD   . PRO A 1 10 ? -6.533  -12.517 -5.991  1.00 0.00 ? 10 PRO A CD   4  
ATOM 2525  H HA   . PRO A 1 10 ? -8.668  -10.519 -7.534  1.00 0.00 ? 10 PRO A HA   4  
ATOM 2526  H HB2  . PRO A 1 10 ? -8.996  -10.591 -4.898  1.00 0.00 ? 10 PRO A HB2  4  
ATOM 2527  H HB3  . PRO A 1 10 ? -9.410  -11.997 -5.888  1.00 0.00 ? 10 PRO A HB3  4  
ATOM 2528  H HG2  . PRO A 1 10 ? -7.027  -11.534 -4.155  1.00 0.00 ? 10 PRO A HG2  4  
ATOM 2529  H HG3  . PRO A 1 10 ? -7.928  -13.031 -4.450  1.00 0.00 ? 10 PRO A HG3  4  
ATOM 2530  H HD2  . PRO A 1 10 ? -5.527  -12.248 -5.700  1.00 0.00 ? 10 PRO A HD2  4  
ATOM 2531  H HD3  . PRO A 1 10 ? -6.594  -13.574 -6.201  1.00 0.00 ? 10 PRO A HD3  4  
ATOM 2532  N N    . LEU A 1 11 ? -7.258  -8.419  -7.256  1.00 0.00 ? 11 LEU A N    4  
ATOM 2533  C CA   . LEU A 1 11 ? -6.643  -7.125  -6.969  1.00 0.00 ? 11 LEU A CA   4  
ATOM 2534  C C    . LEU A 1 11 ? -7.261  -6.500  -5.739  1.00 0.00 ? 11 LEU A C    4  
ATOM 2535  O O    . LEU A 1 11 ? -8.127  -7.104  -5.117  1.00 0.00 ? 11 LEU A O    4  
ATOM 2536  C CB   . LEU A 1 11 ? -6.761  -6.185  -8.170  1.00 0.00 ? 11 LEU A CB   4  
ATOM 2537  C CG   . LEU A 1 11 ? -6.580  -6.849  -9.538  1.00 0.00 ? 11 LEU A CG   4  
ATOM 2538  C CD1  . LEU A 1 11 ? -6.561  -5.801  -10.639 1.00 0.00 ? 11 LEU A CD1  4  
ATOM 2539  C CD2  . LEU A 1 11 ? -5.303  -7.677  -9.566  1.00 0.00 ? 11 LEU A CD2  4  
ATOM 2540  H H    . LEU A 1 11 ? -7.676  -8.570  -8.128  1.00 0.00 ? 11 LEU A H    4  
ATOM 2541  H HA   . LEU A 1 11 ? -5.608  -7.292  -6.752  1.00 0.00 ? 11 LEU A HA   4  
ATOM 2542  H HB2  . LEU A 1 11 ? -7.735  -5.723  -8.143  1.00 0.00 ? 11 LEU A HB2  4  
ATOM 2543  H HB3  . LEU A 1 11 ? -6.011  -5.414  -8.069  1.00 0.00 ? 11 LEU A HB3  4  
ATOM 2544  H HG   . LEU A 1 11 ? -7.413  -7.510  -9.724  1.00 0.00 ? 11 LEU A HG   4  
ATOM 2545  H HD11 . LEU A 1 11 ? -6.235  -4.856  -10.231 1.00 0.00 ? 11 LEU A HD11 4  
ATOM 2546  H HD12 . LEU A 1 11 ? -7.553  -5.693  -11.051 1.00 0.00 ? 11 LEU A HD12 4  
ATOM 2547  H HD13 . LEU A 1 11 ? -5.879  -6.110  -11.418 1.00 0.00 ? 11 LEU A HD13 4  
ATOM 2548  H HD21 . LEU A 1 11 ? -5.213  -8.167  -10.524 1.00 0.00 ? 11 LEU A HD21 4  
ATOM 2549  H HD22 . LEU A 1 11 ? -5.338  -8.421  -8.784  1.00 0.00 ? 11 LEU A HD22 4  
ATOM 2550  H HD23 . LEU A 1 11 ? -4.451  -7.031  -9.411  1.00 0.00 ? 11 LEU A HD23 4  
ATOM 2551  N N    . CYS A 1 12 ? -6.773  -5.313  -5.370  1.00 0.00 ? 12 CYS A N    4  
ATOM 2552  C CA   . CYS A 1 12 ? -7.238  -4.611  -4.175  1.00 0.00 ? 12 CYS A CA   4  
ATOM 2553  C C    . CYS A 1 12 ? -8.733  -4.780  -3.945  1.00 0.00 ? 12 CYS A C    4  
ATOM 2554  O O    . CYS A 1 12 ? -9.502  -3.820  -3.937  1.00 0.00 ? 12 CYS A O    4  
ATOM 2555  C CB   . CYS A 1 12 ? -6.861  -3.127  -4.211  1.00 0.00 ? 12 CYS A CB   4  
ATOM 2556  S SG   . CYS A 1 12 ? -7.949  -2.071  -5.241  1.00 0.00 ? 12 CYS A SG   4  
ATOM 2557  H H    . CYS A 1 12 ? -6.057  -4.919  -5.896  1.00 0.00 ? 12 CYS A H    4  
ATOM 2558  H HA   . CYS A 1 12 ? -6.725  -5.064  -3.346  1.00 0.00 ? 12 CYS A HA   4  
ATOM 2559  H HB2  . CYS A 1 12 ? -6.893  -2.743  -3.203  1.00 0.00 ? 12 CYS A HB2  4  
ATOM 2560  H HB3  . CYS A 1 12 ? -5.852  -3.033  -4.582  1.00 0.00 ? 12 CYS A HB3  4  
ATOM 2561  N N    . ARG A 1 13 ? -9.122  -6.013  -3.720  1.00 0.00 ? 13 ARG A N    4  
ATOM 2562  C CA   . ARG A 1 13 ? -10.514 -6.342  -3.446  1.00 0.00 ? 13 ARG A CA   4  
ATOM 2563  C C    . ARG A 1 13 ? -10.731 -6.314  -1.945  1.00 0.00 ? 13 ARG A C    4  
ATOM 2564  O O    . ARG A 1 13 ? -11.381 -7.190  -1.373  1.00 0.00 ? 13 ARG A O    4  
ATOM 2565  C CB   . ARG A 1 13 ? -10.875 -7.717  -4.017  1.00 0.00 ? 13 ARG A CB   4  
ATOM 2566  C CG   . ARG A 1 13 ? -12.145 -7.713  -4.852  1.00 0.00 ? 13 ARG A CG   4  
ATOM 2567  C CD   . ARG A 1 13 ? -13.385 -7.568  -3.983  1.00 0.00 ? 13 ARG A CD   4  
ATOM 2568  N NE   . ARG A 1 13 ? -14.511 -7.005  -4.725  1.00 0.00 ? 13 ARG A NE   4  
ATOM 2569  C CZ   . ARG A 1 13 ? -14.681 -5.702  -4.944  1.00 0.00 ? 13 ARG A CZ   4  
ATOM 2570  N NH1  . ARG A 1 13 ? -13.808 -4.821  -4.469  1.00 0.00 ? 13 ARG A NH1  4  
ATOM 2571  N NH2  . ARG A 1 13 ? -15.728 -5.277  -5.639  1.00 0.00 ? 13 ARG A NH2  4  
ATOM 2572  H H    . ARG A 1 13 ? -8.439  -6.723  -3.716  1.00 0.00 ? 13 ARG A H    4  
ATOM 2573  H HA   . ARG A 1 13 ? -11.134 -5.587  -3.906  1.00 0.00 ? 13 ARG A HA   4  
ATOM 2574  H HB2  . ARG A 1 13 ? -10.064 -8.061  -4.640  1.00 0.00 ? 13 ARG A HB2  4  
ATOM 2575  H HB3  . ARG A 1 13 ? -11.010 -8.412  -3.201  1.00 0.00 ? 13 ARG A HB3  4  
ATOM 2576  H HG2  . ARG A 1 13 ? -12.106 -6.886  -5.545  1.00 0.00 ? 13 ARG A HG2  4  
ATOM 2577  H HG3  . ARG A 1 13 ? -12.207 -8.642  -5.400  1.00 0.00 ? 13 ARG A HG3  4  
ATOM 2578  H HD2  . ARG A 1 13 ? -13.662 -8.543  -3.610  1.00 0.00 ? 13 ARG A HD2  4  
ATOM 2579  H HD3  . ARG A 1 13 ? -13.151 -6.920  -3.151  1.00 0.00 ? 13 ARG A HD3  4  
ATOM 2580  H HE   . ARG A 1 13 ? -15.175 -7.632  -5.082  1.00 0.00 ? 13 ARG A HE   4  
ATOM 2581  H HH11 . ARG A 1 13 ? -13.018 -5.132  -3.944  1.00 0.00 ? 13 ARG A HH11 4  
ATOM 2582  H HH12 . ARG A 1 13 ? -13.942 -3.845  -4.639  1.00 0.00 ? 13 ARG A HH12 4  
ATOM 2583  H HH21 . ARG A 1 13 ? -16.390 -5.935  -5.997  1.00 0.00 ? 13 ARG A HH21 4  
ATOM 2584  H HH22 . ARG A 1 13 ? -15.856 -4.299  -5.804  1.00 0.00 ? 13 ARG A HH22 4  
ATOM 2585  N N    . CYS A 1 14 ? -10.137 -5.310  -1.314  1.00 0.00 ? 14 CYS A N    4  
ATOM 2586  C CA   . CYS A 1 14 ? -10.204 -5.156  0.125   1.00 0.00 ? 14 CYS A CA   4  
ATOM 2587  C C    . CYS A 1 14 ? -10.202 -3.681  0.525   1.00 0.00 ? 14 CYS A C    4  
ATOM 2588  O O    . CYS A 1 14 ? -9.179  -3.007  0.423   1.00 0.00 ? 14 CYS A O    4  
ATOM 2589  C CB   . CYS A 1 14 ? -9.006  -5.869  0.762   1.00 0.00 ? 14 CYS A CB   4  
ATOM 2590  S SG   . CYS A 1 14 ? -7.584  -6.140  -0.358  1.00 0.00 ? 14 CYS A SG   4  
ATOM 2591  H H    . CYS A 1 14 ? -9.614  -4.669  -1.833  1.00 0.00 ? 14 CYS A H    4  
ATOM 2592  H HA   . CYS A 1 14 ? -11.116 -5.617  0.473   1.00 0.00 ? 14 CYS A HA   4  
ATOM 2593  H HB2  . CYS A 1 14 ? -8.650  -5.286  1.592   1.00 0.00 ? 14 CYS A HB2  4  
ATOM 2594  H HB3  . CYS A 1 14 ? -9.325  -6.837  1.115   1.00 0.00 ? 14 CYS A HB3  4  
ATOM 2595  N N    . ASN A 1 15 ? -11.344 -3.179  0.989   1.00 0.00 ? 15 ASN A N    4  
ATOM 2596  C CA   . ASN A 1 15 ? -11.431 -1.783  1.404   1.00 0.00 ? 15 ASN A CA   4  
ATOM 2597  C C    . ASN A 1 15 ? -11.434 -1.659  2.915   1.00 0.00 ? 15 ASN A C    4  
ATOM 2598  O O    . ASN A 1 15 ? -10.438 -1.254  3.513   1.00 0.00 ? 15 ASN A O    4  
ATOM 2599  C CB   . ASN A 1 15 ? -12.666 -1.101  0.827   1.00 0.00 ? 15 ASN A CB   4  
ATOM 2600  C CG   . ASN A 1 15 ? -12.337 0.283   0.301   1.00 0.00 ? 15 ASN A CG   4  
ATOM 2601  O OD1  . ASN A 1 15 ? -12.956 0.764   -0.648  1.00 0.00 ? 15 ASN A OD1  4  
ATOM 2602  N ND2  . ASN A 1 15 ? -11.351 0.929   0.922   1.00 0.00 ? 15 ASN A ND2  4  
ATOM 2603  H H    . ASN A 1 15 ? -12.132 -3.754  1.061   1.00 0.00 ? 15 ASN A H    4  
ATOM 2604  H HA   . ASN A 1 15 ? -10.554 -1.283  1.028   1.00 0.00 ? 15 ASN A HA   4  
ATOM 2605  H HB2  . ASN A 1 15 ? -13.060 -1.698  0.023   1.00 0.00 ? 15 ASN A HB2  4  
ATOM 2606  H HB3  . ASN A 1 15 ? -13.413 -1.004  1.600   1.00 0.00 ? 15 ASN A HB3  4  
ATOM 2607  H HD21 . ASN A 1 15 ? -10.903 0.482   1.674   1.00 0.00 ? 15 ASN A HD21 4  
ATOM 2608  H HD22 . ASN A 1 15 ? -11.106 1.819   0.601   1.00 0.00 ? 15 ASN A HD22 4  
ATOM 2609  N N    . LYS A 1 16 ? -12.553 -2.020  3.536   1.00 0.00 ? 16 LYS A N    4  
ATOM 2610  C CA   . LYS A 1 16 ? -12.657 -1.955  4.994   1.00 0.00 ? 16 LYS A CA   4  
ATOM 2611  C C    . LYS A 1 16 ? -11.439 -2.610  5.636   1.00 0.00 ? 16 LYS A C    4  
ATOM 2612  O O    . LYS A 1 16 ? -11.097 -2.312  6.779   1.00 0.00 ? 16 LYS A O    4  
ATOM 2613  C CB   . LYS A 1 16 ? -13.928 -2.640  5.499   1.00 0.00 ? 16 LYS A CB   4  
ATOM 2614  C CG   . LYS A 1 16 ? -13.917 -2.868  7.005   1.00 0.00 ? 16 LYS A CG   4  
ATOM 2615  C CD   . LYS A 1 16 ? -15.320 -3.083  7.550   1.00 0.00 ? 16 LYS A CD   4  
ATOM 2616  C CE   . LYS A 1 16 ? -15.298 -3.375  9.042   1.00 0.00 ? 16 LYS A CE   4  
ATOM 2617  N NZ   . LYS A 1 16 ? -15.011 -2.151  9.842   1.00 0.00 ? 16 LYS A NZ   4  
ATOM 2618  H H    . LYS A 1 16 ? -13.310 -2.343  3.005   1.00 0.00 ? 16 LYS A H    4  
ATOM 2619  H HA   . LYS A 1 16 ? -12.681 -0.913  5.278   1.00 0.00 ? 16 LYS A HA   4  
ATOM 2620  H HB2  . LYS A 1 16 ? -14.780 -2.024  5.252   1.00 0.00 ? 16 LYS A HB2  4  
ATOM 2621  H HB3  . LYS A 1 16 ? -14.029 -3.597  5.011   1.00 0.00 ? 16 LYS A HB3  4  
ATOM 2622  H HG2  . LYS A 1 16 ? -13.316 -3.740  7.222   1.00 0.00 ? 16 LYS A HG2  4  
ATOM 2623  H HG3  . LYS A 1 16 ? -13.480 -2.003  7.485   1.00 0.00 ? 16 LYS A HG3  4  
ATOM 2624  H HD2  . LYS A 1 16 ? -15.904 -2.192  7.377   1.00 0.00 ? 16 LYS A HD2  4  
ATOM 2625  H HD3  . LYS A 1 16 ? -15.772 -3.919  7.036   1.00 0.00 ? 16 LYS A HD3  4  
ATOM 2626  H HE2  . LYS A 1 16 ? -16.262 -3.765  9.334   1.00 0.00 ? 16 LYS A HE2  4  
ATOM 2627  H HE3  . LYS A 1 16 ? -14.536 -4.113  9.242   1.00 0.00 ? 16 LYS A HE3  4  
ATOM 2628  H HZ1  . LYS A 1 16 ? -14.437 -1.487  9.285   1.00 0.00 ? 16 LYS A HZ1  4  
ATOM 2629  H HZ2  . LYS A 1 16 ? -14.489 -2.404  10.704  1.00 0.00 ? 16 LYS A HZ2  4  
ATOM 2630  H HZ3  . LYS A 1 16 ? -15.899 -1.683  10.112  1.00 0.00 ? 16 LYS A HZ3  4  
ATOM 2631  N N    . MET A 1 17 ? -10.799 -3.499  4.872   1.00 0.00 ? 17 MET A N    4  
ATOM 2632  C CA   . MET A 1 17 ? -9.605  -4.221  5.297   1.00 0.00 ? 17 MET A CA   4  
ATOM 2633  C C    . MET A 1 17 ? -8.900  -3.532  6.461   1.00 0.00 ? 17 MET A C    4  
ATOM 2634  O O    . MET A 1 17 ? -8.823  -2.305  6.511   1.00 0.00 ? 17 MET A O    4  
ATOM 2635  C CB   . MET A 1 17 ? -8.648  -4.323  4.111   1.00 0.00 ? 17 MET A CB   4  
ATOM 2636  C CG   . MET A 1 17 ? -7.800  -5.584  4.115   1.00 0.00 ? 17 MET A CG   4  
ATOM 2637  S SD   . MET A 1 17 ? -6.372  -5.457  5.209   1.00 0.00 ? 17 MET A SD   4  
ATOM 2638  C CE   . MET A 1 17 ? -5.440  -6.905  4.720   1.00 0.00 ? 17 MET A CE   4  
ATOM 2639  H H    . MET A 1 17 ? -11.144 -3.676  3.973   1.00 0.00 ? 17 MET A H    4  
ATOM 2640  H HA   . MET A 1 17 ? -9.899  -5.213  5.598   1.00 0.00 ? 17 MET A HA   4  
ATOM 2641  H HB2  . MET A 1 17 ? -9.226  -4.302  3.196   1.00 0.00 ? 17 MET A HB2  4  
ATOM 2642  H HB3  . MET A 1 17 ? -7.988  -3.466  4.122   1.00 0.00 ? 17 MET A HB3  4  
ATOM 2643  H HG2  . MET A 1 17 ? -8.411  -6.412  4.440   1.00 0.00 ? 17 MET A HG2  4  
ATOM 2644  H HG3  . MET A 1 17 ? -7.450  -5.771  3.109   1.00 0.00 ? 17 MET A HG3  4  
ATOM 2645  H HE1  . MET A 1 17 ? -4.390  -6.738  4.908   1.00 0.00 ? 17 MET A HE1  4  
ATOM 2646  H HE2  . MET A 1 17 ? -5.591  -7.092  3.667   1.00 0.00 ? 17 MET A HE2  4  
ATOM 2647  H HE3  . MET A 1 17 ? -5.776  -7.759  5.290   1.00 0.00 ? 17 MET A HE3  4  
ATOM 2648  N N    . LEU A 1 18 ? -8.375  -4.325  7.387   1.00 0.00 ? 18 LEU A N    4  
ATOM 2649  C CA   . LEU A 1 18 ? -7.671  -3.772  8.535   1.00 0.00 ? 18 LEU A CA   4  
ATOM 2650  C C    . LEU A 1 18 ? -6.368  -3.141  8.072   1.00 0.00 ? 18 LEU A C    4  
ATOM 2651  O O    . LEU A 1 18 ? -5.279  -3.648  8.338   1.00 0.00 ? 18 LEU A O    4  
ATOM 2652  C CB   . LEU A 1 18 ? -7.394  -4.854  9.585   1.00 0.00 ? 18 LEU A CB   4  
ATOM 2653  C CG   . LEU A 1 18 ? -7.110  -6.252  9.031   1.00 0.00 ? 18 LEU A CG   4  
ATOM 2654  C CD1  . LEU A 1 18 ? -6.036  -6.943  9.856   1.00 0.00 ? 18 LEU A CD1  4  
ATOM 2655  C CD2  . LEU A 1 18 ? -8.383  -7.085  9.006   1.00 0.00 ? 18 LEU A CD2  4  
ATOM 2656  H H    . LEU A 1 18 ? -8.458  -5.296  7.291   1.00 0.00 ? 18 LEU A H    4  
ATOM 2657  H HA   . LEU A 1 18 ? -8.295  -3.006  8.970   1.00 0.00 ? 18 LEU A HA   4  
ATOM 2658  H HB2  . LEU A 1 18 ? -6.544  -4.543  10.174  1.00 0.00 ? 18 LEU A HB2  4  
ATOM 2659  H HB3  . LEU A 1 18 ? -8.254  -4.919  10.236  1.00 0.00 ? 18 LEU A HB3  4  
ATOM 2660  H HG   . LEU A 1 18 ? -6.746  -6.164  8.017   1.00 0.00 ? 18 LEU A HG   4  
ATOM 2661  H HD11 . LEU A 1 18 ? -6.045  -6.546  10.860  1.00 0.00 ? 18 LEU A HD11 4  
ATOM 2662  H HD12 . LEU A 1 18 ? -5.070  -6.769  9.407   1.00 0.00 ? 18 LEU A HD12 4  
ATOM 2663  H HD13 . LEU A 1 18 ? -6.233  -8.005  9.886   1.00 0.00 ? 18 LEU A HD13 4  
ATOM 2664  H HD21 . LEU A 1 18 ? -9.237  -6.433  8.900   1.00 0.00 ? 18 LEU A HD21 4  
ATOM 2665  H HD22 . LEU A 1 18 ? -8.467  -7.639  9.929   1.00 0.00 ? 18 LEU A HD22 4  
ATOM 2666  H HD23 . LEU A 1 18 ? -8.347  -7.772  8.174   1.00 0.00 ? 18 LEU A HD23 4  
ATOM 2667  N N    . GLY A 1 19 ? -6.507  -2.033  7.351   1.00 0.00 ? 19 GLY A N    4  
ATOM 2668  C CA   . GLY A 1 19 ? -5.357  -1.324  6.816   1.00 0.00 ? 19 GLY A CA   4  
ATOM 2669  C C    . GLY A 1 19 ? -4.214  -1.185  7.801   1.00 0.00 ? 19 GLY A C    4  
ATOM 2670  O O    . GLY A 1 19 ? -4.350  -0.533  8.837   1.00 0.00 ? 19 GLY A O    4  
ATOM 2671  H H    . GLY A 1 19 ? -7.415  -1.697  7.166   1.00 0.00 ? 19 GLY A H    4  
ATOM 2672  H HA2  . GLY A 1 19 ? -4.999  -1.857  5.948   1.00 0.00 ? 19 GLY A HA2  4  
ATOM 2673  H HA3  . GLY A 1 19 ? -5.673  -0.337  6.510   1.00 0.00 ? 19 GLY A HA3  4  
ATOM 2674  N N    . ASP A 1 20 ? -3.078  -1.794  7.469   1.00 0.00 ? 20 ASP A N    4  
ATOM 2675  C CA   . ASP A 1 20 ? -1.899  -1.732  8.314   1.00 0.00 ? 20 ASP A CA   4  
ATOM 2676  C C    . ASP A 1 20 ? -1.188  -0.397  8.131   1.00 0.00 ? 20 ASP A C    4  
ATOM 2677  O O    . ASP A 1 20 ? -1.571  0.409   7.284   1.00 0.00 ? 20 ASP A O    4  
ATOM 2678  C CB   . ASP A 1 20 ? -0.945  -2.881  7.982   1.00 0.00 ? 20 ASP A CB   4  
ATOM 2679  C CG   . ASP A 1 20 ? -1.673  -4.155  7.589   1.00 0.00 ? 20 ASP A CG   4  
ATOM 2680  O OD1  . ASP A 1 20 ? -2.715  -4.457  8.205   1.00 0.00 ? 20 ASP A OD1  4  
ATOM 2681  O OD2  . ASP A 1 20 ? -1.198  -4.849  6.665   1.00 0.00 ? 20 ASP A OD2  4  
ATOM 2682  H H    . ASP A 1 20 ? -3.030  -2.292  6.629   1.00 0.00 ? 20 ASP A H    4  
ATOM 2683  H HA   . ASP A 1 20 ? -2.215  -1.822  9.342   1.00 0.00 ? 20 ASP A HA   4  
ATOM 2684  H HB2  . ASP A 1 20 ? -0.306  -2.587  7.163   1.00 0.00 ? 20 ASP A HB2  4  
ATOM 2685  H HB3  . ASP A 1 20 ? -0.339  -3.090  8.845   1.00 0.00 ? 20 ASP A HB3  4  
ATOM 2686  N N    . LEU A 1 21 ? -0.155  -0.168  8.928   1.00 0.00 ? 21 LEU A N    4  
ATOM 2687  C CA   . LEU A 1 21 ? 0.598   1.079   8.847   1.00 0.00 ? 21 LEU A CA   4  
ATOM 2688  C C    . LEU A 1 21 ? 1.821   0.938   7.934   1.00 0.00 ? 21 LEU A C    4  
ATOM 2689  O O    . LEU A 1 21 ? 2.952   0.810   8.396   1.00 0.00 ? 21 LEU A O    4  
ATOM 2690  C CB   . LEU A 1 21 ? 0.996   1.570   10.251  1.00 0.00 ? 21 LEU A CB   4  
ATOM 2691  C CG   . LEU A 1 21 ? 2.184   0.866   10.917  1.00 0.00 ? 21 LEU A CG   4  
ATOM 2692  C CD1  . LEU A 1 21 ? 2.303   1.296   12.370  1.00 0.00 ? 21 LEU A CD1  4  
ATOM 2693  C CD2  . LEU A 1 21 ? 2.046   -0.645  10.824  1.00 0.00 ? 21 LEU A CD2  4  
ATOM 2694  H H    . LEU A 1 21 ? 0.099   -0.846  9.583   1.00 0.00 ? 21 LEU A H    4  
ATOM 2695  H HA   . LEU A 1 21 ? -0.059  1.815   8.405   1.00 0.00 ? 21 LEU A HA   4  
ATOM 2696  H HB2  . LEU A 1 21 ? 1.230   2.621   10.182  1.00 0.00 ? 21 LEU A HB2  4  
ATOM 2697  H HB3  . LEU A 1 21 ? 0.137   1.457   10.897  1.00 0.00 ? 21 LEU A HB3  4  
ATOM 2698  H HG   . LEU A 1 21 ? 3.093   1.154   10.414  1.00 0.00 ? 21 LEU A HG   4  
ATOM 2699  H HD11 . LEU A 1 21 ? 2.059   2.344   12.456  1.00 0.00 ? 21 LEU A HD11 4  
ATOM 2700  H HD12 . LEU A 1 21 ? 3.314   1.132   12.711  1.00 0.00 ? 21 LEU A HD12 4  
ATOM 2701  H HD13 . LEU A 1 21 ? 1.621   0.717   12.974  1.00 0.00 ? 21 LEU A HD13 4  
ATOM 2702  H HD21 . LEU A 1 21 ? 2.834   -1.113  11.393  1.00 0.00 ? 21 LEU A HD21 4  
ATOM 2703  H HD22 . LEU A 1 21 ? 2.117   -0.952  9.791   1.00 0.00 ? 21 LEU A HD22 4  
ATOM 2704  H HD23 . LEU A 1 21 ? 1.088   -0.944  11.225  1.00 0.00 ? 21 LEU A HD23 4  
ATOM 2705  N N    . ILE A 1 22 ? 1.574   0.973   6.627   1.00 0.00 ? 22 ILE A N    4  
ATOM 2706  C CA   . ILE A 1 22 ? 2.641   0.864   5.633   1.00 0.00 ? 22 ILE A CA   4  
ATOM 2707  C C    . ILE A 1 22 ? 3.256   2.231   5.358   1.00 0.00 ? 22 ILE A C    4  
ATOM 2708  O O    . ILE A 1 22 ? 2.563   3.244   5.393   1.00 0.00 ? 22 ILE A O    4  
ATOM 2709  C CB   . ILE A 1 22 ? 2.119   0.271   4.297   1.00 0.00 ? 22 ILE A CB   4  
ATOM 2710  C CG1  . ILE A 1 22 ? 3.092   0.544   3.154   1.00 0.00 ? 22 ILE A CG1  4  
ATOM 2711  C CG2  . ILE A 1 22 ? 0.749   0.829   3.957   1.00 0.00 ? 22 ILE A CG2  4  
ATOM 2712  C CD1  . ILE A 1 22 ? 2.753   1.771   2.334   1.00 0.00 ? 22 ILE A CD1  4  
ATOM 2713  H H    . ILE A 1 22 ? 0.650   1.085   6.323   1.00 0.00 ? 22 ILE A H    4  
ATOM 2714  H HA   . ILE A 1 22 ? 3.403   0.206   6.027   1.00 0.00 ? 22 ILE A HA   4  
ATOM 2715  H HB   . ILE A 1 22 ? 2.028   -0.793  4.413   1.00 0.00 ? 22 ILE A HB   4  
ATOM 2716  H HG12 . ILE A 1 22 ? 4.081   0.678   3.557   1.00 0.00 ? 22 ILE A HG12 4  
ATOM 2717  H HG13 . ILE A 1 22 ? 3.093   -0.305  2.492   1.00 0.00 ? 22 ILE A HG13 4  
ATOM 2718  H HG21 . ILE A 1 22 ? 0.729   1.886   4.176   1.00 0.00 ? 22 ILE A HG21 4  
ATOM 2719  H HG22 . ILE A 1 22 ? -0.003  0.323   4.541   1.00 0.00 ? 22 ILE A HG22 4  
ATOM 2720  H HG23 . ILE A 1 22 ? 0.553   0.677   2.904   1.00 0.00 ? 22 ILE A HG23 4  
ATOM 2721  H HD11 . ILE A 1 22 ? 2.568   2.606   2.993   1.00 0.00 ? 22 ILE A HD11 4  
ATOM 2722  H HD12 . ILE A 1 22 ? 1.868   1.575   1.744   1.00 0.00 ? 22 ILE A HD12 4  
ATOM 2723  H HD13 . ILE A 1 22 ? 3.577   2.003   1.679   1.00 0.00 ? 22 ILE A HD13 4  
ATOM 2724  N N    . CYS A 1 23 ? 4.550   2.253   5.059   1.00 0.00 ? 23 CYS A N    4  
ATOM 2725  C CA   . CYS A 1 23 ? 5.236   3.505   4.752   1.00 0.00 ? 23 CYS A CA   4  
ATOM 2726  C C    . CYS A 1 23 ? 5.520   3.583   3.259   1.00 0.00 ? 23 CYS A C    4  
ATOM 2727  O O    . CYS A 1 23 ? 6.615   3.249   2.806   1.00 0.00 ? 23 CYS A O    4  
ATOM 2728  C CB   . CYS A 1 23 ? 6.539   3.622   5.547   1.00 0.00 ? 23 CYS A CB   4  
ATOM 2729  S SG   . CYS A 1 23 ? 6.893   5.302   6.155   1.00 0.00 ? 23 CYS A SG   4  
ATOM 2730  H H    . CYS A 1 23 ? 5.052   1.405   5.025   1.00 0.00 ? 23 CYS A H    4  
ATOM 2731  H HA   . CYS A 1 23 ? 4.580   4.319   5.026   1.00 0.00 ? 23 CYS A HA   4  
ATOM 2732  H HB2  . CYS A 1 23 ? 6.489   2.967   6.403   1.00 0.00 ? 23 CYS A HB2  4  
ATOM 2733  H HB3  . CYS A 1 23 ? 7.363   3.320   4.917   1.00 0.00 ? 23 CYS A HB3  4  
ATOM 2734  N N    . ALA A 1 24 ? 4.517   4.009   2.497   1.00 0.00 ? 24 ALA A N    4  
ATOM 2735  C CA   . ALA A 1 24 ? 4.643   4.108   1.052   1.00 0.00 ? 24 ALA A CA   4  
ATOM 2736  C C    . ALA A 1 24 ? 5.388   5.368   0.637   1.00 0.00 ? 24 ALA A C    4  
ATOM 2737  O O    . ALA A 1 24 ? 5.191   6.440   1.206   1.00 0.00 ? 24 ALA A O    4  
ATOM 2738  C CB   . ALA A 1 24 ? 3.267   4.069   0.401   1.00 0.00 ? 24 ALA A CB   4  
ATOM 2739  H H    . ALA A 1 24 ? 3.668   4.247   2.915   1.00 0.00 ? 24 ALA A H    4  
ATOM 2740  H HA   . ALA A 1 24 ? 5.196   3.247   0.712   1.00 0.00 ? 24 ALA A HA   4  
ATOM 2741  H HB1  . ALA A 1 24 ? 3.099   4.983   -0.149  1.00 0.00 ? 24 ALA A HB1  4  
ATOM 2742  H HB2  . ALA A 1 24 ? 2.511   3.966   1.165   1.00 0.00 ? 24 ALA A HB2  4  
ATOM 2743  H HB3  . ALA A 1 24 ? 3.212   3.227   -0.274  1.00 0.00 ? 24 ALA A HB3  4  
ATOM 2744  N N    . VAL A 1 25 ? 6.241   5.221   -0.366  1.00 0.00 ? 25 VAL A N    4  
ATOM 2745  C CA   . VAL A 1 25 ? 7.025   6.334   -0.880  1.00 0.00 ? 25 VAL A CA   4  
ATOM 2746  C C    . VAL A 1 25 ? 7.002   6.365   -2.402  1.00 0.00 ? 25 VAL A C    4  
ATOM 2747  O O    . VAL A 1 25 ? 7.027   5.316   -3.064  1.00 0.00 ? 25 VAL A O    4  
ATOM 2748  C CB   . VAL A 1 25 ? 8.488   6.270   -0.399  1.00 0.00 ? 25 VAL A CB   4  
ATOM 2749  C CG1  . VAL A 1 25 ? 9.222   7.556   -0.748  1.00 0.00 ? 25 VAL A CG1  4  
ATOM 2750  C CG2  . VAL A 1 25 ? 8.548   6.004   1.097   1.00 0.00 ? 25 VAL A CG2  4  
ATOM 2751  H H    . VAL A 1 25 ? 6.343   4.337   -0.774  1.00 0.00 ? 25 VAL A H    4  
ATOM 2752  H HA   . VAL A 1 25 ? 6.588   7.252   -0.509  1.00 0.00 ? 25 VAL A HA   4  
ATOM 2753  H HB   . VAL A 1 25 ? 8.978   5.456   -0.907  1.00 0.00 ? 25 VAL A HB   4  
ATOM 2754  H HG11 . VAL A 1 25 ? 9.733   7.433   -1.692  1.00 0.00 ? 25 VAL A HG11 4  
ATOM 2755  H HG12 . VAL A 1 25 ? 9.943   7.780   0.025   1.00 0.00 ? 25 VAL A HG12 4  
ATOM 2756  H HG13 . VAL A 1 25 ? 8.513   8.366   -0.826  1.00 0.00 ? 25 VAL A HG13 4  
ATOM 2757  H HG21 . VAL A 1 25 ? 8.649   4.942   1.271   1.00 0.00 ? 25 VAL A HG21 4  
ATOM 2758  H HG22 . VAL A 1 25 ? 7.641   6.360   1.563   1.00 0.00 ? 25 VAL A HG22 4  
ATOM 2759  H HG23 . VAL A 1 25 ? 9.397   6.520   1.521   1.00 0.00 ? 25 VAL A HG23 4  
ATOM 2760  N N    . ILE A 1 26 ? 6.952   7.578   -2.947  1.00 0.00 ? 26 ILE A N    4  
ATOM 2761  C CA   . ILE A 1 26 ? 6.927   7.778   -4.393  1.00 0.00 ? 26 ILE A CA   4  
ATOM 2762  C C    . ILE A 1 26 ? 7.926   8.849   -4.817  1.00 0.00 ? 26 ILE A C    4  
ATOM 2763  O O    . ILE A 1 26 ? 7.570   10.016  -4.977  1.00 0.00 ? 26 ILE A O    4  
ATOM 2764  C CB   . ILE A 1 26 ? 5.531   8.188   -4.914  1.00 0.00 ? 26 ILE A CB   4  
ATOM 2765  C CG1  . ILE A 1 26 ? 4.607   8.612   -3.758  1.00 0.00 ? 26 ILE A CG1  4  
ATOM 2766  C CG2  . ILE A 1 26 ? 4.918   7.066   -5.742  1.00 0.00 ? 26 ILE A CG2  4  
ATOM 2767  C CD1  . ILE A 1 26 ? 3.889   7.469   -3.070  1.00 0.00 ? 26 ILE A CD1  4  
ATOM 2768  H H    . ILE A 1 26 ? 6.932   8.362   -2.354  1.00 0.00 ? 26 ILE A H    4  
ATOM 2769  H HA   . ILE A 1 26 ? 7.203   6.843   -4.860  1.00 0.00 ? 26 ILE A HA   4  
ATOM 2770  H HB   . ILE A 1 26 ? 5.671   9.031   -5.572  1.00 0.00 ? 26 ILE A HB   4  
ATOM 2771  H HG12 . ILE A 1 26 ? 5.196   9.120   -3.011  1.00 0.00 ? 26 ILE A HG12 4  
ATOM 2772  H HG13 . ILE A 1 26 ? 3.859   9.292   -4.139  1.00 0.00 ? 26 ILE A HG13 4  
ATOM 2773  H HG21 . ILE A 1 26 ? 5.534   6.182   -5.668  1.00 0.00 ? 26 ILE A HG21 4  
ATOM 2774  H HG22 . ILE A 1 26 ? 4.856   7.374   -6.775  1.00 0.00 ? 26 ILE A HG22 4  
ATOM 2775  H HG23 . ILE A 1 26 ? 3.927   6.845   -5.376  1.00 0.00 ? 26 ILE A HG23 4  
ATOM 2776  H HD11 . ILE A 1 26 ? 3.183   7.867   -2.358  1.00 0.00 ? 26 ILE A HD11 4  
ATOM 2777  H HD12 . ILE A 1 26 ? 4.607   6.848   -2.556  1.00 0.00 ? 26 ILE A HD12 4  
ATOM 2778  H HD13 . ILE A 1 26 ? 3.364   6.879   -3.806  1.00 0.00 ? 26 ILE A HD13 4  
ATOM 2779  N N    . GLY A 1 27 ? 9.171   8.440   -4.994  1.00 0.00 ? 27 GLY A N    4  
ATOM 2780  C CA   . GLY A 1 27 ? 10.220  9.358   -5.402  1.00 0.00 ? 27 GLY A CA   4  
ATOM 2781  C C    . GLY A 1 27 ? 10.566  10.358  -4.321  1.00 0.00 ? 27 GLY A C    4  
ATOM 2782  O O    . GLY A 1 27 ? 11.714  10.446  -3.884  1.00 0.00 ? 27 GLY A O    4  
ATOM 2783  H H    . GLY A 1 27 ? 9.379   7.506   -4.846  1.00 0.00 ? 27 GLY A H    4  
ATOM 2784  H HA2  . GLY A 1 27 ? 11.106  8.790   -5.649  1.00 0.00 ? 27 GLY A HA2  4  
ATOM 2785  H HA3  . GLY A 1 27 ? 9.894   9.894   -6.282  1.00 0.00 ? 27 GLY A HA3  4  
ATOM 2786  N N    . ASP A 1 28 ? 9.566   11.109  -3.890  1.00 0.00 ? 28 ASP A N    4  
ATOM 2787  C CA   . ASP A 1 28 ? 9.748   12.111  -2.851  1.00 0.00 ? 28 ASP A CA   4  
ATOM 2788  C C    . ASP A 1 28 ? 8.462   12.306  -2.057  1.00 0.00 ? 28 ASP A C    4  
ATOM 2789  O O    . ASP A 1 28 ? 8.263   13.345  -1.427  1.00 0.00 ? 28 ASP A O    4  
ATOM 2790  C CB   . ASP A 1 28 ? 10.188  13.441  -3.466  1.00 0.00 ? 28 ASP A CB   4  
ATOM 2791  C CG   . ASP A 1 28 ? 11.664  13.459  -3.813  1.00 0.00 ? 28 ASP A CG   4  
ATOM 2792  O OD1  . ASP A 1 28 ? 12.493  13.331  -2.887  1.00 0.00 ? 28 ASP A OD1  4  
ATOM 2793  O OD2  . ASP A 1 28 ? 11.991  13.602  -5.009  1.00 0.00 ? 28 ASP A OD2  4  
ATOM 2794  H H    . ASP A 1 28 ? 8.679   10.982  -4.281  1.00 0.00 ? 28 ASP A H    4  
ATOM 2795  H HA   . ASP A 1 28 ? 10.519  11.759  -2.183  1.00 0.00 ? 28 ASP A HA   4  
ATOM 2796  H HB2  . ASP A 1 28 ? 9.624   13.616  -4.370  1.00 0.00 ? 28 ASP A HB2  4  
ATOM 2797  H HB3  . ASP A 1 28 ? 9.991   14.238  -2.763  1.00 0.00 ? 28 ASP A HB3  4  
ATOM 2798  N N    . ALA A 1 29 ? 7.594   11.299  -2.084  1.00 0.00 ? 29 ALA A N    4  
ATOM 2799  C CA   . ALA A 1 29 ? 6.332   11.367  -1.358  1.00 0.00 ? 29 ALA A CA   4  
ATOM 2800  C C    . ALA A 1 29 ? 6.179   10.165  -0.437  1.00 0.00 ? 29 ALA A C    4  
ATOM 2801  O O    . ALA A 1 29 ? 5.497   9.196   -0.772  1.00 0.00 ? 29 ALA A O    4  
ATOM 2802  C CB   . ALA A 1 29 ? 5.162   11.452  -2.327  1.00 0.00 ? 29 ALA A CB   4  
ATOM 2803  H H    . ALA A 1 29 ? 7.808   10.489  -2.600  1.00 0.00 ? 29 ALA A H    4  
ATOM 2804  H HA   . ALA A 1 29 ? 6.339   12.267  -0.760  1.00 0.00 ? 29 ALA A HA   4  
ATOM 2805  H HB1  . ALA A 1 29 ? 5.466   11.071  -3.291  1.00 0.00 ? 29 ALA A HB1  4  
ATOM 2806  H HB2  . ALA A 1 29 ? 4.852   12.481  -2.428  1.00 0.00 ? 29 ALA A HB2  4  
ATOM 2807  H HB3  . ALA A 1 29 ? 4.339   10.862  -1.951  1.00 0.00 ? 29 ALA A HB3  4  
ATOM 2808  N N    . LYS A 1 30 ? 6.825   10.231  0.722   1.00 0.00 ? 30 LYS A N    4  
ATOM 2809  C CA   . LYS A 1 30 ? 6.770   9.145   1.689   1.00 0.00 ? 30 LYS A CA   4  
ATOM 2810  C C    . LYS A 1 30 ? 5.790   9.461   2.815   1.00 0.00 ? 30 LYS A C    4  
ATOM 2811  O O    . LYS A 1 30 ? 5.906   10.489  3.483   1.00 0.00 ? 30 LYS A O    4  
ATOM 2812  C CB   . LYS A 1 30 ? 8.160   8.879   2.270   1.00 0.00 ? 30 LYS A CB   4  
ATOM 2813  C CG   . LYS A 1 30 ? 8.854   10.129  2.785   1.00 0.00 ? 30 LYS A CG   4  
ATOM 2814  C CD   . LYS A 1 30 ? 9.738   10.754  1.717   1.00 0.00 ? 30 LYS A CD   4  
ATOM 2815  C CE   . LYS A 1 30 ? 11.088  10.061  1.634   1.00 0.00 ? 30 LYS A CE   4  
ATOM 2816  N NZ   . LYS A 1 30 ? 11.476  9.775   0.226   1.00 0.00 ? 30 LYS A NZ   4  
ATOM 2817  H H    . LYS A 1 30 ? 7.357   11.029  0.927   1.00 0.00 ? 30 LYS A H    4  
ATOM 2818  H HA   . LYS A 1 30 ? 6.433   8.261   1.166   1.00 0.00 ? 30 LYS A HA   4  
ATOM 2819  H HB2  . LYS A 1 30 ? 8.067   8.182   3.091   1.00 0.00 ? 30 LYS A HB2  4  
ATOM 2820  H HB3  . LYS A 1 30 ? 8.779   8.439   1.505   1.00 0.00 ? 30 LYS A HB3  4  
ATOM 2821  H HG2  . LYS A 1 30 ? 8.106   10.847  3.085   1.00 0.00 ? 30 LYS A HG2  4  
ATOM 2822  H HG3  . LYS A 1 30 ? 9.465   9.865   3.636   1.00 0.00 ? 30 LYS A HG3  4  
ATOM 2823  H HD2  . LYS A 1 30 ? 9.245   10.672  0.760   1.00 0.00 ? 30 LYS A HD2  4  
ATOM 2824  H HD3  . LYS A 1 30 ? 9.892   11.796  1.957   1.00 0.00 ? 30 LYS A HD3  4  
ATOM 2825  H HE2  . LYS A 1 30 ? 11.834  10.699  2.082   1.00 0.00 ? 30 LYS A HE2  4  
ATOM 2826  H HE3  . LYS A 1 30 ? 11.035  9.130   2.181   1.00 0.00 ? 30 LYS A HE3  4  
ATOM 2827  H HZ1  . LYS A 1 30 ? 10.628  9.691   -0.369  1.00 0.00 ? 30 LYS A HZ1  4  
ATOM 2828  H HZ2  . LYS A 1 30 ? 12.011  8.885   0.177   1.00 0.00 ? 30 LYS A HZ2  4  
ATOM 2829  H HZ3  . LYS A 1 30 ? 12.071  10.545  -0.144  1.00 0.00 ? 30 LYS A HZ3  4  
ATOM 2830  N N    . GLU A 1 31 ? 4.830   8.567   3.022   1.00 0.00 ? 31 GLU A N    4  
ATOM 2831  C CA   . GLU A 1 31 ? 3.829   8.740   4.070   1.00 0.00 ? 31 GLU A CA   4  
ATOM 2832  C C    . GLU A 1 31 ? 3.181   7.402   4.410   1.00 0.00 ? 31 GLU A C    4  
ATOM 2833  O O    . GLU A 1 31 ? 3.142   6.499   3.575   1.00 0.00 ? 31 GLU A O    4  
ATOM 2834  C CB   . GLU A 1 31 ? 2.762   9.745   3.625   1.00 0.00 ? 31 GLU A CB   4  
ATOM 2835  C CG   . GLU A 1 31 ? 2.888   11.102  4.297   1.00 0.00 ? 31 GLU A CG   4  
ATOM 2836  C CD   . GLU A 1 31 ? 1.647   11.955  4.120   1.00 0.00 ? 31 GLU A CD   4  
ATOM 2837  O OE1  . GLU A 1 31 ? 0.553   11.503  4.522   1.00 0.00 ? 31 GLU A OE1  4  
ATOM 2838  O OE2  . GLU A 1 31 ? 1.767   13.074  3.580   1.00 0.00 ? 31 GLU A OE2  4  
ATOM 2839  H H    . GLU A 1 31 ? 4.795   7.767   2.458   1.00 0.00 ? 31 GLU A H    4  
ATOM 2840  H HA   . GLU A 1 31 ? 4.330   9.121   4.949   1.00 0.00 ? 31 GLU A HA   4  
ATOM 2841  H HB2  . GLU A 1 31 ? 2.841   9.886   2.558   1.00 0.00 ? 31 GLU A HB2  4  
ATOM 2842  H HB3  . GLU A 1 31 ? 1.786   9.343   3.855   1.00 0.00 ? 31 GLU A HB3  4  
ATOM 2843  H HG2  . GLU A 1 31 ? 3.058   10.954  5.352   1.00 0.00 ? 31 GLU A HG2  4  
ATOM 2844  H HG3  . GLU A 1 31 ? 3.730   11.626  3.867   1.00 0.00 ? 31 GLU A HG3  4  
ATOM 2845  N N    . GLU A 1 32 ? 2.674   7.271   5.634   1.00 0.00 ? 32 GLU A N    4  
ATOM 2846  C CA   . GLU A 1 32 ? 2.038   6.031   6.047   1.00 0.00 ? 32 GLU A CA   4  
ATOM 2847  C C    . GLU A 1 32 ? 0.714   5.835   5.324   1.00 0.00 ? 32 GLU A C    4  
ATOM 2848  O O    . GLU A 1 32 ? -0.013  6.794   5.062   1.00 0.00 ? 32 GLU A O    4  
ATOM 2849  C CB   . GLU A 1 32 ? 1.812   5.970   7.565   1.00 0.00 ? 32 GLU A CB   4  
ATOM 2850  C CG   . GLU A 1 32 ? 1.887   7.305   8.290   1.00 0.00 ? 32 GLU A CG   4  
ATOM 2851  C CD   . GLU A 1 32 ? 0.822   8.281   7.829   1.00 0.00 ? 32 GLU A CD   4  
ATOM 2852  O OE1  . GLU A 1 32 ? -0.343  7.860   7.675   1.00 0.00 ? 32 GLU A OE1  4  
ATOM 2853  O OE2  . GLU A 1 32 ? 1.155   9.467   7.621   1.00 0.00 ? 32 GLU A OE2  4  
ATOM 2854  H H    . GLU A 1 32 ? 2.730   8.015   6.263   1.00 0.00 ? 32 GLU A H    4  
ATOM 2855  H HA   . GLU A 1 32 ? 2.700   5.228   5.767   1.00 0.00 ? 32 GLU A HA   4  
ATOM 2856  H HB2  . GLU A 1 32 ? 0.834   5.554   7.745   1.00 0.00 ? 32 GLU A HB2  4  
ATOM 2857  H HB3  . GLU A 1 32 ? 2.553   5.315   7.992   1.00 0.00 ? 32 GLU A HB3  4  
ATOM 2858  H HG2  . GLU A 1 32 ? 1.757   7.128   9.349   1.00 0.00 ? 32 GLU A HG2  4  
ATOM 2859  H HG3  . GLU A 1 32 ? 2.857   7.741   8.119   1.00 0.00 ? 32 GLU A HG3  4  
ATOM 2860  N N    . HIS A 1 33 ? 0.410   4.584   5.007   1.00 0.00 ? 33 HIS A N    4  
ATOM 2861  C CA   . HIS A 1 33 ? -0.826  4.246   4.318   1.00 0.00 ? 33 HIS A CA   4  
ATOM 2862  C C    . HIS A 1 33 ? -1.566  3.135   5.053   1.00 0.00 ? 33 HIS A C    4  
ATOM 2863  O O    . HIS A 1 33 ? -0.957  2.180   5.536   1.00 0.00 ? 33 HIS A O    4  
ATOM 2864  C CB   . HIS A 1 33 ? -0.533  3.817   2.879   1.00 0.00 ? 33 HIS A CB   4  
ATOM 2865  C CG   . HIS A 1 33 ? -1.568  4.271   1.897   1.00 0.00 ? 33 HIS A CG   4  
ATOM 2866  N ND1  . HIS A 1 33 ? -1.409  5.380   1.091   1.00 0.00 ? 33 HIS A ND1  4  
ATOM 2867  C CD2  . HIS A 1 33 ? -2.786  3.760   1.593   1.00 0.00 ? 33 HIS A CD2  4  
ATOM 2868  C CE1  . HIS A 1 33 ? -2.482  5.532   0.337   1.00 0.00 ? 33 HIS A CE1  4  
ATOM 2869  N NE2  . HIS A 1 33 ? -3.332  4.562   0.621   1.00 0.00 ? 33 HIS A NE2  4  
ATOM 2870  H H    . HIS A 1 33 ? 1.033   3.868   5.247   1.00 0.00 ? 33 HIS A H    4  
ATOM 2871  H HA   . HIS A 1 33 ? -1.449  5.128   4.302   1.00 0.00 ? 33 HIS A HA   4  
ATOM 2872  H HB2  . HIS A 1 33 ? 0.417   4.232   2.573   1.00 0.00 ? 33 HIS A HB2  4  
ATOM 2873  H HB3  . HIS A 1 33 ? -0.480  2.739   2.835   1.00 0.00 ? 33 HIS A HB3  4  
ATOM 2874  H HD1  . HIS A 1 33 ? -0.626  5.968   1.075   1.00 0.00 ? 33 HIS A HD1  4  
ATOM 2875  H HD2  . HIS A 1 33 ? -3.240  2.884   2.032   1.00 0.00 ? 33 HIS A HD2  4  
ATOM 2876  H HE1  . HIS A 1 33 ? -2.639  6.315   -0.391  1.00 0.00 ? 33 HIS A HE1  4  
ATOM 2877  H HE2  . HIS A 1 33 ? -4.164  4.381   0.137   1.00 0.00 ? 33 HIS A HE2  4  
ATOM 2878  N N    . ARG A 1 34 ? -2.879  3.270   5.144   1.00 0.00 ? 34 ARG A N    4  
ATOM 2879  C CA   . ARG A 1 34 ? -3.702  2.278   5.825   1.00 0.00 ? 34 ARG A CA   4  
ATOM 2880  C C    . ARG A 1 34 ? -4.168  1.194   4.862   1.00 0.00 ? 34 ARG A C    4  
ATOM 2881  O O    . ARG A 1 34 ? -3.872  0.015   5.050   1.00 0.00 ? 34 ARG A O    4  
ATOM 2882  C CB   . ARG A 1 34 ? -4.914  2.945   6.471   1.00 0.00 ? 34 ARG A CB   4  
ATOM 2883  C CG   . ARG A 1 34 ? -4.822  3.041   7.986   1.00 0.00 ? 34 ARG A CG   4  
ATOM 2884  C CD   . ARG A 1 34 ? -5.931  2.255   8.669   1.00 0.00 ? 34 ARG A CD   4  
ATOM 2885  N NE   . ARG A 1 34 ? -5.577  1.884   10.037  1.00 0.00 ? 34 ARG A NE   4  
ATOM 2886  C CZ   . ARG A 1 34 ? -6.424  1.323   10.897  1.00 0.00 ? 34 ARG A CZ   4  
ATOM 2887  N NH1  . ARG A 1 34 ? -7.678  1.075   10.540  1.00 0.00 ? 34 ARG A NH1  4  
ATOM 2888  N NH2  . ARG A 1 34 ? -6.017  1.012   12.121  1.00 0.00 ? 34 ARG A NH2  4  
ATOM 2889  H H    . ARG A 1 34 ? -3.306  4.057   4.747   1.00 0.00 ? 34 ARG A H    4  
ATOM 2890  H HA   . ARG A 1 34 ? -3.099  1.824   6.597   1.00 0.00 ? 34 ARG A HA   4  
ATOM 2891  H HB2  . ARG A 1 34 ? -5.014  3.941   6.071   1.00 0.00 ? 34 ARG A HB2  4  
ATOM 2892  H HB3  . ARG A 1 34 ? -5.797  2.375   6.219   1.00 0.00 ? 34 ARG A HB3  4  
ATOM 2893  H HG2  . ARG A 1 34 ? -3.868  2.646   8.304   1.00 0.00 ? 34 ARG A HG2  4  
ATOM 2894  H HG3  . ARG A 1 34 ? -4.897  4.079   8.276   1.00 0.00 ? 34 ARG A HG3  4  
ATOM 2895  H HD2  . ARG A 1 34 ? -6.824  2.862   8.690   1.00 0.00 ? 34 ARG A HD2  4  
ATOM 2896  H HD3  . ARG A 1 34 ? -6.121  1.357   8.100   1.00 0.00 ? 34 ARG A HD3  4  
ATOM 2897  H HE   . ARG A 1 34 ? -4.659  2.062   10.331  1.00 0.00 ? 34 ARG A HE   4  
ATOM 2898  H HH11 . ARG A 1 34 ? -7.993  1.311   9.621   1.00 0.00 ? 34 ARG A HH11 4  
ATOM 2899  H HH12 . ARG A 1 34 ? -8.309  0.651   11.190  1.00 0.00 ? 34 ARG A HH12 4  
ATOM 2900  H HH21 . ARG A 1 34 ? -5.074  1.200   12.398  1.00 0.00 ? 34 ARG A HH21 4  
ATOM 2901  H HH22 . ARG A 1 34 ? -6.652  0.589   12.768  1.00 0.00 ? 34 ARG A HH22 4  
ATOM 2902  N N    . ASN A 1 35 ? -4.910  1.598   3.836   1.00 0.00 ? 35 ASN A N    4  
ATOM 2903  C CA   . ASN A 1 35 ? -5.429  0.652   2.858   1.00 0.00 ? 35 ASN A CA   4  
ATOM 2904  C C    . ASN A 1 35 ? -4.363  0.256   1.847   1.00 0.00 ? 35 ASN A C    4  
ATOM 2905  O O    . ASN A 1 35 ? -4.515  0.467   0.643   1.00 0.00 ? 35 ASN A O    4  
ATOM 2906  C CB   . ASN A 1 35 ? -6.651  1.235   2.142   1.00 0.00 ? 35 ASN A CB   4  
ATOM 2907  C CG   . ASN A 1 35 ? -7.896  0.389   2.332   1.00 0.00 ? 35 ASN A CG   4  
ATOM 2908  O OD1  . ASN A 1 35 ? -8.668  0.185   1.396   1.00 0.00 ? 35 ASN A OD1  4  
ATOM 2909  N ND2  . ASN A 1 35 ? -8.099  -0.111  3.548   1.00 0.00 ? 35 ASN A ND2  4  
ATOM 2910  H H    . ASN A 1 35 ? -5.122  2.550   3.742   1.00 0.00 ? 35 ASN A H    4  
ATOM 2911  H HA   . ASN A 1 35 ? -5.735  -0.234  3.395   1.00 0.00 ? 35 ASN A HA   4  
ATOM 2912  H HB2  . ASN A 1 35 ? -6.847  2.219   2.532   1.00 0.00 ? 35 ASN A HB2  4  
ATOM 2913  H HB3  . ASN A 1 35 ? -6.445  1.307   1.085   1.00 0.00 ? 35 ASN A HB3  4  
ATOM 2914  H HD21 . ASN A 1 35 ? -7.444  0.092   4.247   1.00 0.00 ? 35 ASN A HD21 4  
ATOM 2915  H HD22 . ASN A 1 35 ? -8.895  -0.664  3.693   1.00 0.00 ? 35 ASN A HD22 4  
ATOM 2916  N N    . MET A 1 36 ? -3.293  -0.350  2.348   1.00 0.00 ? 36 MET A N    4  
ATOM 2917  C CA   . MET A 1 36 ? -2.205  -0.817  1.503   1.00 0.00 ? 36 MET A CA   4  
ATOM 2918  C C    . MET A 1 36 ? -2.753  -1.670  0.355   1.00 0.00 ? 36 MET A C    4  
ATOM 2919  O O    . MET A 1 36 ? -2.117  -1.810  -0.689  1.00 0.00 ? 36 MET A O    4  
ATOM 2920  C CB   . MET A 1 36 ? -1.217  -1.617  2.358   1.00 0.00 ? 36 MET A CB   4  
ATOM 2921  C CG   . MET A 1 36 ? -0.400  -2.647  1.589   1.00 0.00 ? 36 MET A CG   4  
ATOM 2922  S SD   . MET A 1 36 ? -1.095  -4.308  1.708   1.00 0.00 ? 36 MET A SD   4  
ATOM 2923  C CE   . MET A 1 36 ? -1.099  -4.801  -0.012  1.00 0.00 ? 36 MET A CE   4  
ATOM 2924  H H    . MET A 1 36 ? -3.241  -0.505  3.313   1.00 0.00 ? 36 MET A H    4  
ATOM 2925  H HA   . MET A 1 36 ? -1.702  0.046   1.092   1.00 0.00 ? 36 MET A HA   4  
ATOM 2926  H HB2  . MET A 1 36 ? -0.535  -0.929  2.829   1.00 0.00 ? 36 MET A HB2  4  
ATOM 2927  H HB3  . MET A 1 36 ? -1.774  -2.133  3.128   1.00 0.00 ? 36 MET A HB3  4  
ATOM 2928  H HG2  . MET A 1 36 ? -0.366  -2.359  0.549   1.00 0.00 ? 36 MET A HG2  4  
ATOM 2929  H HG3  . MET A 1 36 ? 0.602   -2.661  1.990   1.00 0.00 ? 36 MET A HG3  4  
ATOM 2930  H HE1  . MET A 1 36 ? -0.133  -4.595  -0.449  1.00 0.00 ? 36 MET A HE1  4  
ATOM 2931  H HE2  . MET A 1 36 ? -1.859  -4.248  -0.544  1.00 0.00 ? 36 MET A HE2  4  
ATOM 2932  H HE3  . MET A 1 36 ? -1.308  -5.858  -0.083  1.00 0.00 ? 36 MET A HE3  4  
ATOM 2933  N N    . CYS A 1 37 ? -3.945  -2.227  0.561   1.00 0.00 ? 37 CYS A N    4  
ATOM 2934  C CA   . CYS A 1 37 ? -4.596  -3.056  -0.446  1.00 0.00 ? 37 CYS A CA   4  
ATOM 2935  C C    . CYS A 1 37 ? -4.929  -2.215  -1.674  1.00 0.00 ? 37 CYS A C    4  
ATOM 2936  O O    . CYS A 1 37 ? -4.390  -2.434  -2.764  1.00 0.00 ? 37 CYS A O    4  
ATOM 2937  C CB   . CYS A 1 37 ? -5.855  -3.695  0.165   1.00 0.00 ? 37 CYS A CB   4  
ATOM 2938  S SG   . CYS A 1 37 ? -7.099  -4.282  -1.027  1.00 0.00 ? 37 CYS A SG   4  
ATOM 2939  H H    . CYS A 1 37 ? -4.406  -2.068  1.412   1.00 0.00 ? 37 CYS A H    4  
ATOM 2940  H HA   . CYS A 1 37 ? -3.906  -3.828  -0.736  1.00 0.00 ? 37 CYS A HA   4  
ATOM 2941  H HB2  . CYS A 1 37 ? -5.556  -4.545  0.760   1.00 0.00 ? 37 CYS A HB2  4  
ATOM 2942  H HB3  . CYS A 1 37 ? -6.334  -2.971  0.809   1.00 0.00 ? 37 CYS A HB3  4  
ATOM 2943  N N    . ALA A 1 38 ? -5.795  -1.230  -1.485  1.00 0.00 ? 38 ALA A N    4  
ATOM 2944  C CA   . ALA A 1 38 ? -6.171  -0.331  -2.571  1.00 0.00 ? 38 ALA A CA   4  
ATOM 2945  C C    . ALA A 1 38 ? -4.935  0.360   -3.141  1.00 0.00 ? 38 ALA A C    4  
ATOM 2946  O O    . ALA A 1 38 ? -4.961  0.873   -4.257  1.00 0.00 ? 38 ALA A O    4  
ATOM 2947  C CB   . ALA A 1 38 ? -7.186  0.695   -2.085  1.00 0.00 ? 38 ALA A CB   4  
ATOM 2948  H H    . ALA A 1 38 ? -6.172  -1.093  -0.592  1.00 0.00 ? 38 ALA A H    4  
ATOM 2949  H HA   . ALA A 1 38 ? -6.626  -0.918  -3.354  1.00 0.00 ? 38 ALA A HA   4  
ATOM 2950  H HB1  . ALA A 1 38 ? -8.175  0.262   -2.110  1.00 0.00 ? 38 ALA A HB1  4  
ATOM 2951  H HB2  . ALA A 1 38 ? -7.156  1.563   -2.726  1.00 0.00 ? 38 ALA A HB2  4  
ATOM 2952  H HB3  . ALA A 1 38 ? -6.947  0.986   -1.073  1.00 0.00 ? 38 ALA A HB3  4  
ATOM 2953  N N    . LEU A 1 39 ? -3.851  0.353   -2.369  1.00 0.00 ? 39 LEU A N    4  
ATOM 2954  C CA   . LEU A 1 39 ? -2.598  0.957   -2.796  1.00 0.00 ? 39 LEU A CA   4  
ATOM 2955  C C    . LEU A 1 39 ? -1.943  0.100   -3.864  1.00 0.00 ? 39 LEU A C    4  
ATOM 2956  O O    . LEU A 1 39 ? -1.468  0.596   -4.877  1.00 0.00 ? 39 LEU A O    4  
ATOM 2957  C CB   . LEU A 1 39 ? -1.647  1.079   -1.608  1.00 0.00 ? 39 LEU A CB   4  
ATOM 2958  C CG   . LEU A 1 39 ? -1.202  2.502   -1.250  1.00 0.00 ? 39 LEU A CG   4  
ATOM 2959  C CD1  . LEU A 1 39 ? 0.035   2.457   -0.367  1.00 0.00 ? 39 LEU A CD1  4  
ATOM 2960  C CD2  . LEU A 1 39 ? -0.923  3.317   -2.506  1.00 0.00 ? 39 LEU A CD2  4  
ATOM 2961  H H    . LEU A 1 39 ? -3.890  -0.079  -1.492  1.00 0.00 ? 39 LEU A H    4  
ATOM 2962  H HA   . LEU A 1 39 ? -2.807  1.935   -3.196  1.00 0.00 ? 39 LEU A HA   4  
ATOM 2963  H HB2  . LEU A 1 39 ? -2.136  0.645   -0.754  1.00 0.00 ? 39 LEU A HB2  4  
ATOM 2964  H HB3  . LEU A 1 39 ? -0.761  0.496   -1.821  1.00 0.00 ? 39 LEU A HB3  4  
ATOM 2965  H HG   . LEU A 1 39 ? -1.990  2.992   -0.697  1.00 0.00 ? 39 LEU A HG   4  
ATOM 2966  H HD11 . LEU A 1 39 ? -0.215  2.005   0.581   1.00 0.00 ? 39 LEU A HD11 4  
ATOM 2967  H HD12 . LEU A 1 39 ? 0.398   3.460   -0.203  1.00 0.00 ? 39 LEU A HD12 4  
ATOM 2968  H HD13 . LEU A 1 39 ? 0.802   1.872   -0.854  1.00 0.00 ? 39 LEU A HD13 4  
ATOM 2969  H HD21 . LEU A 1 39 ? -0.295  4.159   -2.256  1.00 0.00 ? 39 LEU A HD21 4  
ATOM 2970  H HD22 . LEU A 1 39 ? -1.856  3.674   -2.918  1.00 0.00 ? 39 LEU A HD22 4  
ATOM 2971  H HD23 . LEU A 1 39 ? -0.422  2.697   -3.234  1.00 0.00 ? 39 LEU A HD23 4  
ATOM 2972  N N    . CYS A 1 40 ? -1.921  -1.199  -3.612  1.00 0.00 ? 40 CYS A N    4  
ATOM 2973  C CA   . CYS A 1 40 ? -1.321  -2.147  -4.536  1.00 0.00 ? 40 CYS A CA   4  
ATOM 2974  C C    . CYS A 1 40 ? -1.974  -2.061  -5.899  1.00 0.00 ? 40 CYS A C    4  
ATOM 2975  O O    . CYS A 1 40 ? -1.329  -2.243  -6.929  1.00 0.00 ? 40 CYS A O    4  
ATOM 2976  C CB   . CYS A 1 40 ? -1.480  -3.563  -4.003  1.00 0.00 ? 40 CYS A CB   4  
ATOM 2977  S SG   . CYS A 1 40 ? -0.779  -4.837  -5.095  1.00 0.00 ? 40 CYS A SG   4  
ATOM 2978  H H    . CYS A 1 40 ? -2.320  -1.529  -2.778  1.00 0.00 ? 40 CYS A H    4  
ATOM 2979  H HA   . CYS A 1 40 ? -0.270  -1.917  -4.627  1.00 0.00 ? 40 CYS A HA   4  
ATOM 2980  H HB2  . CYS A 1 40 ? -0.992  -3.638  -3.047  1.00 0.00 ? 40 CYS A HB2  4  
ATOM 2981  H HB3  . CYS A 1 40 ? -2.531  -3.777  -3.881  1.00 0.00 ? 40 CYS A HB3  4  
ATOM 2982  N N    . CYS A 1 41 ? -3.268  -1.815  -5.890  1.00 0.00 ? 41 CYS A N    4  
ATOM 2983  C CA   . CYS A 1 41 ? -4.029  -1.739  -7.121  1.00 0.00 ? 41 CYS A CA   4  
ATOM 2984  C C    . CYS A 1 41 ? -4.070  -0.323  -7.676  1.00 0.00 ? 41 CYS A C    4  
ATOM 2985  O O    . CYS A 1 41 ? -4.068  -0.116  -8.890  1.00 0.00 ? 41 CYS A O    4  
ATOM 2986  C CB   . CYS A 1 41 ? -5.433  -2.258  -6.854  1.00 0.00 ? 41 CYS A CB   4  
ATOM 2987  S SG   . CYS A 1 41 ? -6.663  -1.004  -6.386  1.00 0.00 ? 41 CYS A SG   4  
ATOM 2988  H H    . CYS A 1 41 ? -3.732  -1.706  -5.026  1.00 0.00 ? 41 CYS A H    4  
ATOM 2989  H HA   . CYS A 1 41 ? -3.556  -2.385  -7.842  1.00 0.00 ? 41 CYS A HA   4  
ATOM 2990  H HB2  . CYS A 1 41 ? -5.796  -2.760  -7.728  1.00 0.00 ? 41 CYS A HB2  4  
ATOM 2991  H HB3  . CYS A 1 41 ? -5.376  -2.961  -6.045  1.00 0.00 ? 41 CYS A HB3  4  
ATOM 2992  N N    . GLU A 1 42 ? -4.137  0.644   -6.777  1.00 0.00 ? 42 GLU A N    4  
ATOM 2993  C CA   . GLU A 1 42 ? -4.215  2.049   -7.171  1.00 0.00 ? 42 GLU A CA   4  
ATOM 2994  C C    . GLU A 1 42 ? -2.889  2.793   -6.998  1.00 0.00 ? 42 GLU A C    4  
ATOM 2995  O O    . GLU A 1 42 ? -2.883  4.014   -6.841  1.00 0.00 ? 42 GLU A O    4  
ATOM 2996  C CB   . GLU A 1 42 ? -5.309  2.757   -6.371  1.00 0.00 ? 42 GLU A CB   4  
ATOM 2997  C CG   . GLU A 1 42 ? -5.913  3.951   -7.091  1.00 0.00 ? 42 GLU A CG   4  
ATOM 2998  C CD   . GLU A 1 42 ? -7.380  3.757   -7.418  1.00 0.00 ? 42 GLU A CD   4  
ATOM 2999  O OE1  . GLU A 1 42 ? -7.790  2.598   -7.643  1.00 0.00 ? 42 GLU A OE1  4  
ATOM 3000  O OE2  . GLU A 1 42 ? -8.120  4.762   -7.449  1.00 0.00 ? 42 GLU A OE2  4  
ATOM 3001  H H    . GLU A 1 42 ? -4.159  0.403   -5.824  1.00 0.00 ? 42 GLU A H    4  
ATOM 3002  H HA   . GLU A 1 42 ? -4.485  2.077   -8.216  1.00 0.00 ? 42 GLU A HA   4  
ATOM 3003  H HB2  . GLU A 1 42 ? -6.098  2.051   -6.161  1.00 0.00 ? 42 GLU A HB2  4  
ATOM 3004  H HB3  . GLU A 1 42 ? -4.888  3.101   -5.437  1.00 0.00 ? 42 GLU A HB3  4  
ATOM 3005  H HG2  . GLU A 1 42 ? -5.813  4.823   -6.461  1.00 0.00 ? 42 GLU A HG2  4  
ATOM 3006  H HG3  . GLU A 1 42 ? -5.372  4.112   -8.012  1.00 0.00 ? 42 GLU A HG3  4  
ATOM 3007  N N    . HIS A 1 43 ? -1.770  2.077   -7.040  1.00 0.00 ? 43 HIS A N    4  
ATOM 3008  C CA   . HIS A 1 43 ? -0.467  2.727   -6.897  1.00 0.00 ? 43 HIS A CA   4  
ATOM 3009  C C    . HIS A 1 43 ? 0.021   3.239   -8.248  1.00 0.00 ? 43 HIS A C    4  
ATOM 3010  O O    . HIS A 1 43 ? -0.411  2.757   -9.296  1.00 0.00 ? 43 HIS A O    4  
ATOM 3011  C CB   . HIS A 1 43 ? 0.576   1.782   -6.289  1.00 0.00 ? 43 HIS A CB   4  
ATOM 3012  C CG   . HIS A 1 43 ? 0.662   0.451   -6.966  1.00 0.00 ? 43 HIS A CG   4  
ATOM 3013  N ND1  . HIS A 1 43 ? 0.178   0.216   -8.236  1.00 0.00 ? 43 HIS A ND1  4  
ATOM 3014  C CD2  . HIS A 1 43 ? 1.202   -0.718  -6.548  1.00 0.00 ? 43 HIS A CD2  4  
ATOM 3015  C CE1  . HIS A 1 43 ? 0.419   -1.040  -8.571  1.00 0.00 ? 43 HIS A CE1  4  
ATOM 3016  N NE2  . HIS A 1 43 ? 1.040   -1.626  -7.565  1.00 0.00 ? 43 HIS A NE2  4  
ATOM 3017  H H    . HIS A 1 43 ? -1.817  1.106   -7.176  1.00 0.00 ? 43 HIS A H    4  
ATOM 3018  H HA   . HIS A 1 43 ? -0.597  3.574   -6.237  1.00 0.00 ? 43 HIS A HA   4  
ATOM 3019  H HB2  . HIS A 1 43 ? 1.550   2.247   -6.359  1.00 0.00 ? 43 HIS A HB2  4  
ATOM 3020  H HB3  . HIS A 1 43 ? 0.342   1.616   -5.248  1.00 0.00 ? 43 HIS A HB3  4  
ATOM 3021  H HD1  . HIS A 1 43 ? -0.279  0.868   -8.806  1.00 0.00 ? 43 HIS A HD1  4  
ATOM 3022  H HD2  . HIS A 1 43 ? 1.670   -0.902  -5.590  1.00 0.00 ? 43 HIS A HD2  4  
ATOM 3023  H HE1  . HIS A 1 43 ? 0.157   -1.505  -9.509  1.00 0.00 ? 43 HIS A HE1  4  
ATOM 3024  H HE2  . HIS A 1 43 ? 1.353   -2.554  -7.557  1.00 0.00 ? 43 HIS A HE2  4  
ATOM 3025  N N    . PRO A 1 44 ? 0.926   4.229   -8.245  1.00 0.00 ? 44 PRO A N    4  
ATOM 3026  C CA   . PRO A 1 44 ? 1.468   4.809   -9.480  1.00 0.00 ? 44 PRO A CA   4  
ATOM 3027  C C    . PRO A 1 44 ? 2.123   3.763   -10.378 1.00 0.00 ? 44 PRO A C    4  
ATOM 3028  O O    . PRO A 1 44 ? 2.289   3.980   -11.579 1.00 0.00 ? 44 PRO A O    4  
ATOM 3029  C CB   . PRO A 1 44 ? 2.510   5.814   -8.979  1.00 0.00 ? 44 PRO A CB   4  
ATOM 3030  C CG   . PRO A 1 44 ? 2.091   6.131   -7.585  1.00 0.00 ? 44 PRO A CG   4  
ATOM 3031  C CD   . PRO A 1 44 ? 1.492   4.865   -7.042  1.00 0.00 ? 44 PRO A CD   4  
ATOM 3032  H HA   . PRO A 1 44 ? 0.703   5.329   -10.039 1.00 0.00 ? 44 PRO A HA   4  
ATOM 3033  H HB2  . PRO A 1 44 ? 3.490   5.362   -9.004  1.00 0.00 ? 44 PRO A HB2  4  
ATOM 3034  H HB3  . PRO A 1 44 ? 2.496   6.695   -9.604  1.00 0.00 ? 44 PRO A HB3  4  
ATOM 3035  H HG2  . PRO A 1 44 ? 2.948   6.421   -7.001  1.00 0.00 ? 44 PRO A HG2  4  
ATOM 3036  H HG3  . PRO A 1 44 ? 1.354   6.921   -7.592  1.00 0.00 ? 44 PRO A HG3  4  
ATOM 3037  H HD2  . PRO A 1 44 ? 2.258   4.243   -6.598  1.00 0.00 ? 44 PRO A HD2  4  
ATOM 3038  H HD3  . PRO A 1 44 ? 0.719   5.088   -6.321  1.00 0.00 ? 44 PRO A HD3  4  
ATOM 3039  N N    . GLY A 1 45 ? 2.493   2.630   -9.790  1.00 0.00 ? 45 GLY A N    4  
ATOM 3040  C CA   . GLY A 1 45 ? 3.126   1.568   -10.549 1.00 0.00 ? 45 GLY A CA   4  
ATOM 3041  C C    . GLY A 1 45 ? 4.054   0.728   -9.694  1.00 0.00 ? 45 GLY A C    4  
ATOM 3042  O O    . GLY A 1 45 ? 5.254   0.649   -9.959  1.00 0.00 ? 45 GLY A O    4  
ATOM 3043  H H    . GLY A 1 45 ? 2.336   2.514   -8.830  1.00 0.00 ? 45 GLY A H    4  
ATOM 3044  H HA2  . GLY A 1 45 ? 2.360   0.930   -10.966 1.00 0.00 ? 45 GLY A HA2  4  
ATOM 3045  H HA3  . GLY A 1 45 ? 3.695   2.005   -11.357 1.00 0.00 ? 45 GLY A HA3  4  
ATOM 3046  N N    . GLY A 1 46 ? 3.496   0.108   -8.659  1.00 0.00 ? 46 GLY A N    4  
ATOM 3047  C CA   . GLY A 1 46 ? 4.290   -0.714  -7.764  1.00 0.00 ? 46 GLY A CA   4  
ATOM 3048  C C    . GLY A 1 46 ? 5.456   0.046   -7.180  1.00 0.00 ? 46 GLY A C    4  
ATOM 3049  O O    . GLY A 1 46 ? 6.568   -0.474  -7.102  1.00 0.00 ? 46 GLY A O    4  
ATOM 3050  H H    . GLY A 1 46 ? 2.537   0.216   -8.496  1.00 0.00 ? 46 GLY A H    4  
ATOM 3051  H HA2  . GLY A 1 46 ? 3.661   -1.060  -6.953  1.00 0.00 ? 46 GLY A HA2  4  
ATOM 3052  H HA3  . GLY A 1 46 ? 4.664   -1.568  -8.304  1.00 0.00 ? 46 GLY A HA3  4  
ATOM 3053  N N    . PHE A 1 47 ? 5.194   1.283   -6.767  1.00 0.00 ? 47 PHE A N    4  
ATOM 3054  C CA   . PHE A 1 47 ? 6.215   2.137   -6.174  1.00 0.00 ? 47 PHE A CA   4  
ATOM 3055  C C    . PHE A 1 47 ? 6.919   1.423   -5.013  1.00 0.00 ? 47 PHE A C    4  
ATOM 3056  O O    . PHE A 1 47 ? 7.438   0.322   -5.187  1.00 0.00 ? 47 PHE A O    4  
ATOM 3057  C CB   . PHE A 1 47 ? 5.597   3.468   -5.721  1.00 0.00 ? 47 PHE A CB   4  
ATOM 3058  C CG   . PHE A 1 47 ? 4.468   3.349   -4.721  1.00 0.00 ? 47 PHE A CG   4  
ATOM 3059  C CD1  . PHE A 1 47 ? 3.791   2.151   -4.516  1.00 0.00 ? 47 PHE A CD1  4  
ATOM 3060  C CD2  . PHE A 1 47 ? 4.076   4.458   -3.994  1.00 0.00 ? 47 PHE A CD2  4  
ATOM 3061  C CE1  . PHE A 1 47 ? 2.751   2.073   -3.612  1.00 0.00 ? 47 PHE A CE1  4  
ATOM 3062  C CE2  . PHE A 1 47 ? 3.040   4.384   -3.085  1.00 0.00 ? 47 PHE A CE2  4  
ATOM 3063  C CZ   . PHE A 1 47 ? 2.375   3.191   -2.895  1.00 0.00 ? 47 PHE A CZ   4  
ATOM 3064  H H    . PHE A 1 47 ? 4.282   1.632   -6.866  1.00 0.00 ? 47 PHE A H    4  
ATOM 3065  H HA   . PHE A 1 47 ? 6.948   2.342   -6.939  1.00 0.00 ? 47 PHE A HA   4  
ATOM 3066  H HB2  . PHE A 1 47 ? 6.367   4.074   -5.271  1.00 0.00 ? 47 PHE A HB2  4  
ATOM 3067  H HB3  . PHE A 1 47 ? 5.213   3.983   -6.590  1.00 0.00 ? 47 PHE A HB3  4  
ATOM 3068  H HD1  . PHE A 1 47 ? 4.082   1.273   -5.066  1.00 0.00 ? 47 PHE A HD1  4  
ATOM 3069  H HD2  . PHE A 1 47 ? 4.595   5.390   -4.135  1.00 0.00 ? 47 PHE A HD2  4  
ATOM 3070  H HE1  . PHE A 1 47 ? 2.234   1.138   -3.462  1.00 0.00 ? 47 PHE A HE1  4  
ATOM 3071  H HE2  . PHE A 1 47 ? 2.748   5.260   -2.526  1.00 0.00 ? 47 PHE A HE2  4  
ATOM 3072  H HZ   . PHE A 1 47 ? 1.561   3.133   -2.192  1.00 0.00 ? 47 PHE A HZ   4  
ATOM 3073  N N    . GLU A 1 48 ? 6.956   2.037   -3.830  1.00 0.00 ? 48 GLU A N    4  
ATOM 3074  C CA   . GLU A 1 48 ? 7.619   1.407   -2.696  1.00 0.00 ? 48 GLU A CA   4  
ATOM 3075  C C    . GLU A 1 48 ? 6.857   1.647   -1.401  1.00 0.00 ? 48 GLU A C    4  
ATOM 3076  O O    . GLU A 1 48 ? 6.050   2.569   -1.293  1.00 0.00 ? 48 GLU A O    4  
ATOM 3077  C CB   . GLU A 1 48 ? 9.048   1.936   -2.569  1.00 0.00 ? 48 GLU A CB   4  
ATOM 3078  C CG   . GLU A 1 48 ? 9.152   3.444   -2.708  1.00 0.00 ? 48 GLU A CG   4  
ATOM 3079  C CD   . GLU A 1 48 ? 10.580  3.917   -2.900  1.00 0.00 ? 48 GLU A CD   4  
ATOM 3080  O OE1  . GLU A 1 48 ? 11.509  3.128   -2.627  1.00 0.00 ? 48 GLU A OE1  4  
ATOM 3081  O OE2  . GLU A 1 48 ? 10.770  5.076   -3.325  1.00 0.00 ? 48 GLU A OE2  4  
ATOM 3082  H H    . GLU A 1 48 ? 6.545   2.925   -3.718  1.00 0.00 ? 48 GLU A H    4  
ATOM 3083  H HA   . GLU A 1 48 ? 7.657   0.334   -2.880  1.00 0.00 ? 48 GLU A HA   4  
ATOM 3084  H HB2  . GLU A 1 48 ? 9.438   1.658   -1.603  1.00 0.00 ? 48 GLU A HB2  4  
ATOM 3085  H HB3  . GLU A 1 48 ? 9.656   1.484   -3.339  1.00 0.00 ? 48 GLU A HB3  4  
ATOM 3086  H HG2  . GLU A 1 48 ? 8.569   3.755   -3.563  1.00 0.00 ? 48 GLU A HG2  4  
ATOM 3087  H HG3  . GLU A 1 48 ? 8.752   3.901   -1.817  1.00 0.00 ? 48 GLU A HG3  4  
ATOM 3088  N N    . TYR A 1 49 ? 7.137   0.802   -0.421  1.00 0.00 ? 49 TYR A N    4  
ATOM 3089  C CA   . TYR A 1 49 ? 6.509   0.887   0.888   1.00 0.00 ? 49 TYR A CA   4  
ATOM 3090  C C    . TYR A 1 49 ? 7.415   0.323   1.951   1.00 0.00 ? 49 TYR A C    4  
ATOM 3091  O O    . TYR A 1 49 ? 8.447   -0.284  1.667   1.00 0.00 ? 49 TYR A O    4  
ATOM 3092  C CB   . TYR A 1 49 ? 5.169   0.150   0.924   1.00 0.00 ? 49 TYR A CB   4  
ATOM 3093  C CG   . TYR A 1 49 ? 5.249   -1.359  0.819   1.00 0.00 ? 49 TYR A CG   4  
ATOM 3094  C CD1  . TYR A 1 49 ? 6.431   -2.012  0.490   1.00 0.00 ? 49 TYR A CD1  4  
ATOM 3095  C CD2  . TYR A 1 49 ? 4.131   -2.134  1.097   1.00 0.00 ? 49 TYR A CD2  4  
ATOM 3096  C CE1  . TYR A 1 49 ? 6.495   -3.389  0.449   1.00 0.00 ? 49 TYR A CE1  4  
ATOM 3097  C CE2  . TYR A 1 49 ? 4.186   -3.509  1.048   1.00 0.00 ? 49 TYR A CE2  4  
ATOM 3098  C CZ   . TYR A 1 49 ? 5.371   -4.131  0.730   1.00 0.00 ? 49 TYR A CZ   4  
ATOM 3099  O OH   . TYR A 1 49 ? 5.434   -5.499  0.705   1.00 0.00 ? 49 TYR A OH   4  
ATOM 3100  H H    . TYR A 1 49 ? 7.798   0.097   -0.582  1.00 0.00 ? 49 TYR A H    4  
ATOM 3101  H HA   . TYR A 1 49 ? 6.328   1.922   1.129   1.00 0.00 ? 49 TYR A HA   4  
ATOM 3102  H HB2  . TYR A 1 49 ? 4.705   0.370   1.860   1.00 0.00 ? 49 TYR A HB2  4  
ATOM 3103  H HB3  . TYR A 1 49 ? 4.537   0.511   0.138   1.00 0.00 ? 49 TYR A HB3  4  
ATOM 3104  H HD1  . TYR A 1 49 ? 7.309   -1.432  0.261   1.00 0.00 ? 49 TYR A HD1  4  
ATOM 3105  H HD2  . TYR A 1 49 ? 3.201   -1.645  1.336   1.00 0.00 ? 49 TYR A HD2  4  
ATOM 3106  H HE1  . TYR A 1 49 ? 7.419   -3.878  0.191   1.00 0.00 ? 49 TYR A HE1  4  
ATOM 3107  H HE2  . TYR A 1 49 ? 3.302   -4.090  1.265   1.00 0.00 ? 49 TYR A HE2  4  
ATOM 3108  H HH   . TYR A 1 49 ? 5.035   -5.853  1.503   1.00 0.00 ? 49 TYR A HH   4  
ATOM 3109  N N    . SER A 1 50 ? 7.001   0.521   3.174   1.00 0.00 ? 50 SER A N    4  
ATOM 3110  C CA   . SER A 1 50 ? 7.740   0.027   4.314   1.00 0.00 ? 50 SER A CA   4  
ATOM 3111  C C    . SER A 1 50 ? 6.771   -0.502  5.340   1.00 0.00 ? 50 SER A C    4  
ATOM 3112  O O    . SER A 1 50 ? 6.399   0.196   6.284   1.00 0.00 ? 50 SER A O    4  
ATOM 3113  C CB   . SER A 1 50 ? 8.599   1.122   4.921   1.00 0.00 ? 50 SER A CB   4  
ATOM 3114  O OG   . SER A 1 50 ? 9.060   2.026   3.932   1.00 0.00 ? 50 SER A OG   4  
ATOM 3115  H H    . SER A 1 50 ? 6.156   1.005   3.313   1.00 0.00 ? 50 SER A H    4  
ATOM 3116  H HA   . SER A 1 50 ? 8.374   -0.779  3.979   1.00 0.00 ? 50 SER A HA   4  
ATOM 3117  H HB2  . SER A 1 50 ? 8.013   1.662   5.645   1.00 0.00 ? 50 SER A HB2  4  
ATOM 3118  H HB3  . SER A 1 50 ? 9.448   0.670   5.406   1.00 0.00 ? 50 SER A HB3  4  
ATOM 3119  H HG   . SER A 1 50 ? 8.310   2.412   3.473   1.00 0.00 ? 50 SER A HG   4  
ATOM 3120  N N    . ASN A 1 51 ? 6.344   -1.732  5.132   1.00 0.00 ? 51 ASN A N    4  
ATOM 3121  C CA   . ASN A 1 51 ? 5.387   -2.357  6.023   1.00 0.00 ? 51 ASN A CA   4  
ATOM 3122  C C    . ASN A 1 51 ? 5.781   -2.158  7.471   1.00 0.00 ? 51 ASN A C    4  
ATOM 3123  O O    . ASN A 1 51 ? 6.907   -2.441  7.881   1.00 0.00 ? 51 ASN A O    4  
ATOM 3124  C CB   . ASN A 1 51 ? 5.221   -3.837  5.730   1.00 0.00 ? 51 ASN A CB   4  
ATOM 3125  C CG   . ASN A 1 51 ? 4.734   -4.098  4.320   1.00 0.00 ? 51 ASN A CG   4  
ATOM 3126  O OD1  . ASN A 1 51 ? 5.516   -4.442  3.434   1.00 0.00 ? 51 ASN A OD1  4  
ATOM 3127  N ND2  . ASN A 1 51 ? 3.434   -3.934  4.106   1.00 0.00 ? 51 ASN A ND2  4  
ATOM 3128  H H    . ASN A 1 51 ? 6.670   -2.219  4.351   1.00 0.00 ? 51 ASN A H    4  
ATOM 3129  H HA   . ASN A 1 51 ? 4.437   -1.868  5.864   1.00 0.00 ? 51 ASN A HA   4  
ATOM 3130  H HB2  . ASN A 1 51 ? 6.164   -4.334  5.867   1.00 0.00 ? 51 ASN A HB2  4  
ATOM 3131  H HB3  . ASN A 1 51 ? 4.497   -4.238  6.420   1.00 0.00 ? 51 ASN A HB3  4  
ATOM 3132  H HD21 . ASN A 1 51 ? 2.872   -3.658  4.860   1.00 0.00 ? 51 ASN A HD21 4  
ATOM 3133  H HD22 . ASN A 1 51 ? 3.089   -4.097  3.205   1.00 0.00 ? 51 ASN A HD22 4  
ATOM 3134  N N    . GLY A 1 52 ? 4.832   -1.657  8.222   1.00 0.00 ? 52 GLY A N    4  
ATOM 3135  C CA   . GLY A 1 52 ? 5.047   -1.390  9.630   1.00 0.00 ? 52 GLY A CA   4  
ATOM 3136  C C    . GLY A 1 52 ? 5.251   0.089   9.907   1.00 0.00 ? 52 GLY A C    4  
ATOM 3137  O O    . GLY A 1 52 ? 5.323   0.889   8.975   1.00 0.00 ? 52 GLY A O    4  
ATOM 3138  H H    . GLY A 1 52 ? 3.971   -1.458  7.803   1.00 0.00 ? 52 GLY A H    4  
ATOM 3139  H HA2  . GLY A 1 52 ? 4.189   -1.737  10.186  1.00 0.00 ? 52 GLY A HA2  4  
ATOM 3140  H HA3  . GLY A 1 52 ? 5.921   -1.931  9.961   1.00 0.00 ? 52 GLY A HA3  4  
ATOM 3141  N N    . PRO A 1 53 ? 5.355   0.487   11.186  1.00 0.00 ? 53 PRO A N    4  
ATOM 3142  C CA   . PRO A 1 53 ? 5.558   1.891   11.563  1.00 0.00 ? 53 PRO A CA   4  
ATOM 3143  C C    . PRO A 1 53 ? 6.813   2.476   10.928  1.00 0.00 ? 53 PRO A C    4  
ATOM 3144  O O    . PRO A 1 53 ? 7.821   1.788   10.769  1.00 0.00 ? 53 PRO A O    4  
ATOM 3145  C CB   . PRO A 1 53 ? 5.698   1.846   13.092  1.00 0.00 ? 53 PRO A CB   4  
ATOM 3146  C CG   . PRO A 1 53 ? 5.983   0.419   13.420  1.00 0.00 ? 53 PRO A CG   4  
ATOM 3147  C CD   . PRO A 1 53 ? 5.294   -0.393  12.363  1.00 0.00 ? 53 PRO A CD   4  
ATOM 3148  H HA   . PRO A 1 53 ? 4.704   2.501   11.292  1.00 0.00 ? 53 PRO A HA   4  
ATOM 3149  H HB2  . PRO A 1 53 ? 6.509   2.490   13.399  1.00 0.00 ? 53 PRO A HB2  4  
ATOM 3150  H HB3  . PRO A 1 53 ? 4.777   2.178   13.549  1.00 0.00 ? 53 PRO A HB3  4  
ATOM 3151  H HG2  . PRO A 1 53 ? 7.048   0.241   13.396  1.00 0.00 ? 53 PRO A HG2  4  
ATOM 3152  H HG3  . PRO A 1 53 ? 5.583   0.179   14.396  1.00 0.00 ? 53 PRO A HG3  4  
ATOM 3153  H HD2  . PRO A 1 53 ? 5.829   -1.315  12.185  1.00 0.00 ? 53 PRO A HD2  4  
ATOM 3154  H HD3  . PRO A 1 53 ? 4.272   -0.594  12.643  1.00 0.00 ? 53 PRO A HD3  4  
ATOM 3155  N N    . CYS A 1 54 ? 6.740   3.750   10.561  1.00 0.00 ? 54 CYS A N    4  
ATOM 3156  C CA   . CYS A 1 54 ? 7.865   4.433   9.937   1.00 0.00 ? 54 CYS A CA   4  
ATOM 3157  C C    . CYS A 1 54 ? 7.608   5.936   9.880   1.00 0.00 ? 54 CYS A C    4  
ATOM 3158  O O    . CYS A 1 54 ? 8.370   6.728   10.434  1.00 0.00 ? 54 CYS A O    4  
ATOM 3159  C CB   . CYS A 1 54 ? 8.107   3.856   8.530   1.00 0.00 ? 54 CYS A CB   4  
ATOM 3160  S SG   . CYS A 1 54 ? 8.585   5.073   7.255   1.00 0.00 ? 54 CYS A SG   4  
ATOM 3161  H H    . CYS A 1 54 ? 5.907   4.242   10.710  1.00 0.00 ? 54 CYS A H    4  
ATOM 3162  H HA   . CYS A 1 54 ? 8.740   4.252   10.544  1.00 0.00 ? 54 CYS A HA   4  
ATOM 3163  H HB2  . CYS A 1 54 ? 8.896   3.122   8.586   1.00 0.00 ? 54 CYS A HB2  4  
ATOM 3164  H HB3  . CYS A 1 54 ? 7.201   3.372   8.195   1.00 0.00 ? 54 CYS A HB3  4  
ATOM 3165  N N    . GLU A 1 55 ? 6.526   6.319   9.209   1.00 0.00 ? 55 GLU A N    4  
ATOM 3166  C CA   . GLU A 1 55 ? 6.163   7.724   9.083   1.00 0.00 ? 55 GLU A CA   4  
ATOM 3167  C C    . GLU A 1 55 ? 5.310   8.168   10.269  1.00 0.00 ? 55 GLU A C    4  
ATOM 3168  O O    . GLU A 1 55 ? 5.831   8.914   11.124  1.00 0.00 ? 55 GLU A O    4  
ATOM 3169  C CB   . GLU A 1 55 ? 5.408   7.956   7.769   1.00 0.00 ? 55 GLU A CB   4  
ATOM 3170  C CG   . GLU A 1 55 ? 4.847   9.363   7.621   1.00 0.00 ? 55 GLU A CG   4  
ATOM 3171  C CD   . GLU A 1 55 ? 5.903   10.371  7.210   1.00 0.00 ? 55 GLU A CD   4  
ATOM 3172  O OE1  . GLU A 1 55 ? 6.696   10.787  8.080   1.00 0.00 ? 55 GLU A OE1  4  
ATOM 3173  O OE2  . GLU A 1 55 ? 5.935   10.745  6.019   1.00 0.00 ? 55 GLU A OE2  4  
ATOM 3174  O OXT  . GLU A 1 55 ? 4.129   7.766   10.332  1.00 0.00 ? 55 GLU A OXT  4  
ATOM 3175  H H    . GLU A 1 55 ? 5.958   5.637   8.792   1.00 0.00 ? 55 GLU A H    4  
ATOM 3176  H HA   . GLU A 1 55 ? 7.073   8.303   9.072   1.00 0.00 ? 55 GLU A HA   4  
ATOM 3177  H HB2  . GLU A 1 55 ? 6.081   7.774   6.944   1.00 0.00 ? 55 GLU A HB2  4  
ATOM 3178  H HB3  . GLU A 1 55 ? 4.588   7.257   7.710   1.00 0.00 ? 55 GLU A HB3  4  
ATOM 3179  H HG2  . GLU A 1 55 ? 4.072   9.352   6.869   1.00 0.00 ? 55 GLU A HG2  4  
ATOM 3180  H HG3  . GLU A 1 55 ? 4.424   9.671   8.566   1.00 0.00 ? 55 GLU A HG3  4  
ATOM 3181  N N    . ALA A 1 1  ? 12.535  -2.102  1.018   1.00 0.00 ? 1  ALA A N    5  
ATOM 3182  C CA   . ALA A 1 1  ? 11.256  -2.832  0.815   1.00 0.00 ? 1  ALA A CA   5  
ATOM 3183  C C    . ALA A 1 1  ? 10.628  -2.471  -0.527  1.00 0.00 ? 1  ALA A C    5  
ATOM 3184  O O    . ALA A 1 1  ? 11.107  -1.580  -1.229  1.00 0.00 ? 1  ALA A O    5  
ATOM 3185  C CB   . ALA A 1 1  ? 10.291  -2.528  1.950   1.00 0.00 ? 1  ALA A CB   5  
ATOM 3186  H H1   . ALA A 1 1  ? 12.894  -2.350  1.962   1.00 0.00 ? 1  ALA A H1   5  
ATOM 3187  H H2   . ALA A 1 1  ? 12.332  -1.084  0.949   1.00 0.00 ? 1  ALA A H2   5  
ATOM 3188  H H3   . ALA A 1 1  ? 13.196  -2.406  0.275   1.00 0.00 ? 1  ALA A H3   5  
ATOM 3189  H HA   . ALA A 1 1  ? 11.464  -3.891  0.827   1.00 0.00 ? 1  ALA A HA   5  
ATOM 3190  H HB1  . ALA A 1 1  ? 9.492   -3.255  1.949   1.00 0.00 ? 1  ALA A HB1  5  
ATOM 3191  H HB2  . ALA A 1 1  ? 9.878   -1.539  1.816   1.00 0.00 ? 1  ALA A HB2  5  
ATOM 3192  H HB3  . ALA A 1 1  ? 10.818  -2.574  2.893   1.00 0.00 ? 1  ALA A HB3  5  
ATOM 3193  N N    . HIS A 1 2  ? 9.554   -3.170  -0.878  1.00 0.00 ? 2  HIS A N    5  
ATOM 3194  C CA   . HIS A 1 2  ? 8.858   -2.937  -2.122  1.00 0.00 ? 2  HIS A CA   5  
ATOM 3195  C C    . HIS A 1 2  ? 7.380   -3.228  -1.957  1.00 0.00 ? 2  HIS A C    5  
ATOM 3196  O O    . HIS A 1 2  ? 6.865   -3.345  -0.845  1.00 0.00 ? 2  HIS A O    5  
ATOM 3197  C CB   . HIS A 1 2  ? 9.455   -3.807  -3.232  1.00 0.00 ? 2  HIS A CB   5  
ATOM 3198  C CG   . HIS A 1 2  ? 9.953   -3.021  -4.404  1.00 0.00 ? 2  HIS A CG   5  
ATOM 3199  N ND1  . HIS A 1 2  ? 11.283  -2.703  -4.589  1.00 0.00 ? 2  HIS A ND1  5  
ATOM 3200  C CD2  . HIS A 1 2  ? 9.292   -2.485  -5.458  1.00 0.00 ? 2  HIS A CD2  5  
ATOM 3201  C CE1  . HIS A 1 2  ? 11.417  -2.008  -5.704  1.00 0.00 ? 2  HIS A CE1  5  
ATOM 3202  N NE2  . HIS A 1 2  ? 10.224  -1.862  -6.251  1.00 0.00 ? 2  HIS A NE2  5  
ATOM 3203  H H    . HIS A 1 2  ? 9.218   -3.865  -0.286  1.00 0.00 ? 2  HIS A H    5  
ATOM 3204  H HA   . HIS A 1 2  ? 8.971   -1.903  -2.394  1.00 0.00 ? 2  HIS A HA   5  
ATOM 3205  H HB2  . HIS A 1 2  ? 10.285  -4.368  -2.832  1.00 0.00 ? 2  HIS A HB2  5  
ATOM 3206  H HB3  . HIS A 1 2  ? 8.700   -4.493  -3.587  1.00 0.00 ? 2  HIS A HB3  5  
ATOM 3207  H HD1  . HIS A 1 2  ? 12.019  -2.952  -3.992  1.00 0.00 ? 2  HIS A HD1  5  
ATOM 3208  H HD2  . HIS A 1 2  ? 8.228   -2.540  -5.641  1.00 0.00 ? 2  HIS A HD2  5  
ATOM 3209  H HE1  . HIS A 1 2  ? 12.345  -1.624  -6.102  1.00 0.00 ? 2  HIS A HE1  5  
ATOM 3210  H HE2  . HIS A 1 2  ? 10.024  -1.300  -7.028  1.00 0.00 ? 2  HIS A HE2  5  
ATOM 3211  N N    . MET A 1 3  ? 6.715   -3.327  -3.080  1.00 0.00 ? 3  MET A N    5  
ATOM 3212  C CA   . MET A 1 3  ? 5.281   -3.591  -3.120  1.00 0.00 ? 3  MET A CA   5  
ATOM 3213  C C    . MET A 1 3  ? 4.958   -5.015  -2.668  1.00 0.00 ? 3  MET A C    5  
ATOM 3214  O O    . MET A 1 3  ? 5.854   -5.819  -2.409  1.00 0.00 ? 3  MET A O    5  
ATOM 3215  C CB   . MET A 1 3  ? 4.741   -3.359  -4.532  1.00 0.00 ? 3  MET A CB   5  
ATOM 3216  C CG   . MET A 1 3  ? 5.533   -4.079  -5.611  1.00 0.00 ? 3  MET A CG   5  
ATOM 3217  S SD   . MET A 1 3  ? 4.649   -4.163  -7.180  1.00 0.00 ? 3  MET A SD   5  
ATOM 3218  C CE   . MET A 1 3  ? 5.606   -3.019  -8.171  1.00 0.00 ? 3  MET A CE   5  
ATOM 3219  H H    . MET A 1 3  ? 7.209   -3.206  -3.908  1.00 0.00 ? 3  MET A H    5  
ATOM 3220  H HA   . MET A 1 3  ? 4.801   -2.898  -2.446  1.00 0.00 ? 3  MET A HA   5  
ATOM 3221  H HB2  . MET A 1 3  ? 3.719   -3.704  -4.575  1.00 0.00 ? 3  MET A HB2  5  
ATOM 3222  H HB3  . MET A 1 3  ? 4.764   -2.300  -4.744  1.00 0.00 ? 3  MET A HB3  5  
ATOM 3223  H HG2  . MET A 1 3  ? 6.463   -3.553  -5.767  1.00 0.00 ? 3  MET A HG2  5  
ATOM 3224  H HG3  . MET A 1 3  ? 5.741   -5.084  -5.275  1.00 0.00 ? 3  MET A HG3  5  
ATOM 3225  H HE1  . MET A 1 3  ? 5.800   -2.124  -7.601  1.00 0.00 ? 3  MET A HE1  5  
ATOM 3226  H HE2  . MET A 1 3  ? 5.050   -2.764  -9.063  1.00 0.00 ? 3  MET A HE2  5  
ATOM 3227  H HE3  . MET A 1 3  ? 6.542   -3.479  -8.450  1.00 0.00 ? 3  MET A HE3  5  
ATOM 3228  N N    . ASP A 1 4  ? 3.665   -5.305  -2.570  1.00 0.00 ? 4  ASP A N    5  
ATOM 3229  C CA   . ASP A 1 4  ? 3.183   -6.617  -2.143  1.00 0.00 ? 4  ASP A CA   5  
ATOM 3230  C C    . ASP A 1 4  ? 1.654   -6.638  -2.129  1.00 0.00 ? 4  ASP A C    5  
ATOM 3231  O O    . ASP A 1 4  ? 1.033   -6.541  -1.071  1.00 0.00 ? 4  ASP A O    5  
ATOM 3232  C CB   . ASP A 1 4  ? 3.724   -6.956  -0.750  1.00 0.00 ? 4  ASP A CB   5  
ATOM 3233  C CG   . ASP A 1 4  ? 4.133   -8.410  -0.627  1.00 0.00 ? 4  ASP A CG   5  
ATOM 3234  O OD1  . ASP A 1 4  ? 5.005   -8.851  -1.406  1.00 0.00 ? 4  ASP A OD1  5  
ATOM 3235  O OD2  . ASP A 1 4  ? 3.582   -9.110  0.249   1.00 0.00 ? 4  ASP A OD2  5  
ATOM 3236  H H    . ASP A 1 4  ? 3.007   -4.611  -2.787  1.00 0.00 ? 4  ASP A H    5  
ATOM 3237  H HA   . ASP A 1 4  ? 3.538   -7.351  -2.851  1.00 0.00 ? 4  ASP A HA   5  
ATOM 3238  H HB2  . ASP A 1 4  ? 4.588   -6.340  -0.544  1.00 0.00 ? 4  ASP A HB2  5  
ATOM 3239  H HB3  . ASP A 1 4  ? 2.961   -6.752  -0.011  1.00 0.00 ? 4  ASP A HB3  5  
ATOM 3240  N N    . CYS A 1 5  ? 1.052   -6.741  -3.310  1.00 0.00 ? 5  CYS A N    5  
ATOM 3241  C CA   . CYS A 1 5  ? -0.405  -6.749  -3.432  1.00 0.00 ? 5  CYS A CA   5  
ATOM 3242  C C    . CYS A 1 5  ? -0.978  -8.121  -3.098  1.00 0.00 ? 5  CYS A C    5  
ATOM 3243  O O    . CYS A 1 5  ? -0.232  -9.061  -2.823  1.00 0.00 ? 5  CYS A O    5  
ATOM 3244  C CB   . CYS A 1 5  ? -0.812  -6.329  -4.849  1.00 0.00 ? 5  CYS A CB   5  
ATOM 3245  S SG   . CYS A 1 5  ? -2.467  -5.571  -4.990  1.00 0.00 ? 5  CYS A SG   5  
ATOM 3246  H H    . CYS A 1 5  ? 1.599   -6.800  -4.122  1.00 0.00 ? 5  CYS A H    5  
ATOM 3247  H HA   . CYS A 1 5  ? -0.792  -6.037  -2.725  1.00 0.00 ? 5  CYS A HA   5  
ATOM 3248  H HB2  . CYS A 1 5  ? -0.096  -5.611  -5.218  1.00 0.00 ? 5  CYS A HB2  5  
ATOM 3249  H HB3  . CYS A 1 5  ? -0.795  -7.200  -5.488  1.00 0.00 ? 5  CYS A HB3  5  
ATOM 3250  N N    . THR A 1 6  ? -2.308  -8.227  -3.112  1.00 0.00 ? 6  THR A N    5  
ATOM 3251  C CA   . THR A 1 6  ? -2.979  -9.480  -2.799  1.00 0.00 ? 6  THR A CA   5  
ATOM 3252  C C    . THR A 1 6  ? -2.423  -10.624 -3.665  1.00 0.00 ? 6  THR A C    5  
ATOM 3253  O O    . THR A 1 6  ? -1.315  -11.094 -3.407  1.00 0.00 ? 6  THR A O    5  
ATOM 3254  C CB   . THR A 1 6  ? -4.493  -9.332  -2.980  1.00 0.00 ? 6  THR A CB   5  
ATOM 3255  O OG1  . THR A 1 6  ? -5.117  -10.602 -3.046  1.00 0.00 ? 6  THR A OG1  5  
ATOM 3256  C CG2  . THR A 1 6  ? -4.877  -8.568  -4.229  1.00 0.00 ? 6  THR A CG2  5  
ATOM 3257  H H    . THR A 1 6  ? -2.850  -7.443  -3.327  1.00 0.00 ? 6  THR A H    5  
ATOM 3258  H HA   . THR A 1 6  ? -2.769  -9.699  -1.747  1.00 0.00 ? 6  THR A HA   5  
ATOM 3259  H HB   . THR A 1 6  ? -4.897  -8.797  -2.129  1.00 0.00 ? 6  THR A HB   5  
ATOM 3260  H HG1  . THR A 1 6  ? -5.473  -10.830 -2.184  1.00 0.00 ? 6  THR A HG1  5  
ATOM 3261  H HG21 . THR A 1 6  ? -5.085  -7.540  -3.972  1.00 0.00 ? 6  THR A HG21 5  
ATOM 3262  H HG22 . THR A 1 6  ? -5.756  -9.014  -4.669  1.00 0.00 ? 6  THR A HG22 5  
ATOM 3263  H HG23 . THR A 1 6  ? -4.062  -8.603  -4.938  1.00 0.00 ? 6  THR A HG23 5  
ATOM 3264  N N    . GLU A 1 7  ? -3.162  -11.089 -4.695  1.00 0.00 ? 7  GLU A N    5  
ATOM 3265  C CA   . GLU A 1 7  ? -2.650  -12.170 -5.529  1.00 0.00 ? 7  GLU A CA   5  
ATOM 3266  C C    . GLU A 1 7  ? -3.640  -12.595 -6.621  1.00 0.00 ? 7  GLU A C    5  
ATOM 3267  O O    . GLU A 1 7  ? -3.244  -13.195 -7.619  1.00 0.00 ? 7  GLU A O    5  
ATOM 3268  C CB   . GLU A 1 7  ? -2.271  -13.365 -4.643  1.00 0.00 ? 7  GLU A CB   5  
ATOM 3269  C CG   . GLU A 1 7  ? -3.205  -14.561 -4.758  1.00 0.00 ? 7  GLU A CG   5  
ATOM 3270  C CD   . GLU A 1 7  ? -2.881  -15.443 -5.948  1.00 0.00 ? 7  GLU A CD   5  
ATOM 3271  O OE1  . GLU A 1 7  ? -1.758  -15.990 -5.991  1.00 0.00 ? 7  GLU A OE1  5  
ATOM 3272  O OE2  . GLU A 1 7  ? -3.748  -15.586 -6.835  1.00 0.00 ? 7  GLU A OE2  5  
ATOM 3273  H H    . GLU A 1 7  ? -4.042  -10.704 -4.901  1.00 0.00 ? 7  GLU A H    5  
ATOM 3274  H HA   . GLU A 1 7  ? -1.755  -11.806 -6.010  1.00 0.00 ? 7  GLU A HA   5  
ATOM 3275  H HB2  . GLU A 1 7  ? -1.277  -13.686 -4.906  1.00 0.00 ? 7  GLU A HB2  5  
ATOM 3276  H HB3  . GLU A 1 7  ? -2.269  -13.039 -3.612  1.00 0.00 ? 7  GLU A HB3  5  
ATOM 3277  H HG2  . GLU A 1 7  ? -3.124  -15.152 -3.858  1.00 0.00 ? 7  GLU A HG2  5  
ATOM 3278  H HG3  . GLU A 1 7  ? -4.218  -14.202 -4.860  1.00 0.00 ? 7  GLU A HG3  5  
ATOM 3279  N N    . PHE A 1 8  ? -4.925  -12.311 -6.419  1.00 0.00 ? 8  PHE A N    5  
ATOM 3280  C CA   . PHE A 1 8  ? -5.949  -12.703 -7.385  1.00 0.00 ? 8  PHE A CA   5  
ATOM 3281  C C    . PHE A 1 8  ? -6.317  -11.553 -8.313  1.00 0.00 ? 8  PHE A C    5  
ATOM 3282  O O    . PHE A 1 8  ? -5.693  -10.491 -8.284  1.00 0.00 ? 8  PHE A O    5  
ATOM 3283  C CB   . PHE A 1 8  ? -7.203  -13.193 -6.653  1.00 0.00 ? 8  PHE A CB   5  
ATOM 3284  C CG   . PHE A 1 8  ? -6.998  -14.465 -5.883  1.00 0.00 ? 8  PHE A CG   5  
ATOM 3285  C CD1  . PHE A 1 8  ? -7.149  -15.695 -6.504  1.00 0.00 ? 8  PHE A CD1  5  
ATOM 3286  C CD2  . PHE A 1 8  ? -6.661  -14.432 -4.540  1.00 0.00 ? 8  PHE A CD2  5  
ATOM 3287  C CE1  . PHE A 1 8  ? -6.966  -16.869 -5.798  1.00 0.00 ? 8  PHE A CE1  5  
ATOM 3288  C CE2  . PHE A 1 8  ? -6.477  -15.602 -3.829  1.00 0.00 ? 8  PHE A CE2  5  
ATOM 3289  C CZ   . PHE A 1 8  ? -6.630  -16.823 -4.459  1.00 0.00 ? 8  PHE A CZ   5  
ATOM 3290  H H    . PHE A 1 8  ? -5.195  -11.845 -5.599  1.00 0.00 ? 8  PHE A H    5  
ATOM 3291  H HA   . PHE A 1 8  ? -5.552  -13.514 -7.977  1.00 0.00 ? 8  PHE A HA   5  
ATOM 3292  H HB2  . PHE A 1 8  ? -7.523  -12.433 -5.957  1.00 0.00 ? 8  PHE A HB2  5  
ATOM 3293  H HB3  . PHE A 1 8  ? -7.987  -13.366 -7.374  1.00 0.00 ? 8  PHE A HB3  5  
ATOM 3294  H HD1  . PHE A 1 8  ? -7.411  -15.731 -7.551  1.00 0.00 ? 8  PHE A HD1  5  
ATOM 3295  H HD2  . PHE A 1 8  ? -6.542  -13.477 -4.048  1.00 0.00 ? 8  PHE A HD2  5  
ATOM 3296  H HE1  . PHE A 1 8  ? -7.088  -17.822 -6.292  1.00 0.00 ? 8  PHE A HE1  5  
ATOM 3297  H HE2  . PHE A 1 8  ? -6.213  -15.563 -2.782  1.00 0.00 ? 8  PHE A HE2  5  
ATOM 3298  H HZ   . PHE A 1 8  ? -6.487  -17.739 -3.905  1.00 0.00 ? 8  PHE A HZ   5  
ATOM 3299  N N    . ASN A 1 9  ? -7.346  -11.769 -9.128  1.00 0.00 ? 9  ASN A N    5  
ATOM 3300  C CA   . ASN A 1 9  ? -7.814  -10.750 -10.055 1.00 0.00 ? 9  ASN A CA   5  
ATOM 3301  C C    . ASN A 1 9  ? -8.452  -9.603  -9.280  1.00 0.00 ? 9  ASN A C    5  
ATOM 3302  O O    . ASN A 1 9  ? -8.063  -8.448  -9.443  1.00 0.00 ? 9  ASN A O    5  
ATOM 3303  C CB   . ASN A 1 9  ? -8.818  -11.345 -11.045 1.00 0.00 ? 9  ASN A CB   5  
ATOM 3304  C CG   . ASN A 1 9  ? -8.208  -11.587 -12.412 1.00 0.00 ? 9  ASN A CG   5  
ATOM 3305  O OD1  . ASN A 1 9  ? -8.412  -10.808 -13.343 1.00 0.00 ? 9  ASN A OD1  5  
ATOM 3306  N ND2  . ASN A 1 9  ? -7.453  -12.673 -12.539 1.00 0.00 ? 9  ASN A ND2  5  
ATOM 3307  H H    . ASN A 1 9  ? -7.806  -12.633 -9.099  1.00 0.00 ? 9  ASN A H    5  
ATOM 3308  H HA   . ASN A 1 9  ? -6.959  -10.374 -10.597 1.00 0.00 ? 9  ASN A HA   5  
ATOM 3309  H HB2  . ASN A 1 9  ? -9.178  -12.288 -10.660 1.00 0.00 ? 9  ASN A HB2  5  
ATOM 3310  H HB3  . ASN A 1 9  ? -9.651  -10.666 -11.158 1.00 0.00 ? 9  ASN A HB3  5  
ATOM 3311  H HD21 . ASN A 1 9  ? -7.335  -13.248 -11.754 1.00 0.00 ? 9  ASN A HD21 5  
ATOM 3312  H HD22 . ASN A 1 9  ? -7.047  -12.854 -13.411 1.00 0.00 ? 9  ASN A HD22 5  
ATOM 3313  N N    . PRO A 1 10 ? -9.430  -9.906  -8.403  1.00 0.00 ? 10 PRO A N    5  
ATOM 3314  C CA   . PRO A 1 10 ? -10.087 -8.884  -7.592  1.00 0.00 ? 10 PRO A CA   5  
ATOM 3315  C C    . PRO A 1 10 ? -9.124  -8.294  -6.569  1.00 0.00 ? 10 PRO A C    5  
ATOM 3316  O O    . PRO A 1 10 ? -9.235  -8.549  -5.371  1.00 0.00 ? 10 PRO A O    5  
ATOM 3317  C CB   . PRO A 1 10 ? -11.226 -9.637  -6.900  1.00 0.00 ? 10 PRO A CB   5  
ATOM 3318  C CG   . PRO A 1 10 ? -10.795 -11.062 -6.889  1.00 0.00 ? 10 PRO A CG   5  
ATOM 3319  C CD   . PRO A 1 10 ? -9.953  -11.258 -8.121  1.00 0.00 ? 10 PRO A CD   5  
ATOM 3320  H HA   . PRO A 1 10 ? -10.491 -8.092  -8.205  1.00 0.00 ? 10 PRO A HA   5  
ATOM 3321  H HB2  . PRO A 1 10 ? -11.355 -9.256  -5.897  1.00 0.00 ? 10 PRO A HB2  5  
ATOM 3322  H HB3  . PRO A 1 10 ? -12.140 -9.506  -7.460  1.00 0.00 ? 10 PRO A HB3  5  
ATOM 3323  H HG2  . PRO A 1 10 ? -10.213 -11.262 -6.003  1.00 0.00 ? 10 PRO A HG2  5  
ATOM 3324  H HG3  . PRO A 1 10 ? -11.661 -11.706 -6.923  1.00 0.00 ? 10 PRO A HG3  5  
ATOM 3325  H HD2  . PRO A 1 10 ? -9.152  -11.947 -7.915  1.00 0.00 ? 10 PRO A HD2  5  
ATOM 3326  H HD3  . PRO A 1 10 ? -10.560 -11.614 -8.940  1.00 0.00 ? 10 PRO A HD3  5  
ATOM 3327  N N    . LEU A 1 11 ? -8.171  -7.516  -7.071  1.00 0.00 ? 11 LEU A N    5  
ATOM 3328  C CA   . LEU A 1 11 ? -7.154  -6.868  -6.246  1.00 0.00 ? 11 LEU A CA   5  
ATOM 3329  C C    . LEU A 1 11 ? -7.769  -6.105  -5.089  1.00 0.00 ? 11 LEU A C    5  
ATOM 3330  O O    . LEU A 1 11 ? -8.892  -6.387  -4.684  1.00 0.00 ? 11 LEU A O    5  
ATOM 3331  C CB   . LEU A 1 11 ? -6.276  -5.962  -7.123  1.00 0.00 ? 11 LEU A CB   5  
ATOM 3332  C CG   . LEU A 1 11 ? -7.013  -5.080  -8.145  1.00 0.00 ? 11 LEU A CG   5  
ATOM 3333  C CD1  . LEU A 1 11 ? -7.174  -5.812  -9.469  1.00 0.00 ? 11 LEU A CD1  5  
ATOM 3334  C CD2  . LEU A 1 11 ? -8.366  -4.630  -7.611  1.00 0.00 ? 11 LEU A CD2  5  
ATOM 3335  H H    . LEU A 1 11 ? -8.148  -7.374  -8.039  1.00 0.00 ? 11 LEU A H    5  
ATOM 3336  H HA   . LEU A 1 11 ? -6.529  -7.624  -5.817  1.00 0.00 ? 11 LEU A HA   5  
ATOM 3337  H HB2  . LEU A 1 11 ? -5.698  -5.322  -6.478  1.00 0.00 ? 11 LEU A HB2  5  
ATOM 3338  H HB3  . LEU A 1 11 ? -5.590  -6.599  -7.665  1.00 0.00 ? 11 LEU A HB3  5  
ATOM 3339  H HG   . LEU A 1 11 ? -6.421  -4.197  -8.334  1.00 0.00 ? 11 LEU A HG   5  
ATOM 3340  H HD11 . LEU A 1 11 ? -6.533  -6.681  -9.482  1.00 0.00 ? 11 LEU A HD11 5  
ATOM 3341  H HD12 . LEU A 1 11 ? -6.901  -5.153  -10.280 1.00 0.00 ? 11 LEU A HD12 5  
ATOM 3342  H HD13 . LEU A 1 11 ? -8.202  -6.121  -9.588  1.00 0.00 ? 11 LEU A HD13 5  
ATOM 3343  H HD21 . LEU A 1 11 ? -8.773  -3.867  -8.258  1.00 0.00 ? 11 LEU A HD21 5  
ATOM 3344  H HD22 . LEU A 1 11 ? -8.245  -4.229  -6.615  1.00 0.00 ? 11 LEU A HD22 5  
ATOM 3345  H HD23 . LEU A 1 11 ? -9.041  -5.472  -7.580  1.00 0.00 ? 11 LEU A HD23 5  
ATOM 3346  N N    . CYS A 1 12 ? -6.997  -5.173  -4.541  1.00 0.00 ? 12 CYS A N    5  
ATOM 3347  C CA   . CYS A 1 12 ? -7.398  -4.376  -3.379  1.00 0.00 ? 12 CYS A CA   5  
ATOM 3348  C C    . CYS A 1 12 ? -8.893  -4.443  -3.115  1.00 0.00 ? 12 CYS A C    5  
ATOM 3349  O O    . CYS A 1 12 ? -9.629  -3.468  -3.264  1.00 0.00 ? 12 CYS A O    5  
ATOM 3350  C CB   . CYS A 1 12 ? -6.986  -2.924  -3.571  1.00 0.00 ? 12 CYS A CB   5  
ATOM 3351  S SG   . CYS A 1 12 ? -7.872  -2.067  -4.919  1.00 0.00 ? 12 CYS A SG   5  
ATOM 3352  H H    . CYS A 1 12 ? -6.100  -5.053  -4.898  1.00 0.00 ? 12 CYS A H    5  
ATOM 3353  H HA   . CYS A 1 12 ? -6.880  -4.770  -2.519  1.00 0.00 ? 12 CYS A HA   5  
ATOM 3354  H HB2  . CYS A 1 12 ? -7.178  -2.387  -2.657  1.00 0.00 ? 12 CYS A HB2  5  
ATOM 3355  H HB3  . CYS A 1 12 ? -5.931  -2.885  -3.788  1.00 0.00 ? 12 CYS A HB3  5  
ATOM 3356  N N    . ARG A 1 13 ? -9.310  -5.616  -2.684  1.00 0.00 ? 13 ARG A N    5  
ATOM 3357  C CA   . ARG A 1 13 ? -10.703 -5.863  -2.343  1.00 0.00 ? 13 ARG A CA   5  
ATOM 3358  C C    . ARG A 1 13 ? -10.876 -5.711  -0.841  1.00 0.00 ? 13 ARG A C    5  
ATOM 3359  O O    . ARG A 1 13 ? -11.694 -6.387  -0.217  1.00 0.00 ? 13 ARG A O    5  
ATOM 3360  C CB   . ARG A 1 13 ? -11.132 -7.263  -2.792  1.00 0.00 ? 13 ARG A CB   5  
ATOM 3361  C CG   . ARG A 1 13 ? -10.382 -8.386  -2.094  1.00 0.00 ? 13 ARG A CG   5  
ATOM 3362  C CD   . ARG A 1 13 ? -10.475 -9.686  -2.877  1.00 0.00 ? 13 ARG A CD   5  
ATOM 3363  N NE   . ARG A 1 13 ? -10.483 -10.856 -2.001  1.00 0.00 ? 13 ARG A NE   5  
ATOM 3364  C CZ   . ARG A 1 13 ? -9.386  -11.388 -1.464  1.00 0.00 ? 13 ARG A CZ   5  
ATOM 3365  N NH1  . ARG A 1 13 ? -8.194  -10.856 -1.707  1.00 0.00 ? 13 ARG A NH1  5  
ATOM 3366  N NH2  . ARG A 1 13 ? -9.482  -12.455 -0.683  1.00 0.00 ? 13 ARG A NH2  5  
ATOM 3367  H H    . ARG A 1 13 ? -8.646  -6.333  -2.569  1.00 0.00 ? 13 ARG A H    5  
ATOM 3368  H HA   . ARG A 1 13 ? -11.309 -5.123  -2.846  1.00 0.00 ? 13 ARG A HA   5  
ATOM 3369  H HB2  . ARG A 1 13 ? -12.187 -7.385  -2.592  1.00 0.00 ? 13 ARG A HB2  5  
ATOM 3370  H HB3  . ARG A 1 13 ? -10.965 -7.354  -3.855  1.00 0.00 ? 13 ARG A HB3  5  
ATOM 3371  H HG2  . ARG A 1 13 ? -9.343  -8.108  -1.999  1.00 0.00 ? 13 ARG A HG2  5  
ATOM 3372  H HG3  . ARG A 1 13 ? -10.808 -8.536  -1.113  1.00 0.00 ? 13 ARG A HG3  5  
ATOM 3373  H HD2  . ARG A 1 13 ? -11.385 -9.678  -3.457  1.00 0.00 ? 13 ARG A HD2  5  
ATOM 3374  H HD3  . ARG A 1 13 ? -9.627  -9.752  -3.542  1.00 0.00 ? 13 ARG A HD3  5  
ATOM 3375  H HE   . ARG A 1 13 ? -11.350 -11.267 -1.803  1.00 0.00 ? 13 ARG A HE   5  
ATOM 3376  H HH11 . ARG A 1 13 ? -8.115  -10.050 -2.294  1.00 0.00 ? 13 ARG A HH11 5  
ATOM 3377  H HH12 . ARG A 1 13 ? -7.374  -11.260 -1.300  1.00 0.00 ? 13 ARG A HH12 5  
ATOM 3378  H HH21 . ARG A 1 13 ? -10.376 -12.860 -0.497  1.00 0.00 ? 13 ARG A HH21 5  
ATOM 3379  H HH22 . ARG A 1 13 ? -8.657  -12.856 -0.280  1.00 0.00 ? 13 ARG A HH22 5  
ATOM 3380  N N    . CYS A 1 14 ? -10.069 -4.823  -0.272  1.00 0.00 ? 14 CYS A N    5  
ATOM 3381  C CA   . CYS A 1 14 ? -10.078 -4.563  1.153   1.00 0.00 ? 14 CYS A CA   5  
ATOM 3382  C C    . CYS A 1 14 ? -10.378 -3.091  1.424   1.00 0.00 ? 14 CYS A C    5  
ATOM 3383  O O    . CYS A 1 14 ? -9.484  -2.247  1.376   1.00 0.00 ? 14 CYS A O    5  
ATOM 3384  C CB   . CYS A 1 14 ? -8.722  -4.941  1.759   1.00 0.00 ? 14 CYS A CB   5  
ATOM 3385  S SG   . CYS A 1 14 ? -7.692  -6.038  0.724   1.00 0.00 ? 14 CYS A SG   5  
ATOM 3386  H H    . CYS A 1 14 ? -9.433  -4.334  -0.832  1.00 0.00 ? 14 CYS A H    5  
ATOM 3387  H HA   . CYS A 1 14 ? -10.849 -5.169  1.602   1.00 0.00 ? 14 CYS A HA   5  
ATOM 3388  H HB2  . CYS A 1 14 ? -8.155  -4.042  1.931   1.00 0.00 ? 14 CYS A HB2  5  
ATOM 3389  H HB3  . CYS A 1 14 ? -8.889  -5.443  2.698   1.00 0.00 ? 14 CYS A HB3  5  
ATOM 3390  N N    . ASN A 1 15 ? -11.640 -2.793  1.703   1.00 0.00 ? 15 ASN A N    5  
ATOM 3391  C CA   . ASN A 1 15 ? -12.064 -1.422  1.976   1.00 0.00 ? 15 ASN A CA   5  
ATOM 3392  C C    . ASN A 1 15 ? -12.021 -1.143  3.455   1.00 0.00 ? 15 ASN A C    5  
ATOM 3393  O O    . ASN A 1 15 ? -11.759 -0.018  3.872   1.00 0.00 ? 15 ASN A O    5  
ATOM 3394  C CB   . ASN A 1 15 ? -13.486 -1.207  1.501   1.00 0.00 ? 15 ASN A CB   5  
ATOM 3395  C CG   . ASN A 1 15 ? -13.584 -0.139  0.431   1.00 0.00 ? 15 ASN A CG   5  
ATOM 3396  O OD1  . ASN A 1 15 ? -14.291 -0.300  -0.564  1.00 0.00 ? 15 ASN A OD1  5  
ATOM 3397  N ND2  . ASN A 1 15 ? -12.869 0.963   0.633   1.00 0.00 ? 15 ASN A ND2  5  
ATOM 3398  H H    . ASN A 1 15 ? -12.306 -3.511  1.722   1.00 0.00 ? 15 ASN A H    5  
ATOM 3399  H HA   . ASN A 1 15 ? -11.403 -0.745  1.458   1.00 0.00 ? 15 ASN A HA   5  
ATOM 3400  H HB2  . ASN A 1 15 ? -13.855 -2.132  1.124   1.00 0.00 ? 15 ASN A HB2  5  
ATOM 3401  H HB3  . ASN A 1 15 ? -14.096 -0.904  2.340   1.00 0.00 ? 15 ASN A HB3  5  
ATOM 3402  H HD21 . ASN A 1 15 ? -12.327 1.020   1.450   1.00 0.00 ? 15 ASN A HD21 5  
ATOM 3403  H HD22 . ASN A 1 15 ? -12.909 1.673   -0.040  1.00 0.00 ? 15 ASN A HD22 5  
ATOM 3404  N N    . LYS A 1 16 ? -12.316 -2.174  4.233   1.00 0.00 ? 16 LYS A N    5  
ATOM 3405  C CA   . LYS A 1 16 ? -12.348 -2.082  5.689   1.00 0.00 ? 16 LYS A CA   5  
ATOM 3406  C C    . LYS A 1 16 ? -11.067 -1.468  6.240   1.00 0.00 ? 16 LYS A C    5  
ATOM 3407  O O    . LYS A 1 16 ? -10.390 -2.059  7.081   1.00 0.00 ? 16 LYS A O    5  
ATOM 3408  C CB   . LYS A 1 16 ? -12.575 -3.467  6.303   1.00 0.00 ? 16 LYS A CB   5  
ATOM 3409  C CG   . LYS A 1 16 ? -11.374 -4.396  6.183   1.00 0.00 ? 16 LYS A CG   5  
ATOM 3410  C CD   . LYS A 1 16 ? -11.696 -5.625  5.347   1.00 0.00 ? 16 LYS A CD   5  
ATOM 3411  C CE   . LYS A 1 16 ? -11.029 -6.874  5.905   1.00 0.00 ? 16 LYS A CE   5  
ATOM 3412  N NZ   . LYS A 1 16 ? -12.027 -7.868  6.388   1.00 0.00 ? 16 LYS A NZ   5  
ATOM 3413  H H    . LYS A 1 16 ? -12.540 -3.022  3.808   1.00 0.00 ? 16 LYS A H    5  
ATOM 3414  H HA   . LYS A 1 16 ? -13.172 -1.441  5.954   1.00 0.00 ? 16 LYS A HA   5  
ATOM 3415  H HB2  . LYS A 1 16 ? -12.807 -3.350  7.352   1.00 0.00 ? 16 LYS A HB2  5  
ATOM 3416  H HB3  . LYS A 1 16 ? -13.415 -3.933  5.809   1.00 0.00 ? 16 LYS A HB3  5  
ATOM 3417  H HG2  . LYS A 1 16 ? -10.561 -3.858  5.714   1.00 0.00 ? 16 LYS A HG2  5  
ATOM 3418  H HG3  . LYS A 1 16 ? -11.074 -4.711  7.173   1.00 0.00 ? 16 LYS A HG3  5  
ATOM 3419  H HD2  . LYS A 1 16 ? -12.766 -5.775  5.341   1.00 0.00 ? 16 LYS A HD2  5  
ATOM 3420  H HD3  . LYS A 1 16 ? -11.348 -5.463  4.338   1.00 0.00 ? 16 LYS A HD3  5  
ATOM 3421  H HE2  . LYS A 1 16 ? -10.434 -7.327  5.125   1.00 0.00 ? 16 LYS A HE2  5  
ATOM 3422  H HE3  . LYS A 1 16 ? -10.389 -6.590  6.727   1.00 0.00 ? 16 LYS A HE3  5  
ATOM 3423  H HZ1  . LYS A 1 16 ? -11.625 -8.827  6.350   1.00 0.00 ? 16 LYS A HZ1  5  
ATOM 3424  H HZ2  . LYS A 1 16 ? -12.879 -7.837  5.795   1.00 0.00 ? 16 LYS A HZ2  5  
ATOM 3425  H HZ3  . LYS A 1 16 ? -12.296 -7.656  7.371   1.00 0.00 ? 16 LYS A HZ3  5  
ATOM 3426  N N    . MET A 1 17 ? -10.753 -0.279  5.755   1.00 0.00 ? 17 MET A N    5  
ATOM 3427  C CA   . MET A 1 17 ? -9.558  0.447   6.181   1.00 0.00 ? 17 MET A CA   5  
ATOM 3428  C C    . MET A 1 17 ? -9.388  0.396   7.693   1.00 0.00 ? 17 MET A C    5  
ATOM 3429  O O    . MET A 1 17 ? -9.878  1.262   8.419   1.00 0.00 ? 17 MET A O    5  
ATOM 3430  C CB   . MET A 1 17 ? -9.621  1.902   5.724   1.00 0.00 ? 17 MET A CB   5  
ATOM 3431  C CG   . MET A 1 17 ? -11.019 2.499   5.767   1.00 0.00 ? 17 MET A CG   5  
ATOM 3432  S SD   . MET A 1 17 ? -11.003 4.298   5.903   1.00 0.00 ? 17 MET A SD   5  
ATOM 3433  C CE   . MET A 1 17 ? -9.726  4.717   4.721   1.00 0.00 ? 17 MET A CE   5  
ATOM 3434  H H    . MET A 1 17 ? -11.347 0.121   5.079   1.00 0.00 ? 17 MET A H    5  
ATOM 3435  H HA   . MET A 1 17 ? -8.704  -0.026  5.720   1.00 0.00 ? 17 MET A HA   5  
ATOM 3436  H HB2  . MET A 1 17 ? -8.982  2.488   6.365   1.00 0.00 ? 17 MET A HB2  5  
ATOM 3437  H HB3  . MET A 1 17 ? -9.256  1.962   4.714   1.00 0.00 ? 17 MET A HB3  5  
ATOM 3438  H HG2  . MET A 1 17 ? -11.539 2.227   4.861   1.00 0.00 ? 17 MET A HG2  5  
ATOM 3439  H HG3  . MET A 1 17 ? -11.544 2.092   6.618   1.00 0.00 ? 17 MET A HG3  5  
ATOM 3440  H HE1  . MET A 1 17 ? -8.760  4.669   5.202   1.00 0.00 ? 17 MET A HE1  5  
ATOM 3441  H HE2  . MET A 1 17 ? -9.893  5.718   4.349   1.00 0.00 ? 17 MET A HE2  5  
ATOM 3442  H HE3  . MET A 1 17 ? -9.754  4.019   3.898   1.00 0.00 ? 17 MET A HE3  5  
ATOM 3443  N N    . LEU A 1 18 ? -8.690  -0.626  8.153   1.00 0.00 ? 18 LEU A N    5  
ATOM 3444  C CA   . LEU A 1 18 ? -8.439  -0.813  9.573   1.00 0.00 ? 18 LEU A CA   5  
ATOM 3445  C C    . LEU A 1 18 ? -7.424  -1.924  9.793   1.00 0.00 ? 18 LEU A C    5  
ATOM 3446  O O    . LEU A 1 18 ? -7.655  -2.862  10.556  1.00 0.00 ? 18 LEU A O    5  
ATOM 3447  C CB   . LEU A 1 18 ? -9.745  -1.125  10.306  1.00 0.00 ? 18 LEU A CB   5  
ATOM 3448  C CG   . LEU A 1 18 ? -10.321 -2.522  10.046  1.00 0.00 ? 18 LEU A CG   5  
ATOM 3449  C CD1  . LEU A 1 18 ? -10.227 -3.380  11.299  1.00 0.00 ? 18 LEU A CD1  5  
ATOM 3450  C CD2  . LEU A 1 18 ? -11.764 -2.427  9.573   1.00 0.00 ? 18 LEU A CD2  5  
ATOM 3451  H H    . LEU A 1 18 ? -8.330  -1.272  7.517   1.00 0.00 ? 18 LEU A H    5  
ATOM 3452  H HA   . LEU A 1 18 ? -8.025  0.104   9.956   1.00 0.00 ? 18 LEU A HA   5  
ATOM 3453  H HB2  . LEU A 1 18 ? -9.571  -1.019  11.366  1.00 0.00 ? 18 LEU A HB2  5  
ATOM 3454  H HB3  . LEU A 1 18 ? -10.481 -0.395  10.004  1.00 0.00 ? 18 LEU A HB3  5  
ATOM 3455  H HG   . LEU A 1 18 ? -9.744  -3.003  9.270   1.00 0.00 ? 18 LEU A HG   5  
ATOM 3456  H HD11 . LEU A 1 18 ? -11.178 -3.376  11.812  1.00 0.00 ? 18 LEU A HD11 5  
ATOM 3457  H HD12 . LEU A 1 18 ? -9.464  -2.982  11.951  1.00 0.00 ? 18 LEU A HD12 5  
ATOM 3458  H HD13 . LEU A 1 18 ? -9.970  -4.393  11.023  1.00 0.00 ? 18 LEU A HD13 5  
ATOM 3459  H HD21 . LEU A 1 18 ? -12.394 -2.123  10.395  1.00 0.00 ? 18 LEU A HD21 5  
ATOM 3460  H HD22 . LEU A 1 18 ? -12.088 -3.391  9.209   1.00 0.00 ? 18 LEU A HD22 5  
ATOM 3461  H HD23 . LEU A 1 18 ? -11.835 -1.701  8.776   1.00 0.00 ? 18 LEU A HD23 5  
ATOM 3462  N N    . GLY A 1 19 ? -6.299  -1.802  9.111   1.00 0.00 ? 19 GLY A N    5  
ATOM 3463  C CA   . GLY A 1 19 ? -5.244  -2.792  9.225   1.00 0.00 ? 19 GLY A CA   5  
ATOM 3464  C C    . GLY A 1 19 ? -3.922  -2.186  9.651   1.00 0.00 ? 19 GLY A C    5  
ATOM 3465  O O    . GLY A 1 19 ? -3.886  -1.278  10.480  1.00 0.00 ? 19 GLY A O    5  
ATOM 3466  H H    . GLY A 1 19 ? -6.185  -1.029  8.522   1.00 0.00 ? 19 GLY A H    5  
ATOM 3467  H HA2  . GLY A 1 19 ? -5.539  -3.534  9.952   1.00 0.00 ? 19 GLY A HA2  5  
ATOM 3468  H HA3  . GLY A 1 19 ? -5.113  -3.274  8.267   1.00 0.00 ? 19 GLY A HA3  5  
ATOM 3469  N N    . ASP A 1 20 ? -2.833  -2.696  9.085   1.00 0.00 ? 20 ASP A N    5  
ATOM 3470  C CA   . ASP A 1 20 ? -1.502  -2.211  9.408   1.00 0.00 ? 20 ASP A CA   5  
ATOM 3471  C C    . ASP A 1 20 ? -1.273  -0.809  8.868   1.00 0.00 ? 20 ASP A C    5  
ATOM 3472  O O    . ASP A 1 20 ? -2.150  -0.211  8.244   1.00 0.00 ? 20 ASP A O    5  
ATOM 3473  C CB   . ASP A 1 20 ? -0.449  -3.151  8.828   1.00 0.00 ? 20 ASP A CB   5  
ATOM 3474  C CG   . ASP A 1 20 ? -0.733  -4.607  9.142   1.00 0.00 ? 20 ASP A CG   5  
ATOM 3475  O OD1  . ASP A 1 20 ? -1.153  -4.898  10.283  1.00 0.00 ? 20 ASP A OD1  5  
ATOM 3476  O OD2  . ASP A 1 20 ? -0.533  -5.457  8.250   1.00 0.00 ? 20 ASP A OD2  5  
ATOM 3477  H H    . ASP A 1 20 ? -2.926  -3.420  8.434   1.00 0.00 ? 20 ASP A H    5  
ATOM 3478  H HA   . ASP A 1 20 ? -1.402  -2.190  10.480  1.00 0.00 ? 20 ASP A HA   5  
ATOM 3479  H HB2  . ASP A 1 20 ? -0.421  -3.031  7.757   1.00 0.00 ? 20 ASP A HB2  5  
ATOM 3480  H HB3  . ASP A 1 20 ? 0.511   -2.894  9.236   1.00 0.00 ? 20 ASP A HB3  5  
ATOM 3481  N N    . LEU A 1 21 ? -0.076  -0.302  9.115   1.00 0.00 ? 21 LEU A N    5  
ATOM 3482  C CA   . LEU A 1 21 ? 0.313   1.021   8.664   1.00 0.00 ? 21 LEU A CA   5  
ATOM 3483  C C    . LEU A 1 21 ? 1.580   0.933   7.814   1.00 0.00 ? 21 LEU A C    5  
ATOM 3484  O O    . LEU A 1 21 ? 2.687   0.754   8.323   1.00 0.00 ? 21 LEU A O    5  
ATOM 3485  C CB   . LEU A 1 21 ? 0.487   1.953   9.874   1.00 0.00 ? 21 LEU A CB   5  
ATOM 3486  C CG   . LEU A 1 21 ? 1.918   2.172   10.378  1.00 0.00 ? 21 LEU A CG   5  
ATOM 3487  C CD1  . LEU A 1 21 ? 2.650   3.168   9.491   1.00 0.00 ? 21 LEU A CD1  5  
ATOM 3488  C CD2  . LEU A 1 21 ? 1.903   2.653   11.822  1.00 0.00 ? 21 LEU A CD2  5  
ATOM 3489  H H    . LEU A 1 21 ? 0.568   -0.839  9.613   1.00 0.00 ? 21 LEU A H    5  
ATOM 3490  H HA   . LEU A 1 21 ? -0.485  1.404   8.042   1.00 0.00 ? 21 LEU A HA   5  
ATOM 3491  H HB2  . LEU A 1 21 ? 0.073   2.914   9.617   1.00 0.00 ? 21 LEU A HB2  5  
ATOM 3492  H HB3  . LEU A 1 21 ? -0.092  1.542   10.689  1.00 0.00 ? 21 LEU A HB3  5  
ATOM 3493  H HG   . LEU A 1 21 ? 2.453   1.235   10.344  1.00 0.00 ? 21 LEU A HG   5  
ATOM 3494  H HD11 . LEU A 1 21 ? 2.170   3.210   8.525   1.00 0.00 ? 21 LEU A HD11 5  
ATOM 3495  H HD12 . LEU A 1 21 ? 3.675   2.855   9.368   1.00 0.00 ? 21 LEU A HD12 5  
ATOM 3496  H HD13 . LEU A 1 21 ? 2.624   4.145   9.948   1.00 0.00 ? 21 LEU A HD13 5  
ATOM 3497  H HD21 . LEU A 1 21 ? 0.896   2.602   12.209  1.00 0.00 ? 21 LEU A HD21 5  
ATOM 3498  H HD22 . LEU A 1 21 ? 2.253   3.673   11.866  1.00 0.00 ? 21 LEU A HD22 5  
ATOM 3499  H HD23 . LEU A 1 21 ? 2.549   2.024   12.416  1.00 0.00 ? 21 LEU A HD23 5  
ATOM 3500  N N    . ILE A 1 22 ? 1.397   1.032   6.508   1.00 0.00 ? 22 ILE A N    5  
ATOM 3501  C CA   . ILE A 1 22 ? 2.500   0.946   5.568   1.00 0.00 ? 22 ILE A CA   5  
ATOM 3502  C C    . ILE A 1 22 ? 3.100   2.324   5.294   1.00 0.00 ? 22 ILE A C    5  
ATOM 3503  O O    . ILE A 1 22 ? 2.422   3.343   5.419   1.00 0.00 ? 22 ILE A O    5  
ATOM 3504  C CB   . ILE A 1 22 ? 2.038   0.280   4.246   1.00 0.00 ? 22 ILE A CB   5  
ATOM 3505  C CG1  . ILE A 1 22 ? 2.935   0.643   3.082   1.00 0.00 ? 22 ILE A CG1  5  
ATOM 3506  C CG2  . ILE A 1 22 ? 0.618   0.658   3.899   1.00 0.00 ? 22 ILE A CG2  5  
ATOM 3507  C CD1  . ILE A 1 22 ? 2.486   1.893   2.347   1.00 0.00 ? 22 ILE A CD1  5  
ATOM 3508  H H    . ILE A 1 22 ? 0.493   1.146   6.164   1.00 0.00 ? 22 ILE A H    5  
ATOM 3509  H HA   . ILE A 1 22 ? 3.261   0.321   6.010   1.00 0.00 ? 22 ILE A HA   5  
ATOM 3510  H HB   . ILE A 1 22 ? 2.066   -0.780  4.388   1.00 0.00 ? 22 ILE A HB   5  
ATOM 3511  H HG12 . ILE A 1 22 ? 3.938   0.800   3.439   1.00 0.00 ? 22 ILE A HG12 5  
ATOM 3512  H HG13 . ILE A 1 22 ? 2.929   -0.175  2.377   1.00 0.00 ? 22 ILE A HG13 5  
ATOM 3513  H HG21 . ILE A 1 22 ? -0.056  0.229   4.619   1.00 0.00 ? 22 ILE A HG21 5  
ATOM 3514  H HG22 . ILE A 1 22 ? 0.385   0.285   2.913   1.00 0.00 ? 22 ILE A HG22 5  
ATOM 3515  H HG23 . ILE A 1 22 ? 0.529   1.733   3.907   1.00 0.00 ? 22 ILE A HG23 5  
ATOM 3516  H HD11 . ILE A 1 22 ? 1.692   1.638   1.660   1.00 0.00 ? 22 ILE A HD11 5  
ATOM 3517  H HD12 . ILE A 1 22 ? 3.315   2.309   1.801   1.00 0.00 ? 22 ILE A HD12 5  
ATOM 3518  H HD13 . ILE A 1 22 ? 2.123   2.619   3.060   1.00 0.00 ? 22 ILE A HD13 5  
ATOM 3519  N N    . CYS A 1 23 ? 4.377   2.343   4.917   1.00 0.00 ? 23 CYS A N    5  
ATOM 3520  C CA   . CYS A 1 23 ? 5.068   3.591   4.619   1.00 0.00 ? 23 CYS A CA   5  
ATOM 3521  C C    . CYS A 1 23 ? 5.429   3.642   3.144   1.00 0.00 ? 23 CYS A C    5  
ATOM 3522  O O    . CYS A 1 23 ? 6.524   3.241   2.748   1.00 0.00 ? 23 CYS A O    5  
ATOM 3523  C CB   . CYS A 1 23 ? 6.328   3.720   5.477   1.00 0.00 ? 23 CYS A CB   5  
ATOM 3524  S SG   . CYS A 1 23 ? 6.612   5.395   6.139   1.00 0.00 ? 23 CYS A SG   5  
ATOM 3525  H H    . CYS A 1 23 ? 4.866   1.493   4.825   1.00 0.00 ? 23 CYS A H    5  
ATOM 3526  H HA   . CYS A 1 23 ? 4.397   4.406   4.846   1.00 0.00 ? 23 CYS A HA   5  
ATOM 3527  H HB2  . CYS A 1 23 ? 6.252   3.045   6.314   1.00 0.00 ? 23 CYS A HB2  5  
ATOM 3528  H HB3  . CYS A 1 23 ? 7.189   3.451   4.882   1.00 0.00 ? 23 CYS A HB3  5  
ATOM 3529  N N    . ALA A 1 24 ? 4.494   4.116   2.332   1.00 0.00 ? 24 ALA A N    5  
ATOM 3530  C CA   . ALA A 1 24 ? 4.709   4.193   0.898   1.00 0.00 ? 24 ALA A CA   5  
ATOM 3531  C C    . ALA A 1 24 ? 5.540   5.411   0.516   1.00 0.00 ? 24 ALA A C    5  
ATOM 3532  O O    . ALA A 1 24 ? 5.318   6.515   1.014   1.00 0.00 ? 24 ALA A O    5  
ATOM 3533  C CB   . ALA A 1 24 ? 3.376   4.213   0.164   1.00 0.00 ? 24 ALA A CB   5  
ATOM 3534  H H    . ALA A 1 24 ? 3.634   4.405   2.705   1.00 0.00 ? 24 ALA A H    5  
ATOM 3535  H HA   . ALA A 1 24 ? 5.240   3.300   0.600   1.00 0.00 ? 24 ALA A HA   5  
ATOM 3536  H HB1  . ALA A 1 24 ? 3.481   4.770   -0.755  1.00 0.00 ? 24 ALA A HB1  5  
ATOM 3537  H HB2  . ALA A 1 24 ? 2.630   4.683   0.787   1.00 0.00 ? 24 ALA A HB2  5  
ATOM 3538  H HB3  . ALA A 1 24 ? 3.073   3.201   -0.061  1.00 0.00 ? 24 ALA A HB3  5  
ATOM 3539  N N    . VAL A 1 25 ? 6.493   5.195   -0.380  1.00 0.00 ? 25 VAL A N    5  
ATOM 3540  C CA   . VAL A 1 25 ? 7.369   6.261   -0.855  1.00 0.00 ? 25 VAL A CA   5  
ATOM 3541  C C    . VAL A 1 25 ? 7.413   6.278   -2.378  1.00 0.00 ? 25 VAL A C    5  
ATOM 3542  O O    . VAL A 1 25 ? 7.506   5.227   -3.018  1.00 0.00 ? 25 VAL A O    5  
ATOM 3543  C CB   . VAL A 1 25 ? 8.803   6.102   -0.316  1.00 0.00 ? 25 VAL A CB   5  
ATOM 3544  C CG1  . VAL A 1 25 ? 9.585   7.395   -0.494  1.00 0.00 ? 25 VAL A CG1  5  
ATOM 3545  C CG2  . VAL A 1 25 ? 8.786   5.676   1.145   1.00 0.00 ? 25 VAL A CG2  5  
ATOM 3546  H H    . VAL A 1 25 ? 6.607   4.291   -0.737  1.00 0.00 ? 25 VAL A H    5  
ATOM 3547  H HA   . VAL A 1 25 ? 6.974   7.206   -0.508  1.00 0.00 ? 25 VAL A HA   5  
ATOM 3548  H HB   . VAL A 1 25 ? 9.297   5.330   -0.888  1.00 0.00 ? 25 VAL A HB   5  
ATOM 3549  H HG11 . VAL A 1 25 ? 9.958   7.454   -1.506  1.00 0.00 ? 25 VAL A HG11 5  
ATOM 3550  H HG12 . VAL A 1 25 ? 10.414  7.413   0.198   1.00 0.00 ? 25 VAL A HG12 5  
ATOM 3551  H HG13 . VAL A 1 25 ? 8.936   8.237   -0.301  1.00 0.00 ? 25 VAL A HG13 5  
ATOM 3552  H HG21 . VAL A 1 25 ? 9.018   4.623   1.216   1.00 0.00 ? 25 VAL A HG21 5  
ATOM 3553  H HG22 . VAL A 1 25 ? 7.806   5.856   1.563   1.00 0.00 ? 25 VAL A HG22 5  
ATOM 3554  H HG23 . VAL A 1 25 ? 9.522   6.244   1.696   1.00 0.00 ? 25 VAL A HG23 5  
ATOM 3555  N N    . ILE A 1 26 ? 7.337   7.473   -2.954  1.00 0.00 ? 26 ILE A N    5  
ATOM 3556  C CA   . ILE A 1 26 ? 7.364   7.616   -4.406  1.00 0.00 ? 26 ILE A CA   5  
ATOM 3557  C C    . ILE A 1 26 ? 8.277   8.757   -4.846  1.00 0.00 ? 26 ILE A C    5  
ATOM 3558  O O    . ILE A 1 26 ? 7.835   9.891   -5.027  1.00 0.00 ? 26 ILE A O    5  
ATOM 3559  C CB   . ILE A 1 26 ? 5.955   7.851   -4.997  1.00 0.00 ? 26 ILE A CB   5  
ATOM 3560  C CG1  . ILE A 1 26 ? 4.973   8.313   -3.911  1.00 0.00 ? 26 ILE A CG1  5  
ATOM 3561  C CG2  . ILE A 1 26 ? 5.449   6.591   -5.690  1.00 0.00 ? 26 ILE A CG2  5  
ATOM 3562  C CD1  . ILE A 1 26 ? 4.523   7.210   -2.975  1.00 0.00 ? 26 ILE A CD1  5  
ATOM 3563  H H    . ILE A 1 26 ? 7.257   8.274   -2.389  1.00 0.00 ? 26 ILE A H    5  
ATOM 3564  H HA   . ILE A 1 26 ? 7.749   6.694   -4.817  1.00 0.00 ? 26 ILE A HA   5  
ATOM 3565  H HB   . ILE A 1 26 ? 6.038   8.624   -5.745  1.00 0.00 ? 26 ILE A HB   5  
ATOM 3566  H HG12 . ILE A 1 26 ? 5.445   9.075   -3.314  1.00 0.00 ? 26 ILE A HG12 5  
ATOM 3567  H HG13 . ILE A 1 26 ? 4.093   8.726   -4.384  1.00 0.00 ? 26 ILE A HG13 5  
ATOM 3568  H HG21 . ILE A 1 26 ? 6.189   5.809   -5.606  1.00 0.00 ? 26 ILE A HG21 5  
ATOM 3569  H HG22 . ILE A 1 26 ? 5.269   6.804   -6.734  1.00 0.00 ? 26 ILE A HG22 5  
ATOM 3570  H HG23 . ILE A 1 26 ? 4.529   6.267   -5.228  1.00 0.00 ? 26 ILE A HG23 5  
ATOM 3571  H HD11 . ILE A 1 26 ? 5.071   6.305   -3.196  1.00 0.00 ? 26 ILE A HD11 5  
ATOM 3572  H HD12 . ILE A 1 26 ? 3.466   7.032   -3.110  1.00 0.00 ? 26 ILE A HD12 5  
ATOM 3573  H HD13 . ILE A 1 26 ? 4.712   7.504   -1.954  1.00 0.00 ? 26 ILE A HD13 5  
ATOM 3574  N N    . GLY A 1 27 ? 9.553   8.439   -5.018  1.00 0.00 ? 27 GLY A N    5  
ATOM 3575  C CA   . GLY A 1 27 ? 10.535  9.420   -5.444  1.00 0.00 ? 27 GLY A CA   5  
ATOM 3576  C C    . GLY A 1 27 ? 10.833  10.439  -4.371  1.00 0.00 ? 27 GLY A C    5  
ATOM 3577  O O    . GLY A 1 27 ? 11.977  10.594  -3.942  1.00 0.00 ? 27 GLY A O    5  
ATOM 3578  H H    . GLY A 1 27 ? 9.829   7.524   -4.855  1.00 0.00 ? 27 GLY A H    5  
ATOM 3579  H HA2  . GLY A 1 27 ? 11.451  8.909   -5.705  1.00 0.00 ? 27 GLY A HA2  5  
ATOM 3580  H HA3  . GLY A 1 27 ? 10.160  9.933   -6.319  1.00 0.00 ? 27 GLY A HA3  5  
ATOM 3581  N N    . ASP A 1 28 ? 9.794   11.128  -3.935  1.00 0.00 ? 28 ASP A N    5  
ATOM 3582  C CA   . ASP A 1 28 ? 9.920   12.140  -2.900  1.00 0.00 ? 28 ASP A CA   5  
ATOM 3583  C C    . ASP A 1 28 ? 8.598   12.314  -2.162  1.00 0.00 ? 28 ASP A C    5  
ATOM 3584  O O    . ASP A 1 28 ? 8.336   13.366  -1.580  1.00 0.00 ? 28 ASP A O    5  
ATOM 3585  C CB   . ASP A 1 28 ? 10.360  13.473  -3.509  1.00 0.00 ? 28 ASP A CB   5  
ATOM 3586  C CG   . ASP A 1 28 ? 10.646  14.525  -2.455  1.00 0.00 ? 28 ASP A CG   5  
ATOM 3587  O OD1  . ASP A 1 28 ? 11.018  14.147  -1.324  1.00 0.00 ? 28 ASP A OD1  5  
ATOM 3588  O OD2  . ASP A 1 28 ? 10.495  15.727  -2.760  1.00 0.00 ? 28 ASP A OD2  5  
ATOM 3589  H H    . ASP A 1 28 ? 8.913   10.947  -4.320  1.00 0.00 ? 28 ASP A H    5  
ATOM 3590  H HA   . ASP A 1 28 ? 10.669  11.807  -2.200  1.00 0.00 ? 28 ASP A HA   5  
ATOM 3591  H HB2  . ASP A 1 28 ? 11.260  13.318  -4.087  1.00 0.00 ? 28 ASP A HB2  5  
ATOM 3592  H HB3  . ASP A 1 28 ? 9.579   13.842  -4.158  1.00 0.00 ? 28 ASP A HB3  5  
ATOM 3593  N N    . ALA A 1 29 ? 7.765   11.275  -2.188  1.00 0.00 ? 29 ALA A N    5  
ATOM 3594  C CA   . ALA A 1 29 ? 6.474   11.327  -1.516  1.00 0.00 ? 29 ALA A CA   5  
ATOM 3595  C C    . ALA A 1 29 ? 6.313   10.155  -0.558  1.00 0.00 ? 29 ALA A C    5  
ATOM 3596  O O    . ALA A 1 29 ? 5.629   9.179   -0.861  1.00 0.00 ? 29 ALA A O    5  
ATOM 3597  C CB   . ALA A 1 29 ? 5.345   11.346  -2.536  1.00 0.00 ? 29 ALA A CB   5  
ATOM 3598  H H    . ALA A 1 29 ? 8.027   10.453  -2.669  1.00 0.00 ? 29 ALA A H    5  
ATOM 3599  H HA   . ALA A 1 29 ? 6.431   12.247  -0.951  1.00 0.00 ? 29 ALA A HA   5  
ATOM 3600  H HB1  . ALA A 1 29 ? 4.945   12.346  -2.612  1.00 0.00 ? 29 ALA A HB1  5  
ATOM 3601  H HB2  . ALA A 1 29 ? 4.564   10.669  -2.223  1.00 0.00 ? 29 ALA A HB2  5  
ATOM 3602  H HB3  . ALA A 1 29 ? 5.725   11.037  -3.499  1.00 0.00 ? 29 ALA A HB3  5  
ATOM 3603  N N    . LYS A 1 30 ? 6.953   10.259  0.602   1.00 0.00 ? 30 LYS A N    5  
ATOM 3604  C CA   . LYS A 1 30 ? 6.887   9.209   1.610   1.00 0.00 ? 30 LYS A CA   5  
ATOM 3605  C C    . LYS A 1 30 ? 5.765   9.487   2.607   1.00 0.00 ? 30 LYS A C    5  
ATOM 3606  O O    . LYS A 1 30 ? 5.916   10.305  3.514   1.00 0.00 ? 30 LYS A O    5  
ATOM 3607  C CB   . LYS A 1 30 ? 8.228   9.101   2.342   1.00 0.00 ? 30 LYS A CB   5  
ATOM 3608  C CG   . LYS A 1 30 ? 8.227   8.097   3.485   1.00 0.00 ? 30 LYS A CG   5  
ATOM 3609  C CD   . LYS A 1 30 ? 9.504   8.189   4.307   1.00 0.00 ? 30 LYS A CD   5  
ATOM 3610  C CE   . LYS A 1 30 ? 10.714  7.717   3.515   1.00 0.00 ? 30 LYS A CE   5  
ATOM 3611  N NZ   . LYS A 1 30 ? 11.937  8.501   3.847   1.00 0.00 ? 30 LYS A NZ   5  
ATOM 3612  H H    . LYS A 1 30 ? 7.485   11.062  0.783   1.00 0.00 ? 30 LYS A H    5  
ATOM 3613  H HA   . LYS A 1 30 ? 6.686   8.278   1.103   1.00 0.00 ? 30 LYS A HA   5  
ATOM 3614  H HB2  . LYS A 1 30 ? 8.988   8.804   1.634   1.00 0.00 ? 30 LYS A HB2  5  
ATOM 3615  H HB3  . LYS A 1 30 ? 8.484   10.070  2.744   1.00 0.00 ? 30 LYS A HB3  5  
ATOM 3616  H HG2  . LYS A 1 30 ? 7.383   8.297   4.126   1.00 0.00 ? 30 LYS A HG2  5  
ATOM 3617  H HG3  . LYS A 1 30 ? 8.144   7.101   3.076   1.00 0.00 ? 30 LYS A HG3  5  
ATOM 3618  H HD2  . LYS A 1 30 ? 9.658   9.218   4.601   1.00 0.00 ? 30 LYS A HD2  5  
ATOM 3619  H HD3  . LYS A 1 30 ? 9.398   7.573   5.188   1.00 0.00 ? 30 LYS A HD3  5  
ATOM 3620  H HE2  . LYS A 1 30 ? 10.893  6.677   3.741   1.00 0.00 ? 30 LYS A HE2  5  
ATOM 3621  H HE3  . LYS A 1 30 ? 10.503  7.824   2.461   1.00 0.00 ? 30 LYS A HE3  5  
ATOM 3622  H HZ1  . LYS A 1 30 ? 12.116  8.468   4.870   1.00 0.00 ? 30 LYS A HZ1  5  
ATOM 3623  H HZ2  . LYS A 1 30 ? 11.815  9.493   3.560   1.00 0.00 ? 30 LYS A HZ2  5  
ATOM 3624  H HZ3  . LYS A 1 30 ? 12.760  8.106   3.348   1.00 0.00 ? 30 LYS A HZ3  5  
ATOM 3625  N N    . GLU A 1 31 ? 4.638   8.801   2.433   1.00 0.00 ? 31 GLU A N    5  
ATOM 3626  C CA   . GLU A 1 31 ? 3.492   8.978   3.318   1.00 0.00 ? 31 GLU A CA   5  
ATOM 3627  C C    . GLU A 1 31 ? 3.001   7.637   3.850   1.00 0.00 ? 31 GLU A C    5  
ATOM 3628  O O    . GLU A 1 31 ? 3.418   6.578   3.379   1.00 0.00 ? 31 GLU A O    5  
ATOM 3629  C CB   . GLU A 1 31 ? 2.357   9.694   2.582   1.00 0.00 ? 31 GLU A CB   5  
ATOM 3630  C CG   . GLU A 1 31 ? 2.822   10.884  1.759   1.00 0.00 ? 31 GLU A CG   5  
ATOM 3631  C CD   . GLU A 1 31 ? 1.761   11.372  0.792   1.00 0.00 ? 31 GLU A CD   5  
ATOM 3632  O OE1  . GLU A 1 31 ? 0.994   10.531  0.278   1.00 0.00 ? 31 GLU A OE1  5  
ATOM 3633  O OE2  . GLU A 1 31 ? 1.699   12.595  0.548   1.00 0.00 ? 31 GLU A OE2  5  
ATOM 3634  H H    . GLU A 1 31 ? 4.576   8.162   1.691   1.00 0.00 ? 31 GLU A H    5  
ATOM 3635  H HA   . GLU A 1 31 ? 3.809   9.587   4.152   1.00 0.00 ? 31 GLU A HA   5  
ATOM 3636  H HB2  . GLU A 1 31 ? 1.875   8.991   1.920   1.00 0.00 ? 31 GLU A HB2  5  
ATOM 3637  H HB3  . GLU A 1 31 ? 1.639   10.043  3.309   1.00 0.00 ? 31 GLU A HB3  5  
ATOM 3638  H HG2  . GLU A 1 31 ? 3.075   11.691  2.429   1.00 0.00 ? 31 GLU A HG2  5  
ATOM 3639  H HG3  . GLU A 1 31 ? 3.698   10.596  1.197   1.00 0.00 ? 31 GLU A HG3  5  
ATOM 3640  N N    . GLU A 1 32 ? 2.107   7.688   4.834   1.00 0.00 ? 32 GLU A N    5  
ATOM 3641  C CA   . GLU A 1 32 ? 1.555   6.477   5.429   1.00 0.00 ? 32 GLU A CA   5  
ATOM 3642  C C    . GLU A 1 32 ? 0.252   6.086   4.752   1.00 0.00 ? 32 GLU A C    5  
ATOM 3643  O O    . GLU A 1 32 ? -0.444  6.930   4.187   1.00 0.00 ? 32 GLU A O    5  
ATOM 3644  C CB   . GLU A 1 32 ? 1.302   6.675   6.922   1.00 0.00 ? 32 GLU A CB   5  
ATOM 3645  C CG   . GLU A 1 32 ? 1.375   5.390   7.726   1.00 0.00 ? 32 GLU A CG   5  
ATOM 3646  C CD   . GLU A 1 32 ? 0.006   4.801   8.006   1.00 0.00 ? 32 GLU A CD   5  
ATOM 3647  O OE1  . GLU A 1 32 ? -0.633  5.226   8.991   1.00 0.00 ? 32 GLU A OE1  5  
ATOM 3648  O OE2  . GLU A 1 32 ? -0.426  3.914   7.239   1.00 0.00 ? 32 GLU A OE2  5  
ATOM 3649  H H    . GLU A 1 32 ? 1.812   8.561   5.166   1.00 0.00 ? 32 GLU A H    5  
ATOM 3650  H HA   . GLU A 1 32 ? 2.273   5.682   5.296   1.00 0.00 ? 32 GLU A HA   5  
ATOM 3651  H HB2  . GLU A 1 32 ? 2.032   7.364   7.313   1.00 0.00 ? 32 GLU A HB2  5  
ATOM 3652  H HB3  . GLU A 1 32 ? 0.314   7.097   7.051   1.00 0.00 ? 32 GLU A HB3  5  
ATOM 3653  H HG2  . GLU A 1 32 ? 1.955   4.667   7.174   1.00 0.00 ? 32 GLU A HG2  5  
ATOM 3654  H HG3  . GLU A 1 32 ? 1.862   5.596   8.668   1.00 0.00 ? 32 GLU A HG3  5  
ATOM 3655  N N    . HIS A 1 33 ? -0.077  4.805   4.822   1.00 0.00 ? 33 HIS A N    5  
ATOM 3656  C CA   . HIS A 1 33 ? -1.306  4.305   4.225   1.00 0.00 ? 33 HIS A CA   5  
ATOM 3657  C C    . HIS A 1 33 ? -1.829  3.097   4.992   1.00 0.00 ? 33 HIS A C    5  
ATOM 3658  O O    . HIS A 1 33 ? -1.120  2.116   5.185   1.00 0.00 ? 33 HIS A O    5  
ATOM 3659  C CB   . HIS A 1 33 ? -1.074  3.941   2.758   1.00 0.00 ? 33 HIS A CB   5  
ATOM 3660  C CG   . HIS A 1 33 ? -1.926  4.725   1.808   1.00 0.00 ? 33 HIS A CG   5  
ATOM 3661  N ND1  . HIS A 1 33 ? -3.194  4.333   1.434   1.00 0.00 ? 33 HIS A ND1  5  
ATOM 3662  C CD2  . HIS A 1 33 ? -1.686  5.888   1.156   1.00 0.00 ? 33 HIS A CD2  5  
ATOM 3663  C CE1  . HIS A 1 33 ? -3.696  5.218   0.591   1.00 0.00 ? 33 HIS A CE1  5  
ATOM 3664  N NE2  . HIS A 1 33 ? -2.802  6.171   0.407   1.00 0.00 ? 33 HIS A NE2  5  
ATOM 3665  H H    . HIS A 1 33 ? 0.519   4.181   5.292   1.00 0.00 ? 33 HIS A H    5  
ATOM 3666  H HA   . HIS A 1 33 ? -2.041  5.094   4.278   1.00 0.00 ? 33 HIS A HA   5  
ATOM 3667  H HB2  . HIS A 1 33 ? -0.041  4.128   2.506   1.00 0.00 ? 33 HIS A HB2  5  
ATOM 3668  H HB3  . HIS A 1 33 ? -1.292  2.893   2.613   1.00 0.00 ? 33 HIS A HB3  5  
ATOM 3669  H HD1  . HIS A 1 33 ? -3.657  3.525   1.741   1.00 0.00 ? 33 HIS A HD1  5  
ATOM 3670  H HD2  . HIS A 1 33 ? -0.785  6.480   1.214   1.00 0.00 ? 33 HIS A HD2  5  
ATOM 3671  H HE1  . HIS A 1 33 ? -4.673  5.169   0.132   1.00 0.00 ? 33 HIS A HE1  5  
ATOM 3672  H HE2  . HIS A 1 33 ? -2.891  6.916   -0.222  1.00 0.00 ? 33 HIS A HE2  5  
ATOM 3673  N N    . ARG A 1 34 ? -3.074  3.176   5.434   1.00 0.00 ? 34 ARG A N    5  
ATOM 3674  C CA   . ARG A 1 34 ? -3.678  2.079   6.180   1.00 0.00 ? 34 ARG A CA   5  
ATOM 3675  C C    . ARG A 1 34 ? -4.154  0.972   5.244   1.00 0.00 ? 34 ARG A C    5  
ATOM 3676  O O    . ARG A 1 34 ? -3.798  -0.193  5.421   1.00 0.00 ? 34 ARG A O    5  
ATOM 3677  C CB   . ARG A 1 34 ? -4.851  2.577   7.020   1.00 0.00 ? 34 ARG A CB   5  
ATOM 3678  C CG   . ARG A 1 34 ? -4.523  3.793   7.870   1.00 0.00 ? 34 ARG A CG   5  
ATOM 3679  C CD   . ARG A 1 34 ? -3.308  3.549   8.753   1.00 0.00 ? 34 ARG A CD   5  
ATOM 3680  N NE   . ARG A 1 34 ? -3.540  2.487   9.731   1.00 0.00 ? 34 ARG A NE   5  
ATOM 3681  C CZ   . ARG A 1 34 ? -2.859  2.364   10.870  1.00 0.00 ? 34 ARG A CZ   5  
ATOM 3682  N NH1  . ARG A 1 34 ? -1.899  3.230   11.176  1.00 0.00 ? 34 ARG A NH1  5  
ATOM 3683  N NH2  . ARG A 1 34 ? -3.138  1.373   11.705  1.00 0.00 ? 34 ARG A NH2  5  
ATOM 3684  H H    . ARG A 1 34 ? -3.593  3.989   5.260   1.00 0.00 ? 34 ARG A H    5  
ATOM 3685  H HA   . ARG A 1 34 ? -2.925  1.675   6.840   1.00 0.00 ? 34 ARG A HA   5  
ATOM 3686  H HB2  . ARG A 1 34 ? -5.665  2.833   6.358   1.00 0.00 ? 34 ARG A HB2  5  
ATOM 3687  H HB3  . ARG A 1 34 ? -5.169  1.779   7.674   1.00 0.00 ? 34 ARG A HB3  5  
