data_1IXR
# 
_entry.id   1IXR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1IXR         pdb_00001ixr 10.2210/pdb1ixr/pdb 
RCSB  RCSB005382   ?            ?                   
WWPDB D_1000005382 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1HQC '1HQC contains ruvB alone.'                          unspecified 
PDB 1IXS '1IXS contains ruvB complexed with ruvA domain III.' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IXR 
_pdbx_database_status.recvd_initial_deposition_date   2002-07-04 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Yamada, K.'    1  
'Miyata, T.'    2  
'Tsuchiya, D.'  3  
'Oyama, T.'     4  
'Fujiwara, Y.'  5  
'Ohnishi, T.'   6  
'Iwasaki, H.'   7  
'Shinagawa, H.' 8  
'Ariyoshi, M.'  9  
'Mayanagi, K.'  10 
'Morikawa, K.'  11 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structure of the RuvA-RuvB Complex: A Structural Basis for the Holliday Junction Migrating Motor Machinery' 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_volume            10 
_citation.page_first                671 
_citation.page_last                 681 
_citation.year                      2002 
_citation.journal_id_ASTM           MOCEFL 
_citation.country                   US 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_id_CSD            2168 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12408833 
_citation.pdbx_database_id_DOI      '10.1016/S1097-2765(02)00641-X' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Yamada, K.'    1  ? 
primary 'Miyata, T.'    2  ? 
primary 'Tsuchiya, D.'  3  ? 
primary 'Oyama, T.'     4  ? 
primary 'Fujiwara, Y.'  5  ? 
primary 'Ohnishi, T.'   6  ? 
primary 'Iwasaki, H.'   7  ? 
primary 'Shinagawa, H.' 8  ? 
primary 'Ariyoshi, M.'  9  ? 
primary 'Mayanagi, K.'  10 ? 
primary 'Morikawa, K.'  11 ? 
# 
_cell.entry_id           1IXR 
_cell.length_a           61.581 
_cell.length_b           195.113 
_cell.length_c           246.244 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IXR 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Holliday junction DNA helicase ruvA'         20441.055 2 ?       ?     ?                ? 
2 polymer     man RuvB                                          34801.312 1 3.6.1.3 Y309R 'residues 1-312' ? 
3 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196   1 ?       ?     ?                ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MIRYLRGLVLKKEAGGFVLLAGGVGFFLQAPTPFLQALEEGKEVGVHTHLLLKEEGLSLYGFPDEENLALFELLLSVSGV
GPKVALALLSALPPRLLARALLEGDARLLTSASGVGRRLAERIALELKGKVPPHLLAGEKVESEAAEEAVMALAALGFKE
AQARAVVLDLLAQNPKARAQDLIKEALKRLR
;
;MIRYLRGLVLKKEAGGFVLLAGGVGFFLQAPTPFLQALEEGKEVGVHTHLLLKEEGLSLYGFPDEENLALFELLLSVSGV
GPKVALALLSALPPRLLARALLEGDARLLTSASGVGRRLAERIALELKGKVPPHLLAGEKVESEAAEEAVMALAALGFKE
AQARAVVLDLLAQNPKARAQDLIKEALKRLR
;
A,B ? 
2 'polypeptide(L)' no no 
;MEDLALRPKTLDEYIGQERLKQKLRVYLEAAKARKEPLEHLLLFGPPGLGKTTLAHVIAHELGVNLRVTSGPAIEKPGDL
AAILANSLEEGDILFIDEIHRLSRQAEEHLYPAMEDFVMDIVIGQGPAARTIRLELPRFTLIGATTRPGLITAPLLSRFG
IVEHLEYYTPEELAQGVMRDARLLGVRITEEAALEIGRRSRGTMRVAKRLFRRVRDFAQVAGEEVITRERALEALAALGL
DELGLEKRDREILEVLILRFGGGPVGLATLATALSEDPGTLEEVHEPYLIRQGLLKRTPRGRVATELARRHL
;
;MEDLALRPKTLDEYIGQERLKQKLRVYLEAAKARKEPLEHLLLFGPPGLGKTTLAHVIAHELGVNLRVTSGPAIEKPGDL
AAILANSLEEGDILFIDEIHRLSRQAEEHLYPAMEDFVMDIVIGQGPAARTIRLELPRFTLIGATTRPGLITAPLLSRFG
IVEHLEYYTPEELAQGVMRDARLLGVRITEEAALEIGRRSRGTMRVAKRLFRRVRDFAQVAGEEVITRERALEALAALGL
DELGLEKRDREILEVLILRFGGGPVGLATLATALSEDPGTLEEVHEPYLIRQGLLKRTPRGRVATELARRHL
;
C   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ILE n 
1 3   ARG n 
1 4   TYR n 
1 5   LEU n 
1 6   ARG n 
1 7   GLY n 
1 8   LEU n 
1 9   VAL n 
1 10  LEU n 
1 11  LYS n 
1 12  LYS n 
1 13  GLU n 
1 14  ALA n 
1 15  GLY n 
1 16  GLY n 
1 17  PHE n 
1 18  VAL n 
1 19  LEU n 
1 20  LEU n 
1 21  ALA n 
1 22  GLY n 
1 23  GLY n 
1 24  VAL n 
1 25  GLY n 
1 26  PHE n 
1 27  PHE n 
1 28  LEU n 
1 29  GLN n 
1 30  ALA n 
1 31  PRO n 
1 32  THR n 
1 33  PRO n 
1 34  PHE n 
1 35  LEU n 
1 36  GLN n 
1 37  ALA n 
1 38  LEU n 
1 39  GLU n 
1 40  GLU n 
1 41  GLY n 
1 42  LYS n 
1 43  GLU n 
1 44  VAL n 
1 45  GLY n 
1 46  VAL n 
1 47  HIS n 
1 48  THR n 
1 49  HIS n 
1 50  LEU n 
1 51  LEU n 
1 52  LEU n 
1 53  LYS n 
1 54  GLU n 
1 55  GLU n 
1 56  GLY n 
1 57  LEU n 
1 58  SER n 
1 59  LEU n 
1 60  TYR n 
1 61  GLY n 
1 62  PHE n 
1 63  PRO n 
1 64  ASP n 
1 65  GLU n 
1 66  GLU n 
1 67  ASN n 
1 68  LEU n 
1 69  ALA n 
1 70  LEU n 
1 71  PHE n 
1 72  GLU n 
1 73  LEU n 
1 74  LEU n 
1 75  LEU n 
1 76  SER n 
1 77  VAL n 
1 78  SER n 
1 79  GLY n 
1 80  VAL n 
1 81  GLY n 
1 82  PRO n 
1 83  LYS n 
1 84  VAL n 
1 85  ALA n 
1 86  LEU n 
1 87  ALA n 
1 88  LEU n 
1 89  LEU n 
1 90  SER n 
1 91  ALA n 
1 92  LEU n 
1 93  PRO n 
1 94  PRO n 
1 95  ARG n 
1 96  LEU n 
1 97  LEU n 
1 98  ALA n 
1 99  ARG n 
1 100 ALA n 
1 101 LEU n 
1 102 LEU n 
1 103 GLU n 
1 104 GLY n 
1 105 ASP n 
1 106 ALA n 
1 107 ARG n 
1 108 LEU n 
1 109 LEU n 
1 110 THR n 
1 111 SER n 
1 112 ALA n 
1 113 SER n 
1 114 GLY n 
1 115 VAL n 
1 116 GLY n 
1 117 ARG n 
1 118 ARG n 
1 119 LEU n 
1 120 ALA n 
1 121 GLU n 
1 122 ARG n 
1 123 ILE n 
1 124 ALA n 
1 125 LEU n 
1 126 GLU n 
1 127 LEU n 
1 128 LYS n 
1 129 GLY n 
1 130 LYS n 
1 131 VAL n 
1 132 PRO n 
1 133 PRO n 
1 134 HIS n 
1 135 LEU n 
1 136 LEU n 
1 137 ALA n 
1 138 GLY n 
1 139 GLU n 
1 140 LYS n 
1 141 VAL n 
1 142 GLU n 
1 143 SER n 
1 144 GLU n 
1 145 ALA n 
1 146 ALA n 
1 147 GLU n 
1 148 GLU n 
1 149 ALA n 
1 150 VAL n 
1 151 MET n 
1 152 ALA n 
1 153 LEU n 
1 154 ALA n 
1 155 ALA n 
1 156 LEU n 
1 157 GLY n 
1 158 PHE n 
1 159 LYS n 
1 160 GLU n 
1 161 ALA n 
1 162 GLN n 
1 163 ALA n 
1 164 ARG n 
1 165 ALA n 
1 166 VAL n 
1 167 VAL n 
1 168 LEU n 
1 169 ASP n 
1 170 LEU n 
1 171 LEU n 
1 172 ALA n 
1 173 GLN n 
1 174 ASN n 
1 175 PRO n 
1 176 LYS n 
1 177 ALA n 
1 178 ARG n 
1 179 ALA n 
1 180 GLN n 
1 181 ASP n 
1 182 LEU n 
1 183 ILE n 
1 184 LYS n 
1 185 GLU n 
1 186 ALA n 
1 187 LEU n 
1 188 LYS n 
1 189 ARG n 
1 190 LEU n 
1 191 ARG n 
2 1   MET n 
2 2   GLU n 
2 3   ASP n 
2 4   LEU n 
2 5   ALA n 
2 6   LEU n 
2 7   ARG n 
2 8   PRO n 
2 9   LYS n 
2 10  THR n 
2 11  LEU n 
2 12  ASP n 
2 13  GLU n 
2 14  TYR n 
2 15  ILE n 
2 16  GLY n 
2 17  GLN n 
2 18  GLU n 
2 19  ARG n 
2 20  LEU n 
2 21  LYS n 
2 22  GLN n 
2 23  LYS n 
2 24  LEU n 
2 25  ARG n 
2 26  VAL n 
2 27  TYR n 
2 28  LEU n 
2 29  GLU n 
2 30  ALA n 
2 31  ALA n 
2 32  LYS n 
2 33  ALA n 
2 34  ARG n 
2 35  LYS n 
2 36  GLU n 
2 37  PRO n 
2 38  LEU n 
2 39  GLU n 
2 40  HIS n 
2 41  LEU n 
2 42  LEU n 
2 43  LEU n 
2 44  PHE n 
2 45  GLY n 
2 46  PRO n 
2 47  PRO n 
2 48  GLY n 
2 49  LEU n 
2 50  GLY n 
2 51  LYS n 
2 52  THR n 
2 53  THR n 
2 54  LEU n 
2 55  ALA n 
2 56  HIS n 
2 57  VAL n 
2 58  ILE n 
2 59  ALA n 
2 60  HIS n 
2 61  GLU n 
2 62  LEU n 
2 63  GLY n 
2 64  VAL n 
2 65  ASN n 
2 66  LEU n 
2 67  ARG n 
2 68  VAL n 
2 69  THR n 
2 70  SER n 
2 71  GLY n 
2 72  PRO n 
2 73  ALA n 
2 74  ILE n 
2 75  GLU n 
2 76  LYS n 
2 77  PRO n 
2 78  GLY n 
2 79  ASP n 
2 80  LEU n 
2 81  ALA n 
2 82  ALA n 
2 83  ILE n 
2 84  LEU n 
2 85  ALA n 
2 86  ASN n 
2 87  SER n 
2 88  LEU n 
2 89  GLU n 
2 90  GLU n 
2 91  GLY n 
2 92  ASP n 
2 93  ILE n 
2 94  LEU n 
2 95  PHE n 
2 96  ILE n 
2 97  ASP n 
2 98  GLU n 
2 99  ILE n 
2 100 HIS n 
2 101 ARG n 
2 102 LEU n 
2 103 SER n 
2 104 ARG n 
2 105 GLN n 
2 106 ALA n 
2 107 GLU n 
2 108 GLU n 
2 109 HIS n 
2 110 LEU n 
2 111 TYR n 
2 112 PRO n 
2 113 ALA n 
2 114 MET n 
2 115 GLU n 
2 116 ASP n 
2 117 PHE n 
2 118 VAL n 
2 119 MET n 
2 120 ASP n 
2 121 ILE n 
2 122 VAL n 
2 123 ILE n 
2 124 GLY n 
2 125 GLN n 
2 126 GLY n 
2 127 PRO n 
2 128 ALA n 
2 129 ALA n 
2 130 ARG n 
2 131 THR n 
2 132 ILE n 
2 133 ARG n 
2 134 LEU n 
2 135 GLU n 
2 136 LEU n 
2 137 PRO n 
2 138 ARG n 
2 139 PHE n 
2 140 THR n 
2 141 LEU n 
2 142 ILE n 
2 143 GLY n 
2 144 ALA n 
2 145 THR n 
2 146 THR n 
2 147 ARG n 
2 148 PRO n 
2 149 GLY n 
2 150 LEU n 
2 151 ILE n 
2 152 THR n 
2 153 ALA n 
2 154 PRO n 
2 155 LEU n 
2 156 LEU n 
2 157 SER n 
2 158 ARG n 
2 159 PHE n 
2 160 GLY n 
2 161 ILE n 
2 162 VAL n 
2 163 GLU n 
2 164 HIS n 
2 165 LEU n 
2 166 GLU n 
2 167 TYR n 
2 168 TYR n 
2 169 THR n 
2 170 PRO n 
2 171 GLU n 
2 172 GLU n 
2 173 LEU n 
2 174 ALA n 
2 175 GLN n 
2 176 GLY n 
2 177 VAL n 
2 178 MET n 
2 179 ARG n 
2 180 ASP n 
2 181 ALA n 
2 182 ARG n 
2 183 LEU n 
2 184 LEU n 
2 185 GLY n 
2 186 VAL n 
2 187 ARG n 
2 188 ILE n 
2 189 THR n 
2 190 GLU n 
2 191 GLU n 
2 192 ALA n 
2 193 ALA n 
2 194 LEU n 
2 195 GLU n 
2 196 ILE n 
2 197 GLY n 
2 198 ARG n 
2 199 ARG n 
2 200 SER n 
2 201 ARG n 
2 202 GLY n 
2 203 THR n 
2 204 MET n 
2 205 ARG n 
2 206 VAL n 
2 207 ALA n 
2 208 LYS n 
2 209 ARG n 
2 210 LEU n 
2 211 PHE n 
2 212 ARG n 
2 213 ARG n 
2 214 VAL n 
2 215 ARG n 
2 216 ASP n 
2 217 PHE n 
2 218 ALA n 
2 219 GLN n 
2 220 VAL n 
2 221 ALA n 
2 222 GLY n 
2 223 GLU n 
2 224 GLU n 
2 225 VAL n 
2 226 ILE n 
2 227 THR n 
2 228 ARG n 
2 229 GLU n 
2 230 ARG n 
2 231 ALA n 
2 232 LEU n 
2 233 GLU n 
2 234 ALA n 
2 235 LEU n 
2 236 ALA n 
2 237 ALA n 
2 238 LEU n 
2 239 GLY n 
2 240 LEU n 
2 241 ASP n 
2 242 GLU n 
2 243 LEU n 
2 244 GLY n 
2 245 LEU n 
2 246 GLU n 
2 247 LYS n 
2 248 ARG n 
2 249 ASP n 
2 250 ARG n 
2 251 GLU n 
2 252 ILE n 
2 253 LEU n 
2 254 GLU n 
2 255 VAL n 
2 256 LEU n 
2 257 ILE n 
2 258 LEU n 
2 259 ARG n 
2 260 PHE n 
2 261 GLY n 
2 262 GLY n 
2 263 GLY n 
2 264 PRO n 
2 265 VAL n 
2 266 GLY n 
2 267 LEU n 
2 268 ALA n 
2 269 THR n 
2 270 LEU n 
2 271 ALA n 
2 272 THR n 
2 273 ALA n 
2 274 LEU n 
2 275 SER n 
2 276 GLU n 
2 277 ASP n 
2 278 PRO n 
2 279 GLY n 
2 280 THR n 
2 281 LEU n 
2 282 GLU n 
2 283 GLU n 
2 284 VAL n 
2 285 HIS n 
2 286 GLU n 
2 287 PRO n 
2 288 TYR n 
2 289 LEU n 
2 290 ILE n 
2 291 ARG n 
2 292 GLN n 
2 293 GLY n 
2 294 LEU n 
2 295 LEU n 
2 296 LYS n 
2 297 ARG n 
2 298 THR n 
2 299 PRO n 
2 300 ARG n 
2 301 GLY n 
2 302 ARG n 
2 303 VAL n 
2 304 ALA n 
2 305 THR n 
2 306 GLU n 
2 307 LEU n 
2 308 ALA n 
2 309 ARG n 
2 310 ARG n 
2 311 HIS n 
2 312 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? Thermus ruvA ? ? ? ? ? ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? pTRA127 ? ? 
2 1 sample ? ? ? ? Thermus ruvB ? ? ? ? ? ? 'Thermus thermophilus' 274 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 
Escherichia ? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? pET11a  ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP RUVA_THET8 1 
;MIRYLRGLVLKKEAGGFVLLAGGVGFFLQAPTPFLQALEEGKEVGVHTHLLLKEEGLSLYGFPDEENLALFELLLSVSGV
GPKVALALLSALPPRLLARALLEGDARLLTSASGVGRRLAERIALELKGKVPPHLLAGEKVESEAAEEAVMALAALGFKE
AQARAVVLDLLAQNPKARAQDLIKEALKRLR
;
1 Q9F1Q3 ? 
2 UNP RUVB_THET8 2 
;MEDLALRPKTLDEYIGQERLKQKLRVYLEAAKARKEPLEHLLLFGPPGLGKTTLAHVIAHELGVNLRVTSGPAIEKPGDL
AAILANSLEEGDILFIDEIHRLSRQAEEHLYPAMEDFVMDIVIGQGPAARTIRLELPRFTLIGATTRPGLITAPLLSRFG
IVEHLEYYTPEELAQGVMRDARLLGVRITEEAALEIGRRSRGTMRVAKRLFRRVRDFAQVAGEEVITRERALEALAALGL
DELGLEKRDREILEVLILRFGGGPVGLATLATALSEDPGTLEEVHEPYLIRQGLLKRTPRGRVATELAYRHL
;
1 Q5SL87 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1IXR A 1 ? 191 ? Q9F1Q3 1 ? 191 ? 1 191 
2 1 1IXR B 1 ? 191 ? Q9F1Q3 1 ? 191 ? 1 191 
3 2 1IXR C 1 ? 312 ? Q5SL87 1 ? 312 ? 1 312 
# 
_struct_ref_seq_dif.align_id                     3 
_struct_ref_seq_dif.pdbx_pdb_id_code             1IXR 
_struct_ref_seq_dif.mon_id                       ARG 
_struct_ref_seq_dif.pdbx_pdb_strand_id           C 
_struct_ref_seq_dif.seq_num                      309 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q5SL87 
_struct_ref_seq_dif.db_mon_id                    TYR 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          309 
_struct_ref_seq_dif.details                      'engineered mutation' 
_struct_ref_seq_dif.pdbx_auth_seq_num            309 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ANP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ? 'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1IXR 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   74.82 
_exptl_crystal.density_Matthews      4.88 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'NaCl, ethanol, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2002-01-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL38B1' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL38B1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
# 
_reflns.entry_id                     1IXR 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            3.2 
_reflns.d_resolution_low             44 
_reflns.number_all                   24710 
_reflns.number_obs                   24710 
_reflns.percent_possible_obs         97.6 
_reflns.pdbx_Rmerge_I_obs            0.0590000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        28.9 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.20 
_reflns_shell.d_res_low              3.31 
_reflns_shell.percent_possible_all   97.6 
_reflns_shell.Rmerge_I_obs           0.4740000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.5 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1IXR 
_refine.ls_d_res_high                            3.3 
_refine.ls_d_res_low                             12 
_refine.pdbx_ls_sigma_F                          3 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     20005 
_refine.ls_number_reflns_obs                     20005 
_refine.ls_number_reflns_R_free                  965 
_refine.ls_percent_reflns_obs                    89.4 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.2680000 
_refine.ls_R_factor_R_free                       0.3350000 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1IXR 
_refine_analyze.Luzzati_coordinate_error_obs    0.43 
_refine_analyze.Luzzati_sigma_a_obs             0.46 
_refine_analyze.Luzzati_d_res_low_obs           5 
_refine_analyze.Luzzati_coordinate_error_free   0.58 
_refine_analyze.Luzzati_sigma_a_free            0.52 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4873 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         31 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4904 
_refine_hist.d_res_high                       3.3 
_refine_hist.d_res_low                        12 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.009 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.72  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       3.30 
_refine_ls_shell.d_res_low                        3.42 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.3710000 
_refine_ls_shell.percent_reflns_obs               70.2 
_refine_ls_shell.R_factor_R_free                  0.3930000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             91 
_refine_ls_shell.number_reflns_obs                1658 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1IXR 
_struct.title                     'RuvA-RuvB complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IXR 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'heterooligomeric complex, octameric RuvA, AAA-ATPase domain, complex with nucleotide, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;The biological assembly is   
generated by the 222   
crystallographic symmetry   
at the origin: (-x,-y,z),  
(x,-y,-z), and (-x,y,-z).
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 31  ? LEU A 38  ? PRO A 31  LEU A 38  1 ? 8  
HELX_P HELX_P2  2  ASP A 64  ? SER A 76  ? ASP A 64  SER A 76  1 ? 13 
HELX_P HELX_P3  3  GLY A 81  ? LEU A 92  ? GLY A 81  LEU A 92  1 ? 12 
HELX_P HELX_P4  4  PRO A 93  ? GLU A 103 ? PRO A 93  GLU A 103 1 ? 11 
HELX_P HELX_P5  5  ASP A 105 ? THR A 110 ? ASP A 105 THR A 110 1 ? 6  
HELX_P HELX_P6  6  GLY A 116 ? LYS A 128 ? GLY A 116 LYS A 128 1 ? 13 
HELX_P HELX_P7  7  PRO B 31  ? ALA B 37  ? PRO B 31  ALA B 37  1 ? 7  
HELX_P HELX_P8  8  ASP B 64  ? VAL B 77  ? ASP B 64  VAL B 77  1 ? 14 
HELX_P HELX_P9  9  GLY B 81  ? LEU B 92  ? GLY B 81  LEU B 92  1 ? 12 
HELX_P HELX_P10 10 PRO B 93  ? GLY B 104 ? PRO B 93  GLY B 104 1 ? 12 
HELX_P HELX_P11 11 ASP B 105 ? SER B 111 ? ASP B 105 SER B 111 1 ? 7  
HELX_P HELX_P12 12 GLY B 116 ? LYS B 128 ? GLY B 116 LYS B 128 1 ? 13 
HELX_P HELX_P13 13 GLU B 144 ? LEU B 156 ? GLU B 144 LEU B 156 1 ? 13 
HELX_P HELX_P14 14 LYS B 159 ? ASN B 174 ? LYS B 159 ASN B 174 1 ? 16 
HELX_P HELX_P15 15 ARG B 178 ? LEU B 190 ? ARG B 178 LEU B 190 1 ? 13 
HELX_P HELX_P16 16 GLU C 18  ? LYS C 23  ? GLU C 18  LYS C 23  1 ? 6  
HELX_P HELX_P17 17 GLU C 29  ? ALA C 33  ? GLU C 29  ALA C 33  5 ? 5  
HELX_P HELX_P18 18 LYS C 51  ? ALA C 59  ? LYS C 51  ALA C 59  1 ? 9  
HELX_P HELX_P19 19 HIS C 60  ? LEU C 62  ? HIS C 60  LEU C 62  5 ? 3  
HELX_P HELX_P20 20 GLY C 78  ? ALA C 85  ? GLY C 78  ALA C 85  1 ? 8  
HELX_P HELX_P21 21 TYR C 111 ? ASP C 116 ? TYR C 111 ASP C 116 1 ? 6  
HELX_P HELX_P22 22 ALA C 153 ? SER C 157 ? ALA C 153 SER C 157 5 ? 5  
HELX_P HELX_P23 23 THR C 169 ? ASP C 180 ? THR C 169 ASP C 180 1 ? 12 
HELX_P HELX_P24 24 THR C 189 ? ARG C 198 ? THR C 189 ARG C 198 1 ? 10 
HELX_P HELX_P25 25 MET C 204 ? ALA C 207 ? MET C 204 ALA C 207 5 ? 4  
HELX_P HELX_P26 26 LYS C 208 ? ARG C 215 ? LYS C 208 ARG C 215 1 ? 8  
HELX_P HELX_P27 27 PHE C 217 ? ALA C 221 ? PHE C 217 ALA C 221 5 ? 5  
HELX_P HELX_P28 28 GLU C 229 ? ALA C 237 ? GLU C 229 ALA C 237 1 ? 9  
HELX_P HELX_P29 29 LYS C 247 ? LEU C 258 ? LYS C 247 LEU C 258 1 ? 12 
HELX_P HELX_P30 30 GLY C 266 ? LEU C 274 ? GLY C 266 LEU C 274 1 ? 9  
HELX_P HELX_P31 31 ASP C 277 ? HIS C 285 ? ASP C 277 HIS C 285 1 ? 9  
HELX_P HELX_P32 32 HIS C 285 ? ARG C 291 ? HIS C 285 ARG C 291 1 ? 7  
HELX_P HELX_P33 33 THR C 305 ? ARG C 310 ? THR C 305 ARG C 310 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 131 B . ? VAL 131 B PRO 132 B ? PRO 132 B 1 -0.90 
2 GLY 126 C . ? GLY 126 C PRO 127 C ? PRO 127 C 1 -0.24 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 12 ? 
B ? 5  ? 
C ? 2  ? 
D ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? parallel      
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
A 10 11 ? anti-parallel 
A 11 12 ? parallel      
B 1  2  ? parallel      
B 2  3  ? parallel      
B 3  4  ? parallel      
B 4  5  ? parallel      
C 1  2  ? anti-parallel 
D 1  2  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  GLU B 43  ? HIS B 47  ? GLU B 43  HIS B 47  
A 2  ILE B 2   ? LYS B 12  ? ILE B 2   LYS B 12  
A 3  VAL A 24  ? GLN A 29  ? VAL A 24  GLN A 29  
A 4  GLY A 16  ? LEU A 20  ? GLY A 16  LEU A 20  
A 5  TYR A 4   ? LYS A 12  ? TYR A 4   LYS A 12  
A 6  GLU A 43  ? THR A 48  ? GLU A 43  THR A 48  
A 7  LEU A 59  ? PHE A 62  ? LEU A 59  PHE A 62  
A 8  VAL A 24  ? GLN A 29  ? VAL A 24  GLN A 29  
A 9  ILE B 2   ? LYS B 12  ? ILE B 2   LYS B 12  
A 10 GLY B 16  ? ALA B 21  ? GLY B 16  ALA B 21  
A 11 VAL B 24  ? GLN B 29  ? VAL B 24  GLN B 29  
A 12 LEU B 59  ? TYR B 60  ? LEU B 59  TYR B 60  
B 1  LEU C 66  ? SER C 70  ? LEU C 66  SER C 70  
B 2  ILE C 93  ? ASP C 97  ? ILE C 93  ASP C 97  
B 3  THR C 140 ? ALA C 144 ? THR C 140 ALA C 144 
B 4  LEU C 41  ? LEU C 43  ? LEU C 41  LEU C 43  
B 5  ILE C 161 ? GLU C 163 ? ILE C 161 GLU C 163 
C 1  ILE C 121 ? VAL C 122 ? ILE C 121 VAL C 122 
C 2  THR C 131 ? ILE C 132 ? THR C 131 ILE C 132 
D 1  LEU C 295 ? THR C 298 ? LEU C 295 THR C 298 
D 2  GLY C 301 ? ALA C 304 ? GLY C 301 ALA C 304 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL B 46  ? N VAL B 46  O LEU B 5   ? O LEU B 5   
A 2  3  N ARG B 3   ? N ARG B 3   O GLY A 25  ? O GLY A 25  
A 3  4  N LEU A 28  ? N LEU A 28  O PHE A 17  ? O PHE A 17  
A 4  5  N LEU A 20  ? N LEU A 20  O LEU A 8   ? O LEU A 8   
A 5  6  N GLY A 7   ? N GLY A 7   O VAL A 44  ? O VAL A 44  
A 6  7  O HIS A 47  ? O HIS A 47  N PHE A 62  ? N PHE A 62  
A 7  8  N LEU A 59  ? N LEU A 59  O PHE A 27  ? O PHE A 27  
A 8  9  O GLY A 25  ? O GLY A 25  N ARG B 3   ? N ARG B 3   
A 9  10 O LYS B 11  ? O LYS B 11  N VAL B 18  ? N VAL B 18  
A 10 11 O ALA B 21  ? O ALA B 21  N VAL B 24  ? N VAL B 24  
A 11 12 N GLN B 29  ? N GLN B 29  O LEU B 59  ? O LEU B 59  
B 1  2  N ARG C 67  ? N ARG C 67  O ILE C 93  ? O ILE C 93  
B 2  3  N LEU C 94  ? N LEU C 94  O THR C 140 ? O THR C 140 
B 3  4  O LEU C 141 ? O LEU C 141 N LEU C 41  ? N LEU C 41  
B 4  5  N LEU C 42  ? N LEU C 42  O ILE C 161 ? O ILE C 161 
C 1  2  N ILE C 121 ? N ILE C 121 O ILE C 132 ? O ILE C 132 
D 1  2  O THR C 298 ? O THR C 298 N GLY C 301 ? N GLY C 301 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    C 
_struct_site.pdbx_auth_comp_id    ANP 
_struct_site.pdbx_auth_seq_id     313 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    11 
_struct_site.details              'BINDING SITE FOR RESIDUE ANP C 313' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 ARG C 7   ? ARG C 7   . ? 1_555 ? 
2  AC1 11 TYR C 14  ? TYR C 14  . ? 1_555 ? 
3  AC1 11 ILE C 15  ? ILE C 15  . ? 1_555 ? 
4  AC1 11 GLY C 48  ? GLY C 48  . ? 1_555 ? 
5  AC1 11 GLY C 50  ? GLY C 50  . ? 1_555 ? 
6  AC1 11 LYS C 51  ? LYS C 51  . ? 1_555 ? 
7  AC1 11 THR C 52  ? THR C 52  . ? 1_555 ? 
8  AC1 11 THR C 53  ? THR C 53  . ? 1_555 ? 
9  AC1 11 MET C 204 ? MET C 204 . ? 1_555 ? 
10 AC1 11 ARG C 205 ? ARG C 205 . ? 1_555 ? 
11 AC1 11 LYS C 208 ? LYS C 208 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1IXR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IXR 
_atom_sites.fract_transf_matrix[1][1]   0.016239 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005125 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004061 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . MET A 1 1   ? -7.808  2.955   21.690 1.00 30.02  ? 1   MET A N     1 
ATOM   2    C CA    . MET A 1 1   ? -8.568  2.363   22.807 1.00 30.02  ? 1   MET A CA    1 
ATOM   3    C C     . MET A 1 1   ? -8.653  3.271   24.052 1.00 30.02  ? 1   MET A C     1 
ATOM   4    O O     . MET A 1 1   ? -9.492  3.052   24.928 1.00 30.02  ? 1   MET A O     1 
ATOM   5    C CB    . MET A 1 1   ? -7.972  0.994   23.169 1.00 59.53  ? 1   MET A CB    1 
ATOM   6    C CG    . MET A 1 1   ? -6.639  1.055   23.879 1.00 59.53  ? 1   MET A CG    1 
ATOM   7    S SD    . MET A 1 1   ? -5.451  -0.011  23.086 1.00 59.53  ? 1   MET A SD    1 
ATOM   8    C CE    . MET A 1 1   ? -4.868  -1.041  24.449 1.00 59.53  ? 1   MET A CE    1 
ATOM   9    N N     . ILE A 1 2   ? -7.807  4.283   24.170 1.00 15.82  ? 2   ILE A N     1 
ATOM   10   C CA    . ILE A 1 2   ? -7.945  5.138   25.353 1.00 15.82  ? 2   ILE A CA    1 
ATOM   11   C C     . ILE A 1 2   ? -9.051  6.164   25.047 1.00 15.82  ? 2   ILE A C     1 
ATOM   12   O O     . ILE A 1 2   ? -9.057  6.812   23.980 1.00 15.82  ? 2   ILE A O     1 
ATOM   13   C CB    . ILE A 1 2   ? -6.612  5.897   25.752 1.00 26.81  ? 2   ILE A CB    1 
ATOM   14   C CG1   . ILE A 1 2   ? -5.496  4.913   26.094 1.00 26.81  ? 2   ILE A CG1   1 
ATOM   15   C CG2   . ILE A 1 2   ? -6.865  6.792   26.963 1.00 26.81  ? 2   ILE A CG2   1 
ATOM   16   C CD1   . ILE A 1 2   ? -4.867  4.331   24.881 1.00 26.81  ? 2   ILE A CD1   1 
ATOM   17   N N     . ARG A 1 3   ? -9.992  6.299   25.979 1.00 35.75  ? 3   ARG A N     1 
ATOM   18   C CA    . ARG A 1 3   ? -11.120 7.209   25.798 1.00 35.75  ? 3   ARG A CA    1 
ATOM   19   C C     . ARG A 1 3   ? -11.141 8.182   26.942 1.00 35.75  ? 3   ARG A C     1 
ATOM   20   O O     . ARG A 1 3   ? -11.602 9.310   26.806 1.00 35.75  ? 3   ARG A O     1 
ATOM   21   C CB    . ARG A 1 3   ? -12.437 6.425   25.795 1.00 63.86  ? 3   ARG A CB    1 
ATOM   22   C CG    . ARG A 1 3   ? -13.654 7.176   25.285 1.00 63.86  ? 3   ARG A CG    1 
ATOM   23   C CD    . ARG A 1 3   ? -13.774 6.996   23.803 1.00 63.86  ? 3   ARG A CD    1 
ATOM   24   N NE    . ARG A 1 3   ? -14.750 7.913   23.238 1.00 63.86  ? 3   ARG A NE    1 
ATOM   25   C CZ    . ARG A 1 3   ? -14.859 8.179   21.938 1.00 63.86  ? 3   ARG A CZ    1 
ATOM   26   N NH1   . ARG A 1 3   ? -14.043 7.588   21.067 1.00 63.86  ? 3   ARG A NH1   1 
ATOM   27   N NH2   . ARG A 1 3   ? -15.774 9.046   21.513 1.00 63.86  ? 3   ARG A NH2   1 
ATOM   28   N N     . TYR A 1 4   ? -10.656 7.725   28.085 1.00 25.74  ? 4   TYR A N     1 
ATOM   29   C CA    . TYR A 1 4   ? -10.616 8.570   29.259 1.00 25.74  ? 4   TYR A CA    1 
ATOM   30   C C     . TYR A 1 4   ? -9.297  8.352   29.960 1.00 25.74  ? 4   TYR A C     1 
ATOM   31   O O     . TYR A 1 4   ? -8.833  7.227   30.073 1.00 25.74  ? 4   TYR A O     1 
ATOM   32   C CB    . TYR A 1 4   ? -11.752 8.218   30.202 1.00 34.99  ? 4   TYR A CB    1 
ATOM   33   C CG    . TYR A 1 4   ? -11.835 9.079   31.435 1.00 34.99  ? 4   TYR A CG    1 
ATOM   34   C CD1   . TYR A 1 4   ? -12.261 10.383  31.355 1.00 34.99  ? 4   TYR A CD1   1 
ATOM   35   C CD2   . TYR A 1 4   ? -11.547 8.562   32.684 1.00 34.99  ? 4   TYR A CD2   1 
ATOM   36   C CE1   . TYR A 1 4   ? -12.412 11.149  32.493 1.00 34.99  ? 4   TYR A CE1   1 
ATOM   37   C CE2   . TYR A 1 4   ? -11.687 9.312   33.821 1.00 34.99  ? 4   TYR A CE2   1 
ATOM   38   C CZ    . TYR A 1 4   ? -12.124 10.604  33.728 1.00 34.99  ? 4   TYR A CZ    1 
ATOM   39   O OH    . TYR A 1 4   ? -12.310 11.365  34.866 1.00 34.99  ? 4   TYR A OH    1 
ATOM   40   N N     . LEU A 1 5   ? -8.687  9.434   30.419 1.00 56.05  ? 5   LEU A N     1 
ATOM   41   C CA    . LEU A 1 5   ? -7.420  9.346   31.114 1.00 56.05  ? 5   LEU A CA    1 
ATOM   42   C C     . LEU A 1 5   ? -7.542  10.323  32.246 1.00 56.05  ? 5   LEU A C     1 
ATOM   43   O O     . LEU A 1 5   ? -7.882  11.485  32.040 1.00 56.05  ? 5   LEU A O     1 
ATOM   44   C CB    . LEU A 1 5   ? -6.272  9.741   30.190 1.00 14.23  ? 5   LEU A CB    1 
ATOM   45   C CG    . LEU A 1 5   ? -5.046  8.834   30.267 1.00 14.23  ? 5   LEU A CG    1 
ATOM   46   C CD1   . LEU A 1 5   ? -5.392  7.358   30.080 1.00 14.23  ? 5   LEU A CD1   1 
ATOM   47   C CD2   . LEU A 1 5   ? -4.125  9.264   29.190 1.00 14.23  ? 5   LEU A CD2   1 
ATOM   48   N N     . ARG A 1 6   ? -7.283  9.839   33.447 1.00 20.79  ? 6   ARG A N     1 
ATOM   49   C CA    . ARG A 1 6   ? -7.384  10.665  34.643 1.00 20.79  ? 6   ARG A CA    1 
ATOM   50   C C     . ARG A 1 6   ? -6.119  10.531  35.483 1.00 20.79  ? 6   ARG A C     1 
ATOM   51   O O     . ARG A 1 6   ? -5.816  9.464   36.025 1.00 20.79  ? 6   ARG A O     1 
ATOM   52   C CB    . ARG A 1 6   ? -8.612  10.248  35.447 1.00 59.13  ? 6   ARG A CB    1 
ATOM   53   C CG    . ARG A 1 6   ? -8.708  10.864  36.806 1.00 59.13  ? 6   ARG A CG    1 
ATOM   54   C CD    . ARG A 1 6   ? -9.483  9.939   37.703 1.00 59.13  ? 6   ARG A CD    1 
ATOM   55   N NE    . ARG A 1 6   ? -10.930 10.014  37.512 1.00 59.13  ? 6   ARG A NE    1 
ATOM   56   C CZ    . ARG A 1 6   ? -11.760 9.003   37.763 1.00 59.13  ? 6   ARG A CZ    1 
ATOM   57   N NH1   . ARG A 1 6   ? -11.270 7.847   38.197 1.00 59.13  ? 6   ARG A NH1   1 
ATOM   58   N NH2   . ARG A 1 6   ? -13.077 9.149   37.609 1.00 59.13  ? 6   ARG A NH2   1 
ATOM   59   N N     . GLY A 1 7   ? -5.378  11.629  35.568 1.00 39.71  ? 7   GLY A N     1 
ATOM   60   C CA    . GLY A 1 7   ? -4.138  11.634  36.314 1.00 39.71  ? 7   GLY A CA    1 
ATOM   61   C C     . GLY A 1 7   ? -3.549  13.024  36.407 1.00 39.71  ? 7   GLY A C     1 
ATOM   62   O O     . GLY A 1 7   ? -4.143  14.014  35.967 1.00 39.71  ? 7   GLY A O     1 
ATOM   63   N N     . LEU A 1 8   ? -2.356  13.082  36.978 1.00 27.84  ? 8   LEU A N     1 
ATOM   64   C CA    . LEU A 1 8   ? -1.637  14.328  37.200 1.00 27.84  ? 8   LEU A CA    1 
ATOM   65   C C     . LEU A 1 8   ? -1.089  14.984  35.951 1.00 27.84  ? 8   LEU A C     1 
ATOM   66   O O     . LEU A 1 8   ? -0.508  14.315  35.104 1.00 27.84  ? 8   LEU A O     1 
ATOM   67   C CB    . LEU A 1 8   ? -0.472  14.056  38.146 1.00 48.53  ? 8   LEU A CB    1 
ATOM   68   C CG    . LEU A 1 8   ? 0.403   15.224  38.576 1.00 48.53  ? 8   LEU A CG    1 
ATOM   69   C CD1   . LEU A 1 8   ? -0.426  16.225  39.354 1.00 48.53  ? 8   LEU A CD1   1 
ATOM   70   C CD2   . LEU A 1 8   ? 1.528   14.696  39.440 1.00 48.53  ? 8   LEU A CD2   1 
ATOM   71   N N     . VAL A 1 9   ? -1.274  16.294  35.834 1.00 26.69  ? 9   VAL A N     1 
ATOM   72   C CA    . VAL A 1 9   ? -0.731  17.009  34.692 1.00 26.69  ? 9   VAL A CA    1 
ATOM   73   C C     . VAL A 1 9   ? 0.730   17.296  35.036 1.00 26.69  ? 9   VAL A C     1 
ATOM   74   O O     . VAL A 1 9   ? 1.066   18.286  35.675 1.00 26.69  ? 9   VAL A O     1 
ATOM   75   C CB    . VAL A 1 9   ? -1.484  18.312  34.428 1.00 25.43  ? 9   VAL A CB    1 
ATOM   76   C CG1   . VAL A 1 9   ? -0.813  19.104  33.335 1.00 25.43  ? 9   VAL A CG1   1 
ATOM   77   C CG2   . VAL A 1 9   ? -2.866  17.986  33.982 1.00 25.43  ? 9   VAL A CG2   1 
ATOM   78   N N     . LEU A 1 10  ? 1.597   16.388  34.617 1.00 24.31  ? 10  LEU A N     1 
ATOM   79   C CA    . LEU A 1 10  ? 3.008   16.502  34.880 1.00 24.31  ? 10  LEU A CA    1 
ATOM   80   C C     . LEU A 1 10  ? 3.588   17.730  34.244 1.00 24.31  ? 10  LEU A C     1 
ATOM   81   O O     . LEU A 1 10  ? 4.503   18.281  34.788 1.00 24.31  ? 10  LEU A O     1 
ATOM   82   C CB    . LEU A 1 10  ? 3.733   15.265  34.381 1.00 13.82  ? 10  LEU A CB    1 
ATOM   83   C CG    . LEU A 1 10  ? 5.097   15.041  35.012 1.00 13.82  ? 10  LEU A CG    1 
ATOM   84   C CD1   . LEU A 1 10  ? 5.039   13.933  36.037 1.00 13.82  ? 10  LEU A CD1   1 
ATOM   85   C CD2   . LEU A 1 10  ? 6.078   14.665  33.899 1.00 13.82  ? 10  LEU A CD2   1 
ATOM   86   N N     . LYS A 1 11  ? 3.095   18.178  33.101 1.00 20.78  ? 11  LYS A N     1 
ATOM   87   C CA    . LYS A 1 11  ? 3.676   19.396  32.540 1.00 20.78  ? 11  LYS A CA    1 
ATOM   88   C C     . LYS A 1 11  ? 2.959   20.034  31.350 1.00 20.78  ? 11  LYS A C     1 
ATOM   89   O O     . LYS A 1 11  ? 3.040   19.509  30.248 1.00 20.78  ? 11  LYS A O     1 
ATOM   90   C CB    . LYS A 1 11  ? 5.143   19.145  32.175 1.00 72.29  ? 11  LYS A CB    1 
ATOM   91   C CG    . LYS A 1 11  ? 5.877   20.359  31.631 1.00 72.29  ? 11  LYS A CG    1 
ATOM   92   C CD    . LYS A 1 11  ? 7.388   20.264  31.882 1.00 72.29  ? 11  LYS A CD    1 
ATOM   93   C CE    . LYS A 1 11  ? 8.123   21.551  31.458 1.00 72.29  ? 11  LYS A CE    1 
ATOM   94   N NZ    . LYS A 1 11  ? 9.442   21.777  32.156 1.00 72.29  ? 11  LYS A NZ    1 
ATOM   95   N N     . LYS A 1 12  ? 2.261   21.157  31.557 1.00 31.88  ? 12  LYS A N     1 
ATOM   96   C CA    . LYS A 1 12  ? 1.592   21.831  30.444 1.00 31.88  ? 12  LYS A CA    1 
ATOM   97   C C     . LYS A 1 12  ? 2.716   22.202  29.511 1.00 31.88  ? 12  LYS A C     1 
ATOM   98   O O     . LYS A 1 12  ? 3.853   22.194  29.942 1.00 31.88  ? 12  LYS A O     1 
ATOM   99   C CB    . LYS A 1 12  ? 0.923   23.110  30.896 1.00 34.25  ? 12  LYS A CB    1 
ATOM   100  C CG    . LYS A 1 12  ? -0.311  22.907  31.700 1.00 34.25  ? 12  LYS A CG    1 
ATOM   101  C CD    . LYS A 1 12  ? -1.394  23.872  31.262 1.00 34.25  ? 12  LYS A CD    1 
ATOM   102  C CE    . LYS A 1 12  ? -0.990  25.308  31.490 1.00 34.25  ? 12  LYS A CE    1 
ATOM   103  N NZ    . LYS A 1 12  ? -1.882  26.232  30.737 1.00 34.25  ? 12  LYS A NZ    1 
ATOM   104  N N     . GLU A 1 13  ? 2.465   22.537  28.252 1.00 70.58  ? 13  GLU A N     1 
ATOM   105  C CA    . GLU A 1 13  ? 3.635   22.871  27.476 1.00 70.58  ? 13  GLU A CA    1 
ATOM   106  C C     . GLU A 1 13  ? 3.585   23.661  26.184 1.00 70.58  ? 13  GLU A C     1 
ATOM   107  O O     . GLU A 1 13  ? 4.552   24.375  25.889 1.00 70.58  ? 13  GLU A O     1 
ATOM   108  C CB    . GLU A 1 13  ? 4.448   21.614  27.242 1.00 35.12  ? 13  GLU A CB    1 
ATOM   109  C CG    . GLU A 1 13  ? 4.063   20.849  26.016 1.00 35.12  ? 13  GLU A CG    1 
ATOM   110  C CD    . GLU A 1 13  ? 5.277   20.257  25.348 1.00 35.12  ? 13  GLU A CD    1 
ATOM   111  O OE1   . GLU A 1 13  ? 6.136   19.759  26.108 1.00 35.12  ? 13  GLU A OE1   1 
ATOM   112  O OE2   . GLU A 1 13  ? 5.369   20.288  24.092 1.00 35.12  ? 13  GLU A OE2   1 
ATOM   113  N N     . ALA A 1 14  ? 2.521   23.567  25.394 1.00 72.24  ? 14  ALA A N     1 
ATOM   114  C CA    . ALA A 1 14  ? 2.521   24.355  24.156 1.00 72.24  ? 14  ALA A CA    1 
ATOM   115  C C     . ALA A 1 14  ? 1.272   24.187  23.329 1.00 72.24  ? 14  ALA A C     1 
ATOM   116  O O     . ALA A 1 14  ? 0.556   25.153  23.048 1.00 72.24  ? 14  ALA A O     1 
ATOM   117  C CB    . ALA A 1 14  ? 3.744   23.996  23.307 1.00 168.17 ? 14  ALA A CB    1 
ATOM   118  N N     . GLY A 1 15  ? 1.051   22.946  22.910 1.00 75.26  ? 15  GLY A N     1 
ATOM   119  C CA    . GLY A 1 15  ? -0.112  22.601  22.118 1.00 75.26  ? 15  GLY A CA    1 
ATOM   120  C C     . GLY A 1 15  ? -0.612  21.338  22.762 1.00 75.26  ? 15  GLY A C     1 
ATOM   121  O O     . GLY A 1 15  ? -1.625  20.768  22.367 1.00 75.26  ? 15  GLY A O     1 
ATOM   122  N N     . GLY A 1 16  ? 0.143   20.911  23.771 1.00 28.97  ? 16  GLY A N     1 
ATOM   123  C CA    . GLY A 1 16  ? -0.195  19.718  24.522 1.00 28.97  ? 16  GLY A CA    1 
ATOM   124  C C     . GLY A 1 16  ? 0.204   19.812  25.987 1.00 28.97  ? 16  GLY A C     1 
ATOM   125  O O     . GLY A 1 16  ? 0.442   20.894  26.508 1.00 28.97  ? 16  GLY A O     1 
ATOM   126  N N     . PHE A 1 17  ? 0.265   18.665  26.647 1.00 35.05  ? 17  PHE A N     1 
ATOM   127  C CA    . PHE A 1 17  ? 0.648   18.583  28.043 1.00 35.05  ? 17  PHE A CA    1 
ATOM   128  C C     . PHE A 1 17  ? 0.942   17.137  28.391 1.00 35.05  ? 17  PHE A C     1 
ATOM   129  O O     . PHE A 1 17  ? 0.576   16.227  27.646 1.00 35.05  ? 17  PHE A O     1 
ATOM   130  C CB    . PHE A 1 17  ? -0.471  19.118  28.917 1.00 26.52  ? 17  PHE A CB    1 
ATOM   131  C CG    . PHE A 1 17  ? -1.702  18.235  28.987 1.00 26.52  ? 17  PHE A CG    1 
ATOM   132  C CD1   . PHE A 1 17  ? -1.752  17.139  29.855 1.00 26.52  ? 17  PHE A CD1   1 
ATOM   133  C CD2   . PHE A 1 17  ? -2.863  18.574  28.286 1.00 26.52  ? 17  PHE A CD2   1 
ATOM   134  C CE1   . PHE A 1 17  ? -2.947  16.398  30.039 1.00 26.52  ? 17  PHE A CE1   1 
ATOM   135  C CE2   . PHE A 1 17  ? -4.056  17.833  28.471 1.00 26.52  ? 17  PHE A CE2   1 
ATOM   136  C CZ    . PHE A 1 17  ? -4.086  16.747  29.353 1.00 26.52  ? 17  PHE A CZ    1 
ATOM   137  N N     . VAL A 1 18  ? 1.614   16.911  29.506 1.00 15.49  ? 18  VAL A N     1 
ATOM   138  C CA    . VAL A 1 18  ? 1.895   15.539  29.872 1.00 15.49  ? 18  VAL A CA    1 
ATOM   139  C C     . VAL A 1 18  ? 1.084   15.101  31.069 1.00 15.49  ? 18  VAL A C     1 
ATOM   140  O O     . VAL A 1 18  ? 1.096   15.736  32.104 1.00 15.49  ? 18  VAL A O     1 
ATOM   141  C CB    . VAL A 1 18  ? 3.358   15.305  30.185 1.00 3.22   ? 18  VAL A CB    1 
ATOM   142  C CG1   . VAL A 1 18  ? 3.531   13.900  30.770 1.00 3.22   ? 18  VAL A CG1   1 
ATOM   143  C CG2   . VAL A 1 18  ? 4.160   15.431  28.941 1.00 3.22   ? 18  VAL A CG2   1 
ATOM   144  N N     . LEU A 1 19  ? 0.385   13.994  30.929 1.00 12.80  ? 19  LEU A N     1 
ATOM   145  C CA    . LEU A 1 19  ? -0.438  13.524  32.006 1.00 12.80  ? 19  LEU A CA    1 
ATOM   146  C C     . LEU A 1 19  ? 0.118   12.222  32.527 1.00 12.80  ? 19  LEU A C     1 
ATOM   147  O O     . LEU A 1 19  ? 0.400   11.292  31.770 1.00 12.80  ? 19  LEU A O     1 
ATOM   148  C CB    . LEU A 1 19  ? -1.864  13.351  31.510 1.00 26.95  ? 19  LEU A CB    1 
ATOM   149  C CG    . LEU A 1 19  ? -2.849  12.865  32.556 1.00 26.95  ? 19  LEU A CG    1 
ATOM   150  C CD1   . LEU A 1 19  ? -4.257  13.166  32.088 1.00 26.95  ? 19  LEU A CD1   1 
ATOM   151  C CD2   . LEU A 1 19  ? -2.646  11.380  32.802 1.00 26.95  ? 19  LEU A CD2   1 
ATOM   152  N N     . LEU A 1 20  ? 0.272   12.167  33.839 1.00 49.48  ? 20  LEU A N     1 
ATOM   153  C CA    . LEU A 1 20  ? 0.817   11.000  34.490 1.00 49.48  ? 20  LEU A CA    1 
ATOM   154  C C     . LEU A 1 20  ? -0.302  10.043  34.815 1.00 49.48  ? 20  LEU A C     1 
ATOM   155  O O     . LEU A 1 20  ? -1.238  10.399  35.535 1.00 49.48  ? 20  LEU A O     1 
ATOM   156  C CB    . LEU A 1 20  ? 1.507   11.410  35.769 1.00 17.96  ? 20  LEU A CB    1 
ATOM   157  C CG    . LEU A 1 20  ? 2.545   10.396  36.188 1.00 17.96  ? 20  LEU A CG    1 
ATOM   158  C CD1   . LEU A 1 20  ? 3.754   10.504  35.254 1.00 17.96  ? 20  LEU A CD1   1 
ATOM   159  C CD2   . LEU A 1 20  ? 2.934   10.643  37.642 1.00 17.96  ? 20  LEU A CD2   1 
ATOM   160  N N     . ALA A 1 21  ? -0.201  8.824   34.299 1.00 45.30  ? 21  ALA A N     1 
ATOM   161  C CA    . ALA A 1 21  ? -1.236  7.840   34.536 1.00 45.30  ? 21  ALA A CA    1 
ATOM   162  C C     . ALA A 1 21  ? -0.702  6.540   35.110 1.00 45.30  ? 21  ALA A C     1 
ATOM   163  O O     . ALA A 1 21  ? -0.751  5.483   34.471 1.00 45.30  ? 21  ALA A O     1 
ATOM   164  C CB    . ALA A 1 21  ? -1.966  7.588   33.270 1.00 1.00   ? 21  ALA A CB    1 
ATOM   165  N N     . GLY A 1 22  ? -0.210  6.630   36.340 1.00 46.98  ? 22  GLY A N     1 
ATOM   166  C CA    . GLY A 1 22  ? 0.336   5.471   37.013 1.00 46.98  ? 22  GLY A CA    1 
ATOM   167  C C     . GLY A 1 22  ? 1.656   5.027   36.419 1.00 46.98  ? 22  GLY A C     1 
ATOM   168  O O     . GLY A 1 22  ? 1.702   4.026   35.694 1.00 46.98  ? 22  GLY A O     1 
ATOM   169  N N     . GLY A 1 23  ? 2.711   5.793   36.718 1.00 95.57  ? 23  GLY A N     1 
ATOM   170  C CA    . GLY A 1 23  ? 4.064   5.509   36.250 1.00 95.57  ? 23  GLY A CA    1 
ATOM   171  C C     . GLY A 1 23  ? 4.360   5.710   34.773 1.00 95.57  ? 23  GLY A C     1 
ATOM   172  O O     . GLY A 1 23  ? 5.442   5.350   34.294 1.00 95.57  ? 23  GLY A O     1 
ATOM   173  N N     . VAL A 1 24  ? 3.414   6.304   34.054 1.00 57.81  ? 24  VAL A N     1 
ATOM   174  C CA    . VAL A 1 24  ? 3.571   6.518   32.623 1.00 57.81  ? 24  VAL A CA    1 
ATOM   175  C C     . VAL A 1 24  ? 3.116   7.887   32.149 1.00 57.81  ? 24  VAL A C     1 
ATOM   176  O O     . VAL A 1 24  ? 1.940   8.240   32.276 1.00 57.81  ? 24  VAL A O     1 
ATOM   177  C CB    . VAL A 1 24  ? 2.794   5.448   31.844 1.00 14.10  ? 24  VAL A CB    1 
ATOM   178  C CG1   . VAL A 1 24  ? 2.775   5.767   30.357 1.00 14.10  ? 24  VAL A CG1   1 
ATOM   179  C CG2   . VAL A 1 24  ? 3.400   4.085   32.136 1.00 14.10  ? 24  VAL A CG2   1 
ATOM   180  N N     . GLY A 1 25  ? 4.065   8.645   31.600 1.00 24.01  ? 25  GLY A N     1 
ATOM   181  C CA    . GLY A 1 25  ? 3.772   9.965   31.079 1.00 24.01  ? 25  GLY A CA    1 
ATOM   182  C C     . GLY A 1 25  ? 3.080   9.960   29.717 1.00 24.01  ? 25  GLY A C     1 
ATOM   183  O O     . GLY A 1 25  ? 3.699   9.686   28.674 1.00 24.01  ? 25  GLY A O     1 
ATOM   184  N N     . PHE A 1 26  ? 1.786   10.240  29.711 1.00 12.66  ? 26  PHE A N     1 
ATOM   185  C CA    . PHE A 1 26  ? 1.068   10.301  28.455 1.00 12.66  ? 26  PHE A CA    1 
ATOM   186  C C     . PHE A 1 26  ? 1.122   11.736  27.890 1.00 12.66  ? 26  PHE A C     1 
ATOM   187  O O     . PHE A 1 26  ? 1.033   12.691  28.650 1.00 12.66  ? 26  PHE A O     1 
ATOM   188  C CB    . PHE A 1 26  ? -0.383  9.908   28.675 1.00 19.90  ? 26  PHE A CB    1 
ATOM   189  C CG    . PHE A 1 26  ? -0.605  8.448   28.751 1.00 19.90  ? 26  PHE A CG    1 
ATOM   190  C CD1   . PHE A 1 26  ? -0.263  7.632   27.699 1.00 19.90  ? 26  PHE A CD1   1 
ATOM   191  C CD2   . PHE A 1 26  ? -1.161  7.879   29.878 1.00 19.90  ? 26  PHE A CD2   1 
ATOM   192  C CE1   . PHE A 1 26  ? -0.465  6.260   27.770 1.00 19.90  ? 26  PHE A CE1   1 
ATOM   193  C CE2   . PHE A 1 26  ? -1.371  6.502   29.958 1.00 19.90  ? 26  PHE A CE2   1 
ATOM   194  C CZ    . PHE A 1 26  ? -1.020  5.696   28.905 1.00 19.90  ? 26  PHE A CZ    1 
ATOM   195  N N     . PHE A 1 27  ? 1.285   11.910  26.582 1.00 19.72  ? 27  PHE A N     1 
ATOM   196  C CA    . PHE A 1 27  ? 1.274   13.273  26.073 1.00 19.72  ? 27  PHE A CA    1 
ATOM   197  C C     . PHE A 1 27  ? 0.104   13.600  25.158 1.00 19.72  ? 27  PHE A C     1 
ATOM   198  O O     . PHE A 1 27  ? -0.019  13.030  24.067 1.00 19.72  ? 27  PHE A O     1 
ATOM   199  C CB    . PHE A 1 27  ? 2.529   13.619  25.305 1.00 11.68  ? 27  PHE A CB    1 
ATOM   200  C CG    . PHE A 1 27  ? 2.423   14.944  24.596 1.00 11.68  ? 27  PHE A CG    1 
ATOM   201  C CD1   . PHE A 1 27  ? 2.278   16.117  25.322 1.00 11.68  ? 27  PHE A CD1   1 
ATOM   202  C CD2   . PHE A 1 27  ? 2.402   15.010  23.210 1.00 11.68  ? 27  PHE A CD2   1 
ATOM   203  C CE1   . PHE A 1 27  ? 2.115   17.332  24.669 1.00 11.68  ? 27  PHE A CE1   1 
ATOM   204  C CE2   . PHE A 1 27  ? 2.240   16.217  22.548 1.00 11.68  ? 27  PHE A CE2   1 
ATOM   205  C CZ    . PHE A 1 27  ? 2.096   17.373  23.273 1.00 11.68  ? 27  PHE A CZ    1 
ATOM   206  N N     . LEU A 1 28  ? -0.707  14.570  25.551 1.00 13.86  ? 28  LEU A N     1 
ATOM   207  C CA    . LEU A 1 28  ? -1.845  14.881  24.727 1.00 13.86  ? 28  LEU A CA    1 
ATOM   208  C C     . LEU A 1 28  ? -1.859  16.282  24.181 1.00 13.86  ? 28  LEU A C     1 
ATOM   209  O O     . LEU A 1 28  ? -1.479  17.221  24.872 1.00 13.86  ? 28  LEU A O     1 
ATOM   210  C CB    . LEU A 1 28  ? -3.133  14.662  25.516 1.00 19.69  ? 28  LEU A CB    1 
ATOM   211  C CG    . LEU A 1 28  ? -3.338  13.286  26.160 1.00 19.69  ? 28  LEU A CG    1 
ATOM   212  C CD1   . LEU A 1 28  ? -2.290  13.007  27.254 1.00 19.69  ? 28  LEU A CD1   1 
ATOM   213  C CD2   . LEU A 1 28  ? -4.729  13.223  26.717 1.00 19.69  ? 28  LEU A CD2   1 
ATOM   214  N N     . GLN A 1 29  ? -2.283  16.412  22.925 1.00 14.79  ? 29  GLN A N     1 
ATOM   215  C CA    . GLN A 1 29  ? -2.440  17.704  22.281 1.00 14.79  ? 29  GLN A CA    1 
ATOM   216  C C     . GLN A 1 29  ? -3.872  17.974  22.753 1.00 14.79  ? 29  GLN A C     1 
ATOM   217  O O     . GLN A 1 29  ? -4.554  17.022  23.122 1.00 14.79  ? 29  GLN A O     1 
ATOM   218  C CB    . GLN A 1 29  ? -2.428  17.554  20.760 1.00 27.46  ? 29  GLN A CB    1 
ATOM   219  C CG    . GLN A 1 29  ? -1.080  17.304  20.089 1.00 27.46  ? 29  GLN A CG    1 
ATOM   220  C CD    . GLN A 1 29  ? -1.230  16.990  18.595 1.00 27.46  ? 29  GLN A CD    1 
ATOM   221  O OE1   . GLN A 1 29  ? -1.428  17.880  17.752 1.00 27.46  ? 29  GLN A OE1   1 
ATOM   222  N NE2   . GLN A 1 29  ? -1.155  15.709  18.269 1.00 27.46  ? 29  GLN A NE2   1 
ATOM   223  N N     . ALA A 1 30  ? -4.336  19.225  22.757 1.00 24.79  ? 30  ALA A N     1 
ATOM   224  C CA    . ALA A 1 30  ? -5.696  19.544  23.223 1.00 24.79  ? 30  ALA A CA    1 
ATOM   225  C C     . ALA A 1 30  ? -5.998  20.958  22.850 1.00 24.79  ? 30  ALA A C     1 
ATOM   226  O O     . ALA A 1 30  ? -5.088  21.695  22.574 1.00 24.79  ? 30  ALA A O     1 
ATOM   227  C CB    . ALA A 1 30  ? -5.787  19.406  24.729 1.00 7.46   ? 30  ALA A CB    1 
ATOM   228  N N     . PRO A 1 31  ? -7.273  21.366  22.856 1.00 24.46  ? 31  PRO A N     1 
ATOM   229  C CA    . PRO A 1 31  ? -7.692  22.729  22.507 1.00 24.46  ? 31  PRO A CA    1 
ATOM   230  C C     . PRO A 1 31  ? -7.084  23.821  23.380 1.00 24.46  ? 31  PRO A C     1 
ATOM   231  O O     . PRO A 1 31  ? -7.127  23.742  24.624 1.00 24.46  ? 31  PRO A O     1 
ATOM   232  C CB    . PRO A 1 31  ? -9.203  22.675  22.658 1.00 46.65  ? 31  PRO A CB    1 
ATOM   233  C CG    . PRO A 1 31  ? -9.507  21.300  22.300 1.00 46.65  ? 31  PRO A CG    1 
ATOM   234  C CD    . PRO A 1 31  ? -8.453  20.519  23.044 1.00 46.65  ? 31  PRO A CD    1 
ATOM   235  N N     . THR A 1 32  ? -6.532  24.837  22.710 1.00 25.23  ? 32  THR A N     1 
ATOM   236  C CA    . THR A 1 32  ? -5.891  25.975  23.356 1.00 25.23  ? 32  THR A CA    1 
ATOM   237  C C     . THR A 1 32  ? -6.657  26.386  24.597 1.00 25.23  ? 32  THR A C     1 
ATOM   238  O O     . THR A 1 32  ? -6.117  26.405  25.694 1.00 25.23  ? 32  THR A O     1 
ATOM   239  C CB    . THR A 1 32  ? -5.838  27.156  22.431 1.00 36.10  ? 32  THR A CB    1 
ATOM   240  O OG1   . THR A 1 32  ? -5.514  26.714  21.117 1.00 36.10  ? 32  THR A OG1   1 
ATOM   241  C CG2   . THR A 1 32  ? -4.798  28.094  22.880 1.00 36.10  ? 32  THR A CG2   1 
ATOM   242  N N     . PRO A 1 33  ? -7.927  26.747  24.442 1.00 20.56  ? 33  PRO A N     1 
ATOM   243  C CA    . PRO A 1 33  ? -8.666  27.129  25.633 1.00 20.56  ? 33  PRO A CA    1 
ATOM   244  C C     . PRO A 1 33  ? -8.391  26.108  26.718 1.00 20.56  ? 33  PRO A C     1 
ATOM   245  O O     . PRO A 1 33  ? -7.637  26.371  27.662 1.00 20.56  ? 33  PRO A O     1 
ATOM   246  C CB    . PRO A 1 33  ? -10.093 27.078  25.159 1.00 33.06  ? 33  PRO A CB    1 
ATOM   247  C CG    . PRO A 1 33  ? -9.946  27.619  23.771 1.00 33.06  ? 33  PRO A CG    1 
ATOM   248  C CD    . PRO A 1 33  ? -8.763  26.878  23.243 1.00 33.06  ? 33  PRO A CD    1 
ATOM   249  N N     . PHE A 1 34  ? -8.984  24.929  26.575 1.00 23.68  ? 34  PHE A N     1 
ATOM   250  C CA    . PHE A 1 34  ? -8.776  23.900  27.570 1.00 23.68  ? 34  PHE A CA    1 
ATOM   251  C C     . PHE A 1 34  ? -7.362  23.987  28.013 1.00 23.68  ? 34  PHE A C     1 
ATOM   252  O O     . PHE A 1 34  ? -7.078  24.137  29.198 1.00 23.68  ? 34  PHE A O     1 
ATOM   253  C CB    . PHE A 1 34  ? -8.986  22.517  27.006 1.00 29.48  ? 34  PHE A CB    1 
ATOM   254  C CG    . PHE A 1 34  ? -8.712  21.434  27.990 1.00 29.48  ? 34  PHE A CG    1 
ATOM   255  C CD1   . PHE A 1 34  ? -7.566  20.678  27.907 1.00 29.48  ? 34  PHE A CD1   1 
ATOM   256  C CD2   . PHE A 1 34  ? -9.582  21.192  29.023 1.00 29.48  ? 34  PHE A CD2   1 
ATOM   257  C CE1   . PHE A 1 34  ? -7.290  19.693  28.849 1.00 29.48  ? 34  PHE A CE1   1 
ATOM   258  C CE2   . PHE A 1 34  ? -9.308  20.211  29.963 1.00 29.48  ? 34  PHE A CE2   1 
ATOM   259  C CZ    . PHE A 1 34  ? -8.164  19.465  29.877 1.00 29.48  ? 34  PHE A CZ    1 
ATOM   260  N N     . LEU A 1 35  ? -6.469  23.921  27.043 1.00 23.61  ? 35  LEU A N     1 
ATOM   261  C CA    . LEU A 1 35  ? -5.059  23.966  27.361 1.00 23.61  ? 35  LEU A CA    1 
ATOM   262  C C     . LEU A 1 35  ? -4.675  24.988  28.424 1.00 23.61  ? 35  LEU A C     1 
ATOM   263  O O     . LEU A 1 35  ? -4.059  24.626  29.422 1.00 23.61  ? 35  LEU A O     1 
ATOM   264  C CB    . LEU A 1 35  ? -4.225  24.187  26.101 1.00 1.00   ? 35  LEU A CB    1 
ATOM   265  C CG    . LEU A 1 35  ? -3.421  22.978  25.681 1.00 1.00   ? 35  LEU A CG    1 
ATOM   266  C CD1   . LEU A 1 35  ? -2.238  23.392  24.874 1.00 1.00   ? 35  LEU A CD1   1 
ATOM   267  C CD2   . LEU A 1 35  ? -2.955  22.293  26.920 1.00 1.00   ? 35  LEU A CD2   1 
ATOM   268  N N     . GLN A 1 36  ? -5.036  26.252  28.223 1.00 32.94  ? 36  GLN A N     1 
ATOM   269  C CA    . GLN A 1 36  ? -4.705  27.298  29.189 1.00 32.94  ? 36  GLN A CA    1 
ATOM   270  C C     . GLN A 1 36  ? -5.443  27.080  30.521 1.00 32.94  ? 36  GLN A C     1 
ATOM   271  O O     . GLN A 1 36  ? -4.838  27.106  31.602 1.00 32.94  ? 36  GLN A O     1 
ATOM   272  C CB    . GLN A 1 36  ? -5.045  28.661  28.590 1.00 71.41  ? 36  GLN A CB    1 
ATOM   273  C CG    . GLN A 1 36  ? -4.399  28.856  27.228 1.00 71.41  ? 36  GLN A CG    1 
ATOM   274  C CD    . GLN A 1 36  ? -4.621  30.235  26.643 1.00 71.41  ? 36  GLN A CD    1 
ATOM   275  O OE1   . GLN A 1 36  ? -4.118  30.549  25.565 1.00 71.41  ? 36  GLN A OE1   1 
ATOM   276  N NE2   . GLN A 1 36  ? -5.377  31.067  27.349 1.00 71.41  ? 36  GLN A NE2   1 
ATOM   277  N N     . ALA A 1 37  ? -6.749  26.846  30.439 1.00 21.31  ? 37  ALA A N     1 
ATOM   278  C CA    . ALA A 1 37  ? -7.533  26.606  31.634 1.00 21.31  ? 37  ALA A CA    1 
ATOM   279  C C     . ALA A 1 37  ? -6.783  25.620  32.503 1.00 21.31  ? 37  ALA A C     1 
ATOM   280  O O     . ALA A 1 37  ? -6.545  25.870  33.676 1.00 21.31  ? 37  ALA A O     1 
ATOM   281  C CB    . ALA A 1 37  ? -8.892  26.042  31.256 1.00 200.00 ? 37  ALA A CB    1 
ATOM   282  N N     . LEU A 1 38  ? -6.400  24.505  31.894 1.00 36.48  ? 38  LEU A N     1 
ATOM   283  C CA    . LEU A 1 38  ? -5.657  23.431  32.556 1.00 36.48  ? 38  LEU A CA    1 
ATOM   284  C C     . LEU A 1 38  ? -4.563  23.875  33.534 1.00 36.48  ? 38  LEU A C     1 
ATOM   285  O O     . LEU A 1 38  ? -3.600  24.527  33.119 1.00 36.48  ? 38  LEU A O     1 
ATOM   286  C CB    . LEU A 1 38  ? -5.021  22.528  31.490 1.00 73.66  ? 38  LEU A CB    1 
ATOM   287  C CG    . LEU A 1 38  ? -4.170  21.354  31.983 1.00 73.66  ? 38  LEU A CG    1 
ATOM   288  C CD1   . LEU A 1 38  ? -5.041  20.390  32.766 1.00 73.66  ? 38  LEU A CD1   1 
ATOM   289  C CD2   . LEU A 1 38  ? -3.555  20.635  30.813 1.00 73.66  ? 38  LEU A CD2   1 
ATOM   290  N N     . GLU A 1 39  ? -4.696  23.521  34.818 1.00 35.71  ? 39  GLU A N     1 
ATOM   291  C CA    . GLU A 1 39  ? -3.650  23.896  35.776 1.00 35.71  ? 39  GLU A CA    1 
ATOM   292  C C     . GLU A 1 39  ? -2.703  22.731  36.116 1.00 35.71  ? 39  GLU A C     1 
ATOM   293  O O     . GLU A 1 39  ? -3.109  21.733  36.706 1.00 35.71  ? 39  GLU A O     1 
ATOM   294  C CB    . GLU A 1 39  ? -4.246  24.544  37.048 1.00 78.57  ? 39  GLU A CB    1 
ATOM   295  C CG    . GLU A 1 39  ? -5.126  23.692  37.958 1.00 78.57  ? 39  GLU A CG    1 
ATOM   296  C CD    . GLU A 1 39  ? -5.709  24.501  39.140 1.00 78.57  ? 39  GLU A CD    1 
ATOM   297  O OE1   . GLU A 1 39  ? -4.950  25.233  39.815 1.00 78.57  ? 39  GLU A OE1   1 
ATOM   298  O OE2   . GLU A 1 39  ? -6.929  24.403  39.403 1.00 78.57  ? 39  GLU A OE2   1 
ATOM   299  N N     . GLU A 1 40  ? -1.435  22.874  35.722 1.00 28.36  ? 40  GLU A N     1 
ATOM   300  C CA    . GLU A 1 40  ? -0.442  21.830  35.928 1.00 28.36  ? 40  GLU A CA    1 
ATOM   301  C C     . GLU A 1 40  ? -0.015  21.627  37.349 1.00 28.36  ? 40  GLU A C     1 
ATOM   302  O O     . GLU A 1 40  ? 0.096   22.571  38.109 1.00 28.36  ? 40  GLU A O     1 
ATOM   303  C CB    . GLU A 1 40  ? 0.802   22.080  35.075 1.00 56.89  ? 40  GLU A CB    1 
ATOM   304  C CG    . GLU A 1 40  ? 1.509   23.391  35.291 1.00 56.89  ? 40  GLU A CG    1 
ATOM   305  C CD    . GLU A 1 40  ? 2.749   23.512  34.411 1.00 56.89  ? 40  GLU A CD    1 
ATOM   306  O OE1   . GLU A 1 40  ? 2.736   23.020  33.257 1.00 56.89  ? 40  GLU A OE1   1 
ATOM   307  O OE2   . GLU A 1 40  ? 3.743   24.112  34.864 1.00 56.89  ? 40  GLU A OE2   1 
ATOM   308  N N     . GLY A 1 41  ? 0.234   20.374  37.701 1.00 40.04  ? 41  GLY A N     1 
ATOM   309  C CA    . GLY A 1 41  ? 0.657   20.055  39.044 1.00 40.04  ? 41  GLY A CA    1 
ATOM   310  C C     . GLY A 1 41  ? -0.477  19.385  39.781 1.00 40.04  ? 41  GLY A C     1 
ATOM   311  O O     . GLY A 1 41  ? -0.269  18.787  40.831 1.00 40.04  ? 41  GLY A O     1 
ATOM   312  N N     . LYS A 1 42  ? -1.684  19.469  39.237 1.00 60.63  ? 42  LYS A N     1 
ATOM   313  C CA    . LYS A 1 42  ? -2.818  18.853  39.902 1.00 60.63  ? 42  LYS A CA    1 
ATOM   314  C C     . LYS A 1 42  ? -3.448  17.720  39.094 1.00 60.63  ? 42  LYS A C     1 
ATOM   315  O O     . LYS A 1 42  ? -2.911  17.298  38.065 1.00 60.63  ? 42  LYS A O     1 
ATOM   316  C CB    . LYS A 1 42  ? -3.855  19.918  40.242 1.00 74.23  ? 42  LYS A CB    1 
ATOM   317  C CG    . LYS A 1 42  ? -3.337  20.970  41.219 1.00 74.23  ? 42  LYS A CG    1 
ATOM   318  C CD    . LYS A 1 42  ? -4.436  21.936  41.627 1.00 74.23  ? 42  LYS A CD    1 
ATOM   319  C CE    . LYS A 1 42  ? -3.956  22.971  42.638 1.00 74.23  ? 42  LYS A CE    1 
ATOM   320  N NZ    . LYS A 1 42  ? -5.055  23.933  42.992 1.00 74.23  ? 42  LYS A NZ    1 
ATOM   321  N N     . GLU A 1 43  ? -4.575  17.206  39.573 1.00 58.39  ? 43  GLU A N     1 
ATOM   322  C CA    . GLU A 1 43  ? -5.233  16.118  38.875 1.00 58.39  ? 43  GLU A CA    1 
ATOM   323  C C     . GLU A 1 43  ? -6.177  16.637  37.815 1.00 58.39  ? 43  GLU A C     1 
ATOM   324  O O     . GLU A 1 43  ? -6.500  17.826  37.776 1.00 58.39  ? 43  GLU A O     1 
ATOM   325  C CB    . GLU A 1 43  ? -6.009  15.216  39.833 1.00 63.10  ? 43  GLU A CB    1 
ATOM   326  C CG    . GLU A 1 43  ? -6.306  13.866  39.206 1.00 63.10  ? 43  GLU A CG    1 
ATOM   327  C CD    . GLU A 1 43  ? -7.255  13.015  40.013 1.00 63.10  ? 43  GLU A CD    1 
ATOM   328  O OE1   . GLU A 1 43  ? -8.468  13.341  40.016 1.00 63.10  ? 43  GLU A OE1   1 
ATOM   329  O OE2   . GLU A 1 43  ? -6.789  12.024  40.638 1.00 63.10  ? 43  GLU A OE2   1 
ATOM   330  N N     . VAL A 1 44  ? -6.608  15.717  36.960 1.00 37.31  ? 44  VAL A N     1 
ATOM   331  C CA    . VAL A 1 44  ? -7.510  16.010  35.857 1.00 37.31  ? 44  VAL A CA    1 
ATOM   332  C C     . VAL A 1 44  ? -7.852  14.727  35.135 1.00 37.31  ? 44  VAL A C     1 
ATOM   333  O O     . VAL A 1 44  ? -7.009  13.824  35.010 1.00 37.31  ? 44  VAL A O     1 
ATOM   334  C CB    . VAL A 1 44  ? -6.862  16.912  34.789 1.00 20.93  ? 44  VAL A CB    1 
ATOM   335  C CG1   . VAL A 1 44  ? -5.555  16.278  34.305 1.00 20.93  ? 44  VAL A CG1   1 
ATOM   336  C CG2   . VAL A 1 44  ? -7.814  17.079  33.598 1.00 20.93  ? 44  VAL A CG2   1 
ATOM   337  N N     . GLY A 1 45  ? -9.091  14.669  34.659 1.00 21.59  ? 45  GLY A N     1 
ATOM   338  C CA    . GLY A 1 45  ? -9.557  13.537  33.890 1.00 21.59  ? 45  GLY A CA    1 
ATOM   339  C C     . GLY A 1 45  ? -9.869  14.231  32.587 1.00 21.59  ? 45  GLY A C     1 
ATOM   340  O O     . GLY A 1 45  ? -10.227 15.407  32.606 1.00 21.59  ? 45  GLY A O     1 
ATOM   341  N N     . VAL A 1 46  ? -9.698  13.559  31.456 1.00 27.42  ? 46  VAL A N     1 
ATOM   342  C CA    . VAL A 1 46  ? -9.999  14.201  30.182 1.00 27.42  ? 46  VAL A CA    1 
ATOM   343  C C     . VAL A 1 46  ? -10.394 13.148  29.175 1.00 27.42  ? 46  VAL A C     1 
ATOM   344  O O     . VAL A 1 46  ? -9.645  12.217  28.924 1.00 27.42  ? 46  VAL A O     1 
ATOM   345  C CB    . VAL A 1 46  ? -8.777  15.019  29.639 1.00 20.90  ? 46  VAL A CB    1 
ATOM   346  C CG1   . VAL A 1 46  ? -7.677  15.066  30.658 1.00 20.90  ? 46  VAL A CG1   1 
ATOM   347  C CG2   . VAL A 1 46  ? -8.246  14.414  28.368 1.00 20.90  ? 46  VAL A CG2   1 
ATOM   348  N N     . HIS A 1 47  ? -11.581 13.288  28.609 1.00 22.59  ? 47  HIS A N     1 
ATOM   349  C CA    . HIS A 1 47  ? -12.055 12.332  27.622 1.00 22.59  ? 47  HIS A CA    1 
ATOM   350  C C     . HIS A 1 47  ? -11.173 12.524  26.416 1.00 22.59  ? 47  HIS A C     1 
ATOM   351  O O     . HIS A 1 47  ? -11.151 13.597  25.795 1.00 22.59  ? 47  HIS A O     1 
ATOM   352  C CB    . HIS A 1 47  ? -13.514 12.591  27.270 1.00 69.11  ? 47  HIS A CB    1 
ATOM   353  C CG    . HIS A 1 47  ? -14.368 12.861  28.463 1.00 69.11  ? 47  HIS A CG    1 
ATOM   354  N ND1   . HIS A 1 47  ? -14.444 14.103  29.054 1.00 69.11  ? 47  HIS A ND1   1 
ATOM   355  C CD2   . HIS A 1 47  ? -15.125 12.037  29.222 1.00 69.11  ? 47  HIS A CD2   1 
ATOM   356  C CE1   . HIS A 1 47  ? -15.209 14.035  30.127 1.00 69.11  ? 47  HIS A CE1   1 
ATOM   357  N NE2   . HIS A 1 47  ? -15.635 12.791  30.251 1.00 69.11  ? 47  HIS A NE2   1 
ATOM   358  N N     . THR A 1 48  ? -10.458 11.448  26.104 1.00 36.92  ? 48  THR A N     1 
ATOM   359  C CA    . THR A 1 48  ? -9.483  11.406  25.031 1.00 36.92  ? 48  THR A CA    1 
ATOM   360  C C     . THR A 1 48  ? -9.856  10.647  23.774 1.00 36.92  ? 48  THR A C     1 
ATOM   361  O O     . THR A 1 48  ? -10.899 10.014  23.683 1.00 36.92  ? 48  THR A O     1 
ATOM   362  C CB    . THR A 1 48  ? -8.226  10.758  25.512 1.00 40.54  ? 48  THR A CB    1 
ATOM   363  O OG1   . THR A 1 48  ? -8.414  9.337   25.468 1.00 40.54  ? 48  THR A OG1   1 
ATOM   364  C CG2   . THR A 1 48  ? -7.927  11.188  26.941 1.00 40.54  ? 48  THR A CG2   1 
ATOM   365  N N     . HIS A 1 49  ? -8.939  10.719  22.819 1.00 31.20  ? 49  HIS A N     1 
ATOM   366  C CA    . HIS A 1 49  ? -9.077  10.052  21.551 1.00 31.20  ? 49  HIS A CA    1 
ATOM   367  C C     . HIS A 1 49  ? -7.711  9.677   21.019 1.00 31.20  ? 49  HIS A C     1 
ATOM   368  O O     . HIS A 1 49  ? -6.912  10.547  20.698 1.00 31.20  ? 49  HIS A O     1 
ATOM   369  C CB    . HIS A 1 49  ? -9.740  10.934  20.528 1.00 31.79  ? 49  HIS A CB    1 
ATOM   370  C CG    . HIS A 1 49  ? -9.774  10.306  19.180 1.00 31.79  ? 49  HIS A CG    1 
ATOM   371  N ND1   . HIS A 1 49  ? -8.628  9.976   18.498 1.00 31.79  ? 49  HIS A ND1   1 
ATOM   372  C CD2   . HIS A 1 49  ? -10.804 9.850   18.433 1.00 31.79  ? 49  HIS A CD2   1 
ATOM   373  C CE1   . HIS A 1 49  ? -8.949  9.341   17.388 1.00 31.79  ? 49  HIS A CE1   1 
ATOM   374  N NE2   . HIS A 1 49  ? -10.264 9.250   17.326 1.00 31.79  ? 49  HIS A NE2   1 
ATOM   375  N N     . LEU A 1 50  ? -7.464  8.375   20.894 1.00 30.34  ? 50  LEU A N     1 
ATOM   376  C CA    . LEU A 1 50  ? -6.183  7.859   20.429 1.00 30.34  ? 50  LEU A CA    1 
ATOM   377  C C     . LEU A 1 50  ? -6.163  7.746   18.943 1.00 30.34  ? 50  LEU A C     1 
ATOM   378  O O     . LEU A 1 50  ? -6.961  7.052   18.359 1.00 30.34  ? 50  LEU A O     1 
ATOM   379  C CB    . LEU A 1 50  ? -5.933  6.500   21.048 1.00 19.58  ? 50  LEU A CB    1 
ATOM   380  C CG    . LEU A 1 50  ? -4.806  5.684   20.445 1.00 19.58  ? 50  LEU A CG    1 
ATOM   381  C CD1   . LEU A 1 50  ? -3.712  6.620   19.991 1.00 19.58  ? 50  LEU A CD1   1 
ATOM   382  C CD2   . LEU A 1 50  ? -4.319  4.623   21.476 1.00 19.58  ? 50  LEU A CD2   1 
ATOM   383  N N     . LEU A 1 51  ? -5.211  8.407   18.329 1.00 4.93   ? 51  LEU A N     1 
ATOM   384  C CA    . LEU A 1 51  ? -5.122  8.421   16.880 1.00 4.93   ? 51  LEU A CA    1 
ATOM   385  C C     . LEU A 1 51  ? -3.832  7.874   16.320 1.00 4.93   ? 51  LEU A C     1 
ATOM   386  O O     . LEU A 1 51  ? -2.760  8.417   16.600 1.00 4.93   ? 51  LEU A O     1 
ATOM   387  C CB    . LEU A 1 51  ? -5.265  9.843   16.400 1.00 17.85  ? 51  LEU A CB    1 
ATOM   388  C CG    . LEU A 1 51  ? -4.784  10.017  14.983 1.00 17.85  ? 51  LEU A CG    1 
ATOM   389  C CD1   . LEU A 1 51  ? -5.743  9.349   14.038 1.00 17.85  ? 51  LEU A CD1   1 
ATOM   390  C CD2   . LEU A 1 51  ? -4.670  11.500  14.711 1.00 17.85  ? 51  LEU A CD2   1 
ATOM   391  N N     . LEU A 1 52  ? -3.934  6.837   15.491 1.00 29.87  ? 52  LEU A N     1 
ATOM   392  C CA    . LEU A 1 52  ? -2.737  6.237   14.926 1.00 29.87  ? 52  LEU A CA    1 
ATOM   393  C C     . LEU A 1 52  ? -2.311  6.915   13.648 1.00 29.87  ? 52  LEU A C     1 
ATOM   394  O O     . LEU A 1 52  ? -3.115  7.550   12.979 1.00 29.87  ? 52  LEU A O     1 
ATOM   395  C CB    . LEU A 1 52  ? -2.924  4.737   14.692 1.00 47.20  ? 52  LEU A CB    1 
ATOM   396  C CG    . LEU A 1 52  ? -3.528  4.227   13.388 1.00 47.20  ? 52  LEU A CG    1 
ATOM   397  C CD1   . LEU A 1 52  ? -2.535  4.417   12.231 1.00 47.20  ? 52  LEU A CD1   1 
ATOM   398  C CD2   . LEU A 1 52  ? -3.871  2.735   13.564 1.00 47.20  ? 52  LEU A CD2   1 
ATOM   399  N N     . LYS A 1 53  ? -1.030  6.760   13.324 1.00 134.58 ? 53  LYS A N     1 
ATOM   400  C CA    . LYS A 1 53  ? -0.446  7.363   12.136 1.00 134.58 ? 53  LYS A CA    1 
ATOM   401  C C     . LYS A 1 53  ? 0.744   6.581   11.588 1.00 134.58 ? 53  LYS A C     1 
ATOM   402  O O     . LYS A 1 53  ? 1.137   5.549   12.135 1.00 134.58 ? 53  LYS A O     1 
ATOM   403  C CB    . LYS A 1 53  ? 0.024   8.777   12.453 1.00 48.70  ? 53  LYS A CB    1 
ATOM   404  C CG    . LYS A 1 53  ? -1.066  9.769   12.694 1.00 48.70  ? 53  LYS A CG    1 
ATOM   405  C CD    . LYS A 1 53  ? -0.461  11.142  12.906 1.00 48.70  ? 53  LYS A CD    1 
ATOM   406  C CE    . LYS A 1 53  ? -1.471  12.255  12.661 1.00 48.70  ? 53  LYS A CE    1 
ATOM   407  N NZ    . LYS A 1 53  ? -0.801  13.588  12.553 1.00 48.70  ? 53  LYS A NZ    1 
ATOM   408  N N     . GLU A 1 54  ? 1.304   7.094   10.494 1.00 132.95 ? 54  GLU A N     1 
ATOM   409  C CA    . GLU A 1 54  ? 2.477   6.504   9.863  1.00 132.95 ? 54  GLU A CA    1 
ATOM   410  C C     . GLU A 1 54  ? 3.522   6.529   10.960 1.00 132.95 ? 54  GLU A C     1 
ATOM   411  O O     . GLU A 1 54  ? 4.187   5.535   11.244 1.00 132.95 ? 54  GLU A O     1 
ATOM   412  C CB    . GLU A 1 54  ? 2.953   7.384   8.704  1.00 169.52 ? 54  GLU A CB    1 
ATOM   413  C CG    . GLU A 1 54  ? 2.048   7.393   7.493  1.00 169.52 ? 54  GLU A CG    1 
ATOM   414  C CD    . GLU A 1 54  ? 2.164   6.119   6.690  1.00 169.52 ? 54  GLU A CD    1 
ATOM   415  O OE1   . GLU A 1 54  ? 1.466   5.994   5.664  1.00 169.52 ? 54  GLU A OE1   1 
ATOM   416  O OE2   . GLU A 1 54  ? 2.959   5.240   7.085  1.00 169.52 ? 54  GLU A OE2   1 
ATOM   417  N N     . GLU A 1 55  ? 3.650   7.698   11.573 1.00 27.26  ? 55  GLU A N     1 
ATOM   418  C CA    . GLU A 1 55  ? 4.584   7.881   12.654 1.00 27.26  ? 55  GLU A CA    1 
ATOM   419  C C     . GLU A 1 55  ? 4.205   6.873   13.715 1.00 27.26  ? 55  GLU A C     1 
ATOM   420  O O     . GLU A 1 55  ? 4.867   5.853   13.874 1.00 27.26  ? 55  GLU A O     1 
ATOM   421  C CB    . GLU A 1 55  ? 4.460   9.299   13.214 1.00 117.02 ? 55  GLU A CB    1 
ATOM   422  C CG    . GLU A 1 55  ? 4.463   10.381  12.150 1.00 117.02 ? 55  GLU A CG    1 
ATOM   423  C CD    . GLU A 1 55  ? 3.121   10.538  11.457 1.00 117.02 ? 55  GLU A CD    1 
ATOM   424  O OE1   . GLU A 1 55  ? 2.505   9.524   11.073 1.00 117.02 ? 55  GLU A OE1   1 
ATOM   425  O OE2   . GLU A 1 55  ? 2.682   11.693  11.287 1.00 117.02 ? 55  GLU A OE2   1 
ATOM   426  N N     . GLY A 1 56  ? 3.110   7.173   14.417 1.00 19.27  ? 56  GLY A N     1 
ATOM   427  C CA    . GLY A 1 56  ? 2.606   6.315   15.472 1.00 19.27  ? 56  GLY A CA    1 
ATOM   428  C C     . GLY A 1 56  ? 1.484   6.988   16.227 1.00 19.27  ? 56  GLY A C     1 