ATOM 3688  H HG2  . ARG A 1 34 ? -4.320  4.630   7.221   1.00 0.00 ? 34 ARG A HG2  5  
ATOM 3689  H HG3  . ARG A 1 34 ? -5.373  4.020   8.498   1.00 0.00 ? 34 ARG A HG3  5  
ATOM 3690  H HD2  . ARG A 1 34 ? -2.474  3.270   8.125   1.00 0.00 ? 34 ARG A HD2  5  
ATOM 3691  H HD3  . ARG A 1 34 ? -3.073  4.463   9.277   1.00 0.00 ? 34 ARG A HD3  5  
ATOM 3692  H HE   . ARG A 1 34 ? -4.239  1.830   9.530   1.00 0.00 ? 34 ARG A HE   5  
ATOM 3693  H HH11 . ARG A 1 34 ? -1.680  3.977   10.551  1.00 0.00 ? 34 ARG A HH11 5  
ATOM 3694  H HH12 . ARG A 1 34 ? -1.393  3.131   12.033  1.00 0.00 ? 34 ARG A HH12 5  
ATOM 3695  H HH21 . ARG A 1 34 ? -3.858  0.717   11.480  1.00 0.00 ? 34 ARG A HH21 5  
ATOM 3696  H HH22 . ARG A 1 34 ? -2.627  1.282   12.560  1.00 0.00 ? 34 ARG A HH22 5  
ATOM 3697  N N    . ASN A 1 35 ? -4.962  1.335   4.250   1.00 0.00 ? 35 ASN A N    5  
ATOM 3698  C CA   . ASN A 1 35 ? -5.473  0.352   3.302   1.00 0.00 ? 35 ASN A CA   5  
ATOM 3699  C C    . ASN A 1 35 ? -4.431  0.015   2.242   1.00 0.00 ? 35 ASN A C    5  
ATOM 3700  O O    . ASN A 1 35 ? -4.609  0.290   1.050   1.00 0.00 ? 35 ASN A O    5  
ATOM 3701  C CB   . ASN A 1 35 ? -6.772  0.837   2.648   1.00 0.00 ? 35 ASN A CB   5  
ATOM 3702  C CG   . ASN A 1 35 ? -7.930  -0.108  2.918   1.00 0.00 ? 35 ASN A CG   5  
ATOM 3703  O OD1  . ASN A 1 35 ? -7.738  -1.318  3.043   1.00 0.00 ? 35 ASN A OD1  5  
ATOM 3704  N ND2  . ASN A 1 35 ? -9.139  0.433   3.008   1.00 0.00 ? 35 ASN A ND2  5  
ATOM 3705  H H    . ASN A 1 35 ? -5.217  2.277   4.153   1.00 0.00 ? 35 ASN A H    5  
ATOM 3706  H HA   . ASN A 1 35 ? -5.687  -0.548  3.861   1.00 0.00 ? 35 ASN A HA   5  
ATOM 3707  H HB2  . ASN A 1 35 ? -7.024  1.809   3.040   1.00 0.00 ? 35 ASN A HB2  5  
ATOM 3708  H HB3  . ASN A 1 35 ? -6.630  0.910   1.579   1.00 0.00 ? 35 ASN A HB3  5  
ATOM 3709  H HD21 . ASN A 1 35 ? -9.224  1.401   2.897   1.00 0.00 ? 35 ASN A HD21 5  
ATOM 3710  H HD22 . ASN A 1 35 ? -9.897  -0.160  3.190   1.00 0.00 ? 35 ASN A HD22 5  
ATOM 3711  N N    . MET A 1 36 ? -3.344  -0.602  2.691   1.00 0.00 ? 36 MET A N    5  
ATOM 3712  C CA   . MET A 1 36 ? -2.264  -1.008  1.807   1.00 0.00 ? 36 MET A CA   5  
ATOM 3713  C C    . MET A 1 36 ? -2.812  -1.730  0.574   1.00 0.00 ? 36 MET A C    5  
ATOM 3714  O O    . MET A 1 36 ? -2.177  -1.746  -0.479  1.00 0.00 ? 36 MET A O    5  
ATOM 3715  C CB   . MET A 1 36 ? -1.294  -1.912  2.572   1.00 0.00 ? 36 MET A CB   5  
ATOM 3716  C CG   . MET A 1 36 ? -0.249  -2.585  1.696   1.00 0.00 ? 36 MET A CG   5  
ATOM 3717  S SD   . MET A 1 36 ? -0.781  -4.202  1.097   1.00 0.00 ? 36 MET A SD   5  
ATOM 3718  C CE   . MET A 1 36 ? -1.129  -5.040  2.643   1.00 0.00 ? 36 MET A CE   5  
ATOM 3719  H H    . MET A 1 36 ? -3.269  -0.798  3.646   1.00 0.00 ? 36 MET A H    5  
ATOM 3720  H HA   . MET A 1 36 ? -1.741  -0.120  1.488   1.00 0.00 ? 36 MET A HA   5  
ATOM 3721  H HB2  . MET A 1 36 ? -0.781  -1.316  3.314   1.00 0.00 ? 36 MET A HB2  5  
ATOM 3722  H HB3  . MET A 1 36 ? -1.863  -2.679  3.075   1.00 0.00 ? 36 MET A HB3  5  
ATOM 3723  H HG2  . MET A 1 36 ? -0.050  -1.951  0.845   1.00 0.00 ? 36 MET A HG2  5  
ATOM 3724  H HG3  . MET A 1 36 ? 0.656   -2.709  2.270   1.00 0.00 ? 36 MET A HG3  5  
ATOM 3725  H HE1  . MET A 1 36 ? -2.157  -4.864  2.924   1.00 0.00 ? 36 MET A HE1  5  
ATOM 3726  H HE2  . MET A 1 36 ? -0.475  -4.660  3.413   1.00 0.00 ? 36 MET A HE2  5  
ATOM 3727  H HE3  . MET A 1 36 ? -0.966  -6.100  2.522   1.00 0.00 ? 36 MET A HE3  5  
ATOM 3728  N N    . CYS A 1 37 ? -4.003  -2.317  0.709   1.00 0.00 ? 37 CYS A N    5  
ATOM 3729  C CA   . CYS A 1 37 ? -4.633  -3.023  -0.401  1.00 0.00 ? 37 CYS A CA   5  
ATOM 3730  C C    . CYS A 1 37 ? -4.850  -2.078  -1.577  1.00 0.00 ? 37 CYS A C    5  
ATOM 3731  O O    . CYS A 1 37 ? -4.221  -2.216  -2.624  1.00 0.00 ? 37 CYS A O    5  
ATOM 3732  C CB   . CYS A 1 37 ? -5.971  -3.631  0.034   1.00 0.00 ? 37 CYS A CB   5  
ATOM 3733  S SG   . CYS A 1 37 ? -5.827  -5.242  0.875   1.00 0.00 ? 37 CYS A SG   5  
ATOM 3734  H H    . CYS A 1 37 ? -4.469  -2.266  1.571   1.00 0.00 ? 37 CYS A H    5  
ATOM 3735  H HA   . CYS A 1 37 ? -3.971  -3.814  -0.709  1.00 0.00 ? 37 CYS A HA   5  
ATOM 3736  H HB2  . CYS A 1 37 ? -6.463  -2.953  0.712   1.00 0.00 ? 37 CYS A HB2  5  
ATOM 3737  H HB3  . CYS A 1 37 ? -6.592  -3.772  -0.839  1.00 0.00 ? 37 CYS A HB3  5  
ATOM 3738  N N    . ALA A 1 38 ? -5.740  -1.111  -1.391  1.00 0.00 ? 38 ALA A N    5  
ATOM 3739  C CA   . ALA A 1 38 ? -6.038  -0.133  -2.434  1.00 0.00 ? 38 ALA A CA   5  
ATOM 3740  C C    . ALA A 1 38 ? -4.762  0.438   -3.026  1.00 0.00 ? 38 ALA A C    5  
ATOM 3741  O O    . ALA A 1 38 ? -4.722  0.812   -4.198  1.00 0.00 ? 38 ALA A O    5  
ATOM 3742  C CB   . ALA A 1 38 ? -6.916  0.982   -1.886  1.00 0.00 ? 38 ALA A CB   5  
ATOM 3743  H H    . ALA A 1 38 ? -6.202  -1.051  -0.531  1.00 0.00 ? 38 ALA A H    5  
ATOM 3744  H HA   . ALA A 1 38 ? -6.579  -0.636  -3.219  1.00 0.00 ? 38 ALA A HA   5  
ATOM 3745  H HB1  . ALA A 1 38 ? -7.908  0.599   -1.696  1.00 0.00 ? 38 ALA A HB1  5  
ATOM 3746  H HB2  . ALA A 1 38 ? -6.971  1.783   -2.608  1.00 0.00 ? 38 ALA A HB2  5  
ATOM 3747  H HB3  . ALA A 1 38 ? -6.491  1.355   -0.966  1.00 0.00 ? 38 ALA A HB3  5  
ATOM 3748  N N    . LEU A 1 39 ? -3.720  0.495   -2.215  1.00 0.00 ? 39 LEU A N    5  
ATOM 3749  C CA   . LEU A 1 39 ? -2.439  1.010   -2.669  1.00 0.00 ? 39 LEU A CA   5  
ATOM 3750  C C    . LEU A 1 39 ? -1.725  -0.016  -3.527  1.00 0.00 ? 39 LEU A C    5  
ATOM 3751  O O    . LEU A 1 39 ? -1.170  0.309   -4.564  1.00 0.00 ? 39 LEU A O    5  
ATOM 3752  C CB   . LEU A 1 39 ? -1.568  1.371   -1.474  1.00 0.00 ? 39 LEU A CB   5  
ATOM 3753  C CG   . LEU A 1 39 ? -1.029  2.802   -1.472  1.00 0.00 ? 39 LEU A CG   5  
ATOM 3754  C CD1  . LEU A 1 39 ? -2.144  3.794   -1.744  1.00 0.00 ? 39 LEU A CD1  5  
ATOM 3755  C CD2  . LEU A 1 39 ? -0.343  3.110   -0.150  1.00 0.00 ? 39 LEU A CD2  5  
ATOM 3756  H H    . LEU A 1 39 ? -3.811  0.178   -1.287  1.00 0.00 ? 39 LEU A H    5  
ATOM 3757  H HA   . LEU A 1 39 ? -2.623  1.894   -3.258  1.00 0.00 ? 39 LEU A HA   5  
ATOM 3758  H HB2  . LEU A 1 39 ? -2.155  1.218   -0.585  1.00 0.00 ? 39 LEU A HB2  5  
ATOM 3759  H HB3  . LEU A 1 39 ? -0.726  0.694   -1.448  1.00 0.00 ? 39 LEU A HB3  5  
ATOM 3760  H HG   . LEU A 1 39 ? -0.301  2.905   -2.260  1.00 0.00 ? 39 LEU A HG   5  
ATOM 3761  H HD11 . LEU A 1 39 ? -1.892  4.747   -1.307  1.00 0.00 ? 39 LEU A HD11 5  
ATOM 3762  H HD12 . LEU A 1 39 ? -3.063  3.428   -1.312  1.00 0.00 ? 39 LEU A HD12 5  
ATOM 3763  H HD13 . LEU A 1 39 ? -2.268  3.907   -2.811  1.00 0.00 ? 39 LEU A HD13 5  
ATOM 3764  H HD21 . LEU A 1 39 ? -0.899  2.657   0.657   1.00 0.00 ? 39 LEU A HD21 5  
ATOM 3765  H HD22 . LEU A 1 39 ? -0.304  4.180   -0.005  1.00 0.00 ? 39 LEU A HD22 5  
ATOM 3766  H HD23 . LEU A 1 39 ? 0.661   2.712   -0.164  1.00 0.00 ? 39 LEU A HD23 5  
ATOM 3767  N N    . CYS A 1 40 ? -1.748  -1.259  -3.086  1.00 0.00 ? 40 CYS A N    5  
ATOM 3768  C CA   . CYS A 1 40 ? -1.099  -2.331  -3.819  1.00 0.00 ? 40 CYS A CA   5  
ATOM 3769  C C    . CYS A 1 40 ? -1.735  -2.492  -5.192  1.00 0.00 ? 40 CYS A C    5  
ATOM 3770  O O    . CYS A 1 40 ? -1.080  -2.898  -6.152  1.00 0.00 ? 40 CYS A O    5  
ATOM 3771  C CB   . CYS A 1 40 ? -1.175  -3.642  -3.030  1.00 0.00 ? 40 CYS A CB   5  
ATOM 3772  S SG   . CYS A 1 40 ? -2.729  -4.576  -3.238  1.00 0.00 ? 40 CYS A SG   5  
ATOM 3773  H H    . CYS A 1 40 ? -2.214  -1.460  -2.252  1.00 0.00 ? 40 CYS A H    5  
ATOM 3774  H HA   . CYS A 1 40 ? -0.063  -2.062  -3.946  1.00 0.00 ? 40 CYS A HA   5  
ATOM 3775  H HB2  . CYS A 1 40 ? -0.365  -4.282  -3.343  1.00 0.00 ? 40 CYS A HB2  5  
ATOM 3776  H HB3  . CYS A 1 40 ? -1.062  -3.422  -1.978  1.00 0.00 ? 40 CYS A HB3  5  
ATOM 3777  N N    . CYS A 1 41 ? -3.022  -2.183  -5.268  1.00 0.00 ? 41 CYS A N    5  
ATOM 3778  C CA   . CYS A 1 41 ? -3.766  -2.302  -6.506  1.00 0.00 ? 41 CYS A CA   5  
ATOM 3779  C C    . CYS A 1 41 ? -3.743  -1.013  -7.319  1.00 0.00 ? 41 CYS A C    5  
ATOM 3780  O O    . CYS A 1 41 ? -3.713  -1.042  -8.549  1.00 0.00 ? 41 CYS A O    5  
ATOM 3781  C CB   . CYS A 1 41 ? -5.204  -2.698  -6.185  1.00 0.00 ? 41 CYS A CB   5  
ATOM 3782  S SG   . CYS A 1 41 ? -6.388  -1.314  -6.073  1.00 0.00 ? 41 CYS A SG   5  
ATOM 3783  H H    . CYS A 1 41 ? -3.493  -1.873  -4.461  1.00 0.00 ? 41 CYS A H    5  
ATOM 3784  H HA   . CYS A 1 41 ? -3.316  -3.091  -7.087  1.00 0.00 ? 41 CYS A HA   5  
ATOM 3785  H HB2  . CYS A 1 41 ? -5.558  -3.366  -6.943  1.00 0.00 ? 41 CYS A HB2  5  
ATOM 3786  H HB3  . CYS A 1 41 ? -5.211  -3.206  -5.237  1.00 0.00 ? 41 CYS A HB3  5  
ATOM 3787  N N    . GLU A 1 42 ? -3.814  0.114   -6.623  1.00 0.00 ? 42 GLU A N    5  
ATOM 3788  C CA   . GLU A 1 42 ? -3.861  1.415   -7.293  1.00 0.00 ? 42 GLU A CA   5  
ATOM 3789  C C    . GLU A 1 42 ? -2.695  2.335   -6.931  1.00 0.00 ? 42 GLU A C    5  
ATOM 3790  O O    . GLU A 1 42 ? -2.867  3.553   -6.864  1.00 0.00 ? 42 GLU A O    5  
ATOM 3791  C CB   . GLU A 1 42 ? -5.179  2.114   -6.958  1.00 0.00 ? 42 GLU A CB   5  
ATOM 3792  C CG   . GLU A 1 42 ? -5.423  3.372   -7.775  1.00 0.00 ? 42 GLU A CG   5  
ATOM 3793  C CD   . GLU A 1 42 ? -5.739  4.577   -6.913  1.00 0.00 ? 42 GLU A CD   5  
ATOM 3794  O OE1  . GLU A 1 42 ? -6.436  4.410   -5.890  1.00 0.00 ? 42 GLU A OE1  5  
ATOM 3795  O OE2  . GLU A 1 42 ? -5.290  5.690   -7.260  1.00 0.00 ? 42 GLU A OE2  5  
ATOM 3796  H H    . GLU A 1 42 ? -3.876  0.064   -5.643  1.00 0.00 ? 42 GLU A H    5  
ATOM 3797  H HA   . GLU A 1 42 ? -3.835  1.234   -8.356  1.00 0.00 ? 42 GLU A HA   5  
ATOM 3798  H HB2  . GLU A 1 42 ? -5.993  1.429   -7.138  1.00 0.00 ? 42 GLU A HB2  5  
ATOM 3799  H HB3  . GLU A 1 42 ? -5.172  2.386   -5.913  1.00 0.00 ? 42 GLU A HB3  5  
ATOM 3800  H HG2  . GLU A 1 42 ? -4.537  3.585   -8.353  1.00 0.00 ? 42 GLU A HG2  5  
ATOM 3801  H HG3  . GLU A 1 42 ? -6.253  3.195   -8.442  1.00 0.00 ? 42 GLU A HG3  5  
ATOM 3802  N N    . HIS A 1 43 ? -1.511  1.778   -6.710  1.00 0.00 ? 43 HIS A N    5  
ATOM 3803  C CA   . HIS A 1 43 ? -0.355  2.616   -6.374  1.00 0.00 ? 43 HIS A CA   5  
ATOM 3804  C C    . HIS A 1 43 ? 0.243   3.253   -7.623  1.00 0.00 ? 43 HIS A C    5  
ATOM 3805  O O    . HIS A 1 43 ? -0.065  2.855   -8.747  1.00 0.00 ? 43 HIS A O    5  
ATOM 3806  C CB   . HIS A 1 43 ? 0.729   1.834   -5.635  1.00 0.00 ? 43 HIS A CB   5  
ATOM 3807  C CG   . HIS A 1 43 ? 0.935   0.443   -6.136  1.00 0.00 ? 43 HIS A CG   5  
ATOM 3808  N ND1  . HIS A 1 43 ? 0.906   0.101   -7.471  1.00 0.00 ? 43 HIS A ND1  5  
ATOM 3809  C CD2  . HIS A 1 43 ? 1.180   -0.697  -5.461  1.00 0.00 ? 43 HIS A CD2  5  
ATOM 3810  C CE1  . HIS A 1 43 ? 1.123   -1.197  -7.594  1.00 0.00 ? 43 HIS A CE1  5  
ATOM 3811  N NE2  . HIS A 1 43 ? 1.294   -1.705  -6.387  1.00 0.00 ? 43 HIS A NE2  5  
ATOM 3812  H H    . HIS A 1 43 ? -1.413  0.802   -6.775  1.00 0.00 ? 43 HIS A H    5  
ATOM 3813  H HA   . HIS A 1 43 ? -0.710  3.407   -5.728  1.00 0.00 ? 43 HIS A HA   5  
ATOM 3814  H HB2  . HIS A 1 43 ? 1.667   2.358   -5.733  1.00 0.00 ? 43 HIS A HB2  5  
ATOM 3815  H HB3  . HIS A 1 43 ? 0.468   1.774   -4.589  1.00 0.00 ? 43 HIS A HB3  5  
ATOM 3816  H HD1  . HIS A 1 43 ? 0.747   0.716   -8.218  1.00 0.00 ? 43 HIS A HD1  5  
ATOM 3817  H HD2  . HIS A 1 43 ? 1.257   -0.794  -4.386  1.00 0.00 ? 43 HIS A HD2  5  
ATOM 3818  H HE1  . HIS A 1 43 ? 1.157   -1.748  -8.522  1.00 0.00 ? 43 HIS A HE1  5  
ATOM 3819  H HE2  . HIS A 1 43 ? 1.558   -2.629  -6.194  1.00 0.00 ? 43 HIS A HE2  5  
ATOM 3820  N N    . PRO A 1 44 ? 1.109   4.264   -7.435  1.00 0.00 ? 44 PRO A N    5  
ATOM 3821  C CA   . PRO A 1 44 ? 1.759   4.976   -8.540  1.00 0.00 ? 44 PRO A CA   5  
ATOM 3822  C C    . PRO A 1 44 ? 2.779   4.111   -9.275  1.00 0.00 ? 44 PRO A C    5  
ATOM 3823  O O    . PRO A 1 44 ? 3.957   4.085   -8.919  1.00 0.00 ? 44 PRO A O    5  
ATOM 3824  C CB   . PRO A 1 44 ? 2.459   6.162   -7.852  1.00 0.00 ? 44 PRO A CB   5  
ATOM 3825  C CG   . PRO A 1 44 ? 1.901   6.209   -6.468  1.00 0.00 ? 44 PRO A CG   5  
ATOM 3826  C CD   . PRO A 1 44 ? 1.519   4.799   -6.130  1.00 0.00 ? 44 PRO A CD   5  
ATOM 3827  H HA   . PRO A 1 44 ? 1.033   5.349   -9.247  1.00 0.00 ? 44 PRO A HA   5  
ATOM 3828  H HB2  . PRO A 1 44 ? 3.526   5.992   -7.839  1.00 0.00 ? 44 PRO A HB2  5  
ATOM 3829  H HB3  . PRO A 1 44 ? 2.244   7.071   -8.393  1.00 0.00 ? 44 PRO A HB3  5  
ATOM 3830  H HG2  . PRO A 1 44 ? 2.652   6.569   -5.780  1.00 0.00 ? 44 PRO A HG2  5  
ATOM 3831  H HG3  . PRO A 1 44 ? 1.031   6.849   -6.444  1.00 0.00 ? 44 PRO A HG3  5  
ATOM 3832  H HD2  . PRO A 1 44 ? 2.368   4.257   -5.737  1.00 0.00 ? 44 PRO A HD2  5  
ATOM 3833  H HD3  . PRO A 1 44 ? 0.697   4.782   -5.429  1.00 0.00 ? 44 PRO A HD3  5  
ATOM 3834  N N    . GLY A 1 45 ? 2.318   3.407   -10.306 1.00 0.00 ? 45 GLY A N    5  
ATOM 3835  C CA   . GLY A 1 45 ? 3.201   2.554   -11.083 1.00 0.00 ? 45 GLY A CA   5  
ATOM 3836  C C    . GLY A 1 45 ? 4.055   1.640   -10.224 1.00 0.00 ? 45 GLY A C    5  
ATOM 3837  O O    . GLY A 1 45 ? 5.262   1.526   -10.437 1.00 0.00 ? 45 GLY A O    5  
ATOM 3838  H H    . GLY A 1 45 ? 1.370   3.472   -10.545 1.00 0.00 ? 45 GLY A H    5  
ATOM 3839  H HA2  . GLY A 1 45 ? 2.603   1.946   -11.745 1.00 0.00 ? 45 GLY A HA2  5  
ATOM 3840  H HA3  . GLY A 1 45 ? 3.851   3.178   -11.679 1.00 0.00 ? 45 GLY A HA3  5  
ATOM 3841  N N    . GLY A 1 46 ? 3.428   0.987   -9.253  1.00 0.00 ? 46 GLY A N    5  
ATOM 3842  C CA   . GLY A 1 46 ? 4.153   0.083   -8.379  1.00 0.00 ? 46 GLY A CA   5  
ATOM 3843  C C    . GLY A 1 46 ? 5.258   0.778   -7.608  1.00 0.00 ? 46 GLY A C    5  
ATOM 3844  O O    . GLY A 1 46 ? 6.435   0.450   -7.763  1.00 0.00 ? 46 GLY A O    5  
ATOM 3845  H H    . GLY A 1 46 ? 2.464   1.114   -9.131  1.00 0.00 ? 46 GLY A H    5  
ATOM 3846  H HA2  . GLY A 1 46 ? 3.461   -0.352  -7.675  1.00 0.00 ? 46 GLY A HA2  5  
ATOM 3847  H HA3  . GLY A 1 46 ? 4.587   -0.706  -8.975  1.00 0.00 ? 46 GLY A HA3  5  
ATOM 3848  N N    . PHE A 1 47 ? 4.876   1.732   -6.768  1.00 0.00 ? 47 PHE A N    5  
ATOM 3849  C CA   . PHE A 1 47 ? 5.834   2.473   -5.957  1.00 0.00 ? 47 PHE A CA   5  
ATOM 3850  C C    . PHE A 1 47 ? 6.559   1.529   -4.989  1.00 0.00 ? 47 PHE A C    5  
ATOM 3851  O O    . PHE A 1 47 ? 6.755   0.355   -5.302  1.00 0.00 ? 47 PHE A O    5  
ATOM 3852  C CB   . PHE A 1 47 ? 5.109   3.589   -5.198  1.00 0.00 ? 47 PHE A CB   5  
ATOM 3853  C CG   . PHE A 1 47 ? 4.028   3.108   -4.265  1.00 0.00 ? 47 PHE A CG   5  
ATOM 3854  C CD1  . PHE A 1 47 ? 3.700   1.759   -4.169  1.00 0.00 ? 47 PHE A CD1  5  
ATOM 3855  C CD2  . PHE A 1 47 ? 3.335   4.014   -3.480  1.00 0.00 ? 47 PHE A CD2  5  
ATOM 3856  C CE1  . PHE A 1 47 ? 2.707   1.335   -3.312  1.00 0.00 ? 47 PHE A CE1  5  
ATOM 3857  C CE2  . PHE A 1 47 ? 2.340   3.591   -2.623  1.00 0.00 ? 47 PHE A CE2  5  
ATOM 3858  C CZ   . PHE A 1 47 ? 2.028   2.251   -2.538  1.00 0.00 ? 47 PHE A CZ   5  
ATOM 3859  H H    . PHE A 1 47 ? 3.922   1.940   -6.687  1.00 0.00 ? 47 PHE A H    5  
ATOM 3860  H HA   . PHE A 1 47 ? 6.562   2.914   -6.622  1.00 0.00 ? 47 PHE A HA   5  
ATOM 3861  H HB2  . PHE A 1 47 ? 5.826   4.143   -4.614  1.00 0.00 ? 47 PHE A HB2  5  
ATOM 3862  H HB3  . PHE A 1 47 ? 4.652   4.255   -5.915  1.00 0.00 ? 47 PHE A HB3  5  
ATOM 3863  H HD1  . PHE A 1 47 ? 4.227   1.038   -4.770  1.00 0.00 ? 47 PHE A HD1  5  
ATOM 3864  H HD2  . PHE A 1 47 ? 3.576   5.061   -3.546  1.00 0.00 ? 47 PHE A HD2  5  
ATOM 3865  H HE1  . PHE A 1 47 ? 2.464   0.285   -3.246  1.00 0.00 ? 47 PHE A HE1  5  
ATOM 3866  H HE2  . PHE A 1 47 ? 1.809   4.310   -2.016  1.00 0.00 ? 47 PHE A HE2  5  
ATOM 3867  H HZ   . PHE A 1 47 ? 1.253   1.920   -1.870  1.00 0.00 ? 47 PHE A HZ   5  
ATOM 3868  N N    . GLU A 1 48 ? 6.961   2.031   -3.820  1.00 0.00 ? 48 GLU A N    5  
ATOM 3869  C CA   . GLU A 1 48 ? 7.661   1.198   -2.847  1.00 0.00 ? 48 GLU A CA   5  
ATOM 3870  C C    . GLU A 1 48 ? 7.210   1.488   -1.420  1.00 0.00 ? 48 GLU A C    5  
ATOM 3871  O O    . GLU A 1 48 ? 7.545   2.528   -0.853  1.00 0.00 ? 48 GLU A O    5  
ATOM 3872  C CB   . GLU A 1 48 ? 9.173   1.411   -2.948  1.00 0.00 ? 48 GLU A CB   5  
ATOM 3873  C CG   . GLU A 1 48 ? 9.572   2.833   -3.312  1.00 0.00 ? 48 GLU A CG   5  
ATOM 3874  C CD   . GLU A 1 48 ? 11.038  2.951   -3.680  1.00 0.00 ? 48 GLU A CD   5  
ATOM 3875  O OE1  . GLU A 1 48 ? 11.813  2.034   -3.336  1.00 0.00 ? 48 GLU A OE1  5  
ATOM 3876  O OE2  . GLU A 1 48 ? 11.411  3.961   -4.312  1.00 0.00 ? 48 GLU A OE2  5  
ATOM 3877  H H    . GLU A 1 48 ? 6.791   2.974   -3.610  1.00 0.00 ? 48 GLU A H    5  
ATOM 3878  H HA   . GLU A 1 48 ? 7.441   0.165   -3.077  1.00 0.00 ? 48 GLU A HA   5  
ATOM 3879  H HB2  . GLU A 1 48 ? 9.619   1.169   -1.995  1.00 0.00 ? 48 GLU A HB2  5  
ATOM 3880  H HB3  . GLU A 1 48 ? 9.568   0.745   -3.698  1.00 0.00 ? 48 GLU A HB3  5  
ATOM 3881  H HG2  . GLU A 1 48 ? 8.978   3.156   -4.153  1.00 0.00 ? 48 GLU A HG2  5  
ATOM 3882  H HG3  . GLU A 1 48 ? 9.375   3.475   -2.465  1.00 0.00 ? 48 GLU A HG3  5  
ATOM 3883  N N    . TYR A 1 49 ? 6.480   0.548   -0.830  1.00 0.00 ? 49 TYR A N    5  
ATOM 3884  C CA   . TYR A 1 49 ? 6.024   0.694   0.544   1.00 0.00 ? 49 TYR A CA   5  
ATOM 3885  C C    . TYR A 1 49 ? 6.712   -0.294  1.452   1.00 0.00 ? 49 TYR A C    5  
ATOM 3886  O O    . TYR A 1 49 ? 7.231   -1.319  1.012   1.00 0.00 ? 49 TYR A O    5  
ATOM 3887  C CB   . TYR A 1 49 ? 4.525   0.538   0.685   1.00 0.00 ? 49 TYR A CB   5  
ATOM 3888  C CG   . TYR A 1 49 ? 3.915   -0.733  0.146   1.00 0.00 ? 49 TYR A CG   5  
ATOM 3889  C CD1  . TYR A 1 49 ? 4.335   -1.982  0.585   1.00 0.00 ? 49 TYR A CD1  5  
ATOM 3890  C CD2  . TYR A 1 49 ? 2.872   -0.674  -0.765  1.00 0.00 ? 49 TYR A CD2  5  
ATOM 3891  C CE1  . TYR A 1 49 ? 3.730   -3.135  0.129   1.00 0.00 ? 49 TYR A CE1  5  
ATOM 3892  C CE2  . TYR A 1 49 ? 2.269   -1.820  -1.234  1.00 0.00 ? 49 TYR A CE2  5  
ATOM 3893  C CZ   . TYR A 1 49 ? 2.698   -3.047  -0.783  1.00 0.00 ? 49 TYR A CZ   5  
ATOM 3894  O OH   . TYR A 1 49 ? 2.079   -4.187  -1.229  1.00 0.00 ? 49 TYR A OH   5  
ATOM 3895  H H    . TYR A 1 49 ? 6.265   -0.272  -1.321  1.00 0.00 ? 49 TYR A H    5  
ATOM 3896  H HA   . TYR A 1 49 ? 6.275   1.686   0.892   1.00 0.00 ? 49 TYR A HA   5  
ATOM 3897  H HB2  . TYR A 1 49 ? 4.308   0.565   1.726   1.00 0.00 ? 49 TYR A HB2  5  
ATOM 3898  H HB3  . TYR A 1 49 ? 4.037   1.370   0.216   1.00 0.00 ? 49 TYR A HB3  5  
ATOM 3899  H HD1  . TYR A 1 49 ? 5.143   -2.048  1.295   1.00 0.00 ? 49 TYR A HD1  5  
ATOM 3900  H HD2  . TYR A 1 49 ? 2.538   0.289   -1.117  1.00 0.00 ? 49 TYR A HD2  5  
ATOM 3901  H HE1  . TYR A 1 49 ? 4.069   -4.099  0.481   1.00 0.00 ? 49 TYR A HE1  5  
ATOM 3902  H HE2  . TYR A 1 49 ? 1.463   -1.752  -1.946  1.00 0.00 ? 49 TYR A HE2  5  
ATOM 3903  H HH   . TYR A 1 49 ? 1.270   -4.328  -0.733  1.00 0.00 ? 49 TYR A HH   5  
ATOM 3904  N N    . SER A 1 50 ? 6.694   0.029   2.727   1.00 0.00 ? 50 SER A N    5  
ATOM 3905  C CA   . SER A 1 50 ? 7.297   -0.819  3.738   1.00 0.00 ? 50 SER A CA   5  
ATOM 3906  C C    . SER A 1 50 ? 6.363   -0.941  4.925   1.00 0.00 ? 50 SER A C    5  
ATOM 3907  O O    . SER A 1 50 ? 6.332   -0.076  5.800   1.00 0.00 ? 50 SER A O    5  
ATOM 3908  C CB   . SER A 1 50 ? 8.644   -0.264  4.180   1.00 0.00 ? 50 SER A CB   5  
ATOM 3909  O OG   . SER A 1 50 ? 8.585   1.140   4.368   1.00 0.00 ? 50 SER A OG   5  
ATOM 3910  H H    . SER A 1 50 ? 6.246   0.863   2.995   1.00 0.00 ? 50 SER A H    5  
ATOM 3911  H HA   . SER A 1 50 ? 7.441   -1.800  3.307   1.00 0.00 ? 50 SER A HA   5  
ATOM 3912  H HB2  . SER A 1 50 ? 8.930   -0.728  5.111   1.00 0.00 ? 50 SER A HB2  5  
ATOM 3913  H HB3  . SER A 1 50 ? 9.382   -0.485  3.425   1.00 0.00 ? 50 SER A HB3  5  
ATOM 3914  H HG   . SER A 1 50 ? 8.643   1.341   5.304   1.00 0.00 ? 50 SER A HG   5  
ATOM 3915  N N    . ASN A 1 51 ? 5.588   -2.013  4.937   1.00 0.00 ? 51 ASN A N    5  
ATOM 3916  C CA   . ASN A 1 51 ? 4.632   -2.241  6.005   1.00 0.00 ? 51 ASN A CA   5  
ATOM 3917  C C    . ASN A 1 51 ? 5.291   -2.161  7.371   1.00 0.00 ? 51 ASN A C    5  
ATOM 3918  O O    . ASN A 1 51 ? 6.329   -2.773  7.619   1.00 0.00 ? 51 ASN A O    5  
ATOM 3919  C CB   . ASN A 1 51 ? 3.943   -3.588  5.849   1.00 0.00 ? 51 ASN A CB   5  
ATOM 3920  C CG   . ASN A 1 51 ? 3.325   -3.773  4.477   1.00 0.00 ? 51 ASN A CG   5  
ATOM 3921  O OD1  . ASN A 1 51 ? 4.029   -3.894  3.476   1.00 0.00 ? 51 ASN A OD1  5  
ATOM 3922  N ND2  . ASN A 1 51 ? 1.998   -3.793  4.426   1.00 0.00 ? 51 ASN A ND2  5  
ATOM 3923  H H    . ASN A 1 51 ? 5.655   -2.657  4.204   1.00 0.00 ? 51 ASN A H    5  
ATOM 3924  H HA   . ASN A 1 51 ? 3.886   -1.466  5.941   1.00 0.00 ? 51 ASN A HA   5  
ATOM 3925  H HB2  . ASN A 1 51 ? 4.664   -4.375  6.009   1.00 0.00 ? 51 ASN A HB2  5  
ATOM 3926  H HB3  . ASN A 1 51 ? 3.163   -3.660  6.591   1.00 0.00 ? 51 ASN A HB3  5  
ATOM 3927  H HD21 . ASN A 1 51 ? 1.500   -3.689  5.264   1.00 0.00 ? 51 ASN A HD21 5  
ATOM 3928  H HD22 . ASN A 1 51 ? 1.570   -3.911  3.552   1.00 0.00 ? 51 ASN A HD22 5  
ATOM 3929  N N    . GLY A 1 52 ? 4.666   -1.398  8.247   1.00 0.00 ? 52 GLY A N    5  
ATOM 3930  C CA   . GLY A 1 52 ? 5.180   -1.230  9.596   1.00 0.00 ? 52 GLY A CA   5  
ATOM 3931  C C    . GLY A 1 52 ? 5.157   0.216   10.058  1.00 0.00 ? 52 GLY A C    5  
ATOM 3932  O O    . GLY A 1 52 ? 5.040   1.127   9.240   1.00 0.00 ? 52 GLY A O    5  
ATOM 3933  H H    . GLY A 1 52 ? 3.841   -0.946  7.970   1.00 0.00 ? 52 GLY A H    5  
ATOM 3934  H HA2  . GLY A 1 52 ? 4.579   -1.820  10.272  1.00 0.00 ? 52 GLY A HA2  5  
ATOM 3935  H HA3  . GLY A 1 52 ? 6.197   -1.591  9.627   1.00 0.00 ? 52 GLY A HA3  5  
ATOM 3936  N N    . PRO A 1 53 ? 5.274   0.457   11.376  1.00 0.00 ? 53 PRO A N    5  
ATOM 3937  C CA   . PRO A 1 53 ? 5.268   1.814   11.938  1.00 0.00 ? 53 PRO A CA   5  
ATOM 3938  C C    . PRO A 1 53 ? 6.480   2.627   11.497  1.00 0.00 ? 53 PRO A C    5  
ATOM 3939  O O    . PRO A 1 53 ? 7.562   2.511   12.073  1.00 0.00 ? 53 PRO A O    5  
ATOM 3940  C CB   . PRO A 1 53 ? 5.301   1.581   13.452  1.00 0.00 ? 53 PRO A CB   5  
ATOM 3941  C CG   . PRO A 1 53 ? 5.876   0.217   13.618  1.00 0.00 ? 53 PRO A CG   5  
ATOM 3942  C CD   . PRO A 1 53 ? 5.423   -0.571  12.421  1.00 0.00 ? 53 PRO A CD   5  
ATOM 3943  H HA   . PRO A 1 53 ? 4.366   2.346   11.673  1.00 0.00 ? 53 PRO A HA   5  
ATOM 3944  H HB2  . PRO A 1 53 ? 5.923   2.331   13.920  1.00 0.00 ? 53 PRO A HB2  5  
ATOM 3945  H HB3  . PRO A 1 53 ? 4.299   1.638   13.850  1.00 0.00 ? 53 PRO A HB3  5  
ATOM 3946  H HG2  . PRO A 1 53 ? 6.954   0.273   13.645  1.00 0.00 ? 53 PRO A HG2  5  
ATOM 3947  H HG3  . PRO A 1 53 ? 5.500   -0.232  14.526  1.00 0.00 ? 53 PRO A HG3  5  
ATOM 3948  H HD2  . PRO A 1 53 ? 6.171   -1.299  12.143  1.00 0.00 ? 53 PRO A HD2  5  
ATOM 3949  H HD3  . PRO A 1 53 ? 4.479   -1.055  12.623  1.00 0.00 ? 53 PRO A HD3  5  
ATOM 3950  N N    . CYS A 1 54 ? 6.289   3.445   10.469  1.00 0.00 ? 54 CYS A N    5  
ATOM 3951  C CA   . CYS A 1 54 ? 7.364   4.278   9.940   1.00 0.00 ? 54 CYS A CA   5  
ATOM 3952  C C    . CYS A 1 54 ? 6.979   5.757   9.982   1.00 0.00 ? 54 CYS A C    5  
ATOM 3953  O O    . CYS A 1 54 ? 7.838   6.625   10.131  1.00 0.00 ? 54 CYS A O    5  
ATOM 3954  C CB   . CYS A 1 54 ? 7.700   3.835   8.507   1.00 0.00 ? 54 CYS A CB   5  
ATOM 3955  S SG   . CYS A 1 54 ? 8.211   5.171   7.371   1.00 0.00 ? 54 CYS A SG   5  
ATOM 3956  H H    . CYS A 1 54 ? 5.405   3.486   10.052  1.00 0.00 ? 54 CYS A H    5  
ATOM 3957  H HA   . CYS A 1 54 ? 8.232   4.129   10.565  1.00 0.00 ? 54 CYS A HA   5  
ATOM 3958  H HB2  . CYS A 1 54 ? 8.509   3.120   8.545   1.00 0.00 ? 54 CYS A HB2  5  
ATOM 3959  H HB3  . CYS A 1 54 ? 6.832   3.356   8.081   1.00 0.00 ? 54 CYS A HB3  5  
ATOM 3960  N N    . GLU A 1 55 ? 5.684   6.038   9.852   1.00 0.00 ? 55 GLU A N    5  
ATOM 3961  C CA   . GLU A 1 55 ? 5.193   7.412   9.876   1.00 0.00 ? 55 GLU A CA   5  
ATOM 3962  C C    . GLU A 1 55 ? 5.653   8.136   11.138  1.00 0.00 ? 55 GLU A C    5  
ATOM 3963  O O    . GLU A 1 55 ? 5.818   7.464   12.179  1.00 0.00 ? 55 GLU A O    5  
ATOM 3964  C CB   . GLU A 1 55 ? 3.664   7.429   9.791   1.00 0.00 ? 55 GLU A CB   5  
ATOM 3965  C CG   . GLU A 1 55 ? 2.977   6.846   11.016  1.00 0.00 ? 55 GLU A CG   5  
ATOM 3966  C CD   . GLU A 1 55 ? 1.504   7.201   11.083  1.00 0.00 ? 55 GLU A CD   5  
ATOM 3967  O OE1  . GLU A 1 55 ? 1.188   8.363   11.415  1.00 0.00 ? 55 GLU A OE1  5  
ATOM 3968  O OE2  . GLU A 1 55 ? 0.668   6.317   10.805  1.00 0.00 ? 55 GLU A OE2  5  
ATOM 3969  O OXT  . GLU A 1 55 ? 5.846   9.368   11.075  1.00 0.00 ? 55 GLU A OXT  5  
ATOM 3970  H H    . GLU A 1 55 ? 5.045   5.305   9.736   1.00 0.00 ? 55 GLU A H    5  
ATOM 3971  H HA   . GLU A 1 55 ? 5.597   7.922   9.016   1.00 0.00 ? 55 GLU A HA   5  
ATOM 3972  H HB2  . GLU A 1 55 ? 3.333   8.450   9.671   1.00 0.00 ? 55 GLU A HB2  5  
ATOM 3973  H HB3  . GLU A 1 55 ? 3.357   6.858   8.928   1.00 0.00 ? 55 GLU A HB3  5  
ATOM 3974  H HG2  . GLU A 1 55 ? 3.072   5.772   10.990  1.00 0.00 ? 55 GLU A HG2  5  
ATOM 3975  H HG3  . GLU A 1 55 ? 3.465   7.228   11.901  1.00 0.00 ? 55 GLU A HG3  5  
ATOM 3976  N N    . ALA A 1 1  ? 11.599  -0.571  -1.049  1.00 0.00 ? 1  ALA A N    6  
ATOM 3977  C CA   . ALA A 1 1  ? 10.836  -1.693  -0.447  1.00 0.00 ? 1  ALA A CA   6  
ATOM 3978  C C    . ALA A 1 1  ? 9.482   -1.858  -1.128  1.00 0.00 ? 1  ALA A C    6  
ATOM 3979  O O    . ALA A 1 1  ? 8.462   -1.389  -0.624  1.00 0.00 ? 1  ALA A O    6  
ATOM 3980  C CB   . ALA A 1 1  ? 10.650  -1.464  1.045   1.00 0.00 ? 1  ALA A CB   6  
ATOM 3981  H H1   . ALA A 1 1  ? 12.610  -0.746  -0.879  1.00 0.00 ? 1  ALA A H1   6  
ATOM 3982  H H2   . ALA A 1 1  ? 11.286  0.308   -0.588  1.00 0.00 ? 1  ALA A H2   6  
ATOM 3983  H H3   . ALA A 1 1  ? 11.390  -0.555  -2.068  1.00 0.00 ? 1  ALA A H3   6  
ATOM 3984  H HA   . ALA A 1 1  ? 11.406  -2.602  -0.580  1.00 0.00 ? 1  ALA A HA   6  
ATOM 3985  H HB1  . ALA A 1 1  ? 11.504  -1.856  1.579   1.00 0.00 ? 1  ALA A HB1  6  
ATOM 3986  H HB2  . ALA A 1 1  ? 9.754   -1.969  1.378   1.00 0.00 ? 1  ALA A HB2  6  
ATOM 3987  H HB3  . ALA A 1 1  ? 10.559  -0.406  1.237   1.00 0.00 ? 1  ALA A HB3  6  
ATOM 3988  N N    . HIS A 1 2  ? 9.479   -2.528  -2.275  1.00 0.00 ? 2  HIS A N    6  
ATOM 3989  C CA   . HIS A 1 2  ? 8.253   -2.755  -3.025  1.00 0.00 ? 2  HIS A CA   6  
ATOM 3990  C C    . HIS A 1 2  ? 7.973   -4.238  -3.161  1.00 0.00 ? 2  HIS A C    6  
ATOM 3991  O O    . HIS A 1 2  ? 8.607   -4.927  -3.960  1.00 0.00 ? 2  HIS A O    6  
ATOM 3992  C CB   . HIS A 1 2  ? 8.345   -2.136  -4.413  1.00 0.00 ? 2  HIS A CB   6  
ATOM 3993  C CG   . HIS A 1 2  ? 7.018   -2.049  -5.091  1.00 0.00 ? 2  HIS A CG   6  
ATOM 3994  N ND1  . HIS A 1 2  ? 5.900   -1.545  -4.467  1.00 0.00 ? 2  HIS A ND1  6  
ATOM 3995  C CD2  . HIS A 1 2  ? 6.631   -2.388  -6.341  1.00 0.00 ? 2  HIS A CD2  6  
ATOM 3996  C CE1  . HIS A 1 2  ? 4.884   -1.571  -5.299  1.00 0.00 ? 2  HIS A CE1  6  
ATOM 3997  N NE2  . HIS A 1 2  ? 5.297   -2.080  -6.447  1.00 0.00 ? 2  HIS A NE2  6  
ATOM 3998  H H    . HIS A 1 2  ? 10.321  -2.881  -2.624  1.00 0.00 ? 2  HIS A H    6  
ATOM 3999  H HA   . HIS A 1 2  ? 7.440   -2.294  -2.485  1.00 0.00 ? 2  HIS A HA   6  
ATOM 4000  H HB2  . HIS A 1 2  ? 8.746   -1.136  -4.332  1.00 0.00 ? 2  HIS A HB2  6  
ATOM 4001  H HB3  . HIS A 1 2  ? 8.997   -2.735  -5.029  1.00 0.00 ? 2  HIS A HB3  6  
ATOM 4002  H HD1  . HIS A 1 2  ? 5.855   -1.226  -3.542  1.00 0.00 ? 2  HIS A HD1  6  
ATOM 4003  H HD2  . HIS A 1 2  ? 7.255   -2.817  -7.113  1.00 0.00 ? 2  HIS A HD2  6  
ATOM 4004  H HE1  . HIS A 1 2  ? 3.891   -1.218  -5.085  1.00 0.00 ? 2  HIS A HE1  6  
ATOM 4005  H HE2  . HIS A 1 2  ? 4.714   -2.331  -7.194  1.00 0.00 ? 2  HIS A HE2  6  
ATOM 4006  N N    . MET A 1 3  ? 7.026   -4.730  -2.378  1.00 0.00 ? 3  MET A N    6  
ATOM 4007  C CA   . MET A 1 3  ? 6.691   -6.160  -2.441  1.00 0.00 ? 3  MET A CA   6  
ATOM 4008  C C    . MET A 1 3  ? 5.443   -6.555  -1.641  1.00 0.00 ? 3  MET A C    6  
ATOM 4009  O O    . MET A 1 3  ? 4.374   -6.787  -2.208  1.00 0.00 ? 3  MET A O    6  
ATOM 4010  C CB   . MET A 1 3  ? 7.886   -6.990  -1.966  1.00 0.00 ? 3  MET A CB   6  
ATOM 4011  C CG   . MET A 1 3  ? 8.753   -7.513  -3.100  1.00 0.00 ? 3  MET A CG   6  
ATOM 4012  S SD   . MET A 1 3  ? 9.107   -9.276  -2.953  1.00 0.00 ? 3  MET A SD   6  
ATOM 4013  C CE   . MET A 1 3  ? 7.983   -9.949  -4.174  1.00 0.00 ? 3  MET A CE   6  
ATOM 4014  H H    . MET A 1 3  ? 6.553   -4.122  -1.763  1.00 0.00 ? 3  MET A H    6  
ATOM 4015  H HA   . MET A 1 3  ? 6.511   -6.399  -3.478  1.00 0.00 ? 3  MET A HA   6  
ATOM 4016  H HB2  . MET A 1 3  ? 8.501   -6.378  -1.324  1.00 0.00 ? 3  MET A HB2  6  
ATOM 4017  H HB3  . MET A 1 3  ? 7.521   -7.835  -1.401  1.00 0.00 ? 3  MET A HB3  6  
ATOM 4018  H HG2  . MET A 1 3  ? 8.241   -7.342  -4.036  1.00 0.00 ? 3  MET A HG2  6  
ATOM 4019  H HG3  . MET A 1 3  ? 9.688   -6.971  -3.099  1.00 0.00 ? 3  MET A HG3  6  
ATOM 4020  H HE1  . MET A 1 3  ? 8.422   -10.829 -4.621  1.00 0.00 ? 3  MET A HE1  6  
ATOM 4021  H HE2  . MET A 1 3  ? 7.800   -9.210  -4.940  1.00 0.00 ? 3  MET A HE2  6  
ATOM 4022  H HE3  . MET A 1 3  ? 7.051   -10.213 -3.698  1.00 0.00 ? 3  MET A HE3  6  
ATOM 4023  N N    . ASP A 1 4  ? 5.612   -6.685  -0.327  1.00 0.00 ? 4  ASP A N    6  
ATOM 4024  C CA   . ASP A 1 4  ? 4.537   -7.115  0.576   1.00 0.00 ? 4  ASP A CA   6  
ATOM 4025  C C    . ASP A 1 4  ? 3.210   -6.377  0.369   1.00 0.00 ? 4  ASP A C    6  
ATOM 4026  O O    . ASP A 1 4  ? 2.938   -5.381  1.038   1.00 0.00 ? 4  ASP A O    6  
ATOM 4027  C CB   . ASP A 1 4  ? 4.985   -6.944  2.027   1.00 0.00 ? 4  ASP A CB   6  
ATOM 4028  C CG   . ASP A 1 4  ? 4.013   -7.568  3.008   1.00 0.00 ? 4  ASP A CG   6  
ATOM 4029  O OD1  . ASP A 1 4  ? 3.054   -6.879  3.413   1.00 0.00 ? 4  ASP A OD1  6  
ATOM 4030  O OD2  . ASP A 1 4  ? 4.211   -8.747  3.372   1.00 0.00 ? 4  ASP A OD2  6  
ATOM 4031  H H    . ASP A 1 4  ? 6.502   -6.526  0.048   1.00 0.00 ? 4  ASP A H    6  
ATOM 4032  H HA   . ASP A 1 4  ? 4.370   -8.165  0.397   1.00 0.00 ? 4  ASP A HA   6  
ATOM 4033  H HB2  . ASP A 1 4  ? 5.949   -7.412  2.157   1.00 0.00 ? 4  ASP A HB2  6  
ATOM 4034  H HB3  . ASP A 1 4  ? 5.067   -5.891  2.250   1.00 0.00 ? 4  ASP A HB3  6  
ATOM 4035  N N    . CYS A 1 5  ? 2.366   -6.900  -0.521  1.00 0.00 ? 5  CYS A N    6  
ATOM 4036  C CA   . CYS A 1 5  ? 1.046   -6.316  -0.765  1.00 0.00 ? 5  CYS A CA   6  
ATOM 4037  C C    . CYS A 1 5  ? 0.118   -7.323  -1.438  1.00 0.00 ? 5  CYS A C    6  
ATOM 4038  O O    . CYS A 1 5  ? 0.485   -8.479  -1.645  1.00 0.00 ? 5  CYS A O    6  
ATOM 4039  C CB   . CYS A 1 5  ? 1.128   -5.032  -1.596  1.00 0.00 ? 5  CYS A CB   6  
ATOM 4040  S SG   . CYS A 1 5  ? 1.762   -5.256  -3.290  1.00 0.00 ? 5  CYS A SG   6  
ATOM 4041  H H    . CYS A 1 5  ? 2.622   -7.717  -0.998  1.00 0.00 ? 5  CYS A H    6  
ATOM 4042  H HA   . CYS A 1 5  ? 0.627   -6.070  0.200   1.00 0.00 ? 5  CYS A HA   6  
ATOM 4043  H HB2  . CYS A 1 5  ? 0.139   -4.612  -1.675  1.00 0.00 ? 5  CYS A HB2  6  
ATOM 4044  H HB3  . CYS A 1 5  ? 1.770   -4.326  -1.092  1.00 0.00 ? 5  CYS A HB3  6  
ATOM 4045  N N    . THR A 1 6  ? -1.092  -6.877  -1.767  1.00 0.00 ? 6  THR A N    6  
ATOM 4046  C CA   . THR A 1 6  ? -2.082  -7.737  -2.407  1.00 0.00 ? 6  THR A CA   6  
ATOM 4047  C C    . THR A 1 6  ? -1.547  -8.348  -3.712  1.00 0.00 ? 6  THR A C    6  
ATOM 4048  O O    . THR A 1 6  ? -2.011  -9.410  -4.118  1.00 0.00 ? 6  THR A O    6  
ATOM 4049  C CB   . THR A 1 6  ? -3.352  -6.939  -2.700  1.00 0.00 ? 6  THR A CB   6  
ATOM 4050  O OG1  . THR A 1 6  ? -3.036  -5.605  -3.057  1.00 0.00 ? 6  THR A OG1  6  
ATOM 4051  C CG2  . THR A 1 6  ? -4.306  -6.887  -1.526  1.00 0.00 ? 6  THR A CG2  6  
ATOM 4052  H H    . THR A 1 6  ? -1.330  -5.945  -1.571  1.00 0.00 ? 6  THR A H    6  
ATOM 4053  H HA   . THR A 1 6  ? -2.334  -8.543  -1.709  1.00 0.00 ? 6  THR A HA   6  
ATOM 4054  H HB   . THR A 1 6  ? -3.872  -7.399  -3.528  1.00 0.00 ? 6  THR A HB   6  
ATOM 4055  H HG1  . THR A 1 6  ? -3.031  -5.523  -4.014  1.00 0.00 ? 6  THR A HG1  6  
ATOM 4056  H HG21 . THR A 1 6  ? -3.984  -6.123  -0.835  1.00 0.00 ? 6  THR A HG21 6  
ATOM 4057  H HG22 . THR A 1 6  ? -4.314  -7.845  -1.027  1.00 0.00 ? 6  THR A HG22 6  
ATOM 4058  H HG23 . THR A 1 6  ? -5.300  -6.656  -1.879  1.00 0.00 ? 6  THR A HG23 6  
ATOM 4059  N N    . GLU A 1 7  ? -0.582  -7.666  -4.376  1.00 0.00 ? 7  GLU A N    6  
ATOM 4060  C CA   . GLU A 1 7  ? -0.001  -8.136  -5.646  1.00 0.00 ? 7  GLU A CA   6  
ATOM 4061  C C    . GLU A 1 7  ? -0.215  -9.632  -5.890  1.00 0.00 ? 7  GLU A C    6  
ATOM 4062  O O    . GLU A 1 7  ? 0.666   -10.452 -5.628  1.00 0.00 ? 7  GLU A O    6  
ATOM 4063  C CB   . GLU A 1 7  ? 1.497   -7.819  -5.685  1.00 0.00 ? 7  GLU A CB   6  
ATOM 4064  C CG   . GLU A 1 7  ? 1.862   -6.738  -6.691  1.00 0.00 ? 7  GLU A CG   6  
ATOM 4065  C CD   . GLU A 1 7  ? 3.349   -6.444  -6.718  1.00 0.00 ? 7  GLU A CD   6  
ATOM 4066  O OE1  . GLU A 1 7  ? 4.139   -7.345  -6.365  1.00 0.00 ? 7  GLU A OE1  6  
ATOM 4067  O OE2  . GLU A 1 7  ? 3.724   -5.313  -7.091  1.00 0.00 ? 7  GLU A OE2  6  
ATOM 4068  H H    . GLU A 1 7  ? -0.257  -6.809  -4.013  1.00 0.00 ? 7  GLU A H    6  
ATOM 4069  H HA   . GLU A 1 7  ? -0.484  -7.592  -6.442  1.00 0.00 ? 7  GLU A HA   6  
ATOM 4070  H HB2  . GLU A 1 7  ? 1.811   -7.491  -4.706  1.00 0.00 ? 7  GLU A HB2  6  
ATOM 4071  H HB3  . GLU A 1 7  ? 2.040   -8.716  -5.944  1.00 0.00 ? 7  GLU A HB3  6  
ATOM 4072  H HG2  . GLU A 1 7  ? 1.558   -7.063  -7.674  1.00 0.00 ? 7  GLU A HG2  6  
ATOM 4073  H HG3  . GLU A 1 7  ? 1.336   -5.831  -6.433  1.00 0.00 ? 7  GLU A HG3  6  
ATOM 4074  N N    . PHE A 1 8  ? -1.391  -9.970  -6.408  1.00 0.00 ? 8  PHE A N    6  
ATOM 4075  C CA   . PHE A 1 8  ? -1.742  -11.353 -6.713  1.00 0.00 ? 8  PHE A CA   6  
ATOM 4076  C C    . PHE A 1 8  ? -2.908  -11.382 -7.704  1.00 0.00 ? 8  PHE A C    6  
ATOM 4077  O O    . PHE A 1 8  ? -3.071  -10.452 -8.493  1.00 0.00 ? 8  PHE A O    6  
ATOM 4078  C CB   . PHE A 1 8  ? -2.088  -12.111 -5.427  1.00 0.00 ? 8  PHE A CB   6  
ATOM 4079  C CG   . PHE A 1 8  ? -1.393  -13.439 -5.309  1.00 0.00 ? 8  PHE A CG   6  
ATOM 4080  C CD1  . PHE A 1 8  ? -1.340  -14.307 -6.388  1.00 0.00 ? 8  PHE A CD1  6  
ATOM 4081  C CD2  . PHE A 1 8  ? -0.792  -13.817 -4.119  1.00 0.00 ? 8  PHE A CD2  6  
ATOM 4082  C CE1  . PHE A 1 8  ? -0.701  -15.528 -6.282  1.00 0.00 ? 8  PHE A CE1  6  
ATOM 4083  C CE2  . PHE A 1 8  ? -0.151  -15.038 -4.006  1.00 0.00 ? 8  PHE A CE2  6  
ATOM 4084  C CZ   . PHE A 1 8  ? -0.106  -15.893 -5.089  1.00 0.00 ? 8  PHE A CZ   6  
ATOM 4085  H H    . PHE A 1 8  ? -2.043  -9.263  -6.602  1.00 0.00 ? 8  PHE A H    6  
ATOM 4086  H HA   . PHE A 1 8  ? -0.882  -11.815 -7.176  1.00 0.00 ? 8  PHE A HA   6  
ATOM 4087  H HB2  . PHE A 1 8  ? -1.800  -11.512 -4.576  1.00 0.00 ? 8  PHE A HB2  6  
ATOM 4088  H HB3  . PHE A 1 8  ? -3.150  -12.287 -5.393  1.00 0.00 ? 8  PHE A HB3  6  
ATOM 4089  H HD1  . PHE A 1 8  ? -1.804  -14.022 -7.321  1.00 0.00 ? 8  PHE A HD1  6  
ATOM 4090  H HD2  . PHE A 1 8  ? -0.826  -13.149 -3.271  1.00 0.00 ? 8  PHE A HD2  6  
ATOM 4091  H HE1  . PHE A 1 8  ? -0.667  -16.196 -7.130  1.00 0.00 ? 8  PHE A HE1  6  
ATOM 4092  H HE2  . PHE A 1 8  ? 0.312   -15.321 -3.073  1.00 0.00 ? 8  PHE A HE2  6  
ATOM 4093  H HZ   . PHE A 1 8  ? 0.393   -16.847 -5.004  1.00 0.00 ? 8  PHE A HZ   6  
ATOM 4094  N N    . ASN A 1 9  ? -3.724  -12.433 -7.667  1.00 0.00 ? 9  ASN A N    6  
ATOM 4095  C CA   . ASN A 1 9  ? -4.863  -12.530 -8.574  1.00 0.00 ? 9  ASN A CA   6  
ATOM 4096  C C    . ASN A 1 9  ? -5.933  -11.500 -8.207  1.00 0.00 ? 9  ASN A C    6  
ATOM 4097  O O    . ASN A 1 9  ? -6.408  -10.757 -9.066  1.00 0.00 ? 9  ASN A O    6  
ATOM 4098  C CB   . ASN A 1 9  ? -5.463  -13.940 -8.559  1.00 0.00 ? 9  ASN A CB   6  
ATOM 4099  C CG   . ASN A 1 9  ? -4.411  -15.023 -8.409  1.00 0.00 ? 9  ASN A CG   6  
ATOM 4100  O OD1  . ASN A 1 9  ? -4.291  -15.647 -7.354  1.00 0.00 ? 9  ASN A OD1  6  
ATOM 4101  N ND2  . ASN A 1 9  ? -3.642  -15.251 -9.467  1.00 0.00 ? 9  ASN A ND2  6  
ATOM 4102  H H    . ASN A 1 9  ? -3.563  -13.151 -7.021  1.00 0.00 ? 9  ASN A H    6  
ATOM 4103  H HA   . ASN A 1 9  ? -4.507  -12.313 -9.571  1.00 0.00 ? 9  ASN A HA   6  
ATOM 4104  H HB2  . ASN A 1 9  ? -6.158  -14.022 -7.738  1.00 0.00 ? 9  ASN A HB2  6  
ATOM 4105  H HB3  . ASN A 1 9  ? -5.992  -14.106 -9.486  1.00 0.00 ? 9  ASN A HB3  6  
ATOM 4106  H HD21 . ASN A 1 9  ? -3.795  -14.716 -10.274 1.00 0.00 ? 9  ASN A HD21 6  
ATOM 4107  H HD22 . ASN A 1 9  ? -2.954  -15.947 -9.399  1.00 0.00 ? 9  ASN A HD22 6  
ATOM 4108  N N    . PRO A 1 10 ? -6.326  -11.437 -6.920  1.00 0.00 ? 10 PRO A N    6  
ATOM 4109  C CA   . PRO A 1 10 ? -7.329  -10.502 -6.440  1.00 0.00 ? 10 PRO A CA   6  
ATOM 4110  C C    . PRO A 1 10 ? -6.703  -9.235  -5.864  1.00 0.00 ? 10 PRO A C    6  
ATOM 4111  O O    . PRO A 1 10 ? -6.380  -9.176  -4.677  1.00 0.00 ? 10 PRO A O    6  
ATOM 4112  C CB   . PRO A 1 10 ? -8.020  -11.308 -5.342  1.00 0.00 ? 10 PRO A CB   6  
ATOM 4113  C CG   . PRO A 1 10 ? -6.984  -12.272 -4.835  1.00 0.00 ? 10 PRO A CG   6  
ATOM 4114  C CD   . PRO A 1 10 ? -5.831  -12.266 -5.815  1.00 0.00 ? 10 PRO A CD   6  
ATOM 4115  H HA   . PRO A 1 10 ? -8.040  -10.243 -7.210  1.00 0.00 ? 10 PRO A HA   6  
ATOM 4116  H HB2  . PRO A 1 10 ? -8.352  -10.641 -4.559  1.00 0.00 ? 10 PRO A HB2  6  
ATOM 4117  H HB3  . PRO A 1 10 ? -8.869  -11.830 -5.758  1.00 0.00 ? 10 PRO A HB3  6  
ATOM 4118  H HG2  . PRO A 1 10 ? -6.641  -11.956 -3.862  1.00 0.00 ? 10 PRO A HG2  6  
ATOM 4119  H HG3  . PRO A 1 10 ? -7.412  -13.262 -4.773  1.00 0.00 ? 10 PRO A HG3  6  
ATOM 4120  H HD2  . PRO A 1 10 ? -4.960  -11.818 -5.363  1.00 0.00 ? 10 PRO A HD2  6  
ATOM 4121  H HD3  . PRO A 1 10 ? -5.613  -13.268 -6.150  1.00 0.00 ? 10 PRO A HD3  6  
ATOM 4122  N N    . LEU A 1 11 ? -6.528  -8.224  -6.710  1.00 0.00 ? 11 LEU A N    6  
ATOM 4123  C CA   . LEU A 1 11 ? -5.934  -6.959  -6.282  1.00 0.00 ? 11 LEU A CA   6  
ATOM 4124  C C    . LEU A 1 11 ? -6.644  -6.403  -5.062  1.00 0.00 ? 11 LEU A C    6  
ATOM 4125  O O    . LEU A 1 11 ? -7.616  -6.988  -4.597  1.00 0.00 ? 11 LEU A O    6  
ATOM 4126  C CB   . LEU A 1 11 ? -5.967  -5.939  -7.420  1.00 0.00 ? 11 LEU A CB   6  
ATOM 4127  C CG   . LEU A 1 11 ? -5.343  -6.412  -8.734  1.00 0.00 ? 11 LEU A CG   6  
ATOM 4128  C CD1  . LEU A 1 11 ? -6.055  -5.780  -9.921  1.00 0.00 ? 11 LEU A CD1  6  
ATOM 4129  C CD2  . LEU A 1 11 ? -3.857  -6.084  -8.766  1.00 0.00 ? 11 LEU A CD2  6  
ATOM 4130  H H    . LEU A 1 11 ? -6.802  -8.331  -7.645  1.00 0.00 ? 11 LEU A H    6  
ATOM 4131  H HA   . LEU A 1 11 ? -4.911  -7.152  -6.010  1.00 0.00 ? 11 LEU A HA   6  
ATOM 4132  H HB2  . LEU A 1 11 ? -6.997  -5.675  -7.609  1.00 0.00 ? 11 LEU A HB2  6  
ATOM 4133  H HB3  . LEU A 1 11 ? -5.440  -5.055  -7.097  1.00 0.00 ? 11 LEU A HB3  6  
ATOM 4134  H HG   . LEU A 1 11 ? -5.452  -7.483  -8.813  1.00 0.00 ? 11 LEU A HG   6  
ATOM 4135  H HD11 . LEU A 1 11 ? -6.125  -6.498  -10.723 1.00 0.00 ? 11 LEU A HD11 6  
ATOM 4136  H HD12 . LEU A 1 11 ? -5.499  -4.917  -10.256 1.00 0.00 ? 11 LEU A HD12 6  
ATOM 4137  H HD13 . LEU A 1 11 ? -7.048  -5.474  -9.623  1.00 0.00 ? 11 LEU A HD13 6  
ATOM 4138  H HD21 . LEU A 1 11 ? -3.706  -5.150  -9.287  1.00 0.00 ? 11 LEU A HD21 6  
ATOM 4139  H HD22 . LEU A 1 11 ? -3.326  -6.872  -9.279  1.00 0.00 ? 11 LEU A HD22 6  
ATOM 4140  H HD23 . LEU A 1 11 ? -3.487  -5.998  -7.756  1.00 0.00 ? 11 LEU A HD23 6  
ATOM 4141  N N    . CYS A 1 12 ? -6.121  -5.282  -4.545  1.00 0.00 ? 12 CYS A N    6  
ATOM 4142  C CA   . CYS A 1 12 ? -6.651  -4.615  -3.352  1.00 0.00 ? 12 CYS A CA   6  
ATOM 4143  C C    . CYS A 1 12 ? -8.082  -5.017  -3.039  1.00 0.00 ? 12 CYS A C    6  
ATOM 4144  O O    . CYS A 1 12 ? -8.999  -4.194  -3.042  1.00 0.00 ? 12 CYS A O    6  
ATOM 4145  C CB   . CYS A 1 12 ? -6.555  -3.099  -3.492  1.00 0.00 ? 12 CYS A CB   6  
ATOM 4146  S SG   . CYS A 1 12 ? -7.530  -2.402  -4.863  1.00 0.00 ? 12 CYS A SG   6  
ATOM 4147  H H    . CYS A 1 12 ? -5.330  -4.901  -4.971  1.00 0.00 ? 12 CYS A H    6  
ATOM 4148  H HA   . CYS A 1 12 ? -6.033  -4.917  -2.523  1.00 0.00 ? 12 CYS A HA   6  
ATOM 4149  H HB2  . CYS A 1 12 ? -6.900  -2.640  -2.579  1.00 0.00 ? 12 CYS A HB2  6  
ATOM 4150  H HB3  . CYS A 1 12 ? -5.523  -2.828  -3.652  1.00 0.00 ? 12 CYS A HB3  6  
ATOM 4151  N N    . ARG A 1 13 ? -8.248  -6.296  -2.759  1.00 0.00 ? 13 ARG A N    6  
ATOM 4152  C CA   . ARG A 1 13 ? -9.552  -6.853  -2.424  1.00 0.00 ? 13 ARG A CA   6  
ATOM 4153  C C    . ARG A 1 13 ? -9.833  -6.696  -0.931  1.00 0.00 ? 13 ARG A C    6  
ATOM 4154  O O    . ARG A 1 13 ? -10.461 -7.555  -0.312  1.00 0.00 ? 13 ARG A O    6  
ATOM 4155  C CB   . ARG A 1 13 ? -9.623  -8.331  -2.817  1.00 0.00 ? 13 ARG A CB   6  
ATOM 4156  C CG   . ARG A 1 13 ? -10.983 -8.756  -3.346  1.00 0.00 ? 13 ARG A CG   6  
ATOM 4157  C CD   . ARG A 1 13 ? -11.066 -10.263 -3.526  1.00 0.00 ? 13 ARG A CD   6  
ATOM 4158  N NE   . ARG A 1 13 ? -12.442 -10.750 -3.448  1.00 0.00 ? 13 ARG A NE   6  
ATOM 4159  C CZ   . ARG A 1 13 ? -13.104 -10.925 -2.306  1.00 0.00 ? 13 ARG A CZ   6  
ATOM 4160  N NH1  . ARG A 1 13 ? -12.522 -10.656 -1.145  1.00 0.00 ? 13 ARG A NH1  6  
ATOM 4161  N NH2  . ARG A 1 13 ? -14.354 -11.370 -2.326  1.00 0.00 ? 13 ARG A NH2  6  
ATOM 4162  H H    . ARG A 1 13 ? -7.459  -6.884  -2.783  1.00 0.00 ? 13 ARG A H    6  
ATOM 4163  H HA   . ARG A 1 13 ? -10.300 -6.305  -2.979  1.00 0.00 ? 13 ARG A HA   6  
ATOM 4164  H HB2  . ARG A 1 13 ? -8.887  -8.524  -3.582  1.00 0.00 ? 13 ARG A HB2  6  
ATOM 4165  H HB3  . ARG A 1 13 ? -9.394  -8.934  -1.949  1.00 0.00 ? 13 ARG A HB3  6  
ATOM 4166  H HG2  . ARG A 1 13 ? -11.744 -8.447  -2.645  1.00 0.00 ? 13 ARG A HG2  6  
ATOM 4167  H HG3  . ARG A 1 13 ? -11.154 -8.278  -4.299  1.00 0.00 ? 13 ARG A HG3  6  
ATOM 4168  H HD2  . ARG A 1 13 ? -10.659 -10.520 -4.493  1.00 0.00 ? 13 ARG A HD2  6  
ATOM 4169  H HD3  . ARG A 1 13 ? -10.481 -10.739 -2.753  1.00 0.00 ? 13 ARG A HD3  6  
ATOM 4170  H HE   . ARG A 1 13 ? -12.896 -10.958 -4.292  1.00 0.00 ? 13 ARG A HE   6  
ATOM 4171  H HH11 . ARG A 1 13 ? -11.580 -10.320 -1.123  1.00 0.00 ? 13 ARG A HH11 6  
ATOM 4172  H HH12 . ARG A 1 13 ? -13.025 -10.789 -0.291  1.00 0.00 ? 13 ARG A HH12 6  
ATOM 4173  H HH21 . ARG A 1 13 ? -14.799 -11.575 -3.198  1.00 0.00 ? 13 ARG A HH21 6  
ATOM 4174  H HH22 . ARG A 1 13 ? -14.852 -11.501 -1.468  1.00 0.00 ? 13 ARG A HH22 6  
ATOM 4175  N N    . CYS A 1 14 ? -9.362  -5.589  -0.364  1.00 0.00 ? 14 CYS A N    6  
ATOM 4176  C CA   . CYS A 1 14 ? -9.558  -5.306  1.048   1.00 0.00 ? 14 CYS A CA   6  
ATOM 4177  C C    . CYS A 1 14 ? -10.029 -3.865  1.242   1.00 0.00 ? 14 CYS A C    6  
ATOM 4178  O O    . CYS A 1 14 ? -9.308  -2.911  0.946   1.00 0.00 ? 14 CYS A O    6  
ATOM 4179  C CB   . CYS A 1 14 ? -8.265  -5.595  1.840   1.00 0.00 ? 14 CYS A CB   6  
ATOM 4180  S SG   . CYS A 1 14 ? -7.199  -4.149  2.188   1.00 0.00 ? 14 CYS A SG   6  
ATOM 4181  H H    . CYS A 1 14 ? -8.877  -4.944  -0.909  1.00 0.00 ? 14 CYS A H    6  
ATOM 4182  H HA   . CYS A 1 14 ? -10.336 -5.966  1.404   1.00 0.00 ? 14 CYS A HA   6  
ATOM 4183  H HB2  . CYS A 1 14 ? -8.534  -6.028  2.790   1.00 0.00 ? 14 CYS A HB2  6  
ATOM 4184  H HB3  . CYS A 1 14 ? -7.675  -6.310  1.285   1.00 0.00 ? 14 CYS A HB3  6  
ATOM 4185  N N    . ASN A 1 15 ? -11.250 -3.720  1.730   1.00 0.00 ? 15 ASN A N    6  
ATOM 4186  C CA   . ASN A 1 15 ? -11.832 -2.402  1.965   1.00 0.00 ? 15 ASN A CA   6  
ATOM 4187  C C    . ASN A 1 15 ? -11.414 -1.882  3.322   1.00 0.00 ? 15 ASN A C    6  
ATOM 4188  O O    . ASN A 1 15 ? -10.853 -0.796  3.423   1.00 0.00 ? 15 ASN A O    6  
ATOM 4189  C CB   . ASN A 1 15 ? -13.358 -2.466  1.906   1.00 0.00 ? 15 ASN A CB   6  
ATOM 4190  C CG   . ASN A 1 15 ? -13.936 -1.594  0.808   1.00 0.00 ? 15 ASN A CG   6  
ATOM 4191  O OD1  . ASN A 1 15 ? -14.839 -2.008  0.082   1.00 0.00 ? 15 ASN A OD1  6  
ATOM 4192  N ND2  . ASN A 1 15 ? -13.415 -0.380  0.683   1.00 0.00 ? 15 ASN A ND2  6  
ATOM 4193  H H    . ASN A 1 15 ? -11.773 -4.519  1.934   1.00 0.00 ? 15 ASN A H    6  
ATOM 4194  H HA   . ASN A 1 15 ? -11.472 -1.729  1.207   1.00 0.00 ? 15 ASN A HA   6  
ATOM 4195  H HB2  . ASN A 1 15 ? -13.657 -3.479  1.738   1.00 0.00 ? 15 ASN A HB2  6  
ATOM 4196  H HB3  . ASN A 1 15 ? -13.762 -2.132  2.850   1.00 0.00 ? 15 ASN A HB3  6  
ATOM 4197  H HD21 . ASN A 1 15 ? -12.699 -0.120  1.297   1.00 0.00 ? 15 ASN A HD21 6  
ATOM 4198  H HD22 . ASN A 1 15 ? -13.768 0.205   -0.019  1.00 0.00 ? 15 ASN A HD22 6  
ATOM 4199  N N    . LYS A 1 16 ? -11.715 -2.680  4.350   1.00 0.00 ? 16 LYS A N    6  
ATOM 4200  C CA   . LYS A 1 16 ? -11.413 -2.364  5.748   1.00 0.00 ? 16 LYS A CA   6  
ATOM 4201  C C    . LYS A 1 16 ? -10.336 -1.300  5.877   1.00 0.00 ? 16 LYS A C    6  
ATOM 4202  O O    . LYS A 1 16 ? -9.261  -1.547  6.420   1.00 0.00 ? 16 LYS A O    6  
ATOM 4203  C CB   . LYS A 1 16 ? -10.983 -3.631  6.490   1.00 0.00 ? 16 LYS A CB   6  
ATOM 4204  C CG   . LYS A 1 16 ? -10.794 -3.425  7.984   1.00 0.00 ? 16 LYS A CG   6  
ATOM 4205  C CD   . LYS A 1 16 ? -9.577  -4.176  8.504   1.00 0.00 ? 16 LYS A CD   6  
ATOM 4206  C CE   . LYS A 1 16 ? -9.466  -4.077  10.016  1.00 0.00 ? 16 LYS A CE   6  
ATOM 4207  N NZ   . LYS A 1 16 ? -10.736 -4.463  10.692  1.00 0.00 ? 16 LYS A NZ   6  
ATOM 4208  H H    . LYS A 1 16 ? -12.172 -3.516  4.159   1.00 0.00 ? 16 LYS A H    6  
ATOM 4209  H HA   . LYS A 1 16 ? -12.318 -1.991  6.200   1.00 0.00 ? 16 LYS A HA   6  
ATOM 4210  H HB2  . LYS A 1 16 ? -11.736 -4.393  6.347   1.00 0.00 ? 16 LYS A HB2  6  
ATOM 4211  H HB3  . LYS A 1 16 ? -10.049 -3.979  6.075   1.00 0.00 ? 16 LYS A HB3  6  
ATOM 4212  H HG2  . LYS A 1 16 ? -10.662 -2.371  8.178   1.00 0.00 ? 16 LYS A HG2  6  
ATOM 4213  H HG3  . LYS A 1 16 ? -11.672 -3.780  8.502   1.00 0.00 ? 16 LYS A HG3  6  
ATOM 4214  H HD2  . LYS A 1 16 ? -9.661  -5.216  8.225   1.00 0.00 ? 16 LYS A HD2  6  
ATOM 4215  H HD3  . LYS A 1 16 ? -8.687  -3.754  8.058   1.00 0.00 ? 16 LYS A HD3  6  
ATOM 4216  H HE2  . LYS A 1 16 ? -8.678  -4.736  10.351  1.00 0.00 ? 16 LYS A HE2  6  
ATOM 4217  H HE3  . LYS A 1 16 ? -9.221  -3.060  10.281  1.00 0.00 ? 16 LYS A HE3  6  
ATOM 4218  H HZ1  . LYS A 1 16 ? -11.444 -3.709  10.577  1.00 0.00 ? 16 LYS A HZ1  6  
ATOM 4219  H HZ2  . LYS A 1 16 ? -10.569 -4.613  11.708  1.00 0.00 ? 16 LYS A HZ2  6  
ATOM 4220  H HZ3  . LYS A 1 16 ? -11.108 -5.342  10.279  1.00 0.00 ? 16 LYS A HZ3  6  
ATOM 4221  N N    . MET A 1 17 ? -10.644 -0.125  5.347   1.00 0.00 ? 17 MET A N    6  
ATOM 4222  C CA   . MET A 1 17 ? -9.722  1.018   5.367   1.00 0.00 ? 17 MET A CA   6  
ATOM 4223  C C    . MET A 1 17 ? -9.379  1.454   6.792   1.00 0.00 ? 17 MET A C    6  
ATOM 4224  O O    . MET A 1 17 ? -9.549  2.612   7.173   1.00 0.00 ? 17 MET A O    6  
ATOM 4225  C CB   . MET A 1 17 ? -10.327 2.190   4.615   1.00 0.00 ? 17 MET A CB   6  
ATOM 4226  C CG   . MET A 1 17 ? -9.816  2.338   3.190   1.00 0.00 ? 17 MET A CG   6  
ATOM 4227  S SD   . MET A 1 17 ? -11.014 1.791   1.959   1.00 0.00 ? 17 MET A SD   6  
ATOM 4228  C CE   . MET A 1 17 ? -12.287 3.037   2.145   1.00 0.00 ? 17 MET A CE   6  
ATOM 4229  H H    . MET A 1 17 ? -11.523 -0.033  4.901   1.00 0.00 ? 17 MET A H    6  
ATOM 4230  H HA   . MET A 1 17 ? -8.813  0.718   4.874   1.00 0.00 ? 17 MET A HA   6  
ATOM 4231  H HB2  . MET A 1 17 ? -11.395 2.056   4.586   1.00 0.00 ? 17 MET A HB2  6  
ATOM 4232  H HB3  . MET A 1 17 ? -10.098 3.096   5.153   1.00 0.00 ? 17 MET A HB3  6  
ATOM 4233  H HG2  . MET A 1 17 ? -9.587  3.378   3.010   1.00 0.00 ? 17 MET A HG2  6  
ATOM 4234  H HG3  . MET A 1 17 ? -8.917  1.749   3.082   1.00 0.00 ? 17 MET A HG3  6  
ATOM 4235  H HE1  . MET A 1 17 ? -13.233 2.637   1.816   1.00 0.00 ? 17 MET A HE1  6  
ATOM 4236  H HE2  . MET A 1 17 ? -12.034 3.902   1.548   1.00 0.00 ? 17 MET A HE2  6  
ATOM 4237  H HE3  . MET A 1 17 ? -12.359 3.326   3.183   1.00 0.00 ? 17 MET A HE3  6  
ATOM 4238  N N    . LEU A 1 18 ? -8.886  0.510   7.558   1.00 0.00 ? 18 LEU A N    6  
ATOM 4239  C CA   . LEU A 1 18 ? -8.487  0.739   8.938   1.00 0.00 ? 18 LEU A CA   6  
ATOM 4240  C C    . LEU A 1 18 ? -7.758  -0.485  9.481   1.00 0.00 ? 18 LEU A C    6  
ATOM 4241  O O    . LEU A 1 18 ? -8.179  -1.090  10.466  1.00 0.00 ? 18 LEU A O    6  
ATOM 4242  C CB   . LEU A 1 18 ? -9.709  1.071   9.800   1.00 0.00 ? 18 LEU A CB   6  
ATOM 4243  C CG   . LEU A 1 18 ? -10.664 -0.100  10.062  1.00 0.00 ? 18 LEU A CG   6  
ATOM 4244  C CD1  . LEU A 1 18 ? -10.657 -0.478  11.537  1.00 0.00 ? 18 LEU A CD1  6  
ATOM 4245  C CD2  . LEU A 1 18 ? -12.076 0.245   9.610   1.00 0.00 ? 18 LEU A CD2  6  
ATOM 4246  H H    . LEU A 1 18 ? -8.775  -0.370  7.175   1.00 0.00 ? 18 LEU A H    6  
ATOM 4247  H HA   . LEU A 1 18 ? -7.806  1.576   8.948   1.00 0.00 ? 18 LEU A HA   6  
ATOM 4248  H HB2  . LEU A 1 18 ? -9.359  1.445   10.750  1.00 0.00 ? 18 LEU A HB2  6  
ATOM 4249  H HB3  . LEU A 1 18 ? -10.264 1.854   9.306   1.00 0.00 ? 18 LEU A HB3  6  
ATOM 4250  H HG   . LEU A 1 18 ? -10.332 -0.959  9.499   1.00 0.00 ? 18 LEU A HG   6  
ATOM 4251  H HD11 . LEU A 1 18 ? -10.304 0.359   12.122  1.00 0.00 ? 18 LEU A HD11 6  
ATOM 4252  H HD12 . LEU A 1 18 ? -10.005 -1.325  11.690  1.00 0.00 ? 18 LEU A HD12 6  
ATOM 4253  H HD13 . LEU A 1 18 ? -11.659 -0.736  11.849  1.00 0.00 ? 18 LEU A HD13 6  
ATOM 4254  H HD21 . LEU A 1 18 ? -12.564 0.835   10.372  1.00 0.00 ? 18 LEU A HD21 6  
ATOM 4255  H HD22 . LEU A 1 18 ? -12.634 -0.666  9.447   1.00 0.00 ? 18 LEU A HD22 6  
ATOM 4256  H HD23 . LEU A 1 18 ? -12.032 0.809   8.691   1.00 0.00 ? 18 LEU A HD23 6  
ATOM 4257  N N    . GLY A 1 19 ? -6.669  -0.857  8.818   1.00 0.00 ? 19 GLY A N    6  
ATOM 4258  C CA   . GLY A 1 19 ? -5.912  -2.024  9.236   1.00 0.00 ? 19 GLY A CA   6  
ATOM 4259  C C    . GLY A 1 19 ? -4.433  -1.751  9.430   1.00 0.00 ? 19 GLY A C    6  
ATOM 4260  O O    . GLY A 1 19 ? -4.049  -0.880  10.210  1.00 0.00 ? 19 GLY A O    6  
ATOM 4261  H H    . GLY A 1 19 ? -6.389  -0.344  8.032   1.00 0.00 ? 19 GLY A H    6  
ATOM 4262  H HA2  . GLY A 1 19 ? -6.320  -2.387  10.167  1.00 0.00 ? 19 GLY A HA2  6  
ATOM 4263  H HA3  . GLY A 1 19 ? -6.025  -2.794  8.486   1.00 0.00 ? 19 GLY A HA3  6  
ATOM 4264  N N    . ASP A 1 20 ? -3.605  -2.520  8.727   1.00 0.00 ? 20 ASP A N    6  
ATOM 4265  C CA   . ASP A 1 20 ? -2.156  -2.398  8.819   1.00 0.00 ? 20 ASP A CA   6  
ATOM 4266  C C    . ASP A 1 20 ? -1.683  -0.958  8.663   1.00 0.00 ? 20 ASP A C    6  
ATOM 4267  O O    . ASP A 1 20 ? -2.478  -0.031  8.519   1.00 0.00 ? 20 ASP A O    6  
ATOM 4268  C CB   . ASP A 1 20 ? -1.488  -3.276  7.762   1.00 0.00 ? 20 ASP A CB   6  
ATOM 4269  C CG   . ASP A 1 20 ? -2.043  -4.688  7.742   1.00 0.00 ? 20 ASP A CG   6  
ATOM 4270  O OD1  . ASP A 1 20 ? -2.800  -5.043  8.669   1.00 0.00 ? 20 ASP A OD1  6  
ATOM 4271  O OD2  . ASP A 1 20 ? -1.718  -5.439  6.799   1.00 0.00 ? 20 ASP A OD2  6  
ATOM 4272  H H    . ASP A 1 20 ? -3.980  -3.204  8.135   1.00 0.00 ? 20 ASP A H    6  
ATOM 4273  H HA   . ASP A 1 20 ? -1.859  -2.748  9.794   1.00 0.00 ? 20 ASP A HA   6  
ATOM 4274  H HB2  . ASP A 1 20 ? -1.638  -2.837  6.788   1.00 0.00 ? 20 ASP A HB2  6  
ATOM 4275  H HB3  . ASP A 1 20 ? -0.433  -3.329  7.968   1.00 0.00 ? 20 ASP A HB3  6  
ATOM 4276  N N    . LEU A 1 21 ? -0.369  -0.800  8.709   1.00 0.00 ? 21 LEU A N    6  
ATOM 4277  C CA   . LEU A 1 21 ? 0.275   0.503   8.589   1.00 0.00 ? 21 LEU A CA   6  
ATOM 4278  C C    . LEU A 1 21 ? 1.404   0.440   7.576   1.00 0.00 ? 21 LEU A C    6  
ATOM 4279  O O    . LEU A 1 21 ? 2.479   -0.068  7.869   1.00 0.00 ? 21 LEU A O    6  
ATOM 4280  C CB   . LEU A 1 21 ? 0.834   0.919   9.950   1.00 0.00 ? 21 LEU A CB   6  
ATOM 4281  C CG   . LEU A 1 21 ? 0.987   2.420   10.163  1.00 0.00 ? 21 LEU A CG   6  
ATOM 4282  C CD1  . LEU A 1 21 ? 1.386   2.716   11.599  1.00 0.00 ? 21 LEU A CD1  6  
ATOM 4283  C CD2  . LEU A 1 21 ? 2.001   2.999   9.188   1.00 0.00 ? 21 LEU A CD2  6  
ATOM 4284  H H    . LEU A 1 21 ? 0.192   -1.593  8.834   1.00 0.00 ? 21 LEU A H    6  
ATOM 4285  H HA   . LEU A 1 21 ? -0.457  1.231   8.258   1.00 0.00 ? 21 LEU A HA   6  
ATOM 4286  H HB2  . LEU A 1 21 ? 0.177   0.535   10.717  1.00 0.00 ? 21 LEU A HB2  6  
ATOM 4287  H HB3  . LEU A 1 21 ? 1.804   0.462   10.071  1.00 0.00 ? 21 LEU A HB3  6  
ATOM 4288  H HG   . LEU A 1 21 ? 0.043   2.894   9.980   1.00 0.00 ? 21 LEU A HG   6  
ATOM 4289  H HD11 . LEU A 1 21 ? 2.268   2.147   11.851  1.00 0.00 ? 21 LEU A HD11 6  
ATOM 4290  H HD12 . LEU A 1 21 ? 0.579   2.439   12.262  1.00 0.00 ? 21 LEU A HD12 6  
ATOM 4291  H HD13 . LEU A 1 21 ? 1.594   3.770   11.707  1.00 0.00 ? 21 LEU A HD13 6  
ATOM 4292  H HD21 . LEU A 1 21 ? 2.620   3.722   9.697   1.00 0.00 ? 21 LEU A HD21 6  
ATOM 4293  H HD22 . LEU A 1 21 ? 1.480   3.483   8.373   1.00 0.00 ? 21 LEU A HD22 6  
ATOM 4294  H HD23 . LEU A 1 21 ? 2.618   2.205   8.798   1.00 0.00 ? 21 LEU A HD23 6  
ATOM 4295  N N    . ILE A 1 22 ? 1.153   0.943   6.379   1.00 0.00 ? 22 ILE A N    6  
ATOM 4296  C CA   . ILE A 1 22 ? 2.157   0.927   5.334   1.00 0.00 ? 22 ILE A CA   6  
ATOM 4297  C C    . ILE A 1 22 ? 2.786   2.298   5.126   1.00 0.00 ? 22 ILE A C    6  
ATOM 4298  O O    . ILE A 1 22 ? 2.091   3.313   5.059   1.00 0.00 ? 22 ILE A O    6  
ATOM 4299  C CB   . ILE A 1 22 ? 1.555   0.447   4.002   1.00 0.00 ? 22 ILE A CB   6  
ATOM 4300  C CG1  . ILE A 1 22 ? 2.536   0.667   2.862   1.00 0.00 ? 22 ILE A CG1  6  
ATOM 4301  C CG2  . ILE A 1 22 ? 0.250   1.160   3.716   1.00 0.00 ? 22 ILE A CG2  6  
ATOM 4302  C CD1  . ILE A 1 22 ? 2.239   1.890   2.018   1.00 0.00 ? 22 ILE A CD1  6  
ATOM 4303  H H    . ILE A 1 22 ? 0.273   1.323   6.189   1.00 0.00 ? 22 ILE A H    6  
ATOM 4304  H HA   . ILE A 1 22 ? 2.927   0.229   5.624   1.00 0.00 ? 22 ILE A HA   6  
ATOM 4305  H HB   . ILE A 1 22 ? 1.350   -0.601  4.090   1.00 0.00 ? 22 ILE A HB   6  
ATOM 4306  H HG12 . ILE A 1 22 ? 3.524   0.787   3.275   1.00 0.00 ? 22 ILE A HG12 6  
ATOM 4307  H HG13 . ILE A 1 22 ? 2.521   -0.196  2.213   1.00 0.00 ? 22 ILE A HG13 6  
ATOM 4308  H HG21 . ILE A 1 22 ? 0.357   2.208   3.956   1.00 0.00 ? 22 ILE A HG21 6  
ATOM 4309  H HG22 . ILE A 1 22 ? -0.534  0.727   4.311   1.00 0.00 ? 22 ILE A HG22 6  
ATOM 4310  H HG23 . ILE A 1 22 ? 0.012   1.056   2.666   1.00 0.00 ? 22 ILE A HG23 6  
ATOM 4311  H HD11 . ILE A 1 22 ? 1.863   2.681   2.650   1.00 0.00 ? 22 ILE A HD11 6  
ATOM 4312  H HD12 . ILE A 1 22 ? 1.499   1.644   1.272   1.00 0.00 ? 22 ILE A HD12 6  
ATOM 4313  H HD13 . ILE A 1 22 ? 3.142   2.219   1.535   1.00 0.00 ? 22 ILE A HD13 6  
ATOM 4314  N N    . CYS A 1 23 ? 4.104   2.310   4.979   1.00 0.00 ? 23 CYS A N    6  
ATOM 4315  C CA   . CYS A 1 23 ? 4.831   3.545   4.726   1.00 0.00 ? 23 CYS A CA   6  
ATOM 4316  C C    . CYS A 1 23 ? 5.196   3.592   3.258   1.00 0.00 ? 23 CYS A C    6  
ATOM 4317  O O    . CYS A 1 23 ? 6.277   3.152   2.867   1.00 0.00 ? 23 CYS A O    6  
ATOM 4318  C CB   . CYS A 1 23 ? 6.097   3.636   5.583   1.00 0.00 ? 23 CYS A CB   6  
ATOM 4319  S SG   . CYS A 1 23 ? 5.821   3.328   7.355   1.00 0.00 ? 23 CYS A SG   6  
ATOM 4320  H H    . CYS A 1 23 ? 4.598   1.461   5.008   1.00 0.00 ? 23 CYS A H    6  
ATOM 4321  H HA   . CYS A 1 23 ? 4.177   4.372   4.951   1.00 0.00 ? 23 CYS A HA   6  
ATOM 4322  H HB2  . CYS A 1 23 ? 6.809   2.907   5.231   1.00 0.00 ? 23 CYS A HB2  6  
ATOM 4323  H HB3  . CYS A 1 23 ? 6.521   4.624   5.482   1.00 0.00 ? 23 CYS A HB3  6  
ATOM 4324  N N    . ALA A 1 24 ? 4.281   4.094   2.441   1.00 0.00 ? 24 ALA A N    6  
ATOM 4325  C CA   . ALA A 1 24 ? 4.514   4.145   1.009   1.00 0.00 ? 24 ALA A CA   6  
ATOM 4326  C C    . ALA A 1 24 ? 5.425   5.298   0.629   1.00 0.00 ? 24 ALA A C    6  
ATOM 4327  O O    . ALA A 1 24 ? 5.358   6.386   1.201   1.00 0.00 ? 24 ALA A O    6  
ATOM 4328  C CB   . ALA A 1 24 ? 3.195   4.242   0.254   1.00 0.00 ? 24 ALA A CB   6  
ATOM 4329  H H    . ALA A 1 24 ? 3.422   4.406   2.805   1.00 0.00 ? 24 ALA A H    6  
ATOM 4330  H HA   . ALA A 1 24 ? 4.992   3.215   0.731   1.00 0.00 ? 24 ALA A HA   6  
ATOM 4331  H HB1  . ALA A 1 24 ? 3.169   3.493   -0.523  1.00 0.00 ? 24 ALA A HB1  6  
ATOM 4332  H HB2  . ALA A 1 24 ? 3.103   5.223   -0.189  1.00 0.00 ? 24 ALA A HB2  6  
ATOM 4333  H HB3  . ALA A 1 24 ? 2.377   4.079   0.939   1.00 0.00 ? 24 ALA A HB3  6  
ATOM 4334  N N    . VAL A 1 25 ? 6.285   5.033   -0.342  1.00 0.00 ? 25 VAL A N    6  
ATOM 4335  C CA   . VAL A 1 25 ? 7.236   6.020   -0.826  1.00 0.00 ? 25 VAL A CA   6  
ATOM 4336  C C    . VAL A 1 25 ? 7.335   5.991   -2.341  1.00 0.00 ? 25 VAL A C    6  
ATOM 4337  O O    . VAL A 1 25 ? 7.298   4.929   -2.971  1.00 0.00 ? 25 VAL A O    6  
ATOM 4338  C CB   . VAL A 1 25 ? 8.637   5.784   -0.231  1.00 0.00 ? 25 VAL A CB   6  
ATOM 4339  C CG1  . VAL A 1 25 ? 9.568   6.935   -0.583  1.00 0.00 ? 25 VAL A CG1  6  
ATOM 4340  C CG2  . VAL A 1 25 ? 8.555   5.599   1.278   1.00 0.00 ? 25 VAL A CG2  6  
ATOM 4341  H H    . VAL A 1 25 ? 6.280   4.141   -0.742  1.00 0.00 ? 25 VAL A H    6  
ATOM 4342  H HA   . VAL A 1 25 ? 6.900   7.005   -0.524  1.00 0.00 ? 25 VAL A HA   6  
ATOM 4343  H HB   . VAL A 1 25 ? 9.042   4.880   -0.662  1.00 0.00 ? 25 VAL A HB   6  
ATOM 4344  H HG11 . VAL A 1 25 ? 9.179   7.852   -0.167  1.00 0.00 ? 25 VAL A HG11 6  
ATOM 4345  H HG12 . VAL A 1 25 ? 9.635   7.027   -1.657  1.00 0.00 ? 25 VAL A HG12 6  
ATOM 4346  H HG13 . VAL A 1 25 ? 10.549  6.742   -0.176  1.00 0.00 ? 25 VAL A HG13 6  
ATOM 4347  H HG21 . VAL A 1 25 ? 8.134   4.629   1.499   1.00 0.00 ? 25 VAL A HG21 6  
ATOM 4348  H HG22 . VAL A 1 25 ? 7.929   6.369   1.701   1.00 0.00 ? 25 VAL A HG22 6  
ATOM 4349  H HG23 . VAL A 1 25 ? 9.546   5.666   1.703   1.00 0.00 ? 25 VAL A HG23 6  
ATOM 4350  N N    . ILE A 1 26 ? 7.472   7.180   -2.904  1.00 0.00 ? 26 ILE A N    6  
ATOM 4351  C CA   . ILE A 1 26 ? 7.603   7.369   -4.339  1.00 0.00 ? 26 ILE A CA   6  
ATOM 4352  C C    . ILE A 1 26 ? 8.871   8.143   -4.618  1.00 0.00 ? 26 ILE A C    6  
ATOM 4353  O O    . ILE A 1 26 ? 9.627   8.461   -3.700  1.00 0.00 ? 26 ILE A O    6  
ATOM 4354  C CB   . ILE A 1 26 ? 6.402   8.117   -4.966  1.00 0.00 ? 26 ILE A CB   6  
ATOM 4355  C CG1  . ILE A 1 26 ? 5.561   8.806   -3.891  1.00 0.00 ? 26 ILE A CG1  6  
ATOM 4356  C CG2  . ILE A 1 26 ? 5.549   7.159   -5.785  1.00 0.00 ? 26 ILE A CG2  6  
ATOM 4357  C CD1  . ILE A 1 26 ? 4.615   7.877   -3.157  1.00 0.00 ? 26 ILE A CD1  6  
ATOM 4358  H H    . ILE A 1 26 ? 7.500   7.970   -2.326  1.00 0.00 ? 26 ILE A H    6  
ATOM 4359  H HA   . ILE A 1 26 ? 7.684   6.397   -4.804  1.00 0.00 ? 26 ILE A HA   6  
ATOM 4360  H HB   . ILE A 1 26 ? 6.791   8.866   -5.640  1.00 0.00 ? 26 ILE A HB   6  
ATOM 4361  H HG12 . ILE A 1 26 ? 6.224   9.244   -3.164  1.00 0.00 ? 26 ILE A HG12 6  
ATOM 4362  H HG13 . ILE A 1 26 ? 4.973   9.587   -4.350  1.00 0.00 ? 26 ILE A HG13 6  
ATOM 4363  H HG21 . ILE A 1 26 ? 5.719   6.150   -5.446  1.00 0.00 ? 26 ILE A HG21 6  
ATOM 4364  H HG22 . ILE A 1 26 ? 5.820   7.239   -6.828  1.00 0.00 ? 26 ILE A HG22 6  
ATOM 4365  H HG23 . ILE A 1 26 ? 4.506   7.410   -5.662  1.00 0.00 ? 26 ILE A HG23 6  
ATOM 4366  H HD11 . ILE A 1 26 ? 5.114   6.943   -2.950  1.00 0.00 ? 26 ILE A HD11 6  
ATOM 4367  H HD12 . ILE A 1 26 ? 3.745   7.693   -3.770  1.00 0.00 ? 26 ILE A HD12 6  
ATOM 4368  H HD13 . ILE A 1 26 ? 4.310   8.336   -2.229  1.00 0.00 ? 26 ILE A HD13 6  
ATOM 4369  N N    . GLY A 1 27 ? 9.101   8.432   -5.886  1.00 0.00 ? 27 GLY A N    6  
ATOM 4370  C CA   . GLY A 1 27 ? 10.285  9.174   -6.297  1.00 0.00 ? 27 GLY A CA   6  
ATOM 4371  C C    . GLY A 1 27 ? 10.725  10.193  -5.262  1.00 0.00 ? 27 GLY A C    6  
ATOM 4372  O O    . GLY A 1 27 ? 11.920  10.434  -5.087  1.00 0.00 ? 27 GLY A O    6  
ATOM 4373  H H    . GLY A 1 27 ? 8.453   8.142   -6.551  1.00 0.00 ? 27 GLY A H    6  
ATOM 4374  H HA2  . GLY A 1 27 ? 11.093  8.477   -6.463  1.00 0.00 ? 27 GLY A HA2  6  
ATOM 4375  H HA3  . GLY A 1 27 ? 10.070  9.687   -7.222  1.00 0.00 ? 27 GLY A HA3  6  
ATOM 4376  N N    . ASP A 1 28 ? 9.757   10.782  -4.566  1.00 0.00 ? 28 ASP A N    6  
ATOM 4377  C CA   . ASP A 1 28 ? 10.054  11.765  -3.538  1.00 0.00 ? 28 ASP A CA   6  
ATOM 4378  C C    . ASP A 1 28 ? 8.845   12.018  -2.640  1.00 0.00 ? 28 ASP A C    6  
ATOM 4379  O O    . ASP A 1 28 ? 8.697   13.112  -2.094  1.00 0.00 ? 28 ASP A O    6  
ATOM 4380  C CB   . ASP A 1 28 ? 10.509  13.076  -4.178  1.00 0.00 ? 28 ASP A CB   6  
ATOM 4381  C CG   . ASP A 1 28 ? 11.575  13.780  -3.361  1.00 0.00 ? 28 ASP A CG   6  
ATOM 4382  O OD1  . ASP A 1 28 ? 12.326  13.088  -2.642  1.00 0.00 ? 28 ASP A OD1  6  
ATOM 4383  O OD2  . ASP A 1 28 ? 11.658  15.024  -3.440  1.00 0.00 ? 28 ASP A OD2  6  
ATOM 4384  H H    . ASP A 1 28 ? 8.824   10.545  -4.744  1.00 0.00 ? 28 ASP A H    6  
ATOM 4385  H HA   . ASP A 1 28 ? 10.859  11.374  -2.934  1.00 0.00 ? 28 ASP A HA   6  
ATOM 4386  H HB2  . ASP A 1 28 ? 10.912  12.871  -5.158  1.00 0.00 ? 28 ASP A HB2  6  
ATOM 4387  H HB3  . ASP A 1 28 ? 9.659   13.737  -4.274  1.00 0.00 ? 28 ASP A HB3  6  
ATOM 4388  N N    . ALA A 1 29 ? 7.972   11.015  -2.480  1.00 0.00 ? 29 ALA A N    6  
ATOM 4389  C CA   . ALA A 1 29 ? 6.793   11.191  -1.637  1.00 0.00 ? 29 ALA A CA   6  
ATOM 4390  C C    . ALA A 1 29 ? 6.590   10.007  -0.697  1.00 0.00 ? 29 ALA A C    6  
ATOM 4391  O O    . ALA A 1 29 ? 6.132   8.943   -1.110  1.00 0.00 ? 29 ALA A O    6  
ATOM 4392  C CB   . ALA A 1 29 ? 5.560   11.411  -2.498  1.00 0.00 ? 29 ALA A CB   6  
ATOM 4393  H H    . ALA A 1 29 ? 8.119   10.148  -2.936  1.00 0.00 ? 29 ALA A H    6  
ATOM 4394  H HA   . ALA A 1 29 ? 6.944   12.081  -1.043  1.00 0.00 ? 29 ALA A HA   6  
ATOM 4395  H HB1  . ALA A 1 29 ? 5.850   11.426  -3.539  1.00 0.00 ? 29 ALA A HB1  6  
ATOM 4396  H HB2  . ALA A 1 29 ? 5.102   12.351  -2.238  1.00 0.00 ? 29 ALA A HB2  6  
ATOM 4397  H HB3  . ALA A 1 29 ? 4.858   10.608  -2.332  1.00 0.00 ? 29 ALA A HB3  6  
ATOM 4398  N N    . LYS A 1 30 ? 6.926   10.202  0.574   1.00 0.00 ? 30 LYS A N    6  
ATOM 4399  C CA   . LYS A 1 30 ? 6.774   9.152   1.574   1.00 0.00 ? 30 LYS A CA   6  
ATOM 4400  C C    . LYS A 1 30 ? 5.580   9.432   2.480   1.00 0.00 ? 30 LYS A C    6  
ATOM 4401  O O    . LYS A 1 30 ? 5.647   10.279  3.371   1.00 0.00 ? 30 LYS A O    6  
ATOM 4402  C CB   . LYS A 1 30 ? 8.046   9.025   2.412   1.00 0.00 ? 30 LYS A CB   6  
ATOM 4403  C CG   . LYS A 1 30 ? 8.664   10.361  2.787   1.00 0.00 ? 30 LYS A CG   6  
ATOM 4404  C CD   . LYS A 1 30 ? 9.671   10.815  1.744   1.00 0.00 ? 30 LYS A CD   6  
ATOM 4405  C CE   . LYS A 1 30 ? 10.954  10.003  1.817   1.00 0.00 ? 30 LYS A CE   6  
ATOM 4406  N NZ   . LYS A 1 30 ? 11.406  9.802   3.222   1.00 0.00 ? 30 LYS A NZ   6  
ATOM 4407  H H    . LYS A 1 30 ? 7.280   11.074  0.847   1.00 0.00 ? 30 LYS A H    6  
ATOM 4408  H HA   . LYS A 1 30 ? 6.603   8.222   1.052   1.00 0.00 ? 30 LYS A HA   6  
ATOM 4409  H HB2  . LYS A 1 30 ? 7.812   8.493   3.322   1.00 0.00 ? 30 LYS A HB2  6  
ATOM 4410  H HB3  . LYS A 1 30 ? 8.777   8.459   1.852   1.00 0.00 ? 30 LYS A HB3  6  
ATOM 4411  H HG2  . LYS A 1 30 ? 7.881   11.101  2.863   1.00 0.00 ? 30 LYS A HG2  6  
ATOM 4412  H HG3  . LYS A 1 30 ? 9.163   10.263  3.740   1.00 0.00 ? 30 LYS A HG3  6  
ATOM 4413  H HD2  . LYS A 1 30 ? 9.237   10.696  0.763   1.00 0.00 ? 30 LYS A HD2  6  
ATOM 4414  H HD3  . LYS A 1 30 ? 9.904   11.857  1.912   1.00 0.00 ? 30 LYS A HD3  6  
ATOM 4415  H HE2  . LYS A 1 30 ? 10.780  9.038   1.364   1.00 0.00 ? 30 LYS A HE2  6  
ATOM 4416  H HE3  . LYS A 1 30 ? 11.727  10.524  1.271   1.00 0.00 ? 30 LYS A HE3  6  
ATOM 4417  H HZ1  . LYS A 1 30 ? 12.438  9.676   3.251   1.00 0.00 ? 30 LYS A HZ1  6  
ATOM 4418  H HZ2  . LYS A 1 30 ? 10.952  8.959   3.627   1.00 0.00 ? 30 LYS A HZ2  6  
ATOM 4419  H HZ3  . LYS A 1 30 ? 11.152  10.630  3.800   1.00 0.00 ? 30 LYS A HZ3  6  
ATOM 4420  N N    . GLU A 1 31 ? 4.488   8.712   2.247   1.00 0.00 ? 31 GLU A N    6  
ATOM 4421  C CA   . GLU A 1 31 ? 3.278   8.878   3.043   1.00 0.00 ? 31 GLU A CA   6  
ATOM 4422  C C    . GLU A 1 31 ? 2.867   7.557   3.681   1.00 0.00 ? 31 GLU A C    6  
ATOM 4423  O O    . GLU A 1 31 ? 3.450   6.511   3.396   1.00 0.00 ? 31 GLU A O    6  
ATOM 4424  C CB   . GLU A 1 31 ? 2.139   9.418   2.175   1.00 0.00 ? 31 GLU A CB   6  
ATOM 4425  C CG   . GLU A 1 31 ? 2.551   10.572  1.279   1.00 0.00 ? 31 GLU A CG   6  
ATOM 4426  C CD   . GLU A 1 31 ? 2.726   10.154  -0.168  1.00 0.00 ? 31 GLU A CD   6  
ATOM 4427  O OE1  . GLU A 1 31 ? 3.841   9.725   -0.531  1.00 0.00 ? 31 GLU A OE1  6  
ATOM 4428  O OE2  . GLU A 1 31 ? 1.747   10.254  -0.938  1.00 0.00 ? 31 GLU A OE2  6  
ATOM 4429  H H    . GLU A 1 31 ? 4.497   8.051   1.524   1.00 0.00 ? 31 GLU A H    6  
ATOM 4430  H HA   . GLU A 1 31 ? 3.490   9.591   3.826   1.00 0.00 ? 31 GLU A HA   6  
ATOM 4431  H HB2  . GLU A 1 31 ? 1.768   8.619   1.551   1.00 0.00 ? 31 GLU A HB2  6  
ATOM 4432  H HB3  . GLU A 1 31 ? 1.342   9.758   2.821   1.00 0.00 ? 31 GLU A HB3  6  
ATOM 4433  H HG2  . GLU A 1 31 ? 1.790   11.337  1.326   1.00 0.00 ? 31 GLU A HG2  6  
ATOM 4434  H HG3  . GLU A 1 31 ? 3.487   10.975  1.638   1.00 0.00 ? 31 GLU A HG3  6  
ATOM 4435  N N    . GLU A 1 32 ? 1.861   7.612   4.546   1.00 0.00 ? 32 GLU A N    6  
ATOM 4436  C CA   . GLU A 1 32 ? 1.377   6.418   5.227   1.00 0.00 ? 32 GLU A CA   6  
ATOM 4437  C C    . GLU A 1 32 ? 0.000   6.015   4.729   1.00 0.00 ? 32 GLU A C    6  
ATOM 4438  O O    . GLU A 1 32 ? -0.727  6.823   4.151   1.00 0.00 ? 32 GLU A O    6  
ATOM 4439  C CB   . GLU A 1 32 ? 1.319   6.648   6.736   1.00 0.00 ? 32 GLU A CB   6  
ATOM 4440  C CG   . GLU A 1 32 ? 2.685   6.714   7.391   1.00 0.00 ? 32 GLU A CG   6  
ATOM 4441  C CD   . GLU A 1 32 ? 3.579   5.565   6.978   1.00 0.00 ? 32 GLU A CD   6  
ATOM 4442  O OE1  . GLU A 1 32 ? 3.182   4.401   7.191   1.00 0.00 ? 32 GLU A OE1  6  
ATOM 4443  O OE2  . GLU A 1 32 ? 4.669   5.830   6.431   1.00 0.00 ? 32 GLU A OE2  6  
ATOM 4444  H H    . GLU A 1 32 ? 1.438   8.476   4.734   1.00 0.00 ? 32 GLU A H    6  
ATOM 4445  H HA   . GLU A 1 32 ? 2.069   5.616   5.021   1.00 0.00 ? 32 GLU A HA   6  
ATOM 4446  H HB2  . GLU A 1 32 ? 0.803   7.577   6.927   1.00 0.00 ? 32 GLU A HB2  6  
ATOM 4447  H HB3  . GLU A 1 32 ? 0.763   5.839   7.190   1.00 0.00 ? 32 GLU A HB3  6  
ATOM 4448  H HG2  . GLU A 1 32 ? 3.162   7.637   7.104   1.00 0.00 ? 32 GLU A HG2  6  
ATOM 4449  H HG3  . GLU A 1 32 ? 2.559   6.686   8.462   1.00 0.00 ? 32 GLU A HG3  6  
ATOM 4450  N N    . HIS A 1 33 ? -0.358  4.761   4.973   1.00 0.00 ? 33 HIS A N    6  
ATOM 4451  C CA   . HIS A 1 33 ? -1.663  4.252   4.562   1.00 0.00 ? 33 HIS A CA   6  
ATOM 4452  C C    . HIS A 1 33 ? -2.051  3.018   5.365   1.00 0.00 ? 33 HIS A C    6  
ATOM 4453  O O    . HIS A 1 33 ? -1.195  2.235   5.773   1.00 0.00 ? 33 HIS A O    6  
ATOM 4454  C CB   . HIS A 1 33 ? -1.677  3.894   3.073   1.00 0.00 ? 33 HIS A CB   6  
ATOM 4455  C CG   . HIS A 1 33 ? -0.965  4.867   2.189   1.00 0.00 ? 33 HIS A CG   6  
ATOM 4456  N ND1  . HIS A 1 33 ? 0.408   4.963   2.124   1.00 0.00 ? 33 HIS A ND1  6  
ATOM 4457  C CD2  . HIS A 1 33 ? -1.445  5.766   1.300   1.00 0.00 ? 33 HIS A CD2  6  
ATOM 4458  C CE1  . HIS A 1 33 ? 0.740   5.877   1.233   1.00 0.00 ? 33 HIS A CE1  6  
ATOM 4459  N NE2  . HIS A 1 33 ? -0.366  6.380   0.717   1.00 0.00 ? 33 HIS A NE2  6  
ATOM 4460  H H    . HIS A 1 33 ? 0.268   4.167   5.451   1.00 0.00 ? 33 HIS A H    6  
ATOM 4461  H HA   . HIS A 1 33 ? -2.392  5.027   4.742   1.00 0.00 ? 33 HIS A HA   6  
ATOM 4462  H HB2  . HIS A 1 33 ? -1.210  2.932   2.940   1.00 0.00 ? 33 HIS A HB2  6  
ATOM 4463  H HB3  . HIS A 1 33 ? -2.703  3.834   2.740   1.00 0.00 ? 33 HIS A HB3  6  
ATOM 4464  H HD1  . HIS A 1 33 ? 1.044   4.442   2.656   1.00 0.00 ? 33 HIS A HD1  6  
ATOM 4465  H HD2  . HIS A 1 33 ? -2.484  5.957   1.084   1.00 0.00 ? 33 HIS A HD2  6  
ATOM 4466  H HE1  . HIS A 1 33 ? 1.743   6.143   0.949   1.00 0.00 ? 33 HIS A HE1  6  
ATOM 4467  H HE2  . HIS A 1 33 ? -0.404  6.974   -0.061  1.00 0.00 ? 33 HIS A HE2  6  
ATOM 4468  N N    . ARG A 1 34 ? -3.350  2.842   5.565   1.00 0.00 ? 34 ARG A N    6  
ATOM 4469  C CA   . ARG A 1 34 ? -3.857  1.688   6.292   1.00 0.00 ? 34 ARG A CA   6  
ATOM 4470  C C    . ARG A 1 34 ? -4.241  0.586   5.313   1.00 0.00 ? 34 ARG A C    6  
ATOM 4471  O O    . ARG A 1 34 ? -3.849  -0.569  5.475   1.00 0.00 ? 34 ARG A O    6  
ATOM 4472  C CB   . ARG A 1 34 ? -5.064  2.069   7.145   1.00 0.00 ? 34 ARG A CB   6  
ATOM 4473  C CG   . ARG A 1 34 ? -4.870  3.351   7.941   1.00 0.00 ? 34 ARG A CG   6  
ATOM 4474  C CD   . ARG A 1 34 ? -5.154  3.140   9.420   1.00 0.00 ? 34 ARG A CD   6  
ATOM 4475  N NE   . ARG A 1 34 ? -4.006  2.568   10.124  1.00 0.00 ? 34 ARG A NE   6  
ATOM 4476  C CZ   . ARG A 1 34 ? -3.762  2.749   11.420  1.00 0.00 ? 34 ARG A CZ   6  
ATOM 4477  N NH1  . ARG A 1 34 ? -4.598  3.459   12.171  1.00 0.00 ? 34 ARG A NH1  6  
ATOM 4478  N NH2  . ARG A 1 34 ? -2.684  2.210   11.972  1.00 0.00 ? 34 ARG A NH2  6  
ATOM 4479  H H    . ARG A 1 34 ? -3.982  3.495   5.200   1.00 0.00 ? 34 ARG A H    6  
ATOM 4480  H HA   . ARG A 1 34 ? -3.069  1.326   6.933   1.00 0.00 ? 34 ARG A HA   6  
ATOM 4481  H HB2  . ARG A 1 34 ? -5.919  2.197   6.498   1.00 0.00 ? 34 ARG A HB2  6  
ATOM 4482  H HB3  . ARG A 1 34 ? -5.265  1.265   7.838   1.00 0.00 ? 34 ARG A HB3  6  
ATOM 4483  H HG2  . ARG A 1 34 ? -3.849  3.681   7.826   1.00 0.00 ? 34 ARG A HG2  6  
ATOM 4484  H HG3  . ARG A 1 34 ? -5.541  4.105   7.558   1.00 0.00 ? 34 ARG A HG3  6  
ATOM 4485  H HD2  . ARG A 1 34 ? -5.397  4.094   9.863   1.00 0.00 ? 34 ARG A HD2  6  
ATOM 4486  H HD3  . ARG A 1 34 ? -5.997  2.472   9.521   1.00 0.00 ? 34 ARG A HD3  6  
ATOM 4487  H HE   . ARG A 1 34 ? -3.380  2.026   9.599   1.00 0.00 ? 34 ARG A HE   6  
ATOM 4488  H HH11 . ARG A 1 34 ? -5.416  3.863   11.765  1.00 0.00 ? 34 ARG A HH11 6  
ATOM 4489  H HH12 . ARG A 1 34 ? -4.406  3.588   13.143  1.00 0.00 ? 34 ARG A HH12 6  
ATOM 4490  H HH21 . ARG A 1 34 ? -2.054  1.669   11.414  1.00 0.00 ? 34 ARG A HH21 6  
ATOM 4491  H HH22 . ARG A 1 34 ? -2.499  2.346   12.946  1.00 0.00 ? 34 ARG A HH22 6  
ATOM 4492  N N    . ASN A 1 35 ? -4.997  0.959   4.283   1.00 0.00 ? 35 ASN A N    6  
ATOM 4493  C CA   . ASN A 1 35 ? -5.414  0.007   3.263   1.00 0.00 ? 35 ASN A CA   6  
ATOM 4494  C C    . ASN A 1 35 ? -4.281  -0.226  2.276   1.00 0.00 ? 35 ASN A C    6  
ATOM 4495  O O    . ASN A 1 35 ? -4.387  0.092   1.089   1.00 0.00 ? 35 ASN A O    6  
ATOM 4496  C CB   . ASN A 1 35 ? -6.666  0.505   2.534   1.00 0.00 ? 35 ASN A CB   6  
ATOM 4497  C CG   . ASN A 1 35 ? -7.836  -0.455  2.660   1.00 0.00 ? 35 ASN A CG   6  
ATOM 4498  O OD1  . ASN A 1 35 ? -8.590  -0.655  1.708   1.00 0.00 ? 35 ASN A OD1  6  
ATOM 4499  N ND2  . ASN A 1 35 ? -7.993  -1.055  3.834   1.00 0.00 ? 35 ASN A ND2  6  
ATOM 4500  H H    . ASN A 1 35 ? -5.266  1.897   4.202   1.00 0.00 ? 35 ASN A H    6  
ATOM 4501  H HA   . ASN A 1 35 ? -5.641  -0.926  3.755   1.00 0.00 ? 35 ASN A HA   6  
ATOM 4502  H HB2  . ASN A 1 35 ? -6.960  1.454   2.951   1.00 0.00 ? 35 ASN A HB2  6  
ATOM 4503  H HB3  . ASN A 1 35 ? -6.442  0.633   1.486   1.00 0.00 ? 35 ASN A HB3  6  
ATOM 4504  H HD21 . ASN A 1 35 ? -7.356  -0.850  4.551   1.00 0.00 ? 35 ASN A HD21 6  
ATOM 4505  H HD22 . ASN A 1 35 ? -8.741  -1.681  3.937   1.00 0.00 ? 35 ASN A HD22 6  
ATOM 4506  N N    . MET A 1 36 ? -3.194  -0.791  2.784   1.00 0.00 ? 36 MET A N    6  
ATOM 4507  C CA   . MET A 1 36 ? -2.022  -1.085  1.973   1.00 0.00 ? 36 MET A CA   6  
ATOM 4508  C C    . MET A 1 36 ? -2.417  -1.785  0.674   1.00 0.00 ? 36 MET A C    6  
ATOM 4509  O O    . MET A 1 36 ? -1.691  -1.728  -0.318  1.00 0.00 ? 36 MET A O    6  
ATOM 4510  C CB   . MET A 1 36 ? -1.039  -1.935  2.794   1.00 0.00 ? 36 MET A CB   6  
ATOM 4511  C CG   . MET A 1 36 ? -0.707  -3.291  2.184   1.00 0.00 ? 36 MET A CG   6  
ATOM 4512  S SD   . MET A 1 36 ? 0.144   -4.381  3.340   1.00 0.00 ? 36 MET A SD   6  
ATOM 4513  C CE   . MET A 1 36 ? -0.547  -5.966  2.877   1.00 0.00 ? 36 MET A CE   6  
ATOM 4514  H H    . MET A 1 36 ? -3.179  -1.018  3.736   1.00 0.00 ? 36 MET A H    6  
ATOM 4515  H HA   . MET A 1 36 ? -1.550  -0.145  1.727   1.00 0.00 ? 36 MET A HA   6  
ATOM 4516  H HB2  . MET A 1 36 ? -0.120  -1.383  2.908   1.00 0.00 ? 36 MET A HB2  6  
ATOM 4517  H HB3  . MET A 1 36 ? -1.468  -2.102  3.772   1.00 0.00 ? 36 MET A HB3  6  
ATOM 4518  H HG2  . MET A 1 36 ? -1.626  -3.767  1.875   1.00 0.00 ? 36 MET A HG2  6  
ATOM 4519  H HG3  . MET A 1 36 ? -0.074  -3.137  1.322   1.00 0.00 ? 36 MET A HG3  6  
ATOM 4520  H HE1  . MET A 1 36 ? -0.587  -6.041  1.800   1.00 0.00 ? 36 MET A HE1  6  
ATOM 4521  H HE2  . MET A 1 36 ? -1.545  -6.055  3.281   1.00 0.00 ? 36 MET A HE2  6  
ATOM 4522  H HE3  . MET A 1 36 ? 0.072   -6.758  3.270   1.00 0.00 ? 36 MET A HE3  6  
ATOM 4523  N N    . CYS A 1 37 ? -3.579  -2.435  0.683   1.00 0.00 ? 37 CYS A N    6  
ATOM 4524  C CA   . CYS A 1 37 ? -4.066  -3.128  -0.501  1.00 0.00 ? 37 CYS A CA   6  
ATOM 4525  C C    . CYS A 1 37 ? -4.373  -2.126  -1.604  1.00 0.00 ? 37 CYS A C    6  
ATOM 4526  O O    . CYS A 1 37 ? -3.734  -2.124  -2.656  1.00 0.00 ? 37 CYS A O    6  
ATOM 4527  C CB   . CYS A 1 37 ? -5.325  -3.947  -0.185  1.00 0.00 ? 37 CYS A CB   6  
ATOM 4528  S SG   . CYS A 1 37 ? -5.374  -4.688  1.481   1.00 0.00 ? 37 CYS A SG   6  
ATOM 4529  H H    . CYS A 1 37 ? -4.122  -2.439  1.498   1.00 0.00 ? 37 CYS A H    6  
ATOM 4530  H HA   . CYS A 1 37 ? -3.288  -3.789  -0.841  1.00 0.00 ? 37 CYS A HA   6  
ATOM 4531  H HB2  . CYS A 1 37 ? -6.189  -3.308  -0.278  1.00 0.00 ? 37 CYS A HB2  6  
ATOM 4532  H HB3  . CYS A 1 37 ? -5.405  -4.751  -0.900  1.00 0.00 ? 37 CYS A HB3  6  
ATOM 4533  N N    . ALA A 1 38 ? -5.357  -1.272  -1.347  1.00 0.00 ? 38 ALA A N    6  
ATOM 4534  C CA   . ALA A 1 38 ? -5.766  -0.250  -2.306  1.00 0.00 ? 38 ALA A CA   6  
ATOM 4535  C C    . ALA A 1 38 ? -4.569  0.532   -2.832  1.00 0.00 ? 38 ALA A C    6  
ATOM 4536  O O    . ALA A 1 38 ? -4.611  1.078   -3.934  1.00 0.00 ? 38 ALA A O    6  
ATOM 4537  C CB   . ALA A 1 38 ? -6.775  0.693   -1.671  1.00 0.00 ? 38 ALA A CB   6  
ATOM 4538  H H    . ALA A 1 38 ? -5.818  -1.329  -0.486  1.00 0.00 ? 38 ALA A H    6  
ATOM 4539  H HA   . ALA A 1 38 ? -6.245  -0.746  -3.136  1.00 0.00 ? 38 ALA A HA   6  
ATOM 4540  H HB1  . ALA A 1 38 ? -7.477  1.028   -2.422  1.00 0.00 ? 38 ALA A HB1  6  
ATOM 4541  H HB2  . ALA A 1 38 ? -6.260  1.546   -1.255  1.00 0.00 ? 38 ALA A HB2  6  
ATOM 4542  H HB3  . ALA A 1 38 ? -7.307  0.175   -0.887  1.00 0.00 ? 38 ALA A HB3  6  
ATOM 4543  N N    . LEU A 1 39 ? -3.501  0.581   -2.045  1.00 0.00 ? 39 LEU A N    6  
ATOM 4544  C CA   . LEU A 1 39 ? -2.299  1.295   -2.451  1.00 0.00 ? 39 LEU A CA   6  
ATOM 4545  C C    . LEU A 1 39 ? -1.512  0.481   -3.469  1.00 0.00 ? 39 LEU A C    6  
ATOM 4546  O O    . LEU A 1 39 ? -1.094  0.994   -4.503  1.00 0.00 ? 39 LEU A O    6  
ATOM 4547  C CB   . LEU A 1 39 ? -1.417  1.593   -1.234  1.00 0.00 ? 39 LEU A CB   6  
ATOM 4548  C CG   . LEU A 1 39 ? -1.135  3.073   -0.943  1.00 0.00 ? 39 LEU A CG   6  
ATOM 4549  C CD1  . LEU A 1 39 ? 0.234   3.227   -0.303  1.00 0.00 ? 39 LEU A CD1  6  
ATOM 4550  C CD2  . LEU A 1 39 ? -1.223  3.920   -2.208  1.00 0.00 ? 39 LEU A CD2  6  
ATOM 4551  H H    . LEU A 1 39 ? -3.519  0.128   -1.175  1.00 0.00 ? 39 LEU A H    6  
ATOM 4552  H HA   . LEU A 1 39 ? -2.604  2.221   -2.908  1.00 0.00 ? 39 LEU A HA   6  
ATOM 4553  H HB2  . LEU A 1 39 ? -1.897  1.169   -0.367  1.00 0.00 ? 39 LEU A HB2  6  
ATOM 4554  H HB3  . LEU A 1 39 ? -0.467  1.097   -1.372  1.00 0.00 ? 39 LEU A HB3  6  
ATOM 4555  H HG   . LEU A 1 39 ? -1.874  3.435   -0.243  1.00 0.00 ? 39 LEU A HG   6  
ATOM 4556  H HD11 . LEU A 1 39 ? 0.141   3.141   0.768   1.00 0.00 ? 39 LEU A HD11 6  
ATOM 4557  H HD12 . LEU A 1 39 ? 0.642   4.195   -0.554  1.00 0.00 ? 39 LEU A HD12 6  
ATOM 4558  H HD13 . LEU A 1 39 ? 0.893   2.454   -0.670  1.00 0.00 ? 39 LEU A HD13 6  
ATOM 4559  H HD21 . LEU A 1 39 ? -0.917  3.330   -3.059  1.00 0.00 ? 39 LEU A HD21 6  
ATOM 4560  H HD22 . LEU A 1 39 ? -0.574  4.778   -2.113  1.00 0.00 ? 39 LEU A HD22 6  
ATOM 4561  H HD23 . LEU A 1 39 ? -2.241  4.253   -2.347  1.00 0.00 ? 39 LEU A HD23 6  
ATOM 4562  N N    . CYS A 1 40 ? -1.319  -0.791  -3.165  1.00 0.00 ? 40 CYS A N    6  
ATOM 4563  C CA   . CYS A 1 40 ? -0.580  -1.679  -4.052  1.00 0.00 ? 40 CYS A CA   6  
ATOM 4564  C C    . CYS A 1 40 ? -1.320  -1.852  -5.373  1.00 0.00 ? 40 CYS A C    6  
ATOM 4565  O O    . CYS A 1 40 ? -0.708  -2.092  -6.411  1.00 0.00 ? 40 CYS A O    6  
ATOM 4566  C CB   . CYS A 1 40 ? -0.351  -3.038  -3.385  1.00 0.00 ? 40 CYS A CB   6  
ATOM 4567  S SG   . CYS A 1 40 ? 0.415   -4.290  -4.472  1.00 0.00 ? 40 CYS A SG   6  
ATOM 4568  H H    . CYS A 1 40 ? -1.684  -1.140  -2.328  1.00 0.00 ? 40 CYS A H    6  
ATOM 4569  H HA   . CYS A 1 40 ? 0.378   -1.222  -4.251  1.00 0.00 ? 40 CYS A HA   6  
ATOM 4570  H HB2  . CYS A 1 40 ? 0.298   -2.904  -2.533  1.00 0.00 ? 40 CYS A HB2  6  
ATOM 4571  H HB3  . CYS A 1 40 ? -1.302  -3.430  -3.051  1.00 0.00 ? 40 CYS A HB3  6  
ATOM 4572  N N    . CYS A 1 41 ? -2.641  -1.732  -5.330  1.00 0.00 ? 41 CYS A N    6  
ATOM 4573  C CA   . CYS A 1 41 ? -3.450  -1.878  -6.524  1.00 0.00 ? 41 CYS A CA   6  
ATOM 4574  C C    . CYS A 1 41 ? -3.651  -0.539  -7.226  1.00 0.00 ? 41 CYS A C    6  
ATOM 4575  O O    . CYS A 1 41 ? -3.692  -0.467  -8.454  1.00 0.00 ? 41 CYS A O    6  
ATOM 4576  C CB   . CYS A 1 41 ? -4.796  -2.498  -6.158  1.00 0.00 ? 41 CYS A CB   6  
ATOM 4577  S SG   . CYS A 1 41 ? -6.165  -1.317  -5.901  1.00 0.00 ? 41 CYS A SG   6  
ATOM 4578  H H    . CYS A 1 41 ? -3.084  -1.546  -4.473  1.00 0.00 ? 41 CYS A H    6  
ATOM 4579  H HA   . CYS A 1 41 ? -2.931  -2.546  -7.193  1.00 0.00 ? 41 CYS A HA   6  
ATOM 4580  H HB2  . CYS A 1 41 ? -5.090  -3.164  -6.942  1.00 0.00 ? 41 CYS A HB2  6  
ATOM 4581  H HB3  . CYS A 1 41 ? -4.676  -3.058  -5.247  1.00 0.00 ? 41 CYS A HB3  6  
ATOM 4582  N N    . GLU A 1 42 ? -3.808  0.511   -6.432  1.00 0.00 ? 42 GLU A N    6  
ATOM 4583  C CA   . GLU A 1 42 ? -4.046  1.850   -6.976  1.00 0.00 ? 42 GLU A CA   6  
ATOM 4584  C C    . GLU A 1 42 ? -2.855  2.792   -6.787  1.00 0.00 ? 42 GLU A C    6  
ATOM 4585  O O    . GLU A 1 42 ? -3.038  4.004   -6.669  1.00 0.00 ? 42 GLU A O    6  
ATOM 4586  C CB   . GLU A 1 42 ? -5.290  2.465   -6.333  1.00 0.00 ? 42 GLU A CB   6  
ATOM 4587  C CG   . GLU A 1 42 ? -6.066  3.384   -7.263  1.00 0.00 ? 42 GLU A CG   6  
ATOM 4588  C CD   . GLU A 1 42 ? -7.539  3.454   -6.917  1.00 0.00 ? 42 GLU A CD   6  
ATOM 4589  O OE1  . GLU A 1 42 ? -7.899  4.224   -6.001  1.00 0.00 ? 42 GLU A OE1  6  
ATOM 4590  O OE2  . GLU A 1 42 ? -8.336  2.740   -7.563  1.00 0.00 ? 42 GLU A OE2  6  
ATOM 4591  H H    . GLU A 1 42 ? -3.790  0.376   -5.457  1.00 0.00 ? 42 GLU A H    6  
ATOM 4592  H HA   . GLU A 1 42 ? -4.229  1.741   -8.034  1.00 0.00 ? 42 GLU A HA   6  
ATOM 4593  H HB2  . GLU A 1 42 ? -5.948  1.670   -6.015  1.00 0.00 ? 42 GLU A HB2  6  
ATOM 4594  H HB3  . GLU A 1 42 ? -4.988  3.037   -5.467  1.00 0.00 ? 42 GLU A HB3  6  
ATOM 4595  H HG2  . GLU A 1 42 ? -5.648  4.378   -7.197  1.00 0.00 ? 42 GLU A HG2  6  
ATOM 4596  H HG3  . GLU A 1 42 ? -5.965  3.019   -8.275  1.00 0.00 ? 42 GLU A HG3  6  
ATOM 4597  N N    . HIS A 1 43 ? -1.643  2.250   -6.772  1.00 0.00 ? 43 HIS A N    6  
ATOM 4598  C CA   . HIS A 1 43 ? -0.451  3.082   -6.612  1.00 0.00 ? 43 HIS A CA   6  
ATOM 4599  C C    . HIS A 1 43 ? -0.071  3.743   -7.936  1.00 0.00 ? 43 HIS A C    6  
ATOM 4600  O O    . HIS A 1 43 ? -0.544  3.339   -8.998  1.00 0.00 ? 43 HIS A O    6  
ATOM 4601  C CB   . HIS A 1 43 ? 0.731   2.262   -6.085  1.00 0.00 ? 43 HIS A CB   6  
ATOM 4602  C CG   . HIS A 1 43 ? 0.885   0.930   -6.746  1.00 0.00 ? 43 HIS A CG   6  
ATOM 4603  N ND1  . HIS A 1 43 ? 0.396   0.652   -8.005  1.00 0.00 ? 43 HIS A ND1  6  
ATOM 4604  C CD2  . HIS A 1 43 ? 1.497   -0.201  -6.324  1.00 0.00 ? 43 HIS A CD2  6  
ATOM 4605  C CE1  . HIS A 1 43 ? 0.701   -0.592  -8.329  1.00 0.00 ? 43 HIS A CE1  6  
ATOM 4606  N NE2  . HIS A 1 43 ? 1.370   -1.131  -7.327  1.00 0.00 ? 43 HIS A NE2  6  
ATOM 4607  H H    . HIS A 1 43 ? -1.547  1.279   -6.875  1.00 0.00 ? 43 HIS A H    6  
ATOM 4608  H HA   . HIS A 1 43 ? -0.685  3.856   -5.895  1.00 0.00 ? 43 HIS A HA   6  
ATOM 4609  H HB2  . HIS A 1 43 ? 1.642   2.816   -6.251  1.00 0.00 ? 43 HIS A HB2  6  
ATOM 4610  H HB3  . HIS A 1 43 ? 0.606   2.098   -5.026  1.00 0.00 ? 43 HIS A HB3  6  
ATOM 4611  H HD1  . HIS A 1 43 ? -0.102  1.274   -8.575  1.00 0.00 ? 43 HIS A HD1  6  
ATOM 4612  H HD2  . HIS A 1 43 ? 1.991   -0.346  -5.373  1.00 0.00 ? 43 HIS A HD2  6  
ATOM 4613  H HE1  . HIS A 1 43 ? 0.448   -1.084  -9.257  1.00 0.00 ? 43 HIS A HE1  6  
ATOM 4614  H HE2  . HIS A 1 43 ? 1.805   -2.009  -7.347  1.00 0.00 ? 43 HIS A HE2  6  
ATOM 4615  N N    . PRO A 1 44 ? 0.788   4.777   -7.891  1.00 0.00 ? 44 PRO A N    6  
ATOM 4616  C CA   . PRO A 1 44 ? 1.227   5.499   -9.092  1.00 0.00 ? 44 PRO A CA   6  
ATOM 4617  C C    . PRO A 1 44 ? 1.846   4.575   -10.136 1.00 0.00 ? 44 PRO A C    6  
ATOM 4618  O O    . PRO A 1 44 ? 1.702   4.797   -11.338 1.00 0.00 ? 44 PRO A O    6  
ATOM 4619  C CB   . PRO A 1 44 ? 2.277   6.479   -8.560  1.00 0.00 ? 44 PRO A CB   6  
ATOM 4620  C CG   . PRO A 1 44 ? 1.935   6.654   -7.121  1.00 0.00 ? 44 PRO A CG   6  
ATOM 4621  C CD   . PRO A 1 44 ? 1.398   5.328   -6.666  1.00 0.00 ? 44 PRO A CD   6  
ATOM 4622  H HA   . PRO A 1 44 ? 0.413   6.049   -9.541  1.00 0.00 ? 44 PRO A HA   6  
ATOM 4623  H HB2  . PRO A 1 44 ? 3.263   6.055   -8.683  1.00 0.00 ? 44 PRO A HB2  6  
ATOM 4624  H HB3  . PRO A 1 44 ? 2.209   7.411   -9.098  1.00 0.00 ? 44 PRO A HB3  6  
ATOM 4625  H HG2  . PRO A 1 44 ? 2.822   6.914   -6.562  1.00 0.00 ? 44 PRO A HG2  6  
ATOM 4626  H HG3  . PRO A 1 44 ? 1.184   7.421   -7.013  1.00 0.00 ? 44 PRO A HG3  6  
ATOM 4627  H HD2  . PRO A 1 44 ? 2.199   4.696   -6.314  1.00 0.00 ? 44 PRO A HD2  6  
ATOM 4628  H HD3  . PRO A 1 44 ? 0.655   5.465   -5.894  1.00 0.00 ? 44 PRO A HD3  6  
ATOM 4629  N N    . GLY A 1 45 ? 2.539   3.543   -9.669  1.00 0.00 ? 45 GLY A N    6  
ATOM 4630  C CA   . GLY A 1 45 ? 3.173   2.604   -10.574 1.00 0.00 ? 45 GLY A CA   6  
ATOM 4631  C C    . GLY A 1 45 ? 4.077   1.628   -9.850  1.00 0.00 ? 45 GLY A C    6  
ATOM 4632  O O    . GLY A 1 45 ? 5.269   1.537   -10.146 1.00 0.00 ? 45 GLY A O    6  
ATOM 4633  H H    . GLY A 1 45 ? 2.621   3.419   -8.700  1.00 0.00 ? 45 GLY A H    6  
ATOM 4634  H HA2  . GLY A 1 45 ? 2.407   2.050   -11.097 1.00 0.00 ? 45 GLY A HA2  6  
ATOM 4635  H HA3  . GLY A 1 45 ? 3.759   3.155   -11.294 1.00 0.00 ? 45 GLY A HA3  6  
ATOM 4636  N N    . GLY A 1 46 ? 3.510   0.902   -8.894  1.00 0.00 ? 46 GLY A N    6  
ATOM 4637  C CA   . GLY A 1 46 ? 4.286   -0.059  -8.134  1.00 0.00 ? 46 GLY A CA   6  
ATOM 4638  C C    . GLY A 1 46 ? 5.461   0.581   -7.429  1.00 0.00 ? 46 GLY A C    6  
ATOM 4639  O O    . GLY A 1 46 ? 6.580   0.073   -7.488  1.00 0.00 ? 46 GLY A O    6  
ATOM 4640  H H    . GLY A 1 46 ? 2.558   1.022   -8.700  1.00 0.00 ? 46 GLY A H    6  
ATOM 4641  H HA2  . GLY A 1 46 ? 3.648   -0.519  -7.392  1.00 0.00 ? 46 GLY A HA2  6  
ATOM 4642  H HA3  . GLY A 1 46 ? 4.654   -0.823  -8.800  1.00 0.00 ? 46 GLY A HA3  6  
ATOM 4643  N N    . PHE A 1 47 ? 5.202   1.693   -6.752  1.00 0.00 ? 47 PHE A N    6  
ATOM 4644  C CA   . PHE A 1 47 ? 6.243   2.398   -6.020  1.00 0.00 ? 47 PHE A CA   6  
ATOM 4645  C C    . PHE A 1 47 ? 6.822   1.483   -4.936  1.00 0.00 ? 47 PHE A C    6  
ATOM 4646  O O    . PHE A 1 47 ? 7.372   0.432   -5.252  1.00 0.00 ? 47 PHE A O    6  
ATOM 4647  C CB   . PHE A 1 47 ? 5.676   3.694   -5.424  1.00 0.00 ? 47 PHE A CB   6  
ATOM 4648  C CG   . PHE A 1 47 ? 4.385   3.528   -4.657  1.00 0.00 ? 47 PHE A CG   6  
ATOM 4649  C CD1  . PHE A 1 47 ? 3.912   2.271   -4.301  1.00 0.00 ? 47 PHE A CD1  6  
ATOM 4650  C CD2  . PHE A 1 47 ? 3.648   4.641   -4.286  1.00 0.00 ? 47 PHE A CD2  6  
ATOM 4651  C CE1  . PHE A 1 47 ? 2.734   2.132   -3.594  1.00 0.00 ? 47 PHE A CE1  6  
ATOM 4652  C CE2  . PHE A 1 47 ? 2.468   4.507   -3.579  1.00 0.00 ? 47 PHE A CE2  6  
ATOM 4653  C CZ   . PHE A 1 47 ? 2.011   3.251   -3.232  1.00 0.00 ? 47 PHE A CZ   6  
ATOM 4654  H H    . PHE A 1 47 ? 4.287   2.043   -6.738  1.00 0.00 ? 47 PHE A H    6  
ATOM 4655  H HA   . PHE A 1 47 ? 7.028   2.645   -6.720  1.00 0.00 ? 47 PHE A HA   6  
ATOM 4656  H HB2  . PHE A 1 47 ? 6.405   4.118   -4.753  1.00 0.00 ? 47 PHE A HB2  6  
ATOM 4657  H HB3  . PHE A 1 47 ? 5.494   4.392   -6.228  1.00 0.00 ? 47 PHE A HB3  6  
ATOM 4658  H HD1  . PHE A 1 47 ? 4.473   1.393   -4.582  1.00 0.00 ? 47 PHE A HD1  6  
ATOM 4659  H HD2  . PHE A 1 47 ? 4.003   5.625   -4.556  1.00 0.00 ? 47 PHE A HD2  6  
ATOM 4660  H HE1  . PHE A 1 47 ? 2.379   1.149   -3.325  1.00 0.00 ? 47 PHE A HE1  6  
ATOM 4661  H HE2  . PHE A 1 47 ? 1.904   5.383   -3.298  1.00 0.00 ? 47 PHE A HE2  6  
ATOM 4662  H HZ   . PHE A 1 47 ? 1.090   3.143   -2.678  1.00 0.00 ? 47 PHE A HZ   6  
ATOM 4663  N N    . GLU A 1 48 ? 6.702   1.863   -3.668  1.00 0.00 ? 48 GLU A N    6  
ATOM 4664  C CA   . GLU A 1 48 ? 7.212   1.035   -2.583  1.00 0.00 ? 48 GLU A CA   6  
ATOM 4665  C C    . GLU A 1 48 ? 6.560   1.424   -1.266  1.00 0.00 ? 48 GLU A C    6  
ATOM 4666  O O    . GLU A 1 48 ? 5.906   2.463   -1.163  1.00 0.00 ? 48 GLU A O    6  
ATOM 4667  C CB   . GLU A 1 48 ? 8.728   1.162   -2.491  1.00 0.00 ? 48 GLU A CB   6  
ATOM 4668  C CG   . GLU A 1 48 ? 9.210   2.548   -2.091  1.00 0.00 ? 48 GLU A CG   6  
ATOM 4669  C CD   . GLU A 1 48 ? 10.719  2.681   -2.159  1.00 0.00 ? 48 GLU A CD   6  
ATOM 4670  O OE1  . GLU A 1 48 ? 11.412  1.981   -1.392  1.00 0.00 ? 48 GLU A OE1  6  
ATOM 4671  O OE2  . GLU A 1 48 ? 11.208  3.485   -2.979  1.00 0.00 ? 48 GLU A OE2  6  
ATOM 4672  H H    . GLU A 1 48 ? 6.261   2.712   -3.451  1.00 0.00 ? 48 GLU A H    6  
ATOM 4673  H HA   . GLU A 1 48 ? 6.960   -0.009  -2.794  1.00 0.00 ? 48 GLU A HA   6  
ATOM 4674  H HB2  . GLU A 1 48 ? 9.089   0.453   -1.763  1.00 0.00 ? 48 GLU A HB2  6  
ATOM 4675  H HB3  . GLU A 1 48 ? 9.151   0.921   -3.456  1.00 0.00 ? 48 GLU A HB3  6  
ATOM 4676  H HG2  . GLU A 1 48 ? 8.770   3.275   -2.756  1.00 0.00 ? 48 GLU A HG2  6  
ATOM 4677  H HG3  . GLU A 1 48 ? 8.891   2.748   -1.078  1.00 0.00 ? 48 GLU A HG3  6  
ATOM 4678  N N    . TYR A 1 49 ? 6.738   0.577   -0.273  1.00 0.00 ? 49 TYR A N    6  
ATOM 4679  C CA   . TYR A 1 49 ? 6.173   0.797   1.046   1.00 0.00 ? 49 TYR A CA   6  
ATOM 4680  C C    . TYR A 1 49 ? 6.953   0.032   2.082   1.00 0.00 ? 49 TYR A C    6  
ATOM 4681  O O    . TYR A 1 49 ? 7.668   -0.920  1.771   1.00 0.00 ? 49 TYR A O    6  
ATOM 4682  C CB   . TYR A 1 49 ? 4.733   0.353   1.088   1.00 0.00 ? 49 TYR A CB   6  
ATOM 4683  C CG   . TYR A 1 49 ? 4.492   -0.964  0.431   1.00 0.00 ? 49 TYR A CG   6  
ATOM 4684  C CD1  . TYR A 1 49 ? 4.979   -2.126  1.000   1.00 0.00 ? 49 TYR A CD1  6  
ATOM 4685  C CD2  . TYR A 1 49 ? 3.779   -1.048  -0.749  1.00 0.00 ? 49 TYR A CD2  6  
ATOM 4686  C CE1  . TYR A 1 49 ? 4.765   -3.346  0.410   1.00 0.00 ? 49 TYR A CE1  6  
ATOM 4687  C CE2  . TYR A 1 49 ? 3.557   -2.261  -1.348  1.00 0.00 ? 49 TYR A CE2  6  
ATOM 4688  C CZ   . TYR A 1 49 ? 4.050   -3.408  -0.770  1.00 0.00 ? 49 TYR A CZ   6  
ATOM 4689  O OH   . TYR A 1 49 ? 3.831   -4.613  -1.380  1.00 0.00 ? 49 TYR A OH   6  
ATOM 4690  H H    . TYR A 1 49 ? 7.265   -0.234  -0.432  1.00 0.00 ? 49 TYR A H    6  
ATOM 4691  H HA   . TYR A 1 49 ? 6.204   1.843   1.289   1.00 0.00 ? 49 TYR A HA   6  
ATOM 4692  H HB2  . TYR A 1 49 ? 4.441   0.260   2.114   1.00 0.00 ? 49 TYR A HB2  6  
ATOM 4693  H HB3  . TYR A 1 49 ? 4.120   1.091   0.601   1.00 0.00 ? 49 TYR A HB3  6  
ATOM 4694  H HD1  . TYR A 1 49 ? 5.537   -2.066  1.920   1.00 0.00 ? 49 TYR A HD1  6  
ATOM 4695  H HD2  . TYR A 1 49 ? 3.395   -0.144  -1.203  1.00 0.00 ? 49 TYR A HD2  6  
ATOM 4696  H HE1  . TYR A 1 49 ? 5.152   -4.241  0.877   1.00 0.00 ? 49 TYR A HE1  6  
ATOM 4697  H HE2  . TYR A 1 49 ? 2.998   -2.308  -2.261  1.00 0.00 ? 49 TYR A HE2  6  
ATOM 4698  H HH   . TYR A 1 49 ? 4.125   -4.567  -2.293  1.00 0.00 ? 49 TYR A HH   6  
ATOM 4699  N N    . SER A 1 50 ? 6.795   0.448   3.313   1.00 0.00 ? 50 SER A N    6  
ATOM 4700  C CA   . SER A 1 50 ? 7.467   -0.201  4.419   1.00 0.00 ? 50 SER A CA   6  
ATOM 4701  C C    . SER A 1 50 ? 6.531   -0.293  5.606   1.00 0.00 ? 50 SER A C    6  
ATOM 4702  O O    . SER A 1 50 ? 6.378   0.660   6.371   1.00 0.00 ? 50 SER A O    6  
ATOM 4703  C CB   . SER A 1 50 ? 8.741   0.550   4.782   1.00 0.00 ? 50 SER A CB   6  
ATOM 4704  O OG   . SER A 1 50 ? 8.599   1.941   4.562   1.00 0.00 ? 50 SER A OG   6  
ATOM 4705  H H    . SER A 1 50 ? 6.194   1.211   3.482   1.00 0.00 ? 50 SER A H    6  
ATOM 4706  H HA   . SER A 1 50 ? 7.727   -1.202  4.106   1.00 0.00 ? 50 SER A HA   6  
ATOM 4707  H HB2  . SER A 1 50 ? 8.968   0.381   5.819   1.00 0.00 ? 50 SER A HB2  6  
ATOM 4708  H HB3  . SER A 1 50 ? 9.549   0.182   4.168   1.00 0.00 ? 50 SER A HB3  6  
ATOM 4709  H HG   . SER A 1 50 ? 9.076   2.190   3.767   1.00 0.00 ? 50 SER A HG   6  
ATOM 4710  N N    . ASN A 1 51 ? 5.881   -1.441  5.734   1.00 0.00 ? 51 ASN A N    6  
ATOM 4711  C CA   . ASN A 1 51 ? 4.922   -1.659  6.805   1.00 0.00 ? 51 ASN A CA   6  
ATOM 4712  C C    . ASN A 1 51 ? 5.469   -1.194  8.155   1.00 0.00 ? 51 ASN A C    6  
ATOM 4713  O O    . ASN A 1 51 ? 6.614   -1.478  8.505   1.00 0.00 ? 51 ASN A O    6  
ATOM 4714  C CB   . ASN A 1 51 ? 4.534   -3.130  6.900   1.00 0.00 ? 51 ASN A CB   6  
ATOM 4715  C CG   . ASN A 1 51 ? 4.135   -3.717  5.561   1.00 0.00 ? 51 ASN A CG   6  
ATOM 4716  O OD1  . ASN A 1 51 ? 4.988   -4.070  4.747   1.00 0.00 ? 51 ASN A OD1  6  
ATOM 4717  N ND2  . ASN A 1 51 ? 2.833   -3.825  5.328   1.00 0.00 ? 51 ASN A ND2  6  
ATOM 4718  H H    . ASN A 1 51 ? 6.033   -2.150  5.077   1.00 0.00 ? 51 ASN A H    6  
ATOM 4719  H HA   . ASN A 1 51 ? 4.040   -1.088  6.557   1.00 0.00 ? 51 ASN A HA   6  
ATOM 4720  H HB2  . ASN A 1 51 ? 5.370   -3.694  7.287   1.00 0.00 ? 51 ASN A HB2  6  
ATOM 4721  H HB3  . ASN A 1 51 ? 3.698   -3.219  7.580   1.00 0.00 ? 51 ASN A HB3  6  
ATOM 4722  H HD21 . ASN A 1 51 ? 2.212   -3.524  6.023   1.00 0.00 ? 51 ASN A HD21 6  
ATOM 4723  H HD22 . ASN A 1 51 ? 2.546   -4.203  4.471   1.00 0.00 ? 51 ASN A HD22 6  
ATOM 4724  N N    . GLY A 1 52 ? 4.635   -0.489  8.913   1.00 0.00 ? 52 GLY A N    6  
ATOM 4725  C CA   . GLY A 1 52 ? 5.043   -0.004  10.223  1.00 0.00 ? 52 GLY A CA   6  
ATOM 4726  C C    . GLY A 1 52 ? 4.785   1.482   10.402  1.00 0.00 ? 52 GLY A C    6  
ATOM 4727  O O    . GLY A 1 52 ? 4.666   2.209   9.426   1.00 0.00 ? 52 GLY A O    6  
ATOM 4728  H H    . GLY A 1 52 ? 3.730   -0.300  8.579   1.00 0.00 ? 52 GLY A H    6  
ATOM 4729  H HA2  . GLY A 1 52 ? 4.497   -0.547  10.979  1.00 0.00 ? 52 GLY A HA2  6  
ATOM 4730  H HA3  . GLY A 1 52 ? 6.099   -0.193  10.352  1.00 0.00 ? 52 GLY A HA3  6  
ATOM 4731  N N    . PRO A 1 53 ? 4.680   1.965   11.650  1.00 0.00 ? 53 PRO A N    6  
ATOM 4732  C CA   . PRO A 1 53 ? 4.422   3.384   11.929  1.00 0.00 ? 53 PRO A CA   6  
ATOM 4733  C C    . PRO A 1 53 ? 5.597   4.290   11.564  1.00 0.00 ? 53 PRO A C    6  
ATOM 4734  O O    . PRO A 1 53 ? 6.671   4.206   12.159  1.00 0.00 ? 53 PRO A O    6  
ATOM 4735  C CB   . PRO A 1 53 ? 4.179   3.411   13.440  1.00 0.00 ? 53 PRO A CB   6  
ATOM 4736  C CG   . PRO A 1 53 ? 4.898   2.215   13.960  1.00 0.00 ? 53 PRO A CG   6  
ATOM 4737  C CD   . PRO A 1 53 ? 4.782   1.171   12.886  1.00 0.00 ? 53 PRO A CD   6  
ATOM 4738  H HA   . PRO A 1 53 ? 3.541   3.732   11.417  1.00 0.00 ? 53 PRO A HA   6  
ATOM 4739  H HB2  . PRO A 1 53 ? 4.577   4.326   13.856  1.00 0.00 ? 53 PRO A HB2  6  
ATOM 4740  H HB3  . PRO A 1 53 ? 3.119   3.350   13.638  1.00 0.00 ? 53 PRO A HB3  6  
ATOM 4741  H HG2  . PRO A 1 53 ? 5.936   2.459   14.137  1.00 0.00 ? 53 PRO A HG2  6  
ATOM 4742  H HG3  . PRO A 1 53 ? 4.431   1.872   14.869  1.00 0.00 ? 53 PRO A HG3  6  
ATOM 4743  H HD2  . PRO A 1 53 ? 5.660   0.544   12.868  1.00 0.00 ? 53 PRO A HD2  6  
ATOM 4744  H HD3  . PRO A 1 53 ? 3.892   0.575   13.033  1.00 0.00 ? 53 PRO A HD3  6  
ATOM 4745  N N    . CYS A 1 54 ? 5.370   5.174   10.595  1.00 0.00 ? 54 CYS A N    6  
ATOM 4746  C CA   . CYS A 1 54 ? 6.389   6.121   10.155  1.00 0.00 ? 54 CYS A CA   6  
ATOM 4747  C C    . CYS A 1 54 ? 5.887   7.550   10.341  1.00 0.00 ? 54 CYS A C    6  
ATOM 4748  O O    . CYS A 1 54 ? 6.591   8.407   10.875  1.00 0.00 ? 54 CYS A O    6  
ATOM 4749  C CB   . CYS A 1 54 ? 6.749   5.898   8.683   1.00 0.00 ? 54 CYS A CB   6  
ATOM 4750  S SG   . CYS A 1 54 ? 7.381   4.234   8.290   1.00 0.00 ? 54 CYS A SG   6  
ATOM 4751  H H    . CYS A 1 54 ? 4.485   5.198   10.174  1.00 0.00 ? 54 CYS A H    6  
ATOM 4752  H HA   . CYS A 1 54 ? 7.269   5.974   10.764  1.00 0.00 ? 54 CYS A HA   6  
ATOM 4753  H HB2  . CYS A 1 54 ? 5.871   6.062   8.082   1.00 0.00 ? 54 CYS A HB2  6  
ATOM 4754  H HB3  . CYS A 1 54 ? 7.509   6.611   8.396   1.00 0.00 ? 54 CYS A HB3  6  
ATOM 4755  N N    . GLU A 1 55 ? 4.656   7.791   9.895   1.00 0.00 ? 55 GLU A N    6  
ATOM 4756  C CA   . GLU A 1 55 ? 4.035   9.109   10.002  1.00 0.00 ? 55 GLU A CA   6  
ATOM 4757  C C    . GLU A 1 55 ? 3.638   9.404   11.446  1.00 0.00 ? 55 GLU A C    6  
ATOM 4758  O O    . GLU A 1 55 ? 3.154   8.477   12.127  1.00 0.00 ? 55 GLU A O    6  
ATOM 4759  C CB   . GLU A 1 55 ? 2.803   9.189   9.091   1.00 0.00 ? 55 GLU A CB   6  
ATOM 4760  C CG   . GLU A 1 55 ? 2.027   10.491  9.220   1.00 0.00 ? 55 GLU A CG   6  
ATOM 4761  C CD   . GLU A 1 55 ? 2.065   11.324  7.952   1.00 0.00 ? 55 GLU A CD   6  
ATOM 4762  O OE1  . GLU A 1 55 ? 2.184   10.734  6.859   1.00 0.00 ? 55 GLU A OE1  6  
ATOM 4763  O OE2  . GLU A 1 55 ? 1.974   12.565  8.054   1.00 0.00 ? 55 GLU A OE2  6  
ATOM 4764  O OXT  . GLU A 1 55 ? 3.815   10.562  11.881  1.00 0.00 ? 55 GLU A OXT  6  
ATOM 4765  H H    . GLU A 1 55 ? 4.150   7.061   9.482   1.00 0.00 ? 55 GLU A H    6  
ATOM 4766  H HA   . GLU A 1 55 ? 4.758   9.843   9.682   1.00 0.00 ? 55 GLU A HA   6  
ATOM 4767  H HB2  . GLU A 1 55 ? 3.123   9.090   8.065   1.00 0.00 ? 55 GLU A HB2  6  
ATOM 4768  H HB3  . GLU A 1 55 ? 2.137   8.373   9.329   1.00 0.00 ? 55 GLU A HB3  6  
ATOM 4769  H HG2  . GLU A 1 55 ? 0.998   10.261  9.448   1.00 0.00 ? 55 GLU A HG2  6  
ATOM 4770  H HG3  . GLU A 1 55 ? 2.452   11.071  10.026  1.00 0.00 ? 55 GLU A HG3  6  
ATOM 4771  N N    . ALA A 1 1  ? 12.473  -0.344  -5.361  1.00 0.00 ? 1  ALA A N    7  
ATOM 4772  C CA   . ALA A 1 1  ? 11.017  -0.156  -5.130  1.00 0.00 ? 1  ALA A CA   7  
ATOM 4773  C C    . ALA A 1 1  ? 10.474  -1.200  -4.161  1.00 0.00 ? 1  ALA A C    7  
ATOM 4774  O O    . ALA A 1 1  ? 10.815  -2.380  -4.249  1.00 0.00 ? 1  ALA A O    7  
ATOM 4775  C CB   . ALA A 1 1  ? 10.261  -0.219  -6.448  1.00 0.00 ? 1  ALA A CB   7  
ATOM 4776  H H1   . ALA A 1 1  ? 12.897  -0.665  -4.468  1.00 0.00 ? 1  ALA A H1   7  
ATOM 4777  H H2   . ALA A 1 1  ? 12.867  0.573   -5.656  1.00 0.00 ? 1  ALA A H2   7  
ATOM 4778  H H3   . ALA A 1 1  ? 12.586  -1.060  -6.106  1.00 0.00 ? 1  ALA A H3   7  
ATOM 4779  H HA   . ALA A 1 1  ? 10.865  0.826   -4.704  1.00 0.00 ? 1  ALA A HA   7  
ATOM 4780  H HB1  . ALA A 1 1  ? 10.335  -1.217  -6.858  1.00 0.00 ? 1  ALA A HB1  7  
ATOM 4781  H HB2  . ALA A 1 1  ? 10.690  0.487   -7.144  1.00 0.00 ? 1  ALA A HB2  7  
ATOM 4782  H HB3  . ALA A 1 1  ? 9.223   0.025   -6.281  1.00 0.00 ? 1  ALA A HB3  7  
ATOM 4783  N N    . HIS A 1 2  ? 9.628   -0.759  -3.238  1.00 0.00 ? 2  HIS A N    7  
ATOM 4784  C CA   . HIS A 1 2  ? 9.036   -1.655  -2.251  1.00 0.00 ? 2  HIS A CA   7  
ATOM 4785  C C    . HIS A 1 2  ? 7.568   -1.919  -2.574  1.00 0.00 ? 2  HIS A C    7  
ATOM 4786  O O    . HIS A 1 2  ? 6.679   -1.657  -1.765  1.00 0.00 ? 2  HIS A O    7  
ATOM 4787  C CB   . HIS A 1 2  ? 9.174   -1.061  -0.850  1.00 0.00 ? 2  HIS A CB   7  
ATOM 4788  C CG   . HIS A 1 2  ? 10.559  -0.594  -0.531  1.00 0.00 ? 2  HIS A CG   7  
ATOM 4789  N ND1  . HIS A 1 2  ? 10.819  0.511   0.254   1.00 0.00 ? 2  HIS A ND1  7  
ATOM 4790  C CD2  . HIS A 1 2  ? 11.767  -1.088  -0.893  1.00 0.00 ? 2  HIS A CD2  7  
ATOM 4791  C CE1  . HIS A 1 2  ? 12.126  0.676   0.358   1.00 0.00 ? 2  HIS A CE1  7  
ATOM 4792  N NE2  . HIS A 1 2  ? 12.724  -0.281  -0.327  1.00 0.00 ? 2  HIS A NE2  7  
ATOM 4793  H H    . HIS A 1 2  ? 9.395   0.192   -3.219  1.00 0.00 ? 2  HIS A H    7  
ATOM 4794  H HA   . HIS A 1 2  ? 9.571   -2.590  -2.294  1.00 0.00 ? 2  HIS A HA   7  
ATOM 4795  H HB2  . HIS A 1 2  ? 8.511   -0.214  -0.761  1.00 0.00 ? 2  HIS A HB2  7  
ATOM 4796  H HB3  . HIS A 1 2  ? 8.896   -1.808  -0.121  1.00 0.00 ? 2  HIS A HB3  7  
ATOM 4797  H HD1  . HIS A 1 2  ? 10.146  1.088   0.671   1.00 0.00 ? 2  HIS A HD1  7  
ATOM 4798  H HD2  . HIS A 1 2  ? 11.945  -1.955  -1.514  1.00 0.00 ? 2  HIS A HD2  7  
ATOM 4799  H HE1  . HIS A 1 2  ? 12.621  1.460   0.913   1.00 0.00 ? 2  HIS A HE1  7  
ATOM 4800  H HE2  . HIS A 1 2  ? 13.688  -0.455  -0.329  1.00 0.00 ? 2  HIS A HE2  7  
ATOM 4801  N N    . MET A 1 3  ? 7.334   -2.434  -3.772  1.00 0.00 ? 3  MET A N    7  
ATOM 4802  C CA   . MET A 1 3  ? 5.982   -2.735  -4.240  1.00 0.00 ? 3  MET A CA   7  
ATOM 4803  C C    . MET A 1 3  ? 5.487   -4.089  -3.723  1.00 0.00 ? 3  MET A C    7  
ATOM 4804  O O    . MET A 1 3  ? 6.276   -4.956  -3.349  1.00 0.00 ? 3  MET A O    7  
ATOM 4805  C CB   . MET A 1 3  ? 5.941   -2.723  -5.769  1.00 0.00 ? 3  MET A CB   7  
ATOM 4806  C CG   . MET A 1 3  ? 7.042   -3.551  -6.413  1.00 0.00 ? 3  MET A CG   7  
ATOM 4807  S SD   . MET A 1 3  ? 6.772   -3.818  -8.176  1.00 0.00 ? 3  MET A SD   7  
ATOM 4808  C CE   . MET A 1 3  ? 8.455   -3.769  -8.786  1.00 0.00 ? 3  MET A CE   7  
ATOM 4809  H H    . MET A 1 3  ? 8.093   -2.605  -4.364  1.00 0.00 ? 3  MET A H    7  
ATOM 4810  H HA   . MET A 1 3  ? 5.327   -1.963  -3.869  1.00 0.00 ? 3  MET A HA   7  
ATOM 4811  H HB2  . MET A 1 3  ? 4.989   -3.113  -6.095  1.00 0.00 ? 3  MET A HB2  7  
ATOM 4812  H HB3  . MET A 1 3  ? 6.039   -1.703  -6.111  1.00 0.00 ? 3  MET A HB3  7  
ATOM 4813  H HG2  . MET A 1 3  ? 7.983   -3.036  -6.284  1.00 0.00 ? 3  MET A HG2  7  
ATOM 4814  H HG3  . MET A 1 3  ? 7.088   -4.510  -5.920  1.00 0.00 ? 3  MET A HG3  7  
ATOM 4815  H HE1  . MET A 1 3  ? 9.107   -4.269  -8.085  1.00 0.00 ? 3  MET A HE1  7  
ATOM 4816  H HE2  . MET A 1 3  ? 8.768   -2.740  -8.896  1.00 0.00 ? 3  MET A HE2  7  
ATOM 4817  H HE3  . MET A 1 3  ? 8.507   -4.265  -9.743  1.00 0.00 ? 3  MET A HE3  7  
ATOM 4818  N N    . ASP A 1 4  ? 4.164   -4.249  -3.714  1.00 0.00 ? 4  ASP A N    7  
ATOM 4819  C CA   . ASP A 1 4  ? 3.518   -5.479  -3.259  1.00 0.00 ? 4  ASP A CA   7  
ATOM 4820  C C    . ASP A 1 4  ? 2.002   -5.327  -3.371  1.00 0.00 ? 4  ASP A C    7  
ATOM 4821  O O    . ASP A 1 4  ? 1.286   -5.351  -2.370  1.00 0.00 ? 4  ASP A O    7  
ATOM 4822  C CB   . ASP A 1 4  ? 3.917   -5.787  -1.810  1.00 0.00 ? 4  ASP A CB   7  
ATOM 4823  C CG   . ASP A 1 4  ? 5.046   -6.797  -1.721  1.00 0.00 ? 4  ASP A CG   7  
ATOM 4824  O OD1  . ASP A 1 4  ? 5.503   -7.276  -2.780  1.00 0.00 ? 4  ASP A OD1  7  
ATOM 4825  O OD2  . ASP A 1 4  ? 5.473   -7.108  -0.588  1.00 0.00 ? 4  ASP A OD2  7  
ATOM 4826  H H    . ASP A 1 4  ? 3.601   -3.512  -4.032  1.00 0.00 ? 4  ASP A H    7  
ATOM 4827  H HA   . ASP A 1 4  ? 3.841   -6.286  -3.899  1.00 0.00 ? 4  ASP A HA   7  
ATOM 4828  H HB2  . ASP A 1 4  ? 4.238   -4.875  -1.329  1.00 0.00 ? 4  ASP A HB2  7  
ATOM 4829  H HB3  . ASP A 1 4  ? 3.061   -6.184  -1.282  1.00 0.00 ? 4  ASP A HB3  7  
ATOM 4830  N N    . CYS A 1 5  ? 1.526   -5.125  -4.595  1.00 0.00 ? 5  CYS A N    7  
ATOM 4831  C CA   . CYS A 1 5  ? 0.103   -4.907  -4.839  1.00 0.00 ? 5  CYS A CA   7  
ATOM 4832  C C    . CYS A 1 5  ? -0.701  -6.197  -4.820  1.00 0.00 ? 5  CYS A C    7  
ATOM 4833  O O    . CYS A 1 5  ? -0.147  -7.296  -4.817  1.00 0.00 ? 5  CYS A O    7  
ATOM 4834  C CB   . CYS A 1 5  ? -0.094  -4.216  -6.190  1.00 0.00 ? 5  CYS A CB   7  
ATOM 4835  S SG   . CYS A 1 5  ? 1.135   -2.923  -6.546  1.00 0.00 ? 5  CYS A SG   7  
ATOM 4836  H H    . CYS A 1 5  ? 2.151   -5.087  -5.348  1.00 0.00 ? 5  CYS A H    7  
ATOM 4837  H HA   . CYS A 1 5  ? -0.268  -4.258  -4.062  1.00 0.00 ? 5  CYS A HA   7  
ATOM 4838  H HB2  . CYS A 1 5  ? -0.032  -4.953  -6.977  1.00 0.00 ? 5  CYS A HB2  7  
ATOM 4839  H HB3  . CYS A 1 5  ? -1.071  -3.756  -6.212  1.00 0.00 ? 5  CYS A HB3  7  
ATOM 4840  N N    . THR A 1 6  ? -2.023  -6.039  -4.815  1.00 0.00 ? 6  THR A N    7  
ATOM 4841  C CA   . THR A 1 6  ? -2.934  -7.170  -4.807  1.00 0.00 ? 6  THR A CA   7  
ATOM 4842  C C    . THR A 1 6  ? -2.763  -8.031  -6.071  1.00 0.00 ? 6  THR A C    7  
ATOM 4843  O O    . THR A 1 6  ? -3.348  -9.108  -6.143  1.00 0.00 ? 6  THR A O    7  
ATOM 4844  C CB   . THR A 1 6  ? -4.379  -6.670  -4.725  1.00 0.00 ? 6  THR A CB   7  
ATOM 4845  O OG1  . THR A 1 6  ? -4.425  -5.349  -4.212  1.00 0.00 ? 6  THR A OG1  7  
ATOM 4846  C CG2  . THR A 1 6  ? -5.261  -7.534  -3.849  1.00 0.00 ? 6  THR A CG2  7  
ATOM 4847  H H    . THR A 1 6  ? -2.398  -5.127  -4.823  1.00 0.00 ? 6  THR A H    7  
ATOM 4848  H HA   . THR A 1 6  ? -2.731  -7.779  -3.913  1.00 0.00 ? 6  THR A HA   7  
ATOM 4849  H HB   . THR A 1 6  ? -4.802  -6.663  -5.717  1.00 0.00 ? 6  THR A HB   7  
ATOM 4850  H HG1  . THR A 1 6  ? -3.845  -5.280  -3.449  1.00 0.00 ? 6  THR A HG1  7  