ATOM   429  O O     . GLY A 1 56  ? 1.007   8.021   15.813 1.00 19.27  ? 56  GLY A O     1 
ATOM   430  N N     . LEU A 1 57  ? 1.074   6.405   17.343 1.00 29.70  ? 57  LEU A N     1 
ATOM   431  C CA    . LEU A 1 57  ? -0.010  6.933   18.165 1.00 29.70  ? 57  LEU A CA    1 
ATOM   432  C C     . LEU A 1 57  ? 0.026   8.435   18.384 1.00 29.70  ? 57  LEU A C     1 
ATOM   433  O O     . LEU A 1 57  ? 1.058   9.054   18.220 1.00 29.70  ? 57  LEU A O     1 
ATOM   434  C CB    . LEU A 1 57  ? -0.004  6.223   19.522 1.00 35.89  ? 57  LEU A CB    1 
ATOM   435  C CG    . LEU A 1 57  ? 0.080   4.689   19.421 1.00 35.89  ? 57  LEU A CG    1 
ATOM   436  C CD1   . LEU A 1 57  ? -0.237  4.031   20.764 1.00 35.89  ? 57  LEU A CD1   1 
ATOM   437  C CD2   . LEU A 1 57  ? -0.899  4.217   18.358 1.00 35.89  ? 57  LEU A CD2   1 
ATOM   438  N N     . SER A 1 58  ? -1.121  9.005   18.736 1.00 27.30  ? 58  SER A N     1 
ATOM   439  C CA    . SER A 1 58  ? -1.291  10.428  19.028 1.00 27.30  ? 58  SER A CA    1 
ATOM   440  C C     . SER A 1 58  ? -2.536  10.508  19.896 1.00 27.30  ? 58  SER A C     1 
ATOM   441  O O     . SER A 1 58  ? -3.610  10.087  19.468 1.00 27.30  ? 58  SER A O     1 
ATOM   442  C CB    . SER A 1 58  ? -1.559  11.226  17.765 1.00 45.48  ? 58  SER A CB    1 
ATOM   443  O OG    . SER A 1 58  ? -0.495  11.105  16.852 1.00 45.48  ? 58  SER A OG    1 
ATOM   444  N N     . LEU A 1 59  ? -2.421  11.020  21.115 1.00 25.41  ? 59  LEU A N     1 
ATOM   445  C CA    . LEU A 1 59  ? -3.592  11.128  21.973 1.00 25.41  ? 59  LEU A CA    1 
ATOM   446  C C     . LEU A 1 59  ? -4.161  12.520  21.864 1.00 25.41  ? 59  LEU A C     1 
ATOM   447  O O     . LEU A 1 59  ? -3.478  13.458  21.479 1.00 25.41  ? 59  LEU A O     1 
ATOM   448  C CB    . LEU A 1 59  ? -3.220  10.882  23.415 1.00 37.93  ? 59  LEU A CB    1 
ATOM   449  C CG    . LEU A 1 59  ? -3.770  9.623   24.041 1.00 37.93  ? 59  LEU A CG    1 
ATOM   450  C CD1   . LEU A 1 59  ? -3.372  8.444   23.177 1.00 37.93  ? 59  LEU A CD1   1 
ATOM   451  C CD2   . LEU A 1 59  ? -3.227  9.480   25.450 1.00 37.93  ? 59  LEU A CD2   1 
ATOM   452  N N     . TYR A 1 60  ? -5.423  12.663  22.216 1.00 56.18  ? 60  TYR A N     1 
ATOM   453  C CA    . TYR A 1 60  ? -6.051  13.961  22.168 1.00 56.18  ? 60  TYR A CA    1 
ATOM   454  C C     . TYR A 1 60  ? -7.001  14.014  23.317 1.00 56.18  ? 60  TYR A C     1 
ATOM   455  O O     . TYR A 1 60  ? -8.027  13.364  23.316 1.00 56.18  ? 60  TYR A O     1 
ATOM   456  C CB    . TYR A 1 60  ? -6.789  14.123  20.869 1.00 24.28  ? 60  TYR A CB    1 
ATOM   457  C CG    . TYR A 1 60  ? -5.869  14.239  19.704 1.00 24.28  ? 60  TYR A CG    1 
ATOM   458  C CD1   . TYR A 1 60  ? -5.237  15.444  19.420 1.00 24.28  ? 60  TYR A CD1   1 
ATOM   459  C CD2   . TYR A 1 60  ? -5.662  13.174  18.853 1.00 24.28  ? 60  TYR A CD2   1 
ATOM   460  C CE1   . TYR A 1 60  ? -4.427  15.599  18.304 1.00 24.28  ? 60  TYR A CE1   1 
ATOM   461  C CE2   . TYR A 1 60  ? -4.850  13.299  17.729 1.00 24.28  ? 60  TYR A CE2   1 
ATOM   462  C CZ    . TYR A 1 60  ? -4.231  14.523  17.453 1.00 24.28  ? 60  TYR A CZ    1 
ATOM   463  O OH    . TYR A 1 60  ? -3.416  14.670  16.330 1.00 24.28  ? 60  TYR A OH    1 
ATOM   464  N N     . GLY A 1 61  ? -6.638  14.763  24.331 1.00 35.26  ? 61  GLY A N     1 
ATOM   465  C CA    . GLY A 1 61  ? -7.518  14.847  25.460 1.00 35.26  ? 61  GLY A CA    1 
ATOM   466  C C     . GLY A 1 61  ? -8.387  16.075  25.342 1.00 35.26  ? 61  GLY A C     1 
ATOM   467  O O     . GLY A 1 61  ? -7.982  17.094  24.790 1.00 35.26  ? 61  GLY A O     1 
ATOM   468  N N     . PHE A 1 62  ? -9.598  15.962  25.864 1.00 32.91  ? 62  PHE A N     1 
ATOM   469  C CA    . PHE A 1 62  ? -10.550 17.048  25.866 1.00 32.91  ? 62  PHE A CA    1 
ATOM   470  C C     . PHE A 1 62  ? -11.268 16.991  27.211 1.00 32.91  ? 62  PHE A C     1 
ATOM   471  O O     . PHE A 1 62  ? -11.254 15.965  27.897 1.00 32.91  ? 62  PHE A O     1 
ATOM   472  C CB    . PHE A 1 62  ? -11.536 16.840  24.749 1.00 7.96   ? 62  PHE A CB    1 
ATOM   473  C CG    . PHE A 1 62  ? -10.957 17.005  23.383 1.00 7.96   ? 62  PHE A CG    1 
ATOM   474  C CD1   . PHE A 1 62  ? -11.001 18.239  22.738 1.00 7.96   ? 62  PHE A CD1   1 
ATOM   475  C CD2   . PHE A 1 62  ? -10.450 15.921  22.694 1.00 7.96   ? 62  PHE A CD2   1 
ATOM   476  C CE1   . PHE A 1 62  ? -10.557 18.389  21.411 1.00 7.96   ? 62  PHE A CE1   1 
ATOM   477  C CE2   . PHE A 1 62  ? -9.998  16.072  21.360 1.00 7.96   ? 62  PHE A CE2   1 
ATOM   478  C CZ    . PHE A 1 62  ? -10.058 17.308  20.724 1.00 7.96   ? 62  PHE A CZ    1 
ATOM   479  N N     . PRO A 1 63  ? -11.923 18.089  27.599 1.00 26.63  ? 63  PRO A N     1 
ATOM   480  C CA    . PRO A 1 63  ? -12.656 18.200  28.864 1.00 26.63  ? 63  PRO A CA    1 
ATOM   481  C C     . PRO A 1 63  ? -14.010 17.516  28.952 1.00 26.63  ? 63  PRO A C     1 
ATOM   482  O O     . PRO A 1 63  ? -14.578 17.436  30.031 1.00 26.63  ? 63  PRO A O     1 
ATOM   483  C CB    . PRO A 1 63  ? -12.793 19.698  29.034 1.00 31.52  ? 63  PRO A CB    1 
ATOM   484  C CG    . PRO A 1 63  ? -13.056 20.121  27.627 1.00 31.52  ? 63  PRO A CG    1 
ATOM   485  C CD    . PRO A 1 63  ? -11.984 19.360  26.859 1.00 31.52  ? 63  PRO A CD    1 
ATOM   486  N N     . ASP A 1 64  ? -14.542 17.016  27.846 1.00 75.71  ? 64  ASP A N     1 
ATOM   487  C CA    . ASP A 1 64  ? -15.856 16.392  27.924 1.00 75.71  ? 64  ASP A CA    1 
ATOM   488  C C     . ASP A 1 64  ? -16.290 15.539  26.740 1.00 75.71  ? 64  ASP A C     1 
ATOM   489  O O     . ASP A 1 64  ? -15.744 15.648  25.642 1.00 75.71  ? 64  ASP A O     1 
ATOM   490  C CB    . ASP A 1 64  ? -16.905 17.476  28.166 1.00 53.95  ? 64  ASP A CB    1 
ATOM   491  C CG    . ASP A 1 64  ? -16.567 18.777  27.462 1.00 53.95  ? 64  ASP A CG    1 
ATOM   492  O OD1   . ASP A 1 64  ? -16.138 18.731  26.289 1.00 53.95  ? 64  ASP A OD1   1 
ATOM   493  O OD2   . ASP A 1 64  ? -16.738 19.844  28.083 1.00 53.95  ? 64  ASP A OD2   1 
ATOM   494  N N     . GLU A 1 65  ? -17.296 14.697  26.984 1.00 36.45  ? 65  GLU A N     1 
ATOM   495  C CA    . GLU A 1 65  ? -17.845 13.825  25.955 1.00 36.45  ? 65  GLU A CA    1 
ATOM   496  C C     . GLU A 1 65  ? -18.163 14.802  24.857 1.00 36.45  ? 65  GLU A C     1 
ATOM   497  O O     . GLU A 1 65  ? -18.108 14.491  23.668 1.00 36.45  ? 65  GLU A O     1 
ATOM   498  C CB    . GLU A 1 65  ? -19.142 13.159  26.436 1.00 175.45 ? 65  GLU A CB    1 
ATOM   499  C CG    . GLU A 1 65  ? -19.010 12.272  27.671 1.00 175.45 ? 65  GLU A CG    1 
ATOM   500  C CD    . GLU A 1 65  ? -20.350 11.709  28.135 1.00 175.45 ? 65  GLU A CD    1 
ATOM   501  O OE1   . GLU A 1 65  ? -21.043 11.063  27.321 1.00 175.45 ? 65  GLU A OE1   1 
ATOM   502  O OE2   . GLU A 1 65  ? -20.710 11.909  29.315 1.00 175.45 ? 65  GLU A OE2   1 
ATOM   503  N N     . GLU A 1 66  ? -18.461 16.011  25.307 1.00 28.78  ? 66  GLU A N     1 
ATOM   504  C CA    . GLU A 1 66  ? -18.833 17.115  24.454 1.00 28.78  ? 66  GLU A CA    1 
ATOM   505  C C     . GLU A 1 66  ? -17.831 17.447  23.359 1.00 28.78  ? 66  GLU A C     1 
ATOM   506  O O     . GLU A 1 66  ? -18.070 17.152  22.178 1.00 28.78  ? 66  GLU A O     1 
ATOM   507  C CB    . GLU A 1 66  ? -19.084 18.345  25.318 1.00 81.13  ? 66  GLU A CB    1 
ATOM   508  C CG    . GLU A 1 66  ? -19.859 19.398  24.599 1.00 81.13  ? 66  GLU A CG    1 
ATOM   509  C CD    . GLU A 1 66  ? -20.984 18.789  23.816 1.00 81.13  ? 66  GLU A CD    1 
ATOM   510  O OE1   . GLU A 1 66  ? -21.695 17.926  24.384 1.00 81.13  ? 66  GLU A OE1   1 
ATOM   511  O OE2   . GLU A 1 66  ? -21.149 19.170  22.642 1.00 81.13  ? 66  GLU A OE2   1 
ATOM   512  N N     . ASN A 1 67  ? -16.717 18.067  23.758 1.00 43.49  ? 67  ASN A N     1 
ATOM   513  C CA    . ASN A 1 67  ? -15.649 18.467  22.839 1.00 43.49  ? 67  ASN A CA    1 
ATOM   514  C C     . ASN A 1 67  ? -15.095 17.294  22.076 1.00 43.49  ? 67  ASN A C     1 
ATOM   515  O O     . ASN A 1 67  ? -14.877 17.358  20.869 1.00 43.49  ? 67  ASN A O     1 
ATOM   516  C CB    . ASN A 1 67  ? -14.535 19.131  23.613 1.00 37.99  ? 67  ASN A CB    1 
ATOM   517  C CG    . ASN A 1 67  ? -14.887 20.522  24.016 1.00 37.99  ? 67  ASN A CG    1 
ATOM   518  O OD1   . ASN A 1 67  ? -15.290 21.326  23.180 1.00 37.99  ? 67  ASN A OD1   1 
ATOM   519  N ND2   . ASN A 1 67  ? -14.742 20.828  25.299 1.00 37.99  ? 67  ASN A ND2   1 
ATOM   520  N N     . LEU A 1 68  ? -14.850 16.227  22.816 1.00 42.37  ? 68  LEU A N     1 
ATOM   521  C CA    . LEU A 1 68  ? -14.366 14.987  22.248 1.00 42.37  ? 68  LEU A CA    1 
ATOM   522  C C     . LEU A 1 68  ? -15.191 14.657  21.023 1.00 42.37  ? 68  LEU A C     1 
ATOM   523  O O     . LEU A 1 68  ? -14.655 14.433  19.922 1.00 42.37  ? 68  LEU A O     1 
ATOM   524  C CB    . LEU A 1 68  ? -14.552 13.872  23.257 1.00 11.08  ? 68  LEU A CB    1 
ATOM   525  C CG    . LEU A 1 68  ? -14.365 12.441  22.792 1.00 11.08  ? 68  LEU A CG    1 
ATOM   526  C CD1   . LEU A 1 68  ? -13.742 12.360  21.404 1.00 11.08  ? 68  LEU A CD1   1 
ATOM   527  C CD2   . LEU A 1 68  ? -13.479 11.778  23.831 1.00 11.08  ? 68  LEU A CD2   1 
ATOM   528  N N     . ALA A 1 69  ? -16.501 14.591  21.255 1.00 34.36  ? 69  ALA A N     1 
ATOM   529  C CA    . ALA A 1 69  ? -17.476 14.288  20.226 1.00 34.36  ? 69  ALA A CA    1 
ATOM   530  C C     . ALA A 1 69  ? -17.322 15.182  19.001 1.00 34.36  ? 69  ALA A C     1 
ATOM   531  O O     . ALA A 1 69  ? -17.352 14.699  17.883 1.00 34.36  ? 69  ALA A O     1 
ATOM   532  C CB    . ALA A 1 69  ? -18.823 14.428  20.785 1.00 11.72  ? 69  ALA A CB    1 
ATOM   533  N N     . LEU A 1 70  ? -17.164 16.479  19.192 1.00 36.42  ? 70  LEU A N     1 
ATOM   534  C CA    . LEU A 1 70  ? -16.987 17.356  18.046 1.00 36.42  ? 70  LEU A CA    1 
ATOM   535  C C     . LEU A 1 70  ? -15.651 17.069  17.361 1.00 36.42  ? 70  LEU A C     1 
ATOM   536  O O     . LEU A 1 70  ? -15.528 17.102  16.118 1.00 36.42  ? 70  LEU A O     1 
ATOM   537  C CB    . LEU A 1 70  ? -16.972 18.787  18.516 1.00 30.33  ? 70  LEU A CB    1 
ATOM   538  C CG    . LEU A 1 70  ? -18.306 19.218  19.048 1.00 30.33  ? 70  LEU A CG    1 
ATOM   539  C CD1   . LEU A 1 70  ? -18.112 20.023  20.324 1.00 30.33  ? 70  LEU A CD1   1 
ATOM   540  C CD2   . LEU A 1 70  ? -19.006 19.991  17.951 1.00 30.33  ? 70  LEU A CD2   1 
ATOM   541  N N     . PHE A 1 71  ? -14.640 16.816  18.194 1.00 13.90  ? 71  PHE A N     1 
ATOM   542  C CA    . PHE A 1 71  ? -13.314 16.552  17.690 1.00 13.90  ? 71  PHE A CA    1 
ATOM   543  C C     . PHE A 1 71  ? -13.395 15.383  16.794 1.00 13.90  ? 71  PHE A C     1 
ATOM   544  O O     . PHE A 1 71  ? -12.911 15.434  15.664 1.00 13.90  ? 71  PHE A O     1 
ATOM   545  C CB    . PHE A 1 71  ? -12.338 16.238  18.808 1.00 32.94  ? 71  PHE A CB    1 
ATOM   546  C CG    . PHE A 1 71  ? -10.978 15.820  18.321 1.00 32.94  ? 71  PHE A CG    1 
ATOM   547  C CD1   . PHE A 1 71  ? -10.261 16.627  17.467 1.00 32.94  ? 71  PHE A CD1   1 
ATOM   548  C CD2   . PHE A 1 71  ? -10.413 14.620  18.737 1.00 32.94  ? 71  PHE A CD2   1 
ATOM   549  C CE1   . PHE A 1 71  ? -9.013  16.246  17.039 1.00 32.94  ? 71  PHE A CE1   1 
ATOM   550  C CE2   . PHE A 1 71  ? -9.174  14.235  18.320 1.00 32.94  ? 71  PHE A CE2   1 
ATOM   551  C CZ    . PHE A 1 71  ? -8.468  15.047  17.466 1.00 32.94  ? 71  PHE A CZ    1 
ATOM   552  N N     . GLU A 1 72  ? -14.015 14.323  17.298 1.00 24.79  ? 72  GLU A N     1 
ATOM   553  C CA    . GLU A 1 72  ? -14.127 13.116  16.508 1.00 24.79  ? 72  GLU A CA    1 
ATOM   554  C C     . GLU A 1 72  ? -14.932 13.352  15.238 1.00 24.79  ? 72  GLU A C     1 
ATOM   555  O O     . GLU A 1 72  ? -14.544 12.922  14.145 1.00 24.79  ? 72  GLU A O     1 
ATOM   556  C CB    . GLU A 1 72  ? -14.702 11.984  17.359 1.00 30.64  ? 72  GLU A CB    1 
ATOM   557  C CG    . GLU A 1 72  ? -13.626 11.299  18.175 1.00 30.64  ? 72  GLU A CG    1 
ATOM   558  C CD    . GLU A 1 72  ? -14.159 10.315  19.206 1.00 30.64  ? 72  GLU A CD    1 
ATOM   559  O OE1   . GLU A 1 72  ? -13.354 9.605   19.839 1.00 30.64  ? 72  GLU A OE1   1 
ATOM   560  O OE2   . GLU A 1 72  ? -15.387 10.248  19.405 1.00 30.64  ? 72  GLU A OE2   1 
ATOM   561  N N     . LEU A 1 73  ? -16.023 14.085  15.369 1.00 40.92  ? 73  LEU A N     1 
ATOM   562  C CA    . LEU A 1 73  ? -16.857 14.334  14.218 1.00 40.92  ? 73  LEU A CA    1 
ATOM   563  C C     . LEU A 1 73  ? -16.052 15.068  13.197 1.00 40.92  ? 73  LEU A C     1 
ATOM   564  O O     . LEU A 1 73  ? -15.988 14.652  12.057 1.00 40.92  ? 73  LEU A O     1 
ATOM   565  C CB    . LEU A 1 73  ? -18.091 15.151  14.593 1.00 41.67  ? 73  LEU A CB    1 
ATOM   566  C CG    . LEU A 1 73  ? -19.097 15.445  13.479 1.00 41.67  ? 73  LEU A CG    1 
ATOM   567  C CD1   . LEU A 1 73  ? -19.592 14.150  12.881 1.00 41.67  ? 73  LEU A CD1   1 
ATOM   568  C CD2   . LEU A 1 73  ? -20.245 16.257  14.056 1.00 41.67  ? 73  LEU A CD2   1 
ATOM   569  N N     . LEU A 1 74  ? -15.420 16.158  13.590 1.00 36.09  ? 74  LEU A N     1 
ATOM   570  C CA    . LEU A 1 74  ? -14.635 16.881  12.609 1.00 36.09  ? 74  LEU A CA    1 
ATOM   571  C C     . LEU A 1 74  ? -13.573 15.991  11.923 1.00 36.09  ? 74  LEU A C     1 
ATOM   572  O O     . LEU A 1 74  ? -13.323 16.118  10.721 1.00 36.09  ? 74  LEU A O     1 
ATOM   573  C CB    . LEU A 1 74  ? -13.998 18.110  13.265 1.00 15.02  ? 74  LEU A CB    1 
ATOM   574  C CG    . LEU A 1 74  ? -14.838 19.335  12.970 1.00 15.02  ? 74  LEU A CG    1 
ATOM   575  C CD1   . LEU A 1 74  ? -14.303 20.502  13.699 1.00 15.02  ? 74  LEU A CD1   1 
ATOM   576  C CD2   . LEU A 1 74  ? -14.807 19.608  11.498 1.00 15.02  ? 74  LEU A CD2   1 
ATOM   577  N N     . LEU A 1 75  ? -12.981 15.070  12.678 1.00 39.86  ? 75  LEU A N     1 
ATOM   578  C CA    . LEU A 1 75  ? -11.961 14.203  12.126 1.00 39.86  ? 75  LEU A CA    1 
ATOM   579  C C     . LEU A 1 75  ? -12.384 13.389  10.904 1.00 39.86  ? 75  LEU A C     1 
ATOM   580  O O     . LEU A 1 75  ? -11.534 13.003  10.088 1.00 39.86  ? 75  LEU A O     1 
ATOM   581  C CB    . LEU A 1 75  ? -11.432 13.249  13.196 1.00 23.94  ? 75  LEU A CB    1 
ATOM   582  C CG    . LEU A 1 75  ? -10.312 13.683  14.156 1.00 23.94  ? 75  LEU A CG    1 
ATOM   583  C CD1   . LEU A 1 75  ? -9.629  12.446  14.744 1.00 23.94  ? 75  LEU A CD1   1 
ATOM   584  C CD2   . LEU A 1 75  ? -9.273  14.488  13.421 1.00 23.94  ? 75  LEU A CD2   1 
ATOM   585  N N     . SER A 1 76  ? -13.680 13.126  10.755 1.00 35.94  ? 76  SER A N     1 
ATOM   586  C CA    . SER A 1 76  ? -14.158 12.327  9.623  1.00 35.94  ? 76  SER A CA    1 
ATOM   587  C C     . SER A 1 76  ? -14.639 13.123  8.415  1.00 35.94  ? 76  SER A C     1 
ATOM   588  O O     . SER A 1 76  ? -15.816 13.138  8.118  1.00 35.94  ? 76  SER A O     1 
ATOM   589  C CB    . SER A 1 76  ? -15.289 11.406  10.081 1.00 37.39  ? 76  SER A CB    1 
ATOM   590  O OG    . SER A 1 76  ? -16.446 12.139  10.466 1.00 37.39  ? 76  SER A OG    1 
ATOM   591  N N     . VAL A 1 77  ? -13.742 13.756  7.684  1.00 48.12  ? 77  VAL A N     1 
ATOM   592  C CA    . VAL A 1 77  ? -14.183 14.531  6.540  1.00 48.12  ? 77  VAL A CA    1 
ATOM   593  C C     . VAL A 1 77  ? -13.206 14.407  5.361  1.00 48.12  ? 77  VAL A C     1 
ATOM   594  O O     . VAL A 1 77  ? -13.493 13.708  4.392  1.00 48.12  ? 77  VAL A O     1 
ATOM   595  C CB    . VAL A 1 77  ? -14.352 15.993  6.971  1.00 25.23  ? 77  VAL A CB    1 
ATOM   596  C CG1   . VAL A 1 77  ? -14.689 16.867  5.776  1.00 25.23  ? 77  VAL A CG1   1 
ATOM   597  C CG2   . VAL A 1 77  ? -15.411 16.091  8.061  1.00 25.23  ? 77  VAL A CG2   1 
ATOM   598  N N     . SER A 1 78  ? -12.064 15.087  5.452  1.00 35.91  ? 78  SER A N     1 
ATOM   599  C CA    . SER A 1 78  ? -11.004 15.066  4.440  1.00 35.91  ? 78  SER A CA    1 
ATOM   600  C C     . SER A 1 78  ? -9.929  16.008  4.953  1.00 35.91  ? 78  SER A C     1 
ATOM   601  O O     . SER A 1 78  ? -8.753  15.701  4.915  1.00 35.91  ? 78  SER A O     1 
ATOM   602  C CB    . SER A 1 78  ? -11.527 15.479  3.065  1.00 43.63  ? 78  SER A CB    1 
ATOM   603  O OG    . SER A 1 78  ? -11.875 14.328  2.289  1.00 43.63  ? 78  SER A OG    1 
ATOM   604  N N     . GLY A 1 79  ? -10.344 17.167  5.430  1.00 49.65  ? 79  GLY A N     1 
ATOM   605  C CA    . GLY A 1 79  ? -9.413  18.070  6.084  1.00 49.65  ? 79  GLY A CA    1 
ATOM   606  C C     . GLY A 1 79  ? -9.677  17.516  7.480  1.00 49.65  ? 79  GLY A C     1 
ATOM   607  O O     . GLY A 1 79  ? -10.447 18.050  8.306  1.00 49.65  ? 79  GLY A O     1 
ATOM   608  N N     . VAL A 1 80  ? -9.085  16.348  7.681  1.00 35.96  ? 80  VAL A N     1 
ATOM   609  C CA    . VAL A 1 80  ? -9.205  15.554  8.903  1.00 35.96  ? 80  VAL A CA    1 
ATOM   610  C C     . VAL A 1 80  ? -8.190  16.130  9.899  1.00 35.96  ? 80  VAL A C     1 
ATOM   611  O O     . VAL A 1 80  ? -7.986  15.651  11.021 1.00 35.96  ? 80  VAL A O     1 
ATOM   612  C CB    . VAL A 1 80  ? -8.924  14.038  8.529  1.00 105.49 ? 80  VAL A CB    1 
ATOM   613  C CG1   . VAL A 1 80  ? -8.866  13.154  9.765  1.00 105.49 ? 80  VAL A CG1   1 
ATOM   614  C CG2   . VAL A 1 80  ? -10.007 13.532  7.561  1.00 105.49 ? 80  VAL A CG2   1 
ATOM   615  N N     . GLY A 1 81  ? -7.578  17.212  9.456  1.00 67.03  ? 81  GLY A N     1 
ATOM   616  C CA    . GLY A 1 81  ? -6.586  17.861  10.272 1.00 67.03  ? 81  GLY A CA    1 
ATOM   617  C C     . GLY A 1 81  ? -6.868  17.906  11.757 1.00 67.03  ? 81  GLY A C     1 
ATOM   618  O O     . GLY A 1 81  ? -7.655  18.734  12.196 1.00 67.03  ? 81  GLY A O     1 
ATOM   619  N N     . PRO A 1 82  ? -6.308  16.983  12.553 1.00 17.52  ? 82  PRO A N     1 
ATOM   620  C CA    . PRO A 1 82  ? -6.599  17.119  13.969 1.00 17.52  ? 82  PRO A CA    1 
ATOM   621  C C     . PRO A 1 82  ? -6.113  18.549  14.256 1.00 17.52  ? 82  PRO A C     1 
ATOM   622  O O     . PRO A 1 82  ? -6.491  19.181  15.249 1.00 17.52  ? 82  PRO A O     1 
ATOM   623  C CB    . PRO A 1 82  ? -5.684  16.082  14.604 1.00 1.66   ? 82  PRO A CB    1 
ATOM   624  C CG    . PRO A 1 82  ? -5.628  15.020  13.584 1.00 1.66   ? 82  PRO A CG    1 
ATOM   625  C CD    . PRO A 1 82  ? -5.580  15.735  12.280 1.00 1.66   ? 82  PRO A CD    1 
ATOM   626  N N     . LYS A 1 83  ? -5.248  19.051  13.380 1.00 22.92  ? 83  LYS A N     1 
ATOM   627  C CA    . LYS A 1 83  ? -4.777  20.393  13.567 1.00 22.92  ? 83  LYS A CA    1 
ATOM   628  C C     . LYS A 1 83  ? -6.080  21.157  13.359 1.00 22.92  ? 83  LYS A C     1 
ATOM   629  O O     . LYS A 1 83  ? -6.684  21.610  14.327 1.00 22.92  ? 83  LYS A O     1 
ATOM   630  C CB    . LYS A 1 83  ? -3.739  20.753  12.508 1.00 52.55  ? 83  LYS A CB    1 
ATOM   631  C CG    . LYS A 1 83  ? -2.793  21.883  12.920 1.00 52.55  ? 83  LYS A CG    1 
ATOM   632  C CD    . LYS A 1 83  ? -1.873  22.292  11.759 1.00 52.55  ? 83  LYS A CD    1 
ATOM   633  C CE    . LYS A 1 83  ? -0.732  23.236  12.201 1.00 52.55  ? 83  LYS A CE    1 
ATOM   634  N NZ    . LYS A 1 83  ? 0.348   22.570  13.025 1.00 52.55  ? 83  LYS A NZ    1 
ATOM   635  N N     . VAL A 1 84  ? -6.548  21.248  12.111 1.00 22.46  ? 84  VAL A N     1 
ATOM   636  C CA    . VAL A 1 84  ? -7.802  21.954  11.793 1.00 22.46  ? 84  VAL A CA    1 
ATOM   637  C C     . VAL A 1 84  ? -8.846  21.645  12.842 1.00 22.46  ? 84  VAL A C     1 
ATOM   638  O O     . VAL A 1 84  ? -9.518  22.540  13.323 1.00 22.46  ? 84  VAL A O     1 
ATOM   639  C CB    . VAL A 1 84  ? -8.401  21.523  10.454 1.00 6.59   ? 84  VAL A CB    1 
ATOM   640  C CG1   . VAL A 1 84  ? -9.217  22.649  9.881  1.00 6.59   ? 84  VAL A CG1   1 
ATOM   641  C CG2   . VAL A 1 84  ? -7.301  21.090  9.495  1.00 6.59   ? 84  VAL A CG2   1 
ATOM   642  N N     . ALA A 1 85  ? -8.983  20.363  13.171 1.00 21.30  ? 85  ALA A N     1 
ATOM   643  C CA    . ALA A 1 85  ? -9.917  19.922  14.193 1.00 21.30  ? 85  ALA A CA    1 
ATOM   644  C C     . ALA A 1 85  ? -9.647  20.808  15.380 1.00 21.30  ? 85  ALA A C     1 
ATOM   645  O O     . ALA A 1 85  ? -10.471 21.635  15.757 1.00 21.30  ? 85  ALA A O     1 
ATOM   646  C CB    . ALA A 1 85  ? -9.666  18.485  14.560 1.00 1.00   ? 85  ALA A CB    1 
ATOM   647  N N     . LEU A 1 86  ? -8.472  20.662  15.966 1.00 17.08  ? 86  LEU A N     1 
ATOM   648  C CA    . LEU A 1 86  ? -8.148  21.496  17.105 1.00 17.08  ? 86  LEU A CA    1 
ATOM   649  C C     . LEU A 1 86  ? -8.249  22.966  16.694 1.00 17.08  ? 86  LEU A C     1 
ATOM   650  O O     . LEU A 1 86  ? -8.689  23.793  17.459 1.00 17.08  ? 86  LEU A O     1 
ATOM   651  C CB    . LEU A 1 86  ? -6.754  21.145  17.651 1.00 24.24  ? 86  LEU A CB    1 
ATOM   652  C CG    . LEU A 1 86  ? -6.632  19.696  18.135 1.00 24.24  ? 86  LEU A CG    1 
ATOM   653  C CD1   . LEU A 1 86  ? -5.333  19.453  18.829 1.00 24.24  ? 86  LEU A CD1   1 
ATOM   654  C CD2   . LEU A 1 86  ? -7.729  19.427  19.098 1.00 24.24  ? 86  LEU A CD2   1 
ATOM   655  N N     . ALA A 1 87  ? -7.877  23.295  15.475 1.00 36.98  ? 87  ALA A N     1 
ATOM   656  C CA    . ALA A 1 87  ? -7.986  24.674  15.065 1.00 36.98  ? 87  ALA A CA    1 
ATOM   657  C C     . ALA A 1 87  ? -9.390  25.183  15.390 1.00 36.98  ? 87  ALA A C     1 
ATOM   658  O O     . ALA A 1 87  ? -9.539  26.134  16.158 1.00 36.98  ? 87  ALA A O     1 
ATOM   659  C CB    . ALA A 1 87  ? -7.721  24.794  13.596 1.00 36.53  ? 87  ALA A CB    1 
ATOM   660  N N     . LEU A 1 88  ? -10.410 24.538  14.816 1.00 40.42  ? 88  LEU A N     1 
ATOM   661  C CA    . LEU A 1 88  ? -11.814 24.910  15.016 1.00 40.42  ? 88  LEU A CA    1 
ATOM   662  C C     . LEU A 1 88  ? -12.262 24.910  16.467 1.00 40.42  ? 88  LEU A C     1 
ATOM   663  O O     . LEU A 1 88  ? -12.784 25.912  16.969 1.00 40.42  ? 88  LEU A O     1 
ATOM   664  C CB    . LEU A 1 88  ? -12.705 23.978  14.208 1.00 18.12  ? 88  LEU A CB    1 
ATOM   665  C CG    . LEU A 1 88  ? -12.424 24.213  12.726 1.00 18.12  ? 88  LEU A CG    1 
ATOM   666  C CD1   . LEU A 1 88  ? -12.921 23.081  11.874 1.00 18.12  ? 88  LEU A CD1   1 
ATOM   667  C CD2   . LEU A 1 88  ? -13.091 25.479  12.317 1.00 18.12  ? 88  LEU A CD2   1 
ATOM   668  N N     . LEU A 1 89  ? -12.069 23.780  17.137 1.00 27.72  ? 89  LEU A N     1 
ATOM   669  C CA    . LEU A 1 89  ? -12.431 23.636  18.547 1.00 27.72  ? 89  LEU A CA    1 
ATOM   670  C C     . LEU A 1 89  ? -11.773 24.672  19.472 1.00 27.72  ? 89  LEU A C     1 
ATOM   671  O O     . LEU A 1 89  ? -12.196 24.866  20.613 1.00 27.72  ? 89  LEU A O     1 
ATOM   672  C CB    . LEU A 1 89  ? -12.033 22.249  19.019 1.00 19.98  ? 89  LEU A CB    1 
ATOM   673  C CG    . LEU A 1 89  ? -13.202 21.334  19.317 1.00 19.98  ? 89  LEU A CG    1 
ATOM   674  C CD1   . LEU A 1 89  ? -12.783 19.932  19.043 1.00 19.98  ? 89  LEU A CD1   1 
ATOM   675  C CD2   . LEU A 1 89  ? -13.634 21.480  20.756 1.00 19.98  ? 89  LEU A CD2   1 
ATOM   676  N N     . SER A 1 90  ? -10.725 25.321  18.984 1.00 28.18  ? 90  SER A N     1 
ATOM   677  C CA    . SER A 1 90  ? -10.018 26.296  19.783 1.00 28.18  ? 90  SER A CA    1 
ATOM   678  C C     . SER A 1 90  ? -10.587 27.661  19.545 1.00 28.18  ? 90  SER A C     1 
ATOM   679  O O     . SER A 1 90  ? -10.555 28.510  20.434 1.00 28.18  ? 90  SER A O     1 
ATOM   680  C CB    . SER A 1 90  ? -8.529  26.302  19.435 1.00 70.00  ? 90  SER A CB    1 
ATOM   681  O OG    . SER A 1 90  ? -7.861  25.178  19.977 1.00 70.00  ? 90  SER A OG    1 
ATOM   682  N N     . ALA A 1 91  ? -11.104 27.871  18.340 1.00 46.81  ? 91  ALA A N     1 
ATOM   683  C CA    . ALA A 1 91  ? -11.669 29.161  17.967 1.00 46.81  ? 91  ALA A CA    1 
ATOM   684  C C     . ALA A 1 91  ? -13.118 29.321  18.392 1.00 46.81  ? 91  ALA A C     1 
ATOM   685  O O     . ALA A 1 91  ? -13.510 30.372  18.888 1.00 46.81  ? 91  ALA A O     1 
ATOM   686  C CB    . ALA A 1 91  ? -11.545 29.372  16.466 1.00 21.96  ? 91  ALA A CB    1 
ATOM   687  N N     . LEU A 1 92  ? -13.922 28.287  18.205 1.00 52.29  ? 92  LEU A N     1 
ATOM   688  C CA    . LEU A 1 92  ? -15.311 28.400  18.585 1.00 52.29  ? 92  LEU A CA    1 
ATOM   689  C C     . LEU A 1 92  ? -15.670 27.416  19.667 1.00 52.29  ? 92  LEU A C     1 
ATOM   690  O O     . LEU A 1 92  ? -15.211 26.277  19.657 1.00 52.29  ? 92  LEU A O     1 
ATOM   691  C CB    . LEU A 1 92  ? -16.196 28.167  17.370 1.00 14.80  ? 92  LEU A CB    1 
ATOM   692  C CG    . LEU A 1 92  ? -15.730 29.038  16.214 1.00 14.80  ? 92  LEU A CG    1 
ATOM   693  C CD1   . LEU A 1 92  ? -16.558 28.788  14.977 1.00 14.80  ? 92  LEU A CD1   1 
ATOM   694  C CD2   . LEU A 1 92  ? -15.822 30.491  16.624 1.00 14.80  ? 92  LEU A CD2   1 
ATOM   695  N N     . PRO A 1 93  ? -16.480 27.852  20.638 1.00 54.20  ? 93  PRO A N     1 
ATOM   696  C CA    . PRO A 1 93  ? -16.913 26.983  21.739 1.00 54.20  ? 93  PRO A CA    1 
ATOM   697  C C     . PRO A 1 93  ? -17.777 25.866  21.147 1.00 54.20  ? 93  PRO A C     1 
ATOM   698  O O     . PRO A 1 93  ? -18.437 26.056  20.128 1.00 54.20  ? 93  PRO A O     1 
ATOM   699  C CB    . PRO A 1 93  ? -17.714 27.929  22.619 1.00 76.23  ? 93  PRO A CB    1 
ATOM   700  C CG    . PRO A 1 93  ? -17.031 29.269  22.378 1.00 76.23  ? 93  PRO A CG    1 
ATOM   701  C CD    . PRO A 1 93  ? -16.848 29.257  20.888 1.00 76.23  ? 93  PRO A CD    1 
ATOM   702  N N     . PRO A 1 94  ? -17.800 24.693  21.785 1.00 53.91  ? 94  PRO A N     1 
ATOM   703  C CA    . PRO A 1 94  ? -18.601 23.574  21.265 1.00 53.91  ? 94  PRO A CA    1 
ATOM   704  C C     . PRO A 1 94  ? -20.007 23.936  20.798 1.00 53.91  ? 94  PRO A C     1 
ATOM   705  O O     . PRO A 1 94  ? -20.451 23.492  19.734 1.00 53.91  ? 94  PRO A O     1 
ATOM   706  C CB    . PRO A 1 94  ? -18.604 22.575  22.424 1.00 67.53  ? 94  PRO A CB    1 
ATOM   707  C CG    . PRO A 1 94  ? -18.385 23.449  23.633 1.00 67.53  ? 94  PRO A CG    1 
ATOM   708  C CD    . PRO A 1 94  ? -17.353 24.432  23.161 1.00 67.53  ? 94  PRO A CD    1 
ATOM   709  N N     . ARG A 1 95  ? -20.697 24.748  21.597 1.00 58.65  ? 95  ARG A N     1 
ATOM   710  C CA    . ARG A 1 95  ? -22.060 25.187  21.291 1.00 58.65  ? 95  ARG A CA    1 
ATOM   711  C C     . ARG A 1 95  ? -22.134 25.875  19.935 1.00 58.65  ? 95  ARG A C     1 
ATOM   712  O O     . ARG A 1 95  ? -22.848 25.420  19.042 1.00 58.65  ? 95  ARG A O     1 
ATOM   713  C CB    . ARG A 1 95  ? -22.574 26.128  22.389 1.00 147.76 ? 95  ARG A CB    1 
ATOM   714  C CG    . ARG A 1 95  ? -21.482 26.883  23.136 1.00 147.76 ? 95  ARG A CG    1 
ATOM   715  C CD    . ARG A 1 95  ? -20.797 25.997  24.170 1.00 147.76 ? 95  ARG A CD    1 
ATOM   716  N NE    . ARG A 1 95  ? -19.531 26.566  24.623 1.00 147.76 ? 95  ARG A NE    1 
ATOM   717  C CZ    . ARG A 1 95  ? -18.768 26.036  25.574 1.00 147.76 ? 95  ARG A CZ    1 
ATOM   718  N NH1   . ARG A 1 95  ? -19.143 24.919  26.183 1.00 147.76 ? 95  ARG A NH1   1 
ATOM   719  N NH2   . ARG A 1 95  ? -17.622 26.618  25.912 1.00 147.76 ? 95  ARG A NH2   1 
ATOM   720  N N     . LEU A 1 96  ? -21.396 26.971  19.787 1.00 58.70  ? 96  LEU A N     1 
ATOM   721  C CA    . LEU A 1 96  ? -21.377 27.696  18.525 1.00 58.70  ? 96  LEU A CA    1 
ATOM   722  C C     . LEU A 1 96  ? -20.952 26.753  17.405 1.00 58.70  ? 96  LEU A C     1 
ATOM   723  O O     . LEU A 1 96  ? -21.577 26.732  16.349 1.00 58.70  ? 96  LEU A O     1 
ATOM   724  C CB    . LEU A 1 96  ? -20.426 28.898  18.588 1.00 84.35  ? 96  LEU A CB    1 
ATOM   725  C CG    . LEU A 1 96  ? -20.879 30.143  19.360 1.00 84.35  ? 96  LEU A CG    1 
ATOM   726  C CD1   . LEU A 1 96  ? -21.087 29.797  20.822 1.00 84.35  ? 96  LEU A CD1   1 
ATOM   727  C CD2   . LEU A 1 96  ? -19.838 31.248  19.217 1.00 84.35  ? 96  LEU A CD2   1 
ATOM   728  N N     . LEU A 1 97  ? -19.900 25.968  17.623 1.00 31.94  ? 97  LEU A N     1 
ATOM   729  C CA    . LEU A 1 97  ? -19.470 25.030  16.587 1.00 31.94  ? 97  LEU A CA    1 
ATOM   730  C C     . LEU A 1 97  ? -20.646 24.139  16.174 1.00 31.94  ? 97  LEU A C     1 
ATOM   731  O O     . LEU A 1 97  ? -21.173 24.282  15.074 1.00 31.94  ? 97  LEU A O     1 
ATOM   732  C CB    . LEU A 1 97  ? -18.328 24.134  17.080 1.00 31.90  ? 97  LEU A CB    1 
ATOM   733  C CG    . LEU A 1 97  ? -17.055 24.053  16.225 1.00 31.90  ? 97  LEU A CG    1 
ATOM   734  C CD1   . LEU A 1 97  ? -16.365 22.772  16.572 1.00 31.90  ? 97  LEU A CD1   1 
ATOM   735  C CD2   . LEU A 1 97  ? -17.339 24.088  14.748 1.00 31.90  ? 97  LEU A CD2   1 
ATOM   736  N N     . ALA A 1 98  ? -21.044 23.228  17.061 1.00 50.22  ? 98  ALA A N     1 
ATOM   737  C CA    . ALA A 1 98  ? -22.153 22.321  16.783 1.00 50.22  ? 98  ALA A CA    1 
ATOM   738  C C     . ALA A 1 98  ? -23.297 23.038  16.081 1.00 50.22  ? 98  ALA A C     1 
ATOM   739  O O     . ALA A 1 98  ? -23.808 22.540  15.080 1.00 50.22  ? 98  ALA A O     1 
ATOM   740  C CB    . ALA A 1 98  ? -22.652 21.680  18.062 1.00 26.46  ? 98  ALA A CB    1 
ATOM   741  N N     . ARG A 1 99  ? -23.709 24.196  16.597 1.00 48.99  ? 99  ARG A N     1 
ATOM   742  C CA    . ARG A 1 99  ? -24.776 24.943  15.946 1.00 48.99  ? 99  ARG A CA    1 
ATOM   743  C C     . ARG A 1 99  ? -24.291 25.381  14.571 1.00 48.99  ? 99  ARG A C     1 
ATOM   744  O O     . ARG A 1 99  ? -25.053 25.344  13.616 1.00 48.99  ? 99  ARG A O     1 
ATOM   745  C CB    . ARG A 1 99  ? -25.189 26.167  16.758 1.00 131.98 ? 99  ARG A CB    1 
ATOM   746  C CG    . ARG A 1 99  ? -26.271 26.988  16.069 1.00 131.98 ? 99  ARG A CG    1 
ATOM   747  C CD    . ARG A 1 99  ? -26.924 27.992  17.014 1.00 131.98 ? 99  ARG A CD    1 
ATOM   748  N NE    . ARG A 1 99  ? -27.915 28.827  16.333 1.00 131.98 ? 99  ARG A NE    1 
ATOM   749  C CZ    . ARG A 1 99  ? -28.662 29.753  16.931 1.00 131.98 ? 99  ARG A CZ    1 
ATOM   750  N NH1   . ARG A 1 99  ? -28.543 29.971  18.235 1.00 131.98 ? 99  ARG A NH1   1 
ATOM   751  N NH2   . ARG A 1 99  ? -29.528 30.466  16.222 1.00 131.98 ? 99  ARG A NH2   1 
ATOM   752  N N     . ALA A 1 100 ? -23.023 25.778  14.460 1.00 49.32  ? 100 ALA A N     1 
ATOM   753  C CA    . ALA A 1 100 ? -22.460 26.204  13.165 1.00 49.32  ? 100 ALA A CA    1 
ATOM   754  C C     . ALA A 1 100 ? -22.312 25.014  12.228 1.00 49.32  ? 100 ALA A C     1 
ATOM   755  O O     . ALA A 1 100 ? -22.819 25.012  11.104 1.00 49.32  ? 100 ALA A O     1 
ATOM   756  C CB    . ALA A 1 100 ? -21.099 26.861  13.352 1.00 11.49  ? 100 ALA A CB    1 
ATOM   757  N N     . LEU A 1 101 ? -21.583 24.011  12.691 1.00 50.26  ? 101 LEU A N     1 
ATOM   758  C CA    . LEU A 1 101 ? -21.391 22.833  11.892 1.00 50.26  ? 101 LEU A CA    1 
ATOM   759  C C     . LEU A 1 101 ? -22.770 22.529  11.355 1.00 50.26  ? 101 LEU A C     1 
ATOM   760  O O     . LEU A 1 101 ? -23.034 22.785  10.186 1.00 50.26  ? 101 LEU A O     1 
ATOM   761  C CB    . LEU A 1 101 ? -20.873 21.700  12.760 1.00 28.41  ? 101 LEU A CB    1 
ATOM   762  C CG    . LEU A 1 101 ? -19.511 22.016  13.385 1.00 28.41  ? 101 LEU A CG    1 
ATOM   763  C CD1   . LEU A 1 101 ? -19.412 21.344  14.743 1.00 28.41  ? 101 LEU A CD1   1 
ATOM   764  C CD2   . LEU A 1 101 ? -18.369 21.586  12.468 1.00 28.41  ? 101 LEU A CD2   1 
ATOM   765  N N     . LEU A 1 102 ? -23.654 22.041  12.223 1.00 59.52  ? 102 LEU A N     1 
ATOM   766  C CA    . LEU A 1 102 ? -25.037 21.690  11.866 1.00 59.52  ? 102 LEU A CA    1 
ATOM   767  C C     . LEU A 1 102 ? -25.771 22.680  10.923 1.00 59.52  ? 102 LEU A C     1 
ATOM   768  O O     . LEU A 1 102 ? -26.195 22.314  9.824  1.00 59.52  ? 102 LEU A O     1 
ATOM   769  C CB    . LEU A 1 102 ? -25.825 21.481  13.166 1.00 50.38  ? 102 LEU A CB    1 
ATOM   770  C CG    . LEU A 1 102 ? -27.313 21.126  13.262 1.00 50.38  ? 102 LEU A CG    1 
ATOM   771  C CD1   . LEU A 1 102 ? -27.599 20.682  14.684 1.00 50.38  ? 102 LEU A CD1   1 
ATOM   772  C CD2   . LEU A 1 102 ? -28.194 22.306  12.917 1.00 50.38  ? 102 LEU A CD2   1 
ATOM   773  N N     . GLU A 1 103 ? -25.934 23.929  11.335 1.00 28.79  ? 103 GLU A N     1 
ATOM   774  C CA    . GLU A 1 103 ? -26.602 24.866  10.466 1.00 28.79  ? 103 GLU A CA    1 
ATOM   775  C C     . GLU A 1 103 ? -25.589 25.246  9.390  1.00 28.79  ? 103 GLU A C     1 
ATOM   776  O O     . GLU A 1 103 ? -25.767 26.244  8.689  1.00 28.79  ? 103 GLU A O     1 
ATOM   777  C CB    . GLU A 1 103 ? -27.011 26.123  11.240 1.00 122.66 ? 103 GLU A CB    1 
ATOM   778  C CG    . GLU A 1 103 ? -27.798 25.881  12.529 1.00 122.66 ? 103 GLU A CG    1 
ATOM   779  C CD    . GLU A 1 103 ? -29.203 25.351  12.294 1.00 122.66 ? 103 GLU A CD    1 
ATOM   780  O OE1   . GLU A 1 103 ? -29.975 25.254  13.280 1.00 122.66 ? 103 GLU A OE1   1 
ATOM   781  O OE2   . GLU A 1 103 ? -29.531 25.031  11.130 1.00 122.66 ? 103 GLU A OE2   1 
ATOM   782  N N     . GLY A 1 104 ? -24.511 24.470  9.287  1.00 32.84  ? 104 GLY A N     1 
ATOM   783  C CA    . GLY A 1 104 ? -23.454 24.738  8.315  1.00 32.84  ? 104 GLY A CA    1 
ATOM   784  C C     . GLY A 1 104 ? -23.027 26.198  8.159  1.00 32.84  ? 104 GLY A C     1 
ATOM   785  O O     . GLY A 1 104 ? -23.184 26.777  7.078  1.00 32.84  ? 104 GLY A O     1 
ATOM   786  N N     . ASP A 1 105 ? -22.478 26.806  9.210  1.00 65.07  ? 105 ASP A N     1 
ATOM   787  C CA    . ASP A 1 105 ? -22.064 28.209  9.117  1.00 65.07  ? 105 ASP A CA    1 
ATOM   788  C C     . ASP A 1 105 ? -20.606 28.430  8.727  1.00 65.07  ? 105 ASP A C     1 
ATOM   789  O O     . ASP A 1 105 ? -19.719 28.503  9.574  1.00 65.07  ? 105 ASP A O     1 
ATOM   790  C CB    . ASP A 1 105 ? -22.337 28.945  10.433 1.00 90.71  ? 105 ASP A CB    1 
ATOM   791  C CG    . ASP A 1 105 ? -21.973 30.427  10.356 1.00 90.71  ? 105 ASP A CG    1 
ATOM   792  O OD1   . ASP A 1 105 ? -22.223 31.160  11.339 1.00 90.71  ? 105 ASP A OD1   1 
ATOM   793  O OD2   . ASP A 1 105 ? -21.438 30.857  9.311  1.00 90.71  ? 105 ASP A OD2   1 
ATOM   794  N N     . ALA A 1 106 ? -20.356 28.564  7.439  1.00 58.19  ? 106 ALA A N     1 
ATOM   795  C CA    . ALA A 1 106 ? -18.999 28.784  7.000  1.00 58.19  ? 106 ALA A CA    1 
ATOM   796  C C     . ALA A 1 106 ? -18.643 30.231  7.316  1.00 58.19  ? 106 ALA A C     1 
ATOM   797  O O     . ALA A 1 106 ? -17.481 30.579  7.540  1.00 58.19  ? 106 ALA A O     1 
ATOM   798  C CB    . ALA A 1 106 ? -18.898 28.525  5.526  1.00 29.71  ? 106 ALA A CB    1 
ATOM   799  N N     . ARG A 1 107 ? -19.662 31.078  7.340  1.00 199.73 ? 107 ARG A N     1 
ATOM   800  C CA    . ARG A 1 107 ? -19.475 32.492  7.626  1.00 199.73 ? 107 ARG A CA    1 
ATOM   801  C C     . ARG A 1 107 ? -18.973 32.672  9.057  1.00 199.73 ? 107 ARG A C     1 
ATOM   802  O O     . ARG A 1 107 ? -19.114 33.743  9.647  1.00 199.73 ? 107 ARG A O     1 
ATOM   803  C CB    . ARG A 1 107 ? -20.804 33.228  7.424  1.00 199.65 ? 107 ARG A CB    1 
ATOM   804  C CG    . ARG A 1 107 ? -21.448 32.938  6.067  1.00 199.65 ? 107 ARG A CG    1 
ATOM   805  C CD    . ARG A 1 107 ? -22.881 33.444  5.975  1.00 199.65 ? 107 ARG A CD    1 
ATOM   806  N NE    . ARG A 1 107 ? -23.529 33.014  4.737  1.00 199.65 ? 107 ARG A NE    1 
ATOM   807  C CZ    . ARG A 1 107 ? -23.743 31.744  4.400  1.00 199.65 ? 107 ARG A CZ    1 
ATOM   808  N NH1   . ARG A 1 107 ? -23.363 30.762  5.208  1.00 199.65 ? 107 ARG A NH1   1 
ATOM   809  N NH2   . ARG A 1 107 ? -24.336 31.454  3.250  1.00 199.65 ? 107 ARG A NH2   1 
ATOM   810  N N     . LEU A 1 108 ? -18.383 31.613  9.605  1.00 93.82  ? 108 LEU A N     1 
ATOM   811  C CA    . LEU A 1 108 ? -17.854 31.637  10.962 1.00 93.82  ? 108 LEU A CA    1 
ATOM   812  C C     . LEU A 1 108 ? -16.581 30.800  11.039 1.00 93.82  ? 108 LEU A C     1 
ATOM   813  O O     . LEU A 1 108 ? -15.509 31.311  11.351 1.00 93.82  ? 108 LEU A O     1 
ATOM   814  C CB    . LEU A 1 108 ? -18.887 31.078  11.945 1.00 25.44  ? 108 LEU A CB    1 
ATOM   815  C CG    . LEU A 1 108 ? -18.883 31.757  13.320 1.00 25.44  ? 108 LEU A CG    1 
ATOM   816  C CD1   . LEU A 1 108 ? -19.690 30.934  14.303 1.00 25.44  ? 108 LEU A CD1   1 
ATOM   817  C CD2   . LEU A 1 108 ? -17.439 31.921  13.818 1.00 25.44  ? 108 LEU A CD2   1 
ATOM   818  N N     . LEU A 1 109 ? -16.727 29.509  10.756 1.00 58.28  ? 109 LEU A N     1 
ATOM   819  C CA    . LEU A 1 109 ? -15.630 28.543  10.765 1.00 58.28  ? 109 LEU A CA    1 
ATOM   820  C C     . LEU A 1 109 ? -14.252 29.125  10.459 1.00 58.28  ? 109 LEU A C     1 
ATOM   821  O O     . LEU A 1 109 ? -13.271 28.811  11.121 1.00 58.28  ? 109 LEU A O     1 
ATOM   822  C CB    . LEU A 1 109 ? -15.936 27.433  9.758  1.00 16.55  ? 109 LEU A CB    1 
ATOM   823  C CG    . LEU A 1 109 ? -17.123 26.550  10.111 1.00 16.55  ? 109 LEU A CG    1 
ATOM   824  C CD1   . LEU A 1 109 ? -17.335 25.511  9.027  1.00 16.55  ? 109 LEU A CD1   1 
ATOM   825  C CD2   . LEU A 1 109 ? -16.867 25.900  11.474 1.00 16.55  ? 109 LEU A CD2   1 
ATOM   826  N N     . THR A 1 110 ? -14.190 29.959  9.433  1.00 36.31  ? 110 THR A N     1 
ATOM   827  C CA    . THR A 1 110 ? -12.962 30.598  8.999  1.00 36.31  ? 110 THR A CA    1 
ATOM   828  C C     . THR A 1 110 ? -12.095 31.198  10.128 1.00 36.31  ? 110 THR A C     1 
ATOM   829  O O     . THR A 1 110 ? -10.872 31.410  9.944  1.00 36.31  ? 110 THR A O     1 
ATOM   830  C CB    . THR A 1 110 ? -13.326 31.663  8.022  1.00 41.81  ? 110 THR A CB    1 
ATOM   831  O OG1   . THR A 1 110 ? -14.686 31.453  7.649  1.00 41.81  ? 110 THR A OG1   1 
ATOM   832  C CG2   . THR A 1 110 ? -12.471 31.581  6.782  1.00 41.81  ? 110 THR A CG2   1 
ATOM   833  N N     . SER A 1 111 ? -12.722 31.474  11.279 1.00 45.78  ? 111 SER A N     1 
ATOM   834  C CA    . SER A 1 111 ? -12.019 32.012  12.446 1.00 45.78  ? 111 SER A CA    1 
ATOM   835  C C     . SER A 1 111 ? -10.858 31.098  12.739 1.00 45.78  ? 111 SER A C     1 
ATOM   836  O O     . SER A 1 111 ? -9.722  31.550  12.867 1.00 45.78  ? 111 SER A O     1 
ATOM   837  C CB    . SER A 1 111 ? -12.924 32.046  13.667 1.00 38.93  ? 111 SER A CB    1 
ATOM   838  O OG    . SER A 1 111 ? -14.171 31.434  13.389 1.00 38.93  ? 111 SER A OG    1 
ATOM   839  N N     . ALA A 1 112 ? -11.155 29.806  12.841 1.00 32.19  ? 112 ALA A N     1 
ATOM   840  C CA    . ALA A 1 112 ? -10.132 28.798  13.089 1.00 32.19  ? 112 ALA A CA    1 
ATOM   841  C C     . ALA A 1 112 ? -9.001  29.059  12.119 1.00 32.19  ? 112 ALA A C     1 
ATOM   842  O O     . ALA A 1 112 ? -9.250  29.472  10.977 1.00 32.19  ? 112 ALA A O     1 
ATOM   843  C CB    . ALA A 1 112 ? -10.689 27.410  12.852 1.00 29.31  ? 112 ALA A CB    1 
ATOM   844  N N     . SER A 1 113 ? -7.766  28.820  12.557 1.00 40.96  ? 113 SER A N     1 
ATOM   845  C CA    . SER A 1 113 ? -6.627  29.059  11.677 1.00 40.96  ? 113 SER A CA    1 
ATOM   846  C C     . SER A 1 113 ? -6.394  27.877  10.747 1.00 40.96  ? 113 SER A C     1 
ATOM   847  O O     . SER A 1 113 ? -6.425  26.735  11.173 1.00 40.96  ? 113 SER A O     1 
ATOM   848  C CB    . SER A 1 113 ? -5.356  29.367  12.490 1.00 56.08  ? 113 SER A CB    1 
ATOM   849  O OG    . SER A 1 113 ? -4.892  28.252  13.225 1.00 56.08  ? 113 SER A OG    1 
ATOM   850  N N     . GLY A 1 114 ? -6.174  28.155  9.469  1.00 70.07  ? 114 GLY A N     1 
ATOM   851  C CA    . GLY A 1 114 ? -5.941  27.076  8.527  1.00 70.07  ? 114 GLY A CA    1 
ATOM   852  C C     . GLY A 1 114 ? -7.181  26.664  7.760  1.00 70.07  ? 114 GLY A C     1 
ATOM   853  O O     . GLY A 1 114 ? -7.083  25.958  6.751  1.00 70.07  ? 114 GLY A O     1 
ATOM   854  N N     . VAL A 1 115 ? -8.346  27.096  8.242  1.00 46.35  ? 115 VAL A N     1 
ATOM   855  C CA    . VAL A 1 115 ? -9.616  26.787  7.593  1.00 46.35  ? 115 VAL A CA    1 
ATOM   856  C C     . VAL A 1 115 ? -10.007 27.926  6.650  1.00 46.35  ? 115 VAL A C     1 
ATOM   857  O O     . VAL A 1 115 ? -10.697 28.855  7.050  1.00 46.35  ? 115 VAL A O     1 
ATOM   858  C CB    . VAL A 1 115 ? -10.756 26.642  8.614  1.00 49.25  ? 115 VAL A CB    1 
ATOM   859  C CG1   . VAL A 1 115 ? -11.879 25.846  8.009  1.00 49.25  ? 115 VAL A CG1   1 
ATOM   860  C CG2   . VAL A 1 115 ? -10.264 25.997  9.870  1.00 49.25  ? 115 VAL A CG2   1 
ATOM   861  N N     . GLY A 1 116 ? -9.556  27.867  5.405  1.00 71.01  ? 116 GLY A N     1 
ATOM   862  C CA    . GLY A 1 116 ? -9.925  28.911  4.470  1.00 71.01  ? 116 GLY A CA    1 
ATOM   863  C C     . GLY A 1 116 ? -11.416 28.830  4.188  1.00 71.01  ? 116 GLY A C     1 
ATOM   864  O O     . GLY A 1 116 ? -12.126 28.079  4.865  1.00 71.01  ? 116 GLY A O     1 
ATOM   865  N N     . ARG A 1 117 ? -11.903 29.599  3.211  1.00 54.46  ? 117 ARG A N     1 
ATOM   866  C CA    . ARG A 1 117 ? -13.323 29.550  2.870  1.00 54.46  ? 117 ARG A CA    1 
ATOM   867  C C     . ARG A 1 117 ? -13.623 28.120  2.451  1.00 54.46  ? 117 ARG A C     1 
ATOM   868  O O     . ARG A 1 117 ? -14.411 27.426  3.095  1.00 54.46  ? 117 ARG A O     1 
ATOM   869  C CB    . ARG A 1 117 ? -13.641 30.487  1.709  1.00 94.48  ? 117 ARG A CB    1 
ATOM   870  C CG    . ARG A 1 117 ? -15.087 30.412  1.238  1.00 94.48  ? 117 ARG A CG    1 
ATOM   871  C CD    . ARG A 1 117 ? -16.061 31.041  2.239  1.00 94.48  ? 117 ARG A CD    1 
ATOM   872  N NE    . ARG A 1 117 ? -17.451 30.946  1.782  1.00 94.48  ? 117 ARG A NE    1 
ATOM   873  C CZ    . ARG A 1 117 ? -18.491 31.532  2.374  1.00 94.48  ? 117 ARG A CZ    1 
ATOM   874  N NH1   . ARG A 1 117 ? -18.318 32.271  3.462  1.00 94.48  ? 117 ARG A NH1   1 
ATOM   875  N NH2   . ARG A 1 117 ? -19.710 31.374  1.874  1.00 94.48  ? 117 ARG A NH2   1 
ATOM   876  N N     . ARG A 1 118 ? -12.947 27.696  1.380  1.00 37.86  ? 118 ARG A N     1 
ATOM   877  C CA    . ARG A 1 118 ? -13.066 26.365  0.777  1.00 37.86  ? 118 ARG A CA    1 
ATOM   878  C C     . ARG A 1 118 ? -13.231 25.263  1.803  1.00 37.86  ? 118 ARG A C     1 
ATOM   879  O O     . ARG A 1 118 ? -14.299 24.679  1.917  1.00 37.86  ? 118 ARG A O     1 
ATOM   880  C CB    . ARG A 1 118 ? -11.840 26.074  -0.089 1.00 155.36 ? 118 ARG A CB    1 
ATOM   881  C CG    . ARG A 1 118 ? -11.509 27.172  -1.096 1.00 155.36 ? 118 ARG A CG    1 
ATOM   882  C CD    . ARG A 1 118 ? -10.998 28.442  -0.409 1.00 155.36 ? 118 ARG A CD    1 
ATOM   883  N NE    . ARG A 1 118 ? -9.773  28.207  0.350  1.00 155.36 ? 118 ARG A NE    1 
ATOM   884  C CZ    . ARG A 1 118 ? -8.592  27.938  -0.200 1.00 155.36 ? 118 ARG A CZ    1 
ATOM   885  N NH1   . ARG A 1 118 ? -8.467  27.873  -1.519 1.00 155.36 ? 118 ARG A NH1   1 
ATOM   886  N NH2   . ARG A 1 118 ? -7.535  27.727  0.570  1.00 155.36 ? 118 ARG A NH2   1 
ATOM   887  N N     . LEU A 1 119 ? -12.185 24.967  2.557  1.00 26.64  ? 119 LEU A N     1 
ATOM   888  C CA    . LEU A 1 119 ? -12.291 23.914  3.556  1.00 26.64  ? 119 LEU A CA    1 
ATOM   889  C C     . LEU A 1 119 ? -13.583 24.027  4.353  1.00 26.64  ? 119 LEU A C     1 
ATOM   890  O O     . LEU A 1 119 ? -14.457 23.170  4.241  1.00 26.64  ? 119 LEU A O     1 
ATOM   891  C CB    . LEU A 1 119 ? -11.106 23.956  4.512  1.00 12.04  ? 119 LEU A CB    1 
ATOM   892  C CG    . LEU A 1 119 ? -11.046 22.761  5.453  1.00 12.04  ? 119 LEU A CG    1 
ATOM   893  C CD1   . LEU A 1 119 ? -11.191 21.501  4.661  1.00 12.04  ? 119 LEU A CD1   1 
ATOM   894  C CD2   . LEU A 1 119 ? -9.721  22.776  6.213  1.00 12.04  ? 119 LEU A CD2   1 
ATOM   895  N N     . ALA A 1 120 ? -13.712 25.081  5.151  1.00 30.97  ? 120 ALA A N     1 
ATOM   896  C CA    . ALA A 1 120 ? -14.928 25.264  5.944  1.00 30.97  ? 120 ALA A CA    1 
ATOM   897  C C     . ALA A 1 120 ? -16.163 25.103  5.060  1.00 30.97  ? 120 ALA A C     1 
ATOM   898  O O     . ALA A 1 120 ? -17.104 24.382  5.402  1.00 30.97  ? 120 ALA A O     1 
ATOM   899  C CB    . ALA A 1 120 ? -14.936 26.631  6.581  1.00 38.86  ? 120 ALA A CB    1 
ATOM   900  N N     . GLU A 1 121 ? -16.146 25.793  3.925  1.00 54.28  ? 121 GLU A N     1 
ATOM   901  C CA    . GLU A 1 121 ? -17.241 25.742  2.970  1.00 54.28  ? 121 GLU A CA    1 
ATOM   902  C C     . GLU A 1 121 ? -17.557 24.285  2.686  1.00 54.28  ? 121 GLU A C     1 
ATOM   903  O O     . GLU A 1 121 ? -18.715 23.873  2.745  1.00 54.28  ? 121 GLU A O     1 
ATOM   904  C CB    . GLU A 1 121 ? -16.842 26.442  1.672  1.00 64.97  ? 121 GLU A CB    1 
ATOM   905  C CG    . GLU A 1 121 ? -17.966 26.717  0.680  1.00 64.97  ? 121 GLU A CG    1 
ATOM   906  C CD    . GLU A 1 121 ? -18.877 27.858  1.115  1.00 64.97  ? 121 GLU A CD    1 
ATOM   907  O OE1   . GLU A 1 121 ? -19.819 27.606  1.907  1.00 64.97  ? 121 GLU A OE1   1 
ATOM   908  O OE2   . GLU A 1 121 ? -18.646 29.009  0.668  1.00 64.97  ? 121 GLU A OE2   1 
ATOM   909  N N     . ARG A 1 122 ? -16.535 23.493  2.381  1.00 25.43  ? 122 ARG A N     1 
ATOM   910  C CA    . ARG A 1 122 ? -16.783 22.084  2.111  1.00 25.43  ? 122 ARG A CA    1 
ATOM   911  C C     . ARG A 1 122 ? -16.546 21.218  3.323  1.00 25.43  ? 122 ARG A C     1 
ATOM   912  O O     . ARG A 1 122 ? -16.008 20.135  3.201  1.00 25.43  ? 122 ARG A O     1 
ATOM   913  C CB    . ARG A 1 122 ? -15.941 21.571  0.948  1.00 77.58  ? 122 ARG A CB    1 
ATOM   914  C CG    . ARG A 1 122 ? -14.463 21.612  1.169  1.00 77.58  ? 122 ARG A CG    1 
ATOM   915  C CD    . ARG A 1 122 ? -13.817 20.493  0.393  1.00 77.58  ? 122 ARG A CD    1 
ATOM   916  N NE    . ARG A 1 122 ? -13.963 19.241  1.118  1.00 77.58  ? 122 ARG A NE    1 
ATOM   917  C CZ    . ARG A 1 122 ? -12.982 18.656  1.798  1.00 77.58  ? 122 ARG A CZ    1 
ATOM   918  N NH1   . ARG A 1 122 ? -11.768 19.206  1.838  1.00 77.58  ? 122 ARG A NH1   1 
ATOM   919  N NH2   . ARG A 1 122 ? -13.225 17.530  2.458  1.00 77.58  ? 122 ARG A NH2   1 
ATOM   920  N N     . ILE A 1 123 ? -16.934 21.729  4.487  1.00 34.18  ? 123 ILE A N     1 
ATOM   921  C CA    . ILE A 1 123 ? -16.831 21.009  5.747  1.00 34.18  ? 123 ILE A CA    1 
ATOM   922  C C     . ILE A 1 123 ? -18.265 20.961  6.224  1.00 34.18  ? 123 ILE A C     1 
ATOM   923  O O     . ILE A 1 123 ? -18.731 19.959  6.784  1.00 34.18  ? 123 ILE A O     1 
ATOM   924  C CB    . ILE A 1 123 ? -15.981 21.765  6.817  1.00 24.40  ? 123 ILE A CB    1 
ATOM   925  C CG1   . ILE A 1 123 ? -14.493 21.512  6.563  1.00 24.40  ? 123 ILE A CG1   1 
ATOM   926  C CG2   . ILE A 1 123 ? -16.368 21.315  8.248  1.00 24.40  ? 123 ILE A CG2   1 
ATOM   927  C CD1   . ILE A 1 123 ? -13.578 22.017  7.647  1.00 24.40  ? 123 ILE A CD1   1 
ATOM   928  N N     . ALA A 1 124 ? -18.967 22.064  5.998  1.00 34.54  ? 124 ALA A N     1 
ATOM   929  C CA    . ALA A 1 124 ? -20.356 22.142  6.401  1.00 34.54  ? 124 ALA A CA    1 
ATOM   930  C C     . ALA A 1 124 ? -21.136 21.169  5.534  1.00 34.54  ? 124 ALA A C     1 
ATOM   931  O O     . ALA A 1 124 ? -21.912 20.346  6.041  1.00 34.54  ? 124 ALA A O     1 
ATOM   932  C CB    . ALA A 1 124 ? -20.868 23.540  6.221  1.00 8.99   ? 124 ALA A CB    1 
ATOM   933  N N     . LEU A 1 125 ? -20.917 21.271  4.225  1.00 28.20  ? 125 LEU A N     1 
ATOM   934  C CA    . LEU A 1 125 ? -21.575 20.393  3.279  1.00 28.20  ? 125 LEU A CA    1 
ATOM   935  C C     . LEU A 1 125 ? -21.286 18.968  3.693  1.00 28.20  ? 125 LEU A C     1 
ATOM   936  O O     . LEU A 1 125 ? -22.182 18.142  3.791  1.00 28.20  ? 125 LEU A O     1 
ATOM   937  C CB    . LEU A 1 125 ? -21.042 20.613  1.861  1.00 14.26  ? 125 LEU A CB    1 
ATOM   938  C CG    . LEU A 1 125 ? -21.533 19.718  0.705  1.00 14.26  ? 125 LEU A CG    1 
ATOM   939  C CD1   . LEU A 1 125 ? -20.768 20.060  -0.565 1.00 14.26  ? 125 LEU A CD1   1 
ATOM   940  C CD2   . LEU A 1 125 ? -21.332 18.247  0.999  1.00 14.26  ? 125 LEU A CD2   1 
ATOM   941  N N     . GLU A 1 126 ? -20.030 18.661  3.942  1.00 34.21  ? 126 GLU A N     1 
ATOM   942  C CA    . GLU A 1 126 ? -19.721 17.294  4.293  1.00 34.21  ? 126 GLU A CA    1 
ATOM   943  C C     . GLU A 1 126 ? -20.485 16.821  5.520  1.00 34.21  ? 126 GLU A C     1 
ATOM   944  O O     . GLU A 1 126 ? -20.822 15.651  5.631  1.00 34.21  ? 126 GLU A O     1 
ATOM   945  C CB    . GLU A 1 126 ? -18.226 17.137  4.534  1.00 69.01  ? 126 GLU A CB    1 
ATOM   946  C CG    . GLU A 1 126 ? -17.654 15.860  3.963  1.00 69.01  ? 126 GLU A CG    1 
ATOM   947  C CD    . GLU A 1 126 ? -17.423 15.966  2.480  1.00 69.01  ? 126 GLU A CD    1 
ATOM   948  O OE1   . GLU A 1 126 ? -18.408 16.150  1.739  1.00 69.01  ? 126 GLU A OE1   1 
ATOM   949  O OE2   . GLU A 1 126 ? -16.251 15.878  2.055  1.00 69.01  ? 126 GLU A OE2   1 
ATOM   950  N N     . LEU A 1 127 ? -20.780 17.728  6.433  1.00 22.16  ? 127 LEU A N     1 
ATOM   951  C CA    . LEU A 1 127 ? -21.449 17.325  7.652  1.00 22.16  ? 127 LEU A CA    1 
ATOM   952  C C     . LEU A 1 127 ? -22.938 17.656  7.747  1.00 22.16  ? 127 LEU A C     1 
ATOM   953  O O     . LEU A 1 127 ? -23.569 17.527  8.835  1.00 22.16  ? 127 LEU A O     1 
ATOM   954  C CB    . LEU A 1 127 ? -20.730 17.946  8.827  1.00 22.27  ? 127 LEU A CB    1 
ATOM   955  C CG    . LEU A 1 127 ? -19.339 17.455  9.165  1.00 22.27  ? 127 LEU A CG    1 
ATOM   956  C CD1   . LEU A 1 127 ? -18.861 18.285  10.362 1.00 22.27  ? 127 LEU A CD1   1 
ATOM   957  C CD2   . LEU A 1 127 ? -19.359 15.947  9.464  1.00 22.27  ? 127 LEU A CD2   1 
ATOM   958  N N     . LYS A 1 128 ? -23.490 18.103  6.616  1.00 70.09  ? 128 LYS A N     1 
ATOM   959  C CA    . LYS A 1 128 ? -24.902 18.441  6.529  1.00 70.09  ? 128 LYS A CA    1 
ATOM   960  C C     . LYS A 1 128 ? -25.675 17.375  7.268  1.00 70.09  ? 128 LYS A C     1 
ATOM   961  O O     . LYS A 1 128 ? -25.706 16.216  6.848  1.00 70.09  ? 128 LYS A O     1 
ATOM   962  C CB    . LYS A 1 128 ? -25.381 18.452  5.080  1.00 104.62 ? 128 LYS A CB    1 
ATOM   963  C CG    . LYS A 1 128 ? -25.101 19.715  4.316  1.00 104.62 ? 128 LYS A CG    1 
ATOM   964  C CD    . LYS A 1 128 ? -25.987 19.785  3.088  1.00 104.62 ? 128 LYS A CD    1 
ATOM   965  C CE    . LYS A 1 128 ? -25.855 21.129  2.418  1.00 43.84  ? 128 LYS A CE    1 
ATOM   966  N NZ    . LYS A 1 128 ? -27.066 21.502  1.627  1.00 43.84  ? 128 LYS A NZ    1 
ATOM   967  N N     . GLY A 1 129 ? -26.285 17.771  8.375  1.00 65.72  ? 129 GLY A N     1 
ATOM   968  C CA    . GLY A 1 129 ? -27.059 16.826  9.142  1.00 65.72  ? 129 GLY A CA    1 
ATOM   969  C C     . GLY A 1 129 ? -26.282 15.605  9.586  1.00 65.72  ? 129 GLY A C     1 
ATOM   970  O O     . GLY A 1 129 ? -26.652 14.454  9.281  1.00 65.72  ? 129 GLY A O     1 
ATOM   971  N N     . LYS A 1 130 ? -25.180 15.860  10.284 1.00 23.87  ? 130 LYS A N     1 
ATOM   972  C CA    . LYS A 1 130 ? -24.373 14.780  10.840 1.00 23.87  ? 130 LYS A CA    1 
ATOM   973  C C     . LYS A 1 130 ? -24.101 15.276  12.237 1.00 23.87  ? 130 LYS A C     1 
ATOM   974  O O     . LYS A 1 130 ? -23.692 14.536  13.104 1.00 23.87  ? 130 LYS A O     1 
ATOM   975  C CB    . LYS A 1 130 ? -23.083 14.594  10.061 1.00 78.03  ? 130 LYS A CB    1 
ATOM   976  C CG    . LYS A 1 130 ? -23.279 14.000  8.682  1.00 78.03  ? 130 LYS A CG    1 
ATOM   977  C CD    . LYS A 1 130 ? -23.815 12.589  8.743  1.00 78.03  ? 130 LYS A CD    1 
ATOM   978  C CE    . LYS A 1 130 ? -23.709 11.921  7.367  1.00 78.03  ? 130 LYS A CE    1 
ATOM   979  N NZ    . LYS A 1 130 ? -24.288 10.530  7.323  1.00 78.03  ? 130 LYS A NZ    1 
ATOM   980  N N     . VAL A 1 131 ? -24.359 16.556  12.438 1.00 43.39  ? 131 VAL A N     1 
ATOM   981  C CA    . VAL A 1 131 ? -24.165 17.172  13.728 1.00 43.39  ? 131 VAL A CA    1 
ATOM   982  C C     . VAL A 1 131 ? -25.386 16.798  14.547 1.00 43.39  ? 131 VAL A C     1 
ATOM   983  O O     . VAL A 1 131 ? -26.467 17.345  14.316 1.00 43.39  ? 131 VAL A O     1 
ATOM   984  C CB    . VAL A 1 131 ? -24.127 18.706  13.604 1.00 63.51  ? 131 VAL A CB    1 
ATOM   985  C CG1   . VAL A 1 131 ? -23.644 19.327  14.898 1.00 63.51  ? 131 VAL A CG1   1 
ATOM   986  C CG2   . VAL A 1 131 ? -23.250 19.109  12.441 1.00 63.51  ? 131 VAL A CG2   1 
ATOM   987  N N     . PRO A 1 132 ? -25.235 15.867  15.513 1.00 70.87  ? 132 PRO A N     1 
ATOM   988  C CA    . PRO A 1 132 ? -26.267 15.353  16.423 1.00 70.87  ? 132 PRO A CA    1 
ATOM   989  C C     . PRO A 1 132 ? -26.881 16.409  17.339 1.00 70.87  ? 132 PRO A C     1 
ATOM   990  O O     . PRO A 1 132 ? -26.163 17.126  18.033 1.00 70.87  ? 132 PRO A O     1 
ATOM   991  C CB    . PRO A 1 132 ? -25.524 14.299  17.226 1.00 43.10  ? 132 PRO A CB    1 
ATOM   992  C CG    . PRO A 1 132 ? -24.520 13.828  16.287 1.00 43.10  ? 132 PRO A CG    1 
ATOM   993  C CD    . PRO A 1 132 ? -23.993 15.113  15.712 1.00 43.10  ? 132 PRO A CD    1 
ATOM   994  N N     . PRO A 1 133 ? -28.225 16.478  17.380 1.00 43.51  ? 133 PRO A N     1 
ATOM   995  C CA    . PRO A 1 133 ? -29.017 17.412  18.179 1.00 43.51  ? 133 PRO A CA    1 
ATOM   996  C C     . PRO A 1 133 ? -28.371 17.854  19.496 1.00 43.51  ? 133 PRO A C     1 
ATOM   997  O O     . PRO A 1 133 ? -28.301 19.038  19.803 1.00 43.51  ? 133 PRO A O     1 
ATOM   998  C CB    . PRO A 1 133 ? -30.304 16.635  18.391 1.00 64.59  ? 133 PRO A CB    1 
ATOM   999  C CG    . PRO A 1 133 ? -30.458 15.943  17.089 1.00 64.59  ? 133 PRO A CG    1 
ATOM   1000 C CD    . PRO A 1 133 ? -29.089 15.400  16.859 1.00 64.59  ? 133 PRO A CD    1 
ATOM   1001 N N     . HIS A 1 134 ? -27.916 16.879  20.264 1.00 45.89  ? 134 HIS A N     1 
ATOM   1002 C CA    . HIS A 1 134 ? -27.269 17.106  21.547 1.00 45.89  ? 134 HIS A CA    1 
ATOM   1003 C C     . HIS A 1 134 ? -26.329 18.338  21.558 1.00 45.89  ? 134 HIS A C     1 
ATOM   1004 O O     . HIS A 1 134 ? -25.107 18.200  21.647 1.00 45.89  ? 134 HIS A O     1 
ATOM   1005 C CB    . HIS A 1 134 ? -26.492 15.828  21.887 1.00 97.01  ? 134 HIS A CB    1 
ATOM   1006 C CG    . HIS A 1 134 ? -25.911 15.809  23.263 1.00 97.01  ? 134 HIS A CG    1 
ATOM   1007 N ND1   . HIS A 1 134 ? -25.293 16.905  23.827 1.00 97.01  ? 134 HIS A ND1   1 
ATOM   1008 C CD2   . HIS A 1 134 ? -25.795 14.805  24.163 1.00 97.01  ? 134 HIS A CD2   1 
ATOM   1009 C CE1   . HIS A 1 134 ? -24.818 16.575  25.015 1.00 97.01  ? 134 HIS A CE1   1 
ATOM   1010 N NE2   . HIS A 1 134 ? -25.109 15.306  25.243 1.00 97.01  ? 134 HIS A NE2   1 
ATOM   1011 N N     . LEU A 1 135 ? -26.874 19.544  21.477 1.00 157.51 ? 135 LEU A N     1 
ATOM   1012 C CA    . LEU A 1 135 ? -26.004 20.715  21.473 1.00 157.51 ? 135 LEU A CA    1 
ATOM   1013 C C     . LEU A 1 135 ? -26.333 21.776  22.525 1.00 157.51 ? 135 LEU A C     1 
ATOM   1014 O O     . LEU A 1 135 ? -25.412 22.136  23.289 1.00 157.51 ? 135 LEU A O     1 
ATOM   1015 C CB    . LEU A 1 135 ? -25.955 21.335  20.063 1.00 73.11  ? 135 LEU A CB    1 
ATOM   1016 C CG    . LEU A 1 135 ? -27.217 21.669  19.241 1.00 73.11  ? 135 LEU A CG    1 
ATOM   1017 C CD1   . LEU A 1 135 ? -28.031 22.742  19.935 1.00 73.11  ? 135 LEU A CD1   1 
ATOM   1018 C CD2   . LEU A 1 135 ? -26.827 22.170  17.842 1.00 73.11  ? 135 LEU A CD2   1 
ATOM   1019 N N     . MET B 1 1   ? 2.734   8.952   22.026 1.00 20.36  ? 1   MET B N     1 
ATOM   1020 C CA    . MET B 1 1   ? 1.771   8.802   23.135 1.00 20.36  ? 1   MET B CA    1 
ATOM   1021 C C     . MET B 1 1   ? 2.584   8.644   24.396 1.00 20.36  ? 1   MET B C     1 
ATOM   1022 O O     . MET B 1 1   ? 2.467   9.471   25.304 1.00 20.36  ? 1   MET B O     1 
ATOM   1023 C CB    . MET B 1 1   ? 0.904   7.581   22.890 1.00 50.62  ? 1   MET B CB    1 
ATOM   1024 C CG    . MET B 1 1   ? -0.291  7.466   23.795 1.00 50.62  ? 1   MET B CG    1 
ATOM   1025 S SD    . MET B 1 1   ? -1.182  6.063   23.215 1.00 50.62  ? 1   MET B SD    1 
ATOM   1026 C CE    . MET B 1 1   ? -0.405  4.718   24.151 1.00 50.62  ? 1   MET B CE    1 
ATOM   1027 N N     . ILE B 1 2   ? 3.394   7.588   24.470 1.00 4.67   ? 2   ILE B N     1 
ATOM   1028 C CA    . ILE B 1 2   ? 4.275   7.445   25.635 1.00 4.67   ? 2   ILE B CA    1 
ATOM   1029 C C     . ILE B 1 2   ? 5.429   8.457   25.512 1.00 4.67   ? 2   ILE B C     1 
ATOM   1030 O O     . ILE B 1 2   ? 6.197   8.438   24.531 1.00 4.67   ? 2   ILE B O     1 
ATOM   1031 C CB    . ILE B 1 2   ? 4.987   6.090   25.747 1.00 3.51   ? 2   ILE B CB    1 
ATOM   1032 C CG1   . ILE B 1 2   ? 4.008   4.923   25.668 1.00 3.51   ? 2   ILE B CG1   1 
ATOM   1033 C CG2   . ILE B 1 2   ? 5.727   6.064   27.061 1.00 3.51   ? 2   ILE B CG2   1 
ATOM   1034 C CD1   . ILE B 1 2   ? 2.639   5.285   26.133 1.00 3.51   ? 2   ILE B CD1   1 
ATOM   1035 N N     . ARG B 1 3   ? 5.546   9.346   26.492 1.00 36.81  ? 3   ARG B N     1 
ATOM   1036 C CA    . ARG B 1 3   ? 6.614   10.317  26.444 1.00 36.81  ? 3   ARG B CA    1 
ATOM   1037 C C     . ARG B 1 3   ? 7.507   10.178  27.642 1.00 36.81  ? 3   ARG B C     1 
ATOM   1038 O O     . ARG B 1 3   ? 8.711   10.371  27.530 1.00 36.81  ? 3   ARG B O     1 
ATOM   1039 C CB    . ARG B 1 3   ? 6.078   11.731  26.390 1.00 42.19  ? 3   ARG B CB    1 
ATOM   1040 C CG    . ARG B 1 3   ? 7.157   12.770  26.549 1.00 42.19  ? 3   ARG B CG    1 
ATOM   1041 C CD    . ARG B 1 3   ? 6.558   14.149  26.554 1.00 42.19  ? 3   ARG B CD    1 
ATOM   1042 N NE    . ARG B 1 3   ? 6.122   14.511  25.219 1.00 42.19  ? 3   ARG B NE    1 
ATOM   1043 C CZ    . ARG B 1 3   ? 6.954   14.942  24.285 1.00 42.19  ? 3   ARG B CZ    1 
ATOM   1044 N NH1   . ARG B 1 3   ? 8.247   15.069  24.563 1.00 42.19  ? 3   ARG B NH1   1 
ATOM   1045 N NH2   . ARG B 1 3   ? 6.508   15.214  23.069 1.00 42.19  ? 3   ARG B NH2   1 
ATOM   1046 N N     . TYR B 1 4   ? 6.926   9.841   28.787 1.00 10.27  ? 4   TYR B N     1 
ATOM   1047 C CA    . TYR B 1 4   ? 7.699   9.680   30.004 1.00 10.27  ? 4   TYR B CA    1 
ATOM   1048 C C     . TYR B 1 4   ? 7.482   8.307   30.636 1.00 10.27  ? 4   TYR B C     1 
ATOM   1049 O O     . TYR B 1 4   ? 6.450   7.689   30.401 1.00 10.27  ? 4   TYR B O     1 
ATOM   1050 C CB    . TYR B 1 4   ? 7.299   10.758  30.965 1.00 24.57  ? 4   TYR B CB    1 
ATOM   1051 C CG    . TYR B 1 4   ? 8.014   10.682  32.268 1.00 24.57  ? 4   TYR B CG    1 
ATOM   1052 C CD1   . TYR B 1 4   ? 7.350   10.265  33.408 1.00 24.57  ? 4   TYR B CD1   1 
ATOM   1053 C CD2   . TYR B 1 4   ? 9.346   11.073  32.380 1.00 24.57  ? 4   TYR B CD2   1 
ATOM   1054 C CE1   . TYR B 1 4   ? 7.976   10.245  34.631 1.00 24.57  ? 4   TYR B CE1   1 
ATOM   1055 C CE2   . TYR B 1 4   ? 9.988   11.055  33.608 1.00 24.57  ? 4   TYR B CE2   1 
ATOM   1056 C CZ    . TYR B 1 4   ? 9.285   10.640  34.730 1.00 24.57  ? 4   TYR B CZ    1 
ATOM   1057 O OH    . TYR B 1 4   ? 9.874   10.637  35.967 1.00 24.57  ? 4   TYR B OH    1 
ATOM   1058 N N     . LEU B 1 5   ? 8.452   7.831   31.428 1.00 48.72  ? 5   LEU B N     1 
ATOM   1059 C CA    . LEU B 1 5   ? 8.390   6.516   32.101 1.00 48.72  ? 5   LEU B CA    1 
ATOM   1060 C C     . LEU B 1 5   ? 9.378   6.375   33.254 1.00 48.72  ? 5   LEU B C     1 
ATOM   1061 O O     . LEU B 1 5   ? 10.501  6.876   33.183 1.00 48.72  ? 5   LEU B O     1 
ATOM   1062 C CB    . LEU B 1 5   ? 8.702   5.385   31.122 1.00 7.77   ? 5   LEU B CB    1 
ATOM   1063 C CG    . LEU B 1 5   ? 7.707   5.057   30.015 1.00 7.77   ? 5   LEU B CG    1 
ATOM   1064 C CD1   . LEU B 1 5   ? 8.204   3.886   29.148 1.00 7.77   ? 5   LEU B CD1   1 
ATOM   1065 C CD2   . LEU B 1 5   ? 6.387   4.726   30.672 1.00 7.77   ? 5   LEU B CD2   1 
ATOM   1066 N N     . ARG B 1 6   ? 8.970   5.669   34.302 1.00 66.29  ? 6   ARG B N     1 
ATOM   1067 C CA    . ARG B 1 6   ? 9.845   5.437   35.453 1.00 66.29  ? 6   ARG B CA    1 
ATOM   1068 C C     . ARG B 1 6   ? 9.959   3.938   35.715 1.00 66.29  ? 6   ARG B C     1 
ATOM   1069 O O     . ARG B 1 6   ? 8.950   3.237   35.709 1.00 66.29  ? 6   ARG B O     1 
ATOM   1070 C CB    . ARG B 1 6   ? 9.295   6.122   36.709 1.00 55.29  ? 6   ARG B CB    1 
ATOM   1071 C CG    . ARG B 1 6   ? 9.779   7.544   36.916 1.00 55.29  ? 6   ARG B CG    1 
ATOM   1072 C CD    . ARG B 1 6   ? 11.289  7.590   37.086 1.00 55.29  ? 6   ARG B CD    1 
ATOM   1073 N NE    . ARG B 1 6   ? 11.738  7.995   38.425 1.00 55.29  ? 6   ARG B NE    1 
ATOM   1074 C CZ    . ARG B 1 6   ? 11.205  7.571   39.577 1.00 55.29  ? 6   ARG B CZ    1 
ATOM   1075 N NH1   . ARG B 1 6   ? 10.171  6.725   39.585 1.00 55.29  ? 6   ARG B NH1   1 
ATOM   1076 N NH2   . ARG B 1 6   ? 11.740  7.957   40.734 1.00 55.29  ? 6   ARG B NH2   1 
ATOM   1077 N N     . GLY B 1 7   ? 11.174  3.445   35.951 1.00 44.35  ? 7   GLY B N     1 
ATOM   1078 C CA    . GLY B 1 7   ? 11.356  2.024   36.216 1.00 44.35  ? 7   GLY B CA    1 
ATOM   1079 C C     . GLY B 1 7   ? 12.819  1.680   36.358 1.00 44.35  ? 7   GLY B C     1 
ATOM   1080 O O     . GLY B 1 7   ? 13.655  2.560   36.239 1.00 44.35  ? 7   GLY B O     1 
ATOM   1081 N N     . LEU B 1 8   ? 13.144  0.413   36.593 1.00 37.64  ? 8   LEU B N     1 
ATOM   1082 C CA    . LEU B 1 8   ? 14.548  0.019   36.774 1.00 37.64  ? 8   LEU B CA    1 
ATOM   1083 C C     . LEU B 1 8   ? 15.286  -0.133  35.482 1.00 37.64  ? 8   LEU B C     1 
ATOM   1084 O O     . LEU B 1 8   ? 14.693  -0.397  34.456 1.00 37.64  ? 8   LEU B O     1 
ATOM   1085 C CB    . LEU B 1 8   ? 14.669  -1.318  37.498 1.00 58.96  ? 8   LEU B CB    1 
ATOM   1086 C CG    . LEU B 1 8   ? 14.093  -1.524  38.890 1.00 58.96  ? 8   LEU B CG    1 
ATOM   1087 C CD1   . LEU B 1 8   ? 14.635  -2.846  39.386 1.00 58.96  ? 8   LEU B CD1   1 
ATOM   1088 C CD2   . LEU B 1 8   ? 14.471  -0.390  39.837 1.00 58.96  ? 8   LEU B CD2   1 
ATOM   1089 N N     . VAL B 1 9   ? 16.595  -0.018  35.535 1.00 42.18  ? 9   VAL B N     1 
ATOM   1090 C CA    . VAL B 1 9   ? 17.353  -0.171  34.324 1.00 42.18  ? 9   VAL B CA    1 
ATOM   1091 C C     . VAL B 1 9   ? 17.655  -1.643  34.009 1.00 42.18  ? 9   VAL B C     1 
ATOM   1092 O O     . VAL B 1 9   ? 18.677  -1.955  33.377 1.00 42.18  ? 9   VAL B O     1 
ATOM   1093 C CB    . VAL B 1 9   ? 18.640  0.597   34.424 1.00 39.30  ? 9   VAL B CB    1 
ATOM   1094 C CG1   . VAL B 1 9   ? 19.247  0.767   33.029 1.00 39.30  ? 9   VAL B CG1   1 
ATOM   1095 C CG2   . VAL B 1 9   ? 18.371  1.926   35.089 1.00 39.30  ? 9   VAL B CG2   1 
ATOM   1096 N N     . LEU B 1 10  ? 16.757  -2.533  34.439 1.00 29.10  ? 10  LEU B N     1 
ATOM   1097 C CA    . LEU B 1 10  ? 16.862  -3.982  34.230 1.00 29.10  ? 10  LEU B CA    1 
ATOM   1098 C C     . LEU B 1 10  ? 18.075  -4.569  33.505 1.00 29.10  ? 10  LEU B C     1 
ATOM   1099 O O     . LEU B 1 10  ? 18.643  -5.536  33.976 1.00 29.10  ? 10  LEU B O     1 
ATOM   1100 C CB    . LEU B 1 10  ? 15.632  -4.496  33.525 1.00 24.94  ? 10  LEU B CB    1 
ATOM   1101 C CG    . LEU B 1 10  ? 15.336  -5.862  34.109 1.00 24.94  ? 10  LEU B CG    1 
ATOM   1102 C CD1   . LEU B 1 10  ? 14.334  -5.617  35.200 1.00 24.94  ? 10  LEU B CD1   1 
ATOM   1103 C CD2   . LEU B 1 10  ? 14.794  -6.853  33.087 1.00 24.94  ? 10  LEU B CD2   1 
ATOM   1104 N N     . LYS B 1 11  ? 18.450  -4.045  32.348 1.00 30.71  ? 11  LYS B N     1 
ATOM   1105 C CA    . LYS B 1 11  ? 19.614  -4.559  31.658 1.00 30.71  ? 11  LYS B CA    1 
ATOM   1106 C C     . LYS B 1 11  ? 19.966  -3.600  30.554 1.00 30.71  ? 11  LYS B C     1 
ATOM   1107 O O     . LYS B 1 11  ? 19.087  -3.194  29.797 1.00 30.71  ? 11  LYS B O     1 
ATOM   1108 C CB    . LYS B 1 11  ? 19.335  -5.924  31.074 1.00 56.03  ? 11  LYS B CB    1 
ATOM   1109 C CG    . LYS B 1 11  ? 20.608  -6.743  30.882 1.00 56.03  ? 11  LYS B CG    1 
ATOM   1110 C CD    . LYS B 1 11  ? 20.705  -7.985  31.836 1.00 56.03  ? 11  LYS B CD    1 
ATOM   1111 C CE    . LYS B 1 11  ? 20.971  -7.652  33.326 1.00 56.03  ? 11  LYS B CE    1 
ATOM   1112 N NZ    . LYS B 1 11  ? 22.423  -7.460  33.663 1.00 56.03  ? 11  LYS B NZ    1 
ATOM   1113 N N     . LYS B 1 12  ? 21.249  -3.232  30.461 1.00 36.97  ? 12  LYS B N     1 
ATOM   1114 C CA    . LYS B 1 12  ? 21.728  -2.281  29.449 1.00 36.97  ? 12  LYS B CA    1 
ATOM   1115 C C     . LYS B 1 12  ? 22.118  -2.914  28.142 1.00 36.97  ? 12  LYS B C     1 
ATOM   1116 O O     . LYS B 1 12  ? 21.866  -4.088  27.917 1.00 36.97  ? 12  LYS B O     1 
ATOM   1117 C CB    . LYS B 1 12  ? 22.922  -1.495  29.963 1.00 34.51  ? 12  LYS B CB    1 
ATOM   1118 C CG    . LYS B 1 12  ? 22.606  -0.595  31.146 1.00 34.51  ? 12  LYS B CG    1 
ATOM   1119 C CD    . LYS B 1 12  ? 23.810  0.261   31.515 1.00 34.51  ? 12  LYS B CD    1 
ATOM   1120 C CE    . LYS B 1 12  ? 24.306  1.041   30.287 1.00 34.51  ? 12  LYS B CE    1 
ATOM   1121 N NZ    . LYS B 1 12  ? 25.506  1.901   30.518 1.00 34.51  ? 12  LYS B NZ    1 
ATOM   1122 N N     . GLU B 1 13  ? 22.744  -2.130  27.277 1.00 61.99  ? 13  GLU B N     1 
ATOM   1123 C CA    . GLU B 1 13  ? 23.145  -2.641  25.981 1.00 61.99  ? 13  GLU B CA    1 
ATOM   1124 C C     . GLU B 1 13  ? 23.894  -1.664  25.090 1.00 61.99  ? 13  GLU B C     1 
ATOM   1125 O O     . GLU B 1 13  ? 23.939  -0.456  25.365 1.00 61.99  ? 13  GLU B O     1 
ATOM   1126 C CB    . GLU B 1 13  ? 21.932  -3.179  25.229 1.00 48.95  ? 13  GLU B CB    1 
ATOM   1127 C CG    . GLU B 1 13  ? 21.806  -4.666  25.365 1.00 48.95  ? 13  GLU B CG    1 
ATOM   1128 C CD    . GLU B 1 13  ? 20.665  -5.227  24.570 1.00 48.95  ? 13  GLU B CD    1 
ATOM   1129 O OE1   . GLU B 1 13  ? 20.425  -4.714  23.455 1.00 48.95  ? 13  GLU B OE1   1 
ATOM   1130 O OE2   . GLU B 1 13  ? 20.025  -6.187  25.053 1.00 48.95  ? 13  GLU B OE2   1 
ATOM   1131 N N     . ALA B 1 14  ? 24.478  -2.221  24.024 1.00 96.31  ? 14  ALA B N     1 
ATOM   1132 C CA    . ALA B 1 14  ? 25.258  -1.478  23.039 1.00 96.31  ? 14  ALA B CA    1 
ATOM   1133 C C     . ALA B 1 14  ? 24.644  -0.122  22.709 1.00 96.31  ? 14  ALA B C     1 
ATOM   1134 O O     . ALA B 1 14  ? 25.301  0.919   22.829 1.00 96.31  ? 14  ALA B O     1 
ATOM   1135 C CB    . ALA B 1 14  ? 25.401  -2.308  21.771 1.00 200.00 ? 14  ALA B CB    1 
ATOM   1136 N N     . GLY B 1 15  ? 23.384  -0.145  22.287 1.00 116.80 ? 15  GLY B N     1 
ATOM   1137 C CA    . GLY B 1 15  ? 22.687  1.082   21.951 1.00 116.80 ? 15  GLY B CA    1 
ATOM   1138 C C     . GLY B 1 15  ? 21.267  1.046   22.473 1.00 116.80 ? 15  GLY B C     1 
ATOM   1139 O O     . GLY B 1 15  ? 20.419  1.819   22.034 1.00 116.80 ? 15  GLY B O     1 
ATOM   1140 N N     . GLY B 1 16  ? 21.017  0.147   23.421 1.00 33.53  ? 16  GLY B N     1 
ATOM   1141 C CA    . GLY B 1 16  ? 19.690  0.003   23.990 1.00 33.53  ? 16  GLY B CA    1 
ATOM   1142 C C     . GLY B 1 16  ? 19.703  -0.323  25.468 1.00 33.53  ? 16  GLY B C     1 
ATOM   1143 O O     . GLY B 1 16  ? 20.758  -0.430  26.052 1.00 33.53  ? 16  GLY B O     1 
ATOM   1144 N N     . PHE B 1 17  ? 18.540  -0.496  26.076 1.00 23.07  ? 17  PHE B N     1 
ATOM   1145 C CA    . PHE B 1 17  ? 18.472  -0.791  27.492 1.00 23.07  ? 17  PHE B CA    1 
ATOM   1146 C C     . PHE B 1 17  ? 17.017  -1.120  27.893 1.00 23.07  ? 17  PHE B C     1 
ATOM   1147 O O     . PHE B 1 17  ? 16.076  -0.718  27.209 1.00 23.07  ? 17  PHE B O     1 
ATOM   1148 C CB    . PHE B 1 17  ? 19.009  0.423   28.224 1.00 11.67  ? 17  PHE B CB    1 
ATOM   1149 C CG    . PHE B 1 17  ? 17.961  1.398   28.664 1.00 11.67  ? 17  PHE B CG    1 
ATOM   1150 C CD1   . PHE B 1 17  ? 17.181  1.146   29.797 1.00 11.67  ? 17  PHE B CD1   1 
ATOM   1151 C CD2   . PHE B 1 17  ? 17.819  2.614   28.026 1.00 11.67  ? 17  PHE B CD2   1 
ATOM   1152 C CE1   . PHE B 1 17  ? 16.294  2.105   30.283 1.00 11.67  ? 17  PHE B CE1   1 
ATOM   1153 C CE2   . PHE B 1 17  ? 16.930  3.579   28.512 1.00 11.67  ? 17  PHE B CE2   1 
ATOM   1154 C CZ    . PHE B 1 17  ? 16.174  3.326   29.637 1.00 11.67  ? 17  PHE B CZ    1 
ATOM   1155 N N     . VAL B 1 18  ? 16.793  -1.837  28.986 1.00 24.92  ? 18  VAL B N     1 
ATOM   1156 C CA    . VAL B 1 18  ? 15.403  -2.144  29.312 1.00 24.92  ? 18  VAL B CA    1 
ATOM   1157 C C     . VAL B 1 18  ? 14.846  -1.559  30.610 1.00 24.92  ? 18  VAL B C     1 
ATOM   1158 O O     . VAL B 1 18  ? 15.383  -1.761  31.693 1.00 24.92  ? 18  VAL B O     1 
ATOM   1159 C CB    . VAL B 1 18  ? 15.146  -3.670  29.295 1.00 28.86  ? 18  VAL B CB    1 
ATOM   1160 C CG1   . VAL B 1 18  ? 15.580  -4.247  27.973 1.00 28.86  ? 18  VAL B CG1   1 
ATOM   1161 C CG2   . VAL B 1 18  ? 15.888  -4.338  30.420 1.00 28.86  ? 18  VAL B CG2   1 
ATOM   1162 N N     . LEU B 1 19  ? 13.728  -0.855  30.474 1.00 33.13  ? 19  LEU B N     1 
ATOM   1163 C CA    . LEU B 1 19  ? 13.064  -0.200  31.598 1.00 33.13  ? 19  LEU B CA    1 
ATOM   1164 C C     . LEU B 1 19  ? 11.867  -0.932  32.136 1.00 33.13  ? 19  LEU B C     1 
ATOM   1165 O O     . LEU B 1 19  ? 10.825  -1.029  31.480 1.00 33.13  ? 19  LEU B O     1 
ATOM   1166 C CB    . LEU B 1 19  ? 12.617  1.197   31.215 1.00 14.65  ? 19  LEU B CB    1 
ATOM   1167 C CG    . LEU B 1 19  ? 13.051  2.141   32.308 1.00 14.65  ? 19  LEU B CG    1 
ATOM   1168 C CD1   . LEU B 1 19  ? 13.534  3.401   31.658 1.00 14.65  ? 19  LEU B CD1   1 
ATOM   1169 C CD2   . LEU B 1 19  ? 11.950  2.383   33.284 1.00 14.65  ? 19  LEU B CD2   1 
ATOM   1170 N N     . LEU B 1 20  ? 12.019  -1.413  33.360 1.00 33.42  ? 20  LEU B N     1 
ATOM   1171 C CA    . LEU B 1 20  ? 10.963  -2.144  34.000 1.00 33.42  ? 20  LEU B CA    1 
ATOM   1172 C C     . LEU B 1 20  ? 10.124  -1.187  34.770 1.00 33.42  ? 20  LEU B C     1 
ATOM   1173 O O     . LEU B 1 20  ? 10.336  -1.008  35.966 1.00 33.42  ? 20  LEU B O     1 
ATOM   1174 C CB    . LEU B 1 20  ? 11.529  -3.191  34.943 1.00 33.31  ? 20  LEU B CB    1 
ATOM   1175 C CG    . LEU B 1 20  ? 10.499  -4.273  35.232 1.00 33.31  ? 20  LEU B CG    1 
ATOM   1176 C CD1   . LEU B 1 20  ? 11.169  -5.615  35.304 1.00 33.31  ? 20  LEU B CD1   1 
ATOM   1177 C CD2   . LEU B 1 20  ? 9.766   -3.939  36.506 1.00 33.31  ? 20  LEU B CD2   1 
ATOM   1178 N N     . ALA B 1 21  ? 9.208   -0.539  34.059 1.00 36.22  ? 21  ALA B N     1 
ATOM   1179 C CA    . ALA B 1 21  ? 8.262   0.396   34.650 1.00 36.22  ? 21  ALA B CA    1 
ATOM   1180 C C     . ALA B 1 21  ? 7.111   -0.564  34.812 1.00 36.22  ? 21  ALA B C     1 
ATOM   1181 O O     . ALA B 1 21  ? 7.107   -1.612  34.153 1.00 36.22  ? 21  ALA B O     1 
ATOM   1182 C CB    . ALA B 1 21  ? 7.904   1.489   33.666 1.00 200.00 ? 21  ALA B CB    1 
ATOM   1183 N N     . GLY B 1 22  ? 6.151   -0.245  35.676 1.00 172.57 ? 22  GLY B N     1 
ATOM   1184 C CA    . GLY B 1 22  ? 5.034   -1.150  35.887 1.00 172.57 ? 22  GLY B CA    1 
ATOM   1185 C C     . GLY B 1 22  ? 5.562   -2.555  36.120 1.00 172.57 ? 22  GLY B C     1 
ATOM   1186 O O     . GLY B 1 22  ? 6.391   -2.773  37.006 1.00 172.57 ? 22  GLY B O     1 
ATOM   1187 N N     . GLY B 1 23  ? 5.086   -3.507  35.322 1.00 69.53  ? 23  GLY B N     1 
ATOM   1188 C CA    . GLY B 1 23  ? 5.543   -4.884  35.440 1.00 69.53  ? 23  GLY B CA    1 
ATOM   1189 C C     . GLY B 1 23  ? 6.123   -5.259  34.100 1.00 69.53  ? 23  GLY B C     1 
ATOM   1190 O O     . GLY B 1 23  ? 6.616   -6.354  33.875 1.00 69.53  ? 23  GLY B O     1 
ATOM   1191 N N     . VAL B 1 24  ? 6.066   -4.287  33.211 1.00 34.09  ? 24  VAL B N     1 
ATOM   1192 C CA    . VAL B 1 24  ? 6.536   -4.416  31.857 1.00 34.09  ? 24  VAL B CA    1 
ATOM   1193 C C     . VAL B 1 24  ? 8.003   -4.076  31.668 1.00 34.09  ? 24  VAL B C     1 
ATOM   1194 O O     . VAL B 1 24  ? 8.502   -3.081  32.193 1.00 34.09  ? 24  VAL B O     1 
ATOM   1195 C CB    . VAL B 1 24  ? 5.739   -3.490  30.966 1.00 26.79  ? 24  VAL B CB    1 
ATOM   1196 C CG1   . VAL B 1 24  ? 6.104   -3.708  29.503 1.00 26.79  ? 24  VAL B CG1   1 
ATOM   1197 C CG2   . VAL B 1 24  ? 4.268   -3.710  31.230 1.00 26.79  ? 24  VAL B CG2   1 
ATOM   1198 N N     . GLY B 1 25  ? 8.683   -4.923  30.909 1.00 19.97  ? 25  GLY B N     1 
ATOM   1199 C CA    . GLY B 1 25  ? 10.068  -4.695  30.584 1.00 19.97  ? 25  GLY B CA    1 
ATOM   1200 C C     . GLY B 1 25  ? 10.058  -4.055  29.196 1.00 19.97  ? 25  GLY B C     1 
ATOM   1201 O O     . GLY B 1 25  ? 9.959   -4.744  28.159 1.00 19.97  ? 25  GLY B O     1 
ATOM   1202 N N     . PHE B 1 26  ? 10.122  -2.725  29.178 1.00 25.78  ? 26  PHE B N     1 
ATOM   1203 C CA    . PHE B 1 26  ? 10.155  -1.948  27.945 1.00 25.78  ? 26  PHE B CA    1 
ATOM   1204 C C     . PHE B 1 26  ? 11.594  -1.881  27.370 1.00 25.78  ? 26  PHE B C     1 
ATOM   1205 O O     . PHE B 1 26  ? 12.565  -1.749  28.110 1.00 25.78  ? 26  PHE B O     1 
ATOM   1206 C CB    . PHE B 1 26  ? 9.686   -0.546  28.259 1.00 17.37  ? 26  PHE B CB    1 
ATOM   1207 C CG    . PHE B 1 26  ? 8.213   -0.389  28.318 1.00 17.37  ? 26  PHE B CG    1 
ATOM   1208 C CD1   . PHE B 1 26  ? 7.430   -0.620  27.199 1.00 17.37  ? 26  PHE B CD1   1 
ATOM   1209 C CD2   . PHE B 1 26  ? 7.603   0.078   29.473 1.00 17.37  ? 26  PHE B CD2   1 
ATOM   1210 C CE1   . PHE B 1 26  ? 6.054   -0.380  27.234 1.00 17.37  ? 26  PHE B CE1   1 
ATOM   1211 C CE2   . PHE B 1 26  ? 6.231   0.327   29.529 1.00 17.37  ? 26  PHE B CE2   1 
ATOM   1212 C CZ    . PHE B 1 26  ? 5.460   0.100   28.416 1.00 17.37  ? 26  PHE B CZ    1 
ATOM   1213 N N     . PHE B 1 27  ? 11.751  -1.971  26.061 1.00 24.43  ? 27  PHE B N     1 
ATOM   1214 C CA    . PHE B 1 27  ? 13.097  -1.891  25.527 1.00 24.43  ? 27  PHE B CA    1 
ATOM   1215 C C     . PHE B 1 27  ? 13.265  -0.701  24.651 1.00 24.43  ? 27  PHE B C     1 
ATOM   1216 O O     . PHE B 1 27  ? 12.698  -0.654  23.561 1.00 24.43  ? 27  PHE B O     1 
ATOM   1217 C CB    . PHE B 1 27  ? 13.466  -3.060  24.672 1.00 12.47  ? 27  PHE B CB    1 
ATOM   1218 C CG    . PHE B 1 27  ? 14.718  -2.822  23.906 1.00 12.47  ? 27  PHE B CG    1 
ATOM   1219 C CD1   . PHE B 1 27  ? 15.824  -2.292  24.535 1.00 12.47  ? 27  PHE B CD1   1 
ATOM   1220 C CD2   . PHE B 1 27  ? 14.808  -3.125  22.562 1.00 12.47  ? 27  PHE B CD2   1 
ATOM   1221 C CE1   . PHE B 1 27  ? 17.002  -2.070  23.829 1.00 12.47  ? 27  PHE B CE1   1 
ATOM   1222 C CE2   . PHE B 1 27  ? 16.000  -2.904  21.832 1.00 12.47  ? 27  PHE B CE2   1 
ATOM   1223 C CZ    . PHE B 1 27  ? 17.079  -2.381  22.469 1.00 12.47  ? 27  PHE B CZ    1 
ATOM   1224 N N     . LEU B 1 28  ? 14.110  0.226   25.072 1.00 22.91  ? 28  LEU B N     1 
ATOM   1225 C CA    . LEU B 1 28  ? 14.293  1.447   24.311 1.00 22.91  ? 28  LEU B CA    1 
ATOM   1226 C C     . LEU B 1 28  ? 15.725  1.756   23.987 1.00 22.91  ? 28  LEU B C     1 
ATOM   1227 O O     . LEU B 1 28  ? 16.608  1.475   24.768 1.00 22.91  ? 28  LEU B O     1 
ATOM   1228 C CB    . LEU B 1 28  ? 13.655  2.625   25.064 1.00 41.34  ? 28  LEU B CB    1 
ATOM   1229 C CG    . LEU B 1 28  ? 13.782  2.689   26.596 1.00 41.34  ? 28  LEU B CG    1 
ATOM   1230 C CD1   . LEU B 1 28  ? 13.056  3.888   27.095 1.00 41.34  ? 28  LEU B CD1   1 
ATOM   1231 C CD2   . LEU B 1 28  ? 13.175  1.478   27.259 1.00 41.34  ? 28  LEU B CD2   1 
ATOM   1232 N N     . GLN B 1 29  ? 15.934  2.331   22.812 1.00 38.09  ? 29  GLN B N     1 
ATOM   1233 C CA    . GLN B 1 29  ? 17.248  2.728   22.352 1.00 38.09  ? 29  GLN B CA    1 
ATOM   1234 C C     . GLN B 1 29  ? 17.492  4.147   22.822 1.00 38.09  ? 29  GLN B C     1 
ATOM   1235 O O     . GLN B 1 29  ? 16.552  4.921   22.978 1.00 38.09  ? 29  GLN B O     1 
ATOM   1236 C CB    . GLN B 1 29  ? 17.292  2.664   20.850 1.00 45.35  ? 29  GLN B CB    1 
ATOM   1237 C CG    . GLN B 1 29  ? 17.110  1.278   20.378 1.00 45.35  ? 29  GLN B CG    1 
ATOM   1238 C CD    . GLN B 1 29  ? 16.991  1.213   18.895 1.00 45.35  ? 29  GLN B CD    1 
ATOM   1239 O OE1   . GLN B 1 29  ? 15.934  1.502   18.332 1.00 45.35  ? 29  GLN B OE1   1 
ATOM   1240 N NE2   . GLN B 1 29  ? 18.083  0.847   18.235 1.00 45.35  ? 29  GLN B NE2   1 
ATOM   1241 N N     . ALA B 1 30  ? 18.751  4.489   23.051 1.00 2.89   ? 30  ALA B N     1 
ATOM   1242 C CA    . ALA B 1 30  ? 19.071  5.804   23.537 1.00 2.89   ? 30  ALA B CA    1 
ATOM   1243 C C     . ALA B 1 30  ? 20.418  6.309   23.069 1.00 2.89   ? 30  ALA B C     1 
ATOM   1244 O O     . ALA B 1 30  ? 21.186  5.589   22.473 1.00 2.89   ? 30  ALA B O     1 
ATOM   1245 C CB    . ALA B 1 30  ? 19.021  5.778   25.039 1.00 19.30  ? 30  ALA B CB    1 
ATOM   1246 N N     . PRO B 1 31  ? 20.728  7.576   23.325 1.00 43.13  ? 31  PRO B N     1 
ATOM   1247 C CA    . PRO B 1 31  ? 22.054  7.955   22.840 1.00 43.13  ? 31  PRO B CA    1 
ATOM   1248 C C     . PRO B 1 31  ? 23.195  7.428   23.740 1.00 43.13  ? 31  PRO B C     1 
ATOM   1249 O O     . PRO B 1 31  ? 23.108  7.477   24.988 1.00 43.13  ? 31  PRO B O     1 
ATOM   1250 C CB    . PRO B 1 31  ? 21.985  9.480   22.815 1.00 77.28  ? 31  PRO B CB    1 
ATOM   1251 C CG    . PRO B 1 31  ? 20.543  9.741   22.556 1.00 77.28  ? 31  PRO B CG    1 
ATOM   1252 C CD    . PRO B 1 31  ? 19.880  8.764   23.492 1.00 77.28  ? 31  PRO B CD    1 
ATOM   1253 N N     . THR B 1 32  ? 24.251  6.926   23.088 1.00 25.53  ? 32  THR B N     1 
ATOM   1254 C CA    . THR B 1 32  ? 25.424  6.411   23.779 1.00 25.53  ? 32  THR B CA    1 
ATOM   1255 C C     . THR B 1 32  ? 25.685  7.249   25.017 1.00 25.53  ? 32  THR B C     1 
ATOM   1256 O O     . THR B 1 32  ? 25.632  6.738   26.119 1.00 25.53  ? 32  THR B O     1 
ATOM   1257 C CB    . THR B 1 32  ? 26.638  6.420   22.865 1.00 73.23  ? 32  THR B CB    1 
ATOM   1258 O OG1   . THR B 1 32  ? 26.535  7.519   21.957 1.00 73.23  ? 32  THR B OG1   1 
ATOM   1259 C CG2   . THR B 1 32  ? 26.704  5.136   22.078 1.00 73.23  ? 32  THR B CG2   1 
ATOM   1260 N N     . PRO B 1 33  ? 25.955  8.549   24.867 1.00 31.46  ? 33  PRO B N     1 
ATOM   1261 C CA    . PRO B 1 33  ? 26.181  9.278   26.119 1.00 31.46  ? 33  PRO B CA    1 
ATOM   1262 C C     . PRO B 1 33  ? 25.216  8.837   27.199 1.00 31.46  ? 33  PRO B C     1 
ATOM   1263 O O     . PRO B 1 33  ? 25.613  8.151   28.142 1.00 31.46  ? 33  PRO B O     1 
ATOM   1264 C CB    . PRO B 1 33  ? 25.966  10.741  25.740 1.00 20.04  ? 33  PRO B CB    1 
ATOM   1265 C CG    . PRO B 1 33  ? 25.327  10.680  24.369 1.00 20.04  ? 33  PRO B CG    1 
ATOM   1266 C CD    . PRO B 1 33  ? 25.923  9.466   23.726 1.00 20.04  ? 33  PRO B CD    1 
ATOM   1267 N N     . PHE B 1 34  ? 23.948  9.213   27.037 1.00 45.42  ? 34  PHE B N     1 
ATOM   1268 C CA    . PHE B 1 34  ? 22.877  8.886   27.984 1.00 45.42  ? 34  PHE B CA    1 
ATOM   1269 C C     . PHE B 1 34  ? 22.947  7.449   28.365 1.00 45.42  ? 34  PHE B C     1 
ATOM   1270 O O     . PHE B 1 34  ? 22.811  7.075   29.525 1.00 45.42  ? 34  PHE B O     1 
ATOM   1271 C CB    . PHE B 1 34  ? 21.505  9.101   27.353 1.00 47.02  ? 34  PHE B CB    1 
ATOM   1272 C CG    . PHE B 1 34  ? 20.363  8.702   28.245 1.00 47.02  ? 34  PHE B CG    1 
ATOM   1273 C CD1   . PHE B 1 34  ? 19.336  7.893   27.764 1.00 47.02  ? 34  PHE B CD1   1 
ATOM   1274 C CD2   . PHE B 1 34  ? 20.309  9.143   29.565 1.00 47.02  ? 34  PHE B CD2   1 
ATOM   1275 C CE1   . PHE B 1 34  ? 18.277  7.529   28.586 1.00 47.02  ? 34  PHE B CE1   1 
ATOM   1276 C CE2   . PHE B 1 34  ? 19.250  8.782   30.397 1.00 47.02  ? 34  PHE B CE2   1 
ATOM   1277 C CZ    . PHE B 1 34  ? 18.236  7.976   29.908 1.00 47.02  ? 34  PHE B CZ    1 
ATOM   1278 N N     . LEU B 1 35  ? 23.144  6.635   27.352 1.00 33.09  ? 35  LEU B N     1 
ATOM   1279 C CA    . LEU B 1 35  ? 23.192  5.218   27.577 1.00 33.09  ? 35  LEU B CA    1 
ATOM   1280 C C     . LEU B 1 35  ? 24.216  4.800   28.626 1.00 33.09  ? 35  LEU B C     1 
ATOM   1281 O O     . LEU B 1 35  ? 23.884  4.025   29.524 1.00 33.09  ? 35  LEU B O     1 
ATOM   1282 C CB    . LEU B 1 35  ? 23.435  4.514   26.255 1.00 20.62  ? 35  LEU B CB    1 
ATOM   1283 C CG    . LEU B 1 35  ? 22.418  3.407   26.102 1.00 20.62  ? 35  LEU B CG    1 
ATOM   1284 C CD1   . LEU B 1 35  ? 22.643  2.720   24.784 1.00 20.62  ? 35  LEU B CD1   1 
ATOM   1285 C CD2   . LEU B 1 35  ? 22.558  2.436   27.272 1.00 20.62  ? 35  LEU B CD2   1 
ATOM   1286 N N     . GLN B 1 36  ? 25.440  5.332   28.516 1.00 48.30  ? 36  GLN B N     1 
ATOM   1287 C CA    . GLN B 1 36  ? 26.549  5.041   29.440 1.00 48.30  ? 36  GLN B CA    1 
ATOM   1288 C C     . GLN B 1 36  ? 26.311  5.526   30.879 1.00 48.30  ? 36  GLN B C     1 
ATOM   1289 O O     . GLN B 1 36  ? 26.595  4.811   31.844 1.00 48.30  ? 36  GLN B O     1 
ATOM   1290 C CB    . GLN B 1 36  ? 27.856  5.645   28.898 1.00 82.29  ? 36  GLN B CB    1 
ATOM   1291 C CG    . GLN B 1 36  ? 28.308  5.025   27.565 1.00 82.29  ? 36  GLN B CG    1 
ATOM   1292 C CD    . GLN B 1 36  ? 29.690  5.487   27.098 1.00 82.29  ? 36  GLN B CD    1 
ATOM   1293 O OE1   . GLN B 1 36  ? 29.890  6.648   26.717 1.00 82.29  ? 36  GLN B OE1   1 
ATOM   1294 N NE2   . GLN B 1 36  ? 30.650  4.568   27.124 1.00 82.29  ? 36  GLN B NE2   1 
ATOM   1295 N N     . ALA B 1 37  ? 25.780  6.737   31.016 1.00 49.29  ? 37  ALA B N     1 
ATOM   1296 C CA    . ALA B 1 37  ? 25.497  7.312   32.323 1.00 49.29  ? 37  ALA B CA    1 
ATOM   1297 C C     . ALA B 1 37  ? 24.330  6.571   32.935 1.00 49.29  ? 37  ALA B C     1 
ATOM   1298 O O     . ALA B 1 37  ? 23.707  7.044   33.883 1.00 49.29  ? 37  ALA B O     1 
ATOM   1299 C CB    . ALA B 1 37  ? 25.162  8.788   32.180 1.00 143.47 ? 37  ALA B CB    1 
ATOM   1300 N N     . LEU B 1 38  ? 24.060  5.387   32.395 1.00 54.31  ? 38  LEU B N     1 
ATOM   1301 C CA    . LEU B 1 38  ? 22.940  4.555   32.827 1.00 54.31  ? 38  LEU B CA    1 
ATOM   1302 C C     . LEU B 1 38  ? 23.422  3.298   33.569 1.00 54.31  ? 38  LEU B C     1 
ATOM   1303 O O     . LEU B 1 38  ? 24.234  2.548   33.041 1.00 54.31  ? 38  LEU B O     1 
ATOM   1304 C CB    . LEU B 1 38  ? 22.147  4.183   31.581 1.00 27.13  ? 38  LEU B CB    1 
ATOM   1305 C CG    . LEU B 1 38  ? 20.640  4.099   31.686 1.00 27.13  ? 38  LEU B CG    1 
ATOM   1306 C CD1   . LEU B 1 38  ? 20.049  5.414   32.184 1.00 27.13  ? 38  LEU B CD1   1 
ATOM   1307 C CD2   . LEU B 1 38  ? 20.110  3.750   30.319 1.00 27.13  ? 38  LEU B CD2   1 
ATOM   1308 N N     . GLU B 1 39  ? 22.919  3.059   34.781 1.00 48.36  ? 39  GLU B N     1 
ATOM   1309 C CA    . GLU B 1 39  ? 23.366  1.899   35.567 1.00 48.36  ? 39  GLU B CA    1 
ATOM   1310 C C     . GLU B 1 39  ? 22.279  0.954   36.092 1.00 48.36  ? 39  GLU B C     1 
ATOM   1311 O O     . GLU B 1 39  ? 21.458  1.332   36.936 1.00 48.36  ? 39  GLU B O     1 
ATOM   1312 C CB    . GLU B 1 39  ? 24.222  2.373   36.746 1.00 199.83 ? 39  GLU B CB    1 
ATOM   1313 C CG    . GLU B 1 39  ? 23.518  3.351   37.677 1.00 199.83 ? 39  GLU B CG    1 
ATOM   1314 C CD    . GLU B 1 39  ? 24.399  3.801   38.827 1.00 199.83 ? 39  GLU B CD    1 
ATOM   1315 O OE1   . GLU B 1 39  ? 24.809  2.938   39.632 1.00 199.83 ? 39  GLU B OE1   1 
ATOM   1316 O OE2   . GLU B 1 39  ? 24.682  5.016   38.924 1.00 199.83 ? 39  GLU B OE2   1 
ATOM   1317 N N     . GLU B 1 40  ? 22.314  -0.288  35.603 1.00 37.89  ? 40  GLU B N     1 
ATOM   1318 C CA    . GLU B 1 40  ? 21.349  -1.326  35.968 1.00 37.89  ? 40  GLU B CA    1 
ATOM   1319 C C     . GLU B 1 40  ? 21.035  -1.254  37.443 1.00 37.89  ? 40  GLU B C     1 
ATOM   1320 O O     . GLU B 1 40  ? 21.914  -0.982  38.259 1.00 37.89  ? 40  GLU B O     1 
ATOM   1321 C CB    . GLU B 1 40  ? 21.907  -2.722  35.627 1.00 70.30  ? 40  GLU B CB    1 
ATOM   1322 C CG    . GLU B 1 40  ? 22.408  -2.883  34.171 1.00 70.30  ? 40  GLU B CG    1 
ATOM   1323 C CD    . GLU B 1 40  ? 22.977  -4.276  33.840 1.00 70.30  ? 40  GLU B CD    1 
ATOM   1324 O OE1   . GLU B 1 40  ? 23.540  -4.448  32.727 1.00 70.30  ? 40  GLU B OE1   1 
ATOM   1325 O OE2   . GLU B 1 40  ? 22.857  -5.195  34.687 1.00 70.30  ? 40  GLU B OE2   1 
ATOM   1326 N N     . GLY B 1 41  ? 19.770  -1.459  37.787 1.00 31.16  ? 41  GLY B N     1 
ATOM   1327 C CA    . GLY B 1 41  ? 19.382  -1.459  39.191 1.00 31.16  ? 41  GLY B CA    1 
ATOM   1328 C C     . GLY B 1 41  ? 18.765  -0.221  39.808 1.00 31.16  ? 41  GLY B C     1 
ATOM   1329 O O     . GLY B 1 41  ? 17.941  -0.337  40.721 1.00 31.16  ? 41  GLY B O     1 
ATOM   1330 N N     . LYS B 1 42  ? 19.159  0.959   39.341 1.00 50.32  ? 42  LYS B N     1 
ATOM   1331 C CA    . LYS B 1 42  ? 18.612  2.189   39.892 1.00 50.32  ? 42  LYS B CA    1 
ATOM   1332 C C     . LYS B 1 42  ? 17.410  2.688   39.111 1.00 50.32  ? 42  LYS B C     1 
ATOM   1333 O O     . LYS B 1 42  ? 17.349  2.531   37.891 1.00 50.32  ? 42  LYS B O     1 
ATOM   1334 C CB    . LYS B 1 42  ? 19.689  3.273   39.940 1.00 84.85  ? 42  LYS B CB    1 
ATOM   1335 C CG    . LYS B 1 42  ? 20.650  3.137   41.120 1.00 84.85  ? 42  LYS B CG    1 
ATOM   1336 C CD    . LYS B 1 42  ? 21.554  1.919   40.999 1.00 84.85  ? 42  LYS B CD    1 
ATOM   1337 C CE    . LYS B 1 42  ? 22.262  1.635   42.313 1.00 84.85  ? 42  LYS B CE    1 
ATOM   1338 N NZ    . LYS B 1 42  ? 21.309  1.223   43.387 1.00 84.85  ? 42  LYS B NZ    1 
ATOM   1339 N N     . GLU B 1 43  ? 16.436  3.259   39.824 1.00 62.84  ? 43  GLU B N     1 
ATOM   1340 C CA    . GLU B 1 43  ? 15.249  3.808   39.179 1.00 62.84  ? 43  GLU B CA    1 
ATOM   1341 C C     . GLU B 1 43  ? 15.737  4.944   38.269 1.00 62.84  ? 43  GLU B C     1 
ATOM   1342 O O     . GLU B 1 43  ? 16.857  5.447   38.406 1.00 62.84  ? 43  GLU B O     1 
ATOM   1343 C CB    . GLU B 1 43  ? 14.261  4.345   40.220 1.00 112.26 ? 43  GLU B CB    1 
ATOM   1344 C CG    . GLU B 1 43  ? 13.026  3.472   40.429 1.00 112.26 ? 43  GLU B CG    1 
ATOM   1345 C CD    . GLU B 1 43  ? 11.987  4.102   41.377 1.00 112.26 ? 43  GLU B CD    1 
ATOM   1346 O OE1   . GLU B 1 43  ? 10.903  3.506   41.569 1.00 112.26 ? 43  GLU B OE1   1 
ATOM   1347 O OE2   . GLU B 1 43  ? 12.245  5.193   41.934 1.00 112.26 ? 43  GLU B OE2   1 
ATOM   1348 N N     . VAL B 1 44  ? 14.905  5.344   37.327 1.00 34.52  ? 44  VAL B N     1 
ATOM   1349 C CA    . VAL B 1 44  ? 15.294  6.395   36.414 1.00 34.52  ? 44  VAL B CA    1 
ATOM   1350 C C     . VAL B 1 44  ? 14.100  6.880   35.639 1.00 34.52  ? 44  VAL B C     1 
ATOM   1351 O O     . VAL B 1 44  ? 13.154  6.140   35.409 1.00 34.52  ? 44  VAL B O     1 
ATOM   1352 C CB    . VAL B 1 44  ? 16.290  5.903   35.395 1.00 33.19  ? 44  VAL B CB    1 
ATOM   1353 C CG1   . VAL B 1 44  ? 15.633  4.906   34.439 1.00 33.19  ? 44  VAL B CG1   1 
ATOM   1354 C CG2   . VAL B 1 44  ? 16.794  7.068   34.622 1.00 33.19  ? 44  VAL B CG2   1 
ATOM   1355 N N     . GLY B 1 45  ? 14.134  8.133   35.234 1.00 46.87  ? 45  GLY B N     1 
ATOM   1356 C CA    . GLY B 1 45  ? 13.030  8.645   34.460 1.00 46.87  ? 45  GLY B CA    1 
ATOM   1357 C C     . GLY B 1 45  ? 13.535  8.713   33.044 1.00 46.87  ? 45  GLY B C     1 
ATOM   1358 O O     . GLY B 1 45  ? 14.714  8.970   32.806 1.00 46.87  ? 45  GLY B O     1 
ATOM   1359 N N     . VAL B 1 46  ? 12.663  8.477   32.086 1.00 31.39  ? 46  VAL B N     1 
ATOM   1360 C CA    . VAL B 1 46  ? 13.120  8.557   30.729 1.00 31.39  ? 46  VAL B CA    1 
ATOM   1361 C C     . VAL B 1 46  ? 12.153  9.340   29.859 1.00 31.39  ? 46  VAL B C     1 
ATOM   1362 O O     . VAL B 1 46  ? 10.941  9.142   29.951 1.00 31.39  ? 46  VAL B O     1 
ATOM   1363 C CB    . VAL B 1 46  ? 13.309  7.158   30.155 1.00 23.54  ? 46  VAL B CB    1 
ATOM   1364 C CG1   . VAL B 1 46  ? 13.820  7.230   28.726 1.00 23.54  ? 46  VAL B CG1   1 
ATOM   1365 C CG2   . VAL B 1 46  ? 14.275  6.410   31.001 1.00 23.54  ? 46  VAL B CG2   1 
ATOM   1366 N N     . HIS B 1 47  ? 12.694  10.255  29.050 1.00 19.40  ? 47  HIS B N     1 
ATOM   1367 C CA    . HIS B 1 47  ? 11.891  11.017  28.116 1.00 19.40  ? 47  HIS B CA    1 
ATOM   1368 C C     . HIS B 1 47  ? 11.872  10.195  26.864 1.00 19.40  ? 47  HIS B C     1 
ATOM   1369 O O     . HIS B 1 47  ? 12.786  10.245  26.057 1.00 19.40  ? 47  HIS B O     1 
ATOM   1370 C CB    . HIS B 1 47  ? 12.498  12.375  27.898 1.00 40.25  ? 47  HIS B CB    1 
ATOM   1371 C CG    . HIS B 1 47  ? 12.356  13.240  29.095 1.00 40.25  ? 47  HIS B CG    1 
ATOM   1372 N ND1   . HIS B 1 47  ? 13.289  13.256  30.105 1.00 40.25  ? 47  HIS B ND1   1 
ATOM   1373 C CD2   . HIS B 1 47  ? 11.307  13.973  29.536 1.00 40.25  ? 47  HIS B CD2   1 
ATOM   1374 C CE1   . HIS B 1 47  ? 12.817  13.957  31.122 1.00 40.25  ? 47  HIS B CE1   1 
ATOM   1375 N NE2   . HIS B 1 47  ? 11.615  14.400  30.803 1.00 40.25  ? 47  HIS B NE2   1 
ATOM   1376 N N     . THR B 1 48  ? 10.805  9.417   26.740 1.00 3.60   ? 48  THR B N     1 
ATOM   1377 C CA    . THR B 1 48  ? 10.597  8.469   25.661 1.00 3.60   ? 48  THR B CA    1 
ATOM   1378 C C     . THR B 1 48  ? 9.999   9.031   24.393 1.00 3.60   ? 48  THR B C     1 
ATOM   1379 O O     . THR B 1 48  ? 9.540   10.158  24.374 1.00 3.60   ? 48  THR B O     1 
ATOM   1380 C CB    . THR B 1 48  ? 9.649   7.382   26.141 1.00 15.00  ? 48  THR B CB    1 
ATOM   1381 O OG1   . THR B 1 48  ? 8.298   7.766   25.846 1.00 15.00  ? 48  THR B OG1   1 
ATOM   1382 C CG2   . THR B 1 48  ? 9.789   7.204   27.663 1.00 15.00  ? 48  THR B CG2   1 
ATOM   1383 N N     . HIS B 1 49  ? 10.042  8.238   23.329 1.00 5.78   ? 49  HIS B N     1 
ATOM   1384 C CA    . HIS B 1 49  ? 9.397   8.608   22.080 1.00 5.78   ? 49  HIS B CA    1 
ATOM   1385 C C     . HIS B 1 49  ? 8.928   7.375   21.299 1.00 5.78   ? 49  HIS B C     1 
ATOM   1386 O O     . HIS B 1 49  ? 9.716   6.772   20.601 1.00 5.78   ? 49  HIS B O     1 
ATOM   1387 C CB    . HIS B 1 49  ? 10.288  9.400   21.164 1.00 7.88   ? 49  HIS B CB    1 
ATOM   1388 C CG    . HIS B 1 49  ? 9.674   9.603   19.816 1.00 7.88   ? 49  HIS B CG    1 
ATOM   1389 N ND1   . HIS B 1 49  ? 8.627   10.470  19.603 1.00 7.88   ? 49  HIS B ND1   1 
ATOM   1390 C CD2   . HIS B 1 49  ? 9.881   8.970   18.638 1.00 7.88   ? 49  HIS B CD2   1 
ATOM   1391 C CE1   . HIS B 1 49  ? 8.213   10.363  18.353 1.00 7.88   ? 49  HIS B CE1   1 
ATOM   1392 N NE2   . HIS B 1 49  ? 8.958   9.458   17.746 1.00 7.88   ? 49  HIS B NE2   1 
ATOM   1393 N N     . LEU B 1 50  ? 7.648   7.013   21.391 1.00 24.99  ? 50  LEU B N     1 
ATOM   1394 C CA    . LEU B 1 50  ? 7.145   5.834   20.690 1.00 24.99  ? 50  LEU B CA    1 
ATOM   1395 C C     . LEU B 1 50  ? 7.387   6.033   19.229 1.00 24.99  ? 50  LEU B C     1 
ATOM   1396 O O     . LEU B 1 50  ? 7.825   7.092   18.811 1.00 24.99  ? 50  LEU B O     1 
ATOM   1397 C CB    . LEU B 1 50  ? 5.645   5.637   20.922 1.00 37.97  ? 50  LEU B CB    1 
ATOM   1398 C CG    . LEU B 1 50  ? 5.195   4.197   21.221 1.00 37.97  ? 50  LEU B CG    1 
ATOM   1399 C CD1   . LEU B 1 50  ? 3.691   4.131   21.444 1.00 37.97  ? 50  LEU B CD1   1 
ATOM   1400 C CD2   . LEU B 1 50  ? 5.581   3.301   20.067 1.00 37.97  ? 50  LEU B CD2   1 
ATOM   1401 N N     . LEU B 1 51  ? 7.101   5.006   18.450 1.00 28.21  ? 51  LEU B N     1 
ATOM   1402 C CA    . LEU B 1 51  ? 7.293   5.065   17.018 1.00 28.21  ? 51  LEU B CA    1 
ATOM   1403 C C     . LEU B 1 51  ? 6.766   3.816   16.363 1.00 28.21  ? 51  LEU B C     1 
ATOM   1404 O O     . LEU B 1 51  ? 7.374   2.762   16.481 1.00 28.21  ? 51  LEU B O     1 
ATOM   1405 C CB    . LEU B 1 51  ? 8.769   5.174   16.667 1.00 52.28  ? 51  LEU B CB    1 
ATOM   1406 C CG    . LEU B 1 51  ? 8.887   5.260   15.149 1.00 52.28  ? 51  LEU B CG    1 
ATOM   1407 C CD1   . LEU B 1 51  ? 8.379   6.633   14.727 1.00 52.28  ? 51  LEU B CD1   1 
ATOM   1408 C CD2   . LEU B 1 51  ? 10.306  5.054   14.686 1.00 52.28  ? 51  LEU B CD2   1 
ATOM   1409 N N     . LEU B 1 52  ? 5.644   3.920   15.666 1.00 39.71  ? 52  LEU B N     1 
ATOM   1410 C CA    . LEU B 1 52  ? 5.120   2.753   14.989 1.00 39.71  ? 52  LEU B CA    1 
ATOM   1411 C C     . LEU B 1 52  ? 6.075   2.287   13.893 1.00 39.71  ? 52  LEU B C     1 
ATOM   1412 O O     . LEU B 1 52  ? 7.183   2.815   13.752 1.00 39.71  ? 52  LEU B O     1 
ATOM   1413 C CB    . LEU B 1 52  ? 3.756   3.050   14.396 1.00 31.15  ? 52  LEU B CB    1 
ATOM   1414 C CG    . LEU B 1 52  ? 2.698   2.241   15.135 1.00 31.15  ? 52  LEU B CG    1 
ATOM   1415 C CD1   . LEU B 1 52  ? 2.740   2.608   16.607 1.00 31.15  ? 52  LEU B CD1   1 
ATOM   1416 C CD2   . LEU B 1 52  ? 1.321   2.515   14.561 1.00 31.15  ? 52  LEU B CD2   1 
ATOM   1417 N N     . LYS B 1 53  ? 5.640   1.296   13.122 1.00 127.45 ? 53  LYS B N     1 
ATOM   1418 C CA    . LYS B 1 53  ? 6.450   0.732   12.047 1.00 127.45 ? 53  LYS B CA    1 
ATOM   1419 C C     . LYS B 1 53  ? 5.533   -0.211  11.275 1.00 127.45 ? 53  LYS B C     1 
ATOM   1420 O O     . LYS B 1 53  ? 4.312   -0.105  11.379 1.00 127.45 ? 53  LYS B O     1 
ATOM   1421 C CB    . LYS B 1 53  ? 7.627   -0.046  12.654 1.00 169.09 ? 53  LYS B CB    1 
ATOM   1422 C CG    . LYS B 1 53  ? 8.707   -0.493  11.675 1.00 169.09 ? 53  LYS B CG    1 
ATOM   1423 C CD    . LYS B 1 53  ? 9.814   -1.256  12.402 1.00 169.09 ? 53  LYS B CD    1 
ATOM   1424 C CE    . LYS B 1 53  ? 10.952  -1.659  11.465 1.00 169.09 ? 53  LYS B CE    1 
ATOM   1425 N NZ    . LYS B 1 53  ? 11.701  -0.490  10.916 1.00 169.09 ? 53  LYS B NZ    1 
ATOM   1426 N N     . GLU B 1 54  ? 6.112   -1.120  10.495 1.00 138.43 ? 54  GLU B N     1 
ATOM   1427 C CA    . GLU B 1 54  ? 5.312   -2.086  9.755  1.00 138.43 ? 54  GLU B CA    1 
ATOM   1428 C C     . GLU B 1 54  ? 5.571   -3.505  10.250 1.00 138.43 ? 54  GLU B C     1 
ATOM   1429 O O     . GLU B 1 54  ? 5.040   -4.462  9.694  1.00 138.43 ? 54  GLU B O     1 
ATOM   1430 C CB    . GLU B 1 54  ? 5.569   -2.002  8.243  1.00 98.34  ? 54  GLU B CB    1 
ATOM   1431 C CG    . GLU B 1 54  ? 6.786   -1.183  7.797  1.00 98.34  ? 54  GLU B CG    1 
ATOM   1432 C CD    . GLU B 1 54  ? 8.124   -1.850  8.084  1.00 98.34  ? 54  GLU B CD    1 
ATOM   1433 O OE1   . GLU B 1 54  ? 8.275   -3.059  7.796  1.00 98.34  ? 54  GLU B OE1   1 
ATOM   1434 O OE2   . GLU B 1 54  ? 9.033   -1.153  8.583  1.00 98.34  ? 54  GLU B OE2   1 
ATOM   1435 N N     . GLU B 1 55  ? 6.384   -3.638  11.297 1.00 43.39  ? 55  GLU B N     1 
ATOM   1436 C CA    . GLU B 1 55  ? 6.680   -4.947  11.870 1.00 43.39  ? 55  GLU B CA    1 
ATOM   1437 C C     . GLU B 1 55  ? 6.585   -4.947  13.400 1.00 43.39  ? 55  GLU B C     1 
ATOM   1438 O O     . GLU B 1 55  ? 6.445   -5.998  14.033 1.00 43.39  ? 55  GLU B O     1 
ATOM   1439 C CB    . GLU B 1 55  ? 8.071   -5.417  11.434 1.00 79.13  ? 55  GLU B CB    1 
ATOM   1440 C CG    . GLU B 1 55  ? 8.193   -5.767  9.948  1.00 79.13  ? 55  GLU B CG    1 
ATOM   1441 C CD    . GLU B 1 55  ? 7.286   -6.922  9.522  1.00 79.13  ? 55  GLU B CD    1 
ATOM   1442 O OE1   . GLU B 1 55  ? 7.423   -7.399  8.375  1.00 79.13  ? 55  GLU B OE1   1 
ATOM   1443 O OE2   . GLU B 1 55  ? 6.432   -7.353  10.323 1.00 79.13  ? 55  GLU B OE2   1 
ATOM   1444 N N     . GLY B 1 56  ? 6.648   -3.766  14.000 1.00 30.61  ? 56  GLY B N     1 
ATOM   1445 C CA    . GLY B 1 56  ? 6.575   -3.690  15.448 1.00 30.61  ? 56  GLY B CA    1 
ATOM   1446 C C     . GLY B 1 56  ? 6.516   -2.243  15.870 1.00 30.61  ? 56  GLY B C     1 
ATOM   1447 O O     . GLY B 1 56  ? 6.252   -1.375  15.040 1.00 30.61  ? 56  GLY B O     1 
ATOM   1448 N N     . LEU B 1 57  ? 6.743   -1.984  17.152 1.00 37.64  ? 57  LEU B N     1 
ATOM   1449 C CA    . LEU B 1 57  ? 6.738   -0.623  17.682 1.00 37.64  ? 57  LEU B CA    1 
ATOM   1450 C C     . LEU B 1 57  ? 8.131   -0.390  18.252 1.00 37.64  ? 57  LEU B C     1 
ATOM   1451 O O     . LEU B 1 57  ? 8.737   -1.332  18.746 1.00 37.64  ? 57  LEU B O     1 
ATOM   1452 C CB    . LEU B 1 57  ? 5.724   -0.499  18.814 1.00 35.65  ? 57  LEU B CB    1 
ATOM   1453 C CG    . LEU B 1 57  ? 4.213   -0.367  18.621 1.00 35.65  ? 57  LEU B CG    1 
ATOM   1454 C CD1   . LEU B 1 57  ? 3.671   -1.309  17.549 1.00 35.65  ? 57  LEU B CD1   1 
ATOM   1455 C CD2   . LEU B 1 57  ? 3.584   -0.642  19.981 1.00 35.65  ? 57  LEU B CD2   1 
ATOM   1456 N N     . SER B 1 58  ? 8.631   0.844   18.208 1.00 30.39  ? 58  SER B N     1 
ATOM   1457 C CA    . SER B 1 58  ? 9.969   1.149   18.727 1.00 30.39  ? 58  SER B CA    1 
ATOM   1458 C C     . SER B 1 58  ? 9.973   2.245   19.787 1.00 30.39  ? 58  SER B C     1 
ATOM   1459 O O     . SER B 1 58  ? 9.207   3.204   19.716 1.00 30.39  ? 58  SER B O     1 
ATOM   1460 C CB    . SER B 1 58  ? 10.888  1.561   17.587 1.00 46.92  ? 58  SER B CB    1 
ATOM   1461 O OG    . SER B 1 58  ? 10.908  0.559   16.591 1.00 46.92  ? 58  SER B OG    1 
ATOM   1462 N N     . LEU B 1 59  ? 10.841  2.100   20.778 1.00 40.04  ? 59  LEU B N     1 
ATOM   1463 C CA    . LEU B 1 59  ? 10.917  3.091   21.832 1.00 40.04  ? 59  LEU B CA    1 
ATOM   1464 C C     . LEU B 1 59  ? 12.306  3.667   21.857 1.00 40.04  ? 59  LEU B C     1 
ATOM   1465 O O     . LEU B 1 59  ? 13.273  2.934   21.794 1.00 40.04  ? 59  LEU B O     1 
ATOM   1466 C CB    . LEU B 1 59  ? 10.582  2.465   23.185 1.00 28.70  ? 59  LEU B CB    1 
ATOM   1467 C CG    . LEU B 1 59  ? 9.222   2.876   23.773 1.00 28.70  ? 59  LEU B CG    1 
ATOM   1468 C CD1   . LEU B 1 59  ? 8.846   1.967   24.936 1.00 28.70  ? 59  LEU B CD1   1 
ATOM   1469 C CD2   . LEU B 1 59  ? 9.280   4.327   24.219 1.00 28.70  ? 59  LEU B CD2   1 
ATOM   1470 N N     . TYR B 1 60  ? 12.390  4.986   21.941 1.00 25.53  ? 60  TYR B N     1 
ATOM   1471 C CA    . TYR B 1 60  ? 13.650  5.702   21.973 1.00 25.53  ? 60  TYR B CA    1 
ATOM   1472 C C     . TYR B 1 60  ? 13.656  6.594   23.216 1.00 25.53  ? 60  TYR B C     1 
ATOM   1473 O O     . TYR B 1 60  ? 12.776  7.450   23.378 1.00 25.53  ? 60  TYR B O     1 
ATOM   1474 C CB    . TYR B 1 60  ? 13.753  6.520   20.705 1.00 16.13  ? 60  TYR B CB    1 
ATOM   1475 C CG    . TYR B 1 60  ? 13.750  5.663   19.462 1.00 16.13  ? 60  TYR B CG    1 
ATOM   1476 C CD1   . TYR B 1 60  ? 14.912  5.068   18.998 1.00 16.13  ? 60  TYR B CD1   1 
ATOM   1477 C CD2   . TYR B 1 60  ? 12.605  5.477   18.725 1.00 16.13  ? 60  TYR B CD2   1 
ATOM   1478 C CE1   . TYR B 1 60  ? 14.932  4.326   17.822 1.00 16.13  ? 60  TYR B CE1   1 
ATOM   1479 C CE2   . TYR B 1 60  ? 12.613  4.727   17.545 1.00 16.13  ? 60  TYR B CE2   1 
ATOM   1480 C CZ    . TYR B 1 60  ? 13.782  4.163   17.100 1.00 16.13  ? 60  TYR B CZ    1 
ATOM   1481 O OH    . TYR B 1 60  ? 13.808  3.462   15.908 1.00 16.13  ? 60  TYR B OH    1 
ATOM   1482 N N     . GLY B 1 61  ? 14.632  6.383   24.102 1.00 21.70  ? 61  GLY B N     1 
ATOM   1483 C CA    . GLY B 1 61  ? 14.701  7.154   25.340 1.00 21.70  ? 61  GLY B CA    1 
ATOM   1484 C C     . GLY B 1 61  ? 15.712  8.269   25.313 1.00 21.70  ? 61  GLY B C     1 
ATOM   1485 O O     . GLY B 1 61  ? 16.629  8.230   24.517 1.00 21.70  ? 61  GLY B O     1 
ATOM   1486 N N     . PHE B 1 62  ? 15.544  9.268   26.173 1.00 12.10  ? 62  PHE B N     1 
ATOM   1487 C CA    . PHE B 1 62  ? 16.448  10.417  26.212 1.00 12.10  ? 62  PHE B CA    1 
ATOM   1488 C C     . PHE B 1 62  ? 16.616  10.943  27.611 1.00 12.10  ? 62  PHE B C     1 
ATOM   1489 O O     . PHE B 1 62  ? 15.724  10.841  28.433 1.00 12.10  ? 62  PHE B O     1 
ATOM   1490 C CB    . PHE B 1 62  ? 15.952  11.517  25.276 1.00 15.01  ? 62  PHE B CB    1 
ATOM   1491 C CG    . PHE B 1 62  ? 15.855  11.063  23.867 1.00 15.01  ? 62  PHE B CG    1 
ATOM   1492 C CD1   . PHE B 1 62  ? 16.916  11.196  23.007 1.00 15.01  ? 62  PHE B CD1   1 
ATOM   1493 C CD2   . PHE B 1 62  ? 14.761  10.337  23.440 1.00 15.01  ? 62  PHE B CD2   1 
ATOM   1494 C CE1   . PHE B 1 62  ? 16.895  10.590  21.738 1.00 15.01  ? 62  PHE B CE1   1 
ATOM   1495 C CE2   . PHE B 1 62  ? 14.747  9.735   22.177 1.00 15.01  ? 62  PHE B CE2   1 
ATOM   1496 C CZ    . PHE B 1 62  ? 15.815  9.862   21.336 1.00 15.01  ? 62  PHE B CZ    1 
ATOM   1497 N N     . PRO B 1 63  ? 17.773  11.539  27.889 1.00 19.78  ? 63  PRO B N     1 
ATOM   1498 C CA    . PRO B 1 63  ? 18.072  12.076  29.212 1.00 19.78  ? 63  PRO B CA    1 
ATOM   1499 C C     . PRO B 1 63  ? 17.102  13.122  29.737 1.00 19.78  ? 63  PRO B C     1 
ATOM   1500 O O     . PRO B 1 63  ? 16.665  13.029  30.877 1.00 19.78  ? 63  PRO B O     1 
ATOM   1501 C CB    . PRO B 1 63  ? 19.477  12.662  29.044 1.00 54.62  ? 63  PRO B CB    1 
ATOM   1502 C CG    . PRO B 1 63  ? 20.007  12.051  27.749 1.00 54.62  ? 63  PRO B CG    1 
ATOM   1503 C CD    . PRO B 1 63  ? 18.792  11.959  26.910 1.00 54.62  ? 63  PRO B CD    1 
ATOM   1504 N N     . ASP B 1 64  ? 16.769  14.103  28.898 1.00 38.79  ? 64  ASP B N     1 
ATOM   1505 C CA    . ASP B 1 64  ? 15.920  15.237  29.277 1.00 38.79  ? 64  ASP B CA    1 
ATOM   1506 C C     . ASP B 1 64  ? 15.096  15.760  28.117 1.00 38.79  ? 64  ASP B C     1 
ATOM   1507 O O     . ASP B 1 64  ? 15.461  15.566  26.949 1.00 38.79  ? 64  ASP B O     1 
ATOM   1508 C CB    . ASP B 1 64  ? 16.808  16.381  29.734 1.00 44.26  ? 64  ASP B CB    1 
ATOM   1509 C CG    . ASP B 1 64  ? 17.895  16.713  28.704 1.00 44.26  ? 64  ASP B CG    1 
ATOM   1510 O OD1   . ASP B 1 64  ? 17.585  16.716  27.486 1.00 44.26  ? 64  ASP B OD1   1 
ATOM   1511 O OD2   . ASP B 1 64  ? 19.056  16.970  29.110 1.00 44.26  ? 64  ASP B OD2   1 
ATOM   1512 N N     . GLU B 1 65  ? 14.017  16.475  28.442 1.00 36.16  ? 65  GLU B N     1 
ATOM   1513 C CA    . GLU B 1 65  ? 13.145  17.030  27.417 1.00 36.16  ? 65  GLU B CA    1 
ATOM   1514 C C     . GLU B 1 65  ? 13.945  17.600  26.252 1.00 36.16  ? 65  GLU B C     1 
ATOM   1515 O O     . GLU B 1 65  ? 13.624  17.328  25.091 1.00 36.16  ? 65  GLU B O     1 
ATOM   1516 C CB    . GLU B 1 65  ? 12.231  18.106  28.001 1.00 87.81  ? 65  GLU B CB    1 
ATOM   1517 C CG    . GLU B 1 65  ? 10.809  17.625  28.312 1.00 87.81  ? 65  GLU B CG    1 
ATOM   1518 C CD    . GLU B 1 65  ? 10.042  17.084  27.075 1.00 87.81  ? 65  GLU B CD    1 
ATOM   1519 O OE1   . GLU B 1 65  ? 10.378  17.485  25.930 1.00 87.81  ? 65  GLU B OE1   1 
ATOM   1520 O OE2   . GLU B 1 65  ? 9.089   16.274  27.256 1.00 87.81  ? 65  GLU B OE2   1 
ATOM   1521 N N     . GLU B 1 66  ? 14.996  18.364  26.558 1.00 27.04  ? 66  GLU B N     1 
ATOM   1522 C CA    . GLU B 1 66  ? 15.840  18.965  25.515 1.00 27.04  ? 66  GLU B CA    1 
ATOM   1523 C C     . GLU B 1 66  ? 16.169  17.945  24.441 1.00 27.04  ? 66  GLU B C     1 
ATOM   1524 O O     . GLU B 1 66  ? 15.783  18.082  23.276 1.00 27.04  ? 66  GLU B O     1 
ATOM   1525 C CB    . GLU B 1 66  ? 17.155  19.499  26.101 1.00 123.24 ? 66  GLU B CB    1 
ATOM   1526 C CG    . GLU B 1 66  ? 17.270  21.020  26.157 1.00 123.24 ? 66  GLU B CG    1 
ATOM   1527 C CD    . GLU B 1 66  ? 16.466  21.638  27.295 1.00 123.24 ? 66  GLU B CD    1 
ATOM   1528 O OE1   . GLU B 1 66  ? 16.404  22.888  27.374 1.00 123.24 ? 66  GLU B OE1   1 
ATOM   1529 O OE2   . GLU B 1 66  ? 15.900  20.878  28.114 1.00 123.24 ? 66  GLU B OE2   1 
ATOM   1530 N N     . ASN B 1 67  ? 16.885  16.909  24.850 1.00 25.65  ? 67  ASN B N     1 
ATOM   1531 C CA    . ASN B 1 67  ? 17.282  15.873  23.926 1.00 25.65  ? 67  ASN B CA    1 
ATOM   1532 C C     . ASN B 1 67  ? 16.116  15.385  23.092 1.00 25.65  ? 67  ASN B C     1 
ATOM   1533 O O     . ASN B 1 67  ? 16.157  15.472  21.855 1.00 25.65  ? 67  ASN B O     1 
ATOM   1534 C CB    . ASN B 1 67  ? 17.890  14.721  24.702 1.00 66.19  ? 67  ASN B CB    1 
ATOM   1535 C CG    . ASN B 1 67  ? 19.235  15.063  25.248 1.00 66.19  ? 67  ASN B CG    1 
ATOM   1536 O OD1   . ASN B 1 67  ? 20.166  15.281  24.490 1.00 66.19  ? 67  ASN B OD1   1 
ATOM   1537 N ND2   . ASN B 1 67  ? 19.350  15.130  26.564 1.00 66.19  ? 67  ASN B ND2   1 
ATOM   1538 N N     . LEU B 1 68  ? 15.083  14.887  23.788 1.00 26.52  ? 68  LEU B N     1 
ATOM   1539 C CA    . LEU B 1 68  ? 13.863  14.350  23.167 1.00 26.52  ? 68  LEU B CA    1 
ATOM   1540 C C     . LEU B 1 68  ? 13.451  15.276  22.066 1.00 26.52  ? 68  LEU B C     1 
ATOM   1541 O O     . LEU B 1 68  ? 13.190  14.865  20.940 1.00 26.52  ? 68  LEU B O     1 
ATOM   1542 C CB    . LEU B 1 68  ? 12.737  14.266  24.175 1.00 22.90  ? 68  LEU B CB    1 
ATOM   1543 C CG    . LEU B 1 68  ? 11.889  13.028  23.896 1.00 22.90  ? 68  LEU B CG    1 
ATOM   1544 C CD1   . LEU B 1 68  ? 10.610  13.088  24.729 1.00 22.90  ? 68  LEU B CD1   1 
ATOM   1545 C CD2   . LEU B 1 68  ? 11.549  12.934  22.415 1.00 22.90  ? 68  LEU B CD2   1 
ATOM   1546 N N     . ALA B 1 69  ? 13.417  16.546  22.426 1.00 46.43  ? 69  ALA B N     1 
ATOM   1547 C CA    . ALA B 1 69  ? 13.087  17.604  21.510 1.00 46.43  ? 69  ALA B CA    1 
ATOM   1548 C C     . ALA B 1 69  ? 13.881  17.455  20.223 1.00 46.43  ? 69  ALA B C     1 
ATOM   1549 O O     . ALA B 1 69  ? 13.308  17.274  19.150 1.00 46.43  ? 69  ALA B O     1 
ATOM   1550 C CB    . ALA B 1 69  ? 13.410  18.892  22.142 1.00 1.00   ? 69  ALA B CB    1 
ATOM   1551 N N     . LEU B 1 70  ? 15.204  17.537  20.316 1.00 20.91  ? 70  LEU B N     1 
ATOM   1552 C CA    . LEU B 1 70  ? 15.986  17.410  19.110 1.00 20.91  ? 70  LEU B CA    1 
ATOM   1553 C C     . LEU B 1 70  ? 15.643  16.126  18.372 1.00 20.91  ? 70  LEU B C     1 
ATOM   1554 O O     . LEU B 1 70  ? 15.313  16.170  17.194 1.00 20.91  ? 70  LEU B O     1 
ATOM   1555 C CB    . LEU B 1 70  ? 17.474  17.416  19.420 1.00 56.33  ? 70  LEU B CB    1 
ATOM   1556 C CG    . LEU B 1 70  ? 18.073  18.637  20.106 1.00 56.33  ? 70  LEU B CG    1 
ATOM   1557 C CD1   . LEU B 1 70  ? 17.911  19.875  19.247 1.00 56.33  ? 70  LEU B CD1   1 
ATOM   1558 C CD2   . LEU B 1 70  ? 17.404  18.801  21.442 1.00 56.33  ? 70  LEU B CD2   1 
ATOM   1559 N N     . PHE B 1 71  ? 15.715  14.990  19.068 1.00 32.40  ? 71  PHE B N     1 
ATOM   1560 C CA    . PHE B 1 71  ? 15.436  13.694  18.449 1.00 32.40  ? 71  PHE B CA    1 
ATOM   1561 C C     . PHE B 1 71  ? 14.213  13.776  17.570 1.00 32.40  ? 71  PHE B C     1 
ATOM   1562 O O     . PHE B 1 71  ? 14.214  13.270  16.443 1.00 32.40  ? 71  PHE B O     1 
ATOM   1563 C CB    . PHE B 1 71  ? 15.208  12.586  19.495 1.00 13.78  ? 71  PHE B CB    1 
ATOM   1564 C CG    . PHE B 1 71  ? 14.926  11.224  18.888 1.00 13.78  ? 71  PHE B CG    1 
ATOM   1565 C CD1   . PHE B 1 71  ? 15.935  10.472  18.321 1.00 13.78  ? 71  PHE B CD1   1 
ATOM   1566 C CD2   . PHE B 1 71  ? 13.652  10.710  18.861 1.00 13.78  ? 71  PHE B CD2   1 
ATOM   1567 C CE1   . PHE B 1 71  ? 15.674  9.228   17.733 1.00 13.78  ? 71  PHE B CE1   1 
ATOM   1568 C CE2   . PHE B 1 71  ? 13.387  9.473   18.278 1.00 13.78  ? 71  PHE B CE2   1 
ATOM   1569 C CZ    . PHE B 1 71  ? 14.401  8.737   17.714 1.00 13.78  ? 71  PHE B CZ    1 
ATOM   1570 N N     . GLU B 1 72  ? 13.157  14.400  18.085 1.00 18.55  ? 72  GLU B N     1 
ATOM   1571 C CA    . GLU B 1 72  ? 11.947  14.508  17.294 1.00 18.55  ? 72  GLU B CA    1 
ATOM   1572 C C     . GLU B 1 72  ? 12.325  15.430  16.159 1.00 18.55  ? 72  GLU B C     1 
ATOM   1573 O O     . GLU B 1 72  ? 12.551  14.981  15.035 1.00 18.55  ? 72  GLU B O     1 
ATOM   1574 C CB    . GLU B 1 72  ? 10.808  15.106  18.104 1.00 48.76  ? 72  GLU B CB    1 
ATOM   1575 C CG    . GLU B 1 72  ? 10.733  14.589  19.514 1.00 48.76  ? 72  GLU B CG    1 
ATOM   1576 C CD    . GLU B 1 72  ? 9.412   13.933  19.837 1.00 48.76  ? 72  GLU B CD    1 
ATOM   1577 O OE1   . GLU B 1 72  ? 9.212   12.793  19.380 1.00 48.76  ? 72  GLU B OE1   1 
ATOM   1578 O OE2   . GLU B 1 72  ? 8.582   14.562  20.542 1.00 48.76  ? 72  GLU B OE2   1 
ATOM   1579 N N     . LEU B 1 73  ? 12.437  16.718  16.478 1.00 18.50  ? 73  LEU B N     1 
ATOM   1580 C CA    . LEU B 1 73  ? 12.782  17.725  15.496 1.00 18.50  ? 73  LEU B CA    1 
ATOM   1581 C C     . LEU B 1 73  ? 13.609  17.061  14.422 1.00 18.50  ? 73  LEU B C     1 
ATOM   1582 O O     . LEU B 1 73  ? 13.273  17.109  13.254 1.00 18.50  ? 73  LEU B O     1 
ATOM   1583 C CB    . LEU B 1 73  ? 13.556  18.862  16.161 1.00 30.09  ? 73  LEU B CB    1 
ATOM   1584 C CG    . LEU B 1 73  ? 14.240  19.834  15.189 1.00 30.09  ? 73  LEU B CG    1 
ATOM   1585 C CD1   . LEU B 1 73  ? 13.321  20.194  14.041 1.00 30.09  ? 73  LEU B CD1   1 
ATOM   1586 C CD2   . LEU B 1 73  ? 14.688  21.076  15.937 1.00 30.09  ? 73  LEU B CD2   1 
ATOM   1587 N N     . LEU B 1 74  ? 14.671  16.393  14.842 1.00 26.25  ? 74  LEU B N     1 
ATOM   1588 C CA    . LEU B 1 74  ? 15.556  15.710  13.917 1.00 26.25  ? 74  LEU B CA    1 
ATOM   1589 C C     . LEU B 1 74  ? 14.776  14.810  12.977 1.00 26.25  ? 74  LEU B C     1 
ATOM   1590 O O     . LEU B 1 74  ? 14.910  14.930  11.759 1.00 26.25  ? 74  LEU B O     1 
ATOM   1591 C CB    . LEU B 1 74  ? 16.585  14.877  14.685 1.00 22.62  ? 74  LEU B CB    1 
ATOM   1592 C CG    . LEU B 1 74  ? 18.038  15.197  14.369 1.00 22.62  ? 74  LEU B CG    1 
ATOM   1593 C CD1   . LEU B 1 74  ? 18.297  15.083  12.883 1.00 22.62  ? 74  LEU B CD1   1 
ATOM   1594 C CD2   . LEU B 1 74  ? 18.310  16.604  14.853 1.00 22.62  ? 74  LEU B CD2   1 
ATOM   1595 N N     . LEU B 1 75  ? 13.980  13.900  13.549 1.00 34.97  ? 75  LEU B N     1 
ATOM   1596 C CA    . LEU B 1 75  ? 13.157  12.964  12.770 1.00 34.97  ? 75  LEU B CA    1 
ATOM   1597 C C     . LEU B 1 75  ? 12.217  13.708  11.846 1.00 34.97  ? 75  LEU B C     1 
ATOM   1598 O O     . LEU B 1 75  ? 11.737  13.141  10.846 1.00 34.97  ? 75  LEU B O     1 
ATOM   1599 C CB    . LEU B 1 75  ? 12.310  12.097  13.679 1.00 27.15  ? 75  LEU B CB    1 
ATOM   1600 C CG    . LEU B 1 75  ? 12.997  10.908  14.311 1.00 27.15  ? 75  LEU B CG    1 
ATOM   1601 C CD1   . LEU B 1 75  ? 11.962  10.099  15.070 1.00 27.15  ? 75  LEU B CD1   1 
ATOM   1602 C CD2   . LEU B 1 75  ? 13.647  10.053  13.219 1.00 27.15  ? 75  LEU B CD2   1 
ATOM   1603 N N     . SER B 1 76  ? 11.952  14.968  12.224 1.00 30.98  ? 76  SER B N     1 
ATOM   1604 C CA    . SER B 1 76  ? 11.089  15.860  11.485 1.00 30.98  ? 76  SER B CA    1 
ATOM   1605 C C     . SER B 1 76  ? 11.555  15.927  10.059 1.00 30.98  ? 76  SER B C     1 
ATOM   1606 O O     . SER B 1 76  ? 10.733  15.908  9.158  1.00 30.98  ? 76  SER B O     1 
ATOM   1607 C CB    . SER B 1 76  ? 11.104  17.260  12.091 1.00 58.62  ? 76  SER B CB    1 
ATOM   1608 O OG    . SER B 1 76  ? 10.870  18.252  11.102 1.00 58.62  ? 76  SER B OG    1 
ATOM   1609 N N     . VAL B 1 77  ? 12.865  15.993  9.841  1.00 47.88  ? 77  VAL B N     1 
ATOM   1610 C CA    . VAL B 1 77  ? 13.402  16.059  8.482  1.00 47.88  ? 77  VAL B CA    1 
ATOM   1611 C C     . VAL B 1 77  ? 13.132  14.799  7.652  1.00 47.88  ? 77  VAL B C     1 
ATOM   1612 O O     . VAL B 1 77  ? 13.050  13.676  8.176  1.00 47.88  ? 77  VAL B O     1 
ATOM   1613 C CB    . VAL B 1 77  ? 14.921  16.302  8.476  1.00 37.40  ? 77  VAL B CB    1 
ATOM   1614 C CG1   . VAL B 1 77  ? 15.453  16.176  7.060  1.00 37.40  ? 77  VAL B CG1   1 
ATOM   1615 C CG2   . VAL B 1 77  ? 15.238  17.681  9.023  1.00 37.40  ? 77  VAL B CG2   1 
ATOM   1616 N N     . SER B 1 78  ? 13.000  15.002  6.346  1.00 57.86  ? 78  SER B N     1 
ATOM   1617 C CA    . SER B 1 78  ? 12.742  13.915  5.425  1.00 57.86  ? 78  SER B CA    1 
ATOM   1618 C C     . SER B 1 78  ? 14.045  13.162  5.197  1.00 57.86  ? 78  SER B C     1 
ATOM   1619 O O     . SER B 1 78  ? 15.047  13.769  4.823  1.00 57.86  ? 78  SER B O     1 
ATOM   1620 C CB    . SER B 1 78  ? 12.231  14.475  4.099  1.00 144.62 ? 78  SER B CB    1 
ATOM   1621 O OG    . SER B 1 78  ? 11.229  15.453  4.319  1.00 144.62 ? 78  SER B OG    1 
ATOM   1622 N N     . GLY B 1 79  ? 14.040  11.851  5.443  1.00 57.88  ? 79  GLY B N     1 
ATOM   1623 C CA    . GLY B 1 79  ? 15.241  11.059  5.230  1.00 57.88  ? 79  GLY B CA    1 
ATOM   1624 C C     . GLY B 1 79  ? 16.029  10.704  6.476  1.00 57.88  ? 79  GLY B C     1 
ATOM   1625 O O     . GLY B 1 79  ? 16.726  9.701   6.515  1.00 57.88  ? 79  GLY B O     1 
ATOM   1626 N N     . VAL B 1 80  ? 15.945  11.542  7.491  1.00 31.61  ? 80  VAL B N     1 
ATOM   1627 C CA    . VAL B 1 80  ? 16.641  11.278  8.730  1.00 31.61  ? 80  VAL B CA    1 
ATOM   1628 C C     . VAL B 1 80  ? 15.800  10.319  9.520  1.00 31.61  ? 80  VAL B C     1 
ATOM   1629 O O     . VAL B 1 80  ? 14.627  10.570  9.703  1.00 31.61  ? 80  VAL B O     1 
ATOM   1630 C CB    . VAL B 1 80  ? 16.736  12.513  9.571  1.00 22.38  ? 80  VAL B CB    1 
ATOM   1631 C CG1   . VAL B 1 80  ? 17.327  12.178  10.906 1.00 22.38  ? 80  VAL B CG1   1 
ATOM   1632 C CG2   . VAL B 1 80  ? 17.550  13.525  8.870  1.00 22.38  ? 80  VAL B CG2   1 
ATOM   1633 N N     . GLY B 1 81  ? 16.390  9.239   10.005 1.00 39.48  ? 81  GLY B N     1 
ATOM   1634 C CA    . GLY B 1 81  ? 15.640  8.287   10.802 1.00 39.48  ? 81  GLY B CA    1 
ATOM   1635 C C     . GLY B 1 81  ? 16.086  8.296   12.254 1.00 39.48  ? 81  GLY B C     1 
ATOM   1636 O O     . GLY B 1 81  ? 16.856  9.170   12.672 1.00 39.48  ? 81  GLY B O     1 
ATOM   1637 N N     . PRO B 1 82  ? 15.615  7.332   13.059 1.00 52.24  ? 82  PRO B N     1 
ATOM   1638 C CA    . PRO B 1 82  ? 15.982  7.248   14.472 1.00 52.24  ? 82  PRO B CA    1 
ATOM   1639 C C     . PRO B 1 82  ? 17.473  7.024   14.645 1.00 52.24  ? 82  PRO B C     1 
ATOM   1640 O O     . PRO B 1 82  ? 18.119  7.640   15.498 1.00 52.24  ? 82  PRO B O     1 
ATOM   1641 C CB    . PRO B 1 82  ? 15.169  6.057   14.962 1.00 18.38  ? 82  PRO B CB    1 
ATOM   1642 C CG    . PRO B 1 82  ? 13.974  6.111   14.118 1.00 18.38  ? 82  PRO B CG    1 
ATOM   1643 C CD    . PRO B 1 82  ? 14.546  6.371   12.757 1.00 18.38  ? 82  PRO B CD    1 
ATOM   1644 N N     . LYS B 1 83  ? 18.012  6.131   13.825 1.00 42.53  ? 83  LYS B N     1 
ATOM   1645 C CA    . LYS B 1 83  ? 19.424  5.824   13.899 1.00 42.53  ? 83  LYS B CA    1 
ATOM   1646 C C     . LYS B 1 83  ? 20.209  7.121   13.786 1.00 42.53  ? 83  LYS B C     1 
ATOM   1647 O O     . LYS B 1 83  ? 20.878  7.538   14.730 1.00 42.53  ? 83  LYS B O     1 
ATOM   1648 C CB    . LYS B 1 83  ? 19.816  4.862   12.774 1.00 58.53  ? 83  LYS B CB    1 
ATOM   1649 C CG    . LYS B 1 83  ? 21.196  4.261   12.968 1.00 58.53  ? 83  LYS B CG    1 
ATOM   1650 C CD    . LYS B 1 83  ? 21.324  2.821   12.444 1.00 58.53  ? 83  LYS B CD    1 
ATOM   1651 C CE    . LYS B 1 83  ? 21.601  2.767   10.950 1.00 58.53  ? 83  LYS B CE    1 
ATOM   1652 N NZ    . LYS B 1 83  ? 22.018  1.393   10.552 1.00 58.53  ? 83  LYS B NZ    1 
ATOM   1653 N N     . VAL B 1 84  ? 20.096  7.772   12.634 1.00 13.60  ? 84  VAL B N     1 
ATOM   1654 C CA    . VAL B 1 84  ? 20.813  9.005   12.395 1.00 13.60  ? 84  VAL B CA    1 
ATOM   1655 C C     . VAL B 1 84  ? 20.537  10.016  13.465 1.00 13.60  ? 84  VAL B C     1 
ATOM   1656 O O     . VAL B 1 84  ? 21.460  10.497  14.124 1.00 13.60  ? 84  VAL B O     1 
ATOM   1657 C CB    . VAL B 1 84  ? 20.440  9.649   11.052 1.00 10.42  ? 84  VAL B CB    1 
ATOM   1658 C CG1   . VAL B 1 84  ? 21.101  11.031  10.934 1.00 10.42  ? 84  VAL B CG1   1 
ATOM   1659 C CG2   . VAL B 1 84  ? 20.842  8.732   9.902  1.00 10.42  ? 84  VAL B CG2   1 
ATOM   1660 N N     . ALA B 1 85  ? 19.269  10.357  13.640 1.00 17.32  ? 85  ALA B N     1 
ATOM   1661 C CA    . ALA B 1 85  ? 18.950  11.359  14.641 1.00 17.32  ? 85  ALA B CA    1 
ATOM   1662 C C     . ALA B 1 85  ? 19.708  10.979  15.914 1.00 17.32  ? 85  ALA B C     1 
ATOM   1663 O O     . ALA B 1 85  ? 20.392  11.795  16.530 1.00 17.32  ? 85  ALA B O     1 
ATOM   1664 C CB    . ALA B 1 85  ? 17.461  11.401  14.872 1.00 1.00   ? 85  ALA B CB    1 
ATOM   1665 N N     . LEU B 1 86  ? 19.613  9.710   16.273 1.00 19.38  ? 86  LEU B N     1 
ATOM   1666 C CA    . LEU B 1 86  ? 20.284  9.220   17.448 1.00 19.38  ? 86  LEU B CA    1 
ATOM   1667 C C     . LEU B 1 86  ? 21.772  9.524   17.342 1.00 19.38  ? 86  LEU B C     1 
ATOM   1668 O O     . LEU B 1 86  ? 22.322  10.140  18.245 1.00 19.38  ? 86  LEU B O     1 
ATOM   1669 C CB    . LEU B 1 86  ? 20.036  7.720   17.592 1.00 12.52  ? 86  LEU B CB    1 
ATOM   1670 C CG    . LEU B 1 86  ? 18.958  7.269   18.575 1.00 12.52  ? 86  LEU B CG    1 
ATOM   1671 C CD1   . LEU B 1 86  ? 18.682  5.803   18.376 1.00 12.52  ? 86  LEU B CD1   1 
ATOM   1672 C CD2   . LEU B 1 86  ? 19.425  7.517   20.002 1.00 12.52  ? 86  LEU B CD2   1 
ATOM   1673 N N     . ALA B 1 87  ? 22.426  9.104   16.254 1.00 38.40  ? 87  ALA B N     1 
ATOM   1674 C CA    . ALA B 1 87  ? 23.870  9.370   16.058 1.00 38.40  ? 87  ALA B CA    1 
ATOM   1675 C C     . ALA B 1 87  ? 24.158  10.808  16.438 1.00 38.40  ? 87  ALA B C     1 
ATOM   1676 O O     . ALA B 1 87  ? 24.826  11.101  17.437 1.00 38.40  ? 87  ALA B O     1 
ATOM   1677 C CB    . ALA B 1 87  ? 24.273  9.161   14.592 1.00 2.70   ? 87  ALA B CB    1 
ATOM   1678 N N     . LEU B 1 88  ? 23.658  11.698  15.597 1.00 12.49  ? 88  LEU B N     1 
ATOM   1679 C CA    . LEU B 1 88  ? 23.790  13.107  15.838 1.00 12.49  ? 88  LEU B CA    1 
ATOM   1680 C C     . LEU B 1 88  ? 23.640  13.384  17.326 1.00 12.49  ? 88  LEU B C     1 
ATOM   1681 O O     . LEU B 1 88  ? 24.491  14.011  17.926 1.00 12.49  ? 88  LEU B O     1 
ATOM   1682 C CB    . LEU B 1 88  ? 22.713  13.860  15.062 1.00 47.73  ? 88  LEU B CB    1 
ATOM   1683 C CG    . LEU B 1 88  ? 22.921  13.900  13.551 1.00 47.73  ? 88  LEU B CG    1 
ATOM   1684 C CD1   . LEU B 1 88  ? 21.634  13.574  12.839 1.00 47.73  ? 88  LEU B CD1   1 
ATOM   1685 C CD2   . LEU B 1 88  ? 23.439  15.273  13.169 1.00 47.73  ? 88  LEU B CD2   1 
ATOM   1686 N N     . LEU B 1 89  ? 22.568  12.916  17.943 1.00 28.75  ? 89  LEU B N     1 
ATOM   1687 C CA    . LEU B 1 89  ? 22.408  13.194  19.364 1.00 28.75  ? 89  LEU B CA    1 
ATOM   1688 C C     . LEU B 1 89  ? 23.492  12.536  20.207 1.00 28.75  ? 89  LEU B C     1 
ATOM   1689 O O     . LEU B 1 89  ? 23.919  13.079  21.222 1.00 28.75  ? 89  LEU B O     1 
ATOM   1690 C CB    . LEU B 1 89  ? 21.002  12.781  19.854 1.00 18.58  ? 89  LEU B CB    1 
ATOM   1691 C CG    . LEU B 1 89  ? 20.012  13.920  20.175 1.00 18.58  ? 89  LEU B CG    1 
ATOM   1692 C CD1   . LEU B 1 89  ? 19.494  13.752  21.596 1.00 18.58  ? 89  LEU B CD1   1 
ATOM   1693 C CD2   . LEU B 1 89  ? 20.693  15.286  20.045 1.00 18.58  ? 89  LEU B CD2   1 
ATOM   1694 N N     . SER B 1 90  ? 23.954  11.375  19.772 1.00 49.09  ? 90  SER B N     1 
ATOM   1695 C CA    . SER B 1 90  ? 24.981  10.676  20.518 1.00 49.09  ? 90  SER B CA    1 
ATOM   1696 C C     . SER B 1 90  ? 26.348  11.309  20.337 1.00 49.09  ? 90  SER B C     1 
ATOM   1697 O O     . SER B 1 90  ? 27.217  11.152  21.188 1.00 49.09  ? 90  SER B O     1 
ATOM   1698 C CB    . SER B 1 90  ? 25.033  9.207   20.107 1.00 46.48  ? 90  SER B CB    1 
ATOM   1699 O OG    . SER B 1 90  ? 24.019  8.465   20.753 1.00 46.48  ? 90  SER B OG    1 
ATOM   1700 N N     . ALA B 1 91  ? 26.539  12.022  19.233 1.00 60.98  ? 91  ALA B N     1 
ATOM   1701 C CA    . ALA B 1 91  ? 27.822  12.663  18.968 1.00 60.98  ? 91  ALA B CA    1 
ATOM   1702 C C     . ALA B 1 91  ? 28.001  13.957  19.754 1.00 60.98  ? 91  ALA B C     1 
ATOM   1703 O O     . ALA B 1 91  ? 28.434  13.928  20.902 1.00 60.98  ? 91  ALA B O     1 
ATOM   1704 C CB    . ALA B 1 91  ? 27.975  12.929  17.490 1.00 31.40  ? 91  ALA B CB    1 
ATOM   1705 N N     . LEU B 1 92  ? 27.672  15.091  19.142 1.00 56.56  ? 92  LEU B N     1 
ATOM   1706 C CA    . LEU B 1 92  ? 27.821  16.387  19.811 1.00 56.56  ? 92  LEU B CA    1 
ATOM   1707 C C     . LEU B 1 92  ? 26.711  16.729  20.796 1.00 56.56  ? 92  LEU B C     1 
ATOM   1708 O O     . LEU B 1 92  ? 25.568  16.328  20.612 1.00 56.56  ? 92  LEU B O     1 
ATOM   1709 C CB    . LEU B 1 92  ? 27.905  17.502  18.785 1.00 42.02  ? 92  LEU B CB    1 
ATOM   1710 C CG    . LEU B 1 92  ? 26.842  17.356  17.712 1.00 42.02  ? 92  LEU B CG    1 
ATOM   1711 C CD1   . LEU B 1 92  ? 26.444  18.734  17.225 1.00 42.02  ? 92  LEU B CD1   1 
ATOM   1712 C CD2   . LEU B 1 92  ? 27.371  16.466  16.580 1.00 42.02  ? 92  LEU B CD2   1 
ATOM   1713 N N     . PRO B 1 93  ? 27.046  17.484  21.860 1.00 56.94  ? 93  PRO B N     1 
ATOM   1714 C CA    . PRO B 1 93  ? 26.123  17.920  22.917 1.00 56.94  ? 93  PRO B CA    1 
ATOM   1715 C C     . PRO B 1 93  ? 24.909  18.625  22.338 1.00 56.94  ? 93  PRO B C     1 
ATOM   1716 O O     . PRO B 1 93  ? 25.003  19.324  21.331 1.00 56.94  ? 93  PRO B O     1 
ATOM   1717 C CB    . PRO B 1 93  ? 26.985  18.848  23.763 1.00 157.85 ? 93  PRO B CB    1 
ATOM   1718 C CG    . PRO B 1 93  ? 28.339  18.217  23.651 1.00 157.85 ? 93  PRO B CG    1 
ATOM   1719 C CD    . PRO B 1 93  ? 28.425  17.908  22.173 1.00 157.85 ? 93  PRO B CD    1 
ATOM   1720 N N     . PRO B 1 94  ? 23.753  18.468  22.983 1.00 66.20  ? 94  PRO B N     1 
ATOM   1721 C CA    . PRO B 1 94  ? 22.534  19.103  22.488 1.00 66.20  ? 94  PRO B CA    1 
ATOM   1722 C C     . PRO B 1 94  ? 22.713  20.579  22.169 1.00 66.20  ? 94  PRO B C     1 
ATOM   1723 O O     . PRO B 1 94  ? 22.595  20.994  21.015 1.00 66.20  ? 94  PRO B O     1 
ATOM   1724 C CB    . PRO B 1 94  ? 21.534  18.856  23.619 1.00 63.58  ? 94  PRO B CB    1 
ATOM   1725 C CG    . PRO B 1 94  ? 22.401  18.855  24.825 1.00 63.58  ? 94  PRO B CG    1 
ATOM   1726 C CD    . PRO B 1 94  ? 23.570  18.015  24.369 1.00 63.58  ? 94  PRO B CD    1 
ATOM   1727 N N     . ARG B 1 95  ? 23.009  21.365  23.197 1.00 73.26  ? 95  ARG B N     1 
ATOM   1728 C CA    . ARG B 1 95  ? 23.186  22.794  23.012 1.00 73.26  ? 95  ARG B CA    1 
ATOM   1729 C C     . ARG B 1 95  ? 23.878  23.060  21.672 1.00 73.26  ? 95  ARG B C     1 
ATOM   1730 O O     . ARG B 1 95  ? 23.286  23.662  20.772 1.00 73.26  ? 95  ARG B O     1 
ATOM   1731 C CB    . ARG B 1 95  ? 24.010  23.371  24.167 1.00 149.15 ? 95  ARG B CB    1 
ATOM   1732 C CG    . ARG B 1 95  ? 23.990  24.887  24.245 1.00 149.15 ? 95  ARG B CG    1 
ATOM   1733 C CD    . ARG B 1 95  ? 24.967  25.403  25.288 1.00 149.15 ? 95  ARG B CD    1 
ATOM   1734 N NE    . ARG B 1 95  ? 24.614  24.993  26.644 1.00 149.15 ? 95  ARG B NE    1 
ATOM   1735 C CZ    . ARG B 1 95  ? 25.429  25.103  27.689 1.00 149.15 ? 95  ARG B CZ    1 
ATOM   1736 N NH1   . ARG B 1 95  ? 26.647  25.606  27.533 1.00 149.15 ? 95  ARG B NH1   1 
ATOM   1737 N NH2   . ARG B 1 95  ? 25.028  24.709  28.891 1.00 149.15 ? 95  ARG B NH2   1 
ATOM   1738 N N     . LEU B 1 96  ? 25.116  22.579  21.542 1.00 65.01  ? 96  LEU B N     1 
ATOM   1739 C CA    . LEU B 1 96  ? 25.911  22.759  20.328 1.00 65.01  ? 96  LEU B CA    1 
ATOM   1740 C C     . LEU B 1 96  ? 25.181  22.231  19.090 1.00 65.01  ? 96  LEU B C     1 
ATOM   1741 O O     . LEU B 1 96  ? 25.331  22.757  17.983 1.00 65.01  ? 96  LEU B O     1 
ATOM   1742 C CB    . LEU B 1 96  ? 27.263  22.051  20.485 1.00 44.50  ? 96  LEU B CB    1 
ATOM   1743 C CG    . LEU B 1 96  ? 28.406  22.346  19.492 1.00 44.50  ? 96  LEU B CG    1 
ATOM   1744 C CD1   . LEU B 1 96  ? 29.698  21.773  20.060 1.00 44.50  ? 96  LEU B CD1   1 
ATOM   1745 C CD2   . LEU B 1 96  ? 28.135  21.764  18.119 1.00 44.50  ? 96  LEU B CD2   1 
ATOM   1746 N N     . LEU B 1 97  ? 24.384  21.189  19.273 1.00 52.96  ? 97  LEU B N     1 
ATOM   1747 C CA    . LEU B 1 97  ? 23.657  20.631  18.151 1.00 52.96  ? 97  LEU B CA    1 
ATOM   1748 C C     . LEU B 1 97  ? 22.470  21.532  17.799 1.00 52.96  ? 97  LEU B C     1 
ATOM   1749 O O     . LEU B 1 97  ? 22.108  21.690  16.634 1.00 52.96  ? 97  LEU B O     1 