ATOM 4851  H HG21 . THR A 1 6  ? -4.911  -7.487  -2.828  1.00 0.00 ? 6  THR A HG21 7  
ATOM 4852  H HG22 . THR A 1 6  ? -5.223  -8.555  -4.197  1.00 0.00 ? 6  THR A HG22 7  
ATOM 4853  H HG23 . THR A 1 6  ? -6.278  -7.174  -3.897  1.00 0.00 ? 6  THR A HG23 7  
ATOM 4854  N N    . GLU A 1 7  ? -1.977  -7.550  -7.078  1.00 0.00 ? 7  GLU A N    7  
ATOM 4855  C CA   . GLU A 1 7  ? -1.764  -8.285  -8.336  1.00 0.00 ? 7  GLU A CA   7  
ATOM 4856  C C    . GLU A 1 7  ? -2.107  -9.767  -8.213  1.00 0.00 ? 7  GLU A C    7  
ATOM 4857  O O    . GLU A 1 7  ? -1.233  -10.616 -8.042  1.00 0.00 ? 7  GLU A O    7  
ATOM 4858  C CB   . GLU A 1 7  ? -0.312  -8.131  -8.793  1.00 0.00 ? 7  GLU A CB   7  
ATOM 4859  C CG   . GLU A 1 7  ? 0.700   -8.664  -7.790  1.00 0.00 ? 7  GLU A CG   7  
ATOM 4860  C CD   . GLU A 1 7  ? 1.793   -7.662  -7.473  1.00 0.00 ? 7  GLU A CD   7  
ATOM 4861  O OE1  . GLU A 1 7  ? 2.019   -6.749  -8.296  1.00 0.00 ? 7  GLU A OE1  7  
ATOM 4862  O OE2  . GLU A 1 7  ? 2.423   -7.790  -6.402  1.00 0.00 ? 7  GLU A OE2  7  
ATOM 4863  H H    . GLU A 1 7  ? -1.543  -6.667  -6.991  1.00 0.00 ? 7  GLU A H    7  
ATOM 4864  H HA   . GLU A 1 7  ? -2.407  -7.845  -9.083  1.00 0.00 ? 7  GLU A HA   7  
ATOM 4865  H HB2  . GLU A 1 7  ? -0.180  -8.665  -9.722  1.00 0.00 ? 7  GLU A HB2  7  
ATOM 4866  H HB3  . GLU A 1 7  ? -0.107  -7.084  -8.957  1.00 0.00 ? 7  GLU A HB3  7  
ATOM 4867  H HG2  . GLU A 1 7  ? 0.184   -8.911  -6.874  1.00 0.00 ? 7  GLU A HG2  7  
ATOM 4868  H HG3  . GLU A 1 7  ? 1.155   -9.555  -8.197  1.00 0.00 ? 7  GLU A HG3  7  
ATOM 4869  N N    . PHE A 1 8  ? -3.399  -10.050 -8.306  1.00 0.00 ? 8  PHE A N    7  
ATOM 4870  C CA   . PHE A 1 8  ? -3.924  -11.403 -8.214  1.00 0.00 ? 8  PHE A CA   7  
ATOM 4871  C C    . PHE A 1 8  ? -5.318  -11.428 -8.835  1.00 0.00 ? 8  PHE A C    7  
ATOM 4872  O O    . PHE A 1 8  ? -5.575  -10.715 -9.805  1.00 0.00 ? 8  PHE A O    7  
ATOM 4873  C CB   . PHE A 1 8  ? -3.958  -11.858 -6.746  1.00 0.00 ? 8  PHE A CB   7  
ATOM 4874  C CG   . PHE A 1 8  ? -2.596  -12.034 -6.136  1.00 0.00 ? 8  PHE A CG   7  
ATOM 4875  C CD1  . PHE A 1 8  ? -1.688  -12.927 -6.682  1.00 0.00 ? 8  PHE A CD1  7  
ATOM 4876  C CD2  . PHE A 1 8  ? -2.224  -11.308 -5.015  1.00 0.00 ? 8  PHE A CD2  7  
ATOM 4877  C CE1  . PHE A 1 8  ? -0.435  -13.092 -6.124  1.00 0.00 ? 8  PHE A CE1  7  
ATOM 4878  C CE2  . PHE A 1 8  ? -0.972  -11.469 -4.452  1.00 0.00 ? 8  PHE A CE2  7  
ATOM 4879  C CZ   . PHE A 1 8  ? -0.076  -12.362 -5.007  1.00 0.00 ? 8  PHE A CZ   7  
ATOM 4880  H H    . PHE A 1 8  ? -4.029  -9.312  -8.444  1.00 0.00 ? 8  PHE A H    7  
ATOM 4881  H HA   . PHE A 1 8  ? -3.280  -12.058 -8.776  1.00 0.00 ? 8  PHE A HA   7  
ATOM 4882  H HB2  . PHE A 1 8  ? -4.492  -11.124 -6.161  1.00 0.00 ? 8  PHE A HB2  7  
ATOM 4883  H HB3  . PHE A 1 8  ? -4.472  -12.805 -6.682  1.00 0.00 ? 8  PHE A HB3  7  
ATOM 4884  H HD1  . PHE A 1 8  ? -1.967  -13.498 -7.556  1.00 0.00 ? 8  PHE A HD1  7  
ATOM 4885  H HD2  . PHE A 1 8  ? -2.923  -10.611 -4.579  1.00 0.00 ? 8  PHE A HD2  7  
ATOM 4886  H HE1  . PHE A 1 8  ? 0.263   -13.791 -6.560  1.00 0.00 ? 8  PHE A HE1  7  
ATOM 4887  H HE2  . PHE A 1 8  ? -0.694  -10.897 -3.579  1.00 0.00 ? 8  PHE A HE2  7  
ATOM 4888  H HZ   . PHE A 1 8  ? 0.902   -12.490 -4.569  1.00 0.00 ? 8  PHE A HZ   7  
ATOM 4889  N N    . ASN A 1 9  ? -6.222  -12.225 -8.283  1.00 0.00 ? 9  ASN A N    7  
ATOM 4890  C CA   . ASN A 1 9  ? -7.576  -12.291 -8.809  1.00 0.00 ? 9  ASN A CA   7  
ATOM 4891  C C    . ASN A 1 9  ? -8.320  -10.985 -8.520  1.00 0.00 ? 9  ASN A C    7  
ATOM 4892  O O    . ASN A 1 9  ? -8.829  -10.340 -9.438  1.00 0.00 ? 9  ASN A O    7  
ATOM 4893  C CB   . ASN A 1 9  ? -8.330  -13.480 -8.210  1.00 0.00 ? 9  ASN A CB   7  
ATOM 4894  C CG   . ASN A 1 9  ? -8.534  -14.599 -9.213  1.00 0.00 ? 9  ASN A CG   7  
ATOM 4895  O OD1  . ASN A 1 9  ? -9.263  -14.444 -10.193 1.00 0.00 ? 9  ASN A OD1  7  
ATOM 4896  N ND2  . ASN A 1 9  ? -7.889  -15.734 -8.972  1.00 0.00 ? 9  ASN A ND2  7  
ATOM 4897  H H    . ASN A 1 9  ? -5.980  -12.770 -7.510  1.00 0.00 ? 9  ASN A H    7  
ATOM 4898  H HA   . ASN A 1 9  ? -7.507  -12.421 -9.879  1.00 0.00 ? 9  ASN A HA   7  
ATOM 4899  H HB2  . ASN A 1 9  ? -7.769  -13.872 -7.375  1.00 0.00 ? 9  ASN A HB2  7  
ATOM 4900  H HB3  . ASN A 1 9  ? -9.299  -13.150 -7.864  1.00 0.00 ? 9  ASN A HB3  7  
ATOM 4901  H HD21 . ASN A 1 9  ? -7.327  -15.786 -8.171  1.00 0.00 ? 9  ASN A HD21 7  
ATOM 4902  H HD22 . ASN A 1 9  ? -8.003  -16.474 -9.605  1.00 0.00 ? 9  ASN A HD22 7  
ATOM 4903  N N    . PRO A 1 10 ? -8.408  -10.582 -7.237  1.00 0.00 ? 10 PRO A N    7  
ATOM 4904  C CA   . PRO A 1 10 ? -9.098  -9.370  -6.824  1.00 0.00 ? 10 PRO A CA   7  
ATOM 4905  C C    . PRO A 1 10 ? -8.155  -8.201  -6.521  1.00 0.00 ? 10 PRO A C    7  
ATOM 4906  O O    . PRO A 1 10 ? -7.543  -8.154  -5.454  1.00 0.00 ? 10 PRO A O    7  
ATOM 4907  C CB   . PRO A 1 10 ? -9.761  -9.847  -5.538  1.00 0.00 ? 10 PRO A CB   7  
ATOM 4908  C CG   . PRO A 1 10 ? -8.767  -10.797 -4.935  1.00 0.00 ? 10 PRO A CG   7  
ATOM 4909  C CD   . PRO A 1 10 ? -7.869  -11.278 -6.060  1.00 0.00 ? 10 PRO A CD   7  
ATOM 4910  H HA   . PRO A 1 10 ? -9.851  -9.067  -7.534  1.00 0.00 ? 10 PRO A HA   7  
ATOM 4911  H HB2  . PRO A 1 10 ? -9.949  -9.002  -4.891  1.00 0.00 ? 10 PRO A HB2  7  
ATOM 4912  H HB3  . PRO A 1 10 ? -10.690 -10.345 -5.770  1.00 0.00 ? 10 PRO A HB3  7  
ATOM 4913  H HG2  . PRO A 1 10 ? -8.181  -10.283 -4.188  1.00 0.00 ? 10 PRO A HG2  7  
ATOM 4914  H HG3  . PRO A 1 10 ? -9.287  -11.634 -4.491  1.00 0.00 ? 10 PRO A HG3  7  
ATOM 4915  H HD2  . PRO A 1 10 ? -6.844  -10.990 -5.876  1.00 0.00 ? 10 PRO A HD2  7  
ATOM 4916  H HD3  . PRO A 1 10 ? -7.947  -12.347 -6.172  1.00 0.00 ? 10 PRO A HD3  7  
ATOM 4917  N N    . LEU A 1 11 ? -8.063  -7.246  -7.445  1.00 0.00 ? 11 LEU A N    7  
ATOM 4918  C CA   . LEU A 1 11 ? -7.216  -6.070  -7.243  1.00 0.00 ? 11 LEU A CA   7  
ATOM 4919  C C    . LEU A 1 11 ? -7.780  -5.228  -6.116  1.00 0.00 ? 11 LEU A C    7  
ATOM 4920  O O    . LEU A 1 11 ? -8.774  -5.611  -5.516  1.00 0.00 ? 11 LEU A O    7  
ATOM 4921  C CB   . LEU A 1 11 ? -7.124  -5.243  -8.527  1.00 0.00 ? 11 LEU A CB   7  
ATOM 4922  C CG   . LEU A 1 11 ? -5.963  -5.611  -9.451  1.00 0.00 ? 11 LEU A CG   7  
ATOM 4923  C CD1  . LEU A 1 11 ? -4.643  -5.555  -8.696  1.00 0.00 ? 11 LEU A CD1  7  
ATOM 4924  C CD2  . LEU A 1 11 ? -6.178  -6.992  -10.050 1.00 0.00 ? 11 LEU A CD2  7  
ATOM 4925  H H    . LEU A 1 11 ? -8.589  -7.322  -8.269  1.00 0.00 ? 11 LEU A H    7  
ATOM 4926  H HA   . LEU A 1 11 ? -6.232  -6.398  -6.958  1.00 0.00 ? 11 LEU A HA   7  
ATOM 4927  H HB2  . LEU A 1 11 ? -8.046  -5.365  -9.076  1.00 0.00 ? 11 LEU A HB2  7  
ATOM 4928  H HB3  . LEU A 1 11 ? -7.022  -4.203  -8.254  1.00 0.00 ? 11 LEU A HB3  7  
ATOM 4929  H HG   . LEU A 1 11 ? -5.914  -4.897  -10.260 1.00 0.00 ? 11 LEU A HG   7  
ATOM 4930  H HD11 . LEU A 1 11 ? -4.703  -4.805  -7.921  1.00 0.00 ? 11 LEU A HD11 7  
ATOM 4931  H HD12 . LEU A 1 11 ? -3.847  -5.302  -9.380  1.00 0.00 ? 11 LEU A HD12 7  
ATOM 4932  H HD13 . LEU A 1 11 ? -4.441  -6.518  -8.250  1.00 0.00 ? 11 LEU A HD13 7  
ATOM 4933  H HD21 . LEU A 1 11 ? -6.657  -6.895  -11.013 1.00 0.00 ? 11 LEU A HD21 7  
ATOM 4934  H HD22 . LEU A 1 11 ? -6.806  -7.575  -9.393  1.00 0.00 ? 11 LEU A HD22 7  
ATOM 4935  H HD23 . LEU A 1 11 ? -5.224  -7.486  -10.169 1.00 0.00 ? 11 LEU A HD23 7  
ATOM 4936  N N    . CYS A 1 12 ? -7.129  -4.095  -5.828  1.00 0.00 ? 12 CYS A N    7  
ATOM 4937  C CA   . CYS A 1 12 ? -7.546  -3.185  -4.748  1.00 0.00 ? 12 CYS A CA   7  
ATOM 4938  C C    . CYS A 1 12 ? -8.988  -3.404  -4.299  1.00 0.00 ? 12 CYS A C    7  
ATOM 4939  O O    . CYS A 1 12 ? -9.825  -2.503  -4.370  1.00 0.00 ? 12 CYS A O    7  
ATOM 4940  C CB   . CYS A 1 12 ? -7.393  -1.741  -5.205  1.00 0.00 ? 12 CYS A CB   7  
ATOM 4941  S SG   . CYS A 1 12 ? -8.049  -1.422  -6.866  1.00 0.00 ? 12 CYS A SG   7  
ATOM 4942  H H    . CYS A 1 12 ? -6.322  -3.871  -6.342  1.00 0.00 ? 12 CYS A H    7  
ATOM 4943  H HA   . CYS A 1 12 ? -6.893  -3.352  -3.907  1.00 0.00 ? 12 CYS A HA   7  
ATOM 4944  H HB2  . CYS A 1 12 ? -7.913  -1.098  -4.515  1.00 0.00 ? 12 CYS A HB2  7  
ATOM 4945  H HB3  . CYS A 1 12 ? -6.346  -1.481  -5.208  1.00 0.00 ? 12 CYS A HB3  7  
ATOM 4946  N N    . ARG A 1 13 ? -9.257  -4.606  -3.823  1.00 0.00 ? 13 ARG A N    7  
ATOM 4947  C CA   . ARG A 1 13 ? -10.585 -4.965  -3.337  1.00 0.00 ? 13 ARG A CA   7  
ATOM 4948  C C    . ARG A 1 13 ? -10.547 -5.157  -1.826  1.00 0.00 ? 13 ARG A C    7  
ATOM 4949  O O    . ARG A 1 13 ? -11.052 -6.146  -1.295  1.00 0.00 ? 13 ARG A O    7  
ATOM 4950  C CB   . ARG A 1 13 ? -11.091 -6.240  -4.024  1.00 0.00 ? 13 ARG A CB   7  
ATOM 4951  C CG   . ARG A 1 13 ? -12.152 -5.982  -5.083  1.00 0.00 ? 13 ARG A CG   7  
ATOM 4952  C CD   . ARG A 1 13 ? -11.624 -5.099  -6.203  1.00 0.00 ? 13 ARG A CD   7  
ATOM 4953  N NE   . ARG A 1 13 ? -12.561 -5.012  -7.320  1.00 0.00 ? 13 ARG A NE   7  
ATOM 4954  C CZ   . ARG A 1 13 ? -12.680 -5.946  -8.262  1.00 0.00 ? 13 ARG A CZ   7  
ATOM 4955  N NH1  . ARG A 1 13 ? -11.932 -7.042  -8.218  1.00 0.00 ? 13 ARG A NH1  7  
ATOM 4956  N NH2  . ARG A 1 13 ? -13.549 -5.785  -9.250  1.00 0.00 ? 13 ARG A NH2  7  
ATOM 4957  H H    . ARG A 1 13 ? -8.531  -5.272  -3.794  1.00 0.00 ? 13 ARG A H    7  
ATOM 4958  H HA   . ARG A 1 13 ? -11.255 -4.150  -3.568  1.00 0.00 ? 13 ARG A HA   7  
ATOM 4959  H HB2  . ARG A 1 13 ? -10.257 -6.739  -4.495  1.00 0.00 ? 13 ARG A HB2  7  
ATOM 4960  H HB3  . ARG A 1 13 ? -11.513 -6.897  -3.279  1.00 0.00 ? 13 ARG A HB3  7  
ATOM 4961  H HG2  . ARG A 1 13 ? -12.465 -6.926  -5.502  1.00 0.00 ? 13 ARG A HG2  7  
ATOM 4962  H HG3  . ARG A 1 13 ? -12.996 -5.494  -4.619  1.00 0.00 ? 13 ARG A HG3  7  
ATOM 4963  H HD2  . ARG A 1 13 ? -11.453 -4.107  -5.811  1.00 0.00 ? 13 ARG A HD2  7  
ATOM 4964  H HD3  . ARG A 1 13 ? -10.692 -5.510  -6.559  1.00 0.00 ? 13 ARG A HD3  7  
ATOM 4965  H HE   . ARG A 1 13 ? -13.129 -4.216  -7.375  1.00 0.00 ? 13 ARG A HE   7  
ATOM 4966  H HH11 . ARG A 1 13 ? -11.275 -7.171  -7.476  1.00 0.00 ? 13 ARG A HH11 7  
ATOM 4967  H HH12 . ARG A 1 13 ? -12.025 -7.739  -8.929  1.00 0.00 ? 13 ARG A HH12 7  
ATOM 4968  H HH21 . ARG A 1 13 ? -14.117 -4.963  -9.287  1.00 0.00 ? 13 ARG A HH21 7  
ATOM 4969  H HH22 . ARG A 1 13 ? -13.638 -6.486  -9.958  1.00 0.00 ? 13 ARG A HH22 7  
ATOM 4970  N N    . CYS A 1 14 ? -9.925  -4.204  -1.142  1.00 0.00 ? 14 CYS A N    7  
ATOM 4971  C CA   . CYS A 1 14 ? -9.793  -4.263  0.308   1.00 0.00 ? 14 CYS A CA   7  
ATOM 4972  C C    . CYS A 1 14 ? -10.076 -2.906  0.948   1.00 0.00 ? 14 CYS A C    7  
ATOM 4973  O O    . CYS A 1 14 ? -9.215  -2.028  0.968   1.00 0.00 ? 14 CYS A O    7  
ATOM 4974  C CB   . CYS A 1 14 ? -8.384  -4.736  0.688   1.00 0.00 ? 14 CYS A CB   7  
ATOM 4975  S SG   . CYS A 1 14 ? -7.103  -4.363  -0.560  1.00 0.00 ? 14 CYS A SG   7  
ATOM 4976  H H    . CYS A 1 14 ? -9.533  -3.448  -1.626  1.00 0.00 ? 14 CYS A H    7  
ATOM 4977  H HA   . CYS A 1 14 ? -10.512 -4.979  0.677   1.00 0.00 ? 14 CYS A HA   7  
ATOM 4978  H HB2  . CYS A 1 14 ? -8.089  -4.260  1.610   1.00 0.00 ? 14 CYS A HB2  7  
ATOM 4979  H HB3  . CYS A 1 14 ? -8.400  -5.807  0.830   1.00 0.00 ? 14 CYS A HB3  7  
ATOM 4980  N N    . ASN A 1 15 ? -11.285 -2.747  1.482   1.00 0.00 ? 15 ASN A N    7  
ATOM 4981  C CA   . ASN A 1 15 ? -11.671 -1.500  2.135   1.00 0.00 ? 15 ASN A CA   7  
ATOM 4982  C C    . ASN A 1 15 ? -11.273 -1.531  3.596   1.00 0.00 ? 15 ASN A C    7  
ATOM 4983  O O    . ASN A 1 15 ? -10.704 -0.571  4.104   1.00 0.00 ? 15 ASN A O    7  
ATOM 4984  C CB   . ASN A 1 15 ? -13.179 -1.275  2.023   1.00 0.00 ? 15 ASN A CB   7  
ATOM 4985  C CG   . ASN A 1 15 ? -13.521 0.003   1.281   1.00 0.00 ? 15 ASN A CG   7  
ATOM 4986  O OD1  . ASN A 1 15 ? -14.334 -0.002  0.357   1.00 0.00 ? 15 ASN A OD1  7  
ATOM 4987  N ND2  . ASN A 1 15 ? -12.900 1.104   1.684   1.00 0.00 ? 15 ASN A ND2  7  
ATOM 4988  H H    . ASN A 1 15 ? -11.926 -3.486  1.443   1.00 0.00 ? 15 ASN A H    7  
ATOM 4989  H HA   . ASN A 1 15 ? -11.153 -0.689  1.652   1.00 0.00 ? 15 ASN A HA   7  
ATOM 4990  H HB2  . ASN A 1 15 ? -13.618 -2.105  1.503   1.00 0.00 ? 15 ASN A HB2  7  
ATOM 4991  H HB3  . ASN A 1 15 ? -13.603 -1.216  3.015   1.00 0.00 ? 15 ASN A HB3  7  
ATOM 4992  H HD21 . ASN A 1 15 ? -12.265 1.033   2.427   1.00 0.00 ? 15 ASN A HD21 7  
ATOM 4993  H HD22 . ASN A 1 15 ? -13.102 1.945   1.223   1.00 0.00 ? 15 ASN A HD22 7  
ATOM 4994  N N    . LYS A 1 16 ? -11.595 -2.651  4.252   1.00 0.00 ? 16 LYS A N    7  
ATOM 4995  C CA   . LYS A 1 16 ? -11.305 -2.888  5.674   1.00 0.00 ? 16 LYS A CA   7  
ATOM 4996  C C    . LYS A 1 16 ? -10.206 -1.976  6.205   1.00 0.00 ? 16 LYS A C    7  
ATOM 4997  O O    . LYS A 1 16 ? -9.168  -2.440  6.678   1.00 0.00 ? 16 LYS A O    7  
ATOM 4998  C CB   . LYS A 1 16 ? -10.909 -4.351  5.881   1.00 0.00 ? 16 LYS A CB   7  
ATOM 4999  C CG   . LYS A 1 16 ? -10.925 -4.788  7.337   1.00 0.00 ? 16 LYS A CG   7  
ATOM 5000  C CD   . LYS A 1 16 ? -12.335 -5.109  7.808   1.00 0.00 ? 16 LYS A CD   7  
ATOM 5001  C CE   . LYS A 1 16 ? -12.964 -6.219  6.980   1.00 0.00 ? 16 LYS A CE   7  
ATOM 5002  N NZ   . LYS A 1 16 ? -12.013 -7.337  6.730   1.00 0.00 ? 16 LYS A NZ   7  
ATOM 5003  H H    . LYS A 1 16 ? -12.054 -3.350  3.759   1.00 0.00 ? 16 LYS A H    7  
ATOM 5004  H HA   . LYS A 1 16 ? -12.210 -2.694  6.228   1.00 0.00 ? 16 LYS A HA   7  
ATOM 5005  H HB2  . LYS A 1 16 ? -11.594 -4.978  5.331   1.00 0.00 ? 16 LYS A HB2  7  
ATOM 5006  H HB3  . LYS A 1 16 ? -9.911  -4.498  5.495   1.00 0.00 ? 16 LYS A HB3  7  
ATOM 5007  H HG2  . LYS A 1 16 ? -10.310 -5.669  7.445   1.00 0.00 ? 16 LYS A HG2  7  
ATOM 5008  H HG3  . LYS A 1 16 ? -10.524 -3.991  7.944   1.00 0.00 ? 16 LYS A HG3  7  
ATOM 5009  H HD2  . LYS A 1 16 ? -12.295 -5.425  8.840   1.00 0.00 ? 16 LYS A HD2  7  
ATOM 5010  H HD3  . LYS A 1 16 ? -12.943 -4.221  7.725   1.00 0.00 ? 16 LYS A HD3  7  
ATOM 5011  H HE2  . LYS A 1 16 ? -13.824 -6.601  7.508   1.00 0.00 ? 16 LYS A HE2  7  
ATOM 5012  H HE3  . LYS A 1 16 ? -13.279 -5.806  6.032   1.00 0.00 ? 16 LYS A HE3  7  
ATOM 5013  H HZ1  . LYS A 1 16 ? -12.535 -8.215  6.538   1.00 0.00 ? 16 LYS A HZ1  7  
ATOM 5014  H HZ2  . LYS A 1 16 ? -11.406 -7.482  7.562   1.00 0.00 ? 16 LYS A HZ2  7  
ATOM 5015  H HZ3  . LYS A 1 16 ? -11.410 -7.117  5.911   1.00 0.00 ? 16 LYS A HZ3  7  
ATOM 5016  N N    . MET A 1 17 ? -10.443 -0.677  6.103   1.00 0.00 ? 17 MET A N    7  
ATOM 5017  C CA   . MET A 1 17 ? -9.476  0.322   6.557   1.00 0.00 ? 17 MET A CA   7  
ATOM 5018  C C    . MET A 1 17 ? -9.212  0.218   8.050   1.00 0.00 ? 17 MET A C    7  
ATOM 5019  O O    . MET A 1 17 ? -9.660  1.047   8.842   1.00 0.00 ? 17 MET A O    7  
ATOM 5020  C CB   . MET A 1 17 ? -9.940  1.726   6.219   1.00 0.00 ? 17 MET A CB   7  
ATOM 5021  C CG   . MET A 1 17 ? -11.431 1.952   6.423   1.00 0.00 ? 17 MET A CG   7  
ATOM 5022  S SD   . MET A 1 17 ? -11.786 3.403   7.435   1.00 0.00 ? 17 MET A SD   7  
ATOM 5023  C CE   . MET A 1 17 ? -10.776 4.638   6.622   1.00 0.00 ? 17 MET A CE   7  
ATOM 5024  H H    . MET A 1 17 ? -11.289 -0.386  5.689   1.00 0.00 ? 17 MET A H    7  
ATOM 5025  H HA   . MET A 1 17 ? -8.550  0.132   6.037   1.00 0.00 ? 17 MET A HA   7  
ATOM 5026  H HB2  . MET A 1 17 ? -9.400  2.417   6.848   1.00 0.00 ? 17 MET A HB2  7  
ATOM 5027  H HB3  . MET A 1 17 ? -9.701  1.923   5.188   1.00 0.00 ? 17 MET A HB3  7  
ATOM 5028  H HG2  . MET A 1 17 ? -11.897 2.083   5.457   1.00 0.00 ? 17 MET A HG2  7  
ATOM 5029  H HG3  . MET A 1 17 ? -11.849 1.081   6.907   1.00 0.00 ? 17 MET A HG3  7  
ATOM 5030  H HE1  . MET A 1 17 ? -11.368 5.523   6.438   1.00 0.00 ? 17 MET A HE1  7  
ATOM 5031  H HE2  . MET A 1 17 ? -10.414 4.247   5.683   1.00 0.00 ? 17 MET A HE2  7  
ATOM 5032  H HE3  . MET A 1 17 ? -9.938  4.891   7.255   1.00 0.00 ? 17 MET A HE3  7  
ATOM 5033  N N    . LEU A 1 18 ? -8.469  -0.806  8.410   1.00 0.00 ? 18 LEU A N    7  
ATOM 5034  C CA   . LEU A 1 18 ? -8.099  -1.062  9.791   1.00 0.00 ? 18 LEU A CA   7  
ATOM 5035  C C    . LEU A 1 18 ? -7.066  -2.179  9.864   1.00 0.00 ? 18 LEU A C    7  
ATOM 5036  O O    . LEU A 1 18 ? -7.303  -3.221  10.477  1.00 0.00 ? 18 LEU A O    7  
ATOM 5037  C CB   . LEU A 1 18 ? -9.334  -1.425  10.611  1.00 0.00 ? 18 LEU A CB   7  
ATOM 5038  C CG   . LEU A 1 18 ? -10.116 -2.639  10.103  1.00 0.00 ? 18 LEU A CG   7  
ATOM 5039  C CD1  . LEU A 1 18 ? -10.429 -3.593  11.246  1.00 0.00 ? 18 LEU A CD1  7  
ATOM 5040  C CD2  . LEU A 1 18 ? -11.397 -2.196  9.411   1.00 0.00 ? 18 LEU A CD2  7  
ATOM 5041  H H    . LEU A 1 18 ? -8.150  -1.404  7.715   1.00 0.00 ? 18 LEU A H    7  
ATOM 5042  H HA   . LEU A 1 18 ? -7.661  -0.159  10.189  1.00 0.00 ? 18 LEU A HA   7  
ATOM 5043  H HB2  . LEU A 1 18 ? -9.018  -1.621  11.624  1.00 0.00 ? 18 LEU A HB2  7  
ATOM 5044  H HB3  . LEU A 1 18 ? -9.997  -0.574  10.615  1.00 0.00 ? 18 LEU A HB3  7  
ATOM 5045  H HG   . LEU A 1 18 ? -9.511  -3.170  9.383   1.00 0.00 ? 18 LEU A HG   7  
ATOM 5046  H HD11 . LEU A 1 18 ? -9.551  -3.718  11.861  1.00 0.00 ? 18 LEU A HD11 7  
ATOM 5047  H HD12 . LEU A 1 18 ? -10.727 -4.550  10.845  1.00 0.00 ? 18 LEU A HD12 7  
ATOM 5048  H HD13 . LEU A 1 18 ? -11.232 -3.187  11.843  1.00 0.00 ? 18 LEU A HD13 7  
ATOM 5049  H HD21 . LEU A 1 18 ? -11.943 -1.527  10.059  1.00 0.00 ? 18 LEU A HD21 7  
ATOM 5050  H HD22 . LEU A 1 18 ? -12.004 -3.060  9.190   1.00 0.00 ? 18 LEU A HD22 7  
ATOM 5051  H HD23 . LEU A 1 18 ? -11.151 -1.684  8.492   1.00 0.00 ? 18 LEU A HD23 7  
ATOM 5052  N N    . GLY A 1 19 ? -5.927  -1.962  9.220   1.00 0.00 ? 19 GLY A N    7  
ATOM 5053  C CA   . GLY A 1 19 ? -4.881  -2.969  9.210   1.00 0.00 ? 19 GLY A CA   7  
ATOM 5054  C C    . GLY A 1 19 ? -3.545  -2.451  9.707   1.00 0.00 ? 19 GLY A C    7  
ATOM 5055  O O    . GLY A 1 19 ? -3.486  -1.615  10.608  1.00 0.00 ? 19 GLY A O    7  
ATOM 5056  H H    . GLY A 1 19 ? -5.801  -1.117  8.740   1.00 0.00 ? 19 GLY A H    7  
ATOM 5057  H HA2  . GLY A 1 19 ? -5.187  -3.793  9.837   1.00 0.00 ? 19 GLY A HA2  7  
ATOM 5058  H HA3  . GLY A 1 19 ? -4.759  -3.330  8.199   1.00 0.00 ? 19 GLY A HA3  7  
ATOM 5059  N N    . ASP A 1 20 ? -2.471  -2.969  9.120   1.00 0.00 ? 20 ASP A N    7  
ATOM 5060  C CA   . ASP A 1 20 ? -1.118  -2.587  9.496   1.00 0.00 ? 20 ASP A CA   7  
ATOM 5061  C C    . ASP A 1 20 ? -0.835  -1.119  9.209   1.00 0.00 ? 20 ASP A C    7  
ATOM 5062  O O    . ASP A 1 20 ? -1.703  -0.372  8.759   1.00 0.00 ? 20 ASP A O    7  
ATOM 5063  C CB   . ASP A 1 20 ? -0.111  -3.457  8.747   1.00 0.00 ? 20 ASP A CB   7  
ATOM 5064  C CG   . ASP A 1 20 ? -0.423  -4.936  8.866   1.00 0.00 ? 20 ASP A CG   7  
ATOM 5065  O OD1  . ASP A 1 20 ? -1.180  -5.311  9.785   1.00 0.00 ? 20 ASP A OD1  7  
ATOM 5066  O OD2  . ASP A 1 20 ? 0.092   -5.720  8.039   1.00 0.00 ? 20 ASP A OD2  7  
ATOM 5067  H H    . ASP A 1 20 ? -2.590  -3.639  8.416   1.00 0.00 ? 20 ASP A H    7  
ATOM 5068  H HA   . ASP A 1 20 ? -1.002  -2.758  10.554  1.00 0.00 ? 20 ASP A HA   7  
ATOM 5069  H HB2  . ASP A 1 20 ? -0.120  -3.188  7.702   1.00 0.00 ? 20 ASP A HB2  7  
ATOM 5070  H HB3  . ASP A 1 20 ? 0.871   -3.282  9.149   1.00 0.00 ? 20 ASP A HB3  7  
ATOM 5071  N N    . LEU A 1 21 ? 0.404   -0.728  9.476   1.00 0.00 ? 21 LEU A N    7  
ATOM 5072  C CA   . LEU A 1 21 ? 0.860   0.639   9.259   1.00 0.00 ? 21 LEU A CA   7  
ATOM 5073  C C    . LEU A 1 21 ? 2.021   0.652   8.274   1.00 0.00 ? 21 LEU A C    7  
ATOM 5074  O O    . LEU A 1 21 ? 3.175   0.452   8.652   1.00 0.00 ? 21 LEU A O    7  
ATOM 5075  C CB   . LEU A 1 21 ? 1.284   1.275   10.586  1.00 0.00 ? 21 LEU A CB   7  
ATOM 5076  C CG   . LEU A 1 21 ? 2.057   2.589   10.461  1.00 0.00 ? 21 LEU A CG   7  
ATOM 5077  C CD1  . LEU A 1 21 ? 1.332   3.547   9.530   1.00 0.00 ? 21 LEU A CD1  7  
ATOM 5078  C CD2  . LEU A 1 21 ? 2.258   3.219   11.829  1.00 0.00 ? 21 LEU A CD2  7  
ATOM 5079  H H    . LEU A 1 21 ? 1.036   -1.387  9.827   1.00 0.00 ? 21 LEU A H    7  
ATOM 5080  H HA   . LEU A 1 21 ? 0.040   1.206   8.838   1.00 0.00 ? 21 LEU A HA   7  
ATOM 5081  H HB2  . LEU A 1 21 ? 0.394   1.459   11.172  1.00 0.00 ? 21 LEU A HB2  7  
ATOM 5082  H HB3  . LEU A 1 21 ? 1.902   0.568   11.117  1.00 0.00 ? 21 LEU A HB3  7  
ATOM 5083  H HG   . LEU A 1 21 ? 3.030   2.386   10.038  1.00 0.00 ? 21 LEU A HG   7  
ATOM 5084  H HD11 . LEU A 1 21 ? 0.282   3.295   9.500   1.00 0.00 ? 21 LEU A HD11 7  
ATOM 5085  H HD12 . LEU A 1 21 ? 1.749   3.467   8.536   1.00 0.00 ? 21 LEU A HD12 7  
ATOM 5086  H HD13 . LEU A 1 21 ? 1.451   4.558   9.889   1.00 0.00 ? 21 LEU A HD13 7  
ATOM 5087  H HD21 . LEU A 1 21 ? 1.308   3.558   12.213  1.00 0.00 ? 21 LEU A HD21 7  
ATOM 5088  H HD22 . LEU A 1 21 ? 2.933   4.058   11.743  1.00 0.00 ? 21 LEU A HD22 7  
ATOM 5089  H HD23 . LEU A 1 21 ? 2.678   2.487   12.503  1.00 0.00 ? 21 LEU A HD23 7  
ATOM 5090  N N    . ILE A 1 22 ? 1.701   0.879   7.011   1.00 0.00 ? 22 ILE A N    7  
ATOM 5091  C CA   . ILE A 1 22 ? 2.703   0.909   5.953   1.00 0.00 ? 22 ILE A CA   7  
ATOM 5092  C C    . ILE A 1 22 ? 3.295   2.303   5.789   1.00 0.00 ? 22 ILE A C    7  
ATOM 5093  O O    . ILE A 1 22 ? 2.635   3.309   6.054   1.00 0.00 ? 22 ILE A O    7  
ATOM 5094  C CB   . ILE A 1 22 ? 2.094   0.450   4.603   1.00 0.00 ? 22 ILE A CB   7  
ATOM 5095  C CG1  . ILE A 1 22 ? 2.941   0.890   3.424   1.00 0.00 ? 22 ILE A CG1  7  
ATOM 5096  C CG2  . ILE A 1 22 ? 0.696   0.995   4.430   1.00 0.00 ? 22 ILE A CG2  7  
ATOM 5097  C CD1  . ILE A 1 22 ? 2.536   2.239   2.860   1.00 0.00 ? 22 ILE A CD1  7  
ATOM 5098  H H    . ILE A 1 22 ? 0.762   1.024   6.781   1.00 0.00 ? 22 ILE A H    7  
ATOM 5099  H HA   . ILE A 1 22 ? 3.492   0.222   6.220   1.00 0.00 ? 22 ILE A HA   7  
ATOM 5100  H HB   . ILE A 1 22 ? 2.040   -0.620  4.604   1.00 0.00 ? 22 ILE A HB   7  
ATOM 5101  H HG12 . ILE A 1 22 ? 3.972   0.946   3.727   1.00 0.00 ? 22 ILE A HG12 7  
ATOM 5102  H HG13 . ILE A 1 22 ? 2.840   0.158   2.635   1.00 0.00 ? 22 ILE A HG13 7  
ATOM 5103  H HG21 . ILE A 1 22 ? 0.024   0.485   5.096   1.00 0.00 ? 22 ILE A HG21 7  
ATOM 5104  H HG22 . ILE A 1 22 ? 0.384   0.847   3.409   1.00 0.00 ? 22 ILE A HG22 7  
ATOM 5105  H HG23 . ILE A 1 22 ? 0.702   2.051   4.652   1.00 0.00 ? 22 ILE A HG23 7  
ATOM 5106  H HD11 . ILE A 1 22 ? 3.357   2.657   2.312   1.00 0.00 ? 22 ILE A HD11 7  
ATOM 5107  H HD12 . ILE A 1 22 ? 2.266   2.903   3.667   1.00 0.00 ? 22 ILE A HD12 7  
ATOM 5108  H HD13 . ILE A 1 22 ? 1.691   2.114   2.200   1.00 0.00 ? 22 ILE A HD13 7  
ATOM 5109  N N    . CYS A 1 23 ? 4.532   2.352   5.309   1.00 0.00 ? 23 CYS A N    7  
ATOM 5110  C CA   . CYS A 1 23 ? 5.205   3.622   5.061   1.00 0.00 ? 23 CYS A CA   7  
ATOM 5111  C C    . CYS A 1 23 ? 5.483   3.748   3.572   1.00 0.00 ? 23 CYS A C    7  
ATOM 5112  O O    . CYS A 1 23 ? 6.521   3.305   3.081   1.00 0.00 ? 23 CYS A O    7  
ATOM 5113  C CB   . CYS A 1 23 ? 6.507   3.745   5.866   1.00 0.00 ? 23 CYS A CB   7  
ATOM 5114  S SG   . CYS A 1 23 ? 7.219   2.164   6.431   1.00 0.00 ? 23 CYS A SG   7  
ATOM 5115  H H    . CYS A 1 23 ? 4.994   1.508   5.086   1.00 0.00 ? 23 CYS A H    7  
ATOM 5116  H HA   . CYS A 1 23 ? 4.531   4.414   5.355   1.00 0.00 ? 23 CYS A HA   7  
ATOM 5117  H HB2  . CYS A 1 23 ? 7.250   4.236   5.258   1.00 0.00 ? 23 CYS A HB2  7  
ATOM 5118  H HB3  . CYS A 1 23 ? 6.315   4.348   6.741   1.00 0.00 ? 23 CYS A HB3  7  
ATOM 5119  N N    . ALA A 1 24 ? 4.522   4.316   2.853   1.00 0.00 ? 24 ALA A N    7  
ATOM 5120  C CA   . ALA A 1 24 ? 4.629   4.460   1.411   1.00 0.00 ? 24 ALA A CA   7  
ATOM 5121  C C    . ALA A 1 24 ? 5.503   5.632   1.012   1.00 0.00 ? 24 ALA A C    7  
ATOM 5122  O O    . ALA A 1 24 ? 5.660   6.595   1.757   1.00 0.00 ? 24 ALA A O    7  
ATOM 5123  C CB   . ALA A 1 24 ? 3.244   4.608   0.798   1.00 0.00 ? 24 ALA A CB   7  
ATOM 5124  H H    . ALA A 1 24 ? 3.706   4.619   3.302   1.00 0.00 ? 24 ALA A H    7  
ATOM 5125  H HA   . ALA A 1 24 ? 5.065   3.553   1.024   1.00 0.00 ? 24 ALA A HA   7  
ATOM 5126  H HB1  . ALA A 1 24 ? 3.306   5.231   -0.083  1.00 0.00 ? 24 ALA A HB1  7  
ATOM 5127  H HB2  . ALA A 1 24 ? 2.580   5.064   1.517   1.00 0.00 ? 24 ALA A HB2  7  
ATOM 5128  H HB3  . ALA A 1 24 ? 2.865   3.635   0.525   1.00 0.00 ? 24 ALA A HB3  7  
ATOM 5129  N N    . VAL A 1 25 ? 6.064   5.529   -0.182  1.00 0.00 ? 25 VAL A N    7  
ATOM 5130  C CA   . VAL A 1 25 ? 6.927   6.565   -0.728  1.00 0.00 ? 25 VAL A CA   7  
ATOM 5131  C C    . VAL A 1 25 ? 6.766   6.658   -2.238  1.00 0.00 ? 25 VAL A C    7  
ATOM 5132  O O    . VAL A 1 25 ? 6.497   5.658   -2.909  1.00 0.00 ? 25 VAL A O    7  
ATOM 5133  C CB   . VAL A 1 25 ? 8.408   6.304   -0.395  1.00 0.00 ? 25 VAL A CB   7  
ATOM 5134  C CG1  . VAL A 1 25 ? 9.262   7.500   -0.782  1.00 0.00 ? 25 VAL A CG1  7  
ATOM 5135  C CG2  . VAL A 1 25 ? 8.573   5.974   1.081   1.00 0.00 ? 25 VAL A CG2  7  
ATOM 5136  H H    . VAL A 1 25 ? 5.888   4.728   -0.715  1.00 0.00 ? 25 VAL A H    7  
ATOM 5137  H HA   . VAL A 1 25 ? 6.641   7.510   -0.289  1.00 0.00 ? 25 VAL A HA   7  
ATOM 5138  H HB   . VAL A 1 25 ? 8.740   5.452   -0.971  1.00 0.00 ? 25 VAL A HB   7  
ATOM 5139  H HG11 . VAL A 1 25 ? 10.121  7.556   -0.130  1.00 0.00 ? 25 VAL A HG11 7  
ATOM 5140  H HG12 . VAL A 1 25 ? 8.678   8.404   -0.686  1.00 0.00 ? 25 VAL A HG12 7  
ATOM 5141  H HG13 . VAL A 1 25 ? 9.591   7.391   -1.805  1.00 0.00 ? 25 VAL A HG13 7  
ATOM 5142  H HG21 . VAL A 1 25 ? 7.906   6.591   1.664   1.00 0.00 ? 25 VAL A HG21 7  
ATOM 5143  H HG22 . VAL A 1 25 ? 9.594   6.166   1.381   1.00 0.00 ? 25 VAL A HG22 7  
ATOM 5144  H HG23 . VAL A 1 25 ? 8.340   4.933   1.246   1.00 0.00 ? 25 VAL A HG23 7  
ATOM 5145  N N    . ILE A 1 26 ? 6.928   7.867   -2.763  1.00 0.00 ? 26 ILE A N    7  
ATOM 5146  C CA   . ILE A 1 26 ? 6.803   8.105   -4.198  1.00 0.00 ? 26 ILE A CA   7  
ATOM 5147  C C    . ILE A 1 26 ? 7.823   9.133   -4.676  1.00 0.00 ? 26 ILE A C    7  
ATOM 5148  O O    . ILE A 1 26 ? 7.531   10.326  -4.752  1.00 0.00 ? 26 ILE A O    7  
ATOM 5149  C CB   . ILE A 1 26 ? 5.392   8.591   -4.598  1.00 0.00 ? 26 ILE A CB   7  
ATOM 5150  C CG1  . ILE A 1 26 ? 4.566   8.969   -3.360  1.00 0.00 ? 26 ILE A CG1  7  
ATOM 5151  C CG2  . ILE A 1 26 ? 4.677   7.534   -5.428  1.00 0.00 ? 26 ILE A CG2  7  
ATOM 5152  C CD1  . ILE A 1 26 ? 4.038   7.779   -2.586  1.00 0.00 ? 26 ILE A CD1  7  
ATOM 5153  H H    . ILE A 1 26 ? 7.136   8.620   -2.167  1.00 0.00 ? 26 ILE A H    7  
ATOM 5154  H HA   . ILE A 1 26 ? 6.993   7.169   -4.704  1.00 0.00 ? 26 ILE A HA   7  
ATOM 5155  H HB   . ILE A 1 26 ? 5.514   9.466   -5.217  1.00 0.00 ? 26 ILE A HB   7  
ATOM 5156  H HG12 . ILE A 1 26 ? 5.181   9.550   -2.691  1.00 0.00 ? 26 ILE A HG12 7  
ATOM 5157  H HG13 . ILE A 1 26 ? 3.719   9.565   -3.671  1.00 0.00 ? 26 ILE A HG13 7  
ATOM 5158  H HG21 . ILE A 1 26 ? 4.805   6.565   -4.967  1.00 0.00 ? 26 ILE A HG21 7  
ATOM 5159  H HG22 . ILE A 1 26 ? 5.092   7.517   -6.424  1.00 0.00 ? 26 ILE A HG22 7  
ATOM 5160  H HG23 . ILE A 1 26 ? 3.625   7.771   -5.481  1.00 0.00 ? 26 ILE A HG23 7  
ATOM 5161  H HD11 . ILE A 1 26 ? 4.536   7.720   -1.630  1.00 0.00 ? 26 ILE A HD11 7  
ATOM 5162  H HD12 . ILE A 1 26 ? 4.222   6.872   -3.143  1.00 0.00 ? 26 ILE A HD12 7  
ATOM 5163  H HD13 . ILE A 1 26 ? 2.975   7.894   -2.430  1.00 0.00 ? 26 ILE A HD13 7  
ATOM 5164  N N    . GLY A 1 27 ? 9.015   8.656   -4.993  1.00 0.00 ? 27 GLY A N    7  
ATOM 5165  C CA   . GLY A 1 27 ? 10.079  9.526   -5.463  1.00 0.00 ? 27 GLY A CA   7  
ATOM 5166  C C    . GLY A 1 27 ? 10.618  10.411  -4.362  1.00 0.00 ? 27 GLY A C    7  
ATOM 5167  O O    . GLY A 1 27 ? 11.807  10.379  -4.046  1.00 0.00 ? 27 GLY A O    7  
ATOM 5168  H H    . GLY A 1 27 ? 9.176   7.706   -4.902  1.00 0.00 ? 27 GLY A H    7  
ATOM 5169  H HA2  . GLY A 1 27 ? 10.884  8.919   -5.850  1.00 0.00 ? 27 GLY A HA2  7  
ATOM 5170  H HA3  . GLY A 1 27 ? 9.697   10.150  -6.258  1.00 0.00 ? 27 GLY A HA3  7  
ATOM 5171  N N    . ASP A 1 28 ? 9.729   11.195  -3.776  1.00 0.00 ? 28 ASP A N    7  
ATOM 5172  C CA   . ASP A 1 28 ? 10.088  12.098  -2.695  1.00 0.00 ? 28 ASP A CA   7  
ATOM 5173  C C    . ASP A 1 28 ? 8.874   12.392  -1.822  1.00 0.00 ? 28 ASP A C    7  
ATOM 5174  O O    . ASP A 1 28 ? 8.816   13.420  -1.148  1.00 0.00 ? 28 ASP A O    7  
ATOM 5175  C CB   . ASP A 1 28 ? 10.659  13.403  -3.255  1.00 0.00 ? 28 ASP A CB   7  
ATOM 5176  C CG   . ASP A 1 28 ? 9.660   14.141  -4.126  1.00 0.00 ? 28 ASP A CG   7  
ATOM 5177  O OD1  . ASP A 1 28 ? 9.264   13.589  -5.172  1.00 0.00 ? 28 ASP A OD1  7  
ATOM 5178  O OD2  . ASP A 1 28 ? 9.276   15.272  -3.759  1.00 0.00 ? 28 ASP A OD2  7  
ATOM 5179  H H    . ASP A 1 28 ? 8.800   11.163  -4.078  1.00 0.00 ? 28 ASP A H    7  
ATOM 5180  H HA   . ASP A 1 28 ? 10.842  11.613  -2.094  1.00 0.00 ? 28 ASP A HA   7  
ATOM 5181  H HB2  . ASP A 1 28 ? 10.939  14.047  -2.435  1.00 0.00 ? 28 ASP A HB2  7  
ATOM 5182  H HB3  . ASP A 1 28 ? 11.533  13.181  -3.848  1.00 0.00 ? 28 ASP A HB3  7  
ATOM 5183  N N    . ALA A 1 29 ? 7.902   11.481  -1.838  1.00 0.00 ? 29 ALA A N    7  
ATOM 5184  C CA   . ALA A 1 29 ? 6.691   11.650  -1.045  1.00 0.00 ? 29 ALA A CA   7  
ATOM 5185  C C    . ALA A 1 29 ? 6.448   10.434  -0.163  1.00 0.00 ? 29 ALA A C    7  
ATOM 5186  O O    . ALA A 1 29 ? 5.665   9.549   -0.510  1.00 0.00 ? 29 ALA A O    7  
ATOM 5187  C CB   . ALA A 1 29 ? 5.495   11.899  -1.951  1.00 0.00 ? 29 ALA A CB   7  
ATOM 5188  H H    . ALA A 1 29 ? 8.002   10.674  -2.395  1.00 0.00 ? 29 ALA A H    7  
ATOM 5189  H HA   . ALA A 1 29 ? 6.823   12.518  -0.415  1.00 0.00 ? 29 ALA A HA   7  
ATOM 5190  H HB1  . ALA A 1 29 ? 5.336   12.962  -2.054  1.00 0.00 ? 29 ALA A HB1  7  
ATOM 5191  H HB2  . ALA A 1 29 ? 4.615   11.443  -1.521  1.00 0.00 ? 29 ALA A HB2  7  
ATOM 5192  H HB3  . ALA A 1 29 ? 5.684   11.468  -2.923  1.00 0.00 ? 29 ALA A HB3  7  
ATOM 5193  N N    . LYS A 1 30 ? 7.127   10.392  0.977   1.00 0.00 ? 30 LYS A N    7  
ATOM 5194  C CA   . LYS A 1 30 ? 6.984   9.277   1.901   1.00 0.00 ? 30 LYS A CA   7  
ATOM 5195  C C    . LYS A 1 30 ? 5.998   9.609   3.019   1.00 0.00 ? 30 LYS A C    7  
ATOM 5196  O O    . LYS A 1 30 ? 6.151   10.609  3.720   1.00 0.00 ? 30 LYS A O    7  
ATOM 5197  C CB   . LYS A 1 30 ? 8.342   8.898   2.495   1.00 0.00 ? 30 LYS A CB   7  
ATOM 5198  C CG   . LYS A 1 30 ? 9.129   10.086  3.021   1.00 0.00 ? 30 LYS A CG   7  
ATOM 5199  C CD   . LYS A 1 30 ? 10.229  9.647   3.975   1.00 0.00 ? 30 LYS A CD   7  
ATOM 5200  C CE   . LYS A 1 30 ? 11.211  8.704   3.299   1.00 0.00 ? 30 LYS A CE   7  
ATOM 5201  N NZ   . LYS A 1 30 ? 10.869  7.275   3.545   1.00 0.00 ? 30 LYS A NZ   7  
ATOM 5202  H H    . LYS A 1 30 ? 7.740   11.124  1.198   1.00 0.00 ? 30 LYS A H    7  
ATOM 5203  H HA   . LYS A 1 30 ? 6.604   8.440   1.338   1.00 0.00 ? 30 LYS A HA   7  
ATOM 5204  H HB2  . LYS A 1 30 ? 8.185   8.208   3.310   1.00 0.00 ? 30 LYS A HB2  7  
ATOM 5205  H HB3  . LYS A 1 30 ? 8.932   8.412   1.732   1.00 0.00 ? 30 LYS A HB3  7  
ATOM 5206  H HG2  . LYS A 1 30 ? 9.577   10.608  2.188   1.00 0.00 ? 30 LYS A HG2  7  
ATOM 5207  H HG3  . LYS A 1 30 ? 8.456   10.750  3.543   1.00 0.00 ? 30 LYS A HG3  7  
ATOM 5208  H HD2  . LYS A 1 30 ? 10.763  10.520  4.319   1.00 0.00 ? 30 LYS A HD2  7  
ATOM 5209  H HD3  . LYS A 1 30 ? 9.780   9.142   4.817   1.00 0.00 ? 30 LYS A HD3  7  
ATOM 5210  H HE2  . LYS A 1 30 ? 11.195  8.889   2.235   1.00 0.00 ? 30 LYS A HE2  7  
ATOM 5211  H HE3  . LYS A 1 30 ? 12.201  8.899   3.684   1.00 0.00 ? 30 LYS A HE3  7  
ATOM 5212  H HZ1  . LYS A 1 30 ? 11.071  6.708   2.697   1.00 0.00 ? 30 LYS A HZ1  7  
ATOM 5213  H HZ2  . LYS A 1 30 ? 9.859   7.183   3.777   1.00 0.00 ? 30 LYS A HZ2  7  
ATOM 5214  H HZ3  . LYS A 1 30 ? 11.429  6.905   4.339   1.00 0.00 ? 30 LYS A HZ3  7  
ATOM 5215  N N    . GLU A 1 31 ? 4.988   8.759   3.179   1.00 0.00 ? 31 GLU A N    7  
ATOM 5216  C CA   . GLU A 1 31 ? 3.972   8.952   4.208   1.00 0.00 ? 31 GLU A CA   7  
ATOM 5217  C C    . GLU A 1 31 ? 3.354   7.616   4.613   1.00 0.00 ? 31 GLU A C    7  
ATOM 5218  O O    . GLU A 1 31 ? 3.437   6.635   3.874   1.00 0.00 ? 31 GLU A O    7  
ATOM 5219  C CB   . GLU A 1 31 ? 2.884   9.904   3.709   1.00 0.00 ? 31 GLU A CB   7  
ATOM 5220  C CG   . GLU A 1 31 ? 2.525   9.709   2.244   1.00 0.00 ? 31 GLU A CG   7  
ATOM 5221  C CD   . GLU A 1 31 ? 1.743   8.433   2.002   1.00 0.00 ? 31 GLU A CD   7  
ATOM 5222  O OE1  . GLU A 1 31 ? 0.814   8.151   2.786   1.00 0.00 ? 31 GLU A OE1  7  
ATOM 5223  O OE2  . GLU A 1 31 ? 2.062   7.717   1.030   1.00 0.00 ? 31 GLU A OE2  7  
ATOM 5224  H H    . GLU A 1 31 ? 4.923   7.982   2.588   1.00 0.00 ? 31 GLU A H    7  
ATOM 5225  H HA   . GLU A 1 31 ? 4.454   9.388   5.072   1.00 0.00 ? 31 GLU A HA   7  
ATOM 5226  H HB2  . GLU A 1 31 ? 1.993   9.754   4.299   1.00 0.00 ? 31 GLU A HB2  7  
ATOM 5227  H HB3  . GLU A 1 31 ? 3.226   10.920  3.841   1.00 0.00 ? 31 GLU A HB3  7  
ATOM 5228  H HG2  . GLU A 1 31 ? 1.925   10.547  1.920   1.00 0.00 ? 31 GLU A HG2  7  
ATOM 5229  H HG3  . GLU A 1 31 ? 3.435   9.672   1.665   1.00 0.00 ? 31 GLU A HG3  7  
ATOM 5230  N N    . GLU A 1 32 ? 2.738   7.579   5.792   1.00 0.00 ? 32 GLU A N    7  
ATOM 5231  C CA   . GLU A 1 32 ? 2.114   6.357   6.290   1.00 0.00 ? 32 GLU A CA   7  
ATOM 5232  C C    . GLU A 1 32 ? 0.865   6.008   5.500   1.00 0.00 ? 32 GLU A C    7  
ATOM 5233  O O    . GLU A 1 32 ? 0.296   6.850   4.806   1.00 0.00 ? 32 GLU A O    7  
ATOM 5234  C CB   . GLU A 1 32 ? 1.730   6.503   7.759   1.00 0.00 ? 32 GLU A CB   7  
ATOM 5235  C CG   . GLU A 1 32 ? 2.869   6.979   8.646   1.00 0.00 ? 32 GLU A CG   7  
ATOM 5236  C CD   . GLU A 1 32 ? 2.452   8.102   9.576   1.00 0.00 ? 32 GLU A CD   7  
ATOM 5237  O OE1  . GLU A 1 32 ? 1.779   7.815   10.589  1.00 0.00 ? 32 GLU A OE1  7  
ATOM 5238  O OE2  . GLU A 1 32 ? 2.799   9.268   9.293   1.00 0.00 ? 32 GLU A OE2  7  
ATOM 5239  H H    . GLU A 1 32 ? 2.706   8.391   6.340   1.00 0.00 ? 32 GLU A H    7  
ATOM 5240  H HA   . GLU A 1 32 ? 2.827   5.553   6.191   1.00 0.00 ? 32 GLU A HA   7  
ATOM 5241  H HB2  . GLU A 1 32 ? 0.916   7.209   7.834   1.00 0.00 ? 32 GLU A HB2  7  
ATOM 5242  H HB3  . GLU A 1 32 ? 1.391   5.543   8.122   1.00 0.00 ? 32 GLU A HB3  7  
ATOM 5243  H HG2  . GLU A 1 32 ? 3.215   6.148   9.243   1.00 0.00 ? 32 GLU A HG2  7  
ATOM 5244  H HG3  . GLU A 1 32 ? 3.674   7.332   8.018   1.00 0.00 ? 32 GLU A HG3  7  
ATOM 5245  N N    . HIS A 1 33 ? 0.435   4.761   5.630   1.00 0.00 ? 33 HIS A N    7  
ATOM 5246  C CA   . HIS A 1 33 ? -0.759  4.298   4.947   1.00 0.00 ? 33 HIS A CA   7  
ATOM 5247  C C    . HIS A 1 33 ? -1.313  3.042   5.609   1.00 0.00 ? 33 HIS A C    7  
ATOM 5248  O O    . HIS A 1 33 ? -0.612  2.348   6.345   1.00 0.00 ? 33 HIS A O    7  
ATOM 5249  C CB   . HIS A 1 33 ? -0.462  4.032   3.469   1.00 0.00 ? 33 HIS A CB   7  
ATOM 5250  C CG   . HIS A 1 33 ? -0.942  5.125   2.565   1.00 0.00 ? 33 HIS A CG   7  
ATOM 5251  N ND1  . HIS A 1 33 ? -2.259  5.529   2.507   1.00 0.00 ? 33 HIS A ND1  7  
ATOM 5252  C CD2  . HIS A 1 33 ? -0.270  5.910   1.689   1.00 0.00 ? 33 HIS A CD2  7  
ATOM 5253  C CE1  . HIS A 1 33 ? -2.377  6.514   1.634   1.00 0.00 ? 33 HIS A CE1  7  
ATOM 5254  N NE2  . HIS A 1 33 ? -1.186  6.765   1.125   1.00 0.00 ? 33 HIS A NE2  7  
ATOM 5255  H H    . HIS A 1 33 ? 0.930   4.142   6.209   1.00 0.00 ? 33 HIS A H    7  
ATOM 5256  H HA   . HIS A 1 33 ? -1.501  5.079   5.017   1.00 0.00 ? 33 HIS A HA   7  
ATOM 5257  H HB2  . HIS A 1 33 ? 0.605   3.933   3.335   1.00 0.00 ? 33 HIS A HB2  7  
ATOM 5258  H HB3  . HIS A 1 33 ? -0.946  3.114   3.168   1.00 0.00 ? 33 HIS A HB3  7  
ATOM 5259  H HD1  . HIS A 1 33 ? -2.998  5.150   3.027   1.00 0.00 ? 33 HIS A HD1  7  
ATOM 5260  H HD2  . HIS A 1 33 ? 0.787   5.871   1.475   1.00 0.00 ? 33 HIS A HD2  7  
ATOM 5261  H HE1  . HIS A 1 33 ? -3.293  7.028   1.382   1.00 0.00 ? 33 HIS A HE1  7  
ATOM 5262  H HE2  . HIS A 1 33 ? -0.972  7.515   0.532   1.00 0.00 ? 33 HIS A HE2  7  
ATOM 5263  N N    . ARG A 1 34 ? -2.579  2.767   5.346   1.00 0.00 ? 34 ARG A N    7  
ATOM 5264  C CA   . ARG A 1 34 ? -3.247  1.598   5.908   1.00 0.00 ? 34 ARG A CA   7  
ATOM 5265  C C    . ARG A 1 34 ? -3.561  0.573   4.821   1.00 0.00 ? 34 ARG A C    7  
ATOM 5266  O O    . ARG A 1 34 ? -2.938  -0.486  4.758   1.00 0.00 ? 34 ARG A O    7  
ATOM 5267  C CB   . ARG A 1 34 ? -4.531  2.016   6.619   1.00 0.00 ? 34 ARG A CB   7  
ATOM 5268  C CG   . ARG A 1 34 ? -4.984  1.031   7.687   1.00 0.00 ? 34 ARG A CG   7  
ATOM 5269  C CD   . ARG A 1 34 ? -5.336  1.734   8.988   1.00 0.00 ? 34 ARG A CD   7  
ATOM 5270  N NE   . ARG A 1 34 ? -4.144  2.142   9.732   1.00 0.00 ? 34 ARG A NE   7  
ATOM 5271  C CZ   . ARG A 1 34 ? -3.651  3.379   9.737   1.00 0.00 ? 34 ARG A CZ   7  
ATOM 5272  N NH1  . ARG A 1 34 ? -4.234  4.344   9.035   1.00 0.00 ? 34 ARG A NH1  7  
ATOM 5273  N NH2  . ARG A 1 34 ? -2.566  3.655   10.448  1.00 0.00 ? 34 ARG A NH2  7  
ATOM 5274  H H    . ARG A 1 34 ? -3.079  3.370   4.760   1.00 0.00 ? 34 ARG A H    7  
ATOM 5275  H HA   . ARG A 1 34 ? -2.578  1.148   6.626   1.00 0.00 ? 34 ARG A HA   7  
ATOM 5276  H HB2  . ARG A 1 34 ? -4.371  2.974   7.085   1.00 0.00 ? 34 ARG A HB2  7  
ATOM 5277  H HB3  . ARG A 1 34 ? -5.318  2.107   5.887   1.00 0.00 ? 34 ARG A HB3  7  
ATOM 5278  H HG2  . ARG A 1 34 ? -5.855  0.503   7.328   1.00 0.00 ? 34 ARG A HG2  7  
ATOM 5279  H HG3  . ARG A 1 34 ? -4.187  0.327   7.872   1.00 0.00 ? 34 ARG A HG3  7  
ATOM 5280  H HD2  . ARG A 1 34 ? -5.927  2.607   8.763   1.00 0.00 ? 34 ARG A HD2  7  
ATOM 5281  H HD3  . ARG A 1 34 ? -5.915  1.058   9.600   1.00 0.00 ? 34 ARG A HD3  7  
ATOM 5282  H HE   . ARG A 1 34 ? -3.686  1.454   10.259  1.00 0.00 ? 34 ARG A HE   7  
ATOM 5283  H HH11 . ARG A 1 34 ? -5.052  4.150   8.495   1.00 0.00 ? 34 ARG A HH11 7  
ATOM 5284  H HH12 . ARG A 1 34 ? -3.854  5.270   9.047   1.00 0.00 ? 34 ARG A HH12 7  
ATOM 5285  H HH21 . ARG A 1 34 ? -2.121  2.933   10.980  1.00 0.00 ? 34 ARG A HH21 7  
ATOM 5286  H HH22 . ARG A 1 34 ? -2.193  4.583   10.454  1.00 0.00 ? 34 ARG A HH22 7  
ATOM 5287  N N    . ASN A 1 35 ? -4.526  0.896   3.962   1.00 0.00 ? 35 ASN A N    7  
ATOM 5288  C CA   . ASN A 1 35 ? -4.909  0.000   2.878   1.00 0.00 ? 35 ASN A CA   7  
ATOM 5289  C C    . ASN A 1 35 ? -3.926  0.120   1.722   1.00 0.00 ? 35 ASN A C    7  
ATOM 5290  O O    . ASN A 1 35 ? -4.270  0.593   0.639   1.00 0.00 ? 35 ASN A O    7  
ATOM 5291  C CB   . ASN A 1 35 ? -6.326  0.305   2.397   1.00 0.00 ? 35 ASN A CB   7  
ATOM 5292  C CG   . ASN A 1 35 ? -7.339  -0.687  2.931   1.00 0.00 ? 35 ASN A CG   7  
ATOM 5293  O OD1  . ASN A 1 35 ? -7.323  -1.864  2.567   1.00 0.00 ? 35 ASN A OD1  7  
ATOM 5294  N ND2  . ASN A 1 35 ? -8.224  -0.218  3.798   1.00 0.00 ? 35 ASN A ND2  7  
ATOM 5295  H H    . ASN A 1 35 ? -4.985  1.757   4.056   1.00 0.00 ? 35 ASN A H    7  
ATOM 5296  H HA   . ASN A 1 35 ? -4.875  -1.011  3.258   1.00 0.00 ? 35 ASN A HA   7  
ATOM 5297  H HB2  . ASN A 1 35 ? -6.607  1.292   2.730   1.00 0.00 ? 35 ASN A HB2  7  
ATOM 5298  H HB3  . ASN A 1 35 ? -6.353  0.273   1.318   1.00 0.00 ? 35 ASN A HB3  7  
ATOM 5299  H HD21 . ASN A 1 35 ? -8.176  0.730   4.042   1.00 0.00 ? 35 ASN A HD21 7  
ATOM 5300  H HD22 . ASN A 1 35 ? -8.892  -0.838  4.160   1.00 0.00 ? 35 ASN A HD22 7  
ATOM 5301  N N    . MET A 1 36 ? -2.700  -0.311  1.970   1.00 0.00 ? 36 MET A N    7  
ATOM 5302  C CA   . MET A 1 36 ? -1.650  -0.256  0.965   1.00 0.00 ? 36 MET A CA   7  
ATOM 5303  C C    . MET A 1 36 ? -1.956  -1.189  -0.208  1.00 0.00 ? 36 MET A C    7  
ATOM 5304  O O    . MET A 1 36 ? -1.316  -1.108  -1.255  1.00 0.00 ? 36 MET A O    7  
ATOM 5305  C CB   . MET A 1 36 ? -0.305  -0.601  1.619   1.00 0.00 ? 36 MET A CB   7  
ATOM 5306  C CG   . MET A 1 36 ? 0.423   -1.797  1.013   1.00 0.00 ? 36 MET A CG   7  
ATOM 5307  S SD   . MET A 1 36 ? -0.361  -3.369  1.420   1.00 0.00 ? 36 MET A SD   7  
ATOM 5308  C CE   . MET A 1 36 ? -0.413  -4.149  -0.193  1.00 0.00 ? 36 MET A CE   7  
ATOM 5309  H H    . MET A 1 36 ? -2.491  -0.674  2.856   1.00 0.00 ? 36 MET A H    7  
ATOM 5310  H HA   . MET A 1 36 ? -1.606  0.757   0.594   1.00 0.00 ? 36 MET A HA   7  
ATOM 5311  H HB2  . MET A 1 36 ? 0.342   0.259   1.542   1.00 0.00 ? 36 MET A HB2  7  
ATOM 5312  H HB3  . MET A 1 36 ? -0.480  -0.809  2.666   1.00 0.00 ? 36 MET A HB3  7  
ATOM 5313  H HG2  . MET A 1 36 ? 0.442   -1.686  -0.060  1.00 0.00 ? 36 MET A HG2  7  
ATOM 5314  H HG3  . MET A 1 36 ? 1.436   -1.809  1.387   1.00 0.00 ? 36 MET A HG3  7  
ATOM 5315  H HE1  . MET A 1 36 ? 0.358   -4.902  -0.253  1.00 0.00 ? 36 MET A HE1  7  
ATOM 5316  H HE2  . MET A 1 36 ? -0.250  -3.405  -0.958  1.00 0.00 ? 36 MET A HE2  7  
ATOM 5317  H HE3  . MET A 1 36 ? -1.379  -4.610  -0.339  1.00 0.00 ? 36 MET A HE3  7  
ATOM 5318  N N    . CYS A 1 37 ? -2.932  -2.077  -0.030  1.00 0.00 ? 37 CYS A N    7  
ATOM 5319  C CA   . CYS A 1 37 ? -3.299  -3.017  -1.083  1.00 0.00 ? 37 CYS A CA   7  
ATOM 5320  C C    . CYS A 1 37 ? -4.114  -2.332  -2.173  1.00 0.00 ? 37 CYS A C    7  
ATOM 5321  O O    . CYS A 1 37 ? -3.821  -2.474  -3.362  1.00 0.00 ? 37 CYS A O    7  
ATOM 5322  C CB   . CYS A 1 37 ? -4.076  -4.204  -0.502  1.00 0.00 ? 37 CYS A CB   7  
ATOM 5323  S SG   . CYS A 1 37 ? -5.506  -3.742  0.531   1.00 0.00 ? 37 CYS A SG   7  
ATOM 5324  H H    . CYS A 1 37 ? -3.410  -2.101  0.826   1.00 0.00 ? 37 CYS A H    7  
ATOM 5325  H HA   . CYS A 1 37 ? -2.387  -3.380  -1.523  1.00 0.00 ? 37 CYS A HA   7  
ATOM 5326  H HB2  . CYS A 1 37 ? -4.446  -4.812  -1.314  1.00 0.00 ? 37 CYS A HB2  7  
ATOM 5327  H HB3  . CYS A 1 37 ? -3.409  -4.796  0.107   1.00 0.00 ? 37 CYS A HB3  7  
ATOM 5328  N N    . ALA A 1 38 ? -5.127  -1.581  -1.767  1.00 0.00 ? 38 ALA A N    7  
ATOM 5329  C CA   . ALA A 1 38 ? -5.969  -0.869  -2.719  1.00 0.00 ? 38 ALA A CA   7  
ATOM 5330  C C    . ALA A 1 38 ? -5.217  0.297   -3.333  1.00 0.00 ? 38 ALA A C    7  
ATOM 5331  O O    . ALA A 1 38 ? -5.522  0.742   -4.440  1.00 0.00 ? 38 ALA A O    7  
ATOM 5332  C CB   . ALA A 1 38 ? -7.251  -0.395  -2.052  1.00 0.00 ? 38 ALA A CB   7  
ATOM 5333  H H    . ALA A 1 38 ? -5.306  -1.497  -0.809  1.00 0.00 ? 38 ALA A H    7  
ATOM 5334  H HA   . ALA A 1 38 ? -6.223  -1.552  -3.502  1.00 0.00 ? 38 ALA A HA   7  
ATOM 5335  H HB1  . ALA A 1 38 ? -7.667  -1.198  -1.463  1.00 0.00 ? 38 ALA A HB1  7  
ATOM 5336  H HB2  . ALA A 1 38 ? -7.962  -0.098  -2.808  1.00 0.00 ? 38 ALA A HB2  7  
ATOM 5337  H HB3  . ALA A 1 38 ? -7.034  0.446   -1.412  1.00 0.00 ? 38 ALA A HB3  7  
ATOM 5338  N N    . LEU A 1 39 ? -4.224  0.772   -2.608  1.00 0.00 ? 39 LEU A N    7  
ATOM 5339  C CA   . LEU A 1 39 ? -3.401  1.870   -3.061  1.00 0.00 ? 39 LEU A CA   7  
ATOM 5340  C C    . LEU A 1 39 ? -2.414  1.385   -4.102  1.00 0.00 ? 39 LEU A C    7  
ATOM 5341  O O    . LEU A 1 39 ? -2.060  2.111   -5.024  1.00 0.00 ? 39 LEU A O    7  
ATOM 5342  C CB   . LEU A 1 39 ? -2.636  2.431   -1.879  1.00 0.00 ? 39 LEU A CB   7  
ATOM 5343  C CG   . LEU A 1 39 ? -2.920  3.897   -1.548  1.00 0.00 ? 39 LEU A CG   7  
ATOM 5344  C CD1  . LEU A 1 39 ? -4.353  4.069   -1.070  1.00 0.00 ? 39 LEU A CD1  7  
ATOM 5345  C CD2  . LEU A 1 39 ? -1.942  4.402   -0.499  1.00 0.00 ? 39 LEU A CD2  7  
ATOM 5346  H H    . LEU A 1 39 ? -4.030  0.362   -1.740  1.00 0.00 ? 39 LEU A H    7  
ATOM 5347  H HA   . LEU A 1 39 ? -4.034  2.635   -3.482  1.00 0.00 ? 39 LEU A HA   7  
ATOM 5348  H HB2  . LEU A 1 39 ? -2.879  1.823   -1.026  1.00 0.00 ? 39 LEU A HB2  7  
ATOM 5349  H HB3  . LEU A 1 39 ? -1.580  2.328   -2.081  1.00 0.00 ? 39 LEU A HB3  7  
ATOM 5350  H HG   . LEU A 1 39 ? -2.792  4.492   -2.440  1.00 0.00 ? 39 LEU A HG   7  
ATOM 5351  H HD11 . LEU A 1 39 ? -4.511  3.475   -0.182  1.00 0.00 ? 39 LEU A HD11 7  
ATOM 5352  H HD12 . LEU A 1 39 ? -5.033  3.745   -1.844  1.00 0.00 ? 39 LEU A HD12 7  
ATOM 5353  H HD13 . LEU A 1 39 ? -4.535  5.109   -0.844  1.00 0.00 ? 39 LEU A HD13 7  
ATOM 5354  H HD21 . LEU A 1 39 ? -1.713  5.439   -0.691  1.00 0.00 ? 39 LEU A HD21 7  
ATOM 5355  H HD22 . LEU A 1 39 ? -1.035  3.818   -0.542  1.00 0.00 ? 39 LEU A HD22 7  
ATOM 5356  H HD23 . LEU A 1 39 ? -2.385  4.306   0.482   1.00 0.00 ? 39 LEU A HD23 7  
ATOM 5357  N N    . CYS A 1 40 ? -1.964  0.150   -3.933  1.00 0.00 ? 40 CYS A N    7  
ATOM 5358  C CA   . CYS A 1 40 ? -1.006  -0.434  -4.847  1.00 0.00 ? 40 CYS A CA   7  
ATOM 5359  C C    . CYS A 1 40 ? -1.655  -0.731  -6.185  1.00 0.00 ? 40 CYS A C    7  
ATOM 5360  O O    . CYS A 1 40 ? -1.003  -0.650  -7.226  1.00 0.00 ? 40 CYS A O    7  
ATOM 5361  C CB   . CYS A 1 40 ? -0.394  -1.702  -4.255  1.00 0.00 ? 40 CYS A CB   7  
ATOM 5362  S SG   . CYS A 1 40 ? 1.331   -1.984  -4.762  1.00 0.00 ? 40 CYS A SG   7  
ATOM 5363  H H    . CYS A 1 40 ? -2.286  -0.376  -3.174  1.00 0.00 ? 40 CYS A H    7  
ATOM 5364  H HA   . CYS A 1 40 ? -0.220  0.290   -5.001  1.00 0.00 ? 40 CYS A HA   7  
ATOM 5365  H HB2  . CYS A 1 40 ? -0.416  -1.637  -3.178  1.00 0.00 ? 40 CYS A HB2  7  
ATOM 5366  H HB3  . CYS A 1 40 ? -0.977  -2.554  -4.573  1.00 0.00 ? 40 CYS A HB3  7  
ATOM 5367  N N    . CYS A 1 41 ? -2.948  -1.047  -6.168  1.00 0.00 ? 41 CYS A N    7  
ATOM 5368  C CA   . CYS A 1 41 ? -3.642  -1.313  -7.424  1.00 0.00 ? 41 CYS A CA   7  
ATOM 5369  C C    . CYS A 1 41 ? -3.746  -0.012  -8.199  1.00 0.00 ? 41 CYS A C    7  
ATOM 5370  O O    . CYS A 1 41 ? -3.528  0.038   -9.410  1.00 0.00 ? 41 CYS A O    7  
ATOM 5371  C CB   . CYS A 1 41 ? -5.045  -1.888  -7.195  1.00 0.00 ? 41 CYS A CB   7  
ATOM 5372  S SG   . CYS A 1 41 ? -6.401  -0.885  -7.912  1.00 0.00 ? 41 CYS A SG   7  
ATOM 5373  H H    . CYS A 1 41 ? -3.441  -1.077  -5.306  1.00 0.00 ? 41 CYS A H    7  
ATOM 5374  H HA   . CYS A 1 41 ? -3.058  -2.022  -7.989  1.00 0.00 ? 41 CYS A HA   7  
ATOM 5375  H HB2  . CYS A 1 41 ? -5.096  -2.868  -7.640  1.00 0.00 ? 41 CYS A HB2  7  
ATOM 5376  H HB3  . CYS A 1 41 ? -5.214  -1.974  -6.137  1.00 0.00 ? 41 CYS A HB3  7  
ATOM 5377  N N    . GLU A 1 42 ? -4.110  1.039   -7.472  1.00 0.00 ? 42 GLU A N    7  
ATOM 5378  C CA   . GLU A 1 42 ? -4.283  2.367   -8.065  1.00 0.00 ? 42 GLU A CA   7  
ATOM 5379  C C    . GLU A 1 42 ? -2.956  3.117   -8.229  1.00 0.00 ? 42 GLU A C    7  
ATOM 5380  O O    . GLU A 1 42 ? -2.902  4.142   -8.908  1.00 0.00 ? 42 GLU A O    7  
ATOM 5381  C CB   . GLU A 1 42 ? -5.237  3.201   -7.207  1.00 0.00 ? 42 GLU A CB   7  
ATOM 5382  C CG   . GLU A 1 42 ? -6.704  2.989   -7.547  1.00 0.00 ? 42 GLU A CG   7  
ATOM 5383  C CD   . GLU A 1 42 ? -7.622  3.309   -6.386  1.00 0.00 ? 42 GLU A CD   7  
ATOM 5384  O OE1  . GLU A 1 42 ? -7.870  4.508   -6.137  1.00 0.00 ? 42 GLU A OE1  7  
ATOM 5385  O OE2  . GLU A 1 42 ? -8.095  2.361   -5.723  1.00 0.00 ? 42 GLU A OE2  7  
ATOM 5386  H H    . GLU A 1 42 ? -4.286  0.909   -6.502  1.00 0.00 ? 42 GLU A H    7  
ATOM 5387  H HA   . GLU A 1 42 ? -4.724  2.233   -9.039  1.00 0.00 ? 42 GLU A HA   7  
ATOM 5388  H HB2  . GLU A 1 42 ? -5.090  2.943   -6.170  1.00 0.00 ? 42 GLU A HB2  7  
ATOM 5389  H HB3  . GLU A 1 42 ? -5.006  4.247   -7.346  1.00 0.00 ? 42 GLU A HB3  7  
ATOM 5390  H HG2  . GLU A 1 42 ? -6.963  3.628   -8.378  1.00 0.00 ? 42 GLU A HG2  7  
ATOM 5391  H HG3  . GLU A 1 42 ? -6.849  1.956   -7.829  1.00 0.00 ? 42 GLU A HG3  7  
ATOM 5392  N N    . HIS A 1 43 ? -1.896  2.618   -7.604  1.00 0.00 ? 43 HIS A N    7  
ATOM 5393  C CA   . HIS A 1 43 ? -0.587  3.264   -7.683  1.00 0.00 ? 43 HIS A CA   7  
ATOM 5394  C C    . HIS A 1 43 ? 0.211   2.756   -8.883  1.00 0.00 ? 43 HIS A C    7  
ATOM 5395  O O    . HIS A 1 43 ? -0.216  1.830   -9.571  1.00 0.00 ? 43 HIS A O    7  
ATOM 5396  C CB   . HIS A 1 43 ? 0.179   3.055   -6.374  1.00 0.00 ? 43 HIS A CB   7  
ATOM 5397  C CG   . HIS A 1 43 ? -0.220  4.033   -5.310  1.00 0.00 ? 43 HIS A CG   7  
ATOM 5398  N ND1  . HIS A 1 43 ? -0.592  5.332   -5.585  1.00 0.00 ? 43 HIS A ND1  7  
ATOM 5399  C CD2  . HIS A 1 43 ? -0.329  3.890   -3.967  1.00 0.00 ? 43 HIS A CD2  7  
ATOM 5400  C CE1  . HIS A 1 43 ? -0.912  5.945   -4.460  1.00 0.00 ? 43 HIS A CE1  7  
ATOM 5401  N NE2  . HIS A 1 43 ? -0.762  5.092   -3.464  1.00 0.00 ? 43 HIS A NE2  7  
ATOM 5402  H H    . HIS A 1 43 ? -1.995  1.804   -7.066  1.00 0.00 ? 43 HIS A H    7  
ATOM 5403  H HA   . HIS A 1 43 ? -0.751  4.324   -7.817  1.00 0.00 ? 43 HIS A HA   7  
ATOM 5404  H HB2  . HIS A 1 43 ? -0.018  2.062   -6.002  1.00 0.00 ? 43 HIS A HB2  7  
ATOM 5405  H HB3  . HIS A 1 43 ? 1.234   3.166   -6.551  1.00 0.00 ? 43 HIS A HB3  7  
ATOM 5406  H HD1  . HIS A 1 43 ? -0.613  5.746   -6.473  1.00 0.00 ? 43 HIS A HD1  7  
ATOM 5407  H HD2  . HIS A 1 43 ? -0.116  2.996   -3.399  1.00 0.00 ? 43 HIS A HD2  7  
ATOM 5408  H HE1  . HIS A 1 43 ? -1.243  6.969   -4.370  1.00 0.00 ? 43 HIS A HE1  7  
ATOM 5409  H HE2  . HIS A 1 43 ? -0.826  5.319   -2.513  1.00 0.00 ? 43 HIS A HE2  7  
ATOM 5410  N N    . PRO A 1 44 ? 1.371   3.383   -9.166  1.00 0.00 ? 44 PRO A N    7  
ATOM 5411  C CA   . PRO A 1 44 ? 2.223   3.017   -10.311 1.00 0.00 ? 44 PRO A CA   7  
ATOM 5412  C C    . PRO A 1 44 ? 2.671   1.556   -10.298 1.00 0.00 ? 44 PRO A C    7  
ATOM 5413  O O    . PRO A 1 44 ? 3.845   1.258   -10.077 1.00 0.00 ? 44 PRO A O    7  
ATOM 5414  C CB   . PRO A 1 44 ? 3.432   3.949   -10.169 1.00 0.00 ? 44 PRO A CB   7  
ATOM 5415  C CG   . PRO A 1 44 ? 2.928   5.101   -9.371  1.00 0.00 ? 44 PRO A CG   7  
ATOM 5416  C CD   . PRO A 1 44 ? 1.930   4.519   -8.411  1.00 0.00 ? 44 PRO A CD   7  
ATOM 5417  H HA   . PRO A 1 44 ? 1.725   3.222   -11.247 1.00 0.00 ? 44 PRO A HA   7  
ATOM 5418  H HB2  . PRO A 1 44 ? 4.230   3.432   -9.657  1.00 0.00 ? 44 PRO A HB2  7  
ATOM 5419  H HB3  . PRO A 1 44 ? 3.765   4.263   -11.146 1.00 0.00 ? 44 PRO A HB3  7  
ATOM 5420  H HG2  . PRO A 1 44 ? 3.744   5.562   -8.833  1.00 0.00 ? 44 PRO A HG2  7  
ATOM 5421  H HG3  . PRO A 1 44 ? 2.449   5.819   -10.021 1.00 0.00 ? 44 PRO A HG3  7  
ATOM 5422  H HD2  . PRO A 1 44 ? 2.427   4.181   -7.515  1.00 0.00 ? 44 PRO A HD2  7  
ATOM 5423  H HD3  . PRO A 1 44 ? 1.164   5.240   -8.170  1.00 0.00 ? 44 PRO A HD3  7  
ATOM 5424  N N    . GLY A 1 45 ? 1.726   0.653   -10.558 1.00 0.00 ? 45 GLY A N    7  
ATOM 5425  C CA   . GLY A 1 45 ? 2.019   -0.772  -10.596 1.00 0.00 ? 45 GLY A CA   7  
ATOM 5426  C C    . GLY A 1 45 ? 3.011   -1.221  -9.538  1.00 0.00 ? 45 GLY A C    7  
ATOM 5427  O O    . GLY A 1 45 ? 3.776   -2.159  -9.758  1.00 0.00 ? 45 GLY A O    7  
ATOM 5428  H H    . GLY A 1 45 ? 0.814   0.961   -10.738 1.00 0.00 ? 45 GLY A H    7  
ATOM 5429  H HA2  . GLY A 1 45 ? 1.098   -1.318  -10.457 1.00 0.00 ? 45 GLY A HA2  7  
ATOM 5430  H HA3  . GLY A 1 45 ? 2.419   -1.015  -11.571 1.00 0.00 ? 45 GLY A HA3  7  
ATOM 5431  N N    . GLY A 1 46 ? 2.998   -0.554  -8.390  1.00 0.00 ? 46 GLY A N    7  
ATOM 5432  C CA   . GLY A 1 46 ? 3.910   -0.917  -7.322  1.00 0.00 ? 46 GLY A CA   7  
ATOM 5433  C C    . GLY A 1 46 ? 4.464   0.284   -6.584  1.00 0.00 ? 46 GLY A C    7  
ATOM 5434  O O    . GLY A 1 46 ? 5.470   0.863   -6.993  1.00 0.00 ? 46 GLY A O    7  
ATOM 5435  H H    . GLY A 1 46 ? 2.365   0.184   -8.267  1.00 0.00 ? 46 GLY A H    7  
ATOM 5436  H HA2  . GLY A 1 46 ? 3.388   -1.546  -6.617  1.00 0.00 ? 46 GLY A HA2  7  
ATOM 5437  H HA3  . GLY A 1 46 ? 4.732   -1.477  -7.743  1.00 0.00 ? 46 GLY A HA3  7  
ATOM 5438  N N    . PHE A 1 47 ? 3.811   0.653   -5.488  1.00 0.00 ? 47 PHE A N    7  
ATOM 5439  C CA   . PHE A 1 47 ? 4.251   1.784   -4.683  1.00 0.00 ? 47 PHE A CA   7  
ATOM 5440  C C    . PHE A 1 47 ? 5.503   1.417   -3.902  1.00 0.00 ? 47 PHE A C    7  
ATOM 5441  O O    . PHE A 1 47 ? 5.827   0.238   -3.756  1.00 0.00 ? 47 PHE A O    7  
ATOM 5442  C CB   . PHE A 1 47 ? 3.142   2.215   -3.716  1.00 0.00 ? 47 PHE A CB   7  
ATOM 5443  C CG   . PHE A 1 47 ? 2.739   3.657   -3.847  1.00 0.00 ? 47 PHE A CG   7  
ATOM 5444  C CD1  . PHE A 1 47 ? 2.778   4.296   -5.074  1.00 0.00 ? 47 PHE A CD1  7  
ATOM 5445  C CD2  . PHE A 1 47 ? 2.313   4.371   -2.739  1.00 0.00 ? 47 PHE A CD2  7  
ATOM 5446  C CE1  . PHE A 1 47 ? 2.403   5.618   -5.197  1.00 0.00 ? 47 PHE A CE1  7  
ATOM 5447  C CE2  . PHE A 1 47 ? 1.936   5.694   -2.855  1.00 0.00 ? 47 PHE A CE2  7  
ATOM 5448  C CZ   . PHE A 1 47 ? 1.981   6.318   -4.088  1.00 0.00 ? 47 PHE A CZ   7  
ATOM 5449  H H    . PHE A 1 47 ? 3.021   0.146   -5.209  1.00 0.00 ? 47 PHE A H    7  
ATOM 5450  H HA   . PHE A 1 47 ? 4.482   2.600   -5.349  1.00 0.00 ? 47 PHE A HA   7  
ATOM 5451  H HB2  . PHE A 1 47 ? 2.266   1.611   -3.896  1.00 0.00 ? 47 PHE A HB2  7  
ATOM 5452  H HB3  . PHE A 1 47 ? 3.478   2.056   -2.703  1.00 0.00 ? 47 PHE A HB3  7  
ATOM 5453  H HD1  . PHE A 1 47 ? 3.109   3.748   -5.942  1.00 0.00 ? 47 PHE A HD1  7  
ATOM 5454  H HD2  . PHE A 1 47 ? 2.279   3.884   -1.775  1.00 0.00 ? 47 PHE A HD2  7  
ATOM 5455  H HE1  . PHE A 1 47 ? 2.439   6.103   -6.162  1.00 0.00 ? 47 PHE A HE1  7  
ATOM 5456  H HE2  . PHE A 1 47 ? 1.605   6.241   -1.984  1.00 0.00 ? 47 PHE A HE2  7  
ATOM 5457  H HZ   . PHE A 1 47 ? 1.685   7.352   -4.182  1.00 0.00 ? 47 PHE A HZ   7  
ATOM 5458  N N    . GLU A 1 48 ? 6.203   2.423   -3.395  1.00 0.00 ? 48 GLU A N    7  
ATOM 5459  C CA   . GLU A 1 48 ? 7.417   2.167   -2.622  1.00 0.00 ? 48 GLU A CA   7  
ATOM 5460  C C    . GLU A 1 48 ? 7.118   2.227   -1.130  1.00 0.00 ? 48 GLU A C    7  
ATOM 5461  O O    . GLU A 1 48 ? 7.635   3.081   -0.411  1.00 0.00 ? 48 GLU A O    7  
ATOM 5462  C CB   . GLU A 1 48 ? 8.546   3.153   -2.971  1.00 0.00 ? 48 GLU A CB   7  
ATOM 5463  C CG   . GLU A 1 48 ? 8.277   4.026   -4.186  1.00 0.00 ? 48 GLU A CG   7  
ATOM 5464  C CD   . GLU A 1 48 ? 9.308   3.837   -5.282  1.00 0.00 ? 48 GLU A CD   7  
ATOM 5465  O OE1  . GLU A 1 48 ? 9.884   2.732   -5.371  1.00 0.00 ? 48 GLU A OE1  7  
ATOM 5466  O OE2  . GLU A 1 48 ? 9.539   4.793   -6.052  1.00 0.00 ? 48 GLU A OE2  7  
ATOM 5467  H H    . GLU A 1 48 ? 5.896   3.350   -3.536  1.00 0.00 ? 48 GLU A H    7  
ATOM 5468  H HA   . GLU A 1 48 ? 7.746   1.162   -2.865  1.00 0.00 ? 48 GLU A HA   7  
ATOM 5469  H HB2  . GLU A 1 48 ? 8.712   3.804   -2.127  1.00 0.00 ? 48 GLU A HB2  7  
ATOM 5470  H HB3  . GLU A 1 48 ? 9.448   2.589   -3.156  1.00 0.00 ? 48 GLU A HB3  7  
ATOM 5471  H HG2  . GLU A 1 48 ? 7.306   3.786   -4.582  1.00 0.00 ? 48 GLU A HG2  7  
ATOM 5472  H HG3  . GLU A 1 48 ? 8.292   5.059   -3.873  1.00 0.00 ? 48 GLU A HG3  7  
ATOM 5473  N N    . TYR A 1 49 ? 6.282   1.307   -0.670  1.00 0.00 ? 49 TYR A N    7  
ATOM 5474  C CA   . TYR A 1 49 ? 5.920   1.246   0.737   1.00 0.00 ? 49 TYR A CA   7  
ATOM 5475  C C    . TYR A 1 49 ? 6.614   0.103   1.433   1.00 0.00 ? 49 TYR A C    7  
ATOM 5476  O O    . TYR A 1 49 ? 7.086   -0.844  0.807   1.00 0.00 ? 49 TYR A O    7  
ATOM 5477  C CB   . TYR A 1 49 ? 4.432   1.073   0.926   1.00 0.00 ? 49 TYR A CB   7  
ATOM 5478  C CG   . TYR A 1 49 ? 3.838   -0.096  0.201   1.00 0.00 ? 49 TYR A CG   7  
ATOM 5479  C CD1  . TYR A 1 49 ? 4.121   -1.391  0.604   1.00 0.00 ? 49 TYR A CD1  7  
ATOM 5480  C CD2  . TYR A 1 49 ? 2.983   0.094   -0.869  1.00 0.00 ? 49 TYR A CD2  7  
ATOM 5481  C CE1  . TYR A 1 49 ? 3.570   -2.470  -0.045  1.00 0.00 ? 49 TYR A CE1  7  
ATOM 5482  C CE2  . TYR A 1 49 ? 2.423   -0.979  -1.523  1.00 0.00 ? 49 TYR A CE2  7  
ATOM 5483  C CZ   . TYR A 1 49 ? 2.719   -2.258  -1.109  1.00 0.00 ? 49 TYR A CZ   7  
ATOM 5484  O OH   . TYR A 1 49 ? 2.160   -3.325  -1.757  1.00 0.00 ? 49 TYR A OH   7  
ATOM 5485  H H    . TYR A 1 49 ? 5.904   0.650   -1.291  1.00 0.00 ? 49 TYR A H    7  
ATOM 5486  H HA   . TYR A 1 49 ? 6.209   2.164   1.217   1.00 0.00 ? 49 TYR A HA   7  
ATOM 5487  H HB2  . TYR A 1 49 ? 4.258   0.920   1.966   1.00 0.00 ? 49 TYR A HB2  7  
ATOM 5488  H HB3  . TYR A 1 49 ? 3.920   1.962   0.614   1.00 0.00 ? 49 TYR A HB3  7  
ATOM 5489  H HD1  . TYR A 1 49 ? 4.787   -1.549  1.439   1.00 0.00 ? 49 TYR A HD1  7  
ATOM 5490  H HD2  . TYR A 1 49 ? 2.756   1.099   -1.189  1.00 0.00 ? 49 TYR A HD2  7  
ATOM 5491  H HE1  . TYR A 1 49 ? 3.803   -3.472  0.284   1.00 0.00 ? 49 TYR A HE1  7  
ATOM 5492  H HE2  . TYR A 1 49 ? 1.759   -0.813  -2.355  1.00 0.00 ? 49 TYR A HE2  7  
ATOM 5493  H HH   . TYR A 1 49 ? 1.912   -3.996  -1.116  1.00 0.00 ? 49 TYR A HH   7  
ATOM 5494  N N    . SER A 1 50 ? 6.631   0.194   2.741   1.00 0.00 ? 50 SER A N    7  
ATOM 5495  C CA   . SER A 1 50 ? 7.222   -0.828  3.573   1.00 0.00 ? 50 SER A CA   7  
ATOM 5496  C C    . SER A 1 50 ? 6.284   -1.127  4.723   1.00 0.00 ? 50 SER A C    7  
ATOM 5497  O O    . SER A 1 50 ? 6.288   -0.435  5.739   1.00 0.00 ? 50 SER A O    7  
ATOM 5498  C CB   . SER A 1 50 ? 8.576   -0.378  4.100   1.00 0.00 ? 50 SER A CB   7  
ATOM 5499  O OG   . SER A 1 50 ? 9.352   0.220   3.077   1.00 0.00 ? 50 SER A OG   7  
ATOM 5500  H H    . SER A 1 50 ? 6.204   0.972   3.164   1.00 0.00 ? 50 SER A H    7  
ATOM 5501  H HA   . SER A 1 50 ? 7.347   -1.721  2.976   1.00 0.00 ? 50 SER A HA   7  
ATOM 5502  H HB2  . SER A 1 50 ? 8.425   0.339   4.889   1.00 0.00 ? 50 SER A HB2  7  
ATOM 5503  H HB3  . SER A 1 50 ? 9.105   -1.235  4.484   1.00 0.00 ? 50 SER A HB3  7  
ATOM 5504  H HG   . SER A 1 50 ? 8.850   0.929   2.667   1.00 0.00 ? 50 SER A HG   7  
ATOM 5505  N N    . ASN A 1 51 ? 5.456   -2.141  4.544   1.00 0.00 ? 51 ASN A N    7  
ATOM 5506  C CA   . ASN A 1 51 ? 4.486   -2.503  5.561   1.00 0.00 ? 51 ASN A CA   7  
ATOM 5507  C C    . ASN A 1 51 ? 5.126   -2.595  6.933   1.00 0.00 ? 51 ASN A C    7  
ATOM 5508  O O    . ASN A 1 51 ? 6.152   -3.247  7.122   1.00 0.00 ? 51 ASN A O    7  
ATOM 5509  C CB   . ASN A 1 51 ? 3.796   -3.815  5.227   1.00 0.00 ? 51 ASN A CB   7  
ATOM 5510  C CG   . ASN A 1 51 ? 3.206   -3.825  3.830   1.00 0.00 ? 51 ASN A CG   7  
ATOM 5511  O OD1  . ASN A 1 51 ? 3.781   -3.264  2.898   1.00 0.00 ? 51 ASN A OD1  7  
ATOM 5512  N ND2  . ASN A 1 51 ? 2.051   -4.462  3.681   1.00 0.00 ? 51 ASN A ND2  7  
ATOM 5513  H H    . ASN A 1 51 ? 5.486   -2.639  3.703   1.00 0.00 ? 51 ASN A H    7  
ATOM 5514  H HA   . ASN A 1 51 ? 3.740   -1.721  5.587   1.00 0.00 ? 51 ASN A HA   7  
ATOM 5515  H HB2  . ASN A 1 51 ? 4.509   -4.620  5.306   1.00 0.00 ? 51 ASN A HB2  7  
ATOM 5516  H HB3  . ASN A 1 51 ? 2.999   -3.969  5.940   1.00 0.00 ? 51 ASN A HB3  7  
ATOM 5517  H HD21 . ASN A 1 51 ? 1.650   -4.884  4.468   1.00 0.00 ? 51 ASN A HD21 7  
ATOM 5518  H HD22 . ASN A 1 51 ? 1.648   -4.485  2.788   1.00 0.00 ? 51 ASN A HD22 7  
ATOM 5519  N N    . GLY A 1 52 ? 4.500   -1.928  7.882   1.00 0.00 ? 52 GLY A N    7  
ATOM 5520  C CA   . GLY A 1 52 ? 4.993   -1.921  9.246   1.00 0.00 ? 52 GLY A CA   7  
ATOM 5521  C C    . GLY A 1 52 ? 5.468   -0.549  9.687   1.00 0.00 ? 52 GLY A C    7  
ATOM 5522  O O    . GLY A 1 52 ? 5.651   0.342   8.858   1.00 0.00 ? 52 GLY A O    7  
ATOM 5523  H H    . GLY A 1 52 ? 3.687   -1.433  7.646   1.00 0.00 ? 52 GLY A H    7  
ATOM 5524  H HA2  . GLY A 1 52 ? 4.201   -2.244  9.906   1.00 0.00 ? 52 GLY A HA2  7  
ATOM 5525  H HA3  . GLY A 1 52 ? 5.816   -2.617  9.323   1.00 0.00 ? 52 GLY A HA3  7  
ATOM 5526  N N    . PRO A 1 53 ? 5.675   -0.347  10.999  1.00 0.00 ? 53 PRO A N    7  
ATOM 5527  C CA   . PRO A 1 53 ? 6.131   0.940   11.538  1.00 0.00 ? 53 PRO A CA   7  
ATOM 5528  C C    . PRO A 1 53 ? 7.538   1.301   11.073  1.00 0.00 ? 53 PRO A C    7  
ATOM 5529  O O    . PRO A 1 53 ? 8.513   0.647   11.444  1.00 0.00 ? 53 PRO A O    7  
ATOM 5530  C CB   . PRO A 1 53 ? 6.108   0.725   13.056  1.00 0.00 ? 53 PRO A CB   7  
ATOM 5531  C CG   . PRO A 1 53 ? 6.196   -0.751  13.235  1.00 0.00 ? 53 PRO A CG   7  
ATOM 5532  C CD   . PRO A 1 53 ? 5.480   -1.351  12.059  1.00 0.00 ? 53 PRO A CD   7  
ATOM 5533  H HA   . PRO A 1 53 ? 5.453   1.739   11.275  1.00 0.00 ? 53 PRO A HA   7  
ATOM 5534  H HB2  . PRO A 1 53 ? 6.951   1.228   13.505  1.00 0.00 ? 53 PRO A HB2  7  
ATOM 5535  H HB3  . PRO A 1 53 ? 5.188   1.117   13.463  1.00 0.00 ? 53 PRO A HB3  7  
ATOM 5536  H HG2  . PRO A 1 53 ? 7.231   -1.060  13.243  1.00 0.00 ? 53 PRO A HG2  7  
ATOM 5537  H HG3  . PRO A 1 53 ? 5.710   -1.038  14.156  1.00 0.00 ? 53 PRO A HG3  7  
ATOM 5538  H HD2  . PRO A 1 53 ? 5.928   -2.295  11.785  1.00 0.00 ? 53 PRO A HD2  7  
ATOM 5539  H HD3  . PRO A 1 53 ? 4.431   -1.480  12.281  1.00 0.00 ? 53 PRO A HD3  7  
ATOM 5540  N N    . CYS A 1 54 ? 7.637   2.350   10.263  1.00 0.00 ? 54 CYS A N    7  
ATOM 5541  C CA   . CYS A 1 54 ? 8.924   2.805   9.752   1.00 0.00 ? 54 CYS A CA   7  
ATOM 5542  C C    . CYS A 1 54 ? 8.855   4.277   9.347   1.00 0.00 ? 54 CYS A C    7  
ATOM 5543  O O    . CYS A 1 54 ? 9.750   5.057   9.671   1.00 0.00 ? 54 CYS A O    7  
ATOM 5544  C CB   . CYS A 1 54 ? 9.371   1.920   8.572   1.00 0.00 ? 54 CYS A CB   7  
ATOM 5545  S SG   . CYS A 1 54 ? 9.134   2.641   6.909   1.00 0.00 ? 54 CYS A SG   7  
ATOM 5546  H H    . CYS A 1 54 ? 6.823   2.832   10.007  1.00 0.00 ? 54 CYS A H    7  
ATOM 5547  H HA   . CYS A 1 54 ? 9.643   2.705   10.551  1.00 0.00 ? 54 CYS A HA   7  
ATOM 5548  H HB2  . CYS A 1 54 ? 10.422  1.703   8.681   1.00 0.00 ? 54 CYS A HB2  7  
ATOM 5549  H HB3  . CYS A 1 54 ? 8.818   0.991   8.607   1.00 0.00 ? 54 CYS A HB3  7  
ATOM 5550  N N    . GLU A 1 55 ? 7.777   4.636   8.641   1.00 0.00 ? 55 GLU A N    7  
ATOM 5551  C CA   . GLU A 1 55 ? 7.539   6.009   8.168   1.00 0.00 ? 55 GLU A CA   7  
ATOM 5552  C C    . GLU A 1 55 ? 8.761   6.914   8.346   1.00 0.00 ? 55 GLU A C    7  
ATOM 5553  O O    . GLU A 1 55 ? 9.812   6.609   7.743   1.00 0.00 ? 55 GLU A O    7  
ATOM 5554  C CB   . GLU A 1 55 ? 6.329   6.607   8.891   1.00 0.00 ? 55 GLU A CB   7  
ATOM 5555  C CG   . GLU A 1 55 ? 6.544   6.798   10.386  1.00 0.00 ? 55 GLU A CG   7  
ATOM 5556  C CD   . GLU A 1 55 ? 6.200   8.199   10.851  1.00 0.00 ? 55 GLU A CD   7  
ATOM 5557  O OE1  . GLU A 1 55 ? 5.009   8.570   10.789  1.00 0.00 ? 55 GLU A OE1  7  
ATOM 5558  O OE2  . GLU A 1 55 ? 7.123   8.926   11.276  1.00 0.00 ? 55 GLU A OE2  7  
ATOM 5559  O OXT  . GLU A 1 55 ? 8.657   7.918   9.083   1.00 0.00 ? 55 GLU A OXT  7  
ATOM 5560  H H    . GLU A 1 55 ? 7.111   3.950   8.430   1.00 0.00 ? 55 GLU A H    7  
ATOM 5561  H HA   . GLU A 1 55 ? 7.313   5.952   7.115   1.00 0.00 ? 55 GLU A HA   7  
ATOM 5562  H HB2  . GLU A 1 55 ? 6.103   7.569   8.455   1.00 0.00 ? 55 GLU A HB2  7  
ATOM 5563  H HB3  . GLU A 1 55 ? 5.482   5.952   8.752   1.00 0.00 ? 55 GLU A HB3  7  
ATOM 5564  H HG2  . GLU A 1 55 ? 5.920   6.096   10.917  1.00 0.00 ? 55 GLU A HG2  7  
ATOM 5565  H HG3  . GLU A 1 55 ? 7.581   6.602   10.615  1.00 0.00 ? 55 GLU A HG3  7  
ATOM 5566  N N    . ALA A 1 1  ? 7.732   -1.383  -9.559  1.00 0.00 ? 1  ALA A N    8  
ATOM 5567  C CA   . ALA A 1 1  ? 6.948   -2.209  -8.604  1.00 0.00 ? 1  ALA A CA   8  
ATOM 5568  C C    . ALA A 1 1  ? 7.650   -2.303  -7.254  1.00 0.00 ? 1  ALA A C    8  
ATOM 5569  O O    . ALA A 1 1  ? 8.840   -2.011  -7.139  1.00 0.00 ? 1  ALA A O    8  
ATOM 5570  C CB   . ALA A 1 1  ? 6.722   -3.601  -9.175  1.00 0.00 ? 1  ALA A CB   8  
ATOM 5571  H H1   . ALA A 1 1  ? 8.615   -1.889  -9.765  1.00 0.00 ? 1  ALA A H1   8  
ATOM 5572  H H2   . ALA A 1 1  ? 7.921   -0.466  -9.102  1.00 0.00 ? 1  ALA A H2   8  
ATOM 5573  H H3   . ALA A 1 1  ? 7.160   -1.264  -10.419 1.00 0.00 ? 1  ALA A H3   8  
ATOM 5574  H HA   . ALA A 1 1  ? 5.983   -1.744  -8.464  1.00 0.00 ? 1  ALA A HA   8  
ATOM 5575  H HB1  . ALA A 1 1  ? 5.787   -3.622  -9.715  1.00 0.00 ? 1  ALA A HB1  8  
ATOM 5576  H HB2  . ALA A 1 1  ? 6.688   -4.320  -8.368  1.00 0.00 ? 1  ALA A HB2  8  
ATOM 5577  H HB3  . ALA A 1 1  ? 7.531   -3.851  -9.845  1.00 0.00 ? 1  ALA A HB3  8  
ATOM 5578  N N    . HIS A 1 2  ? 6.905   -2.716  -6.235  1.00 0.00 ? 2  HIS A N    8  
ATOM 5579  C CA   . HIS A 1 2  ? 7.447   -2.855  -4.896  1.00 0.00 ? 2  HIS A CA   8  
ATOM 5580  C C    . HIS A 1 2  ? 7.135   -4.219  -4.311  1.00 0.00 ? 2  HIS A C    8  
ATOM 5581  O O    . HIS A 1 2  ? 7.021   -5.216  -5.025  1.00 0.00 ? 2  HIS A O    8  
ATOM 5582  C CB   . HIS A 1 2  ? 6.945   -1.735  -3.991  1.00 0.00 ? 2  HIS A CB   8  
ATOM 5583  C CG   . HIS A 1 2  ? 8.006   -1.269  -3.041  1.00 0.00 ? 2  HIS A CG   8  
ATOM 5584  N ND1  . HIS A 1 2  ? 9.145   -0.606  -3.452  1.00 0.00 ? 2  HIS A ND1  8  
ATOM 5585  C CD2  . HIS A 1 2  ? 8.111   -1.386  -1.697  1.00 0.00 ? 2  HIS A CD2  8  
ATOM 5586  C CE1  . HIS A 1 2  ? 9.901   -0.337  -2.404  1.00 0.00 ? 2  HIS A CE1  8  
ATOM 5587  N NE2  . HIS A 1 2  ? 9.296   -0.800  -1.326  1.00 0.00 ? 2  HIS A NE2  8  
ATOM 5588  H H    . HIS A 1 2  ? 5.964   -2.937  -6.387  1.00 0.00 ? 2  HIS A H    8  
ATOM 5589  H HA   . HIS A 1 2  ? 8.508   -2.771  -4.944  1.00 0.00 ? 2  HIS A HA   8  
ATOM 5590  H HB2  . HIS A 1 2  ? 6.643   -0.895  -4.599  1.00 0.00 ? 2  HIS A HB2  8  
ATOM 5591  H HB3  . HIS A 1 2  ? 6.104   -2.086  -3.413  1.00 0.00 ? 2  HIS A HB3  8  
ATOM 5592  H HD1  . HIS A 1 2  ? 9.365   -0.370  -4.377  1.00 0.00 ? 2  HIS A HD1  8  
ATOM 5593  H HD2  . HIS A 1 2  ? 7.394   -1.857  -1.038  1.00 0.00 ? 2  HIS A HD2  8  
ATOM 5594  H HE1  . HIS A 1 2  ? 10.851  0.174   -2.423  1.00 0.00 ? 2  HIS A HE1  8  
ATOM 5595  H HE2  . HIS A 1 2  ? 9.598   -0.661  -0.404  1.00 0.00 ? 2  HIS A HE2  8  
ATOM 5596  N N    . MET A 1 3  ? 7.050   -4.246  -3.007  1.00 0.00 ? 3  MET A N    8  
ATOM 5597  C CA   . MET A 1 3  ? 6.805   -5.488  -2.261  1.00 0.00 ? 3  MET A CA   8  
ATOM 5598  C C    . MET A 1 3  ? 5.391   -6.049  -2.486  1.00 0.00 ? 3  MET A C    8  
ATOM 5599  O O    . MET A 1 3  ? 4.726   -5.709  -3.464  1.00 0.00 ? 3  MET A O    8  
ATOM 5600  C CB   . MET A 1 3  ? 7.043   -5.246  -0.768  1.00 0.00 ? 3  MET A CB   8  
ATOM 5601  C CG   . MET A 1 3  ? 7.995   -6.245  -0.133  1.00 0.00 ? 3  MET A CG   8  
ATOM 5602  S SD   . MET A 1 3  ? 9.616   -6.258  -0.922  1.00 0.00 ? 3  MET A SD   8  
ATOM 5603  C CE   . MET A 1 3  ? 10.536  -5.183  0.176   1.00 0.00 ? 3  MET A CE   8  
ATOM 5604  H H    . MET A 1 3  ? 7.199   -3.403  -2.529  1.00 0.00 ? 3  MET A H    8  
ATOM 5605  H HA   . MET A 1 3  ? 7.521   -6.218  -2.607  1.00 0.00 ? 3  MET A HA   8  
ATOM 5606  H HB2  . MET A 1 3  ? 7.455   -4.256  -0.636  1.00 0.00 ? 3  MET A HB2  8  
ATOM 5607  H HB3  . MET A 1 3  ? 6.097   -5.303  -0.249  1.00 0.00 ? 3  MET A HB3  8  
ATOM 5608  H HG2  . MET A 1 3  ? 8.121   -5.990  0.909   1.00 0.00 ? 3  MET A HG2  8  
ATOM 5609  H HG3  . MET A 1 3  ? 7.564   -7.232  -0.210  1.00 0.00 ? 3  MET A HG3  8  
ATOM 5610  H HE1  . MET A 1 3  ? 9.897   -4.379  0.511   1.00 0.00 ? 3  MET A HE1  8  
ATOM 5611  H HE2  . MET A 1 3  ? 11.385  -4.773  -0.350  1.00 0.00 ? 3  MET A HE2  8  
ATOM 5612  H HE3  . MET A 1 3  ? 10.879  -5.748  1.030   1.00 0.00 ? 3  MET A HE3  8  
ATOM 5613  N N    . ASP A 1 4  ? 4.960   -6.933  -1.571  1.00 0.00 ? 4  ASP A N    8  
ATOM 5614  C CA   . ASP A 1 4  ? 3.641   -7.588  -1.636  1.00 0.00 ? 4  ASP A CA   8  
ATOM 5615  C C    . ASP A 1 4  ? 2.565   -6.676  -2.224  1.00 0.00 ? 4  ASP A C    8  
ATOM 5616  O O    . ASP A 1 4  ? 1.954   -5.883  -1.509  1.00 0.00 ? 4  ASP A O    8  
ATOM 5617  C CB   . ASP A 1 4  ? 3.223   -8.038  -0.234  1.00 0.00 ? 4  ASP A CB   8  
ATOM 5618  C CG   . ASP A 1 4  ? 2.454   -9.346  -0.250  1.00 0.00 ? 4  ASP A CG   8  
ATOM 5619  O OD1  . ASP A 1 4  ? 2.716   -10.177 -1.145  1.00 0.00 ? 4  ASP A OD1  8  
ATOM 5620  O OD2  . ASP A 1 4  ? 1.590   -9.538  0.630   1.00 0.00 ? 4  ASP A OD2  8  
ATOM 5621  H H    . ASP A 1 4  ? 5.557   -7.166  -0.830  1.00 0.00 ? 4  ASP A H    8  
ATOM 5622  H HA   . ASP A 1 4  ? 3.738   -8.459  -2.266  1.00 0.00 ? 4  ASP A HA   8  
ATOM 5623  H HB2  . ASP A 1 4  ? 4.106   -8.170  0.375   1.00 0.00 ? 4  ASP A HB2  8  
ATOM 5624  H HB3  . ASP A 1 4  ? 2.596   -7.278  0.211   1.00 0.00 ? 4  ASP A HB3  8  
ATOM 5625  N N    . CYS A 1 5  ? 2.347   -6.781  -3.532  1.00 0.00 ? 5  CYS A N    8  
ATOM 5626  C CA   . CYS A 1 5  ? 1.358   -5.946  -4.213  1.00 0.00 ? 5  CYS A CA   8  
ATOM 5627  C C    . CYS A 1 5  ? 0.112   -6.736  -4.611  1.00 0.00 ? 5  CYS A C    8  
ATOM 5628  O O    . CYS A 1 5  ? 0.196   -7.921  -4.933  1.00 0.00 ? 5  CYS A O    8  
ATOM 5629  C CB   . CYS A 1 5  ? 1.989   -5.324  -5.459  1.00 0.00 ? 5  CYS A CB   8  
ATOM 5630  S SG   . CYS A 1 5  ? 1.158   -3.817  -6.040  1.00 0.00 ? 5  CYS A SG   8  
ATOM 5631  H H    . CYS A 1 5  ? 2.872   -7.423  -4.054  1.00 0.00 ? 5  CYS A H    8  
ATOM 5632  H HA   . CYS A 1 5  ? 1.070   -5.159  -3.536  1.00 0.00 ? 5  CYS A HA   8  
ATOM 5633  H HB2  . CYS A 1 5  ? 3.016   -5.068  -5.244  1.00 0.00 ? 5  CYS A HB2  8  
ATOM 5634  H HB3  . CYS A 1 5  ? 1.965   -6.044  -6.263  1.00 0.00 ? 5  CYS A HB3  8  
ATOM 5635  N N    . THR A 1 6  ? -1.045  -6.064  -4.606  1.00 0.00 ? 6  THR A N    8  
ATOM 5636  C CA   . THR A 1 6  ? -2.298  -6.703  -4.986  1.00 0.00 ? 6  THR A CA   8  
ATOM 5637  C C    . THR A 1 6  ? -2.191  -7.319  -6.392  1.00 0.00 ? 6  THR A C    8  
ATOM 5638  O O    . THR A 1 6  ? -2.952  -8.226  -6.718  1.00 0.00 ? 6  THR A O    8  
ATOM 5639  C CB   . THR A 1 6  ? -3.433  -5.678  -4.962  1.00 0.00 ? 6  THR A CB   8  
ATOM 5640  O OG1  . THR A 1 6  ? -4.651  -6.268  -5.378  1.00 0.00 ? 6  THR A OG1  8  
ATOM 5641  C CG2  . THR A 1 6  ? -3.177  -4.478  -5.850  1.00 0.00 ? 6  THR A CG2  8  
ATOM 5642  H H    . THR A 1 6  ? -1.057  -5.111  -4.350  1.00 0.00 ? 6  THR A H    8  
ATOM 5643  H HA   . THR A 1 6  ? -2.522  -7.490  -4.257  1.00 0.00 ? 6  THR A HA   8  
ATOM 5644  H HB   . THR A 1 6  ? -3.558  -5.319  -3.950  1.00 0.00 ? 6  THR A HB   8  
ATOM 5645  H HG1  . THR A 1 6  ? -5.007  -6.803  -4.666  1.00 0.00 ? 6  THR A HG1  8  
ATOM 5646  H HG21 . THR A 1 6  ? -3.259  -3.574  -5.266  1.00 0.00 ? 6  THR A HG21 8  
ATOM 5647  H HG22 . THR A 1 6  ? -3.905  -4.459  -6.647  1.00 0.00 ? 6  THR A HG22 8  
ATOM 5648  H HG23 . THR A 1 6  ? -2.184  -4.546  -6.271  1.00 0.00 ? 6  THR A HG23 8  
ATOM 5649  N N    . GLU A 1 7  ? -1.250  -6.810  -7.228  1.00 0.00 ? 7  GLU A N    8  
ATOM 5650  C CA   . GLU A 1 7  ? -1.054  -7.302  -8.601  1.00 0.00 ? 7  GLU A CA   8  
ATOM 5651  C C    . GLU A 1 7  ? -1.512  -8.750  -8.788  1.00 0.00 ? 7  GLU A C    8  
ATOM 5652  O O    . GLU A 1 7  ? -0.720  -9.686  -8.686  1.00 0.00 ? 7  GLU A O    8  
ATOM 5653  C CB   . GLU A 1 7  ? 0.419   -7.179  -8.992  1.00 0.00 ? 7  GLU A CB   8  
ATOM 5654  C CG   . GLU A 1 7  ? 1.366   -7.863  -8.019  1.00 0.00 ? 7  GLU A CG   8  
ATOM 5655  C CD   . GLU A 1 7  ? 2.802   -7.401  -8.179  1.00 0.00 ? 7  GLU A CD   8  
ATOM 5656  O OE1  . GLU A 1 7  ? 3.135   -6.863  -9.255  1.00 0.00 ? 7  GLU A OE1  8  
ATOM 5657  O OE2  . GLU A 1 7  ? 3.590   -7.578  -7.228  1.00 0.00 ? 7  GLU A OE2  8  
ATOM 5658  H H    . GLU A 1 7  ? -0.673  -6.070  -6.923  1.00 0.00 ? 7  GLU A H    8  
ATOM 5659  H HA   . GLU A 1 7  ? -1.635  -6.673  -9.256  1.00 0.00 ? 7  GLU A HA   8  
ATOM 5660  H HB2  . GLU A 1 7  ? 0.558   -7.621  -9.968  1.00 0.00 ? 7  GLU A HB2  8  
ATOM 5661  H HB3  . GLU A 1 7  ? 0.681   -6.132  -9.040  1.00 0.00 ? 7  GLU A HB3  8  
ATOM 5662  H HG2  . GLU A 1 7  ? 1.044   -7.645  -7.011  1.00 0.00 ? 7  GLU A HG2  8  
ATOM 5663  H HG3  . GLU A 1 7  ? 1.325   -8.930  -8.186  1.00 0.00 ? 7  GLU A HG3  8  
ATOM 5664  N N    . PHE A 1 8  ? -2.798  -8.914  -9.074  1.00 0.00 ? 8  PHE A N    8  
ATOM 5665  C CA   . PHE A 1 8  ? -3.385  -10.231 -9.294  1.00 0.00 ? 8  PHE A CA   8  
ATOM 5666  C C    . PHE A 1 8  ? -4.703  -10.084 -10.053 1.00 0.00 ? 8  PHE A C    8  
ATOM 5667  O O    . PHE A 1 8  ? -4.922  -9.077  -10.726 1.00 0.00 ? 8  PHE A O    8  
ATOM 5668  C CB   . PHE A 1 8  ? -3.598  -10.947 -7.954  1.00 0.00 ? 8  PHE A CB   8  
ATOM 5669  C CG   . PHE A 1 8  ? -2.829  -12.232 -7.830  1.00 0.00 ? 8  PHE A CG   8  
ATOM 5670  C CD1  . PHE A 1 8  ? -3.308  -13.403 -8.396  1.00 0.00 ? 8  PHE A CD1  8  
ATOM 5671  C CD2  . PHE A 1 8  ? -1.624  -12.268 -7.145  1.00 0.00 ? 8  PHE A CD2  8  
ATOM 5672  C CE1  . PHE A 1 8  ? -2.600  -14.584 -8.282  1.00 0.00 ? 8  PHE A CE1  8  
ATOM 5673  C CE2  . PHE A 1 8  ? -0.912  -13.446 -7.028  1.00 0.00 ? 8  PHE A CE2  8  
ATOM 5674  C CZ   . PHE A 1 8  ? -1.401  -14.606 -7.598  1.00 0.00 ? 8  PHE A CZ   8  
ATOM 5675  H H    . PHE A 1 8  ? -3.371  -8.123  -9.147  1.00 0.00 ? 8  PHE A H    8  
ATOM 5676  H HA   . PHE A 1 8  ? -2.697  -10.804 -9.897  1.00 0.00 ? 8  PHE A HA   8  
ATOM 5677  H HB2  . PHE A 1 8  ? -3.283  -10.297 -7.153  1.00 0.00 ? 8  PHE A HB2  8  
ATOM 5678  H HB3  . PHE A 1 8  ? -4.645  -11.172 -7.832  1.00 0.00 ? 8  PHE A HB3  8  
ATOM 5679  H HD1  . PHE A 1 8  ? -4.246  -13.387 -8.931  1.00 0.00 ? 8  PHE A HD1  8  
ATOM 5680  H HD2  . PHE A 1 8  ? -1.241  -11.361 -6.698  1.00 0.00 ? 8  PHE A HD2  8  
ATOM 5681  H HE1  . PHE A 1 8  ? -2.984  -15.489 -8.728  1.00 0.00 ? 8  PHE A HE1  8  
ATOM 5682  H HE2  . PHE A 1 8  ? 0.026   -13.461 -6.492  1.00 0.00 ? 8  PHE A HE2  8  
ATOM 5683  H HZ   . PHE A 1 8  ? -0.845  -15.528 -7.508  1.00 0.00 ? 8  PHE A HZ   8  
ATOM 5684  N N    . ASN A 1 9  ? -5.586  -11.072 -9.944  1.00 0.00 ? 9  ASN A N    8  
ATOM 5685  C CA   . ASN A 1 9  ? -6.872  -11.004 -10.626 1.00 0.00 ? 9  ASN A CA   8  
ATOM 5686  C C    . ASN A 1 9  ? -7.746  -9.930  -9.983  1.00 0.00 ? 9  ASN A C    8  
ATOM 5687  O O    . ASN A 1 9  ? -8.152  -8.973  -10.643 1.00 0.00 ? 9  ASN A O    8  
ATOM 5688  C CB   . ASN A 1 9  ? -7.577  -12.363 -10.585 1.00 0.00 ? 9  ASN A CB   8  
ATOM 5689  C CG   . ASN A 1 9  ? -7.514  -13.089 -11.915 1.00 0.00 ? 9  ASN A CG   8  
ATOM 5690  O OD1  . ASN A 1 9  ? -8.536  -13.312 -12.562 1.00 0.00 ? 9  ASN A OD1  8  
ATOM 5691  N ND2  . ASN A 1 9  ? -6.308  -13.463 -12.329 1.00 0.00 ? 9  ASN A ND2  8  
ATOM 5692  H H    . ASN A 1 9  ? -5.375  -11.853 -9.393  1.00 0.00 ? 9  ASN A H    8  
ATOM 5693  H HA   . ASN A 1 9  ? -6.687  -10.732 -11.655 1.00 0.00 ? 9  ASN A HA   8  
ATOM 5694  H HB2  . ASN A 1 9  ? -7.106  -12.983 -9.837  1.00 0.00 ? 9  ASN A HB2  8  
ATOM 5695  H HB3  . ASN A 1 9  ? -8.615  -12.217 -10.323 1.00 0.00 ? 9  ASN A HB3  8  
ATOM 5696  H HD21 . ASN A 1 9  ? -5.539  -13.254 -11.761 1.00 0.00 ? 9  ASN A HD21 8  
ATOM 5697  H HD22 . ASN A 1 9  ? -6.239  -13.934 -13.186 1.00 0.00 ? 9  ASN A HD22 8  
ATOM 5698  N N    . PRO A 1 10 ? -8.042  -10.067 -8.677  1.00 0.00 ? 10 PRO A N    8  
ATOM 5699  C CA   . PRO A 1 10 ? -8.858  -9.105  -7.942  1.00 0.00 ? 10 PRO A CA   8  
ATOM 5700  C C    . PRO A 1 10 ? -8.023  -7.968  -7.353  1.00 0.00 ? 10 PRO A C    8  
ATOM 5701  O O    . PRO A 1 10 ? -7.459  -8.102  -6.267  1.00 0.00 ? 10 PRO A O    8  
ATOM 5702  C CB   . PRO A 1 10 ? -9.439  -9.968  -6.830  1.00 0.00 ? 10 PRO A CB   8  
ATOM 5703  C CG   . PRO A 1 10 ? -8.354  -10.942 -6.517  1.00 0.00 ? 10 PRO A CG   8  
ATOM 5704  C CD   . PRO A 1 10 ? -7.599  -11.175 -7.804  1.00 0.00 ? 10 PRO A CD   8  
ATOM 5705  H HA   . PRO A 1 10 ? -9.653  -8.702  -8.550  1.00 0.00 ? 10 PRO A HA   8  
ATOM 5706  H HB2  . PRO A 1 10 ? -9.676  -9.350  -5.979  1.00 0.00 ? 10 PRO A HB2  8  
ATOM 5707  H HB3  . PRO A 1 10 ? -10.328 -10.467 -7.182  1.00 0.00 ? 10 PRO A HB3  8  
ATOM 5708  H HG2  . PRO A 1 10 ? -7.695  -10.527 -5.768  1.00 0.00 ? 10 PRO A HG2  8  
ATOM 5709  H HG3  . PRO A 1 10 ? -8.785  -11.868 -6.164  1.00 0.00 ? 10 PRO A HG3  8  
ATOM 5710  H HD2  . PRO A 1 10 ? -6.537  -11.125 -7.630  1.00 0.00 ? 10 PRO A HD2  8  
ATOM 5711  H HD3  . PRO A 1 10 ? -7.869  -12.130 -8.226  1.00 0.00 ? 10 PRO A HD3  8  
ATOM 5712  N N    . LEU A 1 11 ? -7.940  -6.854  -8.075  1.00 0.00 ? 11 LEU A N    8  
ATOM 5713  C CA   . LEU A 1 11 ? -7.164  -5.703  -7.616  1.00 0.00 ? 11 LEU A CA   8  
ATOM 5714  C C    . LEU A 1 11 ? -7.708  -5.162  -6.306  1.00 0.00 ? 11 LEU A C    8  
ATOM 5715  O O    . LEU A 1 11 ? -8.782  -5.565  -5.874  1.00 0.00 ? 11 LEU A O    8  
ATOM 5716  C CB   . LEU A 1 11 ? -7.148  -4.604  -8.679  1.00 0.00 ? 11 LEU A CB   8  
ATOM 5717  C CG   . LEU A 1 11 ? -6.253  -4.884  -9.887  1.00 0.00 ? 11 LEU A CG   8  
ATOM 5718  C CD1  . LEU A 1 11 ? -4.814  -5.102  -9.446  1.00 0.00 ? 11 LEU A CD1  8  
ATOM 5719  C CD2  . LEU A 1 11 ? -6.764  -6.089  -10.660 1.00 0.00 ? 11 LEU A CD2  8  
ATOM 5720  H H    . LEU A 1 11 ? -8.406  -6.805  -8.936  1.00 0.00 ? 11 LEU A H    8  
ATOM 5721  H HA   . LEU A 1 11 ? -6.158  -6.038  -7.439  1.00 0.00 ? 11 LEU A HA   8  
ATOM 5722  H HB2  . LEU A 1 11 ? -8.159  -4.459  -9.032  1.00 0.00 ? 11 LEU A HB2  8  
ATOM 5723  H HB3  . LEU A 1 11 ? -6.812  -3.688  -8.216  1.00 0.00 ? 11 LEU A HB3  8  
ATOM 5724  H HG   . LEU A 1 11 ? -6.272  -4.029  -10.547 1.00 0.00 ? 11 LEU A HG   8  
ATOM 5725  H HD11 . LEU A 1 11 ? -4.654  -4.625  -8.490  1.00 0.00 ? 11 LEU A HD11 8  
ATOM 5726  H HD12 . LEU A 1 11 ? -4.144  -4.676  -10.178 1.00 0.00 ? 11 LEU A HD12 8  
ATOM 5727  H HD13 . LEU A 1 11 ? -4.621  -6.161  -9.356  1.00 0.00 ? 11 LEU A HD13 8  
ATOM 5728  H HD21 . LEU A 1 11 ? -7.843  -6.059  -10.702 1.00 0.00 ? 11 LEU A HD21 8  
ATOM 5729  H HD22 . LEU A 1 11 ? -6.448  -6.996  -10.165 1.00 0.00 ? 11 LEU A HD22 8  
ATOM 5730  H HD23 . LEU A 1 11 ? -6.365  -6.070  -11.664 1.00 0.00 ? 11 LEU A HD23 8  
ATOM 5731  N N    . CYS A 1 12 ? -6.934  -4.259  -5.681  1.00 0.00 ? 12 CYS A N    8  
ATOM 5732  C CA   . CYS A 1 12 ? -7.278  -3.640  -4.396  1.00 0.00 ? 12 CYS A CA   8  
ATOM 5733  C C    . CYS A 1 12 ? -8.761  -3.726  -4.058  1.00 0.00 ? 12 CYS A C    8  
ATOM 5734  O O    . CYS A 1 12 ? -9.436  -2.715  -3.858  1.00 0.00 ? 12 CYS A O    8  
ATOM 5735  C CB   . CYS A 1 12 ? -6.819  -2.189  -4.383  1.00 0.00 ? 12 CYS A CB   8  
ATOM 5736  S SG   . CYS A 1 12 ? -7.813  -1.069  -5.434  1.00 0.00 ? 12 CYS A SG   8  
ATOM 5737  H H    . CYS A 1 12 ? -6.082  -4.006  -6.095  1.00 0.00 ? 12 CYS A H    8  
ATOM 5738  H HA   . CYS A 1 12 ? -6.731  -4.172  -3.633  1.00 0.00 ? 12 CYS A HA   8  
ATOM 5739  H HB2  . CYS A 1 12 ? -6.861  -1.822  -3.371  1.00 0.00 ? 12 CYS A HB2  8  
ATOM 5740  H HB3  . CYS A 1 12 ? -5.798  -2.149  -4.729  1.00 0.00 ? 12 CYS A HB3  8  
ATOM 5741  N N    . ARG A 1 13 ? -9.250  -4.945  -3.976  1.00 0.00 ? 13 ARG A N    8  
ATOM 5742  C CA   . ARG A 1 13 ? -10.652 -5.188  -3.642  1.00 0.00 ? 13 ARG A CA   8  
ATOM 5743  C C    . ARG A 1 13 ? -10.871 -5.111  -2.132  1.00 0.00 ? 13 ARG A C    8  
ATOM 5744  O O    . ARG A 1 13 ? -11.723 -5.810  -1.582  1.00 0.00 ? 13 ARG A O    8  
ATOM 5745  C CB   . ARG A 1 13 ? -11.118 -6.551  -4.168  1.00 0.00 ? 13 ARG A CB   8  
ATOM 5746  C CG   . ARG A 1 13 ? -10.173 -7.702  -3.854  1.00 0.00 ? 13 ARG A CG   8  
ATOM 5747  C CD   . ARG A 1 13 ? -10.407 -8.266  -2.462  1.00 0.00 ? 13 ARG A CD   8  
ATOM 5748  N NE   . ARG A 1 13 ? -11.722 -8.886  -2.335  1.00 0.00 ? 13 ARG A NE   8  
ATOM 5749  C CZ   . ARG A 1 13 ? -12.098 -9.619  -1.288  1.00 0.00 ? 13 ARG A CZ   8  
ATOM 5750  N NH1  . ARG A 1 13 ? -11.265 -9.813  -0.273  1.00 0.00 ? 13 ARG A NH1  8  
ATOM 5751  N NH2  . ARG A 1 13 ? -13.309 -10.158 -1.256  1.00 0.00 ? 13 ARG A NH2  8  
ATOM 5752  H H    . ARG A 1 13 ? -8.646  -5.701  -4.145  1.00 0.00 ? 13 ARG A H    8  
ATOM 5753  H HA   . ARG A 1 13 ? -11.240 -4.413  -4.113  1.00 0.00 ? 13 ARG A HA   8  
ATOM 5754  H HB2  . ARG A 1 13 ? -12.079 -6.779  -3.734  1.00 0.00 ? 13 ARG A HB2  8  
ATOM 5755  H HB3  . ARG A 1 13 ? -11.226 -6.488  -5.242  1.00 0.00 ? 13 ARG A HB3  8  
ATOM 5756  H HG2  . ARG A 1 13 ? -10.335 -8.487  -4.574  1.00 0.00 ? 13 ARG A HG2  8  
ATOM 5757  H HG3  . ARG A 1 13 ? -9.155  -7.353  -3.925  1.00 0.00 ? 13 ARG A HG3  8  
ATOM 5758  H HD2  . ARG A 1 13 ? -9.650  -9.009  -2.259  1.00 0.00 ? 13 ARG A HD2  8  
ATOM 5759  H HD3  . ARG A 1 13 ? -10.322 -7.467  -1.742  1.00 0.00 ? 13 ARG A HD3  8  
ATOM 5760  H HE   . ARG A 1 13 ? -12.358 -8.755  -3.069  1.00 0.00 ? 13 ARG A HE   8  
ATOM 5761  H HH11 . ARG A 1 13 ? -10.350 -9.409  -0.290  1.00 0.00 ? 13 ARG A HH11 8  
ATOM 5762  H HH12 . ARG A 1 13 ? -11.553 -10.363 0.511   1.00 0.00 ? 13 ARG A HH12 8  
ATOM 5763  H HH21 . ARG A 1 13 ? -13.940 -10.016 -2.019  1.00 0.00 ? 13 ARG A HH21 8  
ATOM 5764  H HH22 . ARG A 1 13 ? -13.590 -10.708 -0.469  1.00 0.00 ? 13 ARG A HH22 8  
ATOM 5765  N N    . CYS A 1 14 ? -10.097 -4.255  -1.467  1.00 0.00 ? 14 CYS A N    8  
ATOM 5766  C CA   . CYS A 1 14 ? -10.205 -4.086  -0.028  1.00 0.00 ? 14 CYS A CA   8  
ATOM 5767  C C    . CYS A 1 14 ? -10.425 -2.619  0.335   1.00 0.00 ? 14 CYS A C    8  
ATOM 5768  O O    . CYS A 1 14 ? -9.551  -1.772  0.149   1.00 0.00 ? 14 CYS A O    8  
ATOM 5769  C CB   . CYS A 1 14 ? -8.959  -4.664  0.673   1.00 0.00 ? 14 CYS A CB   8  
ATOM 5770  S SG   . CYS A 1 14 ? -7.627  -3.471  1.066   1.00 0.00 ? 14 CYS A SG   8  
ATOM 5771  H H    . CYS A 1 14 ? -9.445  -3.725  -1.954  1.00 0.00 ? 14 CYS A H    8  
ATOM 5772  H HA   . CYS A 1 14 ? -11.070 -4.646  0.296   1.00 0.00 ? 14 CYS A HA   8  
ATOM 5773  H HB2  . CYS A 1 14 ? -9.266  -5.113  1.604   1.00 0.00 ? 14 CYS A HB2  8  
ATOM 5774  H HB3  . CYS A 1 14 ? -8.534  -5.431  0.041   1.00 0.00 ? 14 CYS A HB3  8  
ATOM 5775  N N    . ASN A 1 15 ? -11.607 -2.334  0.850   1.00 0.00 ? 15 ASN A N    8  
ATOM 5776  C CA   . ASN A 1 15 ? -11.965 -0.976  1.250   1.00 0.00 ? 15 ASN A CA   8  
ATOM 5777  C C    . ASN A 1 15 ? -11.534 -0.728  2.681   1.00 0.00 ? 15 ASN A C    8  
ATOM 5778  O O    . ASN A 1 15 ? -10.896 0.279   2.967   1.00 0.00 ? 15 ASN A O    8  
ATOM 5779  C CB   . ASN A 1 15 ? -13.471 -0.752  1.126   1.00 0.00 ? 15 ASN A CB   8  
ATOM 5780  C CG   . ASN A 1 15 ? -13.813 0.360   0.151   1.00 0.00 ? 15 ASN A CG   8  
ATOM 5781  O OD1  . ASN A 1 15 ? -14.531 0.145   -0.825  1.00 0.00 ? 15 ASN A OD1  8  
ATOM 5782  N ND2  . ASN A 1 15 ? -13.298 1.556   0.413   1.00 0.00 ? 15 ASN A ND2  8  
ATOM 5783  H H    . ASN A 1 15 ? -12.256 -3.055  0.962   1.00 0.00 ? 15 ASN A H    8  
ATOM 5784  H HA   . ASN A 1 15 ? -11.446 -0.285  0.609   1.00 0.00 ? 15 ASN A HA   8  
ATOM 5785  H HB2  . ASN A 1 15 ? -13.934 -1.659  0.789   1.00 0.00 ? 15 ASN A HB2  8  
ATOM 5786  H HB3  . ASN A 1 15 ? -13.872 -0.489  2.094   1.00 0.00 ? 15 ASN A HB3  8  
ATOM 5787  H HD21 . ASN A 1 15 ? -12.734 1.653   1.208   1.00 0.00 ? 15 ASN A HD21 8  
ATOM 5788  H HD22 . ASN A 1 15 ? -13.504 2.292   -0.202  1.00 0.00 ? 15 ASN A HD22 8  
ATOM 5789  N N    . LYS A 1 16 ? -11.904 -1.664  3.561   1.00 0.00 ? 16 LYS A N    8  
ATOM 5790  C CA   . LYS A 1 16 ? -11.595 -1.609  4.994   1.00 0.00 ? 16 LYS A CA   8  
ATOM 5791  C C    . LYS A 1 16 ? -10.443 -0.664  5.299   1.00 0.00 ? 16 LYS A C    8  
ATOM 5792  O O    . LYS A 1 16 ? -9.404  -1.079  5.808   1.00 0.00 ? 16 LYS A O    8  
ATOM 5793  C CB   . LYS A 1 16 ? -11.266 -3.011  5.511   1.00 0.00 ? 16 LYS A CB   8  
ATOM 5794  C CG   . LYS A 1 16 ? -11.473 -3.174  7.008   1.00 0.00 ? 16 LYS A CG   8  
ATOM 5795  C CD   . LYS A 1 16 ? -12.710 -4.004  7.318   1.00 0.00 ? 16 LYS A CD   8  
ATOM 5796  C CE   . LYS A 1 16 ? -12.436 -5.031  8.405   1.00 0.00 ? 16 LYS A CE   8  
ATOM 5797  N NZ   . LYS A 1 16 ? -12.426 -4.416  9.762   1.00 0.00 ? 16 LYS A NZ   8  
ATOM 5798  H H    . LYS A 1 16 ? -12.416 -2.422  3.232   1.00 0.00 ? 16 LYS A H    8  
ATOM 5799  H HA   . LYS A 1 16 ? -12.476 -1.251  5.506   1.00 0.00 ? 16 LYS A HA   8  
ATOM 5800  H HB2  . LYS A 1 16 ? -11.894 -3.727  5.000   1.00 0.00 ? 16 LYS A HB2  8  
ATOM 5801  H HB3  . LYS A 1 16 ? -10.232 -3.230  5.287   1.00 0.00 ? 16 LYS A HB3  8  
ATOM 5802  H HG2  . LYS A 1 16 ? -10.607 -3.664  7.430   1.00 0.00 ? 16 LYS A HG2  8  
ATOM 5803  H HG3  . LYS A 1 16 ? -11.587 -2.197  7.453   1.00 0.00 ? 16 LYS A HG3  8  
ATOM 5804  H HD2  . LYS A 1 16 ? -13.499 -3.347  7.649   1.00 0.00 ? 16 LYS A HD2  8  
ATOM 5805  H HD3  . LYS A 1 16 ? -13.021 -4.519  6.420   1.00 0.00 ? 16 LYS A HD3  8  
ATOM 5806  H HE2  . LYS A 1 16 ? -13.207 -5.788  8.370   1.00 0.00 ? 16 LYS A HE2  8  
ATOM 5807  H HE3  . LYS A 1 16 ? -11.476 -5.488  8.218   1.00 0.00 ? 16 LYS A HE3  8  
ATOM 5808  H HZ1  . LYS A 1 16 ? -13.393 -4.375  10.143  1.00 0.00 ? 16 LYS A HZ1  8  
ATOM 5809  H HZ2  . LYS A 1 16 ? -12.043 -3.450  9.714   1.00 0.00 ? 16 LYS A HZ2  8  
ATOM 5810  H HZ3  . LYS A 1 16 ? -11.834 -4.980  10.405  1.00 0.00 ? 16 LYS A HZ3  8  
ATOM 5811  N N    . MET A 1 17 ? -10.645 0.600   4.953   1.00 0.00 ? 17 MET A N    8  
ATOM 5812  C CA   . MET A 1 17 ? -9.639  1.649   5.153   1.00 0.00 ? 17 MET A CA   8  
ATOM 5813  C C    . MET A 1 17 ? -9.066  1.645   6.567   1.00 0.00 ? 17 MET A C    8  
ATOM 5814  O O    . MET A 1 17 ? -9.260  2.582   7.342   1.00 0.00 ? 17 MET A O    8  
ATOM 5815  C CB   . MET A 1 17 ? -10.234 3.014   4.866   1.00 0.00 ? 17 MET A CB   8  
ATOM 5816  C CG   . MET A 1 17 ? -10.701 3.194   3.430   1.00 0.00 ? 17 MET A CG   8  
ATOM 5817  S SD   . MET A 1 17 ? -10.250 4.803   2.751   1.00 0.00 ? 17 MET A SD   8  
ATOM 5818  C CE   . MET A 1 17 ? -8.547  4.507   2.283   1.00 0.00 ? 17 MET A CE   8  
ATOM 5819  H H    . MET A 1 17 ? -11.502 0.831   4.519   1.00 0.00 ? 17 MET A H    8  
ATOM 5820  H HA   . MET A 1 17 ? -8.836  1.469   4.456   1.00 0.00 ? 17 MET A HA   8  
ATOM 5821  H HB2  . MET A 1 17 ? -11.075 3.159   5.522   1.00 0.00 ? 17 MET A HB2  8  
ATOM 5822  H HB3  . MET A 1 17 ? -9.484  3.758   5.079   1.00 0.00 ? 17 MET A HB3  8  
ATOM 5823  H HG2  . MET A 1 17 ? -10.252 2.423   2.821   1.00 0.00 ? 17 MET A HG2  8  
ATOM 5824  H HG3  . MET A 1 17 ? -11.776 3.093   3.400   1.00 0.00 ? 17 MET A HG3  8  
ATOM 5825  H HE1  . MET A 1 17 ? -7.930  4.479   3.169   1.00 0.00 ? 17 MET A HE1  8  
ATOM 5826  H HE2  . MET A 1 17 ? -8.209  5.301   1.634   1.00 0.00 ? 17 MET A HE2  8  
ATOM 5827  H HE3  . MET A 1 17 ? -8.475  3.563   1.765   1.00 0.00 ? 17 MET A HE3  8  
ATOM 5828  N N    . LEU A 1 18 ? -8.349  0.588   6.876   1.00 0.00 ? 18 LEU A N    8  
ATOM 5829  C CA   . LEU A 1 18 ? -7.710  0.418   8.170   1.00 0.00 ? 18 LEU A CA   8  
ATOM 5830  C C    . LEU A 1 18 ? -6.786  -0.790  8.137   1.00 0.00 ? 18 LEU A C    8  
ATOM 5831  O O    . LEU A 1 18 ? -6.873  -1.687  8.976   1.00 0.00 ? 18 LEU A O    8  
ATOM 5832  C CB   . LEU A 1 18 ? -8.755  0.269   9.273   1.00 0.00 ? 18 LEU A CB   8  
ATOM 5833  C CG   . LEU A 1 18 ? -9.634  -0.983  9.178   1.00 0.00 ? 18 LEU A CG   8  
ATOM 5834  C CD1  . LEU A 1 18 ? -9.260  -1.988  10.257  1.00 0.00 ? 18 LEU A CD1  8  
ATOM 5835  C CD2  . LEU A 1 18 ? -11.105 -0.610  9.283   1.00 0.00 ? 18 LEU A CD2  8  
ATOM 5836  H H    . LEU A 1 18 ? -8.236  -0.096  6.202   1.00 0.00 ? 18 LEU A H    8  
ATOM 5837  H HA   . LEU A 1 18 ? -7.114  1.296   8.357   1.00 0.00 ? 18 LEU A HA   8  
ATOM 5838  H HB2  . LEU A 1 18 ? -8.243  0.255   10.222  1.00 0.00 ? 18 LEU A HB2  8  
ATOM 5839  H HB3  . LEU A 1 18 ? -9.398  1.135   9.243   1.00 0.00 ? 18 LEU A HB3  8  
ATOM 5840  H HG   . LEU A 1 18 ? -9.476  -1.452  8.217   1.00 0.00 ? 18 LEU A HG   8  
ATOM 5841  H HD11 . LEU A 1 18 ? -8.641  -2.763  9.830   1.00 0.00 ? 18 LEU A HD11 8  
ATOM 5842  H HD12 . LEU A 1 18 ? -10.158 -2.429  10.665  1.00 0.00 ? 18 LEU A HD12 8  
ATOM 5843  H HD13 . LEU A 1 18 ? -8.716  -1.487  11.044  1.00 0.00 ? 18 LEU A HD13 8  
ATOM 5844  H HD21 . LEU A 1 18 ? -11.408 -0.083  8.391   1.00 0.00 ? 18 LEU A HD21 8  
ATOM 5845  H HD22 . LEU A 1 18 ? -11.255 0.025   10.144  1.00 0.00 ? 18 LEU A HD22 8  
ATOM 5846  H HD23 . LEU A 1 18 ? -11.697 -1.507  9.390   1.00 0.00 ? 18 LEU A HD23 8  
ATOM 5847  N N    . GLY A 1 19 ? -5.910  -0.803  7.146   1.00 0.00 ? 19 GLY A N    8  
ATOM 5848  C CA   . GLY A 1 19 ? -4.979  -1.903  6.986   1.00 0.00 ? 19 GLY A CA   8  
ATOM 5849  C C    . GLY A 1 19 ? -3.775  -1.796  7.896   1.00 0.00 ? 19 GLY A C    8  
ATOM 5850  O O    . GLY A 1 19 ? -3.813  -1.111  8.918   1.00 0.00 ? 19 GLY A O    8  
ATOM 5851  H H    . GLY A 1 19 ? -5.903  -0.057  6.510   1.00 0.00 ? 19 GLY A H    8  
ATOM 5852  H HA2  . GLY A 1 19 ? -5.493  -2.827  7.201   1.00 0.00 ? 19 GLY A HA2  8  
ATOM 5853  H HA3  . GLY A 1 19 ? -4.639  -1.925  5.961   1.00 0.00 ? 19 GLY A HA3  8  
ATOM 5854  N N    . ASP A 1 20 ? -2.702  -2.486  7.523   1.00 0.00 ? 20 ASP A N    8  
ATOM 5855  C CA   . ASP A 1 20 ? -1.478  -2.484  8.306   1.00 0.00 ? 20 ASP A CA   8  
ATOM 5856  C C    . ASP A 1 20 ? -0.798  -1.122  8.270   1.00 0.00 ? 20 ASP A C    8  
ATOM 5857  O O    . ASP A 1 20 ? -1.257  -0.196  7.600   1.00 0.00 ? 20 ASP A O    8  
ATOM 5858  C CB   . ASP A 1 20 ? -0.519  -3.555  7.785   1.00 0.00 ? 20 ASP A CB   8  
ATOM 5859  C CG   . ASP A 1 20 ? -1.226  -4.847  7.420   1.00 0.00 ? 20 ASP A CG   8  
ATOM 5860  O OD1  . ASP A 1 20 ? -2.056  -4.826  6.486   1.00 0.00 ? 20 ASP A OD1  8  
ATOM 5861  O OD2  . ASP A 1 20 ? -0.952  -5.878  8.068   1.00 0.00 ? 20 ASP A OD2  8  
ATOM 5862  H H    . ASP A 1 20 ? -2.737  -3.017  6.703   1.00 0.00 ? 20 ASP A H    8  
ATOM 5863  H HA   . ASP A 1 20 ? -1.736  -2.715  9.328   1.00 0.00 ? 20 ASP A HA   8  
ATOM 5864  H HB2  . ASP A 1 20 ? -0.015  -3.182  6.906   1.00 0.00 ? 20 ASP A HB2  8  
ATOM 5865  H HB3  . ASP A 1 20 ? 0.211   -3.771  8.546   1.00 0.00 ? 20 ASP A HB3  8  
ATOM 5866  N N    . LEU A 1 21 ? 0.302   -1.017  9.002   1.00 0.00 ? 21 LEU A N    8  
ATOM 5867  C CA   . LEU A 1 21 ? 1.076   0.214   9.080   1.00 0.00 ? 21 LEU A CA   8  
ATOM 5868  C C    . LEU A 1 21 ? 2.197   0.212   8.050   1.00 0.00 ? 21 LEU A C    8  
ATOM 5869  O O    . LEU A 1 21 ? 3.349   -0.082  8.369   1.00 0.00 ? 21 LEU A O    8  
ATOM 5870  C CB   . LEU A 1 21 ? 1.665   0.357   10.478  1.00 0.00 ? 21 LEU A CB   8  
ATOM 5871  C CG   . LEU A 1 21 ? 2.508   -0.835  10.929  1.00 0.00 ? 21 LEU A CG   8  
ATOM 5872  C CD1  . LEU A 1 21 ? 3.700   -0.369  11.745  1.00 0.00 ? 21 LEU A CD1  8  
ATOM 5873  C CD2  . LEU A 1 21 ? 1.660   -1.821  11.717  1.00 0.00 ? 21 LEU A CD2  8  
ATOM 5874  H H    . LEU A 1 21 ? 0.605   -1.798  9.508   1.00 0.00 ? 21 LEU A H    8  
ATOM 5875  H HA   . LEU A 1 21 ? 0.414   1.047   8.882   1.00 0.00 ? 21 LEU A HA   8  
ATOM 5876  H HB2  . LEU A 1 21 ? 2.281   1.243   10.499  1.00 0.00 ? 21 LEU A HB2  8  
ATOM 5877  H HB3  . LEU A 1 21 ? 0.853   0.481   11.178  1.00 0.00 ? 21 LEU A HB3  8  
ATOM 5878  H HG   . LEU A 1 21 ? 2.887   -1.349  10.056  1.00 0.00 ? 21 LEU A HG   8  
ATOM 5879  H HD11 . LEU A 1 21 ? 4.049   0.577   11.358  1.00 0.00 ? 21 LEU A HD11 8  
ATOM 5880  H HD12 . LEU A 1 21 ? 4.491   -1.101  11.676  1.00 0.00 ? 21 LEU A HD12 8  
ATOM 5881  H HD13 . LEU A 1 21 ? 3.406   -0.250  12.775  1.00 0.00 ? 21 LEU A HD13 8  
ATOM 5882  H HD21 . LEU A 1 21 ? 0.731   -1.351  12.002  1.00 0.00 ? 21 LEU A HD21 8  
ATOM 5883  H HD22 . LEU A 1 21 ? 2.194   -2.130  12.601  1.00 0.00 ? 21 LEU A HD22 8  
ATOM 5884  H HD23 . LEU A 1 21 ? 1.451   -2.685  11.102  1.00 0.00 ? 21 LEU A HD23 8  
ATOM 5885  N N    . ILE A 1 22 ? 1.854   0.534   6.816   1.00 0.00 ? 22 ILE A N    8  
ATOM 5886  C CA   . ILE A 1 22 ? 2.832   0.561   5.738   1.00 0.00 ? 22 ILE A CA   8  
ATOM 5887  C C    . ILE A 1 22 ? 3.454   1.942   5.592   1.00 0.00 ? 22 ILE A C    8  
ATOM 5888  O O    . ILE A 1 22 ? 2.831   2.952   5.914   1.00 0.00 ? 22 ILE A O    8  
ATOM 5889  C CB   . ILE A 1 22 ? 2.194   0.123   4.401   1.00 0.00 ? 22 ILE A CB   8  
ATOM 5890  C CG1  . ILE A 1 22 ? 3.083   0.470   3.216   1.00 0.00 ? 22 ILE A CG1  8  
ATOM 5891  C CG2  . ILE A 1 22 ? 0.826   0.757   4.218   1.00 0.00 ? 22 ILE A CG2  8  
ATOM 5892  C CD1  . ILE A 1 22 ? 2.806   1.836   2.619   1.00 0.00 ? 22 ILE A CD1  8  
ATOM 5893  H H    . ILE A 1 22 ? 0.920   0.755   6.622   1.00 0.00 ? 22 ILE A H    8  
ATOM 5894  H HA   . ILE A 1 22 ? 3.610   -0.145  5.984   1.00 0.00 ? 22 ILE A HA   8  
ATOM 5895  H HB   . ILE A 1 22 ? 2.070   -0.943  4.438   1.00 0.00 ? 22 ILE A HB   8  
ATOM 5896  H HG12 . ILE A 1 22 ? 4.113   0.444   3.528   1.00 0.00 ? 22 ILE A HG12 8  
ATOM 5897  H HG13 . ILE A 1 22 ? 2.930   -0.266  2.440   1.00 0.00 ? 22 ILE A HG13 8  
ATOM 5898  H HG21 . ILE A 1 22 ? 0.887   1.810   4.452   1.00 0.00 ? 22 ILE A HG21 8  
ATOM 5899  H HG22 . ILE A 1 22 ? 0.117   0.279   4.872   1.00 0.00 ? 22 ILE A HG22 8  
ATOM 5900  H HG23 . ILE A 1 22 ? 0.513   0.636   3.191   1.00 0.00 ? 22 ILE A HG23 8  
ATOM 5901  H HD11 . ILE A 1 22 ? 2.484   2.511   3.398   1.00 0.00 ? 22 ILE A HD11 8  
ATOM 5902  H HD12 . ILE A 1 22 ? 2.029   1.751   1.874   1.00 0.00 ? 22 ILE A HD12 8  
ATOM 5903  H HD13 . ILE A 1 22 ? 3.703   2.217   2.159   1.00 0.00 ? 22 ILE A HD13 8  
ATOM 5904  N N    . CYS A 1 23 ? 4.687   1.976   5.093   1.00 0.00 ? 23 CYS A N    8  
ATOM 5905  C CA   . CYS A 1 23 ? 5.395   3.232   4.889   1.00 0.00 ? 23 CYS A CA   8  
ATOM 5906  C C    . CYS A 1 23 ? 5.625   3.453   3.403   1.00 0.00 ? 23 CYS A C    8  
ATOM 5907  O O    . CYS A 1 23 ? 6.634   3.014   2.851   1.00 0.00 ? 23 CYS A O    8  
ATOM 5908  C CB   . CYS A 1 23 ? 6.732   3.221   5.636   1.00 0.00 ? 23 CYS A CB   8  
ATOM 5909  S SG   . CYS A 1 23 ? 7.287   4.865   6.191   1.00 0.00 ? 23 CYS A SG   8  
ATOM 5910  H H    . CYS A 1 23 ? 5.129   1.130   4.844   1.00 0.00 ? 23 CYS A H    8  
ATOM 5911  H HA   . CYS A 1 23 ? 4.779   4.032   5.272   1.00 0.00 ? 23 CYS A HA   8  
ATOM 5912  H HB2  . CYS A 1 23 ? 6.642   2.594   6.511   1.00 0.00 ? 23 CYS A HB2  8  
ATOM 5913  H HB3  . CYS A 1 23 ? 7.495   2.818   4.988   1.00 0.00 ? 23 CYS A HB3  8  
ATOM 5914  N N    . ALA A 1 24 ? 4.672   4.111   2.752   1.00 0.00 ? 24 ALA A N    8  
ATOM 5915  C CA   . ALA A 1 24 ? 4.763   4.355   1.323   1.00 0.00 ? 24 ALA A CA   8  
ATOM 5916  C C    . ALA A 1 24 ? 5.679   5.525   1.006   1.00 0.00 ? 24 ALA A C    8  
ATOM 5917  O O    . ALA A 1 24 ? 5.823   6.458   1.795   1.00 0.00 ? 24 ALA A O    8  
ATOM 5918  C CB   . ALA A 1 24 ? 3.384   4.596   0.732   1.00 0.00 ? 24 ALA A CB   8  
ATOM 5919  H H    . ALA A 1 24 ? 3.881   4.419   3.239   1.00 0.00 ? 24 ALA A H    8  
ATOM 5920  H HA   . ALA A 1 24 ? 5.168   3.464   0.868   1.00 0.00 ? 24 ALA A HA   8  
ATOM 5921  H HB1  . ALA A 1 24 ? 2.895   3.647   0.562   1.00 0.00 ? 24 ALA A HB1  8  
ATOM 5922  H HB2  . ALA A 1 24 ? 3.483   5.123   -0.207  1.00 0.00 ? 24 ALA A HB2  8  
ATOM 5923  H HB3  . ALA A 1 24 ? 2.796   5.187   1.416   1.00 0.00 ? 24 ALA A HB3  8  
ATOM 5924  N N    . VAL A 1 25 ? 6.292   5.452   -0.165  1.00 0.00 ? 25 VAL A N    8  
ATOM 5925  C CA   . VAL A 1 25 ? 7.208   6.482   -0.632  1.00 0.00 ? 25 VAL A CA   8  
ATOM 5926  C C    . VAL A 1 25 ? 7.215   6.545   -2.152  1.00 0.00 ? 25 VAL A C    8  
ATOM 5927  O O    . VAL A 1 25 ? 7.104   5.516   -2.834  1.00 0.00 ? 25 VAL A O    8  
ATOM 5928  C CB   . VAL A 1 25 ? 8.645   6.222   -0.141  1.00 0.00 ? 25 VAL A CB   8  
ATOM 5929  C CG1  . VAL A 1 25 ? 9.530   7.430   -0.406  1.00 0.00 ? 25 VAL A CG1  8  
ATOM 5930  C CG2  . VAL A 1 25 ? 8.651   5.860   1.338   1.00 0.00 ? 25 VAL A CG2  8  
ATOM 5931  H H    . VAL A 1 25 ? 6.122   4.676   -0.734  1.00 0.00 ? 25 VAL A H    8  
ATOM 5932  H HA   . VAL A 1 25 ? 6.882   7.435   -0.244  1.00 0.00 ? 25 VAL A HA   8  
ATOM 5933  H HB   . VAL A 1 25 ? 9.045   5.384   -0.694  1.00 0.00 ? 25 VAL A HB   8  
ATOM 5934  H HG11 . VAL A 1 25 ? 10.048  7.297   -1.343  1.00 0.00 ? 25 VAL A HG11 8  
ATOM 5935  H HG12 . VAL A 1 25 ? 10.249  7.531   0.393   1.00 0.00 ? 25 VAL A HG12 8  
ATOM 5936  H HG13 . VAL A 1 25 ? 8.919   8.320   -0.456  1.00 0.00 ? 25 VAL A HG13 8  
ATOM 5937  H HG21 . VAL A 1 25 ? 9.658   5.932   1.723   1.00 0.00 ? 25 VAL A HG21 8  
ATOM 5938  H HG22 . VAL A 1 25 ? 8.290   4.850   1.463   1.00 0.00 ? 25 VAL A HG22 8  
ATOM 5939  H HG23 . VAL A 1 25 ? 8.010   6.540   1.877   1.00 0.00 ? 25 VAL A HG23 8  
ATOM 5940  N N    . ILE A 1 26 ? 7.340   7.760   -2.678  1.00 0.00 ? 26 ILE A N    8  
ATOM 5941  C CA   . ILE A 1 26 ? 7.366   7.955   -4.125  1.00 0.00 ? 26 ILE A CA   8  
ATOM 5942  C C    . ILE A 1 26 ? 7.989   9.292   -4.526  1.00 0.00 ? 26 ILE A C    8  
ATOM 5943  O O    . ILE A 1 26 ? 7.290   10.292  -4.690  1.00 0.00 ? 26 ILE A O    8  
ATOM 5944  C CB   . ILE A 1 26 ? 5.965   7.852   -4.758  1.00 0.00 ? 26 ILE A CB   8  
ATOM 5945  C CG1  . ILE A 1 26 ? 4.884   8.358   -3.790  1.00 0.00 ? 26 ILE A CG1  8  
ATOM 5946  C CG2  . ILE A 1 26 ? 5.698   6.424   -5.208  1.00 0.00 ? 26 ILE A CG2  8  
ATOM 5947  C CD1  . ILE A 1 26 ? 4.457   7.358   -2.732  1.00 0.00 ? 26 ILE A CD1  8  
ATOM 5948  H H    . ILE A 1 26 ? 7.414   8.537   -2.077  1.00 0.00 ? 26 ILE A H    8  
ATOM 5949  H HA   . ILE A 1 26 ? 7.973   7.165   -4.542  1.00 0.00 ? 26 ILE A HA   8  
ATOM 5950  H HB   . ILE A 1 26 ? 5.957   8.474   -5.641  1.00 0.00 ? 26 ILE A HB   8  
ATOM 5951  H HG12 . ILE A 1 26 ? 5.258   9.229   -3.280  1.00 0.00 ? 26 ILE A HG12 8  
ATOM 5952  H HG13 . ILE A 1 26 ? 4.007   8.633   -4.358  1.00 0.00 ? 26 ILE A HG13 8  
ATOM 5953  H HG21 . ILE A 1 26 ? 5.235   5.870   -4.408  1.00 0.00 ? 26 ILE A HG21 8  
ATOM 5954  H HG22 . ILE A 1 26 ? 6.631   5.953   -5.477  1.00 0.00 ? 26 ILE A HG22 8  
ATOM 5955  H HG23 . ILE A 1 26 ? 5.044   6.436   -6.064  1.00 0.00 ? 26 ILE A HG23 8  
ATOM 5956  H HD11 . ILE A 1 26 ? 4.971   7.568   -1.809  1.00 0.00 ? 26 ILE A HD11 8  
ATOM 5957  H HD12 . ILE A 1 26 ? 4.700   6.357   -3.057  1.00 0.00 ? 26 ILE A HD12 8  
ATOM 5958  H HD13 . ILE A 1 26 ? 3.392   7.434   -2.575  1.00 0.00 ? 26 ILE A HD13 8  
ATOM 5959  N N    . GLY A 1 27 ? 9.306   9.283   -4.700  1.00 0.00 ? 27 GLY A N    8  
ATOM 5960  C CA   . GLY A 1 27 ? 10.036  10.470  -5.112  1.00 0.00 ? 27 GLY A CA   8  
ATOM 5961  C C    . GLY A 1 27 ? 10.053  11.554  -4.063  1.00 0.00 ? 27 GLY A C    8  
ATOM 5962  O O    . GLY A 1 27 ? 11.116  11.983  -3.614  1.00 0.00 ? 27 GLY A O    8  
ATOM 5963  H H    . GLY A 1 27 ? 9.786   8.455   -4.560  1.00 0.00 ? 27 GLY A H    8  
ATOM 5964  H HA2  . GLY A 1 27 ? 11.053  10.190  -5.335  1.00 0.00 ? 27 GLY A HA2  8  
ATOM 5965  H HA3  . GLY A 1 27 ? 9.579   10.862  -6.009  1.00 0.00 ? 27 GLY A HA3  8  
ATOM 5966  N N    . ASP A 1 28 ? 8.873   12.000  -3.678  1.00 0.00 ? 28 ASP A N    8  
ATOM 5967  C CA   . ASP A 1 28 ? 8.742   13.048  -2.680  1.00 0.00 ? 28 ASP A CA   8  
ATOM 5968  C C    . ASP A 1 28 ? 7.489   12.851  -1.841  1.00 0.00 ? 28 ASP A C    8  
ATOM 5969  O O    . ASP A 1 28 ? 6.998   13.790  -1.214  1.00 0.00 ? 28 ASP A O    8  
ATOM 5970  C CB   . ASP A 1 28 ? 8.710   14.421  -3.354  1.00 0.00 ? 28 ASP A CB   8  
ATOM 5971  C CG   . ASP A 1 28 ? 7.625   14.523  -4.408  1.00 0.00 ? 28 ASP A CG   8  
ATOM 5972  O OD1  . ASP A 1 28 ? 7.821   13.980  -5.516  1.00 0.00 ? 28 ASP A OD1  8  
ATOM 5973  O OD2  . ASP A 1 28 ? 6.579   15.145  -4.126  1.00 0.00 ? 28 ASP A OD2  8  
ATOM 5974  H H    . ASP A 1 28 ? 8.068   11.612  -4.079  1.00 0.00 ? 28 ASP A H    8  
ATOM 5975  H HA   . ASP A 1 28 ? 9.602   12.994  -2.033  1.00 0.00 ? 28 ASP A HA   8  
ATOM 5976  H HB2  . ASP A 1 28 ? 8.530   15.179  -2.606  1.00 0.00 ? 28 ASP A HB2  8  
ATOM 5977  H HB3  . ASP A 1 28 ? 9.664   14.606  -3.826  1.00 0.00 ? 28 ASP A HB3  8  
ATOM 5978  N N    . ALA A 1 29 ? 6.979   11.625  -1.818  1.00 0.00 ? 29 ALA A N    8  
ATOM 5979  C CA   . ALA A 1 29 ? 5.792   11.321  -1.035  1.00 0.00 ? 29 ALA A CA   8  
ATOM 5980  C C    . ALA A 1 29 ? 6.054   10.131  -0.131  1.00 0.00 ? 29 ALA A C    8  
ATOM 5981  O O    . ALA A 1 29 ? 5.645   9.011   -0.427  1.00 0.00 ? 29 ALA A O    8  
ATOM 5982  C CB   . ALA A 1 29 ? 4.598   11.064  -1.943  1.00 0.00 ? 29 ALA A CB   8  
ATOM 5983  H H    . ALA A 1 29 ? 7.419   10.903  -2.328  1.00 0.00 ? 29 ALA A H    8  
ATOM 5984  H HA   . ALA A 1 29 ? 5.569   12.182  -0.421  1.00 0.00 ? 29 ALA A HA   8  
ATOM 5985  H HB1  . ALA A 1 29 ? 4.228   10.062  -1.781  1.00 0.00 ? 29 ALA A HB1  8  
ATOM 5986  H HB2  . ALA A 1 29 ? 4.901   11.172  -2.974  1.00 0.00 ? 29 ALA A HB2  8  
ATOM 5987  H HB3  . ALA A 1 29 ? 3.817   11.776  -1.721  1.00 0.00 ? 29 ALA A HB3  8  
ATOM 5988  N N    . LYS A 1 30 ? 6.755   10.385  0.966   1.00 0.00 ? 30 LYS A N    8  
ATOM 5989  C CA   . LYS A 1 30 ? 7.094   9.340   1.920   1.00 0.00 ? 30 LYS A CA   8  
ATOM 5990  C C    . LYS A 1 30 ? 6.243   9.465   3.185   1.00 0.00 ? 30 LYS A C    8  
ATOM 5991  O O    . LYS A 1 30 ? 6.528   10.290  4.053   1.00 0.00 ? 30 LYS A O    8  
ATOM 5992  C CB   . LYS A 1 30 ? 8.584   9.422   2.272   1.00 0.00 ? 30 LYS A CB   8  
ATOM 5993  C CG   . LYS A 1 30 ? 8.985   8.593   3.483   1.00 0.00 ? 30 LYS A CG   8  
ATOM 5994  C CD   . LYS A 1 30 ? 10.497  8.477   3.600   1.00 0.00 ? 30 LYS A CD   8  
ATOM 5995  C CE   . LYS A 1 30 ? 10.912  7.131   4.170   1.00 0.00 ? 30 LYS A CE   8  
ATOM 5996  N NZ   . LYS A 1 30 ? 10.124  6.774   5.382   1.00 0.00 ? 30 LYS A NZ   8  
ATOM 5997  H H    . LYS A 1 30 ? 7.061   11.300  1.135   1.00 0.00 ? 30 LYS A H    8  
ATOM 5998  H HA   . LYS A 1 30 ? 6.895   8.387   1.450   1.00 0.00 ? 30 LYS A HA   8  
ATOM 5999  H HB2  . LYS A 1 30 ? 9.160   9.081   1.425   1.00 0.00 ? 30 LYS A HB2  8  
ATOM 6000  H HB3  . LYS A 1 30 ? 8.835   10.454  2.472   1.00 0.00 ? 30 LYS A HB3  8  
ATOM 6001  H HG2  . LYS A 1 30 ? 8.601   9.066   4.375   1.00 0.00 ? 30 LYS A HG2  8  
ATOM 6002  H HG3  . LYS A 1 30 ? 8.563   7.603   3.388   1.00 0.00 ? 30 LYS A HG3  8  
ATOM 6003  H HD2  . LYS A 1 30 ? 10.933  8.591   2.619   1.00 0.00 ? 30 LYS A HD2  8  
ATOM 6004  H HD3  . LYS A 1 30 ? 10.858  9.261   4.250   1.00 0.00 ? 30 LYS A HD3  8  
ATOM 6005  H HE2  . LYS A 1 30 ? 10.760  6.372   3.417   1.00 0.00 ? 30 LYS A HE2  8  
ATOM 6006  H HE3  . LYS A 1 30 ? 11.959  7.173   4.432   1.00 0.00 ? 30 LYS A HE3  8  
ATOM 6007  H HZ1  . LYS A 1 30 ? 10.665  6.118   5.981   1.00 0.00 ? 30 LYS A HZ1  8  
ATOM 6008  H HZ2  . LYS A 1 30 ? 9.232   6.318   5.106   1.00 0.00 ? 30 LYS A HZ2  8  
ATOM 6009  H HZ3  . LYS A 1 30 ? 9.907   7.630   5.933   1.00 0.00 ? 30 LYS A HZ3  8  
ATOM 6010  N N    . GLU A 1 31 ? 5.203   8.644   3.282   1.00 0.00 ? 31 GLU A N    8  
ATOM 6011  C CA   . GLU A 1 31 ? 4.316   8.666   4.441   1.00 0.00 ? 31 GLU A CA   8  
ATOM 6012  C C    . GLU A 1 31 ? 3.685   7.297   4.666   1.00 0.00 ? 31 GLU A C    8  
ATOM 6013  O O    . GLU A 1 31 ? 3.760   6.422   3.803   1.00 0.00 ? 31 GLU A O    8  