ATOM   1750 C CB    . LEU B 1 97  ? 23.187  19.217  18.496 1.00 36.25  ? 97  LEU B CB    1 
ATOM   1751 C CG    . LEU B 1 97  ? 22.367  18.527  17.407 1.00 36.25  ? 97  LEU B CG    1 
ATOM   1752 C CD1   . LEU B 1 97  ? 23.133  18.495  16.097 1.00 36.25  ? 97  LEU B CD1   1 
ATOM   1753 C CD2   . LEU B 1 97  ? 22.026  17.134  17.859 1.00 36.25  ? 97  LEU B CD2   1 
ATOM   1754 N N     . ALA B 1 98  ? 21.875  22.132  18.822 1.00 40.41  ? 98  ALA B N     1 
ATOM   1755 C CA    . ALA B 1 98  ? 20.733  23.006  18.626 1.00 40.41  ? 98  ALA B CA    1 
ATOM   1756 C C     . ALA B 1 98  ? 21.166  24.168  17.761 1.00 40.41  ? 98  ALA B C     1 
ATOM   1757 O O     . ALA B 1 98  ? 20.519  24.492  16.757 1.00 40.41  ? 98  ALA B O     1 
ATOM   1758 C CB    . ALA B 1 98  ? 20.229  23.508  19.966 1.00 173.30 ? 98  ALA B CB    1 
ATOM   1759 N N     . ARG B 1 99  ? 22.263  24.795  18.183 1.00 43.08  ? 99  ARG B N     1 
ATOM   1760 C CA    . ARG B 1 99  ? 22.859  25.921  17.485 1.00 43.08  ? 99  ARG B CA    1 
ATOM   1761 C C     . ARG B 1 99  ? 23.085  25.427  16.060 1.00 43.08  ? 99  ARG B C     1 
ATOM   1762 O O     . ARG B 1 99  ? 22.417  25.855  15.112 1.00 43.08  ? 99  ARG B O     1 
ATOM   1763 C CB    . ARG B 1 99  ? 24.199  26.269  18.134 1.00 127.80 ? 99  ARG B CB    1 
ATOM   1764 C CG    . ARG B 1 99  ? 24.850  27.542  17.634 1.00 127.80 ? 99  ARG B CG    1 
ATOM   1765 C CD    . ARG B 1 99  ? 24.229  28.763  18.285 1.00 127.80 ? 99  ARG B CD    1 
ATOM   1766 N NE    . ARG B 1 99  ? 24.274  28.671  19.743 1.00 127.80 ? 99  ARG B NE    1 
ATOM   1767 C CZ    . ARG B 1 99  ? 23.906  29.646  20.570 1.00 127.80 ? 99  ARG B CZ    1 
ATOM   1768 N NH1   . ARG B 1 99  ? 23.465  30.799  20.083 1.00 127.80 ? 99  ARG B NH1   1 
ATOM   1769 N NH2   . ARG B 1 99  ? 23.974  29.467  21.886 1.00 127.80 ? 99  ARG B NH2   1 
ATOM   1770 N N     . ALA B 1 100 ? 24.021  24.493  15.927 1.00 30.33  ? 100 ALA B N     1 
ATOM   1771 C CA    . ALA B 1 100 ? 24.360  23.910  14.633 1.00 30.33  ? 100 ALA B CA    1 
ATOM   1772 C C     . ALA B 1 100 ? 23.128  23.740  13.738 1.00 30.33  ? 100 ALA B C     1 
ATOM   1773 O O     . ALA B 1 100 ? 23.107  24.202  12.607 1.00 30.33  ? 100 ALA B O     1 
ATOM   1774 C CB    . ALA B 1 100 ? 25.046  22.564  14.850 1.00 48.07  ? 100 ALA B CB    1 
ATOM   1775 N N     . LEU B 1 101 ? 22.111  23.076  14.271 1.00 48.10  ? 101 LEU B N     1 
ATOM   1776 C CA    . LEU B 1 101 ? 20.879  22.824  13.545 1.00 48.10  ? 101 LEU B CA    1 
ATOM   1777 C C     . LEU B 1 101 ? 20.235  24.088  13.072 1.00 48.10  ? 101 LEU B C     1 
ATOM   1778 O O     . LEU B 1 101 ? 19.717  24.155  11.962 1.00 48.10  ? 101 LEU B O     1 
ATOM   1779 C CB    . LEU B 1 101 ? 19.878  22.092  14.425 1.00 58.07  ? 101 LEU B CB    1 
ATOM   1780 C CG    . LEU B 1 101 ? 20.058  20.586  14.497 1.00 58.07  ? 101 LEU B CG    1 
ATOM   1781 C CD1   . LEU B 1 101 ? 18.865  20.010  15.217 1.00 58.07  ? 101 LEU B CD1   1 
ATOM   1782 C CD2   . LEU B 1 101 ? 20.178  19.996  13.084 1.00 58.07  ? 101 LEU B CD2   1 
ATOM   1783 N N     . LEU B 1 102 ? 20.241  25.090  13.932 1.00 56.51  ? 102 LEU B N     1 
ATOM   1784 C CA    . LEU B 1 102 ? 19.633  26.359  13.583 1.00 56.51  ? 102 LEU B CA    1 
ATOM   1785 C C     . LEU B 1 102 ? 20.410  26.993  12.444 1.00 56.51  ? 102 LEU B C     1 
ATOM   1786 O O     . LEU B 1 102 ? 19.909  27.108  11.320 1.00 56.51  ? 102 LEU B O     1 
ATOM   1787 C CB    . LEU B 1 102 ? 19.653  27.288  14.791 1.00 50.21  ? 102 LEU B CB    1 
ATOM   1788 C CG    . LEU B 1 102 ? 18.587  28.370  14.784 1.00 50.21  ? 102 LEU B CG    1 
ATOM   1789 C CD1   . LEU B 1 102 ? 18.763  29.243  16.011 1.00 50.21  ? 102 LEU B CD1   1 
ATOM   1790 C CD2   . LEU B 1 102 ? 18.679  29.158  13.498 1.00 50.21  ? 102 LEU B CD2   1 
ATOM   1791 N N     . GLU B 1 103 ? 21.640  27.390  12.770 1.00 75.06  ? 103 GLU B N     1 
ATOM   1792 C CA    . GLU B 1 103 ? 22.569  28.023  11.843 1.00 75.06  ? 103 GLU B CA    1 
ATOM   1793 C C     . GLU B 1 103 ? 22.723  27.216  10.566 1.00 75.06  ? 103 GLU B C     1 
ATOM   1794 O O     . GLU B 1 103 ? 22.564  27.748  9.477  1.00 75.06  ? 103 GLU B O     1 
ATOM   1795 C CB    . GLU B 1 103 ? 23.926  28.210  12.529 1.00 63.53  ? 103 GLU B CB    1 
ATOM   1796 C CG    . GLU B 1 103 ? 23.808  29.039  13.808 1.00 63.53  ? 103 GLU B CG    1 
ATOM   1797 C CD    . GLU B 1 103 ? 25.137  29.434  14.433 1.00 63.53  ? 103 GLU B CD    1 
ATOM   1798 O OE1   . GLU B 1 103 ? 25.101  30.309  15.323 1.00 63.53  ? 103 GLU B OE1   1 
ATOM   1799 O OE2   . GLU B 1 103 ? 26.200  28.884  14.053 1.00 63.53  ? 103 GLU B OE2   1 
ATOM   1800 N N     . GLY B 1 104 ? 23.043  25.936  10.692 1.00 36.26  ? 104 GLY B N     1 
ATOM   1801 C CA    . GLY B 1 104 ? 23.158  25.114  9.506  1.00 36.26  ? 104 GLY B CA    1 
ATOM   1802 C C     . GLY B 1 104 ? 24.511  24.494  9.249  1.00 36.26  ? 104 GLY B C     1 
ATOM   1803 O O     . GLY B 1 104 ? 24.915  24.361  8.094  1.00 36.26  ? 104 GLY B O     1 
ATOM   1804 N N     . ASP B 1 105 ? 25.211  24.099  10.305 1.00 79.46  ? 105 ASP B N     1 
ATOM   1805 C CA    . ASP B 1 105 ? 26.530  23.508  10.137 1.00 79.46  ? 105 ASP B CA    1 
ATOM   1806 C C     . ASP B 1 105 ? 26.507  22.104  9.540  1.00 79.46  ? 105 ASP B C     1 
ATOM   1807 O O     . ASP B 1 105 ? 26.658  21.118  10.263 1.00 79.46  ? 105 ASP B O     1 
ATOM   1808 C CB    . ASP B 1 105 ? 27.286  23.477  11.477 1.00 101.83 ? 105 ASP B CB    1 
ATOM   1809 C CG    . ASP B 1 105 ? 28.011  24.790  11.789 1.00 101.83 ? 105 ASP B CG    1 
ATOM   1810 O OD1   . ASP B 1 105 ? 28.601  24.897  12.894 1.00 101.83 ? 105 ASP B OD1   1 
ATOM   1811 O OD2   . ASP B 1 105 ? 27.997  25.706  10.931 1.00 101.83 ? 105 ASP B OD2   1 
ATOM   1812 N N     . ALA B 1 106 ? 26.306  22.012  8.225  1.00 38.38  ? 106 ALA B N     1 
ATOM   1813 C CA    . ALA B 1 106 ? 26.332  20.720  7.547  1.00 38.38  ? 106 ALA B CA    1 
ATOM   1814 C C     . ALA B 1 106 ? 27.781  20.228  7.725  1.00 38.38  ? 106 ALA B C     1 
ATOM   1815 O O     . ALA B 1 106 ? 28.087  19.036  7.623  1.00 38.38  ? 106 ALA B O     1 
ATOM   1816 C CB    . ALA B 1 106 ? 26.007  20.892  6.073  1.00 191.04 ? 106 ALA B CB    1 
ATOM   1817 N N     . ARG B 1 107 ? 28.671  21.176  7.997  1.00 85.82  ? 107 ARG B N     1 
ATOM   1818 C CA    . ARG B 1 107 ? 30.068  20.856  8.223  1.00 85.82  ? 107 ARG B CA    1 
ATOM   1819 C C     . ARG B 1 107 ? 30.184  20.175  9.577  1.00 85.82  ? 107 ARG B C     1 
ATOM   1820 O O     . ARG B 1 107 ? 30.735  19.083  9.681  1.00 85.82  ? 107 ARG B O     1 
ATOM   1821 C CB    . ARG B 1 107 ? 30.933  22.122  8.219  1.00 177.42 ? 107 ARG B CB    1 
ATOM   1822 C CG    . ARG B 1 107 ? 31.197  22.724  6.845  1.00 177.42 ? 107 ARG B CG    1 
ATOM   1823 C CD    . ARG B 1 107 ? 32.148  23.911  6.942  1.00 177.42 ? 107 ARG B CD    1 
ATOM   1824 N NE    . ARG B 1 107 ? 31.658  24.916  7.886  1.00 177.42 ? 107 ARG B NE    1 
ATOM   1825 C CZ    . ARG B 1 107 ? 32.229  26.100  8.087  1.00 177.42 ? 107 ARG B CZ    1 
ATOM   1826 N NH1   . ARG B 1 107 ? 33.318  26.438  7.408  1.00 177.42 ? 107 ARG B NH1   1 
ATOM   1827 N NH2   . ARG B 1 107 ? 31.712  26.948  8.968  1.00 177.42 ? 107 ARG B NH2   1 
ATOM   1828 N N     . LEU B 1 108 ? 29.650  20.815  10.613 1.00 55.85  ? 108 LEU B N     1 
ATOM   1829 C CA    . LEU B 1 108 ? 29.728  20.253  11.954 1.00 55.85  ? 108 LEU B CA    1 
ATOM   1830 C C     . LEU B 1 108 ? 28.937  18.952  12.093 1.00 55.85  ? 108 LEU B C     1 
ATOM   1831 O O     . LEU B 1 108 ? 29.353  18.030  12.811 1.00 55.85  ? 108 LEU B O     1 
ATOM   1832 C CB    . LEU B 1 108 ? 29.241  21.270  12.980 1.00 49.61  ? 108 LEU B CB    1 
ATOM   1833 C CG    . LEU B 1 108 ? 29.450  20.887  14.448 1.00 49.61  ? 108 LEU B CG    1 
ATOM   1834 C CD1   . LEU B 1 108 ? 29.255  22.116  15.310 1.00 49.61  ? 108 LEU B CD1   1 
ATOM   1835 C CD2   . LEU B 1 108 ? 28.490  19.783  14.867 1.00 49.61  ? 108 LEU B CD2   1 
ATOM   1836 N N     . LEU B 1 109 ? 27.795  18.877  11.414 1.00 60.67  ? 109 LEU B N     1 
ATOM   1837 C CA    . LEU B 1 109 ? 26.976  17.680  11.483 1.00 60.67  ? 109 LEU B CA    1 
ATOM   1838 C C     . LEU B 1 109 ? 27.757  16.512  10.967 1.00 60.67  ? 109 LEU B C     1 
ATOM   1839 O O     . LEU B 1 109 ? 27.912  15.524  11.669 1.00 60.67  ? 109 LEU B O     1 
ATOM   1840 C CB    . LEU B 1 109 ? 25.719  17.826  10.655 1.00 30.95  ? 109 LEU B CB    1 
ATOM   1841 C CG    . LEU B 1 109 ? 24.743  18.900  11.126 1.00 30.95  ? 109 LEU B CG    1 
ATOM   1842 C CD1   . LEU B 1 109 ? 23.506  18.821  10.235 1.00 30.95  ? 109 LEU B CD1   1 
ATOM   1843 C CD2   . LEU B 1 109 ? 24.368  18.706  12.594 1.00 30.95  ? 109 LEU B CD2   1 
ATOM   1844 N N     . THR B 1 110 ? 28.250  16.621  9.737  1.00 50.96  ? 110 THR B N     1 
ATOM   1845 C CA    . THR B 1 110 ? 29.037  15.536  9.144  1.00 50.96  ? 110 THR B CA    1 
ATOM   1846 C C     . THR B 1 110 ? 30.030  15.070  10.191 1.00 50.96  ? 110 THR B C     1 
ATOM   1847 O O     . THR B 1 110 ? 30.251  13.867  10.356 1.00 50.96  ? 110 THR B O     1 
ATOM   1848 C CB    . THR B 1 110 ? 29.870  15.983  7.921  1.00 35.47  ? 110 THR B CB    1 
ATOM   1849 O OG1   . THR B 1 110 ? 29.111  16.897  7.111  1.00 35.47  ? 110 THR B OG1   1 
ATOM   1850 C CG2   . THR B 1 110 ? 30.284  14.754  7.099  1.00 35.47  ? 110 THR B CG2   1 
ATOM   1851 N N     . SER B 1 111 ? 30.609  16.050  10.895 1.00 56.85  ? 111 SER B N     1 
ATOM   1852 C CA    . SER B 1 111 ? 31.594  15.814  11.950 1.00 56.85  ? 111 SER B CA    1 
ATOM   1853 C C     . SER B 1 111 ? 30.965  15.092  13.138 1.00 56.85  ? 111 SER B C     1 
ATOM   1854 O O     . SER B 1 111 ? 30.860  15.652  14.231 1.00 56.85  ? 111 SER B O     1 
ATOM   1855 C CB    . SER B 1 111 ? 32.196  17.145  12.415 1.00 110.50 ? 111 SER B CB    1 
ATOM   1856 O OG    . SER B 1 111 ? 32.938  17.767  11.380 1.00 110.50 ? 111 SER B OG    1 
ATOM   1857 N N     . ALA B 1 112 ? 30.580  13.840  12.918 1.00 30.31  ? 112 ALA B N     1 
ATOM   1858 C CA    . ALA B 1 112 ? 29.930  13.065  13.947 1.00 30.31  ? 112 ALA B CA    1 
ATOM   1859 C C     . ALA B 1 112 ? 29.488  11.730  13.372 1.00 30.31  ? 112 ALA B C     1 
ATOM   1860 O O     . ALA B 1 112 ? 28.923  11.709  12.277 1.00 30.31  ? 112 ALA B O     1 
ATOM   1861 C CB    . ALA B 1 112 ? 28.710  13.822  14.444 1.00 37.42  ? 112 ALA B CB    1 
ATOM   1862 N N     . SER B 1 113 ? 29.722  10.638  14.117 1.00 51.56  ? 113 SER B N     1 
ATOM   1863 C CA    . SER B 1 113 ? 29.340  9.279   13.705 1.00 51.56  ? 113 SER B CA    1 
ATOM   1864 C C     . SER B 1 113 ? 28.062  9.313   12.867 1.00 51.56  ? 113 SER B C     1 
ATOM   1865 O O     . SER B 1 113 ? 27.185  10.116  13.134 1.00 51.56  ? 113 SER B O     1 
ATOM   1866 C CB    . SER B 1 113 ? 29.119  8.410   14.945 1.00 134.29 ? 113 SER B CB    1 
ATOM   1867 O OG    . SER B 1 113 ? 28.661  7.115   14.594 1.00 134.29 ? 113 SER B OG    1 
ATOM   1868 N N     . GLY B 1 114 ? 27.927  8.438   11.875 1.00 42.90  ? 114 GLY B N     1 
ATOM   1869 C CA    . GLY B 1 114 ? 26.736  8.507   11.037 1.00 42.90  ? 114 GLY B CA    1 
ATOM   1870 C C     . GLY B 1 114 ? 26.939  9.768   10.198 1.00 42.90  ? 114 GLY B C     1 
ATOM   1871 O O     . GLY B 1 114 ? 26.027  10.400  9.619  1.00 42.90  ? 114 GLY B O     1 
ATOM   1872 N N     . VAL B 1 115 ? 28.211  10.148  10.176 1.00 200.00 ? 115 VAL B N     1 
ATOM   1873 C CA    . VAL B 1 115 ? 28.696  11.301  9.444  1.00 200.00 ? 115 VAL B CA    1 
ATOM   1874 C C     . VAL B 1 115 ? 28.083  11.304  8.052  1.00 200.00 ? 115 VAL B C     1 
ATOM   1875 O O     . VAL B 1 115 ? 28.550  10.601  7.157  1.00 200.00 ? 115 VAL B O     1 
ATOM   1876 C CB    . VAL B 1 115 ? 30.225  11.226  9.302  1.00 51.91  ? 115 VAL B CB    1 
ATOM   1877 C CG1   . VAL B 1 115 ? 30.905  11.516  10.628 1.00 51.91  ? 115 VAL B CG1   1 
ATOM   1878 C CG2   . VAL B 1 115 ? 30.610  9.803   8.835  1.00 51.91  ? 115 VAL B CG2   1 
ATOM   1879 N N     . GLY B 1 116 ? 27.022  12.075  7.871  1.00 59.74  ? 116 GLY B N     1 
ATOM   1880 C CA    . GLY B 1 116 ? 26.414  12.136  6.557  1.00 59.74  ? 116 GLY B CA    1 
ATOM   1881 C C     . GLY B 1 116 ? 26.931  13.315  5.738  1.00 59.74  ? 116 GLY B C     1 
ATOM   1882 O O     . GLY B 1 116 ? 26.841  14.462  6.172  1.00 59.74  ? 116 GLY B O     1 
ATOM   1883 N N     . ARG B 1 117 ? 27.468  13.059  4.548  1.00 87.37  ? 117 ARG B N     1 
ATOM   1884 C CA    . ARG B 1 117 ? 27.972  14.159  3.737  1.00 87.37  ? 117 ARG B CA    1 
ATOM   1885 C C     . ARG B 1 117 ? 26.793  15.031  3.333  1.00 87.37  ? 117 ARG B C     1 
ATOM   1886 O O     . ARG B 1 117 ? 26.513  16.035  3.989  1.00 87.37  ? 117 ARG B O     1 
ATOM   1887 C CB    . ARG B 1 117 ? 28.694  13.648  2.486  1.00 188.33 ? 117 ARG B CB    1 
ATOM   1888 C CG    . ARG B 1 117 ? 29.843  14.557  2.027  1.00 188.33 ? 117 ARG B CG    1 
ATOM   1889 C CD    . ARG B 1 117 ? 29.451  16.039  2.033  1.00 188.33 ? 117 ARG B CD    1 
ATOM   1890 N NE    . ARG B 1 117 ? 30.560  16.919  1.667  1.00 188.33 ? 117 ARG B NE    1 
ATOM   1891 C CZ    . ARG B 1 117 ? 30.495  18.249  1.663  1.00 188.33 ? 117 ARG B CZ    1 
ATOM   1892 N NH1   . ARG B 1 117 ? 29.373  18.866  2.009  1.00 188.33 ? 117 ARG B NH1   1 
ATOM   1893 N NH2   . ARG B 1 117 ? 31.554  18.964  1.308  1.00 188.33 ? 117 ARG B NH2   1 
ATOM   1894 N N     . ARG B 1 118 ? 26.092  14.642  2.268  1.00 73.22  ? 118 ARG B N     1 
ATOM   1895 C CA    . ARG B 1 118 ? 24.949  15.426  1.814  1.00 73.22  ? 118 ARG B CA    1 
ATOM   1896 C C     . ARG B 1 118 ? 23.805  15.383  2.815  1.00 73.22  ? 118 ARG B C     1 
ATOM   1897 O O     . ARG B 1 118 ? 22.999  16.319  2.885  1.00 73.22  ? 118 ARG B O     1 
ATOM   1898 C CB    . ARG B 1 118 ? 24.447  14.975  0.424  1.00 46.94  ? 118 ARG B CB    1 
ATOM   1899 C CG    . ARG B 1 118 ? 24.673  13.506  0.055  1.00 46.94  ? 118 ARG B CG    1 
ATOM   1900 C CD    . ARG B 1 118 ? 26.076  13.309  -0.516 1.00 46.94  ? 118 ARG B CD    1 
ATOM   1901 N NE    . ARG B 1 118 ? 26.140  12.970  -1.945 1.00 46.94  ? 118 ARG B NE    1 
ATOM   1902 C CZ    . ARG B 1 118 ? 25.466  13.586  -2.910 1.00 46.94  ? 118 ARG B CZ    1 
ATOM   1903 N NH1   . ARG B 1 118 ? 24.644  14.586  -2.623 1.00 46.94  ? 118 ARG B NH1   1 
ATOM   1904 N NH2   . ARG B 1 118 ? 25.635  13.218  -4.169 1.00 46.94  ? 118 ARG B NH2   1 
ATOM   1905 N N     . LEU B 1 119 ? 23.732  14.315  3.605  1.00 52.56  ? 119 LEU B N     1 
ATOM   1906 C CA    . LEU B 1 119 ? 22.645  14.236  4.565  1.00 52.56  ? 119 LEU B CA    1 
ATOM   1907 C C     . LEU B 1 119 ? 22.789  15.328  5.576  1.00 52.56  ? 119 LEU B C     1 
ATOM   1908 O O     . LEU B 1 119 ? 21.816  16.003  5.904  1.00 52.56  ? 119 LEU B O     1 
ATOM   1909 C CB    . LEU B 1 119 ? 22.599  12.901  5.307  1.00 35.34  ? 119 LEU B CB    1 
ATOM   1910 C CG    . LEU B 1 119 ? 21.438  12.906  6.315  1.00 35.34  ? 119 LEU B CG    1 
ATOM   1911 C CD1   . LEU B 1 119 ? 20.147  13.128  5.570  1.00 35.34  ? 119 LEU B CD1   1 
ATOM   1912 C CD2   . LEU B 1 119 ? 21.388  11.611  7.087  1.00 35.34  ? 119 LEU B CD2   1 
ATOM   1913 N N     . ALA B 1 120 ? 24.004  15.496  6.080  1.00 25.36  ? 120 ALA B N     1 
ATOM   1914 C CA    . ALA B 1 120 ? 24.239  16.529  7.068  1.00 25.36  ? 120 ALA B CA    1 
ATOM   1915 C C     . ALA B 1 120 ? 23.768  17.836  6.444  1.00 25.36  ? 120 ALA B C     1 
ATOM   1916 O O     . ALA B 1 120 ? 23.272  18.726  7.141  1.00 25.36  ? 120 ALA B O     1 
ATOM   1917 C CB    . ALA B 1 120 ? 25.710  16.587  7.427  1.00 2.54   ? 120 ALA B CB    1 
ATOM   1918 N N     . GLU B 1 121 ? 23.905  17.927  5.122  1.00 47.15  ? 121 GLU B N     1 
ATOM   1919 C CA    . GLU B 1 121 ? 23.471  19.109  4.402  1.00 47.15  ? 121 GLU B CA    1 
ATOM   1920 C C     . GLU B 1 121 ? 21.943  19.218  4.383  1.00 47.15  ? 121 GLU B C     1 
ATOM   1921 O O     . GLU B 1 121 ? 21.377  20.217  4.851  1.00 47.15  ? 121 GLU B O     1 
ATOM   1922 C CB    . GLU B 1 121 ? 23.985  19.087  2.981  1.00 45.81  ? 121 GLU B CB    1 
ATOM   1923 C CG    . GLU B 1 121 ? 25.472  18.940  2.869  1.00 45.81  ? 121 GLU B CG    1 
ATOM   1924 C CD    . GLU B 1 121 ? 25.997  19.526  1.571  1.00 45.81  ? 121 GLU B CD    1 
ATOM   1925 O OE1   . GLU B 1 121 ? 26.222  20.759  1.532  1.00 45.81  ? 121 GLU B OE1   1 
ATOM   1926 O OE2   . GLU B 1 121 ? 26.165  18.765  0.587  1.00 45.81  ? 121 GLU B OE2   1 
ATOM   1927 N N     . ARG B 1 122 ? 21.260  18.211  3.842  1.00 61.29  ? 122 ARG B N     1 
ATOM   1928 C CA    . ARG B 1 122 ? 19.796  18.265  3.833  1.00 61.29  ? 122 ARG B CA    1 
ATOM   1929 C C     . ARG B 1 122 ? 19.346  18.704  5.235  1.00 61.29  ? 122 ARG B C     1 
ATOM   1930 O O     . ARG B 1 122 ? 18.823  19.804  5.413  1.00 61.29  ? 122 ARG B O     1 
ATOM   1931 C CB    . ARG B 1 122 ? 19.204  16.897  3.495  1.00 105.82 ? 122 ARG B CB    1 
ATOM   1932 C CG    . ARG B 1 122 ? 17.730  16.955  3.138  1.00 105.82 ? 122 ARG B CG    1 
ATOM   1933 C CD    . ARG B 1 122 ? 17.178  15.578  2.844  1.00 105.82 ? 122 ARG B CD    1 
ATOM   1934 N NE    . ARG B 1 122 ? 17.944  14.900  1.809  1.00 105.82 ? 122 ARG B NE    1 
ATOM   1935 C CZ    . ARG B 1 122 ? 17.712  13.656  1.404  1.00 105.82 ? 122 ARG B CZ    1 
ATOM   1936 N NH1   . ARG B 1 122 ? 16.729  12.949  1.949  1.00 105.82 ? 122 ARG B NH1   1 
ATOM   1937 N NH2   . ARG B 1 122 ? 18.467  13.114  0.456  1.00 105.82 ? 122 ARG B NH2   1 
ATOM   1938 N N     . ILE B 1 123 ? 19.578  17.839  6.221  1.00 28.00  ? 123 ILE B N     1 
ATOM   1939 C CA    . ILE B 1 123 ? 19.252  18.117  7.619  1.00 28.00  ? 123 ILE B CA    1 
ATOM   1940 C C     . ILE B 1 123 ? 19.569  19.573  7.947  1.00 28.00  ? 123 ILE B C     1 
ATOM   1941 O O     . ILE B 1 123 ? 18.907  20.189  8.772  1.00 28.00  ? 123 ILE B O     1 
ATOM   1942 C CB    . ILE B 1 123 ? 20.102  17.230  8.585  1.00 29.35  ? 123 ILE B CB    1 
ATOM   1943 C CG1   . ILE B 1 123 ? 19.771  15.758  8.363  1.00 29.35  ? 123 ILE B CG1   1 
ATOM   1944 C CG2   . ILE B 1 123 ? 19.885  17.636  10.043 1.00 29.35  ? 123 ILE B CG2   1 
ATOM   1945 C CD1   . ILE B 1 123 ? 20.724  14.806  9.063  1.00 29.35  ? 123 ILE B CD1   1 
ATOM   1946 N N     . ALA B 1 124 ? 20.589  20.130  7.312  1.00 23.76  ? 124 ALA B N     1 
ATOM   1947 C CA    . ALA B 1 124 ? 20.937  21.498  7.619  1.00 23.76  ? 124 ALA B CA    1 
ATOM   1948 C C     . ALA B 1 124 ? 19.983  22.432  6.927  1.00 23.76  ? 124 ALA B C     1 
ATOM   1949 O O     . ALA B 1 124 ? 19.119  23.015  7.573  1.00 23.76  ? 124 ALA B O     1 
ATOM   1950 C CB    . ALA B 1 124 ? 22.347  21.788  7.209  1.00 18.87  ? 124 ALA B CB    1 
ATOM   1951 N N     . LEU B 1 125 ? 20.125  22.581  5.615  1.00 54.31  ? 125 LEU B N     1 
ATOM   1952 C CA    . LEU B 1 125 ? 19.235  23.462  4.855  1.00 54.31  ? 125 LEU B CA    1 
ATOM   1953 C C     . LEU B 1 125 ? 17.793  23.350  5.343  1.00 54.31  ? 125 LEU B C     1 
ATOM   1954 O O     . LEU B 1 125 ? 17.076  24.340  5.440  1.00 54.31  ? 125 LEU B O     1 
ATOM   1955 C CB    . LEU B 1 125 ? 19.278  23.104  3.367  1.00 48.19  ? 125 LEU B CB    1 
ATOM   1956 C CG    . LEU B 1 125 ? 17.978  23.412  2.619  1.00 48.19  ? 125 LEU B CG    1 
ATOM   1957 C CD1   . LEU B 1 125 ? 17.740  24.893  2.605  1.00 48.19  ? 125 LEU B CD1   1 
ATOM   1958 C CD2   . LEU B 1 125 ? 18.058  22.893  1.205  1.00 48.19  ? 125 LEU B CD2   1 
ATOM   1959 N N     . GLU B 1 126 ? 17.403  22.120  5.663  1.00 29.35  ? 126 GLU B N     1 
ATOM   1960 C CA    . GLU B 1 126 ? 16.063  21.777  6.114  1.00 29.35  ? 126 GLU B CA    1 
ATOM   1961 C C     . GLU B 1 126 ? 15.579  22.330  7.457  1.00 29.35  ? 126 GLU B C     1 
ATOM   1962 O O     . GLU B 1 126 ? 14.402  22.632  7.612  1.00 29.35  ? 126 GLU B O     1 
ATOM   1963 C CB    . GLU B 1 126 ? 15.931  20.265  6.114  1.00 73.37  ? 126 GLU B CB    1 
ATOM   1964 C CG    . GLU B 1 126 ? 14.548  19.812  6.392  1.00 73.37  ? 126 GLU B CG    1 
ATOM   1965 C CD    . GLU B 1 126 ? 13.564  20.464  5.472  1.00 73.37  ? 126 GLU B CD    1 
ATOM   1966 O OE1   . GLU B 1 126 ? 13.387  21.697  5.569  1.00 73.37  ? 126 GLU B OE1   1 
ATOM   1967 O OE2   . GLU B 1 126 ? 12.974  19.738  4.648  1.00 73.37  ? 126 GLU B OE2   1 
ATOM   1968 N N     . LEU B 1 127 ? 16.454  22.458  8.438  1.00 41.67  ? 127 LEU B N     1 
ATOM   1969 C CA    . LEU B 1 127 ? 15.996  22.984  9.705  1.00 41.67  ? 127 LEU B CA    1 
ATOM   1970 C C     . LEU B 1 127 ? 16.562  24.354  9.971  1.00 41.67  ? 127 LEU B C     1 
ATOM   1971 O O     . LEU B 1 127 ? 16.373  24.890  11.072 1.00 41.67  ? 127 LEU B O     1 
ATOM   1972 C CB    . LEU B 1 127 ? 16.385  22.069  10.862 1.00 36.50  ? 127 LEU B CB    1 
ATOM   1973 C CG    . LEU B 1 127 ? 15.914  20.617  10.822 1.00 36.50  ? 127 LEU B CG    1 
ATOM   1974 C CD1   . LEU B 1 127 ? 15.969  20.016  12.210 1.00 36.50  ? 127 LEU B CD1   1 
ATOM   1975 C CD2   . LEU B 1 127 ? 14.504  20.568  10.334 1.00 36.50  ? 127 LEU B CD2   1 
ATOM   1976 N N     . LYS B 1 128 ? 17.266  24.928  8.991  1.00 52.85  ? 128 LYS B N     1 
ATOM   1977 C CA    . LYS B 1 128 ? 17.848  26.254  9.190  1.00 52.85  ? 128 LYS B CA    1 
ATOM   1978 C C     . LYS B 1 128 ? 16.703  27.170  9.559  1.00 52.85  ? 128 LYS B C     1 
ATOM   1979 O O     . LYS B 1 128 ? 15.702  27.240  8.843  1.00 52.85  ? 128 LYS B O     1 
ATOM   1980 C CB    . LYS B 1 128 ? 18.517  26.791  7.922  1.00 70.00  ? 128 LYS B CB    1 
ATOM   1981 C CG    . LYS B 1 128 ? 19.096  28.205  8.117  1.00 70.00  ? 128 LYS B CG    1 
ATOM   1982 C CD    . LYS B 1 128 ? 19.188  29.024  6.820  1.00 70.00  ? 128 LYS B CD    1 
ATOM   1983 C CE    . LYS B 1 128 ? 20.482  28.772  6.039  1.00 70.00  ? 128 LYS B CE    1 
ATOM   1984 N NZ    . LYS B 1 128 ? 21.698  29.428  6.622  1.00 70.00  ? 128 LYS B NZ    1 
ATOM   1985 N N     . GLY B 1 129 ? 16.843  27.853  10.688 1.00 54.44  ? 129 GLY B N     1 
ATOM   1986 C CA    . GLY B 1 129 ? 15.801  28.762  11.125 1.00 54.44  ? 129 GLY B CA    1 
ATOM   1987 C C     . GLY B 1 129 ? 14.659  28.086  11.861 1.00 54.44  ? 129 GLY B C     1 
ATOM   1988 O O     . GLY B 1 129 ? 14.248  28.578  12.920 1.00 54.44  ? 129 GLY B O     1 
ATOM   1989 N N     . LYS B 1 130 ? 14.166  26.972  11.308 1.00 76.24  ? 130 LYS B N     1 
ATOM   1990 C CA    . LYS B 1 130 ? 13.057  26.210  11.884 1.00 76.24  ? 130 LYS B CA    1 
ATOM   1991 C C     . LYS B 1 130 ? 13.287  25.689  13.298 1.00 76.24  ? 130 LYS B C     1 
ATOM   1992 O O     . LYS B 1 130 ? 12.412  25.051  13.892 1.00 76.24  ? 130 LYS B O     1 
ATOM   1993 C CB    . LYS B 1 130 ? 12.691  25.031  10.981 1.00 91.17  ? 130 LYS B CB    1 
ATOM   1994 C CG    . LYS B 1 130 ? 12.116  25.415  9.627  1.00 91.17  ? 130 LYS B CG    1 
ATOM   1995 C CD    . LYS B 1 130 ? 11.173  24.327  9.077  1.00 91.17  ? 130 LYS B CD    1 
ATOM   1996 C CE    . LYS B 1 130 ? 11.853  22.965  8.920  1.00 91.17  ? 130 LYS B CE    1 
ATOM   1997 N NZ    . LYS B 1 130 ? 10.921  21.901  8.440  1.00 91.17  ? 130 LYS B NZ    1 
ATOM   1998 N N     . VAL B 1 131 ? 14.469  25.955  13.830 1.00 43.30  ? 131 VAL B N     1 
ATOM   1999 C CA    . VAL B 1 131 ? 14.828  25.539  15.181 1.00 43.30  ? 131 VAL B CA    1 
ATOM   2000 C C     . VAL B 1 131 ? 14.958  26.836  15.988 1.00 43.30  ? 131 VAL B C     1 
ATOM   2001 O O     . VAL B 1 131 ? 15.448  27.850  15.463 1.00 43.30  ? 131 VAL B O     1 
ATOM   2002 C CB    . VAL B 1 131 ? 16.203  24.849  15.153 1.00 40.85  ? 131 VAL B CB    1 
ATOM   2003 C CG1   . VAL B 1 131 ? 16.529  24.225  16.472 1.00 40.85  ? 131 VAL B CG1   1 
ATOM   2004 C CG2   . VAL B 1 131 ? 16.222  23.819  14.052 1.00 40.85  ? 131 VAL B CG2   1 
ATOM   2005 N N     . PRO B 1 132 ? 14.490  26.871  17.245 1.00 56.46  ? 132 PRO B N     1 
ATOM   2006 C CA    . PRO B 1 132 ? 13.826  26.208  18.364 1.00 56.46  ? 132 PRO B CA    1 
ATOM   2007 C C     . PRO B 1 132 ? 13.614  27.332  19.394 1.00 56.46  ? 132 PRO B C     1 
ATOM   2008 O O     . PRO B 1 132 ? 14.430  28.258  19.515 1.00 56.46  ? 132 PRO B O     1 
ATOM   2009 C CB    . PRO B 1 132 ? 14.888  25.263  18.850 1.00 200.00 ? 132 PRO B CB    1 
ATOM   2010 C CG    . PRO B 1 132 ? 16.104  26.202  18.855 1.00 200.00 ? 132 PRO B CG    1 
ATOM   2011 C CD    . PRO B 1 132 ? 15.845  27.227  17.717 1.00 200.00 ? 132 PRO B CD    1 
ATOM   2012 N N     . PRO B 1 133 ? 12.523  27.285  20.153 1.00 145.92 ? 133 PRO B N     1 
ATOM   2013 C CA    . PRO B 1 133 ? 12.440  28.407  21.093 1.00 145.92 ? 133 PRO B CA    1 
ATOM   2014 C C     . PRO B 1 133 ? 13.483  28.263  22.207 1.00 145.92 ? 133 PRO B C     1 
ATOM   2015 O O     . PRO B 1 133 ? 14.668  28.570  22.035 1.00 145.92 ? 133 PRO B O     1 
ATOM   2016 C CB    . PRO B 1 133 ? 11.010  28.301  21.628 1.00 200.00 ? 133 PRO B CB    1 
ATOM   2017 C CG    . PRO B 1 133 ? 10.262  27.643  20.495 1.00 200.00 ? 133 PRO B CG    1 
ATOM   2018 C CD    . PRO B 1 133 ? 11.235  26.580  20.038 1.00 200.00 ? 133 PRO B CD    1 
ATOM   2019 N N     . HIS B 1 134 ? 12.998  27.782  23.346 1.00 144.01 ? 134 HIS B N     1 
ATOM   2020 C CA    . HIS B 1 134 ? 13.789  27.554  24.544 1.00 144.01 ? 134 HIS B CA    1 
ATOM   2021 C C     . HIS B 1 134 ? 14.588  26.292  24.313 1.00 144.01 ? 134 HIS B C     1 
ATOM   2022 O O     . HIS B 1 134 ? 14.297  25.258  24.911 1.00 144.01 ? 134 HIS B O     1 
ATOM   2023 C CB    . HIS B 1 134 ? 12.844  27.356  25.736 1.00 200.00 ? 134 HIS B CB    1 
ATOM   2024 C CG    . HIS B 1 134 ? 13.537  27.140  27.045 1.00 200.00 ? 134 HIS B CG    1 
ATOM   2025 N ND1   . HIS B 1 134 ? 14.209  28.145  27.708 1.00 200.00 ? 134 HIS B ND1   1 
ATOM   2026 C CD2   . HIS B 1 134 ? 13.645  26.038  27.824 1.00 200.00 ? 134 HIS B CD2   1 
ATOM   2027 C CE1   . HIS B 1 134 ? 14.699  27.671  28.840 1.00 200.00 ? 134 HIS B CE1   1 
ATOM   2028 N NE2   . HIS B 1 134 ? 14.371  26.395  28.934 1.00 200.00 ? 134 HIS B NE2   1 
ATOM   2029 N N     . LEU B 1 135 ? 15.590  26.364  23.445 1.00 70.50  ? 135 LEU B N     1 
ATOM   2030 C CA    . LEU B 1 135 ? 16.388  25.173  23.166 1.00 70.50  ? 135 LEU B CA    1 
ATOM   2031 C C     . LEU B 1 135 ? 17.821  25.418  22.745 1.00 70.50  ? 135 LEU B C     1 
ATOM   2032 O O     . LEU B 1 135 ? 18.420  24.596  22.057 1.00 70.50  ? 135 LEU B O     1 
ATOM   2033 C CB    . LEU B 1 135 ? 15.699  24.341  22.096 1.00 43.99  ? 135 LEU B CB    1 
ATOM   2034 C CG    . LEU B 1 135 ? 16.213  22.928  21.827 1.00 43.99  ? 135 LEU B CG    1 
ATOM   2035 C CD1   . LEU B 1 135 ? 16.897  22.345  23.093 1.00 43.99  ? 135 LEU B CD1   1 
ATOM   2036 C CD2   . LEU B 1 135 ? 15.017  22.076  21.327 1.00 43.99  ? 135 LEU B CD2   1 
ATOM   2037 N N     . LEU B 1 136 ? 18.376  26.544  23.167 1.00 53.69  ? 136 LEU B N     1 
ATOM   2038 C CA    . LEU B 1 136 ? 19.734  26.872  22.814 1.00 53.69  ? 136 LEU B CA    1 
ATOM   2039 C C     . LEU B 1 136 ? 20.598  26.678  24.039 1.00 53.69  ? 136 LEU B C     1 
ATOM   2040 O O     . LEU B 1 136 ? 21.818  26.757  23.954 1.00 53.69  ? 136 LEU B O     1 
ATOM   2041 C CB    . LEU B 1 136 ? 19.802  28.314  22.315 1.00 116.18 ? 136 LEU B CB    1 
ATOM   2042 C CG    . LEU B 1 136 ? 18.953  28.636  21.076 1.00 116.18 ? 136 LEU B CG    1 
ATOM   2043 C CD1   . LEU B 1 136 ? 19.347  27.683  19.956 1.00 116.18 ? 136 LEU B CD1   1 
ATOM   2044 C CD2   . LEU B 1 136 ? 17.454  28.528  21.386 1.00 116.18 ? 136 LEU B CD2   1 
ATOM   2045 N N     . ALA B 1 137 ? 19.958  26.410  25.178 1.00 84.28  ? 137 ALA B N     1 
ATOM   2046 C CA    . ALA B 1 137 ? 20.667  26.184  26.442 1.00 84.28  ? 137 ALA B CA    1 
ATOM   2047 C C     . ALA B 1 137 ? 19.825  25.375  27.433 1.00 84.28  ? 137 ALA B C     1 
ATOM   2048 O O     . ALA B 1 137 ? 18.772  25.828  27.876 1.00 84.28  ? 137 ALA B O     1 
ATOM   2049 C CB    . ALA B 1 137 ? 21.060  27.519  27.063 1.00 200.00 ? 137 ALA B CB    1 
ATOM   2050 N N     . GLY B 1 138 ? 20.303  24.182  27.777 1.00 114.13 ? 138 GLY B N     1 
ATOM   2051 C CA    . GLY B 1 138 ? 19.590  23.311  28.700 1.00 114.13 ? 138 GLY B CA    1 
ATOM   2052 C C     . GLY B 1 138 ? 18.964  23.995  29.902 1.00 114.13 ? 138 GLY B C     1 
ATOM   2053 O O     . GLY B 1 138 ? 19.669  24.439  30.809 1.00 114.13 ? 138 GLY B O     1 
ATOM   2054 N N     . GLU B 1 139 ? 17.633  24.071  29.905 1.00 136.94 ? 139 GLU B N     1 
ATOM   2055 C CA    . GLU B 1 139 ? 16.864  24.689  30.988 1.00 136.94 ? 139 GLU B CA    1 
ATOM   2056 C C     . GLU B 1 139 ? 17.342  24.190  32.352 1.00 136.94 ? 139 GLU B C     1 
ATOM   2057 O O     . GLU B 1 139 ? 17.310  22.991  32.628 1.00 136.94 ? 139 GLU B O     1 
ATOM   2058 C CB    . GLU B 1 139 ? 15.372  24.363  30.813 1.00 139.64 ? 139 GLU B CB    1 
ATOM   2059 C CG    . GLU B 1 139 ? 14.435  25.024  31.824 1.00 139.64 ? 139 GLU B CG    1 
ATOM   2060 C CD    . GLU B 1 139 ? 12.983  24.560  31.691 1.00 139.64 ? 139 GLU B CD    1 
ATOM   2061 O OE1   . GLU B 1 139 ? 12.114  25.108  32.404 1.00 139.64 ? 139 GLU B OE1   1 
ATOM   2062 O OE2   . GLU B 1 139 ? 12.706  23.647  30.883 1.00 139.64 ? 139 GLU B OE2   1 
ATOM   2063 N N     . LYS B 1 140 ? 17.787  25.111  33.202 1.00 164.36 ? 140 LYS B N     1 
ATOM   2064 C CA    . LYS B 1 140 ? 18.269  24.750  34.532 1.00 164.36 ? 140 LYS B CA    1 
ATOM   2065 C C     . LYS B 1 140 ? 18.120  25.909  35.512 1.00 164.36 ? 140 LYS B C     1 
ATOM   2066 O O     . LYS B 1 140 ? 18.807  26.925  35.403 1.00 164.36 ? 140 LYS B O     1 
ATOM   2067 C CB    . LYS B 1 140 ? 19.734  24.301  34.454 1.00 200.00 ? 140 LYS B CB    1 
ATOM   2068 C CG    . LYS B 1 140 ? 20.351  23.892  35.789 1.00 200.00 ? 140 LYS B CG    1 
ATOM   2069 C CD    . LYS B 1 140 ? 21.569  22.980  35.597 1.00 200.00 ? 140 LYS B CD    1 
ATOM   2070 C CE    . LYS B 1 140 ? 22.658  23.622  34.742 1.00 200.00 ? 140 LYS B CE    1 
ATOM   2071 N NZ    . LYS B 1 140 ? 23.811  22.702  34.525 1.00 200.00 ? 140 LYS B NZ    1 
ATOM   2072 N N     . VAL B 1 141 ? 17.213  25.743  36.468 1.00 184.07 ? 141 VAL B N     1 
ATOM   2073 C CA    . VAL B 1 141 ? 16.950  26.766  37.470 1.00 184.07 ? 141 VAL B CA    1 
ATOM   2074 C C     . VAL B 1 141 ? 18.066  26.821  38.510 1.00 184.07 ? 141 VAL B C     1 
ATOM   2075 O O     . VAL B 1 141 ? 18.566  25.785  38.951 1.00 184.07 ? 141 VAL B O     1 
ATOM   2076 C CB    . VAL B 1 141 ? 15.611  26.501  38.191 1.00 162.38 ? 141 VAL B CB    1 
ATOM   2077 C CG1   . VAL B 1 141 ? 15.248  27.694  39.071 1.00 162.38 ? 141 VAL B CG1   1 
ATOM   2078 C CG2   . VAL B 1 141 ? 14.516  26.222  37.168 1.00 162.38 ? 141 VAL B CG2   1 
ATOM   2079 N N     . GLU B 1 142 ? 18.449  28.037  38.895 1.00 199.91 ? 142 GLU B N     1 
ATOM   2080 C CA    . GLU B 1 142 ? 19.507  28.241  39.881 1.00 199.91 ? 142 GLU B CA    1 
ATOM   2081 C C     . GLU B 1 142 ? 18.998  27.994  41.301 1.00 199.91 ? 142 GLU B C     1 
ATOM   2082 O O     . GLU B 1 142 ? 18.595  26.879  41.642 1.00 199.91 ? 142 GLU B O     1 
ATOM   2083 C CB    . GLU B 1 142 ? 20.069  29.668  39.788 1.00 199.87 ? 142 GLU B CB    1 
ATOM   2084 C CG    . GLU B 1 142 ? 20.727  30.032  38.460 1.00 199.87 ? 142 GLU B CG    1 
ATOM   2085 C CD    . GLU B 1 142 ? 19.733  30.511  37.420 1.00 199.87 ? 142 GLU B CD    1 
ATOM   2086 O OE1   . GLU B 1 142 ? 19.010  31.492  37.699 1.00 199.87 ? 142 GLU B OE1   1 
ATOM   2087 O OE2   . GLU B 1 142 ? 19.677  29.914  36.323 1.00 199.87 ? 142 GLU B OE2   1 
ATOM   2088 N N     . SER B 1 143 ? 19.027  29.040  42.124 1.00 112.39 ? 143 SER B N     1 
ATOM   2089 C CA    . SER B 1 143 ? 18.569  28.943  43.506 1.00 112.39 ? 143 SER B CA    1 
ATOM   2090 C C     . SER B 1 143 ? 17.164  29.526  43.676 1.00 112.39 ? 143 SER B C     1 
ATOM   2091 O O     . SER B 1 143 ? 16.650  30.227  42.800 1.00 112.39 ? 143 SER B O     1 
ATOM   2092 C CB    . SER B 1 143 ? 19.549  29.661  44.444 1.00 107.07 ? 143 SER B CB    1 
ATOM   2093 O OG    . SER B 1 143 ? 20.823  29.035  44.443 1.00 107.07 ? 143 SER B OG    1 
ATOM   2094 N N     . GLU B 1 144 ? 16.547  29.214  44.811 1.00 199.86 ? 144 GLU B N     1 
ATOM   2095 C CA    . GLU B 1 144 ? 15.207  29.690  45.135 1.00 199.86 ? 144 GLU B CA    1 
ATOM   2096 C C     . GLU B 1 144 ? 15.211  31.211  45.243 1.00 199.86 ? 144 GLU B C     1 
ATOM   2097 O O     . GLU B 1 144 ? 15.338  31.752  46.342 1.00 199.86 ? 144 GLU B O     1 
ATOM   2098 C CB    . GLU B 1 144 ? 14.759  29.063  46.463 1.00 114.73 ? 144 GLU B CB    1 
ATOM   2099 C CG    . GLU B 1 144 ? 13.395  29.500  46.983 1.00 114.73 ? 144 GLU B CG    1 
ATOM   2100 C CD    . GLU B 1 144 ? 12.926  28.649  48.159 1.00 114.73 ? 144 GLU B CD    1 
ATOM   2101 O OE1   . GLU B 1 144 ? 13.699  28.489  49.125 1.00 114.73 ? 144 GLU B OE1   1 
ATOM   2102 O OE2   . GLU B 1 144 ? 11.785  28.138  48.122 1.00 114.73 ? 144 GLU B OE2   1 
ATOM   2103 N N     . ALA B 1 145 ? 15.080  31.897  44.107 1.00 85.08  ? 145 ALA B N     1 
ATOM   2104 C CA    . ALA B 1 145 ? 15.070  33.359  44.098 1.00 85.08  ? 145 ALA B CA    1 
ATOM   2105 C C     . ALA B 1 145 ? 14.317  33.838  45.326 1.00 85.08  ? 145 ALA B C     1 
ATOM   2106 O O     . ALA B 1 145 ? 14.683  34.835  45.944 1.00 85.08  ? 145 ALA B O     1 
ATOM   2107 C CB    . ALA B 1 145 ? 14.402  33.891  42.835 1.00 11.83  ? 145 ALA B CB    1 
ATOM   2108 N N     . ALA B 1 146 ? 13.262  33.122  45.684 1.00 50.98  ? 146 ALA B N     1 
ATOM   2109 C CA    . ALA B 1 146 ? 12.504  33.483  46.861 1.00 50.98  ? 146 ALA B CA    1 
ATOM   2110 C C     . ALA B 1 146 ? 13.476  33.519  48.037 1.00 50.98  ? 146 ALA B C     1 
ATOM   2111 O O     . ALA B 1 146 ? 13.919  34.593  48.451 1.00 50.98  ? 146 ALA B O     1 
ATOM   2112 C CB    . ALA B 1 146 ? 11.414  32.464  47.112 1.00 67.89  ? 146 ALA B CB    1 
ATOM   2113 N N     . GLU B 1 147 ? 13.813  32.345  48.567 1.00 105.78 ? 147 GLU B N     1 
ATOM   2114 C CA    . GLU B 1 147 ? 14.731  32.263  49.700 1.00 105.78 ? 147 GLU B CA    1 
ATOM   2115 C C     . GLU B 1 147 ? 15.906  33.187  49.427 1.00 105.78 ? 147 GLU B C     1 
ATOM   2116 O O     . GLU B 1 147 ? 16.231  34.049  50.240 1.00 105.78 ? 147 GLU B O     1 
ATOM   2117 C CB    . GLU B 1 147 ? 15.234  30.826  49.889 1.00 109.57 ? 147 GLU B CB    1 
ATOM   2118 C CG    . GLU B 1 147 ? 16.055  30.598  51.167 1.00 109.57 ? 147 GLU B CG    1 
ATOM   2119 C CD    . GLU B 1 147 ? 15.262  29.915  52.274 1.00 109.57 ? 147 GLU B CD    1 
ATOM   2120 O OE1   . GLU B 1 147 ? 14.176  30.428  52.635 1.00 109.57 ? 147 GLU B OE1   1 
ATOM   2121 O OE2   . GLU B 1 147 ? 15.728  28.865  52.784 1.00 109.57 ? 147 GLU B OE2   1 
ATOM   2122 N N     . GLU B 1 148 ? 16.529  33.000  48.269 1.00 72.40  ? 148 GLU B N     1 
ATOM   2123 C CA    . GLU B 1 148 ? 17.662  33.812  47.846 1.00 72.40  ? 148 GLU B CA    1 
ATOM   2124 C C     . GLU B 1 148 ? 17.393  35.275  48.178 1.00 72.40  ? 148 GLU B C     1 
ATOM   2125 O O     . GLU B 1 148 ? 18.289  35.997  48.620 1.00 72.40  ? 148 GLU B O     1 
ATOM   2126 C CB    . GLU B 1 148 ? 17.875  33.629  46.344 1.00 86.72  ? 148 GLU B CB    1 
ATOM   2127 C CG    . GLU B 1 148 ? 18.826  34.606  45.701 1.00 86.72  ? 148 GLU B CG    1 
ATOM   2128 C CD    . GLU B 1 148 ? 19.298  34.120  44.348 1.00 86.72  ? 148 GLU B CD    1 
ATOM   2129 O OE1   . GLU B 1 148 ? 20.061  33.129  44.306 1.00 86.72  ? 148 GLU B OE1   1 
ATOM   2130 O OE2   . GLU B 1 148 ? 18.899  34.719  43.327 1.00 86.72  ? 148 GLU B OE2   1 
ATOM   2131 N N     . ALA B 1 149 ? 16.152  35.706  47.966 1.00 89.99  ? 149 ALA B N     1 
ATOM   2132 C CA    . ALA B 1 149 ? 15.768  37.076  48.277 1.00 89.99  ? 149 ALA B CA    1 
ATOM   2133 C C     . ALA B 1 149 ? 16.097  37.220  49.740 1.00 89.99  ? 149 ALA B C     1 
ATOM   2134 O O     . ALA B 1 149 ? 17.071  37.874  50.108 1.00 89.99  ? 149 ALA B O     1 
ATOM   2135 C CB    . ALA B 1 149 ? 14.279  37.281  48.057 1.00 89.87  ? 149 ALA B CB    1 
ATOM   2136 N N     . VAL B 1 150 ? 15.281  36.575  50.565 1.00 67.36  ? 150 VAL B N     1 
ATOM   2137 C CA    . VAL B 1 150 ? 15.463  36.581  52.009 1.00 67.36  ? 150 VAL B CA    1 
ATOM   2138 C C     . VAL B 1 150 ? 16.954  36.591  52.373 1.00 67.36  ? 150 VAL B C     1 
ATOM   2139 O O     . VAL B 1 150 ? 17.481  37.585  52.870 1.00 67.36  ? 150 VAL B O     1 
ATOM   2140 C CB    . VAL B 1 150 ? 14.817  35.332  52.634 1.00 51.42  ? 150 VAL B CB    1 
ATOM   2141 C CG1   . VAL B 1 150 ? 14.813  35.451  54.146 1.00 51.42  ? 150 VAL B CG1   1 
ATOM   2142 C CG2   . VAL B 1 150 ? 13.415  35.147  52.087 1.00 51.42  ? 150 VAL B CG2   1 
ATOM   2143 N N     . MET B 1 151 ? 17.627  35.476  52.111 1.00 77.48  ? 151 MET B N     1 
ATOM   2144 C CA    . MET B 1 151 ? 19.049  35.338  52.399 1.00 77.48  ? 151 MET B CA    1 
ATOM   2145 C C     . MET B 1 151 ? 19.792  36.640  52.198 1.00 77.48  ? 151 MET B C     1 
ATOM   2146 O O     . MET B 1 151 ? 20.671  36.975  52.975 1.00 77.48  ? 151 MET B O     1 
ATOM   2147 C CB    . MET B 1 151 ? 19.673  34.263  51.514 1.00 104.78 ? 151 MET B CB    1 
ATOM   2148 C CG    . MET B 1 151 ? 19.148  32.867  51.753 1.00 104.78 ? 151 MET B CG    1 
ATOM   2149 S SD    . MET B 1 151 ? 20.328  31.659  51.171 1.00 104.78 ? 151 MET B SD    1 
ATOM   2150 C CE    . MET B 1 151 ? 20.864  30.954  52.731 1.00 104.78 ? 151 MET B CE    1 
ATOM   2151 N N     . ALA B 1 152 ? 19.457  37.369  51.145 1.00 104.65 ? 152 ALA B N     1 
ATOM   2152 C CA    . ALA B 1 152 ? 20.109  38.644  50.922 1.00 104.65 ? 152 ALA B CA    1 
ATOM   2153 C C     . ALA B 1 152 ? 19.645  39.547  52.060 1.00 104.65 ? 152 ALA B C     1 
ATOM   2154 O O     . ALA B 1 152 ? 20.449  40.012  52.867 1.00 104.65 ? 152 ALA B O     1 
ATOM   2155 C CB    . ALA B 1 152 ? 19.695  39.221  49.592 1.00 146.87 ? 152 ALA B CB    1 
ATOM   2156 N N     . LEU B 1 153 ? 18.336  39.772  52.120 1.00 92.65  ? 153 LEU B N     1 
ATOM   2157 C CA    . LEU B 1 153 ? 17.715  40.596  53.152 1.00 92.65  ? 153 LEU B CA    1 
ATOM   2158 C C     . LEU B 1 153 ? 18.342  40.423  54.534 1.00 92.65  ? 153 LEU B C     1 
ATOM   2159 O O     . LEU B 1 153 ? 18.710  41.400  55.192 1.00 92.65  ? 153 LEU B O     1 
ATOM   2160 C CB    . LEU B 1 153 ? 16.226  40.267  53.238 1.00 51.01  ? 153 LEU B CB    1 
ATOM   2161 C CG    . LEU B 1 153 ? 15.232  41.110  52.438 1.00 51.01  ? 153 LEU B CG    1 
ATOM   2162 C CD1   . LEU B 1 153 ? 15.778  41.434  51.047 1.00 51.01  ? 153 LEU B CD1   1 
ATOM   2163 C CD2   . LEU B 1 153 ? 13.912  40.355  52.369 1.00 51.01  ? 153 LEU B CD2   1 
ATOM   2164 N N     . ALA B 1 154 ? 18.447  39.177  54.981 1.00 100.67 ? 154 ALA B N     1 
ATOM   2165 C CA    . ALA B 1 154 ? 19.023  38.896  56.286 1.00 100.67 ? 154 ALA B CA    1 
ATOM   2166 C C     . ALA B 1 154 ? 20.389  39.555  56.394 1.00 100.67 ? 154 ALA B C     1 
ATOM   2167 O O     . ALA B 1 154 ? 20.635  40.339  57.306 1.00 100.67 ? 154 ALA B O     1 
ATOM   2168 C CB    . ALA B 1 154 ? 19.145  37.387  56.493 1.00 71.82  ? 154 ALA B CB    1 
ATOM   2169 N N     . ALA B 1 155 ? 21.265  39.246  55.444 1.00 111.39 ? 155 ALA B N     1 
ATOM   2170 C CA    . ALA B 1 155 ? 22.616  39.792  55.428 1.00 111.39 ? 155 ALA B CA    1 
ATOM   2171 C C     . ALA B 1 155 ? 22.658  41.304  55.233 1.00 111.39 ? 155 ALA B C     1 
ATOM   2172 O O     . ALA B 1 155 ? 23.725  41.913  55.333 1.00 111.39 ? 155 ALA B O     1 
ATOM   2173 C CB    . ALA B 1 155 ? 23.443  39.104  54.347 1.00 84.56  ? 155 ALA B CB    1 
ATOM   2174 N N     . LEU B 1 156 ? 21.508  41.909  54.950 1.00 60.50  ? 156 LEU B N     1 
ATOM   2175 C CA    . LEU B 1 156 ? 21.445  43.358  54.761 1.00 60.50  ? 156 LEU B CA    1 
ATOM   2176 C C     . LEU B 1 156 ? 20.934  44.042  56.020 1.00 60.50  ? 156 LEU B C     1 
ATOM   2177 O O     . LEU B 1 156 ? 20.776  45.267  56.052 1.00 60.50  ? 156 LEU B O     1 
ATOM   2178 C CB    . LEU B 1 156 ? 20.537  43.719  53.575 1.00 43.47  ? 156 LEU B CB    1 
ATOM   2179 C CG    . LEU B 1 156 ? 21.069  43.490  52.153 1.00 43.47  ? 156 LEU B CG    1 
ATOM   2180 C CD1   . LEU B 1 156 ? 21.196  44.815  51.409 1.00 43.47  ? 156 LEU B CD1   1 
ATOM   2181 C CD2   . LEU B 1 156 ? 22.417  42.774  52.216 1.00 43.47  ? 156 LEU B CD2   1 
ATOM   2182 N N     . GLY B 1 157 ? 20.690  43.237  57.052 1.00 70.96  ? 157 GLY B N     1 
ATOM   2183 C CA    . GLY B 1 157 ? 20.189  43.741  58.316 1.00 70.96  ? 157 GLY B CA    1 
ATOM   2184 C C     . GLY B 1 157 ? 18.986  42.911  58.707 1.00 70.96  ? 157 GLY B C     1 
ATOM   2185 O O     . GLY B 1 157 ? 19.129  41.888  59.370 1.00 70.96  ? 157 GLY B O     1 
ATOM   2186 N N     . PHE B 1 158 ? 17.809  43.352  58.272 1.00 78.01  ? 158 PHE B N     1 
ATOM   2187 C CA    . PHE B 1 158 ? 16.520  42.698  58.531 1.00 78.01  ? 158 PHE B CA    1 
ATOM   2188 C C     . PHE B 1 158 ? 16.577  41.277  59.098 1.00 78.01  ? 158 PHE B C     1 
ATOM   2189 O O     . PHE B 1 158 ? 17.129  40.373  58.469 1.00 78.01  ? 158 PHE B O     1 
ATOM   2190 C CB    . PHE B 1 158 ? 15.703  42.668  57.240 1.00 83.29  ? 158 PHE B CB    1 
ATOM   2191 C CG    . PHE B 1 158 ? 15.575  44.003  56.570 1.00 83.29  ? 158 PHE B CG    1 
ATOM   2192 C CD1   . PHE B 1 158 ? 14.725  44.976  57.081 1.00 83.29  ? 158 PHE B CD1   1 
ATOM   2193 C CD2   . PHE B 1 158 ? 16.312  44.292  55.424 1.00 83.29  ? 158 PHE B CD2   1 
ATOM   2194 C CE1   . PHE B 1 158 ? 14.611  46.221  56.458 1.00 83.29  ? 158 PHE B CE1   1 
ATOM   2195 C CE2   . PHE B 1 158 ? 16.206  45.534  54.794 1.00 83.29  ? 158 PHE B CE2   1 
ATOM   2196 C CZ    . PHE B 1 158 ? 15.355  46.498  55.312 1.00 83.29  ? 158 PHE B CZ    1 
ATOM   2197 N N     . LYS B 1 159 ? 15.994  41.082  60.279 1.00 95.09  ? 159 LYS B N     1 
ATOM   2198 C CA    . LYS B 1 159 ? 15.970  39.762  60.901 1.00 95.09  ? 159 LYS B CA    1 
ATOM   2199 C C     . LYS B 1 159 ? 15.276  38.834  59.914 1.00 95.09  ? 159 LYS B C     1 
ATOM   2200 O O     . LYS B 1 159 ? 14.202  39.155  59.406 1.00 95.09  ? 159 LYS B O     1 
ATOM   2201 C CB    . LYS B 1 159 ? 15.189  39.800  62.218 1.00 171.41 ? 159 LYS B CB    1 
ATOM   2202 C CG    . LYS B 1 159 ? 15.747  40.763  63.260 1.00 171.41 ? 159 LYS B CG    1 
ATOM   2203 C CD    . LYS B 1 159 ? 17.151  40.372  63.697 1.00 171.41 ? 159 LYS B CD    1 
ATOM   2204 C CE    . LYS B 1 159 ? 17.692  41.328  64.752 1.00 171.41 ? 159 LYS B CE    1 
ATOM   2205 N NZ    . LYS B 1 159 ? 19.067  40.960  65.199 1.00 171.41 ? 159 LYS B NZ    1 
ATOM   2206 N N     . GLU B 1 160 ? 15.895  37.690  59.642 1.00 101.79 ? 160 GLU B N     1 
ATOM   2207 C CA    . GLU B 1 160 ? 15.367  36.714  58.691 1.00 101.79 ? 160 GLU B CA    1 
ATOM   2208 C C     . GLU B 1 160 ? 13.854  36.746  58.466 1.00 101.79 ? 160 GLU B C     1 
ATOM   2209 O O     . GLU B 1 160 ? 13.380  37.343  57.503 1.00 101.79 ? 160 GLU B O     1 
ATOM   2210 C CB    . GLU B 1 160 ? 15.772  35.300  59.106 1.00 99.04  ? 160 GLU B CB    1 
ATOM   2211 C CG    . GLU B 1 160 ? 15.353  34.249  58.099 1.00 99.04  ? 160 GLU B CG    1 
ATOM   2212 C CD    . GLU B 1 160 ? 15.139  32.891  58.721 1.00 99.04  ? 160 GLU B CD    1 
ATOM   2213 O OE1   . GLU B 1 160 ? 14.243  32.765  59.585 1.00 99.04  ? 160 GLU B OE1   1 
ATOM   2214 O OE2   . GLU B 1 160 ? 15.863  31.950  58.337 1.00 99.04  ? 160 GLU B OE2   1 
ATOM   2215 N N     . ALA B 1 161 ? 13.102  36.096  59.351 1.00 68.56  ? 161 ALA B N     1 
ATOM   2216 C CA    . ALA B 1 161 ? 11.652  36.038  59.219 1.00 68.56  ? 161 ALA B CA    1 
ATOM   2217 C C     . ALA B 1 161 ? 11.091  37.335  58.665 1.00 68.56  ? 161 ALA B C     1 
ATOM   2218 O O     . ALA B 1 161 ? 10.455  37.348  57.618 1.00 68.56  ? 161 ALA B O     1 
ATOM   2219 C CB    . ALA B 1 161 ? 11.006  35.722  60.560 1.00 45.96  ? 161 ALA B CB    1 
ATOM   2220 N N     . GLN B 1 162 ? 11.335  38.432  59.365 1.00 73.04  ? 162 GLN B N     1 
ATOM   2221 C CA    . GLN B 1 162 ? 10.836  39.719  58.919 1.00 73.04  ? 162 GLN B CA    1 
ATOM   2222 C C     . GLN B 1 162 ? 10.961  39.760  57.404 1.00 73.04  ? 162 GLN B C     1 
ATOM   2223 O O     . GLN B 1 162 ? 10.008  40.081  56.696 1.00 73.04  ? 162 GLN B O     1 
ATOM   2224 C CB    . GLN B 1 162 ? 11.647  40.847  59.560 1.00 150.03 ? 162 GLN B CB    1 
ATOM   2225 C CG    . GLN B 1 162 ? 10.905  42.167  59.645 1.00 150.03 ? 162 GLN B CG    1 
ATOM   2226 C CD    . GLN B 1 162 ? 9.517   42.005  60.241 1.00 150.03 ? 162 GLN B CD    1 
ATOM   2227 O OE1   . GLN B 1 162 ? 9.338   41.305  61.240 1.00 150.03 ? 162 GLN B OE1   1 
ATOM   2228 N NE2   . GLN B 1 162 ? 8.528   42.657  59.634 1.00 150.03 ? 162 GLN B NE2   1 
ATOM   2229 N N     . ALA B 1 163 ? 12.135  39.390  56.910 1.00 92.75  ? 163 ALA B N     1 
ATOM   2230 C CA    . ALA B 1 163 ? 12.378  39.389  55.477 1.00 92.75  ? 163 ALA B CA    1 
ATOM   2231 C C     . ALA B 1 163 ? 11.646  38.259  54.752 1.00 92.75  ? 163 ALA B C     1 
ATOM   2232 O O     . ALA B 1 163 ? 10.958  38.518  53.773 1.00 92.75  ? 163 ALA B O     1 
ATOM   2233 C CB    . ALA B 1 163 ? 13.882  39.323  55.194 1.00 17.20  ? 163 ALA B CB    1 
ATOM   2234 N N     . ARG B 1 164 ? 11.772  37.018  55.224 1.00 79.95  ? 164 ARG B N     1 
ATOM   2235 C CA    . ARG B 1 164 ? 11.097  35.901  54.560 1.00 79.95  ? 164 ARG B CA    1 
ATOM   2236 C C     . ARG B 1 164 ? 9.573   36.070  54.577 1.00 79.95  ? 164 ARG B C     1 
ATOM   2237 O O     . ARG B 1 164 ? 8.906   35.901  53.553 1.00 79.95  ? 164 ARG B O     1 
ATOM   2238 C CB    . ARG B 1 164 ? 11.480  34.557  55.208 1.00 114.28 ? 164 ARG B CB    1 
ATOM   2239 C CG    . ARG B 1 164 ? 10.489  34.017  56.243 1.00 114.28 ? 164 ARG B CG    1 
ATOM   2240 C CD    . ARG B 1 164 ? 10.635  32.502  56.440 1.00 114.28 ? 164 ARG B CD    1 
ATOM   2241 N NE    . ARG B 1 164 ? 11.878  32.116  57.115 1.00 114.28 ? 164 ARG B NE    1 
ATOM   2242 C CZ    . ARG B 1 164 ? 12.324  30.863  57.222 1.00 114.28 ? 164 ARG B CZ    1 
ATOM   2243 N NH1   . ARG B 1 164 ? 11.639  29.857  56.694 1.00 114.28 ? 164 ARG B NH1   1 
ATOM   2244 N NH2   . ARG B 1 164 ? 13.455  30.611  57.867 1.00 114.28 ? 164 ARG B NH2   1 
ATOM   2245 N N     . ALA B 1 165 ? 9.035   36.427  55.740 1.00 93.14  ? 165 ALA B N     1 
ATOM   2246 C CA    . ALA B 1 165 ? 7.598   36.612  55.925 1.00 93.14  ? 165 ALA B CA    1 
ATOM   2247 C C     . ALA B 1 165 ? 6.959   37.594  54.945 1.00 93.14  ? 165 ALA B C     1 
ATOM   2248 O O     . ALA B 1 165 ? 5.742   37.613  54.781 1.00 93.14  ? 165 ALA B O     1 
ATOM   2249 C CB    . ALA B 1 165 ? 7.317   37.055  57.358 1.00 200.00 ? 165 ALA B CB    1 
ATOM   2250 N N     . VAL B 1 166 ? 7.769   38.414  54.295 1.00 91.35  ? 166 VAL B N     1 
ATOM   2251 C CA    . VAL B 1 166 ? 7.216   39.365  53.349 1.00 91.35  ? 166 VAL B CA    1 
ATOM   2252 C C     . VAL B 1 166 ? 7.669   39.057  51.918 1.00 91.35  ? 166 VAL B C     1 
ATOM   2253 O O     . VAL B 1 166 ? 7.181   39.653  50.954 1.00 91.35  ? 166 VAL B O     1 
ATOM   2254 C CB    . VAL B 1 166 ? 7.594   40.807  53.752 1.00 76.02  ? 166 VAL B CB    1 
ATOM   2255 C CG1   . VAL B 1 166 ? 7.434   40.953  55.250 1.00 76.02  ? 166 VAL B CG1   1 
ATOM   2256 C CG2   . VAL B 1 166 ? 9.013   41.152  53.306 1.00 76.02  ? 166 VAL B CG2   1 
ATOM   2257 N N     . VAL B 1 167 ? 8.607   38.124  51.780 1.00 66.36  ? 167 VAL B N     1 
ATOM   2258 C CA    . VAL B 1 167 ? 9.070   37.743  50.461 1.00 66.36  ? 167 VAL B CA    1 
ATOM   2259 C C     . VAL B 1 167 ? 7.940   36.884  49.955 1.00 66.36  ? 167 VAL B C     1 
ATOM   2260 O O     . VAL B 1 167 ? 7.462   37.058  48.834 1.00 66.36  ? 167 VAL B O     1 
ATOM   2261 C CB    . VAL B 1 167 ? 10.340  36.888  50.508 1.00 46.03  ? 167 VAL B CB    1 
ATOM   2262 C CG1   . VAL B 1 167 ? 10.805  36.595  49.105 1.00 46.03  ? 167 VAL B CG1   1 
ATOM   2263 C CG2   . VAL B 1 167 ? 11.428  37.609  51.256 1.00 46.03  ? 167 VAL B CG2   1 
ATOM   2264 N N     . LEU B 1 168 ? 7.502   35.966  50.810 1.00 69.37  ? 168 LEU B N     1 
ATOM   2265 C CA    . LEU B 1 168 ? 6.412   35.069  50.466 1.00 69.37  ? 168 LEU B CA    1 
ATOM   2266 C C     . LEU B 1 168 ? 5.173   35.846  50.048 1.00 69.37  ? 168 LEU B C     1 
ATOM   2267 O O     . LEU B 1 168 ? 4.637   35.657  48.943 1.00 69.37  ? 168 LEU B O     1 
ATOM   2268 C CB    . LEU B 1 168 ? 6.078   34.164  51.652 1.00 99.19  ? 168 LEU B CB    1 
ATOM   2269 C CG    . LEU B 1 168 ? 7.042   32.995  51.830 1.00 99.19  ? 168 LEU B CG    1 
ATOM   2270 C CD1   . LEU B 1 168 ? 6.916   32.065  50.646 1.00 99.19  ? 168 LEU B CD1   1 
ATOM   2271 C CD2   . LEU B 1 168 ? 8.464   33.505  51.937 1.00 99.19  ? 168 LEU B CD2   1 
ATOM   2272 N N     . ASP B 1 169 ? 4.726   36.724  50.939 1.00 61.47  ? 169 ASP B N     1 
ATOM   2273 C CA    . ASP B 1 169 ? 3.552   37.542  50.689 1.00 61.47  ? 169 ASP B CA    1 
ATOM   2274 C C     . ASP B 1 169 ? 3.739   38.298  49.372 1.00 61.47  ? 169 ASP B C     1 
ATOM   2275 O O     . ASP B 1 169 ? 2.766   38.655  48.714 1.00 61.47  ? 169 ASP B O     1 
ATOM   2276 C CB    . ASP B 1 169 ? 3.344   38.513  51.853 1.00 106.37 ? 169 ASP B CB    1 
ATOM   2277 C CG    . ASP B 1 169 ? 1.884   38.815  52.102 1.00 106.37 ? 169 ASP B CG    1 
ATOM   2278 O OD1   . ASP B 1 169 ? 1.108   37.850  52.274 1.00 106.37 ? 169 ASP B OD1   1 
ATOM   2279 O OD2   . ASP B 1 169 ? 1.514   40.011  52.130 1.00 106.37 ? 169 ASP B OD2   1 
ATOM   2280 N N     . LEU B 1 170 ? 4.989   38.531  48.985 1.00 62.89  ? 170 LEU B N     1 
ATOM   2281 C CA    . LEU B 1 170 ? 5.269   39.228  47.731 1.00 62.89  ? 170 LEU B CA    1 
ATOM   2282 C C     . LEU B 1 170 ? 5.055   38.307  46.531 1.00 62.89  ? 170 LEU B C     1 
ATOM   2283 O O     . LEU B 1 170 ? 4.484   38.712  45.507 1.00 62.89  ? 170 LEU B O     1 
ATOM   2284 C CB    . LEU B 1 170 ? 6.708   39.748  47.707 1.00 85.24  ? 170 LEU B CB    1 
ATOM   2285 C CG    . LEU B 1 170 ? 6.971   41.105  48.353 1.00 85.24  ? 170 LEU B CG    1 
ATOM   2286 C CD1   . LEU B 1 170 ? 8.423   41.489  48.140 1.00 85.24  ? 170 LEU B CD1   1 
ATOM   2287 C CD2   . LEU B 1 170 ? 6.055   42.143  47.734 1.00 85.24  ? 170 LEU B CD2   1 
ATOM   2288 N N     . LEU B 1 171 ? 5.532   37.071  46.662 1.00 81.08  ? 171 LEU B N     1 
ATOM   2289 C CA    . LEU B 1 171 ? 5.387   36.076  45.608 1.00 81.08  ? 171 LEU B CA    1 
ATOM   2290 C C     . LEU B 1 171 ? 3.922   35.750  45.450 1.00 81.08  ? 171 LEU B C     1 
ATOM   2291 O O     . LEU B 1 171 ? 3.494   35.234  44.421 1.00 81.08  ? 171 LEU B O     1 
ATOM   2292 C CB    . LEU B 1 171 ? 6.173   34.814  45.952 1.00 48.52  ? 171 LEU B CB    1 
ATOM   2293 C CG    . LEU B 1 171 ? 7.667   34.973  45.667 1.00 48.52  ? 171 LEU B CG    1 
ATOM   2294 C CD1   . LEU B 1 171 ? 8.420   33.709  46.043 1.00 48.52  ? 171 LEU B CD1   1 
ATOM   2295 C CD2   . LEU B 1 171 ? 7.847   35.291  44.181 1.00 48.52  ? 171 LEU B CD2   1 
ATOM   2296 N N     . ALA B 1 172 ? 3.158   36.053  46.489 1.00 98.10  ? 172 ALA B N     1 
ATOM   2297 C CA    . ALA B 1 172 ? 1.726   35.834  46.451 1.00 98.10  ? 172 ALA B CA    1 
ATOM   2298 C C     . ALA B 1 172 ? 1.165   36.830  45.434 1.00 98.10  ? 172 ALA B C     1 
ATOM   2299 O O     . ALA B 1 172 ? 0.881   36.480  44.288 1.00 98.10  ? 172 ALA B O     1 
ATOM   2300 C CB    . ALA B 1 172 ? 1.121   36.080  47.832 1.00 87.51  ? 172 ALA B CB    1 
ATOM   2301 N N     . GLN B 1 173 ? 1.029   38.080  45.857 1.00 183.62 ? 173 GLN B N     1 
ATOM   2302 C CA    . GLN B 1 173 ? 0.513   39.119  44.983 1.00 183.62 ? 173 GLN B CA    1 
ATOM   2303 C C     . GLN B 1 173 ? 1.192   39.071  43.617 1.00 183.62 ? 173 GLN B C     1 
ATOM   2304 O O     . GLN B 1 173 ? 0.612   39.499  42.618 1.00 183.62 ? 173 GLN B O     1 
ATOM   2305 C CB    . GLN B 1 173 ? 0.725   40.497  45.619 1.00 126.92 ? 173 GLN B CB    1 
ATOM   2306 C CG    . GLN B 1 173 ? 2.173   40.802  45.963 1.00 126.92 ? 173 GLN B CG    1 
ATOM   2307 C CD    . GLN B 1 173 ? 2.377   42.233  46.411 1.00 126.92 ? 173 GLN B CD    1 
ATOM   2308 O OE1   . GLN B 1 173 ? 2.156   43.175  45.648 1.00 126.92 ? 173 GLN B OE1   1 
ATOM   2309 N NE2   . GLN B 1 173 ? 2.802   42.405  47.654 1.00 126.92 ? 173 GLN B NE2   1 
ATOM   2310 N N     . ASN B 1 174 ? 2.414   38.541  43.570 1.00 42.14  ? 174 ASN B N     1 
ATOM   2311 C CA    . ASN B 1 174 ? 3.151   38.459  42.307 1.00 42.14  ? 174 ASN B CA    1 
ATOM   2312 C C     . ASN B 1 174 ? 4.127   37.269  42.206 1.00 42.14  ? 174 ASN B C     1 
ATOM   2313 O O     . ASN B 1 174 ? 5.326   37.414  42.478 1.00 42.14  ? 174 ASN B O     1 
ATOM   2314 C CB    . ASN B 1 174 ? 3.933   39.760  42.062 1.00 169.02 ? 174 ASN B CB    1 
ATOM   2315 C CG    . ASN B 1 174 ? 3.030   40.978  41.910 1.00 169.02 ? 174 ASN B CG    1 
ATOM   2316 O OD1   . ASN B 1 174 ? 2.142   41.010  41.057 1.00 169.02 ? 174 ASN B OD1   1 
ATOM   2317 N ND2   . ASN B 1 174 ? 3.266   41.994  42.734 1.00 169.02 ? 174 ASN B ND2   1 
ATOM   2318 N N     . PRO B 1 175 ? 3.626   36.083  41.787 1.00 72.00  ? 175 PRO B N     1 
ATOM   2319 C CA    . PRO B 1 175 ? 4.375   34.824  41.621 1.00 72.00  ? 175 PRO B CA    1 
ATOM   2320 C C     . PRO B 1 175 ? 5.681   34.982  40.839 1.00 72.00  ? 175 PRO B C     1 
ATOM   2321 O O     . PRO B 1 175 ? 6.703   34.381  41.175 1.00 72.00  ? 175 PRO B O     1 
ATOM   2322 C CB    . PRO B 1 175 ? 3.375   33.929  40.898 1.00 193.32 ? 175 PRO B CB    1 
ATOM   2323 C CG    . PRO B 1 175 ? 2.071   34.388  41.459 1.00 193.32 ? 175 PRO B CG    1 
ATOM   2324 C CD    . PRO B 1 175 ? 2.215   35.890  41.408 1.00 193.32 ? 175 PRO B CD    1 
ATOM   2325 N N     . LYS B 1 176 ? 5.631   35.787  39.785 1.00 174.38 ? 176 LYS B N     1 
ATOM   2326 C CA    . LYS B 1 176 ? 6.809   36.050  38.973 1.00 174.38 ? 176 LYS B CA    1 
ATOM   2327 C C     . LYS B 1 176 ? 7.620   37.087  39.738 1.00 174.38 ? 176 LYS B C     1 
ATOM   2328 O O     . LYS B 1 176 ? 7.171   38.221  39.905 1.00 174.38 ? 176 LYS B O     1 
ATOM   2329 C CB    . LYS B 1 176 ? 6.397   36.612  37.609 1.00 199.84 ? 176 LYS B CB    1 
ATOM   2330 C CG    . LYS B 1 176 ? 5.491   37.844  37.682 1.00 199.84 ? 176 LYS B CG    1 
ATOM   2331 C CD    . LYS B 1 176 ? 5.171   38.407  36.299 1.00 199.84 ? 176 LYS B CD    1 
ATOM   2332 C CE    . LYS B 1 176 ? 6.410   38.974  35.614 1.00 199.84 ? 176 LYS B CE    1 
ATOM   2333 N NZ    . LYS B 1 176 ? 6.984   40.126  36.361 1.00 199.84 ? 176 LYS B NZ    1 
ATOM   2334 N N     . ALA B 1 177 ? 8.804   36.712  40.213 1.00 71.93  ? 177 ALA B N     1 
ATOM   2335 C CA    . ALA B 1 177 ? 9.609   37.663  40.970 1.00 71.93  ? 177 ALA B CA    1 
ATOM   2336 C C     . ALA B 1 177 ? 11.076  37.320  41.092 1.00 71.93  ? 177 ALA B C     1 
ATOM   2337 O O     . ALA B 1 177 ? 11.485  36.694  42.071 1.00 71.93  ? 177 ALA B O     1 
ATOM   2338 C CB    . ALA B 1 177 ? 9.025   37.822  42.352 1.00 28.80  ? 177 ALA B CB    1 
ATOM   2339 N N     . ARG B 1 178 ? 11.875  37.729  40.117 1.00 122.19 ? 178 ARG B N     1 
ATOM   2340 C CA    . ARG B 1 178 ? 13.302  37.462  40.191 1.00 122.19 ? 178 ARG B CA    1 
ATOM   2341 C C     . ARG B 1 178 ? 13.764  38.011  41.544 1.00 122.19 ? 178 ARG B C     1 
ATOM   2342 O O     . ARG B 1 178 ? 13.305  39.073  41.963 1.00 122.19 ? 178 ARG B O     1 
ATOM   2343 C CB    . ARG B 1 178 ? 14.023  38.181  39.050 1.00 161.91 ? 178 ARG B CB    1 
ATOM   2344 C CG    . ARG B 1 178 ? 13.816  39.687  39.037 1.00 161.91 ? 178 ARG B CG    1 
ATOM   2345 C CD    . ARG B 1 178 ? 14.332  40.301  37.753 1.00 161.91 ? 178 ARG B CD    1 
ATOM   2346 N NE    . ARG B 1 178 ? 13.666  39.721  36.593 1.00 161.91 ? 178 ARG B NE    1 
ATOM   2347 C CZ    . ARG B 1 178 ? 13.833  40.144  35.345 1.00 161.91 ? 178 ARG B CZ    1 
ATOM   2348 N NH1   . ARG B 1 178 ? 14.648  41.159  35.091 1.00 161.91 ? 178 ARG B NH1   1 
ATOM   2349 N NH2   . ARG B 1 178 ? 13.188  39.547  34.350 1.00 161.91 ? 178 ARG B NH2   1 
ATOM   2350 N N     . ALA B 1 179 ? 14.644  37.288  42.237 1.00 91.35  ? 179 ALA B N     1 
ATOM   2351 C CA    . ALA B 1 179 ? 15.143  37.736  43.540 1.00 91.35  ? 179 ALA B CA    1 
ATOM   2352 C C     . ALA B 1 179 ? 15.326  39.234  43.503 1.00 91.35  ? 179 ALA B C     1 
ATOM   2353 O O     . ALA B 1 179 ? 14.894  39.938  44.408 1.00 91.35  ? 179 ALA B O     1 
ATOM   2354 C CB    . ALA B 1 179 ? 16.472  37.071  43.869 1.00 74.10  ? 179 ALA B CB    1 
ATOM   2355 N N     . GLN B 1 180 ? 15.973  39.715  42.447 1.00 72.36  ? 180 GLN B N     1 
ATOM   2356 C CA    . GLN B 1 180 ? 16.191  41.140  42.290 1.00 72.36  ? 180 GLN B CA    1 
ATOM   2357 C C     . GLN B 1 180 ? 14.856  41.848  42.532 1.00 72.36  ? 180 GLN B C     1 
ATOM   2358 O O     . GLN B 1 180 ? 14.564  42.271  43.654 1.00 72.36  ? 180 GLN B O     1 
ATOM   2359 C CB    . GLN B 1 180 ? 16.695  41.445  40.880 1.00 144.75 ? 180 GLN B CB    1 
ATOM   2360 C CG    . GLN B 1 180 ? 17.157  42.877  40.695 1.00 144.75 ? 180 GLN B CG    1 
ATOM   2361 C CD    . GLN B 1 180 ? 17.288  43.263  39.238 1.00 144.75 ? 180 GLN B CD    1 
ATOM   2362 O OE1   . GLN B 1 180 ? 16.301  43.294  38.503 1.00 144.75 ? 180 GLN B OE1   1 
ATOM   2363 N NE2   . GLN B 1 180 ? 18.510  43.558  38.810 1.00 144.75 ? 180 GLN B NE2   1 
ATOM   2364 N N     . ASP B 1 181 ? 14.043  41.954  41.482 1.00 83.11  ? 181 ASP B N     1 
ATOM   2365 C CA    . ASP B 1 181 ? 12.738  42.607  41.581 1.00 83.11  ? 181 ASP B CA    1 
ATOM   2366 C C     . ASP B 1 181 ? 11.992  42.201  42.835 1.00 83.11  ? 181 ASP B C     1 
ATOM   2367 O O     . ASP B 1 181 ? 11.085  42.894  43.266 1.00 83.11  ? 181 ASP B O     1 
ATOM   2368 C CB    . ASP B 1 181 ? 11.862  42.291  40.364 1.00 126.09 ? 181 ASP B CB    1 
ATOM   2369 C CG    . ASP B 1 181 ? 12.212  43.137  39.155 1.00 126.09 ? 181 ASP B CG    1 
ATOM   2370 O OD1   . ASP B 1 181 ? 13.313  42.951  38.592 1.00 126.09 ? 181 ASP B OD1   1 
ATOM   2371 O OD2   . ASP B 1 181 ? 11.387  43.994  38.770 1.00 126.09 ? 181 ASP B OD2   1 
ATOM   2372 N N     . LEU B 1 182 ? 12.362  41.074  43.419 1.00 80.70  ? 182 LEU B N     1 
ATOM   2373 C CA    . LEU B 1 182 ? 11.704  40.626  44.631 1.00 80.70  ? 182 LEU B CA    1 
ATOM   2374 C C     . LEU B 1 182 ? 12.349  41.334  45.812 1.00 80.70  ? 182 LEU B C     1 
ATOM   2375 O O     . LEU B 1 182 ? 11.689  42.064  46.549 1.00 80.70  ? 182 LEU B O     1 
ATOM   2376 C CB    . LEU B 1 182 ? 11.853  39.114  44.779 1.00 100.04 ? 182 LEU B CB    1 
ATOM   2377 C CG    . LEU B 1 182 ? 11.186  38.487  46.001 1.00 100.04 ? 182 LEU B CG    1 
ATOM   2378 C CD1   . LEU B 1 182 ? 9.717   38.900  46.080 1.00 100.04 ? 182 LEU B CD1   1 
ATOM   2379 C CD2   . LEU B 1 182 ? 11.329  36.978  45.904 1.00 100.04 ? 182 LEU B CD2   1 
ATOM   2380 N N     . ILE B 1 183 ? 13.648  41.111  45.972 1.00 93.57  ? 183 ILE B N     1 
ATOM   2381 C CA    . ILE B 1 183 ? 14.432  41.709  47.043 1.00 93.57  ? 183 ILE B CA    1 
ATOM   2382 C C     . ILE B 1 183 ? 14.120  43.189  47.202 1.00 93.57  ? 183 ILE B C     1 
ATOM   2383 O O     . ILE B 1 183 ? 13.589  43.617  48.225 1.00 93.57  ? 183 ILE B O     1 
ATOM   2384 C CB    . ILE B 1 183 ? 15.947  41.520  46.768 1.00 77.48  ? 183 ILE B CB    1 
ATOM   2385 C CG1   . ILE B 1 183 ? 16.429  40.242  47.455 1.00 77.48  ? 183 ILE B CG1   1 
ATOM   2386 C CG2   . ILE B 1 183 ? 16.745  42.735  47.238 1.00 77.48  ? 183 ILE B CG2   1 
ATOM   2387 C CD1   . ILE B 1 183 ? 17.892  39.930  47.215 1.00 77.48  ? 183 ILE B CD1   1 
ATOM   2388 N N     . LYS B 1 184 ? 14.459  43.965  46.180 1.00 59.76  ? 184 LYS B N     1 
ATOM   2389 C CA    . LYS B 1 184 ? 14.228  45.399  46.188 1.00 59.76  ? 184 LYS B CA    1 
ATOM   2390 C C     . LYS B 1 184 ? 12.868  45.658  46.795 1.00 59.76  ? 184 LYS B C     1 
ATOM   2391 O O     . LYS B 1 184 ? 12.765  46.081  47.939 1.00 59.76  ? 184 LYS B O     1 
ATOM   2392 C CB    . LYS B 1 184 ? 14.277  45.938  44.757 1.00 70.65  ? 184 LYS B CB    1 
ATOM   2393 C CG    . LYS B 1 184 ? 15.435  45.365  43.950 1.00 70.65  ? 184 LYS B CG    1 
ATOM   2394 C CD    . LYS B 1 184 ? 16.037  46.384  43.022 1.00 70.65  ? 184 LYS B CD    1 
ATOM   2395 C CE    . LYS B 1 184 ? 14.994  46.934  42.085 1.00 70.65  ? 184 LYS B CE    1 
ATOM   2396 N NZ    . LYS B 1 184 ? 15.578  47.987  41.213 1.00 70.65  ? 184 LYS B NZ    1 
ATOM   2397 N N     . GLU B 1 185 ? 11.833  45.378  46.013 1.00 52.06  ? 185 GLU B N     1 
ATOM   2398 C CA    . GLU B 1 185 ? 10.444  45.547  46.418 1.00 52.06  ? 185 GLU B CA    1 
ATOM   2399 C C     . GLU B 1 185 ? 10.175  45.207  47.893 1.00 52.06  ? 185 GLU B C     1 
ATOM   2400 O O     . GLU B 1 185 ? 9.123   45.558  48.440 1.00 52.06  ? 185 GLU B O     1 
ATOM   2401 C CB    . GLU B 1 185 ? 9.567   44.695  45.501 1.00 68.52  ? 185 GLU B CB    1 
ATOM   2402 C CG    . GLU B 1 185 ? 8.084   44.803  45.742 1.00 68.52  ? 185 GLU B CG    1 
ATOM   2403 C CD    . GLU B 1 185 ? 7.583   46.223  45.655 1.00 68.52  ? 185 GLU B CD    1 
ATOM   2404 O OE1   . GLU B 1 185 ? 8.039   46.960  44.752 1.00 68.52  ? 185 GLU B OE1   1 
ATOM   2405 O OE2   . GLU B 1 185 ? 6.724   46.590  46.486 1.00 68.52  ? 185 GLU B OE2   1 
ATOM   2406 N N     . ALA B 1 186 ? 11.119  44.520  48.531 1.00 74.17  ? 186 ALA B N     1 
ATOM   2407 C CA    . ALA B 1 186 ? 10.987  44.171  49.941 1.00 74.17  ? 186 ALA B CA    1 
ATOM   2408 C C     . ALA B 1 186 ? 11.450  45.372  50.756 1.00 74.17  ? 186 ALA B C     1 
ATOM   2409 O O     . ALA B 1 186 ? 10.775  45.799  51.695 1.00 74.17  ? 186 ALA B O     1 
ATOM   2410 C CB    . ALA B 1 186 ? 11.841  42.955  50.270 1.00 76.31  ? 186 ALA B CB    1 
ATOM   2411 N N     . LEU B 1 187 ? 12.613  45.908  50.391 1.00 95.08  ? 187 LEU B N     1 
ATOM   2412 C CA    . LEU B 1 187 ? 13.165  47.077  51.063 1.00 95.08  ? 187 LEU B CA    1 
ATOM   2413 C C     . LEU B 1 187 ? 12.064  48.108  51.178 1.00 95.08  ? 187 LEU B C     1 
ATOM   2414 O O     . LEU B 1 187 ? 11.924  48.767  52.203 1.00 95.08  ? 187 LEU B O     1 
ATOM   2415 C CB    . LEU B 1 187 ? 14.324  47.659  50.258 1.00 67.67  ? 187 LEU B CB    1 
ATOM   2416 C CG    . LEU B 1 187 ? 15.724  47.064  50.432 1.00 67.67  ? 187 LEU B CG    1 
ATOM   2417 C CD1   . LEU B 1 187 ? 15.709  45.887  51.406 1.00 67.67  ? 187 LEU B CD1   1 
ATOM   2418 C CD2   . LEU B 1 187 ? 16.246  46.658  49.060 1.00 67.67  ? 187 LEU B CD2   1 
ATOM   2419 N N     . LYS B 1 188 ? 11.286  48.237  50.108 1.00 70.10  ? 188 LYS B N     1 
ATOM   2420 C CA    . LYS B 1 188 ? 10.169  49.169  50.073 1.00 70.10  ? 188 LYS B CA    1 
ATOM   2421 C C     . LYS B 1 188 ? 9.224   48.914  51.251 1.00 70.10  ? 188 LYS B C     1 
ATOM   2422 O O     . LYS B 1 188 ? 8.991   49.795  52.083 1.00 70.10  ? 188 LYS B O     1 
ATOM   2423 C CB    . LYS B 1 188 ? 9.385   49.014  48.767 1.00 129.27 ? 188 LYS B CB    1 
ATOM   2424 C CG    . LYS B 1 188 ? 8.012   49.665  48.817 1.00 129.27 ? 188 LYS B CG    1 
ATOM   2425 C CD    . LYS B 1 188 ? 7.141   49.260  47.648 1.00 129.27 ? 188 LYS B CD    1 
ATOM   2426 C CE    . LYS B 1 188 ? 5.709   49.762  47.828 1.00 129.27 ? 188 LYS B CE    1 
ATOM   2427 N NZ    . LYS B 1 188 ? 5.034   49.168  49.020 1.00 129.27 ? 188 LYS B NZ    1 
ATOM   2428 N N     . ARG B 1 189 ? 8.675   47.705  51.319 1.00 84.62  ? 189 ARG B N     1 
ATOM   2429 C CA    . ARG B 1 189 ? 7.749   47.373  52.391 1.00 84.62  ? 189 ARG B CA    1 
ATOM   2430 C C     . ARG B 1 189 ? 8.471   47.082  53.699 1.00 84.62  ? 189 ARG B C     1 
ATOM   2431 O O     . ARG B 1 189 ? 7.843   46.749  54.702 1.00 84.62  ? 189 ARG B O     1 
ATOM   2432 C CB    . ARG B 1 189 ? 6.875   46.181  51.990 1.00 169.66 ? 189 ARG B CB    1 
ATOM   2433 C CG    . ARG B 1 189 ? 5.680   45.952  52.910 1.00 169.66 ? 189 ARG B CG    1 
ATOM   2434 C CD    . ARG B 1 189 ? 4.754   44.888  52.350 1.00 169.66 ? 189 ARG B CD    1 
ATOM   2435 N NE    . ARG B 1 189 ? 4.269   45.246  51.021 1.00 169.66 ? 189 ARG B NE    1 
ATOM   2436 C CZ    . ARG B 1 189 ? 3.486   44.472  50.277 1.00 169.66 ? 189 ARG B CZ    1 
ATOM   2437 N NH1   . ARG B 1 189 ? 3.093   43.289  50.731 1.00 169.66 ? 189 ARG B NH1   1 
ATOM   2438 N NH2   . ARG B 1 189 ? 3.098   44.883  49.078 1.00 169.66 ? 189 ARG B NH2   1 
ATOM   2439 N N     . LEU B 1 190 ? 9.793   47.204  53.688 1.00 74.97  ? 190 LEU B N     1 
ATOM   2440 C CA    . LEU B 1 190 ? 10.571  46.972  54.895 1.00 74.97  ? 190 LEU B CA    1 
ATOM   2441 C C     . LEU B 1 190 ? 11.211  48.266  55.408 1.00 74.97  ? 190 LEU B C     1 
ATOM   2442 O O     . LEU B 1 190 ? 11.992  48.258  56.374 1.00 74.97  ? 190 LEU B O     1 
ATOM   2443 C CB    . LEU B 1 190 ? 11.641  45.902  54.648 1.00 43.01  ? 190 LEU B CB    1 
ATOM   2444 C CG    . LEU B 1 190 ? 11.244  44.496  55.114 1.00 43.01  ? 190 LEU B CG    1 
ATOM   2445 C CD1   . LEU B 1 190 ? 12.477  43.610  55.244 1.00 43.01  ? 190 LEU B CD1   1 
ATOM   2446 C CD2   . LEU B 1 190 ? 10.527  44.602  56.463 1.00 43.01  ? 190 LEU B CD2   1 
ATOM   2447 N N     . ARG B 1 191 ? 10.864  49.373  54.754 1.00 200.00 ? 191 ARG B N     1 
ATOM   2448 C CA    . ARG B 1 191 ? 11.364  50.695  55.124 1.00 200.00 ? 191 ARG B CA    1 
ATOM   2449 C C     . ARG B 1 191 ? 11.226  50.871  56.631 1.00 200.00 ? 191 ARG B C     1 
ATOM   2450 O O     . ARG B 1 191 ? 12.272  50.993  57.306 1.00 200.00 ? 191 ARG B O     1 
ATOM   2451 C CB    . ARG B 1 191 ? 10.562  51.791  54.404 1.00 114.51 ? 191 ARG B CB    1 
ATOM   2452 C CG    . ARG B 1 191 ? 10.924  52.009  52.928 1.00 114.51 ? 191 ARG B CG    1 
ATOM   2453 C CD    . ARG B 1 191 ? 9.763   52.650  52.161 1.00 114.51 ? 191 ARG B CD    1 
ATOM   2454 N NE    . ARG B 1 191 ? 10.141  53.141  50.835 1.00 114.51 ? 191 ARG B NE    1 
ATOM   2455 C CZ    . ARG B 1 191 ? 9.276   53.627  49.946 1.00 114.51 ? 191 ARG B CZ    1 
ATOM   2456 N NH1   . ARG B 1 191 ? 7.980   53.679  50.238 1.00 114.51 ? 191 ARG B NH1   1 
ATOM   2457 N NH2   . ARG B 1 191 ? 9.707   54.089  48.777 1.00 114.51 ? 191 ARG B NH2   1 
ATOM   2458 O OXT   . ARG B 1 191 ? 10.070  50.871  57.114 1.00 114.51 ? 191 ARG B OXT   1 
ATOM   2459 N N     . ALA C 2 5   ? 11.437  78.810  52.645 1.00 142.51 ? 5   ALA C N     1 
ATOM   2460 C CA    . ALA C 2 5   ? 11.740  79.838  51.608 1.00 142.51 ? 5   ALA C CA    1 
ATOM   2461 C C     . ALA C 2 5   ? 12.694  79.281  50.554 1.00 142.51 ? 5   ALA C C     1 
ATOM   2462 O O     . ALA C 2 5   ? 13.916  79.399  50.673 1.00 142.51 ? 5   ALA C O     1 
ATOM   2463 C CB    . ALA C 2 5   ? 12.344  81.075  52.261 1.00 57.87  ? 5   ALA C CB    1 
ATOM   2464 N N     . LEU C 2 6   ? 12.119  78.673  49.522 1.00 187.49 ? 6   LEU C N     1 
ATOM   2465 C CA    . LEU C 2 6   ? 12.897  78.087  48.440 1.00 187.49 ? 6   LEU C CA    1 
ATOM   2466 C C     . LEU C 2 6   ? 13.626  79.161  47.637 1.00 187.49 ? 6   LEU C C     1 
ATOM   2467 O O     . LEU C 2 6   ? 13.258  80.335  47.666 1.00 187.49 ? 6   LEU C O     1 
ATOM   2468 C CB    . LEU C 2 6   ? 11.980  77.274  47.519 1.00 162.05 ? 6   LEU C CB    1 
ATOM   2469 C CG    . LEU C 2 6   ? 11.177  76.147  48.183 1.00 162.05 ? 6   LEU C CG    1 
ATOM   2470 C CD1   . LEU C 2 6   ? 10.203  75.557  47.178 1.00 162.05 ? 6   LEU C CD1   1 
ATOM   2471 C CD2   . LEU C 2 6   ? 12.119  75.076  48.719 1.00 162.05 ? 6   LEU C CD2   1 
ATOM   2472 N N     . ARG C 2 7   ? 14.667  78.743  46.925 1.00 179.79 ? 7   ARG C N     1 
ATOM   2473 C CA    . ARG C 2 7   ? 15.467  79.647  46.107 1.00 179.79 ? 7   ARG C CA    1 
ATOM   2474 C C     . ARG C 2 7   ? 15.602  79.083  44.694 1.00 179.79 ? 7   ARG C C     1 
ATOM   2475 O O     . ARG C 2 7   ? 15.755  77.875  44.514 1.00 179.79 ? 7   ARG C O     1 
ATOM   2476 C CB    . ARG C 2 7   ? 16.863  79.808  46.718 1.00 108.39 ? 7   ARG C CB    1 
ATOM   2477 C CG    . ARG C 2 7   ? 17.577  78.485  46.925 1.00 108.39 ? 7   ARG C CG    1 
ATOM   2478 C CD    . ARG C 2 7   ? 19.045  78.655  47.290 1.00 108.39 ? 7   ARG C CD    1 
ATOM   2479 N NE    . ARG C 2 7   ? 19.876  79.074  46.160 1.00 108.39 ? 7   ARG C NE    1 
ATOM   2480 C CZ    . ARG C 2 7   ? 21.208  79.024  46.147 1.00 108.39 ? 7   ARG C CZ    1 
ATOM   2481 N NH1   . ARG C 2 7   ? 21.868  78.571  47.200 1.00 108.39 ? 7   ARG C NH1   1 
ATOM   2482 N NH2   . ARG C 2 7   ? 21.886  79.428  45.084 1.00 108.39 ? 7   ARG C NH2   1 
ATOM   2483 N N     . PRO C 2 8   ? 15.541  79.952  43.671 1.00 200.00 ? 8   PRO C N     1 
ATOM   2484 C CA    . PRO C 2 8   ? 15.670  79.473  42.290 1.00 200.00 ? 8   PRO C CA    1 
ATOM   2485 C C     . PRO C 2 8   ? 17.038  78.821  42.090 1.00 200.00 ? 8   PRO C C     1 
ATOM   2486 O O     . PRO C 2 8   ? 18.041  79.499  41.869 1.00 200.00 ? 8   PRO C O     1 
ATOM   2487 C CB    . PRO C 2 8   ? 15.488  80.747  41.462 1.00 200.00 ? 8   PRO C CB    1 
ATOM   2488 C CG    . PRO C 2 8   ? 15.989  81.827  42.382 1.00 200.00 ? 8   PRO C CG    1 
ATOM   2489 C CD    . PRO C 2 8   ? 15.406  81.419  43.711 1.00 200.00 ? 8   PRO C CD    1 
ATOM   2490 N N     . LYS C 2 9   ? 17.069  77.497  42.184 1.00 141.59 ? 9   LYS C N     1 
ATOM   2491 C CA    . LYS C 2 9   ? 18.307  76.745  42.041 1.00 141.59 ? 9   LYS C CA    1 
ATOM   2492 C C     . LYS C 2 9   ? 19.009  76.956  40.700 1.00 141.59 ? 9   LYS C C     1 
ATOM   2493 O O     . LYS C 2 9   ? 18.424  76.728  39.643 1.00 141.59 ? 9   LYS C O     1 
ATOM   2494 C CB    . LYS C 2 9   ? 18.027  75.253  42.240 1.00 148.48 ? 9   LYS C CB    1 
ATOM   2495 C CG    . LYS C 2 9   ? 17.431  74.897  43.598 1.00 148.48 ? 9   LYS C CG    1 
ATOM   2496 C CD    . LYS C 2 9   ? 17.162  73.401  43.709 1.00 148.48 ? 9   LYS C CD    1 
ATOM   2497 C CE    . LYS C 2 9   ? 16.683  73.012  45.104 1.00 148.48 ? 9   LYS C CE    1 
ATOM   2498 N NZ    . LYS C 2 9   ? 15.395  73.656  45.479 1.00 148.48 ? 9   LYS C NZ    1 
ATOM   2499 N N     . THR C 2 10  ? 20.260  77.411  40.758 1.00 95.74  ? 10  THR C N     1 
ATOM   2500 C CA    . THR C 2 10  ? 21.091  77.630  39.567 1.00 95.74  ? 10  THR C CA    1 
ATOM   2501 C C     . THR C 2 10  ? 22.546  77.637  40.031 1.00 95.74  ? 10  THR C C     1 
ATOM   2502 O O     . THR C 2 10  ? 22.836  77.254  41.159 1.00 95.74  ? 10  THR C O     1 
ATOM   2503 C CB    . THR C 2 10  ? 20.816  78.993  38.862 1.00 69.49  ? 10  THR C CB    1 
ATOM   2504 O OG1   . THR C 2 10  ? 21.784  79.958  39.286 1.00 69.49  ? 10  THR C OG1   1 
ATOM   2505 C CG2   . THR C 2 10  ? 19.424  79.511  39.178 1.00 69.49  ? 10  THR C CG2   1 
ATOM   2506 N N     . LEU C 2 11  ? 23.463  78.053  39.166 1.00 64.79  ? 11  LEU C N     1 
ATOM   2507 C CA    . LEU C 2 11  ? 24.871  78.121  39.549 1.00 64.79  ? 11  LEU C CA    1 
ATOM   2508 C C     . LEU C 2 11  ? 25.274  79.596  39.424 1.00 64.79  ? 11  LEU C C     1 
ATOM   2509 O O     . LEU C 2 11  ? 26.243  80.068  40.039 1.00 64.79  ? 11  LEU C O     1 
ATOM   2510 C CB    . LEU C 2 11  ? 25.726  77.234  38.629 1.00 75.35  ? 11  LEU C CB    1 
ATOM   2511 C CG    . LEU C 2 11  ? 27.222  77.148  38.974 1.00 75.35  ? 11  LEU C CG    1 
ATOM   2512 C CD1   . LEU C 2 11  ? 27.378  76.635  40.398 1.00 75.35  ? 11  LEU C CD1   1 
ATOM   2513 C CD2   . LEU C 2 11  ? 27.958  76.235  37.994 1.00 75.35  ? 11  LEU C CD2   1 
ATOM   2514 N N     . ASP C 2 12  ? 24.497  80.308  38.614 1.00 193.48 ? 12  ASP C N     1 
ATOM   2515 C CA    . ASP C 2 12  ? 24.688  81.730  38.371 1.00 193.48 ? 12  ASP C CA    1 
ATOM   2516 C C     . ASP C 2 12  ? 24.137  82.466  39.586 1.00 193.48 ? 12  ASP C C     1 
ATOM   2517 O O     . ASP C 2 12  ? 24.437  83.639  39.812 1.00 193.48 ? 12  ASP C O     1 
ATOM   2518 C CB    . ASP C 2 12  ? 23.922  82.141  37.109 1.00 197.76 ? 12  ASP C CB    1 
ATOM   2519 C CG    . ASP C 2 12  ? 24.033  83.623  36.811 1.00 197.76 ? 12  ASP C CG    1 
ATOM   2520 O OD1   . ASP C 2 12  ? 23.553  84.437  37.626 1.00 197.76 ? 12  ASP C OD1   1 
ATOM   2521 O OD2   . ASP C 2 12  ? 24.600  83.973  35.755 1.00 197.76 ? 12  ASP C OD2   1 
ATOM   2522 N N     . GLU C 2 13  ? 23.327  81.754  40.364 1.00 94.10  ? 13  GLU C N     1 
ATOM   2523 C CA    . GLU C 2 13  ? 22.716  82.302  41.568 1.00 94.10  ? 13  GLU C CA    1 
ATOM   2524 C C     . GLU C 2 13  ? 23.389  81.760  42.815 1.00 94.10  ? 13  GLU C C     1 
ATOM   2525 O O     . GLU C 2 13  ? 22.826  81.828  43.907 1.00 94.10  ? 13  GLU C O     1 
ATOM   2526 C CB    . GLU C 2 13  ? 21.223  81.958  41.624 1.00 133.80 ? 13  GLU C CB    1 
ATOM   2527 C CG    . GLU C 2 13  ? 20.354  82.765  40.680 1.00 133.80 ? 13  GLU C CG    1 
ATOM   2528 C CD    . GLU C 2 13  ? 18.877  82.592  40.968 1.00 133.80 ? 13  GLU C CD    1 
ATOM   2529 O OE1   . GLU C 2 13  ? 18.362  81.479  40.753 1.00 133.80 ? 13  GLU C OE1   1 
ATOM   2530 O OE2   . GLU C 2 13  ? 18.232  83.568  41.414 1.00 133.80 ? 13  GLU C OE2   1 
ATOM   2531 N N     . TYR C 2 14  ? 24.590  81.218  42.656 1.00 131.31 ? 14  TYR C N     1 
ATOM   2532 C CA    . TYR C 2 14  ? 25.303  80.668  43.796 1.00 131.31 ? 14  TYR C CA    1 
ATOM   2533 C C     . TYR C 2 14  ? 26.427  81.579  44.264 1.00 131.31 ? 14  TYR C C     1 
ATOM   2534 O O     . TYR C 2 14  ? 27.489  81.660  43.644 1.00 131.31 ? 14  TYR C O     1 
ATOM   2535 C CB    . TYR C 2 14  ? 25.870  79.293  43.457 1.00 81.20  ? 14  TYR C CB    1 
ATOM   2536 C CG    . TYR C 2 14  ? 26.393  78.542  44.661 1.00 81.20  ? 14  TYR C CG    1 
ATOM   2537 C CD1   . TYR C 2 14  ? 25.534  78.150  45.690 1.00 81.20  ? 14  TYR C CD1   1 
ATOM   2538 C CD2   . TYR C 2 14  ? 27.752  78.219  44.774 1.00 81.20  ? 14  TYR C CD2   1 
ATOM   2539 C CE1   . TYR C 2 14  ? 26.014  77.453  46.799 1.00 81.20  ? 14  TYR C CE1   1 
ATOM   2540 C CE2   . TYR C 2 14  ? 28.242  77.524  45.881 1.00 81.20  ? 14  TYR C CE2   1 
ATOM   2541 C CZ    . TYR C 2 14  ? 27.367  77.145  46.887 1.00 81.20  ? 14  TYR C CZ    1 
ATOM   2542 O OH    . TYR C 2 14  ? 27.843  76.457  47.980 1.00 81.20  ? 14  TYR C OH    1 
ATOM   2543 N N     . ILE C 2 15  ? 26.178  82.268  45.370 1.00 106.17 ? 15  ILE C N     1 
ATOM   2544 C CA    . ILE C 2 15  ? 27.155  83.169  45.953 1.00 106.17 ? 15  ILE C CA    1 
ATOM   2545 C C     . ILE C 2 15  ? 28.322  82.351  46.480 1.00 106.17 ? 15  ILE C C     1 
ATOM   2546 O O     . ILE C 2 15  ? 28.141  81.537  47.385 1.00 106.17 ? 15  ILE C O     1 
ATOM   2547 C CB    . ILE C 2 15  ? 26.551  83.931  47.136 1.00 71.17  ? 15  ILE C CB    1 
ATOM   2548 C CG1   . ILE C 2 15  ? 25.294  84.695  46.685 1.00 71.17  ? 15  ILE C CG1   1 
ATOM   2549 C CG2   . ILE C 2 15  ? 27.617  84.843  47.759 1.00 71.17  ? 15  ILE C CG2   1 
ATOM   2550 C CD1   . ILE C 2 15  ? 23.990  83.918  46.804 1.00 71.17  ? 15  ILE C CD1   1 
ATOM   2551 N N     . GLY C 2 16  ? 29.514  82.553  45.931 1.00 58.22  ? 16  GLY C N     1 
ATOM   2552 C CA    . GLY C 2 16  ? 30.643  81.785  46.429 1.00 58.22  ? 16  GLY C CA    1 
ATOM   2553 C C     . GLY C 2 16  ? 31.824  81.585  45.499 1.00 58.22  ? 16  GLY C C     1 
ATOM   2554 O O     . GLY C 2 16  ? 31.745  81.877  44.307 1.00 58.22  ? 16  GLY C O     1 
ATOM   2555 N N     . GLN C 2 17  ? 32.915  81.070  46.065 1.00 195.39 ? 17  GLN C N     1 
ATOM   2556 C CA    . GLN C 2 17  ? 34.170  80.812  45.356 1.00 195.39 ? 17  GLN C CA    1 
ATOM   2557 C C     . GLN C 2 17  ? 34.052  80.376  43.903 1.00 195.39 ? 17  GLN C C     1 
ATOM   2558 O O     . GLN C 2 17  ? 33.019  79.872  43.467 1.00 195.39 ? 17  GLN C O     1 
ATOM   2559 C CB    . GLN C 2 17  ? 34.988  79.762  46.112 1.00 140.50 ? 17  GLN C CB    1 
ATOM   2560 C CG    . GLN C 2 17  ? 36.306  79.404  45.444 1.00 140.50 ? 17  GLN C CG    1 
ATOM   2561 C CD    . GLN C 2 17  ? 37.080  78.360  46.212 1.00 140.50 ? 17  GLN C CD    1 
ATOM   2562 O OE1   . GLN C 2 17  ? 36.580  77.262  46.462 1.00 140.50 ? 17  GLN C OE1   1 
ATOM   2563 N NE2   . GLN C 2 17  ? 38.310  78.694  46.594 1.00 140.50 ? 17  GLN C NE2   1 
ATOM   2564 N N     . GLU C 2 18  ? 35.140  80.563  43.163 1.00 197.25 ? 18  GLU C N     1 
ATOM   2565 C CA    . GLU C 2 18  ? 35.183  80.195  41.759 1.00 197.25 ? 18  GLU C CA    1 
ATOM   2566 C C     . GLU C 2 18  ? 36.332  79.240  41.436 1.00 197.25 ? 18  GLU C C     1 
ATOM   2567 O O     . GLU C 2 18  ? 36.757  79.161  40.284 1.00 197.25 ? 18  GLU C O     1 
ATOM   2568 C CB    . GLU C 2 18  ? 35.308  81.449  40.892 1.00 109.72 ? 18  GLU C CB    1 
ATOM   2569 C CG    . GLU C 2 18  ? 34.234  82.493  41.140 1.00 109.72 ? 18  GLU C CG    1 
ATOM   2570 C CD    . GLU C 2 18  ? 32.828  81.919  41.091 1.00 109.72 ? 18  GLU C CD    1 
ATOM   2571 O OE1   . GLU C 2 18  ? 32.561  81.048  40.235 1.00 109.72 ? 18  GLU C OE1   1 
ATOM   2572 O OE2   . GLU C 2 18  ? 31.982  82.352  41.903 1.00 109.72 ? 18  GLU C OE2   1 
ATOM   2573 N N     . ARG C 2 19  ? 36.841  78.522  42.437 1.00 200.00 ? 19  ARG C N     1 
ATOM   2574 C CA    . ARG C 2 19  ? 37.934  77.576  42.193 1.00 200.00 ? 19  ARG C CA    1 
ATOM   2575 C C     . ARG C 2 19  ? 37.453  76.152  41.945 1.00 200.00 ? 19  ARG C C     1 
ATOM   2576 O O     . ARG C 2 19  ? 37.712  75.588  40.881 1.00 200.00 ? 19  ARG C O     1 
ATOM   2577 C CB    . ARG C 2 19  ? 38.945  77.555  43.346 1.00 125.41 ? 19  ARG C CB    1 
ATOM   2578 C CG    . ARG C 2 19  ? 39.961  76.416  43.204 1.00 125.41 ? 19  ARG C CG    1 
ATOM   2579 C CD    . ARG C 2 19  ? 41.155  76.558  44.127 1.00 125.41 ? 19  ARG C CD    1 
ATOM   2580 N NE    . ARG C 2 19  ? 42.094  75.452  43.949 1.00 125.41 ? 19  ARG C NE    1 
ATOM   2581 C CZ    . ARG C 2 19  ? 43.295  75.383  44.517 1.00 125.41 ? 19  ARG C CZ    1 
ATOM   2582 N NH1   . ARG C 2 19  ? 43.716  76.361  45.309 1.00 125.41 ? 19  ARG C NH1   1 
ATOM   2583 N NH2   . ARG C 2 19  ? 44.076  74.331  44.295 1.00 125.41 ? 19  ARG C NH2   1 
ATOM   2584 N N     . LEU C 2 20  ? 36.772  75.563  42.925 1.00 200.00 ? 20  LEU C N     1 
ATOM   2585 C CA    . LEU C 2 20  ? 36.274  74.203  42.758 1.00 200.00 ? 20  LEU C CA    1 
ATOM   2586 C C     . LEU C 2 20  ? 35.552  74.167  41.421 1.00 200.00 ? 20  LEU C C     1 
ATOM   2587 O O     . LEU C 2 20  ? 35.589  73.169  40.702 1.00 200.00 ? 20  LEU C O     1 
ATOM   2588 C CB    . LEU C 2 20  ? 35.311  73.818  43.897 1.00 196.89 ? 20  LEU C CB    1 
ATOM   2589 C CG    . LEU C 2 20  ? 33.885  74.381  44.001 1.00 196.89 ? 20  LEU C CG    1 
ATOM   2590 C CD1   . LEU C 2 20  ? 32.987  73.795  42.922 1.00 196.89 ? 20  LEU C CD1   1 
ATOM   2591 C CD2   . LEU C 2 20  ? 33.316  74.027  45.366 1.00 196.89 ? 20  LEU C CD2   1 
ATOM   2592 N N     . LYS C 2 21  ? 34.913  75.285  41.092 1.00 177.95 ? 21  LYS C N     1 
ATOM   2593 C CA    . LYS C 2 21  ? 34.179  75.414  39.845 1.00 177.95 ? 21  LYS C CA    1 
ATOM   2594 C C     . LYS C 2 21  ? 35.098  75.292  38.631 1.00 177.95 ? 21  LYS C C     1 
ATOM   2595 O O     . LYS C 2 21  ? 34.793  74.556  37.695 1.00 177.95 ? 21  LYS C O     1 
ATOM   2596 C CB    . LYS C 2 21  ? 33.437  76.752  39.815 1.00 114.15 ? 21  LYS C CB    1 
ATOM   2597 C CG    . LYS C 2 21  ? 32.323  76.872  40.846 1.00 114.15 ? 21  LYS C CG    1 
ATOM   2598 C CD    . LYS C 2 21  ? 31.488  78.119  40.589 1.00 114.15 ? 21  LYS C CD    1 
ATOM   2599 C CE    . LYS C 2 21  ? 30.230  78.148  41.447 1.00 114.15 ? 21  LYS C CE    1 
ATOM   2600 N NZ    . LYS C 2 21  ? 29.334  79.288  41.082 1.00 114.15 ? 21  LYS C NZ    1 
ATOM   2601 N N     . GLN C 2 22  ? 36.223  76.002  38.645 1.00 200.00 ? 22  GLN C N     1 
ATOM   2602 C CA    . GLN C 2 22  ? 37.167  75.945  37.530 1.00 200.00 ? 22  GLN C CA    1 
ATOM   2603 C C     . GLN C 2 22  ? 37.539  74.493  37.229 1.00 200.00 ? 22  GLN C C     1 
ATOM   2604 O O     . GLN C 2 22  ? 38.059  74.180  36.155 1.00 200.00 ? 22  GLN C O     1 
ATOM   2605 C CB    . GLN C 2 22  ? 38.432  76.751  37.850 1.00 200.00 ? 22  GLN C CB    1 
ATOM   2606 C CG    . GLN C 2 22  ? 39.435  76.807  36.703 1.00 200.00 ? 22  GLN C CG    1 
ATOM   2607 C CD    . GLN C 2 22  ? 40.647  77.662  37.019 1.00 200.00 ? 22  GLN C CD    1 
ATOM   2608 O OE1   . GLN C 2 22  ? 40.525  78.857  37.290 1.00 200.00 ? 22  GLN C OE1   1 
ATOM   2609 N NE2   . GLN C 2 22  ? 41.828  77.053  36.983 1.00 200.00 ? 22  GLN C NE2   1 
ATOM   2610 N N     . LYS C 2 23  ? 37.274  73.611  38.190 1.00 200.00 ? 23  LYS C N     1 
ATOM   2611 C CA    . LYS C 2 23  ? 37.554  72.192  38.025 1.00 200.00 ? 23  LYS C CA    1 
ATOM   2612 C C     . LYS C 2 23  ? 36.314  71.345  38.304 1.00 200.00 ? 23  LYS C C     1 
ATOM   2613 O O     . LYS C 2 23  ? 36.406  70.127  38.446 1.00 200.00 ? 23  LYS C O     1 
ATOM   2614 C CB    . LYS C 2 23  ? 38.720  71.758  38.923 1.00 149.53 ? 23  LYS C CB    1 
ATOM   2615 C CG    . LYS C 2 23  ? 38.583  72.121  40.393 1.00 149.53 ? 23  LYS C CG    1 
ATOM   2616 C CD    . LYS C 2 23  ? 39.860  71.779  41.154 1.00 149.53 ? 23  LYS C CD    1 
ATOM   2617 C CE    . LYS C 2 23  ? 41.060  72.536  40.588 1.00 149.53 ? 23  LYS C CE    1 
ATOM   2618 N NZ    . LYS C 2 23  ? 42.346  72.151  41.238 1.00 149.53 ? 23  LYS C NZ    1 
ATOM   2619 N N     . LEU C 2 24  ? 35.157  72.000  38.393 1.00 140.60 ? 24  LEU C N     1 
ATOM   2620 C CA    . LEU C 2 24  ? 33.889  71.303  38.605 1.00 140.60 ? 24  LEU C CA    1 
ATOM   2621 C C     . LEU C 2 24  ? 32.849  71.821  37.614 1.00 140.60 ? 24  LEU C C     1 
ATOM   2622 O O     . LEU C 2 24  ? 32.068  71.043  37.070 1.00 140.60 ? 24  LEU C O     1 
ATOM   2623 C CB    . LEU C 2 24  ? 33.363  71.475  40.035 1.00 69.14  ? 24  LEU C CB    1 
ATOM   2624 C CG    . LEU C 2 24  ? 32.127  70.603  40.321 1.00 69.14  ? 24  LEU C CG    1 
ATOM   2625 C CD1   . LEU C 2 24  ? 32.461  69.595  41.412 1.00 69.14  ? 24  LEU C CD1   1 
ATOM   2626 C CD2   . LEU C 2 24  ? 30.942  71.471  40.717 1.00 69.14  ? 24  LEU C CD2   1 
ATOM   2627 N N     . ARG C 2 25  ? 32.832  73.131  37.382 1.00 156.90 ? 25  ARG C N     1 
ATOM   2628 C CA    . ARG C 2 25  ? 31.891  73.703  36.425 1.00 156.90 ? 25  ARG C CA    1 
ATOM   2629 C C     . ARG C 2 25  ? 32.192  73.016  35.099 1.00 156.90 ? 25  ARG C C     1 
ATOM   2630 O O     . ARG C 2 25  ? 31.301  72.785  34.283 1.00 156.90 ? 25  ARG C O     1 
ATOM   2631 C CB    . ARG C 2 25  ? 32.105  75.214  36.268 1.00 192.86 ? 25  ARG C CB    1 
ATOM   2632 C CG    . ARG C 2 25  ? 33.356  75.592  35.473 1.00 192.86 ? 25  ARG C CG    1 
ATOM   2633 C CD    . ARG C 2 25  ? 33.394  77.072  35.120 1.00 192.86 ? 25  ARG C CD    1 
ATOM   2634 N NE    . ARG C 2 25  ? 33.404  77.930  36.302 1.00 192.86 ? 25  ARG C NE    1 
ATOM   2635 C CZ    . ARG C 2 25  ? 33.446  79.258  36.261 1.00 192.86 ? 25  ARG C CZ    1 
ATOM   2636 N NH1   . ARG C 2 25  ? 33.484  79.888  35.095 1.00 192.86 ? 25  ARG C NH1   1 
ATOM   2637 N NH2   . ARG C 2 25  ? 33.446  79.960  37.387 1.00 192.86 ? 25  ARG C NH2   1 
ATOM   2638 N N     . VAL C 2 26  ? 33.469  72.687  34.916 1.00 200.00 ? 26  VAL C N     1 
ATOM   2639 C CA    . VAL C 2 26  ? 33.973  72.027  33.715 1.00 200.00 ? 26  VAL C CA    1 
ATOM   2640 C C     . VAL C 2 26  ? 33.407  70.610  33.591 1.00 200.00 ? 26  VAL C C     1 
ATOM   2641 O O     . VAL C 2 26  ? 32.988  70.188  32.511 1.00 200.00 ? 26  VAL C O     1 
ATOM   2642 C CB    . VAL C 2 26  ? 35.518  71.949  33.750 1.00 101.62 ? 26  VAL C CB    1 
ATOM   2643 C CG1   . VAL C 2 26  ? 36.056  71.612  32.368 1.00 101.62 ? 26  VAL C CG1   1 
ATOM   2644 C CG2   . VAL C 2 26  ? 36.098  73.264  34.255 1.00 101.62 ? 26  VAL C CG2   1 
ATOM   2645 N N     . TYR C 2 27  ? 33.410  69.877  34.701 1.00 122.09 ? 27  TYR C N     1 
ATOM   2646 C CA    . TYR C 2 27  ? 32.880  68.519  34.729 1.00 122.09 ? 27  TYR C CA    1 
ATOM   2647 C C     . TYR C 2 27  ? 31.358  68.591  34.787 1.00 122.09 ? 27  TYR C C     1 
ATOM   2648 O O     . TYR C 2 27  ? 30.669  67.605  34.527 1.00 122.09 ? 27  TYR C O     1 
ATOM   2649 C CB    . TYR C 2 27  ? 33.431  67.762  35.940 1.00 199.34 ? 27  TYR C CB    1 
ATOM   2650 C CG    . TYR C 2 27  ? 34.895  67.394  35.815 1.00 199.34 ? 27  TYR C CG    1 
ATOM   2651 C CD1   . TYR C 2 27  ? 35.833  68.323  35.361 1.00 199.34 ? 27  TYR C CD1   1 
ATOM   2652 C CD2   . TYR C 2 27  ? 35.346  66.120  36.159 1.00 199.34 ? 27  TYR C CD2   1 
ATOM   2653 C CE1   . TYR C 2 27  ? 37.185  67.993  35.252 1.00 199.34 ? 27  TYR C CE1   1 
ATOM   2654 C CE2   . TYR C 2 27  ? 36.697  65.779  36.056 1.00 199.34 ? 27  TYR C CE2   1 
ATOM   2655 C CZ    . TYR C 2 27  ? 37.610  66.720  35.602 1.00 199.34 ? 27  TYR C CZ    1 
ATOM   2656 O OH    . TYR C 2 27  ? 38.945  66.393  35.499 1.00 199.34 ? 27  TYR C OH    1 
ATOM   2657 N N     . LEU C 2 28  ? 30.846  69.769  35.139 1.00 147.25 ? 28  LEU C N     1 
ATOM   2658 C CA    . LEU C 2 28  ? 29.408  70.008  35.200 1.00 147.25 ? 28  LEU C CA    1 
ATOM   2659 C C     . LEU C 2 28  ? 28.977  70.219  33.758 1.00 147.25 ? 28  LEU C C     1 
ATOM   2660 O O     . LEU C 2 28  ? 27.788  70.214  33.432 1.00 147.25 ? 28  LEU C O     1 
ATOM   2661 C CB    . LEU C 2 28  ? 29.098  71.270  36.013 1.00 200.00 ? 28  LEU C CB    1 
ATOM   2662 C CG    . LEU C 2 28  ? 29.305  71.244  37.530 1.00 200.00 ? 28  LEU C CG    1 
ATOM   2663 C CD1   . LEU C 2 28  ? 29.127  72.648  38.095 1.00 200.00 ? 28  LEU C CD1   1 
ATOM   2664 C CD2   . LEU C 2 28  ? 28.319  70.277  38.172 1.00 200.00 ? 28  LEU C CD2   1 
ATOM   2665 N N     . GLU C 2 29  ? 29.979  70.411  32.906 1.00 199.86 ? 29  GLU C N     1 
ATOM   2666 C CA    . GLU C 2 29  ? 29.786  70.625  31.479 1.00 199.86 ? 29  GLU C CA    1 
ATOM   2667 C C     . GLU C 2 29  ? 29.992  69.294  30.757 1.00 199.86 ? 29  GLU C C     1 
ATOM   2668 O O     . GLU C 2 29  ? 29.658  69.150  29.580 1.00 199.86 ? 29  GLU C O     1 
ATOM   2669 C CB    . GLU C 2 29  ? 30.789  71.673  30.978 1.00 173.10 ? 29  GLU C CB    1 
ATOM   2670 C CG    . GLU C 2 29  ? 30.628  73.039  31.649 1.00 173.10 ? 29  GLU C CG    1 
ATOM   2671 C CD    . GLU C 2 29  ? 31.838  73.944  31.479 1.00 173.10 ? 29  GLU C CD    1 
ATOM   2672 O OE1   . GLU C 2 29  ? 31.847  75.038  32.083 1.00 173.10 ? 29  GLU C OE1   1 
ATOM   2673 O OE2   . GLU C 2 29  ? 32.778  73.568  30.747 1.00 173.10 ? 29  GLU C OE2   1 
ATOM   2674 N N     . ALA C 2 30  ? 30.543  68.325  31.483 1.00 169.28 ? 30  ALA C N     1 
ATOM   2675 C CA    . ALA C 2 30  ? 30.796  66.992  30.945 1.00 169.28 ? 30  ALA C CA    1 
ATOM   2676 C C     . ALA C 2 30  ? 29.509  66.170  30.944 1.00 169.28 ? 30  ALA C C     1 
ATOM   2677 O O     . ALA C 2 30  ? 29.338  65.274  30.118 1.00 169.28 ? 30  ALA C O     1 
ATOM   2678 C CB    . ALA C 2 30  ? 31.865  66.291  31.772 1.00 200.00 ? 30  ALA C CB    1 
ATOM   2679 N N     . ALA C 2 31  ? 28.610  66.478  31.876 1.00 121.92 ? 31  ALA C N     1 
ATOM   2680 C CA    . ALA C 2 31  ? 27.328  65.785  31.976 1.00 121.92 ? 31  ALA C CA    1 
ATOM   2681 C C     . ALA C 2 31  ? 26.492  66.178  30.765 1.00 121.92 ? 31  ALA C C     1 
ATOM   2682 O O     . ALA C 2 31  ? 25.286  65.933  30.705 1.00 121.92 ? 31  ALA C O     1 
ATOM   2683 C CB    . ALA C 2 31  ? 26.614  66.184  33.259 1.00 200.00 ? 31  ALA C CB    1 
ATOM   2684 N N     . LYS C 2 32  ? 27.167  66.801  29.805 1.00 200.00 ? 32  LYS C N     1 
ATOM   2685 C CA    . LYS C 2 32  ? 26.562  67.254  28.565 1.00 200.00 ? 32  LYS C CA    1 
ATOM   2686 C C     . LYS C 2 32  ? 27.579  67.109  27.431 1.00 200.00 ? 32  LYS C C     1 
ATOM   2687 O O     . LYS C 2 32  ? 27.376  67.608  26.322 1.00 200.00 ? 32  LYS C O     1 
ATOM   2688 C CB    . LYS C 2 32  ? 26.111  68.710  28.709 1.00 124.50 ? 32  LYS C CB    1 
ATOM   2689 C CG    . LYS C 2 32  ? 24.849  68.884  29.550 1.00 124.50 ? 32  LYS C CG    1 
ATOM   2690 C CD    . LYS C 2 32  ? 23.634  68.299  28.834 1.00 124.50 ? 32  LYS C CD    1 
ATOM   2691 C CE    . LYS C 2 32  ? 22.342  68.563  29.591 1.00 124.50 ? 32  LYS C CE    1 
ATOM   2692 N NZ    . LYS C 2 32  ? 21.151  68.141  28.796 1.00 124.50 ? 32  LYS C NZ    1 
ATOM   2693 N N     . ALA C 2 33  ? 28.678  66.420  27.732 1.00 200.00 ? 33  ALA C N     1 
ATOM   2694 C CA    . ALA C 2 33  ? 29.742  66.161  26.765 1.00 200.00 ? 33  ALA C CA    1 
ATOM   2695 C C     . ALA C 2 33  ? 29.919  64.651  26.679 1.00 200.00 ? 33  ALA C C     1 
ATOM   2696 O O     . ALA C 2 33  ? 30.653  64.147  25.828 1.00 200.00 ? 33  ALA C O     1 
ATOM   2697 C CB    . ALA C 2 33  ? 31.050  66.815  27.214 1.00 114.27 ? 33  ALA C CB    1 
ATOM   2698 N N     . ARG C 2 34  ? 29.235  63.939  27.574 1.00 200.00 ? 34  ARG C N     1 
ATOM   2699 C CA    . ARG C 2 34  ? 29.298  62.482  27.629 1.00 200.00 ? 34  ARG C CA    1 
ATOM   2700 C C     . ARG C 2 34  ? 27.969  61.842  28.051 1.00 200.00 ? 34  ARG C C     1 
ATOM   2701 O O     . ARG C 2 34  ? 27.281  61.236  27.228 1.00 200.00 ? 34  ARG C O     1 
ATOM   2702 C CB    . ARG C 2 34  ? 30.431  62.046  28.572 1.00 198.86 ? 34  ARG C CB    1 
ATOM   2703 C CG    . ARG C 2 34  ? 30.387  62.674  29.962 1.00 198.86 ? 34  ARG C CG    1 
ATOM   2704 C CD    . ARG C 2 34  ? 31.688  62.445  30.730 1.00 198.86 ? 34  ARG C CD    1 
ATOM   2705 N NE    . ARG C 2 34  ? 32.825  63.130  30.114 1.00 198.86 ? 34  ARG C NE    1 
ATOM   2706 C CZ    . ARG C 2 34  ? 34.071  63.086  30.579 1.00 198.86 ? 34  ARG C CZ    1 
ATOM   2707 N NH1   . ARG C 2 34  ? 34.351  62.387  31.671 1.00 198.86 ? 34  ARG C NH1   1 
ATOM   2708 N NH2   . ARG C 2 34  ? 35.039  63.742  29.953 1.00 198.86 ? 34  ARG C NH2   1 
ATOM   2709 N N     . LYS C 2 35  ? 27.608  61.976  29.326 1.00 200.00 ? 35  LYS C N     1 
ATOM   2710 C CA    . LYS C 2 35  ? 26.360  61.407  29.839 1.00 200.00 ? 35  LYS C CA    1 
ATOM   2711 C C     . LYS C 2 35  ? 25.831  62.172  31.055 1.00 200.00 ? 35  LYS C C     1 
ATOM   2712 O O     . LYS C 2 35  ? 26.087  63.366  31.204 1.00 200.00 ? 35  LYS C O     1 
ATOM   2713 C CB    . LYS C 2 35  ? 26.563  59.929  30.200 1.00 150.22 ? 35  LYS C CB    1 
ATOM   2714 C CG    . LYS C 2 35  ? 26.732  59.016  28.994 1.00 150.22 ? 35  LYS C CG    1 
ATOM   2715 C CD    . LYS C 2 35  ? 27.213  57.617  29.373 1.00 150.22 ? 35  LYS C CD    1 
ATOM   2716 C CE    . LYS C 2 35  ? 26.204  56.853  30.219 1.00 150.22 ? 35  LYS C CE    1 
ATOM   2717 N NZ    . LYS C 2 35  ? 26.101  57.380  31.604 1.00 150.22 ? 35  LYS C NZ    1 
ATOM   2718 N N     . GLU C 2 36  ? 25.085  61.481  31.913 1.00 200.00 ? 36  GLU C N     1 
ATOM   2719 C CA    . GLU C 2 36  ? 24.511  62.084  33.116 1.00 200.00 ? 36  GLU C CA    1 
ATOM   2720 C C     . GLU C 2 36  ? 25.321  61.860  34.399 1.00 200.00 ? 36  GLU C C     1 
ATOM   2721 O O     . GLU C 2 36  ? 25.197  62.627  35.354 1.00 200.00 ? 36  GLU C O     1 
ATOM   2722 C CB    . GLU C 2 36  ? 23.081  61.570  33.330 1.00 197.86 ? 36  GLU C CB    1 
ATOM   2723 C CG    . GLU C 2 36  ? 21.992  62.357  32.602 1.00 197.86 ? 36  GLU C CG    1 
ATOM   2724 C CD    . GLU C 2 36  ? 22.210  62.440  31.102 1.00 197.86 ? 36  GLU C CD    1 
ATOM   2725 O OE1   . GLU C 2 36  ? 23.188  63.088  30.674 1.00 197.86 ? 36  GLU C OE1   1 
ATOM   2726 O OE2   . GLU C 2 36  ? 21.400  61.858  30.348 1.00 197.86 ? 36  GLU C OE2   1 
ATOM   2727 N N     . PRO C 2 37  ? 26.144  60.797  34.447 1.00 200.00 ? 37  PRO C N     1 
ATOM   2728 C CA    . PRO C 2 37  ? 26.961  60.499  35.633 1.00 200.00 ? 37  PRO C CA    1 
ATOM   2729 C C     . PRO C 2 37  ? 28.226  61.349  35.818 1.00 200.00 ? 37  PRO C C     1 
ATOM   2730 O O     . PRO C 2 37  ? 29.259  61.072  35.207 1.00 200.00 ? 37  PRO C O     1 
ATOM   2731 C CB    . PRO C 2 37  ? 27.312  59.019  35.451 1.00 107.13 ? 37  PRO C CB    1 
ATOM   2732 C CG    . PRO C 2 37  ? 26.197  58.499  34.608 1.00 107.13 ? 37  PRO C CG    1 
ATOM   2733 C CD    . PRO C 2 37  ? 26.031  59.599  33.601 1.00 107.13 ? 37  PRO C CD    1 
ATOM   2734 N N     . LEU C 2 38  ? 28.145  62.372  36.665 1.00 101.08 ? 38  LEU C N     1 
ATOM   2735 C CA    . LEU C 2 38  ? 29.298  63.224  36.941 1.00 101.08 ? 38  LEU C CA    1 
ATOM   2736 C C     . LEU C 2 38  ? 30.017  62.695  38.181 1.00 101.08 ? 38  LEU C C     1 
ATOM   2737 O O     . LEU C 2 38  ? 29.499  62.791  39.299 1.00 101.08 ? 38  LEU C O     1 
ATOM   2738 C CB    . LEU C 2 38  ? 28.857  64.677  37.165 1.00 119.37 ? 38  LEU C CB    1 
ATOM   2739 C CG    . LEU C 2 38  ? 27.510  64.931  37.849 1.00 119.37 ? 38  LEU C CG    1 
ATOM   2740 C CD1   . LEU C 2 38  ? 27.506  66.303  38.493 1.00 119.37 ? 38  LEU C CD1   1 
ATOM   2741 C CD2   . LEU C 2 38  ? 26.391  64.811  36.824 1.00 119.37 ? 38  LEU C CD2   1 
ATOM   2742 N N     . GLU C 2 39  ? 31.208  62.139  37.961 1.00 191.11 ? 39  GLU C N     1 
ATOM   2743 C CA    . GLU C 2 39  ? 32.048  61.551  39.008 1.00 191.11 ? 39  GLU C CA    1 
ATOM   2744 C C     . GLU C 2 39  ? 31.706  61.890  40.463 1.00 191.11 ? 39  GLU C C     1 
ATOM   2745 O O     . GLU C 2 39  ? 31.361  63.028  40.790 1.00 191.11 ? 39  GLU C O     1 
ATOM   2746 C CB    . GLU C 2 39  ? 33.519  61.892  38.746 1.00 176.94 ? 39  GLU C CB    1 
ATOM   2747 C CG    . GLU C 2 39  ? 34.039  61.411  37.400 1.00 176.94 ? 39  GLU C CG    1 
ATOM   2748 C CD    . GLU C 2 39  ? 35.555  61.324  37.358 1.00 176.94 ? 39  GLU C CD    1 
ATOM   2749 O OE1   . GLU C 2 39  ? 36.122  60.487  38.092 1.00 176.94 ? 39  GLU C OE1   1 
ATOM   2750 O OE2   . GLU C 2 39  ? 36.180  62.090  36.595 1.00 176.94 ? 39  GLU C OE2   1 
ATOM   2751 N N     . HIS C 2 40  ? 31.818  60.883  41.329 1.00 142.41 ? 40  HIS C N     1 
ATOM   2752 C CA    . HIS C 2 40  ? 31.532  61.024  42.755 1.00 142.41 ? 40  HIS C CA    1 
ATOM   2753 C C     . HIS C 2 40  ? 32.224  62.248  43.326 1.00 142.41 ? 40  HIS C C     1 
ATOM   2754 O O     . HIS C 2 40  ? 33.450  62.344  43.308 1.00 142.41 ? 40  HIS C O     1 
ATOM   2755 C CB    . HIS C 2 40  ? 31.984  59.772  43.509 1.00 191.28 ? 40  HIS C CB    1 
ATOM   2756 C CG    . HIS C 2 40  ? 31.116  58.577  43.267 1.00 191.28 ? 40  HIS C CG    1 
ATOM   2757 N ND1   . HIS C 2 40  ? 30.852  58.091  42.004 1.00 191.28 ? 40  HIS C ND1   1 
ATOM   2758 C CD2   . HIS C 2 40  ? 30.447  57.773  44.127 1.00 191.28 ? 40  HIS C CD2   1 
ATOM   2759 C CE1   . HIS C 2 40  ? 30.056  57.040  42.096 1.00 191.28 ? 40  HIS C CE1   1 
ATOM   2760 N NE2   . HIS C 2 40  ? 29.796  56.826  43.374 1.00 191.28 ? 40  HIS C NE2   1 
ATOM   2761 N N     . LEU C 2 41  ? 31.425  63.177  43.842 1.00 138.46 ? 41  LEU C N     1 
ATOM   2762 C CA    . LEU C 2 41  ? 31.941  64.419  44.398 1.00 138.46 ? 41  LEU C CA    1 
ATOM   2763 C C     . LEU C 2 41  ? 31.924  64.480  45.920 1.00 138.46 ? 41  LEU C C     1 
ATOM   2764 O O     . LEU C 2 41  ? 30.864  64.596  46.537 1.00 138.46 ? 41  LEU C O     1 
ATOM   2765 C CB    . LEU C 2 41  ? 31.146  65.597  43.836 1.00 96.17  ? 41  LEU C CB    1 
ATOM   2766 C CG    . LEU C 2 41  ? 31.539  66.997  44.308 1.00 96.17  ? 41  LEU C CG    1 
ATOM   2767 C CD1   . LEU C 2 41  ? 32.974  67.299  43.882 1.00 96.17  ? 41  LEU C CD1   1 
ATOM   2768 C CD2   . LEU C 2 41  ? 30.564  68.020  43.725 1.00 96.17  ? 41  LEU C CD2   1 
ATOM   2769 N N     . LEU C 2 42  ? 33.115  64.404  46.510 1.00 181.69 ? 42  LEU C N     1 
ATOM   2770 C CA    . LEU C 2 42  ? 33.294  64.475  47.959 1.00 181.69 ? 42  LEU C CA    1 
ATOM   2771 C C     . LEU C 2 42  ? 33.492  65.959  48.272 1.00 181.69 ? 42  LEU C C     1 
ATOM   2772 O O     . LEU C 2 42  ? 33.858  66.731  47.385 1.00 181.69 ? 42  LEU C O     1 
ATOM   2773 C CB    . LEU C 2 42  ? 34.543  63.672  48.372 1.00 57.12  ? 42  LEU C CB    1 
ATOM   2774 C CG    . LEU C 2 42  ? 34.982  63.538  49.843 1.00 57.12  ? 42  LEU C CG    1 
ATOM   2775 C CD1   . LEU C 2 42  ? 34.135  62.514  50.595 1.00 57.12  ? 42  LEU C CD1   1 
ATOM   2776 C CD2   . LEU C 2 42  ? 36.435  63.104  49.871 1.00 57.12  ? 42  LEU C CD2   1 
ATOM   2777 N N     . LEU C 2 43  ? 33.244  66.363  49.516 1.00 115.34 ? 43  LEU C N     1 
ATOM   2778 C CA    . LEU C 2 43  ? 33.419  67.762  49.897 1.00 115.34 ? 43  LEU C CA    1 
ATOM   2779 C C     . LEU C 2 43  ? 34.134  67.921  51.240 1.00 115.34 ? 43  LEU C C     1 
ATOM   2780 O O     . LEU C 2 43  ? 33.856  67.197  52.197 1.00 115.34 ? 43  LEU C O     1 
ATOM   2781 C CB    . LEU C 2 43  ? 32.067  68.473  49.948 1.00 78.68  ? 43  LEU C CB    1 
ATOM   2782 C CG    . LEU C 2 43  ? 31.200  68.418  48.689 1.00 78.68  ? 43  LEU C CG    1 
ATOM   2783 C CD1   . LEU C 2 43  ? 29.993  69.313  48.902 1.00 78.68  ? 43  LEU C CD1   1 
ATOM   2784 C CD2   . LEU C 2 43  ? 31.985  68.870  47.467 1.00 78.68  ? 43  LEU C CD2   1 
ATOM   2785 N N     . PHE C 2 44  ? 35.050  68.883  51.296 1.00 125.71 ? 44  PHE C N     1 
ATOM   2786 C CA    . PHE C 2 44  ? 35.831  69.159  52.497 1.00 125.71 ? 44  PHE C CA    1 
ATOM   2787 C C     . PHE C 2 44  ? 35.495  70.506  53.126 1.00 125.71 ? 44  PHE C C     1 
ATOM   2788 O O     . PHE C 2 44  ? 34.465  71.110  52.827 1.00 125.71 ? 44  PHE C O     1 
ATOM   2789 C CB    . PHE C 2 44  ? 37.317  69.156  52.157 1.00 140.27 ? 44  PHE C CB    1 
ATOM   2790 C CG    . PHE C 2 44  ? 37.918  67.798  52.067 1.00 140.27 ? 44  PHE C CG    1 
ATOM   2791 C CD1   . PHE C 2 44  ? 37.279  66.785  51.373 1.00 140.27 ? 44  PHE C CD1   1 
ATOM   2792 C CD2   . PHE C 2 44  ? 39.148  67.538  52.661 1.00 140.27 ? 44  PHE C CD2   1 
ATOM   2793 C CE1   . PHE C 2 44  ? 37.855  65.527  51.270 1.00 140.27 ? 44  PHE C CE1   1 
ATOM   2794 C CE2   . PHE C 2 44  ? 39.735  66.286  52.564 1.00 140.27 ? 44  PHE C CE2   1 
ATOM   2795 C CZ    . PHE C 2 44  ? 39.085  65.273  51.865 1.00 140.27 ? 44  PHE C CZ    1 
ATOM   2796 N N     . GLY C 2 45  ? 36.391  70.964  53.998 1.00 200.00 ? 45  GLY C N     1 
ATOM   2797 C CA    . GLY C 2 45  ? 36.227  72.245  54.662 1.00 200.00 ? 45  GLY C CA    1 
ATOM   2798 C C     . GLY C 2 45  ? 35.287  72.259  55.851 1.00 200.00 ? 45  GLY C C     1 
ATOM   2799 O O     . GLY C 2 45  ? 34.565  71.291  56.085 1.00 200.00 ? 45  GLY C O     1 
ATOM   2800 N N     . PRO C 2 46  ? 35.286  73.353  56.633 1.00 106.61 ? 46  PRO C N     1 
ATOM   2801 C CA    . PRO C 2 46  ? 34.438  73.535  57.820 1.00 106.61 ? 46  PRO C CA    1 
ATOM   2802 C C     . PRO C 2 46  ? 32.940  73.629  57.480 1.00 106.61 ? 46  PRO C C     1 
ATOM   2803 O O     . PRO C 2 46  ? 32.571  74.023  56.371 1.00 106.61 ? 46  PRO C O     1 
ATOM   2804 C CB    . PRO C 2 46  ? 34.988  74.816  58.438 1.00 116.87 ? 46  PRO C CB    1 
ATOM   2805 C CG    . PRO C 2 46  ? 35.518  75.558  57.237 1.00 116.87 ? 46  PRO C CG    1 
ATOM   2806 C CD    . PRO C 2 46  ? 36.218  74.482  56.480 1.00 116.87 ? 46  PRO C CD    1 
ATOM   2807 N N     . PRO C 2 47  ? 32.062  73.271  58.440 1.00 61.02  ? 47  PRO C N     1 
ATOM   2808 C CA    . PRO C 2 47  ? 30.598  73.282  58.308 1.00 61.02  ? 47  PRO C CA    1 
ATOM   2809 C C     . PRO C 2 47  ? 30.060  74.600  57.787 1.00 61.02  ? 47  PRO C C     1 
ATOM   2810 O O     . PRO C 2 47  ? 30.828  75.483  57.447 1.00 61.02  ? 47  PRO C O     1 
ATOM   2811 C CB    . PRO C 2 47  ? 30.123  73.158  59.754 1.00 135.15 ? 47  PRO C CB    1 
ATOM   2812 C CG    . PRO C 2 47  ? 31.175  72.303  60.366 1.00 135.15 ? 47  PRO C CG    1 
ATOM   2813 C CD    . PRO C 2 47  ? 32.446  72.931  59.823 1.00 135.15 ? 47  PRO C CD    1 
ATOM   2814 N N     . GLY C 2 48  ? 28.734  74.710  57.727 1.00 67.18  ? 48  GLY C N     1 
ATOM   2815 C CA    . GLY C 2 48  ? 28.076  75.922  57.262 1.00 67.18  ? 48  GLY C CA    1 
ATOM   2816 C C     . GLY C 2 48  ? 28.424  76.286  55.830 1.00 67.18  ? 48  GLY C C     1 
ATOM   2817 O O     . GLY C 2 48  ? 27.527  76.499  55.011 1.00 67.18  ? 48  GLY C O     1 
ATOM   2818 N N     . LEU C 2 49  ? 29.725  76.366  55.551 1.00 76.78  ? 49  LEU C N     1 
ATOM   2819 C CA    . LEU C 2 49  ? 30.305  76.701  54.249 1.00 76.78  ? 49  LEU C CA    1 
ATOM   2820 C C     . LEU C 2 49  ? 29.414  76.546  53.030 1.00 76.78  ? 49  LEU C C     1 
ATOM   2821 O O     . LEU C 2 49  ? 29.610  77.239  52.036 1.00 76.78  ? 49  LEU C O     1 
ATOM   2822 C CB    . LEU C 2 49  ? 31.585  75.888  54.024 1.00 84.21  ? 49  LEU C CB    1 
ATOM   2823 C CG    . LEU C 2 49  ? 32.918  76.480  54.494 1.00 84.21  ? 49  LEU C CG    1 
ATOM   2824 C CD1   . LEU C 2 49  ? 32.854  76.876  55.954 1.00 84.21  ? 49  LEU C CD1   1 
ATOM   2825 C CD2   . LEU C 2 49  ? 34.015  75.460  54.271 1.00 84.21  ? 49  LEU C CD2   1 
ATOM   2826 N N     . GLY C 2 50  ? 28.448  75.639  53.093 1.00 200.00 ? 50  GLY C N     1 
ATOM   2827 C CA    . GLY C 2 50  ? 27.563  75.445  51.961 1.00 200.00 ? 50  GLY C CA    1 
ATOM   2828 C C     . GLY C 2 50  ? 27.881  74.143  51.262 1.00 200.00 ? 50  GLY C C     1 
ATOM   2829 O O     . GLY C 2 50  ? 28.772  74.066  50.417 1.00 200.00 ? 50  GLY C O     1 
ATOM   2830 N N     . LYS C 2 51  ? 27.142  73.107  51.626 1.00 137.57 ? 51  LYS C N     1 
ATOM   2831 C CA    . LYS C 2 51  ? 27.343  71.796  51.047 1.00 137.57 ? 51  LYS C CA    1 
ATOM   2832 C C     . LYS C 2 51  ? 26.052  71.340  50.373 1.00 137.57 ? 51  LYS C C     1 
ATOM   2833 O O     . LYS C 2 51  ? 25.986  71.235  49.146 1.00 137.57 ? 51  LYS C O     1 
ATOM   2834 C CB    . LYS C 2 51  ? 27.742  70.816  52.148 1.00 54.61  ? 51  LYS C CB    1 
ATOM   2835 C CG    . LYS C 2 51  ? 29.043  71.150  52.868 1.00 54.61  ? 51  LYS C CG    1 
ATOM   2836 C CD    . LYS C 2 51  ? 30.242  70.921  51.958 1.00 54.61  ? 51  LYS C CD    1 
ATOM   2837 C CE    . LYS C 2 51  ? 31.547  70.887  52.743 1.00 54.61  ? 51  LYS C CE    1 
ATOM   2838 N NZ    . LYS C 2 51  ? 31.564  69.832  53.800 1.00 54.61  ? 51  LYS C NZ    1 
ATOM   2839 N N     . THR C 2 52  ? 25.029  71.077  51.184 1.00 85.80  ? 52  THR C N     1 
ATOM   2840 C CA    . THR C 2 52  ? 23.733  70.638  50.678 1.00 85.80  ? 52  THR C CA    1 
ATOM   2841 C C     . THR C 2 52  ? 23.234  71.564  49.576 1.00 85.80  ? 52  THR C C     1 
ATOM   2842 O O     . THR C 2 52  ? 23.222  71.189  48.404 1.00 85.80  ? 52  THR C O     1 
ATOM   2843 C CB    . THR C 2 52  ? 22.669  70.586  51.810 1.00 109.22 ? 52  THR C CB    1 
ATOM   2844 O OG1   . THR C 2 52  ? 22.945  69.481  52.683 1.00 109.22 ? 52  THR C OG1   1 
ATOM   2845 C CG2   . THR C 2 52  ? 21.265  70.429  51.229 1.00 109.22 ? 52  THR C CG2   1 
ATOM   2846 N N     . THR C 2 53  ? 22.844  72.776  49.959 1.00 126.84 ? 53  THR C N     1 
ATOM   2847 C CA    . THR C 2 53  ? 22.322  73.765  49.024 1.00 126.84 ? 53  THR C CA    1 
ATOM   2848 C C     . THR C 2 53  ? 23.106  73.877  47.714 1.00 126.84 ? 53  THR C C     1 
ATOM   2849 O O     . THR C 2 53  ? 22.589  74.385  46.721 1.00 126.84 ? 53  THR C O     1 
ATOM   2850 C CB    . THR C 2 53  ? 22.254  75.149  49.683 1.00 171.72 ? 53  THR C CB    1 
ATOM   2851 O OG1   . THR C 2 53  ? 21.738  75.016  51.014 1.00 171.72 ? 53  THR C OG1   1 
ATOM   2852 C CG2   . THR C 2 53  ? 21.331  76.058  48.895 1.00 171.72 ? 53  THR C CG2   1 
ATOM   2853 N N     . LEU C 2 54  ? 24.351  73.409  47.712 1.00 159.68 ? 54  LEU C N     1 
ATOM   2854 C CA    . LEU C 2 54  ? 25.172  73.450  46.504 1.00 159.68 ? 54  LEU C CA    1 
ATOM   2855 C C     . LEU C 2 54  ? 24.579  72.528  45.445 1.00 159.68 ? 54  LEU C C     1 
ATOM   2856 O O     . LEU C 2 54  ? 24.097  72.988  44.408 1.00 159.68 ? 54  LEU C O     1 
ATOM   2857 C CB    . LEU C 2 54  ? 26.607  73.010  46.813 1.00 72.08  ? 54  LEU C CB    1 
ATOM   2858 C CG    . LEU C 2 54  ? 27.530  72.757  45.609 1.00 72.08  ? 54  LEU C CG    1 
ATOM   2859 C CD1   . LEU C 2 54  ? 27.666  74.025  44.756 1.00 72.08  ? 54  LEU C CD1   1 
ATOM   2860 C CD2   . LEU C 2 54  ? 28.896  72.282  46.108 1.00 72.08  ? 54  LEU C CD2   1 
ATOM   2861 N N     . ALA C 2 55  ? 24.620  71.224  45.716 1.00 179.08 ? 55  ALA C N     1 
ATOM   2862 C CA    . ALA C 2 55  ? 24.089  70.219  44.799 1.00 179.08 ? 55  ALA C CA    1 
ATOM   2863 C C     . ALA C 2 55  ? 22.569  70.182  44.863 1.00 179.08 ? 55  ALA C C     1 
ATOM   2864 O O     . ALA C 2 55  ? 21.906  69.839  43.883 1.00 179.08 ? 55  ALA C O     1 
ATOM   2865 C CB    . ALA C 2 55  ? 24.665  68.851  45.124 1.00 79.38  ? 55  ALA C CB    1 
ATOM   2866 N N     . HIS C 2 56  ? 22.031  70.533  46.028 1.00 82.33  ? 56  HIS C N     1 
ATOM   2867 C CA    . HIS C 2 56  ? 20.589  70.591  46.247 1.00 82.33  ? 56  HIS C CA    1 
ATOM   2868 C C     . HIS C 2 56  ? 20.099  71.419  45.067 1.00 82.33  ? 56  HIS C C     1 
ATOM   2869 O O     . HIS C 2 56  ? 18.968  71.279  44.597 1.00 82.33  ? 56  HIS C O     1 
ATOM   2870 C CB    . HIS C 2 56  ? 20.306  71.317  47.569 1.00 138.79 ? 56  HIS C CB    1 
ATOM   2871 C CG    . HIS C 2 56  ? 18.945  71.059  48.138 1.00 138.79 ? 56  HIS C CG    1 
ATOM   2872 N ND1   . HIS C 2 56  ? 17.782  71.344  47.455 1.00 138.79 ? 56  HIS C ND1   1 
ATOM   2873 C CD2   . HIS C 2 56  ? 18.564  70.570  49.342 1.00 138.79 ? 56  HIS C CD2   1 
ATOM   2874 C CE1   . HIS C 2 56  ? 16.743  71.043  48.214 1.00 138.79 ? 56  HIS C CE1   1 
ATOM   2875 N NE2   . HIS C 2 56  ? 17.190  70.572  49.365 1.00 138.79 ? 56  HIS C NE2   1 
ATOM   2876 N N     . VAL C 2 57  ? 20.997  72.279  44.597 1.00 186.54 ? 57  VAL C N     1 
ATOM   2877 C CA    . VAL C 2 57  ? 20.754  73.158  43.467 1.00 186.54 ? 57  VAL C CA    1 
ATOM   2878 C C     . VAL C 2 57  ? 21.377  72.562  42.212 1.00 186.54 ? 57  VAL C C     1 
ATOM   2879 O O     . VAL C 2 57  ? 20.794  72.637  41.132 1.00 186.54 ? 57  VAL C O     1 
ATOM   2880 C CB    . VAL C 2 57  ? 21.373  74.545  43.704 1.00 154.29 ? 57  VAL C CB    1 
ATOM   2881 C CG1   . VAL C 2 57  ? 21.307  75.361  42.434 1.00 154.29 ? 57  VAL C CG1   1 
ATOM   2882 C CG2   . VAL C 2 57  ? 20.639  75.255  44.826 1.00 154.29 ? 57  VAL C CG2   1 
ATOM   2883 N N     . ILE C 2 58  ? 22.565  71.981  42.354 1.00 122.54 ? 58  ILE C N     1 
ATOM   2884 C CA    . ILE C 2 58  ? 23.244  71.376  41.216 1.00 122.54 ? 58  ILE C CA    1 
ATOM   2885 C C     . ILE C 2 58  ? 22.236  70.541  40.421 1.00 122.54 ? 58  ILE C C     1 
ATOM   2886 O O     . ILE C 2 58  ? 22.164  70.638  39.192 1.00 122.54 ? 58  ILE C O     1 
ATOM   2887 C CB    . ILE C 2 58  ? 24.425  70.469  41.668 1.00 77.72  ? 58  ILE C CB    1 
ATOM   2888 C CG1   . ILE C 2 58  ? 25.540  71.309  42.286 1.00 77.72  ? 58  ILE C CG1   1 
ATOM   2889 C CG2   . ILE C 2 58  ? 25.025  69.747  40.475 1.00 77.72  ? 58  ILE C CG2   1 
ATOM   2890 C CD1   . ILE C 2 58  ? 26.764  70.489  42.662 1.00 77.72  ? 58  ILE C CD1   1 
ATOM   2891 N N     . ALA C 2 59  ? 21.445  69.746  41.139 1.00 112.17 ? 59  ALA C N     1 
ATOM   2892 C CA    . ALA C 2 59  ? 20.428  68.887  40.532 1.00 112.17 ? 59  ALA C CA    1 
ATOM   2893 C C     . ALA C 2 59  ? 19.664  69.550  39.394 1.00 112.17 ? 59  ALA C C     1 
ATOM   2894 O O     . ALA C 2 59  ? 19.774  69.133  38.247 1.00 112.17 ? 59  ALA C O     1 
ATOM   2895 C CB    . ALA C 2 59  ? 19.435  68.418  41.595 1.00 62.27  ? 59  ALA C CB    1 
ATOM   2896 N N     . HIS C 2 60  ? 18.889  70.582  39.722 1.00 147.46 ? 60  HIS C N     1 
ATOM   2897 C CA    . HIS C 2 60  ? 18.077  71.288  38.735 1.00 147.46 ? 60  HIS C CA    1 
ATOM   2898 C C     . HIS C 2 60  ? 18.840  71.706  37.480 1.00 147.46 ? 60  HIS C C     1 
ATOM   2899 O O     . HIS C 2 60  ? 18.284  71.686  36.382 1.00 147.46 ? 60  HIS C O     1 
ATOM   2900 C CB    . HIS C 2 60  ? 17.408  72.503  39.377 1.00 159.08 ? 60  HIS C CB    1 
ATOM   2901 C CG    . HIS C 2 60  ? 16.247  73.035  38.594 1.00 159.08 ? 60  HIS C CG    1 
ATOM   2902 N ND1   . HIS C 2 60  ? 15.274  73.833  39.158 1.00 159.08 ? 60  HIS C ND1   1 
ATOM   2903 C CD2   . HIS C 2 60  ? 15.903  72.886  37.293 1.00 159.08 ? 60  HIS C CD2   1 
ATOM   2904 C CE1   . HIS C 2 60  ? 14.380  74.150  38.238 1.00 159.08 ? 60  HIS C CE1   1 
ATOM   2905 N NE2   . HIS C 2 60  ? 14.738  73.588  37.098 1.00 159.08 ? 60  HIS C NE2   1 
ATOM   2906 N N     . GLU C 2 61  ? 20.102  72.095  37.629 1.00 150.87 ? 61  GLU C N     1 
ATOM   2907 C CA    . GLU C 2 61  ? 20.893  72.467  36.462 1.00 150.87 ? 61  GLU C CA    1 
ATOM   2908 C C     . GLU C 2 61  ? 21.565  71.206  35.949 1.00 150.87 ? 61  GLU C C     1 
ATOM   2909 O O     . GLU C 2 61  ? 22.722  71.222  35.533 1.00 150.87 ? 61  GLU C O     1 
ATOM   2910 C CB    . GLU C 2 61  ? 21.941  73.525  36.815 1.00 116.05 ? 61  GLU C CB    1 
ATOM   2911 C CG    . GLU C 2 61  ? 21.337  74.879  37.165 1.00 116.05 ? 61  GLU C CG    1 
ATOM   2912 C CD    . GLU C 2 61  ? 20.495  75.472  36.039 1.00 116.05 ? 61  GLU C CD    1 
ATOM   2913 O OE1   . GLU C 2 61  ? 21.074  75.967  35.043 1.00 116.05 ? 61  GLU C OE1   1 
ATOM   2914 O OE2   . GLU C 2 61  ? 19.248  75.437  36.153 1.00 116.05 ? 61  GLU C OE2   1 
ATOM   2915 N N     . LEU C 2 62  ? 20.811  70.112  36.000 1.00 200.00 ? 62  LEU C N     1 
ATOM   2916 C CA    . LEU C 2 62  ? 21.262  68.801  35.549 1.00 200.00 ? 62  LEU C CA    1 
ATOM   2917 C C     . LEU C 2 62  ? 20.050  68.032  35.019 1.00 200.00 ? 62  LEU C C     1 
ATOM   2918 O O     . LEU C 2 62  ? 20.151  67.292  34.042 1.00 200.00 ? 62  LEU C O     1 
ATOM   2919 C CB    . LEU C 2 62  ? 21.888  68.024  36.705 1.00 113.46 ? 62  LEU C CB    1 
ATOM   2920 C CG    . LEU C 2 62  ? 22.969  68.704  37.543 1.00 113.46 ? 62  LEU C CG    1 
ATOM   2921 C CD1   . LEU C 2 62  ? 23.390  67.751  38.649 1.00 113.46 ? 62  LEU C CD1   1 
ATOM   2922 C CD2   . LEU C 2 62  ? 24.156  69.092  36.682 1.00 113.46 ? 62  LEU C CD2   1 
ATOM   2923 N N     . GLY C 2 63  ? 18.908  68.204  35.683 1.00 199.94 ? 63  GLY C N     1 
ATOM   2924 C CA    . GLY C 2 63  ? 17.689  67.542  35.250 1.00 199.94 ? 63  GLY C CA    1 
ATOM   2925 C C     . GLY C 2 63  ? 17.185  66.388  36.098 1.00 199.94 ? 63  GLY C C     1 
ATOM   2926 O O     . GLY C 2 63  ? 16.402  65.572  35.614 1.00 199.94 ? 63  GLY C O     1 
ATOM   2927 N N     . VAL C 2 64  ? 17.612  66.313  37.357 1.00 200.00 ? 64  VAL C N     1 
ATOM   2928 C CA    . VAL C 2 64  ? 17.183  65.231  38.244 1.00 200.00 ? 64  VAL C CA    1 
ATOM   2929 C C     . VAL C 2 64  ? 17.018  65.652  39.697 1.00 200.00 ? 64  VAL C C     1 
ATOM   2930 O O     . VAL C 2 64  ? 17.756  66.503  40.192 1.00 200.00 ? 64  VAL C O     1 
ATOM   2931 C CB    . VAL C 2 64  ? 18.174  64.063  38.214 1.00 97.20  ? 64  VAL C CB    1 
ATOM   2932 C CG1   . VAL C 2 64  ? 17.929  63.210  36.990 1.00 97.20  ? 64  VAL C CG1   1 
ATOM   2933 C CG2   . VAL C 2 64  ? 19.594  64.598  38.213 1.00 97.20  ? 64  VAL C CG2   1 
ATOM   2934 N N     . ASN C 2 65  ? 16.056  65.037  40.381 1.00 99.84  ? 65  ASN C N     1 
ATOM   2935 C CA    . ASN C 2 65  ? 15.806  65.356  41.783 1.00 99.84  ? 65  ASN C CA    1 
ATOM   2936 C C     . ASN C 2 65  ? 17.042  65.028  42.608 1.00 99.84  ? 65  ASN C C     1 
ATOM   2937 O O     . ASN C 2 65  ? 18.080  64.632  42.076 1.00 99.84  ? 65  ASN C O     1 
ATOM   2938 C CB    . ASN C 2 65  ? 14.619  64.558  42.337 1.00 126.50 ? 65  ASN C CB    1 
ATOM   2939 C CG    . ASN C 2 65  ? 13.401  64.611  41.437 1.00 126.50 ? 65  ASN C CG    1 
ATOM   2940 O OD1   . ASN C 2 65  ? 13.067  65.658  40.881 1.00 126.50 ? 65  ASN C OD1   1 
ATOM   2941 N ND2   . ASN C 2 65  ? 12.718  63.477  41.303 1.00 126.50 ? 65  ASN C ND2   1 
ATOM   2942 N N     . LEU C 2 66  ? 16.920  65.187  43.917 1.00 100.19 ? 66  LEU C N     1 
ATOM   2943 C CA    . LEU C 2 66  ? 18.033  64.902  44.798 1.00 100.19 ? 66  LEU C CA    1 
ATOM   2944 C C     . LEU C 2 66  ? 17.591  64.243  46.086 1.00 100.19 ? 66  LEU C C     1 
ATOM   2945 O O     . LEU C 2 66  ? 16.624  64.668  46.730 1.00 100.19 ? 66  LEU C O     1 
ATOM   2946 C CB    . LEU C 2 66  ? 18.807  66.187  45.124 1.00 125.28 ? 66  LEU C CB    1 
ATOM   2947 C CG    . LEU C 2 66  ? 19.787  66.136  46.306 1.00 125.28 ? 66  LEU C CG    1 
ATOM   2948 C CD1   . LEU C 2 66  ? 20.798  65.026  46.102 1.00 125.28 ? 66  LEU C CD1   1 
ATOM   2949 C CD2   . LEU C 2 66  ? 20.490  67.467  46.451 1.00 125.28 ? 66  LEU C CD2   1 
ATOM   2950 N N     . ARG C 2 67  ? 18.311  63.185  46.437 1.00 102.20 ? 67  ARG C N     1 
ATOM   2951 C CA    . ARG C 2 67  ? 18.068  62.455  47.663 1.00 102.20 ? 67  ARG C CA    1 
ATOM   2952 C C     . ARG C 2 67  ? 19.332  62.654  48.493 1.00 102.20 ? 67  ARG C C     1 
ATOM   2953 O O     . ARG C 2 67  ? 20.446  62.422  48.016 1.00 102.20 ? 67  ARG C O     1 
ATOM   2954 C CB    . ARG C 2 67  ? 17.840  60.968  47.384 1.00 122.69 ? 67  ARG C CB    1 
ATOM   2955 C CG    . ARG C 2 67  ? 17.409  60.193  48.622 1.00 122.69 ? 67  ARG C CG    1 
ATOM   2956 C CD    . ARG C 2 67  ? 16.017  59.578  48.476 1.00 122.69 ? 67  ARG C CD    1 
ATOM   2957 N NE    . ARG C 2 67  ? 15.027  60.523  47.964 1.00 122.69 ? 67  ARG C NE    1 
ATOM   2958 C CZ    . ARG C 2 67  ? 13.720  60.281  47.911 1.00 122.69 ? 67  ARG C CZ    1 
ATOM   2959 N NH1   . ARG C 2 67  ? 13.242  59.121  48.345 1.00 122.69 ? 67  ARG C NH1   1 
ATOM   2960 N NH2   . ARG C 2 67  ? 12.891  61.192  47.414 1.00 122.69 ? 67  ARG C NH2   1 
ATOM   2961 N N     . VAL C 2 68  ? 19.151  63.112  49.727 1.00 101.74 ? 68  VAL C N     1 
ATOM   2962 C CA    . VAL C 2 68  ? 20.270  63.365  50.621 1.00 101.74 ? 68  VAL C CA    1 
ATOM   2963 C C     . VAL C 2 68  ? 20.063  62.668  51.952 1.00 101.74 ? 68  VAL C C     1 
ATOM   2964 O O     . VAL C 2 68  ? 18.979  62.721  52.539 1.00 101.74 ? 68  VAL C O     1 
ATOM   2965 C CB    . VAL C 2 68  ? 20.440  64.874  50.887 1.00 167.79 ? 68  VAL C CB    1 
ATOM   2966 C CG1   . VAL C 2 68  ? 20.611  65.616  49.575 1.00 167.79 ? 68  VAL C CG1   1 
ATOM   2967 C CG2   . VAL C 2 68  ? 19.231  65.412  51.642 1.00 167.79 ? 68  VAL C CG2   1 
ATOM   2968 N N     . THR C 2 69  ? 21.108  62.005  52.423 1.00 82.74  ? 69  THR C N     1 
ATOM   2969 C CA    . THR C 2 69  ? 21.034  61.314  53.693 1.00 82.74  ? 69  THR C CA    1 
ATOM   2970 C C     . THR C 2 69  ? 22.358  61.397  54.430 1.00 82.74  ? 69  THR C C     1 
ATOM   2971 O O     . THR C 2 69  ? 23.434  61.264  53.841 1.00 82.74  ? 69  THR C O     1 
ATOM   2972 C CB    . THR C 2 69  ? 20.642  59.825  53.521 1.00 84.81  ? 69  THR C CB    1 
ATOM   2973 O OG1   . THR C 2 69  ? 19.341  59.739  52.932 1.00 84.81  ? 69  THR C OG1   1 
ATOM   2974 C CG2   . THR C 2 69  ? 20.600  59.123  54.871 1.00 84.81  ? 69  THR C CG2   1 
ATOM   2975 N N     . SER C 2 70  ? 22.252  61.635  55.731 1.00 69.42  ? 70  SER C N     1 
ATOM   2976 C CA    . SER C 2 70  ? 23.403  61.733  56.602 1.00 69.42  ? 70  SER C CA    1 
ATOM   2977 C C     . SER C 2 70  ? 24.052  60.361  56.694 1.00 69.42  ? 70  SER C C     1 
ATOM   2978 O O     . SER C 2 70  ? 23.392  59.337  56.539 1.00 69.42  ? 70  SER C O     1 
ATOM   2979 C CB    . SER C 2 70  ? 22.957  62.182  57.995 1.00 138.91 ? 70  SER C CB    1 
ATOM   2980 O OG    . SER C 2 70  ? 22.099  63.309  57.915 1.00 138.91 ? 70  SER C OG    1 
ATOM   2981 N N     . GLY C 2 71  ? 25.353  60.356  56.940 1.00 63.12  ? 71  GLY C N     1 
ATOM   2982 C CA    . GLY C 2 71  ? 26.081  59.114  57.078 1.00 63.12  ? 71  GLY C CA    1 
ATOM   2983 C C     . GLY C 2 71  ? 25.559  58.293  58.241 1.00 63.12  ? 71  GLY C C     1 
ATOM   2984 O O     . GLY C 2 71  ? 24.710  57.431  58.034 1.00 63.12  ? 71  GLY C O     1 
ATOM   2985 N N     . PRO C 2 72  ? 26.023  58.540  59.478 1.00 80.53  ? 72  PRO C N     1 
ATOM   2986 C CA    . PRO C 2 72  ? 25.586  57.801  60.667 1.00 80.53  ? 72  PRO C CA    1 
ATOM   2987 C C     . PRO C 2 72  ? 24.106  57.391  60.696 1.00 80.53  ? 72  PRO C C     1 
ATOM   2988 O O     . PRO C 2 72  ? 23.720  56.497  61.463 1.00 80.53  ? 72  PRO C O     1 
ATOM   2989 C CB    . PRO C 2 72  ? 25.957  58.746  61.800 1.00 200.00 ? 72  PRO C CB    1 
ATOM   2990 C CG    . PRO C 2 72  ? 27.243  59.319  61.310 1.00 200.00 ? 72  PRO C CG    1 
ATOM   2991 C CD    . PRO C 2 72  ? 26.930  59.638  59.858 1.00 200.00 ? 72  PRO C CD    1 
ATOM   2992 N N     . ALA C 2 73  ? 23.287  58.044  59.868 1.00 72.71  ? 73  ALA C N     1 
ATOM   2993 C CA    . ALA C 2 73  ? 21.856  57.745  59.780 1.00 72.71  ? 73  ALA C CA    1 
ATOM   2994 C C     . ALA C 2 73  ? 21.633  56.454  58.991 1.00 72.71  ? 73  ALA C C     1 
ATOM   2995 O O     . ALA C 2 73  ? 20.646  56.304  58.269 1.00 72.71  ? 73  ALA C O     1 
ATOM   2996 C CB    . ALA C 2 73  ? 21.124  58.901  59.104 1.00 129.26 ? 73  ALA C CB    1 
ATOM   2997 N N     . ILE C 2 74  ? 22.557  55.517  59.144 1.00 112.45 ? 74  ILE C N     1 
ATOM   2998 C CA    . ILE C 2 74  ? 22.473  54.253  58.441 1.00 112.45 ? 74  ILE C CA    1 
ATOM   2999 C C     . ILE C 2 74  ? 22.705  53.051  59.352 1.00 112.45 ? 74  ILE C C     1 
ATOM   3000 O O     . ILE C 2 74  ? 23.847  52.699  59.660 1.00 112.45 ? 74  ILE C O     1 
ATOM   3001 C CB    . ILE C 2 74  ? 23.488  54.223  57.284 1.00 71.20  ? 74  ILE C CB    1 
ATOM   3002 C CG1   . ILE C 2 74  ? 22.989  55.109  56.138 1.00 71.20  ? 74  ILE C CG1   1 
ATOM   3003 C CG2   . ILE C 2 74  ? 23.713  52.793  56.814 1.00 71.20  ? 74  ILE C CG2   1 
ATOM   3004 C CD1   . ILE C 2 74  ? 23.911  55.134  54.918 1.00 71.20  ? 74  ILE C CD1   1 
ATOM   3005 N N     . GLU C 2 75  ? 21.611  52.433  59.785 1.00 154.63 ? 75  GLU C N     1 
ATOM   3006 C CA    . GLU C 2 75  ? 21.682  51.252  60.636 1.00 154.63 ? 75  GLU C CA    1 
ATOM   3007 C C     . GLU C 2 75  ? 21.697  50.031  59.724 1.00 154.63 ? 75  GLU C C     1 
ATOM   3008 O O     . GLU C 2 75  ? 22.745  49.423  59.494 1.00 154.63 ? 75  GLU C O     1 
ATOM   3009 C CB    . GLU C 2 75  ? 20.465  51.172  61.564 1.00 137.74 ? 75  GLU C CB    1 
ATOM   3010 C CG    . GLU C 2 75  ? 20.387  49.855  62.340 1.00 137.74 ? 75  GLU C CG    1 
ATOM   3011 C CD    . GLU C 2 75  ? 19.035  49.621  62.985 1.00 137.74 ? 75  GLU C CD    1 
ATOM   3012 O OE1   . GLU C 2 75  ? 18.015  49.688  62.267 1.00 137.74 ? 75  GLU C OE1   1 
ATOM   3013 O OE2   . GLU C 2 75  ? 18.991  49.362  64.206 1.00 137.74 ? 75  GLU C OE2   1 
ATOM   3014 N N     . LYS C 2 76  ? 20.521  49.685  59.205 1.00 199.72 ? 76  LYS C N     1 
ATOM   3015 C CA    . LYS C 2 76  ? 20.382  48.544  58.312 1.00 199.72 ? 76  LYS C CA    1 
ATOM   3016 C C     . LYS C 2 76  ? 21.388  48.691  57.173 1.00 199.72 ? 76  LYS C C     1 
ATOM   3017 O O     . LYS C 2 76  ? 21.292  49.615  56.363 1.00 199.72 ? 76  LYS C O     1 
ATOM   3018 C CB    . LYS C 2 76  ? 18.953  48.469  57.742 1.00 78.33  ? 76  LYS C CB    1 
ATOM   3019 C CG    . LYS C 2 76  ? 17.839  48.434  58.784 1.00 78.33  ? 76  LYS C CG    1 
ATOM   3020 C CD    . LYS C 2 76  ? 16.481  48.265  58.112 1.00 78.33  ? 76  LYS C CD    1 
ATOM   3021 C CE    . LYS C 2 76  ? 15.293  48.351  59.092 1.00 78.33  ? 76  LYS C CE    1 
ATOM   3022 N NZ    . LYS C 2 76  ? 15.251  47.264  60.127 1.00 78.33  ? 76  LYS C NZ    1 
ATOM   3023 N N     . PRO C 2 77  ? 22.383  47.789  57.111 1.00 126.52 ? 77  PRO C N     1 
ATOM   3024 C CA    . PRO C 2 77  ? 23.410  47.819  56.066 1.00 126.52 ? 77  PRO C CA    1 
ATOM   3025 C C     . PRO C 2 77  ? 22.797  47.898  54.674 1.00 126.52 ? 77  PRO C C     1 
ATOM   3026 O O     . PRO C 2 77  ? 23.508  48.048  53.684 1.00 126.52 ? 77  PRO C O     1 
ATOM   3027 C CB    . PRO C 2 77  ? 24.161  46.511  56.290 1.00 188.97 ? 77  PRO C CB    1 
ATOM   3028 C CG    . PRO C 2 77  ? 24.087  46.347  57.769 1.00 188.97 ? 77  PRO C CG    1 
ATOM   3029 C CD    . PRO C 2 77  ? 22.642  46.692  58.060 1.00 188.97 ? 77  PRO C CD    1 
ATOM   3030 N N     . GLY C 2 78  ? 21.474  47.790  54.609 1.00 123.43 ? 78  GLY C N     1 
ATOM   3031 C CA    . GLY C 2 78  ? 20.780  47.852  53.337 1.00 123.43 ? 78  GLY C CA    1 
ATOM   3032 C C     . GLY C 2 78  ? 19.866  49.055  53.249 1.00 123.43 ? 78  GLY C C     1 
ATOM   3033 O O     . GLY C 2 78  ? 18.948  49.103  52.431 1.00 123.43 ? 78  GLY C O     1 
ATOM   3034 N N     . ASP C 2 79  ? 20.115  50.030  54.110 1.00 96.15  ? 79  ASP C N     1 
ATOM   3035 C CA    . ASP C 2 79  ? 19.318  51.241  54.116 1.00 96.15  ? 79  ASP C CA    1 
ATOM   3036 C C     . ASP C 2 79  ? 19.690  52.094  52.910 1.00 96.15  ? 79  ASP C C     1 
ATOM   3037 O O     . ASP C 2 79  ? 18.836  52.776  52.346 1.00 96.15  ? 79  ASP C O     1 
ATOM   3038 C CB    . ASP C 2 79  ? 19.545  52.008  55.420 1.00 91.91  ? 79  ASP C CB    1 
ATOM   3039 C CG    . ASP C 2 79  ? 18.587  51.582  56.518 1.00 91.91  ? 79  ASP C CG    1 
ATOM   3040 O OD1   . ASP C 2 79  ? 19.017  51.453  57.681 1.00 91.91  ? 79  ASP C OD1   1 
ATOM   3041 O OD2   . ASP C 2 79  ? 17.393  51.387  56.219 1.00 91.91  ? 79  ASP C OD2   1 
ATOM   3042 N N     . LEU C 2 80  ? 20.964  52.043  52.517 1.00 84.50  ? 80  LEU C N     1 
ATOM   3043 C CA    . LEU C 2 80  ? 21.447  52.800  51.361 1.00 84.50  ? 80  LEU C CA    1 
ATOM   3044 C C     . LEU C 2 80  ? 20.993  52.071  50.118 1.00 84.50  ? 80  LEU C C     1 
ATOM   3045 O O     . LEU C 2 80  ? 20.595  52.690  49.129 1.00 84.50  ? 80  LEU C O     1 
ATOM   3046 C CB    . LEU C 2 80  ? 22.974  52.893  51.350 1.00 88.09  ? 80  LEU C CB    1 
ATOM   3047 C CG    . LEU C 2 80  ? 23.760  51.582  51.309 1.00 88.09  ? 80  LEU C CG    1 
ATOM   3048 C CD1   . LEU C 2 80  ? 25.206  51.854  50.929 1.00 88.09  ? 80  LEU C CD1   1 
ATOM   3049 C CD2   . LEU C 2 80  ? 23.677  50.901  52.671 1.00 88.09  ? 80  LEU C CD2   1 
ATOM   3050 N N     . ALA C 2 81  ? 21.069  50.745  50.179 1.00 116.55 ? 81  ALA C N     1 
ATOM   3051 C CA    . ALA C 2 81  ? 20.636  49.905  49.077 1.00 116.55 ? 81  ALA C CA    1 
ATOM   3052 C C     . ALA C 2 81  ? 19.252  50.414  48.720 1.00 116.55 ? 81  ALA C C     1 
ATOM   3053 O O     . ALA C 2 81  ? 18.953  50.681  47.561 1.00 116.55 ? 81  ALA C O     1 
ATOM   3054 C CB    . ALA C 2 81  ? 20.562  48.465  49.525 1.00 84.85  ? 81  ALA C CB    1 
ATOM   3055 N N     . ALA C 2 82  ? 18.419  50.557  49.744 1.00 70.78  ? 82  ALA C N     1 
ATOM   3056 C CA    . ALA C 2 82  ? 17.061  51.058  49.581 1.00 70.78  ? 82  ALA C CA    1 
ATOM   3057 C C     . ALA C 2 82  ? 17.114  52.481  49.052 1.00 70.78  ? 82  ALA C C     1 
ATOM   3058 O O     . ALA C 2 82  ? 16.237  52.913  48.309 1.00 70.78  ? 82  ALA C O     1 
ATOM   3059 C CB    . ALA C 2 82  ? 16.323  51.025  50.924 1.00 66.02  ? 82  ALA C CB    1 
ATOM   3060 N N     . ILE C 2 83  ? 18.143  53.214  49.454 1.00 129.55 ? 83  ILE C N     1 
ATOM   3061 C CA    . ILE C 2 83  ? 18.303  54.587  49.015 1.00 129.55 ? 83  ILE C CA    1 
ATOM   3062 C C     . ILE C 2 83  ? 18.797  54.578  47.576 1.00 129.55 ? 83  ILE C C     1 
ATOM   3063 O O     . ILE C 2 83  ? 18.852  55.615  46.917 1.00 129.55 ? 83  ILE C O     1 
ATOM   3064 C CB    . ILE C 2 83  ? 19.312  55.327  49.907 1.00 96.63  ? 83  ILE C CB    1 
ATOM   3065 C CG1   . ILE C 2 83  ? 18.854  55.259  51.364 1.00 96.63  ? 83  ILE C CG1   1 
ATOM   3066 C CG2   . ILE C 2 83  ? 19.416  56.776  49.485 1.00 96.63  ? 83  ILE C CG2   1 
ATOM   3067 C CD1   . ILE C 2 83  ? 19.860  55.820  52.357 1.00 96.63  ? 83  ILE C CD1   1 
ATOM   3068 N N     . LEU C 2 84  ? 19.139  53.391  47.089 1.00 99.03  ? 84  LEU C N     1 
ATOM   3069 C CA    . LEU C 2 84  ? 19.634  53.232  45.726 1.00 99.03  ? 84  LEU C CA    1 