ATOM 6014  C CB   . GLU A 1 31 ? 3.220   9.720   4.254   1.00 0.00 ? 31 GLU A CB   8  
ATOM 6015  C CG   . GLU A 1 31 ? 2.708   10.306  5.561   1.00 0.00 ? 31 GLU A CG   8  
ATOM 6016  C CD   . GLU A 1 31 ? 2.905   11.807  5.646   1.00 0.00 ? 31 GLU A CD   8  
ATOM 6017  O OE1  . GLU A 1 31 ? 2.907   12.467  4.586   1.00 0.00 ? 31 GLU A OE1  8  
ATOM 6018  O OE2  . GLU A 1 31 ? 3.059   12.323  6.773   1.00 0.00 ? 31 GLU A OE2  8  
ATOM 6019  H H    . GLU A 1 31 ? 5.027   8.007   2.558   1.00 0.00 ? 31 GLU A H    8  
ATOM 6020  H HA   . GLU A 1 31 ? 4.907   8.925   5.307   1.00 0.00 ? 31 GLU A HA   8  
ATOM 6021  H HB2  . GLU A 1 31 ? 3.611   10.525  3.651   1.00 0.00 ? 31 GLU A HB2  8  
ATOM 6022  H HB3  . GLU A 1 31 ? 2.387   9.266   3.737   1.00 0.00 ? 31 GLU A HB3  8  
ATOM 6023  H HG2  . GLU A 1 31 ? 1.653   10.093  5.647   1.00 0.00 ? 31 GLU A HG2  8  
ATOM 6024  H HG3  . GLU A 1 31 ? 3.235   9.840   6.381   1.00 0.00 ? 31 GLU A HG3  8  
ATOM 6025  N N    . GLU A 1 32 ? 3.064   7.115   5.827   1.00 0.00 ? 32 GLU A N    8  
ATOM 6026  C CA   . GLU A 1 32 ? 2.423   5.847   6.153   1.00 0.00 ? 32 GLU A CA   8  
ATOM 6027  C C    . GLU A 1 32 ? 1.098   5.701   5.424   1.00 0.00 ? 32 GLU A C    8  
ATOM 6028  O O    . GLU A 1 32 ? 0.592   6.654   4.831   1.00 0.00 ? 32 GLU A O    8  
ATOM 6029  C CB   . GLU A 1 32 ? 2.179   5.726   7.657   1.00 0.00 ? 32 GLU A CB   8  
ATOM 6030  C CG   . GLU A 1 32 ? 3.385   5.223   8.433   1.00 0.00 ? 32 GLU A CG   8  
ATOM 6031  C CD   . GLU A 1 32 ? 3.062   4.923   9.884   1.00 0.00 ? 32 GLU A CD   8  
ATOM 6032  O OE1  . GLU A 1 32 ? 2.412   5.767   10.535  1.00 0.00 ? 32 GLU A OE1  8  
ATOM 6033  O OE2  . GLU A 1 32 ? 3.458   3.842   10.369  1.00 0.00 ? 32 GLU A OE2  8  
ATOM 6034  H H    . GLU A 1 32 ? 3.035   7.847   6.477   1.00 0.00 ? 32 GLU A H    8  
ATOM 6035  H HA   . GLU A 1 32 ? 3.084   5.055   5.839   1.00 0.00 ? 32 GLU A HA   8  
ATOM 6036  H HB2  . GLU A 1 32 ? 1.903   6.695   8.043   1.00 0.00 ? 32 GLU A HB2  8  
ATOM 6037  H HB3  . GLU A 1 32 ? 1.360   5.038   7.819   1.00 0.00 ? 32 GLU A HB3  8  
ATOM 6038  H HG2  . GLU A 1 32 ? 3.746   4.319   7.966   1.00 0.00 ? 32 GLU A HG2  8  
ATOM 6039  H HG3  . GLU A 1 32 ? 4.155   5.977   8.400   1.00 0.00 ? 32 GLU A HG3  8  
ATOM 6040  N N    . HIS A 1 33 ? 0.535   4.503   5.485   1.00 0.00 ? 33 HIS A N    8  
ATOM 6041  C CA   . HIS A 1 33 ? -0.742  4.232   4.844   1.00 0.00 ? 33 HIS A CA   8  
ATOM 6042  C C    . HIS A 1 33 ? -1.403  2.996   5.439   1.00 0.00 ? 33 HIS A C    8  
ATOM 6043  O O    . HIS A 1 33 ? -0.732  2.099   5.947   1.00 0.00 ? 33 HIS A O    8  
ATOM 6044  C CB   . HIS A 1 33 ? -0.567  4.053   3.336   1.00 0.00 ? 33 HIS A CB   8  
ATOM 6045  C CG   . HIS A 1 33 ? -1.867  3.957   2.600   1.00 0.00 ? 33 HIS A CG   8  
ATOM 6046  N ND1  . HIS A 1 33 ? -2.790  4.981   2.567   1.00 0.00 ? 33 HIS A ND1  8  
ATOM 6047  C CD2  . HIS A 1 33 ? -2.403  2.948   1.873   1.00 0.00 ? 33 HIS A CD2  8  
ATOM 6048  C CE1  . HIS A 1 33 ? -3.838  4.605   1.855   1.00 0.00 ? 33 HIS A CE1  8  
ATOM 6049  N NE2  . HIS A 1 33 ? -3.627  3.376   1.423   1.00 0.00 ? 33 HIS A NE2  8  
ATOM 6050  H H    . HIS A 1 33 ? 0.986   3.787   5.982   1.00 0.00 ? 33 HIS A H    8  
ATOM 6051  H HA   . HIS A 1 33 ? -1.384  5.084   5.020   1.00 0.00 ? 33 HIS A HA   8  
ATOM 6052  H HB2  . HIS A 1 33 ? -0.021  4.896   2.940   1.00 0.00 ? 33 HIS A HB2  8  
ATOM 6053  H HB3  . HIS A 1 33 ? -0.008  3.147   3.150   1.00 0.00 ? 33 HIS A HB3  8  
ATOM 6054  H HD1  . HIS A 1 33 ? -2.692  5.853   3.002   1.00 0.00 ? 33 HIS A HD1  8  
ATOM 6055  H HD2  . HIS A 1 33 ? -1.951  1.984   1.684   1.00 0.00 ? 33 HIS A HD2  8  
ATOM 6056  H HE1  . HIS A 1 33 ? -4.716  5.203   1.659   1.00 0.00 ? 33 HIS A HE1  8  
ATOM 6057  H HE2  . HIS A 1 33 ? -4.268  2.838   0.913   1.00 0.00 ? 33 HIS A HE2  8  
ATOM 6058  N N    . ARG A 1 34 ? -2.726  2.959   5.370   1.00 0.00 ? 34 ARG A N    8  
ATOM 6059  C CA   . ARG A 1 34 ? -3.490  1.835   5.899   1.00 0.00 ? 34 ARG A CA   8  
ATOM 6060  C C    . ARG A 1 34 ? -3.953  0.908   4.776   1.00 0.00 ? 34 ARG A C    8  
ATOM 6061  O O    . ARG A 1 34 ? -3.670  -0.290  4.794   1.00 0.00 ? 34 ARG A O    8  
ATOM 6062  C CB   . ARG A 1 34 ? -4.701  2.335   6.683   1.00 0.00 ? 34 ARG A CB   8  
ATOM 6063  C CG   . ARG A 1 34 ? -4.403  3.530   7.574   1.00 0.00 ? 34 ARG A CG   8  
ATOM 6064  C CD   . ARG A 1 34 ? -3.523  3.140   8.751   1.00 0.00 ? 34 ARG A CD   8  
ATOM 6065  N NE   . ARG A 1 34 ? -4.191  2.195   9.643   1.00 0.00 ? 34 ARG A NE   8  
ATOM 6066  C CZ   . ARG A 1 34 ? -5.209  2.518   10.436  1.00 0.00 ? 34 ARG A CZ   8  
ATOM 6067  N NH1  . ARG A 1 34 ? -5.677  3.759   10.455  1.00 0.00 ? 34 ARG A NH1  8  
ATOM 6068  N NH2  . ARG A 1 34 ? -5.761  1.596   11.213  1.00 0.00 ? 34 ARG A NH2  8  
ATOM 6069  H H    . ARG A 1 34 ? -3.200  3.709   4.958   1.00 0.00 ? 34 ARG A H    8  
ATOM 6070  H HA   . ARG A 1 34 ? -2.846  1.281   6.565   1.00 0.00 ? 34 ARG A HA   8  
ATOM 6071  H HB2  . ARG A 1 34 ? -5.473  2.618   5.983   1.00 0.00 ? 34 ARG A HB2  8  
ATOM 6072  H HB3  . ARG A 1 34 ? -5.067  1.531   7.304   1.00 0.00 ? 34 ARG A HB3  8  
ATOM 6073  H HG2  . ARG A 1 34 ? -3.895  4.284   6.993   1.00 0.00 ? 34 ARG A HG2  8  
ATOM 6074  H HG3  . ARG A 1 34 ? -5.335  3.927   7.949   1.00 0.00 ? 34 ARG A HG3  8  
ATOM 6075  H HD2  . ARG A 1 34 ? -2.618  2.687   8.375   1.00 0.00 ? 34 ARG A HD2  8  
ATOM 6076  H HD3  . ARG A 1 34 ? -3.274  4.032   9.308   1.00 0.00 ? 34 ARG A HD3  8  
ATOM 6077  H HE   . ARG A 1 34 ? -3.863  1.271   9.650   1.00 0.00 ? 34 ARG A HE   8  
ATOM 6078  H HH11 . ARG A 1 34 ? -5.267  4.459   9.872   1.00 0.00 ? 34 ARG A HH11 8  
ATOM 6079  H HH12 . ARG A 1 34 ? -6.443  3.996   11.055  1.00 0.00 ? 34 ARG A HH12 8  
ATOM 6080  H HH21 . ARG A 1 34 ? -5.413  0.659   11.203  1.00 0.00 ? 34 ARG A HH21 8  
ATOM 6081  H HH22 . ARG A 1 34 ? -6.526  1.838   11.810  1.00 0.00 ? 34 ARG A HH22 8  
ATOM 6082  N N    . ASN A 1 35 ? -4.666  1.467   3.801   1.00 0.00 ? 35 ASN A N    8  
ATOM 6083  C CA   . ASN A 1 35 ? -5.165  0.681   2.676   1.00 0.00 ? 35 ASN A CA   8  
ATOM 6084  C C    . ASN A 1 35 ? -4.063  0.447   1.650   1.00 0.00 ? 35 ASN A C    8  
ATOM 6085  O O    . ASN A 1 35 ? -4.108  0.965   0.534   1.00 0.00 ? 35 ASN A O    8  
ATOM 6086  C CB   . ASN A 1 35 ? -6.364  1.371   2.021   1.00 0.00 ? 35 ASN A CB   8  
ATOM 6087  C CG   . ASN A 1 35 ? -7.614  0.512   2.051   1.00 0.00 ? 35 ASN A CG   8  
ATOM 6088  O OD1  . ASN A 1 35 ? -8.358  0.444   1.071   1.00 0.00 ? 35 ASN A OD1  8  
ATOM 6089  N ND2  . ASN A 1 35 ? -7.854  -0.150  3.177   1.00 0.00 ? 35 ASN A ND2  8  
ATOM 6090  H H    . ASN A 1 35 ? -4.863  2.426   3.838   1.00 0.00 ? 35 ASN A H    8  
ATOM 6091  H HA   . ASN A 1 35 ? -5.481  -0.277  3.062   1.00 0.00 ? 35 ASN A HA   8  
ATOM 6092  H HB2  . ASN A 1 35 ? -6.571  2.290   2.545   1.00 0.00 ? 35 ASN A HB2  8  
ATOM 6093  H HB3  . ASN A 1 35 ? -6.130  1.596   0.990   1.00 0.00 ? 35 ASN A HB3  8  
ATOM 6094  H HD21 . ASN A 1 35 ? -7.221  -0.049  3.917   1.00 0.00 ? 35 ASN A HD21 8  
ATOM 6095  H HD22 . ASN A 1 35 ? -8.656  -0.714  3.221   1.00 0.00 ? 35 ASN A HD22 8  
ATOM 6096  N N    . MET A 1 36 ? -3.073  -0.341  2.045   1.00 0.00 ? 36 MET A N    8  
ATOM 6097  C CA   . MET A 1 36 ? -1.952  -0.658  1.176   1.00 0.00 ? 36 MET A CA   8  
ATOM 6098  C C    . MET A 1 36 ? -2.418  -1.363  -0.099  1.00 0.00 ? 36 MET A C    8  
ATOM 6099  O O    . MET A 1 36 ? -1.664  -1.462  -1.067  1.00 0.00 ? 36 MET A O    8  
ATOM 6100  C CB   . MET A 1 36 ? -0.934  -1.514  1.949   1.00 0.00 ? 36 MET A CB   8  
ATOM 6101  C CG   . MET A 1 36 ? -0.518  -2.802  1.248   1.00 0.00 ? 36 MET A CG   8  
ATOM 6102  S SD   . MET A 1 36 ? 0.487   -3.870  2.299   1.00 0.00 ? 36 MET A SD   8  
ATOM 6103  C CE   . MET A 1 36 ? 1.983   -3.994  1.324   1.00 0.00 ? 36 MET A CE   8  
ATOM 6104  H H    . MET A 1 36 ? -3.097  -0.720  2.947   1.00 0.00 ? 36 MET A H    8  
ATOM 6105  H HA   . MET A 1 36 ? -1.482  0.272   0.897   1.00 0.00 ? 36 MET A HA   8  
ATOM 6106  H HB2  . MET A 1 36 ? -0.047  -0.924  2.117   1.00 0.00 ? 36 MET A HB2  8  
ATOM 6107  H HB3  . MET A 1 36 ? -1.363  -1.775  2.906   1.00 0.00 ? 36 MET A HB3  8  
ATOM 6108  H HG2  . MET A 1 36 ? -1.406  -3.343  0.957   1.00 0.00 ? 36 MET A HG2  8  
ATOM 6109  H HG3  . MET A 1 36 ? 0.053   -2.549  0.366   1.00 0.00 ? 36 MET A HG3  8  
ATOM 6110  H HE1  . MET A 1 36 ? 1.734   -3.951  0.274   1.00 0.00 ? 36 MET A HE1  8  
ATOM 6111  H HE2  . MET A 1 36 ? 2.476   -4.931  1.540   1.00 0.00 ? 36 MET A HE2  8  
ATOM 6112  H HE3  . MET A 1 36 ? 2.642   -3.176  1.570   1.00 0.00 ? 36 MET A HE3  8  
ATOM 6113  N N    . CYS A 1 37 ? -3.658  -1.852  -0.105  1.00 0.00 ? 37 CYS A N    8  
ATOM 6114  C CA   . CYS A 1 37 ? -4.183  -2.534  -1.280  1.00 0.00 ? 37 CYS A CA   8  
ATOM 6115  C C    . CYS A 1 37 ? -4.660  -1.527  -2.322  1.00 0.00 ? 37 CYS A C    8  
ATOM 6116  O O    . CYS A 1 37 ? -4.295  -1.616  -3.493  1.00 0.00 ? 37 CYS A O    8  
ATOM 6117  C CB   . CYS A 1 37 ? -5.299  -3.525  -0.891  1.00 0.00 ? 37 CYS A CB   8  
ATOM 6118  S SG   . CYS A 1 37 ? -6.976  -2.815  -0.745  1.00 0.00 ? 37 CYS A SG   8  
ATOM 6119  H H    . CYS A 1 37 ? -4.226  -1.749  0.687   1.00 0.00 ? 37 CYS A H    8  
ATOM 6120  H HA   . CYS A 1 37 ? -3.368  -3.092  -1.710  1.00 0.00 ? 37 CYS A HA   8  
ATOM 6121  H HB2  . CYS A 1 37 ? -5.345  -4.303  -1.636  1.00 0.00 ? 37 CYS A HB2  8  
ATOM 6122  H HB3  . CYS A 1 37 ? -5.049  -3.969  0.062   1.00 0.00 ? 37 CYS A HB3  8  
ATOM 6123  N N    . ALA A 1 38 ? -5.457  -0.557  -1.888  1.00 0.00 ? 38 ALA A N    8  
ATOM 6124  C CA   . ALA A 1 38 ? -5.965  0.478   -2.786  1.00 0.00 ? 38 ALA A CA   8  
ATOM 6125  C C    . ALA A 1 38 ? -4.834  1.331   -3.336  1.00 0.00 ? 38 ALA A C    8  
ATOM 6126  O O    . ALA A 1 38 ? -4.978  1.990   -4.366  1.00 0.00 ? 38 ALA A O    8  
ATOM 6127  C CB   . ALA A 1 38 ? -6.986  1.347   -2.069  1.00 0.00 ? 38 ALA A CB   8  
ATOM 6128  H H    . ALA A 1 38 ? -5.696  -0.527  -0.940  1.00 0.00 ? 38 ALA A H    8  
ATOM 6129  H HA   . ALA A 1 38 ? -6.455  -0.008  -3.610  1.00 0.00 ? 38 ALA A HA   8  
ATOM 6130  H HB1  . ALA A 1 38 ? -7.808  0.733   -1.730  1.00 0.00 ? 38 ALA A HB1  8  
ATOM 6131  H HB2  . ALA A 1 38 ? -7.356  2.101   -2.747  1.00 0.00 ? 38 ALA A HB2  8  
ATOM 6132  H HB3  . ALA A 1 38 ? -6.519  1.824   -1.220  1.00 0.00 ? 38 ALA A HB3  8  
ATOM 6133  N N    . LEU A 1 39 ? -3.708  1.310   -2.643  1.00 0.00 ? 39 LEU A N    8  
ATOM 6134  C CA   . LEU A 1 39 ? -2.544  2.072   -3.049  1.00 0.00 ? 39 LEU A CA   8  
ATOM 6135  C C    . LEU A 1 39 ? -1.811  1.354   -4.165  1.00 0.00 ? 39 LEU A C    8  
ATOM 6136  O O    . LEU A 1 39 ? -1.390  1.961   -5.149  1.00 0.00 ? 39 LEU A O    8  
ATOM 6137  C CB   . LEU A 1 39 ? -1.614  2.224   -1.855  1.00 0.00 ? 39 LEU A CB   8  
ATOM 6138  C CG   . LEU A 1 39 ? -1.345  3.662   -1.409  1.00 0.00 ? 39 LEU A CG   8  
ATOM 6139  C CD1  . LEU A 1 39 ? -2.648  4.371   -1.076  1.00 0.00 ? 39 LEU A CD1  8  
ATOM 6140  C CD2  . LEU A 1 39 ? -0.399  3.680   -0.218  1.00 0.00 ? 39 LEU A CD2  8  
ATOM 6141  H H    . LEU A 1 39 ? -3.657  0.764   -1.829  1.00 0.00 ? 39 LEU A H    8  
ATOM 6142  H HA   . LEU A 1 39 ? -2.864  3.040   -3.392  1.00 0.00 ? 39 LEU A HA   8  
ATOM 6143  H HB2  . LEU A 1 39 ? -2.051  1.679   -1.036  1.00 0.00 ? 39 LEU A HB2  8  
ATOM 6144  H HB3  . LEU A 1 39 ? -0.668  1.765   -2.101  1.00 0.00 ? 39 LEU A HB3  8  
ATOM 6145  H HG   . LEU A 1 39 ? -0.873  4.196   -2.217  1.00 0.00 ? 39 LEU A HG   8  
ATOM 6146  H HD11 . LEU A 1 39 ? -2.940  4.996   -1.908  1.00 0.00 ? 39 LEU A HD11 8  
ATOM 6147  H HD12 . LEU A 1 39 ? -2.510  4.985   -0.198  1.00 0.00 ? 39 LEU A HD12 8  
ATOM 6148  H HD13 . LEU A 1 39 ? -3.419  3.640   -0.888  1.00 0.00 ? 39 LEU A HD13 8  
ATOM 6149  H HD21 . LEU A 1 39 ? 0.611   3.842   -0.562  1.00 0.00 ? 39 LEU A HD21 8  
ATOM 6150  H HD22 . LEU A 1 39 ? -0.455  2.733   0.301   1.00 0.00 ? 39 LEU A HD22 8  
ATOM 6151  H HD23 . LEU A 1 39 ? -0.683  4.475   0.455   1.00 0.00 ? 39 LEU A HD23 8  
ATOM 6152  N N    . CYS A 1 40 ? -1.654  0.054   -3.986  1.00 0.00 ? 40 CYS A N    8  
ATOM 6153  C CA   . CYS A 1 40 ? -0.964  -0.772  -4.953  1.00 0.00 ? 40 CYS A CA   8  
ATOM 6154  C C    . CYS A 1 40 ? -1.722  -0.823  -6.267  1.00 0.00 ? 40 CYS A C    8  
ATOM 6155  O O    . CYS A 1 40 ? -1.121  -0.805  -7.341  1.00 0.00 ? 40 CYS A O    8  
ATOM 6156  C CB   . CYS A 1 40 ? -0.772  -2.179  -4.397  1.00 0.00 ? 40 CYS A CB   8  
ATOM 6157  S SG   . CYS A 1 40 ? 0.965   -2.710  -4.353  1.00 0.00 ? 40 CYS A SG   8  
ATOM 6158  H H    . CYS A 1 40 ? -2.009  -0.360  -3.173  1.00 0.00 ? 40 CYS A H    8  
ATOM 6159  H HA   . CYS A 1 40 ? 0.002   -0.331  -5.128  1.00 0.00 ? 40 CYS A HA   8  
ATOM 6160  H HB2  . CYS A 1 40 ? -1.152  -2.215  -3.388  1.00 0.00 ? 40 CYS A HB2  8  
ATOM 6161  H HB3  . CYS A 1 40 ? -1.316  -2.882  -5.009  1.00 0.00 ? 40 CYS A HB3  8  
ATOM 6162  N N    . CYS A 1 41 ? -3.041  -0.884  -6.180  1.00 0.00 ? 41 CYS A N    8  
ATOM 6163  C CA   . CYS A 1 41 ? -3.864  -0.936  -7.376  1.00 0.00 ? 41 CYS A CA   8  
ATOM 6164  C C    . CYS A 1 41 ? -3.893  0.418   -8.070  1.00 0.00 ? 41 CYS A C    8  
ATOM 6165  O O    . CYS A 1 41 ? -3.892  0.505   -9.297  1.00 0.00 ? 41 CYS A O    8  
ATOM 6166  C CB   . CYS A 1 41 ? -5.270  -1.391  -7.012  1.00 0.00 ? 41 CYS A CB   8  
ATOM 6167  S SG   . CYS A 1 41 ? -6.422  -0.068  -6.519  1.00 0.00 ? 41 CYS A SG   8  
ATOM 6168  H H    . CYS A 1 41 ? -3.473  -0.895  -5.289  1.00 0.00 ? 41 CYS A H    8  
ATOM 6169  H HA   . CYS A 1 41 ? -3.427  -1.662  -8.046  1.00 0.00 ? 41 CYS A HA   8  
ATOM 6170  H HB2  . CYS A 1 41 ? -5.703  -1.905  -7.851  1.00 0.00 ? 41 CYS A HB2  8  
ATOM 6171  H HB3  . CYS A 1 41 ? -5.192  -2.070  -6.185  1.00 0.00 ? 41 CYS A HB3  8  
ATOM 6172  N N    . GLU A 1 42 ? -3.922  1.471   -7.265  1.00 0.00 ? 42 GLU A N    8  
ATOM 6173  C CA   . GLU A 1 42 ? -3.957  2.836   -7.789  1.00 0.00 ? 42 GLU A CA   8  
ATOM 6174  C C    . GLU A 1 42 ? -2.559  3.334   -8.167  1.00 0.00 ? 42 GLU A C    8  
ATOM 6175  O O    . GLU A 1 42 ? -2.419  4.373   -8.812  1.00 0.00 ? 42 GLU A O    8  
ATOM 6176  C CB   . GLU A 1 42 ? -4.587  3.780   -6.765  1.00 0.00 ? 42 GLU A CB   8  
ATOM 6177  C CG   . GLU A 1 42 ? -6.085  3.581   -6.597  1.00 0.00 ? 42 GLU A CG   8  
ATOM 6178  C CD   . GLU A 1 42 ? -6.839  3.690   -7.909  1.00 0.00 ? 42 GLU A CD   8  
ATOM 6179  O OE1  . GLU A 1 42 ? -6.353  4.399   -8.815  1.00 0.00 ? 42 GLU A OE1  8  
ATOM 6180  O OE2  . GLU A 1 42 ? -7.913  3.065   -8.030  1.00 0.00 ? 42 GLU A OE2  8  
ATOM 6181  H H    . GLU A 1 42 ? -3.926  1.322   -6.291  1.00 0.00 ? 42 GLU A H    8  
ATOM 6182  H HA   . GLU A 1 42 ? -4.569  2.828   -8.677  1.00 0.00 ? 42 GLU A HA   8  
ATOM 6183  H HB2  . GLU A 1 42 ? -4.115  3.621   -5.806  1.00 0.00 ? 42 GLU A HB2  8  
ATOM 6184  H HB3  . GLU A 1 42 ? -4.414  4.800   -7.077  1.00 0.00 ? 42 GLU A HB3  8  
ATOM 6185  H HG2  . GLU A 1 42 ? -6.261  2.601   -6.179  1.00 0.00 ? 42 GLU A HG2  8  
ATOM 6186  H HG3  . GLU A 1 42 ? -6.462  4.333   -5.919  1.00 0.00 ? 42 GLU A HG3  8  
ATOM 6187  N N    . HIS A 1 43 ? -1.529  2.599   -7.757  1.00 0.00 ? 43 HIS A N    8  
ATOM 6188  C CA   . HIS A 1 43 ? -0.149  2.978   -8.048  1.00 0.00 ? 43 HIS A CA   8  
ATOM 6189  C C    . HIS A 1 43 ? 0.442   2.112   -9.159  1.00 0.00 ? 43 HIS A C    8  
ATOM 6190  O O    . HIS A 1 43 ? -0.159  1.120   -9.574  1.00 0.00 ? 43 HIS A O    8  
ATOM 6191  C CB   . HIS A 1 43 ? 0.688   2.890   -6.772  1.00 0.00 ? 43 HIS A CB   8  
ATOM 6192  C CG   . HIS A 1 43 ? 0.351   3.968   -5.791  1.00 0.00 ? 43 HIS A CG   8  
ATOM 6193  N ND1  . HIS A 1 43 ? -0.096  5.214   -6.174  1.00 0.00 ? 43 HIS A ND1  8  
ATOM 6194  C CD2  . HIS A 1 43 ? 0.385   3.984   -4.437  1.00 0.00 ? 43 HIS A CD2  8  
ATOM 6195  C CE1  . HIS A 1 43 ? -0.319  5.951   -5.103  1.00 0.00 ? 43 HIS A CE1  8  
ATOM 6196  N NE2  . HIS A 1 43 ? -0.035  5.230   -4.034  1.00 0.00 ? 43 HIS A NE2  8  
ATOM 6197  H H    . HIS A 1 43 ? -1.699  1.785   -7.240  1.00 0.00 ? 43 HIS A H    8  
ATOM 6198  H HA   . HIS A 1 43 ? -0.148  4.004   -8.388  1.00 0.00 ? 43 HIS A HA   8  
ATOM 6199  H HB2  . HIS A 1 43 ? 0.514   1.937   -6.295  1.00 0.00 ? 43 HIS A HB2  8  
ATOM 6200  H HB3  . HIS A 1 43 ? 1.733   2.979   -7.021  1.00 0.00 ? 43 HIS A HB3  8  
ATOM 6201  H HD1  . HIS A 1 43 ? -0.228  5.516   -7.098  1.00 0.00 ? 43 HIS A HD1  8  
ATOM 6202  H HD2  . HIS A 1 43 ? 0.681   3.168   -3.794  1.00 0.00 ? 43 HIS A HD2  8  
ATOM 6203  H HE1  . HIS A 1 43 ? -0.673  6.971   -5.100  1.00 0.00 ? 43 HIS A HE1  8  
ATOM 6204  H HE2  . HIS A 1 43 ? 0.066   5.592   -3.129  1.00 0.00 ? 43 HIS A HE2  8  
ATOM 6205  N N    . PRO A 1 44 ? 1.631   2.486   -9.662  1.00 0.00 ? 44 PRO A N    8  
ATOM 6206  C CA   . PRO A 1 44 ? 2.315   1.761   -10.735 1.00 0.00 ? 44 PRO A CA   8  
ATOM 6207  C C    . PRO A 1 44 ? 2.959   0.479   -10.232 1.00 0.00 ? 44 PRO A C    8  
ATOM 6208  O O    . PRO A 1 44 ? 4.051   0.504   -9.663  1.00 0.00 ? 44 PRO A O    8  
ATOM 6209  C CB   . PRO A 1 44 ? 3.391   2.751   -11.221 1.00 0.00 ? 44 PRO A CB   8  
ATOM 6210  C CG   . PRO A 1 44 ? 3.127   4.031   -10.489 1.00 0.00 ? 44 PRO A CG   8  
ATOM 6211  C CD   . PRO A 1 44 ? 2.409   3.645   -9.230  1.00 0.00 ? 44 PRO A CD   8  
ATOM 6212  H HA   . PRO A 1 44 ? 1.640   1.529   -11.548 1.00 0.00 ? 44 PRO A HA   8  
ATOM 6213  H HB2  . PRO A 1 44 ? 4.371   2.361   -10.988 1.00 0.00 ? 44 PRO A HB2  8  
ATOM 6214  H HB3  . PRO A 1 44 ? 3.300   2.885   -12.289 1.00 0.00 ? 44 PRO A HB3  8  
ATOM 6215  H HG2  . PRO A 1 44 ? 4.063   4.517   -10.253 1.00 0.00 ? 44 PRO A HG2  8  
ATOM 6216  H HG3  . PRO A 1 44 ? 2.507   4.678   -11.092 1.00 0.00 ? 44 PRO A HG3  8  
ATOM 6217  H HD2  . PRO A 1 44 ? 3.114   3.370   -8.460  1.00 0.00 ? 44 PRO A HD2  8  
ATOM 6218  H HD3  . PRO A 1 44 ? 1.764   4.444   -8.890  1.00 0.00 ? 44 PRO A HD3  8  
ATOM 6219  N N    . GLY A 1 45 ? 2.271   -0.641  -10.427 1.00 0.00 ? 45 GLY A N    8  
ATOM 6220  C CA   . GLY A 1 45 ? 2.793   -1.911  -9.964  1.00 0.00 ? 45 GLY A CA   8  
ATOM 6221  C C    . GLY A 1 45 ? 3.061   -1.898  -8.471  1.00 0.00 ? 45 GLY A C    8  
ATOM 6222  O O    . GLY A 1 45 ? 3.824   -2.718  -7.961  1.00 0.00 ? 45 GLY A O    8  
ATOM 6223  H H    . GLY A 1 45 ? 1.401   -0.601  -10.874 1.00 0.00 ? 45 GLY A H    8  
ATOM 6224  H HA2  . GLY A 1 45 ? 2.075   -2.688  -10.187 1.00 0.00 ? 45 GLY A HA2  8  
ATOM 6225  H HA3  . GLY A 1 45 ? 3.714   -2.124  -10.484 1.00 0.00 ? 45 GLY A HA3  8  
ATOM 6226  N N    . GLY A 1 46 ? 2.427   -0.959  -7.771  1.00 0.00 ? 46 GLY A N    8  
ATOM 6227  C CA   . GLY A 1 46 ? 2.609   -0.850  -6.339  1.00 0.00 ? 46 GLY A CA   8  
ATOM 6228  C C    . GLY A 1 46 ? 3.691   0.141   -5.959  1.00 0.00 ? 46 GLY A C    8  
ATOM 6229  O O    . GLY A 1 46 ? 4.876   -0.122  -6.160  1.00 0.00 ? 46 GLY A O    8  
ATOM 6230  H H    . GLY A 1 46 ? 1.830   -0.334  -8.232  1.00 0.00 ? 46 GLY A H    8  
ATOM 6231  H HA2  . GLY A 1 46 ? 1.680   -0.538  -5.892  1.00 0.00 ? 46 GLY A HA2  8  
ATOM 6232  H HA3  . GLY A 1 46 ? 2.876   -1.819  -5.949  1.00 0.00 ? 46 GLY A HA3  8  
ATOM 6233  N N    . PHE A 1 47 ? 3.289   1.280   -5.392  1.00 0.00 ? 47 PHE A N    8  
ATOM 6234  C CA   . PHE A 1 47 ? 4.251   2.296   -4.969  1.00 0.00 ? 47 PHE A CA   8  
ATOM 6235  C C    . PHE A 1 47 ? 5.321   1.656   -4.096  1.00 0.00 ? 47 PHE A C    8  
ATOM 6236  O O    . PHE A 1 47 ? 5.232   0.471   -3.775  1.00 0.00 ? 47 PHE A O    8  
ATOM 6237  C CB   . PHE A 1 47 ? 3.545   3.426   -4.204  1.00 0.00 ? 47 PHE A CB   8  
ATOM 6238  C CG   . PHE A 1 47 ? 3.213   4.641   -5.039  1.00 0.00 ? 47 PHE A CG   8  
ATOM 6239  C CD1  . PHE A 1 47 ? 3.377   4.639   -6.416  1.00 0.00 ? 47 PHE A CD1  8  
ATOM 6240  C CD2  . PHE A 1 47 ? 2.732   5.791   -4.434  1.00 0.00 ? 47 PHE A CD2  8  
ATOM 6241  C CE1  . PHE A 1 47 ? 3.070   5.758   -7.169  1.00 0.00 ? 47 PHE A CE1  8  
ATOM 6242  C CE2  . PHE A 1 47 ? 2.425   6.913   -5.181  1.00 0.00 ? 47 PHE A CE2  8  
ATOM 6243  C CZ   . PHE A 1 47 ? 2.595   6.896   -6.551  1.00 0.00 ? 47 PHE A CZ   8  
ATOM 6244  H H    . PHE A 1 47 ? 2.333   1.432   -5.243  1.00 0.00 ? 47 PHE A H    8  
ATOM 6245  H HA   . PHE A 1 47 ? 4.721   2.699   -5.851  1.00 0.00 ? 47 PHE A HA   8  
ATOM 6246  H HB2  . PHE A 1 47 ? 2.622   3.046   -3.797  1.00 0.00 ? 47 PHE A HB2  8  
ATOM 6247  H HB3  . PHE A 1 47 ? 4.180   3.746   -3.391  1.00 0.00 ? 47 PHE A HB3  8  
ATOM 6248  H HD1  . PHE A 1 47 ? 3.750   3.753   -6.901  1.00 0.00 ? 47 PHE A HD1  8  
ATOM 6249  H HD2  . PHE A 1 47 ? 2.598   5.808   -3.362  1.00 0.00 ? 47 PHE A HD2  8  
ATOM 6250  H HE1  . PHE A 1 47 ? 3.204   5.741   -8.241  1.00 0.00 ? 47 PHE A HE1  8  
ATOM 6251  H HE2  . PHE A 1 47 ? 2.051   7.801   -4.695  1.00 0.00 ? 47 PHE A HE2  8  
ATOM 6252  H HZ   . PHE A 1 47 ? 2.356   7.770   -7.137  1.00 0.00 ? 47 PHE A HZ   8  
ATOM 6253  N N    . GLU A 1 48 ? 6.329   2.425   -3.708  1.00 0.00 ? 48 GLU A N    8  
ATOM 6254  C CA   . GLU A 1 48 ? 7.393   1.862   -2.873  1.00 0.00 ? 48 GLU A CA   8  
ATOM 6255  C C    . GLU A 1 48 ? 7.075   2.041   -1.399  1.00 0.00 ? 48 GLU A C    8  
ATOM 6256  O O    . GLU A 1 48 ? 7.331   3.089   -0.811  1.00 0.00 ? 48 GLU A O    8  
ATOM 6257  C CB   . GLU A 1 48 ? 8.777   2.459   -3.192  1.00 0.00 ? 48 GLU A CB   8  
ATOM 6258  C CG   . GLU A 1 48 ? 8.769   3.706   -4.067  1.00 0.00 ? 48 GLU A CG   8  
ATOM 6259  C CD   . GLU A 1 48 ? 9.919   3.727   -5.054  1.00 0.00 ? 48 GLU A CD   8  
ATOM 6260  O OE1  . GLU A 1 48 ? 10.926  3.030   -4.808  1.00 0.00 ? 48 GLU A OE1  8  
ATOM 6261  O OE2  . GLU A 1 48 ? 9.813   4.438   -6.075  1.00 0.00 ? 48 GLU A OE2  8  
ATOM 6262  H H    . GLU A 1 48 ? 6.356   3.373   -3.982  1.00 0.00 ? 48 GLU A H    8  
ATOM 6263  H HA   . GLU A 1 48 ? 7.421   0.793   -3.073  1.00 0.00 ? 48 GLU A HA   8  
ATOM 6264  H HB2  . GLU A 1 48 ? 9.264   2.712   -2.262  1.00 0.00 ? 48 GLU A HB2  8  
ATOM 6265  H HB3  . GLU A 1 48 ? 9.365   1.704   -3.692  1.00 0.00 ? 48 GLU A HB3  8  
ATOM 6266  H HG2  . GLU A 1 48 ? 7.845   3.746   -4.618  1.00 0.00 ? 48 GLU A HG2  8  
ATOM 6267  H HG3  . GLU A 1 48 ? 8.849   4.574   -3.430  1.00 0.00 ? 48 GLU A HG3  8  
ATOM 6268  N N    . TYR A 1 49 ? 6.521   0.991   -0.813  1.00 0.00 ? 49 TYR A N    8  
ATOM 6269  C CA   . TYR A 1 49 ? 6.156   0.989   0.599   1.00 0.00 ? 49 TYR A CA   8  
ATOM 6270  C C    . TYR A 1 49 ? 7.062   0.082   1.394   1.00 0.00 ? 49 TYR A C    8  
ATOM 6271  O O    . TYR A 1 49 ? 7.764   -0.767  0.849   1.00 0.00 ? 49 TYR A O    8  
ATOM 6272  C CB   . TYR A 1 49 ? 4.729   0.534   0.771   1.00 0.00 ? 49 TYR A CB   8  
ATOM 6273  C CG   . TYR A 1 49 ? 4.400   -0.706  0.005   1.00 0.00 ? 49 TYR A CG   8  
ATOM 6274  C CD1  . TYR A 1 49 ? 4.711   -1.949  0.522   1.00 0.00 ? 49 TYR A CD1  8  
ATOM 6275  C CD2  . TYR A 1 49 ? 3.781   -0.634  -1.230  1.00 0.00 ? 49 TYR A CD2  8  
ATOM 6276  C CE1  . TYR A 1 49 ? 4.416   -3.095  -0.171  1.00 0.00 ? 49 TYR A CE1  8  
ATOM 6277  C CE2  . TYR A 1 49 ? 3.480   -1.775  -1.934  1.00 0.00 ? 49 TYR A CE2  8  
ATOM 6278  C CZ   . TYR A 1 49 ? 3.799   -3.004  -1.401  1.00 0.00 ? 49 TYR A CZ   8  
ATOM 6279  O OH   . TYR A 1 49 ? 3.500   -4.142  -2.095  1.00 0.00 ? 49 TYR A OH   8  
ATOM 6280  H H    . TYR A 1 49 ? 6.356   0.182   -1.352  1.00 0.00 ? 49 TYR A H    8  
ATOM 6281  H HA   . TYR A 1 49 ? 6.238   1.983   0.998   1.00 0.00 ? 49 TYR A HA   8  
ATOM 6282  H HB2  . TYR A 1 49 ? 4.567   0.325   1.808   1.00 0.00 ? 49 TYR A HB2  8  
ATOM 6283  H HB3  . TYR A 1 49 ? 4.061   1.317   0.452   1.00 0.00 ? 49 TYR A HB3  8  
ATOM 6284  H HD1  . TYR A 1 49 ? 5.194   -2.013  1.486   1.00 0.00 ? 49 TYR A HD1  8  
ATOM 6285  H HD2  . TYR A 1 49 ? 3.536   0.334   -1.642  1.00 0.00 ? 49 TYR A HD2  8  
ATOM 6286  H HE1  . TYR A 1 49 ? 4.665   -4.057  0.251   1.00 0.00 ? 49 TYR A HE1  8  
ATOM 6287  H HE2  . TYR A 1 49 ? 2.999   -1.703  -2.893  1.00 0.00 ? 49 TYR A HE2  8  
ATOM 6288  H HH   . TYR A 1 49 ? 3.499   -4.884  -1.490  1.00 0.00 ? 49 TYR A HH   8  
ATOM 6289  N N    . SER A 1 50 ? 7.024   0.264   2.692   1.00 0.00 ? 50 SER A N    8  
ATOM 6290  C CA   . SER A 1 50 ? 7.824   -0.539  3.592   1.00 0.00 ? 50 SER A CA   8  
ATOM 6291  C C    . SER A 1 50 ? 7.026   -0.858  4.837   1.00 0.00 ? 50 SER A C    8  
ATOM 6292  O O    . SER A 1 50 ? 6.990   -0.074  5.786   1.00 0.00 ? 50 SER A O    8  
ATOM 6293  C CB   . SER A 1 50 ? 9.112   0.185   3.954   1.00 0.00 ? 50 SER A CB   8  
ATOM 6294  O OG   . SER A 1 50 ? 8.945   1.591   3.897   1.00 0.00 ? 50 SER A OG   8  
ATOM 6295  H H    . SER A 1 50 ? 6.430   0.956   3.059   1.00 0.00 ? 50 SER A H    8  
ATOM 6296  H HA   . SER A 1 50 ? 8.066   -1.462  3.087   1.00 0.00 ? 50 SER A HA   8  
ATOM 6297  H HB2  . SER A 1 50 ? 9.404   -0.091  4.953   1.00 0.00 ? 50 SER A HB2  8  
ATOM 6298  H HB3  . SER A 1 50 ? 9.885   -0.102  3.257   1.00 0.00 ? 50 SER A HB3  8  
ATOM 6299  H HG   . SER A 1 50 ? 9.353   1.992   4.668   1.00 0.00 ? 50 SER A HG   8  
ATOM 6300  N N    . ASN A 1 51 ? 6.369   -2.007  4.819   1.00 0.00 ? 51 ASN A N    8  
ATOM 6301  C CA   . ASN A 1 51 ? 5.547   -2.425  5.941   1.00 0.00 ? 51 ASN A CA   8  
ATOM 6302  C C    . ASN A 1 51 ? 6.298   -2.278  7.254   1.00 0.00 ? 51 ASN A C    8  
ATOM 6303  O O    . ASN A 1 51 ? 7.449   -2.695  7.383   1.00 0.00 ? 51 ASN A O    8  
ATOM 6304  C CB   . ASN A 1 51 ? 5.070   -3.862  5.771   1.00 0.00 ? 51 ASN A CB   8  
ATOM 6305  C CG   . ASN A 1 51 ? 4.403   -4.096  4.430   1.00 0.00 ? 51 ASN A CG   8  
ATOM 6306  O OD1  . ASN A 1 51 ? 5.006   -3.882  3.378   1.00 0.00 ? 51 ASN A OD1  8  
ATOM 6307  N ND2  . ASN A 1 51 ? 3.152   -4.538  4.460   1.00 0.00 ? 51 ASN A ND2  8  
ATOM 6308  H H    . ASN A 1 51 ? 6.430   -2.578  4.026   1.00 0.00 ? 51 ASN A H    8  
ATOM 6309  H HA   . ASN A 1 51 ? 4.684   -1.777  5.966   1.00 0.00 ? 51 ASN A HA   8  
ATOM 6310  H HB2  . ASN A 1 51 ? 5.911   -4.530  5.856   1.00 0.00 ? 51 ASN A HB2  8  
ATOM 6311  H HB3  . ASN A 1 51 ? 4.356   -4.079  6.551   1.00 0.00 ? 51 ASN A HB3  8  
ATOM 6312  H HD21 . ASN A 1 51 ? 2.733   -4.687  5.333   1.00 0.00 ? 51 ASN A HD21 8  
ATOM 6313  H HD22 . ASN A 1 51 ? 2.696   -4.698  3.606   1.00 0.00 ? 51 ASN A HD22 8  
ATOM 6314  N N    . GLY A 1 52 ? 5.629   -1.673  8.218   1.00 0.00 ? 52 GLY A N    8  
ATOM 6315  C CA   . GLY A 1 52 ? 6.229   -1.460  9.523   1.00 0.00 ? 52 GLY A CA   8  
ATOM 6316  C C    . GLY A 1 52 ? 6.069   -0.030  10.011  1.00 0.00 ? 52 GLY A C    8  
ATOM 6317  O O    . GLY A 1 52 ? 5.600   0.832   9.269   1.00 0.00 ? 52 GLY A O    8  
ATOM 6318  H H    . GLY A 1 52 ? 4.716   -1.368  8.037   1.00 0.00 ? 52 GLY A H    8  
ATOM 6319  H HA2  . GLY A 1 52 ? 5.762   -2.126  10.234  1.00 0.00 ? 52 GLY A HA2  8  
ATOM 6320  H HA3  . GLY A 1 52 ? 7.282   -1.693  9.465   1.00 0.00 ? 52 GLY A HA3  8  
ATOM 6321  N N    . PRO A 1 53 ? 6.450   0.251   11.271  1.00 0.00 ? 53 PRO A N    8  
ATOM 6322  C CA   . PRO A 1 53 ? 6.337   1.594   11.854  1.00 0.00 ? 53 PRO A CA   8  
ATOM 6323  C C    . PRO A 1 53 ? 7.354   2.573   11.274  1.00 0.00 ? 53 PRO A C    8  
ATOM 6324  O O    . PRO A 1 53 ? 8.477   2.195   10.944  1.00 0.00 ? 53 PRO A O    8  
ATOM 6325  C CB   . PRO A 1 53 ? 6.616   1.357   13.339  1.00 0.00 ? 53 PRO A CB   8  
ATOM 6326  C CG   . PRO A 1 53 ? 7.475   0.141   13.371  1.00 0.00 ? 53 PRO A CG   8  
ATOM 6327  C CD   . PRO A 1 53 ? 7.015   -0.720  12.227  1.00 0.00 ? 53 PRO A CD   8  
ATOM 6328  H HA   . PRO A 1 53 ? 5.344   1.998   11.732  1.00 0.00 ? 53 PRO A HA   8  
ATOM 6329  H HB2  . PRO A 1 53 ? 7.128   2.214   13.754  1.00 0.00 ? 53 PRO A HB2  8  
ATOM 6330  H HB3  . PRO A 1 53 ? 5.686   1.197   13.863  1.00 0.00 ? 53 PRO A HB3  8  
ATOM 6331  H HG2  . PRO A 1 53 ? 8.510   0.418   13.238  1.00 0.00 ? 53 PRO A HG2  8  
ATOM 6332  H HG3  . PRO A 1 53 ? 7.342   -0.379  14.308  1.00 0.00 ? 53 PRO A HG3  8  
ATOM 6333  H HD2  . PRO A 1 53 ? 7.851   -1.248  11.792  1.00 0.00 ? 53 PRO A HD2  8  
ATOM 6334  H HD3  . PRO A 1 53 ? 6.259   -1.417  12.560  1.00 0.00 ? 53 PRO A HD3  8  
ATOM 6335  N N    . CYS A 1 54 ? 6.950   3.835   11.156  1.00 0.00 ? 54 CYS A N    8  
ATOM 6336  C CA   . CYS A 1 54 ? 7.824   4.870   10.619  1.00 0.00 ? 54 CYS A CA   8  
ATOM 6337  C C    . CYS A 1 54 ? 7.245   6.262   10.867  1.00 0.00 ? 54 CYS A C    8  
ATOM 6338  O O    . CYS A 1 54 ? 7.969   7.191   11.222  1.00 0.00 ? 54 CYS A O    8  
ATOM 6339  C CB   . CYS A 1 54 ? 8.045   4.648   9.122   1.00 0.00 ? 54 CYS A CB   8  
ATOM 6340  S SG   . CYS A 1 54 ? 6.583   4.989   8.089   1.00 0.00 ? 54 CYS A SG   8  
ATOM 6341  H H    . CYS A 1 54 ? 6.044   4.075   11.437  1.00 0.00 ? 54 CYS A H    8  
ATOM 6342  H HA   . CYS A 1 54 ? 8.774   4.795   11.126  1.00 0.00 ? 54 CYS A HA   8  
ATOM 6343  H HB2  . CYS A 1 54 ? 8.841   5.294   8.785   1.00 0.00 ? 54 CYS A HB2  8  
ATOM 6344  H HB3  . CYS A 1 54 ? 8.330   3.620   8.959   1.00 0.00 ? 54 CYS A HB3  8  
ATOM 6345  N N    . GLU A 1 55 ? 5.935   6.399   10.676  1.00 0.00 ? 55 GLU A N    8  
ATOM 6346  C CA   . GLU A 1 55 ? 5.261   7.678   10.876  1.00 0.00 ? 55 GLU A CA   8  
ATOM 6347  C C    . GLU A 1 55 ? 4.282   7.602   12.044  1.00 0.00 ? 55 GLU A C    8  
ATOM 6348  O O    . GLU A 1 55 ? 3.995   6.476   12.502  1.00 0.00 ? 55 GLU A O    8  
ATOM 6349  C CB   . GLU A 1 55 ? 4.522   8.095   9.603   1.00 0.00 ? 55 GLU A CB   8  
ATOM 6350  C CG   . GLU A 1 55 ? 4.446   9.601   9.409   1.00 0.00 ? 55 GLU A CG   8  
ATOM 6351  C CD   . GLU A 1 55 ? 5.775   10.202  8.993   1.00 0.00 ? 55 GLU A CD   8  
ATOM 6352  O OE1  . GLU A 1 55 ? 6.609   10.469  9.883   1.00 0.00 ? 55 GLU A OE1  8  
ATOM 6353  O OE2  . GLU A 1 55 ? 5.981   10.404  7.778   1.00 0.00 ? 55 GLU A OE2  8  
ATOM 6354  O OXT  . GLU A 1 55 ? 3.811   8.670   12.490  1.00 0.00 ? 55 GLU A OXT  8  
ATOM 6355  H H    . GLU A 1 55 ? 5.410   5.622   10.392  1.00 0.00 ? 55 GLU A H    8  
ATOM 6356  H HA   . GLU A 1 55 ? 6.015   8.418   11.102  1.00 0.00 ? 55 GLU A HA   8  
ATOM 6357  H HB2  . GLU A 1 55 ? 5.030   7.670   8.750   1.00 0.00 ? 55 GLU A HB2  8  
ATOM 6358  H HB3  . GLU A 1 55 ? 3.515   7.707   9.641   1.00 0.00 ? 55 GLU A HB3  8  
ATOM 6359  H HG2  . GLU A 1 55 ? 3.716   9.818   8.645   1.00 0.00 ? 55 GLU A HG2  8  
ATOM 6360  H HG3  . GLU A 1 55 ? 4.138   10.056  10.340  1.00 0.00 ? 55 GLU A HG3  8  
ATOM 6361  N N    . ALA A 1 1  ? 10.884  -2.730  2.771   1.00 0.00 ? 1  ALA A N    9  
ATOM 6362  C CA   . ALA A 1 1  ? 10.116  -3.456  1.724   1.00 0.00 ? 1  ALA A CA   9  
ATOM 6363  C C    . ALA A 1 1  ? 9.941   -2.601  0.473   1.00 0.00 ? 1  ALA A C    9  
ATOM 6364  O O    . ALA A 1 1  ? 10.348  -1.439  0.437   1.00 0.00 ? 1  ALA A O    9  
ATOM 6365  C CB   . ALA A 1 1  ? 8.761   -3.892  2.265   1.00 0.00 ? 1  ALA A CB   9  
ATOM 6366  H H1   . ALA A 1 1  ? 11.444  -3.431  3.297   1.00 0.00 ? 1  ALA A H1   9  
ATOM 6367  H H2   . ALA A 1 1  ? 10.200  -2.253  3.393   1.00 0.00 ? 1  ALA A H2   9  
ATOM 6368  H H3   . ALA A 1 1  ? 11.501  -2.043  2.295   1.00 0.00 ? 1  ALA A H3   9  
ATOM 6369  H HA   . ALA A 1 1  ? 10.668  -4.346  1.458   1.00 0.00 ? 1  ALA A HA   9  
ATOM 6370  H HB1  . ALA A 1 1  ? 7.996   -3.688  1.530   1.00 0.00 ? 1  ALA A HB1  9  
ATOM 6371  H HB2  . ALA A 1 1  ? 8.544   -3.347  3.172   1.00 0.00 ? 1  ALA A HB2  9  
ATOM 6372  H HB3  . ALA A 1 1  ? 8.782   -4.950  2.478   1.00 0.00 ? 1  ALA A HB3  9  
ATOM 6373  N N    . HIS A 1 2  ? 9.342   -3.194  -0.552  1.00 0.00 ? 2  HIS A N    9  
ATOM 6374  C CA   . HIS A 1 2  ? 9.114   -2.515  -1.816  1.00 0.00 ? 2  HIS A CA   9  
ATOM 6375  C C    . HIS A 1 2  ? 7.754   -2.888  -2.384  1.00 0.00 ? 2  HIS A C    9  
ATOM 6376  O O    . HIS A 1 2  ? 6.812   -3.186  -1.650  1.00 0.00 ? 2  HIS A O    9  
ATOM 6377  C CB   . HIS A 1 2  ? 10.250  -2.855  -2.790  1.00 0.00 ? 2  HIS A CB   9  
ATOM 6378  C CG   . HIS A 1 2  ? 11.248  -1.750  -2.945  1.00 0.00 ? 2  HIS A CG   9  
ATOM 6379  N ND1  . HIS A 1 2  ? 12.610  -1.940  -2.827  1.00 0.00 ? 2  HIS A ND1  9  
ATOM 6380  C CD2  . HIS A 1 2  ? 11.077  -0.434  -3.211  1.00 0.00 ? 2  HIS A CD2  9  
ATOM 6381  C CE1  . HIS A 1 2  ? 13.231  -0.788  -3.012  1.00 0.00 ? 2  HIS A CE1  9  
ATOM 6382  N NE2  . HIS A 1 2  ? 12.323  0.140   -3.247  1.00 0.00 ? 2  HIS A NE2  9  
ATOM 6383  H H    . HIS A 1 2  ? 9.051   -4.122  -0.460  1.00 0.00 ? 2  HIS A H    9  
ATOM 6384  H HA   . HIS A 1 2  ? 9.116   -1.459  -1.654  1.00 0.00 ? 2  HIS A HA   9  
ATOM 6385  H HB2  . HIS A 1 2  ? 10.773  -3.723  -2.428  1.00 0.00 ? 2  HIS A HB2  9  
ATOM 6386  H HB3  . HIS A 1 2  ? 9.840   -3.068  -3.763  1.00 0.00 ? 2  HIS A HB3  9  
ATOM 6387  H HD1  . HIS A 1 2  ? 13.054  -2.793  -2.636  1.00 0.00 ? 2  HIS A HD1  9  
ATOM 6388  H HD2  . HIS A 1 2  ? 10.133  0.071   -3.366  1.00 0.00 ? 2  HIS A HD2  9  
ATOM 6389  H HE1  . HIS A 1 2  ? 14.298  -0.634  -2.979  1.00 0.00 ? 2  HIS A HE1  9  
ATOM 6390  H HE2  . HIS A 1 2  ? 12.515  1.070   -3.490  1.00 0.00 ? 2  HIS A HE2  9  
ATOM 6391  N N    . MET A 1 3  ? 7.665   -2.829  -3.687  1.00 0.00 ? 3  MET A N    9  
ATOM 6392  C CA   . MET A 1 3  ? 6.430   -3.116  -4.405  1.00 0.00 ? 3  MET A CA   9  
ATOM 6393  C C    . MET A 1 3  ? 6.029   -4.590  -4.288  1.00 0.00 ? 3  MET A C    9  
ATOM 6394  O O    . MET A 1 3  ? 6.098   -5.351  -5.253  1.00 0.00 ? 3  MET A O    9  
ATOM 6395  C CB   . MET A 1 3  ? 6.603   -2.735  -5.878  1.00 0.00 ? 3  MET A CB   9  
ATOM 6396  C CG   . MET A 1 3  ? 5.379   -3.001  -6.737  1.00 0.00 ? 3  MET A CG   9  
ATOM 6397  S SD   . MET A 1 3  ? 5.582   -2.407  -8.428  1.00 0.00 ? 3  MET A SD   9  
ATOM 6398  C CE   . MET A 1 3  ? 6.880   -3.491  -9.016  1.00 0.00 ? 3  MET A CE   9  
ATOM 6399  H H    . MET A 1 3  ? 8.452   -2.545  -4.179  1.00 0.00 ? 3  MET A H    9  
ATOM 6400  H HA   . MET A 1 3  ? 5.649   -2.507  -3.976  1.00 0.00 ? 3  MET A HA   9  
ATOM 6401  H HB2  . MET A 1 3  ? 6.833   -1.682  -5.939  1.00 0.00 ? 3  MET A HB2  9  
ATOM 6402  H HB3  . MET A 1 3  ? 7.430   -3.298  -6.287  1.00 0.00 ? 3  MET A HB3  9  
ATOM 6403  H HG2  . MET A 1 3  ? 5.197   -4.064  -6.765  1.00 0.00 ? 3  MET A HG2  9  
ATOM 6404  H HG3  . MET A 1 3  ? 4.531   -2.503  -6.295  1.00 0.00 ? 3  MET A HG3  9  
ATOM 6405  H HE1  . MET A 1 3  ? 7.672   -2.902  -9.454  1.00 0.00 ? 3  MET A HE1  9  
ATOM 6406  H HE2  . MET A 1 3  ? 6.478   -4.163  -9.760  1.00 0.00 ? 3  MET A HE2  9  
ATOM 6407  H HE3  . MET A 1 3  ? 7.272   -4.064  -8.189  1.00 0.00 ? 3  MET A HE3  9  
ATOM 6408  N N    . ASP A 1 4  ? 5.583   -4.963  -3.089  1.00 0.00 ? 4  ASP A N    9  
ATOM 6409  C CA   . ASP A 1 4  ? 5.125   -6.320  -2.800  1.00 0.00 ? 4  ASP A CA   9  
ATOM 6410  C C    . ASP A 1 4  ? 3.731   -6.265  -2.169  1.00 0.00 ? 4  ASP A C    9  
ATOM 6411  O O    . ASP A 1 4  ? 3.597   -6.293  -0.945  1.00 0.00 ? 4  ASP A O    9  
ATOM 6412  C CB   . ASP A 1 4  ? 6.100   -7.020  -1.849  1.00 0.00 ? 4  ASP A CB   9  
ATOM 6413  C CG   . ASP A 1 4  ? 7.142   -7.837  -2.586  1.00 0.00 ? 4  ASP A CG   9  
ATOM 6414  O OD1  . ASP A 1 4  ? 7.399   -7.542  -3.772  1.00 0.00 ? 4  ASP A OD1  9  
ATOM 6415  O OD2  . ASP A 1 4  ? 7.700   -8.774  -1.979  1.00 0.00 ? 4  ASP A OD2  9  
ATOM 6416  H H    . ASP A 1 4  ? 5.542   -4.295  -2.376  1.00 0.00 ? 4  ASP A H    9  
ATOM 6417  H HA   . ASP A 1 4  ? 5.074   -6.866  -3.731  1.00 0.00 ? 4  ASP A HA   9  
ATOM 6418  H HB2  . ASP A 1 4  ? 6.608   -6.275  -1.253  1.00 0.00 ? 4  ASP A HB2  9  
ATOM 6419  H HB3  . ASP A 1 4  ? 5.546   -7.678  -1.195  1.00 0.00 ? 4  ASP A HB3  9  
ATOM 6420  N N    . CYS A 1 5  ? 2.700   -6.150  -3.006  1.00 0.00 ? 5  CYS A N    9  
ATOM 6421  C CA   . CYS A 1 5  ? 1.325   -6.049  -2.517  1.00 0.00 ? 5  CYS A CA   9  
ATOM 6422  C C    . CYS A 1 5  ? 0.375   -6.978  -3.298  1.00 0.00 ? 5  CYS A C    9  
ATOM 6423  O O    . CYS A 1 5  ? 0.733   -8.116  -3.602  1.00 0.00 ? 5  CYS A O    9  
ATOM 6424  C CB   . CYS A 1 5  ? 0.885   -4.581  -2.604  1.00 0.00 ? 5  CYS A CB   9  
ATOM 6425  S SG   . CYS A 1 5  ? -0.670  -4.171  -1.750  1.00 0.00 ? 5  CYS A SG   9  
ATOM 6426  H H    . CYS A 1 5  ? 2.870   -6.106  -3.971  1.00 0.00 ? 5  CYS A H    9  
ATOM 6427  H HA   . CYS A 1 5  ? 1.324   -6.350  -1.480  1.00 0.00 ? 5  CYS A HA   9  
ATOM 6428  H HB2  . CYS A 1 5  ? 1.653   -3.965  -2.169  1.00 0.00 ? 5  CYS A HB2  9  
ATOM 6429  H HB3  . CYS A 1 5  ? 0.767   -4.314  -3.645  1.00 0.00 ? 5  CYS A HB3  9  
ATOM 6430  N N    . THR A 1 6  ? -0.842  -6.506  -3.598  1.00 0.00 ? 6  THR A N    9  
ATOM 6431  C CA   . THR A 1 6  ? -1.833  -7.305  -4.307  1.00 0.00 ? 6  THR A CA   9  
ATOM 6432  C C    . THR A 1 6  ? -1.399  -7.655  -5.739  1.00 0.00 ? 6  THR A C    9  
ATOM 6433  O O    . THR A 1 6  ? -1.876  -8.650  -6.277  1.00 0.00 ? 6  THR A O    9  
ATOM 6434  C CB   . THR A 1 6  ? -3.157  -6.546  -4.351  1.00 0.00 ? 6  THR A CB   9  
ATOM 6435  O OG1  . THR A 1 6  ? -4.176  -7.345  -4.922  1.00 0.00 ? 6  THR A OG1  9  
ATOM 6436  C CG2  . THR A 1 6  ? -3.081  -5.257  -5.143  1.00 0.00 ? 6  THR A CG2  9  
ATOM 6437  H H    . THR A 1 6  ? -1.093  -5.602  -3.322  1.00 0.00 ? 6  THR A H    9  
ATOM 6438  H HA   . THR A 1 6  ? -1.989  -8.229  -3.742  1.00 0.00 ? 6  THR A HA   9  
ATOM 6439  H HB   . THR A 1 6  ? -3.449  -6.294  -3.341  1.00 0.00 ? 6  THR A HB   9  
ATOM 6440  H HG1  . THR A 1 6  ? -3.870  -7.706  -5.757  1.00 0.00 ? 6  THR A HG1  9  
ATOM 6441  H HG21 . THR A 1 6  ? -2.049  -4.956  -5.244  1.00 0.00 ? 6  THR A HG21 9  
ATOM 6442  H HG22 . THR A 1 6  ? -3.633  -4.485  -4.628  1.00 0.00 ? 6  THR A HG22 9  
ATOM 6443  H HG23 . THR A 1 6  ? -3.508  -5.412  -6.123  1.00 0.00 ? 6  THR A HG23 9  
ATOM 6444  N N    . GLU A 1 7  ? -0.517  -6.833  -6.364  1.00 0.00 ? 7  GLU A N    9  
ATOM 6445  C CA   . GLU A 1 7  ? -0.061  -7.067  -7.747  1.00 0.00 ? 7  GLU A CA   9  
ATOM 6446  C C    . GLU A 1 7  ? -0.289  -8.507  -8.213  1.00 0.00 ? 7  GLU A C    9  
ATOM 6447  O O    . GLU A 1 7  ? 0.642   -9.308  -8.292  1.00 0.00 ? 7  GLU A O    9  
ATOM 6448  C CB   . GLU A 1 7  ? 1.422   -6.714  -7.875  1.00 0.00 ? 7  GLU A CB   9  
ATOM 6449  C CG   . GLU A 1 7  ? 2.330   -7.564  -7.002  1.00 0.00 ? 7  GLU A CG   9  
ATOM 6450  C CD   . GLU A 1 7  ? 3.635   -6.868  -6.667  1.00 0.00 ? 7  GLU A CD   9  
ATOM 6451  O OE1  . GLU A 1 7  ? 3.925   -5.821  -7.282  1.00 0.00 ? 7  GLU A OE1  9  
ATOM 6452  O OE2  . GLU A 1 7  ? 4.369   -7.372  -5.790  1.00 0.00 ? 7  GLU A OE2  9  
ATOM 6453  H H    . GLU A 1 7  ? -0.178  -6.034  -5.898  1.00 0.00 ? 7  GLU A H    9  
ATOM 6454  H HA   . GLU A 1 7  ? -0.625  -6.408  -8.389  1.00 0.00 ? 7  GLU A HA   9  
ATOM 6455  H HB2  . GLU A 1 7  ? 1.724   -6.845  -8.904  1.00 0.00 ? 7  GLU A HB2  9  
ATOM 6456  H HB3  . GLU A 1 7  ? 1.560   -5.679  -7.599  1.00 0.00 ? 7  GLU A HB3  9  
ATOM 6457  H HG2  . GLU A 1 7  ? 1.815   -7.790  -6.081  1.00 0.00 ? 7  GLU A HG2  9  
ATOM 6458  H HG3  . GLU A 1 7  ? 2.554   -8.483  -7.524  1.00 0.00 ? 7  GLU A HG3  9  
ATOM 6459  N N    . PHE A 1 8  ? -1.546  -8.816  -8.518  1.00 0.00 ? 8  PHE A N    9  
ATOM 6460  C CA   . PHE A 1 8  ? -1.939  -10.143 -8.977  1.00 0.00 ? 8  PHE A CA   9  
ATOM 6461  C C    . PHE A 1 8  ? -3.294  -10.063 -9.687  1.00 0.00 ? 8  PHE A C    9  
ATOM 6462  O O    . PHE A 1 8  ? -3.650  -9.014  -10.223 1.00 0.00 ? 8  PHE A O    9  
ATOM 6463  C CB   . PHE A 1 8  ? -1.995  -11.114 -7.791  1.00 0.00 ? 8  PHE A CB   9  
ATOM 6464  C CG   . PHE A 1 8  ? -0.641  -11.495 -7.265  1.00 0.00 ? 8  PHE A CG   9  
ATOM 6465  C CD1  . PHE A 1 8  ? 0.212   -12.283 -8.022  1.00 0.00 ? 8  PHE A CD1  9  
ATOM 6466  C CD2  . PHE A 1 8  ? -0.220  -11.067 -6.016  1.00 0.00 ? 8  PHE A CD2  9  
ATOM 6467  C CE1  . PHE A 1 8  ? 1.458   -12.637 -7.544  1.00 0.00 ? 8  PHE A CE1  9  
ATOM 6468  C CE2  . PHE A 1 8  ? 1.025   -11.418 -5.532  1.00 0.00 ? 8  PHE A CE2  9  
ATOM 6469  C CZ   . PHE A 1 8  ? 1.866   -12.205 -6.297  1.00 0.00 ? 8  PHE A CZ   9  
ATOM 6470  H H    . PHE A 1 8  ? -2.236  -8.125  -8.430  1.00 0.00 ? 8  PHE A H    9  
ATOM 6471  H HA   . PHE A 1 8  ? -1.194  -10.486 -9.682  1.00 0.00 ? 8  PHE A HA   9  
ATOM 6472  H HB2  . PHE A 1 8  ? -2.547  -10.655 -6.985  1.00 0.00 ? 8  PHE A HB2  9  
ATOM 6473  H HB3  . PHE A 1 8  ? -2.499  -12.018 -8.094  1.00 0.00 ? 8  PHE A HB3  9  
ATOM 6474  H HD1  . PHE A 1 8  ? -0.107  -12.622 -8.997  1.00 0.00 ? 8  PHE A HD1  9  
ATOM 6475  H HD2  . PHE A 1 8  ? -0.877  -10.454 -5.417  1.00 0.00 ? 8  PHE A HD2  9  
ATOM 6476  H HE1  . PHE A 1 8  ? 2.113   -13.252 -8.144  1.00 0.00 ? 8  PHE A HE1  9  
ATOM 6477  H HE2  . PHE A 1 8  ? 1.343   -11.079 -4.558  1.00 0.00 ? 8  PHE A HE2  9  
ATOM 6478  H HZ   . PHE A 1 8  ? 2.840   -12.479 -5.921  1.00 0.00 ? 8  PHE A HZ   9  
ATOM 6479  N N    . ASN A 1 9  ? -4.053  -11.158 -9.686  1.00 0.00 ? 9  ASN A N    9  
ATOM 6480  C CA   . ASN A 1 9  ? -5.364  -11.167 -10.329 1.00 0.00 ? 9  ASN A CA   9  
ATOM 6481  C C    . ASN A 1 9  ? -6.355  -10.308 -9.543  1.00 0.00 ? 9  ASN A C    9  
ATOM 6482  O O    . ASN A 1 9  ? -7.033  -9.452  -10.113 1.00 0.00 ? 9  ASN A O    9  
ATOM 6483  C CB   . ASN A 1 9  ? -5.901  -12.597 -10.463 1.00 0.00 ? 9  ASN A CB   9  
ATOM 6484  C CG   . ASN A 1 9  ? -4.803  -13.617 -10.706 1.00 0.00 ? 9  ASN A CG   9  
ATOM 6485  O OD1  . ASN A 1 9  ? -4.062  -13.976 -9.792  1.00 0.00 ? 9  ASN A OD1  9  
ATOM 6486  N ND2  . ASN A 1 9  ? -4.696  -14.089 -11.943 1.00 0.00 ? 9  ASN A ND2  9  
ATOM 6487  H H    . ASN A 1 9  ? -3.734  -11.968 -9.245  1.00 0.00 ? 9  ASN A H    9  
ATOM 6488  H HA   . ASN A 1 9  ? -5.247  -10.743 -11.316 1.00 0.00 ? 9  ASN A HA   9  
ATOM 6489  H HB2  . ASN A 1 9  ? -6.421  -12.867 -9.558  1.00 0.00 ? 9  ASN A HB2  9  
ATOM 6490  H HB3  . ASN A 1 9  ? -6.591  -12.636 -11.292 1.00 0.00 ? 9  ASN A HB3  9  
ATOM 6491  H HD21 . ASN A 1 9  ? -5.322  -13.757 -12.621 1.00 0.00 ? 9  ASN A HD21 9  
ATOM 6492  H HD22 . ASN A 1 9  ? -3.997  -14.749 -12.127 1.00 0.00 ? 9  ASN A HD22 9  
ATOM 6493  N N    . PRO A 1 10 ? -6.453  -10.521 -8.215  1.00 0.00 ? 10 PRO A N    9  
ATOM 6494  C CA   . PRO A 1 10 ? -7.357  -9.768  -7.355  1.00 0.00 ? 10 PRO A CA   9  
ATOM 6495  C C    . PRO A 1 10 ? -6.680  -8.547  -6.738  1.00 0.00 ? 10 PRO A C    9  
ATOM 6496  O O    . PRO A 1 10 ? -6.146  -8.620  -5.632  1.00 0.00 ? 10 PRO A O    9  
ATOM 6497  C CB   . PRO A 1 10 ? -7.691  -10.793 -6.278  1.00 0.00 ? 10 PRO A CB   9  
ATOM 6498  C CG   . PRO A 1 10 ? -6.437  -11.593 -6.120  1.00 0.00 ? 10 PRO A CG   9  
ATOM 6499  C CD   . PRO A 1 10 ? -5.692  -11.517 -7.437  1.00 0.00 ? 10 PRO A CD   9  
ATOM 6500  H HA   . PRO A 1 10 ? -8.255  -9.470  -7.874  1.00 0.00 ? 10 PRO A HA   9  
ATOM 6501  H HB2  . PRO A 1 10 ? -7.956  -10.283 -5.362  1.00 0.00 ? 10 PRO A HB2  9  
ATOM 6502  H HB3  . PRO A 1 10 ? -8.513  -11.410 -6.606  1.00 0.00 ? 10 PRO A HB3  9  
ATOM 6503  H HG2  . PRO A 1 10 ? -5.834  -11.172 -5.328  1.00 0.00 ? 10 PRO A HG2  9  
ATOM 6504  H HG3  . PRO A 1 10 ? -6.686  -12.619 -5.893  1.00 0.00 ? 10 PRO A HG3  9  
ATOM 6505  H HD2  . PRO A 1 10 ? -4.678  -11.182 -7.275  1.00 0.00 ? 10 PRO A HD2  9  
ATOM 6506  H HD3  . PRO A 1 10 ? -5.697  -12.478 -7.926  1.00 0.00 ? 10 PRO A HD3  9  
ATOM 6507  N N    . LEU A 1 11 ? -6.695  -7.432  -7.461  1.00 0.00 ? 11 LEU A N    9  
ATOM 6508  C CA   . LEU A 1 11 ? -6.067  -6.204  -6.980  1.00 0.00 ? 11 LEU A CA   9  
ATOM 6509  C C    . LEU A 1 11 ? -6.747  -5.682  -5.729  1.00 0.00 ? 11 LEU A C    9  
ATOM 6510  O O    . LEU A 1 11 ? -7.742  -6.244  -5.288  1.00 0.00 ? 11 LEU A O    9  
ATOM 6511  C CB   . LEU A 1 11 ? -6.067  -5.134  -8.076  1.00 0.00 ? 11 LEU A CB   9  
ATOM 6512  C CG   . LEU A 1 11 ? -4.691  -4.792  -8.649  1.00 0.00 ? 11 LEU A CG   9  
ATOM 6513  C CD1  . LEU A 1 11 ? -3.974  -6.054  -9.105  1.00 0.00 ? 11 LEU A CD1  9  
ATOM 6514  C CD2  . LEU A 1 11 ? -4.824  -3.807  -9.801  1.00 0.00 ? 11 LEU A CD2  9  
ATOM 6515  H H    . LEU A 1 11 ? -7.128  -7.435  -8.340  1.00 0.00 ? 11 LEU A H    9  
ATOM 6516  H HA   . LEU A 1 11 ? -5.053  -6.438  -6.718  1.00 0.00 ? 11 LEU A HA   9  
ATOM 6517  H HB2  . LEU A 1 11 ? -6.695  -5.478  -8.884  1.00 0.00 ? 11 LEU A HB2  9  
ATOM 6518  H HB3  . LEU A 1 11 ? -6.497  -4.229  -7.671  1.00 0.00 ? 11 LEU A HB3  9  
ATOM 6519  H HG   . LEU A 1 11 ? -4.092  -4.328  -7.879  1.00 0.00 ? 11 LEU A HG   9  
ATOM 6520  H HD11 . LEU A 1 11 ? -4.703  -6.809  -9.362  1.00 0.00 ? 11 LEU A HD11 9  
ATOM 6521  H HD12 . LEU A 1 11 ? -3.344  -6.418  -8.307  1.00 0.00 ? 11 LEU A HD12 9  
ATOM 6522  H HD13 . LEU A 1 11 ? -3.367  -5.831  -9.970  1.00 0.00 ? 11 LEU A HD13 9  
ATOM 6523  H HD21 . LEU A 1 11 ? -3.900  -3.779  -10.360 1.00 0.00 ? 11 LEU A HD21 9  
ATOM 6524  H HD22 . LEU A 1 11 ? -5.037  -2.823  -9.412  1.00 0.00 ? 11 LEU A HD22 9  
ATOM 6525  H HD23 . LEU A 1 11 ? -5.628  -4.119  -10.451 1.00 0.00 ? 11 LEU A HD23 9  
ATOM 6526  N N    . CYS A 1 12 ? -6.168  -4.613  -5.164  1.00 0.00 ? 12 CYS A N    9  
ATOM 6527  C CA   . CYS A 1 12 ? -6.651  -3.986  -3.938  1.00 0.00 ? 12 CYS A CA   9  
ATOM 6528  C C    . CYS A 1 12 ? -8.087  -4.354  -3.622  1.00 0.00 ? 12 CYS A C    9  
ATOM 6529  O O    . CYS A 1 12 ? -8.990  -3.517  -3.634  1.00 0.00 ? 12 CYS A O    9  
ATOM 6530  C CB   . CYS A 1 12 ? -6.500  -2.473  -4.022  1.00 0.00 ? 12 CYS A CB   9  
ATOM 6531  S SG   . CYS A 1 12 ? -7.525  -1.676  -5.303  1.00 0.00 ? 12 CYS A SG   9  
ATOM 6532  H H    . CYS A 1 12 ? -5.364  -4.247  -5.575  1.00 0.00 ? 12 CYS A H    9  
ATOM 6533  H HA   . CYS A 1 12 ? -6.029  -4.345  -3.133  1.00 0.00 ? 12 CYS A HA   9  
ATOM 6534  H HB2  . CYS A 1 12 ? -6.766  -2.043  -3.070  1.00 0.00 ? 12 CYS A HB2  9  
ATOM 6535  H HB3  . CYS A 1 12 ? -5.469  -2.242  -4.235  1.00 0.00 ? 12 CYS A HB3  9  
ATOM 6536  N N    . ARG A 1 13 ? -8.266  -5.622  -3.311  1.00 0.00 ? 13 ARG A N    9  
ATOM 6537  C CA   . ARG A 1 13 ? -9.578  -6.147  -2.947  1.00 0.00 ? 13 ARG A CA   9  
ATOM 6538  C C    . ARG A 1 13 ? -9.720  -6.116  -1.435  1.00 0.00 ? 13 ARG A C    9  
ATOM 6539  O O    . ARG A 1 13 ? -10.265 -7.034  -0.823  1.00 0.00 ? 13 ARG A O    9  
ATOM 6540  C CB   . ARG A 1 13 ? -9.775  -7.576  -3.474  1.00 0.00 ? 13 ARG A CB   9  
ATOM 6541  C CG   . ARG A 1 13 ? -8.521  -8.441  -3.442  1.00 0.00 ? 13 ARG A CG   9  
ATOM 6542  C CD   . ARG A 1 13 ? -7.915  -8.507  -2.049  1.00 0.00 ? 13 ARG A CD   9  
ATOM 6543  N NE   . ARG A 1 13 ? -7.231  -9.775  -1.808  1.00 0.00 ? 13 ARG A NE   9  
ATOM 6544  C CZ   . ARG A 1 13 ? -6.877  -10.209 -0.600  1.00 0.00 ? 13 ARG A CZ   9  
ATOM 6545  N NH1  . ARG A 1 13 ? -7.141  -9.482  0.479   1.00 0.00 ? 13 ARG A NH1  9  
ATOM 6546  N NH2  . ARG A 1 13 ? -6.258  -11.374 -0.470  1.00 0.00 ? 13 ARG A NH2  9  
ATOM 6547  H H    . ARG A 1 13 ? -7.478  -6.216  -3.309  1.00 0.00 ? 13 ARG A H    9  
ATOM 6548  H HA   . ARG A 1 13 ? -10.327 -5.500  -3.382  1.00 0.00 ? 13 ARG A HA   9  
ATOM 6549  H HB2  . ARG A 1 13 ? -10.532 -8.062  -2.877  1.00 0.00 ? 13 ARG A HB2  9  
ATOM 6550  H HB3  . ARG A 1 13 ? -10.119 -7.522  -4.496  1.00 0.00 ? 13 ARG A HB3  9  
ATOM 6551  H HG2  . ARG A 1 13 ? -8.779  -9.440  -3.756  1.00 0.00 ? 13 ARG A HG2  9  
ATOM 6552  H HG3  . ARG A 1 13 ? -7.792  -8.028  -4.121  1.00 0.00 ? 13 ARG A HG3  9  
ATOM 6553  H HD2  . ARG A 1 13 ? -7.206  -7.702  -1.942  1.00 0.00 ? 13 ARG A HD2  9  
ATOM 6554  H HD3  . ARG A 1 13 ? -8.703  -8.392  -1.321  1.00 0.00 ? 13 ARG A HD3  9  
ATOM 6555  H HE   . ARG A 1 13 ? -7.023  -10.333 -2.587  1.00 0.00 ? 13 ARG A HE   9  
ATOM 6556  H HH11 . ARG A 1 13 ? -7.608  -8.603  0.389   1.00 0.00 ? 13 ARG A HH11 9  
ATOM 6557  H HH12 . ARG A 1 13 ? -6.873  -9.815  1.384   1.00 0.00 ? 13 ARG A HH12 9  
ATOM 6558  H HH21 . ARG A 1 13 ? -6.056  -11.926 -1.279  1.00 0.00 ? 13 ARG A HH21 9  
ATOM 6559  H HH22 . ARG A 1 13 ? -5.992  -11.701 0.437   1.00 0.00 ? 13 ARG A HH22 9  
ATOM 6560  N N    . CYS A 1 14 ? -9.192  -5.052  -0.842  1.00 0.00 ? 14 CYS A N    9  
ATOM 6561  C CA   . CYS A 1 14 ? -9.209  -4.885  0.597   1.00 0.00 ? 14 CYS A CA   9  
ATOM 6562  C C    . CYS A 1 14 ? -9.548  -3.442  0.977   1.00 0.00 ? 14 CYS A C    9  
ATOM 6563  O O    . CYS A 1 14 ? -8.750  -2.530  0.761   1.00 0.00 ? 14 CYS A O    9  
ATOM 6564  C CB   . CYS A 1 14 ? -7.842  -5.277  1.172   1.00 0.00 ? 14 CYS A CB   9  
ATOM 6565  S SG   . CYS A 1 14 ? -6.672  -5.982  -0.039  1.00 0.00 ? 14 CYS A SG   9  
ATOM 6566  H H    . CYS A 1 14 ? -8.757  -4.369  -1.388  1.00 0.00 ? 14 CYS A H    9  
ATOM 6567  H HA   . CYS A 1 14 ? -9.963  -5.541  1.003   1.00 0.00 ? 14 CYS A HA   9  
ATOM 6568  H HB2  . CYS A 1 14 ? -7.374  -4.403  1.591   1.00 0.00 ? 14 CYS A HB2  9  
ATOM 6569  H HB3  . CYS A 1 14 ? -7.987  -6.012  1.946   1.00 0.00 ? 14 CYS A HB3  9  
ATOM 6570  N N    . ASN A 1 15 ? -10.735 -3.247  1.545   1.00 0.00 ? 15 ASN A N    9  
ATOM 6571  C CA   . ASN A 1 15 ? -11.183 -1.917  1.957   1.00 0.00 ? 15 ASN A CA   9  
ATOM 6572  C C    . ASN A 1 15 ? -10.817 -1.650  3.401   1.00 0.00 ? 15 ASN A C    9  
ATOM 6573  O O    . ASN A 1 15 ? -10.328 -0.573  3.724   1.00 0.00 ? 15 ASN A O    9  
ATOM 6574  C CB   . ASN A 1 15 ? -12.696 -1.786  1.788   1.00 0.00 ? 15 ASN A CB   9  
ATOM 6575  C CG   . ASN A 1 15 ? -13.078 -0.685  0.819   1.00 0.00 ? 15 ASN A CG   9  
ATOM 6576  O OD1  . ASN A 1 15 ? -13.618 -0.947  -0.255  1.00 0.00 ? 15 ASN A OD1  9  
ATOM 6577  N ND2  . ASN A 1 15 ? -12.795 0.557   1.193   1.00 0.00 ? 15 ASN A ND2  9  
ATOM 6578  H H    . ASN A 1 15 ? -11.325 -4.015  1.689   1.00 0.00 ? 15 ASN A H    9  
ATOM 6579  H HA   . ASN A 1 15 ? -10.693 -1.185  1.340   1.00 0.00 ? 15 ASN A HA   9  
ATOM 6580  H HB2  . ASN A 1 15 ? -13.090 -2.718  1.429   1.00 0.00 ? 15 ASN A HB2  9  
ATOM 6581  H HB3  . ASN A 1 15 ? -13.140 -1.562  2.748   1.00 0.00 ? 15 ASN A HB3  9  
ATOM 6582  H HD21 . ASN A 1 15 ? -12.363 0.692   2.063   1.00 0.00 ? 15 ASN A HD21 9  
ATOM 6583  H HD22 . ASN A 1 15 ? -13.030 1.289   0.586   1.00 0.00 ? 15 ASN A HD22 9  
ATOM 6584  N N    . LYS A 1 16 ? -11.083 -2.643  4.252   1.00 0.00 ? 16 LYS A N    9  
ATOM 6585  C CA   . LYS A 1 16 ? -10.822 -2.572  5.693   1.00 0.00 ? 16 LYS A CA   9  
ATOM 6586  C C    . LYS A 1 16 ? -9.817  -1.487  6.055   1.00 0.00 ? 16 LYS A C    9  
ATOM 6587  O O    . LYS A 1 16 ? -8.741  -1.764  6.585   1.00 0.00 ? 16 LYS A O    9  
ATOM 6588  C CB   . LYS A 1 16 ? -10.337 -3.930  6.210   1.00 0.00 ? 16 LYS A CB   9  
ATOM 6589  C CG   . LYS A 1 16 ? -8.954  -4.319  5.711   1.00 0.00 ? 16 LYS A CG   9  
ATOM 6590  C CD   . LYS A 1 16 ? -8.020  -4.667  6.859   1.00 0.00 ? 16 LYS A CD   9  
ATOM 6591  C CE   . LYS A 1 16 ? -8.555  -5.829  7.684   1.00 0.00 ? 16 LYS A CE   9  
ATOM 6592  N NZ   . LYS A 1 16 ? -7.989  -5.840  9.062   1.00 0.00 ? 16 LYS A NZ   9  
ATOM 6593  H H    . LYS A 1 16 ? -11.490 -3.450  3.897   1.00 0.00 ? 16 LYS A H    9  
ATOM 6594  H HA   . LYS A 1 16 ? -11.756 -2.339  6.176   1.00 0.00 ? 16 LYS A HA   9  
ATOM 6595  H HB2  . LYS A 1 16 ? -10.313 -3.904  7.289   1.00 0.00 ? 16 LYS A HB2  9  
ATOM 6596  H HB3  . LYS A 1 16 ? -11.036 -4.692  5.895   1.00 0.00 ? 16 LYS A HB3  9  
ATOM 6597  H HG2  . LYS A 1 16 ? -9.044  -5.177  5.061   1.00 0.00 ? 16 LYS A HG2  9  
ATOM 6598  H HG3  . LYS A 1 16 ? -8.536  -3.490  5.157   1.00 0.00 ? 16 LYS A HG3  9  
ATOM 6599  H HD2  . LYS A 1 16 ? -7.055  -4.940  6.457   1.00 0.00 ? 16 LYS A HD2  9  
ATOM 6600  H HD3  . LYS A 1 16 ? -7.914  -3.803  7.498   1.00 0.00 ? 16 LYS A HD3  9  
ATOM 6601  H HE2  . LYS A 1 16 ? -9.629  -5.744  7.747   1.00 0.00 ? 16 LYS A HE2  9  
ATOM 6602  H HE3  . LYS A 1 16 ? -8.296  -6.753  7.189   1.00 0.00 ? 16 LYS A HE3  9  
ATOM 6603  H HZ1  . LYS A 1 16 ? -7.035  -6.253  9.054   1.00 0.00 ? 16 LYS A HZ1  9  
ATOM 6604  H HZ2  . LYS A 1 16 ? -8.594  -6.406  9.691   1.00 0.00 ? 16 LYS A HZ2  9  
ATOM 6605  H HZ3  . LYS A 1 16 ? -7.934  -4.870  9.434   1.00 0.00 ? 16 LYS A HZ3  9  
ATOM 6606  N N    . MET A 1 17 ? -10.190 -0.253  5.743   1.00 0.00 ? 17 MET A N    9  
ATOM 6607  C CA   . MET A 1 17 ? -9.353  0.926   6.008   1.00 0.00 ? 17 MET A CA   9  
ATOM 6608  C C    . MET A 1 17 ? -9.105  1.131   7.496   1.00 0.00 ? 17 MET A C    9  
ATOM 6609  O O    . MET A 1 17 ? -9.359  2.202   8.051   1.00 0.00 ? 17 MET A O    9  
ATOM 6610  C CB   . MET A 1 17 ? -10.028 2.157   5.448   1.00 0.00 ? 17 MET A CB   9  
ATOM 6611  C CG   . MET A 1 17 ? -9.212  3.433   5.593   1.00 0.00 ? 17 MET A CG   9  
ATOM 6612  S SD   . MET A 1 17 ? -9.535  4.619   4.274   1.00 0.00 ? 17 MET A SD   9  
ATOM 6613  C CE   . MET A 1 17 ? -11.307 4.833   4.431   1.00 0.00 ? 17 MET A CE   9  
ATOM 6614  H H    . MET A 1 17 ? -11.061 -0.134  5.294   1.00 0.00 ? 17 MET A H    9  
ATOM 6615  H HA   . MET A 1 17 ? -8.407  0.783   5.513   1.00 0.00 ? 17 MET A HA   9  
ATOM 6616  H HB2  . MET A 1 17 ? -10.222 1.987   4.406   1.00 0.00 ? 17 MET A HB2  9  
ATOM 6617  H HB3  . MET A 1 17 ? -10.961 2.287   5.971   1.00 0.00 ? 17 MET A HB3  9  
ATOM 6618  H HG2  . MET A 1 17 ? -9.458  3.894   6.538   1.00 0.00 ? 17 MET A HG2  9  
ATOM 6619  H HG3  . MET A 1 17 ? -8.164  3.178   5.580   1.00 0.00 ? 17 MET A HG3  9  
ATOM 6620  H HE1  . MET A 1 17 ? -11.738 3.952   4.880   1.00 0.00 ? 17 MET A HE1  9  
ATOM 6621  H HE2  . MET A 1 17 ? -11.740 4.987   3.453   1.00 0.00 ? 17 MET A HE2  9  
ATOM 6622  H HE3  . MET A 1 17 ? -11.512 5.691   5.053   1.00 0.00 ? 17 MET A HE3  9  
ATOM 6623  N N    . LEU A 1 18 ? -8.605  0.098   8.116   1.00 0.00 ? 18 LEU A N    9  
ATOM 6624  C CA   . LEU A 1 18 ? -8.296  0.108   9.538   1.00 0.00 ? 18 LEU A CA   9  
ATOM 6625  C C    . LEU A 1 18 ? -7.522  -1.148  9.932   1.00 0.00 ? 18 LEU A C    9  
ATOM 6626  O O    . LEU A 1 18 ? -8.024  -1.987  10.681  1.00 0.00 ? 18 LEU A O    9  
ATOM 6627  C CB   . LEU A 1 18 ? -9.587  0.211   10.350  1.00 0.00 ? 18 LEU A CB   9  
ATOM 6628  C CG   . LEU A 1 18 ? -10.527 -0.995  10.229  1.00 0.00 ? 18 LEU A CG   9  
ATOM 6629  C CD1  . LEU A 1 18 ? -10.608 -1.746  11.550  1.00 0.00 ? 18 LEU A CD1  9  
ATOM 6630  C CD2  . LEU A 1 18 ? -11.912 -0.552  9.781   1.00 0.00 ? 18 LEU A CD2  9  
ATOM 6631  H H    . LEU A 1 18 ? -8.434  -0.697  7.597   1.00 0.00 ? 18 LEU A H    9  
ATOM 6632  H HA   . LEU A 1 18 ? -7.683  0.974   9.739   1.00 0.00 ? 18 LEU A HA   9  
ATOM 6633  H HB2  . LEU A 1 18 ? -9.322  0.336   11.389  1.00 0.00 ? 18 LEU A HB2  9  
ATOM 6634  H HB3  . LEU A 1 18 ? -10.121 1.089   10.021  1.00 0.00 ? 18 LEU A HB3  9  
ATOM 6635  H HG   . LEU A 1 18 ? -10.135 -1.674  9.485   1.00 0.00 ? 18 LEU A HG   9  
ATOM 6636  H HD11 . LEU A 1 18 ? -10.669 -2.807  11.357  1.00 0.00 ? 18 LEU A HD11 9  
ATOM 6637  H HD12 . LEU A 1 18 ? -11.488 -1.429  12.090  1.00 0.00 ? 18 LEU A HD12 9  
ATOM 6638  H HD13 . LEU A 1 18 ? -9.729  -1.537  12.139  1.00 0.00 ? 18 LEU A HD13 9  
ATOM 6639  H HD21 . LEU A 1 18 ? -11.973 -0.596  8.703   1.00 0.00 ? 18 LEU A HD21 9  
ATOM 6640  H HD22 . LEU A 1 18 ? -12.091 0.460   10.111  1.00 0.00 ? 18 LEU A HD22 9  
ATOM 6641  H HD23 . LEU A 1 18 ? -12.655 -1.207  10.211  1.00 0.00 ? 18 LEU A HD23 9  
ATOM 6642  N N    . GLY A 1 19 ? -6.301  -1.285  9.418   1.00 0.00 ? 19 GLY A N    9  
ATOM 6643  C CA   . GLY A 1 19 ? -5.504  -2.457  9.731   1.00 0.00 ? 19 GLY A CA   9  
ATOM 6644  C C    . GLY A 1 19 ? -4.005  -2.208  9.682   1.00 0.00 ? 19 GLY A C    9  
ATOM 6645  O O    . GLY A 1 19 ? -3.470  -1.427  10.471  1.00 0.00 ? 19 GLY A O    9  
ATOM 6646  H H    . GLY A 1 19 ? -5.949  -0.593  8.820   1.00 0.00 ? 19 GLY A H    9  
ATOM 6647  H HA2  . GLY A 1 19 ? -5.764  -2.796  10.722  1.00 0.00 ? 19 GLY A HA2  9  
ATOM 6648  H HA3  . GLY A 1 19 ? -5.747  -3.238  9.025   1.00 0.00 ? 19 GLY A HA3  9  
ATOM 6649  N N    . ASP A 1 20 ? -3.329  -2.897  8.765   1.00 0.00 ? 20 ASP A N    9  
ATOM 6650  C CA   . ASP A 1 20 ? -1.881  -2.785  8.610   1.00 0.00 ? 20 ASP A CA   9  
ATOM 6651  C C    . ASP A 1 20 ? -1.415  -1.336  8.536   1.00 0.00 ? 20 ASP A C    9  
ATOM 6652  O O    . ASP A 1 20 ? -2.212  -0.401  8.603   1.00 0.00 ? 20 ASP A O    9  
ATOM 6653  C CB   . ASP A 1 20 ? -1.427  -3.532  7.357   1.00 0.00 ? 20 ASP A CB   9  
ATOM 6654  C CG   . ASP A 1 20 ? -2.050  -4.910  7.238   1.00 0.00 ? 20 ASP A CG   9  
ATOM 6655  O OD1  . ASP A 1 20 ? -2.030  -5.659  8.239   1.00 0.00 ? 20 ASP A OD1  9  
ATOM 6656  O OD2  . ASP A 1 20 ? -2.558  -5.240  6.146   1.00 0.00 ? 20 ASP A OD2  9  
ATOM 6657  H H    . ASP A 1 20 ? -3.817  -3.513  8.182   1.00 0.00 ? 20 ASP A H    9  
ATOM 6658  H HA   . ASP A 1 20 ? -1.421  -3.246  9.470   1.00 0.00 ? 20 ASP A HA   9  
ATOM 6659  H HB2  . ASP A 1 20 ? -1.699  -2.958  6.485   1.00 0.00 ? 20 ASP A HB2  9  
ATOM 6660  H HB3  . ASP A 1 20 ? -0.357  -3.645  7.386   1.00 0.00 ? 20 ASP A HB3  9  
ATOM 6661  N N    . LEU A 1 21 ? -0.104  -1.176  8.395   1.00 0.00 ? 21 LEU A N    9  
ATOM 6662  C CA   . LEU A 1 21 ? 0.517   0.142   8.305   1.00 0.00 ? 21 LEU A CA   9  
ATOM 6663  C C    . LEU A 1 21 ? 1.736   0.096   7.387   1.00 0.00 ? 21 LEU A C    9  
ATOM 6664  O O    . LEU A 1 21 ? 2.823   -0.312  7.796   1.00 0.00 ? 21 LEU A O    9  
ATOM 6665  C CB   . LEU A 1 21 ? 0.927   0.631   9.696   1.00 0.00 ? 21 LEU A CB   9  
ATOM 6666  C CG   . LEU A 1 21 ? 1.756   1.917   9.713   1.00 0.00 ? 21 LEU A CG   9  
ATOM 6667  C CD1  . LEU A 1 21 ? 1.052   3.013   8.927   1.00 0.00 ? 21 LEU A CD1  9  
ATOM 6668  C CD2  . LEU A 1 21 ? 2.014   2.366   11.144  1.00 0.00 ? 21 LEU A CD2  9  
ATOM 6669  H H    . LEU A 1 21 ? 0.464   -1.973  8.349   1.00 0.00 ? 21 LEU A H    9  
ATOM 6670  H HA   . LEU A 1 21 ? -0.206  0.827   7.887   1.00 0.00 ? 21 LEU A HA   9  
ATOM 6671  H HB2  . LEU A 1 21 ? 0.030   0.797   10.275  1.00 0.00 ? 21 LEU A HB2  9  
ATOM 6672  H HB3  . LEU A 1 21 ? 1.504   -0.148  10.173  1.00 0.00 ? 21 LEU A HB3  9  
ATOM 6673  H HG   . LEU A 1 21 ? 2.709   1.729   9.243   1.00 0.00 ? 21 LEU A HG   9  
ATOM 6674  H HD11 . LEU A 1 21 ? -0.012  2.958   9.107   1.00 0.00 ? 21 LEU A HD11 9  
ATOM 6675  H HD12 . LEU A 1 21 ? 1.247   2.881   7.873   1.00 0.00 ? 21 LEU A HD12 9  
ATOM 6676  H HD13 . LEU A 1 21 ? 1.421   3.976   9.244   1.00 0.00 ? 21 LEU A HD13 9  
ATOM 6677  H HD21 . LEU A 1 21 ? 3.022   2.744   11.225  1.00 0.00 ? 21 LEU A HD21 9  
ATOM 6678  H HD22 . LEU A 1 21 ? 1.888   1.528   11.813  1.00 0.00 ? 21 LEU A HD22 9  
ATOM 6679  H HD23 . LEU A 1 21 ? 1.314   3.146   11.408  1.00 0.00 ? 21 LEU A HD23 9  
ATOM 6680  N N    . ILE A 1 22 ? 1.537   0.510   6.142   1.00 0.00 ? 22 ILE A N    9  
ATOM 6681  C CA   . ILE A 1 22 ? 2.605   0.515   5.147   1.00 0.00 ? 22 ILE A CA   9  
ATOM 6682  C C    . ILE A 1 22 ? 3.290   1.878   5.084   1.00 0.00 ? 22 ILE A C    9  
ATOM 6683  O O    . ILE A 1 22 ? 2.700   2.898   5.441   1.00 0.00 ? 22 ILE A O    9  
ATOM 6684  C CB   . ILE A 1 22 ? 2.050   0.138   3.754   1.00 0.00 ? 22 ILE A CB   9  
ATOM 6685  C CG1  . ILE A 1 22 ? 3.036   0.470   2.646   1.00 0.00 ? 22 ILE A CG1  9  
ATOM 6686  C CG2  . ILE A 1 22 ? 0.725   0.833   3.494   1.00 0.00 ? 22 ILE A CG2  9  
ATOM 6687  C CD1  . ILE A 1 22 ? 2.872   1.863   2.082   1.00 0.00 ? 22 ILE A CD1  9  
ATOM 6688  H H    . ILE A 1 22 ? 0.644   0.815   5.882   1.00 0.00 ? 22 ILE A H    9  
ATOM 6689  H HA   . ILE A 1 22 ? 3.332   -0.230  5.435   1.00 0.00 ? 22 ILE A HA   9  
ATOM 6690  H HB   . ILE A 1 22 ? 1.876   -0.919  3.746   1.00 0.00 ? 22 ILE A HB   9  
ATOM 6691  H HG12 . ILE A 1 22 ? 4.040   0.377   3.023   1.00 0.00 ? 22 ILE A HG12 9  
ATOM 6692  H HG13 . ILE A 1 22 ? 2.897   -0.232  1.835   1.00 0.00 ? 22 ILE A HG13 9  
ATOM 6693  H HG21 . ILE A 1 22 ? 0.802   1.870   3.784   1.00 0.00 ? 22 ILE A HG21 9  
ATOM 6694  H HG22 . ILE A 1 22 ? -0.051  0.352   4.065   1.00 0.00 ? 22 ILE A HG22 9  
ATOM 6695  H HG23 . ILE A 1 22 ? 0.491   0.772   2.442   1.00 0.00 ? 22 ILE A HG23 9  
ATOM 6696  H HD11 . ILE A 1 22 ? 3.832   2.239   1.777   1.00 0.00 ? 22 ILE A HD11 9  
ATOM 6697  H HD12 . ILE A 1 22 ? 2.451   2.512   2.835   1.00 0.00 ? 22 ILE A HD12 9  
ATOM 6698  H HD13 . ILE A 1 22 ? 2.214   1.826   1.228   1.00 0.00 ? 22 ILE A HD13 9  
ATOM 6699  N N    . CYS A 1 23 ? 4.537   1.888   4.617   1.00 0.00 ? 23 CYS A N    9  
ATOM 6700  C CA   . CYS A 1 23 ? 5.296   3.133   4.499   1.00 0.00 ? 23 CYS A CA   9  
ATOM 6701  C C    . CYS A 1 23 ? 5.592   3.418   3.032   1.00 0.00 ? 23 CYS A C    9  
ATOM 6702  O O    . CYS A 1 23 ? 6.633   3.019   2.513   1.00 0.00 ? 23 CYS A O    9  
ATOM 6703  C CB   . CYS A 1 23 ? 6.602   3.046   5.294   1.00 0.00 ? 23 CYS A CB   9  
ATOM 6704  S SG   . CYS A 1 23 ? 6.494   2.040   6.812   1.00 0.00 ? 23 CYS A SG   9  
ATOM 6705  H H    . CYS A 1 23 ? 4.956   1.036   4.335   1.00 0.00 ? 23 CYS A H    9  
ATOM 6706  H HA   . CYS A 1 23 ? 4.689   3.933   4.896   1.00 0.00 ? 23 CYS A HA   9  
ATOM 6707  H HB2  . CYS A 1 23 ? 7.366   2.612   4.668   1.00 0.00 ? 23 CYS A HB2  9  
ATOM 6708  H HB3  . CYS A 1 23 ? 6.906   4.042   5.582   1.00 0.00 ? 23 CYS A HB3  9  
ATOM 6709  N N    . ALA A 1 24 ? 4.651   4.073   2.357   1.00 0.00 ? 24 ALA A N    9  
ATOM 6710  C CA   . ALA A 1 24 ? 4.802   4.362   0.935   1.00 0.00 ? 24 ALA A CA   9  
ATOM 6711  C C    . ALA A 1 24 ? 5.565   5.642   0.656   1.00 0.00 ? 24 ALA A C    9  
ATOM 6712  O O    . ALA A 1 24 ? 5.266   6.700   1.207   1.00 0.00 ? 24 ALA A O    9  
ATOM 6713  C CB   . ALA A 1 24 ? 3.446   4.425   0.257   1.00 0.00 ? 24 ALA A CB   9  
ATOM 6714  H H    . ALA A 1 24 ? 3.824   4.340   2.817   1.00 0.00 ? 24 ALA A H    9  
ATOM 6715  H HA   . ALA A 1 24 ? 5.343   3.542   0.496   1.00 0.00 ? 24 ALA A HA   9  
ATOM 6716  H HB1  . ALA A 1 24 ? 3.504   5.077   -0.603  1.00 0.00 ? 24 ALA A HB1  9  
ATOM 6717  H HB2  . ALA A 1 24 ? 2.715   4.808   0.951   1.00 0.00 ? 24 ALA A HB2  9  
ATOM 6718  H HB3  . ALA A 1 24 ? 3.157   3.435   -0.063  1.00 0.00 ? 24 ALA A HB3  9  
ATOM 6719  N N    . VAL A 1 25 ? 6.534   5.535   -0.241  1.00 0.00 ? 25 VAL A N    9  
ATOM 6720  C CA   . VAL A 1 25 ? 7.335   6.671   -0.652  1.00 0.00 ? 25 VAL A CA   9  
ATOM 6721  C C    . VAL A 1 25 ? 7.349   6.774   -2.170  1.00 0.00 ? 25 VAL A C    9  
ATOM 6722  O O    . VAL A 1 25 ? 7.243   5.763   -2.877  1.00 0.00 ? 25 VAL A O    9  
ATOM 6723  C CB   . VAL A 1 25 ? 8.777   6.582   -0.110  1.00 0.00 ? 25 VAL A CB   9  
ATOM 6724  C CG1  . VAL A 1 25 ? 9.584   5.510   -0.832  1.00 0.00 ? 25 VAL A CG1  9  
ATOM 6725  C CG2  . VAL A 1 25 ? 9.465   7.935   -0.208  1.00 0.00 ? 25 VAL A CG2  9  
ATOM 6726  H H    . VAL A 1 25 ? 6.702   4.664   -0.656  1.00 0.00 ? 25 VAL A H    9  
ATOM 6727  H HA   . VAL A 1 25 ? 6.878   7.567   -0.253  1.00 0.00 ? 25 VAL A HA   9  
ATOM 6728  H HB   . VAL A 1 25 ? 8.721   6.310   0.930   1.00 0.00 ? 25 VAL A HB   9  
ATOM 6729  H HG11 . VAL A 1 25 ? 10.637  5.725   -0.729  1.00 0.00 ? 25 VAL A HG11 9  
ATOM 6730  H HG12 . VAL A 1 25 ? 9.322   5.499   -1.878  1.00 0.00 ? 25 VAL A HG12 9  
ATOM 6731  H HG13 . VAL A 1 25 ? 9.371   4.546   -0.396  1.00 0.00 ? 25 VAL A HG13 9  
ATOM 6732  H HG21 . VAL A 1 25 ? 10.226  8.006   0.555   1.00 0.00 ? 25 VAL A HG21 9  
ATOM 6733  H HG22 . VAL A 1 25 ? 8.737   8.720   -0.066  1.00 0.00 ? 25 VAL A HG22 9  
ATOM 6734  H HG23 . VAL A 1 25 ? 9.922   8.037   -1.182  1.00 0.00 ? 25 VAL A HG23 9  
ATOM 6735  N N    . ILE A 1 26 ? 7.458   8.001   -2.661  1.00 0.00 ? 26 ILE A N    9  
ATOM 6736  C CA   . ILE A 1 26 ? 7.476   8.247   -4.099  1.00 0.00 ? 26 ILE A CA   9  
ATOM 6737  C C    . ILE A 1 26 ? 8.363   9.436   -4.453  1.00 0.00 ? 26 ILE A C    9  
ATOM 6738  O O    . ILE A 1 26 ? 7.890   10.567  -4.564  1.00 0.00 ? 26 ILE A O    9  
ATOM 6739  C CB   . ILE A 1 26 ? 6.065   8.495   -4.675  1.00 0.00 ? 26 ILE A CB   9  
ATOM 6740  C CG1  . ILE A 1 26 ? 5.053   8.820   -3.563  1.00 0.00 ? 26 ILE A CG1  9  
ATOM 6741  C CG2  . ILE A 1 26 ? 5.613   7.302   -5.506  1.00 0.00 ? 26 ILE A CG2  9  
ATOM 6742  C CD1  . ILE A 1 26 ? 4.610   7.622   -2.747  1.00 0.00 ? 26 ILE A CD1  9  
ATOM 6743  H H    . ILE A 1 26 ? 7.521   8.756   -2.038  1.00 0.00 ? 26 ILE A H    9  
ATOM 6744  H HA   . ILE A 1 26 ? 7.881   7.366   -4.575  1.00 0.00 ? 26 ILE A HA   9  
ATOM 6745  H HB   . ILE A 1 26 ? 6.133   9.344   -5.341  1.00 0.00 ? 26 ILE A HB   9  
ATOM 6746  H HG12 . ILE A 1 26 ? 5.497   9.528   -2.883  1.00 0.00 ? 26 ILE A HG12 9  
ATOM 6747  H HG13 . ILE A 1 26 ? 4.173   9.262   -4.008  1.00 0.00 ? 26 ILE A HG13 9  
ATOM 6748  H HG21 . ILE A 1 26 ? 6.480   6.785   -5.891  1.00 0.00 ? 26 ILE A HG21 9  
ATOM 6749  H HG22 . ILE A 1 26 ? 5.007   7.647   -6.329  1.00 0.00 ? 26 ILE A HG22 9  
ATOM 6750  H HG23 . ILE A 1 26 ? 5.037   6.627   -4.891  1.00 0.00 ? 26 ILE A HG23 9  
ATOM 6751  H HD11 . ILE A 1 26 ? 5.063   7.666   -1.767  1.00 0.00 ? 26 ILE A HD11 9  
ATOM 6752  H HD12 . ILE A 1 26 ? 4.914   6.712   -3.243  1.00 0.00 ? 26 ILE A HD12 9  
ATOM 6753  H HD13 . ILE A 1 26 ? 3.534   7.635   -2.645  1.00 0.00 ? 26 ILE A HD13 9  
ATOM 6754  N N    . GLY A 1 27 ? 9.647   9.164   -4.630  1.00 0.00 ? 27 GLY A N    9  
ATOM 6755  C CA   . GLY A 1 27 ? 10.605  10.200  -4.977  1.00 0.00 ? 27 GLY A CA   9  
ATOM 6756  C C    . GLY A 1 27 ? 10.851  11.158  -3.836  1.00 0.00 ? 27 GLY A C    9  
ATOM 6757  O O    . GLY A 1 27 ? 11.981  11.321  -3.376  1.00 0.00 ? 27 GLY A O    9  
ATOM 6758  H H    . GLY A 1 27 ? 9.948   8.250   -4.523  1.00 0.00 ? 27 GLY A H    9  
ATOM 6759  H HA2  . GLY A 1 27 ? 11.540  9.736   -5.251  1.00 0.00 ? 27 GLY A HA2  9  
ATOM 6760  H HA3  . GLY A 1 27 ? 10.228  10.754  -5.824  1.00 0.00 ? 27 GLY A HA3  9  
ATOM 6761  N N    . ASP A 1 28 ? 9.782   11.786  -3.379  1.00 0.00 ? 28 ASP A N    9  
ATOM 6762  C CA   . ASP A 1 28 ? 9.855   12.733  -2.280  1.00 0.00 ? 28 ASP A CA   9  
ATOM 6763  C C    . ASP A 1 28 ? 8.515   12.812  -1.558  1.00 0.00 ? 28 ASP A C    9  
ATOM 6764  O O    . ASP A 1 28 ? 8.201   13.822  -0.927  1.00 0.00 ? 28 ASP A O    9  
ATOM 6765  C CB   . ASP A 1 28 ? 10.256  14.116  -2.792  1.00 0.00 ? 28 ASP A CB   9  
ATOM 6766  C CG   . ASP A 1 28 ? 9.334   14.616  -3.887  1.00 0.00 ? 28 ASP A CG   9  
ATOM 6767  O OD1  . ASP A 1 28 ? 8.150   14.218  -3.894  1.00 0.00 ? 28 ASP A OD1  9  
ATOM 6768  O OD2  . ASP A 1 28 ? 9.796   15.405  -4.738  1.00 0.00 ? 28 ASP A OD2  9  
ATOM 6769  H H    . ASP A 1 28 ? 8.915   11.601  -3.792  1.00 0.00 ? 28 ASP A H    9  
ATOM 6770  H HA   . ASP A 1 28 ? 10.605  12.381  -1.587  1.00 0.00 ? 28 ASP A HA   9  
ATOM 6771  H HB2  . ASP A 1 28 ? 10.226  14.820  -1.974  1.00 0.00 ? 28 ASP A HB2  9  
ATOM 6772  H HB3  . ASP A 1 28 ? 11.261  14.070  -3.186  1.00 0.00 ? 28 ASP A HB3  9  
ATOM 6773  N N    . ALA A 1 29 ? 7.728   11.742  -1.652  1.00 0.00 ? 29 ALA A N    9  
ATOM 6774  C CA   . ALA A 1 29 ? 6.426   11.705  -1.001  1.00 0.00 ? 29 ALA A CA   9  
ATOM 6775  C C    . ALA A 1 29 ? 6.286   10.449  -0.153  1.00 0.00 ? 29 ALA A C    9  
ATOM 6776  O O    . ALA A 1 29 ? 5.719   9.449   -0.593  1.00 0.00 ? 29 ALA A O    9  
ATOM 6777  C CB   . ALA A 1 29 ? 5.312   11.784  -2.036  1.00 0.00 ? 29 ALA A CB   9  
ATOM 6778  H H    . ALA A 1 29 ? 8.031   10.957  -2.168  1.00 0.00 ? 29 ALA A H    9  
ATOM 6779  H HA   . ALA A 1 29 ? 6.349   12.570  -0.358  1.00 0.00 ? 29 ALA A HA   9  
ATOM 6780  H HB1  . ALA A 1 29 ? 5.705   11.517  -3.006  1.00 0.00 ? 29 ALA A HB1  9  
ATOM 6781  H HB2  . ALA A 1 29 ? 4.923   12.790  -2.069  1.00 0.00 ? 29 ALA A HB2  9  
ATOM 6782  H HB3  . ALA A 1 29 ? 4.521   11.099  -1.767  1.00 0.00 ? 29 ALA A HB3  9  
ATOM 6783  N N    . LYS A 1 30 ? 6.814   10.507  1.064   1.00 0.00 ? 30 LYS A N    9  
ATOM 6784  C CA   . LYS A 1 30 ? 6.756   9.374   1.975   1.00 0.00 ? 30 LYS A CA   9  
ATOM 6785  C C    . LYS A 1 30 ? 5.599   9.523   2.959   1.00 0.00 ? 30 LYS A C    9  
ATOM 6786  O O    . LYS A 1 30 ? 5.681   10.290  3.919   1.00 0.00 ? 30 LYS A O    9  
ATOM 6787  C CB   . LYS A 1 30 ? 8.077   9.237   2.734   1.00 0.00 ? 30 LYS A CB   9  
ATOM 6788  C CG   . LYS A 1 30 ? 8.103   8.074   3.712   1.00 0.00 ? 30 LYS A CG   9  
ATOM 6789  C CD   . LYS A 1 30 ? 9.328   8.132   4.613   1.00 0.00 ? 30 LYS A CD   9  
ATOM 6790  C CE   . LYS A 1 30 ? 9.773   6.744   5.040   1.00 0.00 ? 30 LYS A CE   9  
ATOM 6791  N NZ   . LYS A 1 30 ? 9.317   6.412   6.418   1.00 0.00 ? 30 LYS A NZ   9  
ATOM 6792  H H    . LYS A 1 30 ? 7.257   11.332  1.354   1.00 0.00 ? 30 LYS A H    9  
ATOM 6793  H HA   . LYS A 1 30 ? 6.598   8.485   1.381   1.00 0.00 ? 30 LYS A HA   9  
ATOM 6794  H HB2  . LYS A 1 30 ? 8.876   9.096   2.021   1.00 0.00 ? 30 LYS A HB2  9  
ATOM 6795  H HB3  . LYS A 1 30 ? 8.257   10.147  3.287   1.00 0.00 ? 30 LYS A HB3  9  
ATOM 6796  H HG2  . LYS A 1 30 ? 7.216   8.111   4.326   1.00 0.00 ? 30 LYS A HG2  9  
ATOM 6797  H HG3  . LYS A 1 30 ? 8.120   7.148   3.157   1.00 0.00 ? 30 LYS A HG3  9  
ATOM 6798  H HD2  . LYS A 1 30 ? 10.134  8.610   4.076   1.00 0.00 ? 30 LYS A HD2  9  
ATOM 6799  H HD3  . LYS A 1 30 ? 9.087   8.711   5.494   1.00 0.00 ? 30 LYS A HD3  9  
ATOM 6800  H HE2  . LYS A 1 30 ? 9.364   6.019   4.351   1.00 0.00 ? 30 LYS A HE2  9  
ATOM 6801  H HE3  . LYS A 1 30 ? 10.852  6.700   5.007   1.00 0.00 ? 30 LYS A HE3  9  
ATOM 6802  H HZ1  . LYS A 1 30 ? 8.334   6.723   6.553   1.00 0.00 ? 30 LYS A HZ1  9  
ATOM 6803  H HZ2  . LYS A 1 30 ? 9.918   6.891   7.119   1.00 0.00 ? 30 LYS A HZ2  9  
ATOM 6804  H HZ3  . LYS A 1 30 ? 9.370   5.386   6.575   1.00 0.00 ? 30 LYS A HZ3  9  
ATOM 6805  N N    . GLU A 1 31 ? 4.524   8.780   2.716   1.00 0.00 ? 31 GLU A N    9  
ATOM 6806  C CA   . GLU A 1 31 ? 3.350   8.822   3.579   1.00 0.00 ? 31 GLU A CA   9  
ATOM 6807  C C    . GLU A 1 31 ? 2.869   7.410   3.899   1.00 0.00 ? 31 GLU A C    9  
ATOM 6808  O O    . GLU A 1 31 ? 2.874   6.533   3.036   1.00 0.00 ? 31 GLU A O    9  
ATOM 6809  C CB   . GLU A 1 31 ? 2.227   9.615   2.909   1.00 0.00 ? 31 GLU A CB   9  
ATOM 6810  C CG   . GLU A 1 31 ? 1.407   10.449  3.879   1.00 0.00 ? 31 GLU A CG   9  
ATOM 6811  C CD   . GLU A 1 31 ? 0.751   9.610   4.958   1.00 0.00 ? 31 GLU A CD   9  
ATOM 6812  O OE1  . GLU A 1 31 ? 1.385   9.399   6.013   1.00 0.00 ? 31 GLU A OE1  9  
ATOM 6813  O OE2  . GLU A 1 31 ? -0.397  9.165   4.748   1.00 0.00 ? 31 GLU A OE2  9  
ATOM 6814  H H    . GLU A 1 31 ? 4.521   8.186   1.937   1.00 0.00 ? 31 GLU A H    9  
ATOM 6815  H HA   . GLU A 1 31 ? 3.629   9.314   4.498   1.00 0.00 ? 31 GLU A HA   9  
ATOM 6816  H HB2  . GLU A 1 31 ? 2.659   10.279  2.174   1.00 0.00 ? 31 GLU A HB2  9  
ATOM 6817  H HB3  . GLU A 1 31 ? 1.561   8.926   2.409   1.00 0.00 ? 31 GLU A HB3  9  
ATOM 6818  H HG2  . GLU A 1 31 ? 2.057   11.171  4.352   1.00 0.00 ? 31 GLU A HG2  9  
ATOM 6819  H HG3  . GLU A 1 31 ? 0.636   10.966  3.327   1.00 0.00 ? 31 GLU A HG3  9  
ATOM 6820  N N    . GLU A 1 32 ? 2.459   7.196   5.145   1.00 0.00 ? 32 GLU A N    9  
ATOM 6821  C CA   . GLU A 1 32 ? 1.980   5.886   5.571   1.00 0.00 ? 32 GLU A CA   9  
ATOM 6822  C C    . GLU A 1 32 ? 0.472   5.777   5.419   1.00 0.00 ? 32 GLU A C    9  
ATOM 6823  O O    . GLU A 1 32 ? -0.242  6.780   5.444   1.00 0.00 ? 32 GLU A O    9  
ATOM 6824  C CB   . GLU A 1 32 ? 2.357   5.618   7.027   1.00 0.00 ? 32 GLU A CB   9  
ATOM 6825  C CG   . GLU A 1 32 ? 3.850   5.447   7.256   1.00 0.00 ? 32 GLU A CG   9  
ATOM 6826  C CD   . GLU A 1 32 ? 4.656   6.653   6.812   1.00 0.00 ? 32 GLU A CD   9  
ATOM 6827  O OE1  . GLU A 1 32 ? 4.966   6.747   5.606   1.00 0.00 ? 32 GLU A OE1  9  
ATOM 6828  O OE2  . GLU A 1 32 ? 4.978   7.501   7.669   1.00 0.00 ? 32 GLU A OE2  9  
ATOM 6829  H H    . GLU A 1 32 ? 2.478   7.933   5.790   1.00 0.00 ? 32 GLU A H    9  
ATOM 6830  H HA   . GLU A 1 32 ? 2.449   5.141   4.945   1.00 0.00 ? 32 GLU A HA   9  
ATOM 6831  H HB2  . GLU A 1 32 ? 2.010   6.443   7.632   1.00 0.00 ? 32 GLU A HB2  9  
ATOM 6832  H HB3  . GLU A 1 32 ? 1.859   4.715   7.350   1.00 0.00 ? 32 GLU A HB3  9  
ATOM 6833  H HG2  . GLU A 1 32 ? 4.023   5.289   8.310   1.00 0.00 ? 32 GLU A HG2  9  
ATOM 6834  H HG3  . GLU A 1 32 ? 4.189   4.583   6.703   1.00 0.00 ? 32 GLU A HG3  9  
ATOM 6835  N N    . HIS A 1 33 ? -0.007  4.550   5.271   1.00 0.00 ? 33 HIS A N    9  
ATOM 6836  C CA   . HIS A 1 33 ? -1.432  4.302   5.126   1.00 0.00 ? 33 HIS A CA   9  
ATOM 6837  C C    . HIS A 1 33 ? -1.764  2.854   5.460   1.00 0.00 ? 33 HIS A C    9  
ATOM 6838  O O    . HIS A 1 33 ? -0.947  1.957   5.260   1.00 0.00 ? 33 HIS A O    9  
ATOM 6839  C CB   . HIS A 1 33 ? -1.878  4.622   3.705   1.00 0.00 ? 33 HIS A CB   9  
ATOM 6840  C CG   . HIS A 1 33 ? -1.018  3.986   2.665   1.00 0.00 ? 33 HIS A CG   9  
ATOM 6841  N ND1  . HIS A 1 33 ? -1.427  2.916   1.902   1.00 0.00 ? 33 HIS A ND1  9  
ATOM 6842  C CD2  . HIS A 1 33 ? 0.242   4.272   2.268   1.00 0.00 ? 33 HIS A CD2  9  
ATOM 6843  C CE1  . HIS A 1 33 ? -0.454  2.570   1.081   1.00 0.00 ? 33 HIS A CE1  9  
ATOM 6844  N NE2  . HIS A 1 33 ? 0.569   3.376   1.282   1.00 0.00 ? 33 HIS A NE2  9  
ATOM 6845  H H    . HIS A 1 33 ? 0.615   3.791   5.263   1.00 0.00 ? 33 HIS A H    9  
ATOM 6846  H HA   . HIS A 1 33 ? -1.955  4.948   5.814   1.00 0.00 ? 33 HIS A HA   9  
ATOM 6847  H HB2  . HIS A 1 33 ? -2.889  4.272   3.563   1.00 0.00 ? 33 HIS A HB2  9  
ATOM 6848  H HB3  . HIS A 1 33 ? -1.847  5.692   3.558   1.00 0.00 ? 33 HIS A HB3  9  
ATOM 6849  H HD1  . HIS A 1 33 ? -2.300  2.474   1.955   1.00 0.00 ? 33 HIS A HD1  9  
ATOM 6850  H HD2  . HIS A 1 33 ? 0.874   5.058   2.656   1.00 0.00 ? 33 HIS A HD2  9  
ATOM 6851  H HE1  . HIS A 1 33 ? -0.489  1.768   0.360   1.00 0.00 ? 33 HIS A HE1  9  
ATOM 6852  H HE2  . HIS A 1 33 ? 1.334   3.459   0.681   1.00 0.00 ? 33 HIS A HE2  9  
ATOM 6853  N N    . ARG A 1 34 ? -2.961  2.635   5.977   1.00 0.00 ? 34 ARG A N    9  
ATOM 6854  C CA   . ARG A 1 34 ? -3.399  1.294   6.347   1.00 0.00 ? 34 ARG A CA   9  
ATOM 6855  C C    . ARG A 1 34 ? -3.925  0.522   5.137   1.00 0.00 ? 34 ARG A C    9  
ATOM 6856  O O    . ARG A 1 34 ? -3.812  -0.703  5.080   1.00 0.00 ? 34 ARG A O    9  
ATOM 6857  C CB   . ARG A 1 34 ? -4.478  1.366   7.430   1.00 0.00 ? 34 ARG A CB   9  
ATOM 6858  C CG   . ARG A 1 34 ? -4.238  2.458   8.462   1.00 0.00 ? 34 ARG A CG   9  
ATOM 6859  C CD   . ARG A 1 34 ? -2.873  2.315   9.118   1.00 0.00 ? 34 ARG A CD   9  
ATOM 6860  N NE   . ARG A 1 34 ? -2.932  1.500   10.328  1.00 0.00 ? 34 ARG A NE   9  
ATOM 6861  C CZ   . ARG A 1 34 ? -3.571  1.864   11.436  1.00 0.00 ? 34 ARG A CZ   9  
ATOM 6862  N NH1  . ARG A 1 34 ? -4.205  3.029   11.493  1.00 0.00 ? 34 ARG A NH1  9  
ATOM 6863  N NH2  . ARG A 1 34 ? -3.578  1.062   12.492  1.00 0.00 ? 34 ARG A NH2  9  
ATOM 6864  H H    . ARG A 1 34 ? -3.561  3.395   6.121   1.00 0.00 ? 34 ARG A H    9  
ATOM 6865  H HA   . ARG A 1 34 ? -2.544  0.769   6.744   1.00 0.00 ? 34 ARG A HA   9  
ATOM 6866  H HB2  . ARG A 1 34 ? -5.433  1.549   6.959   1.00 0.00 ? 34 ARG A HB2  9  
ATOM 6867  H HB3  . ARG A 1 34 ? -4.516  0.417   7.944   1.00 0.00 ? 34 ARG A HB3  9  
ATOM 6868  H HG2  . ARG A 1 34 ? -4.291  3.419   7.972   1.00 0.00 ? 34 ARG A HG2  9  
ATOM 6869  H HG3  . ARG A 1 34 ? -5.002  2.395   9.222   1.00 0.00 ? 34 ARG A HG3  9  
ATOM 6870  H HD2  . ARG A 1 34 ? -2.195  1.853   8.416   1.00 0.00 ? 34 ARG A HD2  9  
ATOM 6871  H HD3  . ARG A 1 34 ? -2.508  3.299   9.375   1.00 0.00 ? 34 ARG A HD3  9  
ATOM 6872  H HE   . ARG A 1 34 ? -2.471  0.634   10.314  1.00 0.00 ? 34 ARG A HE   9  
ATOM 6873  H HH11 . ARG A 1 34 ? -4.203  3.640   10.700  1.00 0.00 ? 34 ARG A HH11 9  
ATOM 6874  H HH12 . ARG A 1 34 ? -4.684  3.298   12.328  1.00 0.00 ? 34 ARG A HH12 9  
ATOM 6875  H HH21 . ARG A 1 34 ? -3.103  0.183   12.454  1.00 0.00 ? 34 ARG A HH21 9  
ATOM 6876  H HH22 . ARG A 1 34 ? -4.059  1.336   13.325  1.00 0.00 ? 34 ARG A HH22 9  
ATOM 6877  N N    . ASN A 1 35 ? -4.507  1.236   4.177   1.00 0.00 ? 35 ASN A N    9  
ATOM 6878  C CA   . ASN A 1 35 ? -5.052  0.598   2.981   1.00 0.00 ? 35 ASN A CA   9  
ATOM 6879  C C    . ASN A 1 35 ? -3.977  0.397   1.918   1.00 0.00 ? 35 ASN A C    9  
ATOM 6880  O O    . ASN A 1 35 ? -4.103  0.882   0.791   1.00 0.00 ? 35 ASN A O    9  
ATOM 6881  C CB   . ASN A 1 35 ? -6.197  1.430   2.400   1.00 0.00 ? 35 ASN A CB   9  
ATOM 6882  C CG   . ASN A 1 35 ? -7.514  1.193   3.111   1.00 0.00 ? 35 ASN A CG   9  
ATOM 6883  O OD1  . ASN A 1 35 ? -8.231  2.138   3.432   1.00 0.00 ? 35 ASN A OD1  9  
ATOM 6884  N ND2  . ASN A 1 35 ? -7.846  -0.072  3.354   1.00 0.00 ? 35 ASN A ND2  9  
ATOM 6885  H H    . ASN A 1 35 ? -4.576  2.208   4.277   1.00 0.00 ? 35 ASN A H    9  
ATOM 6886  H HA   . ASN A 1 35 ? -5.434  -0.369  3.269   1.00 0.00 ? 35 ASN A HA   9  
ATOM 6887  H HB2  . ASN A 1 35 ? -5.948  2.476   2.483   1.00 0.00 ? 35 ASN A HB2  9  
ATOM 6888  H HB3  . ASN A 1 35 ? -6.321  1.176   1.357   1.00 0.00 ? 35 ASN A HB3  9  
ATOM 6889  H HD21 . ASN A 1 35 ? -7.231  -0.776  3.063   1.00 0.00 ? 35 ASN A HD21 9  
ATOM 6890  H HD22 . ASN A 1 35 ? -8.693  -0.247  3.815   1.00 0.00 ? 35 ASN A HD22 9  
ATOM 6891  N N    . MET A 1 36 ? -2.925  -0.329  2.272   1.00 0.00 ? 36 MET A N    9  
ATOM 6892  C CA   . MET A 1 36 ? -1.839  -0.595  1.337   1.00 0.00 ? 36 MET A CA   9  
ATOM 6893  C C    . MET A 1 36 ? -2.368  -1.216  0.055   1.00 0.00 ? 36 MET A C    9  
ATOM 6894  O O    . MET A 1 36 ? -1.741  -1.112  -0.998  1.00 0.00 ? 36 MET A O    9  
ATOM 6895  C CB   . MET A 1 36 ? -0.799  -1.523  1.971   1.00 0.00 ? 36 MET A CB   9  
ATOM 6896  C CG   . MET A 1 36 ? 0.501   -1.608  1.187   1.00 0.00 ? 36 MET A CG   9  
ATOM 6897  S SD   . MET A 1 36 ? 1.618   -2.870  1.830   1.00 0.00 ? 36 MET A SD   9  
ATOM 6898  C CE   . MET A 1 36 ? 1.089   -4.302  0.891   1.00 0.00 ? 36 MET A CE   9  
ATOM 6899  H H    . MET A 1 36 ? -2.877  -0.697  3.180   1.00 0.00 ? 36 MET A H    9  
ATOM 6900  H HA   . MET A 1 36 ? -1.379  0.343   1.094   1.00 0.00 ? 36 MET A HA   9  
ATOM 6901  H HB2  . MET A 1 36 ? -0.574  -1.167  2.964   1.00 0.00 ? 36 MET A HB2  9  
ATOM 6902  H HB3  . MET A 1 36 ? -1.216  -2.516  2.041   1.00 0.00 ? 36 MET A HB3  9  
ATOM 6903  H HG2  . MET A 1 36 ? 0.272   -1.843  0.158   1.00 0.00 ? 36 MET A HG2  9  
ATOM 6904  H HG3  . MET A 1 36 ? 0.999   -0.652  1.234   1.00 0.00 ? 36 MET A HG3  9  
ATOM 6905  H HE1  . MET A 1 36 ? 1.498   -4.248  -0.107  1.00 0.00 ? 36 MET A HE1  9  
ATOM 6906  H HE2  . MET A 1 36 ? 0.011   -4.320  0.840   1.00 0.00 ? 36 MET A HE2  9  
ATOM 6907  H HE3  . MET A 1 36 ? 1.441   -5.200  1.376   1.00 0.00 ? 36 MET A HE3  9  
ATOM 6908  N N    . CYS A 1 37 ? -3.522  -1.859  0.149   1.00 0.00 ? 37 CYS A N    9  
ATOM 6909  C CA   . CYS A 1 37 ? -4.131  -2.498  -1.004  1.00 0.00 ? 37 CYS A CA   9  
ATOM 6910  C C    . CYS A 1 37 ? -4.515  -1.475  -2.062  1.00 0.00 ? 37 CYS A C    9  
ATOM 6911  O O    . CYS A 1 37 ? -3.944  -1.444  -3.150  1.00 0.00 ? 37 CYS A O    9  
ATOM 6912  C CB   . CYS A 1 37 ? -5.364  -3.295  -0.574  1.00 0.00 ? 37 CYS A CB   9  
ATOM 6913  S SG   . CYS A 1 37 ? -4.981  -4.889  0.221   1.00 0.00 ? 37 CYS A SG   9  
ATOM 6914  H H    . CYS A 1 37 ? -3.976  -1.907  1.017   1.00 0.00 ? 37 CYS A H    9  
ATOM 6915  H HA   . CYS A 1 37 ? -3.408  -3.170  -1.425  1.00 0.00 ? 37 CYS A HA   9  
ATOM 6916  H HB2  . CYS A 1 37 ? -5.935  -2.709  0.130   1.00 0.00 ? 37 CYS A HB2  9  
ATOM 6917  H HB3  . CYS A 1 37 ? -5.973  -3.498  -1.441  1.00 0.00 ? 37 CYS A HB3  9  
ATOM 6918  N N    . ALA A 1 38 ? -5.489  -0.644  -1.738  1.00 0.00 ? 38 ALA A N    9  
ATOM 6919  C CA   . ALA A 1 38 ? -5.962  0.375   -2.666  1.00 0.00 ? 38 ALA A CA   9  
ATOM 6920  C C    . ALA A 1 38 ? -4.832  1.265   -3.160  1.00 0.00 ? 38 ALA A C    9  
ATOM 6921  O O    . ALA A 1 38 ? -4.958  1.915   -4.198  1.00 0.00 ? 38 ALA A O    9  
ATOM 6922  C CB   . ALA A 1 38 ? -7.056  1.212   -2.021  1.00 0.00 ? 38 ALA A CB   9  
ATOM 6923  H H    . ALA A 1 38 ? -5.904  -0.721  -0.855  1.00 0.00 ? 38 ALA A H    9  
ATOM 6924  H HA   . ALA A 1 38 ? -6.387  -0.132  -3.518  1.00 0.00 ? 38 ALA A HA   9  
ATOM 6925  H HB1  . ALA A 1 38 ? -7.497  0.661   -1.204  1.00 0.00 ? 38 ALA A HB1  9  
ATOM 6926  H HB2  . ALA A 1 38 ? -7.816  1.439   -2.754  1.00 0.00 ? 38 ALA A HB2  9  
ATOM 6927  H HB3  . ALA A 1 38 ? -6.631  2.132   -1.646  1.00 0.00 ? 38 ALA A HB3  9  
ATOM 6928  N N    . LEU A 1 39 ? -3.731  1.302   -2.422  1.00 0.00 ? 39 LEU A N    9  
ATOM 6929  C CA   . LEU A 1 39 ? -2.602  2.125   -2.814  1.00 0.00 ? 39 LEU A CA   9  
ATOM 6930  C C    . LEU A 1 39 ? -1.700  1.392   -3.789  1.00 0.00 ? 39 LEU A C    9  
ATOM 6931  O O    . LEU A 1 39 ? -1.160  1.994   -4.716  1.00 0.00 ? 39 LEU A O    9  
ATOM 6932  C CB   . LEU A 1 39 ? -1.806  2.532   -1.586  1.00 0.00 ? 39 LEU A CB   9  
ATOM 6933  C CG   . LEU A 1 39 ? -1.713  4.046   -1.348  1.00 0.00 ? 39 LEU A CG   9  
ATOM 6934  C CD1  . LEU A 1 39 ? -2.594  4.462   -0.178  1.00 0.00 ? 39 LEU A CD1  9  
ATOM 6935  C CD2  . LEU A 1 39 ? -0.266  4.467   -1.114  1.00 0.00 ? 39 LEU A CD2  9  
ATOM 6936  H H    . LEU A 1 39 ? -3.676  0.770   -1.596  1.00 0.00 ? 39 LEU A H    9  
ATOM 6937  H HA   . LEU A 1 39 ? -2.987  3.009   -3.294  1.00 0.00 ? 39 LEU A HA   9  
ATOM 6938  H HB2  . LEU A 1 39 ? -2.271  2.069   -0.733  1.00 0.00 ? 39 LEU A HB2  9  
ATOM 6939  H HB3  . LEU A 1 39 ? -0.804  2.143   -1.683  1.00 0.00 ? 39 LEU A HB3  9  
ATOM 6940  H HG   . LEU A 1 39 ? -2.070  4.561   -2.229  1.00 0.00 ? 39 LEU A HG   9  
ATOM 6941  H HD11 . LEU A 1 39 ? -2.010  5.034   0.528   1.00 0.00 ? 39 LEU A HD11 9  
ATOM 6942  H HD12 . LEU A 1 39 ? -2.987  3.583   0.310   1.00 0.00 ? 39 LEU A HD12 9  
ATOM 6943  H HD13 . LEU A 1 39 ? -3.412  5.067   -0.541  1.00 0.00 ? 39 LEU A HD13 9  
ATOM 6944  H HD21 . LEU A 1 39 ? 0.067   5.090   -1.927  1.00 0.00 ? 39 LEU A HD21 9  
ATOM 6945  H HD22 . LEU A 1 39 ? 0.361   3.589   -1.056  1.00 0.00 ? 39 LEU A HD22 9  
ATOM 6946  H HD23 . LEU A 1 39 ? -0.196  5.019   -0.188  1.00 0.00 ? 39 LEU A HD23 9  
ATOM 6947  N N    . CYS A 1 40 ? -1.529  0.094   -3.580  1.00 0.00 ? 40 CYS A N    9  
ATOM 6948  C CA   . CYS A 1 40 ? -0.676  -0.689  -4.456  1.00 0.00 ? 40 CYS A CA   9  
ATOM 6949  C C    . CYS A 1 40 ? -1.371  -0.971  -5.778  1.00 0.00 ? 40 CYS A C    9  
ATOM 6950  O O    . CYS A 1 40 ? -0.715  -1.160  -6.803  1.00 0.00 ? 40 CYS A O    9  
ATOM 6951  C CB   . CYS A 1 40 ? -0.243  -1.993  -3.785  1.00 0.00 ? 40 CYS A CB   9  
ATOM 6952  S SG   . CYS A 1 40 ? -1.603  -3.002  -3.121  1.00 0.00 ? 40 CYS A SG   9  
ATOM 6953  H H    . CYS A 1 40 ? -1.982  -0.341  -2.825  1.00 0.00 ? 40 CYS A H    9  
ATOM 6954  H HA   . CYS A 1 40 ? 0.201   -0.096  -4.655  1.00 0.00 ? 40 CYS A HA   9  
ATOM 6955  H HB2  . CYS A 1 40 ? 0.286   -2.597  -4.506  1.00 0.00 ? 40 CYS A HB2  9  
ATOM 6956  H HB3  . CYS A 1 40 ? 0.421   -1.761  -2.966  1.00 0.00 ? 40 CYS A HB3  9  
ATOM 6957  N N    . CYS A 1 41 ? -2.699  -0.990  -5.761  1.00 0.00 ? 41 CYS A N    9  
ATOM 6958  C CA   . CYS A 1 41 ? -3.455  -1.241  -6.976  1.00 0.00 ? 41 CYS A CA   9  
ATOM 6959  C C    . CYS A 1 41 ? -3.611  0.039   -7.790  1.00 0.00 ? 41 CYS A C    9  
ATOM 6960  O O    . CYS A 1 41 ? -3.560  0.020   -9.020  1.00 0.00 ? 41 CYS A O    9  
ATOM 6961  C CB   . CYS A 1 41 ? -4.814  -1.836  -6.618  1.00 0.00 ? 41 CYS A CB   9  
ATOM 6962  S SG   . CYS A 1 41 ? -6.177  -0.641  -6.413  1.00 0.00 ? 41 CYS A SG   9  
ATOM 6963  H H    . CYS A 1 41 ? -3.184  -0.829  -4.912  1.00 0.00 ? 41 CYS A H    9  
ATOM 6964  H HA   . CYS A 1 41 ? -2.903  -1.958  -7.564  1.00 0.00 ? 41 CYS A HA   9  
ATOM 6965  H HB2  . CYS A 1 41 ? -5.104  -2.525  -7.386  1.00 0.00 ? 41 CYS A HB2  9  
ATOM 6966  H HB3  . CYS A 1 41 ? -4.712  -2.367  -5.691  1.00 0.00 ? 41 CYS A HB3  9  
ATOM 6967  N N    . GLU A 1 42 ? -3.802  1.144   -7.087  1.00 0.00 ? 42 GLU A N    9  
ATOM 6968  C CA   . GLU A 1 42 ? -3.968  2.447   -7.732  1.00 0.00 ? 42 GLU A CA   9  
ATOM 6969  C C    . GLU A 1 42 ? -2.629  3.009   -8.213  1.00 0.00 ? 42 GLU A C    9  
ATOM 6970  O O    . GLU A 1 42 ? -2.563  3.699   -9.231  1.00 0.00 ? 42 GLU A O    9  
ATOM 6971  C CB   . GLU A 1 42 ? -4.626  3.434   -6.765  1.00 0.00 ? 42 GLU A CB   9  
ATOM 6972  C CG   . GLU A 1 42 ? -4.881  4.804   -7.373  1.00 0.00 ? 42 GLU A CG   9  
ATOM 6973  C CD   . GLU A 1 42 ? -5.794  5.662   -6.518  1.00 0.00 ? 42 GLU A CD   9  
ATOM 6974  O OE1  . GLU A 1 42 ? -5.940  5.359   -5.315  1.00 0.00 ? 42 GLU A OE1  9  
ATOM 6975  O OE2  . GLU A 1 42 ? -6.363  6.637   -7.052  1.00 0.00 ? 42 GLU A OE2  9  
ATOM 6976  H H    . GLU A 1 42 ? -3.835  1.081   -6.107  1.00 0.00 ? 42 GLU A H    9  
ATOM 6977  H HA   . GLU A 1 42 ? -4.613  2.312   -8.586  1.00 0.00 ? 42 GLU A HA   9  
ATOM 6978  H HB2  . GLU A 1 42 ? -5.573  3.026   -6.441  1.00 0.00 ? 42 GLU A HB2  9  
ATOM 6979  H HB3  . GLU A 1 42 ? -3.986  3.559   -5.905  1.00 0.00 ? 42 GLU A HB3  9  
ATOM 6980  H HG2  . GLU A 1 42 ? -3.936  5.315   -7.488  1.00 0.00 ? 42 GLU A HG2  9  
ATOM 6981  H HG3  . GLU A 1 42 ? -5.339  4.673   -8.343  1.00 0.00 ? 42 GLU A HG3  9  
ATOM 6982  N N    . HIS A 1 43 ? -1.567  2.715   -7.470  1.00 0.00 ? 43 HIS A N    9  
ATOM 6983  C CA   . HIS A 1 43 ? -0.226  3.190   -7.806  1.00 0.00 ? 43 HIS A CA   9  
ATOM 6984  C C    . HIS A 1 43 ? 0.433   2.286   -8.846  1.00 0.00 ? 43 HIS A C    9  
ATOM 6985  O O    . HIS A 1 43 ? -0.133  1.264   -9.233  1.00 0.00 ? 43 HIS A O    9  
ATOM 6986  C CB   . HIS A 1 43 ? 0.604   3.291   -6.527  1.00 0.00 ? 43 HIS A CB   9  
ATOM 6987  C CG   . HIS A 1 43 ? 0.137   4.409   -5.647  1.00 0.00 ? 43 HIS A CG   9  
ATOM 6988  N ND1  . HIS A 1 43 ? -0.202  5.651   -6.142  1.00 0.00 ? 43 HIS A ND1  9  
ATOM 6989  C CD2  . HIS A 1 43 ? -0.083  4.466   -4.314  1.00 0.00 ? 43 HIS A CD2  9  
ATOM 6990  C CE1  . HIS A 1 43 ? -0.611  6.422   -5.153  1.00 0.00 ? 43 HIS A CE1  9  
ATOM 6991  N NE2  . HIS A 1 43 ? -0.551  5.729   -4.032  1.00 0.00 ? 43 HIS A NE2  9  
ATOM 6992  H H    . HIS A 1 43 ? -1.687  2.165   -6.668  1.00 0.00 ? 43 HIS A H    9  
ATOM 6993  H HA   . HIS A 1 43 ? -0.316  4.178   -8.234  1.00 0.00 ? 43 HIS A HA   9  
ATOM 6994  H HB2  . HIS A 1 43 ? 0.523   2.368   -5.974  1.00 0.00 ? 43 HIS A HB2  9  
ATOM 6995  H HB3  . HIS A 1 43 ? 1.635   3.469   -6.774  1.00 0.00 ? 43 HIS A HB3  9  
ATOM 6996  H HD1  . HIS A 1 43 ? -0.149  5.927   -7.081  1.00 0.00 ? 43 HIS A HD1  9  
ATOM 6997  H HD2  . HIS A 1 43 ? 0.078   3.668   -3.603  1.00 0.00 ? 43 HIS A HD2  9  
ATOM 6998  H HE1  . HIS A 1 43 ? -0.942  7.446   -5.245  1.00 0.00 ? 43 HIS A HE1  9  
ATOM 6999  H HE2  . HIS A 1 43 ? -0.962  6.002   -3.185  1.00 0.00 ? 43 HIS A HE2  9  
ATOM 7000  N N    . PRO A 1 44 ? 1.632   2.661   -9.329  1.00 0.00 ? 44 PRO A N    9  
ATOM 7001  C CA   . PRO A 1 44 ? 2.356   1.887   -10.346 1.00 0.00 ? 44 PRO A CA   9  
ATOM 7002  C C    . PRO A 1 44 ? 2.645   0.465   -9.885  1.00 0.00 ? 44 PRO A C    9  
ATOM 7003  O O    . PRO A 1 44 ? 3.753   0.155   -9.449  1.00 0.00 ? 44 PRO A O    9  
ATOM 7004  C CB   . PRO A 1 44 ? 3.660   2.672   -10.536 1.00 0.00 ? 44 PRO A CB   9  
ATOM 7005  C CG   . PRO A 1 44 ? 3.348   4.048   -10.057 1.00 0.00 ? 44 PRO A CG   9  
ATOM 7006  C CD   . PRO A 1 44 ? 2.373   3.869   -8.931  1.00 0.00 ? 44 PRO A CD   9  
ATOM 7007  H HA   . PRO A 1 44 ? 1.813   1.856   -11.279 1.00 0.00 ? 44 PRO A HA   9  
ATOM 7008  H HB2  . PRO A 1 44 ? 4.446   2.217   -9.950  1.00 0.00 ? 44 PRO A HB2  9  
ATOM 7009  H HB3  . PRO A 1 44 ? 3.935   2.671   -11.580 1.00 0.00 ? 44 PRO A HB3  9  
ATOM 7010  H HG2  . PRO A 1 44 ? 4.248   4.529   -9.702  1.00 0.00 ? 44 PRO A HG2  9  
ATOM 7011  H HG3  . PRO A 1 44 ? 2.900   4.624   -10.853 1.00 0.00 ? 44 PRO A HG3  9  
ATOM 7012  H HD2  . PRO A 1 44 ? 2.898   3.707   -8.001  1.00 0.00 ? 44 PRO A HD2  9  
ATOM 7013  H HD3  . PRO A 1 44 ? 1.712   4.720   -8.850  1.00 0.00 ? 44 PRO A HD3  9  
ATOM 7014  N N    . GLY A 1 45 ? 1.631   -0.392  -9.966  1.00 0.00 ? 45 GLY A N    9  
ATOM 7015  C CA   . GLY A 1 45 ? 1.789   -1.768  -9.535  1.00 0.00 ? 45 GLY A CA   9  
ATOM 7016  C C    . GLY A 1 45 ? 2.298   -1.857  -8.109  1.00 0.00 ? 45 GLY A C    9  
ATOM 7017  O O    . GLY A 1 45 ? 2.824   -2.889  -7.692  1.00 0.00 ? 45 GLY A O    9  
ATOM 7018  H H    . GLY A 1 45 ? 0.766   -0.085  -10.309 1.00 0.00 ? 45 GLY A H    9  
ATOM 7019  H HA2  . GLY A 1 45 ? 0.835   -2.268  -9.599  1.00 0.00 ? 45 GLY A HA2  9  
ATOM 7020  H HA3  . GLY A 1 45 ? 2.492   -2.262  -10.189 1.00 0.00 ? 45 GLY A HA3  9  
ATOM 7021  N N    . GLY A 1 46 ? 2.143   -0.766  -7.361  1.00 0.00 ? 46 GLY A N    9  
ATOM 7022  C CA   . GLY A 1 46 ? 2.597   -0.734  -5.989  1.00 0.00 ? 46 GLY A CA   9  
ATOM 7023  C C    . GLY A 1 46 ? 3.739   0.243   -5.783  1.00 0.00 ? 46 GLY A C    9  
ATOM 7024  O O    . GLY A 1 46 ? 4.868   -0.016  -6.200  1.00 0.00 ? 46 GLY A O    9  
ATOM 7025  H H    . GLY A 1 46 ? 1.715   0.025   -7.748  1.00 0.00 ? 46 GLY A H    9  
ATOM 7026  H HA2  . GLY A 1 46 ? 1.775   -0.444  -5.357  1.00 0.00 ? 46 GLY A HA2  9  
ATOM 7027  H HA3  . GLY A 1 46 ? 2.926   -1.721  -5.703  1.00 0.00 ? 46 GLY A HA3  9  
ATOM 7028  N N    . PHE A 1 47 ? 3.445   1.370   -5.138  1.00 0.00 ? 47 PHE A N    9  
ATOM 7029  C CA   . PHE A 1 47 ? 4.454   2.395   -4.872  1.00 0.00 ? 47 PHE A CA   9  
ATOM 7030  C C    . PHE A 1 47 ? 5.673   1.789   -4.187  1.00 0.00 ? 47 PHE A C    9  
ATOM 7031  O O    . PHE A 1 47 ? 5.745   0.577   -3.985  1.00 0.00 ? 47 PHE A O    9  
ATOM 7032  C CB   . PHE A 1 47 ? 3.870   3.500   -3.979  1.00 0.00 ? 47 PHE A CB   9  
ATOM 7033  C CG   . PHE A 1 47 ? 3.394   4.736   -4.705  1.00 0.00 ? 47 PHE A CG   9  
ATOM 7034  C CD1  . PHE A 1 47 ? 3.632   4.920   -6.060  1.00 0.00 ? 47 PHE A CD1  9  
ATOM 7035  C CD2  . PHE A 1 47 ? 2.705   5.720   -4.015  1.00 0.00 ? 47 PHE A CD2  9  
ATOM 7036  C CE1  . PHE A 1 47 ? 3.190   6.059   -6.708  1.00 0.00 ? 47 PHE A CE1  9  
ATOM 7037  C CE2  . PHE A 1 47 ? 2.263   6.860   -4.658  1.00 0.00 ? 47 PHE A CE2  9  
ATOM 7038  C CZ   . PHE A 1 47 ? 2.505   7.029   -6.006  1.00 0.00 ? 47 PHE A CZ   9  
ATOM 7039  H H    . PHE A 1 47 ? 2.525   1.517   -4.830  1.00 0.00 ? 47 PHE A H    9  
ATOM 7040  H HA   . PHE A 1 47 ? 4.759   2.818   -5.813  1.00 0.00 ? 47 PHE A HA   9  
ATOM 7041  H HB2  . PHE A 1 47 ? 3.026   3.099   -3.438  1.00 0.00 ? 47 PHE A HB2  9  
ATOM 7042  H HB3  . PHE A 1 47 ? 4.624   3.807   -3.268  1.00 0.00 ? 47 PHE A HB3  9  
ATOM 7043  H HD1  . PHE A 1 47 ? 4.166   4.165   -6.613  1.00 0.00 ? 47 PHE A HD1  9  
ATOM 7044  H HD2  . PHE A 1 47 ? 2.514   5.591   -2.960  1.00 0.00 ? 47 PHE A HD2  9  
ATOM 7045  H HE1  . PHE A 1 47 ? 3.382   6.188   -7.763  1.00 0.00 ? 47 PHE A HE1  9  
ATOM 7046  H HE2  . PHE A 1 47 ? 1.727   7.618   -4.106  1.00 0.00 ? 47 PHE A HE2  9  
ATOM 7047  H HZ   . PHE A 1 47 ? 2.159   7.919   -6.510  1.00 0.00 ? 47 PHE A HZ   9  
ATOM 7048  N N    . GLU A 1 48 ? 6.620   2.639   -3.812  1.00 0.00 ? 48 GLU A N    9  
ATOM 7049  C CA   . GLU A 1 48 ? 7.823   2.166   -3.124  1.00 0.00 ? 48 GLU A CA   9  
ATOM 7050  C C    . GLU A 1 48 ? 7.549   2.089   -1.632  1.00 0.00 ? 48 GLU A C    9  
ATOM 7051  O O    . GLU A 1 48 ? 8.195   2.758   -0.825  1.00 0.00 ? 48 GLU A O    9  
ATOM 7052  C CB   . GLU A 1 48 ? 9.030   3.076   -3.391  1.00 0.00 ? 48 GLU A CB   9  
ATOM 7053  C CG   . GLU A 1 48 ? 8.843   4.037   -4.551  1.00 0.00 ? 48 GLU A CG   9  
ATOM 7054  C CD   . GLU A 1 48 ? 10.060  4.108   -5.453  1.00 0.00 ? 48 GLU A CD   9  
ATOM 7055  O OE1  . GLU A 1 48 ? 11.073  4.707   -5.037  1.00 0.00 ? 48 GLU A OE1  9  
ATOM 7056  O OE2  . GLU A 1 48 ? 9.999   3.564   -6.577  1.00 0.00 ? 48 GLU A OE2  9  
ATOM 7057  H H    . GLU A 1 48 ? 6.498   3.607   -3.983  1.00 0.00 ? 48 GLU A H    9  
ATOM 7058  H HA   . GLU A 1 48 ? 8.046   1.165   -3.485  1.00 0.00 ? 48 GLU A HA   9  
ATOM 7059  H HB2  . GLU A 1 48 ? 9.230   3.657   -2.504  1.00 0.00 ? 48 GLU A HB2  9  
ATOM 7060  H HB3  . GLU A 1 48 ? 9.888   2.456   -3.602  1.00 0.00 ? 48 GLU A HB3  9  
ATOM 7061  H HG2  . GLU A 1 48 ? 7.998   3.714   -5.137  1.00 0.00 ? 48 GLU A HG2  9  
ATOM 7062  H HG3  . GLU A 1 48 ? 8.649   5.021   -4.154  1.00 0.00 ? 48 GLU A HG3  9  
ATOM 7063  N N    . TYR A 1 49 ? 6.571   1.274   -1.277  1.00 0.00 ? 49 TYR A N    9  
ATOM 7064  C CA   . TYR A 1 49 ? 6.188   1.106   0.111   1.00 0.00 ? 49 TYR A CA   9  
ATOM 7065  C C    . TYR A 1 49 ? 7.078   0.114   0.818   1.00 0.00 ? 49 TYR A C    9  
ATOM 7066  O O    . TYR A 1 49 ? 7.740   -0.718  0.197   1.00 0.00 ? 49 TYR A O    9  
ATOM 7067  C CB   . TYR A 1 49 ? 4.751   0.646   0.226   1.00 0.00 ? 49 TYR A CB   9  
ATOM 7068  C CG   . TYR A 1 49 ? 4.401   -0.511  -0.656  1.00 0.00 ? 49 TYR A CG   9  
ATOM 7069  C CD1  . TYR A 1 49 ? 3.966   -0.308  -1.952  1.00 0.00 ? 49 TYR A CD1  9  
ATOM 7070  C CD2  . TYR A 1 49 ? 4.503   -1.809  -0.186  1.00 0.00 ? 49 TYR A CD2  9  
ATOM 7071  C CE1  . TYR A 1 49 ? 3.644   -1.369  -2.761  1.00 0.00 ? 49 TYR A CE1  9  
ATOM 7072  C CE2  . TYR A 1 49 ? 4.182   -2.879  -0.986  1.00 0.00 ? 49 TYR A CE2  9  
ATOM 7073  C CZ   . TYR A 1 49 ? 3.752   -2.654  -2.279  1.00 0.00 ? 49 TYR A CZ   9  
ATOM 7074  O OH   . TYR A 1 49 ? 3.434   -3.716  -3.093  1.00 0.00 ? 49 TYR A OH   9  
ATOM 7075  H H    . TYR A 1 49 ? 6.091   0.778   -1.969  1.00 0.00 ? 49 TYR A H    9  
ATOM 7076  H HA   . TYR A 1 49 ? 6.273   2.052   0.609   1.00 0.00 ? 49 TYR A HA   9  
ATOM 7077  H HB2  . TYR A 1 49 ? 4.580   0.340   1.238   1.00 0.00 ? 49 TYR A HB2  9  
ATOM 7078  H HB3  . TYR A 1 49 ? 4.096   1.468   -0.015  1.00 0.00 ? 49 TYR A HB3  9  
ATOM 7079  H HD1  . TYR A 1 49 ? 3.883   0.701   -2.327  1.00 0.00 ? 49 TYR A HD1  9  
ATOM 7080  H HD2  . TYR A 1 49 ? 4.840   -1.976  0.827   1.00 0.00 ? 49 TYR A HD2  9  
ATOM 7081  H HE1  . TYR A 1 49 ? 3.308   -1.191  -3.763  1.00 0.00 ? 49 TYR A HE1  9  
ATOM 7082  H HE2  . TYR A 1 49 ? 4.270   -3.883  -0.598  1.00 0.00 ? 49 TYR A HE2  9  
ATOM 7083  H HH   . TYR A 1 49 ? 2.786   -3.439  -3.746  1.00 0.00 ? 49 TYR A HH   9  
ATOM 7084  N N    . SER A 1 50 ? 7.060   0.205   2.130   1.00 0.00 ? 50 SER A N    9  
ATOM 7085  C CA   . SER A 1 50 ? 7.832   -0.682  2.971   1.00 0.00 ? 50 SER A CA   9  
ATOM 7086  C C    . SER A 1 50 ? 6.995   -1.086  4.169   1.00 0.00 ? 50 SER A C    9  
ATOM 7087  O O    . SER A 1 50 ? 6.826   -0.313  5.113   1.00 0.00 ? 50 SER A O    9  
ATOM 7088  C CB   . SER A 1 50 ? 9.129   -0.015  3.419   1.00 0.00 ? 50 SER A CB   9  
ATOM 7089  O OG   . SER A 1 50 ? 8.901   1.315   3.848   1.00 0.00 ? 50 SER A OG   9  
ATOM 7090  H H    . SER A 1 50 ? 6.489   0.887   2.546   1.00 0.00 ? 50 SER A H    9  
ATOM 7091  H HA   . SER A 1 50 ? 8.067   -1.564  2.395   1.00 0.00 ? 50 SER A HA   9  
ATOM 7092  H HB2  . SER A 1 50 ? 9.554   -0.576  4.238   1.00 0.00 ? 50 SER A HB2  9  
ATOM 7093  H HB3  . SER A 1 50 ? 9.825   -0.002  2.593   1.00 0.00 ? 50 SER A HB3  9  
ATOM 7094  H HG   . SER A 1 50 ? 9.709   1.824   3.753   1.00 0.00 ? 50 SER A HG   9  
ATOM 7095  N N    . ASN A 1 51 ? 6.441   -2.289  4.108   1.00 0.00 ? 51 ASN A N    9  
ATOM 7096  C CA   . ASN A 1 51 ? 5.590   -2.782  5.177   1.00 0.00 ? 51 ASN A CA   9  
ATOM 7097  C C    . ASN A 1 51 ? 6.252   -2.625  6.535   1.00 0.00 ? 51 ASN A C    9  
ATOM 7098  O O    . ASN A 1 51 ? 7.413   -2.984  6.728   1.00 0.00 ? 51 ASN A O    9  
ATOM 7099  C CB   . ASN A 1 51 ? 5.223   -4.242  4.955   1.00 0.00 ? 51 ASN A CB   9  
ATOM 7100  C CG   . ASN A 1 51 ? 4.632   -4.490  3.582   1.00 0.00 ? 51 ASN A CG   9  
ATOM 7101  O OD1  . ASN A 1 51 ? 5.313   -4.353  2.565   1.00 0.00 ? 51 ASN A OD1  9  
ATOM 7102  N ND2  . ASN A 1 51 ? 3.357   -4.860  3.544   1.00 0.00 ? 51 ASN A ND2  9  
ATOM 7103  H H    . ASN A 1 51 ? 6.594   -2.847  3.318   1.00 0.00 ? 51 ASN A H    9  
ATOM 7104  H HA   . ASN A 1 51 ? 4.685   -2.195  5.168   1.00 0.00 ? 51 ASN A HA   9  
ATOM 7105  H HB2  . ASN A 1 51 ? 6.107   -4.851  5.063   1.00 0.00 ? 51 ASN A HB2  9  
ATOM 7106  H HB3  . ASN A 1 51 ? 4.497   -4.529  5.700   1.00 0.00 ? 51 ASN A HB3  9  
ATOM 7107  H HD21 . ASN A 1 51 ? 2.876   -4.950  4.393   1.00 0.00 ? 51 ASN A HD21 9  
ATOM 7108  H HD22 . ASN A 1 51 ? 2.949   -5.027  2.669   1.00 0.00 ? 51 ASN A HD22 9  
ATOM 7109  N N    . GLY A 1 52 ? 5.492   -2.087  7.470   1.00 0.00 ? 52 GLY A N    9  
ATOM 7110  C CA   . GLY A 1 52 ? 5.996   -1.882  8.815   1.00 0.00 ? 52 GLY A CA   9  
ATOM 7111  C C    . GLY A 1 52 ? 5.504   -0.586  9.433   1.00 0.00 ? 52 GLY A C    9  
ATOM 7112  O O    . GLY A 1 52 ? 5.084   0.324   8.719   1.00 0.00 ? 52 GLY A O    9  
ATOM 7113  H H    . GLY A 1 52 ? 4.574   -1.829  7.240   1.00 0.00 ? 52 GLY A H    9  
ATOM 7114  H HA2  . GLY A 1 52 ? 5.678   -2.708  9.436   1.00 0.00 ? 52 GLY A HA2  9  
ATOM 7115  H HA3  . GLY A 1 52 ? 7.076   -1.865  8.783   1.00 0.00 ? 52 GLY A HA3  9  
ATOM 7116  N N    . PRO A 1 53 ? 5.543   -0.475  10.772  1.00 0.00 ? 53 PRO A N    9  
ATOM 7117  C CA   . PRO A 1 53 ? 5.094   0.725   11.480  1.00 0.00 ? 53 PRO A CA   9  
ATOM 7118  C C    . PRO A 1 53 ? 6.130   1.844   11.446  1.00 0.00 ? 53 PRO A C    9  
ATOM 7119  O O    . PRO A 1 53 ? 7.037   1.889   12.277  1.00 0.00 ? 53 PRO A O    9  
ATOM 7120  C CB   . PRO A 1 53 ? 4.897   0.224   12.909  1.00 0.00 ? 53 PRO A CB   9  
ATOM 7121  C CG   . PRO A 1 53 ? 5.895   -0.872  13.060  1.00 0.00 ? 53 PRO A CG   9  
ATOM 7122  C CD   . PRO A 1 53 ? 6.027   -1.514  11.703  1.00 0.00 ? 53 PRO A CD   9  
ATOM 7123  H HA   . PRO A 1 53 ? 4.156   1.090   11.089  1.00 0.00 ? 53 PRO A HA   9  
ATOM 7124  H HB2  . PRO A 1 53 ? 5.081   1.029   13.605  1.00 0.00 ? 53 PRO A HB2  9  
ATOM 7125  H HB3  . PRO A 1 53 ? 3.888   -0.143  13.030  1.00 0.00 ? 53 PRO A HB3  9  
ATOM 7126  H HG2  . PRO A 1 53 ? 6.845   -0.461  13.373  1.00 0.00 ? 53 PRO A HG2  9  
ATOM 7127  H HG3  . PRO A 1 53 ? 5.543   -1.592  13.782  1.00 0.00 ? 53 PRO A HG3  9  
ATOM 7128  H HD2  . PRO A 1 53 ? 7.059   -1.760  11.501  1.00 0.00 ? 53 PRO A HD2  9  
ATOM 7129  H HD3  . PRO A 1 53 ? 5.410   -2.399  11.645  1.00 0.00 ? 53 PRO A HD3  9  
ATOM 7130  N N    . CYS A 1 54 ? 5.988   2.750   10.483  1.00 0.00 ? 54 CYS A N    9  
ATOM 7131  C CA   . CYS A 1 54 ? 6.912   3.870   10.345  1.00 0.00 ? 54 CYS A CA   9  
ATOM 7132  C C    . CYS A 1 54 ? 6.345   5.121   11.008  1.00 0.00 ? 54 CYS A C    9  
ATOM 7133  O O    . CYS A 1 54 ? 7.047   5.824   11.734  1.00 0.00 ? 54 CYS A O    9  
ATOM 7134  C CB   . CYS A 1 54 ? 7.198   4.150   8.869   1.00 0.00 ? 54 CYS A CB   9  
ATOM 7135  S SG   . CYS A 1 54 ? 7.982   2.765   7.986   1.00 0.00 ? 54 CYS A SG   9  
ATOM 7136  H H    . CYS A 1 54 ? 5.244   2.662   9.851   1.00 0.00 ? 54 CYS A H    9  
ATOM 7137  H HA   . CYS A 1 54 ? 7.834   3.602   10.838  1.00 0.00 ? 54 CYS A HA   9  
ATOM 7138  H HB2  . CYS A 1 54 ? 6.269   4.374   8.366   1.00 0.00 ? 54 CYS A HB2  9  
ATOM 7139  H HB3  . CYS A 1 54 ? 7.856   5.004   8.794   1.00 0.00 ? 54 CYS A HB3  9  
ATOM 7140  N N    . GLU A 1 55 ? 5.070   5.393   10.751  1.00 0.00 ? 55 GLU A N    9  
ATOM 7141  C CA   . GLU A 1 55 ? 4.406   6.559   11.322  1.00 0.00 ? 55 GLU A CA   9  
ATOM 7142  C C    . GLU A 1 55 ? 3.861   6.248   12.713  1.00 0.00 ? 55 GLU A C    9  
ATOM 7143  O O    . GLU A 1 55 ? 2.738   5.708   12.800  1.00 0.00 ? 55 GLU A O    9  
ATOM 7144  C CB   . GLU A 1 55 ? 3.270   7.023   10.409  1.00 0.00 ? 55 GLU A CB   9  
ATOM 7145  C CG   . GLU A 1 55 ? 2.756   8.416   10.737  1.00 0.00 ? 55 GLU A CG   9  
ATOM 7146  C CD   . GLU A 1 55 ? 1.265   8.556   10.506  1.00 0.00 ? 55 GLU A CD   9  
ATOM 7147  O OE1  . GLU A 1 55 ? 0.507   7.679   10.970  1.00 0.00 ? 55 GLU A OE1  9  
ATOM 7148  O OE2  . GLU A 1 55 ? 0.854   9.545   9.863   1.00 0.00 ? 55 GLU A OE2  9  
ATOM 7149  O OXT  . GLU A 1 55 ? 4.562   6.546   13.702  1.00 0.00 ? 55 GLU A OXT  9  
ATOM 7150  H H    . GLU A 1 55 ? 4.562   4.794   10.164  1.00 0.00 ? 55 GLU A H    9  
ATOM 7151  H HA   . GLU A 1 55 ? 5.137   7.349   11.404  1.00 0.00 ? 55 GLU A HA   9  
ATOM 7152  H HB2  . GLU A 1 55 ? 3.622   7.023   9.387   1.00 0.00 ? 55 GLU A HB2  9  
ATOM 7153  H HB3  . GLU A 1 55 ? 2.446   6.329   10.496  1.00 0.00 ? 55 GLU A HB3  9  
ATOM 7154  H HG2  . GLU A 1 55 ? 2.966   8.627   11.774  1.00 0.00 ? 55 GLU A HG2  9  
ATOM 7155  H HG3  . GLU A 1 55 ? 3.271   9.131   10.112  1.00 0.00 ? 55 GLU A HG3  9  
ATOM 7156  N N    . ALA A 1 1  ? 9.291   -0.434  -0.926  1.00 0.00 ? 1  ALA A N    10 
ATOM 7157  C CA   . ALA A 1 1  ? 9.601   -0.684  -2.358  1.00 0.00 ? 1  ALA A CA   10 
ATOM 7158  C C    . ALA A 1 1  ? 8.346   -1.069  -3.133  1.00 0.00 ? 1  ALA A C    10 
ATOM 7159  O O    . ALA A 1 1  ? 7.420   -1.660  -2.580  1.00 0.00 ? 1  ALA A O    10 
ATOM 7160  C CB   . ALA A 1 1  ? 10.651  -1.780  -2.482  1.00 0.00 ? 1  ALA A CB   10 
ATOM 7161  H H1   . ALA A 1 1  ? 10.170  -0.136  -0.459  1.00 0.00 ? 1  ALA A H1   10 
ATOM 7162  H H2   . ALA A 1 1  ? 8.932   -1.322  -0.520  1.00 0.00 ? 1  ALA A H2   10 
ATOM 7163  H H3   . ALA A 1 1  ? 8.572   0.315   -0.883  1.00 0.00 ? 1  ALA A H3   10 
ATOM 7164  H HA   . ALA A 1 1  ? 10.010  0.219   -2.782  1.00 0.00 ? 1  ALA A HA   10 
ATOM 7165  H HB1  . ALA A 1 1  ? 11.235  -1.824  -1.575  1.00 0.00 ? 1  ALA A HB1  10 
ATOM 7166  H HB2  . ALA A 1 1  ? 11.299  -1.564  -3.318  1.00 0.00 ? 1  ALA A HB2  10 
ATOM 7167  H HB3  . ALA A 1 1  ? 10.163  -2.730  -2.642  1.00 0.00 ? 1  ALA A HB3  10 
ATOM 7168  N N    . HIS A 1 2  ? 8.329   -0.736  -4.421  1.00 0.00 ? 2  HIS A N    10 
ATOM 7169  C CA   . HIS A 1 2  ? 7.196   -1.054  -5.281  1.00 0.00 ? 2  HIS A CA   10 
ATOM 7170  C C    . HIS A 1 2  ? 7.130   -2.559  -5.511  1.00 0.00 ? 2  HIS A C    10 
ATOM 7171  O O    . HIS A 1 2  ? 7.337   -3.039  -6.627  1.00 0.00 ? 2  HIS A O    10 
ATOM 7172  C CB   . HIS A 1 2  ? 7.327   -0.332  -6.627  1.00 0.00 ? 2  HIS A CB   10 
ATOM 7173  C CG   . HIS A 1 2  ? 7.612   1.135   -6.510  1.00 0.00 ? 2  HIS A CG   10 
ATOM 7174  N ND1  . HIS A 1 2  ? 6.630   2.080   -6.298  1.00 0.00 ? 2  HIS A ND1  10 
ATOM 7175  C CD2  . HIS A 1 2  ? 8.778   1.820   -6.594  1.00 0.00 ? 2  HIS A CD2  10 
ATOM 7176  C CE1  . HIS A 1 2  ? 7.178   3.281   -6.257  1.00 0.00 ? 2  HIS A CE1  10 
ATOM 7177  N NE2  . HIS A 1 2  ? 8.479   3.151   -6.432  1.00 0.00 ? 2  HIS A NE2  10 