ATOM   3070 C C     . LEU C 2 84  ? 18.624  52.445  44.877 1.00 99.03  ? 84  LEU C C     1 
ATOM   3071 O O     . LEU C 2 84  ? 18.371  52.764  43.711 1.00 99.03  ? 84  LEU C O     1 
ATOM   3072 C CB    . LEU C 2 84  ? 20.973  52.483  45.751 1.00 65.94  ? 84  LEU C CB    1 
ATOM   3073 C CG    . LEU C 2 84  ? 22.096  52.988  46.670 1.00 65.94  ? 84  LEU C CG    1 
ATOM   3074 C CD1   . LEU C 2 84  ? 22.879  51.799  47.202 1.00 65.94  ? 84  LEU C CD1   1 
ATOM   3075 C CD2   . LEU C 2 84  ? 23.014  53.942  45.928 1.00 65.94  ? 84  LEU C CD2   1 
ATOM   3076 N N     . ALA C 2 85  ? 18.042  51.420  45.486 1.00 92.81  ? 85  ALA C N     1 
ATOM   3077 C CA    . ALA C 2 85  ? 17.086  50.547  44.820 1.00 92.81  ? 85  ALA C CA    1 
ATOM   3078 C C     . ALA C 2 85  ? 15.695  51.147  44.593 1.00 92.81  ? 85  ALA C C     1 
ATOM   3079 O O     . ALA C 2 85  ? 14.815  51.080  45.459 1.00 92.81  ? 85  ALA C O     1 
ATOM   3080 C CB    . ALA C 2 85  ? 16.977  49.233  45.600 1.00 89.31  ? 85  ALA C CB    1 
ATOM   3081 N N     . ASN C 2 86  ? 15.504  51.710  43.405 1.00 179.45 ? 86  ASN C N     1 
ATOM   3082 C CA    . ASN C 2 86  ? 14.236  52.314  43.008 1.00 179.45 ? 86  ASN C CA    1 
ATOM   3083 C C     . ASN C 2 86  ? 13.790  53.452  43.921 1.00 179.45 ? 86  ASN C C     1 
ATOM   3084 O O     . ASN C 2 86  ? 13.254  53.236  45.011 1.00 179.45 ? 86  ASN C O     1 
ATOM   3085 C CB    . ASN C 2 86  ? 13.135  51.249  42.930 1.00 146.03 ? 86  ASN C CB    1 
ATOM   3086 C CG    . ASN C 2 86  ? 11.922  51.720  42.141 1.00 146.03 ? 86  ASN C CG    1 
ATOM   3087 O OD1   . ASN C 2 86  ? 10.947  50.985  41.983 1.00 146.03 ? 86  ASN C OD1   1 
ATOM   3088 N ND2   . ASN C 2 86  ? 11.980  52.949  41.638 1.00 146.03 ? 86  ASN C ND2   1 
ATOM   3089 N N     . SER C 2 87  ? 14.021  54.668  43.443 1.00 200.00 ? 87  SER C N     1 
ATOM   3090 C CA    . SER C 2 87  ? 13.669  55.895  44.143 1.00 200.00 ? 87  SER C CA    1 
ATOM   3091 C C     . SER C 2 87  ? 14.248  57.029  43.305 1.00 200.00 ? 87  SER C C     1 
ATOM   3092 O O     . SER C 2 87  ? 14.000  58.206  43.567 1.00 200.00 ? 87  SER C O     1 
ATOM   3093 C CB    . SER C 2 87  ? 14.275  55.915  45.552 1.00 144.69 ? 87  SER C CB    1 
ATOM   3094 O OG    . SER C 2 87  ? 15.690  55.978  45.509 1.00 144.69 ? 87  SER C OG    1 
ATOM   3095 N N     . LEU C 2 88  ? 15.019  56.653  42.285 1.00 123.65 ? 88  LEU C N     1 
ATOM   3096 C CA    . LEU C 2 88  ? 15.649  57.613  41.386 1.00 123.65 ? 88  LEU C CA    1 
ATOM   3097 C C     . LEU C 2 88  ? 14.958  57.656  40.019 1.00 123.65 ? 88  LEU C C     1 
ATOM   3098 O O     . LEU C 2 88  ? 13.852  57.138  39.855 1.00 123.65 ? 88  LEU C O     1 
ATOM   3099 C CB    . LEU C 2 88  ? 17.137  57.276  41.205 1.00 109.87 ? 88  LEU C CB    1 
ATOM   3100 C CG    . LEU C 2 88  ? 18.000  57.194  42.472 1.00 109.87 ? 88  LEU C CG    1 
ATOM   3101 C CD1   . LEU C 2 88  ? 19.468  57.239  42.074 1.00 109.87 ? 88  LEU C CD1   1 
ATOM   3102 C CD2   . LEU C 2 88  ? 17.681  58.349  43.420 1.00 109.87 ? 88  LEU C CD2   1 
ATOM   3103 N N     . GLU C 2 89  ? 15.616  58.290  39.050 1.00 200.00 ? 89  GLU C N     1 
ATOM   3104 C CA    . GLU C 2 89  ? 15.085  58.413  37.693 1.00 200.00 ? 89  GLU C CA    1 
ATOM   3105 C C     . GLU C 2 89  ? 16.212  58.557  36.667 1.00 200.00 ? 89  GLU C C     1 
ATOM   3106 O O     . GLU C 2 89  ? 16.140  59.392  35.763 1.00 200.00 ? 89  GLU C O     1 
ATOM   3107 C CB    . GLU C 2 89  ? 14.140  59.620  37.595 1.00 200.00 ? 89  GLU C CB    1 
ATOM   3108 C CG    . GLU C 2 89  ? 12.881  59.521  38.456 1.00 200.00 ? 89  GLU C CG    1 
ATOM   3109 C CD    . GLU C 2 89  ? 11.946  58.399  38.025 1.00 200.00 ? 89  GLU C CD    1 
ATOM   3110 O OE1   . GLU C 2 89  ? 10.927  58.176  38.712 1.00 200.00 ? 89  GLU C OE1   1 
ATOM   3111 O OE2   . GLU C 2 89  ? 12.226  57.744  37.000 1.00 200.00 ? 89  GLU C OE2   1 
ATOM   3112 N N     . GLU C 2 90  ? 17.250  57.738  36.824 1.00 194.61 ? 90  GLU C N     1 
ATOM   3113 C CA    . GLU C 2 90  ? 18.402  57.733  35.924 1.00 194.61 ? 90  GLU C CA    1 
ATOM   3114 C C     . GLU C 2 90  ? 19.167  59.052  35.910 1.00 194.61 ? 90  GLU C C     1 
ATOM   3115 O O     . GLU C 2 90  ? 19.541  59.550  34.847 1.00 194.61 ? 90  GLU C O     1 
ATOM   3116 C CB    . GLU C 2 90  ? 17.958  57.395  34.497 1.00 142.76 ? 90  GLU C CB    1 
ATOM   3117 C CG    . GLU C 2 90  ? 17.038  56.192  34.397 1.00 142.76 ? 90  GLU C CG    1 
ATOM   3118 C CD    . GLU C 2 90  ? 17.530  55.019  35.214 1.00 142.76 ? 90  GLU C CD    1 
ATOM   3119 O OE1   . GLU C 2 90  ? 18.721  54.665  35.085 1.00 142.76 ? 90  GLU C OE1   1 
ATOM   3120 O OE2   . GLU C 2 90  ? 16.723  54.452  35.982 1.00 142.76 ? 90  GLU C OE2   1 
ATOM   3121 N N     . GLY C 2 91  ? 19.408  59.614  37.088 1.00 178.37 ? 91  GLY C N     1 
ATOM   3122 C CA    . GLY C 2 91  ? 20.129  60.871  37.156 1.00 178.37 ? 91  GLY C CA    1 
ATOM   3123 C C     . GLY C 2 91  ? 20.131  61.507  38.533 1.00 178.37 ? 91  GLY C C     1 
ATOM   3124 O O     . GLY C 2 91  ? 21.118  62.138  38.918 1.00 178.37 ? 91  GLY C O     1 
ATOM   3125 N N     . ASP C 2 92  ? 19.026  61.356  39.264 1.00 79.29  ? 92  ASP C N     1 
ATOM   3126 C CA    . ASP C 2 92  ? 18.897  61.906  40.609 1.00 79.29  ? 92  ASP C CA    1 
ATOM   3127 C C     . ASP C 2 92  ? 20.215  61.821  41.371 1.00 79.29  ? 92  ASP C C     1 
ATOM   3128 O O     . ASP C 2 92  ? 21.052  60.955  41.101 1.00 79.29  ? 92  ASP C O     1 
ATOM   3129 C CB    . ASP C 2 92  ? 17.795  61.171  41.369 1.00 89.02  ? 92  ASP C CB    1 
ATOM   3130 C CG    . ASP C 2 92  ? 16.409  61.593  40.926 1.00 89.02  ? 92  ASP C CG    1 
ATOM   3131 O OD1   . ASP C 2 92  ? 16.275  62.062  39.773 1.00 89.02  ? 92  ASP C OD1   1 
ATOM   3132 O OD2   . ASP C 2 92  ? 15.454  61.451  41.723 1.00 89.02  ? 92  ASP C OD2   1 
ATOM   3133 N N     . ILE C 2 93  ? 20.404  62.732  42.319 1.00 113.11 ? 93  ILE C N     1 
ATOM   3134 C CA    . ILE C 2 93  ? 21.639  62.759  43.086 1.00 113.11 ? 93  ILE C CA    1 
ATOM   3135 C C     . ILE C 2 93  ? 21.450  62.221  44.488 1.00 113.11 ? 93  ILE C C     1 
ATOM   3136 O O     . ILE C 2 93  ? 20.398  62.400  45.101 1.00 113.11 ? 93  ILE C O     1 
ATOM   3137 C CB    . ILE C 2 93  ? 22.202  64.190  43.213 1.00 105.36 ? 93  ILE C CB    1 
ATOM   3138 C CG1   . ILE C 2 93  ? 22.017  64.960  41.906 1.00 105.36 ? 93  ILE C CG1   1 
ATOM   3139 C CG2   . ILE C 2 93  ? 23.680  64.129  43.573 1.00 105.36 ? 93  ILE C CG2   1 
ATOM   3140 C CD1   . ILE C 2 93  ? 20.614  65.467  41.691 1.00 105.36 ? 93  ILE C CD1   1 
ATOM   3141 N N     . LEU C 2 94  ? 22.477  61.556  44.996 1.00 81.17  ? 94  LEU C N     1 
ATOM   3142 C CA    . LEU C 2 94  ? 22.407  61.030  46.343 1.00 81.17  ? 94  LEU C CA    1 
ATOM   3143 C C     . LEU C 2 94  ? 23.495  61.695  47.172 1.00 81.17  ? 94  LEU C C     1 
ATOM   3144 O O     . LEU C 2 94  ? 24.687  61.465  46.947 1.00 81.17  ? 94  LEU C O     1 
ATOM   3145 C CB    . LEU C 2 94  ? 22.598  59.511  46.351 1.00 77.89  ? 94  LEU C CB    1 
ATOM   3146 C CG    . LEU C 2 94  ? 22.163  58.777  47.629 1.00 77.89  ? 94  LEU C CG    1 
ATOM   3147 C CD1   . LEU C 2 94  ? 23.103  59.073  48.787 1.00 77.89  ? 94  LEU C CD1   1 
ATOM   3148 C CD2   . LEU C 2 94  ? 20.745  59.200  47.973 1.00 77.89  ? 94  LEU C CD2   1 
ATOM   3149 N N     . PHE C 2 95  ? 23.080  62.531  48.120 1.00 78.57  ? 95  PHE C N     1 
ATOM   3150 C CA    . PHE C 2 95  ? 24.027  63.217  48.981 1.00 78.57  ? 95  PHE C CA    1 
ATOM   3151 C C     . PHE C 2 95  ? 24.156  62.498  50.321 1.00 78.57  ? 95  PHE C C     1 
ATOM   3152 O O     . PHE C 2 95  ? 23.156  62.109  50.936 1.00 78.57  ? 95  PHE C O     1 
ATOM   3153 C CB    . PHE C 2 95  ? 23.586  64.668  49.194 1.00 149.10 ? 95  PHE C CB    1 
ATOM   3154 C CG    . PHE C 2 95  ? 24.435  65.428  50.177 1.00 149.10 ? 95  PHE C CG    1 
ATOM   3155 C CD1   . PHE C 2 95  ? 24.185  65.350  51.542 1.00 149.10 ? 95  PHE C CD1   1 
ATOM   3156 C CD2   . PHE C 2 95  ? 25.502  66.208  49.737 1.00 149.10 ? 95  PHE C CD2   1 
ATOM   3157 C CE1   . PHE C 2 95  ? 24.984  66.034  52.448 1.00 149.10 ? 95  PHE C CE1   1 
ATOM   3158 C CE2   . PHE C 2 95  ? 26.308  66.896  50.640 1.00 149.10 ? 95  PHE C CE2   1 
ATOM   3159 C CZ    . PHE C 2 95  ? 26.048  66.808  51.998 1.00 149.10 ? 95  PHE C CZ    1 
ATOM   3160 N N     . ILE C 2 96  ? 25.399  62.320  50.762 1.00 93.45  ? 96  ILE C N     1 
ATOM   3161 C CA    . ILE C 2 96  ? 25.676  61.660  52.029 1.00 93.45  ? 96  ILE C CA    1 
ATOM   3162 C C     . ILE C 2 96  ? 26.505  62.576  52.931 1.00 93.45  ? 96  ILE C C     1 
ATOM   3163 O O     . ILE C 2 96  ? 27.729  62.660  52.780 1.00 93.45  ? 96  ILE C O     1 
ATOM   3164 C CB    . ILE C 2 96  ? 26.453  60.341  51.824 1.00 80.13  ? 96  ILE C CB    1 
ATOM   3165 C CG1   . ILE C 2 96  ? 25.766  59.475  50.765 1.00 80.13  ? 96  ILE C CG1   1 
ATOM   3166 C CG2   . ILE C 2 96  ? 26.502  59.562  53.128 1.00 80.13  ? 96  ILE C CG2   1 
ATOM   3167 C CD1   . ILE C 2 96  ? 26.495  58.160  50.474 1.00 80.13  ? 96  ILE C CD1   1 
ATOM   3168 N N     . ASP C 2 97  ? 25.828  63.261  53.857 1.00 90.07  ? 97  ASP C N     1 
ATOM   3169 C CA    . ASP C 2 97  ? 26.479  64.172  54.804 1.00 90.07  ? 97  ASP C CA    1 
ATOM   3170 C C     . ASP C 2 97  ? 27.116  63.356  55.916 1.00 90.07  ? 97  ASP C C     1 
ATOM   3171 O O     . ASP C 2 97  ? 26.662  62.258  56.206 1.00 90.07  ? 97  ASP C O     1 
ATOM   3172 C CB    . ASP C 2 97  ? 25.454  65.126  55.419 1.00 126.71 ? 97  ASP C CB    1 
ATOM   3173 C CG    . ASP C 2 97  ? 26.099  66.254  56.208 1.00 126.71 ? 97  ASP C CG    1 
ATOM   3174 O OD1   . ASP C 2 97  ? 25.350  67.057  56.805 1.00 126.71 ? 97  ASP C OD1   1 
ATOM   3175 O OD2   . ASP C 2 97  ? 27.345  66.345  56.227 1.00 126.71 ? 97  ASP C OD2   1 
ATOM   3176 N N     . GLU C 2 98  ? 28.159  63.892  56.542 1.00 106.05 ? 98  GLU C N     1 
ATOM   3177 C CA    . GLU C 2 98  ? 28.841  63.179  57.619 1.00 106.05 ? 98  GLU C CA    1 
ATOM   3178 C C     . GLU C 2 98  ? 29.201  61.780  57.121 1.00 106.05 ? 98  GLU C C     1 
ATOM   3179 O O     . GLU C 2 98  ? 29.294  60.820  57.897 1.00 106.05 ? 98  GLU C O     1 
ATOM   3180 C CB    . GLU C 2 98  ? 27.922  63.094  58.843 1.00 110.27 ? 98  GLU C CB    1 
ATOM   3181 C CG    . GLU C 2 98  ? 27.660  64.435  59.518 1.00 110.27 ? 98  GLU C CG    1 
ATOM   3182 C CD    . GLU C 2 98  ? 26.444  64.415  60.429 1.00 110.27 ? 98  GLU C CD    1 
ATOM   3183 O OE1   . GLU C 2 98  ? 25.310  64.455  59.904 1.00 110.27 ? 98  GLU C OE1   1 
ATOM   3184 O OE2   . GLU C 2 98  ? 26.621  64.357  61.667 1.00 110.27 ? 98  GLU C OE2   1 
ATOM   3185 N N     . ILE C 2 99  ? 29.412  61.682  55.812 1.00 75.51  ? 99  ILE C N     1 
ATOM   3186 C CA    . ILE C 2 99  ? 29.739  60.416  55.173 1.00 75.51  ? 99  ILE C CA    1 
ATOM   3187 C C     . ILE C 2 99  ? 30.934  59.711  55.782 1.00 75.51  ? 99  ILE C C     1 
ATOM   3188 O O     . ILE C 2 99  ? 30.962  58.494  55.830 1.00 75.51  ? 99  ILE C O     1 
ATOM   3189 C CB    . ILE C 2 99  ? 30.004  60.595  53.668 1.00 79.65  ? 99  ILE C CB    1 
ATOM   3190 C CG1   . ILE C 2 99  ? 30.086  59.229  52.991 1.00 79.65  ? 99  ILE C CG1   1 
ATOM   3191 C CG2   . ILE C 2 99  ? 31.301  61.346  53.457 1.00 79.65  ? 99  ILE C CG2   1 
ATOM   3192 C CD1   . ILE C 2 99  ? 30.337  59.313  51.512 1.00 79.65  ? 99  ILE C CD1   1 
ATOM   3193 N N     . HIS C 2 100 ? 31.918  60.464  56.254 1.00 108.24 ? 100 HIS C N     1 
ATOM   3194 C CA    . HIS C 2 100 ? 33.104  59.854  56.838 1.00 108.24 ? 100 HIS C CA    1 
ATOM   3195 C C     . HIS C 2 100 ? 32.764  58.935  58.009 1.00 108.24 ? 100 HIS C C     1 
ATOM   3196 O O     . HIS C 2 100 ? 33.592  58.123  58.420 1.00 108.24 ? 100 HIS C O     1 
ATOM   3197 C CB    . HIS C 2 100 ? 34.077  60.935  57.294 1.00 107.56 ? 100 HIS C CB    1 
ATOM   3198 C CG    . HIS C 2 100 ? 33.744  61.524  58.629 1.00 107.56 ? 100 HIS C CG    1 
ATOM   3199 N ND1   . HIS C 2 100 ? 34.332  61.093  59.799 1.00 107.56 ? 100 HIS C ND1   1 
ATOM   3200 C CD2   . HIS C 2 100 ? 32.888  62.512  58.980 1.00 107.56 ? 100 HIS C CD2   1 
ATOM   3201 C CE1   . HIS C 2 100 ? 33.857  61.792  60.813 1.00 107.56 ? 100 HIS C CE1   1 
ATOM   3202 N NE2   . HIS C 2 100 ? 32.978  62.660  60.344 1.00 107.56 ? 100 HIS C NE2   1 
ATOM   3203 N N     . ARG C 2 101 ? 31.551  59.062  58.544 1.00 151.78 ? 101 ARG C N     1 
ATOM   3204 C CA    . ARG C 2 101 ? 31.122  58.224  59.663 1.00 151.78 ? 101 ARG C CA    1 
ATOM   3205 C C     . ARG C 2 101 ? 30.081  57.190  59.262 1.00 151.78 ? 101 ARG C C     1 
ATOM   3206 O O     . ARG C 2 101 ? 28.893  57.358  59.532 1.00 151.78 ? 101 ARG C O     1 
ATOM   3207 C CB    . ARG C 2 101 ? 30.562  59.079  60.803 1.00 195.51 ? 101 ARG C CB    1 
ATOM   3208 C CG    . ARG C 2 101 ? 31.627  59.787  61.605 1.00 195.51 ? 101 ARG C CG    1 
ATOM   3209 C CD    . ARG C 2 101 ? 31.074  60.447  62.856 1.00 195.51 ? 101 ARG C CD    1 
ATOM   3210 N NE    . ARG C 2 101 ? 32.126  61.168  63.568 1.00 195.51 ? 101 ARG C NE    1 
ATOM   3211 C CZ    . ARG C 2 101 ? 31.982  61.723  64.767 1.00 195.51 ? 101 ARG C CZ    1 
ATOM   3212 N NH1   . ARG C 2 101 ? 30.823  61.645  65.404 1.00 195.51 ? 101 ARG C NH1   1 
ATOM   3213 N NH2   . ARG C 2 101 ? 33.002  62.357  65.328 1.00 195.51 ? 101 ARG C NH2   1 
ATOM   3214 N N     . LEU C 2 102 ? 30.534  56.113  58.630 1.00 198.80 ? 102 LEU C N     1 
ATOM   3215 C CA    . LEU C 2 102 ? 29.632  55.057  58.194 1.00 198.80 ? 102 LEU C CA    1 
ATOM   3216 C C     . LEU C 2 102 ? 30.043  53.701  58.764 1.00 198.80 ? 102 LEU C C     1 
ATOM   3217 O O     . LEU C 2 102 ? 31.193  53.517  59.165 1.00 198.80 ? 102 LEU C O     1 
ATOM   3218 C CB    . LEU C 2 102 ? 29.602  55.001  56.664 1.00 54.46  ? 102 LEU C CB    1 
ATOM   3219 C CG    . LEU C 2 102 ? 29.349  56.325  55.934 1.00 54.46  ? 102 LEU C CG    1 
ATOM   3220 C CD1   . LEU C 2 102 ? 28.841  56.061  54.523 1.00 54.46  ? 102 LEU C CD1   1 
ATOM   3221 C CD2   . LEU C 2 102 ? 28.334  57.141  56.687 1.00 54.46  ? 102 LEU C CD2   1 
ATOM   3222 N N     . SER C 2 103 ? 29.101  52.759  58.797 1.00 116.58 ? 103 SER C N     1 
ATOM   3223 C CA    . SER C 2 103 ? 29.358  51.420  59.328 1.00 116.58 ? 103 SER C CA    1 
ATOM   3224 C C     . SER C 2 103 ? 30.623  50.821  58.714 1.00 116.58 ? 103 SER C C     1 
ATOM   3225 O O     . SER C 2 103 ? 30.903  51.025  57.530 1.00 116.58 ? 103 SER C O     1 
ATOM   3226 C CB    . SER C 2 103 ? 28.156  50.504  59.058 1.00 121.32 ? 103 SER C CB    1 
ATOM   3227 O OG    . SER C 2 103 ? 26.948  51.066  59.550 1.00 121.32 ? 103 SER C OG    1 
ATOM   3228 N N     . ARG C 2 104 ? 31.382  50.090  59.528 1.00 115.58 ? 104 ARG C N     1 
ATOM   3229 C CA    . ARG C 2 104 ? 32.629  49.464  59.079 1.00 115.58 ? 104 ARG C CA    1 
ATOM   3230 C C     . ARG C 2 104 ? 32.527  48.885  57.670 1.00 115.58 ? 104 ARG C C     1 
ATOM   3231 O O     . ARG C 2 104 ? 33.477  48.959  56.887 1.00 115.58 ? 104 ARG C O     1 
ATOM   3232 C CB    . ARG C 2 104 ? 33.059  48.347  60.049 1.00 175.26 ? 104 ARG C CB    1 
ATOM   3233 C CG    . ARG C 2 104 ? 33.702  48.824  61.356 1.00 175.26 ? 104 ARG C CG    1 
ATOM   3234 C CD    . ARG C 2 104 ? 34.379  47.675  62.119 1.00 175.26 ? 104 ARG C CD    1 
ATOM   3235 N NE    . ARG C 2 104 ? 33.435  46.796  62.809 1.00 175.26 ? 104 ARG C NE    1 
ATOM   3236 C CZ    . ARG C 2 104 ? 32.843  47.082  63.966 1.00 175.26 ? 104 ARG C CZ    1 
ATOM   3237 N NH1   . ARG C 2 104 ? 33.092  48.230  64.580 1.00 175.26 ? 104 ARG C NH1   1 
ATOM   3238 N NH2   . ARG C 2 104 ? 31.999  46.219  64.513 1.00 175.26 ? 104 ARG C NH2   1 
ATOM   3239 N N     . GLN C 2 105 ? 31.368  48.311  57.360 1.00 119.45 ? 105 GLN C N     1 
ATOM   3240 C CA    . GLN C 2 105 ? 31.119  47.701  56.061 1.00 119.45 ? 105 GLN C CA    1 
ATOM   3241 C C     . GLN C 2 105 ? 30.161  48.504  55.188 1.00 119.45 ? 105 GLN C C     1 
ATOM   3242 O O     . GLN C 2 105 ? 30.315  48.543  53.973 1.00 119.45 ? 105 GLN C O     1 
ATOM   3243 C CB    . GLN C 2 105 ? 30.572  46.280  56.245 1.00 200.00 ? 105 GLN C CB    1 
ATOM   3244 C CG    . GLN C 2 105 ? 29.405  46.163  57.225 1.00 200.00 ? 105 GLN C CG    1 
ATOM   3245 C CD    . GLN C 2 105 ? 29.852  45.966  58.668 1.00 200.00 ? 105 GLN C CD    1 
ATOM   3246 O OE1   . GLN C 2 105 ? 30.574  46.790  59.229 1.00 200.00 ? 105 GLN C OE1   1 
ATOM   3247 N NE2   . GLN C 2 105 ? 29.418  44.865  59.274 1.00 200.00 ? 105 GLN C NE2   1 
ATOM   3248 N N     . ALA C 2 106 ? 29.168  49.136  55.802 1.00 107.96 ? 106 ALA C N     1 
ATOM   3249 C CA    . ALA C 2 106 ? 28.201  49.926  55.049 1.00 107.96 ? 106 ALA C CA    1 
ATOM   3250 C C     . ALA C 2 106 ? 28.912  50.737  53.976 1.00 107.96 ? 106 ALA C C     1 
ATOM   3251 O O     . ALA C 2 106 ? 28.387  50.918  52.876 1.00 107.96 ? 106 ALA C O     1 
ATOM   3252 C CB    . ALA C 2 106 ? 27.434  50.859  55.983 1.00 112.13 ? 106 ALA C CB    1 
ATOM   3253 N N     . GLU C 2 107 ? 30.111  51.215  54.301 1.00 138.95 ? 107 GLU C N     1 
ATOM   3254 C CA    . GLU C 2 107 ? 30.887  52.014  53.363 1.00 138.95 ? 107 GLU C CA    1 
ATOM   3255 C C     . GLU C 2 107 ? 31.594  51.151  52.329 1.00 138.95 ? 107 GLU C C     1 
ATOM   3256 O O     . GLU C 2 107 ? 32.156  51.670  51.365 1.00 138.95 ? 107 GLU C O     1 
ATOM   3257 C CB    . GLU C 2 107 ? 31.908  52.881  54.105 1.00 200.00 ? 107 GLU C CB    1 
ATOM   3258 C CG    . GLU C 2 107 ? 32.950  52.117  54.898 1.00 200.00 ? 107 GLU C CG    1 
ATOM   3259 C CD    . GLU C 2 107 ? 34.013  53.035  55.478 1.00 200.00 ? 107 GLU C CD    1 
ATOM   3260 O OE1   . GLU C 2 107 ? 33.653  53.956  56.245 1.00 200.00 ? 107 GLU C OE1   1 
ATOM   3261 O OE2   . GLU C 2 107 ? 35.207  52.839  55.166 1.00 200.00 ? 107 GLU C OE2   1 
ATOM   3262 N N     . GLU C 2 108 ? 31.566  49.837  52.531 1.00 120.62 ? 108 GLU C N     1 
ATOM   3263 C CA    . GLU C 2 108 ? 32.188  48.908  51.591 1.00 120.62 ? 108 GLU C CA    1 
ATOM   3264 C C     . GLU C 2 108 ? 31.176  48.539  50.502 1.00 120.62 ? 108 GLU C C     1 
ATOM   3265 O O     . GLU C 2 108 ? 31.523  48.484  49.323 1.00 120.62 ? 108 GLU C O     1 
ATOM   3266 C CB    . GLU C 2 108 ? 32.684  47.651  52.315 1.00 136.99 ? 108 GLU C CB    1 
ATOM   3267 C CG    . GLU C 2 108 ? 33.623  47.952  53.481 1.00 136.99 ? 108 GLU C CG    1 
ATOM   3268 C CD    . GLU C 2 108 ? 34.364  46.723  53.989 1.00 136.99 ? 108 GLU C CD    1 
ATOM   3269 O OE1   . GLU C 2 108 ? 33.722  45.664  54.171 1.00 136.99 ? 108 GLU C OE1   1 
ATOM   3270 O OE2   . GLU C 2 108 ? 35.590  46.825  54.217 1.00 136.99 ? 108 GLU C OE2   1 
ATOM   3271 N N     . HIS C 2 109 ? 29.928  48.288  50.896 1.00 100.35 ? 109 HIS C N     1 
ATOM   3272 C CA    . HIS C 2 109 ? 28.876  47.971  49.931 1.00 100.35 ? 109 HIS C CA    1 
ATOM   3273 C C     . HIS C 2 109 ? 28.419  49.300  49.334 1.00 100.35 ? 109 HIS C C     1 
ATOM   3274 O O     . HIS C 2 109 ? 27.225  49.538  49.149 1.00 100.35 ? 109 HIS C O     1 
ATOM   3275 C CB    . HIS C 2 109 ? 27.689  47.272  50.610 1.00 178.41 ? 109 HIS C CB    1 
ATOM   3276 C CG    . HIS C 2 109 ? 27.917  45.819  50.901 1.00 178.41 ? 109 HIS C CG    1 
ATOM   3277 N ND1   . HIS C 2 109 ? 28.266  44.908  49.926 1.00 178.41 ? 109 HIS C ND1   1 
ATOM   3278 C CD2   . HIS C 2 109 ? 27.822  45.115  52.054 1.00 178.41 ? 109 HIS C CD2   1 
ATOM   3279 C CE1   . HIS C 2 109 ? 28.375  43.707  50.466 1.00 178.41 ? 109 HIS C CE1   1 
ATOM   3280 N NE2   . HIS C 2 109 ? 28.111  43.805  51.756 1.00 178.41 ? 109 HIS C NE2   1 
ATOM   3281 N N     . LEU C 2 110 ? 29.393  50.161  49.041 1.00 105.80 ? 110 LEU C N     1 
ATOM   3282 C CA    . LEU C 2 110 ? 29.137  51.484  48.484 1.00 105.80 ? 110 LEU C CA    1 
ATOM   3283 C C     . LEU C 2 110 ? 29.983  51.681  47.225 1.00 105.80 ? 110 LEU C C     1 
ATOM   3284 O O     . LEU C 2 110 ? 29.719  52.576  46.416 1.00 105.80 ? 110 LEU C O     1 
ATOM   3285 C CB    . LEU C 2 110 ? 29.487  52.548  49.529 1.00 94.13  ? 110 LEU C CB    1 
ATOM   3286 C CG    . LEU C 2 110 ? 28.740  53.883  49.518 1.00 94.13  ? 110 LEU C CG    1 
ATOM   3287 C CD1   . LEU C 2 110 ? 29.172  54.688  50.731 1.00 94.13  ? 110 LEU C CD1   1 
ATOM   3288 C CD2   . LEU C 2 110 ? 29.013  54.649  48.228 1.00 94.13  ? 110 LEU C CD2   1 
ATOM   3289 N N     . TYR C 2 111 ? 31.000  50.833  47.075 1.00 151.82 ? 111 TYR C N     1 
ATOM   3290 C CA    . TYR C 2 111 ? 31.904  50.861  45.922 1.00 151.82 ? 111 TYR C CA    1 
ATOM   3291 C C     . TYR C 2 111 ? 31.208  50.381  44.642 1.00 151.82 ? 111 TYR C C     1 
ATOM   3292 O O     . TYR C 2 111 ? 31.493  50.869  43.549 1.00 151.82 ? 111 TYR C O     1 
ATOM   3293 C CB    . TYR C 2 111 ? 33.136  49.982  46.180 1.00 101.51 ? 111 TYR C CB    1 
ATOM   3294 C CG    . TYR C 2 111 ? 33.980  50.389  47.374 1.00 101.51 ? 111 TYR C CG    1 
ATOM   3295 C CD1   . TYR C 2 111 ? 33.690  51.543  48.110 1.00 101.51 ? 111 TYR C CD1   1 
ATOM   3296 C CD2   . TYR C 2 111 ? 35.073  49.612  47.771 1.00 101.51 ? 111 TYR C CD2   1 
ATOM   3297 C CE1   . TYR C 2 111 ? 34.466  51.910  49.215 1.00 101.51 ? 111 TYR C CE1   1 
ATOM   3298 C CE2   . TYR C 2 111 ? 35.856  49.970  48.876 1.00 101.51 ? 111 TYR C CE2   1 
ATOM   3299 C CZ    . TYR C 2 111 ? 35.544  51.118  49.592 1.00 101.51 ? 111 TYR C CZ    1 
ATOM   3300 O OH    . TYR C 2 111 ? 36.294  51.459  50.694 1.00 101.51 ? 111 TYR C OH    1 
ATOM   3301 N N     . PRO C 2 112 ? 30.306  49.393  44.759 1.00 118.87 ? 112 PRO C N     1 
ATOM   3302 C CA    . PRO C 2 112 ? 29.605  48.900  43.573 1.00 118.87 ? 112 PRO C CA    1 
ATOM   3303 C C     . PRO C 2 112 ? 28.964  50.055  42.809 1.00 118.87 ? 112 PRO C C     1 
ATOM   3304 O O     . PRO C 2 112 ? 29.086  50.152  41.586 1.00 118.87 ? 112 PRO C O     1 
ATOM   3305 C CB    . PRO C 2 112 ? 28.568  47.955  44.165 1.00 193.20 ? 112 PRO C CB    1 
ATOM   3306 C CG    . PRO C 2 112 ? 29.288  47.383  45.336 1.00 193.20 ? 112 PRO C CG    1 
ATOM   3307 C CD    . PRO C 2 112 ? 29.933  48.603  45.947 1.00 193.20 ? 112 PRO C CD    1 
ATOM   3308 N N     . ALA C 2 113 ? 28.284  50.928  43.547 1.00 87.20  ? 113 ALA C N     1 
ATOM   3309 C CA    . ALA C 2 113 ? 27.620  52.086  42.964 1.00 87.20  ? 113 ALA C CA    1 
ATOM   3310 C C     . ALA C 2 113 ? 28.638  53.107  42.456 1.00 87.20  ? 113 ALA C C     1 
ATOM   3311 O O     . ALA C 2 113 ? 28.275  54.229  42.093 1.00 87.20  ? 113 ALA C O     1 
ATOM   3312 C CB    . ALA C 2 113 ? 26.705  52.730  43.996 1.00 200.00 ? 113 ALA C CB    1 
ATOM   3313 N N     . MET C 2 114 ? 29.911  52.710  42.430 1.00 119.10 ? 114 MET C N     1 
ATOM   3314 C CA    . MET C 2 114 ? 30.991  53.581  41.965 1.00 119.10 ? 114 MET C CA    1 
ATOM   3315 C C     . MET C 2 114 ? 31.301  53.367  40.486 1.00 119.10 ? 114 MET C C     1 
ATOM   3316 O O     . MET C 2 114 ? 31.022  54.235  39.654 1.00 119.10 ? 114 MET C O     1 
ATOM   3317 C CB    . MET C 2 114 ? 32.257  53.346  42.802 1.00 199.81 ? 114 MET C CB    1 
ATOM   3318 C CG    . MET C 2 114 ? 33.493  54.146  42.377 1.00 199.81 ? 114 MET C CG    1 
ATOM   3319 S SD    . MET C 2 114 ? 34.356  53.502  40.919 1.00 199.81 ? 114 MET C SD    1 
ATOM   3320 C CE    . MET C 2 114 ? 35.226  52.097  41.629 1.00 199.81 ? 114 MET C CE    1 
ATOM   3321 N N     . GLU C 2 115 ? 31.872  52.208  40.164 1.00 200.00 ? 115 GLU C N     1 
ATOM   3322 C CA    . GLU C 2 115 ? 32.229  51.890  38.784 1.00 200.00 ? 115 GLU C CA    1 
ATOM   3323 C C     . GLU C 2 115 ? 31.106  52.201  37.793 1.00 200.00 ? 115 GLU C C     1 
ATOM   3324 O O     . GLU C 2 115 ? 31.367  52.682  36.687 1.00 200.00 ? 115 GLU C O     1 
ATOM   3325 C CB    . GLU C 2 115 ? 32.652  50.414  38.657 1.00 117.94 ? 115 GLU C CB    1 
ATOM   3326 C CG    . GLU C 2 115 ? 31.666  49.398  39.227 1.00 117.94 ? 115 GLU C CG    1 
ATOM   3327 C CD    . GLU C 2 115 ? 32.050  47.962  38.902 1.00 117.94 ? 115 GLU C CD    1 
ATOM   3328 O OE1   . GLU C 2 115 ? 33.198  47.556  39.190 1.00 117.94 ? 115 GLU C OE1   1 
ATOM   3329 O OE2   . GLU C 2 115 ? 31.194  47.236  38.358 1.00 117.94 ? 115 GLU C OE2   1 
ATOM   3330 N N     . ASP C 2 116 ? 29.861  51.940  38.192 1.00 155.02 ? 116 ASP C N     1 
ATOM   3331 C CA    . ASP C 2 116 ? 28.718  52.199  37.323 1.00 155.02 ? 116 ASP C CA    1 
ATOM   3332 C C     . ASP C 2 116 ? 27.403  52.400  38.081 1.00 155.02 ? 116 ASP C C     1 
ATOM   3333 O O     . ASP C 2 116 ? 26.920  53.527  38.199 1.00 155.02 ? 116 ASP C O     1 
ATOM   3334 C CB    . ASP C 2 116 ? 28.567  51.061  36.304 1.00 193.38 ? 116 ASP C CB    1 
ATOM   3335 C CG    . ASP C 2 116 ? 29.752  50.965  35.350 1.00 193.38 ? 116 ASP C CG    1 
ATOM   3336 O OD1   . ASP C 2 116 ? 29.989  51.927  34.587 1.00 193.38 ? 116 ASP C OD1   1 
ATOM   3337 O OD2   . ASP C 2 116 ? 30.451  49.929  35.366 1.00 193.38 ? 116 ASP C OD2   1 
ATOM   3338 N N     . PHE C 2 117 ? 26.828  51.315  38.598 1.00 84.42  ? 117 PHE C N     1 
ATOM   3339 C CA    . PHE C 2 117 ? 25.554  51.402  39.323 1.00 84.42  ? 117 PHE C CA    1 
ATOM   3340 C C     . PHE C 2 117 ? 25.072  50.076  39.942 1.00 84.42  ? 117 PHE C C     1 
ATOM   3341 O O     . PHE C 2 117 ? 23.870  49.848  40.093 1.00 84.42  ? 117 PHE C O     1 
ATOM   3342 C CB    . PHE C 2 117 ? 24.476  51.964  38.385 1.00 176.54 ? 117 PHE C CB    1 
ATOM   3343 C CG    . PHE C 2 117 ? 24.353  51.220  37.079 1.00 176.54 ? 117 PHE C CG    1 
ATOM   3344 C CD1   . PHE C 2 117 ? 23.889  49.906  37.045 1.00 176.54 ? 117 PHE C CD1   1 
ATOM   3345 C CD2   . PHE C 2 117 ? 24.717  51.829  35.880 1.00 176.54 ? 117 PHE C CD2   1 
ATOM   3346 C CE1   . PHE C 2 117 ? 23.791  49.209  35.838 1.00 176.54 ? 117 PHE C CE1   1 
ATOM   3347 C CE2   . PHE C 2 117 ? 24.623  51.140  34.666 1.00 176.54 ? 117 PHE C CE2   1 
ATOM   3348 C CZ    . PHE C 2 117 ? 24.159  49.827  34.647 1.00 176.54 ? 117 PHE C CZ    1 
ATOM   3349 N N     . VAL C 2 118 ? 26.016  49.216  40.309 1.00 157.11 ? 118 VAL C N     1 
ATOM   3350 C CA    . VAL C 2 118 ? 25.688  47.922  40.900 1.00 157.11 ? 118 VAL C CA    1 
ATOM   3351 C C     . VAL C 2 118 ? 25.710  47.954  42.429 1.00 157.11 ? 118 VAL C C     1 
ATOM   3352 O O     . VAL C 2 118 ? 25.949  49.002  43.033 1.00 157.11 ? 118 VAL C O     1 
ATOM   3353 C CB    . VAL C 2 118 ? 26.662  46.821  40.408 1.00 200.00 ? 118 VAL C CB    1 
ATOM   3354 C CG1   . VAL C 2 118 ? 26.438  46.545  38.927 1.00 200.00 ? 118 VAL C CG1   1 
ATOM   3355 C CG2   . VAL C 2 118 ? 28.097  47.256  40.646 1.00 200.00 ? 118 VAL C CG2   1 
ATOM   3356 N N     . MET C 2 119 ? 25.445  46.800  43.043 1.00 105.23 ? 119 MET C N     1 
ATOM   3357 C CA    . MET C 2 119 ? 25.424  46.666  44.502 1.00 105.23 ? 119 MET C CA    1 
ATOM   3358 C C     . MET C 2 119 ? 25.480  45.186  44.850 1.00 105.23 ? 119 MET C C     1 
ATOM   3359 O O     . MET C 2 119 ? 24.597  44.666  45.523 1.00 105.23 ? 119 MET C O     1 
ATOM   3360 C CB    . MET C 2 119 ? 24.137  47.275  45.076 1.00 131.35 ? 119 MET C CB    1 
ATOM   3361 C CG    . MET C 2 119 ? 24.294  47.996  46.416 1.00 131.35 ? 119 MET C CG    1 
ATOM   3362 S SD    . MET C 2 119 ? 24.720  46.935  47.808 1.00 131.35 ? 119 MET C SD    1 
ATOM   3363 C CE    . MET C 2 119 ? 23.132  46.746  48.580 1.00 131.35 ? 119 MET C CE    1 
ATOM   3364 N N     . ASP C 2 120 ? 26.521  44.512  44.373 1.00 135.91 ? 120 ASP C N     1 
ATOM   3365 C CA    . ASP C 2 120 ? 26.704  43.087  44.622 1.00 135.91 ? 120 ASP C CA    1 
ATOM   3366 C C     . ASP C 2 120 ? 26.683  42.788  46.126 1.00 135.91 ? 120 ASP C C     1 
ATOM   3367 O O     . ASP C 2 120 ? 27.494  43.320  46.887 1.00 135.91 ? 120 ASP C O     1 
ATOM   3368 C CB    . ASP C 2 120 ? 28.029  42.628  43.997 1.00 132.28 ? 120 ASP C CB    1 
ATOM   3369 C CG    . ASP C 2 120 ? 28.063  42.814  42.480 1.00 132.28 ? 120 ASP C CG    1 
ATOM   3370 O OD1   . ASP C 2 120 ? 29.175  42.837  41.912 1.00 132.28 ? 120 ASP C OD1   1 
ATOM   3371 O OD2   . ASP C 2 120 ? 26.988  42.927  41.851 1.00 132.28 ? 120 ASP C OD2   1 
ATOM   3372 N N     . ILE C 2 121 ? 25.746  41.936  46.543 1.00 65.66  ? 121 ILE C N     1 
ATOM   3373 C CA    . ILE C 2 121 ? 25.590  41.566  47.950 1.00 65.66  ? 121 ILE C CA    1 
ATOM   3374 C C     . ILE C 2 121 ? 26.168  40.194  48.276 1.00 65.66  ? 121 ILE C C     1 
ATOM   3375 O O     . ILE C 2 121 ? 25.532  39.175  48.024 1.00 65.66  ? 121 ILE C O     1 
ATOM   3376 C CB    . ILE C 2 121 ? 24.100  41.538  48.368 1.00 74.40  ? 121 ILE C CB    1 
ATOM   3377 C CG1   . ILE C 2 121 ? 23.416  42.857  47.997 1.00 74.40  ? 121 ILE C CG1   1 
ATOM   3378 C CG2   . ILE C 2 121 ? 23.995  41.271  49.865 1.00 74.40  ? 121 ILE C CG2   1 
ATOM   3379 C CD1   . ILE C 2 121 ? 21.911  42.875  48.228 1.00 74.40  ? 121 ILE C CD1   1 
ATOM   3380 N N     . VAL C 2 122 ? 27.366  40.168  48.844 1.00 81.27  ? 122 VAL C N     1 
ATOM   3381 C CA    . VAL C 2 122 ? 28.000  38.908  49.216 1.00 81.27  ? 122 VAL C CA    1 
ATOM   3382 C C     . VAL C 2 122 ? 27.046  38.139  50.138 1.00 81.27  ? 122 VAL C C     1 
ATOM   3383 O O     . VAL C 2 122 ? 26.279  38.747  50.877 1.00 81.27  ? 122 VAL C O     1 
ATOM   3384 C CB    . VAL C 2 122 ? 29.336  39.167  49.952 1.00 103.61 ? 122 VAL C CB    1 
ATOM   3385 C CG1   . VAL C 2 122 ? 29.996  37.849  50.321 1.00 103.61 ? 122 VAL C CG1   1 
ATOM   3386 C CG2   . VAL C 2 122 ? 30.261  40.015  49.073 1.00 103.61 ? 122 VAL C CG2   1 
ATOM   3387 N N     . ILE C 2 123 ? 27.085  36.809  50.085 1.00 130.69 ? 123 ILE C N     1 
ATOM   3388 C CA    . ILE C 2 123 ? 26.204  35.984  50.915 1.00 130.69 ? 123 ILE C CA    1 
ATOM   3389 C C     . ILE C 2 123 ? 26.668  34.537  51.068 1.00 130.69 ? 123 ILE C C     1 
ATOM   3390 O O     . ILE C 2 123 ? 27.147  33.919  50.114 1.00 130.69 ? 123 ILE C O     1 
ATOM   3391 C CB    . ILE C 2 123 ? 24.778  35.948  50.346 1.00 175.49 ? 123 ILE C CB    1 
ATOM   3392 C CG1   . ILE C 2 123 ? 23.929  34.966  51.154 1.00 175.49 ? 123 ILE C CG1   1 
ATOM   3393 C CG2   . ILE C 2 123 ? 24.815  35.552  48.875 1.00 175.49 ? 123 ILE C CG2   1 
ATOM   3394 C CD1   . ILE C 2 123 ? 22.550  34.753  50.595 1.00 83.86  ? 123 ILE C CD1   1 
ATOM   3395 N N     . GLY C 2 124 ? 26.500  34.000  52.273 1.00 162.78 ? 124 GLY C N     1 
ATOM   3396 C CA    . GLY C 2 124 ? 26.901  32.632  52.541 1.00 162.78 ? 124 GLY C CA    1 
ATOM   3397 C C     . GLY C 2 124 ? 26.759  32.255  54.004 1.00 162.78 ? 124 GLY C C     1 
ATOM   3398 O O     . GLY C 2 124 ? 26.846  33.111  54.887 1.00 162.78 ? 124 GLY C O     1 
ATOM   3399 N N     . GLN C 2 125 ? 26.541  30.968  54.261 1.00 200.00 ? 125 GLN C N     1 
ATOM   3400 C CA    . GLN C 2 125 ? 26.385  30.479  55.627 1.00 200.00 ? 125 GLN C CA    1 
ATOM   3401 C C     . GLN C 2 125 ? 27.516  29.548  56.059 1.00 200.00 ? 125 GLN C C     1 
ATOM   3402 O O     . GLN C 2 125 ? 27.966  29.609  57.206 1.00 200.00 ? 125 GLN C O     1 
ATOM   3403 C CB    . GLN C 2 125 ? 25.039  29.766  55.789 1.00 179.45 ? 125 GLN C CB    1 
ATOM   3404 C CG    . GLN C 2 125 ? 23.815  30.681  55.700 1.00 179.45 ? 125 GLN C CG    1 
ATOM   3405 C CD    . GLN C 2 125 ? 23.742  31.709  56.825 1.00 179.45 ? 125 GLN C CD    1 
ATOM   3406 O OE1   . GLN C 2 125 ? 22.746  32.421  56.963 1.00 179.45 ? 125 GLN C OE1   1 
ATOM   3407 N NE2   . GLN C 2 125 ? 24.797  31.792  57.629 1.00 179.45 ? 125 GLN C NE2   1 
ATOM   3408 N N     . GLY C 2 126 ? 27.971  28.685  55.153 1.00 199.66 ? 126 GLY C N     1 
ATOM   3409 C CA    . GLY C 2 126 ? 29.056  27.779  55.498 1.00 199.66 ? 126 GLY C CA    1 
ATOM   3410 C C     . GLY C 2 126 ? 29.116  26.435  54.785 1.00 199.66 ? 126 GLY C C     1 
ATOM   3411 O O     . GLY C 2 126 ? 28.407  25.500  55.166 1.00 199.66 ? 126 GLY C O     1 
ATOM   3412 N N     . PRO C 2 127 ? 29.958  26.303  53.745 1.00 195.78 ? 127 PRO C N     1 
ATOM   3413 C CA    . PRO C 2 127 ? 30.831  27.370  53.235 1.00 195.78 ? 127 PRO C CA    1 
ATOM   3414 C C     . PRO C 2 127 ? 30.040  28.366  52.389 1.00 195.78 ? 127 PRO C C     1 
ATOM   3415 O O     . PRO C 2 127 ? 29.147  27.976  51.636 1.00 195.78 ? 127 PRO C O     1 
ATOM   3416 C CB    . PRO C 2 127 ? 31.865  26.607  52.408 1.00 200.00 ? 127 PRO C CB    1 
ATOM   3417 C CG    . PRO C 2 127 ? 31.906  25.259  53.071 1.00 200.00 ? 127 PRO C CG    1 
ATOM   3418 C CD    . PRO C 2 127 ? 30.440  24.989  53.288 1.00 200.00 ? 127 PRO C CD    1 
ATOM   3419 N N     . ALA C 2 128 ? 30.374  29.647  52.521 1.00 200.00 ? 128 ALA C N     1 
ATOM   3420 C CA    . ALA C 2 128 ? 29.698  30.707  51.777 1.00 200.00 ? 128 ALA C CA    1 
ATOM   3421 C C     . ALA C 2 128 ? 29.375  30.277  50.347 1.00 200.00 ? 128 ALA C C     1 
ATOM   3422 O O     . ALA C 2 128 ? 30.087  29.464  49.756 1.00 200.00 ? 128 ALA C O     1 
ATOM   3423 C CB    . ALA C 2 128 ? 30.560  31.964  51.764 1.00 147.52 ? 128 ALA C CB    1 
ATOM   3424 N N     . ALA C 2 129 ? 28.298  30.828  49.797 1.00 167.48 ? 129 ALA C N     1 
ATOM   3425 C CA    . ALA C 2 129 ? 27.878  30.489  48.443 1.00 167.48 ? 129 ALA C CA    1 
ATOM   3426 C C     . ALA C 2 129 ? 28.344  31.510  47.409 1.00 167.48 ? 129 ALA C C     1 
ATOM   3427 O O     . ALA C 2 129 ? 29.511  31.901  47.387 1.00 167.48 ? 129 ALA C O     1 
ATOM   3428 C CB    . ALA C 2 129 ? 26.355  30.341  48.390 1.00 83.27  ? 129 ALA C CB    1 
ATOM   3429 N N     . ARG C 2 130 ? 27.416  31.936  46.556 1.00 200.00 ? 130 ARG C N     1 
ATOM   3430 C CA    . ARG C 2 130 ? 27.697  32.894  45.490 1.00 200.00 ? 130 ARG C CA    1 
ATOM   3431 C C     . ARG C 2 130 ? 27.708  34.337  45.985 1.00 200.00 ? 130 ARG C C     1 
ATOM   3432 O O     . ARG C 2 130 ? 28.321  34.655  47.003 1.00 200.00 ? 130 ARG C O     1 
ATOM   3433 C CB    . ARG C 2 130 ? 26.649  32.752  44.380 1.00 199.28 ? 130 ARG C CB    1 
ATOM   3434 C CG    . ARG C 2 130 ? 26.422  31.324  43.905 1.00 199.28 ? 130 ARG C CG    1 
ATOM   3435 C CD    . ARG C 2 130 ? 25.232  31.239  42.957 1.00 199.28 ? 130 ARG C CD    1 
ATOM   3436 N NE    . ARG C 2 130 ? 23.979  31.667  43.582 1.00 199.28 ? 130 ARG C NE    1 
ATOM   3437 C CZ    . ARG C 2 130 ? 23.408  31.063  44.621 1.00 199.28 ? 130 ARG C CZ    1 
ATOM   3438 N NH1   . ARG C 2 130 ? 23.971  29.995  45.170 1.00 199.28 ? 130 ARG C NH1   1 
ATOM   3439 N NH2   . ARG C 2 130 ? 22.266  31.525  45.110 1.00 199.28 ? 130 ARG C NH2   1 
ATOM   3440 N N     . THR C 2 131 ? 27.019  35.202  45.245 1.00 67.00  ? 131 THR C N     1 
ATOM   3441 C CA    . THR C 2 131 ? 26.923  36.624  45.573 1.00 67.00  ? 131 THR C CA    1 
ATOM   3442 C C     . THR C 2 131 ? 25.882  37.315  44.686 1.00 67.00  ? 131 THR C C     1 
ATOM   3443 O O     . THR C 2 131 ? 25.961  37.288  43.451 1.00 67.00  ? 131 THR C O     1 
ATOM   3444 C CB    . THR C 2 131 ? 28.289  37.335  45.418 1.00 147.36 ? 131 THR C CB    1 
ATOM   3445 O OG1   . THR C 2 131 ? 28.115  38.746  45.594 1.00 147.36 ? 131 THR C OG1   1 
ATOM   3446 C CG2   . THR C 2 131 ? 28.887  37.062  44.049 1.00 147.36 ? 131 THR C CG2   1 
ATOM   3447 N N     . ILE C 2 132 ? 24.910  37.943  45.340 1.00 92.29  ? 132 ILE C N     1 
ATOM   3448 C CA    . ILE C 2 132 ? 23.813  38.614  44.660 1.00 92.29  ? 132 ILE C CA    1 
ATOM   3449 C C     . ILE C 2 132 ? 24.132  39.999  44.120 1.00 92.29  ? 132 ILE C C     1 
ATOM   3450 O O     . ILE C 2 132 ? 24.952  40.723  44.671 1.00 92.29  ? 132 ILE C O     1 
ATOM   3451 C CB    . ILE C 2 132 ? 22.615  38.716  45.592 1.00 87.81  ? 132 ILE C CB    1 
ATOM   3452 C CG1   . ILE C 2 132 ? 22.412  37.370  46.293 1.00 87.81  ? 132 ILE C CG1   1 
ATOM   3453 C CG2   . ILE C 2 132 ? 21.378  39.096  44.803 1.00 87.81  ? 132 ILE C CG2   1 
ATOM   3454 C CD1   . ILE C 2 132 ? 21.504  37.430  47.493 1.00 87.81  ? 132 ILE C CD1   1 
ATOM   3455 N N     . ARG C 2 133 ? 23.459  40.348  43.030 1.00 93.93  ? 133 ARG C N     1 
ATOM   3456 C CA    . ARG C 2 133 ? 23.623  41.628  42.353 1.00 93.93  ? 133 ARG C CA    1 
ATOM   3457 C C     . ARG C 2 133 ? 22.234  42.243  42.198 1.00 93.93  ? 133 ARG C C     1 
ATOM   3458 O O     . ARG C 2 133 ? 21.235  41.520  42.166 1.00 93.93  ? 133 ARG C O     1 
ATOM   3459 C CB    . ARG C 2 133 ? 24.254  41.400  40.978 1.00 146.58 ? 133 ARG C CB    1 
ATOM   3460 C CG    . ARG C 2 133 ? 23.435  40.470  40.089 1.00 146.58 ? 133 ARG C CG    1 
ATOM   3461 C CD    . ARG C 2 133 ? 24.242  39.940  38.912 1.00 146.58 ? 133 ARG C CD    1 
ATOM   3462 N NE    . ARG C 2 133 ? 23.448  39.054  38.061 1.00 146.58 ? 133 ARG C NE    1 
ATOM   3463 C CZ    . ARG C 2 133 ? 23.942  38.343  37.050 1.00 146.58 ? 133 ARG C CZ    1 
ATOM   3464 N NH1   . ARG C 2 133 ? 25.235  38.410  36.760 1.00 146.58 ? 133 ARG C NH1   1 
ATOM   3465 N NH2   . ARG C 2 133 ? 23.142  37.569  36.326 1.00 146.58 ? 133 ARG C NH2   1 
ATOM   3466 N N     . LEU C 2 134 ? 22.168  43.570  42.107 1.00 100.32 ? 134 LEU C N     1 
ATOM   3467 C CA    . LEU C 2 134 ? 20.892  44.268  41.959 1.00 100.32 ? 134 LEU C CA    1 
ATOM   3468 C C     . LEU C 2 134 ? 20.783  44.979  40.612 1.00 100.32 ? 134 LEU C C     1 
ATOM   3469 O O     . LEU C 2 134 ? 20.847  44.340  39.567 1.00 100.32 ? 134 LEU C O     1 
ATOM   3470 C CB    . LEU C 2 134 ? 20.707  45.265  43.104 1.00 128.75 ? 134 LEU C CB    1 
ATOM   3471 C CG    . LEU C 2 134 ? 20.646  44.639  44.502 1.00 128.75 ? 134 LEU C CG    1 
ATOM   3472 C CD1   . LEU C 2 134 ? 20.467  45.727  45.538 1.00 128.75 ? 134 LEU C CD1   1 
ATOM   3473 C CD2   . LEU C 2 134 ? 19.494  43.647  44.579 1.00 128.75 ? 134 LEU C CD2   1 
ATOM   3474 N N     . GLU C 2 135 ? 20.613  46.296  40.634 1.00 118.49 ? 135 GLU C N     1 
ATOM   3475 C CA    . GLU C 2 135 ? 20.501  47.064  39.395 1.00 118.49 ? 135 GLU C CA    1 
ATOM   3476 C C     . GLU C 2 135 ? 20.247  48.547  39.683 1.00 118.49 ? 135 GLU C C     1 
ATOM   3477 O O     . GLU C 2 135 ? 19.352  49.167  39.097 1.00 118.49 ? 135 GLU C O     1 
ATOM   3478 C CB    . GLU C 2 135 ? 19.372  46.492  38.528 1.00 199.84 ? 135 GLU C CB    1 
ATOM   3479 C CG    . GLU C 2 135 ? 19.436  46.889  37.061 1.00 199.84 ? 135 GLU C CG    1 
ATOM   3480 C CD    . GLU C 2 135 ? 18.493  46.071  36.197 1.00 199.84 ? 135 GLU C CD    1 
ATOM   3481 O OE1   . GLU C 2 135 ? 17.265  46.139  36.421 1.00 199.84 ? 135 GLU C OE1   1 
ATOM   3482 O OE2   . GLU C 2 135 ? 18.981  45.356  35.296 1.00 199.84 ? 135 GLU C OE2   1 
ATOM   3483 N N     . LEU C 2 136 ? 21.049  49.105  40.589 1.00 97.52  ? 136 LEU C N     1 
ATOM   3484 C CA    . LEU C 2 136 ? 20.939  50.504  40.978 1.00 97.52  ? 136 LEU C CA    1 
ATOM   3485 C C     . LEU C 2 136 ? 21.123  51.343  39.737 1.00 97.52  ? 136 LEU C C     1 
ATOM   3486 O O     . LEU C 2 136 ? 22.030  51.100  38.943 1.00 97.52  ? 136 LEU C O     1 
ATOM   3487 C CB    . LEU C 2 136 ? 22.028  50.886  41.980 1.00 103.17 ? 136 LEU C CB    1 
ATOM   3488 C CG    . LEU C 2 136 ? 22.357  49.932  43.122 1.00 103.17 ? 136 LEU C CG    1 
ATOM   3489 C CD1   . LEU C 2 136 ? 22.859  48.629  42.551 1.00 103.17 ? 136 LEU C CD1   1 
ATOM   3490 C CD2   . LEU C 2 136 ? 23.413  50.550  44.016 1.00 103.17 ? 136 LEU C CD2   1 
ATOM   3491 N N     . PRO C 2 137 ? 20.259  52.343  39.549 1.00 134.85 ? 137 PRO C N     1 
ATOM   3492 C CA    . PRO C 2 137 ? 20.359  53.212  38.376 1.00 134.85 ? 137 PRO C CA    1 
ATOM   3493 C C     . PRO C 2 137 ? 21.643  54.047  38.356 1.00 134.85 ? 137 PRO C C     1 
ATOM   3494 O O     . PRO C 2 137 ? 22.439  54.012  39.298 1.00 134.85 ? 137 PRO C O     1 
ATOM   3495 C CB    . PRO C 2 137 ? 19.094  54.066  38.476 1.00 111.25 ? 137 PRO C CB    1 
ATOM   3496 C CG    . PRO C 2 137 ? 18.832  54.117  39.955 1.00 111.25 ? 137 PRO C CG    1 
ATOM   3497 C CD    . PRO C 2 137 ? 19.094  52.697  40.376 1.00 111.25 ? 137 PRO C CD    1 
ATOM   3498 N N     . ARG C 2 138 ? 21.841  54.777  37.261 1.00 154.14 ? 138 ARG C N     1 
ATOM   3499 C CA    . ARG C 2 138 ? 23.005  55.640  37.093 1.00 154.14 ? 138 ARG C CA    1 
ATOM   3500 C C     . ARG C 2 138 ? 22.712  56.949  37.821 1.00 154.14 ? 138 ARG C C     1 
ATOM   3501 O O     . ARG C 2 138 ? 21.731  57.635  37.519 1.00 154.14 ? 138 ARG C O     1 
ATOM   3502 C CB    . ARG C 2 138 ? 23.263  55.879  35.596 1.00 126.51 ? 138 ARG C CB    1 
ATOM   3503 C CG    . ARG C 2 138 ? 22.018  56.270  34.791 1.00 126.51 ? 138 ARG C CG    1 
ATOM   3504 C CD    . ARG C 2 138 ? 22.059  55.724  33.359 1.00 126.51 ? 138 ARG C CD    1 
ATOM   3505 N NE    . ARG C 2 138 ? 22.945  56.464  32.461 1.00 126.51 ? 138 ARG C NE    1 
ATOM   3506 C CZ    . ARG C 2 138 ? 22.683  57.674  31.974 1.00 126.51 ? 138 ARG C CZ    1 
ATOM   3507 N NH1   . ARG C 2 138 ? 21.556  58.296  32.296 1.00 126.51 ? 138 ARG C NH1   1 
ATOM   3508 N NH2   . ARG C 2 138 ? 23.544  58.260  31.152 1.00 126.51 ? 138 ARG C NH2   1 
ATOM   3509 N N     . PHE C 2 139 ? 23.563  57.282  38.788 1.00 199.77 ? 139 PHE C N     1 
ATOM   3510 C CA    . PHE C 2 139 ? 23.381  58.487  39.592 1.00 199.77 ? 139 PHE C CA    1 
ATOM   3511 C C     . PHE C 2 139 ? 24.689  59.177  39.984 1.00 199.77 ? 139 PHE C C     1 
ATOM   3512 O O     . PHE C 2 139 ? 25.776  58.623  39.815 1.00 199.77 ? 139 PHE C O     1 
ATOM   3513 C CB    . PHE C 2 139 ? 22.591  58.134  40.859 1.00 104.96 ? 139 PHE C CB    1 
ATOM   3514 C CG    . PHE C 2 139 ? 23.297  57.164  41.769 1.00 104.96 ? 139 PHE C CG    1 
ATOM   3515 C CD1   . PHE C 2 139 ? 23.850  55.990  41.271 1.00 104.96 ? 139 PHE C CD1   1 
ATOM   3516 C CD2   . PHE C 2 139 ? 23.397  57.418  43.128 1.00 104.96 ? 139 PHE C CD2   1 
ATOM   3517 C CE1   . PHE C 2 139 ? 24.495  55.082  42.118 1.00 104.96 ? 139 PHE C CE1   1 
ATOM   3518 C CE2   . PHE C 2 139 ? 24.037  56.520  43.982 1.00 104.96 ? 139 PHE C CE2   1 
ATOM   3519 C CZ    . PHE C 2 139 ? 24.587  55.352  43.476 1.00 104.96 ? 139 PHE C CZ    1 
ATOM   3520 N N     . THR C 2 140 ? 24.566  60.394  40.510 1.00 188.66 ? 140 THR C N     1 
ATOM   3521 C CA    . THR C 2 140 ? 25.718  61.179  40.947 1.00 188.66 ? 140 THR C CA    1 
ATOM   3522 C C     . THR C 2 140 ? 25.711  61.222  42.473 1.00 188.66 ? 140 THR C C     1 
ATOM   3523 O O     . THR C 2 140 ? 24.693  61.536  43.090 1.00 188.66 ? 140 THR C O     1 
ATOM   3524 C CB    . THR C 2 140 ? 25.647  62.608  40.397 1.00 169.43 ? 140 THR C CB    1 
ATOM   3525 O OG1   . THR C 2 140 ? 24.558  63.304  41.011 1.00 169.43 ? 140 THR C OG1   1 
ATOM   3526 C CG2   . THR C 2 140 ? 25.419  62.576  38.896 1.00 169.43 ? 140 THR C CG2   1 
ATOM   3527 N N     . LEU C 2 141 ? 26.849  60.909  43.079 1.00 127.27 ? 141 LEU C N     1 
ATOM   3528 C CA    . LEU C 2 141 ? 26.940  60.874  44.530 1.00 127.27 ? 141 LEU C CA    1 
ATOM   3529 C C     . LEU C 2 141 ? 27.749  62.007  45.138 1.00 127.27 ? 141 LEU C C     1 
ATOM   3530 O O     . LEU C 2 141 ? 28.874  62.282  44.719 1.00 127.27 ? 141 LEU C O     1 
ATOM   3531 C CB    . LEU C 2 141 ? 27.539  59.532  44.975 1.00 199.98 ? 141 LEU C CB    1 
ATOM   3532 C CG    . LEU C 2 141 ? 27.610  59.164  46.467 1.00 199.98 ? 141 LEU C CG    1 
ATOM   3533 C CD1   . LEU C 2 141 ? 28.100  57.730  46.599 1.00 199.98 ? 141 LEU C CD1   1 
ATOM   3534 C CD2   . LEU C 2 141 ? 28.539  60.100  47.222 1.00 199.98 ? 141 LEU C CD2   1 
ATOM   3535 N N     . ILE C 2 142 ? 27.165  62.656  46.140 1.00 101.35 ? 142 ILE C N     1 
ATOM   3536 C CA    . ILE C 2 142 ? 27.836  63.731  46.852 1.00 101.35 ? 142 ILE C CA    1 
ATOM   3537 C C     . ILE C 2 142 ? 27.982  63.261  48.300 1.00 101.35 ? 142 ILE C C     1 
ATOM   3538 O O     . ILE C 2 142 ? 26.989  63.040  48.997 1.00 101.35 ? 142 ILE C O     1 
ATOM   3539 C CB    . ILE C 2 142 ? 27.024  65.055  46.817 1.00 70.04  ? 142 ILE C CB    1 
ATOM   3540 C CG1   . ILE C 2 142 ? 26.704  65.444  45.376 1.00 70.04  ? 142 ILE C CG1   1 
ATOM   3541 C CG2   . ILE C 2 142 ? 27.851  66.185  47.431 1.00 70.04  ? 142 ILE C CG2   1 
ATOM   3542 C CD1   . ILE C 2 142 ? 27.933  65.756  44.559 1.00 70.04  ? 142 ILE C CD1   1 
ATOM   3543 N N     . GLY C 2 143 ? 29.228  63.080  48.727 1.00 61.09  ? 143 GLY C N     1 
ATOM   3544 C CA    . GLY C 2 143 ? 29.513  62.646  50.085 1.00 61.09  ? 143 GLY C CA    1 
ATOM   3545 C C     . GLY C 2 143 ? 30.451  63.639  50.750 1.00 61.09  ? 143 GLY C C     1 
ATOM   3546 O O     . GLY C 2 143 ? 31.669  63.553  50.615 1.00 61.09  ? 143 GLY C O     1 
ATOM   3547 N N     . ALA C 2 144 ? 29.868  64.590  51.471 1.00 105.66 ? 144 ALA C N     1 
ATOM   3548 C CA    . ALA C 2 144 ? 30.628  65.630  52.150 1.00 105.66 ? 144 ALA C CA    1 
ATOM   3549 C C     . ALA C 2 144 ? 31.058  65.201  53.539 1.00 105.66 ? 144 ALA C C     1 
ATOM   3550 O O     . ALA C 2 144 ? 30.389  64.392  54.179 1.00 105.66 ? 144 ALA C O     1 
ATOM   3551 C CB    . ALA C 2 144 ? 29.794  66.883  52.240 1.00 83.27  ? 144 ALA C CB    1 
ATOM   3552 N N     . THR C 2 145 ? 32.176  65.754  54.002 1.00 145.63 ? 145 THR C N     1 
ATOM   3553 C CA    . THR C 2 145 ? 32.700  65.437  55.326 1.00 145.63 ? 145 THR C CA    1 
ATOM   3554 C C     . THR C 2 145 ? 33.057  66.705  56.093 1.00 145.63 ? 145 THR C C     1 
ATOM   3555 O O     . THR C 2 145 ? 33.709  67.604  55.564 1.00 145.63 ? 145 THR C O     1 
ATOM   3556 C CB    . THR C 2 145 ? 33.957  64.547  55.241 1.00 190.36 ? 145 THR C CB    1 
ATOM   3557 O OG1   . THR C 2 145 ? 33.619  63.289  54.642 1.00 190.36 ? 145 THR C OG1   1 
ATOM   3558 C CG2   . THR C 2 145 ? 34.524  64.300  56.628 1.00 190.36 ? 145 THR C CG2   1 
ATOM   3559 N N     . THR C 2 146 ? 32.624  66.765  57.346 1.00 200.00 ? 146 THR C N     1 
ATOM   3560 C CA    . THR C 2 146 ? 32.886  67.918  58.195 1.00 200.00 ? 146 THR C CA    1 
ATOM   3561 C C     . THR C 2 146 ? 34.298  67.884  58.775 1.00 200.00 ? 146 THR C C     1 
ATOM   3562 O O     . THR C 2 146 ? 34.831  68.910  59.195 1.00 200.00 ? 146 THR C O     1 
ATOM   3563 C CB    . THR C 2 146 ? 31.868  67.984  59.350 1.00 200.00 ? 146 THR C CB    1 
ATOM   3564 O OG1   . THR C 2 146 ? 31.919  66.766  60.103 1.00 200.00 ? 146 THR C OG1   1 
ATOM   3565 C CG2   . THR C 2 146 ? 30.459  68.178  58.804 1.00 200.00 ? 146 THR C CG2   1 
ATOM   3566 N N     . ARG C 2 147 ? 34.898  66.700  58.796 1.00 111.86 ? 147 ARG C N     1 
ATOM   3567 C CA    . ARG C 2 147 ? 36.252  66.525  59.316 1.00 111.86 ? 147 ARG C CA    1 
ATOM   3568 C C     . ARG C 2 147 ? 36.909  65.340  58.601 1.00 111.86 ? 147 ARG C C     1 
ATOM   3569 O O     . ARG C 2 147 ? 37.039  64.251  59.158 1.00 111.86 ? 147 ARG C O     1 
ATOM   3570 C CB    . ARG C 2 147 ? 36.213  66.297  60.836 1.00 137.56 ? 147 ARG C CB    1 
ATOM   3571 C CG    . ARG C 2 147 ? 37.569  65.981  61.466 1.00 137.56 ? 147 ARG C CG    1 
ATOM   3572 C CD    . ARG C 2 147 ? 37.540  66.093  62.987 1.00 137.56 ? 147 ARG C CD    1 
ATOM   3573 N NE    . ARG C 2 147 ? 37.652  67.479  63.441 1.00 137.56 ? 147 ARG C NE    1 
ATOM   3574 C CZ    . ARG C 2 147 ? 37.718  67.856  64.717 1.00 137.56 ? 147 ARG C CZ    1 
ATOM   3575 N NH1   . ARG C 2 147 ? 37.681  66.950  65.687 1.00 137.56 ? 147 ARG C NH1   1 
ATOM   3576 N NH2   . ARG C 2 147 ? 37.834  69.141  65.025 1.00 137.56 ? 147 ARG C NH2   1 
ATOM   3577 N N     . PRO C 2 148 ? 37.326  65.548  57.343 1.00 96.22  ? 148 PRO C N     1 
ATOM   3578 C CA    . PRO C 2 148 ? 37.970  64.542  56.489 1.00 96.22  ? 148 PRO C CA    1 
ATOM   3579 C C     . PRO C 2 148 ? 39.292  64.005  57.014 1.00 96.22  ? 148 PRO C C     1 
ATOM   3580 O O     . PRO C 2 148 ? 39.456  62.796  57.175 1.00 96.22  ? 148 PRO C O     1 
ATOM   3581 C CB    . PRO C 2 148 ? 38.147  65.278  55.164 1.00 200.00 ? 148 PRO C CB    1 
ATOM   3582 C CG    . PRO C 2 148 ? 37.027  66.277  55.171 1.00 200.00 ? 148 PRO C CG    1 
ATOM   3583 C CD    . PRO C 2 148 ? 37.077  66.786  56.583 1.00 200.00 ? 148 PRO C CD    1 
ATOM   3584 N N     . GLY C 2 149 ? 40.232  64.915  57.262 1.00 164.93 ? 149 GLY C N     1 
ATOM   3585 C CA    . GLY C 2 149 ? 41.542  64.531  57.761 1.00 164.93 ? 149 GLY C CA    1 
ATOM   3586 C C     . GLY C 2 149 ? 41.934  63.123  57.360 1.00 164.93 ? 149 GLY C C     1 
ATOM   3587 O O     . GLY C 2 149 ? 42.407  62.891  56.246 1.00 164.93 ? 149 GLY C O     1 
ATOM   3588 N N     . LEU C 2 150 ? 41.732  62.182  58.278 1.00 177.50 ? 150 LEU C N     1 
ATOM   3589 C CA    . LEU C 2 150 ? 42.046  60.779  58.040 1.00 177.50 ? 150 LEU C CA    1 
ATOM   3590 C C     . LEU C 2 150 ? 40.901  59.936  58.592 1.00 177.50 ? 150 LEU C C     1 
ATOM   3591 O O     . LEU C 2 150 ? 41.087  59.117  59.493 1.00 177.50 ? 150 LEU C O     1 
ATOM   3592 C CB    . LEU C 2 150 ? 43.368  60.398  58.726 1.00 200.00 ? 150 LEU C CB    1 
ATOM   3593 C CG    . LEU C 2 150 ? 44.141  59.141  58.283 1.00 200.00 ? 150 LEU C CG    1 
ATOM   3594 C CD1   . LEU C 2 150 ? 43.385  57.875  58.650 1.00 200.00 ? 150 LEU C CD1   1 
ATOM   3595 C CD2   . LEU C 2 150 ? 44.391  59.204  56.782 1.00 200.00 ? 150 LEU C CD2   1 
ATOM   3596 N N     . ILE C 2 151 ? 39.705  60.166  58.063 1.00 115.35 ? 151 ILE C N     1 
ATOM   3597 C CA    . ILE C 2 151 ? 38.535  59.409  58.486 1.00 115.35 ? 151 ILE C CA    1 
ATOM   3598 C C     . ILE C 2 151 ? 37.716  59.019  57.254 1.00 115.35 ? 151 ILE C C     1 
ATOM   3599 O O     . ILE C 2 151 ? 36.742  58.271  57.350 1.00 115.35 ? 151 ILE C O     1 
ATOM   3600 C CB    . ILE C 2 151 ? 37.658  60.207  59.493 1.00 106.89 ? 151 ILE C CB    1 
ATOM   3601 C CG1   . ILE C 2 151 ? 38.513  60.683  60.673 1.00 106.89 ? 151 ILE C CG1   1 
ATOM   3602 C CG2   . ILE C 2 151 ? 36.549  59.313  60.040 1.00 106.89 ? 151 ILE C CG2   1 
ATOM   3603 C CD1   . ILE C 2 151 ? 37.716  61.277  61.817 1.00 106.89 ? 151 ILE C CD1   1 
ATOM   3604 N N     . THR C 2 152 ? 38.121  59.535  56.095 1.00 193.25 ? 152 THR C N     1 
ATOM   3605 C CA    . THR C 2 152 ? 37.463  59.212  54.831 1.00 193.25 ? 152 THR C CA    1 
ATOM   3606 C C     . THR C 2 152 ? 38.332  58.130  54.185 1.00 193.25 ? 152 THR C C     1 
ATOM   3607 O O     . THR C 2 152 ? 39.090  58.395  53.252 1.00 193.25 ? 152 THR C O     1 
ATOM   3608 C CB    . THR C 2 152 ? 37.379  60.442  53.887 1.00 79.87  ? 152 THR C CB    1 
ATOM   3609 O OG1   . THR C 2 152 ? 36.573  61.464  54.488 1.00 79.87  ? 152 THR C OG1   1 
ATOM   3610 C CG2   . THR C 2 152 ? 36.759  60.051  52.556 1.00 79.87  ? 152 THR C CG2   1 
ATOM   3611 N N     . ALA C 2 153 ? 38.213  56.918  54.723 1.00 200.00 ? 153 ALA C N     1 
ATOM   3612 C CA    . ALA C 2 153 ? 38.955  55.727  54.298 1.00 200.00 ? 153 ALA C CA    1 
ATOM   3613 C C     . ALA C 2 153 ? 39.310  55.628  52.807 1.00 200.00 ? 153 ALA C C     1 
ATOM   3614 O O     . ALA C 2 153 ? 38.904  56.474  52.008 1.00 200.00 ? 153 ALA C O     1 
ATOM   3615 C CB    . ALA C 2 153 ? 38.177  54.492  54.735 1.00 32.93  ? 153 ALA C CB    1 
ATOM   3616 N N     . PRO C 2 154 ? 40.082  54.586  52.415 1.00 196.37 ? 154 PRO C N     1 
ATOM   3617 C CA    . PRO C 2 154 ? 40.489  54.381  51.018 1.00 196.37 ? 154 PRO C CA    1 
ATOM   3618 C C     . PRO C 2 154 ? 39.367  54.621  50.011 1.00 196.37 ? 154 PRO C C     1 
ATOM   3619 O O     . PRO C 2 154 ? 39.604  54.673  48.804 1.00 196.37 ? 154 PRO C O     1 
ATOM   3620 C CB    . PRO C 2 154 ? 40.967  52.935  51.015 1.00 153.71 ? 154 PRO C CB    1 
ATOM   3621 C CG    . PRO C 2 154 ? 41.625  52.826  52.341 1.00 153.71 ? 154 PRO C CG    1 
ATOM   3622 C CD    . PRO C 2 154 ? 40.635  53.515  53.268 1.00 153.71 ? 154 PRO C CD    1 
ATOM   3623 N N     . LEU C 2 155 ? 38.148  54.766  50.522 1.00 200.00 ? 155 LEU C N     1 
ATOM   3624 C CA    . LEU C 2 155 ? 36.980  55.014  49.691 1.00 200.00 ? 155 LEU C CA    1 
ATOM   3625 C C     . LEU C 2 155 ? 37.176  56.327  48.938 1.00 200.00 ? 155 LEU C C     1 
ATOM   3626 O O     . LEU C 2 155 ? 36.373  56.682  48.077 1.00 200.00 ? 155 LEU C O     1 
ATOM   3627 C CB    . LEU C 2 155 ? 35.714  55.079  50.564 1.00 94.26  ? 155 LEU C CB    1 
ATOM   3628 C CG    . LEU C 2 155 ? 35.319  56.393  51.255 1.00 94.26  ? 155 LEU C CG    1 
ATOM   3629 C CD1   . LEU C 2 155 ? 34.344  57.144  50.359 1.00 94.26  ? 155 LEU C CD1   1 
ATOM   3630 C CD2   . LEU C 2 155 ? 34.661  56.119  52.607 1.00 94.26  ? 155 LEU C CD2   1 
ATOM   3631 N N     . LEU C 2 156 ? 38.249  57.046  49.266 1.00 99.60  ? 156 LEU C N     1 
ATOM   3632 C CA    . LEU C 2 156 ? 38.540  58.308  48.598 1.00 99.60  ? 156 LEU C CA    1 
ATOM   3633 C C     . LEU C 2 156 ? 38.831  57.960  47.150 1.00 99.60  ? 156 LEU C C     1 
ATOM   3634 O O     . LEU C 2 156 ? 38.641  58.773  46.245 1.00 99.60  ? 156 LEU C O     1 
ATOM   3635 C CB    . LEU C 2 156 ? 39.769  58.990  49.211 1.00 112.80 ? 156 LEU C CB    1 
ATOM   3636 C CG    . LEU C 2 156 ? 41.156  58.472  48.807 1.00 112.80 ? 156 LEU C CG    1 
ATOM   3637 C CD1   . LEU C 2 156 ? 42.222  59.472  49.247 1.00 112.80 ? 156 LEU C CD1   1 
ATOM   3638 C CD2   . LEU C 2 156 ? 41.406  57.094  49.412 1.00 112.80 ? 156 LEU C CD2   1 
ATOM   3639 N N     . SER C 2 157 ? 39.299  56.732  46.952 1.00 200.00 ? 157 SER C N     1 
ATOM   3640 C CA    . SER C 2 157 ? 39.629  56.226  45.629 1.00 200.00 ? 157 SER C CA    1 
ATOM   3641 C C     . SER C 2 157 ? 38.367  56.178  44.777 1.00 200.00 ? 157 SER C C     1 
ATOM   3642 O O     . SER C 2 157 ? 38.296  56.806  43.719 1.00 200.00 ? 157 SER C O     1 
ATOM   3643 C CB    . SER C 2 157 ? 40.230  54.823  45.743 1.00 181.09 ? 157 SER C CB    1 
ATOM   3644 O OG    . SER C 2 157 ? 41.315  54.804  46.655 1.00 181.09 ? 157 SER C OG    1 
ATOM   3645 N N     . ARG C 2 158 ? 37.373  55.431  45.250 1.00 191.22 ? 158 ARG C N     1 
ATOM   3646 C CA    . ARG C 2 158 ? 36.107  55.293  44.540 1.00 191.22 ? 158 ARG C CA    1 
ATOM   3647 C C     . ARG C 2 158 ? 35.470  56.639  44.214 1.00 191.22 ? 158 ARG C C     1 
ATOM   3648 O O     . ARG C 2 158 ? 34.834  56.789  43.171 1.00 191.22 ? 158 ARG C O     1 
ATOM   3649 C CB    . ARG C 2 158 ? 35.131  54.443  45.354 1.00 117.88 ? 158 ARG C CB    1 
ATOM   3650 C CG    . ARG C 2 158 ? 35.281  52.946  45.149 1.00 117.88 ? 158 ARG C CG    1 
ATOM   3651 C CD    . ARG C 2 158 ? 36.620  52.406  45.629 1.00 117.88 ? 158 ARG C CD    1 
ATOM   3652 N NE    . ARG C 2 158 ? 36.696  50.957  45.439 1.00 117.88 ? 158 ARG C NE    1 
ATOM   3653 C CZ    . ARG C 2 158 ? 37.676  50.181  45.894 1.00 117.88 ? 158 ARG C CZ    1 
ATOM   3654 N NH1   . ARG C 2 158 ? 38.686  50.706  46.574 1.00 117.88 ? 158 ARG C NH1   1 
ATOM   3655 N NH2   . ARG C 2 158 ? 37.640  48.873  45.676 1.00 117.88 ? 158 ARG C NH2   1 
ATOM   3656 N N     . PHE C 2 159 ? 35.629  57.615  45.106 1.00 95.88  ? 159 PHE C N     1 
ATOM   3657 C CA    . PHE C 2 159 ? 35.068  58.938  44.862 1.00 95.88  ? 159 PHE C CA    1 
ATOM   3658 C C     . PHE C 2 159 ? 35.773  59.526  43.647 1.00 95.88  ? 159 PHE C C     1 
ATOM   3659 O O     . PHE C 2 159 ? 36.968  59.295  43.430 1.00 95.88  ? 159 PHE C O     1 
ATOM   3660 C CB    . PHE C 2 159 ? 35.257  59.864  46.081 1.00 80.22  ? 159 PHE C CB    1 
ATOM   3661 C CG    . PHE C 2 159 ? 33.991  60.095  46.877 1.00 80.22  ? 159 PHE C CG    1 
ATOM   3662 C CD1   . PHE C 2 159 ? 33.739  59.378  48.047 1.00 80.22  ? 159 PHE C CD1   1 
ATOM   3663 C CD2   . PHE C 2 159 ? 33.034  61.014  46.442 1.00 80.22  ? 159 PHE C CD2   1 
ATOM   3664 C CE1   . PHE C 2 159 ? 32.548  59.572  48.775 1.00 80.22  ? 159 PHE C CE1   1 
ATOM   3665 C CE2   . PHE C 2 159 ? 31.839  61.214  47.163 1.00 80.22  ? 159 PHE C CE2   1 
ATOM   3666 C CZ    . PHE C 2 159 ? 31.599  60.490  48.331 1.00 80.22  ? 159 PHE C CZ    1 
ATOM   3667 N N     . GLY C 2 160 ? 35.026  60.272  42.845 1.00 108.67 ? 160 GLY C N     1 
ATOM   3668 C CA    . GLY C 2 160 ? 35.611  60.873  41.667 1.00 108.67 ? 160 GLY C CA    1 
ATOM   3669 C C     . GLY C 2 160 ? 36.571  61.996  42.009 1.00 108.67 ? 160 GLY C C     1 
ATOM   3670 O O     . GLY C 2 160 ? 37.747  61.766  42.293 1.00 108.67 ? 160 GLY C O     1 
ATOM   3671 N N     . ILE C 2 161 ? 36.054  63.217  42.000 1.00 200.00 ? 161 ILE C N     1 
ATOM   3672 C CA    . ILE C 2 161 ? 36.846  64.408  42.276 1.00 200.00 ? 161 ILE C CA    1 
ATOM   3673 C C     . ILE C 2 161 ? 36.789  64.895  43.725 1.00 200.00 ? 161 ILE C C     1 
ATOM   3674 O O     . ILE C 2 161 ? 35.716  64.991  44.322 1.00 200.00 ? 161 ILE C O     1 
ATOM   3675 C CB    . ILE C 2 161 ? 36.414  65.530  41.322 1.00 93.78  ? 161 ILE C CB    1 
ATOM   3676 C CG1   . ILE C 2 161 ? 34.886  65.482  41.132 1.00 93.78  ? 161 ILE C CG1   1 
ATOM   3677 C CG2   . ILE C 2 161 ? 37.154  65.376  39.996 1.00 93.78  ? 161 ILE C CG2   1 
ATOM   3678 C CD1   . ILE C 2 161 ? 34.330  66.386  40.037 1.00 93.78  ? 161 ILE C CD1   1 
ATOM   3679 N N     . VAL C 2 162 ? 37.961  65.208  44.276 1.00 127.72 ? 162 VAL C N     1 
ATOM   3680 C CA    . VAL C 2 162 ? 38.086  65.671  45.658 1.00 127.72 ? 162 VAL C CA    1 
ATOM   3681 C C     . VAL C 2 162 ? 38.482  67.148  45.746 1.00 127.72 ? 162 VAL C C     1 
ATOM   3682 O O     . VAL C 2 162 ? 39.667  67.480  45.743 1.00 127.72 ? 162 VAL C O     1 
ATOM   3683 C CB    . VAL C 2 162 ? 39.147  64.833  46.424 1.00 91.51  ? 162 VAL C CB    1 
ATOM   3684 C CG1   . VAL C 2 162 ? 39.163  65.214  47.888 1.00 91.51  ? 162 VAL C CG1   1 
ATOM   3685 C CG2   . VAL C 2 162 ? 38.852  63.358  46.277 1.00 91.51  ? 162 VAL C CG2   1 
ATOM   3686 N N     . GLU C 2 163 ? 37.490  68.030  45.829 1.00 174.84 ? 163 GLU C N     1 
ATOM   3687 C CA    . GLU C 2 163 ? 37.755  69.462  45.926 1.00 174.84 ? 163 GLU C CA    1 
ATOM   3688 C C     . GLU C 2 163 ? 37.414  69.986  47.321 1.00 174.84 ? 163 GLU C C     1 
ATOM   3689 O O     . GLU C 2 163 ? 36.441  69.551  47.936 1.00 174.84 ? 163 GLU C O     1 
ATOM   3690 C CB    . GLU C 2 163 ? 36.960  70.217  44.854 1.00 170.63 ? 163 GLU C CB    1 
ATOM   3691 C CG    . GLU C 2 163 ? 35.445  70.073  44.941 1.00 170.63 ? 163 GLU C CG    1 
ATOM   3692 C CD    . GLU C 2 163 ? 34.802  71.127  45.824 1.00 170.63 ? 163 GLU C CD    1 
ATOM   3693 O OE1   . GLU C 2 163 ? 33.558  71.131  45.939 1.00 170.63 ? 163 GLU C OE1   1 
ATOM   3694 O OE2   . GLU C 2 163 ? 35.539  71.954  46.399 1.00 170.63 ? 163 GLU C OE2   1 
ATOM   3695 N N     . HIS C 2 164 ? 38.220  70.920  47.815 1.00 113.78 ? 164 HIS C N     1 
ATOM   3696 C CA    . HIS C 2 164 ? 38.016  71.489  49.143 1.00 113.78 ? 164 HIS C CA    1 
ATOM   3697 C C     . HIS C 2 164 ? 37.050  72.673  49.165 1.00 113.78 ? 164 HIS C C     1 
ATOM   3698 O O     . HIS C 2 164 ? 36.697  73.231  48.124 1.00 113.78 ? 164 HIS C O     1 
ATOM   3699 C CB    . HIS C 2 164 ? 39.358  71.937  49.729 1.00 199.94 ? 164 HIS C CB    1 
ATOM   3700 C CG    . HIS C 2 164 ? 39.911  73.177  49.093 1.00 199.94 ? 164 HIS C CG    1 
ATOM   3701 N ND1   . HIS C 2 164 ? 39.267  74.395  49.155 1.00 199.94 ? 164 HIS C ND1   1 
ATOM   3702 C CD2   . HIS C 2 164 ? 41.043  73.386  48.381 1.00 199.94 ? 164 HIS C CD2   1 
ATOM   3703 C CE1   . HIS C 2 164 ? 39.979  75.301  48.510 1.00 199.94 ? 164 HIS C CE1   1 
ATOM   3704 N NE2   . HIS C 2 164 ? 41.061  74.715  48.030 1.00 199.94 ? 164 HIS C NE2   1 
ATOM   3705 N N     . LEU C 2 165 ? 36.640  73.046  50.373 1.00 84.69  ? 165 LEU C N     1 
ATOM   3706 C CA    . LEU C 2 165 ? 35.741  74.172  50.601 1.00 84.69  ? 165 LEU C CA    1 
ATOM   3707 C C     . LEU C 2 165 ? 36.265  74.952  51.807 1.00 84.69  ? 165 LEU C C     1 
ATOM   3708 O O     . LEU C 2 165 ? 36.719  74.344  52.777 1.00 84.69  ? 165 LEU C O     1 
ATOM   3709 C CB    . LEU C 2 165 ? 34.327  73.663  50.870 1.00 101.66 ? 165 LEU C CB    1 
ATOM   3710 C CG    . LEU C 2 165 ? 33.601  73.140  49.630 1.00 101.66 ? 165 LEU C CG    1 
ATOM   3711 C CD1   . LEU C 2 165 ? 32.387  72.337  50.041 1.00 101.66 ? 165 LEU C CD1   1 
ATOM   3712 C CD2   . LEU C 2 165 ? 33.201  74.317  48.740 1.00 101.66 ? 165 LEU C CD2   1 
ATOM   3713 N N     . GLU C 2 166 ? 36.223  76.285  51.742 1.00 200.00 ? 166 GLU C N     1 
ATOM   3714 C CA    . GLU C 2 166 ? 36.709  77.134  52.840 1.00 200.00 ? 166 GLU C CA    1 
ATOM   3715 C C     . GLU C 2 166 ? 35.675  78.215  53.202 1.00 200.00 ? 166 GLU C C     1 
ATOM   3716 O O     . GLU C 2 166 ? 34.517  78.117  52.797 1.00 200.00 ? 166 GLU C O     1 
ATOM   3717 C CB    . GLU C 2 166 ? 38.042  77.791  52.448 1.00 158.91 ? 166 GLU C CB    1 
ATOM   3718 C CG    . GLU C 2 166 ? 38.988  78.082  53.620 1.00 158.91 ? 166 GLU C CG    1 
ATOM   3719 C CD    . GLU C 2 166 ? 39.709  76.838  54.131 1.00 158.91 ? 166 GLU C CD    1 
ATOM   3720 O OE1   . GLU C 2 166 ? 40.459  76.215  53.348 1.00 158.91 ? 166 GLU C OE1   1 
ATOM   3721 O OE2   . GLU C 2 166 ? 39.528  76.485  55.317 1.00 158.91 ? 166 GLU C OE2   1 
ATOM   3722 N N     . TYR C 2 167 ? 36.091  79.243  53.947 1.00 111.13 ? 167 TYR C N     1 
ATOM   3723 C CA    . TYR C 2 167 ? 35.179  80.319  54.374 1.00 111.13 ? 167 TYR C CA    1 
ATOM   3724 C C     . TYR C 2 167 ? 34.910  81.380  53.316 1.00 111.13 ? 167 TYR C C     1 
ATOM   3725 O O     . TYR C 2 167 ? 35.823  81.805  52.606 1.00 111.13 ? 167 TYR C O     1 
ATOM   3726 C CB    . TYR C 2 167 ? 35.718  80.975  55.636 1.00 51.12  ? 167 TYR C CB    1 
ATOM   3727 C CG    . TYR C 2 167 ? 35.913  79.987  56.757 1.00 51.12  ? 167 TYR C CG    1 
ATOM   3728 C CD1   . TYR C 2 167 ? 34.831  79.546  57.520 1.00 51.12  ? 167 TYR C CD1   1 
ATOM   3729 C CD2   . TYR C 2 167 ? 37.178  79.479  57.043 1.00 51.12  ? 167 TYR C CD2   1 
ATOM   3730 C CE1   . TYR C 2 167 ? 35.007  78.631  58.541 1.00 51.12  ? 167 TYR C CE1   1 
ATOM   3731 C CE2   . TYR C 2 167 ? 37.368  78.560  58.059 1.00 51.12  ? 167 TYR C CE2   1 
ATOM   3732 C CZ    . TYR C 2 167 ? 36.283  78.139  58.810 1.00 51.12  ? 167 TYR C CZ    1 
ATOM   3733 O OH    . TYR C 2 167 ? 36.476  77.236  59.842 1.00 51.12  ? 167 TYR C OH    1 
ATOM   3734 N N     . TYR C 2 168 ? 33.655  81.824  53.235 1.00 69.72  ? 168 TYR C N     1 
ATOM   3735 C CA    . TYR C 2 168 ? 33.267  82.793  52.224 1.00 69.72  ? 168 TYR C CA    1 
ATOM   3736 C C     . TYR C 2 168 ? 33.175  84.245  52.643 1.00 69.72  ? 168 TYR C C     1 
ATOM   3737 O O     . TYR C 2 168 ? 32.112  84.761  52.984 1.00 69.72  ? 168 TYR C O     1 
ATOM   3738 C CB    . TYR C 2 168 ? 31.980  82.328  51.541 1.00 199.61 ? 168 TYR C CB    1 
ATOM   3739 C CG    . TYR C 2 168 ? 32.218  81.056  50.756 1.00 199.61 ? 168 TYR C CG    1 
ATOM   3740 C CD1   . TYR C 2 168 ? 33.239  80.989  49.805 1.00 199.61 ? 168 TYR C CD1   1 
ATOM   3741 C CD2   . TYR C 2 168 ? 31.476  79.903  51.005 1.00 199.61 ? 168 TYR C CD2   1 
ATOM   3742 C CE1   . TYR C 2 168 ? 33.522  79.804  49.126 1.00 199.61 ? 168 TYR C CE1   1 
ATOM   3743 C CE2   . TYR C 2 168 ? 31.751  78.708  50.329 1.00 199.61 ? 168 TYR C CE2   1 
ATOM   3744 C CZ    . TYR C 2 168 ? 32.777  78.666  49.392 1.00 199.61 ? 168 TYR C CZ    1 
ATOM   3745 O OH    . TYR C 2 168 ? 33.068  77.490  48.734 1.00 199.61 ? 168 TYR C OH    1 
ATOM   3746 N N     . THR C 2 169 ? 34.347  84.875  52.572 1.00 183.23 ? 169 THR C N     1 
ATOM   3747 C CA    . THR C 2 169 ? 34.630  86.275  52.890 1.00 183.23 ? 169 THR C CA    1 
ATOM   3748 C C     . THR C 2 169 ? 33.522  87.190  53.398 1.00 183.23 ? 169 THR C C     1 
ATOM   3749 O O     . THR C 2 169 ? 32.360  87.071  53.004 1.00 183.23 ? 169 THR C O     1 
ATOM   3750 C CB    . THR C 2 169 ? 35.284  86.972  51.680 1.00 82.73  ? 169 THR C CB    1 
ATOM   3751 O OG1   . THR C 2 169 ? 34.338  87.047  50.601 1.00 82.73  ? 169 THR C OG1   1 
ATOM   3752 C CG2   . THR C 2 169 ? 36.530  86.208  51.236 1.00 82.73  ? 169 THR C CG2   1 
ATOM   3753 N N     . PRO C 2 170 ? 33.890  88.147  54.273 1.00 63.09  ? 170 PRO C N     1 
ATOM   3754 C CA    . PRO C 2 170 ? 32.946  89.110  54.853 1.00 63.09  ? 170 PRO C CA    1 
ATOM   3755 C C     . PRO C 2 170 ? 32.069  89.667  53.745 1.00 63.09  ? 170 PRO C C     1 
ATOM   3756 O O     . PRO C 2 170 ? 30.860  89.849  53.911 1.00 63.09  ? 170 PRO C O     1 
ATOM   3757 C CB    . PRO C 2 170 ? 33.864  90.174  55.452 1.00 87.52  ? 170 PRO C CB    1 
ATOM   3758 C CG    . PRO C 2 170 ? 35.064  89.390  55.862 1.00 87.52  ? 170 PRO C CG    1 
ATOM   3759 C CD    . PRO C 2 170 ? 35.273  88.461  54.685 1.00 87.52  ? 170 PRO C CD    1 
ATOM   3760 N N     . GLU C 2 171 ? 32.709  89.925  52.611 1.00 171.61 ? 171 GLU C N     1 
ATOM   3761 C CA    . GLU C 2 171 ? 32.036  90.455  51.443 1.00 171.61 ? 171 GLU C CA    1 
ATOM   3762 C C     . GLU C 2 171 ? 30.982  89.466  50.969 1.00 171.61 ? 171 GLU C C     1 
ATOM   3763 O O     . GLU C 2 171 ? 29.784  89.726  51.068 1.00 171.61 ? 171 GLU C O     1 
ATOM   3764 C CB    . GLU C 2 171 ? 33.047  90.706  50.317 1.00 117.78 ? 171 GLU C CB    1 
ATOM   3765 C CG    . GLU C 2 171 ? 34.061  91.827  50.572 1.00 117.78 ? 171 GLU C CG    1 
ATOM   3766 C CD    . GLU C 2 171 ? 35.132  91.463  51.589 1.00 117.78 ? 171 GLU C CD    1 
ATOM   3767 O OE1   . GLU C 2 171 ? 34.839  91.479  52.802 1.00 117.78 ? 171 GLU C OE1   1 
ATOM   3768 O OE2   . GLU C 2 171 ? 36.271  91.156  51.170 1.00 117.78 ? 171 GLU C OE2   1 
ATOM   3769 N N     . GLU C 2 172 ? 31.441  88.324  50.468 1.00 136.54 ? 172 GLU C N     1 
ATOM   3770 C CA    . GLU C 2 172 ? 30.547  87.299  49.954 1.00 136.54 ? 172 GLU C CA    1 
ATOM   3771 C C     . GLU C 2 172 ? 29.363  86.957  50.859 1.00 136.54 ? 172 GLU C C     1 
ATOM   3772 O O     . GLU C 2 172 ? 28.223  86.902  50.383 1.00 136.54 ? 172 GLU C O     1 
ATOM   3773 C CB    . GLU C 2 172 ? 31.350  86.041  49.615 1.00 122.28 ? 172 GLU C CB    1 
ATOM   3774 C CG    . GLU C 2 172 ? 32.318  86.262  48.461 1.00 122.28 ? 172 GLU C CG    1 
ATOM   3775 C CD    . GLU C 2 172 ? 33.038  84.998  48.020 1.00 122.28 ? 172 GLU C CD    1 
ATOM   3776 O OE1   . GLU C 2 172 ? 33.857  84.467  48.796 1.00 122.28 ? 172 GLU C OE1   1 
ATOM   3777 O OE2   . GLU C 2 172 ? 32.785  84.535  46.889 1.00 122.28 ? 172 GLU C OE2   1 
ATOM   3778 N N     . LEU C 2 173 ? 29.614  86.739  52.151 1.00 69.89  ? 173 LEU C N     1 
ATOM   3779 C CA    . LEU C 2 173 ? 28.525  86.406  53.070 1.00 69.89  ? 173 LEU C CA    1 
ATOM   3780 C C     . LEU C 2 173 ? 27.633  87.599  53.299 1.00 69.89  ? 173 LEU C C     1 
ATOM   3781 O O     . LEU C 2 173 ? 26.405  87.468  53.389 1.00 69.89  ? 173 LEU C O     1 
ATOM   3782 C CB    . LEU C 2 173 ? 29.065  85.904  54.402 1.00 63.66  ? 173 LEU C CB    1 
ATOM   3783 C CG    . LEU C 2 173 ? 29.705  84.518  54.317 1.00 63.66  ? 173 LEU C CG    1 
ATOM   3784 C CD1   . LEU C 2 173 ? 29.581  83.882  55.679 1.00 63.66  ? 173 LEU C CD1   1 
ATOM   3785 C CD2   . LEU C 2 173 ? 29.021  83.630  53.246 1.00 63.66  ? 173 LEU C CD2   1 
ATOM   3786 N N     . ALA C 2 174 ? 28.270  88.763  53.389 1.00 69.46  ? 174 ALA C N     1 
ATOM   3787 C CA    . ALA C 2 174 ? 27.563  90.015  53.587 1.00 69.46  ? 174 ALA C CA    1 
ATOM   3788 C C     . ALA C 2 174 ? 26.725  90.206  52.337 1.00 69.46  ? 174 ALA C C     1 
ATOM   3789 O O     . ALA C 2 174 ? 25.555  90.615  52.399 1.00 69.46  ? 174 ALA C O     1 
ATOM   3790 C CB    . ALA C 2 174 ? 28.552  91.138  53.738 1.00 57.74  ? 174 ALA C CB    1 
ATOM   3791 N N     . GLN C 2 175 ? 27.350  89.890  51.205 1.00 99.63  ? 175 GLN C N     1 
ATOM   3792 C CA    . GLN C 2 175 ? 26.714  89.972  49.902 1.00 99.63  ? 175 GLN C CA    1 
ATOM   3793 C C     . GLN C 2 175 ? 25.421  89.190  49.965 1.00 99.63  ? 175 GLN C C     1 
ATOM   3794 O O     . GLN C 2 175 ? 24.337  89.738  49.754 1.00 99.63  ? 175 GLN C O     1 
ATOM   3795 C CB    . GLN C 2 175 ? 27.621  89.368  48.833 1.00 94.96  ? 175 GLN C CB    1 
ATOM   3796 C CG    . GLN C 2 175 ? 26.873  88.844  47.615 1.00 94.96  ? 175 GLN C CG    1 
ATOM   3797 C CD    . GLN C 2 175 ? 27.792  88.601  46.437 1.00 94.96  ? 175 GLN C CD    1 
ATOM   3798 O OE1   . GLN C 2 175 ? 28.996  88.406  46.608 1.00 94.96  ? 175 GLN C OE1   1 
ATOM   3799 N NE2   . GLN C 2 175 ? 27.227  88.600  45.232 1.00 94.96  ? 175 GLN C NE2   1 
ATOM   3800 N N     . GLY C 2 176 ? 25.541  87.899  50.246 1.00 77.80  ? 176 GLY C N     1 
ATOM   3801 C CA    . GLY C 2 176 ? 24.348  87.094  50.351 1.00 77.80  ? 176 GLY C CA    1 
ATOM   3802 C C     . GLY C 2 176 ? 23.337  87.840  51.204 1.00 77.80  ? 176 GLY C C     1 
ATOM   3803 O O     . GLY C 2 176 ? 22.267  88.228  50.729 1.00 77.80  ? 176 GLY C O     1 
ATOM   3804 N N     . VAL C 2 177 ? 23.692  88.062  52.464 1.00 79.96  ? 177 VAL C N     1 
ATOM   3805 C CA    . VAL C 2 177 ? 22.816  88.760  53.390 1.00 79.96  ? 177 VAL C CA    1 
ATOM   3806 C C     . VAL C 2 177 ? 21.947  89.811  52.716 1.00 79.96  ? 177 VAL C C     1 
ATOM   3807 O O     . VAL C 2 177 ? 20.771  89.970  53.061 1.00 79.96  ? 177 VAL C O     1 
ATOM   3808 C CB    . VAL C 2 177 ? 23.623  89.439  54.488 1.00 123.09 ? 177 VAL C CB    1 
ATOM   3809 C CG1   . VAL C 2 177 ? 22.684  90.174  55.441 1.00 123.09 ? 177 VAL C CG1   1 
ATOM   3810 C CG2   . VAL C 2 177 ? 24.448  88.395  55.223 1.00 123.09 ? 177 VAL C CG2   1 
ATOM   3811 N N     . MET C 2 178 ? 22.527  90.529  51.759 1.00 134.70 ? 178 MET C N     1 
ATOM   3812 C CA    . MET C 2 178 ? 21.792  91.564  51.042 1.00 134.70 ? 178 MET C CA    1 
ATOM   3813 C C     . MET C 2 178 ? 20.559  90.973  50.372 1.00 134.70 ? 178 MET C C     1 
ATOM   3814 O O     . MET C 2 178 ? 19.430  91.370  50.659 1.00 134.70 ? 178 MET C O     1 
ATOM   3815 C CB    . MET C 2 178 ? 22.685  92.225  49.985 1.00 199.89 ? 178 MET C CB    1 
ATOM   3816 C CG    . MET C 2 178 ? 22.013  93.369  49.227 1.00 199.89 ? 178 MET C CG    1 
ATOM   3817 S SD    . MET C 2 178 ? 23.078  94.142  47.979 1.00 199.89 ? 178 MET C SD    1 
ATOM   3818 C CE    . MET C 2 178 ? 22.596  93.229  46.504 1.00 199.89 ? 178 MET C CE    1 
ATOM   3819 N N     . ARG C 2 179 ? 20.777  90.017  49.477 1.00 163.81 ? 179 ARG C N     1 
ATOM   3820 C CA    . ARG C 2 179 ? 19.670  89.387  48.776 1.00 163.81 ? 179 ARG C CA    1 
ATOM   3821 C C     . ARG C 2 179 ? 18.718  88.811  49.823 1.00 163.81 ? 179 ARG C C     1 
ATOM   3822 O O     . ARG C 2 179 ? 17.551  88.538  49.538 1.00 163.81 ? 179 ARG C O     1 
ATOM   3823 C CB    . ARG C 2 179 ? 20.198  88.284  47.849 1.00 200.00 ? 179 ARG C CB    1 
ATOM   3824 C CG    . ARG C 2 179 ? 19.323  87.998  46.627 1.00 200.00 ? 179 ARG C CG    1 
ATOM   3825 C CD    . ARG C 2 179 ? 19.204  89.212  45.693 1.00 200.00 ? 179 ARG C CD    1 
ATOM   3826 N NE    . ARG C 2 179 ? 20.485  89.631  45.121 1.00 200.00 ? 179 ARG C NE    1 
ATOM   3827 C CZ    . ARG C 2 179 ? 20.634  90.649  44.275 1.00 200.00 ? 179 ARG C CZ    1 
ATOM   3828 N NH1   . ARG C 2 179 ? 19.585  91.364  43.891 1.00 200.00 ? 179 ARG C NH1   1 
ATOM   3829 N NH2   . ARG C 2 179 ? 21.838  90.959  43.813 1.00 200.00 ? 179 ARG C NH2   1 
ATOM   3830 N N     . ASP C 2 180 ? 19.226  88.649  51.042 1.00 145.16 ? 180 ASP C N     1 
ATOM   3831 C CA    . ASP C 2 180 ? 18.433  88.114  52.142 1.00 145.16 ? 180 ASP C CA    1 
ATOM   3832 C C     . ASP C 2 180 ? 17.667  89.245  52.811 1.00 145.16 ? 180 ASP C C     1 
ATOM   3833 O O     . ASP C 2 180 ? 16.942  89.027  53.779 1.00 145.16 ? 180 ASP C O     1 
ATOM   3834 C CB    . ASP C 2 180 ? 19.335  87.436  53.174 1.00 102.42 ? 180 ASP C CB    1 
ATOM   3835 C CG    . ASP C 2 180 ? 20.359  86.527  52.539 1.00 102.42 ? 180 ASP C CG    1 
ATOM   3836 O OD1   . ASP C 2 180 ? 21.115  85.867  53.280 1.00 102.42 ? 180 ASP C OD1   1 
ATOM   3837 O OD2   . ASP C 2 180 ? 20.414  86.477  51.295 1.00 102.42 ? 180 ASP C OD2   1 
ATOM   3838 N N     . ALA C 2 181 ? 17.846  90.458  52.300 1.00 158.69 ? 181 ALA C N     1 
ATOM   3839 C CA    . ALA C 2 181 ? 17.159  91.623  52.841 1.00 158.69 ? 181 ALA C CA    1 
ATOM   3840 C C     . ALA C 2 181 ? 15.787  91.706  52.195 1.00 158.69 ? 181 ALA C C     1 
ATOM   3841 O O     . ALA C 2 181 ? 14.943  92.515  52.586 1.00 158.69 ? 181 ALA C O     1 
ATOM   3842 C CB    . ALA C 2 181 ? 17.948  92.882  52.547 1.00 180.43 ? 181 ALA C CB    1 
ATOM   3843 N N     . ARG C 2 182 ? 15.582  90.858  51.194 1.00 177.37 ? 182 ARG C N     1 
ATOM   3844 C CA    . ARG C 2 182 ? 14.324  90.801  50.469 1.00 177.37 ? 182 ARG C CA    1 
ATOM   3845 C C     . ARG C 2 182 ? 13.631  89.509  50.894 1.00 177.37 ? 182 ARG C C     1 
ATOM   3846 O O     . ARG C 2 182 ? 13.605  88.525  50.154 1.00 177.37 ? 182 ARG C O     1 
ATOM   3847 C CB    . ARG C 2 182 ? 14.603  90.810  48.963 1.00 123.18 ? 182 ARG C CB    1 
ATOM   3848 C CG    . ARG C 2 182 ? 15.747  91.751  48.578 1.00 123.18 ? 182 ARG C CG    1 
ATOM   3849 C CD    . ARG C 2 182 ? 15.937  91.886  47.068 1.00 123.18 ? 182 ARG C CD    1 
ATOM   3850 N NE    . ARG C 2 182 ? 17.186  92.580  46.744 1.00 123.18 ? 182 ARG C NE    1 
ATOM   3851 C CZ    . ARG C 2 182 ? 17.589  92.880  45.510 1.00 123.18 ? 182 ARG C CZ    1 
ATOM   3852 N NH1   . ARG C 2 182 ? 16.842  92.555  44.462 1.00 123.18 ? 182 ARG C NH1   1 
ATOM   3853 N NH2   . ARG C 2 182 ? 18.752  93.495  45.321 1.00 123.18 ? 182 ARG C NH2   1 
ATOM   3854 N N     . LEU C 2 183 ? 13.086  89.523  52.106 1.00 184.93 ? 183 LEU C N     1 
ATOM   3855 C CA    . LEU C 2 183 ? 12.403  88.364  52.668 1.00 184.93 ? 183 LEU C CA    1 
ATOM   3856 C C     . LEU C 2 183 ? 10.940  88.667  52.976 1.00 184.93 ? 183 LEU C C     1 
ATOM   3857 O O     . LEU C 2 183 ? 10.082  88.568  52.098 1.00 184.93 ? 183 LEU C O     1 
ATOM   3858 C CB    . LEU C 2 183 ? 13.114  87.914  53.945 1.00 112.78 ? 183 LEU C CB    1 
ATOM   3859 C CG    . LEU C 2 183 ? 14.588  87.545  53.782 1.00 112.78 ? 183 LEU C CG    1 
ATOM   3860 C CD1   . LEU C 2 183 ? 15.196  87.285  55.149 1.00 112.78 ? 183 LEU C CD1   1 
ATOM   3861 C CD2   . LEU C 2 183 ? 14.722  86.323  52.881 1.00 112.78 ? 183 LEU C CD2   1 
ATOM   3862 N N     . LEU C 2 184 ? 10.659  89.034  54.224 1.00 163.65 ? 184 LEU C N     1 
ATOM   3863 C CA    . LEU C 2 184 ? 9.294   89.345  54.629 1.00 163.65 ? 184 LEU C CA    1 
ATOM   3864 C C     . LEU C 2 184 ? 9.154   90.529  55.590 1.00 163.65 ? 184 LEU C C     1 
ATOM   3865 O O     . LEU C 2 184 ? 8.973   90.346  56.795 1.00 163.65 ? 184 LEU C O     1 
ATOM   3866 C CB    . LEU C 2 184 ? 8.630   88.104  55.242 1.00 174.79 ? 184 LEU C CB    1 
ATOM   3867 C CG    . LEU C 2 184 ? 8.248   86.966  54.287 1.00 174.79 ? 184 LEU C CG    1 
ATOM   3868 C CD1   . LEU C 2 184 ? 7.642   85.812  55.076 1.00 174.79 ? 184 LEU C CD1   1 
ATOM   3869 C CD2   . LEU C 2 184 ? 7.257   87.476  53.249 1.00 174.79 ? 184 LEU C CD2   1 
ATOM   3870 N N     . GLY C 2 185 ? 9.243   91.740  55.046 1.00 161.99 ? 185 GLY C N     1 
ATOM   3871 C CA    . GLY C 2 185 ? 9.084   92.937  55.854 1.00 161.99 ? 185 GLY C CA    1 
ATOM   3872 C C     . GLY C 2 185 ? 10.303  93.492  56.568 1.00 161.99 ? 185 GLY C C     1 
ATOM   3873 O O     . GLY C 2 185 ? 10.239  93.747  57.769 1.00 161.99 ? 185 GLY C O     1 
ATOM   3874 N N     . VAL C 2 186 ? 11.403  93.696  55.845 1.00 107.07 ? 186 VAL C N     1 
ATOM   3875 C CA    . VAL C 2 186 ? 12.617  94.243  56.448 1.00 107.07 ? 186 VAL C CA    1 
ATOM   3876 C C     . VAL C 2 186 ? 13.635  94.727  55.411 1.00 107.07 ? 186 VAL C C     1 
ATOM   3877 O O     . VAL C 2 186 ? 13.939  94.035  54.436 1.00 107.07 ? 186 VAL C O     1 
ATOM   3878 C CB    . VAL C 2 186 ? 13.296  93.206  57.375 1.00 117.46 ? 186 VAL C CB    1 
ATOM   3879 C CG1   . VAL C 2 186 ? 13.801  92.033  56.562 1.00 117.46 ? 186 VAL C CG1   1 
ATOM   3880 C CG2   . VAL C 2 186 ? 14.433  93.856  58.143 1.00 117.46 ? 186 VAL C CG2   1 
ATOM   3881 N N     . ARG C 2 187 ? 14.150  95.932  55.637 1.00 89.91  ? 187 ARG C N     1 
ATOM   3882 C CA    . ARG C 2 187 ? 15.140  96.545  54.752 1.00 89.91  ? 187 ARG C CA    1 
ATOM   3883 C C     . ARG C 2 187 ? 16.401  96.858  55.531 1.00 89.91  ? 187 ARG C C     1 
ATOM   3884 O O     . ARG C 2 187 ? 16.359  97.552  56.549 1.00 89.91  ? 187 ARG C O     1 
ATOM   3885 C CB    . ARG C 2 187 ? 14.586  97.843  54.144 1.00 138.89 ? 187 ARG C CB    1 
ATOM   3886 C CG    . ARG C 2 187 ? 15.630  98.935  53.834 1.00 138.89 ? 187 ARG C CG    1 
ATOM   3887 C CD    . ARG C 2 187 ? 16.208  98.881  52.413 1.00 138.89 ? 187 ARG C CD    1 
ATOM   3888 N NE    . ARG C 2 187 ? 17.236  97.858  52.221 1.00 138.89 ? 187 ARG C NE    1 
ATOM   3889 C CZ    . ARG C 2 187 ? 17.957  97.727  51.108 1.00 138.89 ? 187 ARG C CZ    1 
ATOM   3890 N NH1   . ARG C 2 187 ? 17.765  98.554  50.089 1.00 138.89 ? 187 ARG C NH1   1 
ATOM   3891 N NH2   . ARG C 2 187 ? 18.868  96.767  51.009 1.00 138.89 ? 187 ARG C NH2   1 
ATOM   3892 N N     . ILE C 2 188 ? 17.521  96.337  55.053 1.00 72.27  ? 188 ILE C N     1 
ATOM   3893 C CA    . ILE C 2 188 ? 18.793  96.585  55.710 1.00 72.27  ? 188 ILE C CA    1 
ATOM   3894 C C     . ILE C 2 188 ? 19.712  97.224  54.704 1.00 72.27  ? 188 ILE C C     1 
ATOM   3895 O O     . ILE C 2 188 ? 19.550  97.023  53.500 1.00 72.27  ? 188 ILE C O     1 
ATOM   3896 C CB    . ILE C 2 188 ? 19.469  95.288  56.217 1.00 150.45 ? 188 ILE C CB    1 
ATOM   3897 C CG1   . ILE C 2 188 ? 20.801  95.627  56.898 1.00 150.45 ? 188 ILE C CG1   1 
ATOM   3898 C CG2   . ILE C 2 188 ? 19.697  94.335  55.065 1.00 150.45 ? 188 ILE C CG2   1 
ATOM   3899 C CD1   . ILE C 2 188 ? 21.546  94.435  57.441 1.00 150.45 ? 188 ILE C CD1   1 
ATOM   3900 N N     . THR C 2 189 ? 20.672  97.996  55.200 1.00 152.34 ? 189 THR C N     1 
ATOM   3901 C CA    . THR C 2 189 ? 21.625  98.661  54.331 1.00 152.34 ? 189 THR C CA    1 
ATOM   3902 C C     . THR C 2 189 ? 22.913  97.845  54.200 1.00 152.34 ? 189 THR C C     1 
ATOM   3903 O O     . THR C 2 189 ? 23.193  96.961  55.017 1.00 152.34 ? 189 THR C O     1 
ATOM   3904 C CB    . THR C 2 189 ? 21.930  100.082 54.837 1.00 74.80  ? 189 THR C CB    1 
ATOM   3905 O OG1   . THR C 2 189 ? 23.037  100.619 54.107 1.00 74.80  ? 189 THR C OG1   1 
ATOM   3906 C CG2   . THR C 2 189 ? 22.237  100.069 56.307 1.00 74.80  ? 189 THR C CG2   1 
ATOM   3907 N N     . GLU C 2 190 ? 23.683  98.148  53.156 1.00 99.24  ? 190 GLU C N     1 
ATOM   3908 C CA    . GLU C 2 190 ? 24.921  97.438  52.856 1.00 99.24  ? 190 GLU C CA    1 
ATOM   3909 C C     . GLU C 2 190 ? 25.970  97.519  53.946 1.00 99.24  ? 190 GLU C C     1 
ATOM   3910 O O     . GLU C 2 190 ? 26.087  96.610  54.763 1.00 99.24  ? 190 GLU C O     1 
ATOM   3911 C CB    . GLU C 2 190 ? 25.508  97.946  51.534 1.00 193.58 ? 190 GLU C CB    1 
ATOM   3912 C CG    . GLU C 2 190 ? 26.695  97.134  51.008 1.00 193.58 ? 190 GLU C CG    1 
ATOM   3913 C CD    . GLU C 2 190 ? 26.348  95.678  50.717 1.00 193.58 ? 190 GLU C CD    1 
ATOM   3914 O OE1   . GLU C 2 190 ? 26.063  94.926  51.673 1.00 193.58 ? 190 GLU C OE1   1 
ATOM   3915 O OE2   . GLU C 2 190 ? 26.360  95.284  49.530 1.00 193.58 ? 190 GLU C OE2   1 
ATOM   3916 N N     . GLU C 2 191 ? 26.745  98.597  53.942 1.00 123.30 ? 191 GLU C N     1 
ATOM   3917 C CA    . GLU C 2 191 ? 27.791  98.789  54.937 1.00 123.30 ? 191 GLU C CA    1 
ATOM   3918 C C     . GLU C 2 191 ? 27.377  98.166  56.262 1.00 123.30 ? 191 GLU C C     1 
ATOM   3919 O O     . GLU C 2 191 ? 28.166  97.486  56.920 1.00 123.30 ? 191 GLU C O     1 
ATOM   3920 C CB    . GLU C 2 191 ? 28.078  100.283 55.103 1.00 108.99 ? 191 GLU C CB    1 
ATOM   3921 C CG    . GLU C 2 191 ? 26.910  101.188 54.744 1.00 108.99 ? 191 GLU C CG    1 
ATOM   3922 C CD    . GLU C 2 191 ? 25.891  101.310 55.857 1.00 108.99 ? 191 GLU C CD    1 
ATOM   3923 O OE1   . GLU C 2 191 ? 26.162  102.026 56.847 1.00 108.99 ? 191 GLU C OE1   1 
ATOM   3924 O OE2   . GLU C 2 191 ? 24.819  100.685 55.740 1.00 108.99 ? 191 GLU C OE2   1 
ATOM   3925 N N     . ALA C 2 192 ? 26.124  98.390  56.637 1.00 69.43  ? 192 ALA C N     1 
ATOM   3926 C CA    . ALA C 2 192 ? 25.591  97.843  57.876 1.00 69.43  ? 192 ALA C CA    1 
ATOM   3927 C C     . ALA C 2 192 ? 25.728  96.355  57.745 1.00 69.43  ? 192 ALA C C     1 
ATOM   3928 O O     . ALA C 2 192 ? 26.459  95.725  58.493 1.00 69.43  ? 192 ALA C O     1 
ATOM   3929 C CB    . ALA C 2 192 ? 24.134  98.215  58.029 1.00 39.25  ? 192 ALA C CB    1 
ATOM   3930 N N     . ALA C 2 193 ? 25.012  95.808  56.769 1.00 194.52 ? 193 ALA C N     1 
ATOM   3931 C CA    . ALA C 2 193 ? 25.043  94.387  56.492 1.00 194.52 ? 193 ALA C CA    1 
ATOM   3932 C C     . ALA C 2 193 ? 26.491  93.898  56.490 1.00 194.52 ? 193 ALA C C     1 
ATOM   3933 O O     . ALA C 2 193 ? 26.745  92.716  56.725 1.00 194.52 ? 193 ALA C O     1 
ATOM   3934 C CB    . ALA C 2 193 ? 24.381  94.109  55.151 1.00 107.04 ? 193 ALA C CB    1 
ATOM   3935 N N     . LEU C 2 194 ? 27.440  94.797  56.223 1.00 61.94  ? 194 LEU C N     1 
ATOM   3936 C CA    . LEU C 2 194 ? 28.844  94.399  56.243 1.00 61.94  ? 194 LEU C CA    1 
ATOM   3937 C C     . LEU C 2 194 ? 29.163  94.007  57.667 1.00 61.94  ? 194 LEU C C     1 
ATOM   3938 O O     . LEU C 2 194 ? 29.971  93.120  57.894 1.00 61.94  ? 194 LEU C O     1 
ATOM   3939 C CB    . LEU C 2 194 ? 29.780  95.531  55.796 1.00 64.54  ? 194 LEU C CB    1 
ATOM   3940 C CG    . LEU C 2 194 ? 30.064  95.671  54.294 1.00 64.54  ? 194 LEU C CG    1 
ATOM   3941 C CD1   . LEU C 2 194 ? 30.777  94.433  53.758 1.00 64.54  ? 194 LEU C CD1   1 
ATOM   3942 C CD2   . LEU C 2 194 ? 28.745  95.883  53.558 1.00 64.54  ? 194 LEU C CD2   1 
ATOM   3943 N N     . GLU C 2 195 ? 28.522  94.672  58.624 1.00 103.93 ? 195 GLU C N     1 
ATOM   3944 C CA    . GLU C 2 195 ? 28.719  94.364  60.040 1.00 103.93 ? 195 GLU C CA    1 
ATOM   3945 C C     . GLU C 2 195 ? 28.455  92.870  60.193 1.00 103.93 ? 195 GLU C C     1 
ATOM   3946 O O     . GLU C 2 195 ? 29.368  92.094  60.479 1.00 103.93 ? 195 GLU C O     1 
ATOM   3947 C CB    . GLU C 2 195 ? 27.730  95.158  60.901 1.00 178.42 ? 195 GLU C CB    1 
ATOM   3948 C CG    . GLU C 2 195 ? 28.006  96.655  60.959 1.00 178.42 ? 195 GLU C CG    1 
ATOM   3949 C CD    . GLU C 2 195 ? 29.153  97.003  61.882 1.00 178.42 ? 195 GLU C CD    1 
ATOM   3950 O OE1   . GLU C 2 195 ? 30.251  96.434  61.718 1.00 178.42 ? 195 GLU C OE1   1 
ATOM   3951 O OE2   . GLU C 2 195 ? 28.958  97.858  62.771 1.00 178.42 ? 195 GLU C OE2   1 
ATOM   3952 N N     . ILE C 2 196 ? 27.194  92.488  60.001 1.00 73.72  ? 196 ILE C N     1 
ATOM   3953 C CA    . ILE C 2 196 ? 26.764  91.094  60.056 1.00 73.72  ? 196 ILE C CA    1 
ATOM   3954 C C     . ILE C 2 196 ? 27.818  90.248  59.345 1.00 73.72  ? 196 ILE C C     1 
ATOM   3955 O O     . ILE C 2 196 ? 28.390  89.326  59.921 1.00 73.72  ? 196 ILE C O     1 
ATOM   3956 C CB    . ILE C 2 196 ? 25.434  90.928  59.314 1.00 71.19  ? 196 ILE C CB    1 
ATOM   3957 C CG1   . ILE C 2 196 ? 24.360  91.752  60.018 1.00 71.19  ? 196 ILE C CG1   1 
ATOM   3958 C CG2   . ILE C 2 196 ? 25.080  89.466  59.194 1.00 71.19  ? 196 ILE C CG2   1 
ATOM   3959 C CD1   . ILE C 2 196 ? 23.220  92.141  59.123 1.00 71.19  ? 196 ILE C CD1   1 
ATOM   3960 N N     . GLY C 2 197 ? 28.069  90.585  58.087 1.00 55.25  ? 197 GLY C N     1 
ATOM   3961 C CA    . GLY C 2 197 ? 29.059  89.880  57.298 1.00 55.25  ? 197 GLY C CA    1 
ATOM   3962 C C     . GLY C 2 197 ? 30.261  89.310  58.032 1.00 55.25  ? 197 GLY C C     1 
ATOM   3963 O O     . GLY C 2 197 ? 30.580  88.135  57.850 1.00 55.25  ? 197 GLY C O     1 
ATOM   3964 N N     . ARG C 2 198 ? 30.931  90.106  58.861 1.00 106.99 ? 198 ARG C N     1 
ATOM   3965 C CA    . ARG C 2 198 ? 32.111  89.607  59.559 1.00 106.99 ? 198 ARG C CA    1 
ATOM   3966 C C     . ARG C 2 198 ? 31.847  88.962  60.914 1.00 106.99 ? 198 ARG C C     1 
ATOM   3967 O O     . ARG C 2 198 ? 32.776  88.652  61.653 1.00 106.99 ? 198 ARG C O     1 
ATOM   3968 C CB    . ARG C 2 198 ? 33.155  90.716  59.702 1.00 111.03 ? 198 ARG C CB    1 
ATOM   3969 C CG    . ARG C 2 198 ? 34.542  90.222  60.109 1.00 111.03 ? 198 ARG C CG    1 
ATOM   3970 C CD    . ARG C 2 198 ? 34.807  90.463  61.587 1.00 111.03 ? 198 ARG C CD    1 
ATOM   3971 N NE    . ARG C 2 198 ? 36.044  89.844  62.056 1.00 111.03 ? 198 ARG C NE    1 
ATOM   3972 C CZ    . ARG C 2 198 ? 37.249  90.092  61.552 1.00 111.03 ? 198 ARG C CZ    1 
ATOM   3973 N NH1   . ARG C 2 198 ? 37.394  90.950  60.555 1.00 111.03 ? 198 ARG C NH1   1 
ATOM   3974 N NH2   . ARG C 2 198 ? 38.314  89.480  62.048 1.00 111.03 ? 198 ARG C NH2   1 
ATOM   3975 N N     . ARG C 2 199 ? 30.583  88.755  61.250 1.00 199.54 ? 199 ARG C N     1 
ATOM   3976 C CA    . ARG C 2 199 ? 30.271  88.096  62.508 1.00 199.54 ? 199 ARG C CA    1 
ATOM   3977 C C     . ARG C 2 199 ? 29.784  86.689  62.178 1.00 199.54 ? 199 ARG C C     1 
ATOM   3978 O O     . ARG C 2 199 ? 29.526  85.875  63.067 1.00 199.54 ? 199 ARG C O     1 
ATOM   3979 C CB    . ARG C 2 199 ? 29.220  88.884  63.294 1.00 161.03 ? 199 ARG C CB    1 
ATOM   3980 C CG    . ARG C 2 199 ? 29.781  90.140  63.974 1.00 161.03 ? 199 ARG C CG    1 
ATOM   3981 C CD    . ARG C 2 199 ? 30.148  91.223  62.961 1.00 161.03 ? 199 ARG C CD    1 
ATOM   3982 N NE    . ARG C 2 199 ? 30.825  92.372  63.559 1.00 161.03 ? 199 ARG C NE    1 
ATOM   3983 C CZ    . ARG C 2 199 ? 30.391  93.031  64.629 1.00 161.03 ? 199 ARG C CZ    1 
ATOM   3984 N NH1   . ARG C 2 199 ? 29.276  92.661  65.239 1.00 161.03 ? 199 ARG C NH1   1 
ATOM   3985 N NH2   . ARG C 2 199 ? 31.073  94.070  65.088 1.00 161.03 ? 199 ARG C NH2   1 
ATOM   3986 N N     . SER C 2 200 ? 29.675  86.420  60.877 1.00 54.74  ? 200 SER C N     1 
ATOM   3987 C CA    . SER C 2 200 ? 29.260  85.115  60.367 1.00 54.74  ? 200 SER C CA    1 
ATOM   3988 C C     . SER C 2 200 ? 30.576  84.557  59.868 1.00 54.74  ? 200 SER C C     1 
ATOM   3989 O O     . SER C 2 200 ? 30.864  84.598  58.688 1.00 54.74  ? 200 SER C O     1 
ATOM   3990 C CB    . SER C 2 200 ? 28.264  85.290  59.229 1.00 62.63  ? 200 SER C CB    1 
ATOM   3991 O OG    . SER C 2 200 ? 27.087  85.907  59.718 1.00 62.63  ? 200 SER C OG    1 
ATOM   3992 N N     . ARG C 2 201 ? 31.361  84.063  60.819 1.00 68.58  ? 201 ARG C N     1 
ATOM   3993 C CA    . ARG C 2 201 ? 32.685  83.471  60.633 1.00 68.58  ? 201 ARG C CA    1 
ATOM   3994 C C     . ARG C 2 201 ? 32.869  82.718  59.316 1.00 68.58  ? 201 ARG C C     1 
ATOM   3995 O O     . ARG C 2 201 ? 33.050  81.495  59.304 1.00 68.58  ? 201 ARG C O     1 
ATOM   3996 C CB    . ARG C 2 201 ? 32.917  82.517  61.814 1.00 80.08  ? 201 ARG C CB    1 
ATOM   3997 C CG    . ARG C 2 201 ? 32.713  83.150  63.214 1.00 80.08  ? 201 ARG C CG    1 
ATOM   3998 C CD    . ARG C 2 201 ? 31.237  83.388  63.592 1.00 80.08  ? 201 ARG C CD    1 
ATOM   3999 N NE    . ARG C 2 201 ? 30.764  82.482  64.641 1.00 80.08  ? 201 ARG C NE    1 
ATOM   4000 C CZ    . ARG C 2 201 ? 31.139  82.536  65.916 1.00 80.08  ? 201 ARG C CZ    1 
ATOM   4001 N NH1   . ARG C 2 201 ? 31.994  83.456  66.321 1.00 80.08  ? 201 ARG C NH1   1 
ATOM   4002 N NH2   . ARG C 2 201 ? 30.654  81.665  66.789 1.00 80.08  ? 201 ARG C NH2   1 
ATOM   4003 N N     . GLY C 2 202 ? 32.850  83.460  58.211 1.00 109.23 ? 202 GLY C N     1 
ATOM   4004 C CA    . GLY C 2 202 ? 33.000  82.861  56.892 1.00 109.23 ? 202 GLY C CA    1 
ATOM   4005 C C     . GLY C 2 202 ? 32.056  81.696  56.704 1.00 109.23 ? 202 GLY C C     1 
ATOM   4006 O O     . GLY C 2 202 ? 32.456  80.668  56.179 1.00 109.23 ? 202 GLY C O     1 
ATOM   4007 N N     . THR C 2 203 ? 30.801  81.873  57.121 1.00 40.07  ? 203 THR C N     1 
ATOM   4008 C CA    . THR C 2 203 ? 29.783  80.826  57.047 1.00 40.07  ? 203 THR C CA    1 
ATOM   4009 C C     . THR C 2 203 ? 28.335  81.340  56.876 1.00 40.07  ? 203 THR C C     1 
ATOM   4010 O O     . THR C 2 203 ? 27.824  82.088  57.706 1.00 40.07  ? 203 THR C O     1 
ATOM   4011 C CB    . THR C 2 203 ? 29.852  79.937  58.326 1.00 90.20  ? 203 THR C CB    1 
ATOM   4012 O OG1   . THR C 2 203 ? 31.170  79.384  58.464 1.00 90.20  ? 203 THR C OG1   1 
ATOM   4013 C CG2   . THR C 2 203 ? 28.841  78.809  58.258 1.00 90.20  ? 203 THR C CG2   1 
ATOM   4014 N N     . MET C 2 204 ? 27.672  80.919  55.803 1.00 58.74  ? 204 MET C N     1 
ATOM   4015 C CA    . MET C 2 204 ? 26.296  81.338  55.551 1.00 58.74  ? 204 MET C CA    1 
ATOM   4016 C C     . MET C 2 204 ? 25.416  80.917  56.718 1.00 58.74  ? 204 MET C C     1 
ATOM   4017 O O     . MET C 2 204 ? 24.483  81.622  57.094 1.00 58.74  ? 204 MET C O     1 
ATOM   4018 C CB    . MET C 2 204 ? 25.749  80.687  54.275 1.00 92.58  ? 204 MET C CB    1 
ATOM   4019 C CG    . MET C 2 204 ? 26.528  80.958  52.988 1.00 92.58  ? 204 MET C CG    1 
ATOM   4020 S SD    . MET C 2 204 ? 26.214  82.551  52.202 1.00 92.58  ? 204 MET C SD    1 
ATOM   4021 C CE    . MET C 2 204 ? 24.390  82.508  52.079 1.00 92.58  ? 204 MET C CE    1 
ATOM   4022 N N     . ARG C 2 205 ? 25.711  79.747  57.275 1.00 106.60 ? 205 ARG C N     1 
ATOM   4023 C CA    . ARG C 2 205 ? 24.947  79.211  58.394 1.00 106.60 ? 205 ARG C CA    1 
ATOM   4024 C C     . ARG C 2 205 ? 24.913  80.266  59.489 1.00 106.60 ? 205 ARG C C     1 
ATOM   4025 O O     . ARG C 2 205 ? 23.852  80.800  59.817 1.00 106.60 ? 205 ARG C O     1 
ATOM   4026 C CB    . ARG C 2 205 ? 25.602  77.915  58.896 1.00 176.39 ? 205 ARG C CB    1 
ATOM   4027 C CG    . ARG C 2 205 ? 24.716  77.037  59.776 1.00 176.39 ? 205 ARG C CG    1 
ATOM   4028 C CD    . ARG C 2 205 ? 25.003  77.232  61.259 1.00 176.39 ? 205 ARG C CD    1 
ATOM   4029 N NE    . ARG C 2 205 ? 26.356  76.811  61.620 1.00 176.39 ? 205 ARG C NE    1 
ATOM   4030 C CZ    . ARG C 2 205 ? 26.863  76.883  62.848 1.00 176.39 ? 205 ARG C CZ    1 
ATOM   4031 N NH1   . ARG C 2 205 ? 26.132  77.361  63.847 1.00 176.39 ? 205 ARG C NH1   1 
ATOM   4032 N NH2   . ARG C 2 205 ? 28.106  76.478  63.079 1.00 176.39 ? 205 ARG C NH2   1 
ATOM   4033 N N     . VAL C 2 206 ? 26.082  80.585  60.036 1.00 98.66  ? 206 VAL C N     1 
ATOM   4034 C CA    . VAL C 2 206 ? 26.176  81.591  61.085 1.00 98.66  ? 206 VAL C CA    1 
ATOM   4035 C C     . VAL C 2 206 ? 25.889  82.943  60.476 1.00 98.66  ? 206 VAL C C     1 
ATOM   4036 O O     . VAL C 2 206 ? 26.024  83.967  61.136 1.00 98.66  ? 206 VAL C O     1 
ATOM   4037 C CB    . VAL C 2 206 ? 27.584  81.654  61.704 1.00 149.52 ? 206 VAL C CB    1 
ATOM   4038 C CG1   . VAL C 2 206 ? 27.936  80.323  62.344 1.00 149.52 ? 206 VAL C CG1   1 
ATOM   4039 C CG2   . VAL C 2 206 ? 28.597  82.023  60.643 1.00 149.52 ? 206 VAL C CG2   1 
ATOM   4040 N N     . ALA C 2 207 ? 25.505  82.943  59.206 1.00 60.89  ? 207 ALA C N     1 
ATOM   4041 C CA    . ALA C 2 207 ? 25.209  84.187  58.514 1.00 60.89  ? 207 ALA C CA    1 
ATOM   4042 C C     . ALA C 2 207 ? 23.724  84.536  58.494 1.00 60.89  ? 207 ALA C C     1 
ATOM   4043 O O     . ALA C 2 207 ? 23.318  85.513  57.886 1.00 60.89  ? 207 ALA C O     1 
ATOM   4044 C CB    . ALA C 2 207 ? 25.755  84.134  57.091 1.00 159.73 ? 207 ALA C CB    1 
ATOM   4045 N N     . LYS C 2 208 ? 22.899  83.754  59.163 1.00 87.98  ? 208 LYS C N     1 
ATOM   4046 C CA    . LYS C 2 208 ? 21.488  84.071  59.152 1.00 87.98  ? 208 LYS C CA    1 
ATOM   4047 C C     . LYS C 2 208 ? 20.938  83.823  60.546 1.00 87.98  ? 208 LYS C C     1 
ATOM   4048 O O     . LYS C 2 208 ? 19.865  84.313  60.904 1.00 87.98  ? 208 LYS C O     1 
ATOM   4049 C CB    . LYS C 2 208 ? 20.792  83.204  58.100 1.00 100.77 ? 208 LYS C CB    1 
ATOM   4050 C CG    . LYS C 2 208 ? 21.534  83.171  56.759 1.00 100.77 ? 208 LYS C CG    1 
ATOM   4051 C CD    . LYS C 2 208 ? 20.858  82.265  55.732 1.00 100.77 ? 208 LYS C CD    1 
ATOM   4052 C CE    . LYS C 2 208 ? 21.729  82.041  54.479 1.00 100.77 ? 208 LYS C CE    1 
ATOM   4053 N NZ    . LYS C 2 208 ? 21.866  83.213  53.563 1.00 100.77 ? 208 LYS C NZ    1 
ATOM   4054 N N     . ARG C 2 209 ? 21.702  83.067  61.329 1.00 128.29 ? 209 ARG C N     1 
ATOM   4055 C CA    . ARG C 2 209 ? 21.327  82.735  62.695 1.00 128.29 ? 209 ARG C CA    1 
ATOM   4056 C C     . ARG C 2 209 ? 20.904  83.995  63.427 1.00 128.29 ? 209 ARG C C     1 
ATOM   4057 O O     . ARG C 2 209 ? 19.811  84.063  63.992 1.00 128.29 ? 209 ARG C O     1 
ATOM   4058 C CB    . ARG C 2 209 ? 22.515  82.108  63.431 1.00 199.70 ? 209 ARG C CB    1 
ATOM   4059 C CG    . ARG C 2 209 ? 23.073  80.854  62.783 1.00 199.70 ? 209 ARG C CG    1 
ATOM   4060 C CD    . ARG C 2 209 ? 22.116  79.670  62.906 1.00 199.70 ? 209 ARG C CD    1 
ATOM   4061 N NE    . ARG C 2 209 ? 22.016  79.163  64.275 1.00 199.70 ? 209 ARG C NE    1 
ATOM   4062 C CZ    . ARG C 2 209 ? 21.335  78.073  64.625 1.00 199.70 ? 209 ARG C CZ    1 
ATOM   4063 N NH1   . ARG C 2 209 ? 20.685  77.366  63.707 1.00 199.70 ? 209 ARG C NH1   1 
ATOM   4064 N NH2   . ARG C 2 209 ? 21.307  77.685  65.894 1.00 199.70 ? 209 ARG C NH2   1 
ATOM   4065 N N     . LEU C 2 210 ? 21.790  84.988  63.392 1.00 81.56  ? 210 LEU C N     1 
ATOM   4066 C CA    . LEU C 2 210 ? 21.606  86.281  64.050 1.00 81.56  ? 210 LEU C CA    1 
ATOM   4067 C C     . LEU C 2 210 ? 20.190  86.871  63.989 1.00 81.56  ? 210 LEU C C     1 
ATOM   4068 O O     . LEU C 2 210 ? 19.627  87.312  64.998 1.00 81.56  ? 210 LEU C O     1 
ATOM   4069 C CB    . LEU C 2 210 ? 22.591  87.301  63.454 1.00 62.16  ? 210 LEU C CB    1 
ATOM   4070 C CG    . LEU C 2 210 ? 23.970  86.765  63.051 1.00 62.16  ? 210 LEU C CG    1 
ATOM   4071 C CD1   . LEU C 2 210 ? 23.846  86.263  61.635 1.00 62.16  ? 210 LEU C CD1   1 
ATOM   4072 C CD2   . LEU C 2 210 ? 25.072  87.829  63.130 1.00 62.16  ? 210 LEU C CD2   1 
ATOM   4073 N N     . PHE C 2 211 ? 19.623  86.854  62.790 1.00 121.16 ? 211 PHE C N     1 
ATOM   4074 C CA    . PHE C 2 211 ? 18.314  87.430  62.517 1.00 121.16 ? 211 PHE C CA    1 
ATOM   4075 C C     . PHE C 2 211 ? 17.145  86.486  62.705 1.00 121.16 ? 211 PHE C C     1 
ATOM   4076 O O     . PHE C 2 211 ? 16.095  86.883  63.205 1.00 121.16 ? 211 PHE C O     1 
ATOM   4077 C CB    . PHE C 2 211 ? 18.366  87.986  61.098 1.00 74.28  ? 211 PHE C CB    1 
ATOM   4078 C CG    . PHE C 2 211 ? 19.705  88.555  60.767 1.00 74.28  ? 211 PHE C CG    1 
ATOM   4079 C CD1   . PHE C 2 211 ? 20.125  89.744  61.352 1.00 74.28  ? 211 PHE C CD1   1 
ATOM   4080 C CD2   . PHE C 2 211 ? 20.619  87.817  60.023 1.00 74.28  ? 211 PHE C CD2   1 
ATOM   4081 C CE1   . PHE C 2 211 ? 21.433  90.180  61.212 1.00 74.28  ? 211 PHE C CE1   1 
ATOM   4082 C CE2   . PHE C 2 211 ? 21.928  88.248  59.880 1.00 74.28  ? 211 PHE C CE2   1 
ATOM   4083 C CZ    . PHE C 2 211 ? 22.333  89.426  60.476 1.00 74.28  ? 211 PHE C CZ    1 
ATOM   4084 N N     . ARG C 2 212 ? 17.321  85.235  62.309 1.00 133.69 ? 212 ARG C N     1 
ATOM   4085 C CA    . ARG C 2 212 ? 16.252  84.261  62.452 1.00 133.69 ? 212 ARG C CA    1 
ATOM   4086 C C     . ARG C 2 212 ? 15.556  84.350  63.812 1.00 133.69 ? 212 ARG C C     1 
ATOM   4087 O O     . ARG C 2 212 ? 14.328  84.272  63.895 1.00 133.69 ? 212 ARG C O     1 
ATOM   4088 C CB    . ARG C 2 212 ? 16.805  82.862  62.191 1.00 128.15 ? 212 ARG C CB    1 
ATOM   4089 C CG    . ARG C 2 212 ? 16.942  82.597  60.704 1.00 128.15 ? 212 ARG C CG    1 
ATOM   4090 C CD    . ARG C 2 212 ? 17.630  81.292  60.399 1.00 128.15 ? 212 ARG C CD    1 
ATOM   4091 N NE    . ARG C 2 212 ? 19.080  81.418  60.454 1.00 128.15 ? 212 ARG C NE    1 
ATOM   4092 C CZ    . ARG C 2 212 ? 19.918  80.482  60.024 1.00 128.15 ? 212 ARG C CZ    1 
ATOM   4093 N NH1   . ARG C 2 212 ? 19.440  79.353  59.511 1.00 128.15 ? 212 ARG C NH1   1 
ATOM   4094 N NH2   . ARG C 2 212 ? 21.229  80.676  60.098 1.00 128.15 ? 212 ARG C NH2   1 
ATOM   4095 N N     . ARG C 2 213 ? 16.336  84.531  64.873 1.00 188.04 ? 213 ARG C N     1 
ATOM   4096 C CA    . ARG C 2 213 ? 15.769  84.659  66.212 1.00 188.04 ? 213 ARG C CA    1 
ATOM   4097 C C     . ARG C 2 213 ? 15.286  86.099  66.404 1.00 188.04 ? 213 ARG C C     1 
ATOM   4098 O O     . ARG C 2 213 ? 14.316  86.348  67.124 1.00 188.04 ? 213 ARG C O     1 
ATOM   4099 C CB    . ARG C 2 213 ? 16.819  84.290  67.273 1.00 171.50 ? 213 ARG C CB    1 
ATOM   4100 C CG    . ARG C 2 213 ? 17.100  85.369  68.321 1.00 171.50 ? 213 ARG C CG    1 
ATOM   4101 C CD    . ARG C 2 213 ? 18.137  84.900  69.341 1.00 171.50 ? 213 ARG C CD    1 
ATOM   4102 N NE    . ARG C 2 213 ? 18.512  85.952  70.286 1.00 171.50 ? 213 ARG C NE    1 
ATOM   4103 C CZ    . ARG C 2 213 ? 19.403  85.800  71.263 1.00 171.50 ? 213 ARG C CZ    1 
ATOM   4104 N NH1   . ARG C 2 213 ? 20.015  84.636  71.430 1.00 171.50 ? 213 ARG C NH1   1 
ATOM   4105 N NH2   . ARG C 2 213 ? 19.686  86.814  72.071 1.00 171.50 ? 213 ARG C NH2   1 
ATOM   4106 N N     . VAL C 2 214 ? 15.971  87.036  65.748 1.00 167.83 ? 214 VAL C N     1 
ATOM   4107 C CA    . VAL C 2 214 ? 15.628  88.459  65.819 1.00 167.83 ? 214 VAL C CA    1 
ATOM   4108 C C     . VAL C 2 214 ? 14.138  88.647  65.548 1.00 167.83 ? 214 VAL C C     1 
ATOM   4109 O O     . VAL C 2 214 ? 13.494  89.531  66.121 1.00 167.83 ? 214 VAL C O     1 
ATOM   4110 C CB    . VAL C 2 214 ? 16.436  89.291  64.775 1.00 112.11 ? 214 VAL C CB    1 
ATOM   4111 C CG1   . VAL C 2 214 ? 15.861  90.694  64.654 1.00 112.11 ? 214 VAL C CG1   1 
ATOM   4112 C CG2   . VAL C 2 214 ? 17.894  89.369  65.185 1.00 112.11 ? 214 VAL C CG2   1 
ATOM   4113 N N     . ARG C 2 215 ? 13.608  87.801  64.669 1.00 135.45 ? 215 ARG C N     1 
ATOM   4114 C CA    . ARG C 2 215 ? 12.204  87.848  64.298 1.00 135.45 ? 215 ARG C CA    1 
ATOM   4115 C C     . ARG C 2 215 ? 11.287  88.007  65.506 1.00 135.45 ? 215 ARG C C     1 
ATOM   4116 O O     . ARG C 2 215 ? 10.709  89.078  65.717 1.00 135.45 ? 215 ARG C O     1 
ATOM   4117 C CB    . ARG C 2 215 ? 11.829  86.592  63.513 1.00 128.41 ? 215 ARG C CB    1 
ATOM   4118 C CG    . ARG C 2 215 ? 12.108  86.694  62.022 1.00 128.41 ? 215 ARG C CG    1 
ATOM   4119 C CD    . ARG C 2 215 ? 13.594  86.732  61.690 1.00 128.41 ? 215 ARG C CD    1 
ATOM   4120 N NE    . ARG C 2 215 ? 13.816  87.220  60.328 1.00 128.41 ? 215 ARG C NE    1 
ATOM   4121 C CZ    . ARG C 2 215 ? 14.940  87.057  59.635 1.00 128.41 ? 215 ARG C CZ    1 
ATOM   4122 N NH1   . ARG C 2 215 ? 15.969  86.408  60.164 1.00 128.41 ? 215 ARG C NH1   1 
ATOM   4123 N NH2   . ARG C 2 215 ? 15.039  87.552  58.408 1.00 128.41 ? 215 ARG C NH2   1 
ATOM   4124 N N     . ASP C 2 216 ? 11.159  86.949  66.303 1.00 176.86 ? 216 ASP C N     1 
ATOM   4125 C CA    . ASP C 2 216 ? 10.296  86.999  67.478 1.00 176.86 ? 216 ASP C CA    1 
ATOM   4126 C C     . ASP C 2 216 ? 10.968  87.660  68.676 1.00 176.86 ? 216 ASP C C     1 
ATOM   4127 O O     . ASP C 2 216 ? 11.267  87.009  69.678 1.00 176.86 ? 216 ASP C O     1 
ATOM   4128 C CB    . ASP C 2 216 ? 9.821   85.595  67.857 1.00 131.09 ? 216 ASP C CB    1 
ATOM   4129 C CG    . ASP C 2 216 ? 8.309   85.502  67.951 1.00 131.09 ? 216 ASP C CG    1 
ATOM   4130 O OD1   . ASP C 2 216 ? 7.802   84.412  68.280 1.00 131.09 ? 216 ASP C OD1   1 
ATOM   4131 O OD2   . ASP C 2 216 ? 7.626   86.518  67.693 1.00 131.09 ? 216 ASP C OD2   1 
ATOM   4132 N N     . PHE C 2 217 ? 11.197  88.964  68.558 1.00 168.58 ? 217 PHE C N     1 
ATOM   4133 C CA    . PHE C 2 217 ? 11.824  89.752  69.612 1.00 168.58 ? 217 PHE C CA    1 
ATOM   4134 C C     . PHE C 2 217 ? 11.095  91.094  69.716 1.00 168.58 ? 217 PHE C C     1 
ATOM   4135 O O     . PHE C 2 217 ? 10.778  91.719  68.702 1.00 168.58 ? 217 PHE C O     1 
ATOM   4136 C CB    . PHE C 2 217 ? 13.308  89.973  69.296 1.00 183.07 ? 217 PHE C CB    1 
ATOM   4137 C CG    . PHE C 2 217 ? 14.234  89.617  70.432 1.00 183.07 ? 217 PHE C CG    1 
ATOM   4138 C CD1   . PHE C 2 217 ? 14.170  90.296  71.646 1.00 183.07 ? 217 PHE C CD1   1 
ATOM   4139 C CD2   . PHE C 2 217 ? 15.162  88.586  70.292 1.00 183.07 ? 217 PHE C CD2   1 
ATOM   4140 C CE1   . PHE C 2 217 ? 15.014  89.955  72.707 1.00 183.07 ? 217 PHE C CE1   1 
ATOM   4141 C CE2   . PHE C 2 217 ? 16.011  88.237  71.345 1.00 183.07 ? 217 PHE C CE2   1 
ATOM   4142 C CZ    . PHE C 2 217 ? 15.935  88.922  72.554 1.00 183.07 ? 217 PHE C CZ    1 
ATOM   4143 N N     . ALA C 2 218 ? 10.839  91.532  70.946 1.00 200.00 ? 218 ALA C N     1 
ATOM   4144 C CA    . ALA C 2 218 ? 10.132  92.786  71.204 1.00 200.00 ? 218 ALA C CA    1 
ATOM   4145 C C     . ALA C 2 218 ? 10.716  94.031  70.532 1.00 200.00 ? 218 ALA C C     1 
ATOM   4146 O O     . ALA C 2 218 ? 10.366  94.358  69.397 1.00 200.00 ? 218 ALA C O     1 
ATOM   4147 C CB    . ALA C 2 218 ? 10.023  93.017  72.714 1.00 196.20 ? 218 ALA C CB    1 
ATOM   4148 N N     . GLN C 2 219 ? 11.597  94.722  71.251 1.00 200.00 ? 219 GLN C N     1 
ATOM   4149 C CA    . GLN C 2 219 ? 12.226  95.952  70.773 1.00 200.00 ? 219 GLN C CA    1 
ATOM   4150 C C     . GLN C 2 219 ? 13.099  95.821  69.526 1.00 200.00 ? 219 GLN C C     1 
ATOM   4151 O O     . GLN C 2 219 ? 14.252  96.255  69.531 1.00 200.00 ? 219 GLN C O     1 
ATOM   4152 C CB    . GLN C 2 219 ? 13.064  96.577  71.902 1.00 179.20 ? 219 GLN C CB    1 
ATOM   4153 C CG    . GLN C 2 219 ? 13.388  98.062  71.723 1.00 179.20 ? 219 GLN C CG    1 
ATOM   4154 C CD    . GLN C 2 219 ? 12.357  98.975  72.374 1.00 179.20 ? 219 GLN C CD    1 
ATOM   4155 O OE1   . GLN C 2 219 ? 12.358  100.188 72.149 1.00 179.20 ? 219 GLN C OE1   1 
ATOM   4156 N NE2   . GLN C 2 219 ? 11.484  98.400  73.195 1.00 179.20 ? 219 GLN C NE2   1 
ATOM   4157 N N     . VAL C 2 220 ? 12.562  95.228  68.466 1.00 200.00 ? 220 VAL C N     1 
ATOM   4158 C CA    . VAL C 2 220 ? 13.241  95.090  67.184 1.00 200.00 ? 220 VAL C CA    1 
ATOM   4159 C C     . VAL C 2 220 ? 12.245  95.122  66.023 1.00 200.00 ? 220 VAL C C     1 
ATOM   4160 O O     . VAL C 2 220 ? 12.587  95.352  64.869 1.00 200.00 ? 220 VAL C O     1 
ATOM   4161 C CB    . VAL C 2 220 ? 14.004  93.765  67.183 1.00 184.53 ? 220 VAL C CB    1 
ATOM   4162 C CG1   . VAL C 2 220 ? 13.266  92.744  66.317 1.00 184.53 ? 220 VAL C CG1   1 
ATOM   4163 C CG2   . VAL C 2 220 ? 15.401  93.973  66.626 1.00 184.53 ? 220 VAL C CG2   1 
ATOM   4164 N N     . ALA C 2 221 ? 10.975  94.838  66.360 1.00 200.00 ? 221 ALA C N     1 
ATOM   4165 C CA    . ALA C 2 221 ? 9.927   94.898  65.349 1.00 200.00 ? 221 ALA C CA    1 
ATOM   4166 C C     . ALA C 2 221 ? 9.374   96.318  65.210 1.00 200.00 ? 221 ALA C C     1 
ATOM   4167 O O     . ALA C 2 221 ? 8.783   96.696  64.207 1.00 200.00 ? 221 ALA C O     1 
ATOM   4168 C CB    . ALA C 2 221 ? 8.807   93.946  65.769 1.00 159.21 ? 221 ALA C CB    1 
ATOM   4169 N N     . GLY C 2 222 ? 9.542   97.099  66.296 1.00 200.00 ? 222 GLY C N     1 
ATOM   4170 C CA    . GLY C 2 222 ? 9.087   98.485  66.269 1.00 200.00 ? 222 GLY C CA    1 
ATOM   4171 C C     . GLY C 2 222 ? 10.034  99.359  65.447 1.00 200.00 ? 222 GLY C C     1 
ATOM   4172 O O     . GLY C 2 222 ? 9.645   100.329 64.810 1.00 200.00 ? 222 GLY C O     1 
ATOM   4173 N N     . GLU C 2 223 ? 11.332  99.003  65.520 1.00 183.86 ? 223 GLU C N     1 
ATOM   4174 C CA    . GLU C 2 223 ? 12.319  99.698  64.704 1.00 183.86 ? 223 GLU C CA    1 
ATOM   4175 C C     . GLU C 2 223 ? 12.815  98.805  63.564 1.00 183.86 ? 223 GLU C C     1 
ATOM   4176 O O     . GLU C 2 223 ? 13.958  98.861  63.133 1.00 183.86 ? 223 GLU C O     1 
ATOM   4177 C CB    . GLU C 2 223 ? 13.486  100.106 65.604 1.00 200.00 ? 223 GLU C CB    1 
ATOM   4178 C CG    . GLU C 2 223 ? 13.213  101.420 66.338 1.00 200.00 ? 223 GLU C CG    1 
ATOM   4179 C CD    . GLU C 2 223 ? 12.733  101.121 67.738 1.00 200.00 ? 223 GLU C CD    1 
ATOM   4180 O OE1   . GLU C 2 223 ? 11.587  101.420 68.043 1.00 200.00 ? 223 GLU C OE1   1 
ATOM   4181 O OE2   . GLU C 2 223 ? 13.514  100.578 68.517 1.00 200.00 ? 223 GLU C OE2   1 
ATOM   4182 N N     . GLU C 2 224 ? 11.904  97.930  63.102 1.00 178.77 ? 224 GLU C N     1 
ATOM   4183 C CA    . GLU C 2 224 ? 12.243  97.032  62.003 1.00 178.77 ? 224 GLU C CA    1 
ATOM   4184 C C     . GLU C 2 224 ? 13.521  97.457  61.274 1.00 178.77 ? 224 GLU C C     1 
ATOM   4185 O O     . GLU C 2 224 ? 14.500  96.728  61.191 1.00 178.77 ? 224 GLU C O     1 
ATOM   4186 C CB    . GLU C 2 224 ? 11.071  97.027  61.020 1.00 198.60 ? 224 GLU C CB    1 
ATOM   4187 C CG    . GLU C 2 224 ? 10.343  95.682  60.986 1.00 198.60 ? 224 GLU C CG    1 
ATOM   4188 C CD    . GLU C 2 224 ? 9.068   95.826  60.191 1.00 198.60 ? 224 GLU C CD    1 
ATOM   4189 O OE1   . GLU C 2 224 ? 8.333   94.855  60.087 1.00 198.60 ? 224 GLU C OE1   1 
ATOM   4190 O OE2   . GLU C 2 224 ? 8.807   96.922  59.697 1.00 198.60 ? 224 GLU C OE2   1 
ATOM   4191 N N     . VAL C 2 225 ? 13.474  98.671  60.692 1.00 200.00 ? 225 VAL C N     1 
ATOM   4192 C CA    . VAL C 2 225 ? 14.591  99.121  59.867 1.00 200.00 ? 225 VAL C CA    1 
ATOM   4193 C C     . VAL C 2 225 ? 15.951  98.757  60.468 1.00 200.00 ? 225 VAL C C     1 
ATOM   4194 O O     . VAL C 2 225 ? 16.123  98.618  61.673 1.00 200.00 ? 225 VAL C O     1 
ATOM   4195 C CB    . VAL C 2 225 ? 14.491  100.635 59.689 1.00 126.31 ? 225 VAL C CB    1 
ATOM   4196 C CG1   . VAL C 2 225 ? 15.386  101.074 58.530 1.00 126.31 ? 225 VAL C CG1   1 
ATOM   4197 C CG2   . VAL C 2 225 ? 13.059  101.035 59.389 1.00 126.31 ? 225 VAL C CG2   1 
ATOM   4198 N N     . ILE C 2 226 ? 16.933  98.570  59.564 1.00 164.45 ? 226 ILE C N     1 
ATOM   4199 C CA    . ILE C 2 226 ? 18.276  98.212  60.010 1.00 164.45 ? 226 ILE C CA    1 
ATOM   4200 C C     . ILE C 2 226 ? 19.350  98.732  59.047 1.00 164.45 ? 226 ILE C C     1 
ATOM   4201 O O     . ILE C 2 226 ? 19.568  98.195  57.967 1.00 164.45 ? 226 ILE C O     1 
ATOM   4202 C CB    . ILE C 2 226 ? 18.354  96.687  60.104 1.00 72.93  ? 226 ILE C CB    1 
ATOM   4203 C CG1   . ILE C 2 226 ? 17.716  96.047  58.867 1.00 72.93  ? 226 ILE C CG1   1 
ATOM   4204 C CG2   . ILE C 2 226 ? 17.576  96.201  61.340 1.00 72.93  ? 226 ILE C CG2   1 
ATOM   4205 C CD1   . ILE C 2 226 ? 17.864  94.523  58.860 1.00 72.93  ? 226 ILE C CD1   1 
ATOM   4206 N N     . THR C 2 227 ? 19.969  99.759  59.625 1.00 129.96 ? 227 THR C N     1 
ATOM   4207 C CA    . THR C 2 227 ? 21.086  100.449 59.006 1.00 129.96 ? 227 THR C CA    1 
ATOM   4208 C C     . THR C 2 227 ? 22.311  100.267 59.878 1.00 129.96 ? 227 THR C C     1 
ATOM   4209 O O     . THR C 2 227 ? 22.205  99.743  60.981 1.00 129.96 ? 227 THR C O     1 
ATOM   4210 C CB    . THR C 2 227 ? 20.808  101.950 58.850 1.00 112.43 ? 227 THR C CB    1 
ATOM   4211 O OG1   . THR C 2 227 ? 20.749  102.565 60.146 1.00 112.43 ? 227 THR C OG1   1 
ATOM   4212 C CG2   . THR C 2 227 ? 19.494  102.160 58.115 1.00 112.43 ? 227 THR C CG2   1 
ATOM   4213 N N     . ARG C 2 228 ? 23.467  100.723 59.400 1.00 78.48  ? 228 ARG C N     1 
ATOM   4214 C CA    . ARG C 2 228 ? 24.686  100.540 60.176 1.00 78.48  ? 228 ARG C CA    1 
ATOM   4215 C C     . ARG C 2 228 ? 24.627  101.022 61.618 1.00 78.48  ? 228 ARG C C     1 
ATOM   4216 O O     . ARG C 2 228 ? 25.618  100.935 62.344 1.00 78.48  ? 228 ARG C O     1 
ATOM   4217 C CB    . ARG C 2 228 ? 25.898  101.171 59.497 1.00 97.16  ? 228 ARG C CB    1 
ATOM   4218 C CG    . ARG C 2 228 ? 27.180  100.494 59.934 1.00 97.16  ? 228 ARG C CG    1 
ATOM   4219 C CD    . ARG C 2 228 ? 28.414  101.221 59.504 1.00 97.16  ? 228 ARG C CD    1 
ATOM   4220 N NE    . ARG C 2 228 ? 29.576  100.351 59.620 1.00 97.16  ? 228 ARG C NE    1 
ATOM   4221 C CZ    . ARG C 2 228 ? 30.016  99.568  58.638 1.00 97.16  ? 228 ARG C CZ    1 
ATOM   4222 N NH1   . ARG C 2 228 ? 29.390  99.560  57.470 1.00 97.16  ? 228 ARG C NH1   1 
ATOM   4223 N NH2   . ARG C 2 228 ? 31.076  98.790  58.824 1.00 97.16  ? 228 ARG C NH2   1 
ATOM   4224 N N     . GLU C 2 229 ? 23.485  101.553 62.036 1.00 70.49  ? 229 GLU C N     1 
ATOM   4225 C CA    . GLU C 2 229 ? 23.377  101.984 63.410 1.00 70.49  ? 229 GLU C CA    1 
ATOM   4226 C C     . GLU C 2 229 ? 22.813  100.790 64.162 1.00 70.49  ? 229 GLU C C     1 
ATOM   4227 O O     . GLU C 2 229 ? 23.449  100.308 65.091 1.00 70.49  ? 229 GLU C O     1 
ATOM   4228 C CB    . GLU C 2 229 ? 22.472  103.210 63.555 1.00 200.00 ? 229 GLU C CB    1 
ATOM   4229 C CG    . GLU C 2 229 ? 21.001  102.994 63.281 1.00 200.00 ? 229 GLU C CG    1 
ATOM   4230 C CD    . GLU C 2 229 ? 20.189  104.244 63.560 1.00 200.00 ? 229 GLU C CD    1 
ATOM   4231 O OE1   . GLU C 2 229 ? 20.365  105.244 62.831 1.00 200.00 ? 229 GLU C OE1   1 
ATOM   4232 O OE2   . GLU C 2 229 ? 19.384  104.231 64.517 1.00 200.00 ? 229 GLU C OE2   1 
ATOM   4233 N N     . ARG C 2 230 ? 21.647  100.291 63.743 1.00 121.65 ? 230 ARG C N     1 
ATOM   4234 C CA    . ARG C 2 230 ? 21.027  99.129  64.393 1.00 121.65 ? 230 ARG C CA    1 
ATOM   4235 C C     . ARG C 2 230 ? 21.867  97.889  64.100 1.00 121.65 ? 230 ARG C C     1 
ATOM   4236 O O     . ARG C 2 230 ? 21.984  96.984  64.935 1.00 121.65 ? 230 ARG C O     1 
ATOM   4237 C CB    . ARG C 2 230 ? 19.595  98.899  63.883 1.00 87.44  ? 230 ARG C CB    1 
ATOM   4238 C CG    . ARG C 2 230 ? 18.676  100.100 64.013 1.00 87.44  ? 230 ARG C CG    1 
ATOM   4239 C CD    . ARG C 2 230 ? 17.202  99.707  64.026 1.00 87.44  ? 230 ARG C CD    1 
ATOM   4240 N NE    . ARG C 2 230 ? 16.782  99.133  65.306 1.00 87.44  ? 230 ARG C NE    1 
ATOM   4241 C CZ    . ARG C 2 230 ? 16.812  99.775  66.475 1.00 87.44  ? 230 ARG C CZ    1 
ATOM   4242 N NH1   . ARG C 2 230 ? 17.246  101.026 66.552 1.00 87.44  ? 230 ARG C NH1   1 
ATOM   4243 N NH2   . ARG C 2 230 ? 16.403  99.166  67.580 1.00 87.44  ? 230 ARG C NH2   1 
ATOM   4244 N N     . ALA C 2 231 ? 22.446  97.868  62.901 1.00 111.15 ? 231 ALA C N     1 
ATOM   4245 C CA    . ALA C 2 231 ? 23.294  96.772  62.445 1.00 111.15 ? 231 ALA C CA    1 
ATOM   4246 C C     . ALA C 2 231 ? 24.297  96.384  63.517 1.00 111.15 ? 231 ALA C C     1 
ATOM   4247 O O     . ALA C 2 231 ? 24.386  95.220  63.902 1.00 111.15 ? 231 ALA C O     1 
ATOM   4248 C CB    . ALA C 2 231 ? 24.033  97.180  61.181 1.00 59.53  ? 231 ALA C CB    1 
ATOM   4249 N N     . LEU C 2 232 ? 25.055  97.367  63.991 1.00 200.00 ? 232 LEU C N     1 
ATOM   4250 C CA    . LEU C 2 232 ? 26.052  97.131  65.023 1.00 200.00 ? 232 LEU C CA    1 
ATOM   4251 C C     . LEU C 2 232 ? 25.463  97.434  66.401 1.00 200.00 ? 232 LEU C C     1 
ATOM   4252 O O     . LEU C 2 232 ? 26.118  97.237  67.424 1.00 200.00 ? 232 LEU C O     1 
ATOM   4253 C CB    . LEU C 2 232 ? 27.297  97.995  64.758 1.00 89.64  ? 232 LEU C CB    1 
ATOM   4254 C CG    . LEU C 2 232 ? 28.525  97.784  65.660 1.00 89.64  ? 232 LEU C CG    1 
ATOM   4255 C CD1   . LEU C 2 232 ? 29.788  98.212  64.940 1.00 89.64  ? 232 LEU C CD1   1 
ATOM   4256 C CD2   . LEU C 2 232 ? 28.363  98.555  66.963 1.00 89.64  ? 232 LEU C CD2   1 
ATOM   4257 N N     . GLU C 2 233 ? 24.215  97.895  66.425 1.00 109.95 ? 233 GLU C N     1 
ATOM   4258 C CA    . GLU C 2 233 ? 23.563  98.218  67.688 1.00 109.95 ? 233 GLU C CA    1 
ATOM   4259 C C     . GLU C 2 233 ? 22.912  96.991  68.306 1.00 109.95 ? 233 GLU C C     1 
ATOM   4260 O O     . GLU C 2 233 ? 23.463  96.412  69.242 1.00 109.95 ? 233 GLU C O     1 
ATOM   4261 C CB    . GLU C 2 233 ? 22.522  99.321  67.494 1.00 150.23 ? 233 GLU C CB    1 
ATOM   4262 C CG    . GLU C 2 233 ? 21.939  99.857  68.790 1.00 150.23 ? 233 GLU C CG    1 
ATOM   4263 C CD    . GLU C 2 233 ? 21.096  101.099 68.582 1.00 150.23 ? 233 GLU C CD    1 
ATOM   4264 O OE1   . GLU C 2 233 ? 20.456  101.543 69.557 1.00 150.23 ? 233 GLU C OE1   1 
ATOM   4265 O OE2   . GLU C 2 233 ? 21.076  101.634 67.452 1.00 150.23 ? 233 GLU C OE2   1 
ATOM   4266 N N     . ALA C 2 234 ? 21.751  96.590  67.788 1.00 148.77 ? 234 ALA C N     1 
ATOM   4267 C CA    . ALA C 2 234 ? 21.056  95.414  68.314 1.00 148.77 ? 234 ALA C CA    1 
ATOM   4268 C C     . ALA C 2 234 ? 21.867  94.160  67.990 1.00 148.77 ? 234 ALA C C     1 
ATOM   4269 O O     . ALA C 2 234 ? 21.342  93.041  67.970 1.00 148.77 ? 234 ALA C O     1 
ATOM   4270 C CB    . ALA C 2 234 ? 19.654  95.313  67.721 1.00 64.60  ? 234 ALA C CB    1 
ATOM   4271 N N     . LEU C 2 235 ? 23.158  94.379  67.742 1.00 72.27  ? 235 LEU C N     1 
ATOM   4272 C CA    . LEU C 2 235 ? 24.126  93.336  67.418 1.00 72.27  ? 235 LEU C CA    1 
ATOM   4273 C C     . LEU C 2 235 ? 25.160  93.296  68.529 1.00 72.27  ? 235 LEU C C     1 
ATOM   4274 O O     . LEU C 2 235 ? 25.563  92.228  68.994 1.00 72.27  ? 235 LEU C O     1 
ATOM   4275 C CB    . LEU C 2 235 ? 24.806  93.667  66.099 1.00 32.45  ? 235 LEU C CB    1 
ATOM   4276 C CG    . LEU C 2 235 ? 25.971  92.780  65.712 1.00 32.45  ? 235 LEU C CG    1 
ATOM   4277 C CD1   . LEU C 2 235 ? 25.510  91.331  65.467 1.00 32.45  ? 235 LEU C CD1   1 
ATOM   4278 C CD2   . LEU C 2 235 ? 26.597  93.379  64.476 1.00 32.45  ? 235 LEU C CD2   1 
ATOM   4279 N N     . ALA C 2 236 ? 25.595  94.480  68.938 1.00 112.03 ? 236 ALA C N     1 
ATOM   4280 C CA    . ALA C 2 236 ? 26.562  94.596  70.010 1.00 112.03 ? 236 ALA C CA    1 
ATOM   4281 C C     . ALA C 2 236 ? 25.733  94.719  71.278 1.00 112.03 ? 236 ALA C C     1 
ATOM   4282 O O     . ALA C 2 236 ? 26.240  94.586  72.393 1.00 112.03 ? 236 ALA C O     1 
ATOM   4283 C CB    . ALA C 2 236 ? 27.433  95.834  69.808 1.00 79.05  ? 236 ALA C CB    1 
ATOM   4284 N N     . ALA C 2 237 ? 24.440  94.951  71.088 1.00 148.98 ? 237 ALA C N     1 
ATOM   4285 C CA    . ALA C 2 237 ? 23.523  95.103  72.203 1.00 148.98 ? 237 ALA C CA    1 
ATOM   4286 C C     . ALA C 2 237 ? 22.979  93.769  72.692 1.00 148.98 ? 237 ALA C C     1 
ATOM   4287 O O     . ALA C 2 237 ? 23.700  92.978  73.303 1.00 148.98 ? 237 ALA C O     1 
ATOM   4288 C CB    . ALA C 2 237 ? 22.375  96.027  71.812 1.00 197.33 ? 237 ALA C CB    1 
ATOM   4289 N N     . LEU C 2 238 ? 21.705  93.518  72.415 1.00 67.31  ? 238 LEU C N     1 
ATOM   4290 C CA    . LEU C 2 238 ? 21.075  92.291  72.861 1.00 67.31  ? 238 LEU C CA    1 
ATOM   4291 C C     . LEU C 2 238 ? 21.268  91.154  71.857 1.00 67.31  ? 238 LEU C C     1 
ATOM   4292 O O     . LEU C 2 238 ? 20.951  89.996  72.158 1.00 67.31  ? 238 LEU C O     1 
ATOM   4293 C CB    . LEU C 2 238 ? 19.592  92.543  73.142 1.00 94.66  ? 238 LEU C CB    1 
ATOM   4294 C CG    . LEU C 2 238 ? 19.059  91.858  74.406 1.00 94.66  ? 238 LEU C CG    1 
ATOM   4295 C CD1   . LEU C 2 238 ? 17.764  92.537  74.842 1.00 94.66  ? 238 LEU C CD1   1 
ATOM   4296 C CD2   . LEU C 2 238 ? 18.858  90.356  74.155 1.00 94.66  ? 238 LEU C CD2   1 
ATOM   4297 N N     . GLY C 2 239 ? 21.787  91.484  70.668 1.00 86.85  ? 239 GLY C N     1 
ATOM   4298 C CA    . GLY C 2 239 ? 22.086  90.467  69.663 1.00 86.85  ? 239 GLY C CA    1 
ATOM   4299 C C     . GLY C 2 239 ? 23.218  89.724  70.346 1.00 86.85  ? 239 GLY C C     1 
ATOM   4300 O O     . GLY C 2 239 ? 23.857  88.809  69.834 1.00 86.85  ? 239 GLY C O     1 
ATOM   4301 N N     . LEU C 2 240 ? 23.433  90.217  71.556 1.00 53.08  ? 240 LEU C N     1 
ATOM   4302 C CA    . LEU C 2 240 ? 24.378  89.784  72.545 1.00 53.08  ? 240 LEU C CA    1 
ATOM   4303 C C     . LEU C 2 240 ? 25.731  89.309  72.135 1.00 53.08  ? 240 LEU C C     1 
ATOM   4304 O O     . LEU C 2 240 ? 26.085  88.203  72.475 1.00 53.08  ? 240 LEU C O     1 
ATOM   4305 C CB    . LEU C 2 240 ? 23.713  88.740  73.449 1.00 170.52 ? 240 LEU C CB    1 
ATOM   4306 C CG    . LEU C 2 240 ? 22.571  89.286  74.317 1.00 170.52 ? 240 LEU C CG    1 
ATOM   4307 C CD1   . LEU C 2 240 ? 21.882  88.148  75.051 1.00 170.52 ? 240 LEU C CD1   1 
ATOM   4308 C CD2   . LEU C 2 240 ? 23.115  90.320  75.299 1.00 170.52 ? 240 LEU C CD2   1 
ATOM   4309 N N     . ASP C 2 241 ? 26.502  90.141  71.439 1.00 63.82  ? 241 ASP C N     1 
ATOM   4310 C CA    . ASP C 2 241 ? 27.867  89.770  71.062 1.00 63.82  ? 241 ASP C CA    1 
ATOM   4311 C C     . ASP C 2 241 ? 28.530  90.815  70.224 1.00 63.82  ? 241 ASP C C     1 
ATOM   4312 O O     . ASP C 2 241 ? 27.896  91.462  69.402 1.00 63.82  ? 241 ASP C O     1 
ATOM   4313 C CB    . ASP C 2 241 ? 27.912  88.456  70.275 1.00 98.18  ? 241 ASP C CB    1 
ATOM   4314 C CG    . ASP C 2 241 ? 27.393  88.599  68.816 1.00 98.18  ? 241 ASP C CG    1 
ATOM   4315 O OD1   . ASP C 2 241 ? 28.228  88.939  67.898 1.00 98.18  ? 241 ASP C OD1   1 
ATOM   4316 O OD2   . ASP C 2 241 ? 26.145  88.371  68.610 1.00 98.18  ? 241 ASP C OD2   1 
ATOM   4317 N N     . GLU C 2 242 ? 29.825  90.960  70.416 1.00 100.89 ? 242 GLU C N     1 
ATOM   4318 C CA    . GLU C 2 242 ? 30.563  91.928  69.640 1.00 100.89 ? 242 GLU C CA    1 
ATOM   4319 C C     . GLU C 2 242 ? 30.946  91.307  68.301 1.00 100.89 ? 242 GLU C C     1 
ATOM   4320 O O     . GLU C 2 242 ? 30.079  90.839  67.556 1.00 100.89 ? 242 GLU C O     1 
ATOM   4321 C CB    . GLU C 2 242 ? 31.795  92.382  70.428 1.00 147.03 ? 242 GLU C CB    1 
ATOM   4322 C CG    . GLU C 2 242 ? 32.390  91.310  71.316 1.00 147.03 ? 242 GLU C CG    1 
ATOM   4323 C CD    . GLU C 2 242 ? 33.469  90.530  70.626 1.00 147.03 ? 242 GLU C CD    1 
ATOM   4324 O OE1   . GLU C 2 242 ? 33.819  89.443  71.128 1.00 147.03 ? 242 GLU C OE1   1 
ATOM   4325 O OE2   . GLU C 2 242 ? 33.978  91.008  69.590 1.00 147.03 ? 242 GLU C OE2   1 
ATOM   4326 N N     . LEU C 2 243 ? 32.238  91.309  67.996 1.00 106.15 ? 243 LEU C N     1 
ATOM   4327 C CA    . LEU C 2 243 ? 32.747  90.743  66.755 1.00 106.15 ? 243 LEU C CA    1 
ATOM   4328 C C     . LEU C 2 243 ? 32.611  89.240  66.804 1.00 106.15 ? 243 LEU C C     1 
ATOM   4329 O O     . LEU C 2 243 ? 33.522  88.553  67.257 1.00 106.15 ? 243 LEU C O     1 
ATOM   4330 C CB    . LEU C 2 243 ? 34.219  91.071  66.598 1.00 129.36 ? 243 LEU C CB    1 
ATOM   4331 C CG    . LEU C 2 243 ? 34.782  90.875  65.188 1.00 129.36 ? 243 LEU C CG    1 
ATOM   4332 C CD1   . LEU C 2 243 ? 34.233  91.997  64.301 1.00 129.36 ? 243 LEU C CD1   1 
ATOM   4333 C CD2   . LEU C 2 243 ? 36.325  90.921  65.192 1.00 129.36 ? 243 LEU C CD2   1 
ATOM   4334 N N     . GLY C 2 244 ? 31.488  88.723  66.327 1.00 89.39  ? 244 GLY C N     1 
ATOM   4335 C CA    . GLY C 2 244 ? 31.290  87.289  66.366 1.00 89.39  ? 244 GLY C CA    1 
ATOM   4336 C C     . GLY C 2 244 ? 31.236  86.802  67.803 1.00 89.39  ? 244 GLY C C     1 
ATOM   4337 O O     . GLY C 2 244 ? 30.137  86.673  68.352 1.00 89.39  ? 244 GLY C O     1 
ATOM   4338 N N     . LEU C 2 245 ? 32.408  86.544  68.403 1.00 46.35  ? 245 LEU C N     1 
ATOM   4339 C CA    . LEU C 2 245 ? 32.512  86.066  69.782 1.00 46.35  ? 245 LEU C CA    1 
ATOM   4340 C C     . LEU C 2 245 ? 31.261  86.464  70.529 1.00 46.35  ? 245 LEU C C     1 
ATOM   4341 O O     . LEU C 2 245 ? 30.962  87.661  70.643 1.00 46.35  ? 245 LEU C O     1 
ATOM   4342 C CB    . LEU C 2 245 ? 33.693  86.688  70.517 1.00 38.25  ? 245 LEU C CB    1 
ATOM   4343 C CG    . LEU C 2 245 ? 35.129  86.669  70.000 1.00 38.25  ? 245 LEU C CG    1 
ATOM   4344 C CD1   . LEU C 2 245 ? 36.049  86.306  71.163 1.00 38.25  ? 245 LEU C CD1   1 
ATOM   4345 C CD2   . LEU C 2 245 ? 35.291  85.686  68.853 1.00 38.25  ? 245 LEU C CD2   1 
ATOM   4346 N N     . GLU C 2 246 ? 30.520  85.472  71.024 1.00 80.28  ? 246 GLU C N     1 
ATOM   4347 C CA    . GLU C 2 246 ? 29.300  85.746  71.766 1.00 80.28  ? 246 GLU C CA    1 
ATOM   4348 C C     . GLU C 2 246 ? 29.189  84.978  73.090 1.00 80.28  ? 246 GLU C C     1 
ATOM   4349 O O     . GLU C 2 246 ? 29.737  83.882  73.247 1.00 80.28  ? 246 GLU C O     1 
ATOM   4350 C CB    . GLU C 2 246 ? 28.079  85.492  70.893 1.00 70.12  ? 246 GLU C CB    1 
ATOM   4351 C CG    . GLU C 2 246 ? 27.628  84.083  70.826 1.00 70.12  ? 246 GLU C CG    1 
ATOM   4352 C CD    . GLU C 2 246 ? 26.181  83.997  70.403 1.00 70.12  ? 246 GLU C CD    1 
ATOM   4353 O OE1   . GLU C 2 246 ? 25.814  84.705  69.438 1.00 70.12  ? 246 GLU C OE1   1 
ATOM   4354 O OE2   . GLU C 2 246 ? 25.418  83.229  71.032 1.00 70.12  ? 246 GLU C OE2   1 
ATOM   4355 N N     . LYS C 2 247 ? 28.459  85.596  74.026 1.00 69.54  ? 247 LYS C N     1 
ATOM   4356 C CA    . LYS C 2 247 ? 28.237  85.118  75.392 1.00 69.54  ? 247 LYS C CA    1 
ATOM   4357 C C     . LYS C 2 247 ? 29.069  83.925  75.809 1.00 69.54  ? 247 LYS C C     1 
ATOM   4358 O O     . LYS C 2 247 ? 30.101  84.064  76.472 1.00 69.54  ? 247 LYS C O     1 
ATOM   4359 C CB    . LYS C 2 247 ? 26.760  84.799  75.640 1.00 102.86 ? 247 LYS C CB    1 
ATOM   4360 C CG    . LYS C 2 247 ? 26.458  84.680  77.140 1.00 102.86 ? 247 LYS C CG    1 
ATOM   4361 C CD    . LYS C 2 247 ? 25.058  84.184  77.457 1.00 102.86 ? 247 LYS C CD    1 
ATOM   4362 C CE    . LYS C 2 247 ? 24.820  84.113  78.975 1.00 102.86 ? 247 LYS C CE    1 
ATOM   4363 N NZ    . LYS C 2 247 ? 24.811  85.457  79.656 1.00 102.86 ? 247 LYS C NZ    1 
ATOM   4364 N N     . ARG C 2 248 ? 28.602  82.749  75.412 1.00 58.52  ? 248 ARG C N     1 
ATOM   4365 C CA    . ARG C 2 248 ? 29.259  81.510  75.749 1.00 58.52  ? 248 ARG C CA    1 
ATOM   4366 C C     . ARG C 2 248 ? 30.759  81.562  75.428 1.00 58.52  ? 248 ARG C C     1 
ATOM   4367 O O     . ARG C 2 248 ? 31.585  80.976  76.139 1.00 58.52  ? 248 ARG C O     1 
ATOM   4368 C CB    . ARG C 2 248 ? 28.578  80.382  75.001 1.00 53.99  ? 248 ARG C CB    1 
ATOM   4369 C CG    . ARG C 2 248 ? 29.007  79.028  75.481 1.00 53.99  ? 248 ARG C CG    1 
ATOM   4370 C CD    . ARG C 2 248 ? 28.620  78.826  76.918 1.00 53.99  ? 248 ARG C CD    1 
ATOM   4371 N NE    . ARG C 2 248 ? 29.233  77.625  77.463 1.00 53.99  ? 248 ARG C NE    1 
ATOM   4372 C CZ    . ARG C 2 248 ? 29.371  77.380  78.760 1.00 53.99  ? 248 ARG C CZ    1 
ATOM   4373 N NH1   . ARG C 2 248 ? 28.933  78.260  79.653 1.00 53.99  ? 248 ARG C NH1   1 
ATOM   4374 N NH2   . ARG C 2 248 ? 29.963  76.264  79.163 1.00 53.99  ? 248 ARG C NH2   1 
ATOM   4375 N N     . ASP C 2 249 ? 31.106  82.282  74.366 1.00 58.73  ? 249 ASP C N     1 
ATOM   4376 C CA    . ASP C 2 249 ? 32.487  82.412  73.950 1.00 58.73  ? 249 ASP C CA    1 
ATOM   4377 C C     . ASP C 2 249 ? 33.237  83.238  74.977 1.00 58.73  ? 249 ASP C C     1 
ATOM   4378 O O     . ASP C 2 249 ? 34.308  82.839  75.475 1.00 58.73  ? 249 ASP C O     1 
ATOM   4379 C CB    . ASP C 2 249 ? 32.536  83.060  72.573 1.00 69.70  ? 249 ASP C CB    1 
ATOM   4380 C CG    . ASP C 2 249 ? 32.236  82.071  71.467 1.00 69.70  ? 249 ASP C CG    1 
ATOM   4381 O OD1   . ASP C 2 249 ? 33.139  81.255  71.179 1.00 69.70  ? 249 ASP C OD1   1 
ATOM   4382 O OD2   . ASP C 2 249 ? 31.111  82.089  70.905 1.00 69.70  ? 249 ASP C OD2   1 
ATOM   4383 N N     . ARG C 2 250 ? 32.657  84.389  75.305 1.00 56.14  ? 250 ARG C N     1 
ATOM   4384 C CA    . ARG C 2 250 ? 33.231  85.293  76.298 1.00 56.14  ? 250 ARG C CA    1 
ATOM   4385 C C     . ARG C 2 250 ? 33.389  84.438  77.559 1.00 56.14  ? 250 ARG C C     1 
ATOM   4386 O O     . ARG C 2 250 ? 34.473  84.377  78.150 1.00 56.14  ? 250 ARG C O     1 
ATOM   4387 C CB    . ARG C 2 250 ? 32.260  86.469  76.563 1.00 90.31  ? 250 ARG C CB    1 
ATOM   4388 C CG    . ARG C 2 250 ? 32.898  87.864  76.799 1.00 90.31  ? 250 ARG C CG    1 
ATOM   4389 C CD    . ARG C 2 250 ? 32.312  88.567  78.043 1.00 90.31  ? 250 ARG C CD    1 
ATOM   4390 N NE    . ARG C 2 250 ? 30.862  88.786  77.968 1.00 90.31  ? 250 ARG C NE    1 