ATOM 7178  H H    . HIS A 1 2  ? 9.099   -0.271  -4.802  1.00 0.00 ? 2  HIS A H    10 
ATOM 7179  H HA   . HIS A 1 2  ? 6.293   -0.730  -4.787  1.00 0.00 ? 2  HIS A HA   10 
ATOM 7180  H HB2  . HIS A 1 2  ? 8.135   -0.779  -7.186  1.00 0.00 ? 2  HIS A HB2  10 
ATOM 7181  H HB3  . HIS A 1 2  ? 6.408   -0.450  -7.181  1.00 0.00 ? 2  HIS A HB3  10 
ATOM 7182  H HD1  . HIS A 1 2  ? 5.672   1.897   -6.195  1.00 0.00 ? 2  HIS A HD1  10 
ATOM 7183  H HD2  . HIS A 1 2  ? 9.759   1.398   -6.755  1.00 0.00 ? 2  HIS A HD2  10 
ATOM 7184  H HE1  . HIS A 1 2  ? 6.651   4.211   -6.102  1.00 0.00 ? 2  HIS A HE1  10 
ATOM 7185  H HE2  . HIS A 1 2  ? 9.114   3.892   -6.525  1.00 0.00 ? 2  HIS A HE2  10 
ATOM 7186  N N    . MET A 1 3  ? 6.868   -3.301  -4.443  1.00 0.00 ? 3  MET A N    10 
ATOM 7187  C CA   . MET A 1 3  ? 6.807   -4.762  -4.531  1.00 0.00 ? 3  MET A CA   10 
ATOM 7188  C C    . MET A 1 3  ? 5.422   -5.320  -4.178  1.00 0.00 ? 3  MET A C    10 
ATOM 7189  O O    . MET A 1 3  ? 4.586   -5.514  -5.061  1.00 0.00 ? 3  MET A O    10 
ATOM 7190  C CB   . MET A 1 3  ? 7.875   -5.386  -3.625  1.00 0.00 ? 3  MET A CB   10 
ATOM 7191  C CG   . MET A 1 3  ? 9.141   -5.788  -4.364  1.00 0.00 ? 3  MET A CG   10 
ATOM 7192  S SD   . MET A 1 3  ? 10.108  -4.367  -4.913  1.00 0.00 ? 3  MET A SD   10 
ATOM 7193  C CE   . MET A 1 3  ? 11.611  -4.594  -3.966  1.00 0.00 ? 3  MET A CE   10 
ATOM 7194  H H    . MET A 1 3  ? 6.733   -2.856  -3.575  1.00 0.00 ? 3  MET A H    10 
ATOM 7195  H HA   . MET A 1 3  ? 7.030   -5.031  -5.553  1.00 0.00 ? 3  MET A HA   10 
ATOM 7196  H HB2  . MET A 1 3  ? 8.143   -4.672  -2.859  1.00 0.00 ? 3  MET A HB2  10 
ATOM 7197  H HB3  . MET A 1 3  ? 7.464   -6.266  -3.156  1.00 0.00 ? 3  MET A HB3  10 
ATOM 7198  H HG2  . MET A 1 3  ? 9.752   -6.386  -3.705  1.00 0.00 ? 3  MET A HG2  10 
ATOM 7199  H HG3  . MET A 1 3  ? 8.866   -6.374  -5.229  1.00 0.00 ? 3  MET A HG3  10 
ATOM 7200  H HE1  . MET A 1 3  ? 12.374  -3.925  -4.337  1.00 0.00 ? 3  MET A HE1  10 
ATOM 7201  H HE2  . MET A 1 3  ? 11.948  -5.615  -4.063  1.00 0.00 ? 3  MET A HE2  10 
ATOM 7202  H HE3  . MET A 1 3  ? 11.417  -4.376  -2.925  1.00 0.00 ? 3  MET A HE3  10 
ATOM 7203  N N    . ASP A 1 4  ? 5.198   -5.601  -2.893  1.00 0.00 ? 4  ASP A N    10 
ATOM 7204  C CA   . ASP A 1 4  ? 3.928   -6.166  -2.426  1.00 0.00 ? 4  ASP A CA   10 
ATOM 7205  C C    . ASP A 1 4  ? 2.723   -5.503  -3.094  1.00 0.00 ? 4  ASP A C    10 
ATOM 7206  O O    . ASP A 1 4  ? 2.843   -4.434  -3.692  1.00 0.00 ? 4  ASP A O    10 
ATOM 7207  C CB   . ASP A 1 4  ? 3.820   -6.034  -0.902  1.00 0.00 ? 4  ASP A CB   10 
ATOM 7208  C CG   . ASP A 1 4  ? 3.484   -7.351  -0.231  1.00 0.00 ? 4  ASP A CG   10 
ATOM 7209  O OD1  . ASP A 1 4  ? 3.882   -8.409  -0.764  1.00 0.00 ? 4  ASP A OD1  10 
ATOM 7210  O OD2  . ASP A 1 4  ? 2.823   -7.326  0.828   1.00 0.00 ? 4  ASP A OD2  10 
ATOM 7211  H H    . ASP A 1 4  ? 5.911   -5.442  -2.240  1.00 0.00 ? 4  ASP A H    10 
ATOM 7212  H HA   . ASP A 1 4  ? 3.925   -7.215  -2.681  1.00 0.00 ? 4  ASP A HA   10 
ATOM 7213  H HB2  . ASP A 1 4  ? 4.763   -5.683  -0.509  1.00 0.00 ? 4  ASP A HB2  10 
ATOM 7214  H HB3  . ASP A 1 4  ? 3.046   -5.320  -0.659  1.00 0.00 ? 4  ASP A HB3  10 
ATOM 7215  N N    . CYS A 1 5  ? 1.563   -6.152  -2.985  1.00 0.00 ? 5  CYS A N    10 
ATOM 7216  C CA   . CYS A 1 5  ? 0.327   -5.629  -3.566  1.00 0.00 ? 5  CYS A CA   10 
ATOM 7217  C C    . CYS A 1 5  ? -0.896  -6.281  -2.926  1.00 0.00 ? 5  CYS A C    10 
ATOM 7218  O O    . CYS A 1 5  ? -0.785  -6.953  -1.902  1.00 0.00 ? 5  CYS A O    10 
ATOM 7219  C CB   . CYS A 1 5  ? 0.307   -5.847  -5.080  1.00 0.00 ? 5  CYS A CB   10 
ATOM 7220  S SG   . CYS A 1 5  ? -0.308  -4.412  -6.016  1.00 0.00 ? 5  CYS A SG   10 
ATOM 7221  H H    . CYS A 1 5  ? 1.536   -6.999  -2.495  1.00 0.00 ? 5  CYS A H    10 
ATOM 7222  H HA   . CYS A 1 5  ? 0.295   -4.571  -3.364  1.00 0.00 ? 5  CYS A HA   10 
ATOM 7223  H HB2  . CYS A 1 5  ? 1.310   -6.058  -5.422  1.00 0.00 ? 5  CYS A HB2  10 
ATOM 7224  H HB3  . CYS A 1 5  ? -0.331  -6.688  -5.310  1.00 0.00 ? 5  CYS A HB3  10 
ATOM 7225  N N    . THR A 1 6  ? -2.065  -6.079  -3.541  1.00 0.00 ? 6  THR A N    10 
ATOM 7226  C CA   . THR A 1 6  ? -3.310  -6.647  -3.037  1.00 0.00 ? 6  THR A CA   10 
ATOM 7227  C C    . THR A 1 6  ? -3.119  -8.109  -2.621  1.00 0.00 ? 6  THR A C    10 
ATOM 7228  O O    . THR A 1 6  ? -2.822  -8.382  -1.458  1.00 0.00 ? 6  THR A O    10 
ATOM 7229  C CB   . THR A 1 6  ? -4.405  -6.533  -4.097  1.00 0.00 ? 6  THR A CB   10 
ATOM 7230  O OG1  . THR A 1 6  ? -4.534  -5.193  -4.536  1.00 0.00 ? 6  THR A OG1  10 
ATOM 7231  C CG2  . THR A 1 6  ? -5.761  -6.993  -3.607  1.00 0.00 ? 6  THR A CG2  10 
ATOM 7232  H H    . THR A 1 6  ? -2.093  -5.534  -4.352  1.00 0.00 ? 6  THR A H    10 
ATOM 7233  H HA   . THR A 1 6  ? -3.605  -6.069  -2.164  1.00 0.00 ? 6  THR A HA   10 
ATOM 7234  H HB   . THR A 1 6  ? -4.136  -7.141  -4.949  1.00 0.00 ? 6  THR A HB   10 
ATOM 7235  H HG1  . THR A 1 6  ? -3.898  -5.022  -5.234  1.00 0.00 ? 6  THR A HG1  10 
ATOM 7236  H HG21 . THR A 1 6  ? -6.262  -7.540  -4.392  1.00 0.00 ? 6  THR A HG21 10 
ATOM 7237  H HG22 . THR A 1 6  ? -6.355  -6.133  -3.332  1.00 0.00 ? 6  THR A HG22 10 
ATOM 7238  H HG23 . THR A 1 6  ? -5.634  -7.634  -2.747  1.00 0.00 ? 6  THR A HG23 10 
ATOM 7239  N N    . GLU A 1 7  ? -3.286  -9.058  -3.556  1.00 0.00 ? 7  GLU A N    10 
ATOM 7240  C CA   . GLU A 1 7  ? -3.119  -10.459 -3.217  1.00 0.00 ? 7  GLU A CA   10 
ATOM 7241  C C    . GLU A 1 7  ? -3.384  -11.361 -4.423  1.00 0.00 ? 7  GLU A C    10 
ATOM 7242  O O    . GLU A 1 7  ? -2.843  -12.463 -4.510  1.00 0.00 ? 7  GLU A O    10 
ATOM 7243  C CB   . GLU A 1 7  ? -4.047  -10.814 -2.049  1.00 0.00 ? 7  GLU A CB   10 
ATOM 7244  C CG   . GLU A 1 7  ? -5.035  -11.929 -2.347  1.00 0.00 ? 7  GLU A CG   10 
ATOM 7245  C CD   . GLU A 1 7  ? -5.839  -12.343 -1.131  1.00 0.00 ? 7  GLU A CD   10 
ATOM 7246  O OE1  . GLU A 1 7  ? -5.345  -13.185 -0.351  1.00 0.00 ? 7  GLU A OE1  10 
ATOM 7247  O OE2  . GLU A 1 7  ? -6.964  -11.827 -0.958  1.00 0.00 ? 7  GLU A OE2  10 
ATOM 7248  H H    . GLU A 1 7  ? -3.520  -8.817  -4.479  1.00 0.00 ? 7  GLU A H    10 
ATOM 7249  H HA   . GLU A 1 7  ? -2.097  -10.600 -2.902  1.00 0.00 ? 7  GLU A HA   10 
ATOM 7250  H HB2  . GLU A 1 7  ? -3.442  -11.115 -1.208  1.00 0.00 ? 7  GLU A HB2  10 
ATOM 7251  H HB3  . GLU A 1 7  ? -4.607  -9.930  -1.778  1.00 0.00 ? 7  GLU A HB3  10 
ATOM 7252  H HG2  . GLU A 1 7  ? -5.719  -11.589 -3.112  1.00 0.00 ? 7  GLU A HG2  10 
ATOM 7253  H HG3  . GLU A 1 7  ? -4.489  -12.787 -2.710  1.00 0.00 ? 7  GLU A HG3  10 
ATOM 7254  N N    . PHE A 1 8  ? -4.229  -10.899 -5.343  1.00 0.00 ? 8  PHE A N    10 
ATOM 7255  C CA   . PHE A 1 8  ? -4.564  -11.694 -6.526  1.00 0.00 ? 8  PHE A CA   10 
ATOM 7256  C C    . PHE A 1 8  ? -4.939  -10.792 -7.705  1.00 0.00 ? 8  PHE A C    10 
ATOM 7257  O O    . PHE A 1 8  ? -4.482  -9.652  -7.787  1.00 0.00 ? 8  PHE A O    10 
ATOM 7258  C CB   . PHE A 1 8  ? -5.720  -12.652 -6.197  1.00 0.00 ? 8  PHE A CB   10 
ATOM 7259  C CG   . PHE A 1 8  ? -5.343  -13.767 -5.262  1.00 0.00 ? 8  PHE A CG   10 
ATOM 7260  C CD1  . PHE A 1 8  ? -4.233  -14.558 -5.514  1.00 0.00 ? 8  PHE A CD1  10 
ATOM 7261  C CD2  . PHE A 1 8  ? -6.104  -14.027 -4.133  1.00 0.00 ? 8  PHE A CD2  10 
ATOM 7262  C CE1  . PHE A 1 8  ? -3.889  -15.587 -4.657  1.00 0.00 ? 8  PHE A CE1  10 
ATOM 7263  C CE2  . PHE A 1 8  ? -5.764  -15.055 -3.272  1.00 0.00 ? 8  PHE A CE2  10 
ATOM 7264  C CZ   . PHE A 1 8  ? -4.656  -15.835 -3.535  1.00 0.00 ? 8  PHE A CZ   10 
ATOM 7265  H H    . PHE A 1 8  ? -4.644  -10.008 -5.220  1.00 0.00 ? 8  PHE A H    10 
ATOM 7266  H HA   . PHE A 1 8  ? -3.694  -12.273 -6.793  1.00 0.00 ? 8  PHE A HA   10 
ATOM 7267  H HB2  . PHE A 1 8  ? -6.521  -12.094 -5.738  1.00 0.00 ? 8  PHE A HB2  10 
ATOM 7268  H HB3  . PHE A 1 8  ? -6.080  -13.098 -7.111  1.00 0.00 ? 8  PHE A HB3  10 
ATOM 7269  H HD1  . PHE A 1 8  ? -3.633  -14.363 -6.390  1.00 0.00 ? 8  PHE A HD1  10 
ATOM 7270  H HD2  . PHE A 1 8  ? -6.971  -13.418 -3.927  1.00 0.00 ? 8  PHE A HD2  10 
ATOM 7271  H HE1  . PHE A 1 8  ? -3.022  -16.196 -4.866  1.00 0.00 ? 8  PHE A HE1  10 
ATOM 7272  H HE2  . PHE A 1 8  ? -6.365  -15.245 -2.395  1.00 0.00 ? 8  PHE A HE2  10 
ATOM 7273  H HZ   . PHE A 1 8  ? -4.389  -16.638 -2.864  1.00 0.00 ? 8  PHE A HZ   10 
ATOM 7274  N N    . ASN A 1 9  ? -5.781  -11.297 -8.611  1.00 0.00 ? 9  ASN A N    10 
ATOM 7275  C CA   . ASN A 1 9  ? -6.209  -10.516 -9.763  1.00 0.00 ? 9  ASN A CA   10 
ATOM 7276  C C    . ASN A 1 9  ? -7.103  -9.375  -9.298  1.00 0.00 ? 9  ASN A C    10 
ATOM 7277  O O    . ASN A 1 9  ? -6.851  -8.215  -9.623  1.00 0.00 ? 9  ASN A O    10 
ATOM 7278  C CB   . ASN A 1 9  ? -6.955  -11.394 -10.776 1.00 0.00 ? 9  ASN A CB   10 
ATOM 7279  C CG   . ASN A 1 9  ? -6.385  -12.796 -10.868 1.00 0.00 ? 9  ASN A CG   10 
ATOM 7280  O OD1  . ASN A 1 9  ? -6.588  -13.620 -9.976  1.00 0.00 ? 9  ASN A OD1  10 
ATOM 7281  N ND2  . ASN A 1 9  ? -5.664  -13.074 -11.947 1.00 0.00 ? 9  ASN A ND2  10 
ATOM 7282  H H    . ASN A 1 9  ? -6.121  -12.206 -8.501  1.00 0.00 ? 9  ASN A H    10 
ATOM 7283  H HA   . ASN A 1 9  ? -5.328  -10.103 -10.231 1.00 0.00 ? 9  ASN A HA   10 
ATOM 7284  H HB2  . ASN A 1 9  ? -7.991  -11.466 -10.487 1.00 0.00 ? 9  ASN A HB2  10 
ATOM 7285  H HB3  . ASN A 1 9  ? -6.891  -10.935 -11.752 1.00 0.00 ? 9  ASN A HB3  10 
ATOM 7286  H HD21 . ASN A 1 9  ? -5.542  -12.367 -12.616 1.00 0.00 ? 9  ASN A HD21 10 
ATOM 7287  H HD22 . ASN A 1 9  ? -5.285  -13.973 -12.032 1.00 0.00 ? 9  ASN A HD22 10 
ATOM 7288  N N    . PRO A 1 10 ? -8.143  -9.672  -8.494  1.00 0.00 ? 10 PRO A N    10 
ATOM 7289  C CA   . PRO A 1 10 ? -9.023  -8.636  -7.966  1.00 0.00 ? 10 PRO A CA   10 
ATOM 7290  C C    . PRO A 1 10 ? -8.280  -7.804  -6.931  1.00 0.00 ? 10 PRO A C    10 
ATOM 7291  O O    . PRO A 1 10 ? -8.418  -8.019  -5.728  1.00 0.00 ? 10 PRO A O    10 
ATOM 7292  C CB   . PRO A 1 10 ? -10.167 -9.418  -7.323  1.00 0.00 ? 10 PRO A CB   10 
ATOM 7293  C CG   . PRO A 1 10 ? -9.576  -10.739 -6.973  1.00 0.00 ? 10 PRO A CG   10 
ATOM 7294  C CD   . PRO A 1 10 ? -8.513  -11.016 -8.005  1.00 0.00 ? 10 PRO A CD   10 
ATOM 7295  H HA   . PRO A 1 10 ? -9.401  -7.992  -8.749  1.00 0.00 ? 10 PRO A HA   10 
ATOM 7296  H HB2  . PRO A 1 10 ? -10.516 -8.895  -6.445  1.00 0.00 ? 10 PRO A HB2  10 
ATOM 7297  H HB3  . PRO A 1 10 ? -10.976 -9.525  -8.031  1.00 0.00 ? 10 PRO A HB3  10 
ATOM 7298  H HG2  . PRO A 1 10 ? -9.137  -10.694 -5.988  1.00 0.00 ? 10 PRO A HG2  10 
ATOM 7299  H HG3  . PRO A 1 10 ? -10.338 -11.504 -7.009  1.00 0.00 ? 10 PRO A HG3  10 
ATOM 7300  H HD2  . PRO A 1 10 ? -7.670  -11.505 -7.544  1.00 0.00 ? 10 PRO A HD2  10 
ATOM 7301  H HD3  . PRO A 1 10 ? -8.913  -11.621 -8.804  1.00 0.00 ? 10 PRO A HD3  10 
ATOM 7302  N N    . LEU A 1 11 ? -7.461  -6.881  -7.427  1.00 0.00 ? 11 LEU A N    10 
ATOM 7303  C CA   . LEU A 1 11 ? -6.643  -6.015  -6.579  1.00 0.00 ? 11 LEU A CA   10 
ATOM 7304  C C    . LEU A 1 11 ? -7.439  -5.376  -5.459  1.00 0.00 ? 11 LEU A C    10 
ATOM 7305  O O    . LEU A 1 11 ? -8.516  -5.844  -5.102  1.00 0.00 ? 11 LEU A O    10 
ATOM 7306  C CB   . LEU A 1 11 ? -5.950  -4.942  -7.422  1.00 0.00 ? 11 LEU A CB   10 
ATOM 7307  C CG   . LEU A 1 11 ? -5.512  -5.374  -8.826  1.00 0.00 ? 11 LEU A CG   10 
ATOM 7308  C CD1  . LEU A 1 11 ? -4.663  -4.291  -9.473  1.00 0.00 ? 11 LEU A CD1  10 
ATOM 7309  C CD2  . LEU A 1 11 ? -4.746  -6.688  -8.767  1.00 0.00 ? 11 LEU A CD2  10 
ATOM 7310  H H    . LEU A 1 11 ? -7.388  -6.792  -8.398  1.00 0.00 ? 11 LEU A H    10 
ATOM 7311  H HA   . LEU A 1 11 ? -5.886  -6.615  -6.115  1.00 0.00 ? 11 LEU A HA   10 
ATOM 7312  H HB2  . LEU A 1 11 ? -6.624  -4.108  -7.521  1.00 0.00 ? 11 LEU A HB2  10 
ATOM 7313  H HB3  . LEU A 1 11 ? -5.073  -4.615  -6.885  1.00 0.00 ? 11 LEU A HB3  10 
ATOM 7314  H HG   . LEU A 1 11 ? -6.387  -5.522  -9.441  1.00 0.00 ? 11 LEU A HG   10 
ATOM 7315  H HD11 . LEU A 1 11 ? -4.890  -4.238  -10.527 1.00 0.00 ? 11 LEU A HD11 10 
ATOM 7316  H HD12 . LEU A 1 11 ? -3.618  -4.528  -9.341  1.00 0.00 ? 11 LEU A HD12 10 
ATOM 7317  H HD13 . LEU A 1 11 ? -4.878  -3.340  -9.009  1.00 0.00 ? 11 LEU A HD13 10 
ATOM 7318  H HD21 . LEU A 1 11 ? -4.612  -7.072  -9.767  1.00 0.00 ? 11 LEU A HD21 10 
ATOM 7319  H HD22 . LEU A 1 11 ? -5.300  -7.403  -8.177  1.00 0.00 ? 11 LEU A HD22 10 
ATOM 7320  H HD23 . LEU A 1 11 ? -3.780  -6.520  -8.313  1.00 0.00 ? 11 LEU A HD23 10 
ATOM 7321  N N    . CYS A 1 12 ? -6.850  -4.333  -4.888  1.00 0.00 ? 12 CYS A N    10 
ATOM 7322  C CA   . CYS A 1 12 ? -7.409  -3.611  -3.750  1.00 0.00 ? 12 CYS A CA   10 
ATOM 7323  C C    . CYS A 1 12 ? -8.883  -3.888  -3.532  1.00 0.00 ? 12 CYS A C    10 
ATOM 7324  O O    . CYS A 1 12 ? -9.747  -3.027  -3.699  1.00 0.00 ? 12 CYS A O    10 
ATOM 7325  C CB   . CYS A 1 12 ? -7.177  -2.117  -3.904  1.00 0.00 ? 12 CYS A CB   10 
ATOM 7326  S SG   . CYS A 1 12 ? -8.045  -1.343  -5.307  1.00 0.00 ? 12 CYS A SG   10 
ATOM 7327  H H    . CYS A 1 12 ? -5.969  -4.070  -5.214  1.00 0.00 ? 12 CYS A H    10 
ATOM 7328  H HA   . CYS A 1 12 ? -6.876  -3.942  -2.873  1.00 0.00 ? 12 CYS A HA   10 
ATOM 7329  H HB2  . CYS A 1 12 ? -7.504  -1.625  -3.004  1.00 0.00 ? 12 CYS A HB2  10 
ATOM 7330  H HB3  . CYS A 1 12 ? -6.121  -1.946  -4.037  1.00 0.00 ? 12 CYS A HB3  10 
ATOM 7331  N N    . ARG A 1 13 ? -9.129  -5.113  -3.105  1.00 0.00 ? 13 ARG A N    10 
ATOM 7332  C CA   . ARG A 1 13 ? -10.469 -5.579  -2.786  1.00 0.00 ? 13 ARG A CA   10 
ATOM 7333  C C    . ARG A 1 13 ? -10.671 -5.462  -1.278  1.00 0.00 ? 13 ARG A C    10 
ATOM 7334  O O    . ARG A 1 13 ? -11.376 -6.255  -0.655  1.00 0.00 ? 13 ARG A O    10 
ATOM 7335  C CB   . ARG A 1 13 ? -10.644 -7.033  -3.253  1.00 0.00 ? 13 ARG A CB   10 
ATOM 7336  C CG   . ARG A 1 13 ? -11.926 -7.701  -2.769  1.00 0.00 ? 13 ARG A CG   10 
ATOM 7337  C CD   . ARG A 1 13 ? -11.645 -8.717  -1.669  1.00 0.00 ? 13 ARG A CD   10 
ATOM 7338  N NE   . ARG A 1 13 ? -12.155 -10.047 -2.000  1.00 0.00 ? 13 ARG A NE   10 
ATOM 7339  C CZ   . ARG A 1 13 ? -13.296 -10.550 -1.526  1.00 0.00 ? 13 ARG A CZ   10 
ATOM 7340  N NH1  . ARG A 1 13 ? -14.068 -9.831  -0.719  1.00 0.00 ? 13 ARG A NH1  10 
ATOM 7341  N NH2  . ARG A 1 13 ? -13.667 -11.775 -1.867  1.00 0.00 ? 13 ARG A NH2  10 
ATOM 7342  H H    . ARG A 1 13 ? -8.363  -5.719  -2.977  1.00 0.00 ? 13 ARG A H    10 
ATOM 7343  H HA   . ARG A 1 13 ? -11.181 -4.945  -3.293  1.00 0.00 ? 13 ARG A HA   10 
ATOM 7344  H HB2  . ARG A 1 13 ? -10.647 -7.050  -4.334  1.00 0.00 ? 13 ARG A HB2  10 
ATOM 7345  H HB3  . ARG A 1 13 ? -9.806  -7.613  -2.899  1.00 0.00 ? 13 ARG A HB3  10 
ATOM 7346  H HG2  . ARG A 1 13 ? -12.592 -6.944  -2.385  1.00 0.00 ? 13 ARG A HG2  10 
ATOM 7347  H HG3  . ARG A 1 13 ? -12.393 -8.206  -3.601  1.00 0.00 ? 13 ARG A HG3  10 
ATOM 7348  H HD2  . ARG A 1 13 ? -10.577 -8.783  -1.521  1.00 0.00 ? 13 ARG A HD2  10 
ATOM 7349  H HD3  . ARG A 1 13 ? -12.110 -8.378  -0.756  1.00 0.00 ? 13 ARG A HD3  10 
ATOM 7350  H HE   . ARG A 1 13 ? -11.614 -10.600 -2.601  1.00 0.00 ? 13 ARG A HE   10 
ATOM 7351  H HH11 . ARG A 1 13 ? -13.799 -8.905  -0.459  1.00 0.00 ? 13 ARG A HH11 10 
ATOM 7352  H HH12 . ARG A 1 13 ? -14.920 -10.219 -0.369  1.00 0.00 ? 13 ARG A HH12 10 
ATOM 7353  H HH21 . ARG A 1 13 ? -13.094 -12.320 -2.479  1.00 0.00 ? 13 ARG A HH21 10 
ATOM 7354  H HH22 . ARG A 1 13 ? -14.521 -12.156 -1.513  1.00 0.00 ? 13 ARG A HH22 10 
ATOM 7355  N N    . CYS A 1 14 ? -10.014 -4.463  -0.694  1.00 0.00 ? 14 CYS A N    10 
ATOM 7356  C CA   . CYS A 1 14 ? -10.067 -4.220  0.718   1.00 0.00 ? 14 CYS A CA   10 
ATOM 7357  C C    . CYS A 1 14 ? -10.399 -2.764  0.985   1.00 0.00 ? 14 CYS A C    10 
ATOM 7358  O O    . CYS A 1 14 ? -10.662 -1.984  0.069   1.00 0.00 ? 14 CYS A O    10 
ATOM 7359  C CB   . CYS A 1 14 ? -8.717  -4.577  1.360   1.00 0.00 ? 14 CYS A CB   10 
ATOM 7360  S SG   . CYS A 1 14 ? -7.392  -5.016  0.176   1.00 0.00 ? 14 CYS A SG   10 
ATOM 7361  H H    . CYS A 1 14 ? -9.462  -3.874  -1.230  1.00 0.00 ? 14 CYS A H    10 
ATOM 7362  H HA   . CYS A 1 14 ? -10.838 -4.841  1.146   1.00 0.00 ? 14 CYS A HA   10 
ATOM 7363  H HB2  . CYS A 1 14 ? -8.367  -3.735  1.935   1.00 0.00 ? 14 CYS A HB2  10 
ATOM 7364  H HB3  . CYS A 1 14 ? -8.856  -5.421  2.017   1.00 0.00 ? 14 CYS A HB3  10 
ATOM 7365  N N    . ASN A 1 15 ? -10.375 -2.424  2.248   1.00 0.00 ? 15 ASN A N    10 
ATOM 7366  C CA   . ASN A 1 15 ? -10.663 -1.074  2.703   1.00 0.00 ? 15 ASN A CA   10 
ATOM 7367  C C    . ASN A 1 15 ? -10.324 -0.929  4.174   1.00 0.00 ? 15 ASN A C    10 
ATOM 7368  O O    . ASN A 1 15 ? -9.611  -0.007  4.560   1.00 0.00 ? 15 ASN A O    10 
ATOM 7369  C CB   . ASN A 1 15 ? -12.135 -0.748  2.492   1.00 0.00 ? 15 ASN A CB   10 
ATOM 7370  C CG   . ASN A 1 15 ? -12.348 0.437   1.571   1.00 0.00 ? 15 ASN A CG   10 
ATOM 7371  O OD1  . ASN A 1 15 ? -13.243 0.428   0.726   1.00 0.00 ? 15 ASN A OD1  10 
ATOM 7372  N ND2  . ASN A 1 15 ? -11.522 1.465   1.729   1.00 0.00 ? 15 ASN A ND2  10 
ATOM 7373  H H    . ASN A 1 15 ? -10.156 -3.108  2.896   1.00 0.00 ? 15 ASN A H    10 
ATOM 7374  H HA   . ASN A 1 15 ? -10.060 -0.387  2.131   1.00 0.00 ? 15 ASN A HA   10 
ATOM 7375  H HB2  . ASN A 1 15 ? -12.624 -1.605  2.069   1.00 0.00 ? 15 ASN A HB2  10 
ATOM 7376  H HB3  . ASN A 1 15 ? -12.582 -0.527  3.446   1.00 0.00 ? 15 ASN A HB3  10 
ATOM 7377  H HD21 . ASN A 1 15 ? -10.832 1.402   2.422   1.00 0.00 ? 15 ASN A HD21 10 
ATOM 7378  H HD22 . ASN A 1 15 ? -11.637 2.245   1.147   1.00 0.00 ? 15 ASN A HD22 10 
ATOM 7379  N N    . LYS A 1 16 ? -10.865 -1.855  4.975   1.00 0.00 ? 16 LYS A N    10 
ATOM 7380  C CA   . LYS A 1 16 ? -10.687 -1.901  6.434   1.00 0.00 ? 16 LYS A CA   10 
ATOM 7381  C C    . LYS A 1 16 ? -9.477  -1.108  6.912   1.00 0.00 ? 16 LYS A C    10 
ATOM 7382  O O    . LYS A 1 16 ? -8.584  -1.643  7.572   1.00 0.00 ? 16 LYS A O    10 
ATOM 7383  C CB   . LYS A 1 16 ? -10.564 -3.355  6.893   1.00 0.00 ? 16 LYS A CB   10 
ATOM 7384  C CG   . LYS A 1 16 ? -9.285  -4.037  6.425   1.00 0.00 ? 16 LYS A CG   10 
ATOM 7385  C CD   . LYS A 1 16 ? -9.550  -4.998  5.277   1.00 0.00 ? 16 LYS A CD   10 
ATOM 7386  C CE   . LYS A 1 16 ? -10.519 -6.098  5.679   1.00 0.00 ? 16 LYS A CE   10 
ATOM 7387  N NZ   . LYS A 1 16 ? -11.862 -5.913  5.061   1.00 0.00 ? 16 LYS A NZ   10 
ATOM 7388  H H    . LYS A 1 16 ? -11.426 -2.534  4.565   1.00 0.00 ? 16 LYS A H    10 
ATOM 7389  H HA   . LYS A 1 16 ? -11.572 -1.475  6.882   1.00 0.00 ? 16 LYS A HA   10 
ATOM 7390  H HB2  . LYS A 1 16 ? -10.586 -3.383  7.972   1.00 0.00 ? 16 LYS A HB2  10 
ATOM 7391  H HB3  . LYS A 1 16 ? -11.405 -3.915  6.510   1.00 0.00 ? 16 LYS A HB3  10 
ATOM 7392  H HG2  . LYS A 1 16 ? -8.587  -3.283  6.094   1.00 0.00 ? 16 LYS A HG2  10 
ATOM 7393  H HG3  . LYS A 1 16 ? -8.858  -4.586  7.252   1.00 0.00 ? 16 LYS A HG3  10 
ATOM 7394  H HD2  . LYS A 1 16 ? -9.972  -4.447  4.449   1.00 0.00 ? 16 LYS A HD2  10 
ATOM 7395  H HD3  . LYS A 1 16 ? -8.615  -5.446  4.974   1.00 0.00 ? 16 LYS A HD3  10 
ATOM 7396  H HE2  . LYS A 1 16 ? -10.117 -7.049  5.361   1.00 0.00 ? 16 LYS A HE2  10 
ATOM 7397  H HE3  . LYS A 1 16 ? -10.624 -6.095  6.754   1.00 0.00 ? 16 LYS A HE3  10 
ATOM 7398  H HZ1  . LYS A 1 16 ? -12.602 -5.975  5.789   1.00 0.00 ? 16 LYS A HZ1  10 
ATOM 7399  H HZ2  . LYS A 1 16 ? -12.032 -6.650  4.347   1.00 0.00 ? 16 LYS A HZ2  10 
ATOM 7400  H HZ3  . LYS A 1 16 ? -11.919 -4.981  4.601   1.00 0.00 ? 16 LYS A HZ3  10 
ATOM 7401  N N    . MET A 1 17 ? -9.458  0.168   6.572   1.00 0.00 ? 17 MET A N    10 
ATOM 7402  C CA   . MET A 1 17 ? -8.358  1.041   6.964   1.00 0.00 ? 17 MET A CA   10 
ATOM 7403  C C    . MET A 1 17 ? -8.344  1.256   8.466   1.00 0.00 ? 17 MET A C    10 
ATOM 7404  O O    . MET A 1 17 ? -8.759  2.299   8.970   1.00 0.00 ? 17 MET A O    10 
ATOM 7405  C CB   . MET A 1 17 ? -8.443  2.379   6.257   1.00 0.00 ? 17 MET A CB   10 
ATOM 7406  C CG   . MET A 1 17 ? -9.845  2.967   6.213   1.00 0.00 ? 17 MET A CG   10 
ATOM 7407  S SD   . MET A 1 17 ? -10.544 2.982   4.551   1.00 0.00 ? 17 MET A SD   10 
ATOM 7408  C CE   . MET A 1 17 ? -12.282 2.735   4.913   1.00 0.00 ? 17 MET A CE   10 
ATOM 7409  H H    . MET A 1 17 ? -10.204 0.527   6.035   1.00 0.00 ? 17 MET A H    10 
ATOM 7410  H HA   . MET A 1 17 ? -7.438  0.554   6.678   1.00 0.00 ? 17 MET A HA   10 
ATOM 7411  H HB2  . MET A 1 17 ? -7.800  3.074   6.774   1.00 0.00 ? 17 MET A HB2  10 
ATOM 7412  H HB3  . MET A 1 17 ? -8.090  2.254   5.248   1.00 0.00 ? 17 MET A HB3  10 
ATOM 7413  H HG2  . MET A 1 17 ? -10.487 2.381   6.852   1.00 0.00 ? 17 MET A HG2  10 
ATOM 7414  H HG3  . MET A 1 17 ? -9.806  3.982   6.580   1.00 0.00 ? 17 MET A HG3  10 
ATOM 7415  H HE1  . MET A 1 17 ? -12.818 2.552   3.995   1.00 0.00 ? 17 MET A HE1  10 
ATOM 7416  H HE2  . MET A 1 17 ? -12.678 3.618   5.393   1.00 0.00 ? 17 MET A HE2  10 
ATOM 7417  H HE3  . MET A 1 17 ? -12.394 1.886   5.571   1.00 0.00 ? 17 MET A HE3  10 
ATOM 7418  N N    . LEU A 1 18 ? -7.860  0.251   9.166   1.00 0.00 ? 18 LEU A N    10 
ATOM 7419  C CA   . LEU A 1 18 ? -7.776  0.286   10.615  1.00 0.00 ? 18 LEU A CA   10 
ATOM 7420  C C    . LEU A 1 18 ? -6.974  -0.898  11.142  1.00 0.00 ? 18 LEU A C    10 
ATOM 7421  O O    . LEU A 1 18 ? -7.483  -1.712  11.914  1.00 0.00 ? 18 LEU A O    10 
ATOM 7422  C CB   . LEU A 1 18 ? -9.178  0.283   11.216  1.00 0.00 ? 18 LEU A CB   10 
ATOM 7423  C CG   . LEU A 1 18 ? -10.203 -0.580  10.475  1.00 0.00 ? 18 LEU A CG   10 
ATOM 7424  C CD1  . LEU A 1 18 ? -9.798  -2.045  10.510  1.00 0.00 ? 18 LEU A CD1  10 
ATOM 7425  C CD2  . LEU A 1 18 ? -11.588 -0.394  11.075  1.00 0.00 ? 18 LEU A CD2  10 
ATOM 7426  H H    . LEU A 1 18 ? -7.554  -0.536  8.690   1.00 0.00 ? 18 LEU A H    10 
ATOM 7427  H HA   . LEU A 1 18 ? -7.271  1.197   10.896  1.00 0.00 ? 18 LEU A HA   10 
ATOM 7428  H HB2  . LEU A 1 18 ? -9.107  -0.073  12.232  1.00 0.00 ? 18 LEU A HB2  10 
ATOM 7429  H HB3  . LEU A 1 18 ? -9.539  1.298   11.229  1.00 0.00 ? 18 LEU A HB3  10 
ATOM 7430  H HG   . LEU A 1 18 ? -10.242 -0.270  9.440   1.00 0.00 ? 18 LEU A HG   10 
ATOM 7431  H HD11 . LEU A 1 18 ? -9.743  -2.379  11.536  1.00 0.00 ? 18 LEU A HD11 10 
ATOM 7432  H HD12 . LEU A 1 18 ? -8.832  -2.163  10.042  1.00 0.00 ? 18 LEU A HD12 10 
ATOM 7433  H HD13 . LEU A 1 18 ? -10.530 -2.634  9.979   1.00 0.00 ? 18 LEU A HD13 10 
ATOM 7434  H HD21 . LEU A 1 18 ? -11.592 -0.762  12.091  1.00 0.00 ? 18 LEU A HD21 10 
ATOM 7435  H HD22 . LEU A 1 18 ? -12.311 -0.942  10.491  1.00 0.00 ? 18 LEU A HD22 10 
ATOM 7436  H HD23 . LEU A 1 18 ? -11.843 0.655   11.073  1.00 0.00 ? 18 LEU A HD23 10 
ATOM 7437  N N    . GLY A 1 19 ? -5.721  -0.991  10.721  1.00 0.00 ? 19 GLY A N    10 
ATOM 7438  C CA   . GLY A 1 19 ? -4.877  -2.084  11.164  1.00 0.00 ? 19 GLY A CA   10 
ATOM 7439  C C    . GLY A 1 19 ? -3.401  -1.831  10.925  1.00 0.00 ? 19 GLY A C    10 
ATOM 7440  O O    . GLY A 1 19 ? -2.753  -1.122  11.695  1.00 0.00 ? 19 GLY A O    10 
ATOM 7441  H H    . GLY A 1 19 ? -5.370  -0.313  10.107  1.00 0.00 ? 19 GLY A H    10 
ATOM 7442  H HA2  . GLY A 1 19 ? -5.035  -2.239  12.221  1.00 0.00 ? 19 GLY A HA2  10 
ATOM 7443  H HA3  . GLY A 1 19 ? -5.166  -2.981  10.634  1.00 0.00 ? 19 GLY A HA3  10 
ATOM 7444  N N    . ASP A 1 20 ? -2.866  -2.425  9.863   1.00 0.00 ? 20 ASP A N    10 
ATOM 7445  C CA   . ASP A 1 20 ? -1.456  -2.274  9.531   1.00 0.00 ? 20 ASP A CA   10 
ATOM 7446  C C    . ASP A 1 20 ? -1.082  -0.810  9.348   1.00 0.00 ? 20 ASP A C    10 
ATOM 7447  O O    . ASP A 1 20 ? -1.930  0.078   9.421   1.00 0.00 ? 20 ASP A O    10 
ATOM 7448  C CB   . ASP A 1 20 ? -1.117  -3.055  8.260   1.00 0.00 ? 20 ASP A CB   10 
ATOM 7449  C CG   . ASP A 1 20 ? -1.800  -4.408  8.199   1.00 0.00 ? 20 ASP A CG   10 
ATOM 7450  O OD1  . ASP A 1 20 ? -1.279  -5.363  8.813   1.00 0.00 ? 20 ASP A OD1  10 
ATOM 7451  O OD2  . ASP A 1 20 ? -2.853  -4.513  7.538   1.00 0.00 ? 20 ASP A OD2  10 
ATOM 7452  H H    . ASP A 1 20 ? -3.431  -2.985  9.292   1.00 0.00 ? 20 ASP A H    10 
ATOM 7453  H HA   . ASP A 1 20 ? -0.879  -2.676  10.349  1.00 0.00 ? 20 ASP A HA   10 
ATOM 7454  H HB2  . ASP A 1 20 ? -1.424  -2.479  7.400   1.00 0.00 ? 20 ASP A HB2  10 
ATOM 7455  H HB3  . ASP A 1 20 ? -0.053  -3.209  8.219   1.00 0.00 ? 20 ASP A HB3  10 
ATOM 7456  N N    . LEU A 1 21 ? 0.201   -0.574  9.110   1.00 0.00 ? 21 LEU A N    10 
ATOM 7457  C CA   . LEU A 1 21 ? 0.718   0.773   8.914   1.00 0.00 ? 21 LEU A CA   10 
ATOM 7458  C C    . LEU A 1 21 ? 2.012   0.732   8.112   1.00 0.00 ? 21 LEU A C    10 
ATOM 7459  O O    . LEU A 1 21 ? 3.106   0.728   8.672   1.00 0.00 ? 21 LEU A O    10 
ATOM 7460  C CB   . LEU A 1 21 ? 0.948   1.452   10.268  1.00 0.00 ? 21 LEU A CB   10 
ATOM 7461  C CG   . LEU A 1 21 ? 1.899   2.653   10.252  1.00 0.00 ? 21 LEU A CG   10 
ATOM 7462  C CD1  . LEU A 1 21 ? 1.651   3.518   9.025   1.00 0.00 ? 21 LEU A CD1  10 
ATOM 7463  C CD2  . LEU A 1 21 ? 1.739   3.469   11.522  1.00 0.00 ? 21 LEU A CD2  10 
ATOM 7464  H H    . LEU A 1 21 ? 0.820   -1.333  9.065   1.00 0.00 ? 21 LEU A H    10 
ATOM 7465  H HA   . LEU A 1 21 ? -0.017  1.338   8.353   1.00 0.00 ? 21 LEU A HA   10 
ATOM 7466  H HB2  . LEU A 1 21 ? -0.008  1.781   10.646  1.00 0.00 ? 21 LEU A HB2  10 
ATOM 7467  H HB3  . LEU A 1 21 ? 1.349   0.715   10.949  1.00 0.00 ? 21 LEU A HB3  10 
ATOM 7468  H HG   . LEU A 1 21 ? 2.917   2.298   10.209  1.00 0.00 ? 21 LEU A HG   10 
ATOM 7469  H HD11 . LEU A 1 21 ? 1.806   4.555   9.278   1.00 0.00 ? 21 LEU A HD11 10 
ATOM 7470  H HD12 . LEU A 1 21 ? 0.636   3.377   8.684   1.00 0.00 ? 21 LEU A HD12 10 
ATOM 7471  H HD13 . LEU A 1 21 ? 2.337   3.232   8.241   1.00 0.00 ? 21 LEU A HD13 10 
ATOM 7472  H HD21 . LEU A 1 21 ? 2.214   2.953   12.344  1.00 0.00 ? 21 LEU A HD21 10 
ATOM 7473  H HD22 . LEU A 1 21 ? 0.689   3.598   11.736  1.00 0.00 ? 21 LEU A HD22 10 
ATOM 7474  H HD23 . LEU A 1 21 ? 2.200   4.436   11.388  1.00 0.00 ? 21 LEU A HD23 10 
ATOM 7475  N N    . ILE A 1 22 ? 1.869   0.695   6.800   1.00 0.00 ? 22 ILE A N    10 
ATOM 7476  C CA   . ILE A 1 22 ? 3.004   0.651   5.900   1.00 0.00 ? 22 ILE A CA   10 
ATOM 7477  C C    . ILE A 1 22 ? 3.613   2.044   5.716   1.00 0.00 ? 22 ILE A C    10 
ATOM 7478  O O    . ILE A 1 22 ? 2.989   3.051   6.053   1.00 0.00 ? 22 ILE A O    10 
ATOM 7479  C CB   . ILE A 1 22 ? 2.584   0.030   4.539   1.00 0.00 ? 22 ILE A CB   10 
ATOM 7480  C CG1  . ILE A 1 22 ? 3.352   0.603   3.369   1.00 0.00 ? 22 ILE A CG1  10 
ATOM 7481  C CG2  . ILE A 1 22 ? 1.111   0.208   4.261   1.00 0.00 ? 22 ILE A CG2  10 
ATOM 7482  C CD1  . ILE A 1 22 ? 2.876   1.986   2.955   1.00 0.00 ? 22 ILE A CD1  10 
ATOM 7483  H H    . ILE A 1 22 ? 0.970   0.692   6.420   1.00 0.00 ? 22 ILE A H    10 
ATOM 7484  H HA   . ILE A 1 22 ? 3.749   0.007   6.347   1.00 0.00 ? 22 ILE A HA   10 
ATOM 7485  H HB   . ILE A 1 22 ? 2.771   -1.017  4.597   1.00 0.00 ? 22 ILE A HB   10 
ATOM 7486  H HG12 . ILE A 1 22 ? 4.397   0.662   3.619   1.00 0.00 ? 22 ILE A HG12 10 
ATOM 7487  H HG13 . ILE A 1 22 ? 3.225   -0.055  2.522   1.00 0.00 ? 22 ILE A HG13 10 
ATOM 7488  H HG21 . ILE A 1 22 ? 0.903   -0.113  3.251   1.00 0.00 ? 22 ILE A HG21 10 
ATOM 7489  H HG22 . ILE A 1 22 ? 0.864   1.253   4.360   1.00 0.00 ? 22 ILE A HG22 10 
ATOM 7490  H HG23 . ILE A 1 22 ? 0.537   -0.377  4.955   1.00 0.00 ? 22 ILE A HG23 10 
ATOM 7491  H HD11 . ILE A 1 22 ? 2.923   2.079   1.885   1.00 0.00 ? 22 ILE A HD11 10 
ATOM 7492  H HD12 . ILE A 1 22 ? 3.501   2.729   3.408   1.00 0.00 ? 22 ILE A HD12 10 
ATOM 7493  H HD13 . ILE A 1 22 ? 1.858   2.133   3.282   1.00 0.00 ? 22 ILE A HD13 10 
ATOM 7494  N N    . CYS A 1 23 ? 4.829   2.094   5.171   1.00 0.00 ? 23 CYS A N    10 
ATOM 7495  C CA   . CYS A 1 23 ? 5.515   3.364   4.932   1.00 0.00 ? 23 CYS A CA   10 
ATOM 7496  C C    . CYS A 1 23 ? 5.786   3.530   3.443   1.00 0.00 ? 23 CYS A C    10 
ATOM 7497  O O    . CYS A 1 23 ? 6.802   3.059   2.933   1.00 0.00 ? 23 CYS A O    10 
ATOM 7498  C CB   . CYS A 1 23 ? 6.836   3.433   5.713   1.00 0.00 ? 23 CYS A CB   10 
ATOM 7499  S SG   . CYS A 1 23 ? 6.951   2.282   7.122   1.00 0.00 ? 23 CYS A SG   10 
ATOM 7500  H H    . CYS A 1 23 ? 5.273   1.255   4.909   1.00 0.00 ? 23 CYS A H    10 
ATOM 7501  H HA   . CYS A 1 23 ? 4.866   4.161   5.261   1.00 0.00 ? 23 CYS A HA   10 
ATOM 7502  H HB2  . CYS A 1 23 ? 7.652   3.208   5.043   1.00 0.00 ? 23 CYS A HB2  10 
ATOM 7503  H HB3  . CYS A 1 23 ? 6.962   4.436   6.096   1.00 0.00 ? 23 CYS A HB3  10 
ATOM 7504  N N    . ALA A 1 24 ? 4.860   4.176   2.743   1.00 0.00 ? 24 ALA A N    10 
ATOM 7505  C CA   . ALA A 1 24 ? 4.997   4.367   1.310   1.00 0.00 ? 24 ALA A CA   10 
ATOM 7506  C C    . ALA A 1 24 ? 5.815   5.604   0.974   1.00 0.00 ? 24 ALA A C    10 
ATOM 7507  O O    . ALA A 1 24 ? 5.961   6.516   1.788   1.00 0.00 ? 24 ALA A O    10 
ATOM 7508  C CB   . ALA A 1 24 ? 3.629   4.445   0.651   1.00 0.00 ? 24 ALA A CB   10 
ATOM 7509  H H    . ALA A 1 24 ? 4.058   4.513   3.196   1.00 0.00 ? 24 ALA A H    10 
ATOM 7510  H HA   . ALA A 1 24 ? 5.504   3.498   0.917   1.00 0.00 ? 24 ALA A HA   10 
ATOM 7511  H HB1  . ALA A 1 24 ? 3.559   5.353   0.072   1.00 0.00 ? 24 ALA A HB1  10 
ATOM 7512  H HB2  . ALA A 1 24 ? 2.863   4.442   1.412   1.00 0.00 ? 24 ALA A HB2  10 
ATOM 7513  H HB3  . ALA A 1 24 ? 3.496   3.592   0.002   1.00 0.00 ? 24 ALA A HB3  10 
ATOM 7514  N N    . VAL A 1 25 ? 6.345   5.611   -0.240  1.00 0.00 ? 25 VAL A N    10 
ATOM 7515  C CA   . VAL A 1 25 ? 7.162   6.708   -0.733  1.00 0.00 ? 25 VAL A CA   10 
ATOM 7516  C C    . VAL A 1 25 ? 7.070   6.802   -2.250  1.00 0.00 ? 25 VAL A C    10 
ATOM 7517  O O    . VAL A 1 25 ? 6.875   5.795   -2.940  1.00 0.00 ? 25 VAL A O    10 
ATOM 7518  C CB   . VAL A 1 25 ? 8.641   6.522   -0.349  1.00 0.00 ? 25 VAL A CB   10 
ATOM 7519  C CG1  . VAL A 1 25 ? 9.413   7.818   -0.544  1.00 0.00 ? 25 VAL A CG1  10 
ATOM 7520  C CG2  . VAL A 1 25 ? 8.775   6.025   1.084   1.00 0.00 ? 25 VAL A CG2  10 
ATOM 7521  H H    . VAL A 1 25 ? 6.183   4.845   -0.825  1.00 0.00 ? 25 VAL A H    10 
ATOM 7522  H HA   . VAL A 1 25 ? 6.805   7.632   -0.299  1.00 0.00 ? 25 VAL A HA   10 
ATOM 7523  H HB   . VAL A 1 25 ? 9.065   5.775   -1.004  1.00 0.00 ? 25 VAL A HB   10 
ATOM 7524  H HG11 . VAL A 1 25 ? 9.080   8.548   0.178   1.00 0.00 ? 25 VAL A HG11 10 
ATOM 7525  H HG12 . VAL A 1 25 ? 9.239   8.192   -1.542  1.00 0.00 ? 25 VAL A HG12 10 
ATOM 7526  H HG13 . VAL A 1 25 ? 10.468  7.631   -0.409  1.00 0.00 ? 25 VAL A HG13 10 
ATOM 7527  H HG21 . VAL A 1 25 ? 8.531   4.973   1.124   1.00 0.00 ? 25 VAL A HG21 10 
ATOM 7528  H HG22 . VAL A 1 25 ? 8.099   6.574   1.720   1.00 0.00 ? 25 VAL A HG22 10 
ATOM 7529  H HG23 . VAL A 1 25 ? 9.789   6.173   1.424   1.00 0.00 ? 25 VAL A HG23 10 
ATOM 7530  N N    . ILE A 1 26 ? 7.222   8.016   -2.763  1.00 0.00 ? 26 ILE A N    10 
ATOM 7531  C CA   . ILE A 1 26 ? 7.172   8.245   -4.203  1.00 0.00 ? 26 ILE A CA   10 
ATOM 7532  C C    . ILE A 1 26 ? 8.231   9.256   -4.629  1.00 0.00 ? 26 ILE A C    10 
ATOM 7533  O O    . ILE A 1 26 ? 7.963   10.453  -4.731  1.00 0.00 ? 26 ILE A O    10 
ATOM 7534  C CB   . ILE A 1 26 ? 5.791   8.737   -4.689  1.00 0.00 ? 26 ILE A CB   10 
ATOM 7535  C CG1  . ILE A 1 26 ? 4.918   9.199   -3.515  1.00 0.00 ? 26 ILE A CG1  10 
ATOM 7536  C CG2  . ILE A 1 26 ? 5.093   7.647   -5.490  1.00 0.00 ? 26 ILE A CG2  10 
ATOM 7537  C CD1  . ILE A 1 26 ? 4.392   8.070   -2.651  1.00 0.00 ? 26 ILE A CD1  10 
ATOM 7538  H H    . ILE A 1 26 ? 7.378   8.774   -2.156  1.00 0.00 ? 26 ILE A H    10 
ATOM 7539  H HA   . ILE A 1 26 ? 7.385   7.304   -4.690  1.00 0.00 ? 26 ILE A HA   10 
ATOM 7540  H HB   . ILE A 1 26 ? 5.958   9.572   -5.352  1.00 0.00 ? 26 ILE A HB   10 
ATOM 7541  H HG12 . ILE A 1 26 ? 5.498   9.852   -2.884  1.00 0.00 ? 26 ILE A HG12 10 
ATOM 7542  H HG13 . ILE A 1 26 ? 4.069   9.745   -3.901  1.00 0.00 ? 26 ILE A HG13 10 
ATOM 7543  H HG21 . ILE A 1 26 ? 5.804   7.170   -6.147  1.00 0.00 ? 26 ILE A HG21 10 
ATOM 7544  H HG22 . ILE A 1 26 ? 4.298   8.085   -6.077  1.00 0.00 ? 26 ILE A HG22 10 
ATOM 7545  H HG23 . ILE A 1 26 ? 4.678   6.912   -4.815  1.00 0.00 ? 26 ILE A HG23 10 
ATOM 7546  H HD11 . ILE A 1 26 ? 4.985   7.996   -1.753  1.00 0.00 ? 26 ILE A HD11 10 
ATOM 7547  H HD12 . ILE A 1 26 ? 4.446   7.140   -3.197  1.00 0.00 ? 26 ILE A HD12 10 
ATOM 7548  H HD13 . ILE A 1 26 ? 3.364   8.271   -2.385  1.00 0.00 ? 26 ILE A HD13 10 
ATOM 7549  N N    . GLY A 1 27 ? 9.437   8.759   -4.861  1.00 0.00 ? 27 GLY A N    10 
ATOM 7550  C CA   . GLY A 1 27 ? 10.543  9.607   -5.268  1.00 0.00 ? 27 GLY A CA   10 
ATOM 7551  C C    . GLY A 1 27 ? 11.031  10.475  -4.132  1.00 0.00 ? 27 GLY A C    10 
ATOM 7552  O O    . GLY A 1 27 ? 12.197  10.418  -3.742  1.00 0.00 ? 27 GLY A O    10 
ATOM 7553  H H    . GLY A 1 27 ? 9.576   7.807   -4.747  1.00 0.00 ? 27 GLY A H    10 
ATOM 7554  H HA2  . GLY A 1 27 ? 11.357  8.984   -5.608  1.00 0.00 ? 27 GLY A HA2  10 
ATOM 7555  H HA3  . GLY A 1 27 ? 10.220  10.241  -6.080  1.00 0.00 ? 27 GLY A HA3  10 
ATOM 7556  N N    . ASP A 1 28 ? 10.122  11.273  -3.599  1.00 0.00 ? 28 ASP A N    10 
ATOM 7557  C CA   . ASP A 1 28 ? 10.426  12.162  -2.491  1.00 0.00 ? 28 ASP A CA   10 
ATOM 7558  C C    . ASP A 1 28 ? 9.144   12.540  -1.761  1.00 0.00 ? 28 ASP A C    10 
ATOM 7559  O O    . ASP A 1 28 ? 9.059   13.602  -1.146  1.00 0.00 ? 28 ASP A O    10 
ATOM 7560  C CB   . ASP A 1 28 ? 11.134  13.421  -2.997  1.00 0.00 ? 28 ASP A CB   10 
ATOM 7561  C CG   . ASP A 1 28 ? 10.298  14.189  -4.002  1.00 0.00 ? 28 ASP A CG   10 
ATOM 7562  O OD1  . ASP A 1 28 ? 10.080  13.668  -5.116  1.00 0.00 ? 28 ASP A OD1  10 
ATOM 7563  O OD2  . ASP A 1 28 ? 9.863   15.312  -3.676  1.00 0.00 ? 28 ASP A OD2  10 
ATOM 7564  H H    . ASP A 1 28 ? 9.214   11.258  -3.958  1.00 0.00 ? 28 ASP A H    10 
ATOM 7565  H HA   . ASP A 1 28 ? 11.078  11.637  -1.809  1.00 0.00 ? 28 ASP A HA   10 
ATOM 7566  H HB2  . ASP A 1 28 ? 11.342  14.069  -2.159  1.00 0.00 ? 28 ASP A HB2  10 
ATOM 7567  H HB3  . ASP A 1 28 ? 12.063  13.137  -3.469  1.00 0.00 ? 28 ASP A HB3  10 
ATOM 7568  N N    . ALA A 1 29 ? 8.143   11.662  -1.835  1.00 0.00 ? 29 ALA A N    10 
ATOM 7569  C CA   . ALA A 1 29 ? 6.866   11.913  -1.181  1.00 0.00 ? 29 ALA A CA   10 
ATOM 7570  C C    . ALA A 1 29 ? 6.464   10.739  -0.302  1.00 0.00 ? 29 ALA A C    10 
ATOM 7571  O O    . ALA A 1 29 ? 5.747   9.838   -0.735  1.00 0.00 ? 29 ALA A O    10 
ATOM 7572  C CB   . ALA A 1 29 ? 5.789   12.197  -2.217  1.00 0.00 ? 29 ALA A CB   10 
ATOM 7573  H H    . ALA A 1 29 ? 8.266   10.823  -2.344  1.00 0.00 ? 29 ALA A H    10 
ATOM 7574  H HA   . ALA A 1 29 ? 6.976   12.791  -0.562  1.00 0.00 ? 29 ALA A HA   10 
ATOM 7575  H HB1  . ALA A 1 29 ? 4.845   11.797  -1.876  1.00 0.00 ? 29 ALA A HB1  10 
ATOM 7576  H HB2  . ALA A 1 29 ? 6.060   11.732  -3.155  1.00 0.00 ? 29 ALA A HB2  10 
ATOM 7577  H HB3  . ALA A 1 29 ? 5.698   13.264  -2.358  1.00 0.00 ? 29 ALA A HB3  10 
ATOM 7578  N N    . LYS A 1 30 ? 6.933   10.752  0.939   1.00 0.00 ? 30 LYS A N    10 
ATOM 7579  C CA   . LYS A 1 30 ? 6.623   9.687   1.879   1.00 0.00 ? 30 LYS A CA   10 
ATOM 7580  C C    . LYS A 1 30 ? 5.182   9.806   2.370   1.00 0.00 ? 30 LYS A C    10 
ATOM 7581  O O    . LYS A 1 30 ? 4.692   10.907  2.618   1.00 0.00 ? 30 LYS A O    10 
ATOM 7582  C CB   . LYS A 1 30 ? 7.587   9.733   3.069   1.00 0.00 ? 30 LYS A CB   10 
ATOM 7583  C CG   . LYS A 1 30 ? 8.337   8.433   3.301   1.00 0.00 ? 30 LYS A CG   10 
ATOM 7584  C CD   . LYS A 1 30 ? 9.256   8.530   4.509   1.00 0.00 ? 30 LYS A CD   10 
ATOM 7585  C CE   . LYS A 1 30 ? 10.589  9.170   4.147   1.00 0.00 ? 30 LYS A CE   10 
ATOM 7586  N NZ   . LYS A 1 30 ? 10.840  10.409  4.933   1.00 0.00 ? 30 LYS A NZ   10 
ATOM 7587  H H    . LYS A 1 30 ? 7.503   11.496  1.228   1.00 0.00 ? 30 LYS A H    10 
ATOM 7588  H HA   . LYS A 1 30 ? 6.744   8.745   1.359   1.00 0.00 ? 30 LYS A HA   10 
ATOM 7589  H HB2  . LYS A 1 30 ? 8.313   10.515  2.897   1.00 0.00 ? 30 LYS A HB2  10 
ATOM 7590  H HB3  . LYS A 1 30 ? 7.029   9.966   3.963   1.00 0.00 ? 30 LYS A HB3  10 
ATOM 7591  H HG2  . LYS A 1 30 ? 7.624   7.640   3.467   1.00 0.00 ? 30 LYS A HG2  10 
ATOM 7592  H HG3  . LYS A 1 30 ? 8.930   8.210   2.427   1.00 0.00 ? 30 LYS A HG3  10 
ATOM 7593  H HD2  . LYS A 1 30 ? 8.776   9.129   5.268   1.00 0.00 ? 30 LYS A HD2  10 
ATOM 7594  H HD3  . LYS A 1 30 ? 9.437   7.537   4.893   1.00 0.00 ? 30 LYS A HD3  10 
ATOM 7595  H HE2  . LYS A 1 30 ? 11.379  8.462   4.347   1.00 0.00 ? 30 LYS A HE2  10 
ATOM 7596  H HE3  . LYS A 1 30 ? 10.583  9.415   3.096   1.00 0.00 ? 30 LYS A HE3  10 
ATOM 7597  H HZ1  . LYS A 1 30 ? 10.316  11.207  4.518   1.00 0.00 ? 30 LYS A HZ1  10 
ATOM 7598  H HZ2  . LYS A 1 30 ? 11.855  10.636  4.928   1.00 0.00 ? 30 LYS A HZ2  10 
ATOM 7599  H HZ3  . LYS A 1 30 ? 10.531  10.278  5.917   1.00 0.00 ? 30 LYS A HZ3  10 
ATOM 7600  N N    . GLU A 1 31 ? 4.509   8.668   2.509   1.00 0.00 ? 31 GLU A N    10 
ATOM 7601  C CA   . GLU A 1 31 ? 3.125   8.652   2.972   1.00 0.00 ? 31 GLU A CA   10 
ATOM 7602  C C    . GLU A 1 31 ? 2.747   7.275   3.508   1.00 0.00 ? 31 GLU A C    10 
ATOM 7603  O O    . GLU A 1 31 ? 2.996   6.258   2.861   1.00 0.00 ? 31 GLU A O    10 
ATOM 7604  C CB   . GLU A 1 31 ? 2.179   9.046   1.836   1.00 0.00 ? 31 GLU A CB   10 
ATOM 7605  C CG   . GLU A 1 31 ? 1.890   10.538  1.776   1.00 0.00 ? 31 GLU A CG   10 
ATOM 7606  C CD   . GLU A 1 31 ? 2.275   11.156  0.446   1.00 0.00 ? 31 GLU A CD   10 
ATOM 7607  O OE1  . GLU A 1 31 ? 1.839   10.631  -0.602  1.00 0.00 ? 31 GLU A OE1  10 
ATOM 7608  O OE2  . GLU A 1 31 ? 3.012   12.164  0.451   1.00 0.00 ? 31 GLU A OE2  10 
ATOM 7609  H H    . GLU A 1 31 ? 4.952   7.820   2.296   1.00 0.00 ? 31 GLU A H    10 
ATOM 7610  H HA   . GLU A 1 31 ? 3.034   9.373   3.770   1.00 0.00 ? 31 GLU A HA   10 
ATOM 7611  H HB2  . GLU A 1 31 ? 2.618   8.747   0.896   1.00 0.00 ? 31 GLU A HB2  10 
ATOM 7612  H HB3  . GLU A 1 31 ? 1.241   8.525   1.966   1.00 0.00 ? 31 GLU A HB3  10 
ATOM 7613  H HG2  . GLU A 1 31 ? 0.832   10.694  1.934   1.00 0.00 ? 31 GLU A HG2  10 
ATOM 7614  H HG3  . GLU A 1 31 ? 2.447   11.031  2.560   1.00 0.00 ? 31 GLU A HG3  10 
ATOM 7615  N N    . GLU A 1 32 ? 2.145   7.249   4.693   1.00 0.00 ? 32 GLU A N    10 
ATOM 7616  C CA   . GLU A 1 32 ? 1.734   5.993   5.309   1.00 0.00 ? 32 GLU A CA   10 
ATOM 7617  C C    . GLU A 1 32 ? 0.252   5.736   5.103   1.00 0.00 ? 32 GLU A C    10 
ATOM 7618  O O    . GLU A 1 32 ? -0.546  6.669   5.012   1.00 0.00 ? 32 GLU A O    10 
ATOM 7619  C CB   . GLU A 1 32 ? 2.026   5.998   6.805   1.00 0.00 ? 32 GLU A CB   10 
ATOM 7620  C CG   . GLU A 1 32 ? 3.509   5.969   7.139   1.00 0.00 ? 32 GLU A CG   10 
ATOM 7621  C CD   . GLU A 1 32 ? 4.256   7.166   6.586   1.00 0.00 ? 32 GLU A CD   10 
ATOM 7622  O OE1  . GLU A 1 32 ? 3.692   8.280   6.607   1.00 0.00 ? 32 GLU A OE1  10 
ATOM 7623  O OE2  . GLU A 1 32 ? 5.406   6.990   6.129   1.00 0.00 ? 32 GLU A OE2  10 
ATOM 7624  H H    . GLU A 1 32 ? 1.971   8.092   5.162   1.00 0.00 ? 32 GLU A H    10 
ATOM 7625  H HA   . GLU A 1 32 ? 2.294   5.196   4.845   1.00 0.00 ? 32 GLU A HA   10 
ATOM 7626  H HB2  . GLU A 1 32 ? 1.592   6.885   7.240   1.00 0.00 ? 32 GLU A HB2  10 
ATOM 7627  H HB3  . GLU A 1 32 ? 1.560   5.129   7.246   1.00 0.00 ? 32 GLU A HB3  10 
ATOM 7628  H HG2  . GLU A 1 32 ? 3.623   5.957   8.212   1.00 0.00 ? 32 GLU A HG2  10 
ATOM 7629  H HG3  . GLU A 1 32 ? 3.940   5.071   6.723   1.00 0.00 ? 32 GLU A HG3  10 
ATOM 7630  N N    . HIS A 1 33 ? -0.109  4.463   5.047   1.00 0.00 ? 33 HIS A N    10 
ATOM 7631  C CA   . HIS A 1 33 ? -1.497  4.076   4.871   1.00 0.00 ? 33 HIS A CA   10 
ATOM 7632  C C    . HIS A 1 33 ? -1.715  2.634   5.300   1.00 0.00 ? 33 HIS A C    10 
ATOM 7633  O O    . HIS A 1 33 ? -0.816  1.803   5.202   1.00 0.00 ? 33 HIS A O    10 
ATOM 7634  C CB   . HIS A 1 33 ? -1.925  4.265   3.418   1.00 0.00 ? 33 HIS A CB   10 
ATOM 7635  C CG   . HIS A 1 33 ? -1.094  3.497   2.441   1.00 0.00 ? 33 HIS A CG   10 
ATOM 7636  N ND1  . HIS A 1 33 ? 0.220   3.804   2.166   1.00 0.00 ? 33 HIS A ND1  10 
ATOM 7637  C CD2  . HIS A 1 33 ? -1.401  2.434   1.662   1.00 0.00 ? 33 HIS A CD2  10 
ATOM 7638  C CE1  . HIS A 1 33 ? 0.684   2.965   1.258   1.00 0.00 ? 33 HIS A CE1  10 
ATOM 7639  N NE2  . HIS A 1 33 ? -0.278  2.124   0.936   1.00 0.00 ? 33 HIS A NE2  10 
ATOM 7640  H H    . HIS A 1 33 ? 0.575   3.765   5.140   1.00 0.00 ? 33 HIS A H    10 
ATOM 7641  H HA   . HIS A 1 33 ? -2.098  4.717   5.498   1.00 0.00 ? 33 HIS A HA   10 
ATOM 7642  H HB2  . HIS A 1 33 ? -2.948  3.942   3.308   1.00 0.00 ? 33 HIS A HB2  10 
ATOM 7643  H HB3  . HIS A 1 33 ? -1.853  5.313   3.165   1.00 0.00 ? 33 HIS A HB3  10 
ATOM 7644  H HD1  . HIS A 1 33 ? 0.736   4.530   2.575   1.00 0.00 ? 33 HIS A HD1  10 
ATOM 7645  H HD2  . HIS A 1 33 ? -2.355  1.926   1.618   1.00 0.00 ? 33 HIS A HD2  10 
ATOM 7646  H HE1  . HIS A 1 33 ? 1.678   2.972   0.841   1.00 0.00 ? 33 HIS A HE1  10 
ATOM 7647  H HE2  . HIS A 1 33 ? -0.248  1.501   0.179   1.00 0.00 ? 33 HIS A HE2  10 
ATOM 7648  N N    . ARG A 1 34 ? -2.909  2.341   5.778   1.00 0.00 ? 34 ARG A N    10 
ATOM 7649  C CA   . ARG A 1 34 ? -3.236  0.989   6.217   1.00 0.00 ? 34 ARG A CA   10 
ATOM 7650  C C    . ARG A 1 34 ? -3.616  0.105   5.032   1.00 0.00 ? 34 ARG A C    10 
ATOM 7651  O O    . ARG A 1 34 ? -3.166  -1.036  4.930   1.00 0.00 ? 34 ARG A O    10 
ATOM 7652  C CB   . ARG A 1 34 ? -4.381  0.997   7.229   1.00 0.00 ? 34 ARG A CB   10 
ATOM 7653  C CG   . ARG A 1 34 ? -4.512  2.290   8.024   1.00 0.00 ? 34 ARG A CG   10 
ATOM 7654  C CD   . ARG A 1 34 ? -3.211  2.660   8.720   1.00 0.00 ? 34 ARG A CD   10 
ATOM 7655  N NE   . ARG A 1 34 ? -3.188  2.211   10.111  1.00 0.00 ? 34 ARG A NE   10 
ATOM 7656  C CZ   . ARG A 1 34 ? -2.468  2.791   11.069  1.00 0.00 ? 34 ARG A CZ   10 
ATOM 7657  N NH1  . ARG A 1 34 ? -1.701  3.840   10.794  1.00 0.00 ? 34 ARG A NH1  10 
ATOM 7658  N NH2  . ARG A 1 34 ? -2.513  2.318   12.307  1.00 0.00 ? 34 ARG A NH2  10 
ATOM 7659  H H    . ARG A 1 34 ? -3.581  3.048   5.839   1.00 0.00 ? 34 ARG A H    10 
ATOM 7660  H HA   . ARG A 1 34 ? -2.357  0.576   6.688   1.00 0.00 ? 34 ARG A HA   10 
ATOM 7661  H HB2  . ARG A 1 34 ? -5.307  0.830   6.701   1.00 0.00 ? 34 ARG A HB2  10 
ATOM 7662  H HB3  . ARG A 1 34 ? -4.224  0.186   7.925   1.00 0.00 ? 34 ARG A HB3  10 
ATOM 7663  H HG2  . ARG A 1 34 ? -4.788  3.088   7.353   1.00 0.00 ? 34 ARG A HG2  10 
ATOM 7664  H HG3  . ARG A 1 34 ? -5.284  2.164   8.769   1.00 0.00 ? 34 ARG A HG3  10 
ATOM 7665  H HD2  . ARG A 1 34 ? -2.389  2.202   8.191   1.00 0.00 ? 34 ARG A HD2  10 
ATOM 7666  H HD3  . ARG A 1 34 ? -3.102  3.733   8.697   1.00 0.00 ? 34 ARG A HD3  10 
ATOM 7667  H HE   . ARG A 1 34 ? -3.740  1.434   10.343  1.00 0.00 ? 34 ARG A HE   10 
ATOM 7668  H HH11 . ARG A 1 34 ? -1.659  4.201   9.863   1.00 0.00 ? 34 ARG A HH11 10 
ATOM 7669  H HH12 . ARG A 1 34 ? -1.165  4.271   11.521  1.00 0.00 ? 34 ARG A HH12 10 
ATOM 7670  H HH21 . ARG A 1 34 ? -3.086  1.527   12.520  1.00 0.00 ? 34 ARG A HH21 10 
ATOM 7671  H HH22 . ARG A 1 34 ? -1.972  2.752   13.028  1.00 0.00 ? 34 ARG A HH22 10 
ATOM 7672  N N    . ASN A 1 35 ? -4.451  0.635   4.142   1.00 0.00 ? 35 ASN A N    10 
ATOM 7673  C CA   . ASN A 1 35 ? -4.892  -0.116  2.971   1.00 0.00 ? 35 ASN A CA   10 
ATOM 7674  C C    . ASN A 1 35 ? -3.832  -0.106  1.877   1.00 0.00 ? 35 ASN A C    10 
ATOM 7675  O O    . ASN A 1 35 ? -3.995  0.524   0.831   1.00 0.00 ? 35 ASN A O    10 
ATOM 7676  C CB   . ASN A 1 35 ? -6.214  0.441   2.435   1.00 0.00 ? 35 ASN A CB   10 
ATOM 7677  C CG   . ASN A 1 35 ? -7.314  -0.602  2.436   1.00 0.00 ? 35 ASN A CG   10 
ATOM 7678  O OD1  . ASN A 1 35 ? -8.010  -0.786  1.437   1.00 0.00 ? 35 ASN A OD1  10 
ATOM 7679  N ND2  . ASN A 1 35 ? -7.471  -1.295  3.557   1.00 0.00 ? 35 ASN A ND2  10 
ATOM 7680  H H    . ASN A 1 35 ? -4.781  1.548   4.277   1.00 0.00 ? 35 ASN A H    10 
ATOM 7681  H HA   . ASN A 1 35 ? -5.049  -1.137  3.284   1.00 0.00 ? 35 ASN A HA   10 
ATOM 7682  H HB2  . ASN A 1 35 ? -6.526  1.267   3.055   1.00 0.00 ? 35 ASN A HB2  10 
ATOM 7683  H HB3  . ASN A 1 35 ? -6.072  0.788   1.423   1.00 0.00 ? 35 ASN A HB3  10 
ATOM 7684  H HD21 . ASN A 1 35 ? -6.878  -1.097  4.310   1.00 0.00 ? 35 ASN A HD21 10 
ATOM 7685  H HD22 . ASN A 1 35 ? -8.173  -1.979  3.583   1.00 0.00 ? 35 ASN A HD22 10 
ATOM 7686  N N    . MET A 1 36 ? -2.748  -0.821  2.132   1.00 0.00 ? 36 MET A N    10 
ATOM 7687  C CA   . MET A 1 36 ? -1.652  -0.919  1.184   1.00 0.00 ? 36 MET A CA   10 
ATOM 7688  C C    . MET A 1 36 ? -2.119  -1.528  -0.139  1.00 0.00 ? 36 MET A C    10 
ATOM 7689  O O    . MET A 1 36 ? -1.434  -1.415  -1.156  1.00 0.00 ? 36 MET A O    10 
ATOM 7690  C CB   . MET A 1 36 ? -0.517  -1.742  1.807   1.00 0.00 ? 36 MET A CB   10 
ATOM 7691  C CG   . MET A 1 36 ? -0.249  -3.078  1.124   1.00 0.00 ? 36 MET A CG   10 
ATOM 7692  S SD   . MET A 1 36 ? 0.806   -4.162  2.104   1.00 0.00 ? 36 MET A SD   10 
ATOM 7693  C CE   . MET A 1 36 ? -0.367  -4.782  3.307   1.00 0.00 ? 36 MET A CE   10 
ATOM 7694  H H    . MET A 1 36 ? -2.682  -1.302  2.982   1.00 0.00 ? 36 MET A H    10 
ATOM 7695  H HA   . MET A 1 36 ? -1.294  0.080   0.988   1.00 0.00 ? 36 MET A HA   10 
ATOM 7696  H HB2  . MET A 1 36 ? 0.389   -1.160  1.773   1.00 0.00 ? 36 MET A HB2  10 
ATOM 7697  H HB3  . MET A 1 36 ? -0.767  -1.937  2.842   1.00 0.00 ? 36 MET A HB3  10 
ATOM 7698  H HG2  . MET A 1 36 ? -1.193  -3.575  0.954   1.00 0.00 ? 36 MET A HG2  10 
ATOM 7699  H HG3  . MET A 1 36 ? 0.233   -2.890  0.175   1.00 0.00 ? 36 MET A HG3  10 
ATOM 7700  H HE1  . MET A 1 36 ? -1.372  -4.599  2.957   1.00 0.00 ? 36 MET A HE1  10 
ATOM 7701  H HE2  . MET A 1 36 ? -0.217  -4.277  4.250   1.00 0.00 ? 36 MET A HE2  10 
ATOM 7702  H HE3  . MET A 1 36 ? -0.219  -5.843  3.440   1.00 0.00 ? 36 MET A HE3  10 
ATOM 7703  N N    . CYS A 1 37 ? -3.287  -2.171  -0.127  1.00 0.00 ? 37 CYS A N    10 
ATOM 7704  C CA   . CYS A 1 37 ? -3.818  -2.781  -1.337  1.00 0.00 ? 37 CYS A CA   10 
ATOM 7705  C C    . CYS A 1 37 ? -4.434  -1.723  -2.251  1.00 0.00 ? 37 CYS A C    10 
ATOM 7706  O O    . CYS A 1 37 ? -4.139  -1.680  -3.446  1.00 0.00 ? 37 CYS A O    10 
ATOM 7707  C CB   . CYS A 1 37 ? -4.842  -3.876  -1.001  1.00 0.00 ? 37 CYS A CB   10 
ATOM 7708  S SG   . CYS A 1 37 ? -6.257  -3.336  0.019   1.00 0.00 ? 37 CYS A SG   10 
ATOM 7709  H H    . CYS A 1 37 ? -3.797  -2.233  0.708   1.00 0.00 ? 37 CYS A H    10 
ATOM 7710  H HA   . CYS A 1 37 ? -2.991  -3.232  -1.858  1.00 0.00 ? 37 CYS A HA   10 
ATOM 7711  H HB2  . CYS A 1 37 ? -5.239  -4.275  -1.920  1.00 0.00 ? 37 CYS A HB2  10 
ATOM 7712  H HB3  . CYS A 1 37 ? -4.337  -4.668  -0.466  1.00 0.00 ? 37 CYS A HB3  10 
ATOM 7713  N N    . ALA A 1 38 ? -5.269  -0.863  -1.680  1.00 0.00 ? 38 ALA A N    10 
ATOM 7714  C CA   . ALA A 1 38 ? -5.912  0.208   -2.440  1.00 0.00 ? 38 ALA A CA   10 
ATOM 7715  C C    . ALA A 1 38 ? -4.883  1.142   -3.045  1.00 0.00 ? 38 ALA A C    10 
ATOM 7716  O O    . ALA A 1 38 ? -5.115  1.750   -4.090  1.00 0.00 ? 38 ALA A O    10 
ATOM 7717  C CB   . ALA A 1 38 ? -6.874  0.982   -1.551  1.00 0.00 ? 38 ALA A CB   10 
ATOM 7718  H H    . ALA A 1 38 ? -5.448  -0.943  -0.721  1.00 0.00 ? 38 ALA A H    10 
ATOM 7719  H HA   . ALA A 1 38 ? -6.475  -0.233  -3.239  1.00 0.00 ? 38 ALA A HA   10 
ATOM 7720  H HB1  . ALA A 1 38 ? -7.414  0.293   -0.918  1.00 0.00 ? 38 ALA A HB1  10 
ATOM 7721  H HB2  . ALA A 1 38 ? -7.573  1.529   -2.167  1.00 0.00 ? 38 ALA A HB2  10 
ATOM 7722  H HB3  . ALA A 1 38 ? -6.319  1.676   -0.936  1.00 0.00 ? 38 ALA A HB3  10 
ATOM 7723  N N    . LEU A 1 39 ? -3.745  1.249   -2.383  1.00 0.00 ? 39 LEU A N    10 
ATOM 7724  C CA   . LEU A 1 39 ? -2.677  2.107   -2.855  1.00 0.00 ? 39 LEU A CA   10 
ATOM 7725  C C    . LEU A 1 39 ? -1.875  1.424   -3.947  1.00 0.00 ? 39 LEU A C    10 
ATOM 7726  O O    . LEU A 1 39 ? -1.473  2.056   -4.919  1.00 0.00 ? 39 LEU A O    10 
ATOM 7727  C CB   . LEU A 1 39 ? -1.774  2.473   -1.689  1.00 0.00 ? 39 LEU A CB   10 
ATOM 7728  C CG   . LEU A 1 39 ? -1.681  3.974   -1.399  1.00 0.00 ? 39 LEU A CG   10 
ATOM 7729  C CD1  . LEU A 1 39 ? -2.604  4.355   -0.248  1.00 0.00 ? 39 LEU A CD1  10 
ATOM 7730  C CD2  . LEU A 1 39 ? -0.243  4.379   -1.097  1.00 0.00 ? 39 LEU A CD2  10 
ATOM 7731  H H    . LEU A 1 39 ? -3.620  0.738   -1.555  1.00 0.00 ? 39 LEU A H    10 
ATOM 7732  H HA   . LEU A 1 39 ? -3.119  3.004   -3.255  1.00 0.00 ? 39 LEU A HA   10 
ATOM 7733  H HB2  . LEU A 1 39 ? -2.155  1.969   -0.817  1.00 0.00 ? 39 LEU A HB2  10 
ATOM 7734  H HB3  . LEU A 1 39 ? -0.781  2.100   -1.888  1.00 0.00 ? 39 LEU A HB3  10 
ATOM 7735  H HG   . LEU A 1 39 ? -2.005  4.519   -2.273  1.00 0.00 ? 39 LEU A HG   10 
ATOM 7736  H HD11 . LEU A 1 39 ? -2.028  4.819   0.539   1.00 0.00 ? 39 LEU A HD11 10 
ATOM 7737  H HD12 . LEU A 1 39 ? -3.087  3.468   0.136   1.00 0.00 ? 39 LEU A HD12 10 
ATOM 7738  H HD13 . LEU A 1 39 ? -3.353  5.048   -0.601  1.00 0.00 ? 39 LEU A HD13 10 
ATOM 7739  H HD21 . LEU A 1 39 ? 0.093   5.095   -1.830  1.00 0.00 ? 39 LEU A HD21 10 
ATOM 7740  H HD22 . LEU A 1 39 ? 0.394   3.508   -1.130  1.00 0.00 ? 39 LEU A HD22 10 
ATOM 7741  H HD23 . LEU A 1 39 ? -0.193  4.824   -0.113  1.00 0.00 ? 39 LEU A HD23 10 
ATOM 7742  N N    . CYS A 1 40 ? -1.651  0.128   -3.783  1.00 0.00 ? 40 CYS A N    10 
ATOM 7743  C CA   . CYS A 1 40 ? -0.897  -0.634  -4.763  1.00 0.00 ? 40 CYS A CA   10 
ATOM 7744  C C    . CYS A 1 40 ? -1.724  -0.860  -6.017  1.00 0.00 ? 40 CYS A C    10 
ATOM 7745  O O    . CYS A 1 40 ? -1.184  -0.959  -7.118  1.00 0.00 ? 40 CYS A O    10 
ATOM 7746  C CB   . CYS A 1 40 ? -0.454  -1.981  -4.191  1.00 0.00 ? 40 CYS A CB   10 
ATOM 7747  S SG   . CYS A 1 40 ? 0.748   -2.861  -5.242  1.00 0.00 ? 40 CYS A SG   10 
ATOM 7748  H H    . CYS A 1 40 ? -2.004  -0.322  -2.990  1.00 0.00 ? 40 CYS A H    10 
ATOM 7749  H HA   . CYS A 1 40 ? -0.023  -0.060  -5.024  1.00 0.00 ? 40 CYS A HA   10 
ATOM 7750  H HB2  . CYS A 1 40 ? 0.005   -1.823  -3.227  1.00 0.00 ? 40 CYS A HB2  10 
ATOM 7751  H HB3  . CYS A 1 40 ? -1.318  -2.618  -4.074  1.00 0.00 ? 40 CYS A HB3  10 
ATOM 7752  N N    . CYS A 1 41 ? -3.039  -0.943  -5.848  1.00 0.00 ? 41 CYS A N    10 
ATOM 7753  C CA   . CYS A 1 41 ? -3.923  -1.160  -6.982  1.00 0.00 ? 41 CYS A CA   10 
ATOM 7754  C C    . CYS A 1 41 ? -4.061  0.108   -7.816  1.00 0.00 ? 41 CYS A C    10 
ATOM 7755  O O    . CYS A 1 41 ? -4.167  0.057   -9.041  1.00 0.00 ? 41 CYS A O    10 
ATOM 7756  C CB   . CYS A 1 41 ? -5.286  -1.646  -6.492  1.00 0.00 ? 41 CYS A CB   10 
ATOM 7757  S SG   . CYS A 1 41 ? -6.563  -0.359  -6.285  1.00 0.00 ? 41 CYS A SG   10 
ATOM 7758  H H    . CYS A 1 41 ? -3.424  -0.859  -4.939  1.00 0.00 ? 41 CYS A H    10 
ATOM 7759  H HA   . CYS A 1 41 ? -3.483  -1.933  -7.595  1.00 0.00 ? 41 CYS A HA   10 
ATOM 7760  H HB2  . CYS A 1 41 ? -5.668  -2.363  -7.193  1.00 0.00 ? 41 CYS A HB2  10 
ATOM 7761  H HB3  . CYS A 1 41 ? -5.150  -2.124  -5.538  1.00 0.00 ? 41 CYS A HB3  10 
ATOM 7762  N N    . GLU A 1 42 ? -4.074  1.242   -7.131  1.00 0.00 ? 42 GLU A N    10 
ATOM 7763  C CA   . GLU A 1 42 ? -4.219  2.540   -7.792  1.00 0.00 ? 42 GLU A CA   10 
ATOM 7764  C C    . GLU A 1 42 ? -2.871  3.143   -8.205  1.00 0.00 ? 42 GLU A C    10 
ATOM 7765  O O    . GLU A 1 42 ? -2.797  3.897   -9.176  1.00 0.00 ? 42 GLU A O    10 
ATOM 7766  C CB   . GLU A 1 42 ? -4.953  3.516   -6.870  1.00 0.00 ? 42 GLU A CB   10 
ATOM 7767  C CG   . GLU A 1 42 ? -5.900  4.453   -7.603  1.00 0.00 ? 42 GLU A CG   10 
ATOM 7768  C CD   . GLU A 1 42 ? -6.024  5.804   -6.925  1.00 0.00 ? 42 GLU A CD   10 
ATOM 7769  O OE1  . GLU A 1 42 ? -5.705  5.895   -5.721  1.00 0.00 ? 42 GLU A OE1  10 
ATOM 7770  O OE2  . GLU A 1 42 ? -6.440  6.770   -7.598  1.00 0.00 ? 42 GLU A OE2  10 
ATOM 7771  H H    . GLU A 1 42 ? -4.002  1.200   -6.151  1.00 0.00 ? 42 GLU A H    10 
ATOM 7772  H HA   . GLU A 1 42 ? -4.814  2.391   -8.679  1.00 0.00 ? 42 GLU A HA   10 
ATOM 7773  H HB2  . GLU A 1 42 ? -5.527  2.951   -6.151  1.00 0.00 ? 42 GLU A HB2  10 
ATOM 7774  H HB3  . GLU A 1 42 ? -4.224  4.115   -6.345  1.00 0.00 ? 42 GLU A HB3  10 
ATOM 7775  H HG2  . GLU A 1 42 ? -5.532  4.604   -8.607  1.00 0.00 ? 42 GLU A HG2  10 
ATOM 7776  H HG3  . GLU A 1 42 ? -6.878  3.997   -7.644  1.00 0.00 ? 42 GLU A HG3  10 
ATOM 7777  N N    . HIS A 1 43 ? -1.817  2.831   -7.459  1.00 0.00 ? 43 HIS A N    10 
ATOM 7778  C CA   . HIS A 1 43 ? -0.485  3.372   -7.746  1.00 0.00 ? 43 HIS A CA   10 
ATOM 7779  C C    . HIS A 1 43 ? 0.231   2.587   -8.844  1.00 0.00 ? 43 HIS A C    10 
ATOM 7780  O O    . HIS A 1 43 ? -0.235  1.534   -9.279  1.00 0.00 ? 43 HIS A O    10 
ATOM 7781  C CB   . HIS A 1 43 ? 0.346   3.418   -6.465  1.00 0.00 ? 43 HIS A CB   10 
ATOM 7782  C CG   . HIS A 1 43 ? -0.101  4.507   -5.541  1.00 0.00 ? 43 HIS A CG   10 
ATOM 7783  N ND1  . HIS A 1 43 ? -0.417  5.774   -5.983  1.00 0.00 ? 43 HIS A ND1  10 
ATOM 7784  C CD2  . HIS A 1 43 ? -0.310  4.514   -4.204  1.00 0.00 ? 43 HIS A CD2  10 
ATOM 7785  C CE1  . HIS A 1 43 ? -0.802  6.514   -4.960  1.00 0.00 ? 43 HIS A CE1  10 
ATOM 7786  N NE2  . HIS A 1 43 ? -0.747  5.775   -3.869  1.00 0.00 ? 43 HIS A NE2  10 
ATOM 7787  H H    . HIS A 1 43 ? -1.935  2.240   -6.687  1.00 0.00 ? 43 HIS A H    10 
ATOM 7788  H HA   . HIS A 1 43 ? -0.614  4.386   -8.099  1.00 0.00 ? 43 HIS A HA   10 
ATOM 7789  H HB2  . HIS A 1 43 ? 0.260   2.477   -5.945  1.00 0.00 ? 43 HIS A HB2  10 
ATOM 7790  H HB3  . HIS A 1 43 ? 1.379   3.593   -6.713  1.00 0.00 ? 43 HIS A HB3  10 
ATOM 7791  H HD1  . HIS A 1 43 ? -0.367  6.086   -6.911  1.00 0.00 ? 43 HIS A HD1  10 
ATOM 7792  H HD2  . HIS A 1 43 ? -0.161  3.685   -3.527  1.00 0.00 ? 43 HIS A HD2  10 
ATOM 7793  H HE1  . HIS A 1 43 ? -1.111  7.547   -5.008  1.00 0.00 ? 43 HIS A HE1  10 
ATOM 7794  H HE2  . HIS A 1 43 ? -1.084  6.044   -2.990  1.00 0.00 ? 43 HIS A HE2  10 
ATOM 7795  N N    . PRO A 1 44 ? 1.377   3.115   -9.320  1.00 0.00 ? 44 PRO A N    10 
ATOM 7796  C CA   . PRO A 1 44 ? 2.168   2.493   -10.389 1.00 0.00 ? 44 PRO A CA   10 
ATOM 7797  C C    . PRO A 1 44 ? 2.891   1.237   -9.925  1.00 0.00 ? 44 PRO A C    10 
ATOM 7798  O O    . PRO A 1 44 ? 3.848   1.308   -9.154  1.00 0.00 ? 44 PRO A O    10 
ATOM 7799  C CB   . PRO A 1 44 ? 3.186   3.581   -10.775 1.00 0.00 ? 44 PRO A CB   10 
ATOM 7800  C CG   . PRO A 1 44 ? 2.730   4.825   -10.083 1.00 0.00 ? 44 PRO A CG   10 
ATOM 7801  C CD   . PRO A 1 44 ? 1.987   4.368   -8.864  1.00 0.00 ? 44 PRO A CD   10 
ATOM 7802  H HA   . PRO A 1 44 ? 1.554   2.254   -11.245 1.00 0.00 ? 44 PRO A HA   10 
ATOM 7803  H HB2  . PRO A 1 44 ? 4.172   3.287   -10.445 1.00 0.00 ? 44 PRO A HB2  10 
ATOM 7804  H HB3  . PRO A 1 44 ? 3.187   3.707   -11.849 1.00 0.00 ? 44 PRO A HB3  10 
ATOM 7805  H HG2  . PRO A 1 44 ? 3.584   5.422   -9.800  1.00 0.00 ? 44 PRO A HG2  10 
ATOM 7806  H HG3  . PRO A 1 44 ? 2.076   5.389   -10.732 1.00 0.00 ? 44 PRO A HG3  10 
ATOM 7807  H HD2  . PRO A 1 44 ? 2.670   4.192   -8.045  1.00 0.00 ? 44 PRO A HD2  10 
ATOM 7808  H HD3  . PRO A 1 44 ? 1.231   5.086   -8.581  1.00 0.00 ? 44 PRO A HD3  10 
ATOM 7809  N N    . GLY A 1 45 ? 2.424   0.084   -10.398 1.00 0.00 ? 45 GLY A N    10 
ATOM 7810  C CA   . GLY A 1 45 ? 3.037   -1.177  -10.017 1.00 0.00 ? 45 GLY A CA   10 
ATOM 7811  C C    . GLY A 1 45 ? 3.256   -1.282  -8.521  1.00 0.00 ? 45 GLY A C    10 
ATOM 7812  O O    . GLY A 1 45 ? 4.138   -2.008  -8.064  1.00 0.00 ? 45 GLY A O    10 
ATOM 7813  H H    . GLY A 1 45 ? 1.657   0.090   -11.008 1.00 0.00 ? 45 GLY A H    10 
ATOM 7814  H HA2  . GLY A 1 45 ? 2.396   -1.986  -10.336 1.00 0.00 ? 45 GLY A HA2  10 
ATOM 7815  H HA3  . GLY A 1 45 ? 3.989   -1.266  -10.517 1.00 0.00 ? 45 GLY A HA3  10 
ATOM 7816  N N    . GLY A 1 46 ? 2.450   -0.551  -7.757  1.00 0.00 ? 46 GLY A N    10 
ATOM 7817  C CA   . GLY A 1 46 ? 2.575   -0.574  -6.314  1.00 0.00 ? 46 GLY A CA   10 
ATOM 7818  C C    . GLY A 1 46 ? 3.548   0.462   -5.796  1.00 0.00 ? 46 GLY A C    10 
ATOM 7819  O O    . GLY A 1 46 ? 4.754   0.338   -5.994  1.00 0.00 ? 46 GLY A O    10 
ATOM 7820  H H    . GLY A 1 46 ? 1.764   0.009   -8.176  1.00 0.00 ? 46 GLY A H    10 
ATOM 7821  H HA2  . GLY A 1 46 ? 1.606   -0.393  -5.877  1.00 0.00 ? 46 GLY A HA2  10 
ATOM 7822  H HA3  . GLY A 1 46 ? 2.917   -1.554  -6.011  1.00 0.00 ? 46 GLY A HA3  10 
ATOM 7823  N N    . PHE A 1 47 ? 3.028   1.484   -5.120  1.00 0.00 ? 47 PHE A N    10 
ATOM 7824  C CA   . PHE A 1 47 ? 3.875   2.536   -4.563  1.00 0.00 ? 47 PHE A CA   10 
ATOM 7825  C C    . PHE A 1 47 ? 5.035   1.923   -3.790  1.00 0.00 ? 47 PHE A C    10 
ATOM 7826  O O    . PHE A 1 47 ? 4.989   0.752   -3.413  1.00 0.00 ? 47 PHE A O    10 
ATOM 7827  C CB   . PHE A 1 47 ? 3.057   3.455   -3.641  1.00 0.00 ? 47 PHE A CB   10 
ATOM 7828  C CG   . PHE A 1 47 ? 2.716   4.803   -4.229  1.00 0.00 ? 47 PHE A CG   10 
ATOM 7829  C CD1  . PHE A 1 47 ? 2.856   5.054   -5.587  1.00 0.00 ? 47 PHE A CD1  10 
ATOM 7830  C CD2  . PHE A 1 47 ? 2.249   5.821   -3.413  1.00 0.00 ? 47 PHE A CD2  10 
ATOM 7831  C CE1  . PHE A 1 47 ? 2.536   6.290   -6.115  1.00 0.00 ? 47 PHE A CE1  10 
ATOM 7832  C CE2  . PHE A 1 47 ? 1.927   7.058   -3.937  1.00 0.00 ? 47 PHE A CE2  10 
ATOM 7833  C CZ   . PHE A 1 47 ? 2.070   7.293   -5.290  1.00 0.00 ? 47 PHE A CZ   10 
ATOM 7834  H H    . PHE A 1 47 ? 2.059   1.527   -4.984  1.00 0.00 ? 47 PHE A H    10 
ATOM 7835  H HA   . PHE A 1 47 ? 4.273   3.113   -5.382  1.00 0.00 ? 47 PHE A HA   10 
ATOM 7836  H HB2  . PHE A 1 47 ? 2.129   2.963   -3.395  1.00 0.00 ? 47 PHE A HB2  10 
ATOM 7837  H HB3  . PHE A 1 47 ? 3.616   3.623   -2.731  1.00 0.00 ? 47 PHE A HB3  10 
ATOM 7838  H HD1  . PHE A 1 47 ? 3.217   4.273   -6.236  1.00 0.00 ? 47 PHE A HD1  10 
ATOM 7839  H HD2  . PHE A 1 47 ? 2.136   5.640   -2.354  1.00 0.00 ? 47 PHE A HD2  10 
ATOM 7840  H HE1  . PHE A 1 47 ? 2.648   6.471   -7.175  1.00 0.00 ? 47 PHE A HE1  10 
ATOM 7841  H HE2  . PHE A 1 47 ? 1.562   7.841   -3.289  1.00 0.00 ? 47 PHE A HE2  10 
ATOM 7842  H HZ   . PHE A 1 47 ? 1.819   8.260   -5.700  1.00 0.00 ? 47 PHE A HZ   10 
ATOM 7843  N N    . GLU A 1 48 ? 6.075   2.711   -3.559  1.00 0.00 ? 48 GLU A N    10 
ATOM 7844  C CA   . GLU A 1 48 ? 7.242   2.218   -2.831  1.00 0.00 ? 48 GLU A CA   10 
ATOM 7845  C C    . GLU A 1 48 ? 6.986   2.218   -1.339  1.00 0.00 ? 48 GLU A C    10 
ATOM 7846  O O    . GLU A 1 48 ? 7.306   3.183   -0.649  1.00 0.00 ? 48 GLU A O    10 
ATOM 7847  C CB   . GLU A 1 48 ? 8.456   3.096   -3.106  1.00 0.00 ? 48 GLU A CB   10 
ATOM 7848  C CG   . GLU A 1 48 ? 9.701   2.683   -2.337  1.00 0.00 ? 48 GLU A CG   10 
ATOM 7849  C CD   . GLU A 1 48 ? 10.902  2.470   -3.238  1.00 0.00 ? 48 GLU A CD   10 
ATOM 7850  O OE1  . GLU A 1 48 ? 10.990  3.152   -4.280  1.00 0.00 ? 48 GLU A OE1  10 
ATOM 7851  O OE2  . GLU A 1 48 ? 11.755  1.621   -2.900  1.00 0.00 ? 48 GLU A OE2  10 
ATOM 7852  H H    . GLU A 1 48 ? 6.058   3.643   -3.889  1.00 0.00 ? 48 GLU A H    10 
ATOM 7853  H HA   . GLU A 1 48 ? 7.445   1.202   -3.157  1.00 0.00 ? 48 GLU A HA   10 
ATOM 7854  H HB2  . GLU A 1 48 ? 8.677   3.062   -4.154  1.00 0.00 ? 48 GLU A HB2  10 
ATOM 7855  H HB3  . GLU A 1 48 ? 8.212   4.108   -2.823  1.00 0.00 ? 48 GLU A HB3  10 
ATOM 7856  H HG2  . GLU A 1 48 ? 9.938   3.459   -1.624  1.00 0.00 ? 48 GLU A HG2  10 
ATOM 7857  H HG3  . GLU A 1 48 ? 9.494   1.765   -1.809  1.00 0.00 ? 48 GLU A HG3  10 
ATOM 7858  N N    . TYR A 1 49 ? 6.420   1.141   -0.836  1.00 0.00 ? 49 TYR A N    10 
ATOM 7859  C CA   . TYR A 1 49 ? 6.144   1.057   0.579   1.00 0.00 ? 49 TYR A CA   10 
ATOM 7860  C C    . TYR A 1 49 ? 6.865   -0.097  1.242   1.00 0.00 ? 49 TYR A C    10 
ATOM 7861  O O    . TYR A 1 49 ? 7.292   -1.051  0.593   1.00 0.00 ? 49 TYR A O    10 
ATOM 7862  C CB   . TYR A 1 49 ? 4.668   0.924   0.837   1.00 0.00 ? 49 TYR A CB   10 
ATOM 7863  C CG   . TYR A 1 49 ? 3.977   -0.139  0.036   1.00 0.00 ? 49 TYR A CG   10 
ATOM 7864  C CD1  . TYR A 1 49 ? 4.223   -1.481  0.280   1.00 0.00 ? 49 TYR A CD1  10 
ATOM 7865  C CD2  . TYR A 1 49 ? 3.061   0.198   -0.945  1.00 0.00 ? 49 TYR A CD2  10 
ATOM 7866  C CE1  . TYR A 1 49 ? 3.571   -2.461  -0.432  1.00 0.00 ? 49 TYR A CE1  10 
ATOM 7867  C CE2  . TYR A 1 49 ? 2.407   -0.773  -1.668  1.00 0.00 ? 49 TYR A CE2  10 
ATOM 7868  C CZ   . TYR A 1 49 ? 2.663   -2.102  -1.408  1.00 0.00 ? 49 TYR A CZ   10 
ATOM 7869  O OH   . TYR A 1 49 ? 2.000   -3.072  -2.117  1.00 0.00 ? 49 TYR A OH   10 
ATOM 7870  H H    . TYR A 1 49 ? 6.188   0.392   -1.424  1.00 0.00 ? 49 TYR A H    10 
ATOM 7871  H HA   . TYR A 1 49 ? 6.474   1.972   1.039   1.00 0.00 ? 49 TYR A HA   10 
ATOM 7872  H HB2  . TYR A 1 49 ? 4.543   0.677   1.866   1.00 0.00 ? 49 TYR A HB2  10 
ATOM 7873  H HB3  . TYR A 1 49 ? 4.183   1.862   0.640   1.00 0.00 ? 49 TYR A HB3  10 
ATOM 7874  H HD1  . TYR A 1 49 ? 4.936   -1.755  1.043   1.00 0.00 ? 49 TYR A HD1  10 
ATOM 7875  H HD2  . TYR A 1 49 ? 2.865   1.240   -1.146  1.00 0.00 ? 49 TYR A HD2  10 
ATOM 7876  H HE1  . TYR A 1 49 ? 3.779   -3.501  -0.228  1.00 0.00 ? 49 TYR A HE1  10 
ATOM 7877  H HE2  . TYR A 1 49 ? 1.701   -0.491  -2.429  1.00 0.00 ? 49 TYR A HE2  10 
ATOM 7878  H HH   . TYR A 1 49 ? 2.247   -3.019  -3.042  1.00 0.00 ? 49 TYR A HH   10 
ATOM 7879  N N    . SER A 1 50 ? 6.966   0.006   2.554   1.00 0.00 ? 50 SER A N    10 
ATOM 7880  C CA   . SER A 1 50 ? 7.601   -1.015  3.367   1.00 0.00 ? 50 SER A CA   10 
ATOM 7881  C C    . SER A 1 50 ? 6.827   -1.181  4.663   1.00 0.00 ? 50 SER A C    10 
ATOM 7882  O O    . SER A 1 50 ? 6.932   -0.358  5.572   1.00 0.00 ? 50 SER A O    10 
ATOM 7883  C CB   . SER A 1 50 ? 9.055   -0.650  3.658   1.00 0.00 ? 50 SER A CB   10 
ATOM 7884  O OG   . SER A 1 50 ? 9.155   0.647   4.220   1.00 0.00 ? 50 SER A OG   10 
ATOM 7885  H H    . SER A 1 50 ? 6.580   0.796   2.994   1.00 0.00 ? 50 SER A H    10 
ATOM 7886  H HA   . SER A 1 50 ? 7.571   -1.945  2.818   1.00 0.00 ? 50 SER A HA   10 
ATOM 7887  H HB2  . SER A 1 50 ? 9.469   -1.364  4.355   1.00 0.00 ? 50 SER A HB2  10 
ATOM 7888  H HB3  . SER A 1 50 ? 9.619   -0.676  2.738   1.00 0.00 ? 50 SER A HB3  10 
ATOM 7889  H HG   . SER A 1 50 ? 8.680   0.672   5.054   1.00 0.00 ? 50 SER A HG   10 
ATOM 7890  N N    . ASN A 1 51 ? 6.028   -2.238  4.729   1.00 0.00 ? 51 ASN A N    10 
ATOM 7891  C CA   . ASN A 1 51 ? 5.206   -2.504  5.903   1.00 0.00 ? 51 ASN A CA   10 
ATOM 7892  C C    . ASN A 1 51 ? 5.990   -2.312  7.194   1.00 0.00 ? 51 ASN A C    10 
ATOM 7893  O O    . ASN A 1 51 ? 7.126   -2.767  7.327   1.00 0.00 ? 51 ASN A O    10 
ATOM 7894  C CB   . ASN A 1 51 ? 4.632   -3.915  5.851   1.00 0.00 ? 51 ASN A CB   10 
ATOM 7895  C CG   . ASN A 1 51 ? 3.843   -4.173  4.583   1.00 0.00 ? 51 ASN A CG   10 
ATOM 7896  O OD1  . ASN A 1 51 ? 2.628   -3.977  4.544   1.00 0.00 ? 51 ASN A OD1  10 
ATOM 7897  N ND2  . ASN A 1 51 ? 4.530   -4.615  3.537   1.00 0.00 ? 51 ASN A ND2  10 
ATOM 7898  H H    . ASN A 1 51 ? 5.977   -2.844  3.962   1.00 0.00 ? 51 ASN A H    10 
ATOM 7899  H HA   . ASN A 1 51 ? 4.388   -1.800  5.891   1.00 0.00 ? 51 ASN A HA   10 
ATOM 7900  H HB2  . ASN A 1 51 ? 5.441   -4.627  5.904   1.00 0.00 ? 51 ASN A HB2  10 
ATOM 7901  H HB3  . ASN A 1 51 ? 3.978   -4.054  6.698   1.00 0.00 ? 51 ASN A HB3  10 
ATOM 7902  H HD21 . ASN A 1 51 ? 5.496   -4.749  3.640   1.00 0.00 ? 51 ASN A HD21 10 
ATOM 7903  H HD22 . ASN A 1 51 ? 4.046   -4.788  2.703   1.00 0.00 ? 51 ASN A HD22 10 
ATOM 7904  N N    . GLY A 1 52 ? 5.362   -1.631  8.140   1.00 0.00 ? 52 GLY A N    10 
ATOM 7905  C CA   . GLY A 1 52 ? 5.991   -1.373  9.425   1.00 0.00 ? 52 GLY A CA   10 
ATOM 7906  C C    . GLY A 1 52 ? 5.655   0.005   9.968   1.00 0.00 ? 52 GLY A C    10 
ATOM 7907  O O    . GLY A 1 52 ? 5.462   0.945   9.200   1.00 0.00 ? 52 GLY A O    10 
ATOM 7908  H H    . GLY A 1 52 ? 4.457   -1.301  7.961   1.00 0.00 ? 52 GLY A H    10 
ATOM 7909  H HA2  . GLY A 1 52 ? 5.659   -2.117  10.132  1.00 0.00 ? 52 GLY A HA2  10 
ATOM 7910  H HA3  . GLY A 1 52 ? 7.062   -1.450  9.311   1.00 0.00 ? 52 GLY A HA3  10 
ATOM 7911  N N    . PRO A 1 53 ? 5.580   0.159   11.302  1.00 0.00 ? 53 PRO A N    10 
ATOM 7912  C CA   . PRO A 1 53 ? 5.263   1.447   11.932  1.00 0.00 ? 53 PRO A CA   10 
ATOM 7913  C C    . PRO A 1 53 ? 6.289   2.523   11.592  1.00 0.00 ? 53 PRO A C    10 
ATOM 7914  O O    . PRO A 1 53 ? 7.466   2.403   11.933  1.00 0.00 ? 53 PRO A O    10 
ATOM 7915  C CB   . PRO A 1 53 ? 5.291   1.139   13.433  1.00 0.00 ? 53 PRO A CB   10 
ATOM 7916  C CG   . PRO A 1 53 ? 6.068   -0.127  13.557  1.00 0.00 ? 53 PRO A CG   10 
ATOM 7917  C CD   . PRO A 1 53 ? 5.799   -0.900  12.298  1.00 0.00 ? 53 PRO A CD   10 
ATOM 7918  H HA   . PRO A 1 53 ? 4.280   1.792   11.649  1.00 0.00 ? 53 PRO A HA   10 
ATOM 7919  H HB2  . PRO A 1 53 ? 5.771   1.949   13.961  1.00 0.00 ? 53 PRO A HB2  10 
ATOM 7920  H HB3  . PRO A 1 53 ? 4.280   1.017   13.796  1.00 0.00 ? 53 PRO A HB3  10 
ATOM 7921  H HG2  . PRO A 1 53 ? 7.121   0.095   13.644  1.00 0.00 ? 53 PRO A HG2  10 
ATOM 7922  H HG3  . PRO A 1 53 ? 5.729   -0.684  14.419  1.00 0.00 ? 53 PRO A HG3  10 
ATOM 7923  H HD2  . PRO A 1 53 ? 6.654   -1.507  12.037  1.00 0.00 ? 53 PRO A HD2  10 
ATOM 7924  H HD3  . PRO A 1 53 ? 4.918   -1.513  12.410  1.00 0.00 ? 53 PRO A HD3  10 
ATOM 7925  N N    . CYS A 1 54 ? 5.835   3.575   10.918  1.00 0.00 ? 54 CYS A N    10 
ATOM 7926  C CA   . CYS A 1 54 ? 6.713   4.673   10.531  1.00 0.00 ? 54 CYS A CA   10 
ATOM 7927  C C    . CYS A 1 54 ? 6.111   6.018   10.930  1.00 0.00 ? 54 CYS A C    10 
ATOM 7928  O O    . CYS A 1 54 ? 6.760   6.827   11.593  1.00 0.00 ? 54 CYS A O    10 
ATOM 7929  C CB   . CYS A 1 54 ? 6.970   4.644   9.023   1.00 0.00 ? 54 CYS A CB   10 
ATOM 7930  S SG   . CYS A 1 54 ? 8.067   3.294   8.483   1.00 0.00 ? 54 CYS A SG   10 
ATOM 7931  H H    . CYS A 1 54 ? 4.886   3.613   10.674  1.00 0.00 ? 54 CYS A H    10 
ATOM 7932  H HA   . CYS A 1 54 ? 7.652   4.545   11.049  1.00 0.00 ? 54 CYS A HA   10 
ATOM 7933  H HB2  . CYS A 1 54 ? 6.028   4.527   8.509   1.00 0.00 ? 54 CYS A HB2  10 
ATOM 7934  H HB3  . CYS A 1 54 ? 7.424   5.578   8.725   1.00 0.00 ? 54 CYS A HB3  10 
ATOM 7935  N N    . GLU A 1 55 ? 4.868   6.250   10.520  1.00 0.00 ? 55 GLU A N    10 
ATOM 7936  C CA   . GLU A 1 55 ? 4.179   7.497   10.835  1.00 0.00 ? 55 GLU A CA   10 
ATOM 7937  C C    . GLU A 1 55 ? 3.632   7.470   12.258  1.00 0.00 ? 55 GLU A C    10 
ATOM 7938  O O    . GLU A 1 55 ? 3.442   6.360   12.798  1.00 0.00 ? 55 GLU A O    10 
ATOM 7939  C CB   . GLU A 1 55 ? 3.041   7.745   9.840   1.00 0.00 ? 55 GLU A CB   10 
ATOM 7940  C CG   . GLU A 1 55 ? 2.251   9.014   10.118  1.00 0.00 ? 55 GLU A CG   10 
ATOM 7941  C CD   . GLU A 1 55 ? 1.565   9.558   8.880   1.00 0.00 ? 55 GLU A CD   10 
ATOM 7942  O OE1  . GLU A 1 55 ? 2.187   10.372  8.166   1.00 0.00 ? 55 GLU A OE1  10 
ATOM 7943  O OE2  . GLU A 1 55 ? 0.405   9.170   8.625   1.00 0.00 ? 55 GLU A OE2  10 
ATOM 7944  O OXT  . GLU A 1 55 ? 3.398   8.559   12.823  1.00 0.00 ? 55 GLU A OXT  10 
ATOM 7945  H H    . GLU A 1 55 ? 4.402   5.567   9.994   1.00 0.00 ? 55 GLU A H    10 
ATOM 7946  H HA   . GLU A 1 55 ? 4.896   8.301   10.754  1.00 0.00 ? 55 GLU A HA   10 
ATOM 7947  H HB2  . GLU A 1 55 ? 3.458   7.818   8.846   1.00 0.00 ? 55 GLU A HB2  10 
ATOM 7948  H HB3  . GLU A 1 55 ? 2.360   6.907   9.874   1.00 0.00 ? 55 GLU A HB3  10 
ATOM 7949  H HG2  . GLU A 1 55 ? 1.498   8.799   10.862  1.00 0.00 ? 55 GLU A HG2  10 
ATOM 7950  H HG3  . GLU A 1 55 ? 2.926   9.767   10.498  1.00 0.00 ? 55 GLU A HG3  10 
ATOM 7951  N N    . ALA A 1 1  ? 8.315   -4.699  -9.120  1.00 0.00 ? 1  ALA A N    11 
ATOM 7952  C CA   . ALA A 1 1  ? 7.298   -4.727  -8.036  1.00 0.00 ? 1  ALA A CA   11 
ATOM 7953  C C    . ALA A 1 1  ? 7.857   -4.156  -6.737  1.00 0.00 ? 1  ALA A C    11 
ATOM 7954  O O    . ALA A 1 1  ? 9.017   -3.753  -6.667  1.00 0.00 ? 1  ALA A O    11 
ATOM 7955  C CB   . ALA A 1 1  ? 6.796   -6.146  -7.818  1.00 0.00 ? 1  ALA A CB   11 
ATOM 7956  H H1   . ALA A 1 1  ? 8.892   -5.559  -9.036  1.00 0.00 ? 1  ALA A H1   11 
ATOM 7957  H H2   . ALA A 1 1  ? 8.893   -3.842  -8.991  1.00 0.00 ? 1  ALA A H2   11 
ATOM 7958  H H3   . ALA A 1 1  ? 7.810   -4.678  -10.028 1.00 0.00 ? 1  ALA A H3   11 
ATOM 7959  H HA   . ALA A 1 1  ? 6.458   -4.121  -8.342  1.00 0.00 ? 1  ALA A HA   11 
ATOM 7960  H HB1  . ALA A 1 1  ? 6.370   -6.229  -6.830  1.00 0.00 ? 1  ALA A HB1  11 
ATOM 7961  H HB2  . ALA A 1 1  ? 7.620   -6.837  -7.913  1.00 0.00 ? 1  ALA A HB2  11 
ATOM 7962  H HB3  . ALA A 1 1  ? 6.044   -6.378  -8.556  1.00 0.00 ? 1  ALA A HB3  11 
ATOM 7963  N N    . HIS A 1 2  ? 7.012   -4.121  -5.716  1.00 0.00 ? 2  HIS A N    11 
ATOM 7964  C CA   . HIS A 1 2  ? 7.385   -3.601  -4.414  1.00 0.00 ? 2  HIS A CA   11 
ATOM 7965  C C    . HIS A 1 2  ? 7.140   -4.632  -3.334  1.00 0.00 ? 2  HIS A C    11 
ATOM 7966  O O    . HIS A 1 2  ? 7.178   -5.838  -3.583  1.00 0.00 ? 2  HIS A O    11 
ATOM 7967  C CB   . HIS A 1 2  ? 6.637   -2.293  -4.158  1.00 0.00 ? 2  HIS A CB   11 
ATOM 7968  C CG   . HIS A 1 2  ? 7.539   -1.113  -4.311  1.00 0.00 ? 2  HIS A CG   11 
ATOM 7969  N ND1  . HIS A 1 2  ? 7.355   -0.144  -5.270  1.00 0.00 ? 2  HIS A ND1  11 
ATOM 7970  C CD2  . HIS A 1 2  ? 8.667   -0.772  -3.644  1.00 0.00 ? 2  HIS A CD2  11 
ATOM 7971  C CE1  . HIS A 1 2  ? 8.332   0.742   -5.191  1.00 0.00 ? 2  HIS A CE1  11 
ATOM 7972  N NE2  . HIS A 1 2  ? 9.141   0.384   -4.211  1.00 0.00 ? 2  HIS A NE2  11 
ATOM 7973  H H    . HIS A 1 2  ? 6.102   -4.450  -5.842  1.00 0.00 ? 2  HIS A H    11 
ATOM 7974  H HA   . HIS A 1 2  ? 8.432   -3.384  -4.406  1.00 0.00 ? 2  HIS A HA   11 
ATOM 7975  H HB2  . HIS A 1 2  ? 5.830   -2.197  -4.872  1.00 0.00 ? 2  HIS A HB2  11 
ATOM 7976  H HB3  . HIS A 1 2  ? 6.235   -2.285  -3.159  1.00 0.00 ? 2  HIS A HB3  11 
ATOM 7977  H HD1  . HIS A 1 2  ? 6.624   -0.112  -5.918  1.00 0.00 ? 2  HIS A HD1  11 
ATOM 7978  H HD2  . HIS A 1 2  ? 9.112   -1.311  -2.820  1.00 0.00 ? 2  HIS A HD2  11 
ATOM 7979  H HE1  . HIS A 1 2  ? 8.448   1.612   -5.819  1.00 0.00 ? 2  HIS A HE1  11 
ATOM 7980  H HE2  . HIS A 1 2  ? 10.009  0.797   -4.018  1.00 0.00 ? 2  HIS A HE2  11 
ATOM 7981  N N    . MET A 1 3  ? 6.932   -4.154  -2.138  1.00 0.00 ? 3  MET A N    11 
ATOM 7982  C CA   . MET A 1 3  ? 6.726   -5.035  -0.990  1.00 0.00 ? 3  MET A CA   11 
ATOM 7983  C C    . MET A 1 3  ? 5.409   -5.806  -1.112  1.00 0.00 ? 3  MET A C    11 
ATOM 7984  O O    . MET A 1 3  ? 4.816   -5.870  -2.188  1.00 0.00 ? 3  MET A O    11 
ATOM 7985  C CB   . MET A 1 3  ? 6.746   -4.220  0.308   1.00 0.00 ? 3  MET A CB   11 
ATOM 7986  C CG   . MET A 1 3  ? 7.989   -4.453  1.151   1.00 0.00 ? 3  MET A CG   11 
ATOM 7987  S SD   . MET A 1 3  ? 9.394   -3.464  0.604   1.00 0.00 ? 3  MET A SD   11 
ATOM 7988  C CE   . MET A 1 3  ? 10.461  -3.565  2.039   1.00 0.00 ? 3  MET A CE   11 
ATOM 7989  H H    . MET A 1 3  ? 6.960   -3.181  -2.023  1.00 0.00 ? 3  MET A H    11 
ATOM 7990  H HA   . MET A 1 3  ? 7.540   -5.742  -0.969  1.00 0.00 ? 3  MET A HA   11 
ATOM 7991  H HB2  . MET A 1 3  ? 6.700   -3.170  0.059   1.00 0.00 ? 3  MET A HB2  11 
ATOM 7992  H HB3  . MET A 1 3  ? 5.882   -4.478  0.901   1.00 0.00 ? 3  MET A HB3  11 
ATOM 7993  H HG2  . MET A 1 3  ? 7.766   -4.199  2.176   1.00 0.00 ? 3  MET A HG2  11 
ATOM 7994  H HG3  . MET A 1 3  ? 8.257   -5.498  1.090   1.00 0.00 ? 3  MET A HG3  11 
ATOM 7995  H HE1  . MET A 1 3  ? 9.897   -3.315  2.925   1.00 0.00 ? 3  MET A HE1  11 
ATOM 7996  H HE2  . MET A 1 3  ? 11.282  -2.872  1.927   1.00 0.00 ? 3  MET A HE2  11 
ATOM 7997  H HE3  . MET A 1 3  ? 10.849  -4.570  2.130   1.00 0.00 ? 3  MET A HE3  11 
ATOM 7998  N N    . ASP A 1 4  ? 4.983   -6.426  -0.013  1.00 0.00 ? 4  ASP A N    11 
ATOM 7999  C CA   . ASP A 1 4  ? 3.758   -7.226  0.000   1.00 0.00 ? 4  ASP A CA   11 
ATOM 8000  C C    . ASP A 1 4  ? 2.524   -6.385  -0.325  1.00 0.00 ? 4  ASP A C    11 
ATOM 8001  O O    . ASP A 1 4  ? 2.207   -5.430  0.384   1.00 0.00 ? 4  ASP A O    11 
ATOM 8002  C CB   . ASP A 1 4  ? 3.583   -7.894  1.364   1.00 0.00 ? 4  ASP A CB   11 
ATOM 8003  C CG   . ASP A 1 4  ? 4.228   -9.265  1.425   1.00 0.00 ? 4  ASP A CG   11 
ATOM 8004  O OD1  . ASP A 1 4  ? 3.640   -10.222 0.878   1.00 0.00 ? 4  ASP A OD1  11 
ATOM 8005  O OD2  . ASP A 1 4  ? 5.320   -9.382  2.020   1.00 0.00 ? 4  ASP A OD2  11 
ATOM 8006  H H    . ASP A 1 4  ? 5.516   -6.362  0.806   1.00 0.00 ? 4  ASP A H    11 
ATOM 8007  H HA   . ASP A 1 4  ? 3.860   -7.993  -0.752  1.00 0.00 ? 4  ASP A HA   11 
ATOM 8008  H HB2  . ASP A 1 4  ? 4.034   -7.272  2.122   1.00 0.00 ? 4  ASP A HB2  11 
ATOM 8009  H HB3  . ASP A 1 4  ? 2.529   -8.002  1.573   1.00 0.00 ? 4  ASP A HB3  11 
ATOM 8010  N N    . CYS A 1 5  ? 1.825   -6.755  -1.398  1.00 0.00 ? 5  CYS A N    11 
ATOM 8011  C CA   . CYS A 1 5  ? 0.621   -6.040  -1.812  1.00 0.00 ? 5  CYS A CA   11 
ATOM 8012  C C    . CYS A 1 5  ? -0.578  -6.478  -0.963  1.00 0.00 ? 5  CYS A C    11 
ATOM 8013  O O    . CYS A 1 5  ? -0.465  -6.580  0.258   1.00 0.00 ? 5  CYS A O    11 
ATOM 8014  C CB   . CYS A 1 5  ? 0.352   -6.279  -3.303  1.00 0.00 ? 5  CYS A CB   11 
ATOM 8015  S SG   . CYS A 1 5  ? 1.606   -5.560  -4.411  1.00 0.00 ? 5  CYS A SG   11 
ATOM 8016  H H    . CYS A 1 5  ? 2.124   -7.529  -1.919  1.00 0.00 ? 5  CYS A H    11 
ATOM 8017  H HA   . CYS A 1 5  ? 0.791   -4.987  -1.650  1.00 0.00 ? 5  CYS A HA   11 
ATOM 8018  H HB2  . CYS A 1 5  ? 0.317   -7.341  -3.492  1.00 0.00 ? 5  CYS A HB2  11 
ATOM 8019  H HB3  . CYS A 1 5  ? -0.600  -5.840  -3.564  1.00 0.00 ? 5  CYS A HB3  11 
ATOM 8020  N N    . THR A 1 6  ? -1.722  -6.742  -1.598  1.00 0.00 ? 6  THR A N    11 
ATOM 8021  C CA   . THR A 1 6  ? -2.904  -7.166  -0.874  1.00 0.00 ? 6  THR A CA   11 
ATOM 8022  C C    . THR A 1 6  ? -2.660  -8.513  -0.210  1.00 0.00 ? 6  THR A C    11 
ATOM 8023  O O    . THR A 1 6  ? -2.526  -8.588  1.009   1.00 0.00 ? 6  THR A O    11 
ATOM 8024  C CB   . THR A 1 6  ? -4.101  -7.255  -1.822  1.00 0.00 ? 6  THR A CB   11 
ATOM 8025  O OG1  . THR A 1 6  ? -4.410  -5.980  -2.352  1.00 0.00 ? 6  THR A OG1  11 
ATOM 8026  C CG2  . THR A 1 6  ? -5.352  -7.794  -1.162  1.00 0.00 ? 6  THR A CG2  11 
ATOM 8027  H H    . THR A 1 6  ? -1.775  -6.656  -2.566  1.00 0.00 ? 6  THR A H    11 
ATOM 8028  H HA   . THR A 1 6  ? -3.114  -6.427  -0.109  1.00 0.00 ? 6  THR A HA   11 
ATOM 8029  H HB   . THR A 1 6  ? -3.850  -7.912  -2.643  1.00 0.00 ? 6  THR A HB   11 
ATOM 8030  H HG1  . THR A 1 6  ? -3.771  -5.750  -3.030  1.00 0.00 ? 6  THR A HG1  11 
ATOM 8031  H HG21 . THR A 1 6  ? -5.737  -7.062  -0.468  1.00 0.00 ? 6  THR A HG21 11 
ATOM 8032  H HG22 . THR A 1 6  ? -5.116  -8.705  -0.633  1.00 0.00 ? 6  THR A HG22 11 
ATOM 8033  H HG23 . THR A 1 6  ? -6.097  -8.000  -1.917  1.00 0.00 ? 6  THR A HG23 11 
ATOM 8034  N N    . GLU A 1 7  ? -2.603  -9.577  -1.019  1.00 0.00 ? 7  GLU A N    11 
ATOM 8035  C CA   . GLU A 1 7  ? -2.382  -10.914 -0.502  1.00 0.00 ? 7  GLU A CA   11 
ATOM 8036  C C    . GLU A 1 7  ? -2.374  -11.966 -1.609  1.00 0.00 ? 7  GLU A C    11 
ATOM 8037  O O    . GLU A 1 7  ? -1.877  -13.074 -1.404  1.00 0.00 ? 7  GLU A O    11 
ATOM 8038  C CB   . GLU A 1 7  ? -3.472  -11.254 0.504   1.00 0.00 ? 7  GLU A CB   11 
ATOM 8039  C CG   . GLU A 1 7  ? -3.101  -10.892 1.922   1.00 0.00 ? 7  GLU A CG   11 
ATOM 8040  C CD   . GLU A 1 7  ? -3.340  -12.022 2.904   1.00 0.00 ? 7  GLU A CD   11 
ATOM 8041  O OE1  . GLU A 1 7  ? -4.247  -12.844 2.654   1.00 0.00 ? 7  GLU A OE1  11 
ATOM 8042  O OE2  . GLU A 1 7  ? -2.621  -12.086 3.923   1.00 0.00 ? 7  GLU A OE2  11 
ATOM 8043  H H    . GLU A 1 7  ? -2.712  -9.458  -1.976  1.00 0.00 ? 7  GLU A H    11 
ATOM 8044  H HA   . GLU A 1 7  ? -1.428  -10.926 0.000   1.00 0.00 ? 7  GLU A HA   11 
ATOM 8045  H HB2  . GLU A 1 7  ? -4.367  -10.711 0.237   1.00 0.00 ? 7  GLU A HB2  11 
ATOM 8046  H HB3  . GLU A 1 7  ? -3.672  -12.311 0.460   1.00 0.00 ? 7  GLU A HB3  11 
ATOM 8047  H HG2  . GLU A 1 7  ? -2.053  -10.629 1.943   1.00 0.00 ? 7  GLU A HG2  11 
ATOM 8048  H HG3  . GLU A 1 7  ? -3.691  -10.039 2.220   1.00 0.00 ? 7  GLU A HG3  11 
ATOM 8049  N N    . PHE A 1 8  ? -2.948  -11.645 -2.768  1.00 0.00 ? 8  PHE A N    11 
ATOM 8050  C CA   . PHE A 1 8  ? -3.007  -12.621 -3.856  1.00 0.00 ? 8  PHE A CA   11 
ATOM 8051  C C    . PHE A 1 8  ? -3.141  -11.941 -5.220  1.00 0.00 ? 8  PHE A C    11 
ATOM 8052  O O    . PHE A 1 8  ? -2.772  -10.778 -5.379  1.00 0.00 ? 8  PHE A O    11 
ATOM 8053  C CB   . PHE A 1 8  ? -4.176  -13.590 -3.608  1.00 0.00 ? 8  PHE A CB   11 
ATOM 8054  C CG   . PHE A 1 8  ? -5.354  -12.971 -2.900  1.00 0.00 ? 8  PHE A CG   11 
ATOM 8055  C CD1  . PHE A 1 8  ? -5.703  -11.647 -3.122  1.00 0.00 ? 8  PHE A CD1  11 
ATOM 8056  C CD2  . PHE A 1 8  ? -6.114  -13.718 -2.013  1.00 0.00 ? 8  PHE A CD2  11 
ATOM 8057  C CE1  . PHE A 1 8  ? -6.784  -11.081 -2.472  1.00 0.00 ? 8  PHE A CE1  11 
ATOM 8058  C CE2  . PHE A 1 8  ? -7.196  -13.157 -1.360  1.00 0.00 ? 8  PHE A CE2  11 
ATOM 8059  C CZ   . PHE A 1 8  ? -7.531  -11.837 -1.590  1.00 0.00 ? 8  PHE A CZ   11 
ATOM 8060  H H    . PHE A 1 8  ? -3.360  -10.752 -2.888  1.00 0.00 ? 8  PHE A H    11 
ATOM 8061  H HA   . PHE A 1 8  ? -2.084  -13.181 -3.840  1.00 0.00 ? 8  PHE A HA   11 
ATOM 8062  H HB2  . PHE A 1 8  ? -4.527  -13.977 -4.549  1.00 0.00 ? 8  PHE A HB2  11 
ATOM 8063  H HB3  . PHE A 1 8  ? -3.824  -14.412 -3.001  1.00 0.00 ? 8  PHE A HB3  11 
ATOM 8064  H HD1  . PHE A 1 8  ? -5.120  -11.055 -3.812  1.00 0.00 ? 8  PHE A HD1  11 
ATOM 8065  H HD2  . PHE A 1 8  ? -5.853  -14.750 -1.831  1.00 0.00 ? 8  PHE A HD2  11 
ATOM 8066  H HE1  . PHE A 1 8  ? -7.045  -10.049 -2.654  1.00 0.00 ? 8  PHE A HE1  11 
ATOM 8067  H HE2  . PHE A 1 8  ? -7.778  -13.750 -0.671  1.00 0.00 ? 8  PHE A HE2  11 
ATOM 8068  H HZ   . PHE A 1 8  ? -8.375  -11.398 -1.081  1.00 0.00 ? 8  PHE A HZ   11 
ATOM 8069  N N    . ASN A 1 9  ? -3.670  -12.673 -6.205  1.00 0.00 ? 9  ASN A N    11 
ATOM 8070  C CA   . ASN A 1 9  ? -3.847  -12.131 -7.544  1.00 0.00 ? 9  ASN A CA   11 
ATOM 8071  C C    . ASN A 1 9  ? -4.917  -11.048 -7.521  1.00 0.00 ? 9  ASN A C    11 
ATOM 8072  O O    . ASN A 1 9  ? -4.660  -9.917  -7.935  1.00 0.00 ? 9  ASN A O    11 
ATOM 8073  C CB   . ASN A 1 9  ? -4.226  -13.242 -8.529  1.00 0.00 ? 9  ASN A CB   11 
ATOM 8074  C CG   . ASN A 1 9  ? -3.448  -14.522 -8.290  1.00 0.00 ? 9  ASN A CG   11 
ATOM 8075  O OD1  . ASN A 1 9  ? -3.806  -15.330 -7.433  1.00 0.00 ? 9  ASN A OD1  11 
ATOM 8076  N ND2  . ASN A 1 9  ? -2.373  -14.713 -9.047  1.00 0.00 ? 9  ASN A ND2  11 
ATOM 8077  H H    . ASN A 1 9  ? -3.942  -13.594 -6.027  1.00 0.00 ? 9  ASN A H    11 
ATOM 8078  H HA   . ASN A 1 9  ? -2.909  -11.690 -7.851  1.00 0.00 ? 9  ASN A HA   11 
ATOM 8079  H HB2  . ASN A 1 9  ? -5.279  -13.460 -8.429  1.00 0.00 ? 9  ASN A HB2  11 
ATOM 8080  H HB3  . ASN A 1 9  ? -4.028  -12.904 -9.535  1.00 0.00 ? 9  ASN A HB3  11 
ATOM 8081  H HD21 . ASN A 1 9  ? -2.146  -14.028 -9.710  1.00 0.00 ? 9  ASN A HD21 11 
ATOM 8082  H HD22 . ASN A 1 9  ? -1.852  -15.533 -8.913  1.00 0.00 ? 9  ASN A HD22 11 
ATOM 8083  N N    . PRO A 1 10 ? -6.122  -11.349 -6.994  1.00 0.00 ? 10 PRO A N    11 
ATOM 8084  C CA   . PRO A 1 10 ? -7.179  -10.347 -6.890  1.00 0.00 ? 10 PRO A CA   11 
ATOM 8085  C C    . PRO A 1 10 ? -6.746  -9.248  -5.931  1.00 0.00 ? 10 PRO A C    11 
ATOM 8086  O O    . PRO A 1 10 ? -7.056  -9.285  -4.743  1.00 0.00 ? 10 PRO A O    11 
ATOM 8087  C CB   . PRO A 1 10 ? -8.375  -11.123 -6.331  1.00 0.00 ? 10 PRO A CB   11 
ATOM 8088  C CG   . PRO A 1 10 ? -7.787  -12.320 -5.669  1.00 0.00 ? 10 PRO A CG   11 
ATOM 8089  C CD   . PRO A 1 10 ? -6.528  -12.647 -6.425  1.00 0.00 ? 10 PRO A CD   11 
ATOM 8090  H HA   . PRO A 1 10 ? -7.425  -9.921  -7.851  1.00 0.00 ? 10 PRO A HA   11 
ATOM 8091  H HB2  . PRO A 1 10 ? -8.909  -10.503 -5.624  1.00 0.00 ? 10 PRO A HB2  11 
ATOM 8092  H HB3  . PRO A 1 10 ? -9.034  -11.403 -7.138  1.00 0.00 ? 10 PRO A HB3  11 
ATOM 8093  H HG2  . PRO A 1 10 ? -7.557  -12.093 -4.639  1.00 0.00 ? 10 PRO A HG2  11 
ATOM 8094  H HG3  . PRO A 1 10 ? -8.481  -13.146 -5.724  1.00 0.00 ? 10 PRO A HG3  11 
ATOM 8095  H HD2  . PRO A 1 10 ? -5.778  -13.029 -5.752  1.00 0.00 ? 10 PRO A HD2  11 
ATOM 8096  H HD3  . PRO A 1 10 ? -6.735  -13.363 -7.207  1.00 0.00 ? 10 PRO A HD3  11 
ATOM 8097  N N    . LEU A 1 11 ? -5.979  -8.302  -6.464  1.00 0.00 ? 11 LEU A N    11 
ATOM 8098  C CA   . LEU A 1 11 ? -5.428  -7.192  -5.691  1.00 0.00 ? 11 LEU A CA   11 
ATOM 8099  C C    . LEU A 1 11 ? -6.430  -6.556  -4.734  1.00 0.00 ? 11 LEU A C    11 
ATOM 8100  O O    . LEU A 1 11 ? -7.477  -7.124  -4.441  1.00 0.00 ? 11 LEU A O    11 
ATOM 8101  C CB   . LEU A 1 11 ? -4.819  -6.149  -6.633  1.00 0.00 ? 11 LEU A CB   11 
ATOM 8102  C CG   . LEU A 1 11 ? -5.679  -5.730  -7.834  1.00 0.00 ? 11 LEU A CG   11 
ATOM 8103  C CD1  . LEU A 1 11 ? -5.412  -6.636  -9.026  1.00 0.00 ? 11 LEU A CD1  11 
ATOM 8104  C CD2  . LEU A 1 11 ? -7.161  -5.734  -7.480  1.00 0.00 ? 11 LEU A CD2  11 
ATOM 8105  H H    . LEU A 1 11 ? -5.748  -8.370  -7.413  1.00 0.00 ? 11 LEU A H    11 
ATOM 8106  H HA   . LEU A 1 11 ? -4.633  -7.586  -5.084  1.00 0.00 ? 11 LEU A HA   11 
ATOM 8107  H HB2  . LEU A 1 11 ? -4.590  -5.270  -6.056  1.00 0.00 ? 11 LEU A HB2  11 
ATOM 8108  H HB3  . LEU A 1 11 ? -3.892  -6.555  -7.010  1.00 0.00 ? 11 LEU A HB3  11 
ATOM 8109  H HG   . LEU A 1 11 ? -5.409  -4.726  -8.123  1.00 0.00 ? 11 LEU A HG   11 
ATOM 8110  H HD11 . LEU A 1 11 ? -6.208  -7.361  -9.115  1.00 0.00 ? 11 LEU A HD11 11 
ATOM 8111  H HD12 . LEU A 1 11 ? -4.471  -7.149  -8.885  1.00 0.00 ? 11 LEU A HD12 11 
ATOM 8112  H HD13 . LEU A 1 11 ? -5.365  -6.041  -9.926  1.00 0.00 ? 11 LEU A HD13 11 
ATOM 8113  H HD21 . LEU A 1 11 ? -7.319  -5.143  -6.591  1.00 0.00 ? 11 LEU A HD21 11 
ATOM 8114  H HD22 . LEU A 1 11 ? -7.487  -6.747  -7.302  1.00 0.00 ? 11 LEU A HD22 11 
ATOM 8115  H HD23 . LEU A 1 11 ? -7.727  -5.312  -8.298  1.00 0.00 ? 11 LEU A HD23 11 
ATOM 8116  N N    . CYS A 1 12 ? -6.039  -5.392  -4.216  1.00 0.00 ? 12 CYS A N    11 
ATOM 8117  C CA   . CYS A 1 12 ? -6.801  -4.636  -3.216  1.00 0.00 ? 12 CYS A CA   11 
ATOM 8118  C C    . CYS A 1 12 ? -8.256  -5.054  -3.106  1.00 0.00 ? 12 CYS A C    11 
ATOM 8119  O O    . CYS A 1 12 ? -9.180  -4.275  -3.338  1.00 0.00 ? 12 CYS A O    11 
ATOM 8120  C CB   . CYS A 1 12 ? -6.698  -3.131  -3.466  1.00 0.00 ? 12 CYS A CB   11 
ATOM 8121  S SG   . CYS A 1 12 ? -7.702  -2.500  -4.851  1.00 0.00 ? 12 CYS A SG   11 
ATOM 8122  H H    . CYS A 1 12 ? -5.163  -5.057  -4.474  1.00 0.00 ? 12 CYS A H    11 
ATOM 8123  H HA   . CYS A 1 12 ? -6.339  -4.842  -2.265  1.00 0.00 ? 12 CYS A HA   11 
ATOM 8124  H HB2  . CYS A 1 12 ? -7.012  -2.609  -2.575  1.00 0.00 ? 12 CYS A HB2  11 
ATOM 8125  H HB3  . CYS A 1 12 ? -5.670  -2.885  -3.669  1.00 0.00 ? 12 CYS A HB3  11 
ATOM 8126  N N    . ARG A 1 13 ? -8.434  -6.289  -2.685  1.00 0.00 ? 13 ARG A N    11 
ATOM 8127  C CA   . ARG A 1 13 ? -9.759  -6.839  -2.462  1.00 0.00 ? 13 ARG A CA   11 
ATOM 8128  C C    . ARG A 1 13 ? -10.153 -6.611  -1.005  1.00 0.00 ? 13 ARG A C    11 
ATOM 8129  O O    . ARG A 1 13 ? -10.941 -7.364  -0.432  1.00 0.00 ? 13 ARG A O    11 
ATOM 8130  C CB   . ARG A 1 13 ? -9.783  -8.333  -2.793  1.00 0.00 ? 13 ARG A CB   11 
ATOM 8131  C CG   . ARG A 1 13 ? -10.322 -8.639  -4.182  1.00 0.00 ? 13 ARG A CG   11 
ATOM 8132  C CD   . ARG A 1 13 ? -11.730 -8.095  -4.368  1.00 0.00 ? 13 ARG A CD   11 
ATOM 8133  N NE   . ARG A 1 13 ? -12.710 -9.168  -4.535  1.00 0.00 ? 13 ARG A NE   11 
ATOM 8134  C CZ   . ARG A 1 13 ? -12.918 -9.811  -5.681  1.00 0.00 ? 13 ARG A CZ   11 
ATOM 8135  N NH1  . ARG A 1 13 ? -12.220 -9.494  -6.765  1.00 0.00 ? 13 ARG A NH1  11 
ATOM 8136  N NH2  . ARG A 1 13 ? -13.826 -10.776 -5.744  1.00 0.00 ? 13 ARG A NH2  11 
ATOM 8137  H H    . ARG A 1 13 ? -7.641  -6.838  -2.486  1.00 0.00 ? 13 ARG A H    11 
ATOM 8138  H HA   . ARG A 1 13 ? -10.454 -6.317  -3.104  1.00 0.00 ? 13 ARG A HA   11 
ATOM 8139  H HB2  . ARG A 1 13 ? -8.778  -8.721  -2.729  1.00 0.00 ? 13 ARG A HB2  11 
ATOM 8140  H HB3  . ARG A 1 13 ? -10.404 -8.842  -2.071  1.00 0.00 ? 13 ARG A HB3  11 
ATOM 8141  H HG2  . ARG A 1 13 ? -9.673  -8.185  -4.916  1.00 0.00 ? 13 ARG A HG2  11 
ATOM 8142  H HG3  . ARG A 1 13 ? -10.337 -9.709  -4.324  1.00 0.00 ? 13 ARG A HG3  11 
ATOM 8143  H HD2  . ARG A 1 13 ? -11.997 -7.509  -3.502  1.00 0.00 ? 13 ARG A HD2  11 
ATOM 8144  H HD3  . ARG A 1 13 ? -11.747 -7.467  -5.247  1.00 0.00 ? 13 ARG A HD3  11 
ATOM 8145  H HE   . ARG A 1 13 ? -13.238 -9.423  -3.749  1.00 0.00 ? 13 ARG A HE   11 
ATOM 8146  H HH11 . ARG A 1 13 ? -11.532 -8.769  -6.724  1.00 0.00 ? 13 ARG A HH11 11 
ATOM 8147  H HH12 . ARG A 1 13 ? -12.381 -9.981  -7.624  1.00 0.00 ? 13 ARG A HH12 11 
ATOM 8148  H HH21 . ARG A 1 13 ? -14.353 -11.022 -4.930  1.00 0.00 ? 13 ARG A HH21 11 
ATOM 8149  H HH22 . ARG A 1 13 ? -13.982 -11.261 -6.606  1.00 0.00 ? 13 ARG A HH22 11 
ATOM 8150  N N    . CYS A 1 14 ? -9.582  -5.561  -0.409  1.00 0.00 ? 14 CYS A N    11 
ATOM 8151  C CA   . CYS A 1 14 ? -9.833  -5.209  0.960   1.00 0.00 ? 14 CYS A CA   11 
ATOM 8152  C C    . CYS A 1 14 ? -10.337 -3.778  1.031   1.00 0.00 ? 14 CYS A C    11 
ATOM 8153  O O    . CYS A 1 14 ? -10.481 -3.093  0.018   1.00 0.00 ? 14 CYS A O    11 
ATOM 8154  C CB   . CYS A 1 14 ? -8.535  -5.362  1.782   1.00 0.00 ? 14 CYS A CB   11 
ATOM 8155  S SG   . CYS A 1 14 ? -7.568  -3.818  2.004   1.00 0.00 ? 14 CYS A SG   11 
ATOM 8156  H H    . CYS A 1 14 ? -8.968  -5.002  -0.905  1.00 0.00 ? 14 CYS A H    11 
ATOM 8157  H HA   . CYS A 1 14 ? -10.588 -5.873  1.352   1.00 0.00 ? 14 CYS A HA   11 
ATOM 8158  H HB2  . CYS A 1 14 ? -8.785  -5.729  2.765   1.00 0.00 ? 14 CYS A HB2  11 
ATOM 8159  H HB3  . CYS A 1 14 ? -7.895  -6.081  1.291   1.00 0.00 ? 14 CYS A HB3  11 
ATOM 8160  N N    . ASN A 1 15 ? -10.565 -3.341  2.240   1.00 0.00 ? 15 ASN A N    11 
ATOM 8161  C CA   . ASN A 1 15 ? -11.015 -1.984  2.507   1.00 0.00 ? 15 ASN A CA   11 
ATOM 8162  C C    . ASN A 1 15 ? -10.974 -1.689  3.987   1.00 0.00 ? 15 ASN A C    11 
ATOM 8163  O O    . ASN A 1 15 ? -10.134 -0.920  4.455   1.00 0.00 ? 15 ASN A O    11 
ATOM 8164  C CB   . ASN A 1 15 ? -12.419 -1.732  1.981   1.00 0.00 ? 15 ASN A CB   11 
ATOM 8165  C CG   . ASN A 1 15 ? -12.531 -0.349  1.368   1.00 0.00 ? 15 ASN A CG   11 
ATOM 8166  O OD1  . ASN A 1 15 ? -13.329 -0.118  0.462   1.00 0.00 ? 15 ASN A OD1  11 
ATOM 8167  N ND2  . ASN A 1 15 ? -11.715 0.582   1.871   1.00 0.00 ? 15 ASN A ND2  11 
ATOM 8168  H H    . ASN A 1 15 ? -10.394 -3.947  2.979   1.00 0.00 ? 15 ASN A H    11 
ATOM 8169  H HA   . ASN A 1 15 ? -10.334 -1.316  2.008   1.00 0.00 ? 15 ASN A HA   11 
ATOM 8170  H HB2  . ASN A 1 15 ? -12.658 -2.470  1.237   1.00 0.00 ? 15 ASN A HB2  11 
ATOM 8171  H HB3  . ASN A 1 15 ? -13.125 -1.803  2.795   1.00 0.00 ? 15 ASN A HB3  11 
ATOM 8172  H HD21 . ASN A 1 15 ? -11.105 0.326   2.597   1.00 0.00 ? 15 ASN A HD21 11 
ATOM 8173  H HD22 . ASN A 1 15 ? -11.750 1.481   1.492   1.00 0.00 ? 15 ASN A HD22 11 
ATOM 8174  N N    . LYS A 1 16 ? -11.873 -2.319  4.728   1.00 0.00 ? 16 LYS A N    11 
ATOM 8175  C CA   . LYS A 1 16 ? -11.915 -2.137  6.174   1.00 0.00 ? 16 LYS A CA   11 
ATOM 8176  C C    . LYS A 1 16 ? -10.705 -2.801  6.813   1.00 0.00 ? 16 LYS A C    11 
ATOM 8177  O O    . LYS A 1 16 ? -10.774 -3.330  7.923   1.00 0.00 ? 16 LYS A O    11 
ATOM 8178  C CB   . LYS A 1 16 ? -13.197 -2.710  6.773   1.00 0.00 ? 16 LYS A CB   11 
ATOM 8179  C CG   . LYS A 1 16 ? -13.438 -2.247  8.201   1.00 0.00 ? 16 LYS A CG   11 
ATOM 8180  C CD   . LYS A 1 16 ? -14.078 -0.869  8.239   1.00 0.00 ? 16 LYS A CD   11 
ATOM 8181  C CE   . LYS A 1 16 ? -13.083 0.197   8.670   1.00 0.00 ? 16 LYS A CE   11 
ATOM 8182  N NZ   . LYS A 1 16 ? -13.761 1.458   9.080   1.00 0.00 ? 16 LYS A NZ   11 
ATOM 8183  H H    . LYS A 1 16 ? -12.506 -2.929  4.292   1.00 0.00 ? 16 LYS A H    11 
ATOM 8184  H HA   . LYS A 1 16 ? -11.875 -1.075  6.374   1.00 0.00 ? 16 LYS A HA   11 
ATOM 8185  H HB2  . LYS A 1 16 ? -14.037 -2.402  6.168   1.00 0.00 ? 16 LYS A HB2  11 
ATOM 8186  H HB3  . LYS A 1 16 ? -13.135 -3.788  6.771   1.00 0.00 ? 16 LYS A HB3  11 
ATOM 8187  H HG2  . LYS A 1 16 ? -14.090 -2.952  8.694   1.00 0.00 ? 16 LYS A HG2  11 
ATOM 8188  H HG3  . LYS A 1 16 ? -12.490 -2.207  8.720   1.00 0.00 ? 16 LYS A HG3  11 
ATOM 8189  H HD2  . LYS A 1 16 ? -14.444 -0.625  7.251   1.00 0.00 ? 16 LYS A HD2  11 
ATOM 8190  H HD3  . LYS A 1 16 ? -14.901 -0.885  8.937   1.00 0.00 ? 16 LYS A HD3  11 
ATOM 8191  H HE2  . LYS A 1 16 ? -12.510 -0.181  9.505   1.00 0.00 ? 16 LYS A HE2  11 
ATOM 8192  H HE3  . LYS A 1 16 ? -12.419 0.406   7.845   1.00 0.00 ? 16 LYS A HE3  11 
ATOM 8193  H HZ1  . LYS A 1 16 ? -13.906 2.070   8.251   1.00 0.00 ? 16 LYS A HZ1  11 
ATOM 8194  H HZ2  . LYS A 1 16 ? -13.180 1.966   9.776   1.00 0.00 ? 16 LYS A HZ2  11 
ATOM 8195  H HZ3  . LYS A 1 16 ? -14.685 1.243   9.506   1.00 0.00 ? 16 LYS A HZ3  11 
ATOM 8196  N N    . MET A 1 17 ? -9.594  -2.761  6.089   1.00 0.00 ? 17 MET A N    11 
ATOM 8197  C CA   . MET A 1 17 ? -8.342  -3.335  6.531   1.00 0.00 ? 17 MET A CA   11 
ATOM 8198  C C    . MET A 1 17 ? -8.080  -2.998  7.995   1.00 0.00 ? 17 MET A C    11 
ATOM 8199  O O    . MET A 1 17 ? -8.546  -1.975  8.495   1.00 0.00 ? 17 MET A O    11 
ATOM 8200  C CB   . MET A 1 17 ? -7.219  -2.806  5.639   1.00 0.00 ? 17 MET A CB   11 
ATOM 8201  C CG   . MET A 1 17 ? -5.982  -3.688  5.625   1.00 0.00 ? 17 MET A CG   11 
ATOM 8202  S SD   . MET A 1 17 ? -6.242  -5.236  4.737   1.00 0.00 ? 17 MET A SD   11 
ATOM 8203  C CE   . MET A 1 17 ? -6.680  -6.332  6.083   1.00 0.00 ? 17 MET A CE   11 
ATOM 8204  H H    . MET A 1 17 ? -9.616  -2.321  5.222   1.00 0.00 ? 17 MET A H    11 
ATOM 8205  H HA   . MET A 1 17 ? -8.406  -4.407  6.421   1.00 0.00 ? 17 MET A HA   11 
ATOM 8206  H HB2  . MET A 1 17 ? -7.595  -2.728  4.624   1.00 0.00 ? 17 MET A HB2  11 
ATOM 8207  H HB3  . MET A 1 17 ? -6.938  -1.819  5.978   1.00 0.00 ? 17 MET A HB3  11 
ATOM 8208  H HG2  . MET A 1 17 ? -5.176  -3.149  5.150   1.00 0.00 ? 17 MET A HG2  11 
ATOM 8209  H HG3  . MET A 1 17 ? -5.708  -3.916  6.645   1.00 0.00 ? 17 MET A HG3  11 
ATOM 8210  H HE1  . MET A 1 17 ? -6.369  -7.339  5.842   1.00 0.00 ? 17 MET A HE1  11 
ATOM 8211  H HE2  . MET A 1 17 ? -7.750  -6.311  6.230   1.00 0.00 ? 17 MET A HE2  11 
ATOM 8212  H HE3  . MET A 1 17 ? -6.185  -6.010  6.987   1.00 0.00 ? 17 MET A HE3  11 
ATOM 8213  N N    . LEU A 1 18 ? -7.347  -3.867  8.678   1.00 0.00 ? 18 LEU A N    11 
ATOM 8214  C CA   . LEU A 1 18 ? -7.041  -3.661  10.091  1.00 0.00 ? 18 LEU A CA   11 
ATOM 8215  C C    . LEU A 1 18 ? -6.079  -2.492  10.277  1.00 0.00 ? 18 LEU A C    11 
ATOM 8216  O O    . LEU A 1 18 ? -4.964  -2.669  10.768  1.00 0.00 ? 18 LEU A O    11 
ATOM 8217  C CB   . LEU A 1 18 ? -6.442  -4.933  10.702  1.00 0.00 ? 18 LEU A CB   11 
ATOM 8218  C CG   . LEU A 1 18 ? -5.504  -5.723  9.784   1.00 0.00 ? 18 LEU A CG   11 
ATOM 8219  C CD1  . LEU A 1 18 ? -4.511  -4.797  9.098   1.00 0.00 ? 18 LEU A CD1  11 
ATOM 8220  C CD2  . LEU A 1 18 ? -4.771  -6.800  10.571  1.00 0.00 ? 18 LEU A CD2  11 
ATOM 8221  H H    . LEU A 1 18 ? -7.013  -4.669  8.227   1.00 0.00 ? 18 LEU A H    11 
ATOM 8222  H HA   . LEU A 1 18 ? -7.966  -3.431  10.598  1.00 0.00 ? 18 LEU A HA   11 
ATOM 8223  H HB2  . LEU A 1 18 ? -5.891  -4.655  11.590  1.00 0.00 ? 18 LEU A HB2  11 
ATOM 8224  H HB3  . LEU A 1 18 ? -7.254  -5.583  10.994  1.00 0.00 ? 18 LEU A HB3  11 
ATOM 8225  H HG   . LEU A 1 18 ? -6.089  -6.211  9.017   1.00 0.00 ? 18 LEU A HG   11 
ATOM 8226  H HD11 . LEU A 1 18 ? -5.046  -4.010  8.587   1.00 0.00 ? 18 LEU A HD11 11 
ATOM 8227  H HD12 . LEU A 1 18 ? -3.930  -5.359  8.383   1.00 0.00 ? 18 LEU A HD12 11 
ATOM 8228  H HD13 . LEU A 1 18 ? -3.853  -4.363  9.837   1.00 0.00 ? 18 LEU A HD13 11 
ATOM 8229  H HD21 . LEU A 1 18 ? -4.177  -7.396  9.896   1.00 0.00 ? 18 LEU A HD21 11 
ATOM 8230  H HD22 . LEU A 1 18 ? -5.491  -7.430  11.072  1.00 0.00 ? 18 LEU A HD22 11 
ATOM 8231  H HD23 . LEU A 1 18 ? -4.128  -6.335  11.303  1.00 0.00 ? 18 LEU A HD23 11 
ATOM 8232  N N    . GLY A 1 19 ? -6.530  -1.297  9.884   1.00 0.00 ? 19 GLY A N    11 
ATOM 8233  C CA   . GLY A 1 19 ? -5.719  -0.088  10.006  1.00 0.00 ? 19 GLY A CA   11 
ATOM 8234  C C    . GLY A 1 19 ? -4.224  -0.361  10.075  1.00 0.00 ? 19 GLY A C    11 
ATOM 8235  O O    . GLY A 1 19 ? -3.605  -0.179  11.123  1.00 0.00 ? 19 GLY A O    11 
ATOM 8236  H H    . GLY A 1 19 ? -7.437  -1.234  9.509   1.00 0.00 ? 19 GLY A H    11 
ATOM 8237  H HA2  . GLY A 1 19 ? -5.913  0.543   9.152   1.00 0.00 ? 19 GLY A HA2  11 
ATOM 8238  H HA3  . GLY A 1 19 ? -6.017  0.439   10.900  1.00 0.00 ? 19 GLY A HA3  11 
ATOM 8239  N N    . ASP A 1 20 ? -3.647  -0.805  8.963   1.00 0.00 ? 20 ASP A N    11 
ATOM 8240  C CA   . ASP A 1 20 ? -2.226  -1.108  8.913   1.00 0.00 ? 20 ASP A CA   11 
ATOM 8241  C C    . ASP A 1 20 ? -1.393  0.165   8.967   1.00 0.00 ? 20 ASP A C    11 
ATOM 8242  O O    . ASP A 1 20 ? -1.923  1.274   8.902   1.00 0.00 ? 20 ASP A O    11 
ATOM 8243  C CB   . ASP A 1 20 ? -1.882  -1.889  7.645   1.00 0.00 ? 20 ASP A CB   11 
ATOM 8244  C CG   . ASP A 1 20 ? -2.989  -2.827  7.206   1.00 0.00 ? 20 ASP A CG   11 
ATOM 8245  O OD1  . ASP A 1 20 ? -4.122  -2.347  6.994   1.00 0.00 ? 20 ASP A OD1  11 
ATOM 8246  O OD2  . ASP A 1 20 ? -2.723  -4.040  7.073   1.00 0.00 ? 20 ASP A OD2  11 
ATOM 8247  H H    . ASP A 1 20 ? -4.187  -0.936  8.159   1.00 0.00 ? 20 ASP A H    11 
ATOM 8248  H HA   . ASP A 1 20 ? -1.988  -1.715  9.774   1.00 0.00 ? 20 ASP A HA   11 
ATOM 8249  H HB2  . ASP A 1 20 ? -1.690  -1.193  6.848   1.00 0.00 ? 20 ASP A HB2  11 
ATOM 8250  H HB3  . ASP A 1 20 ? -0.995  -2.473  7.826   1.00 0.00 ? 20 ASP A HB3  11 
ATOM 8251  N N    . LEU A 1 21 ? -0.085  -0.008  9.098   1.00 0.00 ? 21 LEU A N    11 
ATOM 8252  C CA   . LEU A 1 21 ? 0.833   1.105   9.178   1.00 0.00 ? 21 LEU A CA   11 
ATOM 8253  C C    . LEU A 1 21 ? 1.943   0.985   8.134   1.00 0.00 ? 21 LEU A C    11 
ATOM 8254  O O    . LEU A 1 21 ? 3.120   0.862   8.474   1.00 0.00 ? 21 LEU A O    11 
ATOM 8255  C CB   . LEU A 1 21 ? 1.425   1.150   10.580  1.00 0.00 ? 21 LEU A CB   11 
ATOM 8256  C CG   . LEU A 1 21 ? 2.238   -0.082  10.987  1.00 0.00 ? 21 LEU A CG   11 
ATOM 8257  C CD1  . LEU A 1 21 ? 3.179   0.258   12.134  1.00 0.00 ? 21 LEU A CD1  11 
ATOM 8258  C CD2  . LEU A 1 21 ? 1.312   -1.226  11.376  1.00 0.00 ? 21 LEU A CD2  11 
ATOM 8259  H H    . LEU A 1 21 ? 0.271   -0.909  9.158   1.00 0.00 ? 21 LEU A H    11 
ATOM 8260  H HA   . LEU A 1 21 ? 0.278   2.013   8.997   1.00 0.00 ? 21 LEU A HA   11 
ATOM 8261  H HB2  . LEU A 1 21 ? 2.058   2.015   10.651  1.00 0.00 ? 21 LEU A HB2  11 
ATOM 8262  H HB3  . LEU A 1 21 ? 0.608   1.255   11.277  1.00 0.00 ? 21 LEU A HB3  11 
ATOM 8263  H HG   . LEU A 1 21 ? 2.836   -0.406  10.150  1.00 0.00 ? 21 LEU A HG   11 
ATOM 8264  H HD11 . LEU A 1 21 ? 2.834   1.153   12.630  1.00 0.00 ? 21 LEU A HD11 11 
ATOM 8265  H HD12 . LEU A 1 21 ? 4.173   0.421   11.746  1.00 0.00 ? 21 LEU A HD12 11 
ATOM 8266  H HD13 . LEU A 1 21 ? 3.197   -0.560  12.839  1.00 0.00 ? 21 LEU A HD13 11 
ATOM 8267  H HD21 . LEU A 1 21 ? 1.242   -1.926  10.555  1.00 0.00 ? 21 LEU A HD21 11 
ATOM 8268  H HD22 . LEU A 1 21 ? 0.331   -0.836  11.601  1.00 0.00 ? 21 LEU A HD22 11 
ATOM 8269  H HD23 . LEU A 1 21 ? 1.708   -1.730  12.246  1.00 0.00 ? 21 LEU A HD23 11 
ATOM 8270  N N    . ILE A 1 22 ? 1.561   1.029   6.864   1.00 0.00 ? 22 ILE A N    11 
ATOM 8271  C CA   . ILE A 1 22 ? 2.531   0.930   5.777   1.00 0.00 ? 22 ILE A CA   11 
ATOM 8272  C C    . ILE A 1 22 ? 3.227   2.266   5.555   1.00 0.00 ? 22 ILE A C    11 
ATOM 8273  O O    . ILE A 1 22 ? 2.635   3.329   5.742   1.00 0.00 ? 22 ILE A O    11 
ATOM 8274  C CB   . ILE A 1 22 ? 1.873   0.459   4.456   1.00 0.00 ? 22 ILE A CB   11 
ATOM 8275  C CG1  . ILE A 1 22 ? 2.805   0.669   3.267   1.00 0.00 ? 22 ILE A CG1  11 
ATOM 8276  C CG2  . ILE A 1 22 ? 0.558   1.177   4.218   1.00 0.00 ? 22 ILE A CG2  11 
ATOM 8277  C CD1  . ILE A 1 22 ? 2.574   1.971   2.531   1.00 0.00 ? 22 ILE A CD1  11 
ATOM 8278  H H    . ILE A 1 22 ? 0.611   1.136   6.653   1.00 0.00 ? 22 ILE A H    11 
ATOM 8279  H HA   . ILE A 1 22 ? 3.272   0.200   6.064   1.00 0.00 ? 22 ILE A HA   11 
ATOM 8280  H HB   . ILE A 1 22 ? 1.670   -0.593  4.541   1.00 0.00 ? 22 ILE A HB   11 
ATOM 8281  H HG12 . ILE A 1 22 ? 3.825   0.660   3.614   1.00 0.00 ? 22 ILE A HG12 11 
ATOM 8282  H HG13 . ILE A 1 22 ? 2.661   -0.139  2.565   1.00 0.00 ? 22 ILE A HG13 11 
ATOM 8283  H HG21 . ILE A 1 22 ? 0.657   2.211   4.513   1.00 0.00 ? 22 ILE A HG21 11 
ATOM 8284  H HG22 . ILE A 1 22 ? -0.219  0.706   4.798   1.00 0.00 ? 22 ILE A HG22 11 
ATOM 8285  H HG23 . ILE A 1 22 ? 0.310   1.126   3.168   1.00 0.00 ? 22 ILE A HG23 11 
ATOM 8286  H HD11 . ILE A 1 22 ? 1.792   1.835   1.798   1.00 0.00 ? 22 ILE A HD11 11 
ATOM 8287  H HD12 . ILE A 1 22 ? 3.483   2.267   2.037   1.00 0.00 ? 22 ILE A HD12 11 
ATOM 8288  H HD13 . ILE A 1 22 ? 2.279   2.734   3.233   1.00 0.00 ? 22 ILE A HD13 11 
ATOM 8289  N N    . CYS A 1 23 ? 4.488   2.201   5.144   1.00 0.00 ? 23 CYS A N    11 
ATOM 8290  C CA   . CYS A 1 23 ? 5.267   3.408   4.883   1.00 0.00 ? 23 CYS A CA   11 
ATOM 8291  C C    . CYS A 1 23 ? 5.522   3.540   3.394   1.00 0.00 ? 23 CYS A C    11 
ATOM 8292  O O    . CYS A 1 23 ? 6.556   3.105   2.890   1.00 0.00 ? 23 CYS A O    11 
ATOM 8293  C CB   . CYS A 1 23 ? 6.593   3.373   5.643   1.00 0.00 ? 23 CYS A CB   11 
ATOM 8294  S SG   . CYS A 1 23 ? 7.632   4.848   5.387   1.00 0.00 ? 23 CYS A SG   11 
ATOM 8295  H H    . CYS A 1 23 ? 4.900   1.316   5.002   1.00 0.00 ? 23 CYS A H    11 
ATOM 8296  H HA   . CYS A 1 23 ? 4.687   4.257   5.216   1.00 0.00 ? 23 CYS A HA   11 
ATOM 8297  H HB2  . CYS A 1 23 ? 6.390   3.294   6.700   1.00 0.00 ? 23 CYS A HB2  11 
ATOM 8298  H HB3  . CYS A 1 23 ? 7.160   2.511   5.325   1.00 0.00 ? 23 CYS A HB3  11 
ATOM 8299  N N    . ALA A 1 24 ? 4.557   4.114   2.687   1.00 0.00 ? 24 ALA A N    11 
ATOM 8300  C CA   . ALA A 1 24 ? 4.669   4.264   1.250   1.00 0.00 ? 24 ALA A CA   11 
ATOM 8301  C C    . ALA A 1 24 ? 5.407   5.534   0.853   1.00 0.00 ? 24 ALA A C    11 
ATOM 8302  O O    . ALA A 1 24 ? 5.228   6.593   1.451   1.00 0.00 ? 24 ALA A O    11 
ATOM 8303  C CB   . ALA A 1 24 ? 3.290   4.238   0.607   1.00 0.00 ? 24 ALA A CB   11 
ATOM 8304  H H    . ALA A 1 24 ? 3.746   4.422   3.138   1.00 0.00 ? 24 ALA A H    11 
ATOM 8305  H HA   . ALA A 1 24 ? 5.220   3.411   0.888   1.00 0.00 ? 24 ALA A HA   11 
ATOM 8306  H HB1  . ALA A 1 24 ? 3.293   4.859   -0.277  1.00 0.00 ? 24 ALA A HB1  11 
ATOM 8307  H HB2  . ALA A 1 24 ? 2.558   4.611   1.308   1.00 0.00 ? 24 ALA A HB2  11 
ATOM 8308  H HB3  . ALA A 1 24 ? 3.041   3.223   0.331   1.00 0.00 ? 24 ALA A HB3  11 
ATOM 8309  N N    . VAL A 1 25 ? 6.231   5.408   -0.176  1.00 0.00 ? 25 VAL A N    11 
ATOM 8310  C CA   . VAL A 1 25 ? 7.003   6.515   -0.698  1.00 0.00 ? 25 VAL A CA   11 
ATOM 8311  C C    . VAL A 1 25 ? 6.930   6.551   -2.220  1.00 0.00 ? 25 VAL A C    11 
ATOM 8312  O O    . VAL A 1 25 ? 6.810   5.509   -2.877  1.00 0.00 ? 25 VAL A O    11 
ATOM 8313  C CB   . VAL A 1 25 ? 8.472   6.420   -0.252  1.00 0.00 ? 25 VAL A CB   11 
ATOM 8314  C CG1  . VAL A 1 25 ? 9.188   5.277   -0.961  1.00 0.00 ? 25 VAL A CG1  11 
ATOM 8315  C CG2  . VAL A 1 25 ? 9.189   7.740   -0.485  1.00 0.00 ? 25 VAL A CG2  11 
ATOM 8316  H H    . VAL A 1 25 ? 6.316   4.536   -0.605  1.00 0.00 ? 25 VAL A H    11 
ATOM 8317  H HA   . VAL A 1 25 ? 6.587   7.432   -0.308  1.00 0.00 ? 25 VAL A HA   11 
ATOM 8318  H HB   . VAL A 1 25 ? 8.480   6.212   0.803   1.00 0.00 ? 25 VAL A HB   11 
ATOM 8319  H HG11 . VAL A 1 25 ? 10.207  5.218   -0.610  1.00 0.00 ? 25 VAL A HG11 11 
ATOM 8320  H HG12 . VAL A 1 25 ? 9.182   5.453   -2.025  1.00 0.00 ? 25 VAL A HG12 11 
ATOM 8321  H HG13 . VAL A 1 25 ? 8.680   4.348   -0.747  1.00 0.00 ? 25 VAL A HG13 11 
ATOM 8322  H HG21 . VAL A 1 25 ? 8.574   8.553   -0.128  1.00 0.00 ? 25 VAL A HG21 11 
ATOM 8323  H HG22 . VAL A 1 25 ? 9.374   7.868   -1.542  1.00 0.00 ? 25 VAL A HG22 11 
ATOM 8324  H HG23 . VAL A 1 25 ? 10.128  7.739   0.047   1.00 0.00 ? 25 VAL A HG23 11 
ATOM 8325  N N    . ILE A 1 26 ? 6.998   7.753   -2.770  1.00 0.00 ? 26 ILE A N    11 
ATOM 8326  C CA   . ILE A 1 26 ? 6.940   7.936   -4.217  1.00 0.00 ? 26 ILE A CA   11 
ATOM 8327  C C    . ILE A 1 26 ? 7.990   8.938   -4.687  1.00 0.00 ? 26 ILE A C    11 
ATOM 8328  O O    . ILE A 1 26 ? 7.735   10.141  -4.756  1.00 0.00 ? 26 ILE A O    11 
ATOM 8329  C CB   . ILE A 1 26 ? 5.549   8.406   -4.697  1.00 0.00 ? 26 ILE A CB   11 
ATOM 8330  C CG1  . ILE A 1 26 ? 4.628   8.713   -3.510  1.00 0.00 ? 26 ILE A CG1  11 
ATOM 8331  C CG2  . ILE A 1 26 ? 4.923   7.361   -5.611  1.00 0.00 ? 26 ILE A CG2  11 
ATOM 8332  C CD1  . ILE A 1 26 ? 4.091   7.478   -2.817  1.00 0.00 ? 26 ILE A CD1  11 
ATOM 8333  H H    . ILE A 1 26 ? 7.089   8.537   -2.186  1.00 0.00 ? 26 ILE A H    11 
ATOM 8334  H HA   . ILE A 1 26 ? 7.150   6.980   -4.674  1.00 0.00 ? 26 ILE A HA   11 
ATOM 8335  H HB   . ILE A 1 26 ? 5.689   9.306   -5.276  1.00 0.00 ? 26 ILE A HB   11 
ATOM 8336  H HG12 . ILE A 1 26 ? 5.174   9.289   -2.779  1.00 0.00 ? 26 ILE A HG12 11 
ATOM 8337  H HG13 . ILE A 1 26 ? 3.784   9.291   -3.858  1.00 0.00 ? 26 ILE A HG13 11 
ATOM 8338  H HG21 . ILE A 1 26 ? 4.641   6.495   -5.029  1.00 0.00 ? 26 ILE A HG21 11 
ATOM 8339  H HG22 . ILE A 1 26 ? 5.637   7.070   -6.366  1.00 0.00 ? 26 ILE A HG22 11 
ATOM 8340  H HG23 . ILE A 1 26 ? 4.046   7.778   -6.085  1.00 0.00 ? 26 ILE A HG23 11 
ATOM 8341  H HD11 . ILE A 1 26 ? 4.254   7.561   -1.753  1.00 0.00 ? 26 ILE A HD11 11 
ATOM 8342  H HD12 . ILE A 1 26 ? 4.602   6.603   -3.193  1.00 0.00 ? 26 ILE A HD12 11 
ATOM 8343  H HD13 . ILE A 1 26 ? 3.032   7.387   -3.012  1.00 0.00 ? 26 ILE A HD13 11 
ATOM 8344  N N    . GLY A 1 27 ? 9.170   8.425   -5.000  1.00 0.00 ? 27 GLY A N    11 
ATOM 8345  C CA   . GLY A 1 27 ? 10.265  9.261   -5.460  1.00 0.00 ? 27 GLY A CA   11 
ATOM 8346  C C    . GLY A 1 27 ? 10.840  10.104  -4.346  1.00 0.00 ? 27 GLY A C    11 
ATOM 8347  O O    . GLY A 1 27 ? 12.026  10.015  -4.028  1.00 0.00 ? 27 GLY A O    11 
ATOM 8348  H H    . GLY A 1 27 ? 9.298   7.469   -4.911  1.00 0.00 ? 27 GLY A H    11 
ATOM 8349  H HA2  . GLY A 1 27 ? 11.043  8.629   -5.860  1.00 0.00 ? 27 GLY A HA2  11 
ATOM 8350  H HA3  . GLY A 1 27 ? 9.904   9.913   -6.241  1.00 0.00 ? 27 GLY A HA3  11 
ATOM 8351  N N    . ASP A 1 28 ? 9.984   10.915  -3.748  1.00 0.00 ? 28 ASP A N    11 
ATOM 8352  C CA   . ASP A 1 28 ? 10.375  11.784  -2.651  1.00 0.00 ? 28 ASP A CA   11 
ATOM 8353  C C    . ASP A 1 28 ? 9.158   12.153  -1.813  1.00 0.00 ? 28 ASP A C    11 
ATOM 8354  O O    . ASP A 1 28 ? 9.138   13.192  -1.152  1.00 0.00 ? 28 ASP A O    11 
ATOM 8355  C CB   . ASP A 1 28 ? 11.047  13.049  -3.185  1.00 0.00 ? 28 ASP A CB   11 
ATOM 8356  C CG   . ASP A 1 28 ? 12.247  12.741  -4.059  1.00 0.00 ? 28 ASP A CG   11 
ATOM 8357  O OD1  . ASP A 1 28 ? 13.321  12.428  -3.504  1.00 0.00 ? 28 ASP A OD1  11 
ATOM 8358  O OD2  . ASP A 1 28 ? 12.112  12.813  -5.299  1.00 0.00 ? 28 ASP A OD2  11 
ATOM 8359  H H    . ASP A 1 28 ? 9.055   10.924  -4.052  1.00 0.00 ? 28 ASP A H    11 
ATOM 8360  H HA   . ASP A 1 28 ? 11.077  11.245  -2.032  1.00 0.00 ? 28 ASP A HA   11 
ATOM 8361  H HB2  . ASP A 1 28 ? 10.333  13.608  -3.771  1.00 0.00 ? 28 ASP A HB2  11 
ATOM 8362  H HB3  . ASP A 1 28 ? 11.376  13.654  -2.352  1.00 0.00 ? 28 ASP A HB3  11 
ATOM 8363  N N    . ALA A 1 29 ? 8.137   11.297  -1.848  1.00 0.00 ? 29 ALA A N    11 
ATOM 8364  C CA   . ALA A 1 29 ? 6.916   11.542  -1.091  1.00 0.00 ? 29 ALA A CA   11 
ATOM 8365  C C    . ALA A 1 29 ? 6.577   10.349  -0.211  1.00 0.00 ? 29 ALA A C    11 
ATOM 8366  O O    . ALA A 1 29 ? 5.779   9.491   -0.591  1.00 0.00 ? 29 ALA A O    11 
ATOM 8367  C CB   . ALA A 1 29 ? 5.764   11.854  -2.035  1.00 0.00 ? 29 ALA A CB   11 
ATOM 8368  H H    . ALA A 1 29 ? 8.208   10.479  -2.396  1.00 0.00 ? 29 ALA A H    11 
ATOM 8369  H HA   . ALA A 1 29 ? 7.081   12.406  -0.463  1.00 0.00 ? 29 ALA A HA   11 
ATOM 8370  H HB1  . ALA A 1 29 ? 6.103   11.777  -3.057  1.00 0.00 ? 29 ALA A HB1  11 
ATOM 8371  H HB2  . ALA A 1 29 ? 5.407   12.857  -1.849  1.00 0.00 ? 29 ALA A HB2  11 
ATOM 8372  H HB3  . ALA A 1 29 ? 4.960   11.151  -1.869  1.00 0.00 ? 29 ALA A HB3  11 
ATOM 8373  N N    . LYS A 1 30 ? 7.188   10.296  0.967   1.00 0.00 ? 30 LYS A N    11 
ATOM 8374  C CA   . LYS A 1 30 ? 6.947   9.202   1.896   1.00 0.00 ? 30 LYS A CA   11 
ATOM 8375  C C    . LYS A 1 30 ? 5.874   9.574   2.915   1.00 0.00 ? 30 LYS A C    11 
ATOM 8376  O O    . LYS A 1 30 ? 5.903   10.657  3.498   1.00 0.00 ? 30 LYS A O    11 
ATOM 8377  C CB   . LYS A 1 30 ? 8.243   8.816   2.611   1.00 0.00 ? 30 LYS A CB   11 
ATOM 8378  C CG   . LYS A 1 30 ? 8.835   9.936   3.450   1.00 0.00 ? 30 LYS A CG   11 
ATOM 8379  C CD   . LYS A 1 30 ? 9.924   9.417   4.375   1.00 0.00 ? 30 LYS A CD   11 
ATOM 8380  C CE   . LYS A 1 30 ? 11.097  8.846   3.593   1.00 0.00 ? 30 LYS A CE   11 
ATOM 8381  N NZ   . LYS A 1 30 ? 12.328  9.669   3.753   1.00 0.00 ? 30 LYS A NZ   11 
ATOM 8382  H H    . LYS A 1 30 ? 7.815   11.008  1.215   1.00 0.00 ? 30 LYS A H    11 
ATOM 8383  H HA   . LYS A 1 30 ? 6.600   8.358   1.320   1.00 0.00 ? 30 LYS A HA   11 
ATOM 8384  H HB2  . LYS A 1 30 ? 8.045   7.976   3.260   1.00 0.00 ? 30 LYS A HB2  11 
ATOM 8385  H HB3  . LYS A 1 30 ? 8.974   8.524   1.871   1.00 0.00 ? 30 LYS A HB3  11 
ATOM 8386  H HG2  . LYS A 1 30 ? 9.259   10.681  2.792   1.00 0.00 ? 30 LYS A HG2  11 
ATOM 8387  H HG3  . LYS A 1 30 ? 8.051   10.382  4.044   1.00 0.00 ? 30 LYS A HG3  11 
ATOM 8388  H HD2  . LYS A 1 30 ? 10.277  10.231  4.991   1.00 0.00 ? 30 LYS A HD2  11 
ATOM 8389  H HD3  . LYS A 1 30 ? 9.509   8.642   5.002   1.00 0.00 ? 30 LYS A HD3  11 
ATOM 8390  H HE2  . LYS A 1 30 ? 11.296  7.846   3.948   1.00 0.00 ? 30 LYS A HE2  11 
ATOM 8391  H HE3  . LYS A 1 30 ? 10.833  8.808   2.546   1.00 0.00 ? 30 LYS A HE3  11 
ATOM 8392  H HZ1  . LYS A 1 30 ? 12.416  9.991   4.738   1.00 0.00 ? 30 LYS A HZ1  11 
ATOM 8393  H HZ2  . LYS A 1 30 ? 12.285  10.500  3.130   1.00 0.00 ? 30 LYS A HZ2  11 
ATOM 8394  H HZ3  . LYS A 1 30 ? 13.168  9.107   3.507   1.00 0.00 ? 30 LYS A HZ3  11 
ATOM 8395  N N    . GLU A 1 31 ? 4.926   8.666   3.122   1.00 0.00 ? 31 GLU A N    11 
ATOM 8396  C CA   . GLU A 1 31 ? 3.839   8.887   4.065   1.00 0.00 ? 31 GLU A CA   11 
ATOM 8397  C C    . GLU A 1 31 ? 3.243   7.560   4.522   1.00 0.00 ? 31 GLU A C    11 
ATOM 8398  O O    . GLU A 1 31 ? 3.484   6.519   3.910   1.00 0.00 ? 31 GLU A O    11 
ATOM 8399  C CB   . GLU A 1 31 ? 2.754   9.753   3.424   1.00 0.00 ? 31 GLU A CB   11 
ATOM 8400  C CG   . GLU A 1 31 ? 2.272   9.228   2.081   1.00 0.00 ? 31 GLU A CG   11 
ATOM 8401  C CD   . GLU A 1 31 ? 0.760   9.163   1.990   1.00 0.00 ? 31 GLU A CD   11 
ATOM 8402  O OE1  . GLU A 1 31 ? 0.089   9.917   2.726   1.00 0.00 ? 31 GLU A OE1  11 
ATOM 8403  O OE2  . GLU A 1 31 ? 0.248   8.360   1.182   1.00 0.00 ? 31 GLU A OE2  11 
ATOM 8404  H H    . GLU A 1 31 ? 4.958   7.822   2.624   1.00 0.00 ? 31 GLU A H    11 
ATOM 8405  H HA   . GLU A 1 31 ? 4.242   9.404   4.923   1.00 0.00 ? 31 GLU A HA   11 
ATOM 8406  H HB2  . GLU A 1 31 ? 1.908   9.802   4.093   1.00 0.00 ? 31 GLU A HB2  11 
ATOM 8407  H HB3  . GLU A 1 31 ? 3.145   10.748  3.278   1.00 0.00 ? 31 GLU A HB3  11 
ATOM 8408  H HG2  . GLU A 1 31 ? 2.637   9.881   1.302   1.00 0.00 ? 31 GLU A HG2  11 
ATOM 8409  H HG3  . GLU A 1 31 ? 2.671   8.234   1.933   1.00 0.00 ? 31 GLU A HG3  11 
ATOM 8410  N N    . GLU A 1 32 ? 2.464   7.599   5.597   1.00 0.00 ? 32 GLU A N    11 
ATOM 8411  C CA   . GLU A 1 32 ? 1.838   6.393   6.127   1.00 0.00 ? 32 GLU A CA   11 
ATOM 8412  C C    . GLU A 1 32 ? 0.514   6.111   5.428   1.00 0.00 ? 32 GLU A C    11 
ATOM 8413  O O    . GLU A 1 32 ? -0.160  7.025   4.955   1.00 0.00 ? 32 GLU A O    11 
ATOM 8414  C CB   . GLU A 1 32 ? 1.607   6.526   7.632   1.00 0.00 ? 32 GLU A CB   11 
ATOM 8415  C CG   . GLU A 1 32 ? 2.844   6.959   8.401   1.00 0.00 ? 32 GLU A CG   11 
ATOM 8416  C CD   . GLU A 1 32 ? 2.522   7.439   9.800   1.00 0.00 ? 32 GLU A CD   11 
ATOM 8417  O OE1  . GLU A 1 32 ? 1.703   6.785   10.480  1.00 0.00 ? 32 GLU A OE1  11 
ATOM 8418  O OE2  . GLU A 1 32 ? 3.087   8.471   10.219  1.00 0.00 ? 32 GLU A OE2  11 
ATOM 8419  H H    . GLU A 1 32 ? 2.308   8.457   6.045   1.00 0.00 ? 32 GLU A H    11 
ATOM 8420  H HA   . GLU A 1 32 ? 2.509   5.567   5.948   1.00 0.00 ? 32 GLU A HA   11 
ATOM 8421  H HB2  . GLU A 1 32 ? 0.829   7.256   7.800   1.00 0.00 ? 32 GLU A HB2  11 
ATOM 8422  H HB3  . GLU A 1 32 ? 1.283   5.570   8.019   1.00 0.00 ? 32 GLU A HB3  11 
ATOM 8423  H HG2  . GLU A 1 32 ? 3.519   6.119   8.472   1.00 0.00 ? 32 GLU A HG2  11 
ATOM 8424  H HG3  . GLU A 1 32 ? 3.325   7.761   7.861   1.00 0.00 ? 32 GLU A HG3  11 
ATOM 8425  N N    . HIS A 1 33 ? 0.148   4.836   5.372   1.00 0.00 ? 33 HIS A N    11 
ATOM 8426  C CA   . HIS A 1 33 ? -1.098  4.424   4.737   1.00 0.00 ? 33 HIS A CA   11 
ATOM 8427  C C    . HIS A 1 33 ? -1.704  3.229   5.465   1.00 0.00 ? 33 HIS A C    11 
ATOM 8428  O O    . HIS A 1 33 ? -0.989  2.410   6.039   1.00 0.00 ? 33 HIS A O    11 
ATOM 8429  C CB   . HIS A 1 33 ? -0.856  4.074   3.267   1.00 0.00 ? 33 HIS A CB   11 
ATOM 8430  C CG   . HIS A 1 33 ? -1.936  4.561   2.350   1.00 0.00 ? 33 HIS A CG   11 
ATOM 8431  N ND1  . HIS A 1 33 ? -3.161  3.938   2.234   1.00 0.00 ? 33 HIS A ND1  11 
ATOM 8432  C CD2  . HIS A 1 33 ? -1.970  5.616   1.500   1.00 0.00 ? 33 HIS A CD2  11 
ATOM 8433  C CE1  . HIS A 1 33 ? -3.902  4.587   1.353   1.00 0.00 ? 33 HIS A CE1  11 
ATOM 8434  N NE2  . HIS A 1 33 ? -3.203  5.609   0.894   1.00 0.00 ? 33 HIS A NE2  11 
ATOM 8435  H H    . HIS A 1 33 ? 0.729   4.154   5.770   1.00 0.00 ? 33 HIS A H    11 
ATOM 8436  H HA   . HIS A 1 33 ? -1.787  5.253   4.793   1.00 0.00 ? 33 HIS A HA   11 
ATOM 8437  H HB2  . HIS A 1 33 ? 0.075   4.517   2.945   1.00 0.00 ? 33 HIS A HB2  11 
ATOM 8438  H HB3  . HIS A 1 33 ? -0.792  3.001   3.165   1.00 0.00 ? 33 HIS A HB3  11 
ATOM 8439  H HD1  . HIS A 1 33 ? -3.445  3.139   2.723   1.00 0.00 ? 33 HIS A HD1  11 
ATOM 8440  H HD2  . HIS A 1 33 ? -1.177  6.330   1.332   1.00 0.00 ? 33 HIS A HD2  11 
ATOM 8441  H HE1  . HIS A 1 33 ? -4.908  4.327   1.059   1.00 0.00 ? 33 HIS A HE1  11 
ATOM 8442  H HE2  . HIS A 1 33 ? -3.547  6.304   0.295   1.00 0.00 ? 33 HIS A HE2  11 
ATOM 8443  N N    . ARG A 1 34 ? -3.028  3.140   5.441   1.00 0.00 ? 34 ARG A N    11 
ATOM 8444  C CA   . ARG A 1 34 ? -3.734  2.047   6.099   1.00 0.00 ? 34 ARG A CA   11 
ATOM 8445  C C    . ARG A 1 34 ? -4.179  0.992   5.090   1.00 0.00 ? 34 ARG A C    11 
ATOM 8446  O O    . ARG A 1 34 ? -3.905  -0.197  5.259   1.00 0.00 ? 34 ARG A O    11 
ATOM 8447  C CB   . ARG A 1 34 ? -4.950  2.580   6.855   1.00 0.00 ? 34 ARG A CB   11 
ATOM 8448  C CG   . ARG A 1 34 ? -4.750  2.654   8.360   1.00 0.00 ? 34 ARG A CG   11 
ATOM 8449  C CD   . ARG A 1 34 ? -4.205  4.007   8.786   1.00 0.00 ? 34 ARG A CD   11 
ATOM 8450  N NE   . ARG A 1 34 ? -2.744  4.014   8.853   1.00 0.00 ? 34 ARG A NE   11 
ATOM 8451  C CZ   . ARG A 1 34 ? -2.020  5.098   9.121   1.00 0.00 ? 34 ARG A CZ   11 
ATOM 8452  N NH1  . ARG A 1 34 ? -2.616  6.263   9.350   1.00 0.00 ? 34 ARG A NH1  11 
ATOM 8453  N NH2  . ARG A 1 34 ? -0.698  5.019   9.163   1.00 0.00 ? 34 ARG A NH2  11 
ATOM 8454  H H    . ARG A 1 34 ? -3.542  3.828   4.972   1.00 0.00 ? 34 ARG A H    11 
ATOM 8455  H HA   . ARG A 1 34 ? -3.054  1.589   6.805   1.00 0.00 ? 34 ARG A HA   11 
ATOM 8456  H HB2  . ARG A 1 34 ? -5.173  3.571   6.493   1.00 0.00 ? 34 ARG A HB2  11 
ATOM 8457  H HB3  . ARG A 1 34 ? -5.794  1.935   6.656   1.00 0.00 ? 34 ARG A HB3  11 
ATOM 8458  H HG2  . ARG A 1 34 ? -5.700  2.491   8.847   1.00 0.00 ? 34 ARG A HG2  11 
ATOM 8459  H HG3  . ARG A 1 34 ? -4.055  1.884   8.659   1.00 0.00 ? 34 ARG A HG3  11 
ATOM 8460  H HD2  . ARG A 1 34 ? -4.525  4.751   8.071   1.00 0.00 ? 34 ARG A HD2  11 
ATOM 8461  H HD3  . ARG A 1 34 ? -4.601  4.250   9.759   1.00 0.00 ? 34 ARG A HD3  11 
ATOM 8462  H HE   . ARG A 1 34 ? -2.279  3.166   8.690   1.00 0.00 ? 34 ARG A HE   11 
ATOM 8463  H HH11 . ARG A 1 34 ? -3.612  6.330   9.322   1.00 0.00 ? 34 ARG A HH11 11 
ATOM 8464  H HH12 . ARG A 1 34 ? -2.066  7.075   9.550   1.00 0.00 ? 34 ARG A HH12 11 
ATOM 8465  H HH21 . ARG A 1 34 ? -0.243  4.144   8.993   1.00 0.00 ? 34 ARG A HH21 11 
ATOM 8466  H HH22 . ARG A 1 34 ? -0.154  5.834   9.365   1.00 0.00 ? 34 ARG A HH22 11 
ATOM 8467  N N    . ASN A 1 35 ? -4.871  1.433   4.042   1.00 0.00 ? 35 ASN A N    11 
ATOM 8468  C CA   . ASN A 1 35 ? -5.359  0.522   3.011   1.00 0.00 ? 35 ASN A CA   11 
ATOM 8469  C C    . ASN A 1 35 ? -4.245  0.160   2.035   1.00 0.00 ? 35 ASN A C    11 
ATOM 8470  O O    . ASN A 1 35 ? -4.327  0.431   0.832   1.00 0.00 ? 35 ASN A O    11 
ATOM 8471  C CB   . ASN A 1 35 ? -6.541  1.142   2.264   1.00 0.00 ? 35 ASN A CB   11 
ATOM 8472  C CG   . ASN A 1 35 ? -7.706  1.457   3.185   1.00 0.00 ? 35 ASN A CG   11 
ATOM 8473  O OD1  . ASN A 1 35 ? -8.313  2.524   3.094   1.00 0.00 ? 35 ASN A OD1  11 
ATOM 8474  N ND2  . ASN A 1 35 ? -8.023  0.528   4.082   1.00 0.00 ? 35 ASN A ND2  11 
ATOM 8475  H H    . ASN A 1 35 ? -5.063  2.391   3.964   1.00 0.00 ? 35 ASN A H    11 
ATOM 8476  H HA   . ASN A 1 35 ? -5.690  -0.380  3.502   1.00 0.00 ? 35 ASN A HA   11 
ATOM 8477  H HB2  . ASN A 1 35 ? -6.221  2.059   1.792   1.00 0.00 ? 35 ASN A HB2  11 
ATOM 8478  H HB3  . ASN A 1 35 ? -6.882  0.451   1.507   1.00 0.00 ? 35 ASN A HB3  11 
ATOM 8479  H HD21 . ASN A 1 35 ? -7.498  -0.299  4.099   1.00 0.00 ? 35 ASN A HD21 11 
ATOM 8480  H HD22 . ASN A 1 35 ? -8.769  0.709   4.691   1.00 0.00 ? 35 ASN A HD22 11 
ATOM 8481  N N    . MET A 1 36 ? -3.202  -0.463  2.570   1.00 0.00 ? 36 MET A N    11 
ATOM 8482  C CA   . MET A 1 36 ? -2.058  -0.883  1.780   1.00 0.00 ? 36 MET A CA   11 
ATOM 8483  C C    . MET A 1 36 ? -2.495  -1.661  0.540   1.00 0.00 ? 36 MET A C    11 
ATOM 8484  O O    . MET A 1 36 ? -1.784  -1.687  -0.465  1.00 0.00 ? 36 MET A O    11 
ATOM 8485  C CB   . MET A 1 36 ? -1.129  -1.730  2.653   1.00 0.00 ? 36 MET A CB   11 
ATOM 8486  C CG   . MET A 1 36 ? -0.054  -2.483  1.880   1.00 0.00 ? 36 MET A CG   11 
ATOM 8487  S SD   . MET A 1 36 ? 0.779   -3.731  2.881   1.00 0.00 ? 36 MET A SD   11 
ATOM 8488  C CE   . MET A 1 36 ? -0.621  -4.631  3.541   1.00 0.00 ? 36 MET A CE   11 
ATOM 8489  H H    . MET A 1 36 ? -3.204  -0.649  3.530   1.00 0.00 ? 36 MET A H    11 
ATOM 8490  H HA   . MET A 1 36 ? -1.529  0.005   1.465   1.00 0.00 ? 36 MET A HA   11 
ATOM 8491  H HB2  . MET A 1 36 ? -0.639  -1.082  3.366   1.00 0.00 ? 36 MET A HB2  11 
ATOM 8492  H HB3  . MET A 1 36 ? -1.726  -2.450  3.194   1.00 0.00 ? 36 MET A HB3  11 
ATOM 8493  H HG2  . MET A 1 36 ? -0.512  -2.972  1.034   1.00 0.00 ? 36 MET A HG2  11 
ATOM 8494  H HG3  . MET A 1 36 ? 0.680   -1.774  1.530   1.00 0.00 ? 36 MET A HG3  11 
ATOM 8495  H HE1  . MET A 1 36 ? -0.277  -5.543  4.005   1.00 0.00 ? 36 MET A HE1  11 
ATOM 8496  H HE2  . MET A 1 36 ? -1.305  -4.871  2.740   1.00 0.00 ? 36 MET A HE2  11 
ATOM 8497  H HE3  . MET A 1 36 ? -1.127  -4.021  4.276   1.00 0.00 ? 36 MET A HE3  11 
ATOM 8498  N N    . CYS A 1 37 ? -3.668  -2.289  0.608   1.00 0.00 ? 37 CYS A N    11 
ATOM 8499  C CA   . CYS A 1 37 ? -4.172  -3.050  -0.527  1.00 0.00 ? 37 CYS A CA   11 
ATOM 8500  C C    . CYS A 1 37 ? -4.460  -2.120  -1.695  1.00 0.00 ? 37 CYS A C    11 
ATOM 8501  O O    . CYS A 1 37 ? -3.833  -2.218  -2.749  1.00 0.00 ? 37 CYS A O    11 
ATOM 8502  C CB   . CYS A 1 37 ? -5.446  -3.840  -0.176  1.00 0.00 ? 37 CYS A CB   11 
ATOM 8503  S SG   . CYS A 1 37 ? -5.641  -4.322  1.574   1.00 0.00 ? 37 CYS A SG   11 
ATOM 8504  H H    . CYS A 1 37 ? -4.201  -2.233  1.425   1.00 0.00 ? 37 CYS A H    11 
ATOM 8505  H HA   . CYS A 1 37 ? -3.399  -3.735  -0.831  1.00 0.00 ? 37 CYS A HA   11 
ATOM 8506  H HB2  . CYS A 1 37 ? -6.305  -3.243  -0.437  1.00 0.00 ? 37 CYS A HB2  11 
ATOM 8507  H HB3  . CYS A 1 37 ? -5.458  -4.744  -0.761  1.00 0.00 ? 37 CYS A HB3  11 
ATOM 8508  N N    . ALA A 1 38 ? -5.405  -1.211  -1.495  1.00 0.00 ? 38 ALA A N    11 
ATOM 8509  C CA   . ALA A 1 38 ? -5.776  -0.249  -2.529  1.00 0.00 ? 38 ALA A CA   11 
ATOM 8510  C C    . ALA A 1 38 ? -4.549  0.452   -3.097  1.00 0.00 ? 38 ALA A C    11 
ATOM 8511  O O    . ALA A 1 38 ? -4.587  0.982   -4.203  1.00 0.00 ? 38 ALA A O    11 
ATOM 8512  C CB   . ALA A 1 38 ? -6.761  0.770   -1.977  1.00 0.00 ? 38 ALA A CB   11 
ATOM 8513  H H    . ALA A 1 38 ? -5.859  -1.183  -0.629  1.00 0.00 ? 38 ALA A H    11 
ATOM 8514  H HA   . ALA A 1 38 ? -6.262  -0.790  -3.326  1.00 0.00 ? 38 ALA A HA   11 
ATOM 8515  H HB1  . ALA A 1 38 ? -7.265  0.354   -1.118  1.00 0.00 ? 38 ALA A HB1  11 
ATOM 8516  H HB2  . ALA A 1 38 ? -7.488  1.015   -2.737  1.00 0.00 ? 38 ALA A HB2  11 
ATOM 8517  H HB3  . ALA A 1 38 ? -6.229  1.664   -1.686  1.00 0.00 ? 38 ALA A HB3  11 
ATOM 8518  N N    . LEU A 1 39 ? -3.464  0.457   -2.334  1.00 0.00 ? 39 LEU A N    11 
ATOM 8519  C CA   . LEU A 1 39 ? -2.232  1.097   -2.771  1.00 0.00 ? 39 LEU A CA   11 
ATOM 8520  C C    . LEU A 1 39 ? -1.508  0.279   -3.823  1.00 0.00 ? 39 LEU A C    11 
ATOM 8521  O O    . LEU A 1 39 ? -1.144  0.794   -4.881  1.00 0.00 ? 39 LEU A O    11 
ATOM 8522  C CB   . LEU A 1 39 ? -1.309  1.301   -1.584  1.00 0.00 ? 39 LEU A CB   11 
ATOM 8523  C CG   . LEU A 1 39 ? -0.306  2.445   -1.733  1.00 0.00 ? 39 LEU A CG   11 
ATOM 8524  C CD1  . LEU A 1 39 ? -1.018  3.739   -2.096  1.00 0.00 ? 39 LEU A CD1  11 
ATOM 8525  C CD2  . LEU A 1 39 ? 0.501   2.613   -0.456  1.00 0.00 ? 39 LEU A CD2  11 
ATOM 8526  H H    . LEU A 1 39 ? -3.493  0.029   -1.450  1.00 0.00 ? 39 LEU A H    11 
ATOM 8527  H HA   . LEU A 1 39 ? -2.482  2.054   -3.193  1.00 0.00 ? 39 LEU A HA   11 
ATOM 8528  H HB2  . LEU A 1 39 ? -1.922  1.481   -0.722  1.00 0.00 ? 39 LEU A HB2  11 
ATOM 8529  H HB3  . LEU A 1 39 ? -0.756  0.387   -1.426  1.00 0.00 ? 39 LEU A HB3  11 
ATOM 8530  H HG   . LEU A 1 39 ? 0.380   2.210   -2.532  1.00 0.00 ? 39 LEU A HG   11 
ATOM 8531  H HD11 . LEU A 1 39 ? -1.187  3.767   -3.162  1.00 0.00 ? 39 LEU A HD11 11 
ATOM 8532  H HD12 . LEU A 1 39 ? -0.407  4.580   -1.805  1.00 0.00 ? 39 LEU A HD12 11 
ATOM 8533  H HD13 . LEU A 1 39 ? -1.966  3.785   -1.580  1.00 0.00 ? 39 LEU A HD13 11 
ATOM 8534  H HD21 . LEU A 1 39 ? 0.732   3.659   -0.310  1.00 0.00 ? 39 LEU A HD21 11 
ATOM 8535  H HD22 . LEU A 1 39 ? 1.419   2.049   -0.535  1.00 0.00 ? 39 LEU A HD22 11 
ATOM 8536  H HD23 . LEU A 1 39 ? -0.073  2.251   0.383   1.00 0.00 ? 39 LEU A HD23 11 
ATOM 8537  N N    . CYS A 1 40 ? -1.292  -0.992  -3.529  1.00 0.00 ? 40 CYS A N    11 
ATOM 8538  C CA   . CYS A 1 40 ? -0.595  -1.858  -4.464  1.00 0.00 ? 40 CYS A CA   11 
ATOM 8539  C C    . CYS A 1 40 ? -1.448  -2.101  -5.694  1.00 0.00 ? 40 CYS A C    11 
ATOM 8540  O O    . CYS A 1 40 ? -0.941  -2.441  -6.762  1.00 0.00 ? 40 CYS A O    11 
ATOM 8541  C CB   . CYS A 1 40 ? -0.207  -3.186  -3.808  1.00 0.00 ? 40 CYS A CB   11 
ATOM 8542  S SG   . CYS A 1 40 ? 1.567   -3.581  -3.961  1.00 0.00 ? 40 CYS A SG   11 
ATOM 8543  H H    . CYS A 1 40 ? -1.609  -1.351  -2.674  1.00 0.00 ? 40 CYS A H    11 
ATOM 8544  H HA   . CYS A 1 40 ? 0.305   -1.347  -4.766  1.00 0.00 ? 40 CYS A HA   11 
ATOM 8545  H HB2  . CYS A 1 40 ? -0.445  -3.145  -2.756  1.00 0.00 ? 40 CYS A HB2  11 
ATOM 8546  H HB3  . CYS A 1 40 ? -0.764  -3.988  -4.269  1.00 0.00 ? 40 CYS A HB3  11 
ATOM 8547  N N    . CYS A 1 41 ? -2.751  -1.919  -5.541  1.00 0.00 ? 41 CYS A N    11 
ATOM 8548  C CA   . CYS A 1 41 ? -3.670  -2.117  -6.644  1.00 0.00 ? 41 CYS A CA   11 
ATOM 8549  C C    . CYS A 1 41 ? -3.910  -0.821  -7.417  1.00 0.00 ? 41 CYS A C    11 
ATOM 8550  O O    . CYS A 1 41 ? -4.078  -0.830  -8.637  1.00 0.00 ? 41 CYS A O    11 
ATOM 8551  C CB   . CYS A 1 41 ? -4.987  -2.683  -6.121  1.00 0.00 ? 41 CYS A CB   11 
ATOM 8552  S SG   . CYS A 1 41 ? -6.349  -1.483  -5.959  1.00 0.00 ? 41 CYS A SG   11 
ATOM 8553  H H    . CYS A 1 41 ? -3.104  -1.640  -4.661  1.00 0.00 ? 41 CYS A H    11 
ATOM 8554  H HA   . CYS A 1 41 ? -3.229  -2.843  -7.307  1.00 0.00 ? 41 CYS A HA   11 
ATOM 8555  H HB2  . CYS A 1 41 ? -5.315  -3.449  -6.789  1.00 0.00 ? 41 CYS A HB2  11 
ATOM 8556  H HB3  . CYS A 1 41 ? -4.815  -3.118  -5.149  1.00 0.00 ? 41 CYS A HB3  11 
ATOM 8557  N N    . GLU A 1 42 ? -3.974  0.282   -6.682  1.00 0.00 ? 42 GLU A N    11 
ATOM 8558  C CA   . GLU A 1 42 ? -4.250  1.592   -7.280  1.00 0.00 ? 42 GLU A CA   11 
ATOM 8559  C C    . GLU A 1 42 ? -2.998  2.442   -7.491  1.00 0.00 ? 42 GLU A C    11 
ATOM 8560  O O    . GLU A 1 42 ? -3.102  3.644   -7.736  1.00 0.00 ? 42 GLU A O    11 
ATOM 8561  C CB   . GLU A 1 42 ? -5.244  2.362   -6.409  1.00 0.00 ? 42 GLU A CB   11 
ATOM 8562  C CG   . GLU A 1 42 ? -6.004  3.442   -7.161  1.00 0.00 ? 42 GLU A CG   11 
ATOM 8563  C CD   . GLU A 1 42 ? -6.717  4.406   -6.234  1.00 0.00 ? 42 GLU A CD   11 
ATOM 8564  O OE1  . GLU A 1 42 ? -7.822  4.067   -5.759  1.00 0.00 ? 42 GLU A OE1  11 
ATOM 8565  O OE2  . GLU A 1 42 ? -6.170  5.500   -5.981  1.00 0.00 ? 42 GLU A OE2  11 
ATOM 8566  H H    . GLU A 1 42 ? -3.865  0.207   -5.707  1.00 0.00 ? 42 GLU A H    11 
ATOM 8567  H HA   . GLU A 1 42 ? -4.708  1.417   -8.242  1.00 0.00 ? 42 GLU A HA   11 
ATOM 8568  H HB2  . GLU A 1 42 ? -5.961  1.665   -6.001  1.00 0.00 ? 42 GLU A HB2  11 
ATOM 8569  H HB3  . GLU A 1 42 ? -4.706  2.829   -5.598  1.00 0.00 ? 42 GLU A HB3  11 
ATOM 8570  H HG2  . GLU A 1 42 ? -5.307  4.000   -7.769  1.00 0.00 ? 42 GLU A HG2  11 
ATOM 8571  H HG3  . GLU A 1 42 ? -6.738  2.970   -7.799  1.00 0.00 ? 42 GLU A HG3  11 
ATOM 8572  N N    . HIS A 1 43 ? -1.820  1.838   -7.410  1.00 0.00 ? 43 HIS A N    11 
ATOM 8573  C CA   . HIS A 1 43 ? -0.586  2.592   -7.613  1.00 0.00 ? 43 HIS A CA   11 
ATOM 8574  C C    . HIS A 1 43 ? -0.324  2.807   -9.102  1.00 0.00 ? 43 HIS A C    11 
ATOM 8575  O O    . HIS A 1 43 ? -0.959  2.177   -9.948  1.00 0.00 ? 43 HIS A O    11 
ATOM 8576  C CB   . HIS A 1 43 ? 0.600   1.884   -6.958  1.00 0.00 ? 43 HIS A CB   11 
ATOM 8577  C CG   . HIS A 1 43 ? 0.792   0.460   -7.384  1.00 0.00 ? 43 HIS A CG   11 
ATOM 8578  N ND1  . HIS A 1 43 ? 0.394   -0.036  -8.611  1.00 0.00 ? 43 HIS A ND1  11 
ATOM 8579  C CD2  . HIS A 1 43 ? 1.371   -0.574  -6.734  1.00 0.00 ? 43 HIS A CD2  11 
ATOM 8580  C CE1  . HIS A 1 43 ? 0.724   -1.313  -8.692  1.00 0.00 ? 43 HIS A CE1  11 
ATOM 8581  N NE2  . HIS A 1 43 ? 1.318   -1.663  -7.568  1.00 0.00 ? 43 HIS A NE2  11 
ATOM 8582  H H    . HIS A 1 43 ? -1.776  0.879   -7.213  1.00 0.00 ? 43 HIS A H    11 
ATOM 8583  H HA   . HIS A 1 43 ? -0.711  3.559   -7.148  1.00 0.00 ? 43 HIS A HA   11 
ATOM 8584  H HB2  . HIS A 1 43 ? 1.505   2.423   -7.195  1.00 0.00 ? 43 HIS A HB2  11 
ATOM 8585  H HB3  . HIS A 1 43 ? 0.458   1.893   -5.888  1.00 0.00 ? 43 HIS A HB3  11 
ATOM 8586  H HD1  . HIS A 1 43 ? -0.063  0.469   -9.314  1.00 0.00 ? 43 HIS A HD1  11 
ATOM 8587  H HD2  . HIS A 1 43 ? 1.791   -0.546  -5.736  1.00 0.00 ? 43 HIS A HD2  11 
ATOM 8588  H HE1  . HIS A 1 43 ? 0.542   -1.960  -9.538  1.00 0.00 ? 43 HIS A HE1  11 
ATOM 8589  H HE2  . HIS A 1 43 ? 1.734   -2.533  -7.395  1.00 0.00 ? 43 HIS A HE2  11 
ATOM 8590  N N    . PRO A 1 44 ? 0.609   3.711   -9.445  1.00 0.00 ? 44 PRO A N    11 
ATOM 8591  C CA   . PRO A 1 44 ? 0.941   4.017   -10.841 1.00 0.00 ? 44 PRO A CA   11 
ATOM 8592  C C    . PRO A 1 44 ? 1.622   2.845   -11.538 1.00 0.00 ? 44 PRO A C    11 
ATOM 8593  O O    . PRO A 1 44 ? 1.042   2.211   -12.419 1.00 0.00 ? 44 PRO A O    11 
ATOM 8594  C CB   . PRO A 1 44 ? 1.897   5.218   -10.741 1.00 0.00 ? 44 PRO A CB   11 
ATOM 8595  C CG   . PRO A 1 44 ? 1.777   5.708   -9.334  1.00 0.00 ? 44 PRO A CG   11 
ATOM 8596  C CD   . PRO A 1 44 ? 1.409   4.510   -8.508  1.00 0.00 ? 44 PRO A CD   11 
ATOM 8597  H HA   . PRO A 1 44 ? 0.062   4.300   -11.400 1.00 0.00 ? 44 PRO A HA   11 
ATOM 8598  H HB2  . PRO A 1 44 ? 2.905   4.898   -10.961 1.00 0.00 ? 44 PRO A HB2  11 
ATOM 8599  H HB3  . PRO A 1 44 ? 1.594   5.977   -11.447 1.00 0.00 ? 44 PRO A HB3  11 
ATOM 8600  H HG2  . PRO A 1 44 ? 2.721   6.115   -9.005  1.00 0.00 ? 44 PRO A HG2  11 
ATOM 8601  H HG3  . PRO A 1 44 ? 1.002   6.458   -9.272  1.00 0.00 ? 44 PRO A HG3  11 
ATOM 8602  H HD2  . PRO A 1 44 ? 2.296   3.974   -8.200  1.00 0.00 ? 44 PRO A HD2  11 
ATOM 8603  H HD3  . PRO A 1 44 ? 0.823   4.802   -7.649  1.00 0.00 ? 44 PRO A HD3  11 
ATOM 8604  N N    . GLY A 1 45 ? 2.851   2.559   -11.131 1.00 0.00 ? 45 GLY A N    11 
ATOM 8605  C CA   . GLY A 1 45 ? 3.591   1.459   -11.714 1.00 0.00 ? 45 GLY A CA   11 
ATOM 8606  C C    . GLY A 1 45 ? 4.299   0.632   -10.661 1.00 0.00 ? 45 GLY A C    11 
ATOM 8607  O O    . GLY A 1 45 ? 5.180   -0.169  -10.977 1.00 0.00 ? 45 GLY A O    11 
ATOM 8608  H H    . GLY A 1 45 ? 3.257   3.095   -10.418 1.00 0.00 ? 45 GLY A H    11 
ATOM 8609  H HA2  . GLY A 1 45 ? 2.905   0.824   -12.256 1.00 0.00 ? 45 GLY A HA2  11 
ATOM 8610  H HA3  . GLY A 1 45 ? 4.324   1.853   -12.401 1.00 0.00 ? 45 GLY A HA3  11 
ATOM 8611  N N    . GLY A 1 46 ? 3.915   0.832   -9.404  1.00 0.00 ? 46 GLY A N    11 
ATOM 8612  C CA   . GLY A 1 46 ? 4.523   0.099   -8.316  1.00 0.00 ? 46 GLY A CA   11 
ATOM 8613  C C    . GLY A 1 46 ? 4.899   0.997   -7.157  1.00 0.00 ? 46 GLY A C    11 
ATOM 8614  O O    . GLY A 1 46 ? 6.078   1.265   -6.930  1.00 0.00 ? 46 GLY A O    11 
ATOM 8615  H H    . GLY A 1 46 ? 3.208   1.484   -9.215  1.00 0.00 ? 46 GLY A H    11 
ATOM 8616  H HA2  . GLY A 1 46 ? 3.828   -0.650  -7.964  1.00 0.00 ? 46 GLY A HA2  11 
ATOM 8617  H HA3  . GLY A 1 46 ? 5.413   -0.393  -8.678  1.00 0.00 ? 46 GLY A HA3  11 
ATOM 8618  N N    . PHE A 1 47 ? 3.898   1.458   -6.415  1.00 0.00 ? 47 PHE A N    11 
ATOM 8619  C CA   . PHE A 1 47 ? 4.135   2.318   -5.264  1.00 0.00 ? 47 PHE A CA   11 
ATOM 8620  C C    . PHE A 1 47 ? 5.090   1.642   -4.296  1.00 0.00 ? 47 PHE A C    11 
ATOM 8621  O O    . PHE A 1 47 ? 5.020   0.432   -4.086  1.00 0.00 ? 47 PHE A O    11 
ATOM 8622  C CB   . PHE A 1 47 ? 2.819   2.627   -4.544  1.00 0.00 ? 47 PHE A CB   11 
ATOM 8623  C CG   . PHE A 1 47 ? 2.359   4.051   -4.682  1.00 0.00 ? 47 PHE A CG   11 
ATOM 8624  C CD1  . PHE A 1 47 ? 2.667   4.790   -5.813  1.00 0.00 ? 47 PHE A CD1  11 
ATOM 8625  C CD2  . PHE A 1 47 ? 1.606   4.647   -3.683  1.00 0.00 ? 47 PHE A CD2  11 
ATOM 8626  C CE1  . PHE A 1 47 ? 2.234   6.095   -5.945  1.00 0.00 ? 47 PHE A CE1  11 
ATOM 8627  C CE2  . PHE A 1 47 ? 1.172   5.952   -3.807  1.00 0.00 ? 47 PHE A CE2  11 
ATOM 8628  C CZ   . PHE A 1 47 ? 1.485   6.678   -4.941  1.00 0.00 ? 47 PHE A CZ   11 
ATOM 8629  H H    . PHE A 1 47 ? 2.982   1.206   -6.640  1.00 0.00 ? 47 PHE A H    11 
ATOM 8630  H HA   . PHE A 1 47 ? 4.577   3.239   -5.614  1.00 0.00 ? 47 PHE A HA   11 
ATOM 8631  H HB2  . PHE A 1 47 ? 2.046   1.990   -4.940  1.00 0.00 ? 47 PHE A HB2  11 
ATOM 8632  H HB3  . PHE A 1 47 ? 2.938   2.420   -3.489  1.00 0.00 ? 47 PHE A HB3  11 
ATOM 8633  H HD1  . PHE A 1 47 ? 3.255   4.336   -6.595  1.00 0.00 ? 47 PHE A HD1  11 
ATOM 8634  H HD2  . PHE A 1 47 ? 1.363   4.080   -2.794  1.00 0.00 ? 47 PHE A HD2  11 
ATOM 8635  H HE1  . PHE A 1 47 ? 2.481   6.660   -6.832  1.00 0.00 ? 47 PHE A HE1  11 
ATOM 8636  H HE2  . PHE A 1 47 ? 0.588   6.405   -3.020  1.00 0.00 ? 47 PHE A HE2  11 
ATOM 8637  H HZ   . PHE A 1 47 ? 1.144   7.698   -5.042  1.00 0.00 ? 47 PHE A HZ   11 
ATOM 8638  N N    . GLU A 1 48 ? 5.973   2.423   -3.700  1.00 0.00 ? 48 GLU A N    11 
ATOM 8639  C CA   . GLU A 1 48 ? 6.924   1.878   -2.745  1.00 0.00 ? 48 GLU A CA   11 
ATOM 8640  C C    . GLU A 1 48 ? 6.353   1.948   -1.347  1.00 0.00 ? 48 GLU A C    11 
ATOM 8641  O O    . GLU A 1 48 ? 5.749   2.943   -0.972  1.00 0.00 ? 48 GLU A O    11 
ATOM 8642  C CB   . GLU A 1 48 ? 8.242   2.652   -2.794  1.00 0.00 ? 48 GLU A CB   11 
ATOM 8643  C CG   . GLU A 1 48 ? 9.325   2.059   -1.910  1.00 0.00 ? 48 GLU A CG   11 
ATOM 8644  C CD   . GLU A 1 48 ? 10.719  2.475   -2.337  1.00 0.00 ? 48 GLU A CD   11 
ATOM 8645  O OE1  . GLU A 1 48 ? 10.868  3.591   -2.877  1.00 0.00 ? 48 GLU A OE1  11 
ATOM 8646  O OE2  . GLU A 1 48 ? 11.664  1.684   -2.130  1.00 0.00 ? 48 GLU A OE2  11 
ATOM 8647  H H    . GLU A 1 48 ? 5.980   3.390   -3.896  1.00 0.00 ? 48 GLU A H    11 
ATOM 8648  H HA   . GLU A 1 48 ? 7.104   0.841   -2.994  1.00 0.00 ? 48 GLU A HA   11 
ATOM 8649  H HB2  . GLU A 1 48 ? 8.602   2.669   -3.809  1.00 0.00 ? 48 GLU A HB2  11 
ATOM 8650  H HB3  . GLU A 1 48 ? 8.058   3.664   -2.470  1.00 0.00 ? 48 GLU A HB3  11 
ATOM 8651  H HG2  . GLU A 1 48 ? 9.163   2.389   -0.895  1.00 0.00 ? 48 GLU A HG2  11 
ATOM 8652  H HG3  . GLU A 1 48 ? 9.257   0.981   -1.952  1.00 0.00 ? 48 GLU A HG3  11 
ATOM 8653  N N    . TYR A 1 49 ? 6.554   0.894   -0.576  1.00 0.00 ? 49 TYR A N    11 
ATOM 8654  C CA   . TYR A 1 49 ? 6.061   0.866   0.792   1.00 0.00 ? 49 TYR A CA   11 
ATOM 8655  C C    . TYR A 1 49 ? 6.856   -0.086  1.646   1.00 0.00 ? 49 TYR A C    11 
ATOM 8656  O O    . TYR A 1 49 ? 7.537   -0.985  1.153   1.00 0.00 ? 49 TYR A O    11 
ATOM 8657  C CB   . TYR A 1 49 ? 4.595   0.490   0.868   1.00 0.00 ? 49 TYR A CB   11 
ATOM 8658  C CG   . TYR A 1 49 ? 4.245   -0.779  0.166   1.00 0.00 ? 49 TYR A CG   11 
ATOM 8659  C CD1  . TYR A 1 49 ? 3.906   -0.780  -1.173  1.00 0.00 ? 49 TYR A CD1  11 
ATOM 8660  C CD2  . TYR A 1 49 ? 4.241   -1.979  0.855   1.00 0.00 ? 49 TYR A CD2  11 
ATOM 8661  C CE1  . TYR A 1 49 ? 3.570   -1.948  -1.810  1.00 0.00 ? 49 TYR A CE1  11 
ATOM 8662  C CE2  . TYR A 1 49 ? 3.911   -3.153  0.229   1.00 0.00 ? 49 TYR A CE2  11 
ATOM 8663  C CZ   . TYR A 1 49 ? 3.571   -3.135  -1.109  1.00 0.00 ? 49 TYR A CZ   11 
ATOM 8664  O OH   . TYR A 1 49 ? 3.229   -4.298  -1.748  1.00 0.00 ? 49 TYR A OH   11 
ATOM 8665  H H    . TYR A 1 49 ? 7.052   0.119   -0.934  1.00 0.00 ? 49 TYR A H    11 
ATOM 8666  H HA   . TYR A 1 49 ? 6.165   1.853   1.209   1.00 0.00 ? 49 TYR A HA   11 
ATOM 8667  H HB2  . TYR A 1 49 ? 4.342   0.360   1.899   1.00 0.00 ? 49 TYR A HB2  11 
ATOM 8668  H HB3  . TYR A 1 49 ? 3.997   1.283   0.455   1.00 0.00 ? 49 TYR A HB3  11 
ATOM 8669  H HD1  . TYR A 1 49 ? 3.908   0.151   -1.720  1.00 0.00 ? 49 TYR A HD1  11 
ATOM 8670  H HD2  . TYR A 1 49 ? 4.507   -1.984  1.901   1.00 0.00 ? 49 TYR A HD2  11 
ATOM 8671  H HE1  . TYR A 1 49 ? 3.310   -1.928  -2.851  1.00 0.00 ? 49 TYR A HE1  11 
ATOM 8672  H HE2  . TYR A 1 49 ? 3.918   -4.077  0.789   1.00 0.00 ? 49 TYR A HE2  11 
ATOM 8673  H HH   . TYR A 1 49 ? 3.760   -4.396  -2.542  1.00 0.00 ? 49 TYR A HH   11 
ATOM 8674  N N    . SER A 1 50 ? 6.748   0.128   2.935   1.00 0.00 ? 50 SER A N    11 
ATOM 8675  C CA   . SER A 1 50 ? 7.433   -0.694  3.910   1.00 0.00 ? 50 SER A CA   11 
ATOM 8676  C C    . SER A 1 50 ? 6.565   -0.851  5.146   1.00 0.00 ? 50 SER A C    11 
ATOM 8677  O O    . SER A 1 50 ? 6.541   0.017   6.017   1.00 0.00 ? 50 SER A O    11 
ATOM 8678  C CB   . SER A 1 50 ? 8.774   -0.070  4.274   1.00 0.00 ? 50 SER A CB   11 
ATOM 8679  O OG   . SER A 1 50 ? 9.189   0.866   3.294   1.00 0.00 ? 50 SER A OG   11 
ATOM 8680  H H    . SER A 1 50 ? 6.175   0.868   3.241   1.00 0.00 ? 50 SER A H    11 
ATOM 8681  H HA   . SER A 1 50 ? 7.600   -1.665  3.470   1.00 0.00 ? 50 SER A HA   11 
ATOM 8682  H HB2  . SER A 1 50 ? 8.683   0.437   5.220   1.00 0.00 ? 50 SER A HB2  11 
ATOM 8683  H HB3  . SER A 1 50 ? 9.515   -0.849  4.347   1.00 0.00 ? 50 SER A HB3  11 
ATOM 8684  H HG   . SER A 1 50 ? 8.561   1.591   3.258   1.00 0.00 ? 50 SER A HG   11 
ATOM 8685  N N    . ASN A 1 51 ? 5.832   -1.953  5.201   1.00 0.00 ? 51 ASN A N    11 
ATOM 8686  C CA   . ASN A 1 51 ? 4.934   -2.214  6.316   1.00 0.00 ? 51 ASN A CA   11 
ATOM 8687  C C    . ASN A 1 51 ? 5.609   -1.973  7.657   1.00 0.00 ? 51 ASN A C    11 
ATOM 8688  O O    . ASN A 1 51 ? 6.734   -2.412  7.896   1.00 0.00 ? 51 ASN A O    11 
ATOM 8689  C CB   . ASN A 1 51 ? 4.395   -3.641  6.269   1.00 0.00 ? 51 ASN A CB   11 
ATOM 8690  C CG   . ASN A 1 51 ? 4.044   -4.103  4.866   1.00 0.00 ? 51 ASN A CG   11 
ATOM 8691  O OD1  . ASN A 1 51 ? 4.148   -5.287  4.548   1.00 0.00 ? 51 ASN A OD1  11 
ATOM 8692  N ND2  . ASN A 1 51 ? 3.624   -3.171  4.014   1.00 0.00 ? 51 ASN A ND2  11 
ATOM 8693  H H    . ASN A 1 51 ? 5.883   -2.597  4.465   1.00 0.00 ? 51 ASN A H    11 
ATOM 8694  H HA   . ASN A 1 51 ? 4.103   -1.533  6.224   1.00 0.00 ? 51 ASN A HA   11 
ATOM 8695  H HB2  . ASN A 1 51 ? 5.140   -4.312  6.671   1.00 0.00 ? 51 ASN A HB2  11 
ATOM 8696  H HB3  . ASN A 1 51 ? 3.507   -3.689  6.882   1.00 0.00 ? 51 ASN A HB3  11 
ATOM 8697  H HD21 . ASN A 1 51 ? 3.560   -2.247  4.332   1.00 0.00 ? 51 ASN A HD21 11 
ATOM 8698  H HD22 . ASN A 1 51 ? 3.401   -3.447  3.102   1.00 0.00 ? 51 ASN A HD22 11 
ATOM 8699  N N    . GLY A 1 52 ? 4.898   -1.277  8.528   1.00 0.00 ? 52 GLY A N    11 
ATOM 8700  C CA   . GLY A 1 52 ? 5.416   -0.984  9.852   1.00 0.00 ? 52 GLY A CA   11 
ATOM 8701  C C    . GLY A 1 52 ? 5.920   0.440   9.989   1.00 0.00 ? 52 GLY A C    11 
ATOM 8702  O O    . GLY A 1 52 ? 5.661   1.279   9.124   1.00 0.00 ? 52 GLY A O    11 
ATOM 8703  H H    . GLY A 1 52 ? 4.004   -0.966  8.268   1.00 0.00 ? 52 GLY A H    11 
ATOM 8704  H HA2  . GLY A 1 52 ? 4.629   -1.144  10.575  1.00 0.00 ? 52 GLY A HA2  11 
ATOM 8705  H HA3  . GLY A 1 52 ? 6.228   -1.663  10.067  1.00 0.00 ? 52 GLY A HA3  11 
ATOM 8706  N N    . PRO A 1 53 ? 6.651   0.745   11.076  1.00 0.00 ? 53 PRO A N    11 
ATOM 8707  C CA   . PRO A 1 53 ? 7.192   2.087   11.318  1.00 0.00 ? 53 PRO A CA   11 
ATOM 8708  C C    . PRO A 1 53 ? 8.223   2.490   10.272  1.00 0.00 ? 53 PRO A C    11 
ATOM 8709  O O    . PRO A 1 53 ? 9.004   1.662   9.804   1.00 0.00 ? 53 PRO A O    11 
ATOM 8710  C CB   . PRO A 1 53 ? 7.845   1.972   12.699  1.00 0.00 ? 53 PRO A CB   11 
ATOM 8711  C CG   . PRO A 1 53 ? 8.115   0.517   12.874  1.00 0.00 ? 53 PRO A CG   11 
ATOM 8712  C CD   . PRO A 1 53 ? 7.006   -0.195  12.154  1.00 0.00 ? 53 PRO A CD   11 
ATOM 8713  H HA   . PRO A 1 53 ? 6.407   2.828   11.349  1.00 0.00 ? 53 PRO A HA   11 
ATOM 8714  H HB2  . PRO A 1 53 ? 8.758   2.548   12.717  1.00 0.00 ? 53 PRO A HB2  11 
ATOM 8715  H HB3  . PRO A 1 53 ? 7.165   2.339   13.453  1.00 0.00 ? 53 PRO A HB3  11 
ATOM 8716  H HG2  . PRO A 1 53 ? 9.069   0.264   12.437  1.00 0.00 ? 53 PRO A HG2  11 
ATOM 8717  H HG3  . PRO A 1 53 ? 8.102   0.264   13.925  1.00 0.00 ? 53 PRO A HG3  11 
ATOM 8718  H HD2  . PRO A 1 53 ? 7.359   -1.132  11.749  1.00 0.00 ? 53 PRO A HD2  11 
ATOM 8719  H HD3  . PRO A 1 53 ? 6.168   -0.358  12.814  1.00 0.00 ? 53 PRO A HD3  11 
ATOM 8720  N N    . CYS A 1 54 ? 8.219   3.769   9.907   1.00 0.00 ? 54 CYS A N    11 
ATOM 8721  C CA   . CYS A 1 54 ? 9.150   4.284   8.910   1.00 0.00 ? 54 CYS A CA   11 
ATOM 8722  C C    . CYS A 1 54 ? 8.843   5.748   8.595   1.00 0.00 ? 54 CYS A C    11 
ATOM 8723  O O    . CYS A 1 54 ? 9.752   6.550   8.377   1.00 0.00 ? 54 CYS A O    11 
ATOM 8724  C CB   . CYS A 1 54 ? 9.087   3.420   7.639   1.00 0.00 ? 54 CYS A CB   11 
ATOM 8725  S SG   . CYS A 1 54 ? 9.460   4.294   6.080   1.00 0.00 ? 54 CYS A SG   11 
ATOM 8726  H H    . CYS A 1 54 ? 7.569   4.379   10.314  1.00 0.00 ? 54 CYS A H    11 
ATOM 8727  H HA   . CYS A 1 54 ? 10.145  4.222   9.327   1.00 0.00 ? 54 CYS A HA   11 
ATOM 8728  H HB2  . CYS A 1 54 ? 9.798   2.613   7.732   1.00 0.00 ? 54 CYS A HB2  11 
ATOM 8729  H HB3  . CYS A 1 54 ? 8.095   3.003   7.552   1.00 0.00 ? 54 CYS A HB3  11 
ATOM 8730  N N    . GLU A 1 55 ? 7.557   6.090   8.575   1.00 0.00 ? 55 GLU A N    11 
ATOM 8731  C CA   . GLU A 1 55 ? 7.135   7.458   8.290   1.00 0.00 ? 55 GLU A CA   11 
ATOM 8732  C C    . GLU A 1 55 ? 6.444   8.079   9.500   1.00 0.00 ? 55 GLU A C    11 
ATOM 8733  O O    . GLU A 1 55 ? 6.658   9.285   9.748   1.00 0.00 ? 55 GLU A O    11 
ATOM 8734  C CB   . GLU A 1 55 ? 6.196   7.485   7.080   1.00 0.00 ? 55 GLU A CB   11 
ATOM 8735  C CG   . GLU A 1 55 ? 6.755   8.259   5.897   1.00 0.00 ? 55 GLU A CG   11 
ATOM 8736  C CD   . GLU A 1 55 ? 6.852   9.748   6.168   1.00 0.00 ? 55 GLU A CD   11 
ATOM 8737  O OE1  . GLU A 1 55 ? 5.795   10.412  6.213   1.00 0.00 ? 55 GLU A OE1  11 
ATOM 8738  O OE2  . GLU A 1 55 ? 7.983   10.249  6.337   1.00 0.00 ? 55 GLU A OE2  11 
ATOM 8739  O OXT  . GLU A 1 55 ? 5.694   7.357   10.189  1.00 0.00 ? 55 GLU A OXT  11 
ATOM 8740  H H    . GLU A 1 55 ? 6.877   5.408   8.759   1.00 0.00 ? 55 GLU A H    11 
ATOM 8741  H HA   . GLU A 1 55 ? 8.017   8.035   8.060   1.00 0.00 ? 55 GLU A HA   11 
ATOM 8742  H HB2  . GLU A 1 55 ? 6.008   6.471   6.762   1.00 0.00 ? 55 GLU A HB2  11 
ATOM 8743  H HB3  . GLU A 1 55 ? 5.262   7.942   7.372   1.00 0.00 ? 55 GLU A HB3  11 
ATOM 8744  H HG2  . GLU A 1 55 ? 7.743   7.885   5.672   1.00 0.00 ? 55 GLU A HG2  11 
ATOM 8745  H HG3  . GLU A 1 55 ? 6.110   8.104   5.044   1.00 0.00 ? 55 GLU A HG3  11 
ATOM 8746  N N    . ALA A 1 1  ? 4.467   -1.268  -4.745  1.00 0.00 ? 1  ALA A N    12 
ATOM 8747  C CA   . ALA A 1 1  ? 5.594   -1.008  -3.815  1.00 0.00 ? 1  ALA A CA   12 
ATOM 8748  C C    . ALA A 1 1  ? 6.813   -1.826  -4.196  1.00 0.00 ? 1  ALA A C    12 
ATOM 8749  O O    . ALA A 1 1  ? 6.815   -2.526  -5.208  1.00 0.00 ? 1  ALA A O    12 
ATOM 8750  C CB   . ALA A 1 1  ? 5.179   -1.316  -2.386  1.00 0.00 ? 1  ALA A CB   12 
ATOM 8751  H H1   . ALA A 1 1  ? 3.932   -2.076  -4.373  1.00 0.00 ? 1  ALA A H1   12 
ATOM 8752  H H2   . ALA A 1 1  ? 4.871   -1.487  -5.678  1.00 0.00 ? 1  ALA A H2   12 
ATOM 8753  H H3   . ALA A 1 1  ? 3.877   -0.413  -4.780  1.00 0.00 ? 1  ALA A H3   12 
ATOM 8754  H HA   . ALA A 1 1  ? 5.852   0.035   -3.868  1.00 0.00 ? 1  ALA A HA   12 
ATOM 8755  H HB1  . ALA A 1 1  ? 4.922   -2.362  -2.303  1.00 0.00 ? 1  ALA A HB1  12 
ATOM 8756  H HB2  . ALA A 1 1  ? 4.323   -0.713  -2.122  1.00 0.00 ? 1  ALA A HB2  12 
ATOM 8757  H HB3  . ALA A 1 1  ? 5.997   -1.092  -1.717  1.00 0.00 ? 1  ALA A HB3  12 
ATOM 8758  N N    . HIS A 1 2  ? 7.850   -1.741  -3.375  1.00 0.00 ? 2  HIS A N    12 
ATOM 8759  C CA   . HIS A 1 2  ? 9.074   -2.486  -3.627  1.00 0.00 ? 2  HIS A CA   12 
ATOM 8760  C C    . HIS A 1 2  ? 9.073   -3.789  -2.860  1.00 0.00 ? 2  HIS A C    12 
ATOM 8761  O O    . HIS A 1 2  ? 10.114  -4.298  -2.445  1.00 0.00 ? 2  HIS A O    12 
ATOM 8762  C CB   . HIS A 1 2  ? 10.312  -1.655  -3.285  1.00 0.00 ? 2  HIS A CB   12 
ATOM 8763  C CG   . HIS A 1 2  ? 11.278  -1.527  -4.421  1.00 0.00 ? 2  HIS A CG   12 
ATOM 8764  N ND1  . HIS A 1 2  ? 10.937  -0.987  -5.643  1.00 0.00 ? 2  HIS A ND1  12 
ATOM 8765  C CD2  . HIS A 1 2  ? 12.584  -1.875  -4.517  1.00 0.00 ? 2  HIS A CD2  12 
ATOM 8766  C CE1  . HIS A 1 2  ? 11.990  -1.007  -6.441  1.00 0.00 ? 2  HIS A CE1  12 
ATOM 8767  N NE2  . HIS A 1 2  ? 13.001  -1.541  -5.782  1.00 0.00 ? 2  HIS A NE2  12 
ATOM 8768  H H    . HIS A 1 2  ? 7.784   -1.171  -2.582  1.00 0.00 ? 2  HIS A H    12 
ATOM 8769  H HA   . HIS A 1 2  ? 9.077   -2.726  -4.669  1.00 0.00 ? 2  HIS A HA   12 
ATOM 8770  H HB2  . HIS A 1 2  ? 10.003  -0.663  -3.000  1.00 0.00 ? 2  HIS A HB2  12 
ATOM 8771  H HB3  . HIS A 1 2  ? 10.831  -2.116  -2.457  1.00 0.00 ? 2  HIS A HB3  12 
ATOM 8772  H HD1  . HIS A 1 2  ? 10.054  -0.640  -5.889  1.00 0.00 ? 2  HIS A HD1  12 
ATOM 8773  H HD2  . HIS A 1 2  ? 13.185  -2.331  -3.743  1.00 0.00 ? 2  HIS A HD2  12 
ATOM 8774  H HE1  . HIS A 1 2  ? 12.018  -0.647  -7.459  1.00 0.00 ? 2  HIS A HE1  12 
ATOM 8775  H HE2  . HIS A 1 2  ? 13.871  -1.770  -6.172  1.00 0.00 ? 2  HIS A HE2  12 
ATOM 8776  N N    . MET A 1 3  ? 7.881   -4.320  -2.704  1.00 0.00 ? 3  MET A N    12 
ATOM 8777  C CA   . MET A 1 3  ? 7.676   -5.589  -2.004  1.00 0.00 ? 3  MET A CA   12 
ATOM 8778  C C    . MET A 1 3  ? 6.323   -6.217  -2.382  1.00 0.00 ? 3  MET A C    12 
ATOM 8779  O O    . MET A 1 3  ? 6.145   -6.675  -3.510  1.00 0.00 ? 3  MET A O    12 
ATOM 8780  C CB   . MET A 1 3  ? 7.789   -5.388  -0.485  1.00 0.00 ? 3  MET A CB   12 
ATOM 8781  C CG   . MET A 1 3  ? 9.210   -5.487  0.049   1.00 0.00 ? 3  MET A CG   12 
ATOM 8782  S SD   . MET A 1 3  ? 9.984   -7.074  -0.320  1.00 0.00 ? 3  MET A SD   12 
ATOM 8783  C CE   . MET A 1 3  ? 11.625  -6.548  -0.805  1.00 0.00 ? 3  MET A CE   12 
ATOM 8784  H H    . MET A 1 3  ? 7.116   -3.839  -3.087  1.00 0.00 ? 3  MET A H    12 
ATOM 8785  H HA   . MET A 1 3  ? 8.460   -6.261  -2.323  1.00 0.00 ? 3  MET A HA   12 
ATOM 8786  H HB2  . MET A 1 3  ? 7.402   -4.413  -0.232  1.00 0.00 ? 3  MET A HB2  12 
ATOM 8787  H HB3  . MET A 1 3  ? 7.194   -6.140  0.011   1.00 0.00 ? 3  MET A HB3  12 
ATOM 8788  H HG2  . MET A 1 3  ? 9.804   -4.701  -0.392  1.00 0.00 ? 3  MET A HG2  12 
ATOM 8789  H HG3  . MET A 1 3  ? 9.186   -5.357  1.121   1.00 0.00 ? 3  MET A HG3  12 
ATOM 8790  H HE1  . MET A 1 3  ? 11.787  -5.530  -0.483  1.00 0.00 ? 3  MET A HE1  12 
ATOM 8791  H HE2  . MET A 1 3  ? 11.718  -6.605  -1.879  1.00 0.00 ? 3  MET A HE2  12 
ATOM 8792  H HE3  . MET A 1 3  ? 12.361  -7.192  -0.346  1.00 0.00 ? 3  MET A HE3  12 
ATOM 8793  N N    . ASP A 1 4  ? 5.372   -6.238  -1.443  1.00 0.00 ? 4  ASP A N    12 
ATOM 8794  C CA   . ASP A 1 4  ? 4.052   -6.810  -1.691  1.00 0.00 ? 4  ASP A CA   12 
ATOM 8795  C C    . ASP A 1 4  ? 3.197   -5.857  -2.520  1.00 0.00 ? 4  ASP A C    12 
ATOM 8796  O O    . ASP A 1 4  ? 3.315   -4.639  -2.391  1.00 0.00 ? 4  ASP A O    12 
ATOM 8797  C CB   . ASP A 1 4  ? 3.351   -7.116  -0.364  1.00 0.00 ? 4  ASP A CB   12 
ATOM 8798  C CG   . ASP A 1 4  ? 2.215   -8.107  -0.524  1.00 0.00 ? 4  ASP A CG   12 
ATOM 8799  O OD1  . ASP A 1 4  ? 2.498   -9.304  -0.744  1.00 0.00 ? 4  ASP A OD1  12 
ATOM 8800  O OD2  . ASP A 1 4  ? 1.043   -7.687  -0.430  1.00 0.00 ? 4  ASP A OD2  12 
ATOM 8801  H H    . ASP A 1 4  ? 5.561   -5.863  -0.564  1.00 0.00 ? 4  ASP A H    12 
ATOM 8802  H HA   . ASP A 1 4  ? 4.183   -7.729  -2.241  1.00 0.00 ? 4  ASP A HA   12 
ATOM 8803  H HB2  . ASP A 1 4  ? 4.070   -7.528  0.331   1.00 0.00 ? 4  ASP A HB2  12 
ATOM 8804  H HB3  . ASP A 1 4  ? 2.950   -6.199  0.046   1.00 0.00 ? 4  ASP A HB3  12 
ATOM 8805  N N    . CYS A 1 5  ? 2.341   -6.409  -3.375  1.00 0.00 ? 5  CYS A N    12 
ATOM 8806  C CA   . CYS A 1 5  ? 1.484   -5.580  -4.214  1.00 0.00 ? 5  CYS A CA   12 
ATOM 8807  C C    . CYS A 1 5  ? 0.283   -6.353  -4.749  1.00 0.00 ? 5  CYS A C    12 
ATOM 8808  O O    . CYS A 1 5  ? 0.422   -7.478  -5.228  1.00 0.00 ? 5  CYS A O    12 
ATOM 8809  C CB   . CYS A 1 5  ? 2.294   -5.005  -5.378  1.00 0.00 ? 5  CYS A CB   12 
ATOM 8810  S SG   . CYS A 1 5  ? 1.827   -3.312  -5.858  1.00 0.00 ? 5  CYS A SG   12 
ATOM 8811  H H    . CYS A 1 5  ? 2.288   -7.385  -3.443  1.00 0.00 ? 5  CYS A H    12 
ATOM 8812  H HA   . CYS A 1 5  ? 1.123   -4.770  -3.605  1.00 0.00 ? 5  CYS A HA   12 
ATOM 8813  H HB2  . CYS A 1 5  ? 3.339   -4.991  -5.106  1.00 0.00 ? 5  CYS A HB2  12 
ATOM 8814  H HB3  . CYS A 1 5  ? 2.164   -5.640  -6.243  1.00 0.00 ? 5  CYS A HB3  12 
ATOM 8815  N N    . THR A 1 6  ? -0.894  -5.733  -4.678  1.00 0.00 ? 6  THR A N    12 
ATOM 8816  C CA   . THR A 1 6  ? -2.116  -6.355  -5.172  1.00 0.00 ? 6  THR A CA   12 
ATOM 8817  C C    . THR A 1 6  ? -1.968  -6.747  -6.650  1.00 0.00 ? 6  THR A C    12 
ATOM 8818  O O    . THR A 1 6  ? -2.488  -7.781  -7.060  1.00 0.00 ? 6  THR A O    12 
ATOM 8819  C CB   . THR A 1 6  ? -3.296  -5.393  -5.011  1.00 0.00 ? 6  THR A CB   12 
ATOM 8820  O OG1  . THR A 1 6  ? -2.845  -4.051  -4.958  1.00 0.00 ? 6  THR A OG1  12 
ATOM 8821  C CG2  . THR A 1 6  ? -4.114  -5.652  -3.764  1.00 0.00 ? 6  THR A CG2  12 
ATOM 8822  H H    . THR A 1 6  ? -0.943  -4.829  -4.292  1.00 0.00 ? 6  THR A H    12 
ATOM 8823  H HA   . THR A 1 6  ? -2.308  -7.251  -4.575  1.00 0.00 ? 6  THR A HA   12 
ATOM 8824  H HB   . THR A 1 6  ? -3.952  -5.498  -5.864  1.00 0.00 ? 6  THR A HB   12 
ATOM 8825  H HG1  . THR A 1 6  ? -3.105  -3.594  -5.761  1.00 0.00 ? 6  THR A HG1  12 
ATOM 8826  H HG21 . THR A 1 6  ? -4.381  -4.711  -3.309  1.00 0.00 ? 6  THR A HG21 12 
ATOM 8827  H HG22 . THR A 1 6  ? -3.532  -6.239  -3.068  1.00 0.00 ? 6  THR A HG22 12 
ATOM 8828  H HG23 . THR A 1 6  ? -5.011  -6.192  -4.029  1.00 0.00 ? 6  THR A HG23 12 
ATOM 8829  N N    . GLU A 1 7  ? -1.261  -5.906  -7.444  1.00 0.00 ? 7  GLU A N    12 
ATOM 8830  C CA   . GLU A 1 7  ? -1.045  -6.146  -8.880  1.00 0.00 ? 7  GLU A CA   12 
ATOM 8831  C C    . GLU A 1 7  ? -1.252  -7.607  -9.280  1.00 0.00 ? 7  GLU A C    12 
ATOM 8832  O O    . GLU A 1 7  ? -0.295  -8.368  -9.425  1.00 0.00 ? 7  GLU A O    12 
ATOM 8833  C CB   . GLU A 1 7  ? 0.365   -5.703  -9.275  1.00 0.00 ? 7  GLU A CB   12 
ATOM 8834  C CG   . GLU A 1 7  ? 0.454   -5.154  -10.690 1.00 0.00 ? 7  GLU A CG   12 
ATOM 8835  C CD   . GLU A 1 7  ? 1.596   -5.762  -11.481 1.00 0.00 ? 7  GLU A CD   12 
ATOM 8836  O OE1  . GLU A 1 7  ? 2.553   -6.263  -10.853 1.00 0.00 ? 7  GLU A OE1  12 
ATOM 8837  O OE2  . GLU A 1 7  ? 1.533   -5.740  -12.728 1.00 0.00 ? 7  GLU A OE2  12 
ATOM 8838  H H    . GLU A 1 7  ? -0.877  -5.085  -7.056  1.00 0.00 ? 7  GLU A H    12 
ATOM 8839  H HA   . GLU A 1 7  ? -1.757  -5.542  -9.419  1.00 0.00 ? 7  GLU A HA   12 
ATOM 8840  H HB2  . GLU A 1 7  ? 0.692   -4.934  -8.592  1.00 0.00 ? 7  GLU A HB2  12 
ATOM 8841  H HB3  . GLU A 1 7  ? 1.030   -6.550  -9.197  1.00 0.00 ? 7  GLU A HB3  12 
ATOM 8842  H HG2  . GLU A 1 7  ? -0.471  -5.365  -11.204 1.00 0.00 ? 7  GLU A HG2  12 
ATOM 8843  H HG3  . GLU A 1 7  ? 0.601   -4.085  -10.638 1.00 0.00 ? 7  GLU A HG3  12 
ATOM 8844  N N    . PHE A 1 8  ? -2.512  -7.981  -9.464  1.00 0.00 ? 8  PHE A N    12 
ATOM 8845  C CA   . PHE A 1 8  ? -2.870  -9.336  -9.858  1.00 0.00 ? 8  PHE A CA   12 
ATOM 8846  C C    . PHE A 1 8  ? -4.280  -9.343  -10.444 1.00 0.00 ? 8  PHE A C    12 
ATOM 8847  O O    . PHE A 1 8  ? -4.734  -8.333  -10.981 1.00 0.00 ? 8  PHE A O    12 
ATOM 8848  C CB   . PHE A 1 8  ? -2.772  -10.279 -8.655  1.00 0.00 ? 8  PHE A CB   12 
ATOM 8849  C CG   . PHE A 1 8  ? -2.134  -11.600 -8.979  1.00 0.00 ? 8  PHE A CG   12 
ATOM 8850  C CD1  . PHE A 1 8  ? -0.800  -11.666 -9.349  1.00 0.00 ? 8  PHE A CD1  12 
ATOM 8851  C CD2  . PHE A 1 8  ? -2.866  -12.774 -8.911  1.00 0.00 ? 8  PHE A CD2  12 
ATOM 8852  C CE1  . PHE A 1 8  ? -0.210  -12.879 -9.648  1.00 0.00 ? 8  PHE A CE1  12 
ATOM 8853  C CE2  . PHE A 1 8  ? -2.281  -13.990 -9.208  1.00 0.00 ? 8  PHE A CE2  12 
ATOM 8854  C CZ   . PHE A 1 8  ? -0.952  -14.043 -9.577  1.00 0.00 ? 8  PHE A CZ   12 
ATOM 8855  H H    . PHE A 1 8  ? -3.225  -7.320  -9.337  1.00 0.00 ? 8  PHE A H    12 
ATOM 8856  H HA   . PHE A 1 8  ? -2.173  -9.656  -10.619 1.00 0.00 ? 8  PHE A HA   12 
ATOM 8857  H HB2  . PHE A 1 8  ? -2.183  -9.807  -7.884  1.00 0.00 ? 8  PHE A HB2  12 
ATOM 8858  H HB3  . PHE A 1 8  ? -3.765  -10.471 -8.275  1.00 0.00 ? 8  PHE A HB3  12 
ATOM 8859  H HD1  . PHE A 1 8  ? -0.221  -10.757 -9.405  1.00 0.00 ? 8  PHE A HD1  12 
ATOM 8860  H HD2  . PHE A 1 8  ? -3.907  -12.733 -8.623  1.00 0.00 ? 8  PHE A HD2  12 
ATOM 8861  H HE1  . PHE A 1 8  ? 0.830   -12.918 -9.936  1.00 0.00 ? 8  PHE A HE1  12 
ATOM 8862  H HE2  . PHE A 1 8  ? -2.863  -14.898 -9.151  1.00 0.00 ? 8  PHE A HE2  12 
ATOM 8863  H HZ   . PHE A 1 8  ? -0.492  -14.992 -9.810  1.00 0.00 ? 8  PHE A HZ   12 
ATOM 8864  N N    . ASN A 1 9  ? -4.981  -10.468 -10.334 1.00 0.00 ? 9  ASN A N    12 
ATOM 8865  C CA   . ASN A 1 9  ? -6.339  -10.554 -10.852 1.00 0.00 ? 9  ASN A CA   12 
ATOM 8866  C C    . ASN A 1 9  ? -7.278  -9.698  -10.003 1.00 0.00 ? 9  ASN A C    12 
ATOM 8867  O O    . ASN A 1 9  ? -7.916  -8.775  -10.512 1.00 0.00 ? 9  ASN A O    12 
ATOM 8868  C CB   . ASN A 1 9  ? -6.815  -12.008 -10.880 1.00 0.00 ? 9  ASN A CB   12 
ATOM 8869  C CG   . ASN A 1 9  ? -6.885  -12.565 -12.288 1.00 0.00 ? 9  ASN A CG   12 
ATOM 8870  O OD1  . ASN A 1 9  ? -7.704  -12.133 -13.100 1.00 0.00 ? 9  ASN A OD1  12 
ATOM 8871  N ND2  . ASN A 1 9  ? -6.024  -13.531 -12.585 1.00 0.00 ? 9  ASN A ND2  12 
ATOM 8872  H H    . ASN A 1 9  ? -4.584  -11.246 -9.891  1.00 0.00 ? 9  ASN A H    12 
ATOM 8873  H HA   . ASN A 1 9  ? -6.332  -10.165 -11.859 1.00 0.00 ? 9  ASN A HA   12 
ATOM 8874  H HB2  . ASN A 1 9  ? -6.131  -12.614 -10.307 1.00 0.00 ? 9  ASN A HB2  12 
ATOM 8875  H HB3  . ASN A 1 9  ? -7.799  -12.067 -10.439 1.00 0.00 ? 9  ASN A HB3  12 
ATOM 8876  H HD21 . ASN A 1 9  ? -5.401  -13.826 -11.889 1.00 0.00 ? 9  ASN A HD21 12 
ATOM 8877  H HD22 . ASN A 1 9  ? -6.047  -13.910 -13.489 1.00 0.00 ? 9  ASN A HD22 12 
ATOM 8878  N N    . PRO A 1 10 ? -7.373  -9.985  -8.691  1.00 0.00 ? 10 PRO A N    12 
ATOM 8879  C CA   . PRO A 1 10 ? -8.227  -9.240  -7.775  1.00 0.00 ? 10 PRO A CA   12 
ATOM 8880  C C    . PRO A 1 10 ? -7.478  -8.112  -7.067  1.00 0.00 ? 10 PRO A C    12 
ATOM 8881  O O    . PRO A 1 10 ? -7.060  -8.260  -5.919  1.00 0.00 ? 10 PRO A O    12 
ATOM 8882  C CB   . PRO A 1 10 ? -8.624  -10.320 -6.779  1.00 0.00 ? 10 PRO A CB   12 
ATOM 8883  C CG   . PRO A 1 10 ? -7.412  -11.191 -6.671  1.00 0.00 ? 10 PRO A CG   12 
ATOM 8884  C CD   . PRO A 1 10 ? -6.659  -11.061 -7.980  1.00 0.00 ? 10 PRO A CD   12 
ATOM 8885  H HA   . PRO A 1 10 ? -9.106  -8.850  -8.266  1.00 0.00 ? 10 PRO A HA   12 
ATOM 8886  H HB2  . PRO A 1 10 ? -8.874  -9.866  -5.830  1.00 0.00 ? 10 PRO A HB2  12 
ATOM 8887  H HB3  . PRO A 1 10 ? -9.473  -10.871 -7.157  1.00 0.00 ? 10 PRO A HB3  12 
ATOM 8888  H HG2  . PRO A 1 10 ? -6.794  -10.854 -5.853  1.00 0.00 ? 10 PRO A HG2  12 
ATOM 8889  H HG3  . PRO A 1 10 ? -7.713  -12.216 -6.514  1.00 0.00 ? 10 PRO A HG3  12 
ATOM 8890  H HD2  . PRO A 1 10 ? -5.632  -10.785 -7.796  1.00 0.00 ? 10 PRO A HD2  12 
ATOM 8891  H HD3  . PRO A 1 10 ? -6.708  -11.988 -8.529  1.00 0.00 ? 10 PRO A HD3  12 
ATOM 8892  N N    . LEU A 1 11 ? -7.307  -6.984  -7.755  1.00 0.00 ? 11 LEU A N    12 
ATOM 8893  C CA   . LEU A 1 11 ? -6.605  -5.837  -7.179  1.00 0.00 ? 11 LEU A CA   12 
ATOM 8894  C C    . LEU A 1 11 ? -7.195  -5.462  -5.835  1.00 0.00 ? 11 LEU A C    12 
ATOM 8895  O O    . LEU A 1 11 ? -8.183  -6.056  -5.416  1.00 0.00 ? 11 LEU A O    12 
ATOM 8896  C CB   . LEU A 1 11 ? -6.653  -4.644  -8.135  1.00 0.00 ? 11 LEU A CB   12 
ATOM 8897  C CG   . LEU A 1 11 ? -5.837  -4.815  -9.419  1.00 0.00 ? 11 LEU A CG   12 
ATOM 8898  C CD1  . LEU A 1 11 ? -6.638  -4.365  -10.631 1.00 0.00 ? 11 LEU A CD1  12 
ATOM 8899  C CD2  . LEU A 1 11 ? -4.528  -4.044  -9.325  1.00 0.00 ? 11 LEU A CD2  12 
ATOM 8900  H H    . LEU A 1 11 ? -7.660  -6.921  -8.667  1.00 0.00 ? 11 LEU A H    12 
ATOM 8901  H HA   . LEU A 1 11 ? -5.581  -6.123  -7.020  1.00 0.00 ? 11 LEU A HA   12 
ATOM 8902  H HB2  . LEU A 1 11 ? -7.684  -4.470  -8.407  1.00 0.00 ? 11 LEU A HB2  12 
ATOM 8903  H HB3  . LEU A 1 11 ? -6.284  -3.775  -7.612  1.00 0.00 ? 11 LEU A HB3  12 
ATOM 8904  H HG   . LEU A 1 11 ? -5.599  -5.861  -9.548  1.00 0.00 ? 11 LEU A HG   12 
ATOM 8905  H HD11 . LEU A 1 11 ? -5.972  -3.926  -11.360 1.00 0.00 ? 11 LEU A HD11 12 
ATOM 8906  H HD12 . LEU A 1 11 ? -7.371  -3.633  -10.326 1.00 0.00 ? 11 LEU A HD12 12 
ATOM 8907  H HD13 . LEU A 1 11 ? -7.139  -5.216  -11.067 1.00 0.00 ? 11 LEU A HD13 12 
ATOM 8908  H HD21 . LEU A 1 11 ? -4.209  -4.000  -8.294  1.00 0.00 ? 11 LEU A HD21 12 
ATOM 8909  H HD22 . LEU A 1 11 ? -4.674  -3.042  -9.699  1.00 0.00 ? 11 LEU A HD22 12 
ATOM 8910  H HD23 . LEU A 1 11 ? -3.773  -4.543  -9.914  1.00 0.00 ? 11 LEU A HD23 12 
ATOM 8911  N N    . CYS A 1 12 ? -6.559  -4.495  -5.156  1.00 0.00 ? 12 CYS A N    12 
ATOM 8912  C CA   . CYS A 1 12 ? -6.981  -4.042  -3.832  1.00 0.00 ? 12 CYS A CA   12 
ATOM 8913  C C    . CYS A 1 12 ? -8.420  -4.407  -3.508  1.00 0.00 ? 12 CYS A C    12 
ATOM 8914  O O    . CYS A 1 12 ? -9.277  -3.547  -3.304  1.00 0.00 ? 12 CYS A O    12 
ATOM 8915  C CB   . CYS A 1 12 ? -6.785  -2.543  -3.688  1.00 0.00 ? 12 CYS A CB   12 
ATOM 8916  S SG   . CYS A 1 12 ? -7.856  -1.525  -4.754  1.00 0.00 ? 12 CYS A SG   12 
ATOM 8917  H H    . CYS A 1 12 ? -5.761  -4.087  -5.552  1.00 0.00 ? 12 CYS A H    12 
ATOM 8918  H HA   . CYS A 1 12 ? -6.344  -4.534  -3.112  1.00 0.00 ? 12 CYS A HA   12 
ATOM 8919  H HB2  . CYS A 1 12 ? -6.985  -2.270  -2.665  1.00 0.00 ? 12 CYS A HB2  12 
ATOM 8920  H HB3  . CYS A 1 12 ? -5.760  -2.301  -3.922  1.00 0.00 ? 12 CYS A HB3  12 
ATOM 8921  N N    . ARG A 1 13 ? -8.652  -5.700  -3.435  1.00 0.00 ? 13 ARG A N    12 
ATOM 8922  C CA   . ARG A 1 13 ? -9.967  -6.229  -3.100  1.00 0.00 ? 13 ARG A CA   12 
ATOM 8923  C C    . ARG A 1 13 ? -10.030 -6.448  -1.600  1.00 0.00 ? 13 ARG A C    12 
ATOM 8924  O O    . ARG A 1 13 ? -10.510 -7.474  -1.118  1.00 0.00 ? 13 ARG A O    12 
ATOM 8925  C CB   . ARG A 1 13 ? -10.230 -7.542  -3.842  1.00 0.00 ? 13 ARG A CB   12 
ATOM 8926  C CG   . ARG A 1 13 ? -11.705 -7.882  -3.977  1.00 0.00 ? 13 ARG A CG   12 
ATOM 8927  C CD   . ARG A 1 13 ? -12.219 -7.595  -5.378  1.00 0.00 ? 13 ARG A CD   12 
ATOM 8928  N NE   . ARG A 1 13 ? -11.807 -6.277  -5.853  1.00 0.00 ? 13 ARG A NE   12 
ATOM 8929  C CZ   . ARG A 1 13 ? -12.200 -5.749  -7.011  1.00 0.00 ? 13 ARG A CZ   12 
ATOM 8930  N NH1  . ARG A 1 13 ? -13.014 -6.425  -7.813  1.00 0.00 ? 13 ARG A NH1  12 
ATOM 8931  N NH2  . ARG A 1 13 ? -11.780 -4.544  -7.366  1.00 0.00 ? 13 ARG A NH2  12 
ATOM 8932  H H    . ARG A 1 13 ? -7.902  -6.318  -3.591  1.00 0.00 ? 13 ARG A H    12 
ATOM 8933  H HA   . ARG A 1 13 ? -10.710 -5.498  -3.384  1.00 0.00 ? 13 ARG A HA   12 
ATOM 8934  H HB2  . ARG A 1 13 ? -9.806  -7.473  -4.834  1.00 0.00 ? 13 ARG A HB2  12 
ATOM 8935  H HB3  . ARG A 1 13 ? -9.744  -8.347  -3.310  1.00 0.00 ? 13 ARG A HB3  12 
ATOM 8936  H HG2  . ARG A 1 13 ? -11.844 -8.932  -3.762  1.00 0.00 ? 13 ARG A HG2  12 
ATOM 8937  H HG3  . ARG A 1 13 ? -12.266 -7.290  -3.269  1.00 0.00 ? 13 ARG A HG3  12 
ATOM 8938  H HD2  . ARG A 1 13 ? -11.833 -8.346  -6.050  1.00 0.00 ? 13 ARG A HD2  12 
ATOM 8939  H HD3  . ARG A 1 13 ? -13.299 -7.643  -5.369  1.00 0.00 ? 13 ARG A HD3  12 
ATOM 8940  H HE   . ARG A 1 13 ? -11.205 -5.756  -5.281  1.00 0.00 ? 13 ARG A HE   12 
ATOM 8941  H HH11 . ARG A 1 13 ? -13.335 -7.336  -7.550  1.00 0.00 ? 13 ARG A HH11 12 
ATOM 8942  H HH12 . ARG A 1 13 ? -13.306 -6.025  -8.681  1.00 0.00 ? 13 ARG A HH12 12 
ATOM 8943  H HH21 . ARG A 1 13 ? -11.168 -4.030  -6.765  1.00 0.00 ? 13 ARG A HH21 12 
ATOM 8944  H HH22 . ARG A 1 13 ? -12.075 -4.148  -8.236  1.00 0.00 ? 13 ARG A HH22 12 
ATOM 8945  N N    . CYS A 1 14 ? -9.494  -5.476  -0.873  1.00 0.00 ? 14 CYS A N    12 
ATOM 8946  C CA   . CYS A 1 14 ? -9.425  -5.538  0.573   1.00 0.00 ? 14 CYS A CA   12 
ATOM 8947  C C    . CYS A 1 14 ? -9.557  -4.148  1.187   1.00 0.00 ? 14 CYS A C    12 
ATOM 8948  O O    . CYS A 1 14 ? -8.707  -3.285  0.976   1.00 0.00 ? 14 CYS A O    12 
ATOM 8949  C CB   . CYS A 1 14 ? -8.091  -6.165  0.985   1.00 0.00 ? 14 CYS A CB   12 
ATOM 8950  S SG   . CYS A 1 14 ? -6.774  -6.028  -0.272  1.00 0.00 ? 14 CYS A SG   12 
ATOM 8951  H H    . CYS A 1 14 ? -9.105  -4.704  -1.327  1.00 0.00 ? 14 CYS A H    12 
ATOM 8952  H HA   . CYS A 1 14 ? -10.233 -6.161  0.924   1.00 0.00 ? 14 CYS A HA   12 
ATOM 8953  H HB2  . CYS A 1 14 ? -7.735  -5.682  1.879   1.00 0.00 ? 14 CYS A HB2  12 
ATOM 8954  H HB3  . CYS A 1 14 ? -8.244  -7.215  1.181   1.00 0.00 ? 14 CYS A HB3  12 
ATOM 8955  N N    . ASN A 1 15 ? -10.623 -3.943  1.949   1.00 0.00 ? 15 ASN A N    12 
ATOM 8956  C CA   . ASN A 1 15 ? -10.862 -2.657  2.599   1.00 0.00 ? 15 ASN A CA   12 
ATOM 8957  C C    . ASN A 1 15 ? -10.806 -2.800  4.096   1.00 0.00 ? 15 ASN A C    12 
ATOM 8958  O O    . ASN A 1 15 ? -10.349 -1.897  4.794   1.00 0.00 ? 15 ASN A O    12 
ATOM 8959  C CB   . ASN A 1 15 ? -12.223 -2.114  2.228   1.00 0.00 ? 15 ASN A CB   12 
ATOM 8960  C CG   . ASN A 1 15 ? -12.126 -0.779  1.517   1.00 0.00 ? 15 ASN A CG   12 
ATOM 8961  O OD1  . ASN A 1 15 ? -12.825 -0.531  0.534   1.00 0.00 ? 15 ASN A OD1  12 
ATOM 8962  N ND2  . ASN A 1 15 ? -11.251 0.088   2.019   1.00 0.00 ? 15 ASN A ND2  12 
ATOM 8963  H H    . ASN A 1 15 ? -11.264 -4.671  2.078   1.00 0.00 ? 15 ASN A H    12 
ATOM 8964  H HA   . ASN A 1 15 ? -10.099 -1.965  2.276   1.00 0.00 ? 15 ASN A HA   12 
ATOM 8965  H HB2  . ASN A 1 15 ? -12.706 -2.826  1.602   1.00 0.00 ? 15 ASN A HB2  12 
ATOM 8966  H HB3  . ASN A 1 15 ? -12.809 -1.979  3.125   1.00 0.00 ? 15 ASN A HB3  12 
ATOM 8967  H HD21 . ASN A 1 15 ? -10.729 -0.183  2.807   1.00 0.00 ? 15 ASN A HD21 12 
ATOM 8968  H HD22 . ASN A 1 15 ? -11.159 0.960   1.584   1.00 0.00 ? 15 ASN A HD22 12 
ATOM 8969  N N    . LYS A 1 16 ? -11.293 -3.930  4.585   1.00 0.00 ? 16 LYS A N    12 
ATOM 8970  C CA   . LYS A 1 16 ? -11.307 -4.198  6.017   1.00 0.00 ? 16 LYS A CA   12 
ATOM 8971  C C    . LYS A 1 16 ? -9.887  -4.212  6.570   1.00 0.00 ? 16 LYS A C    12 
ATOM 8972  O O    . LYS A 1 16 ? -9.471  -5.163  7.232   1.00 0.00 ? 16 LYS A O    12 
ATOM 8973  C CB   . LYS A 1 16 ? -12.000 -5.529  6.315   1.00 0.00 ? 16 LYS A CB   12 
ATOM 8974  C CG   . LYS A 1 16 ? -12.027 -5.878  7.796   1.00 0.00 ? 16 LYS A CG   12 
ATOM 8975  C CD   . LYS A 1 16 ? -13.445 -6.124  8.289   1.00 0.00 ? 16 LYS A CD   12 
ATOM 8976  C CE   . LYS A 1 16 ? -13.518 -7.334  9.206   1.00 0.00 ? 16 LYS A CE   12 
ATOM 8977  N NZ   . LYS A 1 16 ? -14.683 -8.205  8.886   1.00 0.00 ? 16 LYS A NZ   12 
ATOM 8978  H H    . LYS A 1 16 ? -11.662 -4.594  3.963   1.00 0.00 ? 16 LYS A H    12 
ATOM 8979  H HA   . LYS A 1 16 ? -11.855 -3.400  6.495   1.00 0.00 ? 16 LYS A HA   12 
ATOM 8980  H HB2  . LYS A 1 16 ? -13.018 -5.480  5.957   1.00 0.00 ? 16 LYS A HB2  12 
ATOM 8981  H HB3  . LYS A 1 16 ? -11.480 -6.318  5.791   1.00 0.00 ? 16 LYS A HB3  12 
ATOM 8982  H HG2  . LYS A 1 16 ? -11.441 -6.770  7.957   1.00 0.00 ? 16 LYS A HG2  12 
ATOM 8983  H HG3  . LYS A 1 16 ? -11.596 -5.059  8.356   1.00 0.00 ? 16 LYS A HG3  12 
ATOM 8984  H HD2  . LYS A 1 16 ? -13.782 -5.253  8.832   1.00 0.00 ? 16 LYS A HD2  12 
ATOM 8985  H HD3  . LYS A 1 16 ? -14.088 -6.289  7.437   1.00 0.00 ? 16 LYS A HD3  12 
ATOM 8986  H HE2  . LYS A 1 16 ? -12.611 -7.909  9.097   1.00 0.00 ? 16 LYS A HE2  12 
ATOM 8987  H HE3  . LYS A 1 16 ? -13.605 -6.992  10.227  1.00 0.00 ? 16 LYS A HE3  12 
ATOM 8988  H HZ1  . LYS A 1 16 ? -14.789 -8.295  7.855   1.00 0.00 ? 16 LYS A HZ1  12 
ATOM 8989  H HZ2  . LYS A 1 16 ? -15.555 -7.794  9.278   1.00 0.00 ? 16 LYS A HZ2  12 
ATOM 8990  H HZ3  . LYS A 1 16 ? -14.545 -9.151  9.294   1.00 0.00 ? 16 LYS A HZ3  12 
ATOM 8991  N N    . MET A 1 17 ? -9.151  -3.144  6.280   1.00 0.00 ? 17 MET A N    12 
ATOM 8992  C CA   . MET A 1 17 ? -7.768  -2.987  6.722   1.00 0.00 ? 17 MET A CA   12 
ATOM 8993  C C    . MET A 1 17 ? -7.543  -3.616  8.096   1.00 0.00 ? 17 MET A C    12 
ATOM 8994  O O    . MET A 1 17 ? -8.173  -3.230  9.081   1.00 0.00 ? 17 MET A O    12 
ATOM 8995  C CB   . MET A 1 17 ? -7.402  -1.501  6.750   1.00 0.00 ? 17 MET A CB   12 
ATOM 8996  C CG   . MET A 1 17 ? -8.320  -0.662  7.625   1.00 0.00 ? 17 MET A CG   12 
ATOM 8997  S SD   . MET A 1 17 ? -9.513  0.292   6.666   1.00 0.00 ? 17 MET A SD   12 
ATOM 8998  C CE   . MET A 1 17 ? -8.804  1.933   6.776   1.00 0.00 ? 17 MET A CE   12 
ATOM 8999  H H    . MET A 1 17 ? -9.558  -2.432  5.736   1.00 0.00 ? 17 MET A H    12 
ATOM 9000  H HA   . MET A 1 17 ? -7.135  -3.489  6.005   1.00 0.00 ? 17 MET A HA   12 
ATOM 9001  H HB2  . MET A 1 17 ? -6.394  -1.397  7.116   1.00 0.00 ? 17 MET A HB2  12 
ATOM 9002  H HB3  . MET A 1 17 ? -7.451  -1.114  5.742   1.00 0.00 ? 17 MET A HB3  12 
ATOM 9003  H HG2  . MET A 1 17 ? -8.860  -1.318  8.291   1.00 0.00 ? 17 MET A HG2  12 
ATOM 9004  H HG3  . MET A 1 17 ? -7.717  0.020   8.206   1.00 0.00 ? 17 MET A HG3  12 
ATOM 9005  H HE1  . MET A 1 17 ? -8.708  2.350   5.785   1.00 0.00 ? 17 MET A HE1  12 
ATOM 9006  H HE2  . MET A 1 17 ? -7.829  1.874   7.238   1.00 0.00 ? 17 MET A HE2  12 
ATOM 9007  H HE3  . MET A 1 17 ? -9.446  2.564   7.372   1.00 0.00 ? 17 MET A HE3  12 
ATOM 9008  N N    . LEU A 1 18 ? -6.643  -4.591  8.149   1.00 0.00 ? 18 LEU A N    12 
ATOM 9009  C CA   . LEU A 1 18 ? -6.338  -5.281  9.399   1.00 0.00 ? 18 LEU A CA   12 
ATOM 9010  C C    . LEU A 1 18 ? -5.381  -4.456  10.254  1.00 0.00 ? 18 LEU A C    12 
ATOM 9011  O O    . LEU A 1 18 ? -4.268  -4.887  10.559  1.00 0.00 ? 18 LEU A O    12 
ATOM 9012  C CB   . LEU A 1 18 ? -5.751  -6.679  9.136   1.00 0.00 ? 18 LEU A CB   12 
ATOM 9013  C CG   . LEU A 1 18 ? -5.142  -6.900  7.747   1.00 0.00 ? 18 LEU A CG   12 
ATOM 9014  C CD1  . LEU A 1 18 ? -4.129  -8.032  7.783   1.00 0.00 ? 18 LEU A CD1  12 
ATOM 9015  C CD2  . LEU A 1 18 ? -6.234  -7.192  6.726   1.00 0.00 ? 18 LEU A CD2  12 
ATOM 9016  H H    . LEU A 1 18 ? -6.180  -4.851  7.329   1.00 0.00 ? 18 LEU A H    12 
ATOM 9017  H HA   . LEU A 1 18 ? -7.266  -5.393  9.941   1.00 0.00 ? 18 LEU A HA   12 
ATOM 9018  H HB2  . LEU A 1 18 ? -4.983  -6.866  9.872   1.00 0.00 ? 18 LEU A HB2  12 
ATOM 9019  H HB3  . LEU A 1 18 ? -6.539  -7.405  9.275   1.00 0.00 ? 18 LEU A HB3  12 
ATOM 9020  H HG   . LEU A 1 18 ? -4.626  -6.003  7.439   1.00 0.00 ? 18 LEU A HG   12 
ATOM 9021  H HD11 . LEU A 1 18 ? -3.245  -7.706  8.310   1.00 0.00 ? 18 LEU A HD11 12 
ATOM 9022  H HD12 . LEU A 1 18 ? -3.864  -8.310  6.774   1.00 0.00 ? 18 LEU A HD12 12 
ATOM 9023  H HD13 . LEU A 1 18 ? -4.558  -8.883  8.291   1.00 0.00 ? 18 LEU A HD13 12 
ATOM 9024  H HD21 . LEU A 1 18 ? -6.486  -8.242  6.759   1.00 0.00 ? 18 LEU A HD21 12 
ATOM 9025  H HD22 . LEU A 1 18 ? -5.880  -6.936  5.738   1.00 0.00 ? 18 LEU A HD22 12 
ATOM 9026  H HD23 . LEU A 1 18 ? -7.110  -6.605  6.958   1.00 0.00 ? 18 LEU A HD23 12 
ATOM 9027  N N    . GLY A 1 19 ? -5.832  -3.266  10.641  1.00 0.00 ? 19 GLY A N    12 
ATOM 9028  C CA   . GLY A 1 19 ? -5.018  -2.385  11.466  1.00 0.00 ? 19 GLY A CA   12 
ATOM 9029  C C    . GLY A 1 19 ? -3.585  -2.267  10.978  1.00 0.00 ? 19 GLY A C    12 
ATOM 9030  O O    . GLY A 1 19 ? -2.670  -2.055  11.773  1.00 0.00 ? 19 GLY A O    12 
ATOM 9031  H H    . GLY A 1 19 ? -6.731  -2.984  10.369  1.00 0.00 ? 19 GLY A H    12 
ATOM 9032  H HA2  . GLY A 1 19 ? -5.465  -1.403  11.469  1.00 0.00 ? 19 GLY A HA2  12 
ATOM 9033  H HA3  . GLY A 1 19 ? -5.011  -2.766  12.477  1.00 0.00 ? 19 GLY A HA3  12 
ATOM 9034  N N    . ASP A 1 20 ? -3.389  -2.407  9.671   1.00 0.00 ? 20 ASP A N    12 
ATOM 9035  C CA   . ASP A 1 20 ? -2.060  -2.316  9.084   1.00 0.00 ? 20 ASP A CA   12 
ATOM 9036  C C    . ASP A 1 20 ? -1.583  -0.868  9.033   1.00 0.00 ? 20 ASP A C    12 
ATOM 9037  O O    . ASP A 1 20 ? -2.328  0.056   9.358   1.00 0.00 ? 20 ASP A O    12 
ATOM 9038  C CB   . ASP A 1 20 ? -2.058  -2.910  7.675   1.00 0.00 ? 20 ASP A CB   12 
ATOM 9039  C CG   . ASP A 1 20 ? -2.988  -4.100  7.535   1.00 0.00 ? 20 ASP A CG   12 
ATOM 9040  O OD1  . ASP A 1 20 ? -2.655  -5.180  8.066   1.00 0.00 ? 20 ASP A OD1  12 
ATOM 9041  O OD2  . ASP A 1 20 ? -4.050  -3.949  6.895   1.00 0.00 ? 20 ASP A OD2  12 
ATOM 9042  H H    . ASP A 1 20 ? -4.154  -2.576  9.086   1.00 0.00 ? 20 ASP A H    12 
ATOM 9043  H HA   . ASP A 1 20 ? -1.382  -2.882  9.705   1.00 0.00 ? 20 ASP A HA   12 
ATOM 9044  H HB2  . ASP A 1 20 ? -2.366  -2.152  6.971   1.00 0.00 ? 20 ASP A HB2  12 
ATOM 9045  H HB3  . ASP A 1 20 ? -1.060  -3.230  7.434   1.00 0.00 ? 20 ASP A HB3  12 
ATOM 9046  N N    . LEU A 1 21 ? -0.335  -0.683  8.618   1.00 0.00 ? 21 LEU A N    12 
ATOM 9047  C CA   . LEU A 1 21 ? 0.249   0.649   8.516   1.00 0.00 ? 21 LEU A CA   12 
ATOM 9048  C C    . LEU A 1 21 ? 1.452   0.641   7.581   1.00 0.00 ? 21 LEU A C    12 
ATOM 9049  O O    . LEU A 1 21 ? 2.578   0.392   8.003   1.00 0.00 ? 21 LEU A O    12 
ATOM 9050  C CB   . LEU A 1 21 ? 0.665   1.156   9.897   1.00 0.00 ? 21 LEU A CB   12 
ATOM 9051  C CG   . LEU A 1 21 ? 1.432   2.482   9.899   1.00 0.00 ? 21 LEU A CG   12 
ATOM 9052  C CD1  . LEU A 1 21 ? 0.747   3.498   8.997   1.00 0.00 ? 21 LEU A CD1  12 
ATOM 9053  C CD2  . LEU A 1 21 ? 1.556   3.020   11.316  1.00 0.00 ? 21 LEU A CD2  12 
ATOM 9054  H H    . LEU A 1 21 ? 0.205   -1.461  8.371   1.00 0.00 ? 21 LEU A H    12 
ATOM 9055  H HA   . LEU A 1 21 ? -0.503  1.310   8.112   1.00 0.00 ? 21 LEU A HA   12 
ATOM 9056  H HB2  . LEU A 1 21 ? -0.225  1.279   10.497  1.00 0.00 ? 21 LEU A HB2  12 
ATOM 9057  H HB3  . LEU A 1 21 ? 1.289   0.406   10.360  1.00 0.00 ? 21 LEU A HB3  12 
ATOM 9058  H HG   . LEU A 1 21 ? 2.428   2.314   9.516   1.00 0.00 ? 21 LEU A HG   12 
ATOM 9059  H HD11 . LEU A 1 21 ? -0.279  3.200   8.832   1.00 0.00 ? 21 LEU A HD11 12 
ATOM 9060  H HD12 . LEU A 1 21 ? 1.263   3.544   8.048   1.00 0.00 ? 21 LEU A HD12 12 
ATOM 9061  H HD13 . LEU A 1 21 ? 0.767   4.470   9.465   1.00 0.00 ? 21 LEU A HD13 12 
ATOM 9062  H HD21 . LEU A 1 21 ? 2.494   2.697   11.743  1.00 0.00 ? 21 LEU A HD21 12 
ATOM 9063  H HD22 . LEU A 1 21 ? 0.739   2.646   11.915  1.00 0.00 ? 21 LEU A HD22 12 
ATOM 9064  H HD23 . LEU A 1 21 ? 1.523   4.099   11.295  1.00 0.00 ? 21 LEU A HD23 12 
ATOM 9065  N N    . ILE A 1 22 ? 1.202   0.912   6.306   1.00 0.00 ? 22 ILE A N    12 
ATOM 9066  C CA   . ILE A 1 22 ? 2.259   0.930   5.304   1.00 0.00 ? 22 ILE A CA   12 
ATOM 9067  C C    . ILE A 1 22 ? 2.771   2.342   5.053   1.00 0.00 ? 22 ILE A C    12 
ATOM 9068  O O    . ILE A 1 22 ? 2.005   3.304   5.066   1.00 0.00 ? 22 ILE A O    12 
ATOM 9069  C CB   . ILE A 1 22 ? 1.772   0.331   3.966   1.00 0.00 ? 22 ILE A CB   12 
ATOM 9070  C CG1  . ILE A 1 22 ? 2.778   0.596   2.851   1.00 0.00 ? 22 ILE A CG1  12 
ATOM 9071  C CG2  . ILE A 1 22 ? 0.415   0.895   3.588   1.00 0.00 ? 22 ILE A CG2  12 
ATOM 9072  C CD1  . ILE A 1 22 ? 2.459   1.820   2.012   1.00 0.00 ? 22 ILE A CD1  12 
ATOM 9073  H H    . ILE A 1 22 ? 0.281   1.099   6.030   1.00 0.00 ? 22 ILE A H    12 
ATOM 9074  H HA   . ILE A 1 22 ? 3.073   0.324   5.668   1.00 0.00 ? 22 ILE A HA   12 
ATOM 9075  H HB   . ILE A 1 22 ? 1.672   -0.730  4.093   1.00 0.00 ? 22 ILE A HB   12 
ATOM 9076  H HG12 . ILE A 1 22 ? 3.754   0.738   3.288   1.00 0.00 ? 22 ILE A HG12 12 
ATOM 9077  H HG13 . ILE A 1 22 ? 2.804   -0.260  2.193   1.00 0.00 ? 22 ILE A HG13 12 
ATOM 9078  H HG21 . ILE A 1 22 ? 0.383   1.946   3.837   1.00 0.00 ? 22 ILE A HG21 12 
ATOM 9079  H HG22 . ILE A 1 22 ? -0.356  0.371   4.127   1.00 0.00 ? 22 ILE A HG22 12 
ATOM 9080  H HG23 . ILE A 1 22 ? 0.263   0.774   2.527   1.00 0.00 ? 22 ILE A HG23 12 
ATOM 9081  H HD11 . ILE A 1 22 ? 3.301   2.052   1.382   1.00 0.00 ? 22 ILE A HD11 12 
ATOM 9082  H HD12 . ILE A 1 22 ? 2.252   2.657   2.661   1.00 0.00 ? 22 ILE A HD12 12 
ATOM 9083  H HD13 . ILE A 1 22 ? 1.593   1.620   1.398   1.00 0.00 ? 22 ILE A HD13 12 
ATOM 9084  N N    . CYS A 1 23 ? 4.069   2.448   4.788   1.00 0.00 ? 23 CYS A N    12 
ATOM 9085  C CA   . CYS A 1 23 ? 4.683   3.736   4.492   1.00 0.00 ? 23 CYS A CA   12 
ATOM 9086  C C    . CYS A 1 23 ? 5.074   3.782   3.023   1.00 0.00 ? 23 CYS A C    12 
ATOM 9087  O O    . CYS A 1 23 ? 6.214   3.487   2.663   1.00 0.00 ? 23 CYS A O    12 
ATOM 9088  C CB   . CYS A 1 23 ? 5.911   3.976   5.370   1.00 0.00 ? 23 CYS A CB   12 
ATOM 9089  S SG   . CYS A 1 23 ? 6.534   5.690   5.308   1.00 0.00 ? 23 CYS A SG   12 
ATOM 9090  H H    . CYS A 1 23 ? 4.623   1.635   4.765   1.00 0.00 ? 23 CYS A H    12 
ATOM 9091  H HA   . CYS A 1 23 ? 3.950   4.506   4.683   1.00 0.00 ? 23 CYS A HA   12 
ATOM 9092  H HB2  . CYS A 1 23 ? 5.660   3.752   6.395   1.00 0.00 ? 23 CYS A HB2  12 
ATOM 9093  H HB3  . CYS A 1 23 ? 6.707   3.323   5.047   1.00 0.00 ? 23 CYS A HB3  12 
ATOM 9094  N N    . ALA A 1 24 ? 4.113   4.126   2.177   1.00 0.00 ? 24 ALA A N    12 
ATOM 9095  C CA   . ALA A 1 24 ? 4.348   4.180   0.741   1.00 0.00 ? 24 ALA A CA   12 
ATOM 9096  C C    . ALA A 1 24 ? 5.055   5.458   0.329   1.00 0.00 ? 24 ALA A C    12 
ATOM 9097  O O    . ALA A 1 24 ? 4.686   6.554   0.746   1.00 0.00 ? 24 ALA A O    12 
ATOM 9098  C CB   . ALA A 1 24 ? 3.041   4.041   -0.016  1.00 0.00 ? 24 ALA A CB   12 
ATOM 9099  H H    . ALA A 1 24 ? 3.219   4.329   2.524   1.00 0.00 ? 24 ALA A H    12 
ATOM 9100  H HA   . ALA A 1 24 ? 4.971   3.338   0.482   1.00 0.00 ? 24 ALA A HA   12 
ATOM 9101  H HB1  . ALA A 1 24 ? 2.817   4.967   -0.527  1.00 0.00 ? 24 ALA A HB1  12 
ATOM 9102  H HB2  . ALA A 1 24 ? 2.252   3.816   0.680   1.00 0.00 ? 24 ALA A HB2  12 
ATOM 9103  H HB3  . ALA A 1 24 ? 3.125   3.243   -0.737  1.00 0.00 ? 24 ALA A HB3  12 
ATOM 9104  N N    . VAL A 1 25 ? 6.069   5.298   -0.508  1.00 0.00 ? 25 VAL A N    12 
ATOM 9105  C CA   . VAL A 1 25 ? 6.838   6.419   -1.006  1.00 0.00 ? 25 VAL A CA   12 
ATOM 9106  C C    . VAL A 1 25 ? 6.924   6.387   -2.527  1.00 0.00 ? 25 VAL A C    12 
ATOM 9107  O O    . VAL A 1 25 ? 6.943   5.311   -3.145  1.00 0.00 ? 25 VAL A O    12 
ATOM 9108  C CB   . VAL A 1 25 ? 8.256   6.437   -0.403  1.00 0.00 ? 25 VAL A CB   12 
ATOM 9109  C CG1  . VAL A 1 25 ? 9.093   5.284   -0.937  1.00 0.00 ? 25 VAL A CG1  12 
ATOM 9110  C CG2  . VAL A 1 25 ? 8.936   7.771   -0.674  1.00 0.00 ? 25 VAL A CG2  12 
ATOM 9111  H H    . VAL A 1 25 ? 6.301   4.397   -0.803  1.00 0.00 ? 25 VAL A H    12 
ATOM 9112  H HA   . VAL A 1 25 ? 6.334   7.325   -0.707  1.00 0.00 ? 25 VAL A HA   12 
ATOM 9113  H HB   . VAL A 1 25 ? 8.165   6.315   0.663   1.00 0.00 ? 25 VAL A HB   12 
ATOM 9114  H HG11 . VAL A 1 25 ? 9.959   5.146   -0.306  1.00 0.00 ? 25 VAL A HG11 12 
ATOM 9115  H HG12 . VAL A 1 25 ? 9.412   5.506   -1.944  1.00 0.00 ? 25 VAL A HG12 12 
ATOM 9116  H HG13 . VAL A 1 25 ? 8.502   4.380   -0.938  1.00 0.00 ? 25 VAL A HG13 12 
ATOM 9117  H HG21 . VAL A 1 25 ? 9.171   7.849   -1.725  1.00 0.00 ? 25 VAL A HG21 12 
ATOM 9118  H HG22 . VAL A 1 25 ? 9.847   7.833   -0.096  1.00 0.00 ? 25 VAL A HG22 12 
ATOM 9119  H HG23 . VAL A 1 25 ? 8.275   8.576   -0.391  1.00 0.00 ? 25 VAL A HG23 12 
ATOM 9120  N N    . ILE A 1 26 ? 6.967   7.577   -3.115  1.00 0.00 ? 26 ILE A N    12 
ATOM 9121  C CA   . ILE A 1 26 ? 7.047   7.727   -4.562  1.00 0.00 ? 26 ILE A CA   12 
ATOM 9122  C C    . ILE A 1 26 ? 8.193   8.657   -4.942  1.00 0.00 ? 26 ILE A C    12 
ATOM 9123  O O    . ILE A 1 26 ? 8.009   9.865   -5.082  1.00 0.00 ? 26 ILE A O    12 
ATOM 9124  C CB   . ILE A 1 26 ? 5.738   8.280   -5.171  1.00 0.00 ? 26 ILE A CB   12 
ATOM 9125  C CG1  . ILE A 1 26 ? 4.867   8.949   -4.095  1.00 0.00 ? 26 ILE A CG1  12 
ATOM 9126  C CG2  . ILE A 1 26 ? 4.973   7.179   -5.894  1.00 0.00 ? 26 ILE A CG2  12 
ATOM 9127  C CD1  . ILE A 1 26 ? 4.141   7.978   -3.182  1.00 0.00 ? 26 ILE A CD1  12 
ATOM 9128  H H    . ILE A 1 26 ? 6.941   8.380   -2.554  1.00 0.00 ? 26 ILE A H    12 
ATOM 9129  H HA   . ILE A 1 26 ? 7.235   6.751   -4.987  1.00 0.00 ? 26 ILE A HA   12 
ATOM 9130  H HB   . ILE A 1 26 ? 6.011   9.022   -5.907  1.00 0.00 ? 26 ILE A HB   12 
ATOM 9131  H HG12 . ILE A 1 26 ? 5.492   9.572   -3.475  1.00 0.00 ? 26 ILE A HG12 12 
ATOM 9132  H HG13 . ILE A 1 26 ? 4.123   9.566   -4.579  1.00 0.00 ? 26 ILE A HG13 12 
ATOM 9133  H HG21 . ILE A 1 26 ? 4.024   7.015   -5.405  1.00 0.00 ? 26 ILE A HG21 12 
ATOM 9134  H HG22 . ILE A 1 26 ? 5.549   6.265   -5.874  1.00 0.00 ? 26 ILE A HG22 12 
ATOM 9135  H HG23 . ILE A 1 26 ? 4.803   7.473   -6.919  1.00 0.00 ? 26 ILE A HG23 12 
ATOM 9136  H HD11 . ILE A 1 26 ? 3.274   8.462   -2.760  1.00 0.00 ? 26 ILE A HD11 12 
ATOM 9137  H HD12 . ILE A 1 26 ? 4.802   7.668   -2.387  1.00 0.00 ? 26 ILE A HD12 12 
ATOM 9138  H HD13 . ILE A 1 26 ? 3.829   7.114   -3.749  1.00 0.00 ? 26 ILE A HD13 12 
ATOM 9139  N N    . GLY A 1 27 ? 9.377   8.083   -5.094  1.00 0.00 ? 27 GLY A N    12 
ATOM 9140  C CA   . GLY A 1 27 ? 10.552  8.856   -5.448  1.00 0.00 ? 27 GLY A CA   12 
ATOM 9141  C C    . GLY A 1 27 ? 11.034  9.707   -4.298  1.00 0.00 ? 27 GLY A C    12 
ATOM 9142  O O    . GLY A 1 27 ? 12.174  9.580   -3.848  1.00 0.00 ? 27 GLY A O    12 
ATOM 9143  H H    . GLY A 1 27 ? 9.453   7.126   -4.954  1.00 0.00 ? 27 GLY A H    12 
ATOM 9144  H HA2  . GLY A 1 27 ? 11.342  8.179   -5.741  1.00 0.00 ? 27 GLY A HA2  12 
ATOM 9145  H HA3  . GLY A 1 27 ? 10.312  9.498   -6.283  1.00 0.00 ? 27 GLY A HA3  12 
ATOM 9146  N N    . ASP A 1 28 ? 10.154  10.571  -3.818  1.00 0.00 ? 28 ASP A N    12 
ATOM 9147  C CA   . ASP A 1 28 ? 10.468  11.453  -2.704  1.00 0.00 ? 28 ASP A CA   12 
ATOM 9148  C C    . ASP A 1 28 ? 9.195   11.884  -1.984  1.00 0.00 ? 28 ASP A C    12 
ATOM 9149  O O    . ASP A 1 28 ? 9.172   12.913  -1.309  1.00 0.00 ? 28 ASP A O    12 
ATOM 9150  C CB   . ASP A 1 28 ? 11.233  12.681  -3.197  1.00 0.00 ? 28 ASP A CB   12 
ATOM 9151  C CG   . ASP A 1 28 ? 10.426  13.510  -4.178  1.00 0.00 ? 28 ASP A CG   12 
ATOM 9152  O OD1  . ASP A 1 28 ? 9.760   12.914  -5.049  1.00 0.00 ? 28 ASP A OD1  12 
ATOM 9153  O OD2  . ASP A 1 28 ? 10.462  14.754  -4.073  1.00 0.00 ? 28 ASP A OD2  12 
ATOM 9154  H H    . ASP A 1 28 ? 9.265   10.612  -4.221  1.00 0.00 ? 28 ASP A H    12 
ATOM 9155  H HA   . ASP A 1 28 ? 11.088  10.905  -2.013  1.00 0.00 ? 28 ASP A HA   12 
ATOM 9156  H HB2  . ASP A 1 28 ? 11.485  13.305  -2.351  1.00 0.00 ? 28 ASP A HB2  12 
ATOM 9157  H HB3  . ASP A 1 28 ? 12.142  12.360  -3.685  1.00 0.00 ? 28 ASP A HB3  12 
ATOM 9158  N N    . ALA A 1 29 ? 8.135   11.090  -2.130  1.00 0.00 ? 29 ALA A N    12 
ATOM 9159  C CA   . ALA A 1 29 ? 6.863   11.401  -1.487  1.00 0.00 ? 29 ALA A CA   12 
ATOM 9160  C C    . ALA A 1 29 ? 6.361   10.214  -0.674  1.00 0.00 ? 29 ALA A C    12 
ATOM 9161  O O    . ALA A 1 29 ? 5.643   9.356   -1.187  1.00 0.00 ? 29 ALA A O    12 
ATOM 9162  C CB   . ALA A 1 29 ? 5.829   11.811  -2.527  1.00 0.00 ? 29 ALA A CB   12 
ATOM 9163  H H    . ALA A 1 29 ? 8.212   10.277  -2.683  1.00 0.00 ? 29 ALA A H    12 
ATOM 9164  H HA   . ALA A 1 29 ? 7.020   12.238  -0.822  1.00 0.00 ? 29 ALA A HA   12 
ATOM 9165  H HB1  . ALA A 1 29 ? 5.746   12.888  -2.546  1.00 0.00 ? 29 ALA A HB1  12 
ATOM 9166  H HB2  . ALA A 1 29 ? 4.872   11.381  -2.274  1.00 0.00 ? 29 ALA A HB2  12 
ATOM 9167  H HB3  . ALA A 1 29 ? 6.138   11.457  -3.499  1.00 0.00 ? 29 ALA A HB3  12 
ATOM 9168  N N    . LYS A 1 30 ? 6.748   10.168  0.598   1.00 0.00 ? 30 LYS A N    12 
ATOM 9169  C CA   . LYS A 1 30 ? 6.344   9.080   1.479   1.00 0.00 ? 30 LYS A CA   12 
ATOM 9170  C C    . LYS A 1 30 ? 5.128   9.459   2.320   1.00 0.00 ? 30 LYS A C    12 
ATOM 9171  O O    . LYS A 1 30 ? 4.957   10.616  2.703   1.00 0.00 ? 30 LYS A O    12 
ATOM 9172  C CB   . LYS A 1 30 ? 7.504   8.674   2.390   1.00 0.00 ? 30 LYS A CB   12 
ATOM 9173  C CG   . LYS A 1 30 ? 7.897   9.743   3.395   1.00 0.00 ? 30 LYS A CG   12 
ATOM 9174  C CD   . LYS A 1 30 ? 9.284   9.490   3.964   1.00 0.00 ? 30 LYS A CD   12 
ATOM 9175  C CE   . LYS A 1 30 ? 9.360   8.147   4.672   1.00 0.00 ? 30 LYS A CE   12 
ATOM 9176  N NZ   . LYS A 1 30 ? 10.230  8.201   5.879   1.00 0.00 ? 30 LYS A NZ   12 
ATOM 9177  H H    . LYS A 1 30 ? 7.325   10.879  0.949   1.00 0.00 ? 30 LYS A H    12 
ATOM 9178  H HA   . LYS A 1 30 ? 6.082   8.240   0.857   1.00 0.00 ? 30 LYS A HA   12 
ATOM 9179  H HB2  . LYS A 1 30 ? 7.225   7.784   2.935   1.00 0.00 ? 30 LYS A HB2  12 
ATOM 9180  H HB3  . LYS A 1 30 ? 8.366   8.453   1.777   1.00 0.00 ? 30 LYS A HB3  12 
ATOM 9181  H HG2  . LYS A 1 30 ? 7.890   10.705  2.906   1.00 0.00 ? 30 LYS A HG2  12 
ATOM 9182  H HG3  . LYS A 1 30 ? 7.181   9.743   4.205   1.00 0.00 ? 30 LYS A HG3  12 
ATOM 9183  H HD2  . LYS A 1 30 ? 10.001  9.499   3.156   1.00 0.00 ? 30 LYS A HD2  12 
ATOM 9184  H HD3  . LYS A 1 30 ? 9.523   10.272  4.669   1.00 0.00 ? 30 LYS A HD3  12 
ATOM 9185  H HE2  . LYS A 1 30 ? 8.364   7.855   4.972   1.00 0.00 ? 30 LYS A HE2  12 
ATOM 9186  H HE3  . LYS A 1 30 ? 9.757   7.413   3.985   1.00 0.00 ? 30 LYS A HE3  12 
ATOM 9187  H HZ1  . LYS A 1 30 ? 9.844   8.876   6.568   1.00 0.00 ? 30 LYS A HZ1  12 
ATOM 9188  H HZ2  . LYS A 1 30 ? 11.189  8.505   5.614   1.00 0.00 ? 30 LYS A HZ2  12 
ATOM 9189  H HZ3  . LYS A 1 30 ? 10.287  7.263   6.322   1.00 0.00 ? 30 LYS A HZ3  12 
ATOM 9190  N N    . GLU A 1 31 ? 4.291   8.465   2.605   1.00 0.00 ? 31 GLU A N    12 
ATOM 9191  C CA   . GLU A 1 31 ? 3.088   8.671   3.406   1.00 0.00 ? 31 GLU A CA   12 
ATOM 9192  C C    . GLU A 1 31 ? 2.637   7.357   4.035   1.00 0.00 ? 31 GLU A C    12 
ATOM 9193  O O    . GLU A 1 31 ? 3.084   6.283   3.631   1.00 0.00 ? 31 GLU A O    12 
ATOM 9194  C CB   . GLU A 1 31 ? 1.965   9.249   2.541   1.00 0.00 ? 31 GLU A CB   12 
ATOM 9195  C CG   . GLU A 1 31 ? 2.241   10.660  2.049   1.00 0.00 ? 31 GLU A CG   12 
ATOM 9196  C CD   . GLU A 1 31 ? 1.085   11.237  1.257   1.00 0.00 ? 31 GLU A CD   12 
ATOM 9197  O OE1  . GLU A 1 31 ? 0.792   10.709  0.163   1.00 0.00 ? 31 GLU A OE1  12 
ATOM 9198  O OE2  . GLU A 1 31 ? 0.472   12.217  1.730   1.00 0.00 ? 31 GLU A OE2  12 
ATOM 9199  H H    . GLU A 1 31 ? 4.491   7.567   2.271   1.00 0.00 ? 31 GLU A H    12 
ATOM 9200  H HA   . GLU A 1 31 ? 3.325   9.372   4.191   1.00 0.00 ? 31 GLU A HA   12 
ATOM 9201  H HB2  . GLU A 1 31 ? 1.824   8.612   1.680   1.00 0.00 ? 31 GLU A HB2  12 
ATOM 9202  H HB3  . GLU A 1 31 ? 1.053   9.263   3.118   1.00 0.00 ? 31 GLU A HB3  12 
ATOM 9203  H HG2  . GLU A 1 31 ? 2.426   11.295  2.902   1.00 0.00 ? 31 GLU A HG2  12 
ATOM 9204  H HG3  . GLU A 1 31 ? 3.119   10.642  1.418   1.00 0.00 ? 31 GLU A HG3  12 
ATOM 9205  N N    . GLU A 1 32 ? 1.754   7.439   5.027   1.00 0.00 ? 32 GLU A N    12 
ATOM 9206  C CA   . GLU A 1 32 ? 1.260   6.242   5.700   1.00 0.00 ? 32 GLU A CA   12 
ATOM 9207  C C    . GLU A 1 32 ? -0.151  5.895   5.257   1.00 0.00 ? 32 GLU A C    12 
ATOM 9208  O O    . GLU A 1 32 ? -0.986  6.774   5.046   1.00 0.00 ? 32 GLU A O    12 
ATOM 9209  C CB   . GLU A 1 32 ? 1.278   6.415   7.217   1.00 0.00 ? 32 GLU A CB   12 
ATOM 9210  C CG   . GLU A 1 32 ? 2.566   5.939   7.870   1.00 0.00 ? 32 GLU A CG   12 
ATOM 9211  C CD   . GLU A 1 32 ? 2.578   6.164   9.370   1.00 0.00 ? 32 GLU A CD   12 
ATOM 9212  O OE1  . GLU A 1 32 ? 1.643   6.813   9.883   1.00 0.00 ? 32 GLU A OE1  12 
ATOM 9213  O OE2  . GLU A 1 32 ? 3.524   5.689   10.033  1.00 0.00 ? 32 GLU A OE2  12 
ATOM 9214  H H    . GLU A 1 32 ? 1.431   8.320   5.312   1.00 0.00 ? 32 GLU A H    12 
ATOM 9215  H HA   . GLU A 1 32 ? 1.916   5.426   5.437   1.00 0.00 ? 32 GLU A HA   12 
ATOM 9216  H HB2  . GLU A 1 32 ? 1.140   7.460   7.450   1.00 0.00 ? 32 GLU A HB2  12 
ATOM 9217  H HB3  . GLU A 1 32 ? 0.456   5.851   7.638   1.00 0.00 ? 32 GLU A HB3  12 
ATOM 9218  H HG2  . GLU A 1 32 ? 2.679   4.882   7.681   1.00 0.00 ? 32 GLU A HG2  12 
ATOM 9219  H HG3  . GLU A 1 32 ? 3.396   6.471   7.432   1.00 0.00 ? 32 GLU A HG3  12 
ATOM 9220  N N    . HIS A 1 33 ? -0.409  4.601   5.136   1.00 0.00 ? 33 HIS A N    12 
ATOM 9221  C CA   . HIS A 1 33 ? -1.724  4.119   4.736   1.00 0.00 ? 33 HIS A CA   12 
ATOM 9222  C C    . HIS A 1 33 ? -2.014  2.762   5.369   1.00 0.00 ? 33 HIS A C    12 
ATOM 9223  O O    . HIS A 1 33 ? -1.133  1.917   5.479   1.00 0.00 ? 33 HIS A O    12 
ATOM 9224  C CB   . HIS A 1 33 ? -1.823  4.012   3.212   1.00 0.00 ? 33 HIS A CB   12 
ATOM 9225  C CG   . HIS A 1 33 ? -0.846  4.877   2.479   1.00 0.00 ? 33 HIS A CG   12 
ATOM 9226  N ND1  . HIS A 1 33 ? 0.519   4.726   2.584   1.00 0.00 ? 33 HIS A ND1  12 
ATOM 9227  C CD2  . HIS A 1 33 ? -1.041  5.898   1.615   1.00 0.00 ? 33 HIS A CD2  12 
ATOM 9228  C CE1  . HIS A 1 33 ? 1.118   5.615   1.815   1.00 0.00 ? 33 HIS A CE1  12 
ATOM 9229  N NE2  . HIS A 1 33 ? 0.195   6.339   1.217   1.00 0.00 ? 33 HIS A NE2  12 
ATOM 9230  H H    . HIS A 1 33 ? 0.304   3.955   5.327   1.00 0.00 ? 33 HIS A H    12 
ATOM 9231  H HA   . HIS A 1 33 ? -2.458  4.829   5.087   1.00 0.00 ? 33 HIS A HA   12 
ATOM 9232  H HB2  . HIS A 1 33 ? -1.643  2.990   2.917   1.00 0.00 ? 33 HIS A HB2  12 
ATOM 9233  H HB3  . HIS A 1 33 ? -2.818  4.300   2.903   1.00 0.00 ? 33 HIS A HB3  12 
ATOM 9234  H HD1  . HIS A 1 33 ? 0.981   4.066   3.144   1.00 0.00 ? 33 HIS A HD1  12 
ATOM 9235  H HD2  . HIS A 1 33 ? -1.992  6.281   1.286   1.00 0.00 ? 33 HIS A HD2  12 
ATOM 9236  H HE1  . HIS A 1 33 ? 2.181   5.709   1.672   1.00 0.00 ? 33 HIS A HE1  12 
ATOM 9237  H HE2  . HIS A 1 33 ? 0.366   7.106   0.630   1.00 0.00 ? 33 HIS A HE2  12 
ATOM 9238  N N    . ARG A 1 34 ? -3.256  2.563   5.786   1.00 0.00 ? 34 ARG A N    12 
ATOM 9239  C CA   . ARG A 1 34 ? -3.659  1.305   6.411   1.00 0.00 ? 34 ARG A CA   12 
ATOM 9240  C C    . ARG A 1 34 ? -3.912  0.225   5.364   1.00 0.00 ? 34 ARG A C    12 
ATOM 9241  O O    . ARG A 1 34 ? -3.359  -0.871  5.444   1.00 0.00 ? 34 ARG A O    12 
ATOM 9242  C CB   . ARG A 1 34 ? -4.921  1.498   7.240   1.00 0.00 ? 34 ARG A CB   12 
ATOM 9243  C CG   . ARG A 1 34 ? -4.653  1.762   8.713   1.00 0.00 ? 34 ARG A CG   12 
ATOM 9244  C CD   . ARG A 1 34 ? -5.010  0.556   9.567   1.00 0.00 ? 34 ARG A CD   12 
ATOM 9245  N NE   . ARG A 1 34 ? -4.589  0.722   10.957  1.00 0.00 ? 34 ARG A NE   12 
ATOM 9246  C CZ   . ARG A 1 34 ? -5.300  1.373   11.875  1.00 0.00 ? 34 ARG A CZ   12 
ATOM 9247  N NH1  . ARG A 1 34 ? -6.464  1.926   11.557  1.00 0.00 ? 34 ARG A NH1  12 
ATOM 9248  N NH2  . ARG A 1 34 ? -4.846  1.471   13.116  1.00 0.00 ? 34 ARG A NH2  12 
ATOM 9249  H H    . ARG A 1 34 ? -3.913  3.281   5.679   1.00 0.00 ? 34 ARG A H    12 
ATOM 9250  H HA   . ARG A 1 34 ? -2.857  0.983   7.059   1.00 0.00 ? 34 ARG A HA   12 
ATOM 9251  H HB2  . ARG A 1 34 ? -5.471  2.332   6.838   1.00 0.00 ? 34 ARG A HB2  12 
ATOM 9252  H HB3  . ARG A 1 34 ? -5.524  0.605   7.160   1.00 0.00 ? 34 ARG A HB3  12 
ATOM 9253  H HG2  . ARG A 1 34 ? -3.605  1.986   8.845   1.00 0.00 ? 34 ARG A HG2  12 
ATOM 9254  H HG3  . ARG A 1 34 ? -5.247  2.607   9.032   1.00 0.00 ? 34 ARG A HG3  12 
ATOM 9255  H HD2  . ARG A 1 34 ? -6.080  0.414   9.539   1.00 0.00 ? 34 ARG A HD2  12 
ATOM 9256  H HD3  . ARG A 1 34 ? -4.523  -0.316  9.155   1.00 0.00 ? 34 ARG A HD3  12 
ATOM 9257  H HE   . ARG A 1 34 ? -3.732  0.326   11.219  1.00 0.00 ? 34 ARG A HE   12 
ATOM 9258  H HH11 . ARG A 1 34 ? -6.813  1.858   10.623  1.00 0.00 ? 34 ARG A HH11 12 
ATOM 9259  H HH12 . ARG A 1 34 ? -6.993  2.412   12.252  1.00 0.00 ? 34 ARG A HH12 12 
ATOM 9260  H HH21 . ARG A 1 34 ? -3.969  1.056   13.362  1.00 0.00 ? 34 ARG A HH21 12 
ATOM 9261  H HH22 . ARG A 1 34 ? -5.379  1.959   13.807  1.00 0.00 ? 34 ARG A HH22 12 
ATOM 9262  N N    . ASN A 1 35 ? -4.755  0.537   4.382   1.00 0.00 ? 35 ASN A N    12 
ATOM 9263  C CA   . ASN A 1 35 ? -5.073  -0.420  3.332   1.00 0.00 ? 35 ASN A CA   12 
ATOM 9264  C C    . ASN A 1 35 ? -3.951  -0.457  2.310   1.00 0.00 ? 35 ASN A C    12 
ATOM 9265  O O    . ASN A 1 35 ? -4.101  -0.013  1.171   1.00 0.00 ? 35 ASN A O    12 
ATOM 9266  C CB   . ASN A 1 35 ? -6.398  -0.067  2.656   1.00 0.00 ? 35 ASN A CB   12 
ATOM 9267  C CG   . ASN A 1 35 ? -7.533  -0.956  3.121   1.00 0.00 ? 35 ASN A CG   12 
ATOM 9268  O OD1  . ASN A 1 35 ? -7.568  -2.147  2.815   1.00 0.00 ? 35 ASN A OD1  12 
ATOM 9269  N ND2  . ASN A 1 35 ? -8.469  -0.383  3.870   1.00 0.00 ? 35 ASN A ND2  12 
ATOM 9270  H H    . ASN A 1 35 ? -5.171  1.424   4.368   1.00 0.00 ? 35 ASN A H    12 
ATOM 9271  H HA   . ASN A 1 35 ? -5.159  -1.395  3.788   1.00 0.00 ? 35 ASN A HA   12 
ATOM 9272  H HB2  . ASN A 1 35 ? -6.648  0.956   2.881   1.00 0.00 ? 35 ASN A HB2  12 
ATOM 9273  H HB3  . ASN A 1 35 ? -6.292  -0.180  1.587   1.00 0.00 ? 35 ASN A HB3  12 
ATOM 9274  H HD21 . ASN A 1 35 ? -8.377  0.568   4.078   1.00 0.00 ? 35 ASN A HD21 12 
ATOM 9275  H HD22 . ASN A 1 35 ? -9.211  -0.939  4.187   1.00 0.00 ? 35 ASN A HD22 12 
ATOM 9276  N N    . MET A 1 36 ? -2.821  -0.991  2.746   1.00 0.00 ? 36 MET A N    12 
ATOM 9277  C CA   . MET A 1 36 ? -1.637  -1.106  1.912   1.00 0.00 ? 36 MET A CA   12 
ATOM 9278  C C    . MET A 1 36 ? -1.961  -1.735  0.565   1.00 0.00 ? 36 MET A C    12 
ATOM 9279  O O    . MET A 1 36 ? -1.268  -1.489  -0.423  1.00 0.00 ? 36 MET A O    12 
ATOM 9280  C CB   . MET A 1 36 ? -0.592  -1.942  2.643   1.00 0.00 ? 36 MET A CB   12 
ATOM 9281  C CG   . MET A 1 36 ? 0.674   -2.191  1.838   1.00 0.00 ? 36 MET A CG   12 
ATOM 9282  S SD   . MET A 1 36 ? 1.049   -3.947  1.650   1.00 0.00 ? 36 MET A SD   12 
ATOM 9283  C CE   . MET A 1 36 ? -0.507  -4.560  1.010   1.00 0.00 ? 36 MET A CE   12 
ATOM 9284  H H    . MET A 1 36 ? -2.780  -1.319  3.668   1.00 0.00 ? 36 MET A H    12 
ATOM 9285  H HA   . MET A 1 36 ? -1.244  -0.114  1.749   1.00 0.00 ? 36 MET A HA   12 
ATOM 9286  H HB2  . MET A 1 36 ? -0.324  -1.434  3.555   1.00 0.00 ? 36 MET A HB2  12 
ATOM 9287  H HB3  . MET A 1 36 ? -1.034  -2.895  2.892   1.00 0.00 ? 36 MET A HB3  12 
ATOM 9288  H HG2  . MET A 1 36 ? 0.553   -1.759  0.857   1.00 0.00 ? 36 MET A HG2  12 
ATOM 9289  H HG3  . MET A 1 36 ? 1.503   -1.714  2.341   1.00 0.00 ? 36 MET A HG3  12 
ATOM 9290  H HE1  . MET A 1 36 ? -0.376  -5.571  0.653   1.00 0.00 ? 36 MET A HE1  12 
ATOM 9291  H HE2  . MET A 1 36 ? -0.835  -3.930  0.197   1.00 0.00 ? 36 MET A HE2  12 
ATOM 9292  H HE3  . MET A 1 36 ? -1.249  -4.549  1.796   1.00 0.00 ? 36 MET A HE3  12 
ATOM 9293  N N    . CYS A 1 37 ? -3.014  -2.541  0.521   1.00 0.00 ? 37 CYS A N    12 
ATOM 9294  C CA   . CYS A 1 37 ? -3.403  -3.182  -0.723  1.00 0.00 ? 37 CYS A CA   12 
ATOM 9295  C C    . CYS A 1 37 ? -4.165  -2.198  -1.601  1.00 0.00 ? 37 CYS A C    12 
ATOM 9296  O O    . CYS A 1 37 ? -3.981  -2.168  -2.816  1.00 0.00 ? 37 CYS A O    12 
ATOM 9297  C CB   . CYS A 1 37 ? -4.213  -4.457  -0.459  1.00 0.00 ? 37 CYS A CB   12 
ATOM 9298  S SG   . CYS A 1 37 ? -5.944  -4.200  0.046   1.00 0.00 ? 37 CYS A SG   12 
ATOM 9299  H H    . CYS A 1 37 ? -3.539  -2.699  1.337   1.00 0.00 ? 37 CYS A H    12 
ATOM 9300  H HA   . CYS A 1 37 ? -2.493  -3.452  -1.238  1.00 0.00 ? 37 CYS A HA   12 
ATOM 9301  H HB2  . CYS A 1 37 ? -4.227  -5.050  -1.359  1.00 0.00 ? 37 CYS A HB2  12 
ATOM 9302  H HB3  . CYS A 1 37 ? -3.725  -5.020  0.323   1.00 0.00 ? 37 CYS A HB3  12 
ATOM 9303  N N    . ALA A 1 38 ? -4.990  -1.364  -0.973  1.00 0.00 ? 38 ALA A N    12 
ATOM 9304  C CA   . ALA A 1 38 ? -5.743  -0.348  -1.701  1.00 0.00 ? 38 ALA A CA   12 
ATOM 9305  C C    . ALA A 1 38 ? -4.806  0.696   -2.281  1.00 0.00 ? 38 ALA A C    12 
ATOM 9306  O O    . ALA A 1 38 ? -5.175  1.445   -3.184  1.00 0.00 ? 38 ALA A O    12 
ATOM 9307  C CB   . ALA A 1 38 ? -6.782  0.302   -0.798  1.00 0.00 ? 38 ALA A CB   12 
ATOM 9308  H H    . ALA A 1 38 ? -5.071  -1.417  0.003   1.00 0.00 ? 38 ALA A H    12 
ATOM 9309  H HA   . ALA A 1 38 ? -6.251  -0.826  -2.514  1.00 0.00 ? 38 ALA A HA   12 
ATOM 9310  H HB1  . ALA A 1 38 ? -7.352  -0.466  -0.295  1.00 0.00 ? 38 ALA A HB1  12 
ATOM 9311  H HB2  . ALA A 1 38 ? -7.446  0.910   -1.394  1.00 0.00 ? 38 ALA A HB2  12 
ATOM 9312  H HB3  . ALA A 1 38 ? -6.287  0.920   -0.066  1.00 0.00 ? 38 ALA A HB3  12 
ATOM 9313  N N    . LEU A 1 39 ? -3.586  0.726   -1.769  1.00 0.00 ? 39 LEU A N    12 
ATOM 9314  C CA   . LEU A 1 39 ? -2.585  1.658   -2.244  1.00 0.00 ? 39 LEU A CA   12 
ATOM 9315  C C    . LEU A 1 39 ? -1.924  1.122   -3.487  1.00 0.00 ? 39 LEU A C    12 
ATOM 9316  O O    . LEU A 1 39 ? -1.827  1.805   -4.493  1.00 0.00 ? 39 LEU A O    12 
ATOM 9317  C CB   . LEU A 1 39 ? -1.531  1.878   -1.172  1.00 0.00 ? 39 LEU A CB   12 
ATOM 9318  C CG   . LEU A 1 39 ? -1.095  3.325   -0.997  1.00 0.00 ? 39 LEU A CG   12 
ATOM 9319  C CD1  . LEU A 1 39 ? -2.232  4.162   -0.438  1.00 0.00 ? 39 LEU A CD1  12 
ATOM 9320  C CD2  . LEU A 1 39 ? 0.124   3.401   -0.102  1.00 0.00 ? 39 LEU A CD2  12 
ATOM 9321  H H    . LEU A 1 39 ? -3.348  0.095   -1.058  1.00 0.00 ? 39 LEU A H    12 
ATOM 9322  H HA   . LEU A 1 39 ? -3.067  2.593   -2.474  1.00 0.00 ? 39 LEU A HA   12 
ATOM 9323  H HB2  . LEU A 1 39 ? -1.928  1.517   -0.242  1.00 0.00 ? 39 LEU A HB2  12 
ATOM 9324  H HB3  . LEU A 1 39 ? -0.657  1.292   -1.419  1.00 0.00 ? 39 LEU A HB3  12 
ATOM 9325  H HG   . LEU A 1 39 ? -0.828  3.730   -1.960  1.00 0.00 ? 39 LEU A HG   12 
ATOM 9326  H HD11 . LEU A 1 39 ? -2.012  5.209   -0.585  1.00 0.00 ? 39 LEU A HD11 12 
ATOM 9327  H HD12 . LEU A 1 39 ? -2.340  3.961   0.617   1.00 0.00 ? 39 LEU A HD12 12 
ATOM 9328  H HD13 . LEU A 1 39 ? -3.148  3.911   -0.949  1.00 0.00 ? 39 LEU A HD13 12 
ATOM 9329  H HD21 . LEU A 1 39 ? 0.540   4.394   -0.149  1.00 0.00 ? 39 LEU A HD21 12 
ATOM 9330  H HD22 . LEU A 1 39 ? 0.861   2.686   -0.438  1.00 0.00 ? 39 LEU A HD22 12 
ATOM 9331  H HD23 . LEU A 1 39 ? -0.159  3.173   0.914   1.00 0.00 ? 39 LEU A HD23 12 
ATOM 9332  N N    . CYS A 1 40 ? -1.467  -0.109  -3.402  1.00 0.00 ? 40 CYS A N    12 
ATOM 9333  C CA   . CYS A 1 40 ? -0.801  -0.744  -4.522  1.00 0.00 ? 40 CYS A CA   12 
ATOM 9334  C C    . CYS A 1 40 ? -1.688  -0.730  -5.756  1.00 0.00 ? 40 CYS A C    12 
ATOM 9335  O O    . CYS A 1 40 ? -1.195  -0.659  -6.881  1.00 0.00 ? 40 CYS A O    12 
ATOM 9336  C CB   . CYS A 1 40 ? -0.398  -2.169  -4.163  1.00 0.00 ? 40 CYS A CB   12 
ATOM 9337  S SG   . CYS A 1 40 ? 1.402   -2.408  -4.092  1.00 0.00 ? 40 CYS A SG   12 
ATOM 9338  H H    . CYS A 1 40 ? -1.579  -0.602  -2.564  1.00 0.00 ? 40 CYS A H    12 
ATOM 9339  H HA   . CYS A 1 40 ? 0.090   -0.175  -4.735  1.00 0.00 ? 40 CYS A HA   12 
ATOM 9340  H HB2  . CYS A 1 40 ? -0.804  -2.418  -3.193  1.00 0.00 ? 40 CYS A HB2  12 
ATOM 9341  H HB3  . CYS A 1 40 ? -0.795  -2.851  -4.901  1.00 0.00 ? 40 CYS A HB3  12 
ATOM 9342  N N    . CYS A 1 41 ? -2.999  -0.788  -5.547  1.00 0.00 ? 41 CYS A N    12 
ATOM 9343  C CA   . CYS A 1 41 ? -3.928  -0.770  -6.664  1.00 0.00 ? 41 CYS A CA   12 
ATOM 9344  C C    . CYS A 1 41 ? -4.173  0.655   -7.145  1.00 0.00 ? 41 CYS A C    12 
ATOM 9345  O O    . CYS A 1 41 ? -4.399  0.898   -8.330  1.00 0.00 ? 41 CYS A O    12 
ATOM 9346  C CB   . CYS A 1 41 ? -5.240  -1.426  -6.249  1.00 0.00 ? 41 CYS A CB   12 
ATOM 9347  S SG   . CYS A 1 41 ? -6.544  -0.285  -5.676  1.00 0.00 ? 41 CYS A SG   12 
ATOM 9348  H H    . CYS A 1 41 ? -3.352  -0.842  -4.621  1.00 0.00 ? 41 CYS A H    12 
ATOM 9349  H HA   . CYS A 1 41 ? -3.492  -1.343  -7.467  1.00 0.00 ? 41 CYS A HA   12 
ATOM 9350  H HB2  . CYS A 1 41 ? -5.632  -1.967  -7.085  1.00 0.00 ? 41 CYS A HB2  12 
ATOM 9351  H HB3  . CYS A 1 41 ? -5.035  -2.114  -5.449  1.00 0.00 ? 41 CYS A HB3  12 
ATOM 9352  N N    . GLU A 1 42 ? -4.154  1.583   -6.201  1.00 0.00 ? 42 GLU A N    12 
ATOM 9353  C CA   . GLU A 1 42 ? -4.404  2.996   -6.506  1.00 0.00 ? 42 GLU A CA   12 
ATOM 9354  C C    . GLU A 1 42 ? -3.117  3.803   -6.725  1.00 0.00 ? 42 GLU A C    12 
ATOM 9355  O O    . GLU A 1 42 ? -3.171  5.020   -6.900  1.00 0.00 ? 42 GLU A O    12 
ATOM 9356  C CB   . GLU A 1 42 ? -5.224  3.635   -5.383  1.00 0.00 ? 42 GLU A CB   12 
ATOM 9357  C CG   . GLU A 1 42 ? -6.315  4.567   -5.881  1.00 0.00 ? 42 GLU A CG   12 
ATOM 9358  C CD   . GLU A 1 42 ? -5.790  5.943   -6.239  1.00 0.00 ? 42 GLU A CD   12 
ATOM 9359  O OE1  . GLU A 1 42 ? -4.800  6.381   -5.616  1.00 0.00 ? 42 GLU A OE1  12 
ATOM 9360  O OE2  . GLU A 1 42 ? -6.367  6.582   -7.144  1.00 0.00 ? 42 GLU A OE2  12 
ATOM 9361  H H    . GLU A 1 42 ? -3.991  1.304   -5.270  1.00 0.00 ? 42 GLU A H    12 
ATOM 9362  H HA   . GLU A 1 42 ? -4.986  3.032   -7.414  1.00 0.00 ? 42 GLU A HA   12 
ATOM 9363  H HB2  . GLU A 1 42 ? -5.689  2.851   -4.804  1.00 0.00 ? 42 GLU A HB2  12 
ATOM 9364  H HB3  . GLU A 1 42 ? -4.562  4.199   -4.744  1.00 0.00 ? 42 GLU A HB3  12 
ATOM 9365  H HG2  . GLU A 1 42 ? -6.770  4.133   -6.759  1.00 0.00 ? 42 GLU A HG2  12 
ATOM 9366  H HG3  . GLU A 1 42 ? -7.062  4.673   -5.106  1.00 0.00 ? 42 GLU A HG3  12 
ATOM 9367  N N    . HIS A 1 43 ? -1.967  3.138   -6.707  1.00 0.00 ? 43 HIS A N    12 
ATOM 9368  C CA   . HIS A 1 43 ? -0.688  3.822   -6.897  1.00 0.00 ? 43 HIS A CA   12 
ATOM 9369  C C    . HIS A 1 43 ? -0.006  3.376   -8.186  1.00 0.00 ? 43 HIS A C    12 
ATOM 9370  O O    . HIS A 1 43 ? -0.542  2.554   -8.930  1.00 0.00 ? 43 HIS A O    12 
ATOM 9371  C CB   . HIS A 1 43 ? 0.213   3.611   -5.677  1.00 0.00 ? 43 HIS A CB   12 
ATOM 9372  C CG   . HIS A 1 43 ? 0.206   4.798   -4.763  1.00 0.00 ? 43 HIS A CG   12 
ATOM 9373  N ND1  . HIS A 1 43 ? 1.194   5.760   -4.763  1.00 0.00 ? 43 HIS A ND1  12 
ATOM 9374  C CD2  . HIS A 1 43 ? -0.693  5.190   -3.828  1.00 0.00 ? 43 HIS A CD2  12 
ATOM 9375  C CE1  . HIS A 1 43 ? 0.905   6.688   -3.868  1.00 0.00 ? 43 HIS A CE1  12 
ATOM 9376  N NE2  . HIS A 1 43 ? -0.236  6.366   -3.289  1.00 0.00 ? 43 HIS A NE2  12 
ATOM 9377  H H    . HIS A 1 43 ? -1.975  2.170   -6.553  1.00 0.00 ? 43 HIS A H    12 
ATOM 9378  H HA   . HIS A 1 43 ? -0.888  4.880   -6.986  1.00 0.00 ? 43 HIS A HA   12 
ATOM 9379  H HB2  . HIS A 1 43 ? -0.131  2.756   -5.118  1.00 0.00 ? 43 HIS A HB2  12 
ATOM 9380  H HB3  . HIS A 1 43 ? 1.227   3.437   -5.997  1.00 0.00 ? 43 HIS A HB3  12 
ATOM 9381  H HD1  . HIS A 1 43 ? 1.992   5.762   -5.332  1.00 0.00 ? 43 HIS A HD1  12 
ATOM 9382  H HD2  . HIS A 1 43 ? -1.603  4.672   -3.559  1.00 0.00 ? 43 HIS A HD2  12 
ATOM 9383  H HE1  . HIS A 1 43 ? 1.500   7.563   -3.650  1.00 0.00 ? 43 HIS A HE1  12 
ATOM 9384  H HE2  . HIS A 1 43 ? -0.732  6.936   -2.664  1.00 0.00 ? 43 HIS A HE2  12 
ATOM 9385  N N    . PRO A 1 44 ? 1.179   3.936   -8.480  1.00 0.00 ? 44 PRO A N    12 
ATOM 9386  C CA   . PRO A 1 44 ? 1.926   3.615   -9.700  1.00 0.00 ? 44 PRO A CA   12 
ATOM 9387  C C    . PRO A 1 44 ? 2.092   2.116   -9.905  1.00 0.00 ? 44 PRO A C    12 
ATOM 9388  O O    . PRO A 1 44 ? 1.585   1.313   -9.122  1.00 0.00 ? 44 PRO A O    12 
ATOM 9389  C CB   . PRO A 1 44 ? 3.280   4.289   -9.469  1.00 0.00 ? 44 PRO A CB   12 
ATOM 9390  C CG   . PRO A 1 44 ? 2.974   5.428   -8.557  1.00 0.00 ? 44 PRO A CG   12 
ATOM 9391  C CD   . PRO A 1 44 ? 1.879   4.936   -7.651  1.00 0.00 ? 44 PRO A CD   12 
ATOM 9392  H HA   . PRO A 1 44 ? 1.454   4.043   -10.573 1.00 0.00 ? 44 PRO A HA   12 
ATOM 9393  H HB2  . PRO A 1 44 ? 3.963   3.587   -9.012  1.00 0.00 ? 44 PRO A HB2  12 
ATOM 9394  H HB3  . PRO A 1 44 ? 3.682   4.634   -10.409 1.00 0.00 ? 44 PRO A HB3  12 
ATOM 9395  H HG2  . PRO A 1 44 ? 3.850   5.686   -7.982  1.00 0.00 ? 44 PRO A HG2  12 
ATOM 9396  H HG3  . PRO A 1 44 ? 2.634   6.277   -9.130  1.00 0.00 ? 44 PRO A HG3  12 
ATOM 9397  H HD2  . PRO A 1 44 ? 2.299   4.474   -6.768  1.00 0.00 ? 44 PRO A HD2  12 
ATOM 9398  H HD3  . PRO A 1 44 ? 1.212   5.740   -7.374  1.00 0.00 ? 44 PRO A HD3  12 
ATOM 9399  N N    . GLY A 1 45 ? 2.809   1.744   -10.963 1.00 0.00 ? 45 GLY A N    12 
ATOM 9400  C CA   . GLY A 1 45 ? 3.034   0.339   -11.254 1.00 0.00 ? 45 GLY A CA   12 
ATOM 9401  C C    . GLY A 1 45 ? 3.443   -0.452  -10.026 1.00 0.00 ? 45 GLY A C    12 
ATOM 9402  O O    . GLY A 1 45 ? 3.241   -1.664  -9.964  1.00 0.00 ? 45 GLY A O    12 
ATOM 9403  H H    . GLY A 1 45 ? 3.190   2.431   -11.550 1.00 0.00 ? 45 GLY A H    12 
ATOM 9404  H HA2  . GLY A 1 45 ? 2.124   -0.083  -11.654 1.00 0.00 ? 45 GLY A HA2  12 
ATOM 9405  H HA3  . GLY A 1 45 ? 3.813   0.257   -11.998 1.00 0.00 ? 45 GLY A HA3  12 
ATOM 9406  N N    . GLY A 1 46 ? 4.016   0.240   -9.046  1.00 0.00 ? 46 GLY A N    12 
ATOM 9407  C CA   . GLY A 1 46 ? 4.440   -0.414  -7.827  1.00 0.00 ? 46 GLY A CA   12 
ATOM 9408  C C    . GLY A 1 46 ? 5.598   0.295   -7.166  1.00 0.00 ? 46 GLY A C    12 
ATOM 9409  O O    . GLY A 1 46 ? 6.592   -0.338  -6.819  1.00 0.00 ? 46 GLY A O    12 
ATOM 9410  H H    . GLY A 1 46 ? 4.149   1.205   -9.151  1.00 0.00 ? 46 GLY A H    12 
ATOM 9411  H HA2  . GLY A 1 46 ? 3.609   -0.441  -7.135  1.00 0.00 ? 46 GLY A HA2  12 
ATOM 9412  H HA3  . GLY A 1 46 ? 4.736   -1.428  -8.054  1.00 0.00 ? 46 GLY A HA3  12 
ATOM 9413  N N    . PHE A 1 47 ? 5.461   1.612   -6.989  1.00 0.00 ? 47 PHE A N    12 
ATOM 9414  C CA   . PHE A 1 47 ? 6.495   2.431   -6.351  1.00 0.00 ? 47 PHE A CA   12 
ATOM 9415  C C    . PHE A 1 47 ? 7.156   1.682   -5.185  1.00 0.00 ? 47 PHE A C    12 
ATOM 9416  O O    . PHE A 1 47 ? 7.880   0.713   -5.409  1.00 0.00 ? 47 PHE A O    12 
ATOM 9417  C CB   . PHE A 1 47 ? 5.911   3.779   -5.895  1.00 0.00 ? 47 PHE A CB   12 
ATOM 9418  C CG   . PHE A 1 47 ? 4.692   3.700   -5.000  1.00 0.00 ? 47 PHE A CG   12 
ATOM 9419  C CD1  . PHE A 1 47 ? 3.825   2.612   -5.028  1.00 0.00 ? 47 PHE A CD1  12 
ATOM 9420  C CD2  . PHE A 1 47 ? 4.409   4.741   -4.130  1.00 0.00 ? 47 PHE A CD2  12 
ATOM 9421  C CE1  . PHE A 1 47 ? 2.714   2.572   -4.211  1.00 0.00 ? 47 PHE A CE1  12 
ATOM 9422  C CE2  . PHE A 1 47 ? 3.298   4.706   -3.317  1.00 0.00 ? 47 PHE A CE2  12 
ATOM 9423  C CZ   . PHE A 1 47 ? 2.450   3.620   -3.358  1.00 0.00 ? 47 PHE A CZ   12 
ATOM 9424  H H    . PHE A 1 47 ? 4.637   2.046   -7.294  1.00 0.00 ? 47 PHE A H    12 
ATOM 9425  H HA   . PHE A 1 47 ? 7.251   2.622   -7.096  1.00 0.00 ? 47 PHE A HA   12 
ATOM 9426  H HB2  . PHE A 1 47 ? 6.672   4.319   -5.353  1.00 0.00 ? 47 PHE A HB2  12 
ATOM 9427  H HB3  . PHE A 1 47 ? 5.638   4.350   -6.770  1.00 0.00 ? 47 PHE A HB3  12 
ATOM 9428  H HD1  . PHE A 1 47 ? 4.022   1.788   -5.687  1.00 0.00 ? 47 PHE A HD1  12 
ATOM 9429  H HD2  . PHE A 1 47 ? 5.068   5.593   -4.093  1.00 0.00 ? 47 PHE A HD2  12 
ATOM 9430  H HE1  . PHE A 1 47 ? 2.051   1.721   -4.245  1.00 0.00 ? 47 PHE A HE1  12 
ATOM 9431  H HE2  . PHE A 1 47 ? 3.094   5.525   -2.644  1.00 0.00 ? 47 PHE A HE2  12 
ATOM 9432  H HZ   . PHE A 1 47 ? 1.577   3.595   -2.730  1.00 0.00 ? 47 PHE A HZ   12 
ATOM 9433  N N    . GLU A 1 48 ? 6.931   2.114   -3.944  1.00 0.00 ? 48 GLU A N    12 
ATOM 9434  C CA   . GLU A 1 48 ? 7.544   1.424   -2.814  1.00 0.00 ? 48 GLU A CA   12 
ATOM 9435  C C    . GLU A 1 48 ? 6.822   1.729   -1.509  1.00 0.00 ? 48 GLU A C    12 
ATOM 9436  O O    . GLU A 1 48 ? 6.213   2.784   -1.353  1.00 0.00 ? 48 GLU A O    12 
ATOM 9437  C CB   . GLU A 1 48 ? 9.019   1.805   -2.698  1.00 0.00 ? 48 GLU A CB   12 
ATOM 9438  C CG   . GLU A 1 48 ? 9.314   3.250   -3.064  1.00 0.00 ? 48 GLU A CG   12 
ATOM 9439  C CD   . GLU A 1 48 ? 9.685   3.418   -4.523  1.00 0.00 ? 48 GLU A CD   12 
ATOM 9440  O OE1  . GLU A 1 48 ? 10.759  2.922   -4.924  1.00 0.00 ? 48 GLU A OE1  12 
ATOM 9441  O OE2  . GLU A 1 48 ? 8.901   4.045   -5.267  1.00 0.00 ? 48 GLU A OE2  12 
ATOM 9442  H H    . GLU A 1 48 ? 6.361   2.901   -3.786  1.00 0.00 ? 48 GLU A H    12 
ATOM 9443  H HA   . GLU A 1 48 ? 7.475   0.356   -3.002  1.00 0.00 ? 48 GLU A HA   12 
ATOM 9444  H HB2  . GLU A 1 48 ? 9.341   1.642   -1.683  1.00 0.00 ? 48 GLU A HB2  12 
ATOM 9445  H HB3  . GLU A 1 48 ? 9.591   1.170   -3.357  1.00 0.00 ? 48 GLU A HB3  12 
ATOM 9446  H HG2  . GLU A 1 48 ? 8.437   3.843   -2.860  1.00 0.00 ? 48 GLU A HG2  12 
ATOM 9447  H HG3  . GLU A 1 48 ? 10.135  3.601   -2.456  1.00 0.00 ? 48 GLU A HG3  12 
ATOM 9448  N N    . TYR A 1 49 ? 6.906   0.791   -0.571  1.00 0.00 ? 49 TYR A N    12 
ATOM 9449  C CA   . TYR A 1 49 ? 6.276   0.948   0.733   1.00 0.00 ? 49 TYR A CA   12 
ATOM 9450  C C    . TYR A 1 49 ? 7.193   0.506   1.842   1.00 0.00 ? 49 TYR A C    12 
ATOM 9451  O O    . TYR A 1 49 ? 8.279   -0.028  1.612   1.00 0.00 ? 49 TYR A O    12 
ATOM 9452  C CB   . TYR A 1 49 ? 4.941   0.203   0.815   1.00 0.00 ? 49 TYR A CB   12 
ATOM 9453  C CG   . TYR A 1 49 ? 4.989   -1.316  0.827   1.00 0.00 ? 49 TYR A CG   12 
ATOM 9454  C CD1  . TYR A 1 49 ? 5.973   -2.020  1.515   1.00 0.00 ? 49 TYR A CD1  12 
ATOM 9455  C CD2  . TYR A 1 49 ? 4.003   -2.049  0.175   1.00 0.00 ? 49 TYR A CD2  12 
ATOM 9456  C CE1  . TYR A 1 49 ? 5.978   -3.398  1.545   1.00 0.00 ? 49 TYR A CE1  12 
ATOM 9457  C CE2  . TYR A 1 49 ? 3.999   -3.430  0.209   1.00 0.00 ? 49 TYR A CE2  12 
ATOM 9458  C CZ   . TYR A 1 49 ? 4.990   -4.097  0.895   1.00 0.00 ? 49 TYR A CZ   12 
ATOM 9459  O OH   . TYR A 1 49 ? 4.990   -5.470  0.939   1.00 0.00 ? 49 TYR A OH   12 
ATOM 9460  H H    . TYR A 1 49 ? 7.414   -0.027  -0.761  1.00 0.00 ? 49 TYR A H    12 
ATOM 9461  H HA   . TYR A 1 49 ? 6.072   1.995   0.897   1.00 0.00 ? 49 TYR A HA   12 
ATOM 9462  H HB2  . TYR A 1 49 ? 4.466   0.500   1.722   1.00 0.00 ? 49 TYR A HB2  12 
ATOM 9463  H HB3  . TYR A 1 49 ? 4.322   0.508   -0.010  1.00 0.00 ? 49 TYR A HB3  12 
ATOM 9464  H HD1  . TYR A 1 49 ? 6.745   -1.481  2.025   1.00 0.00 ? 49 TYR A HD1  12 
ATOM 9465  H HD2  . TYR A 1 49 ? 3.231   -1.524  -0.371  1.00 0.00 ? 49 TYR A HD2  12 
ATOM 9466  H HE1  . TYR A 1 49 ? 6.752   -3.921  2.084   1.00 0.00 ? 49 TYR A HE1  12 
ATOM 9467  H HE2  . TYR A 1 49 ? 3.223   -3.979  -0.302  1.00 0.00 ? 49 TYR A HE2  12 
ATOM 9468  H HH   . TYR A 1 49 ? 4.642   -5.764  1.784   1.00 0.00 ? 49 TYR A HH   12 
ATOM 9469  N N    . SER A 1 50 ? 6.728   0.730   3.048   1.00 0.00 ? 50 SER A N    12 
ATOM 9470  C CA   . SER A 1 50 ? 7.462   0.359   4.237   1.00 0.00 ? 50 SER A CA   12 
ATOM 9471  C C    . SER A 1 50 ? 6.481   -0.015  5.326   1.00 0.00 ? 50 SER A C    12 
ATOM 9472  O O    . SER A 1 50 ? 6.145   0.794   6.191   1.00 0.00 ? 50 SER A O    12 
ATOM 9473  C CB   . SER A 1 50 ? 8.357   1.497   4.697   1.00 0.00 ? 50 SER A CB   12 
ATOM 9474  O OG   . SER A 1 50 ? 8.440   2.517   3.717   1.00 0.00 ? 50 SER A OG   12 
ATOM 9475  H H    . SER A 1 50 ? 5.847   1.156   3.141   1.00 0.00 ? 50 SER A H    12 
ATOM 9476  H HA   . SER A 1 50 ? 8.071   -0.502  4.000   1.00 0.00 ? 50 SER A HA   12 
ATOM 9477  H HB2  . SER A 1 50 ? 7.955   1.916   5.604   1.00 0.00 ? 50 SER A HB2  12 
ATOM 9478  H HB3  . SER A 1 50 ? 9.345   1.110   4.882   1.00 0.00 ? 50 SER A HB3  12 
ATOM 9479  H HG   . SER A 1 50 ? 8.984   2.217   2.985   1.00 0.00 ? 50 SER A HG   12 
ATOM 9480  N N    . ASN A 1 51 ? 6.003   -1.241  5.253   1.00 0.00 ? 51 ASN A N    12 
ATOM 9481  C CA   . ASN A 1 51 ? 5.028   -1.728  6.210   1.00 0.00 ? 51 ASN A CA   12 
ATOM 9482  C C    . ASN A 1 51 ? 5.522   -1.573  7.634   1.00 0.00 ? 51 ASN A C    12 
ATOM 9483  O O    . ASN A 1 51 ? 6.637   -1.965  7.980   1.00 0.00 ? 51 ASN A O    12 
ATOM 9484  C CB   . ASN A 1 51 ? 4.654   -3.179  5.944   1.00 0.00 ? 51 ASN A CB   12 
ATOM 9485  C CG   . ASN A 1 51 ? 4.084   -3.386  4.556   1.00 0.00 ? 51 ASN A CG   12 
ATOM 9486  O OD1  . ASN A 1 51 ? 4.389   -2.636  3.630   1.00 0.00 ? 51 ASN A OD1  12 
ATOM 9487  N ND2  . ASN A 1 51 ? 3.244   -4.403  4.406   1.00 0.00 ? 51 ASN A ND2  12 
ATOM 9488  H H    . ASN A 1 51 ? 6.301   -1.821  4.528   1.00 0.00 ? 51 ASN A H    12 
ATOM 9489  H HA   . ASN A 1 51 ? 4.142   -1.125  6.097   1.00 0.00 ? 51 ASN A HA   12 
ATOM 9490  H HB2  . ASN A 1 51 ? 5.529   -3.796  6.053   1.00 0.00 ? 51 ASN A HB2  12 
ATOM 9491  H HB3  . ASN A 1 51 ? 3.911   -3.479  6.667   1.00 0.00 ? 51 ASN A HB3  12 
ATOM 9492  H HD21 . ASN A 1 51 ? 3.043   -4.956  5.190   1.00 0.00 ? 51 ASN A HD21 12 
ATOM 9493  H HD22 . ASN A 1 51 ? 2.861   -4.560  3.518   1.00 0.00 ? 51 ASN A HD22 12 
ATOM 9494  N N    . GLY A 1 52 ? 4.666   -0.990  8.444   1.00 0.00 ? 52 GLY A N    12 
ATOM 9495  C CA   . GLY A 1 52 ? 4.982   -0.760  9.843   1.00 0.00 ? 52 GLY A CA   12 
ATOM 9496  C C    . GLY A 1 52 ? 5.093   0.717   10.174  1.00 0.00 ? 52 GLY A C    12 
ATOM 9497  O O    . GLY A 1 52 ? 4.673   1.564   9.386   1.00 0.00 ? 52 GLY A O    12 
ATOM 9498  H H    . GLY A 1 52 ? 3.802   -0.709  8.078   1.00 0.00 ? 52 GLY A H    12 
ATOM 9499  H HA2  . GLY A 1 52 ? 4.206   -1.198  10.453  1.00 0.00 ? 52 GLY A HA2  12 
ATOM 9500  H HA3  . GLY A 1 52 ? 5.921   -1.241  10.072  1.00 0.00 ? 52 GLY A HA3  12 
ATOM 9501  N N    . PRO A 1 53 ? 5.664   1.062   11.341  1.00 0.00 ? 53 PRO A N    12 
ATOM 9502  C CA   . PRO A 1 53 ? 5.828   2.458   11.758  1.00 0.00 ? 53 PRO A CA   12 
ATOM 9503  C C    . PRO A 1 53 ? 6.682   3.248   10.772  1.00 0.00 ? 53 PRO A C    12 
ATOM 9504  O O    . PRO A 1 53 ? 7.635   2.718   10.201  1.00 0.00 ? 53 PRO A O    12 
ATOM 9505  C CB   . PRO A 1 53 ? 6.531   2.358   13.118  1.00 0.00 ? 53 PRO A CB   12 
ATOM 9506  C CG   . PRO A 1 53 ? 7.119   0.988   13.154  1.00 0.00 ? 53 PRO A CG   12 
ATOM 9507  C CD   . PRO A 1 53 ? 6.201   0.124   12.340  1.00 0.00 ? 53 PRO A CD   12 
ATOM 9508  H HA   . PRO A 1 53 ? 4.873   2.949   11.877  1.00 0.00 ? 53 PRO A HA   12 
ATOM 9509  H HB2  . PRO A 1 53 ? 7.295   3.118   13.188  1.00 0.00 ? 53 PRO A HB2  12 
ATOM 9510  H HB3  . PRO A 1 53 ? 5.809   2.496   13.910  1.00 0.00 ? 53 PRO A HB3  12 
ATOM 9511  H HG2  . PRO A 1 53 ? 8.107   1.001   12.717  1.00 0.00 ? 53 PRO A HG2  12 
ATOM 9512  H HG3  . PRO A 1 53 ? 7.163   0.633   14.173  1.00 0.00 ? 53 PRO A HG3  12 
ATOM 9513  H HD2  . PRO A 1 53 ? 6.754   -0.673  11.865  1.00 0.00 ? 53 PRO A HD2  12 
ATOM 9514  H HD3  . PRO A 1 53 ? 5.411   -0.276  12.956  1.00 0.00 ? 53 PRO A HD3  12 
ATOM 9515  N N    . CYS A 1 54 ? 6.331   4.514   10.568  1.00 0.00 ? 54 CYS A N    12 
ATOM 9516  C CA   . CYS A 1 54 ? 7.068   5.363   9.640   1.00 0.00 ? 54 CYS A CA   12 
ATOM 9517  C C    . CYS A 1 54 ? 6.638   6.823   9.763   1.00 0.00 ? 54 CYS A C    12 
ATOM 9518  O O    . CYS A 1 54 ? 7.339   7.636   10.366  1.00 0.00 ? 54 CYS A O    12 
ATOM 9519  C CB   . CYS A 1 54 ? 6.861   4.868   8.208   1.00 0.00 ? 54 CYS A CB   12 
ATOM 9520  S SG   . CYS A 1 54 ? 7.731   5.844   6.941   1.00 0.00 ? 54 CYS A SG   12 
ATOM 9521  H H    . CYS A 1 54 ? 5.559   4.882   11.046  1.00 0.00 ? 54 CYS A H    12 
ATOM 9522  H HA   . CYS A 1 54 ? 8.117   5.288   9.887   1.00 0.00 ? 54 CYS A HA   12 
ATOM 9523  H HB2  . CYS A 1 54 ? 7.213   3.850   8.134   1.00 0.00 ? 54 CYS A HB2  12 
ATOM 9524  H HB3  . CYS A 1 54 ? 5.806   4.893   7.977   1.00 0.00 ? 54 CYS A HB3  12 
ATOM 9525  N N    . GLU A 1 55 ? 5.483   7.151   9.190   1.00 0.00 ? 55 GLU A N    12 
ATOM 9526  C CA   . GLU A 1 55 ? 4.968   8.515   9.238   1.00 0.00 ? 55 GLU A CA   12 
ATOM 9527  C C    . GLU A 1 55 ? 4.281   8.791   10.572  1.00 0.00 ? 55 GLU A C    12 
ATOM 9528  O O    . GLU A 1 55 ? 4.996   9.067   11.558  1.00 0.00 ? 55 GLU A O    12 
ATOM 9529  C CB   . GLU A 1 55 ? 3.992   8.758   8.083   1.00 0.00 ? 55 GLU A CB   12 
ATOM 9530  C CG   . GLU A 1 55 ? 3.885   10.218  7.674   1.00 0.00 ? 55 GLU A CG   12 
ATOM 9531  C CD   . GLU A 1 55 ? 2.455   10.646  7.405   1.00 0.00 ? 55 GLU A CD   12 
ATOM 9532  O OE1  . GLU A 1 55 ? 1.779   9.981   6.593   1.00 0.00 ? 55 GLU A OE1  12 
ATOM 9533  O OE2  . GLU A 1 55 ? 2.013   11.649  8.004   1.00 0.00 ? 55 GLU A OE2  12 
ATOM 9534  O OXT  . GLU A 1 55 ? 3.034   8.731   10.621  1.00 0.00 ? 55 GLU A OXT  12 
ATOM 9535  H H    . GLU A 1 55 ? 4.967   6.462   8.722   1.00 0.00 ? 55 GLU A H    12 
ATOM 9536  H HA   . GLU A 1 55 ? 5.805   9.188   9.134   1.00 0.00 ? 55 GLU A HA   12 
ATOM 9537  H HB2  . GLU A 1 55 ? 4.318   8.189   7.225   1.00 0.00 ? 55 GLU A HB2  12 
ATOM 9538  H HB3  . GLU A 1 55 ? 3.010   8.415   8.378   1.00 0.00 ? 55 GLU A HB3  12 
ATOM 9539  H HG2  . GLU A 1 55 ? 4.283   10.831  8.468   1.00 0.00 ? 55 GLU A HG2  12 
ATOM 9540  H HG3  . GLU A 1 55 ? 4.467   10.370  6.776   1.00 0.00 ? 55 GLU A HG3  12 
ATOM 9541  N N    . ALA A 1 1  ? 11.986  0.954   -5.057  1.00 0.00 ? 1  ALA A N    13 
ATOM 9542  C CA   . ALA A 1 1  ? 10.943  0.133   -5.724  1.00 0.00 ? 1  ALA A CA   13 
ATOM 9543  C C    . ALA A 1 1  ? 10.442  -0.971  -4.800  1.00 0.00 ? 1  ALA A C    13 
ATOM 9544  O O    . ALA A 1 1  ? 10.668  -2.156  -5.050  1.00 0.00 ? 1  ALA A O    13 
ATOM 9545  C CB   . ALA A 1 1  ? 11.487  -0.461  -7.014  1.00 0.00 ? 1  ALA A CB   13 
ATOM 9546  H H1   . ALA A 1 1  ? 12.873  0.412   -5.070  1.00 0.00 ? 1  ALA A H1   13 
ATOM 9547  H H2   . ALA A 1 1  ? 11.671  1.136   -4.082  1.00 0.00 ? 1  ALA A H2   13 
ATOM 9548  H H3   . ALA A 1 1  ? 12.084  1.840   -5.593  1.00 0.00 ? 1  ALA A H3   13 
ATOM 9549  H HA   . ALA A 1 1  ? 10.114  0.779   -5.976  1.00 0.00 ? 1  ALA A HA   13 
ATOM 9550  H HB1  . ALA A 1 1  ? 12.285  -1.151  -6.784  1.00 0.00 ? 1  ALA A HB1  13 
ATOM 9551  H HB2  . ALA A 1 1  ? 11.866  0.330   -7.645  1.00 0.00 ? 1  ALA A HB2  13 
ATOM 9552  H HB3  . ALA A 1 1  ? 10.696  -0.985  -7.531  1.00 0.00 ? 1  ALA A HB3  13 
ATOM 9553  N N    . HIS A 1 2  ? 9.764   -0.574  -3.729  1.00 0.00 ? 2  HIS A N    13 
ATOM 9554  C CA   . HIS A 1 2  ? 9.231   -1.530  -2.764  1.00 0.00 ? 2  HIS A CA   13 
ATOM 9555  C C    . HIS A 1 2  ? 7.761   -1.827  -3.046  1.00 0.00 ? 2  HIS A C    13 
ATOM 9556  O O    . HIS A 1 2  ? 6.892   -1.587  -2.207  1.00 0.00 ? 2  HIS A O    13 
ATOM 9557  C CB   . HIS A 1 2  ? 9.400   -0.995  -1.340  1.00 0.00 ? 2  HIS A CB   13 
ATOM 9558  C CG   . HIS A 1 2  ? 10.763  -0.437  -1.069  1.00 0.00 ? 2  HIS A CG   13 
ATOM 9559  N ND1  . HIS A 1 2  ? 10.983  0.881   -0.728  1.00 0.00 ? 2  HIS A ND1  13 
ATOM 9560  C CD2  . HIS A 1 2  ? 11.983  -1.026  -1.092  1.00 0.00 ? 2  HIS A CD2  13 
ATOM 9561  C CE1  . HIS A 1 2  ? 12.278  1.079   -0.554  1.00 0.00 ? 2  HIS A CE1  13 
ATOM 9562  N NE2  . HIS A 1 2  ? 12.906  -0.062  -0.770  1.00 0.00 ? 2  HIS A NE2  13 
ATOM 9563  H H    . HIS A 1 2  ? 9.619   0.383   -3.583  1.00 0.00 ? 2  HIS A H    13 
ATOM 9564  H HA   . HIS A 1 2  ? 9.792   -2.447  -2.864  1.00 0.00 ? 2  HIS A HA   13 
ATOM 9565  H HB2  . HIS A 1 2  ? 8.679   -0.209  -1.171  1.00 0.00 ? 2  HIS A HB2  13 
ATOM 9566  H HB3  . HIS A 1 2  ? 9.221   -1.797  -0.638  1.00 0.00 ? 2  HIS A HB3  13 
ATOM 9567  H HD1  . HIS A 1 2  ? 10.293  1.570   -0.630  1.00 0.00 ? 2  HIS A HD1  13 
ATOM 9568  H HD2  . HIS A 1 2  ? 12.191  -2.062  -1.323  1.00 0.00 ? 2  HIS A HD2  13 
ATOM 9569  H HE1  . HIS A 1 2  ? 12.743  2.015   -0.281  1.00 0.00 ? 2  HIS A HE1  13 
ATOM 9570  H HE2  . HIS A 1 2  ? 13.866  -0.212  -0.644  1.00 0.00 ? 2  HIS A HE2  13 
ATOM 9571  N N    . MET A 1 3  ? 7.497   -2.350  -4.237  1.00 0.00 ? 3  MET A N    13 
ATOM 9572  C CA   . MET A 1 3  ? 6.136   -2.685  -4.650  1.00 0.00 ? 3  MET A CA   13 
ATOM 9573  C C    . MET A 1 3  ? 5.725   -4.062  -4.129  1.00 0.00 ? 3  MET A C    13 
ATOM 9574  O O    . MET A 1 3  ? 6.489   -5.022  -4.215  1.00 0.00 ? 3  MET A O    13 
ATOM 9575  C CB   . MET A 1 3  ? 6.028   -2.656  -6.177  1.00 0.00 ? 3  MET A CB   13 
ATOM 9576  C CG   . MET A 1 3  ? 6.860   -3.725  -6.867  1.00 0.00 ? 3  MET A CG   13 
ATOM 9577  S SD   . MET A 1 3  ? 6.541   -3.817  -8.639  1.00 0.00 ? 3  MET A SD   13 
ATOM 9578  C CE   . MET A 1 3  ? 7.295   -2.293  -9.200  1.00 0.00 ? 3  MET A CE   13 
ATOM 9579  H H    . MET A 1 3  ? 8.237   -2.511  -4.856  1.00 0.00 ? 3  MET A H    13 
ATOM 9580  H HA   . MET A 1 3  ? 5.471   -1.943  -4.237  1.00 0.00 ? 3  MET A HA   13 
ATOM 9581  H HB2  . MET A 1 3  ? 4.995   -2.798  -6.455  1.00 0.00 ? 3  MET A HB2  13 
ATOM 9582  H HB3  . MET A 1 3  ? 6.358   -1.690  -6.530  1.00 0.00 ? 3  MET A HB3  13 
ATOM 9583  H HG2  . MET A 1 3  ? 7.905   -3.501  -6.716  1.00 0.00 ? 3  MET A HG2  13 
ATOM 9584  H HG3  . MET A 1 3  ? 6.630   -4.682  -6.424  1.00 0.00 ? 3  MET A HG3  13 
ATOM 9585  H HE1  . MET A 1 3  ? 7.173   -1.531  -8.446  1.00 0.00 ? 3  MET A HE1  13 
ATOM 9586  H HE2  . MET A 1 3  ? 6.821   -1.971  -10.116 1.00 0.00 ? 3  MET A HE2  13 
ATOM 9587  H HE3  . MET A 1 3  ? 8.348   -2.457  -9.380  1.00 0.00 ? 3  MET A HE3  13 
ATOM 9588  N N    . ASP A 1 4  ? 4.507   -4.148  -3.594  1.00 0.00 ? 4  ASP A N    13 
ATOM 9589  C CA   . ASP A 1 4  ? 3.988   -5.405  -3.059  1.00 0.00 ? 4  ASP A CA   13 
ATOM 9590  C C    . ASP A 1 4  ? 2.462   -5.382  -2.977  1.00 0.00 ? 4  ASP A C    13 
ATOM 9591  O O    . ASP A 1 4  ? 1.894   -5.200  -1.899  1.00 0.00 ? 4  ASP A O    13 
ATOM 9592  C CB   . ASP A 1 4  ? 4.572   -5.674  -1.669  1.00 0.00 ? 4  ASP A CB   13 
ATOM 9593  C CG   . ASP A 1 4  ? 6.086   -5.753  -1.676  1.00 0.00 ? 4  ASP A CG   13 
ATOM 9594  O OD1  . ASP A 1 4  ? 6.622   -6.863  -1.871  1.00 0.00 ? 4  ASP A OD1  13 
ATOM 9595  O OD2  . ASP A 1 4  ? 6.735   -4.702  -1.488  1.00 0.00 ? 4  ASP A OD2  13 
ATOM 9596  H H    . ASP A 1 4  ? 3.945   -3.347  -3.559  1.00 0.00 ? 4  ASP A H    13 
ATOM 9597  H HA   . ASP A 1 4  ? 4.290   -6.198  -3.727  1.00 0.00 ? 4  ASP A HA   13 
ATOM 9598  H HB2  . ASP A 1 4  ? 4.276   -4.878  -1.002  1.00 0.00 ? 4  ASP A HB2  13 
ATOM 9599  H HB3  . ASP A 1 4  ? 4.183   -6.611  -1.299  1.00 0.00 ? 4  ASP A HB3  13 
ATOM 9600  N N    . CYS A 1 5  ? 1.800   -5.568  -4.116  1.00 0.00 ? 5  CYS A N    13 
ATOM 9601  C CA   . CYS A 1 5  ? 0.339   -5.572  -4.162  1.00 0.00 ? 5  CYS A CA   13 
ATOM 9602  C C    . CYS A 1 5  ? -0.191  -6.923  -3.691  1.00 0.00 ? 5  CYS A C    13 
ATOM 9603  O O    . CYS A 1 5  ? 0.582   -7.757  -3.222  1.00 0.00 ? 5  CYS A O    13 
ATOM 9604  C CB   . CYS A 1 5  ? -0.140  -5.272  -5.591  1.00 0.00 ? 5  CYS A CB   13 
ATOM 9605  S SG   . CYS A 1 5  ? -1.808  -4.534  -5.724  1.00 0.00 ? 5  CYS A SG   13 
ATOM 9606  H H    . CYS A 1 5  ? 2.305   -5.711  -4.943  1.00 0.00 ? 5  CYS A H    13 
ATOM 9607  H HA   . CYS A 1 5  ? -0.014  -4.805  -3.494  1.00 0.00 ? 5  CYS A HA   13 
ATOM 9608  H HB2  . CYS A 1 5  ? 0.553   -4.586  -6.052  1.00 0.00 ? 5  CYS A HB2  13 
ATOM 9609  H HB3  . CYS A 1 5  ? -0.145  -6.194  -6.154  1.00 0.00 ? 5  CYS A HB3  13 
ATOM 9610  N N    . THR A 1 6  ? -1.501  -7.146  -3.808  1.00 0.00 ? 6  THR A N    13 
ATOM 9611  C CA   . THR A 1 6  ? -2.084  -8.409  -3.382  1.00 0.00 ? 6  THR A CA   13 
ATOM 9612  C C    . THR A 1 6  ? -1.466  -9.560  -4.196  1.00 0.00 ? 6  THR A C    13 
ATOM 9613  O O    . THR A 1 6  ? -0.252  -9.751  -4.143  1.00 0.00 ? 6  THR A O    13 
ATOM 9614  C CB   . THR A 1 6  ? -3.608  -8.373  -3.532  1.00 0.00 ? 6  THR A CB   13 
ATOM 9615  O OG1  . THR A 1 6  ? -4.161  -9.667  -3.365  1.00 0.00 ? 6  THR A OG1  13 
ATOM 9616  C CG2  . THR A 1 6  ? -4.067  -7.848  -4.877  1.00 0.00 ? 6  THR A CG2  13 
ATOM 9617  H H    . THR A 1 6  ? -2.081  -6.456  -4.183  1.00 0.00 ? 6  THR A H    13 
ATOM 9618  H HA   . THR A 1 6  ? -1.829  -8.535  -2.327  1.00 0.00 ? 6  THR A HA   13 
ATOM 9619  H HB   . THR A 1 6  ? -4.019  -7.728  -2.769  1.00 0.00 ? 6  THR A HB   13 
ATOM 9620  H HG1  . THR A 1 6  ? -5.039  -9.594  -2.986  1.00 0.00 ? 6  THR A HG1  13 
ATOM 9621  H HG21 . THR A 1 6  ? -4.574  -8.633  -5.416  1.00 0.00 ? 6  THR A HG21 13 
ATOM 9622  H HG22 . THR A 1 6  ? -3.209  -7.517  -5.445  1.00 0.00 ? 6  THR A HG22 13 
ATOM 9623  H HG23 . THR A 1 6  ? -4.742  -7.018  -4.728  1.00 0.00 ? 6  THR A HG23 13 
ATOM 9624  N N    . GLU A 1 7  ? -2.267  -10.329 -4.960  1.00 0.00 ? 7  GLU A N    13 
ATOM 9625  C CA   . GLU A 1 7  ? -1.702  -11.415 -5.747  1.00 0.00 ? 7  GLU A CA   13 
ATOM 9626  C C    . GLU A 1 7  ? -2.786  -12.168 -6.516  1.00 0.00 ? 7  GLU A C    13 
ATOM 9627  O O    . GLU A 1 7  ? -2.628  -13.347 -6.829  1.00 0.00 ? 7  GLU A O    13 
ATOM 9628  C CB   . GLU A 1 7  ? -0.909  -12.366 -4.836  1.00 0.00 ? 7  GLU A CB   13 
ATOM 9629  C CG   . GLU A 1 7  ? -1.715  -13.527 -4.267  1.00 0.00 ? 7  GLU A CG   13 
ATOM 9630  C CD   . GLU A 1 7  ? -1.391  -14.848 -4.938  1.00 0.00 ? 7  GLU A CD   13 
ATOM 9631  O OE1  . GLU A 1 7  ? -0.193  -15.192 -5.022  1.00 0.00 ? 7  GLU A OE1  13 
ATOM 9632  O OE2  . GLU A 1 7  ? -2.335  -15.536 -5.382  1.00 0.00 ? 7  GLU A OE2  13 
ATOM 9633  H H    . GLU A 1 7  ? -3.237  -10.165 -5.010  1.00 0.00 ? 7  GLU A H    13 
ATOM 9634  H HA   . GLU A 1 7  ? -1.021  -10.977 -6.461  1.00 0.00 ? 7  GLU A HA   13 
ATOM 9635  H HB2  . GLU A 1 7  ? -0.085  -12.770 -5.397  1.00 0.00 ? 7  GLU A HB2  13 
ATOM 9636  H HB3  . GLU A 1 7  ? -0.517  -11.795 -4.006  1.00 0.00 ? 7  GLU A HB3  13 
ATOM 9637  H HG2  . GLU A 1 7  ? -1.497  -13.617 -3.213  1.00 0.00 ? 7  GLU A HG2  13 
ATOM 9638  H HG3  . GLU A 1 7  ? -2.767  -13.321 -4.397  1.00 0.00 ? 7  GLU A HG3  13 
ATOM 9639  N N    . PHE A 1 8  ? -3.889  -11.488 -6.815  1.00 0.00 ? 8  PHE A N    13 
ATOM 9640  C CA   . PHE A 1 8  ? -4.985  -12.124 -7.539  1.00 0.00 ? 8  PHE A CA   13 
ATOM 9641  C C    . PHE A 1 8  ? -5.596  -11.179 -8.566  1.00 0.00 ? 8  PHE A C    13 
ATOM 9642  O O    . PHE A 1 8  ? -5.067  -10.099 -8.827  1.00 0.00 ? 8  PHE A O    13 
ATOM 9643  C CB   . PHE A 1 8  ? -6.070  -12.591 -6.565  1.00 0.00 ? 8  PHE A CB   13 
ATOM 9644  C CG   . PHE A 1 8  ? -5.535  -13.129 -5.267  1.00 0.00 ? 8  PHE A CG   13 
ATOM 9645  C CD1  . PHE A 1 8  ? -5.115  -14.445 -5.168  1.00 0.00 ? 8  PHE A CD1  13 
ATOM 9646  C CD2  . PHE A 1 8  ? -5.454  -12.317 -4.148  1.00 0.00 ? 8  PHE A CD2  13 
ATOM 9647  C CE1  . PHE A 1 8  ? -4.625  -14.943 -3.975  1.00 0.00 ? 8  PHE A CE1  13 
ATOM 9648  C CE2  . PHE A 1 8  ? -4.966  -12.807 -2.953  1.00 0.00 ? 8  PHE A CE2  13 
ATOM 9649  C CZ   . PHE A 1 8  ? -4.550  -14.122 -2.866  1.00 0.00 ? 8  PHE A CZ   13 
ATOM 9650  H H    . PHE A 1 8  ? -3.970  -10.546 -6.539  1.00 0.00 ? 8  PHE A H    13 
ATOM 9651  H HA   . PHE A 1 8  ? -4.586  -12.984 -8.054  1.00 0.00 ? 8  PHE A HA   13 
ATOM 9652  H HB2  . PHE A 1 8  ? -6.717  -11.759 -6.333  1.00 0.00 ? 8  PHE A HB2  13 
ATOM 9653  H HB3  . PHE A 1 8  ? -6.651  -13.372 -7.033  1.00 0.00 ? 8  PHE A HB3  13 
ATOM 9654  H HD1  . PHE A 1 8  ? -5.173  -15.086 -6.035  1.00 0.00 ? 8  PHE A HD1  13 
ATOM 9655  H HD2  . PHE A 1 8  ? -5.780  -11.288 -4.215  1.00 0.00 ? 8  PHE A HD2  13 
ATOM 9656  H HE1  . PHE A 1 8  ? -4.302  -15.970 -3.910  1.00 0.00 ? 8  PHE A HE1  13 
ATOM 9657  H HE2  . PHE A 1 8  ? -4.909  -12.164 -2.086  1.00 0.00 ? 8  PHE A HE2  13 
ATOM 9658  H HZ   . PHE A 1 8  ? -4.168  -14.507 -1.932  1.00 0.00 ? 8  PHE A HZ   13 
ATOM 9659  N N    . ASN A 1 9  ? -6.722  -11.596 -9.137  1.00 0.00 ? 9  ASN A N    13 
ATOM 9660  C CA   . ASN A 1 9  ? -7.419  -10.791 -10.128 1.00 0.00 ? 9  ASN A CA   13 
ATOM 9661  C C    . ASN A 1 9  ? -8.034  -9.559  -9.467  1.00 0.00 ? 9  ASN A C    13 
ATOM 9662  O O    . ASN A 1 9  ? -7.802  -8.433  -9.905  1.00 0.00 ? 9  ASN A O    13 
ATOM 9663  C CB   . ASN A 1 9  ? -8.508  -11.619 -10.817 1.00 0.00 ? 9  ASN A CB   13 
ATOM 9664  C CG   . ASN A 1 9  ? -8.181  -11.909 -12.269 1.00 0.00 ? 9  ASN A CG   13 
ATOM 9665  O OD1  . ASN A 1 9  ? -8.751  -11.305 -13.178 1.00 0.00 ? 9  ASN A OD1  13 
ATOM 9666  N ND2  . ASN A 1 9  ? -7.260  -12.838 -12.495 1.00 0.00 ? 9  ASN A ND2  13 
ATOM 9667  H H    . ASN A 1 9  ? -7.094  -12.465 -8.879  1.00 0.00 ? 9  ASN A H    13 
ATOM 9668  H HA   . ASN A 1 9  ? -6.698  -10.470 -10.864 1.00 0.00 ? 9  ASN A HA   13 
ATOM 9669  H HB2  . ASN A 1 9  ? -8.617  -12.560 -10.298 1.00 0.00 ? 9  ASN A HB2  13 
ATOM 9670  H HB3  . ASN A 1 9  ? -9.443  -11.080 -10.778 1.00 0.00 ? 9  ASN A HB3  13 
ATOM 9671  H HD21 . ASN A 1 9  ? -6.848  -13.279 -11.722 1.00 0.00 ? 9  ASN A HD21 13 
ATOM 9672  H HD22 . ASN A 1 9  ? -7.030  -13.046 -13.424 1.00 0.00 ? 9  ASN A HD22 13 
ATOM 9673  N N    . PRO A 1 10 ? -8.822  -9.753  -8.393  1.00 0.00 ? 10 PRO A N    13 
ATOM 9674  C CA   . PRO A 1 10 ? -9.452  -8.645  -7.678  1.00 0.00 ? 10 PRO A CA   13 
ATOM 9675  C C    . PRO A 1 10 ? -8.443  -7.847  -6.861  1.00 0.00 ? 10 PRO A C    13 
ATOM 9676  O O    . PRO A 1 10 ? -8.269  -8.086  -5.666  1.00 0.00 ? 10 PRO A O    13 
ATOM 9677  C CB   . PRO A 1 10 ? -10.460 -9.336  -6.760  1.00 0.00 ? 10 PRO A CB   13 
ATOM 9678  C CG   . PRO A 1 10 ? -9.896  -10.695 -6.532  1.00 0.00 ? 10 PRO A CG   13 
ATOM 9679  C CD   . PRO A 1 10 ? -9.154  -11.061 -7.790  1.00 0.00 ? 10 PRO A CD   13 
ATOM 9680  H HA   . PRO A 1 10 ? -9.971  -7.981  -8.355  1.00 0.00 ? 10 PRO A HA   13 
ATOM 9681  H HB2  . PRO A 1 10 ? -10.549 -8.783  -5.836  1.00 0.00 ? 10 PRO A HB2  13 
ATOM 9682  H HB3  . PRO A 1 10 ? -11.422 -9.386  -7.250  1.00 0.00 ? 10 PRO A HB3  13 
ATOM 9683  H HG2  . PRO A 1 10 ? -9.218  -10.673 -5.692  1.00 0.00 ? 10 PRO A HG2  13 
ATOM 9684  H HG3  . PRO A 1 10 ? -10.695 -11.398 -6.351  1.00 0.00 ? 10 PRO A HG3  13 
ATOM 9685  H HD2  . PRO A 1 10 ? -8.260  -11.613 -7.547  1.00 0.00 ? 10 PRO A HD2  13 
ATOM 9686  H HD3  . PRO A 1 10 ? -9.788  -11.639 -8.446  1.00 0.00 ? 10 PRO A HD3  13 
ATOM 9687  N N    . LEU A 1 11 ? -7.781  -6.898  -7.517  1.00 0.00 ? 11 LEU A N    13 
ATOM 9688  C CA   . LEU A 1 11 ? -6.784  -6.052  -6.865  1.00 0.00 ? 11 LEU A CA   13 
ATOM 9689  C C    . LEU A 1 11 ? -7.356  -5.377  -5.635  1.00 0.00 ? 11 LEU A C    13 
ATOM 9690  O O    . LEU A 1 11 ? -8.433  -5.737  -5.173  1.00 0.00 ? 11 LEU A O    13 
ATOM 9691  C CB   . LEU A 1 11 ? -6.233  -5.014  -7.853  1.00 0.00 ? 11 LEU A CB   13 
ATOM 9692  C CG   . LEU A 1 11 ? -7.267  -4.290  -8.732  1.00 0.00 ? 11 LEU A CG   13 
ATOM 9693  C CD1  . LEU A 1 11 ? -7.494  -5.050  -10.031 1.00 0.00 ? 11 LEU A CD1  13 
ATOM 9694  C CD2  . LEU A 1 11 ? -8.583  -4.087  -7.990  1.00 0.00 ? 11 LEU A CD2  13 
ATOM 9695  H H    . LEU A 1 11 ? -7.969  -6.764  -8.469  1.00 0.00 ? 11 LEU A H    13 
ATOM 9696  H HA   . LEU A 1 11 ? -5.974  -6.676  -6.537  1.00 0.00 ? 11 LEU A HA   13 
ATOM 9697  H HB2  . LEU A 1 11 ? -5.691  -4.270  -7.292  1.00 0.00 ? 11 LEU A HB2  13 
ATOM 9698  H HB3  . LEU A 1 11 ? -5.537  -5.518  -8.507  1.00 0.00 ? 11 LEU A HB3  13 
ATOM 9699  H HG   . LEU A 1 11 ? -6.880  -3.315  -8.989  1.00 0.00 ? 11 LEU A HG   13 
ATOM 9700  H HD11 . LEU A 1 11 ? -8.548  -5.255  -10.151 1.00 0.00 ? 11 LEU A HD11 13 
ATOM 9701  H HD12 . LEU A 1 11 ? -6.948  -5.981  -10.005 1.00 0.00 ? 11 LEU A HD12 13 
ATOM 9702  H HD13 . LEU A 1 11 ? -7.147  -4.453  -10.862 1.00 0.00 ? 11 LEU A HD13 13 
ATOM 9703  H HD21 . LEU A 1 11 ? -9.065  -5.041  -7.839  1.00 0.00 ? 11 LEU A HD21 13 
ATOM 9704  H HD22 . LEU A 1 11 ? -9.229  -3.447  -8.573  1.00 0.00 ? 11 LEU A HD22 13 
ATOM 9705  H HD23 . LEU A 1 11 ? -8.390  -3.626  -7.033  1.00 0.00 ? 11 LEU A HD23 13 
ATOM 9706  N N    . CYS A 1 12 ? -6.596  -4.419  -5.104  1.00 0.00 ? 12 CYS A N    13 
ATOM 9707  C CA   . CYS A 1 12 ? -6.961  -3.681  -3.892  1.00 0.00 ? 12 CYS A CA   13 
ATOM 9708  C C    . CYS A 1 12 ? -8.439  -3.800  -3.553  1.00 0.00 ? 12 CYS A C    13 
ATOM 9709  O O    . CYS A 1 12 ? -9.194  -2.828  -3.579  1.00 0.00 ? 12 CYS A O    13 
ATOM 9710  C CB   . CYS A 1 12 ? -6.590  -2.213  -4.042  1.00 0.00 ? 12 CYS A CB   13 
ATOM 9711  S SG   . CYS A 1 12 ? -7.557  -1.322  -5.311  1.00 0.00 ? 12 CYS A SG   13 
ATOM 9712  H H    . CYS A 1 12 ? -5.737  -4.224  -5.524  1.00 0.00 ? 12 CYS A H    13 
ATOM 9713  H HA   . CYS A 1 12 ? -6.390  -4.097  -3.078  1.00 0.00 ? 12 CYS A HA   13 
ATOM 9714  H HB2  . CYS A 1 12 ? -6.749  -1.718  -3.100  1.00 0.00 ? 12 CYS A HB2  13 
ATOM 9715  H HB3  . CYS A 1 12 ? -5.546  -2.142  -4.308  1.00 0.00 ? 12 CYS A HB3  13 
ATOM 9716  N N    . ARG A 1 13 ? -8.824  -5.012  -3.212  1.00 0.00 ? 13 ARG A N    13 
ATOM 9717  C CA   . ARG A 1 13 ? -10.199 -5.307  -2.833  1.00 0.00 ? 13 ARG A CA   13 
ATOM 9718  C C    . ARG A 1 13 ? -10.292 -5.366  -1.321  1.00 0.00 ? 13 ARG A C    13 
ATOM 9719  O O    . ARG A 1 13 ? -10.913 -6.264  -0.751  1.00 0.00 ? 13 ARG A O    13 
ATOM 9720  C CB   . ARG A 1 13 ? -10.655 -6.632  -3.449  1.00 0.00 ? 13 ARG A CB   13 
ATOM 9721  C CG   . ARG A 1 13 ? -12.140 -6.908  -3.268  1.00 0.00 ? 13 ARG A CG   13 
ATOM 9722  C CD   . ARG A 1 13 ? -12.955 -6.354  -4.425  1.00 0.00 ? 13 ARG A CD   13 
ATOM 9723  N NE   . ARG A 1 13 ? -13.429 -4.997  -4.160  1.00 0.00 ? 13 ARG A NE   13 
ATOM 9724  C CZ   . ARG A 1 13 ? -14.338 -4.696  -3.236  1.00 0.00 ? 13 ARG A CZ   13 
ATOM 9725  N NH1  . ARG A 1 13 ? -14.875 -5.653  -2.488  1.00 0.00 ? 13 ARG A NH1  13 
ATOM 9726  N NH2  . ARG A 1 13 ? -14.712 -3.437  -3.058  1.00 0.00 ? 13 ARG A NH2  13 
ATOM 9727  H H    . ARG A 1 13 ? -8.151  -5.731  -3.201  1.00 0.00 ? 13 ARG A H    13 
ATOM 9728  H HA   . ARG A 1 13 ? -10.828 -4.507  -3.196  1.00 0.00 ? 13 ARG A HA   13 
ATOM 9729  H HB2  . ARG A 1 13 ? -10.440 -6.618  -4.507  1.00 0.00 ? 13 ARG A HB2  13 
ATOM 9730  H HB3  . ARG A 1 13 ? -10.103 -7.438  -2.988  1.00 0.00 ? 13 ARG A HB3  13 
ATOM 9731  H HG2  . ARG A 1 13 ? -12.294 -7.975  -3.211  1.00 0.00 ? 13 ARG A HG2  13 
ATOM 9732  H HG3  . ARG A 1 13 ? -12.473 -6.445  -2.351  1.00 0.00 ? 13 ARG A HG3  13 
ATOM 9733  H HD2  . ARG A 1 13 ? -12.338 -6.343  -5.311  1.00 0.00 ? 13 ARG A HD2  13 
ATOM 9734  H HD3  . ARG A 1 13 ? -13.807 -6.996  -4.588  1.00 0.00 ? 13 ARG A HD3  13 
ATOM 9735  H HE   . ARG A 1 13 ? -13.049 -4.272  -4.699  1.00 0.00 ? 13 ARG A HE   13 
ATOM 9736  H HH11 . ARG A 1 13 ? -14.597 -6.605  -2.617  1.00 0.00 ? 13 ARG A HH11 13 
ATOM 9737  H HH12 . ARG A 1 13 ? -15.557 -5.421  -1.795  1.00 0.00 ? 13 ARG A HH12 13 
ATOM 9738  H HH21 . ARG A 1 13 ? -14.311 -2.713  -3.619  1.00 0.00 ? 13 ARG A HH21 13 
ATOM 9739  H HH22 . ARG A 1 13 ? -15.396 -3.212  -2.364  1.00 0.00 ? 13 ARG A HH22 13 
ATOM 9740  N N    . CYS A 1 14 ? -9.635  -4.411  -0.677  1.00 0.00 ? 14 CYS A N    13 
ATOM 9741  C CA   . CYS A 1 14 ? -9.596  -4.348  0.772   1.00 0.00 ? 14 CYS A CA   13 
ATOM 9742  C C    . CYS A 1 14 ? -9.718  -2.905  1.265   1.00 0.00 ? 14 CYS A C    13 
ATOM 9743  O O    . CYS A 1 14 ? -8.787  -2.112  1.130   1.00 0.00 ? 14 CYS A O    13 
ATOM 9744  C CB   . CYS A 1 14 ? -8.290  -4.977  1.281   1.00 0.00 ? 14 CYS A CB   13 
ATOM 9745  S SG   . CYS A 1 14 ? -7.120  -5.487  -0.026  1.00 0.00 ? 14 CYS A SG   13 
ATOM 9746  H H    . CYS A 1 14 ? -9.142  -3.741  -1.195  1.00 0.00 ? 14 CYS A H    13 
ATOM 9747  H HA   . CYS A 1 14 ? -10.430 -4.917  1.152   1.00 0.00 ? 14 CYS A HA   13 
ATOM 9748  H HB2  . CYS A 1 14 ? -7.779  -4.267  1.908   1.00 0.00 ? 14 CYS A HB2  13 
ATOM 9749  H HB3  . CYS A 1 14 ? -8.531  -5.856  1.860   1.00 0.00 ? 14 CYS A HB3  13 
ATOM 9750  N N    . ASN A 1 15 ? -10.873 -2.576  1.838   1.00 0.00 ? 15 ASN A N    13 
ATOM 9751  C CA   . ASN A 1 15 ? -11.123 -1.231  2.354   1.00 0.00 ? 15 ASN A CA   13 
ATOM 9752  C C    . ASN A 1 15 ? -10.729 -1.144  3.813   1.00 0.00 ? 15 ASN A C    13 
ATOM 9753  O O    . ASN A 1 15 ? -10.148 -0.156  4.239   1.00 0.00 ? 15 ASN A O    13 
ATOM 9754  C CB   . ASN A 1 15 ? -12.601 -0.876  2.215   1.00 0.00 ? 15 ASN A CB   13 
ATOM 9755  C CG   . ASN A 1 15 ? -12.828 0.334   1.330   1.00 0.00 ? 15 ASN A CG   13 
ATOM 9756  O OD1  . ASN A 1 15 ? -13.295 0.211   0.198   1.00 0.00 ? 15 ASN A OD1  13 
ATOM 9757  N ND2  . ASN A 1 15 ? -12.498 1.513   1.846   1.00 0.00 ? 15 ASN A ND2  13 
ATOM 9758  H H    . ASN A 1 15 ? -11.577 -3.254  1.916   1.00 0.00 ? 15 ASN A H    13 
ATOM 9759  H HA   . ASN A 1 15 ? -10.531 -0.530  1.791   1.00 0.00 ? 15 ASN A HA   13 
ATOM 9760  H HB2  . ASN A 1 15 ? -13.123 -1.716  1.797   1.00 0.00 ? 15 ASN A HB2  13 
ATOM 9761  H HB3  . ASN A 1 15 ? -13.007 -0.661  3.194   1.00 0.00 ? 15 ASN A HB3  13 
ATOM 9762  H HD21 . ASN A 1 15 ? -12.131 1.535   2.754   1.00 0.00 ? 15 ASN A HD21 13 
ATOM 9763  H HD22 . ASN A 1 15 ? -12.635 2.313   1.295   1.00 0.00 ? 15 ASN A HD22 13 
ATOM 9764  N N    . LYS A 1 16 ? -11.084 -2.185  4.562   1.00 0.00 ? 16 LYS A N    13 
ATOM 9765  C CA   . LYS A 1 16 ? -10.814 -2.286  5.998   1.00 0.00 ? 16 LYS A CA   13 
ATOM 9766  C C    . LYS A 1 16 ? -9.657  -1.407  6.447   1.00 0.00 ? 16 LYS A C    13 
ATOM 9767  O O    . LYS A 1 16 ? -8.647  -1.893  6.953   1.00 0.00 ? 16 LYS A O    13 
ATOM 9768  C CB   . LYS A 1 16 ? -10.546 -3.744  6.384   1.00 0.00 ? 16 LYS A CB   13 
ATOM 9769  C CG   . LYS A 1 16 ? -10.305 -3.949  7.872   1.00 0.00 ? 16 LYS A CG   13 
ATOM 9770  C CD   . LYS A 1 16 ? -11.578 -4.367  8.591   1.00 0.00 ? 16 LYS A CD   13 
ATOM 9771  C CE   . LYS A 1 16 ? -12.018 -5.765  8.188   1.00 0.00 ? 16 LYS A CE   13 
ATOM 9772  N NZ   . LYS A 1 16 ? -12.315 -6.616  9.374   1.00 0.00 ? 16 LYS A NZ   13 
ATOM 9773  H H    . LYS A 1 16 ? -11.566 -2.910  4.133   1.00 0.00 ? 16 LYS A H    13 
ATOM 9774  H HA   . LYS A 1 16 ? -11.699 -1.953  6.509   1.00 0.00 ? 16 LYS A HA   13 
ATOM 9775  H HB2  . LYS A 1 16 ? -11.397 -4.342  6.093   1.00 0.00 ? 16 LYS A HB2  13 
ATOM 9776  H HB3  . LYS A 1 16 ? -9.675  -4.090  5.849   1.00 0.00 ? 16 LYS A HB3  13 
ATOM 9777  H HG2  . LYS A 1 16 ? -9.561  -4.721  8.003   1.00 0.00 ? 16 LYS A HG2  13 
ATOM 9778  H HG3  . LYS A 1 16 ? -9.946  -3.026  8.301   1.00 0.00 ? 16 LYS A HG3  13 
ATOM 9779  H HD2  . LYS A 1 16 ? -11.401 -4.351  9.656   1.00 0.00 ? 16 LYS A HD2  13 
ATOM 9780  H HD3  . LYS A 1 16 ? -12.364 -3.666  8.346   1.00 0.00 ? 16 LYS A HD3  13 
ATOM 9781  H HE2  . LYS A 1 16 ? -12.908 -5.688  7.580   1.00 0.00 ? 16 LYS A HE2  13 
ATOM 9782  H HE3  . LYS A 1 16 ? -11.230 -6.226  7.613   1.00 0.00 ? 16 LYS A HE3  13 
ATOM 9783  H HZ1  . LYS A 1 16 ? -11.537 -6.555  10.061  1.00 0.00 ? 16 LYS A HZ1  13 
ATOM 9784  H HZ2  . LYS A 1 16 ? -12.428 -7.607  9.084   1.00 0.00 ? 16 LYS A HZ2  13 
ATOM 9785  H HZ3  . LYS A 1 16 ? -13.194 -6.298  9.831   1.00 0.00 ? 16 LYS A HZ3  13 
ATOM 9786  N N    . MET A 1 17 ? -9.822  -0.110  6.244   1.00 0.00 ? 17 MET A N    13 
ATOM 9787  C CA   . MET A 1 17 ? -8.800  0.867   6.622   1.00 0.00 ? 17 MET A CA   13 
ATOM 9788  C C    . MET A 1 17 ? -8.594  0.904   8.130   1.00 0.00 ? 17 MET A C    13 
ATOM 9789  O O    . MET A 1 17 ? -8.866  1.905   8.793   1.00 0.00 ? 17 MET A O    13 
ATOM 9790  C CB   . MET A 1 17 ? -9.161  2.255   6.137   1.00 0.00 ? 17 MET A CB   13 
ATOM 9791  C CG   . MET A 1 17 ? -10.636 2.604   6.273   1.00 0.00 ? 17 MET A CG   13 
ATOM 9792  S SD   . MET A 1 17 ? -10.979 4.336   5.905   1.00 0.00 ? 17 MET A SD   13 
ATOM 9793  C CE   . MET A 1 17 ? -9.786  5.154   6.961   1.00 0.00 ? 17 MET A CE   13 
ATOM 9794  H H    . MET A 1 17 ? -10.653 0.193   5.810   1.00 0.00 ? 17 MET A H    13 
ATOM 9795  H HA   . MET A 1 17 ? -7.874  0.567   6.156   1.00 0.00 ? 17 MET A HA   13 
ATOM 9796  H HB2  . MET A 1 17 ? -8.592  2.966   6.713   1.00 0.00 ? 17 MET A HB2  13 
ATOM 9797  H HB3  . MET A 1 17 ? -8.884  2.334   5.104   1.00 0.00 ? 17 MET A HB3  13 
ATOM 9798  H HG2  . MET A 1 17 ? -11.203 1.990   5.589   1.00 0.00 ? 17 MET A HG2  13 
ATOM 9799  H HG3  . MET A 1 17 ? -10.950 2.397   7.286   1.00 0.00 ? 17 MET A HG3  13 
ATOM 9800  H HE1  . MET A 1 17 ? -10.006 6.210   7.002   1.00 0.00 ? 17 MET A HE1  13 
ATOM 9801  H HE2  . MET A 1 17 ? -8.793  5.007   6.563   1.00 0.00 ? 17 MET A HE2  13 
ATOM 9802  H HE3  . MET A 1 17 ? -9.841  4.736   7.956   1.00 0.00 ? 17 MET A HE3  13 
ATOM 9803  N N    . LEU A 1 18 ? -8.102  -0.196  8.647   1.00 0.00 ? 18 LEU A N    13 
ATOM 9804  C CA   . LEU A 1 18 ? -7.828  -0.341  10.070  1.00 0.00 ? 18 LEU A CA   13 
ATOM 9805  C C    . LEU A 1 18 ? -7.067  -1.642  10.333  1.00 0.00 ? 18 LEU A C    13 
ATOM 9806  O O    . LEU A 1 18 ? -7.631  -2.732  10.235  1.00 0.00 ? 18 LEU A O    13 
ATOM 9807  C CB   . LEU A 1 18 ? -9.144  -0.265  10.871  1.00 0.00 ? 18 LEU A CB   13 
ATOM 9808  C CG   . LEU A 1 18 ? -9.516  -1.489  11.718  1.00 0.00 ? 18 LEU A CG   13 
ATOM 9809  C CD1  . LEU A 1 18 ? -10.348 -1.064  12.919  1.00 0.00 ? 18 LEU A CD1  13 
ATOM 9810  C CD2  . LEU A 1 18 ? -10.277 -2.507  10.878  1.00 0.00 ? 18 LEU A CD2  13 
ATOM 9811  H H    . LEU A 1 18 ? -7.905  -0.932  8.045   1.00 0.00 ? 18 LEU A H    13 
ATOM 9812  H HA   . LEU A 1 18 ? -7.196  0.487   10.362  1.00 0.00 ? 18 LEU A HA   13 
ATOM 9813  H HB2  . LEU A 1 18 ? -9.081  0.586   11.532  1.00 0.00 ? 18 LEU A HB2  13 
ATOM 9814  H HB3  . LEU A 1 18 ? -9.947  -0.088  10.170  1.00 0.00 ? 18 LEU A HB3  13 
ATOM 9815  H HG   . LEU A 1 18 ? -8.617  -1.959  12.086  1.00 0.00 ? 18 LEU A HG   13 
ATOM 9816  H HD11 . LEU A 1 18 ? -10.079 -0.058  13.204  1.00 0.00 ? 18 LEU A HD11 13 
ATOM 9817  H HD12 . LEU A 1 18 ? -10.158 -1.735  13.743  1.00 0.00 ? 18 LEU A HD12 13 
ATOM 9818  H HD13 . LEU A 1 18 ? -11.396 -1.097  12.660  1.00 0.00 ? 18 LEU A HD13 13 
ATOM 9819  H HD21 . LEU A 1 18 ? -9.672  -3.393  10.749  1.00 0.00 ? 18 LEU A HD21 13 
ATOM 9820  H HD22 . LEU A 1 18 ? -10.500 -2.081  9.910   1.00 0.00 ? 18 LEU A HD22 13 
ATOM 9821  H HD23 . LEU A 1 18 ? -11.198 -2.769  11.375  1.00 0.00 ? 18 LEU A HD23 13 
ATOM 9822  N N    . GLY A 1 19 ? -5.783  -1.525  10.657  1.00 0.00 ? 19 GLY A N    13 
ATOM 9823  C CA   . GLY A 1 19 ? -4.978  -2.705  10.919  1.00 0.00 ? 19 GLY A CA   13 
ATOM 9824  C C    . GLY A 1 19 ? -3.494  -2.473  10.703  1.00 0.00 ? 19 GLY A C    13 
ATOM 9825  O O    . GLY A 1 19 ? -2.852  -1.756  11.471  1.00 0.00 ? 19 GLY A O    13 
ATOM 9826  H H    . GLY A 1 19 ? -5.379  -0.634  10.715  1.00 0.00 ? 19 GLY A H    13 
ATOM 9827  H HA2  . GLY A 1 19 ? -5.136  -3.013  11.942  1.00 0.00 ? 19 GLY A HA2  13 
ATOM 9828  H HA3  . GLY A 1 19 ? -5.305  -3.499  10.264  1.00 0.00 ? 19 GLY A HA3  13 
ATOM 9829  N N    . ASP A 1 20 ? -2.944  -3.092  9.659   1.00 0.00 ? 20 ASP A N    13 
ATOM 9830  C CA   . ASP A 1 20 ? -1.525  -2.961  9.348   1.00 0.00 ? 20 ASP A CA   13 
ATOM 9831  C C    . ASP A 1 20 ? -1.141  -1.508  9.102   1.00 0.00 ? 20 ASP A C    13 
ATOM 9832  O O    . ASP A 1 20 ? -1.988  -0.615  9.111   1.00 0.00 ? 20 ASP A O    13 
ATOM 9833  C CB   . ASP A 1 20 ? -1.162  -3.805  8.125   1.00 0.00 ? 20 ASP A CB   13 
ATOM 9834  C CG   . ASP A 1 20 ? -1.858  -5.153  8.111   1.00 0.00 ? 20 ASP A CG   13 
ATOM 9835  O OD1  . ASP A 1 20 ? -3.103  -5.177  8.005   1.00 0.00 ? 20 ASP A OD1  13 
ATOM 9836  O OD2  . ASP A 1 20 ? -1.158  -6.183  8.206   1.00 0.00 ? 20 ASP A OD2  13 
ATOM 9837  H H    . ASP A 1 20 ? -3.504  -3.655  9.089   1.00 0.00 ? 20 ASP A H    13 
ATOM 9838  H HA   . ASP A 1 20 ? -0.967  -3.325  10.199  1.00 0.00 ? 20 ASP A HA   13 
ATOM 9839  H HB2  . ASP A 1 20 ? -1.438  -3.268  7.233   1.00 0.00 ? 20 ASP A HB2  13 
ATOM 9840  H HB3  . ASP A 1 20 ? -0.098  -3.971  8.120   1.00 0.00 ? 20 ASP A HB3  13 
ATOM 9841  N N    . LEU A 1 21 ? 0.151   -1.284  8.896   1.00 0.00 ? 21 LEU A N    13 
ATOM 9842  C CA   . LEU A 1 21 ? 0.679   0.048   8.660   1.00 0.00 ? 21 LEU A CA   13 
ATOM 9843  C C    . LEU A 1 21 ? 1.877   0.000   7.713   1.00 0.00 ? 21 LEU A C    13 
ATOM 9844  O O    . LEU A 1 21 ? 2.995   -0.326  8.108   1.00 0.00 ? 21 LEU A O    13 
ATOM 9845  C CB   . LEU A 1 21 ? 1.032   0.683   10.018  1.00 0.00 ? 21 LEU A CB   13 
ATOM 9846  C CG   . LEU A 1 21 ? 2.499   1.076   10.258  1.00 0.00 ? 21 LEU A CG   13 
ATOM 9847  C CD1  . LEU A 1 21 ? 2.933   2.175   9.300   1.00 0.00 ? 21 LEU A CD1  13 
ATOM 9848  C CD2  . LEU A 1 21 ? 2.693   1.521   11.700  1.00 0.00 ? 21 LEU A CD2  13 
ATOM 9849  H H    . LEU A 1 21 ? 0.768   -2.037  8.916   1.00 0.00 ? 21 LEU A H    13 
ATOM 9850  H HA   . LEU A 1 21 ? -0.098  0.641   8.191   1.00 0.00 ? 21 LEU A HA   13 
ATOM 9851  H HB2  . LEU A 1 21 ? 0.427   1.565   10.135  1.00 0.00 ? 21 LEU A HB2  13 
ATOM 9852  H HB3  . LEU A 1 21 ? 0.750   -0.024  10.786  1.00 0.00 ? 21 LEU A HB3  13 
ATOM 9853  H HG   . LEU A 1 21 ? 3.129   0.216   10.090  1.00 0.00 ? 21 LEU A HG   13 
ATOM 9854  H HD11 . LEU A 1 21 ? 3.033   3.106   9.838   1.00 0.00 ? 21 LEU A HD11 13 
ATOM 9855  H HD12 . LEU A 1 21 ? 2.193   2.286   8.524   1.00 0.00 ? 21 LEU A HD12 13 
ATOM 9856  H HD13 . LEU A 1 21 ? 3.883   1.912   8.857   1.00 0.00 ? 21 LEU A HD13 13 
ATOM 9857  H HD21 . LEU A 1 21 ? 3.640   2.032   11.794  1.00 0.00 ? 21 LEU A HD21 13 
ATOM 9858  H HD22 . LEU A 1 21 ? 2.683   0.658   12.348  1.00 0.00 ? 21 LEU A HD22 13 
ATOM 9859  H HD23 . LEU A 1 21 ? 1.894   2.191   11.981  1.00 0.00 ? 21 LEU A HD23 13 
ATOM 9860  N N    . ILE A 1 22 ? 1.629   0.339   6.456   1.00 0.00 ? 22 ILE A N    13 
ATOM 9861  C CA   . ILE A 1 22 ? 2.677   0.356   5.450   1.00 0.00 ? 22 ILE A CA   13 
ATOM 9862  C C    . ILE A 1 22 ? 3.365   1.709   5.452   1.00 0.00 ? 22 ILE A C    13 
ATOM 9863  O O    . ILE A 1 22 ? 2.777   2.712   5.855   1.00 0.00 ? 22 ILE A O    13 
ATOM 9864  C CB   . ILE A 1 22 ? 2.116   0.059   4.034   1.00 0.00 ? 22 ILE A CB   13 
ATOM 9865  C CG1  . ILE A 1 22 ? 3.053   0.536   2.939   1.00 0.00 ? 22 ILE A CG1  13 
ATOM 9866  C CG2  . ILE A 1 22 ? 0.770   0.710   3.834   1.00 0.00 ? 22 ILE A CG2  13 
ATOM 9867  C CD1  . ILE A 1 22 ? 2.823   1.980   2.533   1.00 0.00 ? 22 ILE A CD1  13 
ATOM 9868  H H    . ILE A 1 22 ? 0.720   0.593   6.199   1.00 0.00 ? 22 ILE A H    13 
ATOM 9869  H HA   . ILE A 1 22 ? 3.398   -0.406  5.702   1.00 0.00 ? 22 ILE A HA   13 
ATOM 9870  H HB   . ILE A 1 22 ? 1.990   -0.999  3.938   1.00 0.00 ? 22 ILE A HB   13 
ATOM 9871  H HG12 . ILE A 1 22 ? 4.071   0.433   3.271   1.00 0.00 ? 22 ILE A HG12 13 
ATOM 9872  H HG13 . ILE A 1 22 ? 2.901   -0.080  2.065   1.00 0.00 ? 22 ILE A HG13 13 
ATOM 9873  H HG21 . ILE A 1 22 ? 0.841   1.753   4.097   1.00 0.00 ? 22 ILE A HG21 13 
ATOM 9874  H HG22 . ILE A 1 22 ? 0.041   0.222   4.456   1.00 0.00 ? 22 ILE A HG22 13 
ATOM 9875  H HG23 . ILE A 1 22 ? 0.485   0.621   2.796   1.00 0.00 ? 22 ILE A HG23 13 
ATOM 9876  H HD11 . ILE A 1 22 ? 3.740   2.394   2.157   1.00 0.00 ? 22 ILE A HD11 13 
ATOM 9877  H HD12 . ILE A 1 22 ? 2.493   2.551   3.387   1.00 0.00 ? 22 ILE A HD12 13 
ATOM 9878  H HD13 . ILE A 1 22 ? 2.069   2.020   1.761   1.00 0.00 ? 22 ILE A HD13 13 
ATOM 9879  N N    . CYS A 1 23 ? 4.596   1.742   4.971   1.00 0.00 ? 23 CYS A N    13 
ATOM 9880  C CA   . CYS A 1 23 ? 5.330   2.994   4.896   1.00 0.00 ? 23 CYS A CA   13 
ATOM 9881  C C    . CYS A 1 23 ? 5.679   3.271   3.452   1.00 0.00 ? 23 CYS A C    13 
ATOM 9882  O O    . CYS A 1 23 ? 6.677   2.769   2.933   1.00 0.00 ? 23 CYS A O    13 
ATOM 9883  C CB   . CYS A 1 23 ? 6.583   2.965   5.772   1.00 0.00 ? 23 CYS A CB   13 
ATOM 9884  S SG   . CYS A 1 23 ? 7.688   1.547   5.491   1.00 0.00 ? 23 CYS A SG   13 
ATOM 9885  H H    . CYS A 1 23 ? 5.010   0.911   4.631   1.00 0.00 ? 23 CYS A H    13 
ATOM 9886  H HA   . CYS A 1 23 ? 4.675   3.780   5.246   1.00 0.00 ? 23 CYS A HA   13 
ATOM 9887  H HB2  . CYS A 1 23 ? 7.156   3.862   5.593   1.00 0.00 ? 23 CYS A HB2  13 
ATOM 9888  H HB3  . CYS A 1 23 ? 6.278   2.942   6.808   1.00 0.00 ? 23 CYS A HB3  13 
ATOM 9889  N N    . ALA A 1 24 ? 4.823   4.038   2.792   1.00 0.00 ? 24 ALA A N    13 
ATOM 9890  C CA   . ALA A 1 24 ? 5.020   4.335   1.388   1.00 0.00 ? 24 ALA A CA   13 
ATOM 9891  C C    . ALA A 1 24 ? 6.059   5.420   1.182   1.00 0.00 ? 24 ALA A C    13 
ATOM 9892  O O    . ALA A 1 24 ? 6.361   6.201   2.084   1.00 0.00 ? 24 ALA A O    13 
ATOM 9893  C CB   . ALA A 1 24 ? 3.705   4.731   0.736   1.00 0.00 ? 24 ALA A CB   13 
ATOM 9894  H H    . ALA A 1 24 ? 4.024   4.380   3.252   1.00 0.00 ? 24 ALA A H    13 
ATOM 9895  H HA   . ALA A 1 24 ? 5.367   3.428   0.913   1.00 0.00 ? 24 ALA A HA   13 
ATOM 9896  H HB1  . ALA A 1 24 ? 3.899   5.407   -0.084  1.00 0.00 ? 24 ALA A HB1  13 
ATOM 9897  H HB2  . ALA A 1 24 ? 3.074   5.218   1.463   1.00 0.00 ? 24 ALA A HB2  13 
ATOM 9898  H HB3  . ALA A 1 24 ? 3.209   3.846   0.362   1.00 0.00 ? 24 ALA A HB3  13 
ATOM 9899  N N    . VAL A 1 25 ? 6.596   5.448   -0.024  1.00 0.00 ? 25 VAL A N    13 
ATOM 9900  C CA   . VAL A 1 25 ? 7.607   6.409   -0.411  1.00 0.00 ? 25 VAL A CA   13 
ATOM 9901  C C    . VAL A 1 25 ? 7.644   6.517   -1.920  1.00 0.00 ? 25 VAL A C    13 
ATOM 9902  O O    . VAL A 1 25 ? 7.435   5.532   -2.632  1.00 0.00 ? 25 VAL A O    13 
ATOM 9903  C CB   . VAL A 1 25 ? 9.005   6.004   0.099   1.00 0.00 ? 25 VAL A CB   13 
ATOM 9904  C CG1  . VAL A 1 25 ? 10.037  7.058   -0.275  1.00 0.00 ? 25 VAL A CG1  13 
ATOM 9905  C CG2  . VAL A 1 25 ? 8.989   5.780   1.604   1.00 0.00 ? 25 VAL A CG2  13 
ATOM 9906  H H    . VAL A 1 25 ? 6.298   4.795   -0.688  1.00 0.00 ? 25 VAL A H    13 
ATOM 9907  H HA   . VAL A 1 25 ? 7.349   7.373   0.006   1.00 0.00 ? 25 VAL A HA   13 
ATOM 9908  H HB   . VAL A 1 25 ? 9.284   5.077   -0.378  1.00 0.00 ? 25 VAL A HB   13 
ATOM 9909  H HG11 . VAL A 1 25 ? 9.621   8.042   -0.118  1.00 0.00 ? 25 VAL A HG11 13 
ATOM 9910  H HG12 . VAL A 1 25 ? 10.309  6.944   -1.313  1.00 0.00 ? 25 VAL A HG12 13 
ATOM 9911  H HG13 . VAL A 1 25 ? 10.916  6.936   0.343   1.00 0.00 ? 25 VAL A HG13 13 
ATOM 9912  H HG21 . VAL A 1 25 ? 10.000  5.643   1.958   1.00 0.00 ? 25 VAL A HG21 13 
ATOM 9913  H HG22 . VAL A 1 25 ? 8.406   4.898   1.830   1.00 0.00 ? 25 VAL A HG22 13 
ATOM 9914  H HG23 . VAL A 1 25 ? 8.549   6.637   2.091   1.00 0.00 ? 25 VAL A HG23 13 
ATOM 9915  N N    . ILE A 1 26 ? 7.886   7.721   -2.396  1.00 0.00 ? 26 ILE A N    13 
ATOM 9916  C CA   . ILE A 1 26 ? 7.941   7.981   -3.819  1.00 0.00 ? 26 ILE A CA   13 
ATOM 9917  C C    . ILE A 1 26 ? 8.684   9.289   -4.076  1.00 0.00 ? 26 ILE A C    13 
ATOM 9918  O O    . ILE A 1 26 ? 9.157   9.931   -3.138  1.00 0.00 ? 26 ILE A O    13 
ATOM 9919  C CB   . ILE A 1 26 ? 6.515   7.991   -4.431  1.00 0.00 ? 26 ILE A CB   13 
ATOM 9920  C CG1  . ILE A 1 26 ? 6.514   7.510   -5.881  1.00 0.00 ? 26 ILE A CG1  13 
ATOM 9921  C CG2  . ILE A 1 26 ? 5.891   9.362   -4.350  1.00 0.00 ? 26 ILE A CG2  13 
ATOM 9922  C CD1  . ILE A 1 26 ? 7.312   6.245   -6.118  1.00 0.00 ? 26 ILE A CD1  13 
ATOM 9923  H H    . ILE A 1 26 ? 8.021   8.462   -1.767  1.00 0.00 ? 26 ILE A H    13 
ATOM 9924  H HA   . ILE A 1 26 ? 8.502   7.183   -4.280  1.00 0.00 ? 26 ILE A HA   13 
ATOM 9925  H HB   . ILE A 1 26 ? 5.904   7.320   -3.847  1.00 0.00 ? 26 ILE A HB   13 
ATOM 9926  H HG12 . ILE A 1 26 ? 5.494   7.316   -6.175  1.00 0.00 ? 26 ILE A HG12 13 
ATOM 9927  H HG13 . ILE A 1 26 ? 6.918   8.287   -6.508  1.00 0.00 ? 26 ILE A HG13 13 
ATOM 9928  H HG21 . ILE A 1 26 ? 6.321   9.895   -3.524  1.00 0.00 ? 26 ILE A HG21 13 
ATOM 9929  H HG22 . ILE A 1 26 ? 4.826   9.260   -4.202  1.00 0.00 ? 26 ILE A HG22 13 
ATOM 9930  H HG23 . ILE A 1 26 ? 6.080   9.898   -5.265  1.00 0.00 ? 26 ILE A HG23 13 
ATOM 9931  H HD11 . ILE A 1 26 ? 7.128   5.548   -5.314  1.00 0.00 ? 26 ILE A HD11 13 
ATOM 9932  H HD12 . ILE A 1 26 ? 8.364   6.484   -6.153  1.00 0.00 ? 26 ILE A HD12 13 
ATOM 9933  H HD13 . ILE A 1 26 ? 7.011   5.800   -7.055  1.00 0.00 ? 26 ILE A HD13 13 
ATOM 9934  N N    . GLY A 1 27 ? 8.797   9.657   -5.343  1.00 0.00 ? 27 GLY A N    13 
ATOM 9935  C CA   . GLY A 1 27 ? 9.497   10.878  -5.734  1.00 0.00 ? 27 GLY A CA   13 
ATOM 9936  C C    . GLY A 1 27 ? 9.415   11.975  -4.688  1.00 0.00 ? 27 GLY A C    13 
ATOM 9937  O O    . GLY A 1 27 ? 10.384  12.698  -4.456  1.00 0.00 ? 27 GLY A O    13 
ATOM 9938  H H    . GLY A 1 27 ? 8.407   9.088   -6.024  1.00 0.00 ? 27 GLY A H    13 
ATOM 9939  H HA2  . GLY A 1 27 ? 10.535  10.642  -5.907  1.00 0.00 ? 27 GLY A HA2  13 
ATOM 9940  H HA3  . GLY A 1 27 ? 9.067   11.245  -6.655  1.00 0.00 ? 27 GLY A HA3  13 
ATOM 9941  N N    . ASP A 1 28 ? 8.259   12.084  -4.050  1.00 0.00 ? 28 ASP A N    13 
ATOM 9942  C CA   . ASP A 1 28 ? 8.045   13.080  -3.014  1.00 0.00 ? 28 ASP A CA   13 
ATOM 9943  C C    . ASP A 1 28 ? 6.872   12.677  -2.133  1.00 0.00 ? 28 ASP A C    13 
ATOM 9944  O O    . ASP A 1 28 ? 6.137   13.528  -1.633  1.00 0.00 ? 28 ASP A O    13 
ATOM 9945  C CB   . ASP A 1 28 ? 7.787   14.453  -3.638  1.00 0.00 ? 28 ASP A CB   13 
ATOM 9946  C CG   . ASP A 1 28 ? 8.536   15.563  -2.927  1.00 0.00 ? 28 ASP A CG   13 
ATOM 9947  O OD1  . ASP A 1 28 ? 9.620   15.286  -2.372  1.00 0.00 ? 28 ASP A OD1  13 
ATOM 9948  O OD2  . ASP A 1 28 ? 8.038   16.708  -2.924  1.00 0.00 ? 28 ASP A OD2  13 
ATOM 9949  H H    . ASP A 1 28 ? 7.530   11.469  -4.277  1.00 0.00 ? 28 ASP A H    13 
ATOM 9950  H HA   . ASP A 1 28 ? 8.938   13.130  -2.408  1.00 0.00 ? 28 ASP A HA   13 
ATOM 9951  H HB2  . ASP A 1 28 ? 8.103   14.437  -4.671  1.00 0.00 ? 28 ASP A HB2  13 
ATOM 9952  H HB3  . ASP A 1 28 ? 6.730   14.670  -3.593  1.00 0.00 ? 28 ASP A HB3  13 
ATOM 9953  N N    . ALA A 1 29 ? 6.692   11.368  -1.954  1.00 0.00 ? 29 ALA A N    13 
ATOM 9954  C CA   . ALA A 1 29 ? 5.595   10.862  -1.141  1.00 0.00 ? 29 ALA A CA   13 
ATOM 9955  C C    . ALA A 1 29 ? 6.074   9.789   -0.177  1.00 0.00 ? 29 ALA A C    13 
ATOM 9956  O O    . ALA A 1 29 ? 5.958   8.599   -0.461  1.00 0.00 ? 29 ALA A O    13 
ATOM 9957  C CB   . ALA A 1 29 ? 4.495   10.309  -2.034  1.00 0.00 ? 29 ALA A CB   13 
ATOM 9958  H H    . ALA A 1 29 ? 7.307   10.726  -2.385  1.00 0.00 ? 29 ALA A H    13 
ATOM 9959  H HA   . ALA A 1 29 ? 5.187   11.687  -0.576  1.00 0.00 ? 29 ALA A HA   13 
ATOM 9960  H HB1  . ALA A 1 29 ? 4.677   9.259   -2.220  1.00 0.00 ? 29 ALA A HB1  13 
ATOM 9961  H HB2  . ALA A 1 29 ? 4.493   10.843  -2.975  1.00 0.00 ? 29 ALA A HB2  13 
ATOM 9962  H HB3  . ALA A 1 29 ? 3.540   10.429  -1.551  1.00 0.00 ? 29 ALA A HB3  13 
ATOM 9963  N N    . LYS A 1 30 ? 6.603   10.217  0.964   1.00 0.00 ? 30 LYS A N    13 
ATOM 9964  C CA   . LYS A 1 30 ? 7.091   9.290   1.979   1.00 0.00 ? 30 LYS A CA   13 
ATOM 9965  C C    . LYS A 1 30 ? 6.261   9.409   3.252   1.00 0.00 ? 30 LYS A C    13 
ATOM 9966  O O    . LYS A 1 30 ? 6.541   10.247  4.110   1.00 0.00 ? 30 LYS A O    13 
ATOM 9967  C CB   . LYS A 1 30 ? 8.566   9.559   2.289   1.00 0.00 ? 30 LYS A CB   13 
ATOM 9968  C CG   . LYS A 1 30 ? 8.899   11.035  2.428   1.00 0.00 ? 30 LYS A CG   13 
ATOM 9969  C CD   . LYS A 1 30 ? 9.407   11.614  1.117   1.00 0.00 ? 30 LYS A CD   13 
ATOM 9970  C CE   . LYS A 1 30 ? 10.843  11.200  0.843   1.00 0.00 ? 30 LYS A CE   13 
ATOM 9971  N NZ   . LYS A 1 30 ? 11.819  12.051  1.580   1.00 0.00 ? 30 LYS A NZ   13 
ATOM 9972  H H    . LYS A 1 30 ? 6.661   11.181  1.131   1.00 0.00 ? 30 LYS A H    13 
ATOM 9973  H HA   . LYS A 1 30 ? 6.990   8.289   1.590   1.00 0.00 ? 30 LYS A HA   13 
ATOM 9974  H HB2  . LYS A 1 30 ? 8.821   9.067   3.216   1.00 0.00 ? 30 LYS A HB2  13 
ATOM 9975  H HB3  . LYS A 1 30 ? 9.169   9.148   1.494   1.00 0.00 ? 30 LYS A HB3  13 
ATOM 9976  H HG2  . LYS A 1 30 ? 8.010   11.570  2.725   1.00 0.00 ? 30 LYS A HG2  13 
ATOM 9977  H HG3  . LYS A 1 30 ? 9.662   11.152  3.183   1.00 0.00 ? 30 LYS A HG3  13 
ATOM 9978  H HD2  . LYS A 1 30 ? 8.780   11.261  0.312   1.00 0.00 ? 30 LYS A HD2  13 
ATOM 9979  H HD3  . LYS A 1 30 ? 9.356   12.692  1.169   1.00 0.00 ? 30 LYS A HD3  13 
ATOM 9980  H HE2  . LYS A 1 30 ? 10.973  10.173  1.149   1.00 0.00 ? 30 LYS A HE2  13 
ATOM 9981  H HE3  . LYS A 1 30 ? 11.032  11.285  -0.217  1.00 0.00 ? 30 LYS A HE3  13 
ATOM 9982  H HZ1  . LYS A 1 30 ? 12.791  11.777  1.331   1.00 0.00 ? 30 LYS A HZ1  13 
ATOM 9983  H HZ2  . LYS A 1 30 ? 11.689  11.937  2.605   1.00 0.00 ? 30 LYS A HZ2  13 
ATOM 9984  H HZ3  . LYS A 1 30 ? 11.677  13.052  1.332   1.00 0.00 ? 30 LYS A HZ3  13 
ATOM 9985  N N    . GLU A 1 31 ? 5.234   8.574   3.365   1.00 0.00 ? 31 GLU A N    13 
ATOM 9986  C CA   . GLU A 1 31 ? 4.361   8.600   4.534   1.00 0.00 ? 31 GLU A CA   13 
ATOM 9987  C C    . GLU A 1 31 ? 3.683   7.253   4.761   1.00 0.00 ? 31 GLU A C    13 
ATOM 9988  O O    . GLU A 1 31 ? 3.856   6.314   3.984   1.00 0.00 ? 31 GLU A O    13 
ATOM 9989  C CB   . GLU A 1 31 ? 3.301   9.691   4.376   1.00 0.00 ? 31 GLU A CB   13 
ATOM 9990  C CG   . GLU A 1 31 ? 2.570   9.644   3.045   1.00 0.00 ? 31 GLU A CG   13 
ATOM 9991  C CD   . GLU A 1 31 ? 1.668   10.845  2.835   1.00 0.00 ? 31 GLU A CD   13 
ATOM 9992  O OE1  . GLU A 1 31 ? 0.557   10.860  3.407   1.00 0.00 ? 31 GLU A OE1  13 
ATOM 9993  O OE2  . GLU A 1 31 ? 2.071   11.771  2.099   1.00 0.00 ? 31 GLU A OE2  13 
ATOM 9994  H H    . GLU A 1 31 ? 5.057   7.933   2.645   1.00 0.00 ? 31 GLU A H    13 
ATOM 9995  H HA   . GLU A 1 31 ? 4.968   8.828   5.397   1.00 0.00 ? 31 GLU A HA   13 
ATOM 9996  H HB2  . GLU A 1 31 ? 2.573   9.585   5.166   1.00 0.00 ? 31 GLU A HB2  13 
ATOM 9997  H HB3  . GLU A 1 31 ? 3.779   10.654  4.467   1.00 0.00 ? 31 GLU A HB3  13 
ATOM 9998  H HG2  . GLU A 1 31 ? 3.300   9.619   2.249   1.00 0.00 ? 31 GLU A HG2  13 
ATOM 9999  H HG3  . GLU A 1 31 ? 1.968   8.749   3.011   1.00 0.00 ? 31 GLU A HG3  13 
ATOM 10000 N N    . GLU A 1 32 ? 2.909   7.174   5.839   1.00 0.00 ? 32 GLU A N    13 
ATOM 10001 C CA   . GLU A 1 32 ? 2.194   5.950   6.190   1.00 0.00 ? 32 GLU A CA   13 
ATOM 10002 C C    . GLU A 1 32 ? 0.911   5.814   5.395   1.00 0.00 ? 32 GLU A C    13 
ATOM 10003 O O    . GLU A 1 32 ? 0.390   6.792   4.860   1.00 0.00 ? 32 GLU A O    13 
ATOM 10004 C CB   . GLU A 1 32 ? 1.836   5.943   7.675   1.00 0.00 ? 32 GLU A CB   13 
ATOM 10005 C CG   . GLU A 1 32 ? 1.397   4.582   8.184   1.00 0.00 ? 32 GLU A CG   13 
ATOM 10006 C CD   . GLU A 1 32 ? -0.111  4.422   8.202   1.00 0.00 ? 32 GLU A CD   13 
ATOM 10007 O OE1  . GLU A 1 32 ? -0.818  5.451   8.197   1.00 0.00 ? 32 GLU A OE1  13 
ATOM 10008 O OE2  . GLU A 1 32 ? -0.585  3.266   8.222   1.00 0.00 ? 32 GLU A OE2  13 
ATOM 10009 H H    . GLU A 1 32 ? 2.819   7.961   6.415   1.00 0.00 ? 32 GLU A H    13 
ATOM 10010 H HA   . GLU A 1 32 ? 2.836   5.110   5.978   1.00 0.00 ? 32 GLU A HA   13 
ATOM 10011 H HB2  . GLU A 1 32 ? 2.690   6.261   8.245   1.00 0.00 ? 32 GLU A HB2  13 
ATOM 10012 H HB3  . GLU A 1 32 ? 1.023   6.638   7.836   1.00 0.00 ? 32 GLU A HB3  13 
ATOM 10013 H HG2  . GLU A 1 32 ? 1.815   3.823   7.541   1.00 0.00 ? 32 GLU A HG2  13 
ATOM 10014 H HG3  . GLU A 1 32 ? 1.771   4.450   9.189   1.00 0.00 ? 32 GLU A HG3  13 
ATOM 10015 N N    . HIS A 1 33 ? 0.388   4.597   5.346   1.00 0.00 ? 33 HIS A N    13 
ATOM 10016 C CA   . HIS A 1 33 ? -0.858  4.347   4.640   1.00 0.00 ? 33 HIS A CA   13 
ATOM 10017 C C    . HIS A 1 33 ? -1.534  3.081   5.144   1.00 0.00 ? 33 HIS A C    13 
ATOM 10018 O O    . HIS A 1 33 ? -0.943  2.009   5.164   1.00 0.00 ? 33 HIS A O    13 
ATOM 10019 C CB   . HIS A 1 33 ? -0.624  4.251   3.133   1.00 0.00 ? 33 HIS A CB   13 
ATOM 10020 C CG   . HIS A 1 33 ? -1.794  4.728   2.329   1.00 0.00 ? 33 HIS A CG   13 
ATOM 10021 N ND1  . HIS A 1 33 ? -2.962  4.006   2.199   1.00 0.00 ? 33 HIS A ND1  13 
ATOM 10022 C CD2  . HIS A 1 33 ? -1.977  5.867   1.619   1.00 0.00 ? 33 HIS A CD2  13 
ATOM 10023 C CE1  . HIS A 1 33 ? -3.812  4.679   1.445   1.00 0.00 ? 33 HIS A CE1  13 
ATOM 10024 N NE2  . HIS A 1 33 ? -3.238  5.811   1.080   1.00 0.00 ? 33 HIS A NE2  13 
ATOM 10025 H H    . HIS A 1 33 ? 0.845   3.855   5.809   1.00 0.00 ? 33 HIS A H    13 
ATOM 10026 H HA   . HIS A 1 33 ? -1.513  5.183   4.834   1.00 0.00 ? 33 HIS A HA   13 
ATOM 10027 H HB2  . HIS A 1 33 ? 0.232   4.853   2.868   1.00 0.00 ? 33 HIS A HB2  13 
ATOM 10028 H HB3  . HIS A 1 33 ? -0.434  3.222   2.868   1.00 0.00 ? 33 HIS A HB3  13 
ATOM 10029 H HD1  . HIS A 1 33 ? -3.142  3.130   2.601   1.00 0.00 ? 33 HIS A HD1  13 
ATOM 10030 H HD2  . HIS A 1 33 ? -1.262  6.669   1.498   1.00 0.00 ? 33 HIS A HD2  13 
ATOM 10031 H HE1  . HIS A 1 33 ? -4.807  4.359   1.173   1.00 0.00 ? 33 HIS A HE1  13 
ATOM 10032 H HE2  . HIS A 1 33 ? -3.675  6.529   0.575   1.00 0.00 ? 33 HIS A HE2  13 
ATOM 10033 N N    . ARG A 1 34 ? -2.782  3.215   5.556   1.00 0.00 ? 34 ARG A N    13 
ATOM 10034 C CA   . ARG A 1 34 ? -3.536  2.072   6.055   1.00 0.00 ? 34 ARG A CA   13 
ATOM 10035 C C    . ARG A 1 34 ? -4.077  1.230   4.902   1.00 0.00 ? 34 ARG A C    13 
ATOM 10036 O O    . ARG A 1 34 ? -3.903  0.013   4.879   1.00 0.00 ? 34 ARG A O    13 
ATOM 10037 C CB   . ARG A 1 34 ? -4.688  2.529   6.940   1.00 0.00 ? 34 ARG A CB   13 
ATOM 10038 C CG   . ARG A 1 34 ? -4.846  1.700   8.205   1.00 0.00 ? 34 ARG A CG   13 
ATOM 10039 C CD   . ARG A 1 34 ? -5.341  0.294   7.895   1.00 0.00 ? 34 ARG A CD   13 
ATOM 10040 N NE   . ARG A 1 34 ? -4.284  -0.553  7.349   1.00 0.00 ? 34 ARG A NE   13 
ATOM 10041 C CZ   . ARG A 1 34 ? -4.495  -1.748  6.802   1.00 0.00 ? 34 ARG A CZ   13 
ATOM 10042 N NH1  . ARG A 1 34 ? -5.719  -2.255  6.747   1.00 0.00 ? 34 ARG A NH1  13 
ATOM 10043 N NH2  . ARG A 1 34 ? -3.478  -2.436  6.304   1.00 0.00 ? 34 ARG A NH2  13 
ATOM 10044 H H    . ARG A 1 34 ? -3.201  4.100   5.528   1.00 0.00 ? 34 ARG A H    13 
ATOM 10045 H HA   . ARG A 1 34 ? -2.863  1.466   6.641   1.00 0.00 ? 34 ARG A HA   13 
ATOM 10046 H HB2  . ARG A 1 34 ? -4.519  3.554   7.222   1.00 0.00 ? 34 ARG A HB2  13 
ATOM 10047 H HB3  . ARG A 1 34 ? -5.605  2.462   6.374   1.00 0.00 ? 34 ARG A HB3  13 
ATOM 10048 H HG2  . ARG A 1 34 ? -3.889  1.630   8.701   1.00 0.00 ? 34 ARG A HG2  13 
ATOM 10049 H HG3  . ARG A 1 34 ? -5.556  2.187   8.857   1.00 0.00 ? 34 ARG A HG3  13 
ATOM 10050 H HD2  . ARG A 1 34 ? -5.711  -0.152  8.806   1.00 0.00 ? 34 ARG A HD2  13 
ATOM 10051 H HD3  . ARG A 1 34 ? -6.145  0.360   7.176   1.00 0.00 ? 34 ARG A HD3  13 
ATOM 10052 H HE   . ARG A 1 34 ? -3.367  -0.210  7.384   1.00 0.00 ? 34 ARG A HE   13 
ATOM 10053 H HH11 . ARG A 1 34 ? -6.490  -1.741  7.116   1.00 0.00 ? 34 ARG A HH11 13 
ATOM 10054 H HH12 . ARG A 1 34 ? -5.870  -3.154  6.334   1.00 0.00 ? 34 ARG A HH12 13 
ATOM 10055 H HH21 . ARG A 1 34 ? -2.554  -2.056  6.338   1.00 0.00 ? 34 ARG A HH21 13 
ATOM 10056 H HH22 . ARG A 1 34 ? -3.634  -3.336  5.895   1.00 0.00 ? 34 ARG A HH22 13 
ATOM 10057 N N    . ASN A 1 35 ? -4.730  1.880   3.942   1.00 0.00 ? 35 ASN A N    13 
ATOM 10058 C CA   . ASN A 1 35 ? -5.287  1.169   2.795   1.00 0.00 ? 35 ASN A CA   13 
ATOM 10059 C C    . ASN A 1 35 ? -4.196  0.862   1.779   1.00 0.00 ? 35 ASN A C    13 
ATOM 10060 O O    . ASN A 1 35 ? -4.264  1.272   0.617   1.00 0.00 ? 35 ASN A O    13 
ATOM 10061 C CB   . ASN A 1 35 ? -6.401  1.984   2.137   1.00 0.00 ? 35 ASN A CB   13 
ATOM 10062 C CG   . ASN A 1 35 ? -7.672  2.012   2.966   1.00 0.00 ? 35 ASN A CG   13 
ATOM 10063 O OD1  . ASN A 1 35 ? -8.275  3.068   3.157   1.00 0.00 ? 35 ASN A OD1  13 
ATOM 10064 N ND2  . ASN A 1 35 ? -8.091  0.848   3.462   1.00 0.00 ? 35 ASN A ND2  13 
ATOM 10065 H H    . ASN A 1 35 ? -4.838  2.851   4.006   1.00 0.00 ? 35 ASN A H    13 
ATOM 10066 H HA   . ASN A 1 35 ? -5.696  0.237   3.153   1.00 0.00 ? 35 ASN A HA   13 
ATOM 10067 H HB2  . ASN A 1 35 ? -6.062  3.000   2.001   1.00 0.00 ? 35 ASN A HB2  13 
ATOM 10068 H HB3  . ASN A 1 35 ? -6.631  1.554   1.173   1.00 0.00 ? 35 ASN A HB3  13 
ATOM 10069 H HD21 . ASN A 1 35 ? -7.567  0.044   3.270   1.00 0.00 ? 35 ASN A HD21 13 
ATOM 10070 H HD22 . ASN A 1 35 ? -8.914  0.841   3.998   1.00 0.00 ? 35 ASN A HD22 13 
ATOM 10071 N N    . MET A 1 36 ? -3.189  0.129   2.234   1.00 0.00 ? 36 MET A N    13 
ATOM 10072 C CA   . MET A 1 36 ? -2.068  -0.259  1.395   1.00 0.00 ? 36 MET A CA   13 
ATOM 10073 C C    . MET A 1 36 ? -2.548  -0.937  0.119   1.00 0.00 ? 36 MET A C    13 
ATOM 10074 O O    . MET A 1 36 ? -1.875  -0.897  -0.911  1.00 0.00 ? 36 MET A O    13 
ATOM 10075 C CB   . MET A 1 36 ? -1.155  -1.197  2.180   1.00 0.00 ? 36 MET A CB   13 
ATOM 10076 C CG   . MET A 1 36 ? 0.182   -1.460  1.505   1.00 0.00 ? 36 MET A CG   13 
ATOM 10077 S SD   . MET A 1 36 ? 0.090   -2.761  0.261   1.00 0.00 ? 36 MET A SD   13 
ATOM 10078 C CE   . MET A 1 36 ? -0.500  -4.132  1.250   1.00 0.00 ? 36 MET A CE   13 
ATOM 10079 H H    . MET A 1 36 ? -3.202  -0.167  3.168   1.00 0.00 ? 36 MET A H    13 
ATOM 10080 H HA   . MET A 1 36 ? -1.519  0.633   1.135   1.00 0.00 ? 36 MET A HA   13 
ATOM 10081 H HB2  . MET A 1 36 ? -0.972  -0.765  3.151   1.00 0.00 ? 36 MET A HB2  13 
ATOM 10082 H HB3  . MET A 1 36 ? -1.663  -2.141  2.311   1.00 0.00 ? 36 MET A HB3  13 
ATOM 10083 H HG2  . MET A 1 36 ? 0.515   -0.550  1.030   1.00 0.00 ? 36 MET A HG2  13 
ATOM 10084 H HG3  . MET A 1 36 ? 0.898   -1.751  2.260   1.00 0.00 ? 36 MET A HG3  13 
ATOM 10085 H HE1  . MET A 1 36 ? -1.502  -4.393  0.943   1.00 0.00 ? 36 MET A HE1  13 
ATOM 10086 H HE2  . MET A 1 36 ? -0.505  -3.848  2.292   1.00 0.00 ? 36 MET A HE2  13 
ATOM 10087 H HE3  . MET A 1 36 ? 0.152   -4.982  1.112   1.00 0.00 ? 36 MET A HE3  13 
ATOM 10088 N N    . CYS A 1 37 ? -3.721  -1.556  0.194   1.00 0.00 ? 37 CYS A N    13 
ATOM 10089 C CA   . CYS A 1 37 ? -4.298  -2.240  -0.954  1.00 0.00 ? 37 CYS A CA   13 
ATOM 10090 C C    . CYS A 1 37 ? -4.526  -1.267  -2.100  1.00 0.00 ? 37 CYS A C    13 
ATOM 10091 O O    . CYS A 1 37 ? -3.875  -1.353  -3.141  1.00 0.00 ? 37 CYS A O    13 
ATOM 10092 C CB   . CYS A 1 37 ? -5.619  -2.905  -0.562  1.00 0.00 ? 37 CYS A CB   13 
ATOM 10093 S SG   . CYS A 1 37 ? -5.429  -4.446  0.393   1.00 0.00 ? 37 CYS A SG   13 
ATOM 10094 H H    . CYS A 1 37 ? -4.211  -1.549  1.042   1.00 0.00 ? 37 CYS A H    13 
ATOM 10095 H HA   . CYS A 1 37 ? -3.601  -2.993  -1.276  1.00 0.00 ? 37 CYS A HA   13 
ATOM 10096 H HB2  . CYS A 1 37 ? -6.194  -2.218  0.040   1.00 0.00 ? 37 CYS A HB2  13 
ATOM 10097 H HB3  . CYS A 1 37 ? -6.174  -3.139  -1.457  1.00 0.00 ? 37 CYS A HB3  13 
ATOM 10098 N N    . ALA A 1 38 ? -5.451  -0.339  -1.897  1.00 0.00 ? 38 ALA A N    13 
ATOM 10099 C CA   . ALA A 1 38 ? -5.768  0.660   -2.912  1.00 0.00 ? 38 ALA A CA   13 
ATOM 10100 C C    . ALA A 1 38 ? -4.505  1.336   -3.421  1.00 0.00 ? 38 ALA A C    13 
ATOM 10101 O O    . ALA A 1 38 ? -4.458  1.824   -4.549  1.00 0.00 ? 38 ALA A O    13 
ATOM 10102 C CB   . ALA A 1 38 ? -6.739  1.690   -2.356  1.00 0.00 ? 38 ALA A CB   13 
ATOM 10103 H H    . ALA A 1 38 ? -5.929  -0.323  -1.043  1.00 0.00 ? 38 ALA A H    13 
ATOM 10104 H HA   . ALA A 1 38 ? -6.243  0.158   -3.736  1.00 0.00 ? 38 ALA A HA   13 
ATOM 10105 H HB1  . ALA A 1 38 ? -7.254  1.275   -1.502  1.00 0.00 ? 38 ALA A HB1  13 
ATOM 10106 H HB2  . ALA A 1 38 ? -7.459  1.955   -3.117  1.00 0.00 ? 38 ALA A HB2  13 
ATOM 10107 H HB3  . ALA A 1 38 ? -6.195  2.573   -2.053  1.00 0.00 ? 38 ALA A HB3  13 
ATOM 10108 N N    . LEU A 1 39 ? -3.482  1.358   -2.580  1.00 0.00 ? 39 LEU A N    13 
ATOM 10109 C CA   . LEU A 1 39 ? -2.213  1.970   -2.932  1.00 0.00 ? 39 LEU A CA   13 
ATOM 10110 C C    . LEU A 1 39 ? -1.466  1.128   -3.952  1.00 0.00 ? 39 LEU A C    13 
ATOM 10111 O O    . LEU A 1 39 ? -0.967  1.639   -4.952  1.00 0.00 ? 39 LEU A O    13 
ATOM 10112 C CB   . LEU A 1 39 ? -1.364  2.117   -1.674  1.00 0.00 ? 39 LEU A CB   13 
ATOM 10113 C CG   . LEU A 1 39 ? -0.975  3.549   -1.305  1.00 0.00 ? 39 LEU A CG   13 
ATOM 10114 C CD1  . LEU A 1 39 ? -2.194  4.456   -1.313  1.00 0.00 ? 39 LEU A CD1  13 
ATOM 10115 C CD2  . LEU A 1 39 ? -0.293  3.578   0.056   1.00 0.00 ? 39 LEU A CD2  13 
ATOM 10116 H H    . LEU A 1 39 ? -3.585  0.953   -1.691  1.00 0.00 ? 39 LEU A H    13 
ATOM 10117 H HA   . LEU A 1 39 ? -2.409  2.940   -3.351  1.00 0.00 ? 39 LEU A HA   13 
ATOM 10118 H HB2  . LEU A 1 39 ? -1.915  1.685   -0.856  1.00 0.00 ? 39 LEU A HB2  13 
ATOM 10119 H HB3  . LEU A 1 39 ? -0.456  1.547   -1.810  1.00 0.00 ? 39 LEU A HB3  13 
ATOM 10120 H HG   . LEU A 1 39 ? -0.276  3.925   -2.034  1.00 0.00 ? 39 LEU A HG   13 
ATOM 10121 H HD11 . LEU A 1 39 ? -1.954  5.387   -0.820  1.00 0.00 ? 39 LEU A HD11 13 
ATOM 10122 H HD12 . LEU A 1 39 ? -3.007  3.972   -0.792  1.00 0.00 ? 39 LEU A HD12 13 
ATOM 10123 H HD13 . LEU A 1 39 ? -2.489  4.654   -2.333  1.00 0.00 ? 39 LEU A HD13 13 
ATOM 10124 H HD21 . LEU A 1 39 ? 0.694   3.148   -0.027  1.00 0.00 ? 39 LEU A HD21 13 
ATOM 10125 H HD22 . LEU A 1 39 ? -0.877  3.007   0.763   1.00 0.00 ? 39 LEU A HD22 13 
ATOM 10126 H HD23 . LEU A 1 39 ? -0.213  4.599   0.396   1.00 0.00 ? 39 LEU A HD23 13 
ATOM 10127 N N    . CYS A 1 40 ? -1.386  -0.165  -3.681  1.00 0.00 ? 40 CYS A N    13 
ATOM 10128 C CA   . CYS A 1 40 ? -0.686  -1.083  -4.564  1.00 0.00 ? 40 CYS A CA   13 
ATOM 10129 C C    . CYS A 1 40 ? -1.400  -1.200  -5.902  1.00 0.00 ? 40 CYS A C    13 
ATOM 10130 O O    . CYS A 1 40 ? -0.764  -1.327  -6.948  1.00 0.00 ? 40 CYS A O    13 
ATOM 10131 C CB   . CYS A 1 40 ? -0.557  -2.459  -3.904  1.00 0.00 ? 40 CYS A CB   13 
ATOM 10132 S SG   . CYS A 1 40 ? -2.058  -3.489  -4.000  1.00 0.00 ? 40 CYS A SG   13 
ATOM 10133 H H    . CYS A 1 40 ? -1.803  -0.510  -2.864  1.00 0.00 ? 40 CYS A H    13 
ATOM 10134 H HA   . CYS A 1 40 ? 0.301   -0.685  -4.734  1.00 0.00 ? 40 CYS A HA   13 
ATOM 10135 H HB2  . CYS A 1 40 ? 0.243   -3.004  -4.380  1.00 0.00 ? 40 CYS A HB2  13 
ATOM 10136 H HB3  . CYS A 1 40 ? -0.321  -2.322  -2.859  1.00 0.00 ? 40 CYS A HB3  13 
ATOM 10137 N N    . CYS A 1 41 ? -2.725  -1.161  -5.862  1.00 0.00 ? 41 CYS A N    13 
ATOM 10138 C CA   . CYS A 1 41 ? -3.520  -1.271  -7.074  1.00 0.00 ? 41 CYS A CA   13 
ATOM 10139 C C    . CYS A 1 41 ? -3.567  0.051   -7.833  1.00 0.00 ? 41 CYS A C    13 
ATOM 10140 O O    . CYS A 1 41 ? -3.567  0.076   -9.064  1.00 0.00 ? 41 CYS A O    13 
ATOM 10141 C CB   . CYS A 1 41 ? -4.929  -1.730  -6.720  1.00 0.00 ? 41 CYS A CB   13 
ATOM 10142 S SG   . CYS A 1 41 ? -6.138  -0.400  -6.425  1.00 0.00 ? 41 CYS A SG   13 
ATOM 10143 H H    . CYS A 1 41 ? -3.181  -1.064  -4.993  1.00 0.00 ? 41 CYS A H    13 
ATOM 10144 H HA   . CYS A 1 41 ? -3.064  -2.021  -7.700  1.00 0.00 ? 41 CYS A HA   13 
ATOM 10145 H HB2  . CYS A 1 41 ? -5.308  -2.340  -7.519  1.00 0.00 ? 41 CYS A HB2  13 
ATOM 10146 H HB3  . CYS A 1 41 ? -4.873  -2.320  -5.823  1.00 0.00 ? 41 CYS A HB3  13 
ATOM 10147 N N    . GLU A 1 42 ? -3.634  1.144   -7.086  1.00 0.00 ? 42 GLU A N    13 
ATOM 10148 C CA   . GLU A 1 42 ? -3.715  2.479   -7.685  1.00 0.00 ? 42 GLU A CA   13 
ATOM 10149 C C    . GLU A 1 42 ? -2.352  2.997   -8.147  1.00 0.00 ? 42 GLU A C    13 
ATOM 10150 O O    . GLU A 1 42 ? -2.267  3.752   -9.116  1.00 0.00 ? 42 GLU A O    13 
ATOM 10151 C CB   . GLU A 1 42 ? -4.333  3.468   -6.697  1.00 0.00 ? 42 GLU A CB   13 
ATOM 10152 C CG   . GLU A 1 42 ? -4.736  4.788   -7.332  1.00 0.00 ? 42 GLU A CG   13 
ATOM 10153 C CD   . GLU A 1 42 ? -6.062  4.701   -8.063  1.00 0.00 ? 42 GLU A CD   13 
ATOM 10154 O OE1  . GLU A 1 42 ? -6.227  3.775   -8.885  1.00 0.00 ? 42 GLU A OE1  13 
ATOM 10155 O OE2  . GLU A 1 42 ? -6.936  5.558   -7.814  1.00 0.00 ? 42 GLU A OE2  13 
ATOM 10156 H H    . GLU A 1 42 ? -3.651  1.050   -6.104  1.00 0.00 ? 42 GLU A H    13 
ATOM 10157 H HA   . GLU A 1 42 ? -4.360  2.407   -8.547  1.00 0.00 ? 42 GLU A HA   13 
ATOM 10158 H HB2  . GLU A 1 42 ? -5.214  3.019   -6.261  1.00 0.00 ? 42 GLU A HB2  13 
ATOM 10159 H HB3  . GLU A 1 42 ? -3.618  3.672   -5.914  1.00 0.00 ? 42 GLU A HB3  13 
ATOM 10160 H HG2  . GLU A 1 42 ? -4.819  5.535   -6.557  1.00 0.00 ? 42 GLU A HG2  13 
ATOM 10161 H HG3  . GLU A 1 42 ? -3.973  5.082   -8.036  1.00 0.00 ? 42 GLU A HG3  13 
ATOM 10162 N N    . HIS A 1 43 ? -1.292  2.606   -7.450  1.00 0.00 ? 43 HIS A N    13 
ATOM 10163 C CA   . HIS A 1 43 ? 0.054   3.057   -7.796  1.00 0.00 ? 43 HIS A CA   13 
ATOM 10164 C C    . HIS A 1 43 ? 0.629   2.262   -8.965  1.00 0.00 ? 43 HIS A C    13 
ATOM 10165 O O    . HIS A 1 43 ? 0.057   1.256   -9.386  1.00 0.00 ? 43 HIS A O    13 
ATOM 10166 C CB   . HIS A 1 43 ? 0.966   2.960   -6.574  1.00 0.00 ? 43 HIS A CB   13 
ATOM 10167 C CG   . HIS A 1 43 ? 0.707   4.046   -5.578  1.00 0.00 ? 43 HIS A CG   13 
ATOM 10168 N ND1  . HIS A 1 43 ? 0.469   5.355   -5.941  1.00 0.00 ? 43 HIS A ND1  13 
ATOM 10169 C CD2  . HIS A 1 43 ? 0.633   4.013   -4.228  1.00 0.00 ? 43 HIS A CD2  13 
ATOM 10170 C CE1  . HIS A 1 43 ? 0.263   6.080   -4.856  1.00 0.00 ? 43 HIS A CE1  13 
ATOM 10171 N NE2  . HIS A 1 43 ? 0.357   5.290   -3.804  1.00 0.00 ? 43 HIS A NE2  13 
ATOM 10172 H H    . HIS A 1 43 ? -1.417  2.013   -6.681  1.00 0.00 ? 43 HIS A H    13 
ATOM 10173 H HA   . HIS A 1 43 ? -0.010  4.093   -8.094  1.00 0.00 ? 43 HIS A HA   13 
ATOM 10174 H HB2  . HIS A 1 43 ? 0.809   2.011   -6.087  1.00 0.00 ? 43 HIS A HB2  13 
ATOM 10175 H HB3  . HIS A 1 43 ? 1.994   3.034   -6.888  1.00 0.00 ? 43 HIS A HB3  13 
ATOM 10176 H HD1  . HIS A 1 43 ? 0.457   5.702   -6.857  1.00 0.00 ? 43 HIS A HD1  13 
ATOM 10177 H HD2  . HIS A 1 43 ? 0.768   3.144   -3.601  1.00 0.00 ? 43 HIS A HD2  13 
ATOM 10178 H HE1  . HIS A 1 43 ? 0.052   7.139   -4.835  1.00 0.00 ? 43 HIS A HE1  13 
ATOM 10179 H HE2  . HIS A 1 43 ? 0.377   5.595   -2.872  1.00 0.00 ? 43 HIS A HE2  13 
ATOM 10180 N N    . PRO A 1 44 ? 1.771   2.714   -9.512  1.00 0.00 ? 44 PRO A N    13 
ATOM 10181 C CA   . PRO A 1 44 ? 2.426   2.053   -10.645 1.00 0.00 ? 44 PRO A CA   13 
ATOM 10182 C C    . PRO A 1 44 ? 2.953   0.677   -10.269 1.00 0.00 ? 44 PRO A C    13 
ATOM 10183 O O    . PRO A 1 44 ? 4.121   0.522   -9.912  1.00 0.00 ? 44 PRO A O    13 
ATOM 10184 C CB   . PRO A 1 44 ? 3.584   3.000   -11.004 1.00 0.00 ? 44 PRO A CB   13 
ATOM 10185 C CG   . PRO A 1 44 ? 3.269   4.285   -10.312 1.00 0.00 ? 44 PRO A CG   13 
ATOM 10186 C CD   . PRO A 1 44 ? 2.515   3.904   -9.075  1.00 0.00 ? 44 PRO A CD   13 
ATOM 10187 H HA   . PRO A 1 44 ? 1.757   1.961   -11.489 1.00 0.00 ? 44 PRO A HA   13 
ATOM 10188 H HB2  . PRO A 1 44 ? 4.515   2.581   -10.652 1.00 0.00 ? 44 PRO A HB2  13 
ATOM 10189 H HB3  . PRO A 1 44 ? 3.625   3.130   -12.076 1.00 0.00 ? 44 PRO A HB3  13 
ATOM 10190 H HG2  . PRO A 1 44 ? 4.183   4.797   -10.053 1.00 0.00 ? 44 PRO A HG2  13 
ATOM 10191 H HG3  . PRO A 1 44 ? 2.656   4.906   -10.949 1.00 0.00 ? 44 PRO A HG3  13 
ATOM 10192 H HD2  . PRO A 1 44 ? 3.200   3.658   -8.276  1.00 0.00 ? 44 PRO A HD2  13 
ATOM 10193 H HD3  . PRO A 1 44 ? 1.844   4.693   -8.770  1.00 0.00 ? 44 PRO A HD3  13 
ATOM 10194 N N    . GLY A 1 45 ? 2.077   -0.321  -10.334 1.00 0.00 ? 45 GLY A N    13 
ATOM 10195 C CA   . GLY A 1 45 ? 2.470   -1.669  -9.979  1.00 0.00 ? 45 GLY A CA   13 
ATOM 10196 C C    . GLY A 1 45 ? 2.880   -1.774  -8.522  1.00 0.00 ? 45 GLY A C    13 
ATOM 10197 O O    . GLY A 1 45 ? 3.528   -2.742  -8.122  1.00 0.00 ? 45 GLY A O    13 
ATOM 10198 H H    . GLY A 1 45 ? 1.157   -0.136  -10.613 1.00 0.00 ? 45 GLY A H    13 
ATOM 10199 H HA2  . GLY A 1 45 ? 1.638   -2.334  -10.159 1.00 0.00 ? 45 GLY A HA2  13 
ATOM 10200 H HA3  . GLY A 1 45 ? 3.302   -1.967  -10.600 1.00 0.00 ? 45 GLY A HA3  13 
ATOM 10201 N N    . GLY A 1 46 ? 2.501   -0.774  -7.730  1.00 0.00 ? 46 GLY A N    13 
ATOM 10202 C CA   . GLY A 1 46 ? 2.840   -0.770  -6.320  1.00 0.00 ? 46 GLY A CA   13 
ATOM 10203 C C    . GLY A 1 46 ? 3.904   0.255   -5.981  1.00 0.00 ? 46 GLY A C    13 
ATOM 10204 O O    . GLY A 1 46 ? 5.072   0.084   -6.330  1.00 0.00 ? 46 GLY A O    13 
ATOM 10205 H H    . GLY A 1 46 ? 1.986   -0.030  -8.106  1.00 0.00 ? 46 GLY A H    13 
ATOM 10206 H HA2  . GLY A 1 46 ? 1.951   -0.551  -5.750  1.00 0.00 ? 46 GLY A HA2  13 
ATOM 10207 H HA3  . GLY A 1 46 ? 3.199   -1.750  -6.045  1.00 0.00 ? 46 GLY A HA3  13 
ATOM 10208 N N    . PHE A 1 47 ? 3.505   1.322   -5.292  1.00 0.00 ? 47 PHE A N    13 
ATOM 10209 C CA   . PHE A 1 47 ? 4.441   2.373   -4.898  1.00 0.00 ? 47 PHE A CA   13 
ATOM 10210 C C    . PHE A 1 47 ? 5.615   1.780   -4.136  1.00 0.00 ? 47 PHE A C    13 
ATOM 10211 O O    . PHE A 1 47 ? 5.713   0.563   -3.977  1.00 0.00 ? 47 PHE A O    13 
ATOM 10212 C CB   . PHE A 1 47 ? 3.735   3.420   -4.025  1.00 0.00 ? 47 PHE A CB   13 
ATOM 10213 C CG   . PHE A 1 47 ? 3.498   4.748   -4.702  1.00 0.00 ? 47 PHE A CG   13 
ATOM 10214 C CD1  . PHE A 1 47 ? 3.517   4.860   -6.083  1.00 0.00 ? 47 PHE A CD1  13 
ATOM 10215 C CD2  . PHE A 1 47 ? 3.250   5.884   -3.948  1.00 0.00 ? 47 PHE A CD2  13 
ATOM 10216 C CE1  . PHE A 1 47 ? 3.294   6.077   -6.698  1.00 0.00 ? 47 PHE A CE1  13 
ATOM 10217 C CE2  . PHE A 1 47 ? 3.027   7.104   -4.557  1.00 0.00 ? 47 PHE A CE2  13 
ATOM 10218 C CZ   . PHE A 1 47 ? 3.048   7.200   -5.935  1.00 0.00 ? 47 PHE A CZ   13 
ATOM 10219 H H    . PHE A 1 47 ? 2.561   1.401   -5.038  1.00 0.00 ? 47 PHE A H    13 
ATOM 10220 H HA   . PHE A 1 47 ? 4.811   2.845   -5.795  1.00 0.00 ? 47 PHE A HA   13 
ATOM 10221 H HB2  . PHE A 1 47 ? 2.778   3.031   -3.720  1.00 0.00 ? 47 PHE A HB2  13 
ATOM 10222 H HB3  . PHE A 1 47 ? 4.336   3.603   -3.145  1.00 0.00 ? 47 PHE A HB3  13 
ATOM 10223 H HD1  . PHE A 1 47 ? 3.710   3.986   -6.681  1.00 0.00 ? 47 PHE A HD1  13 
ATOM 10224 H HD2  . PHE A 1 47 ? 3.233   5.810   -2.870  1.00 0.00 ? 47 PHE A HD2  13 
ATOM 10225 H HE1  . PHE A 1 47 ? 3.312   6.150   -7.775  1.00 0.00 ? 47 PHE A HE1  13 
ATOM 10226 H HE2  . PHE A 1 47 ? 2.835   7.981   -3.957  1.00 0.00 ? 47 PHE A HE2  13 
ATOM 10227 H HZ   . PHE A 1 47 ? 2.873   8.151   -6.414  1.00 0.00 ? 47 PHE A HZ   13 
ATOM 10228 N N    . GLU A 1 48 ? 6.500   2.641   -3.655  1.00 0.00 ? 48 GLU A N    13 
ATOM 10229 C CA   . GLU A 1 48 ? 7.656   2.171   -2.898  1.00 0.00 ? 48 GLU A CA   13 
ATOM 10230 C C    . GLU A 1 48 ? 7.321   2.116   -1.418  1.00 0.00 ? 48 GLU A C    13 
ATOM 10231 O O    . GLU A 1 48 ? 7.828   2.906   -0.620  1.00 0.00 ? 48 GLU A O    13 
ATOM 10232 C CB   . GLU A 1 48 ? 8.889   3.058   -3.124  1.00 0.00 ? 48 GLU A CB   13 
ATOM 10233 C CG   . GLU A 1 48 ? 8.786   3.970   -4.330  1.00 0.00 ? 48 GLU A CG   13 
ATOM 10234 C CD   . GLU A 1 48 ? 9.935   3.788   -5.304  1.00 0.00 ? 48 GLU A CD   13 
ATOM 10235 O OE1  . GLU A 1 48 ? 11.006  4.387   -5.077  1.00 0.00 ? 48 GLU A OE1  13 
ATOM 10236 O OE2  . GLU A 1 48 ? 9.762   3.046   -6.294  1.00 0.00 ? 48 GLU A OE2  13 
ATOM 10237 H H    . GLU A 1 48 ? 6.369   3.607   -3.803  1.00 0.00 ? 48 GLU A H    13 
ATOM 10238 H HA   . GLU A 1 48 ? 7.880   1.168   -3.237  1.00 0.00 ? 48 GLU A HA   13 
ATOM 10239 H HB2  . GLU A 1 48 ? 9.038   3.676   -2.251  1.00 0.00 ? 48 GLU A HB2  13 
ATOM 10240 H HB3  . GLU A 1 48 ? 9.752   2.422   -3.252  1.00 0.00 ? 48 GLU A HB3  13 
ATOM 10241 H HG2  . GLU A 1 48 ? 7.862   3.761   -4.843  1.00 0.00 ? 48 GLU A HG2  13 
ATOM 10242 H HG3  . GLU A 1 48 ? 8.784   4.990   -3.985  1.00 0.00 ? 48 GLU A HG3  13 
ATOM 10243 N N    . TYR A 1 49 ? 6.461   1.177   -1.058  1.00 0.00 ? 49 TYR A N    13 
ATOM 10244 C CA   . TYR A 1 49 ? 6.060   1.013   0.326   1.00 0.00 ? 49 TYR A CA   13 
ATOM 10245 C C    . TYR A 1 49 ? 6.681   -0.222  0.931   1.00 0.00 ? 49 TYR A C    13 
ATOM 10246 O O    . TYR A 1 49 ? 7.185   -1.098  0.231   1.00 0.00 ? 49 TYR A O    13 
ATOM 10247 C CB   . TYR A 1 49 ? 4.558   0.916   0.467   1.00 0.00 ? 49 TYR A CB   13 
ATOM 10248 C CG   . TYR A 1 49 ? 3.898   -0.068  -0.449  1.00 0.00 ? 49 TYR A CG   13 
ATOM 10249 C CD1  . TYR A 1 49 ? 3.715   -1.382  -0.053  1.00 0.00 ? 49 TYR A CD1  13 
ATOM 10250 C CD2  . TYR A 1 49 ? 3.439   0.319   -1.694  1.00 0.00 ? 49 TYR A CD2  13 
ATOM 10251 C CE1  . TYR A 1 49 ? 3.093   -2.291  -0.876  1.00 0.00 ? 49 TYR A CE1  13 
ATOM 10252 C CE2  . TYR A 1 49 ? 2.812   -0.579  -2.525  1.00 0.00 ? 49 TYR A CE2  13 
ATOM 10253 C CZ   . TYR A 1 49 ? 2.640   -1.885  -2.116  1.00 0.00 ? 49 TYR A CZ   13 
ATOM 10254 O OH   . TYR A 1 49 ? 2.010   -2.781  -2.945  1.00 0.00 ? 49 TYR A OH   13 
ATOM 10255 H H    . TYR A 1 49 ? 6.091   0.578   -1.739  1.00 0.00 ? 49 TYR A H    13 
ATOM 10256 H HA   . TYR A 1 49 ? 6.394   1.869   0.886   1.00 0.00 ? 49 TYR A HA   13 
ATOM 10257 H HB2  . TYR A 1 49 ? 4.352   0.602   1.465   1.00 0.00 ? 49 TYR A HB2  13 
ATOM 10258 H HB3  . TYR A 1 49 ? 4.112   1.883   0.303   1.00 0.00 ? 49 TYR A HB3  13 
ATOM 10259 H HD1  . TYR A 1 49 ? 4.071   -1.694  0.918   1.00 0.00 ? 49 TYR A HD1  13 
ATOM 10260 H HD2  . TYR A 1 49 ? 3.578   1.341   -2.012  1.00 0.00 ? 49 TYR A HD2  13 
ATOM 10261 H HE1  . TYR A 1 49 ? 2.963   -3.311  -0.546  1.00 0.00 ? 49 TYR A HE1  13 
ATOM 10262 H HE2  . TYR A 1 49 ? 2.463   -0.257  -3.490  1.00 0.00 ? 49 TYR A HE2  13 
ATOM 10263 H HH   . TYR A 1 49 ? 1.338   -3.256  -2.451  1.00 0.00 ? 49 TYR A HH   13 
ATOM 10264 N N    . SER A 1 50 ? 6.621   -0.278  2.242   1.00 0.00 ? 50 SER A N    13 
ATOM 10265 C CA   . SER A 1 50 ? 7.158   -1.401  2.981   1.00 0.00 ? 50 SER A CA   13 
ATOM 10266 C C    . SER A 1 50 ? 6.294   -1.672  4.201   1.00 0.00 ? 50 SER A C    13 
ATOM 10267 O O    . SER A 1 50 ? 6.407   -0.986  5.217   1.00 0.00 ? 50 SER A O    13 
ATOM 10268 C CB   . SER A 1 50 ? 8.599   -1.116  3.393   1.00 0.00 ? 50 SER A CB   13 
ATOM 10269 O OG   . SER A 1 50 ? 8.928   0.249   3.204   1.00 0.00 ? 50 SER A OG   13 
ATOM 10270 H H    . SER A 1 50 ? 6.194   0.460   2.731   1.00 0.00 ? 50 SER A H    13 
ATOM 10271 H HA   . SER A 1 50 ? 7.137   -2.267  2.336   1.00 0.00 ? 50 SER A HA   13 
ATOM 10272 H HB2  . SER A 1 50 ? 8.729   -1.363  4.432   1.00 0.00 ? 50 SER A HB2  13 
ATOM 10273 H HB3  . SER A 1 50 ? 9.263   -1.716  2.790   1.00 0.00 ? 50 SER A HB3  13 
ATOM 10274 H HG   . SER A 1 50 ? 9.880   0.345   3.144   1.00 0.00 ? 50 SER A HG   13 
ATOM 10275 N N    . ASN A 1 51 ? 5.415   -2.659  4.091   1.00 0.00 ? 51 ASN A N    13 
ATOM 10276 C CA   . ASN A 1 51 ? 4.522   -2.993  5.189   1.00 0.00 ? 51 ASN A CA   13 
ATOM 10277 C C    . ASN A 1 51 ? 5.280   -3.126  6.498   1.00 0.00 ? 51 ASN A C    13 
ATOM 10278 O O    . ASN A 1 51 ? 6.304   -3.805  6.578   1.00 0.00 ? 51 ASN A O    13 
ATOM 10279 C CB   . ASN A 1 51 ? 3.757   -4.278  4.914   1.00 0.00 ? 51 ASN A CB   13 
ATOM 10280 C CG   . ASN A 1 51 ? 3.053   -4.262  3.571   1.00 0.00 ? 51 ASN A CG   13 
ATOM 10281 O OD1  . ASN A 1 51 ? 3.371   -3.453  2.700   1.00 0.00 ? 51 ASN A OD1  13 
ATOM 10282 N ND2  . ASN A 1 51 ? 2.089   -5.159  3.398   1.00 0.00 ? 51 ASN A ND2  13 
ATOM 10283 H H    . ASN A 1 51 ? 5.356   -3.162  3.252   1.00 0.00 ? 51 ASN A H    13 
ATOM 10284 H HA   . ASN A 1 51 ? 3.813   -2.186  5.287   1.00 0.00 ? 51 ASN A HA   13 
ATOM 10285 H HB2  . ASN A 1 51 ? 4.443   -5.111  4.934   1.00 0.00 ? 51 ASN A HB2  13 
ATOM 10286 H HB3  . ASN A 1 51 ? 3.017   -4.405  5.691   1.00 0.00 ? 51 ASN A HB3  13 
ATOM 10287 H HD21 . ASN A 1 51 ? 1.889   -5.772  4.135   1.00 0.00 ? 51 ASN A HD21 13 
ATOM 10288 H HD22 . ASN A 1 51 ? 1.617   -5.170  2.539   1.00 0.00 ? 51 ASN A HD22 13 
ATOM 10289 N N    . GLY A 1 52 ? 4.759   -2.471  7.516   1.00 0.00 ? 52 GLY A N    13 
ATOM 10290 C CA   . GLY A 1 52 ? 5.381   -2.514  8.827   1.00 0.00 ? 52 GLY A CA   13 
ATOM 10291 C C    . GLY A 1 52 ? 5.534   -1.140  9.448   1.00 0.00 ? 52 GLY A C    13 
ATOM 10292 O O    . GLY A 1 52 ? 5.409   -0.128  8.759   1.00 0.00 ? 52 GLY A O    13 
ATOM 10293 H H    . GLY A 1 52 ? 3.939   -1.952  7.373   1.00 0.00 ? 52 GLY A H    13 
ATOM 10294 H HA2  . GLY A 1 52 ? 4.776   -3.127  9.479   1.00 0.00 ? 52 GLY A HA2  13 
ATOM 10295 H HA3  . GLY A 1 52 ? 6.358   -2.965  8.733   1.00 0.00 ? 52 GLY A HA3  13 
ATOM 10296 N N    . PRO A 1 53 ? 5.805   -1.073  10.763  1.00 0.00 ? 53 PRO A N    13 
ATOM 10297 C CA   . PRO A 1 53 ? 5.972   0.198   11.470  1.00 0.00 ? 53 PRO A CA   13 
ATOM 10298 C C    . PRO A 1 53 ? 7.301   0.874   11.149  1.00 0.00 ? 53 PRO A C    13 
ATOM 10299 O O    . PRO A 1 53 ? 8.261   0.775   11.913  1.00 0.00 ? 53 PRO A O    13 
ATOM 10300 C CB   . PRO A 1 53 ? 5.924   -0.213  12.943  1.00 0.00 ? 53 PRO A CB   13 
ATOM 10301 C CG   . PRO A 1 53 ? 6.417   -1.618  12.957  1.00 0.00 ? 53 PRO A CG   13 
ATOM 10302 C CD   . PRO A 1 53 ? 5.967   -2.233  11.660  1.00 0.00 ? 53 PRO A CD   13 
ATOM 10303 H HA   . PRO A 1 53 ? 5.162   0.879   11.257  1.00 0.00 ? 53 PRO A HA   13 
ATOM 10304 H HB2  . PRO A 1 53 ? 6.563   0.438   13.522  1.00 0.00 ? 53 PRO A HB2  13 
ATOM 10305 H HB3  . PRO A 1 53 ? 4.909   -0.147  13.305  1.00 0.00 ? 53 PRO A HB3  13 
ATOM 10306 H HG2  . PRO A 1 53 ? 7.496   -1.628  13.022  1.00 0.00 ? 53 PRO A HG2  13 
ATOM 10307 H HG3  . PRO A 1 53 ? 5.986   -2.149  13.793  1.00 0.00 ? 53 PRO A HG3  13 
ATOM 10308 H HD2  . PRO A 1 53 ? 6.720   -2.910  11.282  1.00 0.00 ? 53 PRO A HD2  13 
ATOM 10309 H HD3  . PRO A 1 53 ? 5.028   -2.750  11.794  1.00 0.00 ? 53 PRO A HD3  13 
ATOM 10310 N N    . CYS A 1 54 ? 7.348   1.566   10.015  1.00 0.00 ? 54 CYS A N    13 
ATOM 10311 C CA   . CYS A 1 54 ? 8.559   2.266   9.594   1.00 0.00 ? 54 CYS A CA   13 
ATOM 10312 C C    . CYS A 1 54 ? 8.318   3.778   9.570   1.00 0.00 ? 54 CYS A C    13 
ATOM 10313 O O    . CYS A 1 54 ? 8.508   4.455   10.580  1.00 0.00 ? 54 CYS A O    13 
ATOM 10314 C CB   . CYS A 1 54 ? 9.040   1.762   8.219   1.00 0.00 ? 54 CYS A CB   13 
ATOM 10315 S SG   . CYS A 1 54 ? 7.851   0.696   7.328   1.00 0.00 ? 54 CYS A SG   13 
ATOM 10316 H H    . CYS A 1 54 ? 6.549   1.613   9.449   1.00 0.00 ? 54 CYS A H    13 
ATOM 10317 H HA   . CYS A 1 54 ? 9.325   2.056   10.328  1.00 0.00 ? 54 CYS A HA   13 
ATOM 10318 H HB2  . CYS A 1 54 ? 9.253   2.609   7.586   1.00 0.00 ? 54 CYS A HB2  13 
ATOM 10319 H HB3  . CYS A 1 54 ? 9.948   1.192   8.356   1.00 0.00 ? 54 CYS A HB3  13 
ATOM 10320 N N    . GLU A 1 55 ? 7.888   4.297   8.421   1.00 0.00 ? 55 GLU A N    13 
ATOM 10321 C CA   . GLU A 1 55 ? 7.605   5.725   8.264   1.00 0.00 ? 55 GLU A CA   13 
ATOM 10322 C C    . GLU A 1 55 ? 8.660   6.587   8.956   1.00 0.00 ? 55 GLU A C    13 
ATOM 10323 O O    . GLU A 1 55 ? 8.343   7.746   9.296   1.00 0.00 ? 55 GLU A O    13 
ATOM 10324 C CB   . GLU A 1 55 ? 6.213   6.048   8.815   1.00 0.00 ? 55 GLU A CB   13 
ATOM 10325 C CG   . GLU A 1 55 ? 6.108   5.917   10.326  1.00 0.00 ? 55 GLU A CG   13 
ATOM 10326 C CD   . GLU A 1 55 ? 4.743   6.317   10.851  1.00 0.00 ? 55 GLU A CD   13 
ATOM 10327 O OE1  . GLU A 1 55 ? 3.762   5.602   10.558  1.00 0.00 ? 55 GLU A OE1  13 
ATOM 10328 O OE2  . GLU A 1 55 ? 4.654   7.345   11.555  1.00 0.00 ? 55 GLU A OE2  13 
ATOM 10329 O OXT  . GLU A 1 55 ? 9.791   6.095   9.153   1.00 0.00 ? 55 GLU A OXT  13 
ATOM 10330 H H    . GLU A 1 55 ? 7.747   3.706   7.659   1.00 0.00 ? 55 GLU A H    13 
ATOM 10331 H HA   . GLU A 1 55 ? 7.620   5.946   7.208   1.00 0.00 ? 55 GLU A HA   13 
ATOM 10332 H HB2  . GLU A 1 55 ? 5.957   7.061   8.543   1.00 0.00 ? 55 GLU A HB2  13 
ATOM 10333 H HB3  . GLU A 1 55 ? 5.497   5.373   8.367   1.00 0.00 ? 55 GLU A HB3  13 
ATOM 10334 H HG2  . GLU A 1 55 ? 6.296   4.890   10.601  1.00 0.00 ? 55 GLU A HG2  13 
ATOM 10335 H HG3  . GLU A 1 55 ? 6.854   6.553   10.782  1.00 0.00 ? 55 GLU A HG3  13 
ATOM 10336 N N    . ALA A 1 1  ? 8.216   -4.534  2.008   1.00 0.00 ? 1  ALA A N    14 
ATOM 10337 C CA   . ALA A 1 1  ? 8.991   -4.471  0.742   1.00 0.00 ? 1  ALA A CA   14 
ATOM 10338 C C    . ALA A 1 1  ? 8.329   -3.533  -0.263  1.00 0.00 ? 1  ALA A C    14 
ATOM 10339 O O    . ALA A 1 1  ? 7.151   -3.203  -0.136  1.00 0.00 ? 1  ALA A O    14 
ATOM 10340 C CB   . ALA A 1 1  ? 9.138   -5.863  0.146   1.00 0.00 ? 1  ALA A CB   14 
ATOM 10341 H H1   . ALA A 1 1  ? 8.536   -5.371  2.535   1.00 0.00 ? 1  ALA A H1   14 
ATOM 10342 H H2   . ALA A 1 1  ? 7.209   -4.609  1.759   1.00 0.00 ? 1  ALA A H2   14 
ATOM 10343 H H3   . ALA A 1 1  ? 8.408   -3.663  2.541   1.00 0.00 ? 1  ALA A H3   14 
ATOM 10344 H HA   . ALA A 1 1  ? 9.980   -4.098  0.967   1.00 0.00 ? 1  ALA A HA   14 
ATOM 10345 H HB1  . ALA A 1 1  ? 8.285   -6.465  0.424   1.00 0.00 ? 1  ALA A HB1  14 
ATOM 10346 H HB2  . ALA A 1 1  ? 10.041  -6.322  0.521   1.00 0.00 ? 1  ALA A HB2  14 
ATOM 10347 H HB3  . ALA A 1 1  ? 9.190   -5.791  -0.930  1.00 0.00 ? 1  ALA A HB3  14 
ATOM 10348 N N    . HIS A 1 2  ? 9.095   -3.112  -1.265  1.00 0.00 ? 2  HIS A N    14 
ATOM 10349 C CA   . HIS A 1 2  ? 8.589   -2.216  -2.301  1.00 0.00 ? 2  HIS A CA   14 
ATOM 10350 C C    . HIS A 1 2  ? 7.933   -3.018  -3.415  1.00 0.00 ? 2  HIS A C    14 
ATOM 10351 O O    . HIS A 1 2  ? 8.264   -2.869  -4.591  1.00 0.00 ? 2  HIS A O    14 
ATOM 10352 C CB   . HIS A 1 2  ? 9.733   -1.367  -2.864  1.00 0.00 ? 2  HIS A CB   14 
ATOM 10353 C CG   . HIS A 1 2  ? 10.856  -1.154  -1.895  1.00 0.00 ? 2  HIS A CG   14 
ATOM 10354 N ND1  . HIS A 1 2  ? 10.659  -1.006  -0.539  1.00 0.00 ? 2  HIS A ND1  14 
ATOM 10355 C CD2  . HIS A 1 2  ? 12.193  -1.057  -2.092  1.00 0.00 ? 2  HIS A CD2  14 
ATOM 10356 C CE1  . HIS A 1 2  ? 11.822  -0.824  0.056   1.00 0.00 ? 2  HIS A CE1  14 
ATOM 10357 N NE2  . HIS A 1 2  ? 12.770  -0.853  -0.862  1.00 0.00 ? 2  HIS A NE2  14 
ATOM 10358 H H    . HIS A 1 2  ? 10.025  -3.414  -1.313  1.00 0.00 ? 2  HIS A H    14 
ATOM 10359 H HA   . HIS A 1 2  ? 7.849   -1.575  -1.853  1.00 0.00 ? 2  HIS A HA   14 
ATOM 10360 H HB2  . HIS A 1 2  ? 10.138  -1.858  -3.735  1.00 0.00 ? 2  HIS A HB2  14 
ATOM 10361 H HB3  . HIS A 1 2  ? 9.349   -0.400  -3.147  1.00 0.00 ? 2  HIS A HB3  14 
ATOM 10362 H HD1  . HIS A 1 2  ? 9.793   -1.030  -0.081  1.00 0.00 ? 2  HIS A HD1  14 
ATOM 10363 H HD2  . HIS A 1 2  ? 12.709  -1.129  -3.038  1.00 0.00 ? 2  HIS A HD2  14 
ATOM 10364 H HE1  . HIS A 1 2  ? 11.972  -0.667  1.112   1.00 0.00 ? 2  HIS A HE1  14 
ATOM 10365 H HE2  . HIS A 1 2  ? 13.733  -0.830  -0.681  1.00 0.00 ? 2  HIS A HE2  14 
ATOM 10366 N N    . MET A 1 3  ? 7.006   -3.875  -3.022  1.00 0.00 ? 3  MET A N    14 
ATOM 10367 C CA   . MET A 1 3  ? 6.291   -4.727  -3.977  1.00 0.00 ? 3  MET A CA   14 
ATOM 10368 C C    . MET A 1 3  ? 5.143   -5.521  -3.337  1.00 0.00 ? 3  MET A C    14 
ATOM 10369 O O    . MET A 1 3  ? 4.012   -5.490  -3.817  1.00 0.00 ? 3  MET A O    14 
ATOM 10370 C CB   . MET A 1 3  ? 7.268   -5.694  -4.651  1.00 0.00 ? 3  MET A CB   14 
ATOM 10371 C CG   . MET A 1 3  ? 8.292   -6.296  -3.700  1.00 0.00 ? 3  MET A CG   14 
ATOM 10372 S SD   . MET A 1 3  ? 9.991   -6.045  -4.255  1.00 0.00 ? 3  MET A SD   14 
ATOM 10373 C CE   . MET A 1 3  ? 10.738  -7.597  -3.768  1.00 0.00 ? 3  MET A CE   14 
ATOM 10374 H H    . MET A 1 3  ? 6.796   -3.921  -2.072  1.00 0.00 ? 3  MET A H    14 
ATOM 10375 H HA   . MET A 1 3  ? 5.875   -4.082  -4.735  1.00 0.00 ? 3  MET A HA   14 
ATOM 10376 H HB2  . MET A 1 3  ? 6.705   -6.501  -5.095  1.00 0.00 ? 3  MET A HB2  14 
ATOM 10377 H HB3  . MET A 1 3  ? 7.797   -5.164  -5.430  1.00 0.00 ? 3  MET A HB3  14 
ATOM 10378 H HG2  . MET A 1 3  ? 8.176   -5.838  -2.729  1.00 0.00 ? 3  MET A HG2  14 
ATOM 10379 H HG3  . MET A 1 3  ? 8.108   -7.357  -3.619  1.00 0.00 ? 3  MET A HG3  14 
ATOM 10380 H HE1  . MET A 1 3  ? 10.776  -8.262  -4.618  1.00 0.00 ? 3  MET A HE1  14 
ATOM 10381 H HE2  . MET A 1 3  ? 10.150  -8.050  -2.983  1.00 0.00 ? 3  MET A HE2  14 
ATOM 10382 H HE3  . MET A 1 3  ? 11.741  -7.418  -3.408  1.00 0.00 ? 3  MET A HE3  14 
ATOM 10383 N N    . ASP A 1 4  ? 5.464   -6.270  -2.281  1.00 0.00 ? 4  ASP A N    14 
ATOM 10384 C CA   . ASP A 1 4  ? 4.493   -7.127  -1.585  1.00 0.00 ? 4  ASP A CA   14 
ATOM 10385 C C    . ASP A 1 4  ? 3.171   -6.417  -1.272  1.00 0.00 ? 4  ASP A C    14 
ATOM 10386 O O    . ASP A 1 4  ? 3.100   -5.593  -0.359  1.00 0.00 ? 4  ASP A O    14 
ATOM 10387 C CB   . ASP A 1 4  ? 5.108   -7.657  -0.288  1.00 0.00 ? 4  ASP A CB   14 
ATOM 10388 C CG   . ASP A 1 4  ? 5.741   -9.023  -0.466  1.00 0.00 ? 4  ASP A CG   14 
ATOM 10389 O OD1  . ASP A 1 4  ? 6.388   -9.246  -1.511  1.00 0.00 ? 4  ASP A OD1  14 
ATOM 10390 O OD2  . ASP A 1 4  ? 5.590   -9.869  0.440   1.00 0.00 ? 4  ASP A OD2  14 
ATOM 10391 H H    . ASP A 1 4  ? 6.396   -6.275  -1.976  1.00 0.00 ? 4  ASP A H    14 
ATOM 10392 H HA   . ASP A 1 4  ? 4.282   -7.966  -2.229  1.00 0.00 ? 4  ASP A HA   14 
ATOM 10393 H HB2  . ASP A 1 4  ? 5.869   -6.969  0.049   1.00 0.00 ? 4  ASP A HB2  14 
ATOM 10394 H HB3  . ASP A 1 4  ? 4.336   -7.732  0.465   1.00 0.00 ? 4  ASP A HB3  14 
ATOM 10395 N N    . CYS A 1 5  ? 2.119   -6.766  -2.018  1.00 0.00 ? 5  CYS A N    14 
ATOM 10396 C CA   . CYS A 1 5  ? 0.790   -6.183  -1.809  1.00 0.00 ? 5  CYS A CA   14 
ATOM 10397 C C    . CYS A 1 5  ? -0.297  -7.068  -2.425  1.00 0.00 ? 5  CYS A C    14 
ATOM 10398 O O    . CYS A 1 5  ? -0.061  -8.242  -2.712  1.00 0.00 ? 5  CYS A O    14 
ATOM 10399 C CB   . CYS A 1 5  ? 0.717   -4.781  -2.411  1.00 0.00 ? 5  CYS A CB   14 
ATOM 10400 S SG   . CYS A 1 5  ? 1.264   -4.687  -4.147  1.00 0.00 ? 5  CYS A SG   14 
ATOM 10401 H H    . CYS A 1 5  ? 2.237   -7.444  -2.717  1.00 0.00 ? 5  CYS A H    14 
ATOM 10402 H HA   . CYS A 1 5  ? 0.623   -6.118  -0.744  1.00 0.00 ? 5  CYS A HA   14 
ATOM 10403 H HB2  . CYS A 1 5  ? -0.302  -4.435  -2.369  1.00 0.00 ? 5  CYS A HB2  14 
ATOM 10404 H HB3  . CYS A 1 5  ? 1.336   -4.115  -1.831  1.00 0.00 ? 5  CYS A HB3  14 
ATOM 10405 N N    . THR A 1 6  ? -1.490  -6.497  -2.634  1.00 0.00 ? 6  THR A N    14 
ATOM 10406 C CA   . THR A 1 6  ? -2.601  -7.236  -3.222  1.00 0.00 ? 6  THR A CA   14 
ATOM 10407 C C    . THR A 1 6  ? -2.188  -7.907  -4.541  1.00 0.00 ? 6  THR A C    14 
ATOM 10408 O O    . THR A 1 6  ? -2.844  -8.854  -4.968  1.00 0.00 ? 6  THR A O    14 
ATOM 10409 C CB   . THR A 1 6  ? -3.782  -6.293  -3.473  1.00 0.00 ? 6  THR A CB   14 
ATOM 10410 O OG1  . THR A 1 6  ? -3.377  -4.939  -3.375  1.00 0.00 ? 6  THR A OG1  14 
ATOM 10411 C CG2  . THR A 1 6  ? -4.926  -6.500  -2.506  1.00 0.00 ? 6  THR A CG2  14 
ATOM 10412 H H    . THR A 1 6  ? -1.628  -5.555  -2.392  1.00 0.00 ? 6  THR A H    14 
ATOM 10413 H HA   . THR A 1 6  ? -2.920  -8.005  -2.507  1.00 0.00 ? 6  THR A HA   14 
ATOM 10414 H HB   . THR A 1 6  ? -4.161  -6.461  -4.472  1.00 0.00 ? 6  THR A HB   14 
ATOM 10415 H HG1  . THR A 1 6  ? -3.245  -4.579  -4.255  1.00 0.00 ? 6  THR A HG1  14 
ATOM 10416 H HG21 . THR A 1 6  ? -5.741  -5.839  -2.764  1.00 0.00 ? 6  THR A HG21 14 
ATOM 10417 H HG22 . THR A 1 6  ? -4.592  -6.285  -1.502  1.00 0.00 ? 6  THR A HG22 14 
ATOM 10418 H HG23 . THR A 1 6  ? -5.265  -7.524  -2.561  1.00 0.00 ? 6  THR A HG23 14 
ATOM 10419 N N    . GLU A 1 7  ? -1.104  -7.408  -5.192  1.00 0.00 ? 7  GLU A N    14 
ATOM 10420 C CA   . GLU A 1 7  ? -0.625  -7.960  -6.471  1.00 0.00 ? 7  GLU A CA   14 
ATOM 10421 C C    . GLU A 1 7  ? -1.143  -9.375  -6.731  1.00 0.00 ? 7  GLU A C    14 
ATOM 10422 O O    . GLU A 1 7  ? -0.469  -10.363 -6.441  1.00 0.00 ? 7  GLU A O    14 
ATOM 10423 C CB   . GLU A 1 7  ? 0.906   -7.966  -6.495  1.00 0.00 ? 7  GLU A CB   14 
ATOM 10424 C CG   . GLU A 1 7  ? 1.516   -6.636  -6.908  1.00 0.00 ? 7  GLU A CG   14 
ATOM 10425 C CD   . GLU A 1 7  ? 2.909   -6.434  -6.342  1.00 0.00 ? 7  GLU A CD   14 
ATOM 10426 O OE1  . GLU A 1 7  ? 3.313   -7.222  -5.461  1.00 0.00 ? 7  GLU A OE1  14 
ATOM 10427 O OE2  . GLU A 1 7  ? 3.596   -5.487  -6.781  1.00 0.00 ? 7  GLU A OE2  14 
ATOM 10428 H H    . GLU A 1 7  ? -0.619  -6.635  -4.816  1.00 0.00 ? 7  GLU A H    14 
ATOM 10429 H HA   . GLU A 1 7  ? -0.979  -7.314  -7.259  1.00 0.00 ? 7  GLU A HA   14 
ATOM 10430 H HB2  . GLU A 1 7  ? 1.268   -8.213  -5.508  1.00 0.00 ? 7  GLU A HB2  14 
ATOM 10431 H HB3  . GLU A 1 7  ? 1.239   -8.721  -7.191  1.00 0.00 ? 7  GLU A HB3  14 
ATOM 10432 H HG2  . GLU A 1 7  ? 1.573   -6.599  -7.986  1.00 0.00 ? 7  GLU A HG2  14 
ATOM 10433 H HG3  . GLU A 1 7  ? 0.880   -5.838  -6.554  1.00 0.00 ? 7  GLU A HG3  14 
ATOM 10434 N N    . PHE A 1 8  ? -2.350  -9.450  -7.280  1.00 0.00 ? 8  PHE A N    14 
ATOM 10435 C CA   . PHE A 1 8  ? -2.987  -10.725 -7.589  1.00 0.00 ? 8  PHE A CA   14 
ATOM 10436 C C    . PHE A 1 8  ? -4.097  -10.517 -8.617  1.00 0.00 ? 8  PHE A C    14 
ATOM 10437 O O    . PHE A 1 8  ? -4.125  -9.497  -9.307  1.00 0.00 ? 8  PHE A O    14 
ATOM 10438 C CB   . PHE A 1 8  ? -3.549  -11.351 -6.308  1.00 0.00 ? 8  PHE A CB   14 
ATOM 10439 C CG   . PHE A 1 8  ? -2.508  -12.032 -5.468  1.00 0.00 ? 8  PHE A CG   14 
ATOM 10440 C CD1  . PHE A 1 8  ? -1.790  -13.106 -5.969  1.00 0.00 ? 8  PHE A CD1  14 
ATOM 10441 C CD2  . PHE A 1 8  ? -2.247  -11.600 -4.177  1.00 0.00 ? 8  PHE A CD2  14 
ATOM 10442 C CE1  . PHE A 1 8  ? -0.831  -13.736 -5.200  1.00 0.00 ? 8  PHE A CE1  14 
ATOM 10443 C CE2  . PHE A 1 8  ? -1.288  -12.227 -3.403  1.00 0.00 ? 8  PHE A CE2  14 
ATOM 10444 C CZ   . PHE A 1 8  ? -0.579  -13.296 -3.915  1.00 0.00 ? 8  PHE A CZ   14 
ATOM 10445 H H    . PHE A 1 8  ? -2.831  -8.621  -7.482  1.00 0.00 ? 8  PHE A H    14 
ATOM 10446 H HA   . PHE A 1 8  ? -2.236  -11.381 -8.006  1.00 0.00 ? 8  PHE A HA   14 
ATOM 10447 H HB2  . PHE A 1 8  ? -4.003  -10.578 -5.708  1.00 0.00 ? 8  PHE A HB2  14 
ATOM 10448 H HB3  . PHE A 1 8  ? -4.297  -12.083 -6.568  1.00 0.00 ? 8  PHE A HB3  14 
ATOM 10449 H HD1  . PHE A 1 8  ? -1.985  -13.451 -6.974  1.00 0.00 ? 8  PHE A HD1  14 
ATOM 10450 H HD2  . PHE A 1 8  ? -2.801  -10.764 -3.776  1.00 0.00 ? 8  PHE A HD2  14 
ATOM 10451 H HE1  . PHE A 1 8  ? -0.278  -14.571 -5.602  1.00 0.00 ? 8  PHE A HE1  14 
ATOM 10452 H HE2  . PHE A 1 8  ? -1.094  -11.881 -2.398  1.00 0.00 ? 8  PHE A HE2  14 
ATOM 10453 H HZ   . PHE A 1 8  ? 0.170   -13.787 -3.311  1.00 0.00 ? 8  PHE A HZ   14 
ATOM 10454 N N    . ASN A 1 9  ? -5.019  -11.472 -8.714  1.00 0.00 ? 9  ASN A N    14 
ATOM 10455 C CA   . ASN A 1 9  ? -6.123  -11.358 -9.657  1.00 0.00 ? 9  ASN A CA   14 
ATOM 10456 C C    . ASN A 1 9  ? -7.083  -10.257 -9.212  1.00 0.00 ? 9  ASN A C    14 
ATOM 10457 O O    . ASN A 1 9  ? -7.357  -9.322  -9.965  1.00 0.00 ? 9  ASN A O    14 
ATOM 10458 C CB   . ASN A 1 9  ? -6.865  -12.693 -9.775  1.00 0.00 ? 9  ASN A CB   14 
ATOM 10459 C CG   . ASN A 1 9  ? -6.564  -13.410 -11.076 1.00 0.00 ? 9  ASN A CG   14 
ATOM 10460 O OD1  . ASN A 1 9  ? -7.472  -13.780 -11.820 1.00 0.00 ? 9  ASN A OD1  14 
ATOM 10461 N ND2  . ASN A 1 9  ? -5.282  -13.612 -11.358 1.00 0.00 ? 9  ASN A ND2  14 
ATOM 10462 H H    . ASN A 1 9  ? -4.958  -12.263 -8.141  1.00 0.00 ? 9  ASN A H    14 
ATOM 10463 H HA   . ASN A 1 9  ? -5.713  -11.096 -10.621 1.00 0.00 ? 9  ASN A HA   14 
ATOM 10464 H HB2  . ASN A 1 9  ? -6.571  -13.334 -8.958  1.00 0.00 ? 9  ASN A HB2  14 
ATOM 10465 H HB3  . ASN A 1 9  ? -7.930  -12.514 -9.721  1.00 0.00 ? 9  ASN A HB3  14 
ATOM 10466 H HD21 . ASN A 1 9  ? -4.612  -13.290 -10.718 1.00 0.00 ? 9  ASN A HD21 14 
ATOM 10467 H HD22 . ASN A 1 9  ? -5.058  -14.073 -12.193 1.00 0.00 ? 9  ASN A HD22 14 
ATOM 10468 N N    . PRO A 1 10 ? -7.599  -10.346 -7.973  1.00 0.00 ? 10 PRO A N    14 
ATOM 10469 C CA   . PRO A 1 10 ? -8.516  -9.353  -7.425  1.00 0.00 ? 10 PRO A CA   14 
ATOM 10470 C C    . PRO A 1 10 ? -7.777  -8.225  -6.705  1.00 0.00 ? 10 PRO A C    14 
ATOM 10471 O O    . PRO A 1 10 ? -7.552  -8.295  -5.498  1.00 0.00 ? 10 PRO A O    14 
ATOM 10472 C CB   . PRO A 1 10 ? -9.325  -10.179 -6.433  1.00 0.00 ? 10 PRO A CB   14 
ATOM 10473 C CG   . PRO A 1 10 ? -8.356  -11.191 -5.911  1.00 0.00 ? 10 PRO A CG   14 
ATOM 10474 C CD   . PRO A 1 10 ? -7.329  -11.420 -6.998  1.00 0.00 ? 10 PRO A CD   14 
ATOM 10475 H HA   . PRO A 1 10 ? -9.167  -8.942  -8.183  1.00 0.00 ? 10 PRO A HA   14 
ATOM 10476 H HB2  . PRO A 1 10 ? -9.694  -9.539  -5.645  1.00 0.00 ? 10 PRO A HB2  14 
ATOM 10477 H HB3  . PRO A 1 10 ? -10.153 -10.651 -6.940  1.00 0.00 ? 10 PRO A HB3  14 
ATOM 10478 H HG2  . PRO A 1 10 ? -7.876  -10.810 -5.022  1.00 0.00 ? 10 PRO A HG2  14 
ATOM 10479 H HG3  . PRO A 1 10 ? -8.875  -12.111 -5.689  1.00 0.00 ? 10 PRO A HG3  14 
ATOM 10480 H HD2  . PRO A 1 10 ? -6.330  -11.332 -6.596  1.00 0.00 ? 10 PRO A HD2  14 
ATOM 10481 H HD3  . PRO A 1 10 ? -7.471  -12.392 -7.447  1.00 0.00 ? 10 PRO A HD3  14 
ATOM 10482 N N    . LEU A 1 11 ? -7.394  -7.192  -7.451  1.00 0.00 ? 11 LEU A N    14 
ATOM 10483 C CA   . LEU A 1 11 ? -6.672  -6.058  -6.875  1.00 0.00 ? 11 LEU A CA   14 
ATOM 10484 C C    . LEU A 1 11 ? -7.439  -5.445  -5.723  1.00 0.00 ? 11 LEU A C    14 
ATOM 10485 O O    . LEU A 1 11 ? -8.552  -5.873  -5.427  1.00 0.00 ? 11 LEU A O    14 
ATOM 10486 C CB   . LEU A 1 11 ? -6.379  -5.004  -7.943  1.00 0.00 ? 11 LEU A CB   14 
ATOM 10487 C CG   . LEU A 1 11 ? -5.514  -5.487  -9.109  1.00 0.00 ? 11 LEU A CG   14 
ATOM 10488 C CD1  . LEU A 1 11 ? -5.203  -4.339  -10.056 1.00 0.00 ? 11 LEU A CD1  14 
ATOM 10489 C CD2  . LEU A 1 11 ? -4.230  -6.118  -8.593  1.00 0.00 ? 11 LEU A CD2  14 
ATOM 10490 H H    . LEU A 1 11 ? -7.595  -7.193  -8.411  1.00 0.00 ? 11 LEU A H    14 
ATOM 10491 H HA   . LEU A 1 11 ? -5.745  -6.431  -6.479  1.00 0.00 ? 11 LEU A HA   14 
ATOM 10492 H HB2  . LEU A 1 11 ? -7.320  -4.654  -8.340  1.00 0.00 ? 11 LEU A HB2  14 
ATOM 10493 H HB3  . LEU A 1 11 ? -5.874  -4.174  -7.471  1.00 0.00 ? 11 LEU A HB3  14 
ATOM 10494 H HG   . LEU A 1 11 ? -6.057  -6.239  -9.664  1.00 0.00 ? 11 LEU A HG   14 
ATOM 10495 H HD11 . LEU A 1 11 ? -5.214  -3.408  -9.508  1.00 0.00 ? 11 LEU A HD11 14 
ATOM 10496 H HD12 . LEU A 1 11 ? -5.947  -4.305  -10.838 1.00 0.00 ? 11 LEU A HD12 14 
ATOM 10497 H HD13 . LEU A 1 11 ? -4.226  -4.487  -10.492 1.00 0.00 ? 11 LEU A HD13 14 
ATOM 10498 H HD21 . LEU A 1 11 ? -3.677  -5.389  -8.019  1.00 0.00 ? 11 LEU A HD21 14 
ATOM 10499 H HD22 . LEU A 1 11 ? -3.631  -6.448  -9.428  1.00 0.00 ? 11 LEU A HD22 14 
ATOM 10500 H HD23 . LEU A 1 11 ? -4.471  -6.963  -7.965  1.00 0.00 ? 11 LEU A HD23 14 
ATOM 10501 N N    . CYS A 1 12 ? -6.810  -4.459  -5.064  1.00 0.00 ? 12 CYS A N    14 
ATOM 10502 C CA   . CYS A 1 12 ? -7.384  -3.778  -3.905  1.00 0.00 ? 12 CYS A CA   14 
ATOM 10503 C C    . CYS A 1 12 ? -8.891  -3.946  -3.826  1.00 0.00 ? 12 CYS A C    14 
ATOM 10504 O O    . CYS A 1 12 ? -9.666  -3.000  -3.956  1.00 0.00 ? 12 CYS A O    14 
ATOM 10505 C CB   . CYS A 1 12 ? -6.981  -2.303  -3.877  1.00 0.00 ? 12 CYS A CB   14 
ATOM 10506 S SG   . CYS A 1 12 ? -7.947  -1.197  -4.965  1.00 0.00 ? 12 CYS A SG   14 
ATOM 10507 H H    . CYS A 1 12 ? -5.916  -4.201  -5.356  1.00 0.00 ? 12 CYS A H    14 
ATOM 10508 H HA   . CYS A 1 12 ? -6.960  -4.252  -3.032  1.00 0.00 ? 12 CYS A HA   14 
ATOM 10509 H HB2  . CYS A 1 12 ? -7.089  -1.941  -2.867  1.00 0.00 ? 12 CYS A HB2  14 
ATOM 10510 H HB3  . CYS A 1 12 ? -5.944  -2.224  -4.163  1.00 0.00 ? 12 CYS A HB3  14 
ATOM 10511 N N    . ARG A 1 13 ? -9.279  -5.177  -3.573  1.00 0.00 ? 13 ARG A N    14 
ATOM 10512 C CA   . ARG A 1 13 ? -10.685 -5.531  -3.431  1.00 0.00 ? 13 ARG A CA   14 
ATOM 10513 C C    . ARG A 1 13 ? -11.091 -5.300  -1.991  1.00 0.00 ? 13 ARG A C    14 
ATOM 10514 O O    . ARG A 1 13 ? -11.796 -6.102  -1.379  1.00 0.00 ? 13 ARG A O    14 
ATOM 10515 C CB   . ARG A 1 13 ? -10.927 -6.989  -3.822  1.00 0.00 ? 13 ARG A CB   14 
ATOM 10516 C CG   . ARG A 1 13 ? -12.369 -7.276  -4.206  1.00 0.00 ? 13 ARG A CG   14 
ATOM 10517 C CD   . ARG A 1 13 ? -12.506 -8.610  -4.919  1.00 0.00 ? 13 ARG A CD   14 
ATOM 10518 N NE   . ARG A 1 13 ? -13.420 -8.528  -6.057  1.00 0.00 ? 13 ARG A NE   14 
ATOM 10519 C CZ   . ARG A 1 13 ? -13.703 -9.554  -6.855  1.00 0.00 ? 13 ARG A CZ   14 
ATOM 10520 N NH1  . ARG A 1 13 ? -13.146 -10.740 -6.643  1.00 0.00 ? 13 ARG A NH1  14 
ATOM 10521 N NH2  . ARG A 1 13 ? -14.542 -9.393  -7.869  1.00 0.00 ? 13 ARG A NH2  14 
ATOM 10522 H H    . ARG A 1 13 ? -8.587  -5.863  -3.458  1.00 0.00 ? 13 ARG A H    14 
ATOM 10523 H HA   . ARG A 1 13 ? -11.267 -4.882  -4.072  1.00 0.00 ? 13 ARG A HA   14 
ATOM 10524 H HB2  . ARG A 1 13 ? -10.295 -7.235  -4.663  1.00 0.00 ? 13 ARG A HB2  14 
ATOM 10525 H HB3  . ARG A 1 13 ? -10.666 -7.623  -2.987  1.00 0.00 ? 13 ARG A HB3  14 
ATOM 10526 H HG2  . ARG A 1 13 ? -12.973 -7.296  -3.310  1.00 0.00 ? 13 ARG A HG2  14 
ATOM 10527 H HG3  . ARG A 1 13 ? -12.719 -6.490  -4.860  1.00 0.00 ? 13 ARG A HG3  14 
ATOM 10528 H HD2  . ARG A 1 13 ? -11.533 -8.917  -5.273  1.00 0.00 ? 13 ARG A HD2  14 
ATOM 10529 H HD3  . ARG A 1 13 ? -12.881 -9.342  -4.220  1.00 0.00 ? 13 ARG A HD3  14 
ATOM 10530 H HE   . ARG A 1 13 ? -13.844 -7.662  -6.235  1.00 0.00 ? 13 ARG A HE   14 
ATOM 10531 H HH11 . ARG A 1 13 ? -12.510 -10.867 -5.882  1.00 0.00 ? 13 ARG A HH11 14 
ATOM 10532 H HH12 . ARG A 1 13 ? -13.363 -11.508 -7.246  1.00 0.00 ? 13 ARG A HH12 14 
ATOM 10533 H HH21 . ARG A 1 13 ? -14.962 -8.500  -8.033  1.00 0.00 ? 13 ARG A HH21 14 
ATOM 10534 H HH22 . ARG A 1 13 ? -14.755 -10.164 -8.469  1.00 0.00 ? 13 ARG A HH22 14 
ATOM 10535 N N    . CYS A 1 14 ? -10.592 -4.199  -1.456  1.00 0.00 ? 14 CYS A N    14 
ATOM 10536 C CA   . CYS A 1 14 ? -10.820 -3.820  -0.098  1.00 0.00 ? 14 CYS A CA   14 
ATOM 10537 C C    . CYS A 1 14 ? -11.301 -2.385  -0.037  1.00 0.00 ? 14 CYS A C    14 
ATOM 10538 O O    . CYS A 1 14 ? -11.664 -1.784  -1.047  1.00 0.00 ? 14 CYS A O    14 
ATOM 10539 C CB   . CYS A 1 14 ? -9.516  -3.990  0.689   1.00 0.00 ? 14 CYS A CB   14 
ATOM 10540 S SG   . CYS A 1 14 ? -8.064  -4.430  -0.324  1.00 0.00 ? 14 CYS A SG   14 
ATOM 10541 H H    . CYS A 1 14 ? -10.021 -3.627  -1.992  1.00 0.00 ? 14 CYS A H    14 
ATOM 10542 H HA   . CYS A 1 14 ? -11.575 -4.459  0.326   1.00 0.00 ? 14 CYS A HA   14 
ATOM 10543 H HB2  . CYS A 1 14 ? -9.286  -3.066  1.188   1.00 0.00 ? 14 CYS A HB2  14 
ATOM 10544 H HB3  . CYS A 1 14 ? -9.649  -4.771  1.419   1.00 0.00 ? 14 CYS A HB3  14 
ATOM 10545 N N    . ASN A 1 15 ? -11.298 -1.861  1.159   1.00 0.00 ? 15 ASN A N    14 
ATOM 10546 C CA   . ASN A 1 15 ? -11.731 -0.497  1.411   1.00 0.00 ? 15 ASN A CA   14 
ATOM 10547 C C    . ASN A 1 15 ? -10.557 0.392   1.793   1.00 0.00 ? 15 ASN A C    14 
ATOM 10548 O O    . ASN A 1 15 ? -9.428  0.195   1.345   1.00 0.00 ? 15 ASN A O    14 
ATOM 10549 C CB   . ASN A 1 15 ? -12.785 -0.489  2.526   1.00 0.00 ? 15 ASN A CB   14 
ATOM 10550 C CG   . ASN A 1 15 ? -13.909 0.498   2.269   1.00 0.00 ? 15 ASN A CG   14 
ATOM 10551 O OD1  . ASN A 1 15 ? -15.062 0.243   2.614   1.00 0.00 ? 15 ASN A OD1  14 
ATOM 10552 N ND2  . ASN A 1 15 ? -13.578 1.630   1.660   1.00 0.00 ? 15 ASN A ND2  14 
ATOM 10553 H H    . ASN A 1 15 ? -10.997 -2.416  1.898   1.00 0.00 ? 15 ASN A H    14 
ATOM 10554 H HA   . ASN A 1 15 ? -12.171 -0.111  0.519   1.00 0.00 ? 15 ASN A HA   14 
ATOM 10555 H HB2  . ASN A 1 15 ? -13.208 -1.461  2.609   1.00 0.00 ? 15 ASN A HB2  14 
ATOM 10556 H HB3  . ASN A 1 15 ? -12.315 -0.235  3.461   1.00 0.00 ? 15 ASN A HB3  14 
ATOM 10557 H HD21 . ASN A 1 15 ? -12.641 1.765   1.409   1.00 0.00 ? 15 ASN A HD21 14 
ATOM 10558 H HD22 . ASN A 1 15 ? -14.281 2.286   1.497   1.00 0.00 ? 15 ASN A HD22 14 
ATOM 10559 N N    . LYS A 1 16 ? -10.848 1.342   2.653   1.00 0.00 ? 16 LYS A N    14 
ATOM 10560 C CA   . LYS A 1 16 ? -9.863  2.267   3.178   1.00 0.00 ? 16 LYS A CA   14 
ATOM 10561 C C    . LYS A 1 16 ? -9.928  2.184   4.688   1.00 0.00 ? 16 LYS A C    14 
ATOM 10562 O O    . LYS A 1 16 ? -9.437  3.048   5.413   1.00 0.00 ? 16 LYS A O    14 
ATOM 10563 C CB   . LYS A 1 16 ? -10.135 3.695   2.709   1.00 0.00 ? 16 LYS A CB   14 
ATOM 10564 C CG   . LYS A 1 16 ? -9.064  4.683   3.145   1.00 0.00 ? 16 LYS A CG   14 
ATOM 10565 C CD   . LYS A 1 16 ? -8.185  5.099   1.979   1.00 0.00 ? 16 LYS A CD   14 
ATOM 10566 C CE   . LYS A 1 16 ? -7.066  6.024   2.429   1.00 0.00 ? 16 LYS A CE   14 
ATOM 10567 N NZ   . LYS A 1 16 ? -5.936  5.274   3.045   1.00 0.00 ? 16 LYS A NZ   14 
ATOM 10568 H H    . LYS A 1 16 ? -11.768 1.398   2.982   1.00 0.00 ? 16 LYS A H    14 
ATOM 10569 H HA   . LYS A 1 16 ? -8.885  1.950   2.844   1.00 0.00 ? 16 LYS A HA   14 
ATOM 10570 H HB2  . LYS A 1 16 ? -10.188 3.704   1.630   1.00 0.00 ? 16 LYS A HB2  14 
ATOM 10571 H HB3  . LYS A 1 16 ? -11.082 4.022   3.111   1.00 0.00 ? 16 LYS A HB3  14 
ATOM 10572 H HG2  . LYS A 1 16 ? -9.540  5.561   3.555   1.00 0.00 ? 16 LYS A HG2  14 
ATOM 10573 H HG3  . LYS A 1 16 ? -8.447  4.219   3.901   1.00 0.00 ? 16 LYS A HG3  14 
ATOM 10574 H HD2  . LYS A 1 16 ? -7.752  4.214   1.536   1.00 0.00 ? 16 LYS A HD2  14 
ATOM 10575 H HD3  . LYS A 1 16 ? -8.794  5.610   1.248   1.00 0.00 ? 16 LYS A HD3  14 
ATOM 10576 H HE2  . LYS A 1 16 ? -6.699  6.567   1.571   1.00 0.00 ? 16 LYS A HE2  14 
ATOM 10577 H HE3  . LYS A 1 16 ? -7.462  6.722   3.153   1.00 0.00 ? 16 LYS A HE3  14 
ATOM 10578 H HZ1  . LYS A 1 16 ? -5.603  5.767   3.899   1.00 0.00 ? 16 LYS A HZ1  14 
ATOM 10579 H HZ2  . LYS A 1 16 ? -5.147  5.201   2.372   1.00 0.00 ? 16 LYS A HZ2  14 
ATOM 10580 H HZ3  . LYS A 1 16 ? -6.243  4.316   3.307   1.00 0.00 ? 16 LYS A HZ3  14 
ATOM 10581 N N    . MET A 1 17 ? -10.571 1.112   5.139   1.00 0.00 ? 17 MET A N    14 
ATOM 10582 C CA   . MET A 1 17 ? -10.757 0.842   6.553   1.00 0.00 ? 17 MET A CA   14 
ATOM 10583 C C    . MET A 1 17 ? -9.439  0.891   7.310   1.00 0.00 ? 17 MET A C    14 
ATOM 10584 O O    . MET A 1 17 ? -8.410  1.301   6.774   1.00 0.00 ? 17 MET A O    14 
ATOM 10585 C CB   . MET A 1 17 ? -11.446 -0.518  6.715   1.00 0.00 ? 17 MET A CB   14 
ATOM 10586 C CG   . MET A 1 17 ? -10.504 -1.714  6.642   1.00 0.00 ? 17 MET A CG   14 
ATOM 10587 S SD   . MET A 1 17 ? -11.033 -2.948  5.436   1.00 0.00 ? 17 MET A SD   14 
ATOM 10588 C CE   . MET A 1 17 ? -9.729  -4.166  5.597   1.00 0.00 ? 17 MET A CE   14 
ATOM 10589 H H    . MET A 1 17 ? -10.941 0.475   4.482   1.00 0.00 ? 17 MET A H    14 
ATOM 10590 H HA   . MET A 1 17 ? -11.402 1.601   6.960   1.00 0.00 ? 17 MET A HA   14 
ATOM 10591 H HB2  . MET A 1 17 ? -11.950 -0.539  7.666   1.00 0.00 ? 17 MET A HB2  14 
ATOM 10592 H HB3  . MET A 1 17 ? -12.182 -0.622  5.927   1.00 0.00 ? 17 MET A HB3  14 
ATOM 10593 H HG2  . MET A 1 17 ? -9.520  -1.366  6.368   1.00 0.00 ? 17 MET A HG2  14 
ATOM 10594 H HG3  . MET A 1 17 ? -10.461 -2.179  7.616   1.00 0.00 ? 17 MET A HG3  14 
ATOM 10595 H HE1  . MET A 1 17 ? -9.267  -4.327  4.634   1.00 0.00 ? 17 MET A HE1  14 
ATOM 10596 H HE2  . MET A 1 17 ? -10.147 -5.095  5.955   1.00 0.00 ? 17 MET A HE2  14 
ATOM 10597 H HE3  . MET A 1 17 ? -8.988  -3.810  6.298   1.00 0.00 ? 17 MET A HE3  14 
ATOM 10598 N N    . LEU A 1 18 ? -9.490  0.486   8.564   1.00 0.00 ? 18 LEU A N    14 
ATOM 10599 C CA   . LEU A 1 18 ? -8.307  0.495   9.419   1.00 0.00 ? 18 LEU A CA   14 
ATOM 10600 C C    . LEU A 1 18 ? -7.292  -0.551  8.967   1.00 0.00 ? 18 LEU A C    14 
ATOM 10601 O O    . LEU A 1 18 ? -7.050  -1.541  9.656   1.00 0.00 ? 18 LEU A O    14 
ATOM 10602 C CB   . LEU A 1 18 ? -8.686  0.263   10.891  1.00 0.00 ? 18 LEU A CB   14 
ATOM 10603 C CG   . LEU A 1 18 ? -9.793  -0.768  11.164  1.00 0.00 ? 18 LEU A CG   14 
ATOM 10604 C CD1  . LEU A 1 18 ? -11.171 -0.134  11.028  1.00 0.00 ? 18 LEU A CD1  14 
ATOM 10605 C CD2  . LEU A 1 18 ? -9.660  -1.980  10.248  1.00 0.00 ? 18 LEU A CD2  14 
ATOM 10606 H H    . LEU A 1 18 ? -10.347 0.190   8.923   1.00 0.00 ? 18 LEU A H    14 
ATOM 10607 H HA   . LEU A 1 18 ? -7.852  1.471   9.329   1.00 0.00 ? 18 LEU A HA   14 
ATOM 10608 H HB2  . LEU A 1 18 ? -7.798  -0.057  11.417  1.00 0.00 ? 18 LEU A HB2  14 
ATOM 10609 H HB3  . LEU A 1 18 ? -9.002  1.209   11.307  1.00 0.00 ? 18 LEU A HB3  14 
ATOM 10610 H HG   . LEU A 1 18 ? -9.696  -1.114  12.184  1.00 0.00 ? 18 LEU A HG   14 
ATOM 10611 H HD11 . LEU A 1 18 ? -11.070 0.870   10.642  1.00 0.00 ? 18 LEU A HD11 14 
ATOM 10612 H HD12 . LEU A 1 18 ? -11.649 -0.099  11.996  1.00 0.00 ? 18 LEU A HD12 14 
ATOM 10613 H HD13 . LEU A 1 18 ? -11.773 -0.721  10.351  1.00 0.00 ? 18 LEU A HD13 14 
ATOM 10614 H HD21 . LEU A 1 18 ? -9.517  -1.653  9.231   1.00 0.00 ? 18 LEU A HD21 14 
ATOM 10615 H HD22 . LEU A 1 18 ? -10.557 -2.578  10.311  1.00 0.00 ? 18 LEU A HD22 14 
ATOM 10616 H HD23 . LEU A 1 18 ? -8.812  -2.572  10.559  1.00 0.00 ? 18 LEU A HD23 14 
ATOM 10617 N N    . GLY A 1 19 ? -6.695  -0.311  7.803   1.00 0.00 ? 19 GLY A N    14 
ATOM 10618 C CA   . GLY A 1 19 ? -5.705  -1.228  7.270   1.00 0.00 ? 19 GLY A CA   14 
ATOM 10619 C C    . GLY A 1 19 ? -4.468  -1.315  8.143   1.00 0.00 ? 19 GLY A C    14 
ATOM 10620 O O    . GLY A 1 19 ? -4.508  -0.973  9.324   1.00 0.00 ? 19 GLY A O    14 
ATOM 10621 H H    . GLY A 1 19 ? -6.926  0.502   7.301   1.00 0.00 ? 19 GLY A H    14 
ATOM 10622 H HA2  . GLY A 1 19 ? -6.147  -2.211  7.190   1.00 0.00 ? 19 GLY A HA2  14 
ATOM 10623 H HA3  . GLY A 1 19 ? -5.414  -0.895  6.284   1.00 0.00 ? 19 GLY A HA3  14 
ATOM 10624 N N    . ASP A 1 20 ? -3.367  -1.781  7.562   1.00 0.00 ? 20 ASP A N    14 
ATOM 10625 C CA   . ASP A 1 20 ? -2.117  -1.922  8.292   1.00 0.00 ? 20 ASP A CA   14 
ATOM 10626 C C    . ASP A 1 20 ? -1.322  -0.619  8.287   1.00 0.00 ? 20 ASP A C    14 
ATOM 10627 O O    . ASP A 1 20 ? -1.691  0.348   7.621   1.00 0.00 ? 20 ASP A O    14 
ATOM 10628 C CB   . ASP A 1 20 ? -1.277  -3.043  7.680   1.00 0.00 ? 20 ASP A CB   14 
ATOM 10629 C CG   . ASP A 1 20 ? -2.123  -4.165  7.106   1.00 0.00 ? 20 ASP A CG   14 
ATOM 10630 O OD1  . ASP A 1 20 ? -2.603  -4.021  5.962   1.00 0.00 ? 20 ASP A OD1  14 
ATOM 10631 O OD2  . ASP A 1 20 ? -2.305  -5.187  7.801   1.00 0.00 ? 20 ASP A OD2  14 
ATOM 10632 H H    . ASP A 1 20 ? -3.394  -2.046  6.622   1.00 0.00 ? 20 ASP A H    14 
ATOM 10633 H HA   . ASP A 1 20 ? -2.357  -2.181  9.313   1.00 0.00 ? 20 ASP A HA   14 
ATOM 10634 H HB2  . ASP A 1 20 ? -0.667  -2.636  6.890   1.00 0.00 ? 20 ASP A HB2  14 
ATOM 10635 H HB3  . ASP A 1 20 ? -0.641  -3.454  8.442   1.00 0.00 ? 20 ASP A HB3  14 
ATOM 10636 N N    . LEU A 1 21 ? -0.228  -0.606  9.043   1.00 0.00 ? 21 LEU A N    14 
ATOM 10637 C CA   . LEU A 1 21 ? 0.632   0.567   9.143   1.00 0.00 ? 21 LEU A CA   14 
ATOM 10638 C C    . LEU A 1 21 ? 1.830   0.447   8.208   1.00 0.00 ? 21 LEU A C    14 
ATOM 10639 O O    . LEU A 1 21 ? 2.916   0.037   8.617   1.00 0.00 ? 21 LEU A O    14 
ATOM 10640 C CB   . LEU A 1 21 ? 1.114   0.722   10.581  1.00 0.00 ? 21 LEU A CB   14 
ATOM 10641 C CG   . LEU A 1 21 ? 1.852   -0.496  11.140  1.00 0.00 ? 21 LEU A CG   14 
ATOM 10642 C CD1  . LEU A 1 21 ? 3.031   -0.061  11.994  1.00 0.00 ? 21 LEU A CD1  14 
ATOM 10643 C CD2  . LEU A 1 21 ? 0.902   -1.374  11.939  1.00 0.00 ? 21 LEU A CD2  14 
ATOM 10644 H H    . LEU A 1 21 ? 0.008   -1.408  9.552   1.00 0.00 ? 21 LEU A H    14 
ATOM 10645 H HA   . LEU A 1 21 ? 0.054   1.436   8.865   1.00 0.00 ? 21 LEU A HA   14 
ATOM 10646 H HB2  . LEU A 1 21 ? 1.775   1.575   10.626  1.00 0.00 ? 21 LEU A HB2  14 
ATOM 10647 H HB3  . LEU A 1 21 ? 0.256   0.913   11.206  1.00 0.00 ? 21 LEU A HB3  14 
ATOM 10648 H HG   . LEU A 1 21 ? 2.236   -1.084  10.319  1.00 0.00 ? 21 LEU A HG   14 
ATOM 10649 H HD11 . LEU A 1 21 ? 3.484   0.818   11.560  1.00 0.00 ? 21 LEU A HD11 14 
ATOM 10650 H HD12 . LEU A 1 21 ? 3.759   -0.858  12.033  1.00 0.00 ? 21 LEU A HD12 14 
ATOM 10651 H HD13 . LEU A 1 21 ? 2.689   0.164   12.992  1.00 0.00 ? 21 LEU A HD13 14 
ATOM 10652 H HD21 . LEU A 1 21 ? 0.065   -0.781  12.278  1.00 0.00 ? 21 LEU A HD21 14 
ATOM 10653 H HD22 . LEU A 1 21 ? 1.422   -1.785  12.792  1.00 0.00 ? 21 LEU A HD22 14 
ATOM 10654 H HD23 . LEU A 1 21 ? 0.544   -2.178  11.314  1.00 0.00 ? 21 LEU A HD23 14 
ATOM 10655 N N    . ILE A 1 22 ? 1.623   0.801   6.949   1.00 0.00 ? 22 ILE A N    14 
ATOM 10656 C CA   . ILE A 1 22 ? 2.678   0.727   5.951   1.00 0.00 ? 22 ILE A CA   14 
ATOM 10657 C C    . ILE A 1 22 ? 3.354   2.080   5.750   1.00 0.00 ? 22 ILE A C    14 
ATOM 10658 O O    . ILE A 1 22 ? 2.765   3.128   6.009   1.00 0.00 ? 22 ILE A O    14 
ATOM 10659 C CB   . ILE A 1 22 ? 2.115   0.215   4.607   1.00 0.00 ? 22 ILE A CB   14 
ATOM 10660 C CG1  . ILE A 1 22 ? 3.086   0.439   3.464   1.00 0.00 ? 22 ILE A CG1  14 
ATOM 10661 C CG2  . ILE A 1 22 ? 0.797   0.886   4.282   1.00 0.00 ? 22 ILE A CG2  14 
ATOM 10662 C CD1  . ILE A 1 22 ? 2.909   1.777   2.778   1.00 0.00 ? 22 ILE A CD1  14 
ATOM 10663 H H    . ILE A 1 22 ? 0.736   1.112   6.681   1.00 0.00 ? 22 ILE A H    14 
ATOM 10664 H HA   . ILE A 1 22 ? 3.415   0.019   6.299   1.00 0.00 ? 22 ILE A HA   14 
ATOM 10665 H HB   . ILE A 1 22 ? 1.941   -0.838  4.708   1.00 0.00 ? 22 ILE A HB   14 
ATOM 10666 H HG12 . ILE A 1 22 ? 4.096   0.383   3.837   1.00 0.00 ? 22 ILE A HG12 14 
ATOM 10667 H HG13 . ILE A 1 22 ? 2.937   -0.334  2.724   1.00 0.00 ? 22 ILE A HG13 14 
ATOM 10668 H HG21 . ILE A 1 22 ? 0.837   1.918   4.599   1.00 0.00 ? 22 ILE A HG21 14 
ATOM 10669 H HG22 . ILE A 1 22 ? -0.002  0.378   4.795   1.00 0.00 ? 22 ILE A HG22 14 
ATOM 10670 H HG23 . ILE A 1 22 ? 0.632   0.845   3.216   1.00 0.00 ? 22 ILE A HG23 14 
ATOM 10671 H HD11 . ILE A 1 22 ? 3.855   2.113   2.401   1.00 0.00 ? 22 ILE A HD11 14 
ATOM 10672 H HD12 . ILE A 1 22 ? 2.525   2.498   3.485   1.00 0.00 ? 22 ILE A HD12 14 
ATOM 10673 H HD13 . ILE A 1 22 ? 2.211   1.671   1.959   1.00 0.00 ? 22 ILE A HD13 14 
ATOM 10674 N N    . CYS A 1 23 ? 4.594   2.041   5.271   1.00 0.00 ? 23 CYS A N    14 
ATOM 10675 C CA   . CYS A 1 23 ? 5.358   3.260   5.011   1.00 0.00 ? 23 CYS A CA   14 
ATOM 10676 C C    . CYS A 1 23 ? 5.638   3.371   3.522   1.00 0.00 ? 23 CYS A C    14 
ATOM 10677 O O    . CYS A 1 23 ? 6.660   2.886   3.037   1.00 0.00 ? 23 CYS A O    14 
ATOM 10678 C CB   . CYS A 1 23 ? 6.674   3.249   5.789   1.00 0.00 ? 23 CYS A CB   14 
ATOM 10679 S SG   . CYS A 1 23 ? 7.593   4.823   5.719   1.00 0.00 ? 23 CYS A SG   14 
ATOM 10680 H H    . CYS A 1 23 ? 4.999   1.163   5.069   1.00 0.00 ? 23 CYS A H    14 
ATOM 10681 H HA   . CYS A 1 23 ? 4.763   4.106   5.323   1.00 0.00 ? 23 CYS A HA   14 
ATOM 10682 H HB2  . CYS A 1 23 ? 6.466   3.033   6.825   1.00 0.00 ? 23 CYS A HB2  14 
ATOM 10683 H HB3  . CYS A 1 23 ? 7.313   2.476   5.389   1.00 0.00 ? 23 CYS A HB3  14 
ATOM 10684 N N    . ALA A 1 24 ? 4.703   3.966   2.790   1.00 0.00 ? 24 ALA A N    14 
ATOM 10685 C CA   . ALA A 1 24 ? 4.837   4.075   1.345   1.00 0.00 ? 24 ALA A CA   14 
ATOM 10686 C C    . ALA A 1 24 ? 5.525   5.361   0.894   1.00 0.00 ? 24 ALA A C    14 
ATOM 10687 O O    . ALA A 1 24 ? 5.248   6.451   1.395   1.00 0.00 ? 24 ALA A O    14 
ATOM 10688 C CB   . ALA A 1 24 ? 3.474   3.946   0.682   1.00 0.00 ? 24 ALA A CB   14 
ATOM 10689 H H    . ALA A 1 24 ? 3.889   4.299   3.226   1.00 0.00 ? 24 ALA A H    14 
ATOM 10690 H HA   . ALA A 1 24 ? 5.437   3.234   1.022   1.00 0.00 ? 24 ALA A HA   14 
ATOM 10691 H HB1  . ALA A 1 24 ? 3.327   4.766   -0.007  1.00 0.00 ? 24 ALA A HB1  14 
ATOM 10692 H HB2  . ALA A 1 24 ? 2.703   3.969   1.438   1.00 0.00 ? 24 ALA A HB2  14 
ATOM 10693 H HB3  . ALA A 1 24 ? 3.423   3.011   0.143   1.00 0.00 ? 24 ALA A HB3  14 
ATOM 10694 N N    . VAL A 1 25 ? 6.417   5.200   -0.076  1.00 0.00 ? 25 VAL A N    14 
ATOM 10695 C CA   . VAL A 1 25 ? 7.169   6.291   -0.660  1.00 0.00 ? 25 VAL A CA   14 
ATOM 10696 C C    . VAL A 1 25 ? 7.182   6.173   -2.177  1.00 0.00 ? 25 VAL A C    14 
ATOM 10697 O O    . VAL A 1 25 ? 7.196   5.063   -2.733  1.00 0.00 ? 25 VAL A O    14 
ATOM 10698 C CB   . VAL A 1 25 ? 8.614   6.291   -0.141  1.00 0.00 ? 25 VAL A CB   14 
ATOM 10699 C CG1  . VAL A 1 25 ? 9.345   5.029   -0.577  1.00 0.00 ? 25 VAL A CG1  14 
ATOM 10700 C CG2  . VAL A 1 25 ? 9.356   7.535   -0.602  1.00 0.00 ? 25 VAL A CG2  14 
ATOM 10701 H H    . VAL A 1 25 ? 6.572   4.303   -0.417  1.00 0.00 ? 25 VAL A H    14 
ATOM 10702 H HA   . VAL A 1 25 ? 6.703   7.223   -0.381  1.00 0.00 ? 25 VAL A HA   14 
ATOM 10703 H HB   . VAL A 1 25 ? 8.572   6.294   0.932   1.00 0.00 ? 25 VAL A HB   14 
ATOM 10704 H HG11 . VAL A 1 25 ? 9.241   4.901   -1.644  1.00 0.00 ? 25 VAL A HG11 14 
ATOM 10705 H HG12 . VAL A 1 25 ? 8.920   4.176   -0.070  1.00 0.00 ? 25 VAL A HG12 14 
ATOM 10706 H HG13 . VAL A 1 25 ? 10.391  5.115   -0.324  1.00 0.00 ? 25 VAL A HG13 14 
ATOM 10707 H HG21 . VAL A 1 25 ? 9.732   7.382   -1.603  1.00 0.00 ? 25 VAL A HG21 14 
ATOM 10708 H HG22 . VAL A 1 25 ? 10.182  7.729   0.066   1.00 0.00 ? 25 VAL A HG22 14 
ATOM 10709 H HG23 . VAL A 1 25 ? 8.682   8.380   -0.595  1.00 0.00 ? 25 VAL A HG23 14 
ATOM 10710 N N    . ILE A 1 26 ? 7.165   7.319   -2.844  1.00 0.00 ? 26 ILE A N    14 
ATOM 10711 C CA   . ILE A 1 26 ? 7.173   7.341   -4.303  1.00 0.00 ? 26 ILE A CA   14 
ATOM 10712 C C    . ILE A 1 26 ? 7.775   8.629   -4.863  1.00 0.00 ? 26 ILE A C    14 
ATOM 10713 O O    . ILE A 1 26 ? 7.071   9.612   -5.093  1.00 0.00 ? 26 ILE A O    14 
ATOM 10714 C CB   . ILE A 1 26 ? 5.764   7.143   -4.905  1.00 0.00 ? 26 ILE A CB   14 
ATOM 10715 C CG1  . ILE A 1 26 ? 4.681   7.719   -3.981  1.00 0.00 ? 26 ILE A CG1  14 
ATOM 10716 C CG2  . ILE A 1 26 ? 5.520   5.668   -5.197  1.00 0.00 ? 26 ILE A CG2  14 
ATOM 10717 C CD1  . ILE A 1 26 ? 4.367   6.868   -2.765  1.00 0.00 ? 26 ILE A CD1  14 
ATOM 10718 H H    . ILE A 1 26 ? 7.144   8.165   -2.340  1.00 0.00 ? 26 ILE A H    14 
ATOM 10719 H HA   . ILE A 1 26 ? 7.788   6.515   -4.631  1.00 0.00 ? 26 ILE A HA   14 
ATOM 10720 H HB   . ILE A 1 26 ? 5.732   7.670   -5.848  1.00 0.00 ? 26 ILE A HB   14 
ATOM 10721 H HG12 . ILE A 1 26 ? 5.004   8.685   -3.626  1.00 0.00 ? 26 ILE A HG12 14 
ATOM 10722 H HG13 . ILE A 1 26 ? 3.766   7.840   -4.545  1.00 0.00 ? 26 ILE A HG13 14 
ATOM 10723 H HG21 . ILE A 1 26 ? 6.467   5.165   -5.317  1.00 0.00 ? 26 ILE A HG21 14 
ATOM 10724 H HG22 . ILE A 1 26 ? 4.945   5.572   -6.106  1.00 0.00 ? 26 ILE A HG22 14 
ATOM 10725 H HG23 . ILE A 1 26 ? 4.976   5.220   -4.380  1.00 0.00 ? 26 ILE A HG23 14 
ATOM 10726 H HD11 . ILE A 1 26 ? 3.339   7.021   -2.476  1.00 0.00 ? 26 ILE A HD11 14 
ATOM 10727 H HD12 . ILE A 1 26 ? 5.011   7.150   -1.951  1.00 0.00 ? 26 ILE A HD12 14 
ATOM 10728 H HD13 . ILE A 1 26 ? 4.521   5.826   -3.001  1.00 0.00 ? 26 ILE A HD13 14 
ATOM 10729 N N    . GLY A 1 27 ? 9.085   8.598   -5.088  1.00 0.00 ? 27 GLY A N    14 
ATOM 10730 C CA   . GLY A 1 27 ? 9.798   9.738   -5.640  1.00 0.00 ? 27 GLY A CA   14 
ATOM 10731 C C    . GLY A 1 27 ? 9.886   10.899  -4.683  1.00 0.00 ? 27 GLY A C    14 
ATOM 10732 O O    . GLY A 1 27 ? 10.976  11.347  -4.326  1.00 0.00 ? 27 GLY A O    14 
ATOM 10733 H H    . GLY A 1 27 ? 9.572   7.788   -4.883  1.00 0.00 ? 27 GLY A H    14 
ATOM 10734 H HA2  . GLY A 1 27 ? 10.799  9.428   -5.902  1.00 0.00 ? 27 GLY A HA2  14 
ATOM 10735 H HA3  . GLY A 1 27 ? 9.291   10.063  -6.537  1.00 0.00 ? 27 GLY A HA3  14 
ATOM 10736 N N    . ASP A 1 28 ? 8.732   11.385  -4.269  1.00 0.00 ? 28 ASP A N    14 
ATOM 10737 C CA   . ASP A 1 28 ? 8.661   12.505  -3.346  1.00 0.00 ? 28 ASP A CA   14 
ATOM 10738 C C    . ASP A 1 28 ? 7.394   12.430  -2.507  1.00 0.00 ? 28 ASP A C    14 
ATOM 10739 O O    . ASP A 1 28 ? 6.923   13.443  -1.990  1.00 0.00 ? 28 ASP A O    14 
ATOM 10740 C CB   . ASP A 1 28 ? 8.704   13.827  -4.112  1.00 0.00 ? 28 ASP A CB   14 
ATOM 10741 C CG   . ASP A 1 28 ? 7.614   13.921  -5.162  1.00 0.00 ? 28 ASP A CG   14 
ATOM 10742 O OD1  . ASP A 1 28 ? 6.592   13.218  -5.021  1.00 0.00 ? 28 ASP A OD1  14 
ATOM 10743 O OD2  . ASP A 1 28 ? 7.783   14.697  -6.126  1.00 0.00 ? 28 ASP A OD2  14 
ATOM 10744 H H    . ASP A 1 28 ? 7.904   10.977  -4.593  1.00 0.00 ? 28 ASP A H    14 
ATOM 10745 H HA   . ASP A 1 28 ? 9.516   12.449  -2.690  1.00 0.00 ? 28 ASP A HA   14 
ATOM 10746 H HB2  . ASP A 1 28 ? 8.579   14.644  -3.416  1.00 0.00 ? 28 ASP A HB2  14 
ATOM 10747 H HB3  . ASP A 1 28 ? 9.661   13.921  -4.602  1.00 0.00 ? 28 ASP A HB3  14 
ATOM 10748 N N    . ALA A 1 29 ? 6.847   11.227  -2.368  1.00 0.00 ? 29 ALA A N    14 
ATOM 10749 C CA   . ALA A 1 29 ? 5.638   11.041  -1.582  1.00 0.00 ? 29 ALA A CA   14 
ATOM 10750 C C    . ALA A 1 29 ? 5.836   9.939   -0.556  1.00 0.00 ? 29 ALA A C    14 
ATOM 10751 O O    . ALA A 1 29 ? 5.401   8.808   -0.755  1.00 0.00 ? 29 ALA A O    14 
ATOM 10752 C CB   . ALA A 1 29 ? 4.455   10.731  -2.487  1.00 0.00 ? 29 ALA A CB   14 
ATOM 10753 H H    . ALA A 1 29 ? 7.269   10.444  -2.801  1.00 0.00 ? 29 ALA A H    14 
ATOM 10754 H HA   . ALA A 1 29 ? 5.432   11.967  -1.063  1.00 0.00 ? 29 ALA A HA   14 
ATOM 10755 H HB1  . ALA A 1 29 ? 4.027   9.778   -2.212  1.00 0.00 ? 29 ALA A HB1  14 
ATOM 10756 H HB2  . ALA A 1 29 ? 4.788   10.693  -3.514  1.00 0.00 ? 29 ALA A HB2  14 
ATOM 10757 H HB3  . ALA A 1 29 ? 3.709   11.505  -2.381  1.00 0.00 ? 29 ALA A HB3  14 
ATOM 10758 N N    . LYS A 1 30 ? 6.503   10.277  0.542   1.00 0.00 ? 30 LYS A N    14 
ATOM 10759 C CA   . LYS A 1 30 ? 6.763   9.310   1.599   1.00 0.00 ? 30 LYS A CA   14 
ATOM 10760 C C    . LYS A 1 30 ? 5.841   9.549   2.790   1.00 0.00 ? 30 LYS A C    14 
ATOM 10761 O O    . LYS A 1 30 ? 6.010   10.515  3.534   1.00 0.00 ? 30 LYS A O    14 
ATOM 10762 C CB   . LYS A 1 30 ? 8.226   9.381   2.058   1.00 0.00 ? 30 LYS A CB   14 
ATOM 10763 C CG   . LYS A 1 30 ? 8.857   10.759  1.921   1.00 0.00 ? 30 LYS A CG   14 
ATOM 10764 C CD   . LYS A 1 30 ? 9.289   11.036  0.490   1.00 0.00 ? 30 LYS A CD   14 
ATOM 10765 C CE   . LYS A 1 30 ? 10.768  10.749  0.284   1.00 0.00 ? 30 LYS A CE   14 
ATOM 10766 N NZ   . LYS A 1 30 ? 11.473  11.895  -0.353  1.00 0.00 ? 30 LYS A NZ   14 
ATOM 10767 H H    . LYS A 1 30 ? 6.826   11.196  0.640   1.00 0.00 ? 30 LYS A H    14 
ATOM 10768 H HA   . LYS A 1 30 ? 6.570   8.326   1.194   1.00 0.00 ? 30 LYS A HA   14 
ATOM 10769 H HB2  . LYS A 1 30 ? 8.275   9.091   3.097   1.00 0.00 ? 30 LYS A HB2  14 
ATOM 10770 H HB3  . LYS A 1 30 ? 8.807   8.684   1.475   1.00 0.00 ? 30 LYS A HB3  14 
ATOM 10771 H HG2  . LYS A 1 30 ? 8.137   11.505  2.219   1.00 0.00 ? 30 LYS A HG2  14 
ATOM 10772 H HG3  . LYS A 1 30 ? 9.722   10.813  2.567   1.00 0.00 ? 30 LYS A HG3  14 
ATOM 10773 H HD2  . LYS A 1 30 ? 8.716   10.408  -0.176  1.00 0.00 ? 30 LYS A HD2  14 
ATOM 10774 H HD3  . LYS A 1 30 ? 9.097   12.074  0.262   1.00 0.00 ? 30 LYS A HD3  14 
ATOM 10775 H HE2  . LYS A 1 30 ? 11.222  10.548  1.244   1.00 0.00 ? 30 LYS A HE2  14 
ATOM 10776 H HE3  . LYS A 1 30 ? 10.868  9.879   -0.349  1.00 0.00 ? 30 LYS A HE3  14 
ATOM 10777 H HZ1  . LYS A 1 30 ? 10.792  12.493  -0.866  1.00 0.00 ? 30 LYS A HZ1  14 
ATOM 10778 H HZ2  . LYS A 1 30 ? 12.187  11.548  -1.025  1.00 0.00 ? 30 LYS A HZ2  14 
ATOM 10779 H HZ3  . LYS A 1 30 ? 11.947  12.472  0.372   1.00 0.00 ? 30 LYS A HZ3  14 
ATOM 10780 N N    . GLU A 1 31 ? 4.867   8.664   2.968   1.00 0.00 ? 31 GLU A N    14 
ATOM 10781 C CA   . GLU A 1 31 ? 3.921   8.785   4.073   1.00 0.00 ? 31 GLU A CA   14 
ATOM 10782 C C    . GLU A 1 31 ? 3.310   7.430   4.411   1.00 0.00 ? 31 GLU A C    14 
ATOM 10783 O O    . GLU A 1 31 ? 3.455   6.468   3.657   1.00 0.00 ? 31 GLU A O    14 
ATOM 10784 C CB   . GLU A 1 31 ? 2.816   9.784   3.723   1.00 0.00 ? 31 GLU A CB   14 
ATOM 10785 C CG   . GLU A 1 31 ? 2.443   10.706  4.874   1.00 0.00 ? 31 GLU A CG   14 
ATOM 10786 C CD   . GLU A 1 31 ? 3.606   11.564  5.334   1.00 0.00 ? 31 GLU A CD   14 
ATOM 10787 O OE1  . GLU A 1 31 ? 4.320   12.110  4.467   1.00 0.00 ? 31 GLU A OE1  14 
ATOM 10788 O OE2  . GLU A 1 31 ? 3.799   11.692  6.561   1.00 0.00 ? 31 GLU A OE2  14 
ATOM 10789 H H    . GLU A 1 31 ? 4.780   7.913   2.344   1.00 0.00 ? 31 GLU A H    14 
ATOM 10790 H HA   . GLU A 1 31 ? 4.463   9.147   4.933   1.00 0.00 ? 31 GLU A HA   14 
ATOM 10791 H HB2  . GLU A 1 31 ? 3.147   10.394  2.895   1.00 0.00 ? 31 GLU A HB2  14 
ATOM 10792 H HB3  . GLU A 1 31 ? 1.932   9.239   3.426   1.00 0.00 ? 31 GLU A HB3  14 
ATOM 10793 H HG2  . GLU A 1 31 ? 1.642   11.354  4.554   1.00 0.00 ? 31 GLU A HG2  14 
ATOM 10794 H HG3  . GLU A 1 31 ? 2.107   10.104  5.705   1.00 0.00 ? 31 GLU A HG3  14 
ATOM 10795 N N    . GLU A 1 32 ? 2.627   7.361   5.548   1.00 0.00 ? 32 GLU A N    14 
ATOM 10796 C CA   . GLU A 1 32 ? 1.995   6.121   5.981   1.00 0.00 ? 32 GLU A CA   14 
ATOM 10797 C C    . GLU A 1 32 ? 0.745   5.836   5.166   1.00 0.00 ? 32 GLU A C    14 
ATOM 10798 O O    . GLU A 1 32 ? 0.202   6.721   4.505   1.00 0.00 ? 32 GLU A O    14 
ATOM 10799 C CB   . GLU A 1 32 ? 1.633   6.187   7.465   1.00 0.00 ? 32 GLU A CB   14 
ATOM 10800 C CG   . GLU A 1 32 ? 2.167   5.018   8.276   1.00 0.00 ? 32 GLU A CG   14 
ATOM 10801 C CD   . GLU A 1 32 ? 3.682   4.980   8.320   1.00 0.00 ? 32 GLU A CD   14 
ATOM 10802 O OE1  . GLU A 1 32 ? 4.317   5.339   7.307   1.00 0.00 ? 32 GLU A OE1  14 
ATOM 10803 O OE2  . GLU A 1 32 ? 4.234   4.593   9.371   1.00 0.00 ? 32 GLU A OE2  14 
ATOM 10804 H H    . GLU A 1 32 ? 2.545   8.162   6.108   1.00 0.00 ? 32 GLU A H    14 
ATOM 10805 H HA   . GLU A 1 32 ? 2.701   5.320   5.825   1.00 0.00 ? 32 GLU A HA   14 
ATOM 10806 H HB2  . GLU A 1 32 ? 2.029   7.099   7.880   1.00 0.00 ? 32 GLU A HB2  14 
ATOM 10807 H HB3  . GLU A 1 32 ? 0.555   6.197   7.559   1.00 0.00 ? 32 GLU A HB3  14 
ATOM 10808 H HG2  . GLU A 1 32 ? 1.796   5.100   9.287   1.00 0.00 ? 32 GLU A HG2  14 
ATOM 10809 H HG3  . GLU A 1 32 ? 1.810   4.099   7.836   1.00 0.00 ? 32 GLU A HG3  14 
ATOM 10810 N N    . HIS A 1 33 ? 0.288   4.594   5.228   1.00 0.00 ? 33 HIS A N    14 
ATOM 10811 C CA   . HIS A 1 33 ? -0.909  4.188   4.506   1.00 0.00 ? 33 HIS A CA   14 
ATOM 10812 C C    . HIS A 1 33 ? -1.635  3.070   5.247   1.00 0.00 ? 33 HIS A C    14 
ATOM 10813 O O    . HIS A 1 33 ? -1.019  2.121   5.726   1.00 0.00 ? 33 HIS A O    14 
ATOM 10814 C CB   . HIS A 1 33 ? -0.551  3.742   3.087   1.00 0.00 ? 33 HIS A CB   14 
ATOM 10815 C CG   . HIS A 1 33 ? -0.936  4.738   2.037   1.00 0.00 ? 33 HIS A CG   14 
ATOM 10816 N ND1  . HIS A 1 33 ? -2.241  4.952   1.643   1.00 0.00 ? 33 HIS A ND1  14 
ATOM 10817 C CD2  . HIS A 1 33 ? -0.179  5.585   1.297   1.00 0.00 ? 33 HIS A CD2  14 
ATOM 10818 C CE1  . HIS A 1 33 ? -2.270  5.885   0.708   1.00 0.00 ? 33 HIS A CE1  14 
ATOM 10819 N NE2  . HIS A 1 33 ? -1.033  6.285   0.481   1.00 0.00 ? 33 HIS A NE2  14 
ATOM 10820 H H    . HIS A 1 33 ? 0.763   3.935   5.778   1.00 0.00 ? 33 HIS A H    14 
ATOM 10821 H HA   . HIS A 1 33 ? -1.562  5.045   4.448   1.00 0.00 ? 33 HIS A HA   14 
ATOM 10822 H HB2  . HIS A 1 33 ? 0.515   3.587   3.023   1.00 0.00 ? 33 HIS A HB2  14 
ATOM 10823 H HB3  . HIS A 1 33 ? -1.059  2.813   2.868   1.00 0.00 ? 33 HIS A HB3  14 
ATOM 10824 H HD1  . HIS A 1 33 ? -3.029  4.489   1.997   1.00 0.00 ? 33 HIS A HD1  14 
ATOM 10825 H HD2  . HIS A 1 33 ? 0.895   5.688   1.342   1.00 0.00 ? 33 HIS A HD2  14 
ATOM 10826 H HE1  . HIS A 1 33 ? -3.155  6.258   0.214   1.00 0.00 ? 33 HIS A HE1  14 
ATOM 10827 H HE2  . HIS A 1 33 ? -0.778  7.029   -0.105  1.00 0.00 ? 33 HIS A HE2  14 
ATOM 10828 N N    . ARG A 1 34 ? -2.949  3.195   5.343   1.00 0.00 ? 34 ARG A N    14 
ATOM 10829 C CA   . ARG A 1 34 ? -3.762  2.196   6.026   1.00 0.00 ? 34 ARG A CA   14 
ATOM 10830 C C    . ARG A 1 34 ? -4.052  1.012   5.112   1.00 0.00 ? 34 ARG A C    14 
ATOM 10831 O O    . ARG A 1 34 ? -3.448  -0.052  5.247   1.00 0.00 ? 34 ARG A O    14 
ATOM 10832 C CB   . ARG A 1 34 ? -5.077  2.811   6.487   1.00 0.00 ? 34 ARG A CB   14 
ATOM 10833 C CG   . ARG A 1 34 ? -5.027  3.403   7.887   1.00 0.00 ? 34 ARG A CG   14 
ATOM 10834 C CD   . ARG A 1 34 ? -3.862  4.369   8.051   1.00 0.00 ? 34 ARG A CD   14 
ATOM 10835 N NE   . ARG A 1 34 ? -2.753  3.767   8.787   1.00 0.00 ? 34 ARG A NE   14 
ATOM 10836 C CZ   . ARG A 1 34 ? -1.758  4.463   9.331   1.00 0.00 ? 34 ARG A CZ   14 
ATOM 10837 N NH1  . ARG A 1 34 ? -1.725  5.786   9.221   1.00 0.00 ? 34 ARG A NH1  14 
ATOM 10838 N NH2  . ARG A 1 34 ? -0.792  3.836   9.988   1.00 0.00 ? 34 ARG A NH2  14 
ATOM 10839 H H    . ARG A 1 34 ? -3.383  3.980   4.948   1.00 0.00 ? 34 ARG A H    14 
ATOM 10840 H HA   . ARG A 1 34 ? -3.213  1.851   6.888   1.00 0.00 ? 34 ARG A HA   14 
ATOM 10841 H HB2  . ARG A 1 34 ? -5.351  3.593   5.795   1.00 0.00 ? 34 ARG A HB2  14 
ATOM 10842 H HB3  . ARG A 1 34 ? -5.837  2.044   6.468   1.00 0.00 ? 34 ARG A HB3  14 
ATOM 10843 H HG2  . ARG A 1 34 ? -5.948  3.934   8.077   1.00 0.00 ? 34 ARG A HG2  14 
ATOM 10844 H HG3  . ARG A 1 34 ? -4.919  2.600   8.602   1.00 0.00 ? 34 ARG A HG3  14 
ATOM 10845 H HD2  . ARG A 1 34 ? -3.515  4.664   7.073   1.00 0.00 ? 34 ARG A HD2  14 
ATOM 10846 H HD3  . ARG A 1 34 ? -4.207  5.240   8.588   1.00 0.00 ? 34 ARG A HD3  14 
ATOM 10847 H HE   . ARG A 1 34 ? -2.750  2.791   8.882   1.00 0.00 ? 34 ARG A HE   14 
ATOM 10848 H HH11 . ARG A 1 34 ? -2.449  6.266   8.726   1.00 0.00 ? 34 ARG A HH11 14 
ATOM 10849 H HH12 . ARG A 1 34 ? -0.973  6.303   9.632   1.00 0.00 ? 34 ARG A HH12 14 
ATOM 10850 H HH21 . ARG A 1 34 ? -0.811  2.839   10.074  1.00 0.00 ? 34 ARG A HH21 14 
ATOM 10851 H HH22 . ARG A 1 34 ? -0.044  4.357   10.397  1.00 0.00 ? 34 ARG A HH22 14 
ATOM 10852 N N    . ASN A 1 35 ? -4.983  1.206   4.181   1.00 0.00 ? 35 ASN A N    14 
ATOM 10853 C CA   . ASN A 1 35 ? -5.353  0.153   3.247   1.00 0.00 ? 35 ASN A CA   14 
ATOM 10854 C C    . ASN A 1 35 ? -4.326  0.059   2.129   1.00 0.00 ? 35 ASN A C    14 
ATOM 10855 O O    . ASN A 1 35 ? -4.594  0.383   0.967   1.00 0.00 ? 35 ASN A O    14 
ATOM 10856 C CB   . ASN A 1 35 ? -6.750  0.402   2.680   1.00 0.00 ? 35 ASN A CB   14 
ATOM 10857 C CG   . ASN A 1 35 ? -7.822  -0.315  3.478   1.00 0.00 ? 35 ASN A CG   14 
ATOM 10858 O OD1  . ASN A 1 35 ? -8.194  0.119   4.568   1.00 0.00 ? 35 ASN A OD1  14 
ATOM 10859 N ND2  . ASN A 1 35 ? -8.319  -1.423  2.942   1.00 0.00 ? 35 ASN A ND2  14 
ATOM 10860 H H    . ASN A 1 35 ? -5.429  2.076   4.124   1.00 0.00 ? 35 ASN A H    14 
ATOM 10861 H HA   . ASN A 1 35 ? -5.358  -0.779  3.791   1.00 0.00 ? 35 ASN A HA   14 
ATOM 10862 H HB2  . ASN A 1 35 ? -6.958  1.463   2.700   1.00 0.00 ? 35 ASN A HB2  14 
ATOM 10863 H HB3  . ASN A 1 35 ? -6.787  0.050   1.660   1.00 0.00 ? 35 ASN A HB3  14 
ATOM 10864 H HD21 . ASN A 1 35 ? -7.973  -1.711  2.073   1.00 0.00 ? 35 ASN A HD21 14 
ATOM 10865 H HD22 . ASN A 1 35 ? -9.014  -1.905  3.436   1.00 0.00 ? 35 ASN A HD22 14 
ATOM 10866 N N    . MET A 1 36 ? -3.139  -0.394  2.506   1.00 0.00 ? 36 MET A N    14 
ATOM 10867 C CA   . MET A 1 36 ? -2.032  -0.551  1.582   1.00 0.00 ? 36 MET A CA   14 
ATOM 10868 C C    . MET A 1 36 ? -2.480  -1.240  0.297   1.00 0.00 ? 36 MET A C    14 
ATOM 10869 O O    . MET A 1 36 ? -1.914  -1.007  -0.771  1.00 0.00 ? 36 MET A O    14 
ATOM 10870 C CB   . MET A 1 36 ? -0.928  -1.351  2.269   1.00 0.00 ? 36 MET A CB   14 
ATOM 10871 C CG   . MET A 1 36 ? 0.200   -1.784  1.343   1.00 0.00 ? 36 MET A CG   14 
ATOM 10872 S SD   . MET A 1 36 ? 0.377   -3.577  1.251   1.00 0.00 ? 36 MET A SD   14 
ATOM 10873 C CE   . MET A 1 36 ? -1.271  -4.057  0.739   1.00 0.00 ? 36 MET A CE   14 
ATOM 10874 H H    . MET A 1 36 ? -3.002  -0.630  3.444   1.00 0.00 ? 36 MET A H    14 
ATOM 10875 H HA   . MET A 1 36 ? -1.655  0.431   1.340   1.00 0.00 ? 36 MET A HA   14 
ATOM 10876 H HB2  . MET A 1 36 ? -0.508  -0.744  3.057   1.00 0.00 ? 36 MET A HB2  14 
ATOM 10877 H HB3  . MET A 1 36 ? -1.369  -2.232  2.711   1.00 0.00 ? 36 MET A HB3  14 
ATOM 10878 H HG2  . MET A 1 36 ? -0.002  -1.407  0.351   1.00 0.00 ? 36 MET A HG2  14 
ATOM 10879 H HG3  . MET A 1 36 ? 1.126   -1.363  1.705   1.00 0.00 ? 36 MET A HG3  14 
ATOM 10880 H HE1  . MET A 1 36 ? -1.471  -3.661  -0.245  1.00 0.00 ? 36 MET A HE1  14 
ATOM 10881 H HE2  . MET A 1 36 ? -1.993  -3.665  1.440   1.00 0.00 ? 36 MET A HE2  14 
ATOM 10882 H HE3  . MET A 1 36 ? -1.340  -5.135  0.716   1.00 0.00 ? 36 MET A HE3  14 
ATOM 10883 N N    . CYS A 1 37 ? -3.503  -2.081  0.403   1.00 0.00 ? 37 CYS A N    14 
ATOM 10884 C CA   . CYS A 1 37 ? -4.018  -2.786  -0.761  1.00 0.00 ? 37 CYS A CA   14 
ATOM 10885 C C    . CYS A 1 37 ? -4.546  -1.792  -1.791  1.00 0.00 ? 37 CYS A C    14 
ATOM 10886 O O    . CYS A 1 37 ? -4.235  -1.893  -2.976  1.00 0.00 ? 37 CYS A O    14 
ATOM 10887 C CB   . CYS A 1 37 ? -5.106  -3.788  -0.359  1.00 0.00 ? 37 CYS A CB   14 
ATOM 10888 S SG   . CYS A 1 37 ? -6.677  -3.037  0.179   1.00 0.00 ? 37 CYS A SG   14 
ATOM 10889 H H    . CYS A 1 37 ? -3.920  -2.224  1.280   1.00 0.00 ? 37 CYS A H    14 
ATOM 10890 H HA   . CYS A 1 37 ? -3.196  -3.325  -1.203  1.00 0.00 ? 37 CYS A HA   14 
ATOM 10891 H HB2  . CYS A 1 37 ? -5.324  -4.426  -1.201  1.00 0.00 ? 37 CYS A HB2  14 
ATOM 10892 H HB3  . CYS A 1 37 ? -4.737  -4.395  0.456   1.00 0.00 ? 37 CYS A HB3  14 
ATOM 10893 N N    . ALA A 1 38 ? -5.314  -0.811  -1.323  1.00 0.00 ? 38 ALA A N    14 
ATOM 10894 C CA   . ALA A 1 38 ? -5.851  0.222   -2.203  1.00 0.00 ? 38 ALA A CA   14 
ATOM 10895 C C    . ALA A 1 38 ? -4.711  0.980   -2.863  1.00 0.00 ? 38 ALA A C    14 
ATOM 10896 O O    . ALA A 1 38 ? -4.837  1.470   -3.985  1.00 0.00 ? 38 ALA A O    14 
ATOM 10897 C CB   . ALA A 1 38 ? -6.759  1.166   -1.425  1.00 0.00 ? 38 ALA A CB   14 
ATOM 10898 H H    . ALA A 1 38 ? -5.500  -0.769  -0.363  1.00 0.00 ? 38 ALA A H    14 
ATOM 10899 H HA   . ALA A 1 38 ? -6.436  -0.258  -2.971  1.00 0.00 ? 38 ALA A HA   14 
ATOM 10900 H HB1  . ALA A 1 38 ? -7.491  0.591   -0.876  1.00 0.00 ? 38 ALA A HB1  14 
ATOM 10901 H HB2  . ALA A 1 38 ? -7.266  1.828   -2.112  1.00 0.00 ? 38 ALA A HB2  14 
ATOM 10902 H HB3  . ALA A 1 38 ? -6.168  1.749   -0.734  1.00 0.00 ? 38 ALA A HB3  14 
ATOM 10903 N N    . LEU A 1 39 ? -3.592  1.053   -2.157  1.00 0.00 ? 39 LEU A N    14 
ATOM 10904 C CA   . LEU A 1 39 ? -2.404  1.728   -2.663  1.00 0.00 ? 39 LEU A CA   14 
ATOM 10905 C C    . LEU A 1 39 ? -1.771  0.922   -3.785  1.00 0.00 ? 39 LEU A C    14 
ATOM 10906 O O    . LEU A 1 39 ? -1.389  1.464   -4.818  1.00 0.00 ? 39 LEU A O    14 
ATOM 10907 C CB   . LEU A 1 39 ? -1.390  1.888   -1.533  1.00 0.00 ? 39 LEU A CB   14 
ATOM 10908 C CG   . LEU A 1 39 ? -0.982  3.321   -1.170  1.00 0.00 ? 39 LEU A CG   14 
ATOM 10909 C CD1  . LEU A 1 39 ? 0.411   3.321   -0.564  1.00 0.00 ? 39 LEU A CD1  14 
ATOM 10910 C CD2  . LEU A 1 39 ? -1.029  4.241   -2.385  1.00 0.00 ? 39 LEU A CD2  14 
ATOM 10911 H H    . LEU A 1 39 ? -3.558  0.629   -1.269  1.00 0.00 ? 39 LEU A H    14 
ATOM 10912 H HA   . LEU A 1 39 ? -2.692  2.695   -3.036  1.00 0.00 ? 39 LEU A HA   14 
ATOM 10913 H HB2  . LEU A 1 39 ? -1.807  1.421   -0.657  1.00 0.00 ? 39 LEU A HB2  14 
ATOM 10914 H HB3  . LEU A 1 39 ? -0.494  1.348   -1.807  1.00 0.00 ? 39 LEU A HB3  14 
ATOM 10915 H HG   . LEU A 1 39 ? -1.669  3.707   -0.428  1.00 0.00 ? 39 LEU A HG   14 
ATOM 10916 H HD11 . LEU A 1 39 ? 0.337   3.280   0.512   1.00 0.00 ? 39 LEU A HD11 14 
ATOM 10917 H HD12 . LEU A 1 39 ? 0.934   4.220   -0.856  1.00 0.00 ? 39 LEU A HD12 14 
ATOM 10918 H HD13 . LEU A 1 39 ? 0.957   2.458   -0.919  1.00 0.00 ? 39 LEU A HD13 14 
ATOM 10919 H HD21 . LEU A 1 39 ? -0.574  3.746   -3.229  1.00 0.00 ? 39 LEU A HD21 14 
ATOM 10920 H HD22 . LEU A 1 39 ? -0.491  5.152   -2.168  1.00 0.00 ? 39 LEU A HD22 14 
ATOM 10921 H HD23 . LEU A 1 39 ? -2.057  4.479   -2.616  1.00 0.00 ? 39 LEU A HD23 14 
ATOM 10922 N N    . CYS A 1 40 ? -1.654  -0.376  -3.557  1.00 0.00 ? 40 CYS A N    14 
ATOM 10923 C CA   . CYS A 1 40 ? -1.056  -1.277  -4.528  1.00 0.00 ? 40 CYS A CA   14 
ATOM 10924 C C    . CYS A 1 40 ? -1.832  -1.258  -5.833  1.00 0.00 ? 40 CYS A C    14 
ATOM 10925 O O    . CYS A 1 40 ? -1.262  -1.418  -6.910  1.00 0.00 ? 40 CYS A O    14 
ATOM 10926 C CB   . CYS A 1 40 ? -1.017  -2.697  -3.968  1.00 0.00 ? 40 CYS A CB   14 
ATOM 10927 S SG   . CYS A 1 40 ? -0.350  -3.937  -5.123  1.00 0.00 ? 40 CYS A SG   14 
ATOM 10928 H H    . CYS A 1 40 ? -1.973  -0.736  -2.706  1.00 0.00 ? 40 CYS A H    14 
ATOM 10929 H HA   . CYS A 1 40 ? -0.048  -0.946  -4.713  1.00 0.00 ? 40 CYS A HA   14 
ATOM 10930 H HB2  . CYS A 1 40 ? -0.400  -2.705  -3.084  1.00 0.00 ? 40 CYS A HB2  14 
ATOM 10931 H HB3  . CYS A 1 40 ? -2.020  -2.999  -3.706  1.00 0.00 ? 40 CYS A HB3  14 
ATOM 10932 N N    . CYS A 1 41 ? -3.138  -1.069  -5.730  1.00 0.00 ? 41 CYS A N    14 
ATOM 10933 C CA   . CYS A 1 41 ? -3.990  -1.038  -6.904  1.00 0.00 ? 41 CYS A CA   14 
ATOM 10934 C C    . CYS A 1 41 ? -4.017  0.353   -7.523  1.00 0.00 ? 41 CYS A C    14 
ATOM 10935 O O    . CYS A 1 41 ? -4.099  0.507   -8.742  1.00 0.00 ? 41 CYS A O    14 
ATOM 10936 C CB   . CYS A 1 41 ? -5.392  -1.490  -6.517  1.00 0.00 ? 41 CYS A CB   14 
ATOM 10937 S SG   . CYS A 1 41 ? -6.530  -0.170  -5.987  1.00 0.00 ? 41 CYS A SG   14 
ATOM 10938 H H    . CYS A 1 41 ? -3.542  -0.954  -4.839  1.00 0.00 ? 41 CYS A H    14 
ATOM 10939 H HA   . CYS A 1 41 ? -3.589  -1.737  -7.621  1.00 0.00 ? 41 CYS A HA   14 
ATOM 10940 H HB2  . CYS A 1 41 ? -5.840  -1.988  -7.353  1.00 0.00 ? 41 CYS A HB2  14 
ATOM 10941 H HB3  . CYS A 1 41 ? -5.304  -2.181  -5.701  1.00 0.00 ? 41 CYS A HB3  14 
ATOM 10942 N N    . GLU A 1 42 ? -3.968  1.359   -6.663  1.00 0.00 ? 42 GLU A N    14 
ATOM 10943 C CA   . GLU A 1 42 ? -4.006  2.754   -7.106  1.00 0.00 ? 42 GLU A CA   14 
ATOM 10944 C C    . GLU A 1 42 ? -2.610  3.335   -7.360  1.00 0.00 ? 42 GLU A C    14 
ATOM 10945 O O    . GLU A 1 42 ? -2.477  4.525   -7.648  1.00 0.00 ? 42 GLU A O    14 
ATOM 10946 C CB   . GLU A 1 42 ? -4.736  3.616   -6.073  1.00 0.00 ? 42 GLU A CB   14 
ATOM 10947 C CG   . GLU A 1 42 ? -5.248  4.935   -6.634  1.00 0.00 ? 42 GLU A CG   14 
ATOM 10948 C CD   . GLU A 1 42 ? -4.597  6.140   -5.982  1.00 0.00 ? 42 GLU A CD   14 
ATOM 10949 O OE1  . GLU A 1 42 ? -4.894  6.407   -4.798  1.00 0.00 ? 42 GLU A OE1  14 
ATOM 10950 O OE2  . GLU A 1 42 ? -3.791  6.816   -6.654  1.00 0.00 ? 42 GLU A OE2  14 
ATOM 10951 H H    . GLU A 1 42 ? -3.922  1.154   -5.702  1.00 0.00 ? 42 GLU A H    14 
ATOM 10952 H HA   . GLU A 1 42 ? -4.562  2.785   -8.031  1.00 0.00 ? 42 GLU A HA   14 
ATOM 10953 H HB2  . GLU A 1 42 ? -5.579  3.062   -5.690  1.00 0.00 ? 42 GLU A HB2  14 
ATOM 10954 H HB3  . GLU A 1 42 ? -4.058  3.834   -5.260  1.00 0.00 ? 42 GLU A HB3  14 
ATOM 10955 H HG2  . GLU A 1 42 ? -5.042  4.965   -7.694  1.00 0.00 ? 42 GLU A HG2  14 
ATOM 10956 H HG3  . GLU A 1 42 ? -6.314  4.990   -6.473  1.00 0.00 ? 42 GLU A HG3  14 
ATOM 10957 N N    . HIS A 1 43 ? -1.571  2.510   -7.250  1.00 0.00 ? 43 HIS A N    14 
ATOM 10958 C CA   . HIS A 1 43 ? -0.203  2.984   -7.469  1.00 0.00 ? 43 HIS A CA   14 
ATOM 10959 C C    . HIS A 1 43 ? 0.126   3.074   -8.959  1.00 0.00 ? 43 HIS A C    14 
ATOM 10960 O O    . HIS A 1 43 ? -0.616  2.568   -9.800  1.00 0.00 ? 43 HIS A O    14 
ATOM 10961 C CB   . HIS A 1 43 ? 0.808   2.082   -6.749  1.00 0.00 ? 43 HIS A CB   14 
ATOM 10962 C CG   . HIS A 1 43 ? 0.885   0.673   -7.258  1.00 0.00 ? 43 HIS A CG   14 
ATOM 10963 N ND1  . HIS A 1 43 ? 0.522   0.291   -8.536  1.00 0.00 ? 43 HIS A ND1  14 
ATOM 10964 C CD2  . HIS A 1 43 ? 1.317   -0.453  -6.644  1.00 0.00 ? 43 HIS A CD2  14 
ATOM 10965 C CE1  . HIS A 1 43 ? 0.731   -1.005  -8.682  1.00 0.00 ? 43 HIS A CE1  14 
ATOM 10966 N NE2  . HIS A 1 43 ? 1.214   -1.480  -7.550  1.00 0.00 ? 43 HIS A NE2  14 
ATOM 10967 H H    . HIS A 1 43 ? -1.724  1.573   -7.010  1.00 0.00 ? 43 HIS A H    14 
ATOM 10968 H HA   . HIS A 1 43 ? -0.134  3.977   -7.051  1.00 0.00 ? 43 HIS A HA   14 
ATOM 10969 H HB2  . HIS A 1 43 ? 1.791   2.513   -6.847  1.00 0.00 ? 43 HIS A HB2  14 
ATOM 10970 H HB3  . HIS A 1 43 ? 0.550   2.041   -5.701  1.00 0.00 ? 43 HIS A HB3  14 
ATOM 10971 H HD1  . HIS A 1 43 ? 0.160   0.877   -9.230  1.00 0.00 ? 43 HIS A HD1  14 
ATOM 10972 H HD2  . HIS A 1 43 ? 1.674   -0.528  -5.624  1.00 0.00 ? 43 HIS A HD2  14 
ATOM 10973 H HE1  . HIS A 1 43 ? 0.542   -1.579  -9.578  1.00 0.00 ? 43 HIS A HE1  14 
ATOM 10974 H HE2  . HIS A 1 43 ? 1.370   -2.427  -7.354  1.00 0.00 ? 43 HIS A HE2  14 
ATOM 10975 N N    . PRO A 1 44 ? 1.249   3.731   -9.305  1.00 0.00 ? 44 PRO A N    14 
ATOM 10976 C CA   . PRO A 1 44 ? 1.677   3.897   -10.699 1.00 0.00 ? 44 PRO A CA   14 
ATOM 10977 C C    . PRO A 1 44 ? 2.077   2.575   -11.344 1.00 0.00 ? 44 PRO A C    14 
ATOM 10978 O O    . PRO A 1 44 ? 1.416   2.097   -12.265 1.00 0.00 ? 44 PRO A O    14 
ATOM 10979 C CB   . PRO A 1 44 ? 2.892   4.834   -10.606 1.00 0.00 ? 44 PRO A CB   14 
ATOM 10980 C CG   . PRO A 1 44 ? 2.858   5.401   -9.224  1.00 0.00 ? 44 PRO A CG   14 
ATOM 10981 C CD   . PRO A 1 44 ? 2.186   4.367   -8.369  1.00 0.00 ? 44 PRO A CD   14 
ATOM 10982 H HA   . PRO A 1 44 ? 0.906   4.364   -11.293 1.00 0.00 ? 44 PRO A HA   14 
ATOM 10983 H HB2  . PRO A 1 44 ? 3.797   4.270   -10.776 1.00 0.00 ? 44 PRO A HB2  14 
ATOM 10984 H HB3  . PRO A 1 44 ? 2.805   5.611   -11.350 1.00 0.00 ? 44 PRO A HB3  14 
ATOM 10985 H HG2  . PRO A 1 44 ? 3.864   5.578   -8.875  1.00 0.00 ? 44 PRO A HG2  14 
ATOM 10986 H HG3  . PRO A 1 44 ? 2.290   6.320   -9.219  1.00 0.00 ? 44 PRO A HG3  14 
ATOM 10987 H HD2  . PRO A 1 44 ? 2.909   3.653   -8.001  1.00 0.00 ? 44 PRO A HD2  14 
ATOM 10988 H HD3  . PRO A 1 44 ? 1.659   4.834   -7.550  1.00 0.00 ? 44 PRO A HD3  14 
ATOM 10989 N N    . GLY A 1 45 ? 3.167   1.991   -10.856 1.00 0.00 ? 45 GLY A N    14 
ATOM 10990 C CA   . GLY A 1 45 ? 3.637   0.731   -11.400 1.00 0.00 ? 45 GLY A CA   14 
ATOM 10991 C C    . GLY A 1 45 ? 4.528   -0.025  -10.435 1.00 0.00 ? 45 GLY A C    14 
ATOM 10992 O O    . GLY A 1 45 ? 5.361   -0.832  -10.851 1.00 0.00 ? 45 GLY A O    14 
ATOM 10993 H H    . GLY A 1 45 ? 3.656   2.419   -10.123 1.00 0.00 ? 45 GLY A H    14 
ATOM 10994 H HA2  . GLY A 1 45 ? 2.784   0.116   -11.643 1.00 0.00 ? 45 GLY A HA2  14 
ATOM 10995 H HA3  . GLY A 1 45 ? 4.193   0.929   -12.305 1.00 0.00 ? 45 GLY A HA3  14 
ATOM 10996 N N    . GLY A 1 46 ? 4.353   0.229   -9.141  1.00 0.00 ? 46 GLY A N    14 
ATOM 10997 C CA   . GLY A 1 46 ? 5.155   -0.447  -8.139  1.00 0.00 ? 46 GLY A CA   14 
ATOM 10998 C C    . GLY A 1 46 ? 5.486   0.437   -6.954  1.00 0.00 ? 46 GLY A C    14 
ATOM 10999 O O    . GLY A 1 46 ? 6.647   0.777   -6.730  1.00 0.00 ? 46 GLY A O    14 
ATOM 11000 H H    . GLY A 1 46 ? 3.673   0.879   -8.866  1.00 0.00 ? 46 GLY A H    14 
ATOM 11001 H HA2  . GLY A 1 46 ? 4.613   -1.312  -7.786  1.00 0.00 ? 46 GLY A HA2  14 
ATOM 11002 H HA3  . GLY A 1 46 ? 6.078   -0.778  -8.595  1.00 0.00 ? 46 GLY A HA3  14 
ATOM 11003 N N    . PHE A 1 47 ? 4.465   0.800   -6.187  1.00 0.00 ? 47 PHE A N    14 
ATOM 11004 C CA   . PHE A 1 47 ? 4.654   1.641   -5.010  1.00 0.00 ? 47 PHE A CA   14 
ATOM 11005 C C    . PHE A 1 47 ? 5.652   0.997   -4.056  1.00 0.00 ? 47 PHE A C    14 
ATOM 11006 O O    . PHE A 1 47 ? 5.658   -0.222  -3.884  1.00 0.00 ? 47 PHE A O    14 
ATOM 11007 C CB   . PHE A 1 47 ? 3.319   1.857   -4.291  1.00 0.00 ? 47 PHE A CB   14 
ATOM 11008 C CG   . PHE A 1 47 ? 2.862   3.288   -4.274  1.00 0.00 ? 47 PHE A CG   14 
ATOM 11009 C CD1  . PHE A 1 47 ? 2.998   4.086   -5.395  1.00 0.00 ? 47 PHE A CD1  14 
ATOM 11010 C CD2  . PHE A 1 47 ? 2.288   3.830   -3.136  1.00 0.00 ? 47 PHE A CD2  14 
ATOM 11011 C CE1  . PHE A 1 47 ? 2.569   5.400   -5.384  1.00 0.00 ? 47 PHE A CE1  14 
ATOM 11012 C CE2  . PHE A 1 47 ? 1.860   5.143   -3.119  1.00 0.00 ? 47 PHE A CE2  14 
ATOM 11013 C CZ   . PHE A 1 47 ? 2.000   5.929   -4.245  1.00 0.00 ? 47 PHE A CZ   14 
ATOM 11014 H H    . PHE A 1 47 ? 3.564   0.491   -6.411  1.00 0.00 ? 47 PHE A H    14 
ATOM 11015 H HA   . PHE A 1 47 ? 5.041   2.594   -5.336  1.00 0.00 ? 47 PHE A HA   14 
ATOM 11016 H HB2  . PHE A 1 47 ? 2.556   1.274   -4.785  1.00 0.00 ? 47 PHE A HB2  14 
ATOM 11017 H HB3  . PHE A 1 47 ? 3.410   1.524   -3.266  1.00 0.00 ? 47 PHE A HB3  14 
ATOM 11018 H HD1  . PHE A 1 47 ? 3.445   3.673   -6.285  1.00 0.00 ? 47 PHE A HD1  14 
ATOM 11019 H HD2  . PHE A 1 47 ? 2.181   3.217   -2.256  1.00 0.00 ? 47 PHE A HD2  14 
ATOM 11020 H HE1  . PHE A 1 47 ? 2.682   6.011   -6.267  1.00 0.00 ? 47 PHE A HE1  14 
ATOM 11021 H HE2  . PHE A 1 47 ? 1.416   5.555   -2.224  1.00 0.00 ? 47 PHE A HE2  14 
ATOM 11022 H HZ   . PHE A 1 47 ? 1.665   6.956   -4.234  1.00 0.00 ? 47 PHE A HZ   14 
ATOM 11023 N N    . GLU A 1 48 ? 6.490   1.814   -3.428  1.00 0.00 ? 48 GLU A N    14 
ATOM 11024 C CA   . GLU A 1 48 ? 7.475   1.294   -2.485  1.00 0.00 ? 48 GLU A CA   14 
ATOM 11025 C C    . GLU A 1 48 ? 7.016   1.552   -1.075  1.00 0.00 ? 48 GLU A C    14 
ATOM 11026 O O    . GLU A 1 48 ? 6.931   2.693   -0.642  1.00 0.00 ? 48 GLU A O    14 
ATOM 11027 C CB   . GLU A 1 48 ? 8.826   1.969   -2.697  1.00 0.00 ? 48 GLU A CB   14 
ATOM 11028 C CG   . GLU A 1 48 ? 9.809   1.773   -1.554  1.00 0.00 ? 48 GLU A CG   14 
ATOM 11029 C CD   . GLU A 1 48 ? 11.253  1.780   -2.020  1.00 0.00 ? 48 GLU A CD   14 
ATOM 11030 O OE1  . GLU A 1 48 ? 11.507  1.372   -3.173  1.00 0.00 ? 48 GLU A OE1  14 
ATOM 11031 O OE2  . GLU A 1 48 ? 12.130  2.192   -1.231  1.00 0.00 ? 48 GLU A OE2  14 
ATOM 11032 H H    . GLU A 1 48 ? 6.438   2.789   -3.591  1.00 0.00 ? 48 GLU A H    14 
ATOM 11033 H HA   . GLU A 1 48 ? 7.569   0.215   -2.639  1.00 0.00 ? 48 GLU A HA   14 
ATOM 11034 H HB2  . GLU A 1 48 ? 9.270   1.579   -3.590  1.00 0.00 ? 48 GLU A HB2  14 
ATOM 11035 H HB3  . GLU A 1 48 ? 8.659   3.029   -2.811  1.00 0.00 ? 48 GLU A HB3  14 
ATOM 11036 H HG2  . GLU A 1 48 ? 9.674   2.573   -0.842  1.00 0.00 ? 48 GLU A HG2  14 
ATOM 11037 H HG3  . GLU A 1 48 ? 9.600   0.831   -1.077  1.00 0.00 ? 48 GLU A HG3  14 
ATOM 11038 N N    . TYR A 1 49 ? 6.728   0.497   -0.360  1.00 0.00 ? 49 TYR A N    14 
ATOM 11039 C CA   . TYR A 1 49 ? 6.284   0.628   1.002   1.00 0.00 ? 49 TYR A CA   14 
ATOM 11040 C C    . TYR A 1 49 ? 7.018   -0.328  1.904   1.00 0.00 ? 49 TYR A C    14 
ATOM 11041 O O    . TYR A 1 49 ? 7.531   -1.357  1.466   1.00 0.00 ? 49 TYR A O    14 
ATOM 11042 C CB   . TYR A 1 49 ? 4.810   0.349   1.100   1.00 0.00 ? 49 TYR A CB   14 
ATOM 11043 C CG   . TYR A 1 49 ? 4.387   -0.804  0.261   1.00 0.00 ? 49 TYR A CG   14 
ATOM 11044 C CD1  . TYR A 1 49 ? 4.765   -2.089  0.601   1.00 0.00 ? 49 TYR A CD1  14 
ATOM 11045 C CD2  . TYR A 1 49 ? 3.640   -0.608  -0.879  1.00 0.00 ? 49 TYR A CD2  14 
ATOM 11046 C CE1  . TYR A 1 49 ? 4.403   -3.158  -0.174  1.00 0.00 ? 49 TYR A CE1  14 
ATOM 11047 C CE2  . TYR A 1 49 ? 3.276   -1.664  -1.667  1.00 0.00 ? 49 TYR A CE2  14 
ATOM 11048 C CZ   . TYR A 1 49 ? 3.657   -2.941  -1.316  1.00 0.00 ? 49 TYR A CZ   14 
ATOM 11049 O OH   . TYR A 1 49 ? 3.302   -3.991  -2.118  1.00 0.00 ? 49 TYR A OH   14 
ATOM 11050 H H    . TYR A 1 49 ? 6.817   -0.394  -0.755  1.00 0.00 ? 49 TYR A H    14 
ATOM 11051 H HA   . TYR A 1 49 ? 6.459   1.634   1.325   1.00 0.00 ? 49 TYR A HA   14 
ATOM 11052 H HB2  . TYR A 1 49 ? 4.576   0.115   2.118   1.00 0.00 ? 49 TYR A HB2  14 
ATOM 11053 H HB3  . TYR A 1 49 ? 4.256   1.219   0.788   1.00 0.00 ? 49 TYR A HB3  14 
ATOM 11054 H HD1  . TYR A 1 49 ? 5.348   -2.246  1.496   1.00 0.00 ? 49 TYR A HD1  14 
ATOM 11055 H HD2  . TYR A 1 49 ? 3.342   0.394   -1.151  1.00 0.00 ? 49 TYR A HD2  14 
ATOM 11056 H HE1  . TYR A 1 49 ? 4.708   -4.151  0.116   1.00 0.00 ? 49 TYR A HE1  14 
ATOM 11057 H HE2  . TYR A 1 49 ? 2.691   -1.491  -2.548  1.00 0.00 ? 49 TYR A HE2  14 
ATOM 11058 H HH   . TYR A 1 49 ? 3.453   -3.756  -3.036  1.00 0.00 ? 49 TYR A HH   14 
ATOM 11059 N N    . SER A 1 50 ? 7.030   0.005   3.170   1.00 0.00 ? 50 SER A N    14 
ATOM 11060 C CA   . SER A 1 50 ? 7.663   -0.838  4.162   1.00 0.00 ? 50 SER A CA   14 
ATOM 11061 C C    . SER A 1 50 ? 6.711   -1.044  5.314   1.00 0.00 ? 50 SER A C    14 
ATOM 11062 O O    . SER A 1 50 ? 6.606   -0.213  6.216   1.00 0.00 ? 50 SER A O    14 
ATOM 11063 C CB   . SER A 1 50 ? 8.973   -0.240  4.640   1.00 0.00 ? 50 SER A CB   14 
ATOM 11064 O OG   . SER A 1 50 ? 8.758   0.826   5.547   1.00 0.00 ? 50 SER A OG   14 
ATOM 11065 H H    . SER A 1 50 ? 6.574   0.832   3.449   1.00 0.00 ? 50 SER A H    14 
ATOM 11066 H HA   . SER A 1 50 ? 7.860   -1.795  3.702   1.00 0.00 ? 50 SER A HA   14 
ATOM 11067 H HB2  . SER A 1 50 ? 9.546   -1.009  5.134   1.00 0.00 ? 50 SER A HB2  14 
ATOM 11068 H HB3  . SER A 1 50 ? 9.520   0.128   3.787   1.00 0.00 ? 50 SER A HB3  14 
ATOM 11069 H HG   . SER A 1 50 ? 8.437   0.478   6.382   1.00 0.00 ? 50 SER A HG   14 
ATOM 11070 N N    . ASN A 1 51 ? 5.992   -2.147  5.252   1.00 0.00 ? 51 ASN A N    14 
ATOM 11071 C CA   . ASN A 1 51 ? 5.006   -2.466  6.267   1.00 0.00 ? 51 ASN A CA   14 
ATOM 11072 C C    . ASN A 1 51 ? 5.590   -2.355  7.665   1.00 0.00 ? 51 ASN A C    14 
ATOM 11073 O O    . ASN A 1 51 ? 6.661   -2.888  7.954   1.00 0.00 ? 51 ASN A O    14 
ATOM 11074 C CB   . ASN A 1 51 ? 4.435   -3.863  6.069   1.00 0.00 ? 51 ASN A CB   14 
ATOM 11075 C CG   . ASN A 1 51 ? 3.931   -4.092  4.657   1.00 0.00 ? 51 ASN A CG   14 
ATOM 11076 O OD1  . ASN A 1 51 ? 4.672   -3.937  3.688   1.00 0.00 ? 51 ASN A OD1  14 
ATOM 11077 N ND2  . ASN A 1 51 ? 2.661   -4.467  4.537   1.00 0.00 ? 51 ASN A ND2  14 
ATOM 11078 H H    . ASN A 1 51 ? 6.116   -2.750  4.491   1.00 0.00 ? 51 ASN A H    14 
ATOM 11079 H HA   . ASN A 1 51 ? 4.203   -1.752  6.166   1.00 0.00 ? 51 ASN A HA   14 
ATOM 11080 H HB2  . ASN A 1 51 ? 5.201   -4.593  6.284   1.00 0.00 ? 51 ASN A HB2  14 
ATOM 11081 H HB3  . ASN A 1 51 ? 3.612   -3.994  6.756   1.00 0.00 ? 51 ASN A HB3  14 
ATOM 11082 H HD21 . ASN A 1 51 ? 2.130   -4.571  5.353   1.00 0.00 ? 51 ASN A HD21 14 
ATOM 11083 H HD22 . ASN A 1 51 ? 2.310   -4.622  3.636   1.00 0.00 ? 51 ASN A HD22 14 
ATOM 11084 N N    . GLY A 1 52 ? 4.865   -1.667  8.528   1.00 0.00 ? 52 GLY A N    14 
ATOM 11085 C CA   . GLY A 1 52 ? 5.305   -1.497  9.903   1.00 0.00 ? 52 GLY A CA   14 
ATOM 11086 C C    . GLY A 1 52 ? 5.475   -0.041  10.299  1.00 0.00 ? 52 GLY A C    14 
ATOM 11087 O O    . GLY A 1 52 ? 5.058   0.858   9.569   1.00 0.00 ? 52 GLY A O    14 
ATOM 11088 H H    . GLY A 1 52 ? 4.016   -1.278  8.226   1.00 0.00 ? 52 GLY A H    14 
ATOM 11089 H HA2  . GLY A 1 52 ? 4.579   -1.951  10.559  1.00 0.00 ? 52 GLY A HA2  14 
ATOM 11090 H HA3  . GLY A 1 52 ? 6.251   -2.004  10.029  1.00 0.00 ? 52 GLY A HA3  14 
ATOM 11091 N N    . PRO A 1 53 ? 6.093   0.221   11.467  1.00 0.00 ? 53 PRO A N    14 
ATOM 11092 C CA   . PRO A 1 53 ? 6.316   1.586   11.960  1.00 0.00 ? 53 PRO A CA   14 
ATOM 11093 C C    . PRO A 1 53 ? 7.126   2.428   10.983  1.00 0.00 ? 53 PRO A C    14 
ATOM 11094 O O    . PRO A 1 53 ? 7.906   1.899   10.191  1.00 0.00 ? 53 PRO A O    14 
ATOM 11095 C CB   . PRO A 1 53 ? 7.092   1.383   13.270  1.00 0.00 ? 53 PRO A CB   14 
ATOM 11096 C CG   . PRO A 1 53 ? 7.619   -0.010  13.202  1.00 0.00 ? 53 PRO A CG   14 
ATOM 11097 C CD   . PRO A 1 53 ? 6.622   -0.789  12.396  1.00 0.00 ? 53 PRO A CD   14 
ATOM 11098 H HA   . PRO A 1 53 ? 5.379   2.085   12.169  1.00 0.00 ? 53 PRO A HA   14 
ATOM 11099 H HB2  . PRO A 1 53 ? 7.892   2.105   13.331  1.00 0.00 ? 53 PRO A HB2  14 
ATOM 11100 H HB3  . PRO A 1 53 ? 6.422   1.508   14.108  1.00 0.00 ? 53 PRO A HB3  14 
ATOM 11101 H HG2  . PRO A 1 53 ? 8.583   -0.015  12.714  1.00 0.00 ? 53 PRO A HG2  14 
ATOM 11102 H HG3  . PRO A 1 53 ? 7.700   -0.422  14.198  1.00 0.00 ? 53 PRO A HG3  14 
ATOM 11103 H HD2  . PRO A 1 53 ? 7.111   -1.590  11.861  1.00 0.00 ? 53 PRO A HD2  14 
ATOM 11104 H HD3  . PRO A 1 53 ? 5.840   -1.177  13.032  1.00 0.00 ? 53 PRO A HD3  14 
ATOM 11105 N N    . CYS A 1 54 ? 6.932   3.743   11.040  1.00 0.00 ? 54 CYS A N    14 
ATOM 11106 C CA   . CYS A 1 54 ? 7.641   4.661   10.154  1.00 0.00 ? 54 CYS A CA   14 
ATOM 11107 C C    . CYS A 1 54 ? 7.265   6.108   10.453  1.00 0.00 ? 54 CYS A C    14 
ATOM 11108 O O    . CYS A 1 54 ? 8.106   6.908   10.864  1.00 0.00 ? 54 CYS A O    14 
ATOM 11109 C CB   . CYS A 1 54 ? 7.315   4.334   8.697   1.00 0.00 ? 54 CYS A CB   14 
ATOM 11110 S SG   . CYS A 1 54 ? 8.562   4.909   7.501   1.00 0.00 ? 54 CYS A SG   14 
ATOM 11111 H H    . CYS A 1 54 ? 6.293   4.104   11.690  1.00 0.00 ? 54 CYS A H    14 
ATOM 11112 H HA   . CYS A 1 54 ? 8.700   4.531   10.316  1.00 0.00 ? 54 CYS A HA   14 
ATOM 11113 H HB2  . CYS A 1 54 ? 7.228   3.264   8.588   1.00 0.00 ? 54 CYS A HB2  14 
ATOM 11114 H HB3  . CYS A 1 54 ? 6.373   4.794   8.437   1.00 0.00 ? 54 CYS A HB3  14 
ATOM 11115 N N    . GLU A 1 55 ? 5.996   6.434   10.239  1.00 0.00 ? 55 GLU A N    14 
ATOM 11116 C CA   . GLU A 1 55 ? 5.500   7.783   10.478  1.00 0.00 ? 55 GLU A CA   14 
ATOM 11117 C C    . GLU A 1 55 ? 5.132   7.975   11.946  1.00 0.00 ? 55 GLU A C    14 
ATOM 11118 O O    . GLU A 1 55 ? 5.711   7.269   12.798  1.00 0.00 ? 55 GLU A O    14 
ATOM 11119 C CB   . GLU A 1 55 ? 4.285   8.065   9.592   1.00 0.00 ? 55 GLU A CB   14 
ATOM 11120 C CG   . GLU A 1 55 ? 3.963   9.543   9.456   1.00 0.00 ? 55 GLU A CG   14 
ATOM 11121 C CD   . GLU A 1 55 ? 2.475   9.806   9.330   1.00 0.00 ? 55 GLU A CD   14 
ATOM 11122 O OE1  . GLU A 1 55 ? 1.768   9.724   10.356  1.00 0.00 ? 55 GLU A OE1  14 
ATOM 11123 O OE2  . GLU A 1 55 ? 2.017   10.095  8.204   1.00 0.00 ? 55 GLU A OE2  14 
ATOM 11124 O OXT  . GLU A 1 55 ? 4.270   8.832   12.231  1.00 0.00 ? 55 GLU A OXT  14 
ATOM 11125 H H    . GLU A 1 55 ? 5.377   5.751   9.909   1.00 0.00 ? 55 GLU A H    14 
ATOM 11126 H HA   . GLU A 1 55 ? 6.289   8.476   10.223  1.00 0.00 ? 55 GLU A HA   14 
ATOM 11127 H HB2  . GLU A 1 55 ? 4.474   7.668   8.605   1.00 0.00 ? 55 GLU A HB2  14 
ATOM 11128 H HB3  . GLU A 1 55 ? 3.423   7.565   10.011  1.00 0.00 ? 55 GLU A HB3  14 
ATOM 11129 H HG2  . GLU A 1 55 ? 4.331   10.060  10.329  1.00 0.00 ? 55 GLU A HG2  14 
ATOM 11130 H HG3  . GLU A 1 55 ? 4.458   9.927   8.576   1.00 0.00 ? 55 GLU A HG3  14 
ATOM 11131 N N    . ALA A 1 1  ? 11.563  -0.531  -4.673  1.00 0.00 ? 1  ALA A N    15 
ATOM 11132 C CA   . ALA A 1 1  ? 10.221  -1.058  -5.032  1.00 0.00 ? 1  ALA A CA   15 
ATOM 11133 C C    . ALA A 1 1  ? 9.817   -2.202  -4.109  1.00 0.00 ? 1  ALA A C    15 
ATOM 11134 O O    . ALA A 1 1  ? 9.705   -3.351  -4.538  1.00 0.00 ? 1  ALA A O    15 
ATOM 11135 C CB   . ALA A 1 1  ? 10.208  -1.518  -6.484  1.00 0.00 ? 1  ALA A CB   15 
ATOM 11136 H H1   . ALA A 1 1  ? 11.915  0.018   -5.483  1.00 0.00 ? 1  ALA A H1   15 
ATOM 11137 H H2   . ALA A 1 1  ? 12.178  -1.345  -4.473  1.00 0.00 ? 1  ALA A H2   15 
ATOM 11138 H H3   . ALA A 1 1  ? 11.451  0.072   -3.833  1.00 0.00 ? 1  ALA A H3   15 
ATOM 11139 H HA   . ALA A 1 1  ? 9.503   -0.257  -4.929  1.00 0.00 ? 1  ALA A HA   15 
ATOM 11140 H HB1  . ALA A 1 1  ? 10.960  -0.978  -7.039  1.00 0.00 ? 1  ALA A HB1  15 
ATOM 11141 H HB2  . ALA A 1 1  ? 9.236   -1.326  -6.913  1.00 0.00 ? 1  ALA A HB2  15 
ATOM 11142 H HB3  . ALA A 1 1  ? 10.418  -2.577  -6.527  1.00 0.00 ? 1  ALA A HB3  15 
ATOM 11143 N N    . HIS A 1 2  ? 9.602   -1.883  -2.838  1.00 0.00 ? 2  HIS A N    15 
ATOM 11144 C CA   . HIS A 1 2  ? 9.212   -2.887  -1.854  1.00 0.00 ? 2  HIS A CA   15 
ATOM 11145 C C    . HIS A 1 2  ? 7.700   -3.068  -1.830  1.00 0.00 ? 2  HIS A C    15 
ATOM 11146 O O    . HIS A 1 2  ? 7.053   -2.898  -0.797  1.00 0.00 ? 2  HIS A O    15 
ATOM 11147 C CB   . HIS A 1 2  ? 9.722   -2.496  -0.462  1.00 0.00 ? 2  HIS A CB   15 
ATOM 11148 C CG   . HIS A 1 2  ? 11.083  -1.869  -0.473  1.00 0.00 ? 2  HIS A CG   15 
ATOM 11149 N ND1  . HIS A 1 2  ? 12.072  -2.235  -1.361  1.00 0.00 ? 2  HIS A ND1  15 
ATOM 11150 C CD2  . HIS A 1 2  ? 11.614  -0.891  0.298   1.00 0.00 ? 2  HIS A CD2  15 
ATOM 11151 C CE1  . HIS A 1 2  ? 13.154  -1.510  -1.135  1.00 0.00 ? 2  HIS A CE1  15 
ATOM 11152 N NE2  . HIS A 1 2  ? 12.901  -0.687  -0.133  1.00 0.00 ? 2  HIS A NE2  15 
ATOM 11153 H H    . HIS A 1 2  ? 9.709   -0.951  -2.553  1.00 0.00 ? 2  HIS A H    15 
ATOM 11154 H HA   . HIS A 1 2  ? 9.664   -3.822  -2.144  1.00 0.00 ? 2  HIS A HA   15 
ATOM 11155 H HB2  . HIS A 1 2  ? 9.035   -1.790  -0.021  1.00 0.00 ? 2  HIS A HB2  15 
ATOM 11156 H HB3  . HIS A 1 2  ? 9.767   -3.380  0.157   1.00 0.00 ? 2  HIS A HB3  15 
ATOM 11157 H HD1  . HIS A 1 2  ? 11.995  -2.924  -2.053  1.00 0.00 ? 2  HIS A HD1  15 
ATOM 11158 H HD2  . HIS A 1 2  ? 11.117  -0.368  1.103   1.00 0.00 ? 2  HIS A HD2  15 
ATOM 11159 H HE1  . HIS A 1 2  ? 14.085  -1.578  -1.678  1.00 0.00 ? 2  HIS A HE1  15 
ATOM 11160 H HE2  . HIS A 1 2  ? 13.494  0.033   0.167   1.00 0.00 ? 2  HIS A HE2  15 
ATOM 11161 N N    . MET A 1 3  ? 7.145   -3.414  -2.982  1.00 0.00 ? 3  MET A N    15 
ATOM 11162 C CA   . MET A 1 3  ? 5.704   -3.621  -3.111  1.00 0.00 ? 3  MET A CA   15 
ATOM 11163 C C    . MET A 1 3  ? 5.254   -4.880  -2.371  1.00 0.00 ? 3  MET A C    15 
ATOM 11164 O O    . MET A 1 3  ? 6.073   -5.648  -1.867  1.00 0.00 ? 3  MET A O    15 
ATOM 11165 C CB   . MET A 1 3  ? 5.293   -3.706  -4.588  1.00 0.00 ? 3  MET A CB   15 
ATOM 11166 C CG   . MET A 1 3  ? 6.294   -4.426  -5.482  1.00 0.00 ? 3  MET A CG   15 
ATOM 11167 S SD   . MET A 1 3  ? 6.750   -6.057  -4.861  1.00 0.00 ? 3  MET A SD   15 
ATOM 11168 C CE   . MET A 1 3  ? 5.682   -7.105  -5.846  1.00 0.00 ? 3  MET A CE   15 
ATOM 11169 H H    . MET A 1 3  ? 7.721   -3.528  -3.764  1.00 0.00 ? 3  MET A H    15 
ATOM 11170 H HA   . MET A 1 3  ? 5.213   -2.768  -2.665  1.00 0.00 ? 3  MET A HA   15 
ATOM 11171 H HB2  . MET A 1 3  ? 4.351   -4.230  -4.653  1.00 0.00 ? 3  MET A HB2  15 
ATOM 11172 H HB3  . MET A 1 3  ? 5.161   -2.704  -4.969  1.00 0.00 ? 3  MET A HB3  15 
ATOM 11173 H HG2  . MET A 1 3  ? 5.858   -4.542  -6.463  1.00 0.00 ? 3  MET A HG2  15 
ATOM 11174 H HG3  . MET A 1 3  ? 7.187   -3.822  -5.560  1.00 0.00 ? 3  MET A HG3  15 
ATOM 11175 H HE1  . MET A 1 3  ? 6.238   -7.499  -6.683  1.00 0.00 ? 3  MET A HE1  15 
ATOM 11176 H HE2  . MET A 1 3  ? 4.846   -6.525  -6.210  1.00 0.00 ? 3  MET A HE2  15 
ATOM 11177 H HE3  . MET A 1 3  ? 5.317   -7.919  -5.239  1.00 0.00 ? 3  MET A HE3  15 
ATOM 11178 N N    . ASP A 1 4  ? 3.939   -5.076  -2.311  1.00 0.00 ? 4  ASP A N    15 
ATOM 11179 C CA   . ASP A 1 4  ? 3.351   -6.231  -1.635  1.00 0.00 ? 4  ASP A CA   15 
ATOM 11180 C C    . ASP A 1 4  ? 1.825   -6.183  -1.730  1.00 0.00 ? 4  ASP A C    15 
ATOM 11181 O O    . ASP A 1 4  ? 1.143   -5.895  -0.749  1.00 0.00 ? 4  ASP A O    15 
ATOM 11182 C CB   . ASP A 1 4  ? 3.789   -6.269  -0.164  1.00 0.00 ? 4  ASP A CB   15 
ATOM 11183 C CG   . ASP A 1 4  ? 4.270   -7.643  0.259   1.00 0.00 ? 4  ASP A CG   15 
ATOM 11184 O OD1  . ASP A 1 4  ? 3.611   -8.640  -0.104  1.00 0.00 ? 4  ASP A OD1  15 
ATOM 11185 O OD2  . ASP A 1 4  ? 5.305   -7.722  0.953   1.00 0.00 ? 4  ASP A OD2  15 
ATOM 11186 H H    . ASP A 1 4  ? 3.344   -4.422  -2.734  1.00 0.00 ? 4  ASP A H    15 
ATOM 11187 H HA   . ASP A 1 4  ? 3.704   -7.122  -2.132  1.00 0.00 ? 4  ASP A HA   15 
ATOM 11188 H HB2  . ASP A 1 4  ? 4.595   -5.565  -0.013  1.00 0.00 ? 4  ASP A HB2  15 
ATOM 11189 H HB3  . ASP A 1 4  ? 2.955   -5.991  0.465   1.00 0.00 ? 4  ASP A HB3  15 
ATOM 11190 N N    . CYS A 1 5  ? 1.296   -6.455  -2.920  1.00 0.00 ? 5  CYS A N    15 
ATOM 11191 C CA   . CYS A 1 5  ? -0.149  -6.427  -3.142  1.00 0.00 ? 5  CYS A CA   15 
ATOM 11192 C C    . CYS A 1 5  ? -0.795  -7.710  -2.626  1.00 0.00 ? 5  CYS A C    15 
ATOM 11193 O O    . CYS A 1 5  ? -0.132  -8.522  -1.981  1.00 0.00 ? 5  CYS A O    15 
ATOM 11194 C CB   . CYS A 1 5  ? -0.440  -6.245  -4.638  1.00 0.00 ? 5  CYS A CB   15 
ATOM 11195 S SG   . CYS A 1 5  ? -1.979  -5.340  -5.041  1.00 0.00 ? 5  CYS A SG   15 
ATOM 11196 H H    . CYS A 1 5  ? 1.890   -6.669  -3.669  1.00 0.00 ? 5  CYS A H    15 
ATOM 11197 H HA   . CYS A 1 5  ? -0.548  -5.591  -2.595  1.00 0.00 ? 5  CYS A HA   15 
ATOM 11198 H HB2  . CYS A 1 5  ? 0.376   -5.700  -5.086  1.00 0.00 ? 5  CYS A HB2  15 
ATOM 11199 H HB3  . CYS A 1 5  ? -0.504  -7.220  -5.099  1.00 0.00 ? 5  CYS A HB3  15 
ATOM 11200 N N    . THR A 1 6  ? -2.088  -7.893  -2.899  1.00 0.00 ? 6  THR A N    15 
ATOM 11201 C CA   . THR A 1 6  ? -2.790  -9.080  -2.444  1.00 0.00 ? 6  THR A CA   15 
ATOM 11202 C C    . THR A 1 6  ? -2.128  -10.336 -3.021  1.00 0.00 ? 6  THR A C    15 
ATOM 11203 O O    . THR A 1 6  ? -1.030  -10.690 -2.592  1.00 0.00 ? 6  THR A O    15 
ATOM 11204 C CB   . THR A 1 6  ? -4.276  -9.004  -2.809  1.00 0.00 ? 6  THR A CB   15 
ATOM 11205 O OG1  . THR A 1 6  ? -4.773  -7.693  -2.608  1.00 0.00 ? 6  THR A OG1  15 
ATOM 11206 C CG2  . THR A 1 6  ? -5.136  -9.950  -1.999  1.00 0.00 ? 6  THR A CG2  15 
ATOM 11207 H H    . THR A 1 6  ? -2.575  -7.221  -3.409  1.00 0.00 ? 6  THR A H    15 
ATOM 11208 H HA   . THR A 1 6  ? -2.697  -9.108  -1.362  1.00 0.00 ? 6  THR A HA   15 
ATOM 11209 H HB   . THR A 1 6  ? -4.398  -9.254  -3.853  1.00 0.00 ? 6  THR A HB   15 
ATOM 11210 H HG1  . THR A 1 6  ? -4.418  -7.337  -1.790  1.00 0.00 ? 6  THR A HG1  15 
ATOM 11211 H HG21 . THR A 1 6  ? -4.825  -9.923  -0.965  1.00 0.00 ? 6  THR A HG21 15 
ATOM 11212 H HG22 . THR A 1 6  ? -5.026  -10.954 -2.381  1.00 0.00 ? 6  THR A HG22 15 
ATOM 11213 H HG23 . THR A 1 6  ? -6.170  -9.648  -2.071  1.00 0.00 ? 6  THR A HG23 15 
ATOM 11214 N N    . GLU A 1 7  ? -2.761  -11.019 -3.991  1.00 0.00 ? 7  GLU A N    15 
ATOM 11215 C CA   . GLU A 1 7  ? -2.150  -12.209 -4.559  1.00 0.00 ? 7  GLU A CA   15 
ATOM 11216 C C    . GLU A 1 7  ? -3.029  -12.844 -5.632  1.00 0.00 ? 7  GLU A C    15 
ATOM 11217 O O    . GLU A 1 7  ? -2.908  -14.038 -5.906  1.00 0.00 ? 7  GLU A O    15 
ATOM 11218 C CB   . GLU A 1 7  ? -1.842  -13.215 -3.443  1.00 0.00 ? 7  GLU A CB   15 
ATOM 11219 C CG   . GLU A 1 7  ? -2.957  -14.218 -3.159  1.00 0.00 ? 7  GLU A CG   15 
ATOM 11220 C CD   . GLU A 1 7  ? -2.621  -15.618 -3.635  1.00 0.00 ? 7  GLU A CD   15 
ATOM 11221 O OE1  . GLU A 1 7  ? -1.514  -16.102 -3.316  1.00 0.00 ? 7  GLU A OE1  15 
ATOM 11222 O OE2  . GLU A 1 7  ? -3.462  -16.229 -4.326  1.00 0.00 ? 7  GLU A OE2  15 
ATOM 11223 H H    . GLU A 1 7  ? -3.633  -10.724 -4.331  1.00 0.00 ? 7  GLU A H    15 
ATOM 11224 H HA   . GLU A 1 7  ? -1.219  -11.909 -5.016  1.00 0.00 ? 7  GLU A HA   15 
ATOM 11225 H HB2  . GLU A 1 7  ? -0.954  -13.762 -3.711  1.00 0.00 ? 7  GLU A HB2  15 
ATOM 11226 H HB3  . GLU A 1 7  ? -1.649  -12.666 -2.533  1.00 0.00 ? 7  GLU A HB3  15 
ATOM 11227 H HG2  . GLU A 1 7  ? -3.128  -14.250 -2.094  1.00 0.00 ? 7  GLU A HG2  15 
ATOM 11228 H HG3  . GLU A 1 7  ? -3.858  -13.890 -3.657  1.00 0.00 ? 7  GLU A HG3  15 
ATOM 11229 N N    . PHE A 1 8  ? -3.916  -12.058 -6.237  1.00 0.00 ? 8  PHE A N    15 
ATOM 11230 C CA   . PHE A 1 8  ? -4.796  -12.600 -7.271  1.00 0.00 ? 8  PHE A CA   15 
ATOM 11231 C C    . PHE A 1 8  ? -5.370  -11.503 -8.166  1.00 0.00 ? 8  PHE A C    15 
ATOM 11232 O O    . PHE A 1 8  ? -4.888  -10.370 -8.165  1.00 0.00 ? 8  PHE A O    15 
ATOM 11233 C CB   . PHE A 1 8  ? -5.925  -13.416 -6.626  1.00 0.00 ? 8  PHE A CB   15 
ATOM 11234 C CG   . PHE A 1 8  ? -6.501  -12.800 -5.379  1.00 0.00 ? 8  PHE A CG   15 
ATOM 11235 C CD1  . PHE A 1 8  ? -6.507  -11.425 -5.196  1.00 0.00 ? 8  PHE A CD1  15 
ATOM 11236 C CD2  . PHE A 1 8  ? -7.044  -13.605 -4.388  1.00 0.00 ? 8  PHE A CD2  15 
ATOM 11237 C CE1  . PHE A 1 8  ? -7.040  -10.867 -4.049  1.00 0.00 ? 8  PHE A CE1  15 
ATOM 11238 C CE2  . PHE A 1 8  ? -7.580  -13.051 -3.242  1.00 0.00 ? 8  PHE A CE2  15 
ATOM 11239 C CZ   . PHE A 1 8  ? -7.577  -11.681 -3.072  1.00 0.00 ? 8  PHE A CZ   15 
ATOM 11240 H H    . PHE A 1 8  ? -3.982  -11.104 -5.982  1.00 0.00 ? 8  PHE A H    15 
ATOM 11241 H HA   . PHE A 1 8  ? -4.202  -13.262 -7.884  1.00 0.00 ? 8  PHE A HA   15 
ATOM 11242 H HB2  . PHE A 1 8  ? -6.728  -13.533 -7.334  1.00 0.00 ? 8  PHE A HB2  15 
ATOM 11243 H HB3  . PHE A 1 8  ? -5.543  -14.392 -6.364  1.00 0.00 ? 8  PHE A HB3  15 
ATOM 11244 H HD1  . PHE A 1 8  ? -6.087  -10.786 -5.958  1.00 0.00 ? 8  PHE A HD1  15 
ATOM 11245 H HD2  . PHE A 1 8  ? -7.046  -14.676 -4.519  1.00 0.00 ? 8  PHE A HD2  15 
ATOM 11246 H HE1  . PHE A 1 8  ? -7.035  -9.796  -3.918  1.00 0.00 ? 8  PHE A HE1  15 
ATOM 11247 H HE2  . PHE A 1 8  ? -7.999  -13.689 -2.478  1.00 0.00 ? 8  PHE A HE2  15 
ATOM 11248 H HZ   . PHE A 1 8  ? -7.995  -11.246 -2.175  1.00 0.00 ? 8  PHE A HZ   15 
ATOM 11249 N N    . ASN A 1 9  ? -6.400  -11.852 -8.938  1.00 0.00 ? 9  ASN A N    15 
ATOM 11250 C CA   . ASN A 1 9  ? -7.035  -10.902 -9.843  1.00 0.00 ? 9  ASN A CA   15 
ATOM 11251 C C    . ASN A 1 9  ? -7.792  -9.828  -9.064  1.00 0.00 ? 9  ASN A C    15 
ATOM 11252 O O    . ASN A 1 9  ? -7.578  -8.637  -9.286  1.00 0.00 ? 9  ASN A O    15 
ATOM 11253 C CB   . ASN A 1 9  ? -7.990  -11.629 -10.797 1.00 0.00 ? 9  ASN A CB   15 
ATOM 11254 C CG   . ASN A 1 9  ? -7.400  -12.917 -11.342 1.00 0.00 ? 9  ASN A CG   15 
ATOM 11255 O OD1  . ASN A 1 9  ? -6.543  -12.896 -12.227 1.00 0.00 ? 9  ASN A OD1  15 
ATOM 11256 N ND2  . ASN A 1 9  ? -7.858  -14.047 -10.816 1.00 0.00 ? 9  ASN A ND2  15 
ATOM 11257 H H    . ASN A 1 9  ? -6.734  -12.771 -8.902  1.00 0.00 ? 9  ASN A H    15 
ATOM 11258 H HA   . ASN A 1 9  ? -6.258  -10.427 -10.421 1.00 0.00 ? 9  ASN A HA   15 
ATOM 11259 H HB2  . ASN A 1 9  ? -8.902  -11.867 -10.274 1.00 0.00 ? 9  ASN A HB2  15 
ATOM 11260 H HB3  . ASN A 1 9  ? -8.218  -10.979 -11.630 1.00 0.00 ? 9  ASN A HB3  15 
ATOM 11261 H HD21 . ASN A 1 9  ? -8.541  -13.987 -10.115 1.00 0.00 ? 9  ASN A HD21 15 
ATOM 11262 H HD22 . ASN A 1 9  ? -7.496  -14.894 -11.150 1.00 0.00 ? 9  ASN A HD22 15 
ATOM 11263 N N    . PRO A 1 10 ? -8.680  -10.223 -8.130  1.00 0.00 ? 10 PRO A N    15 
ATOM 11264 C CA   . PRO A 1 10 ? -9.438  -9.262  -7.326  1.00 0.00 ? 10 PRO A CA   15 
ATOM 11265 C C    . PRO A 1 10 ? -8.519  -8.443  -6.428  1.00 0.00 ? 10 PRO A C    15 
ATOM 11266 O O    . PRO A 1 10 ? -8.416  -8.695  -5.228  1.00 0.00 ? 10 PRO A O    15 
ATOM 11267 C CB   . PRO A 1 10 ? -10.374 -10.137 -6.487  1.00 0.00 ? 10 PRO A CB   15 
ATOM 11268 C CG   . PRO A 1 10 ? -9.728  -11.479 -6.465  1.00 0.00 ? 10 PRO A CG   15 
ATOM 11269 C CD   . PRO A 1 10 ? -9.006  -11.616 -7.776  1.00 0.00 ? 10 PRO A CD   15 
ATOM 11270 H HA   . PRO A 1 10 ? -10.018 -8.595  -7.947  1.00 0.00 ? 10 PRO A HA   15 
ATOM 11271 H HB2  . PRO A 1 10 ? -10.461 -9.724  -5.493  1.00 0.00 ? 10 PRO A HB2  15 
ATOM 11272 H HB3  . PRO A 1 10 ? -11.347 -10.175 -6.954  1.00 0.00 ? 10 PRO A HB3  15 
ATOM 11273 H HG2  . PRO A 1 10 ? -9.029  -11.537 -5.644  1.00 0.00 ? 10 PRO A HG2  15 
ATOM 11274 H HG3  . PRO A 1 10 ? -10.483 -12.247 -6.371  1.00 0.00 ? 10 PRO A HG3  15 
ATOM 11275 H HD2  . PRO A 1 10 ? -8.113  -12.205 -7.649  1.00 0.00 ? 10 PRO A HD2  15 
ATOM 11276 H HD3  . PRO A 1 10 ? -9.653  -12.061 -8.517  1.00 0.00 ? 10 PRO A HD3  15 
ATOM 11277 N N    . LEU A 1 11 ? -7.844  -7.473  -7.033  1.00 0.00 ? 11 LEU A N    15 
ATOM 11278 C CA   . LEU A 1 11 ? -6.910  -6.601  -6.326  1.00 0.00 ? 11 LEU A CA   15 
ATOM 11279 C C    . LEU A 1 11 ? -7.524  -5.992  -5.080  1.00 0.00 ? 11 LEU A C    15 
ATOM 11280 O O    . LEU A 1 11 ? -8.588  -6.410  -4.636  1.00 0.00 ? 11 LEU A O    15 
ATOM 11281 C CB   . LEU A 1 11 ? -6.413  -5.508  -7.272  1.00 0.00 ? 11 LEU A CB   15 
ATOM 11282 C CG   . LEU A 1 11 ? -7.422  -4.395  -7.585  1.00 0.00 ? 11 LEU A CG   15 
ATOM 11283 C CD1  . LEU A 1 11 ? -6.944  -3.559  -8.762  1.00 0.00 ? 11 LEU A CD1  15 
ATOM 11284 C CD2  . LEU A 1 11 ? -8.802  -4.974  -7.872  1.00 0.00 ? 11 LEU A CD2  15 
ATOM 11285 H H    . LEU A 1 11 ? -7.971  -7.341  -7.995  1.00 0.00 ? 11 LEU A H    15 
ATOM 11286 H HA   . LEU A 1 11 ? -6.069  -7.190  -6.012  1.00 0.00 ? 11 LEU A HA   15 
ATOM 11287 H HB2  . LEU A 1 11 ? -5.533  -5.060  -6.834  1.00 0.00 ? 11 LEU A HB2  15 
ATOM 11288 H HB3  . LEU A 1 11 ? -6.129  -5.978  -8.203  1.00 0.00 ? 11 LEU A HB3  15 
ATOM 11289 H HG   . LEU A 1 11 ? -7.505  -3.744  -6.726  1.00 0.00 ? 11 LEU A HG   15 
ATOM 11290 H HD11 . LEU A 1 11 ? -5.870  -3.641  -8.848  1.00 0.00 ? 11 LEU A HD11 15 
ATOM 11291 H HD12 . LEU A 1 11 ? -7.214  -2.525  -8.602  1.00 0.00 ? 11 LEU A HD12 15 
ATOM 11292 H HD13 . LEU A 1 11 ? -7.407  -3.915  -9.669  1.00 0.00 ? 11 LEU A HD13 15 
ATOM 11293 H HD21 . LEU A 1 11 ? -9.149  -5.523  -7.009  1.00 0.00 ? 11 LEU A HD21 15 
ATOM 11294 H HD22 . LEU A 1 11 ? -8.743  -5.638  -8.722  1.00 0.00 ? 11 LEU A HD22 15 
ATOM 11295 H HD23 . LEU A 1 11 ? -9.491  -4.171  -8.090  1.00 0.00 ? 11 LEU A HD23 15 
ATOM 11296 N N    . CYS A 1 12 ? -6.806  -5.018  -4.520  1.00 0.00 ? 12 CYS A N    15 
ATOM 11297 C CA   . CYS A 1 12 ? -7.194  -4.326  -3.291  1.00 0.00 ? 12 CYS A CA   15 
ATOM 11298 C C    . CYS A 1 12 ? -8.662  -4.504  -2.947  1.00 0.00 ? 12 CYS A C    15 
ATOM 11299 O O    . CYS A 1 12 ? -9.447  -3.555  -2.925  1.00 0.00 ? 12 CYS A O    15 
ATOM 11300 C CB   . CYS A 1 12 ? -6.878  -2.844  -3.412  1.00 0.00 ? 12 CYS A CB   15 
ATOM 11301 S SG   . CYS A 1 12 ? -7.875  -1.960  -4.658  1.00 0.00 ? 12 CYS A SG   15 
ATOM 11302 H H    . CYS A 1 12 ? -5.955  -4.779  -4.934  1.00 0.00 ? 12 CYS A H    15 
ATOM 11303 H HA   . CYS A 1 12 ? -6.603  -4.736  -2.488  1.00 0.00 ? 12 CYS A HA   15 
ATOM 11304 H HB2  . CYS A 1 12 ? -7.048  -2.373  -2.458  1.00 0.00 ? 12 CYS A HB2  15 
ATOM 11305 H HB3  . CYS A 1 12 ? -5.842  -2.734  -3.681  1.00 0.00 ? 12 CYS A HB3  15 
ATOM 11306 N N    . ARG A 1 13 ? -9.008  -5.740  -2.654  1.00 0.00 ? 13 ARG A N    15 
ATOM 11307 C CA   . ARG A 1 13 ? -10.369 -6.091  -2.277  1.00 0.00 ? 13 ARG A CA   15 
ATOM 11308 C C    . ARG A 1 13 ? -10.569 -5.895  -0.777  1.00 0.00 ? 13 ARG A C    15 
ATOM 11309 O O    . ARG A 1 13 ? -11.280 -6.663  -0.129  1.00 0.00 ? 13 ARG A O    15 
ATOM 11310 C CB   . ARG A 1 13 ? -10.670 -7.540  -2.661  1.00 0.00 ? 13 ARG A CB   15 
ATOM 11311 C CG   . ARG A 1 13 ? -12.149 -7.889  -2.602  1.00 0.00 ? 13 ARG A CG   15 
ATOM 11312 C CD   . ARG A 1 13 ? -12.751 -8.021  -3.993  1.00 0.00 ? 13 ARG A CD   15 
ATOM 11313 N NE   . ARG A 1 13 ? -13.630 -9.182  -4.100  1.00 0.00 ? 13 ARG A NE   15 
ATOM 11314 C CZ   . ARG A 1 13 ? -13.220 -10.440 -3.958  1.00 0.00 ? 13 ARG A CZ   15 
ATOM 11315 N NH1  . ARG A 1 13 ? -11.942 -10.706 -3.714  1.00 0.00 ? 13 ARG A NH1  15 
ATOM 11316 N NH2  . ARG A 1 13 ? -14.088 -11.437 -4.066  1.00 0.00 ? 13 ARG A NH2  15 
ATOM 11317 H H    . ARG A 1 13 ? -8.316  -6.437  -2.688  1.00 0.00 ? 13 ARG A H    15 
ATOM 11318 H HA   . ARG A 1 13 ? -11.042 -5.436  -2.810  1.00 0.00 ? 13 ARG A HA   15 
ATOM 11319 H HB2  . ARG A 1 13 ? -10.318 -7.714  -3.668  1.00 0.00 ? 13 ARG A HB2  15 
ATOM 11320 H HB3  . ARG A 1 13 ? -10.141 -8.196  -1.986  1.00 0.00 ? 13 ARG A HB3  15 
ATOM 11321 H HG2  . ARG A 1 13 ? -12.265 -8.828  -2.082  1.00 0.00 ? 13 ARG A HG2  15 
ATOM 11322 H HG3  . ARG A 1 13 ? -12.672 -7.111  -2.066  1.00 0.00 ? 13 ARG A HG3  15 
ATOM 11323 H HD2  . ARG A 1 13 ? -13.320 -7.129  -4.211  1.00 0.00 ? 13 ARG A HD2  15 
ATOM 11324 H HD3  . ARG A 1 13 ? -11.950 -8.119  -4.712  1.00 0.00 ? 13 ARG A HD3  15 
ATOM 11325 H HE   . ARG A 1 13 ? -14.579 -9.016  -4.287  1.00 0.00 ? 13 ARG A HE   15 
ATOM 11326 H HH11 . ARG A 1 13 ? -11.281 -9.960  -3.635  1.00 0.00 ? 13 ARG A HH11 15 
ATOM 11327 H HH12 . ARG A 1 13 ? -11.641 -11.654 -3.606  1.00 0.00 ? 13 ARG A HH12 15 
ATOM 11328 H HH21 . ARG A 1 13 ? -15.050 -11.243 -4.254  1.00 0.00 ? 13 ARG A HH21 15 
ATOM 11329 H HH22 . ARG A 1 13 ? -13.779 -12.382 -3.960  1.00 0.00 ? 13 ARG A HH22 15 
ATOM 11330 N N    . CYS A 1 14 ? -9.932  -4.860  -0.237  1.00 0.00 ? 14 CYS A N    15 
ATOM 11331 C CA   . CYS A 1 14 ? -10.026 -4.550  1.180   1.00 0.00 ? 14 CYS A CA   15 
ATOM 11332 C C    . CYS A 1 14 ? -10.240 -3.049  1.386   1.00 0.00 ? 14 CYS A C    15 
ATOM 11333 O O    . CYS A 1 14 ? -9.396  -2.227  1.034   1.00 0.00 ? 14 CYS A O    15 
ATOM 11334 C CB   . CYS A 1 14 ? -8.768  -5.049  1.917   1.00 0.00 ? 14 CYS A CB   15 
ATOM 11335 S SG   . CYS A 1 14 ? -7.395  -3.847  2.051   1.00 0.00 ? 14 CYS A SG   15 
ATOM 11336 H H    . CYS A 1 14 ? -9.385  -4.289  -0.805  1.00 0.00 ? 14 CYS A H    15 
ATOM 11337 H HA   . CYS A 1 14 ? -10.886 -5.074  1.568   1.00 0.00 ? 14 CYS A HA   15 
ATOM 11338 H HB2  . CYS A 1 14 ? -9.044  -5.333  2.918   1.00 0.00 ? 14 CYS A HB2  15 
ATOM 11339 H HB3  . CYS A 1 14 ? -8.388  -5.920  1.400   1.00 0.00 ? 14 CYS A HB3  15 
ATOM 11340 N N    . ASN A 1 15 ? -11.390 -2.702  1.943   1.00 0.00 ? 15 ASN A N    15 
ATOM 11341 C CA   . ASN A 1 15 ? -11.731 -1.304  2.186   1.00 0.00 ? 15 ASN A CA   15 
ATOM 11342 C C    . ASN A 1 15 ? -11.634 -0.981  3.661   1.00 0.00 ? 15 ASN A C    15 
ATOM 11343 O O    . ASN A 1 15 ? -11.202 0.103   4.031   1.00 0.00 ? 15 ASN A O    15 
ATOM 11344 C CB   . ASN A 1 15 ? -13.153 -1.016  1.727   1.00 0.00 ? 15 ASN A CB   15 
ATOM 11345 C CG   . ASN A 1 15 ? -13.210 0.026   0.627   1.00 0.00 ? 15 ASN A CG   15 
ATOM 11346 O OD1  . ASN A 1 15 ? -13.949 -0.122  -0.346  1.00 0.00 ? 15 ASN A OD1  15 
ATOM 11347 N ND2  . ASN A 1 15 ? -12.428 1.089   0.779   1.00 0.00 ? 15 ASN A ND2  15 
ATOM 11348 H H    . ASN A 1 15 ? -12.028 -3.401  2.184   1.00 0.00 ? 15 ASN A H    15 
ATOM 11349 H HA   . ASN A 1 15 ? -11.042 -0.681  1.635   1.00 0.00 ? 15 ASN A HA   15 
ATOM 11350 H HB2  . ASN A 1 15 ? -13.589 -1.924  1.377   1.00 0.00 ? 15 ASN A HB2  15 
ATOM 11351 H HB3  . ASN A 1 15 ? -13.727 -0.652  2.567   1.00 0.00 ? 15 ASN A HB3  15 
ATOM 11352 H HD21 . ASN A 1 15 ? -11.866 1.139   1.580   1.00 0.00 ? 15 ASN A HD21 15 
ATOM 11353 H HD22 . ASN A 1 15 ? -12.445 1.778   0.083   1.00 0.00 ? 15 ASN A HD22 15 
ATOM 11354 N N    . LYS A 1 16 ? -12.081 -1.928  4.484   1.00 0.00 ? 16 LYS A N    15 
ATOM 11355 C CA   . LYS A 1 16 ? -12.099 -1.792  5.943   1.00 0.00 ? 16 LYS A CA   15 
ATOM 11356 C C    . LYS A 1 16 ? -10.882 -1.046  6.472   1.00 0.00 ? 16 LYS A C    15 
ATOM 11357 O O    . LYS A 1 16 ? -10.104 -1.569  7.266   1.00 0.00 ? 16 LYS A O    15 
ATOM 11358 C CB   . LYS A 1 16 ? -12.219 -3.173  6.609   1.00 0.00 ? 16 LYS A CB   15 
ATOM 11359 C CG   . LYS A 1 16 ? -10.921 -3.977  6.654   1.00 0.00 ? 16 LYS A CG   15 
ATOM 11360 C CD   . LYS A 1 16 ? -10.138 -3.876  5.354   1.00 0.00 ? 16 LYS A CD   15 
ATOM 11361 C CE   . LYS A 1 16 ? -8.975  -4.857  5.331   1.00 0.00 ? 16 LYS A CE   15 
ATOM 11362 N NZ   . LYS A 1 16 ? -8.264  -4.909  6.639   1.00 0.00 ? 16 LYS A NZ   15 
ATOM 11363 H H    . LYS A 1 16 ? -12.434 -2.742  4.092   1.00 0.00 ? 16 LYS A H    15 
ATOM 11364 H HA   . LYS A 1 16 ? -12.973 -1.215  6.193   1.00 0.00 ? 16 LYS A HA   15 
ATOM 11365 H HB2  . LYS A 1 16 ? -12.561 -3.037  7.624   1.00 0.00 ? 16 LYS A HB2  15 
ATOM 11366 H HB3  . LYS A 1 16 ? -12.954 -3.752  6.070   1.00 0.00 ? 16 LYS A HB3  15 
ATOM 11367 H HG2  . LYS A 1 16 ? -10.307 -3.606  7.460   1.00 0.00 ? 16 LYS A HG2  15 
ATOM 11368 H HG3  . LYS A 1 16 ? -11.161 -5.013  6.838   1.00 0.00 ? 16 LYS A HG3  15 
ATOM 11369 H HD2  . LYS A 1 16 ? -10.798 -4.096  4.528   1.00 0.00 ? 16 LYS A HD2  15 
ATOM 11370 H HD3  . LYS A 1 16 ? -9.752  -2.873  5.253   1.00 0.00 ? 16 LYS A HD3  15 
ATOM 11371 H HE2  . LYS A 1 16 ? -9.357  -5.841  5.101   1.00 0.00 ? 16 LYS A HE2  15 
ATOM 11372 H HE3  . LYS A 1 16 ? -8.279  -4.553  4.564   1.00 0.00 ? 16 LYS A HE3  15 
ATOM 11373 H HZ1  . LYS A 1 16 ? -7.426  -5.522  6.567   1.00 0.00 ? 16 LYS A HZ1  15 
ATOM 11374 H HZ2  . LYS A 1 16 ? -8.893  -5.288  7.374   1.00 0.00 ? 16 LYS A HZ2  15 
ATOM 11375 H HZ3  . LYS A 1 16 ? -7.958  -3.955  6.918   1.00 0.00 ? 16 LYS A HZ3  15 
ATOM 11376 N N    . MET A 1 17 ? -10.735 0.183   6.020   1.00 0.00 ? 17 MET A N    15 
ATOM 11377 C CA   . MET A 1 17 ? -9.617  1.028   6.435   1.00 0.00 ? 17 MET A CA   15 
ATOM 11378 C C    . MET A 1 17 ? -9.519  1.114   7.953   1.00 0.00 ? 17 MET A C    15 
ATOM 11379 O O    . MET A 1 17 ? -9.975  2.078   8.569   1.00 0.00 ? 17 MET A O    15 
ATOM 11380 C CB   . MET A 1 17 ? -9.747  2.430   5.861   1.00 0.00 ? 17 MET A CB   15 
ATOM 11381 C CG   . MET A 1 17 ? -11.177 2.942   5.793   1.00 0.00 ? 17 MET A CG   15 
ATOM 11382 S SD   . MET A 1 17 ? -11.290 4.721   6.065   1.00 0.00 ? 17 MET A SD   15 
ATOM 11383 C CE   . MET A 1 17 ? -12.945 4.854   6.734   1.00 0.00 ? 17 MET A CE   15 
ATOM 11384 H H    . MET A 1 17 ? -11.399 0.527   5.377   1.00 0.00 ? 17 MET A H    15 
ATOM 11385 H HA   . MET A 1 17 ? -8.710  0.581   6.058   1.00 0.00 ? 17 MET A HA   15 
ATOM 11386 H HB2  . MET A 1 17 ? -9.175  3.102   6.480   1.00 0.00 ? 17 MET A HB2  15 
ATOM 11387 H HB3  . MET A 1 17 ? -9.336  2.431   4.866   1.00 0.00 ? 17 MET A HB3  15 
ATOM 11388 H HG2  . MET A 1 17 ? -11.580 2.715   4.818   1.00 0.00 ? 17 MET A HG2  15 
ATOM 11389 H HG3  . MET A 1 17 ? -11.760 2.437   6.550   1.00 0.00 ? 17 MET A HG3  15 
ATOM 11390 H HE1  . MET A 1 17 ? -12.890 5.089   7.787   1.00 0.00 ? 17 MET A HE1  15 
ATOM 11391 H HE2  . MET A 1 17 ? -13.464 3.917   6.602   1.00 0.00 ? 17 MET A HE2  15 
ATOM 11392 H HE3  . MET A 1 17 ? -13.480 5.638   6.219   1.00 0.00 ? 17 MET A HE3  15 
ATOM 11393 N N    . LEU A 1 18 ? -8.919  0.094   8.538   1.00 0.00 ? 18 LEU A N    15 
ATOM 11394 C CA   . LEU A 1 18 ? -8.740  0.022   9.980   1.00 0.00 ? 18 LEU A CA   15 
ATOM 11395 C C    . LEU A 1 18 ? -7.830  -1.138  10.356  1.00 0.00 ? 18 LEU A C    15 
ATOM 11396 O O    . LEU A 1 18 ? -8.171  -1.971  11.197  1.00 0.00 ? 18 LEU A O    15 
ATOM 11397 C CB   . LEU A 1 18 ? -10.095 -0.117  10.675  1.00 0.00 ? 18 LEU A CB   15 
ATOM 11398 C CG   . LEU A 1 18 ? -10.783 -1.474  10.486  1.00 0.00 ? 18 LEU A CG   15 
ATOM 11399 C CD1  . LEU A 1 18 ? -10.889 -2.212  11.813  1.00 0.00 ? 18 LEU A CD1  15 
ATOM 11400 C CD2  . LEU A 1 18 ? -12.160 -1.295  9.861   1.00 0.00 ? 18 LEU A CD2  15 
ATOM 11401 H H    . LEU A 1 18 ? -8.581  -0.626  7.978   1.00 0.00 ? 18 LEU A H    15 
ATOM 11402 H HA   . LEU A 1 18 ? -8.268  0.937   10.297  1.00 0.00 ? 18 LEU A HA   15 
ATOM 11403 H HB2  . LEU A 1 18 ? -9.951  0.049   11.731  1.00 0.00 ? 18 LEU A HB2  15 
ATOM 11404 H HB3  . LEU A 1 18 ? -10.749 0.650   10.291  1.00 0.00 ? 18 LEU A HB3  15 
ATOM 11405 H HG   . LEU A 1 18 ? -10.189 -2.080  9.817   1.00 0.00 ? 18 LEU A HG   15 
ATOM 11406 H HD11 . LEU A 1 18 ? -10.067 -2.908  11.903  1.00 0.00 ? 18 LEU A HD11 15 
ATOM 11407 H HD12 . LEU A 1 18 ? -11.823 -2.753  11.852  1.00 0.00 ? 18 LEU A HD12 15 
ATOM 11408 H HD13 . LEU A 1 18 ? -10.849 -1.502  12.625  1.00 0.00 ? 18 LEU A HD13 15 
ATOM 11409 H HD21 . LEU A 1 18 ? -12.054 -1.093  8.805   1.00 0.00 ? 18 LEU A HD21 15 
ATOM 11410 H HD22 . LEU A 1 18 ? -12.666 -0.467  10.334  1.00 0.00 ? 18 LEU A HD22 15 
ATOM 11411 H HD23 . LEU A 1 18 ? -12.739 -2.197  9.998   1.00 0.00 ? 18 LEU A HD23 15 
ATOM 11412 N N    . GLY A 1 19 ? -6.672  -1.185  9.722   1.00 0.00 ? 19 GLY A N    15 
ATOM 11413 C CA   . GLY A 1 19 ? -5.718  -2.245  9.991   1.00 0.00 ? 19 GLY A CA   15 
ATOM 11414 C C    . GLY A 1 19 ? -4.294  -1.739  10.110  1.00 0.00 ? 19 GLY A C    15 
ATOM 11415 O O    . GLY A 1 19 ? -4.053  -0.665  10.661  1.00 0.00 ? 19 GLY A O    15 
ATOM 11416 H H    . GLY A 1 19 ? -6.465  -0.490  9.064   1.00 0.00 ? 19 GLY A H    15 
ATOM 11417 H HA2  . GLY A 1 19 ? -5.990  -2.733  10.915  1.00 0.00 ? 19 GLY A HA2  15 
ATOM 11418 H HA3  . GLY A 1 19 ? -5.764  -2.967  9.188   1.00 0.00 ? 19 GLY A HA3  15 
ATOM 11419 N N    . ASP A 1 20 ? -3.349  -2.517  9.592   1.00 0.00 ? 20 ASP A N    15 
ATOM 11420 C CA   . ASP A 1 20 ? -1.938  -2.157  9.637   1.00 0.00 ? 20 ASP A CA   15 
ATOM 11421 C C    . ASP A 1 20 ? -1.701  -0.754  9.101   1.00 0.00 ? 20 ASP A C    15 
ATOM 11422 O O    . ASP A 1 20 ? -2.639  -0.042  8.744   1.00 0.00 ? 20 ASP A O    15 
ATOM 11423 C CB   . ASP A 1 20 ? -1.118  -3.161  8.827   1.00 0.00 ? 20 ASP A CB   15 
ATOM 11424 C CG   . ASP A 1 20 ? -1.445  -4.598  9.181   1.00 0.00 ? 20 ASP A CG   15 
ATOM 11425 O OD1  . ASP A 1 20 ? -1.763  -4.861  10.360  1.00 0.00 ? 20 ASP A OD1  15 
ATOM 11426 O OD2  . ASP A 1 20 ? -1.383  -5.460  8.280   1.00 0.00 ? 20 ASP A OD2  15 
ATOM 11427 H H    . ASP A 1 20 ? -3.605  -3.362  9.168   1.00 0.00 ? 20 ASP A H    15 
ATOM 11428 H HA   . ASP A 1 20 ? -1.613  -2.190  10.664  1.00 0.00 ? 20 ASP A HA   15 
ATOM 11429 H HB2  . ASP A 1 20 ? -1.318  -3.014  7.776   1.00 0.00 ? 20 ASP A HB2  15 
ATOM 11430 H HB3  . ASP A 1 20 ? -0.072  -2.992  9.016   1.00 0.00 ? 20 ASP A HB3  15 
ATOM 11431 N N    . LEU A 1 21 ? -0.435  -0.374  9.053   1.00 0.00 ? 21 LEU A N    15 
ATOM 11432 C CA   . LEU A 1 21 ? -0.036  0.940   8.560   1.00 0.00 ? 21 LEU A CA   15 
ATOM 11433 C C    . LEU A 1 21 ? 1.276   0.850   7.791   1.00 0.00 ? 21 LEU A C    15 
ATOM 11434 O O    . LEU A 1 21 ? 2.344   0.707   8.381   1.00 0.00 ? 21 LEU A O    15 
ATOM 11435 C CB   . LEU A 1 21 ? 0.105   1.927   9.719   1.00 0.00 ? 21 LEU A CB   15 
ATOM 11436 C CG   . LEU A 1 21 ? 0.509   3.346   9.315   1.00 0.00 ? 21 LEU A CG   15 
ATOM 11437 C CD1  . LEU A 1 21 ? -0.311  3.820   8.123   1.00 0.00 ? 21 LEU A CD1  15 
ATOM 11438 C CD2  . LEU A 1 21 ? 0.343   4.298   10.488  1.00 0.00 ? 21 LEU A CD2  15 
ATOM 11439 H H    . LEU A 1 21 ? 0.255   -0.999  9.358   1.00 0.00 ? 21 LEU A H    15 
ATOM 11440 H HA   . LEU A 1 21 ? -0.805  1.296   7.889   1.00 0.00 ? 21 LEU A HA   15 
ATOM 11441 H HB2  . LEU A 1 21 ? -0.841  1.978   10.240  1.00 0.00 ? 21 LEU A HB2  15 
ATOM 11442 H HB3  . LEU A 1 21 ? 0.851   1.545   10.401  1.00 0.00 ? 21 LEU A HB3  15 
ATOM 11443 H HG   . LEU A 1 21 ? 1.550   3.346   9.027   1.00 0.00 ? 21 LEU A HG   15 
ATOM 11444 H HD11 . LEU A 1 21 ? -1.218  3.238   8.056   1.00 0.00 ? 21 LEU A HD11 15 
ATOM 11445 H HD12 . LEU A 1 21 ? 0.265   3.694   7.217   1.00 0.00 ? 21 LEU A HD12 15 
ATOM 11446 H HD13 . LEU A 1 21 ? -0.560  4.863   8.249   1.00 0.00 ? 21 LEU A HD13 15 
ATOM 11447 H HD21 . LEU A 1 21 ? -0.426  3.924   11.148  1.00 0.00 ? 21 LEU A HD21 15 
ATOM 11448 H HD22 . LEU A 1 21 ? 0.060   5.274   10.121  1.00 0.00 ? 21 LEU A HD22 15 
ATOM 11449 H HD23 . LEU A 1 21 ? 1.276   4.372   11.028  1.00 0.00 ? 21 LEU A HD23 15 
ATOM 11450 N N    . ILE A 1 22 ? 1.178   0.930   6.472   1.00 0.00 ? 22 ILE A N    15 
ATOM 11451 C CA   . ILE A 1 22 ? 2.343   0.858   5.601   1.00 0.00 ? 22 ILE A CA   15 
ATOM 11452 C C    . ILE A 1 22 ? 2.954   2.245   5.392   1.00 0.00 ? 22 ILE A C    15 
ATOM 11453 O O    . ILE A 1 22 ? 2.280   3.261   5.562   1.00 0.00 ? 22 ILE A O    15 
ATOM 11454 C CB   . ILE A 1 22 ? 1.966   0.228   4.234   1.00 0.00 ? 22 ILE A CB   15 
ATOM 11455 C CG1  . ILE A 1 22 ? 2.955   0.597   3.149   1.00 0.00 ? 22 ILE A CG1  15 
ATOM 11456 C CG2  . ILE A 1 22 ? 0.575   0.646   3.801   1.00 0.00 ? 22 ILE A CG2  15 
ATOM 11457 C CD1  . ILE A 1 22 ? 2.582   1.862   2.407   1.00 0.00 ? 22 ILE A CD1  15 
ATOM 11458 H H    . ILE A 1 22 ? 0.296   1.034   6.070   1.00 0.00 ? 22 ILE A H    15 
ATOM 11459 H HA   . ILE A 1 22 ? 3.076   0.222   6.076   1.00 0.00 ? 22 ILE A HA   15 
ATOM 11460 H HB   . ILE A 1 22 ? 1.967   -0.835  4.343   1.00 0.00 ? 22 ILE A HB   15 
ATOM 11461 H HG12 . ILE A 1 22 ? 3.930   0.732   3.582   1.00 0.00 ? 22 ILE A HG12 15 
ATOM 11462 H HG13 . ILE A 1 22 ? 2.994   -0.209  2.430   1.00 0.00 ? 22 ILE A HG13 15 
ATOM 11463 H HG21 . ILE A 1 22 ? 0.413   0.328   2.781   1.00 0.00 ? 22 ILE A HG21 15 
ATOM 11464 H HG22 . ILE A 1 22 ? 0.495   1.721   3.859   1.00 0.00 ? 22 ILE A HG22 15 
ATOM 11465 H HG23 . ILE A 1 22 ? -0.155  0.188   4.443   1.00 0.00 ? 22 ILE A HG23 15 
ATOM 11466 H HD11 . ILE A 1 22 ? 3.471   2.402   2.148   1.00 0.00 ? 22 ILE A HD11 15 
ATOM 11467 H HD12 . ILE A 1 22 ? 1.952   2.479   3.031   1.00 0.00 ? 22 ILE A HD12 15 
ATOM 11468 H HD13 . ILE A 1 22 ? 2.049   1.597   1.507   1.00 0.00 ? 22 ILE A HD13 15 
ATOM 11469 N N    . CYS A 1 23 ? 4.229   2.279   5.007   1.00 0.00 ? 23 CYS A N    15 
ATOM 11470 C CA   . CYS A 1 23 ? 4.918   3.540   4.757   1.00 0.00 ? 23 CYS A CA   15 
ATOM 11471 C C    . CYS A 1 23 ? 5.348   3.597   3.303   1.00 0.00 ? 23 CYS A C    15 
ATOM 11472 O O    . CYS A 1 23 ? 6.409   3.092   2.938   1.00 0.00 ? 23 CYS A O    15 
ATOM 11473 C CB   . CYS A 1 23 ? 6.139   3.719   5.672   1.00 0.00 ? 23 CYS A CB   15 
ATOM 11474 S SG   . CYS A 1 23 ? 6.324   2.449   6.968   1.00 0.00 ? 23 CYS A SG   15 
ATOM 11475 H H    . CYS A 1 23 ? 4.714   1.433   4.867   1.00 0.00 ? 23 CYS A H    15 
ATOM 11476 H HA   . CYS A 1 23 ? 4.217   4.342   4.942   1.00 0.00 ? 23 CYS A HA   15 
ATOM 11477 H HB2  . CYS A 1 23 ? 7.036   3.702   5.071   1.00 0.00 ? 23 CYS A HB2  15 
ATOM 11478 H HB3  . CYS A 1 23 ? 6.064   4.678   6.163   1.00 0.00 ? 23 CYS A HB3  15 
ATOM 11479 N N    . ALA A 1 24 ? 4.501   4.183   2.470   1.00 0.00 ? 24 ALA A N    15 
ATOM 11480 C CA   . ALA A 1 24 ? 4.787   4.269   1.051   1.00 0.00 ? 24 ALA A CA   15 
ATOM 11481 C C    . ALA A 1 24 ? 5.697   5.450   0.727   1.00 0.00 ? 24 ALA A C    15 
ATOM 11482 O O    . ALA A 1 24 ? 5.786   6.414   1.488   1.00 0.00 ? 24 ALA A O    15 
ATOM 11483 C CB   . ALA A 1 24 ? 3.494   4.362   0.256   1.00 0.00 ? 24 ALA A CB   15 
ATOM 11484 H H    . ALA A 1 24 ? 3.655   4.543   2.814   1.00 0.00 ? 24 ALA A H    15 
ATOM 11485 H HA   . ALA A 1 24 ? 5.288   3.352   0.767   1.00 0.00 ? 24 ALA A HA   15 
ATOM 11486 H HB1  . ALA A 1 24 ? 3.677   4.894   -0.667  1.00 0.00 ? 24 ALA A HB1  15 
ATOM 11487 H HB2  . ALA A 1 24 ? 2.753   4.893   0.835   1.00 0.00 ? 24 ALA A HB2  15 
ATOM 11488 H HB3  . ALA A 1 24 ? 3.135   3.369   0.033   1.00 0.00 ? 24 ALA A HB3  15 
ATOM 11489 N N    . VAL A 1 25 ? 6.362   5.358   -0.417  1.00 0.00 ? 25 VAL A N    15 
ATOM 11490 C CA   . VAL A 1 25 ? 7.269   6.402   -0.878  1.00 0.00 ? 25 VAL A CA   15 
ATOM 11491 C C    . VAL A 1 25 ? 7.411   6.359   -2.399  1.00 0.00 ? 25 VAL A C    15 
ATOM 11492 O O    . VAL A 1 25 ? 7.454   5.280   -2.998  1.00 0.00 ? 25 VAL A O    15 
ATOM 11493 C CB   . VAL A 1 25 ? 8.667   6.260   -0.243  1.00 0.00 ? 25 VAL A CB   15 
ATOM 11494 C CG1  . VAL A 1 25 ? 9.539   7.458   -0.589  1.00 0.00 ? 25 VAL A CG1  15 
ATOM 11495 C CG2  . VAL A 1 25 ? 8.561   6.089   1.267   1.00 0.00 ? 25 VAL A CG2  15 
ATOM 11496 H H    . VAL A 1 25 ? 6.236   4.563   -0.969  1.00 0.00 ? 25 VAL A H    15 
ATOM 11497 H HA   . VAL A 1 25 ? 6.858   7.360   -0.592  1.00 0.00 ? 25 VAL A HA   15 
ATOM 11498 H HB   . VAL A 1 25 ? 9.133   5.376   -0.650  1.00 0.00 ? 25 VAL A HB   15 
ATOM 11499 H HG11 . VAL A 1 25 ? 10.499  7.115   -0.944  1.00 0.00 ? 25 VAL A HG11 15 
ATOM 11500 H HG12 . VAL A 1 25 ? 9.678   8.069   0.291   1.00 0.00 ? 25 VAL A HG12 15 
ATOM 11501 H HG13 . VAL A 1 25 ? 9.059   8.044   -1.359  1.00 0.00 ? 25 VAL A HG13 15 
ATOM 11502 H HG21 . VAL A 1 25 ? 9.551   6.086   1.699   1.00 0.00 ? 25 VAL A HG21 15 
ATOM 11503 H HG22 . VAL A 1 25 ? 8.068   5.154   1.490   1.00 0.00 ? 25 VAL A HG22 15 
ATOM 11504 H HG23 . VAL A 1 25 ? 7.989   6.905   1.683   1.00 0.00 ? 25 VAL A HG23 15 
ATOM 11505 N N    . ILE A 1 26 ? 7.482   7.539   -3.014  1.00 0.00 ? 26 ILE A N    15 
ATOM 11506 C CA   . ILE A 1 26 ? 7.623   7.643   -4.466  1.00 0.00 ? 26 ILE A CA   15 
ATOM 11507 C C    . ILE A 1 26 ? 8.678   8.680   -4.833  1.00 0.00 ? 26 ILE A C    15 
ATOM 11508 O O    . ILE A 1 26 ? 8.364   9.841   -5.091  1.00 0.00 ? 26 ILE A O    15 
ATOM 11509 C CB   . ILE A 1 26 ? 6.302   8.028   -5.171  1.00 0.00 ? 26 ILE A CB   15 
ATOM 11510 C CG1  . ILE A 1 26 ? 5.167   8.225   -4.162  1.00 0.00 ? 26 ILE A CG1  15 
ATOM 11511 C CG2  . ILE A 1 26 ? 5.922   6.983   -6.211  1.00 0.00 ? 26 ILE A CG2  15 
ATOM 11512 C CD1  . ILE A 1 26 ? 4.730   6.948   -3.479  1.00 0.00 ? 26 ILE A CD1  15 
ATOM 11513 H H    . ILE A 1 26 ? 7.440   8.358   -2.479  1.00 0.00 ? 26 ILE A H    15 
ATOM 11514 H HA   . ILE A 1 26 ? 7.939   6.679   -4.837  1.00 0.00 ? 26 ILE A HA   15 
ATOM 11515 H HB   . ILE A 1 26 ? 6.473   8.955   -5.691  1.00 0.00 ? 26 ILE A HB   15 
ATOM 11516 H HG12 . ILE A 1 26 ? 5.492   8.912   -3.399  1.00 0.00 ? 26 ILE A HG12 15 
ATOM 11517 H HG13 . ILE A 1 26 ? 4.310   8.639   -4.672  1.00 0.00 ? 26 ILE A HG13 15 
ATOM 11518 H HG21 . ILE A 1 26 ? 6.605   6.149   -6.152  1.00 0.00 ? 26 ILE A HG21 15 
ATOM 11519 H HG22 . ILE A 1 26 ? 5.972   7.421   -7.195  1.00 0.00 ? 26 ILE A HG22 15 
ATOM 11520 H HG23 . ILE A 1 26 ? 4.915   6.636   -6.023  1.00 0.00 ? 26 ILE A HG23 15 
ATOM 11521 H HD11 . ILE A 1 26 ? 4.994   6.991   -2.433  1.00 0.00 ? 26 ILE A HD11 15 
ATOM 11522 H HD12 . ILE A 1 26 ? 5.223   6.104   -3.941  1.00 0.00 ? 26 ILE A HD12 15 
ATOM 11523 H HD13 . ILE A 1 26 ? 3.660   6.836   -3.575  1.00 0.00 ? 26 ILE A HD13 15 
ATOM 11524 N N    . GLY A 1 27 ? 9.925   8.247   -4.849  1.00 0.00 ? 27 GLY A N    15 
ATOM 11525 C CA   . GLY A 1 27 ? 11.030  9.129   -5.180  1.00 0.00 ? 27 GLY A CA   15 
ATOM 11526 C C    . GLY A 1 27 ? 11.281  10.155  -4.097  1.00 0.00 ? 27 GLY A C    15 
ATOM 11527 O O    . GLY A 1 27 ? 12.372  10.228  -3.532  1.00 0.00 ? 27 GLY A O    15 
ATOM 11528 H H    . GLY A 1 27 ? 10.097  7.321   -4.629  1.00 0.00 ? 27 GLY A H    15 
ATOM 11529 H HA2  . GLY A 1 27 ? 11.924  8.539   -5.318  1.00 0.00 ? 27 GLY A HA2  15 
ATOM 11530 H HA3  . GLY A 1 27 ? 10.805  9.644   -6.102  1.00 0.00 ? 27 GLY A HA3  15 
ATOM 11531 N N    . ASP A 1 28 ? 10.256  10.938  -3.805  1.00 0.00 ? 28 ASP A N    15 
ATOM 11532 C CA   . ASP A 1 28 ? 10.332  11.967  -2.782  1.00 0.00 ? 28 ASP A CA   15 
ATOM 11533 C C    . ASP A 1 28 ? 8.940   12.273  -2.240  1.00 0.00 ? 28 ASP A C    15 
ATOM 11534 O O    . ASP A 1 28 ? 8.683   13.371  -1.745  1.00 0.00 ? 28 ASP A O    15 
ATOM 11535 C CB   . ASP A 1 28 ? 10.967  13.237  -3.347  1.00 0.00 ? 28 ASP A CB   15 
ATOM 11536 C CG   . ASP A 1 28 ? 10.340  13.660  -4.661  1.00 0.00 ? 28 ASP A CG   15 
ATOM 11537 O OD1  . ASP A 1 28 ? 9.229   14.229  -4.632  1.00 0.00 ? 28 ASP A OD1  15 
ATOM 11538 O OD2  . ASP A 1 28 ? 10.961  13.426  -5.719  1.00 0.00 ? 28 ASP A OD2  15 
ATOM 11539 H H    . ASP A 1 28 ? 9.418   10.816  -4.293  1.00 0.00 ? 28 ASP A H    15 
ATOM 11540 H HA   . ASP A 1 28 ? 10.946  11.591  -1.977  1.00 0.00 ? 28 ASP A HA   15 
ATOM 11541 H HB2  . ASP A 1 28 ? 10.848  14.039  -2.637  1.00 0.00 ? 28 ASP A HB2  15 
ATOM 11542 H HB3  . ASP A 1 28 ? 12.021  13.061  -3.514  1.00 0.00 ? 28 ASP A HB3  15 
ATOM 11543 N N    . ALA A 1 29 ? 8.043   11.294  -2.338  1.00 0.00 ? 29 ALA A N    15 
ATOM 11544 C CA   . ALA A 1 29 ? 6.676   11.461  -1.859  1.00 0.00 ? 29 ALA A CA   15 
ATOM 11545 C C    . ALA A 1 29 ? 6.293   10.330  -0.913  1.00 0.00 ? 29 ALA A C    15 
ATOM 11546 O O    . ALA A 1 29 ? 5.650   9.361   -1.314  1.00 0.00 ? 29 ALA A O    15 
ATOM 11547 C CB   . ALA A 1 29 ? 5.710   11.528  -3.031  1.00 0.00 ? 29 ALA A CB   15 
ATOM 11548 H H    . ALA A 1 29 ? 8.307   10.436  -2.743  1.00 0.00 ? 29 ALA A H    15 
ATOM 11549 H HA   . ALA A 1 29 ? 6.623   12.398  -1.322  1.00 0.00 ? 29 ALA A HA   15 
ATOM 11550 H HB1  . ALA A 1 29 ? 5.553   12.559  -3.311  1.00 0.00 ? 29 ALA A HB1  15 
ATOM 11551 H HB2  . ALA A 1 29 ? 4.767   11.085  -2.747  1.00 0.00 ? 29 ALA A HB2  15 
ATOM 11552 H HB3  . ALA A 1 29 ? 6.123   10.987  -3.870  1.00 0.00 ? 29 ALA A HB3  15 
ATOM 11553 N N    . LYS A 1 30 ? 6.703   10.455  0.342   1.00 0.00 ? 30 LYS A N    15 
ATOM 11554 C CA   . LYS A 1 30 ? 6.412   9.438   1.344   1.00 0.00 ? 30 LYS A CA   15 
ATOM 11555 C C    . LYS A 1 30 ? 5.125   9.753   2.099   1.00 0.00 ? 30 LYS A C    15 
ATOM 11556 O O    . LYS A 1 30 ? 4.844   10.907  2.422   1.00 0.00 ? 30 LYS A O    15 
ATOM 11557 C CB   . LYS A 1 30 ? 7.580   9.314   2.320   1.00 0.00 ? 30 LYS A CB   15 
ATOM 11558 C CG   . LYS A 1 30 ? 7.864   10.591  3.092   1.00 0.00 ? 30 LYS A CG   15 
ATOM 11559 C CD   . LYS A 1 30 ? 9.088   11.309  2.550   1.00 0.00 ? 30 LYS A CD   15 
ATOM 11560 C CE   . LYS A 1 30 ? 10.343  10.464  2.703   1.00 0.00 ? 30 LYS A CE   15 
ATOM 11561 N NZ   . LYS A 1 30 ? 10.441  9.860   4.060   1.00 0.00 ? 30 LYS A NZ   15 
ATOM 11562 H H    . LYS A 1 30 ? 7.217   11.247  0.601   1.00 0.00 ? 30 LYS A H    15 
ATOM 11563 H HA   . LYS A 1 30 ? 6.288   8.498   0.830   1.00 0.00 ? 30 LYS A HA   15 
ATOM 11564 H HB2  . LYS A 1 30 ? 7.362   8.531   3.027   1.00 0.00 ? 30 LYS A HB2  15 
ATOM 11565 H HB3  . LYS A 1 30 ? 8.469   9.049   1.766   1.00 0.00 ? 30 LYS A HB3  15 
ATOM 11566 H HG2  . LYS A 1 30 ? 7.010   11.247  3.010   1.00 0.00 ? 30 LYS A HG2  15 
ATOM 11567 H HG3  . LYS A 1 30 ? 8.032   10.344  4.130   1.00 0.00 ? 30 LYS A HG3  15 
ATOM 11568 H HD2  . LYS A 1 30 ? 8.935   11.521  1.502   1.00 0.00 ? 30 LYS A HD2  15 
ATOM 11569 H HD3  . LYS A 1 30 ? 9.219   12.235  3.090   1.00 0.00 ? 30 LYS A HD3  15 
ATOM 11570 H HE2  . LYS A 1 30 ? 10.323  9.675   1.967   1.00 0.00 ? 30 LYS A HE2  15 
ATOM 11571 H HE3  . LYS A 1 30 ? 11.206  11.091  2.534   1.00 0.00 ? 30 LYS A HE3  15 
ATOM 11572 H HZ1  . LYS A 1 30 ? 9.684   9.159   4.193   1.00 0.00 ? 30 LYS A HZ1  15 
ATOM 11573 H HZ2  . LYS A 1 30 ? 10.348  10.597  4.788   1.00 0.00 ? 30 LYS A HZ2  15 
ATOM 11574 H HZ3  . LYS A 1 30 ? 11.360  9.388   4.175   1.00 0.00 ? 30 LYS A HZ3  15 
ATOM 11575 N N    . GLU A 1 31 ? 4.349   8.710   2.374   1.00 0.00 ? 31 GLU A N    15 
ATOM 11576 C CA   . GLU A 1 31 ? 3.084   8.852   3.090   1.00 0.00 ? 31 GLU A CA   15 
ATOM 11577 C C    . GLU A 1 31 ? 2.656   7.517   3.694   1.00 0.00 ? 31 GLU A C    15 
ATOM 11578 O O    . GLU A 1 31 ? 2.944   6.456   3.141   1.00 0.00 ? 31 GLU A O    15 
ATOM 11579 C CB   . GLU A 1 31 ? 1.996   9.366   2.144   1.00 0.00 ? 31 GLU A CB   15 
ATOM 11580 C CG   . GLU A 1 31 ? 0.648   9.567   2.818   1.00 0.00 ? 31 GLU A CG   15 
ATOM 11581 C CD   . GLU A 1 31 ? -0.397  8.578   2.340   1.00 0.00 ? 31 GLU A CD   15 
ATOM 11582 O OE1  . GLU A 1 31 ? -0.051  7.393   2.153   1.00 0.00 ? 31 GLU A OE1  15 
ATOM 11583 O OE2  . GLU A 1 31 ? -1.562  8.989   2.152   1.00 0.00 ? 31 GLU A OE2  15 
ATOM 11584 H H    . GLU A 1 31 ? 4.635   7.818   2.086   1.00 0.00 ? 31 GLU A H    15 
ATOM 11585 H HA   . GLU A 1 31 ? 3.228   9.567   3.886   1.00 0.00 ? 31 GLU A HA   15 
ATOM 11586 H HB2  . GLU A 1 31 ? 2.312   10.314  1.732   1.00 0.00 ? 31 GLU A HB2  15 
ATOM 11587 H HB3  . GLU A 1 31 ? 1.871   8.658   1.339   1.00 0.00 ? 31 GLU A HB3  15 
ATOM 11588 H HG2  . GLU A 1 31 ? 0.771   9.450   3.883   1.00 0.00 ? 31 GLU A HG2  15 
ATOM 11589 H HG3  . GLU A 1 31 ? 0.299   10.568  2.605   1.00 0.00 ? 31 GLU A HG3  15 
ATOM 11590 N N    . GLU A 1 32 ? 1.969   7.574   4.832   1.00 0.00 ? 32 GLU A N    15 
ATOM 11591 C CA   . GLU A 1 32 ? 1.511   6.363   5.503   1.00 0.00 ? 32 GLU A CA   15 
ATOM 11592 C C    . GLU A 1 32 ? 0.035   6.109   5.250   1.00 0.00 ? 32 GLU A C    15 
ATOM 11593 O O    . GLU A 1 32 ? -0.767  7.040   5.170   1.00 0.00 ? 32 GLU A O    15 
ATOM 11594 C CB   . GLU A 1 32 ? 1.735   6.457   7.012   1.00 0.00 ? 32 GLU A CB   15 
ATOM 11595 C CG   . GLU A 1 32 ? 3.147   6.106   7.448   1.00 0.00 ? 32 GLU A CG   15 
ATOM 11596 C CD   . GLU A 1 32 ? 3.173   5.141   8.614   1.00 0.00 ? 32 GLU A CD   15 
ATOM 11597 O OE1  . GLU A 1 32 ? 2.758   5.537   9.724   1.00 0.00 ? 32 GLU A OE1  15 
ATOM 11598 O OE2  . GLU A 1 32 ? 3.607   3.988   8.418   1.00 0.00 ? 32 GLU A OE2  15 
ATOM 11599 H H    . GLU A 1 32 ? 1.770   8.447   5.230   1.00 0.00 ? 32 GLU A H    15 
ATOM 11600 H HA   . GLU A 1 32 ? 2.080   5.531   5.116   1.00 0.00 ? 32 GLU A HA   15 
ATOM 11601 H HB2  . GLU A 1 32 ? 1.517   7.463   7.333   1.00 0.00 ? 32 GLU A HB2  15 
ATOM 11602 H HB3  . GLU A 1 32 ? 1.051   5.778   7.502   1.00 0.00 ? 32 GLU A HB3  15 
ATOM 11603 H HG2  . GLU A 1 32 ? 3.667   5.655   6.616   1.00 0.00 ? 32 GLU A HG2  15 
ATOM 11604 H HG3  . GLU A 1 32 ? 3.654   7.012   7.740   1.00 0.00 ? 32 GLU A HG3  15 
ATOM 11605 N N    . HIS A 1 33 ? -0.318  4.836   5.155   1.00 0.00 ? 33 HIS A N    15 
ATOM 11606 C CA   . HIS A 1 33 ? -1.705  4.441   4.945   1.00 0.00 ? 33 HIS A CA   15 
ATOM 11607 C C    . HIS A 1 33 ? -1.934  3.023   5.450   1.00 0.00 ? 33 HIS A C    15 
ATOM 11608 O O    . HIS A 1 33 ? -1.055  2.168   5.355   1.00 0.00 ? 33 HIS A O    15 
ATOM 11609 C CB   . HIS A 1 33 ? -2.086  4.545   3.473   1.00 0.00 ? 33 HIS A CB   15 
ATOM 11610 C CG   . HIS A 1 33 ? -1.274  3.665   2.589   1.00 0.00 ? 33 HIS A CG   15 
ATOM 11611 N ND1  . HIS A 1 33 ? -0.148  4.103   1.936   1.00 0.00 ? 33 HIS A ND1  15 
ATOM 11612 C CD2  . HIS A 1 33 ? -1.422  2.361   2.255   1.00 0.00 ? 33 HIS A CD2  15 
ATOM 11613 C CE1  . HIS A 1 33 ? 0.363   3.113   1.237   1.00 0.00 ? 33 HIS A CE1  15 
ATOM 11614 N NE2  . HIS A 1 33 ? -0.389  2.043   1.412   1.00 0.00 ? 33 HIS A NE2  15 
ATOM 11615 H H    . HIS A 1 33 ? 0.373   4.141   5.247   1.00 0.00 ? 33 HIS A H    15 
ATOM 11616 H HA   . HIS A 1 33 ? -2.327  5.114   5.516   1.00 0.00 ? 33 HIS A HA   15 
ATOM 11617 H HB2  . HIS A 1 33 ? -3.123  4.269   3.356   1.00 0.00 ? 33 HIS A HB2  15 
ATOM 11618 H HB3  . HIS A 1 33 ? -1.949  5.565   3.145   1.00 0.00 ? 33 HIS A HB3  15 
ATOM 11619 H HD1  . HIS A 1 33 ? 0.224   5.009   1.978   1.00 0.00 ? 33 HIS A HD1  15 
ATOM 11620 H HD2  . HIS A 1 33 ? -2.206  1.696   2.591   1.00 0.00 ? 33 HIS A HD2  15 
ATOM 11621 H HE1  . HIS A 1 33 ? 1.252   3.165   0.627   1.00 0.00 ? 33 HIS A HE1  15 
ATOM 11622 H HE2  . HIS A 1 33 ? -0.185  1.147   1.073   1.00 0.00 ? 33 HIS A HE2  15 
ATOM 11623 N N    . ARG A 1 34 ? -3.110  2.790   6.010   1.00 0.00 ? 34 ARG A N    15 
ATOM 11624 C CA   . ARG A 1 34 ? -3.449  1.482   6.559   1.00 0.00 ? 34 ARG A CA   15 
ATOM 11625 C C    . ARG A 1 34 ? -3.869  0.484   5.482   1.00 0.00 ? 34 ARG A C    15 
ATOM 11626 O O    . ARG A 1 34 ? -3.492  -0.686  5.537   1.00 0.00 ? 34 ARG A O    15 
ATOM 11627 C CB   . ARG A 1 34 ? -4.568  1.617   7.592   1.00 0.00 ? 34 ARG A CB   15 
ATOM 11628 C CG   . ARG A 1 34 ? -4.322  2.704   8.626   1.00 0.00 ? 34 ARG A CG   15 
ATOM 11629 C CD   . ARG A 1 34 ? -5.087  2.427   9.909   1.00 0.00 ? 34 ARG A CD   15 
ATOM 11630 N NE   . ARG A 1 34 ? -4.344  2.852   11.093  1.00 0.00 ? 34 ARG A NE   15 
ATOM 11631 C CZ   . ARG A 1 34 ? -4.216  4.122   11.471  1.00 0.00 ? 34 ARG A CZ   15 
ATOM 11632 N NH1  . ARG A 1 34 ? -4.771  5.094   10.757  1.00 0.00 ? 34 ARG A NH1  15 
ATOM 11633 N NH2  . ARG A 1 34 ? -3.531  4.422   12.566  1.00 0.00 ? 34 ARG A NH2  15 
ATOM 11634 H H    . ARG A 1 34 ? -3.757  3.521   6.076   1.00 0.00 ? 34 ARG A H    15 
ATOM 11635 H HA   . ARG A 1 34 ? -2.571  1.103   7.052   1.00 0.00 ? 34 ARG A HA   15 
ATOM 11636 H HB2  . ARG A 1 34 ? -5.490  1.844   7.077   1.00 0.00 ? 34 ARG A HB2  15 
ATOM 11637 H HB3  . ARG A 1 34 ? -4.679  0.676   8.110   1.00 0.00 ? 34 ARG A HB3  15 
ATOM 11638 H HG2  . ARG A 1 34 ? -3.266  2.745   8.848   1.00 0.00 ? 34 ARG A HG2  15 
ATOM 11639 H HG3  . ARG A 1 34 ? -4.645  3.652   8.222   1.00 0.00 ? 34 ARG A HG3  15 
ATOM 11640 H HD2  . ARG A 1 34 ? -6.026  2.959   9.876   1.00 0.00 ? 34 ARG A HD2  15 
ATOM 11641 H HD3  . ARG A 1 34 ? -5.278  1.366   9.977   1.00 0.00 ? 34 ARG A HD3  15 
ATOM 11642 H HE   . ARG A 1 34 ? -3.920  2.154   11.636  1.00 0.00 ? 34 ARG A HE   15 
ATOM 11643 H HH11 . ARG A 1 34 ? -5.290  4.875   9.930   1.00 0.00 ? 34 ARG A HH11 15 
ATOM 11644 H HH12 . ARG A 1 34 ? -4.673  6.046   11.047  1.00 0.00 ? 34 ARG A HH12 15 
ATOM 11645 H HH21 . ARG A 1 34 ? -3.111  3.694   13.108  1.00 0.00 ? 34 ARG A HH21 15 
ATOM 11646 H HH22 . ARG A 1 34 ? -3.435  5.376   12.850  1.00 0.00 ? 34 ARG A HH22 15 
ATOM 11647 N N    . ASN A 1 35 ? -4.665  0.932   4.516   1.00 0.00 ? 35 ASN A N    15 
ATOM 11648 C CA   . ASN A 1 35 ? -5.137  0.044   3.458   1.00 0.00 ? 35 ASN A CA   15 
ATOM 11649 C C    . ASN A 1 35 ? -4.079  -0.167  2.380   1.00 0.00 ? 35 ASN A C    15 
ATOM 11650 O O    . ASN A 1 35 ? -4.230  0.277   1.239   1.00 0.00 ? 35 ASN A O    15 
ATOM 11651 C CB   . ASN A 1 35 ? -6.431  0.578   2.842   1.00 0.00 ? 35 ASN A CB   15 
ATOM 11652 C CG   . ASN A 1 35 ? -7.653  -0.133  3.390   1.00 0.00 ? 35 ASN A CG   15 
ATOM 11653 O OD1  . ASN A 1 35 ? -7.610  -1.331  3.671   1.00 0.00 ? 35 ASN A OD1  15 
ATOM 11654 N ND2  . ASN A 1 35 ? -8.749  0.598   3.548   1.00 0.00 ? 35 ASN A ND2  15 
ATOM 11655 H H    . ASN A 1 35 ? -4.954  1.869   4.524   1.00 0.00 ? 35 ASN A H    15 
ATOM 11656 H HA   . ASN A 1 35 ? -5.346  -0.913  3.914   1.00 0.00 ? 35 ASN A HA   15 
ATOM 11657 H HB2  . ASN A 1 35 ? -6.518  1.632   3.062   1.00 0.00 ? 35 ASN A HB2  15 
ATOM 11658 H HB3  . ASN A 1 35 ? -6.402  0.437   1.772   1.00 0.00 ? 35 ASN A HB3  15 
ATOM 11659 H HD21 . ASN A 1 35 ? -8.714  1.544   3.302   1.00 0.00 ? 35 ASN A HD21 15 
ATOM 11660 H HD22 . ASN A 1 35 ? -9.547  0.161   3.910   1.00 0.00 ? 35 ASN A HD22 15 
ATOM 11661 N N    . MET A 1 36 ? -3.012  -0.864  2.754   1.00 0.00 ? 36 MET A N    15 
ATOM 11662 C CA   . MET A 1 36 ? -1.920  -1.164  1.839   1.00 0.00 ? 36 MET A CA   15 
ATOM 11663 C C    . MET A 1 36 ? -2.433  -1.832  0.565   1.00 0.00 ? 36 MET A C    15 
ATOM 11664 O O    . MET A 1 36 ? -1.773  -1.787  -0.472  1.00 0.00 ? 36 MET A O    15 
ATOM 11665 C CB   . MET A 1 36 ? -0.902  -2.075  2.536   1.00 0.00 ? 36 MET A CB   15 
ATOM 11666 C CG   . MET A 1 36 ? 0.081   -2.747  1.592   1.00 0.00 ? 36 MET A CG   15 
ATOM 11667 S SD   . MET A 1 36 ? -0.405  -4.433  1.180   1.00 0.00 ? 36 MET A SD   15 
ATOM 11668 C CE   . MET A 1 36 ? 0.690   -5.372  2.241   1.00 0.00 ? 36 MET A CE   15 
ATOM 11669 H H    . MET A 1 36 ? -2.958  -1.193  3.675   1.00 0.00 ? 36 MET A H    15 
ATOM 11670 H HA   . MET A 1 36 ? -1.441  -0.234  1.576   1.00 0.00 ? 36 MET A HA   15 
ATOM 11671 H HB2  . MET A 1 36 ? -0.340  -1.491  3.246   1.00 0.00 ? 36 MET A HB2  15 
ATOM 11672 H HB3  . MET A 1 36 ? -1.439  -2.846  3.068   1.00 0.00 ? 36 MET A HB3  15 
ATOM 11673 H HG2  . MET A 1 36 ? 0.138   -2.170  0.680   1.00 0.00 ? 36 MET A HG2  15 
ATOM 11674 H HG3  . MET A 1 36 ? 1.053   -2.772  2.063   1.00 0.00 ? 36 MET A HG3  15 
ATOM 11675 H HE1  . MET A 1 36 ? 1.518   -4.750  2.547   1.00 0.00 ? 36 MET A HE1  15 
ATOM 11676 H HE2  . MET A 1 36 ? 1.065   -6.231  1.702   1.00 0.00 ? 36 MET A HE2  15 
ATOM 11677 H HE3  . MET A 1 36 ? 0.148   -5.704  3.114   1.00 0.00 ? 36 MET A HE3  15 
ATOM 11678 N N    . CYS A 1 37 ? -3.605  -2.460  0.642   1.00 0.00 ? 37 CYS A N    15 
ATOM 11679 C CA   . CYS A 1 37 ? -4.166  -3.133  -0.521  1.00 0.00 ? 37 CYS A CA   15 
ATOM 11680 C C    . CYS A 1 37 ? -4.654  -2.123  -1.557  1.00 0.00 ? 37 CYS A C    15 
ATOM 11681 O O    . CYS A 1 37 ? -4.283  -2.196  -2.725  1.00 0.00 ? 37 CYS A O    15 
ATOM 11682 C CB   . CYS A 1 37 ? -5.279  -4.117  -0.113  1.00 0.00 ? 37 CYS A CB   15 
ATOM 11683 S SG   . CYS A 1 37 ? -6.935  -3.388  0.127   1.00 0.00 ? 37 CYS A SG   15 
ATOM 11684 H H    . CYS A 1 37 ? -4.093  -2.475  1.493   1.00 0.00 ? 37 CYS A H    15 
ATOM 11685 H HA   . CYS A 1 37 ? -3.365  -3.697  -0.969  1.00 0.00 ? 37 CYS A HA   15 
ATOM 11686 H HB2  . CYS A 1 37 ? -5.371  -4.871  -0.879  1.00 0.00 ? 37 CYS A HB2  15 
ATOM 11687 H HB3  . CYS A 1 37 ? -4.995  -4.595  0.815   1.00 0.00 ? 37 CYS A HB3  15 
ATOM 11688 N N    . ALA A 1 38 ? -5.465  -1.168  -1.124  1.00 0.00 ? 38 ALA A N    15 
ATOM 11689 C CA   . ALA A 1 38 ? -5.977  -0.142  -2.029  1.00 0.00 ? 38 ALA A CA   15 
ATOM 11690 C C    . ALA A 1 38 ? -4.838  0.620   -2.679  1.00 0.00 ? 38 ALA A C    15 
ATOM 11691 O O    . ALA A 1 38 ? -4.982  1.154   -3.778  1.00 0.00 ? 38 ALA A O    15 
ATOM 11692 C CB   . ALA A 1 38 ? -6.904  0.810   -1.289  1.00 0.00 ? 38 ALA A CB   15 
ATOM 11693 H H    . ALA A 1 38 ? -5.713  -1.143  -0.178  1.00 0.00 ? 38 ALA A H    15 
ATOM 11694 H HA   . ALA A 1 38 ? -6.541  -0.633  -2.805  1.00 0.00 ? 38 ALA A HA   15 
ATOM 11695 H HB1  . ALA A 1 38 ? -7.668  0.245   -0.776  1.00 0.00 ? 38 ALA A HB1  15 
ATOM 11696 H HB2  . ALA A 1 38 ? -7.368  1.482   -1.997  1.00 0.00 ? 38 ALA A HB2  15 
ATOM 11697 H HB3  . ALA A 1 38 ? -6.335  1.381   -0.570  1.00 0.00 ? 38 ALA A HB3  15 
ATOM 11698 N N    . LEU A 1 39 ? -3.704  0.661   -2.000  1.00 0.00 ? 39 LEU A N    15 
ATOM 11699 C CA   . LEU A 1 39 ? -2.539  1.352   -2.520  1.00 0.00 ? 39 LEU A CA   15 
ATOM 11700 C C    . LEU A 1 39 ? -1.792  0.440   -3.477  1.00 0.00 ? 39 LEU A C    15 
ATOM 11701 O O    . LEU A 1 39 ? -1.339  0.861   -4.541  1.00 0.00 ? 39 LEU A O    15 
ATOM 11702 C CB   . LEU A 1 39 ? -1.630  1.761   -1.361  1.00 0.00 ? 39 LEU A CB   15 
ATOM 11703 C CG   . LEU A 1 39 ? -1.392  3.269   -1.182  1.00 0.00 ? 39 LEU A CG   15 
ATOM 11704 C CD1  . LEU A 1 39 ? 0.049   3.639   -1.476  1.00 0.00 ? 39 LEU A CD1  15 
ATOM 11705 C CD2  . LEU A 1 39 ? -2.316  4.090   -2.059  1.00 0.00 ? 39 LEU A CD2  15 
ATOM 11706 H H    . LEU A 1 39 ? -3.646  0.213   -1.127  1.00 0.00 ? 39 LEU A H    15 
ATOM 11707 H HA   . LEU A 1 39 ? -2.872  2.225   -3.052  1.00 0.00 ? 39 LEU A HA   15 
ATOM 11708 H HB2  . LEU A 1 39 ? -2.069  1.378   -0.454  1.00 0.00 ? 39 LEU A HB2  15 
ATOM 11709 H HB3  . LEU A 1 39 ? -0.670  1.283   -1.499  1.00 0.00 ? 39 LEU A HB3  15 
ATOM 11710 H HG   . LEU A 1 39 ? -1.596  3.525   -0.157  1.00 0.00 ? 39 LEU A HG   15 
ATOM 11711 H HD11 . LEU A 1 39 ? 0.686   2.786   -1.300  1.00 0.00 ? 39 LEU A HD11 15 
ATOM 11712 H HD12 . LEU A 1 39 ? 0.350   4.453   -0.832  1.00 0.00 ? 39 LEU A HD12 15 
ATOM 11713 H HD13 . LEU A 1 39 ? 0.134   3.948   -2.505  1.00 0.00 ? 39 LEU A HD13 15 
ATOM 11714 H HD21 . LEU A 1 39 ? -2.254  5.127   -1.774  1.00 0.00 ? 39 LEU A HD21 15 
ATOM 11715 H HD22 . LEU A 1 39 ? -3.328  3.738   -1.938  1.00 0.00 ? 39 LEU A HD22 15 
ATOM 11716 H HD23 . LEU A 1 39 ? -2.016  3.979   -3.092  1.00 0.00 ? 39 LEU A HD23 15 
ATOM 11717 N N    . CYS A 1 40 ? -1.687  -0.822  -3.087  1.00 0.00 ? 40 CYS A N    15 
ATOM 11718 C CA   . CYS A 1 40 ? -1.012  -1.819  -3.903  1.00 0.00 ? 40 CYS A CA   15 
ATOM 11719 C C    . CYS A 1 40 ? -1.718  -1.963  -5.245  1.00 0.00 ? 40 CYS A C    15 
ATOM 11720 O O    . CYS A 1 40 ? -1.096  -2.275  -6.259  1.00 0.00 ? 40 CYS A O    15 
ATOM 11721 C CB   . CYS A 1 40 ? -0.946  -3.171  -3.173  1.00 0.00 ? 40 CYS A CB   15 
ATOM 11722 S SG   . CYS A 1 40 ? -2.411  -4.239  -3.390  1.00 0.00 ? 40 CYS A SG   15 
ATOM 11723 H H    . CYS A 1 40 ? -2.085  -1.085  -2.235  1.00 0.00 ? 40 CYS A H    15 
ATOM 11724 H HA   . CYS A 1 40 ? -0.008  -1.470  -4.076  1.00 0.00 ? 40 CYS A HA   15 
ATOM 11725 H HB2  . CYS A 1 40 ? -0.091  -3.721  -3.534  1.00 0.00 ? 40 CYS A HB2  15 
ATOM 11726 H HB3  . CYS A 1 40 ? -0.826  -2.990  -2.115  1.00 0.00 ? 40 CYS A HB3  15 
ATOM 11727 N N    . CYS A 1 41 ? -3.029  -1.746  -5.237  1.00 0.00 ? 41 CYS A N    15 
ATOM 11728 C CA   . CYS A 1 41 ? -3.828  -1.860  -6.441  1.00 0.00 ? 41 CYS A CA   15 
ATOM 11729 C C    . CYS A 1 41 ? -3.929  -0.533  -7.191  1.00 0.00 ? 41 CYS A C    15 
ATOM 11730 O O    . CYS A 1 41 ? -3.957  -0.505  -8.421  1.00 0.00 ? 41 CYS A O    15 
ATOM 11731 C CB   . CYS A 1 41 ? -5.219  -2.366  -6.067  1.00 0.00 ? 41 CYS A CB   15 
ATOM 11732 S SG   . CYS A 1 41 ? -6.491  -1.074  -5.850  1.00 0.00 ? 41 CYS A SG   15 
ATOM 11733 H H    . CYS A 1 41 ? -3.477  -1.513  -4.391  1.00 0.00 ? 41 CYS A H    15 
ATOM 11734 H HA   . CYS A 1 41 ? -3.357  -2.586  -7.082  1.00 0.00 ? 41 CYS A HA   15 
ATOM 11735 H HB2  . CYS A 1 41 ? -5.561  -3.031  -6.831  1.00 0.00 ? 41 CYS A HB2  15 
ATOM 11736 H HB3  . CYS A 1 41 ? -5.145  -2.905  -5.138  1.00 0.00 ? 41 CYS A HB3  15 
ATOM 11737 N N    . GLU A 1 42 ? -4.028  0.556   -6.441  1.00 0.00 ? 42 GLU A N    15 
ATOM 11738 C CA   . GLU A 1 42 ? -4.180  1.882   -7.046  1.00 0.00 ? 42 GLU A CA   15 
ATOM 11739 C C    . GLU A 1 42 ? -2.908  2.729   -6.996  1.00 0.00 ? 42 GLU A C    15 
ATOM 11740 O O    . GLU A 1 42 ? -2.987  3.958   -7.028  1.00 0.00 ? 42 GLU A O    15 
ATOM 11741 C CB   . GLU A 1 42 ? -5.321  2.643   -6.368  1.00 0.00 ? 42 GLU A CB   15 
ATOM 11742 C CG   . GLU A 1 42 ? -6.685  1.999   -6.563  1.00 0.00 ? 42 GLU A CG   15 
ATOM 11743 C CD   . GLU A 1 42 ? -7.742  2.994   -7.006  1.00 0.00 ? 42 GLU A CD   15 
ATOM 11744 O OE1  . GLU A 1 42 ? -7.807  3.291   -8.217  1.00 0.00 ? 42 GLU A OE1  15 
ATOM 11745 O OE2  . GLU A 1 42 ? -8.504  3.475   -6.141  1.00 0.00 ? 42 GLU A OE2  15 
ATOM 11746 H H    . GLU A 1 42 ? -4.033  0.459   -5.462  1.00 0.00 ? 42 GLU A H    15 
ATOM 11747 H HA   . GLU A 1 42 ? -4.444  1.733   -8.081  1.00 0.00 ? 42 GLU A HA   15 
ATOM 11748 H HB2  . GLU A 1 42 ? -5.122  2.703   -5.309  1.00 0.00 ? 42 GLU A HB2  15 
ATOM 11749 H HB3  . GLU A 1 42 ? -5.359  3.644   -6.773  1.00 0.00 ? 42 GLU A HB3  15 
ATOM 11750 H HG2  . GLU A 1 42 ? -6.601  1.228   -7.314  1.00 0.00 ? 42 GLU A HG2  15 
ATOM 11751 H HG3  . GLU A 1 42 ? -6.997  1.557   -5.628  1.00 0.00 ? 42 GLU A HG3  15 
ATOM 11752 N N    . HIS A 1 43 ? -1.739  2.099   -6.930  1.00 0.00 ? 43 HIS A N    15 
ATOM 11753 C CA   . HIS A 1 43 ? -0.491  2.864   -6.893  1.00 0.00 ? 43 HIS A CA   15 
ATOM 11754 C C    . HIS A 1 43 ? -0.037  3.264   -8.296  1.00 0.00 ? 43 HIS A C    15 
ATOM 11755 O O    . HIS A 1 43 ? -0.549  2.758   -9.295  1.00 0.00 ? 43 HIS A O    15 
ATOM 11756 C CB   . HIS A 1 43 ? 0.615   2.094   -6.180  1.00 0.00 ? 43 HIS A CB   15 
ATOM 11757 C CG   . HIS A 1 43 ? 0.813   0.697   -6.661  1.00 0.00 ? 43 HIS A CG   15 
ATOM 11758 N ND1  . HIS A 1 43 ? 0.765   0.327   -7.989  1.00 0.00 ? 43 HIS A ND1  15 
ATOM 11759 C CD2  . HIS A 1 43 ? 1.083   -0.425  -5.967  1.00 0.00 ? 43 HIS A CD2  15 
ATOM 11760 C CE1  . HIS A 1 43 ? 1.000   -0.971  -8.088  1.00 0.00 ? 43 HIS A CE1  15 
ATOM 11761 N NE2  . HIS A 1 43 ? 1.197   -1.450  -6.873  1.00 0.00 ? 43 HIS A NE2  15 
ATOM 11762 H H    . HIS A 1 43 ? -1.715  1.117   -6.910  1.00 0.00 ? 43 HIS A H    15 
ATOM 11763 H HA   . HIS A 1 43 ? -0.688  3.769   -6.338  1.00 0.00 ? 43 HIS A HA   15 
ATOM 11764 H HB2  . HIS A 1 43 ? 1.550   2.618   -6.307  1.00 0.00 ? 43 HIS A HB2  15 
ATOM 11765 H HB3  . HIS A 1 43 ? 0.378   2.049   -5.130  1.00 0.00 ? 43 HIS A HB3  15 
ATOM 11766 H HD1  . HIS A 1 43 ? 0.586   0.923   -8.745  1.00 0.00 ? 43 HIS A HD1  15 
ATOM 11767 H HD2  . HIS A 1 43 ? 1.184   -0.496  -4.892  1.00 0.00 ? 43 HIS A HD2  15 
ATOM 11768 H HE1  . HIS A 1 43 ? 1.026   -1.541  -9.005  1.00 0.00 ? 43 HIS A HE1  15 
ATOM 11769 H HE2  . HIS A 1 43 ? 1.360   -2.390  -6.654  1.00 0.00 ? 43 HIS A HE2  15 
ATOM 11770 N N    . PRO A 1 44 ? 0.921   4.206   -8.383  1.00 0.00 ? 44 PRO A N    15 
ATOM 11771 C CA   . PRO A 1 44 ? 1.440   4.715   -9.660  1.00 0.00 ? 44 PRO A CA   15 
ATOM 11772 C C    . PRO A 1 44 ? 2.341   3.724   -10.405 1.00 0.00 ? 44 PRO A C    15 
ATOM 11773 O O    . PRO A 1 44 ? 3.432   4.084   -10.847 1.00 0.00 ? 44 PRO A O    15 
ATOM 11774 C CB   . PRO A 1 44 ? 2.245   5.964   -9.257  1.00 0.00 ? 44 PRO A CB   15 
ATOM 11775 C CG   . PRO A 1 44 ? 1.913   6.215   -7.822  1.00 0.00 ? 44 PRO A CG   15 
ATOM 11776 C CD   . PRO A 1 44 ? 1.553   4.880   -7.244  1.00 0.00 ? 44 PRO A CD   15 
ATOM 11777 H HA   . PRO A 1 44 ? 0.633   5.011   -10.314 1.00 0.00 ? 44 PRO A HA   15 
ATOM 11778 H HB2  . PRO A 1 44 ? 3.300   5.772   -9.386  1.00 0.00 ? 44 PRO A HB2  15 
ATOM 11779 H HB3  . PRO A 1 44 ? 1.950   6.797   -9.877  1.00 0.00 ? 44 PRO A HB3  15 
ATOM 11780 H HG2  . PRO A 1 44 ? 2.773   6.625   -7.312  1.00 0.00 ? 44 PRO A HG2  15 
ATOM 11781 H HG3  . PRO A 1 44 ? 1.075   6.892   -7.751  1.00 0.00 ? 44 PRO A HG3  15 
ATOM 11782 H HD2  . PRO A 1 44 ? 2.439   4.351   -6.922  1.00 0.00 ? 44 PRO A HD2  15 
ATOM 11783 H HD3  . PRO A 1 44 ? 0.858   4.993   -6.426  1.00 0.00 ? 44 PRO A HD3  15 
ATOM 11784 N N    . GLY A 1 45 ? 1.875   2.488   -10.567 1.00 0.00 ? 45 GLY A N    15 
ATOM 11785 C CA   . GLY A 1 45 ? 2.650   1.492   -11.288 1.00 0.00 ? 45 GLY A CA   15 
ATOM 11786 C C    . GLY A 1 45 ? 3.409   0.541   -10.384 1.00 0.00 ? 45 GLY A C    15 
ATOM 11787 O O    . GLY A 1 45 ? 3.518   -0.648  -10.681 1.00 0.00 ? 45 GLY A O    15 
ATOM 11788 H H    . GLY A 1 45 ? 0.996   2.255   -10.214 1.00 0.00 ? 45 GLY A H    15 
ATOM 11789 H HA2  . GLY A 1 45 ? 1.981   0.917   -11.908 1.00 0.00 ? 45 GLY A HA2  15 
ATOM 11790 H HA3  . GLY A 1 45 ? 3.358   2.002   -11.927 1.00 0.00 ? 45 GLY A HA3  15 
ATOM 11791 N N    . GLY A 1 46 ? 3.942   1.059   -9.285  1.00 0.00 ? 46 GLY A N    15 
ATOM 11792 C CA   . GLY A 1 46 ? 4.693   0.219   -8.367  1.00 0.00 ? 46 GLY A CA   15 
ATOM 11793 C C    . GLY A 1 46 ? 5.787   0.971   -7.636  1.00 0.00 ? 46 GLY A C    15 
ATOM 11794 O O    . GLY A 1 46 ? 6.969   0.660   -7.780  1.00 0.00 ? 46 GLY A O    15 
ATOM 11795 H H    . GLY A 1 46 ? 3.827   2.015   -9.097  1.00 0.00 ? 46 GLY A H    15 
ATOM 11796 H HA2  . GLY A 1 46 ? 4.013   -0.199  -7.640  1.00 0.00 ? 46 GLY A HA2  15 
ATOM 11797 H HA3  . GLY A 1 46 ? 5.142   -0.589  -8.927  1.00 0.00 ? 46 GLY A HA3  15 
ATOM 11798 N N    . PHE A 1 47 ? 5.387   1.958   -6.846  1.00 0.00 ? 47 PHE A N    15 
ATOM 11799 C CA   . PHE A 1 47 ? 6.329   2.765   -6.074  1.00 0.00 ? 47 PHE A CA   15 
ATOM 11800 C C    . PHE A 1 47 ? 7.067   1.898   -5.045  1.00 0.00 ? 47 PHE A C    15 
ATOM 11801 O O    . PHE A 1 47 ? 7.690   0.903   -5.414  1.00 0.00 ? 47 PHE A O    15 
ATOM 11802 C CB   . PHE A 1 47 ? 5.573   3.908   -5.395  1.00 0.00 ? 47 PHE A CB   15 
ATOM 11803 C CG   . PHE A 1 47 ? 4.296   3.468   -4.739  1.00 0.00 ? 47 PHE A CG   15 
ATOM 11804 C CD1  . PHE A 1 47 ? 4.129   2.154   -4.314  1.00 0.00 ? 47 PHE A CD1  15 
ATOM 11805 C CD2  . PHE A 1 47 ? 3.253   4.358   -4.565  1.00 0.00 ? 47 PHE A CD2  15 
ATOM 11806 C CE1  . PHE A 1 47 ? 2.954   1.747   -3.727  1.00 0.00 ? 47 PHE A CE1  15 
ATOM 11807 C CE2  . PHE A 1 47 ? 2.073   3.953   -3.980  1.00 0.00 ? 47 PHE A CE2  15 
ATOM 11808 C CZ   . PHE A 1 47 ? 1.924   2.643   -3.561  1.00 0.00 ? 47 PHE A CZ   15 
ATOM 11809 H H    . PHE A 1 47 ? 4.429   2.149   -6.776  1.00 0.00 ? 47 PHE A H    15 
ATOM 11810 H HA   . PHE A 1 47 ? 7.051   3.180   -6.762  1.00 0.00 ? 47 PHE A HA   15 
ATOM 11811 H HB2  . PHE A 1 47 ? 6.202   4.359   -4.641  1.00 0.00 ? 47 PHE A HB2  15 
ATOM 11812 H HB3  . PHE A 1 47 ? 5.324   4.650   -6.138  1.00 0.00 ? 47 PHE A HB3  15 
ATOM 11813 H HD1  . PHE A 1 47 ? 4.932   1.448   -4.444  1.00 0.00 ? 47 PHE A HD1  15 
ATOM 11814 H HD2  . PHE A 1 47 ? 3.369   5.381   -4.892  1.00 0.00 ? 47 PHE A HD2  15 
ATOM 11815 H HE1  . PHE A 1 47 ? 2.839   0.724   -3.401  1.00 0.00 ? 47 PHE A HE1  15 
ATOM 11816 H HE2  . PHE A 1 47 ? 1.266   4.657   -3.850  1.00 0.00 ? 47 PHE A HE2  15 
ATOM 11817 H HZ   . PHE A 1 47 ? 1.000   2.319   -3.112  1.00 0.00 ? 47 PHE A HZ   15 
ATOM 11818 N N    . GLU A 1 48 ? 7.006   2.262   -3.757  1.00 0.00 ? 48 GLU A N    15 
ATOM 11819 C CA   . GLU A 1 48 ? 7.687   1.483   -2.730  1.00 0.00 ? 48 GLU A CA   15 
ATOM 11820 C C    . GLU A 1 48 ? 7.131   1.747   -1.328  1.00 0.00 ? 48 GLU A C    15 
ATOM 11821 O O    . GLU A 1 48 ? 7.258   2.851   -0.798  1.00 0.00 ? 48 GLU A O    15 
ATOM 11822 C CB   . GLU A 1 48 ? 9.181   1.797   -2.746  1.00 0.00 ? 48 GLU A CB   15 
ATOM 11823 C CG   . GLU A 1 48 ? 9.493   3.275   -2.918  1.00 0.00 ? 48 GLU A CG   15 
ATOM 11824 C CD   . GLU A 1 48 ? 10.937  3.524   -3.304  1.00 0.00 ? 48 GLU A CD   15 
ATOM 11825 O OE1  . GLU A 1 48 ? 11.794  3.576   -2.397  1.00 0.00 ? 48 GLU A OE1  15 
ATOM 11826 O OE2  . GLU A 1 48 ? 11.211  3.669   -4.513  1.00 0.00 ? 48 GLU A OE2  15 
ATOM 11827 H H    . GLU A 1 48 ? 6.506   3.062   -3.497  1.00 0.00 ? 48 GLU A H    15 
ATOM 11828 H HA   . GLU A 1 48 ? 7.550   0.435   -2.965  1.00 0.00 ? 48 GLU A HA   15 
ATOM 11829 H HB2  . GLU A 1 48 ? 9.613   1.467   -1.814  1.00 0.00 ? 48 GLU A HB2  15 
ATOM 11830 H HB3  . GLU A 1 48 ? 9.640   1.257   -3.559  1.00 0.00 ? 48 GLU A HB3  15 
ATOM