ATOM   4391 C CZ    . ARG C 2 250 ? 30.077  89.019  79.018 1.00 90.31  ? 250 ARG C CZ    1 
ATOM   4392 N NH1   . ARG C 2 250 ? 30.596  89.057  80.232 1.00 90.31  ? 250 ARG C NH1   1 
ATOM   4393 N NH2   . ARG C 2 250 ? 28.776  89.223  78.854 1.00 90.31  ? 250 ARG C NH2   1 
ATOM   4394 N N     . GLU C 2 251 ? 32.304  83.753  77.942 1.00 35.68  ? 251 GLU C N     1 
ATOM   4395 C CA    . GLU C 2 251 ? 32.322  82.910  79.129 1.00 35.68  ? 251 GLU C CA    1 
ATOM   4396 C C     . GLU C 2 251 ? 33.515  81.994  79.017 1.00 35.68  ? 251 GLU C C     1 
ATOM   4397 O O     . GLU C 2 251 ? 34.389  82.026  79.877 1.00 35.68  ? 251 GLU C O     1 
ATOM   4398 C CB    . GLU C 2 251 ? 31.030  82.106  79.266 1.00 47.91  ? 251 GLU C CB    1 
ATOM   4399 C CG    . GLU C 2 251 ? 29.775  82.915  79.002 1.00 47.91  ? 251 GLU C CG    1 
ATOM   4400 C CD    . GLU C 2 251 ? 28.513  82.342  79.653 1.00 47.91  ? 251 GLU C CD    1 
ATOM   4401 O OE1   . GLU C 2 251 ? 28.272  81.117  79.569 1.00 47.91  ? 251 GLU C OE1   1 
ATOM   4402 O OE2   . GLU C 2 251 ? 27.741  83.126  80.245 1.00 47.91  ? 251 GLU C OE2   1 
ATOM   4403 N N     . ILE C 2 252 ? 33.585  81.201  77.954 1.00 27.37  ? 252 ILE C N     1 
ATOM   4404 C CA    . ILE C 2 252 ? 34.722  80.298  77.801 1.00 27.37  ? 252 ILE C CA    1 
ATOM   4405 C C     . ILE C 2 252 ? 36.007  81.021  78.204 1.00 27.37  ? 252 ILE C C     1 
ATOM   4406 O O     . ILE C 2 252 ? 36.608  80.737  79.258 1.00 27.37  ? 252 ILE C O     1 
ATOM   4407 C CB    . ILE C 2 252 ? 34.888  79.819  76.350 1.00 19.13  ? 252 ILE C CB    1 
ATOM   4408 C CG1   . ILE C 2 252 ? 33.629  79.070  75.919 1.00 19.13  ? 252 ILE C CG1   1 
ATOM   4409 C CG2   . ILE C 2 252 ? 36.152  78.956  76.220 1.00 19.13  ? 252 ILE C CG2   1 
ATOM   4410 C CD1   . ILE C 2 252 ? 33.739  78.408  74.568 1.00 19.13  ? 252 ILE C CD1   1 
ATOM   4411 N N     . LEU C 2 253 ? 36.408  81.965  77.356 1.00 37.76  ? 253 LEU C N     1 
ATOM   4412 C CA    . LEU C 2 253 ? 37.611  82.766  77.579 1.00 37.76  ? 253 LEU C CA    1 
ATOM   4413 C C     . LEU C 2 253 ? 37.696  83.200  79.027 1.00 37.76  ? 253 LEU C C     1 
ATOM   4414 O O     . LEU C 2 253 ? 38.705  82.979  79.691 1.00 37.76  ? 253 LEU C O     1 
ATOM   4415 C CB    . LEU C 2 253 ? 37.569  84.003  76.701 1.00 21.40  ? 253 LEU C CB    1 
ATOM   4416 C CG    . LEU C 2 253 ? 37.435  83.720  75.218 1.00 21.40  ? 253 LEU C CG    1 
ATOM   4417 C CD1   . LEU C 2 253 ? 36.444  84.708  74.592 1.00 21.40  ? 253 LEU C CD1   1 
ATOM   4418 C CD2   . LEU C 2 253 ? 38.826  83.791  74.596 1.00 21.40  ? 253 LEU C CD2   1 
ATOM   4419 N N     . GLU C 2 254 ? 36.617  83.828  79.490 1.00 52.93  ? 254 GLU C N     1 
ATOM   4420 C CA    . GLU C 2 254 ? 36.525  84.302  80.854 1.00 52.93  ? 254 GLU C CA    1 
ATOM   4421 C C     . GLU C 2 254 ? 37.044  83.190  81.748 1.00 52.93  ? 254 GLU C C     1 
ATOM   4422 O O     . GLU C 2 254 ? 37.905  83.422  82.591 1.00 52.93  ? 254 GLU C O     1 
ATOM   4423 C CB    . GLU C 2 254 ? 35.071  84.650  81.204 1.00 48.35  ? 254 GLU C CB    1 
ATOM   4424 C CG    . GLU C 2 254 ? 34.811  86.132  81.524 1.00 48.35  ? 254 GLU C CG    1 
ATOM   4425 C CD    . GLU C 2 254 ? 33.343  86.550  81.322 1.00 48.35  ? 254 GLU C CD    1 
ATOM   4426 O OE1   . GLU C 2 254 ? 32.460  86.177  82.127 1.00 48.35  ? 254 GLU C OE1   1 
ATOM   4427 O OE2   . GLU C 2 254 ? 33.063  87.259  80.337 1.00 48.35  ? 254 GLU C OE2   1 
ATOM   4428 N N     . VAL C 2 255 ? 36.559  81.969  81.564 1.00 34.70  ? 255 VAL C N     1 
ATOM   4429 C CA    . VAL C 2 255 ? 37.053  80.906  82.416 1.00 34.70  ? 255 VAL C CA    1 
ATOM   4430 C C     . VAL C 2 255 ? 38.447  80.490  82.034 1.00 34.70  ? 255 VAL C C     1 
ATOM   4431 O O     . VAL C 2 255 ? 39.259  80.121  82.896 1.00 34.70  ? 255 VAL C O     1 
ATOM   4432 C CB    . VAL C 2 255 ? 36.249  79.668  82.324 1.00 20.94  ? 255 VAL C CB    1 
ATOM   4433 C CG1   . VAL C 2 255 ? 36.587  78.791  83.511 1.00 20.94  ? 255 VAL C CG1   1 
ATOM   4434 C CG2   . VAL C 2 255 ? 34.797  80.006  82.258 1.00 20.94  ? 255 VAL C CG2   1 
ATOM   4435 N N     . LEU C 2 256 ? 38.716  80.528  80.731 1.00 36.52  ? 256 LEU C N     1 
ATOM   4436 C CA    . LEU C 2 256 ? 40.023  80.129  80.228 1.00 36.52  ? 256 LEU C CA    1 
ATOM   4437 C C     . LEU C 2 256 ? 41.070  81.046  80.802 1.00 36.52  ? 256 LEU C C     1 
ATOM   4438 O O     . LEU C 2 256 ? 42.048  80.602  81.393 1.00 36.52  ? 256 LEU C O     1 
ATOM   4439 C CB    . LEU C 2 256 ? 40.060  80.179  78.691 1.00 31.39  ? 256 LEU C CB    1 
ATOM   4440 C CG    . LEU C 2 256 ? 41.206  79.410  78.008 1.00 31.39  ? 256 LEU C CG    1 
ATOM   4441 C CD1   . LEU C 2 256 ? 42.242  80.376  77.489 1.00 31.39  ? 256 LEU C CD1   1 
ATOM   4442 C CD2   . LEU C 2 256 ? 41.838  78.406  78.997 1.00 31.39  ? 256 LEU C CD2   1 
ATOM   4443 N N     . ILE C 2 257 ? 40.818  82.335  80.651 1.00 25.16  ? 257 ILE C N     1 
ATOM   4444 C CA    . ILE C 2 257 ? 41.710  83.369  81.124 1.00 25.16  ? 257 ILE C CA    1 
ATOM   4445 C C     . ILE C 2 257 ? 41.605  83.686  82.633 1.00 25.16  ? 257 ILE C C     1 
ATOM   4446 O O     . ILE C 2 257 ? 42.611  83.697  83.333 1.00 25.16  ? 257 ILE C O     1 
ATOM   4447 C CB    . ILE C 2 257 ? 41.465  84.646  80.316 1.00 40.58  ? 257 ILE C CB    1 
ATOM   4448 C CG1   . ILE C 2 257 ? 42.460  85.712  80.710 1.00 40.58  ? 257 ILE C CG1   1 
ATOM   4449 C CG2   . ILE C 2 257 ? 40.078  85.146  80.549 1.00 40.58  ? 257 ILE C CG2   1 
ATOM   4450 C CD1   . ILE C 2 257 ? 43.778  85.523  80.051 1.00 40.58  ? 257 ILE C CD1   1 
ATOM   4451 N N     . LEU C 2 258 ? 40.404  83.925  83.149 1.00 40.98  ? 258 LEU C N     1 
ATOM   4452 C CA    . LEU C 2 258 ? 40.278  84.263  84.564 1.00 40.98  ? 258 LEU C CA    1 
ATOM   4453 C C     . LEU C 2 258 ? 40.637  83.145  85.515 1.00 40.98  ? 258 LEU C C     1 
ATOM   4454 O O     . LEU C 2 258 ? 41.532  83.300  86.350 1.00 40.98  ? 258 LEU C O     1 
ATOM   4455 C CB    . LEU C 2 258 ? 38.868  84.756  84.904 1.00 30.44  ? 258 LEU C CB    1 
ATOM   4456 C CG    . LEU C 2 258 ? 38.381  86.098  84.327 1.00 30.44  ? 258 LEU C CG    1 
ATOM   4457 C CD1   . LEU C 2 258 ? 37.143  86.541  85.113 1.00 30.44  ? 258 LEU C CD1   1 
ATOM   4458 C CD2   . LEU C 2 258 ? 39.476  87.158  84.403 1.00 30.44  ? 258 LEU C CD2   1 
ATOM   4459 N N     . ARG C 2 259 ? 39.939  82.021  85.389 1.00 55.15  ? 259 ARG C N     1 
ATOM   4460 C CA    . ARG C 2 259 ? 40.170  80.867  86.261 1.00 55.15  ? 259 ARG C CA    1 
ATOM   4461 C C     . ARG C 2 259 ? 41.511  80.206  86.149 1.00 55.15  ? 259 ARG C C     1 
ATOM   4462 O O     . ARG C 2 259 ? 42.154  79.920  87.152 1.00 55.15  ? 259 ARG C O     1 
ATOM   4463 C CB    . ARG C 2 259 ? 39.158  79.767  86.013 1.00 45.41  ? 259 ARG C CB    1 
ATOM   4464 C CG    . ARG C 2 259 ? 39.601  78.474  86.672 1.00 45.41  ? 259 ARG C CG    1 
ATOM   4465 C CD    . ARG C 2 259 ? 38.455  77.523  86.816 1.00 45.41  ? 259 ARG C CD    1 
ATOM   4466 N NE    . ARG C 2 259 ? 38.814  76.329  87.563 1.00 45.41  ? 259 ARG C NE    1 
ATOM   4467 C CZ    . ARG C 2 259 ? 37.946  75.360  87.777 1.00 45.41  ? 259 ARG C CZ    1 
ATOM   4468 N NH1   . ARG C 2 259 ? 36.720  75.504  87.293 1.00 45.41  ? 259 ARG C NH1   1 
ATOM   4469 N NH2   . ARG C 2 259 ? 38.287  74.269  88.447 1.00 45.41  ? 259 ARG C NH2   1 
ATOM   4470 N N     . PHE C 2 260 ? 41.891  79.913  84.913 1.00 50.41  ? 260 PHE C N     1 
ATOM   4471 C CA    . PHE C 2 260 ? 43.142  79.245  84.639 1.00 50.41  ? 260 PHE C CA    1 
ATOM   4472 C C     . PHE C 2 260 ? 44.302  80.175  84.295 1.00 50.41  ? 260 PHE C C     1 
ATOM   4473 O O     . PHE C 2 260 ? 45.436  79.946  84.718 1.00 50.41  ? 260 PHE C O     1 
ATOM   4474 C CB    . PHE C 2 260 ? 42.918  78.258  83.513 1.00 34.44  ? 260 PHE C CB    1 
ATOM   4475 C CG    . PHE C 2 260 ? 41.819  77.247  83.790 1.00 34.44  ? 260 PHE C CG    1 
ATOM   4476 C CD1   . PHE C 2 260 ? 40.531  77.436  83.290 1.00 34.44  ? 260 PHE C CD1   1 
ATOM   4477 C CD2   . PHE C 2 260 ? 42.093  76.064  84.493 1.00 34.44  ? 260 PHE C CD2   1 
ATOM   4478 C CE1   . PHE C 2 260 ? 39.539  76.451  83.476 1.00 34.44  ? 260 PHE C CE1   1 
ATOM   4479 C CE2   . PHE C 2 260 ? 41.102  75.085  84.682 1.00 34.44  ? 260 PHE C CE2   1 
ATOM   4480 C CZ    . PHE C 2 260 ? 39.829  75.276  84.172 1.00 34.44  ? 260 PHE C CZ    1 
ATOM   4481 N N     . GLY C 2 261 ? 44.007  81.228  83.537 1.00 52.80  ? 261 GLY C N     1 
ATOM   4482 C CA    . GLY C 2 261 ? 45.026  82.182  83.128 1.00 52.80  ? 261 GLY C CA    1 
ATOM   4483 C C     . GLY C 2 261 ? 45.165  82.122  81.619 1.00 52.80  ? 261 GLY C C     1 
ATOM   4484 O O     . GLY C 2 261 ? 44.316  81.550  80.934 1.00 52.80  ? 261 GLY C O     1 
ATOM   4485 N N     . GLY C 2 262 ? 46.209  82.733  81.079 1.00 156.39 ? 262 GLY C N     1 
ATOM   4486 C CA    . GLY C 2 262 ? 46.403  82.657  79.644 1.00 156.39 ? 262 GLY C CA    1 
ATOM   4487 C C     . GLY C 2 262 ? 47.080  81.319  79.467 1.00 156.39 ? 262 GLY C C     1 
ATOM   4488 O O     . GLY C 2 262 ? 47.407  80.893  78.360 1.00 156.39 ? 262 GLY C O     1 
ATOM   4489 N N     . GLY C 2 263 ? 47.268  80.660  80.609 1.00 104.82 ? 263 GLY C N     1 
ATOM   4490 C CA    . GLY C 2 263 ? 47.926  79.371  80.669 1.00 104.82 ? 263 GLY C CA    1 
ATOM   4491 C C     . GLY C 2 263 ? 47.172  78.260  79.985 1.00 104.82 ? 263 GLY C C     1 
ATOM   4492 O O     . GLY C 2 263 ? 45.971  78.395  79.752 1.00 104.82 ? 263 GLY C O     1 
ATOM   4493 N N     . PRO C 2 264 ? 47.862  77.147  79.651 1.00 46.14  ? 264 PRO C N     1 
ATOM   4494 C CA    . PRO C 2 264 ? 47.284  75.981  78.983 1.00 46.14  ? 264 PRO C CA    1 
ATOM   4495 C C     . PRO C 2 264 ? 46.494  75.088  79.928 1.00 46.14  ? 264 PRO C C     1 
ATOM   4496 O O     . PRO C 2 264 ? 46.863  74.917  81.096 1.00 46.14  ? 264 PRO C O     1 
ATOM   4497 C CB    . PRO C 2 264 ? 48.506  75.299  78.397 1.00 45.00  ? 264 PRO C CB    1 
ATOM   4498 C CG    . PRO C 2 264 ? 49.529  75.534  79.459 1.00 45.00  ? 264 PRO C CG    1 
ATOM   4499 C CD    . PRO C 2 264 ? 49.320  76.976  79.820 1.00 45.00  ? 264 PRO C CD    1 
ATOM   4500 N N     . VAL C 2 265 ? 45.401  74.525  79.425 1.00 34.73  ? 265 VAL C N     1 
ATOM   4501 C CA    . VAL C 2 265 ? 44.569  73.654  80.244 1.00 34.73  ? 265 VAL C CA    1 
ATOM   4502 C C     . VAL C 2 265 ? 44.411  72.221  79.686 1.00 34.73  ? 265 VAL C C     1 
ATOM   4503 O O     . VAL C 2 265 ? 44.910  71.231  80.260 1.00 34.73  ? 265 VAL C O     1 
ATOM   4504 C CB    . VAL C 2 265 ? 43.166  74.235  80.388 1.00 55.12  ? 265 VAL C CB    1 
ATOM   4505 C CG1   . VAL C 2 265 ? 42.490  73.642  81.609 1.00 55.12  ? 265 VAL C CG1   1 
ATOM   4506 C CG2   . VAL C 2 265 ? 43.230  75.738  80.438 1.00 55.12  ? 265 VAL C CG2   1 
ATOM   4507 N N     . GLY C 2 266 ? 43.700  72.127  78.567 1.00 49.93  ? 266 GLY C N     1 
ATOM   4508 C CA    . GLY C 2 266 ? 43.450  70.839  77.960 1.00 49.93  ? 266 GLY C CA    1 
ATOM   4509 C C     . GLY C 2 266 ? 41.969  70.534  78.035 1.00 49.93  ? 266 GLY C C     1 
ATOM   4510 O O     . GLY C 2 266 ? 41.398  70.507  79.129 1.00 49.93  ? 266 GLY C O     1 
ATOM   4511 N N     . LEU C 2 267 ? 41.356  70.334  76.868 1.00 55.44  ? 267 LEU C N     1 
ATOM   4512 C CA    . LEU C 2 267 ? 39.940  70.029  76.758 1.00 55.44  ? 267 LEU C CA    1 
ATOM   4513 C C     . LEU C 2 267 ? 39.507  69.315  78.011 1.00 55.44  ? 267 LEU C C     1 
ATOM   4514 O O     . LEU C 2 267 ? 38.435  69.581  78.552 1.00 55.44  ? 267 LEU C O     1 
ATOM   4515 C CB    . LEU C 2 267 ? 39.689  69.141  75.544 1.00 64.36  ? 267 LEU C CB    1 
ATOM   4516 C CG    . LEU C 2 267 ? 39.252  69.873  74.279 1.00 64.36  ? 267 LEU C CG    1 
ATOM   4517 C CD1   . LEU C 2 267 ? 39.481  68.999  73.083 1.00 64.36  ? 267 LEU C CD1   1 
ATOM   4518 C CD2   . LEU C 2 267 ? 37.784  70.251  74.380 1.00 64.36  ? 267 LEU C CD2   1 
ATOM   4519 N N     . ALA C 2 268 ? 40.369  68.407  78.462 1.00 86.68  ? 268 ALA C N     1 
ATOM   4520 C CA    . ALA C 2 268 ? 40.137  67.623  79.665 1.00 86.68  ? 268 ALA C CA    1 
ATOM   4521 C C     . ALA C 2 268 ? 39.444  68.463  80.727 1.00 86.68  ? 268 ALA C C     1 
ATOM   4522 O O     . ALA C 2 268 ? 38.212  68.503  80.792 1.00 86.68  ? 268 ALA C O     1 
ATOM   4523 C CB    . ALA C 2 268 ? 41.463  67.098  80.200 1.00 195.97 ? 268 ALA C CB    1 
ATOM   4524 N N     . THR C 2 269 ? 40.238  69.142  81.551 1.00 76.89  ? 269 THR C N     1 
ATOM   4525 C CA    . THR C 2 269 ? 39.672  69.971  82.601 1.00 76.89  ? 269 THR C CA    1 
ATOM   4526 C C     . THR C 2 269 ? 38.707  70.983  82.026 1.00 76.89  ? 269 THR C C     1 
ATOM   4527 O O     . THR C 2 269 ? 37.496  70.835  82.144 1.00 76.89  ? 269 THR C O     1 
ATOM   4528 C CB    . THR C 2 269 ? 40.729  70.779  83.387 1.00 39.12  ? 269 THR C CB    1 
ATOM   4529 O OG1   . THR C 2 269 ? 41.727  69.906  83.936 1.00 39.12  ? 269 THR C OG1   1 
ATOM   4530 C CG2   . THR C 2 269 ? 40.042  71.512  84.542 1.00 39.12  ? 269 THR C CG2   1 
ATOM   4531 N N     . LEU C 2 270 ? 39.257  72.008  81.392 1.00 18.66  ? 270 LEU C N     1 
ATOM   4532 C CA    . LEU C 2 270 ? 38.437  73.077  80.838 1.00 18.66  ? 270 LEU C CA    1 
ATOM   4533 C C     . LEU C 2 270 ? 37.012  72.708  80.384 1.00 18.66  ? 270 LEU C C     1 
ATOM   4534 O O     . LEU C 2 270 ? 36.039  73.312  80.838 1.00 18.66  ? 270 LEU C O     1 
ATOM   4535 C CB    . LEU C 2 270 ? 39.220  73.786  79.719 1.00 19.12  ? 270 LEU C CB    1 
ATOM   4536 C CG    . LEU C 2 270 ? 38.546  74.692  78.679 1.00 19.12  ? 270 LEU C CG    1 
ATOM   4537 C CD1   . LEU C 2 270 ? 37.423  75.489  79.282 1.00 19.12  ? 270 LEU C CD1   1 
ATOM   4538 C CD2   . LEU C 2 270 ? 39.606  75.588  78.081 1.00 19.12  ? 270 LEU C CD2   1 
ATOM   4539 N N     . ALA C 2 271 ? 36.870  71.732  79.502 1.00 37.98  ? 271 ALA C N     1 
ATOM   4540 C CA    . ALA C 2 271 ? 35.537  71.359  79.042 1.00 37.98  ? 271 ALA C CA    1 
ATOM   4541 C C     . ALA C 2 271 ? 34.591  71.104  80.221 1.00 37.98  ? 271 ALA C C     1 
ATOM   4542 O O     . ALA C 2 271 ? 33.387  71.338  80.126 1.00 37.98  ? 271 ALA C O     1 
ATOM   4543 C CB    . ALA C 2 271 ? 35.621  70.121  78.169 1.00 200.00 ? 271 ALA C CB    1 
ATOM   4544 N N     . THR C 2 272 ? 35.147  70.609  81.321 1.00 41.65  ? 272 THR C N     1 
ATOM   4545 C CA    . THR C 2 272 ? 34.376  70.313  82.527 1.00 41.65  ? 272 THR C CA    1 
ATOM   4546 C C     . THR C 2 272 ? 34.177  71.576  83.369 1.00 41.65  ? 272 THR C C     1 
ATOM   4547 O O     . THR C 2 272 ? 33.088  71.824  83.872 1.00 41.65  ? 272 THR C O     1 
ATOM   4548 C CB    . THR C 2 272 ? 35.089  69.224  83.398 1.00 52.92  ? 272 THR C CB    1 
ATOM   4549 O OG1   . THR C 2 272 ? 35.063  67.965  82.716 1.00 52.92  ? 272 THR C OG1   1 
ATOM   4550 C CG2   . THR C 2 272 ? 34.403  69.065  84.741 1.00 52.92  ? 272 THR C CG2   1 
ATOM   4551 N N     . ALA C 2 273 ? 35.239  72.361  83.518 1.00 45.09  ? 273 ALA C N     1 
ATOM   4552 C CA    . ALA C 2 273 ? 35.193  73.596  84.291 1.00 45.09  ? 273 ALA C CA    1 
ATOM   4553 C C     . ALA C 2 273 ? 34.300  74.574  83.576 1.00 45.09  ? 273 ALA C C     1 
ATOM   4554 O O     . ALA C 2 273 ? 33.901  75.598  84.142 1.00 45.09  ? 273 ALA C O     1 
ATOM   4555 C CB    . ALA C 2 273 ? 36.568  74.181  84.429 1.00 18.31  ? 273 ALA C CB    1 
ATOM   4556 N N     . LEU C 2 274 ? 34.024  74.268  82.311 1.00 23.14  ? 274 LEU C N     1 
ATOM   4557 C CA    . LEU C 2 274 ? 33.136  75.078  81.495 1.00 23.14  ? 274 LEU C CA    1 
ATOM   4558 C C     . LEU C 2 274 ? 31.800  74.357  81.519 1.00 23.14  ? 274 LEU C C     1 
ATOM   4559 O O     . LEU C 2 274 ? 30.842  74.797  80.903 1.00 23.14  ? 274 LEU C O     1 
ATOM   4560 C CB    . LEU C 2 274 ? 33.656  75.171  80.063 1.00 44.44  ? 274 LEU C CB    1 
ATOM   4561 C CG    . LEU C 2 274 ? 34.076  76.566  79.584 1.00 44.44  ? 274 LEU C CG    1 
ATOM   4562 C CD1   . LEU C 2 274 ? 34.674  76.479  78.189 1.00 44.44  ? 274 LEU C CD1   1 
ATOM   4563 C CD2   . LEU C 2 274 ? 32.873  77.495  79.578 1.00 44.44  ? 274 LEU C CD2   1 
ATOM   4564 N N     . SER C 2 275 ? 31.757  73.249  82.262 1.00 31.81  ? 275 SER C N     1 
ATOM   4565 C CA    . SER C 2 275 ? 30.569  72.411  82.403 1.00 31.81  ? 275 SER C CA    1 
ATOM   4566 C C     . SER C 2 275 ? 30.038  72.088  81.014 1.00 31.81  ? 275 SER C C     1 
ATOM   4567 O O     . SER C 2 275 ? 28.843  72.243  80.755 1.00 31.81  ? 275 SER C O     1 
ATOM   4568 C CB    . SER C 2 275 ? 29.496  73.139  83.214 1.00 50.15  ? 275 SER C CB    1 
ATOM   4569 O OG    . SER C 2 275 ? 29.184  72.422  84.401 1.00 50.15  ? 275 SER C OG    1 
ATOM   4570 N N     . GLU C 2 276 ? 30.928  71.595  80.146 1.00 28.81  ? 276 GLU C N     1 
ATOM   4571 C CA    . GLU C 2 276 ? 30.607  71.320  78.747 1.00 28.81  ? 276 GLU C CA    1 
ATOM   4572 C C     . GLU C 2 276 ? 31.133  69.976  78.208 1.00 28.81  ? 276 GLU C C     1 
ATOM   4573 O O     . GLU C 2 276 ? 32.048  69.373  78.790 1.00 28.81  ? 276 GLU C O     1 
ATOM   4574 C CB    . GLU C 2 276 ? 31.203  72.463  77.921 1.00 60.55  ? 276 GLU C CB    1 
ATOM   4575 C CG    . GLU C 2 276 ? 30.657  72.667  76.530 1.00 60.55  ? 276 GLU C CG    1 
ATOM   4576 C CD    . GLU C 2 276 ? 29.448  73.577  76.497 1.00 60.55  ? 276 GLU C CD    1 
ATOM   4577 O OE1   . GLU C 2 276 ? 29.308  74.330  75.514 1.00 60.55  ? 276 GLU C OE1   1 
ATOM   4578 O OE2   . GLU C 2 276 ? 28.637  73.537  77.443 1.00 60.55  ? 276 GLU C OE2   1 
ATOM   4579 N N     . ASP C 2 277 ? 30.551  69.528  77.085 1.00 55.34  ? 277 ASP C N     1 
ATOM   4580 C CA    . ASP C 2 277 ? 30.944  68.274  76.395 1.00 55.34  ? 277 ASP C CA    1 
ATOM   4581 C C     . ASP C 2 277 ? 32.278  68.469  75.682 1.00 55.34  ? 277 ASP C C     1 
ATOM   4582 O O     . ASP C 2 277 ? 32.319  68.945  74.551 1.00 55.34  ? 277 ASP C O     1 
ATOM   4583 C CB    . ASP C 2 277 ? 29.908  67.888  75.330 1.00 200.00 ? 277 ASP C CB    1 
ATOM   4584 C CG    . ASP C 2 277 ? 28.990  66.749  75.767 1.00 200.00 ? 277 ASP C CG    1 
ATOM   4585 O OD1   . ASP C 2 277 ? 27.802  67.036  76.076 1.00 200.00 ? 277 ASP C OD1   1 
ATOM   4586 O OD2   . ASP C 2 277 ? 29.461  65.579  75.793 1.00 200.00 ? 277 ASP C OD2   1 
ATOM   4587 N N     . PRO C 2 278 ? 33.374  68.032  76.299 1.00 53.34  ? 278 PRO C N     1 
ATOM   4588 C CA    . PRO C 2 278 ? 34.699  68.200  75.687 1.00 53.34  ? 278 PRO C CA    1 
ATOM   4589 C C     . PRO C 2 278 ? 34.674  68.150  74.163 1.00 53.34  ? 278 PRO C C     1 
ATOM   4590 O O     . PRO C 2 278 ? 35.280  68.989  73.488 1.00 53.34  ? 278 PRO C O     1 
ATOM   4591 C CB    . PRO C 2 278 ? 35.508  67.074  76.303 1.00 23.18  ? 278 PRO C CB    1 
ATOM   4592 C CG    . PRO C 2 278 ? 34.487  66.018  76.391 1.00 23.18  ? 278 PRO C CG    1 
ATOM   4593 C CD    . PRO C 2 278 ? 33.323  66.764  77.034 1.00 23.18  ? 278 PRO C CD    1 
ATOM   4594 N N     . GLY C 2 279 ? 33.964  67.175  73.618 1.00 54.89  ? 279 GLY C N     1 
ATOM   4595 C CA    . GLY C 2 279 ? 33.890  67.091  72.177 1.00 54.89  ? 279 GLY C CA    1 
ATOM   4596 C C     . GLY C 2 279 ? 33.185  68.326  71.671 1.00 54.89  ? 279 GLY C C     1 
ATOM   4597 O O     . GLY C 2 279 ? 33.664  68.996  70.762 1.00 54.89  ? 279 GLY C O     1 
ATOM   4598 N N     . THR C 2 280 ? 32.043  68.627  72.273 1.00 33.99  ? 280 THR C N     1 
ATOM   4599 C CA    . THR C 2 280 ? 31.272  69.791  71.883 1.00 33.99  ? 280 THR C CA    1 
ATOM   4600 C C     . THR C 2 280 ? 32.082  71.085  72.022 1.00 33.99  ? 280 THR C C     1 
ATOM   4601 O O     . THR C 2 280 ? 31.797  72.078  71.337 1.00 33.99  ? 280 THR C O     1 
ATOM   4602 C CB    . THR C 2 280 ? 30.007  69.909  72.733 1.00 35.86  ? 280 THR C CB    1 
ATOM   4603 O OG1   . THR C 2 280 ? 29.327  68.653  72.725 1.00 35.86  ? 280 THR C OG1   1 
ATOM   4604 C CG2   . THR C 2 280 ? 29.085  70.999  72.179 1.00 35.86  ? 280 THR C CG2   1 
ATOM   4605 N N     . LEU C 2 281 ? 33.082  71.079  72.905 1.00 48.31  ? 281 LEU C N     1 
ATOM   4606 C CA    . LEU C 2 281 ? 33.895  72.272  73.079 1.00 48.31  ? 281 LEU C CA    1 
ATOM   4607 C C     . LEU C 2 281 ? 34.736  72.436  71.842 1.00 48.31  ? 281 LEU C C     1 
ATOM   4608 O O     . LEU C 2 281 ? 34.344  73.129  70.907 1.00 48.31  ? 281 LEU C O     1 
ATOM   4609 C CB    . LEU C 2 281 ? 34.823  72.175  74.291 1.00 30.11  ? 281 LEU C CB    1 
ATOM   4610 C CG    . LEU C 2 281 ? 35.389  73.542  74.720 1.00 30.11  ? 281 LEU C CG    1 
ATOM   4611 C CD1   . LEU C 2 281 ? 34.220  74.480  75.060 1.00 30.11  ? 281 LEU C CD1   1 
ATOM   4612 C CD2   . LEU C 2 281 ? 36.318  73.396  75.928 1.00 30.11  ? 281 LEU C CD2   1 
ATOM   4613 N N     . GLU C 2 282 ? 35.885  71.766  71.830 1.00 62.99  ? 282 GLU C N     1 
ATOM   4614 C CA    . GLU C 2 282 ? 36.821  71.829  70.704 1.00 62.99  ? 282 GLU C CA    1 
ATOM   4615 C C     . GLU C 2 282 ? 36.158  71.713  69.325 1.00 62.99  ? 282 GLU C C     1 
ATOM   4616 O O     . GLU C 2 282 ? 36.732  72.105  68.312 1.00 62.99  ? 282 GLU C O     1 
ATOM   4617 C CB    . GLU C 2 282 ? 37.884  70.747  70.877 1.00 86.93  ? 282 GLU C CB    1 
ATOM   4618 C CG    . GLU C 2 282 ? 37.454  69.383  70.451 1.00 86.93  ? 282 GLU C CG    1 
ATOM   4619 C CD    . GLU C 2 282 ? 38.083  69.021  69.144 1.00 86.93  ? 282 GLU C CD    1 
ATOM   4620 O OE1   . GLU C 2 282 ? 39.324  69.147  69.058 1.00 86.93  ? 282 GLU C OE1   1 
ATOM   4621 O OE2   . GLU C 2 282 ? 37.353  68.617  68.211 1.00 86.93  ? 282 GLU C OE2   1 
ATOM   4622 N N     . GLU C 2 283 ? 34.934  71.203  69.305 1.00 38.95  ? 283 GLU C N     1 
ATOM   4623 C CA    . GLU C 2 283 ? 34.199  71.048  68.065 1.00 38.95  ? 283 GLU C CA    1 
ATOM   4624 C C     . GLU C 2 283 ? 33.187  72.142  67.714 1.00 38.95  ? 283 GLU C C     1 
ATOM   4625 O O     . GLU C 2 283 ? 33.052  72.474  66.545 1.00 38.95  ? 283 GLU C O     1 
ATOM   4626 C CB    . GLU C 2 283 ? 33.486  69.681  68.030 1.00 90.77  ? 283 GLU C CB    1 
ATOM   4627 C CG    . GLU C 2 283 ? 34.393  68.467  67.736 1.00 90.77  ? 283 GLU C CG    1 
ATOM   4628 C CD    . GLU C 2 283 ? 33.606  67.204  67.384 1.00 90.77  ? 283 GLU C CD    1 
ATOM   4629 O OE1   . GLU C 2 283 ? 32.785  67.251  66.441 1.00 90.77  ? 283 GLU C OE1   1 
ATOM   4630 O OE2   . GLU C 2 283 ? 33.812  66.166  68.049 1.00 90.77  ? 283 GLU C OE2   1 
ATOM   4631 N N     . VAL C 2 284 ? 32.464  72.705  68.676 1.00 70.61  ? 284 VAL C N     1 
ATOM   4632 C CA    . VAL C 2 284 ? 31.499  73.732  68.286 1.00 70.61  ? 284 VAL C CA    1 
ATOM   4633 C C     . VAL C 2 284 ? 31.698  75.118  68.885 1.00 70.61  ? 284 VAL C C     1 
ATOM   4634 O O     . VAL C 2 284 ? 30.796  75.960  68.845 1.00 70.61  ? 284 VAL C O     1 
ATOM   4635 C CB    . VAL C 2 284 ? 30.067  73.288  68.579 1.00 81.52  ? 284 VAL C CB    1 
ATOM   4636 C CG1   . VAL C 2 284 ? 29.074  74.254  67.923 1.00 81.52  ? 284 VAL C CG1   1 
ATOM   4637 C CG2   . VAL C 2 284 ? 29.865  71.883  68.058 1.00 81.52  ? 284 VAL C CG2   1 
ATOM   4638 N N     . HIS C 2 285 ? 32.883  75.360  69.429 1.00 46.70  ? 285 HIS C N     1 
ATOM   4639 C CA    . HIS C 2 285 ? 33.189  76.638  70.026 1.00 46.70  ? 285 HIS C CA    1 
ATOM   4640 C C     . HIS C 2 285 ? 34.635  76.900  69.751 1.00 46.70  ? 285 HIS C C     1 
ATOM   4641 O O     . HIS C 2 285 ? 34.936  77.846  69.039 1.00 46.70  ? 285 HIS C O     1 
ATOM   4642 C CB    . HIS C 2 285 ? 32.921  76.622  71.533 1.00 82.59  ? 285 HIS C CB    1 
ATOM   4643 C CG    . HIS C 2 285 ? 31.465  76.569  71.885 1.00 82.59  ? 285 HIS C CG    1 
ATOM   4644 N ND1   . HIS C 2 285 ? 30.549  77.478  71.401 1.00 82.59  ? 285 HIS C ND1   1 
ATOM   4645 C CD2   . HIS C 2 285 ? 30.764  75.708  72.661 1.00 82.59  ? 285 HIS C CD2   1 
ATOM   4646 C CE1   . HIS C 2 285 ? 29.347  77.179  71.861 1.00 82.59  ? 285 HIS C CE1   1 
ATOM   4647 N NE2   . HIS C 2 285 ? 29.450  76.109  72.628 1.00 82.59  ? 285 HIS C NE2   1 
ATOM   4648 N N     . GLU C 2 286 ? 35.530  76.061  70.279 1.00 42.98  ? 286 GLU C N     1 
ATOM   4649 C CA    . GLU C 2 286 ? 36.970  76.244  70.049 1.00 42.98  ? 286 GLU C CA    1 
ATOM   4650 C C     . GLU C 2 286 ? 37.323  76.686  68.616 1.00 42.98  ? 286 GLU C C     1 
ATOM   4651 O O     . GLU C 2 286 ? 38.282  77.448  68.413 1.00 42.98  ? 286 GLU C O     1 
ATOM   4652 C CB    . GLU C 2 286 ? 37.748  74.976  70.394 1.00 36.49  ? 286 GLU C CB    1 
ATOM   4653 C CG    . GLU C 2 286 ? 37.802  74.702  71.878 1.00 36.49  ? 286 GLU C CG    1 
ATOM   4654 C CD    . GLU C 2 286 ? 38.859  73.662  72.280 1.00 36.49  ? 286 GLU C CD    1 
ATOM   4655 O OE1   . GLU C 2 286 ? 39.053  73.457  73.493 1.00 36.49  ? 286 GLU C OE1   1 
ATOM   4656 O OE2   . GLU C 2 286 ? 39.502  73.045  71.405 1.00 36.49  ? 286 GLU C OE2   1 
ATOM   4657 N N     . PRO C 2 287 ? 36.562  76.207  67.600 1.00 80.31  ? 287 PRO C N     1 
ATOM   4658 C CA    . PRO C 2 287 ? 36.793  76.562  66.196 1.00 80.31  ? 287 PRO C CA    1 
ATOM   4659 C C     . PRO C 2 287 ? 37.054  78.051  65.948 1.00 80.31  ? 287 PRO C C     1 
ATOM   4660 O O     . PRO C 2 287 ? 38.207  78.491  66.029 1.00 80.31  ? 287 PRO C O     1 
ATOM   4661 C CB    . PRO C 2 287 ? 35.524  76.070  65.521 1.00 170.87 ? 287 PRO C CB    1 
ATOM   4662 C CG    . PRO C 2 287 ? 35.299  74.784  66.226 1.00 170.87 ? 287 PRO C CG    1 
ATOM   4663 C CD    . PRO C 2 287 ? 35.547  75.137  67.686 1.00 170.87 ? 287 PRO C CD    1 
ATOM   4664 N N     . TYR C 2 288 ? 35.996  78.825  65.664 1.00 77.64  ? 288 TYR C N     1 
ATOM   4665 C CA    . TYR C 2 288 ? 36.164  80.261  65.387 1.00 77.64  ? 288 TYR C CA    1 
ATOM   4666 C C     . TYR C 2 288 ? 37.180  80.897  66.289 1.00 77.64  ? 288 TYR C C     1 
ATOM   4667 O O     . TYR C 2 288 ? 38.050  81.630  65.828 1.00 77.64  ? 288 TYR C O     1 
ATOM   4668 C CB    . TYR C 2 288 ? 34.871  81.073  65.521 1.00 89.54  ? 288 TYR C CB    1 
ATOM   4669 C CG    . TYR C 2 288 ? 35.096  82.545  65.170 1.00 89.54  ? 288 TYR C CG    1 
ATOM   4670 C CD1   . TYR C 2 288 ? 35.840  82.903  64.044 1.00 89.54  ? 288 TYR C CD1   1 
ATOM   4671 C CD2   . TYR C 2 288 ? 34.555  83.575  65.939 1.00 89.54  ? 288 TYR C CD2   1 
ATOM   4672 C CE1   . TYR C 2 288 ? 36.038  84.252  63.690 1.00 89.54  ? 288 TYR C CE1   1 
ATOM   4673 C CE2   . TYR C 2 288 ? 34.745  84.934  65.587 1.00 89.54  ? 288 TYR C CE2   1 
ATOM   4674 C CZ    . TYR C 2 288 ? 35.490  85.261  64.461 1.00 89.54  ? 288 TYR C CZ    1 
ATOM   4675 O OH    . TYR C 2 288 ? 35.702  86.576  64.095 1.00 89.54  ? 288 TYR C OH    1 
ATOM   4676 N N     . LEU C 2 289 ? 37.044  80.640  67.580 1.00 42.03  ? 289 LEU C N     1 
ATOM   4677 C CA    . LEU C 2 289 ? 37.989  81.191  68.512 1.00 42.03  ? 289 LEU C CA    1 
ATOM   4678 C C     . LEU C 2 289 ? 39.350  81.127  67.827 1.00 42.03  ? 289 LEU C C     1 
ATOM   4679 O O     . LEU C 2 289 ? 39.795  82.124  67.283 1.00 42.03  ? 289 LEU C O     1 
ATOM   4680 C CB    . LEU C 2 289 ? 37.995  80.401  69.830 1.00 78.53  ? 289 LEU C CB    1 
ATOM   4681 C CG    . LEU C 2 289 ? 36.704  80.352  70.669 1.00 78.53  ? 289 LEU C CG    1 
ATOM   4682 C CD1   . LEU C 2 289 ? 37.075  80.001  72.097 1.00 78.53  ? 289 LEU C CD1   1 
ATOM   4683 C CD2   . LEU C 2 289 ? 35.975  81.681  70.655 1.00 78.53  ? 289 LEU C CD2   1 
ATOM   4684 N N     . ILE C 2 290 ? 39.989  79.962  67.805 1.00 71.66  ? 290 ILE C N     1 
ATOM   4685 C CA    . ILE C 2 290 ? 41.301  79.831  67.164 1.00 71.66  ? 290 ILE C CA    1 
ATOM   4686 C C     . ILE C 2 290 ? 41.458  80.630  65.858 1.00 71.66  ? 290 ILE C C     1 
ATOM   4687 O O     . ILE C 2 290 ? 42.372  81.450  65.728 1.00 71.66  ? 290 ILE C O     1 
ATOM   4688 C CB    . ILE C 2 290 ? 41.632  78.361  66.861 1.00 142.82 ? 290 ILE C CB    1 
ATOM   4689 C CG1   . ILE C 2 290 ? 41.631  77.548  68.154 1.00 142.82 ? 290 ILE C CG1   1 
ATOM   4690 C CG2   . ILE C 2 290 ? 43.000  78.263  66.202 1.00 142.82 ? 290 ILE C CG2   1 
ATOM   4691 C CD1   . ILE C 2 290 ? 42.086  76.110  67.972 1.00 142.82 ? 290 ILE C CD1   1 
ATOM   4692 N N     . ARG C 2 291 ? 40.575  80.383  64.892 1.00 78.94  ? 291 ARG C N     1 
ATOM   4693 C CA    . ARG C 2 291 ? 40.621  81.089  63.606 1.00 78.94  ? 291 ARG C CA    1 
ATOM   4694 C C     . ARG C 2 291 ? 40.231  82.558  63.767 1.00 78.94  ? 291 ARG C C     1 
ATOM   4695 O O     . ARG C 2 291 ? 39.451  83.102  62.980 1.00 78.94  ? 291 ARG C O     1 
ATOM   4696 C CB    . ARG C 2 291 ? 39.684  80.421  62.579 1.00 82.16  ? 291 ARG C CB    1 
ATOM   4697 C CG    . ARG C 2 291 ? 38.277  80.161  63.103 1.00 82.16  ? 291 ARG C CG    1 
ATOM   4698 C CD    . ARG C 2 291 ? 37.273  79.791  62.019 1.00 82.16  ? 291 ARG C CD    1 
ATOM   4699 N NE    . ARG C 2 291 ? 36.937  80.936  61.175 1.00 82.16  ? 291 ARG C NE    1 
ATOM   4700 C CZ    . ARG C 2 291 ? 35.716  81.187  60.712 1.00 82.16  ? 291 ARG C CZ    1 
ATOM   4701 N NH1   . ARG C 2 291 ? 34.712  80.374  61.014 1.00 82.16  ? 291 ARG C NH1   1 
ATOM   4702 N NH2   . ARG C 2 291 ? 35.497  82.249  59.950 1.00 82.16  ? 291 ARG C NH2   1 
ATOM   4703 N N     . GLN C 2 292 ? 40.784  83.191  64.795 1.00 45.46  ? 292 GLN C N     1 
ATOM   4704 C CA    . GLN C 2 292 ? 40.514  84.593  65.081 1.00 45.46  ? 292 GLN C CA    1 
ATOM   4705 C C     . GLN C 2 292 ? 41.320  85.047  66.303 1.00 45.46  ? 292 GLN C C     1 
ATOM   4706 O O     . GLN C 2 292 ? 40.765  85.280  67.379 1.00 45.46  ? 292 GLN C O     1 
ATOM   4707 C CB    . GLN C 2 292 ? 39.014  84.810  65.312 1.00 72.31  ? 292 GLN C CB    1 
ATOM   4708 C CG    . GLN C 2 292 ? 38.468  85.954  64.506 1.00 72.31  ? 292 GLN C CG    1 
ATOM   4709 C CD    . GLN C 2 292 ? 39.256  87.215  64.731 1.00 72.31  ? 292 GLN C CD    1 
ATOM   4710 O OE1   . GLN C 2 292 ? 39.066  87.912  65.730 1.00 72.31  ? 292 GLN C OE1   1 
ATOM   4711 N NE2   . GLN C 2 292 ? 40.173  87.513  63.811 1.00 72.31  ? 292 GLN C NE2   1 
ATOM   4712 N N     . GLY C 2 293 ? 42.634  85.164  66.109 1.00 195.84 ? 293 GLY C N     1 
ATOM   4713 C CA    . GLY C 2 293 ? 43.543  85.585  67.164 1.00 195.84 ? 293 GLY C CA    1 
ATOM   4714 C C     . GLY C 2 293 ? 42.942  85.553  68.554 1.00 195.84 ? 293 GLY C C     1 
ATOM   4715 O O     . GLY C 2 293 ? 42.777  86.591  69.192 1.00 195.84 ? 293 GLY C O     1 
ATOM   4716 N N     . LEU C 2 294 ? 42.617  84.355  69.024 1.00 67.88  ? 294 LEU C N     1 
ATOM   4717 C CA    . LEU C 2 294 ? 42.008  84.178  70.340 1.00 67.88  ? 294 LEU C CA    1 
ATOM   4718 C C     . LEU C 2 294 ? 42.470  82.913  71.044 1.00 67.88  ? 294 LEU C C     1 
ATOM   4719 O O     . LEU C 2 294 ? 43.250  82.972  72.000 1.00 67.88  ? 294 LEU C O     1 
ATOM   4720 C CB    . LEU C 2 294 ? 40.492  84.151  70.197 1.00 28.19  ? 294 LEU C CB    1 
ATOM   4721 C CG    . LEU C 2 294 ? 39.915  85.545  69.994 1.00 28.19  ? 294 LEU C CG    1 
ATOM   4722 C CD1   . LEU C 2 294 ? 38.498  85.521  69.438 1.00 28.19  ? 294 LEU C CD1   1 
ATOM   4723 C CD2   . LEU C 2 294 ? 39.953  86.230  71.345 1.00 28.19  ? 294 LEU C CD2   1 
ATOM   4724 N N     . LEU C 2 295 ? 41.983  81.773  70.550 1.00 73.94  ? 295 LEU C N     1 
ATOM   4725 C CA    . LEU C 2 295 ? 42.305  80.467  71.118 1.00 73.94  ? 295 LEU C CA    1 
ATOM   4726 C C     . LEU C 2 295 ? 43.455  79.736  70.426 1.00 73.94  ? 295 LEU C C     1 
ATOM   4727 O O     . LEU C 2 295 ? 43.564  79.734  69.197 1.00 73.94  ? 295 LEU C O     1 
ATOM   4728 C CB    . LEU C 2 295 ? 41.053  79.587  71.112 1.00 57.68  ? 295 LEU C CB    1 
ATOM   4729 C CG    . LEU C 2 295 ? 41.114  78.277  71.909 1.00 57.68  ? 295 LEU C CG    1 
ATOM   4730 C CD1   . LEU C 2 295 ? 42.246  78.289  72.935 1.00 57.68  ? 295 LEU C CD1   1 
ATOM   4731 C CD2   . LEU C 2 295 ? 39.767  78.073  72.589 1.00 57.68  ? 295 LEU C CD2   1 
ATOM   4732 N N     . LYS C 2 296 ? 44.312  79.119  71.236 1.00 102.94 ? 296 LYS C N     1 
ATOM   4733 C CA    . LYS C 2 296 ? 45.457  78.377  70.728 1.00 102.94 ? 296 LYS C CA    1 
ATOM   4734 C C     . LYS C 2 296 ? 45.615  76.988  71.350 1.00 102.94 ? 296 LYS C C     1 
ATOM   4735 O O     . LYS C 2 296 ? 45.760  76.844  72.567 1.00 102.94 ? 296 LYS C O     1 
ATOM   4736 C CB    . LYS C 2 296 ? 46.752  79.164  70.946 1.00 170.61 ? 296 LYS C CB    1 
ATOM   4737 C CG    . LYS C 2 296 ? 47.187  80.012  69.759 1.00 170.61 ? 296 LYS C CG    1 
ATOM   4738 C CD    . LYS C 2 296 ? 48.588  80.578  69.977 1.00 170.61 ? 296 LYS C CD    1 
ATOM   4739 C CE    . LYS C 2 296 ? 49.623  79.466  70.129 1.00 170.61 ? 296 LYS C CE    1 
ATOM   4740 N NZ    . LYS C 2 296 ? 50.986  79.990  70.427 1.00 170.61 ? 296 LYS C NZ    1 
ATOM   4741 N N     . ARG C 2 297 ? 45.595  75.971  70.491 1.00 74.28  ? 297 ARG C N     1 
ATOM   4742 C CA    . ARG C 2 297 ? 45.752  74.594  70.915 1.00 74.28  ? 297 ARG C CA    1 
ATOM   4743 C C     . ARG C 2 297 ? 47.231  74.240  71.015 1.00 74.28  ? 297 ARG C C     1 
ATOM   4744 O O     . ARG C 2 297 ? 47.958  74.247  70.016 1.00 74.28  ? 297 ARG C O     1 
ATOM   4745 C CB    . ARG C 2 297 ? 45.046  73.682  69.930 1.00 41.31  ? 297 ARG C CB    1 
ATOM   4746 C CG    . ARG C 2 297 ? 43.541  73.770  70.015 1.00 41.31  ? 297 ARG C CG    1 
ATOM   4747 C CD    . ARG C 2 297 ? 42.892  72.863  69.003 1.00 41.31  ? 297 ARG C CD    1 
ATOM   4748 N NE    . ARG C 2 297 ? 41.459  72.757  69.217 1.00 41.31  ? 297 ARG C NE    1 
ATOM   4749 C CZ    . ARG C 2 297 ? 40.581  72.471  68.260 1.00 41.31  ? 297 ARG C CZ    1 
ATOM   4750 N NH1   . ARG C 2 297 ? 40.997  72.260  67.021 1.00 41.31  ? 297 ARG C NH1   1 
ATOM   4751 N NH2   . ARG C 2 297 ? 39.283  72.414  68.536 1.00 41.31  ? 297 ARG C NH2   1 
ATOM   4752 N N     . THR C 2 298 ? 47.651  73.942  72.244 1.00 79.05  ? 298 THR C N     1 
ATOM   4753 C CA    . THR C 2 298 ? 49.030  73.597  72.590 1.00 79.05  ? 298 THR C CA    1 
ATOM   4754 C C     . THR C 2 298 ? 49.116  72.215  73.230 1.00 79.05  ? 298 THR C C     1 
ATOM   4755 O O     . THR C 2 298 ? 48.247  71.831  74.004 1.00 79.05  ? 298 THR C O     1 
ATOM   4756 C CB    . THR C 2 298 ? 49.609  74.631  73.595 1.00 70.06  ? 298 THR C CB    1 
ATOM   4757 O OG1   . THR C 2 298 ? 50.144  75.746  72.877 1.00 70.06  ? 298 THR C OG1   1 
ATOM   4758 C CG2   . THR C 2 298 ? 50.688  74.016  74.473 1.00 70.06  ? 298 THR C CG2   1 
ATOM   4759 N N     . PRO C 2 299 ? 50.180  71.455  72.919 1.00 77.55  ? 299 PRO C N     1 
ATOM   4760 C CA    . PRO C 2 299 ? 50.399  70.110  73.460 1.00 77.55  ? 299 PRO C CA    1 
ATOM   4761 C C     . PRO C 2 299 ? 50.335  70.118  74.981 1.00 77.55  ? 299 PRO C C     1 
ATOM   4762 O O     . PRO C 2 299 ? 50.331  69.067  75.621 1.00 77.55  ? 299 PRO C O     1 
ATOM   4763 C CB    . PRO C 2 299 ? 51.792  69.759  72.949 1.00 200.00 ? 299 PRO C CB    1 
ATOM   4764 C CG    . PRO C 2 299 ? 51.842  70.462  71.638 1.00 200.00 ? 299 PRO C CG    1 
ATOM   4765 C CD    . PRO C 2 299 ? 51.254  71.813  71.975 1.00 200.00 ? 299 PRO C CD    1 
ATOM   4766 N N     . ARG C 2 300 ? 50.298  71.318  75.553 1.00 60.27  ? 300 ARG C N     1 
ATOM   4767 C CA    . ARG C 2 300 ? 50.222  71.475  76.996 1.00 60.27  ? 300 ARG C CA    1 
ATOM   4768 C C     . ARG C 2 300 ? 48.757  71.641  77.356 1.00 60.27  ? 300 ARG C C     1 
ATOM   4769 O O     . ARG C 2 300 ? 48.339  71.332  78.468 1.00 60.27  ? 300 ARG C O     1 
ATOM   4770 C CB    . ARG C 2 300 ? 51.021  72.703  77.441 1.00 167.78 ? 300 ARG C CB    1 
ATOM   4771 C CG    . ARG C 2 300 ? 52.515  72.608  77.165 1.00 167.78 ? 300 ARG C CG    1 
ATOM   4772 C CD    . ARG C 2 300 ? 53.155  71.478  77.964 1.00 167.78 ? 300 ARG C CD    1 
ATOM   4773 N NE    . ARG C 2 300 ? 54.578  71.328  77.665 1.00 167.78 ? 300 ARG C NE    1 
ATOM   4774 C CZ    . ARG C 2 300 ? 55.495  72.268  77.880 1.00 167.78 ? 300 ARG C CZ    1 
ATOM   4775 N NH1   . ARG C 2 300 ? 55.139  73.435  78.400 1.00 167.78 ? 300 ARG C NH1   1 
ATOM   4776 N NH2   . ARG C 2 300 ? 56.768  72.045  77.574 1.00 167.78 ? 300 ARG C NH2   1 
ATOM   4777 N N     . GLY C 2 301 ? 47.988  72.122  76.387 1.00 81.24  ? 301 GLY C N     1 
ATOM   4778 C CA    . GLY C 2 301 ? 46.566  72.334  76.577 1.00 81.24  ? 301 GLY C CA    1 
ATOM   4779 C C     . GLY C 2 301 ? 46.172  73.608  75.858 1.00 81.24  ? 301 GLY C C     1 
ATOM   4780 O O     . GLY C 2 301 ? 47.012  74.193  75.181 1.00 81.24  ? 301 GLY C O     1 
ATOM   4781 N N     . ARG C 2 302 ? 44.913  74.030  75.974 1.00 46.12  ? 302 ARG C N     1 
ATOM   4782 C CA    . ARG C 2 302 ? 44.476  75.268  75.337 1.00 46.12  ? 302 ARG C CA    1 
ATOM   4783 C C     . ARG C 2 302 ? 45.188  76.414  76.064 1.00 46.12  ? 302 ARG C C     1 
ATOM   4784 O O     . ARG C 2 302 ? 45.766  76.199  77.125 1.00 46.12  ? 302 ARG C O     1 
ATOM   4785 C CB    . ARG C 2 302 ? 42.974  75.435  75.517 1.00 53.61  ? 302 ARG C CB    1 
ATOM   4786 C CG    . ARG C 2 302 ? 42.166  74.318  74.955 1.00 53.61  ? 302 ARG C CG    1 
ATOM   4787 C CD    . ARG C 2 302 ? 42.126  74.428  73.459 1.00 53.61  ? 302 ARG C CD    1 
ATOM   4788 N NE    . ARG C 2 302 ? 41.379  73.336  72.840 1.00 53.61  ? 302 ARG C NE    1 
ATOM   4789 C CZ    . ARG C 2 302 ? 41.780  72.070  72.782 1.00 53.61  ? 302 ARG C CZ    1 
ATOM   4790 N NH1   . ARG C 2 302 ? 42.945  71.700  73.311 1.00 53.61  ? 302 ARG C NH1   1 
ATOM   4791 N NH2   . ARG C 2 302 ? 41.011  71.176  72.183 1.00 53.61  ? 302 ARG C NH2   1 
ATOM   4792 N N     . VAL C 2 303 ? 45.155  77.616  75.487 1.00 53.61  ? 303 VAL C N     1 
ATOM   4793 C CA    . VAL C 2 303 ? 45.749  78.819  76.094 1.00 53.61  ? 303 VAL C CA    1 
ATOM   4794 C C     . VAL C 2 303 ? 45.137  80.071  75.467 1.00 53.61  ? 303 VAL C C     1 
ATOM   4795 O O     . VAL C 2 303 ? 44.679  80.051  74.319 1.00 53.61  ? 303 VAL C O     1 
ATOM   4796 C CB    . VAL C 2 303 ? 47.269  78.918  75.889 1.00 15.30  ? 303 VAL C CB    1 
ATOM   4797 C CG1   . VAL C 2 303 ? 47.974  77.729  76.508 1.00 15.30  ? 303 VAL C CG1   1 
ATOM   4798 C CG2   . VAL C 2 303 ? 47.575  79.045  74.420 1.00 15.30  ? 303 VAL C CG2   1 
ATOM   4799 N N     . ALA C 2 304 ? 45.136  81.169  76.203 1.00 68.77  ? 304 ALA C N     1 
ATOM   4800 C CA    . ALA C 2 304 ? 44.559  82.383  75.656 1.00 68.77  ? 304 ALA C CA    1 
ATOM   4801 C C     . ALA C 2 304 ? 45.593  83.318  75.030 1.00 68.77  ? 304 ALA C C     1 
ATOM   4802 O O     . ALA C 2 304 ? 46.557  83.737  75.686 1.00 68.77  ? 304 ALA C O     1 
ATOM   4803 C CB    . ALA C 2 304 ? 43.796  83.110  76.734 1.00 121.50 ? 304 ALA C CB    1 
ATOM   4804 N N     . THR C 2 305 ? 45.394  83.647  73.757 1.00 87.91  ? 305 THR C N     1 
ATOM   4805 C CA    . THR C 2 305 ? 46.303  84.559  73.088 1.00 87.91  ? 305 THR C CA    1 
ATOM   4806 C C     . THR C 2 305 ? 46.027  85.932  73.696 1.00 87.91  ? 305 THR C C     1 
ATOM   4807 O O     . THR C 2 305 ? 44.874  86.268  73.976 1.00 87.91  ? 305 THR C O     1 
ATOM   4808 C CB    . THR C 2 305 ? 46.036  84.618  71.576 1.00 124.55 ? 305 THR C CB    1 
ATOM   4809 O OG1   . THR C 2 305 ? 47.074  85.372  70.938 1.00 124.55 ? 305 THR C OG1   1 
ATOM   4810 C CG2   . THR C 2 305 ? 44.711  85.288  71.297 1.00 124.55 ? 305 THR C CG2   1 
ATOM   4811 N N     . GLU C 2 306 ? 47.075  86.721  73.910 1.00 89.85  ? 306 GLU C N     1 
ATOM   4812 C CA    . GLU C 2 306 ? 46.896  88.040  74.497 1.00 89.85  ? 306 GLU C CA    1 
ATOM   4813 C C     . GLU C 2 306 ? 45.678  88.764  73.931 1.00 89.85  ? 306 GLU C C     1 
ATOM   4814 O O     . GLU C 2 306 ? 44.828  89.237  74.679 1.00 89.85  ? 306 GLU C O     1 
ATOM   4815 C CB    . GLU C 2 306 ? 48.140  88.909  74.288 1.00 168.30 ? 306 GLU C CB    1 
ATOM   4816 C CG    . GLU C 2 306 ? 48.001  90.299  74.906 1.00 168.30 ? 306 GLU C CG    1 
ATOM   4817 C CD    . GLU C 2 306 ? 49.202  91.196  74.660 1.00 168.30 ? 306 GLU C CD    1 
ATOM   4818 O OE1   . GLU C 2 306 ? 49.554  91.418  73.482 1.00 168.30 ? 306 GLU C OE1   1 
ATOM   4819 O OE2   . GLU C 2 306 ? 49.789  91.688  75.648 1.00 168.30 ? 306 GLU C OE2   1 
ATOM   4820 N N     . LEU C 2 307 ? 45.585  88.834  72.609 1.00 45.82  ? 307 LEU C N     1 
ATOM   4821 C CA    . LEU C 2 307 ? 44.483  89.524  71.954 1.00 45.82  ? 307 LEU C CA    1 
ATOM   4822 C C     . LEU C 2 307 ? 43.109  89.114  72.450 1.00 45.82  ? 307 LEU C C     1 
ATOM   4823 O O     . LEU C 2 307 ? 42.084  89.627  71.965 1.00 45.82  ? 307 LEU C O     1 
ATOM   4824 C CB    . LEU C 2 307 ? 44.550  89.313  70.444 1.00 110.00 ? 307 LEU C CB    1 
ATOM   4825 C CG    . LEU C 2 307 ? 45.829  89.824  69.784 1.00 110.00 ? 307 LEU C CG    1 
ATOM   4826 C CD1   . LEU C 2 307 ? 45.723  89.637  68.279 1.00 110.00 ? 307 LEU C CD1   1 
ATOM   4827 C CD2   . LEU C 2 307 ? 46.046  91.295  70.134 1.00 110.00 ? 307 LEU C CD2   1 
ATOM   4828 N N     . ALA C 2 308 ? 43.081  88.184  73.401 1.00 63.18  ? 308 ALA C N     1 
ATOM   4829 C CA    . ALA C 2 308 ? 41.823  87.699  73.957 1.00 63.18  ? 308 ALA C CA    1 
ATOM   4830 C C     . ALA C 2 308 ? 41.509  88.456  75.227 1.00 63.18  ? 308 ALA C C     1 
ATOM   4831 O O     . ALA C 2 308 ? 40.434  89.049  75.362 1.00 63.18  ? 308 ALA C O     1 
ATOM   4832 C CB    . ALA C 2 308 ? 41.922  86.211  74.249 1.00 184.42 ? 308 ALA C CB    1 
ATOM   4833 N N     . ARG C 2 309 ? 42.466  88.428  76.152 1.00 63.99  ? 309 ARG C N     1 
ATOM   4834 C CA    . ARG C 2 309 ? 42.335  89.109  77.432 1.00 63.99  ? 309 ARG C CA    1 
ATOM   4835 C C     . ARG C 2 309 ? 41.995  90.575  77.239 1.00 63.99  ? 309 ARG C C     1 
ATOM   4836 O O     . ARG C 2 309 ? 40.874  90.993  77.525 1.00 63.99  ? 309 ARG C O     1 
ATOM   4837 C CB    . ARG C 2 309 ? 43.625  88.968  78.253 1.00 156.75 ? 309 ARG C CB    1 
ATOM   4838 C CG    . ARG C 2 309 ? 44.917  89.200  77.481 1.00 156.75 ? 309 ARG C CG    1 
ATOM   4839 C CD    . ARG C 2 309 ? 45.728  87.913  77.356 1.00 156.75 ? 309 ARG C CD    1 
ATOM   4840 N NE    . ARG C 2 309 ? 46.253  87.452  78.640 1.00 156.75 ? 309 ARG C NE    1 
ATOM   4841 C CZ    . ARG C 2 309 ? 46.933  86.321  78.810 1.00 156.75 ? 309 ARG C CZ    1 
ATOM   4842 N NH1   . ARG C 2 309 ? 47.176  85.524  77.777 1.00 156.75 ? 309 ARG C NH1   1 
ATOM   4843 N NH2   . ARG C 2 309 ? 47.370  85.986  80.017 1.00 156.75 ? 309 ARG C NH2   1 
ATOM   4844 N N     . ARG C 2 310 ? 42.959  91.349  76.752 1.00 200.00 ? 310 ARG C N     1 
ATOM   4845 C CA    . ARG C 2 310 ? 42.746  92.772  76.518 1.00 200.00 ? 310 ARG C CA    1 
ATOM   4846 C C     . ARG C 2 310 ? 41.438  93.002  75.758 1.00 200.00 ? 310 ARG C C     1 
ATOM   4847 O O     . ARG C 2 310 ? 40.761  94.012  75.963 1.00 200.00 ? 310 ARG C O     1 
ATOM   4848 C CB    . ARG C 2 310 ? 43.928  93.363  75.736 1.00 134.58 ? 310 ARG C CB    1 
ATOM   4849 C CG    . ARG C 2 310 ? 45.176  93.678  76.574 1.00 134.58 ? 310 ARG C CG    1 
ATOM   4850 C CD    . ARG C 2 310 ? 44.947  94.873  77.503 1.00 134.58 ? 310 ARG C CD    1 
ATOM   4851 N NE    . ARG C 2 310 ? 46.191  95.518  77.935 1.00 134.58 ? 310 ARG C NE    1 
ATOM   4852 C CZ    . ARG C 2 310 ? 47.063  95.000  78.799 1.00 134.58 ? 310 ARG C CZ    1 
ATOM   4853 N NH1   . ARG C 2 310 ? 46.842  93.811  79.345 1.00 134.58 ? 310 ARG C NH1   1 
ATOM   4854 N NH2   . ARG C 2 310 ? 48.160  95.677  79.119 1.00 134.58 ? 310 ARG C NH2   1 
ATOM   4855 N N     . HIS C 2 311 ? 41.081  92.057  74.889 1.00 72.92  ? 311 HIS C N     1 
ATOM   4856 C CA    . HIS C 2 311 ? 39.852  92.156  74.109 1.00 72.92  ? 311 HIS C CA    1 
ATOM   4857 C C     . HIS C 2 311 ? 38.643  92.109  75.036 1.00 72.92  ? 311 HIS C C     1 
ATOM   4858 O O     . HIS C 2 311 ? 37.634  92.774  74.777 1.00 72.92  ? 311 HIS C O     1 
ATOM   4859 C CB    . HIS C 2 311 ? 39.781  91.006  73.101 1.00 79.73  ? 311 HIS C CB    1 
ATOM   4860 C CG    . HIS C 2 311 ? 38.435  90.833  72.463 1.00 79.73  ? 311 HIS C CG    1 
ATOM   4861 N ND1   . HIS C 2 311 ? 37.265  90.770  73.193 1.00 79.73  ? 311 HIS C ND1   1 
ATOM   4862 C CD2   . HIS C 2 311 ? 38.077  90.660  71.169 1.00 79.73  ? 311 HIS C CD2   1 
ATOM   4863 C CE1   . HIS C 2 311 ? 36.247  90.565  72.377 1.00 79.73  ? 311 HIS C CE1   1 
ATOM   4864 N NE2   . HIS C 2 311 ? 36.713  90.493  71.143 1.00 79.73  ? 311 HIS C NE2   1 
ATOM   4865 N N     . LEU C 2 312 ? 38.762  91.315  76.104 1.00 105.90 ? 312 LEU C N     1 
ATOM   4866 C CA    . LEU C 2 312 ? 37.715  91.113  77.119 1.00 105.90 ? 312 LEU C CA    1 
ATOM   4867 C C     . LEU C 2 312 ? 36.882  89.849  76.870 1.00 105.90 ? 312 LEU C C     1 
ATOM   4868 O O     . LEU C 2 312 ? 37.143  89.161  75.859 1.00 105.90 ? 312 LEU C O     1 
ATOM   4869 C CB    . LEU C 2 312 ? 36.778  92.334  77.211 1.00 107.99 ? 312 LEU C CB    1 
ATOM   4870 C CG    . LEU C 2 312 ? 37.085  93.450  78.222 1.00 107.99 ? 312 LEU C CG    1 
ATOM   4871 C CD1   . LEU C 2 312 ? 36.319  94.695  77.828 1.00 107.99 ? 312 LEU C CD1   1 
ATOM   4872 C CD2   . LEU C 2 312 ? 36.701  93.020  79.640 1.00 107.99 ? 312 LEU C CD2   1 
ATOM   4873 O OXT   . LEU C 2 312 ? 35.981  89.563  77.694 1.00 107.99 ? 312 LEU C OXT   1 
HETATM 4874 P PG    . ANP D 3 .   ? 25.503  71.943  54.975 1.00 114.09 ? 313 ANP C PG    1 
HETATM 4875 O O1G   . ANP D 3 .   ? 26.736  72.826  54.676 1.00 114.09 ? 313 ANP C O1G   1 
HETATM 4876 O O2G   . ANP D 3 .   ? 25.340  70.774  54.039 1.00 114.09 ? 313 ANP C O2G   1 
HETATM 4877 O O3G   . ANP D 3 .   ? 25.559  71.436  56.475 1.00 114.09 ? 313 ANP C O3G   1 
HETATM 4878 P PB    . ANP D 3 .   ? 23.494  73.826  53.631 1.00 114.09 ? 313 ANP C PB    1 
HETATM 4879 O O1B   . ANP D 3 .   ? 24.088  73.491  52.292 1.00 114.09 ? 313 ANP C O1B   1 
HETATM 4880 O O2B   . ANP D 3 .   ? 22.022  73.667  53.748 1.00 114.09 ? 313 ANP C O2B   1 
HETATM 4881 N N3B   . ANP D 3 .   ? 24.167  72.938  54.887 1.00 114.09 ? 313 ANP C N3B   1 
HETATM 4882 P PA    . ANP D 3 .   ? 23.904  76.133  55.495 1.00 114.09 ? 313 ANP C PA    1 
HETATM 4883 O O1A   . ANP D 3 .   ? 24.082  75.234  56.652 1.00 114.09 ? 313 ANP C O1A   1 
HETATM 4884 O O2A   . ANP D 3 .   ? 24.984  77.132  55.465 1.00 114.09 ? 313 ANP C O2A   1 
HETATM 4885 O O3A   . ANP D 3 .   ? 23.888  75.341  54.040 1.00 114.09 ? 313 ANP C O3A   1 
HETATM 4886 O "O5'" . ANP D 3 .   ? 22.450  76.866  55.646 1.00 114.09 ? 313 ANP C "O5'" 1 
HETATM 4887 C "C5'" . ANP D 3 .   ? 21.170  76.405  54.970 1.00 114.09 ? 313 ANP C "C5'" 1 
HETATM 4888 C "C4'" . ANP D 3 .   ? 20.365  77.683  54.540 1.00 114.09 ? 313 ANP C "C4'" 1 
HETATM 4889 O "O4'" . ANP D 3 .   ? 21.204  78.757  54.000 1.00 114.09 ? 313 ANP C "O4'" 1 
HETATM 4890 C "C3'" . ANP D 3 .   ? 19.249  77.427  53.463 1.00 114.09 ? 313 ANP C "C3'" 1 
HETATM 4891 O "O3'" . ANP D 3 .   ? 17.974  77.924  53.885 1.00 114.09 ? 313 ANP C "O3'" 1 
HETATM 4892 C "C2'" . ANP D 3 .   ? 19.768  78.108  52.142 1.00 114.09 ? 313 ANP C "C2'" 1 
HETATM 4893 O "O2'" . ANP D 3 .   ? 18.678  78.772  51.504 1.00 114.09 ? 313 ANP C "O2'" 1 
HETATM 4894 C "C1'" . ANP D 3 .   ? 20.878  79.039  52.620 1.00 114.09 ? 313 ANP C "C1'" 1 
HETATM 4895 N N9    . ANP D 3 .   ? 22.158  79.008  51.794 1.00 70.90  ? 313 ANP C N9    1 
HETATM 4896 C C8    . ANP D 3 .   ? 23.322  78.285  52.028 1.00 70.90  ? 313 ANP C C8    1 
HETATM 4897 N N7    . ANP D 3 .   ? 24.276  78.524  51.100 1.00 70.90  ? 313 ANP C N7    1 
HETATM 4898 C C5    . ANP D 3 .   ? 23.737  79.399  50.261 1.00 70.90  ? 313 ANP C C5    1 
HETATM 4899 C C6    . ANP D 3 .   ? 24.262  80.064  49.059 1.00 70.90  ? 313 ANP C C6    1 
HETATM 4900 N N6    . ANP D 3 .   ? 25.504  79.814  48.641 1.00 70.90  ? 313 ANP C N6    1 
HETATM 4901 N N1    . ANP D 3 .   ? 23.432  80.973  48.353 1.00 70.90  ? 313 ANP C N1    1 
HETATM 4902 C C2    . ANP D 3 .   ? 22.131  81.209  48.836 1.00 70.90  ? 313 ANP C C2    1 
HETATM 4903 N N3    . ANP D 3 .   ? 21.549  80.659  49.933 1.00 70.90  ? 313 ANP C N3    1 
HETATM 4904 C C4    . ANP D 3 .   ? 22.406  79.752  50.619 1.00 70.90  ? 313 ANP C C4    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   ILE 2   2   2   ILE ILE A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   TYR 4   4   4   TYR TYR A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   ARG 6   6   6   ARG ARG A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  LYS 12  12  12  LYS LYS A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  ALA 14  14  14  ALA ALA A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  PHE 17  17  17  PHE PHE A . n 
A 1 18  VAL 18  18  18  VAL VAL A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  LEU 20  20  20  LEU LEU A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  PHE 27  27  27  PHE PHE A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  GLN 29  29  29  GLN GLN A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  PRO 31  31  31  PRO PRO A . n 
A 1 32  THR 32  32  32  THR THR A . n 
A 1 33  PRO 33  33  33  PRO PRO A . n 
A 1 34  PHE 34  34  34  PHE PHE A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  GLN 36  36  36  GLN GLN A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  VAL 44  44  44  VAL VAL A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  HIS 47  47  47  HIS HIS A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  HIS 49  49  49  HIS HIS A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  SER 58  58  58  SER SER A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  TYR 60  60  60  TYR TYR A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  PHE 62  62  62  PHE PHE A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  GLU 66  66  66  GLU GLU A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  ALA 69  69  69  ALA ALA A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  PHE 71  71  71  PHE PHE A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  VAL 77  77  77  VAL VAL A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  VAL 80  80  80  VAL VAL A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  PRO 82  82  82  PRO PRO A . n 
A 1 83  LYS 83  83  83  LYS LYS A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  LEU 86  86  86  LEU LEU A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  PRO 93  93  93  PRO PRO A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  LEU 96  96  96  LEU LEU A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ALA 98  98  98  ALA ALA A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 GLU 103 103 103 GLU GLU A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 LEU 109 109 109 LEU LEU A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 ARG 117 117 117 ARG ARG A . n 
A 1 118 ARG 118 118 118 ARG ARG A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 ALA 124 124 124 ALA ALA A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 GLY 129 129 129 GLY GLY A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 PRO 132 132 132 PRO PRO A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 HIS 134 134 134 HIS HIS A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 LEU 136 136 ?   ?   ?   A . n 
A 1 137 ALA 137 137 ?   ?   ?   A . n 
A 1 138 GLY 138 138 ?   ?   ?   A . n 
A 1 139 GLU 139 139 ?   ?   ?   A . n 
A 1 140 LYS 140 140 ?   ?   ?   A . n 
A 1 141 VAL 141 141 ?   ?   ?   A . n 
A 1 142 GLU 142 142 ?   ?   ?   A . n 
A 1 143 SER 143 143 ?   ?   ?   A . n 
A 1 144 GLU 144 144 ?   ?   ?   A . n 
A 1 145 ALA 145 145 ?   ?   ?   A . n 
A 1 146 ALA 146 146 ?   ?   ?   A . n 
A 1 147 GLU 147 147 ?   ?   ?   A . n 
A 1 148 GLU 148 148 ?   ?   ?   A . n 
A 1 149 ALA 149 149 ?   ?   ?   A . n 
A 1 150 VAL 150 150 ?   ?   ?   A . n 
A 1 151 MET 151 151 ?   ?   ?   A . n 
A 1 152 ALA 152 152 ?   ?   ?   A . n 
A 1 153 LEU 153 153 ?   ?   ?   A . n 
A 1 154 ALA 154 154 ?   ?   ?   A . n 
A 1 155 ALA 155 155 ?   ?   ?   A . n 
A 1 156 LEU 156 156 ?   ?   ?   A . n 
A 1 157 GLY 157 157 ?   ?   ?   A . n 
A 1 158 PHE 158 158 ?   ?   ?   A . n 
A 1 159 LYS 159 159 ?   ?   ?   A . n 
A 1 160 GLU 160 160 ?   ?   ?   A . n 
A 1 161 ALA 161 161 ?   ?   ?   A . n 
A 1 162 GLN 162 162 ?   ?   ?   A . n 
A 1 163 ALA 163 163 ?   ?   ?   A . n 
A 1 164 ARG 164 164 ?   ?   ?   A . n 
A 1 165 ALA 165 165 ?   ?   ?   A . n 
A 1 166 VAL 166 166 ?   ?   ?   A . n 
A 1 167 VAL 167 167 ?   ?   ?   A . n 
A 1 168 LEU 168 168 ?   ?   ?   A . n 
A 1 169 ASP 169 169 ?   ?   ?   A . n 
A 1 170 LEU 170 170 ?   ?   ?   A . n 
A 1 171 LEU 171 171 ?   ?   ?   A . n 
A 1 172 ALA 172 172 ?   ?   ?   A . n 
A 1 173 GLN 173 173 ?   ?   ?   A . n 
A 1 174 ASN 174 174 ?   ?   ?   A . n 
A 1 175 PRO 175 175 ?   ?   ?   A . n 
A 1 176 LYS 176 176 ?   ?   ?   A . n 
A 1 177 ALA 177 177 ?   ?   ?   A . n 
A 1 178 ARG 178 178 ?   ?   ?   A . n 
A 1 179 ALA 179 179 ?   ?   ?   A . n 
A 1 180 GLN 180 180 ?   ?   ?   A . n 
A 1 181 ASP 181 181 ?   ?   ?   A . n 
A 1 182 LEU 182 182 ?   ?   ?   A . n 
A 1 183 ILE 183 183 ?   ?   ?   A . n 
A 1 184 LYS 184 184 ?   ?   ?   A . n 
A 1 185 GLU 185 185 ?   ?   ?   A . n 
A 1 186 ALA 186 186 ?   ?   ?   A . n 
A 1 187 LEU 187 187 ?   ?   ?   A . n 
A 1 188 LYS 188 188 ?   ?   ?   A . n 
A 1 189 ARG 189 189 ?   ?   ?   A . n 
A 1 190 LEU 190 190 ?   ?   ?   A . n 
A 1 191 ARG 191 191 ?   ?   ?   A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   ILE 2   2   2   ILE ILE B . n 
B 1 3   ARG 3   3   3   ARG ARG B . n 
B 1 4   TYR 4   4   4   TYR TYR B . n 
B 1 5   LEU 5   5   5   LEU LEU B . n 
B 1 6   ARG 6   6   6   ARG ARG B . n 
B 1 7   GLY 7   7   7   GLY GLY B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   VAL 9   9   9   VAL VAL B . n 
B 1 10  LEU 10  10  10  LEU LEU B . n 
B 1 11  LYS 11  11  11  LYS LYS B . n 
B 1 12  LYS 12  12  12  LYS LYS B . n 
B 1 13  GLU 13  13  13  GLU GLU B . n 
B 1 14  ALA 14  14  14  ALA ALA B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  GLY 16  16  16  GLY GLY B . n 
B 1 17  PHE 17  17  17  PHE PHE B . n 
B 1 18  VAL 18  18  18  VAL VAL B . n 
B 1 19  LEU 19  19  19  LEU LEU B . n 
B 1 20  LEU 20  20  20  LEU LEU B . n 
B 1 21  ALA 21  21  21  ALA ALA B . n 
B 1 22  GLY 22  22  22  GLY GLY B . n 
B 1 23  GLY 23  23  23  GLY GLY B . n 
B 1 24  VAL 24  24  24  VAL VAL B . n 
B 1 25  GLY 25  25  25  GLY GLY B . n 
B 1 26  PHE 26  26  26  PHE PHE B . n 
B 1 27  PHE 27  27  27  PHE PHE B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  GLN 29  29  29  GLN GLN B . n 
B 1 30  ALA 30  30  30  ALA ALA B . n 
B 1 31  PRO 31  31  31  PRO PRO B . n 
B 1 32  THR 32  32  32  THR THR B . n 
B 1 33  PRO 33  33  33  PRO PRO B . n 
B 1 34  PHE 34  34  34  PHE PHE B . n 
B 1 35  LEU 35  35  35  LEU LEU B . n 
B 1 36  GLN 36  36  36  GLN GLN B . n 
B 1 37  ALA 37  37  37  ALA ALA B . n 
B 1 38  LEU 38  38  38  LEU LEU B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  GLU 40  40  40  GLU GLU B . n 
B 1 41  GLY 41  41  41  GLY GLY B . n 
B 1 42  LYS 42  42  42  LYS LYS B . n 
B 1 43  GLU 43  43  43  GLU GLU B . n 
B 1 44  VAL 44  44  44  VAL VAL B . n 
B 1 45  GLY 45  45  45  GLY GLY B . n 
B 1 46  VAL 46  46  46  VAL VAL B . n 
B 1 47  HIS 47  47  47  HIS HIS B . n 
B 1 48  THR 48  48  48  THR THR B . n 
B 1 49  HIS 49  49  49  HIS HIS B . n 
B 1 50  LEU 50  50  50  LEU LEU B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  GLU 54  54  54  GLU GLU B . n 
B 1 55  GLU 55  55  55  GLU GLU B . n 
B 1 56  GLY 56  56  56  GLY GLY B . n 
B 1 57  LEU 57  57  57  LEU LEU B . n 
B 1 58  SER 58  58  58  SER SER B . n 
B 1 59  LEU 59  59  59  LEU LEU B . n 
B 1 60  TYR 60  60  60  TYR TYR B . n 
B 1 61  GLY 61  61  61  GLY GLY B . n 
B 1 62  PHE 62  62  62  PHE PHE B . n 
B 1 63  PRO 63  63  63  PRO PRO B . n 
B 1 64  ASP 64  64  64  ASP ASP B . n 
B 1 65  GLU 65  65  65  GLU GLU B . n 
B 1 66  GLU 66  66  66  GLU GLU B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  LEU 68  68  68  LEU LEU B . n 
B 1 69  ALA 69  69  69  ALA ALA B . n 
B 1 70  LEU 70  70  70  LEU LEU B . n 
B 1 71  PHE 71  71  71  PHE PHE B . n 
B 1 72  GLU 72  72  72  GLU GLU B . n 
B 1 73  LEU 73  73  73  LEU LEU B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  LEU 75  75  75  LEU LEU B . n 
B 1 76  SER 76  76  76  SER SER B . n 
B 1 77  VAL 77  77  77  VAL VAL B . n 
B 1 78  SER 78  78  78  SER SER B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  VAL 80  80  80  VAL VAL B . n 
B 1 81  GLY 81  81  81  GLY GLY B . n 
B 1 82  PRO 82  82  82  PRO PRO B . n 
B 1 83  LYS 83  83  83  LYS LYS B . n 
B 1 84  VAL 84  84  84  VAL VAL B . n 
B 1 85  ALA 85  85  85  ALA ALA B . n 
B 1 86  LEU 86  86  86  LEU LEU B . n 
B 1 87  ALA 87  87  87  ALA ALA B . n 
B 1 88  LEU 88  88  88  LEU LEU B . n 
B 1 89  LEU 89  89  89  LEU LEU B . n 
B 1 90  SER 90  90  90  SER SER B . n 
B 1 91  ALA 91  91  91  ALA ALA B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  PRO 93  93  93  PRO PRO B . n 
B 1 94  PRO 94  94  94  PRO PRO B . n 
B 1 95  ARG 95  95  95  ARG ARG B . n 
B 1 96  LEU 96  96  96  LEU LEU B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  ALA 98  98  98  ALA ALA B . n 
B 1 99  ARG 99  99  99  ARG ARG B . n 
B 1 100 ALA 100 100 100 ALA ALA B . n 
B 1 101 LEU 101 101 101 LEU LEU B . n 
B 1 102 LEU 102 102 102 LEU LEU B . n 
B 1 103 GLU 103 103 103 GLU GLU B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 ALA 106 106 106 ALA ALA B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 LEU 109 109 109 LEU LEU B . n 
B 1 110 THR 110 110 110 THR THR B . n 
B 1 111 SER 111 111 111 SER SER B . n 
B 1 112 ALA 112 112 112 ALA ALA B . n 
B 1 113 SER 113 113 113 SER SER B . n 
B 1 114 GLY 114 114 114 GLY GLY B . n 
B 1 115 VAL 115 115 115 VAL VAL B . n 
B 1 116 GLY 116 116 116 GLY GLY B . n 
B 1 117 ARG 117 117 117 ARG ARG B . n 
B 1 118 ARG 118 118 118 ARG ARG B . n 
B 1 119 LEU 119 119 119 LEU LEU B . n 
B 1 120 ALA 120 120 120 ALA ALA B . n 
B 1 121 GLU 121 121 121 GLU GLU B . n 
B 1 122 ARG 122 122 122 ARG ARG B . n 
B 1 123 ILE 123 123 123 ILE ILE B . n 
B 1 124 ALA 124 124 124 ALA ALA B . n 
B 1 125 LEU 125 125 125 LEU LEU B . n 
B 1 126 GLU 126 126 126 GLU GLU B . n 
B 1 127 LEU 127 127 127 LEU LEU B . n 
B 1 128 LYS 128 128 128 LYS LYS B . n 
B 1 129 GLY 129 129 129 GLY GLY B . n 
B 1 130 LYS 130 130 130 LYS LYS B . n 
B 1 131 VAL 131 131 131 VAL VAL B . n 
B 1 132 PRO 132 132 132 PRO PRO B . n 
B 1 133 PRO 133 133 133 PRO PRO B . n 
B 1 134 HIS 134 134 134 HIS HIS B . n 
B 1 135 LEU 135 135 135 LEU LEU B . n 
B 1 136 LEU 136 136 136 LEU LEU B . n 
B 1 137 ALA 137 137 137 ALA ALA B . n 
B 1 138 GLY 138 138 138 GLY GLY B . n 
B 1 139 GLU 139 139 139 GLU GLU B . n 
B 1 140 LYS 140 140 140 LYS LYS B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 SER 143 143 143 SER SER B . n 
B 1 144 GLU 144 144 144 GLU GLU B . n 
B 1 145 ALA 145 145 145 ALA ALA B . n 
B 1 146 ALA 146 146 146 ALA ALA B . n 
B 1 147 GLU 147 147 147 GLU GLU B . n 
B 1 148 GLU 148 148 148 GLU GLU B . n 
B 1 149 ALA 149 149 149 ALA ALA B . n 
B 1 150 VAL 150 150 150 VAL VAL B . n 
B 1 151 MET 151 151 151 MET MET B . n 
B 1 152 ALA 152 152 152 ALA ALA B . n 
B 1 153 LEU 153 153 153 LEU LEU B . n 
B 1 154 ALA 154 154 154 ALA ALA B . n 
B 1 155 ALA 155 155 155 ALA ALA B . n 
B 1 156 LEU 156 156 156 LEU LEU B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 PHE 158 158 158 PHE PHE B . n 
B 1 159 LYS 159 159 159 LYS LYS B . n 
B 1 160 GLU 160 160 160 GLU GLU B . n 
B 1 161 ALA 161 161 161 ALA ALA B . n 
B 1 162 GLN 162 162 162 GLN GLN B . n 
B 1 163 ALA 163 163 163 ALA ALA B . n 
B 1 164 ARG 164 164 164 ARG ARG B . n 
B 1 165 ALA 165 165 165 ALA ALA B . n 
B 1 166 VAL 166 166 166 VAL VAL B . n 
B 1 167 VAL 167 167 167 VAL VAL B . n 
B 1 168 LEU 168 168 168 LEU LEU B . n 
B 1 169 ASP 169 169 169 ASP ASP B . n 
B 1 170 LEU 170 170 170 LEU LEU B . n 
B 1 171 LEU 171 171 171 LEU LEU B . n 
B 1 172 ALA 172 172 172 ALA ALA B . n 
B 1 173 GLN 173 173 173 GLN GLN B . n 
B 1 174 ASN 174 174 174 ASN ASN B . n 
B 1 175 PRO 175 175 175 PRO PRO B . n 
B 1 176 LYS 176 176 176 LYS LYS B . n 
B 1 177 ALA 177 177 177 ALA ALA B . n 
B 1 178 ARG 178 178 178 ARG ARG B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 GLN 180 180 180 GLN GLN B . n 
B 1 181 ASP 181 181 181 ASP ASP B . n 
B 1 182 LEU 182 182 182 LEU LEU B . n 
B 1 183 ILE 183 183 183 ILE ILE B . n 
B 1 184 LYS 184 184 184 LYS LYS B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ALA 186 186 186 ALA ALA B . n 
B 1 187 LEU 187 187 187 LEU LEU B . n 
B 1 188 LYS 188 188 188 LYS LYS B . n 
B 1 189 ARG 189 189 189 ARG ARG B . n 
B 1 190 LEU 190 190 190 LEU LEU B . n 
B 1 191 ARG 191 191 191 ARG ARG B . n 
C 2 1   MET 1   1   ?   ?   ?   C . n 
C 2 2   GLU 2   2   ?   ?   ?   C . n 
C 2 3   ASP 3   3   ?   ?   ?   C . n 
C 2 4   LEU 4   4   ?   ?   ?   C . n 
C 2 5   ALA 5   5   5   ALA ALA C . n 
C 2 6   LEU 6   6   6   LEU LEU C . n 
C 2 7   ARG 7   7   7   ARG ARG C . n 
C 2 8   PRO 8   8   8   PRO PRO C . n 
C 2 9   LYS 9   9   9   LYS LYS C . n 
C 2 10  THR 10  10  10  THR THR C . n 
C 2 11  LEU 11  11  11  LEU LEU C . n 
C 2 12  ASP 12  12  12  ASP ASP C . n 
C 2 13  GLU 13  13  13  GLU GLU C . n 
C 2 14  TYR 14  14  14  TYR TYR C . n 
C 2 15  ILE 15  15  15  ILE ILE C . n 
C 2 16  GLY 16  16  16  GLY GLY C . n 
C 2 17  GLN 17  17  17  GLN GLN C . n 
C 2 18  GLU 18  18  18  GLU GLU C . n 
C 2 19  ARG 19  19  19  ARG ARG C . n 
C 2 20  LEU 20  20  20  LEU LEU C . n 
C 2 21  LYS 21  21  21  LYS LYS C . n 
C 2 22  GLN 22  22  22  GLN GLN C . n 
C 2 23  LYS 23  23  23  LYS LYS C . n 
C 2 24  LEU 24  24  24  LEU LEU C . n 
C 2 25  ARG 25  25  25  ARG ARG C . n 
C 2 26  VAL 26  26  26  VAL VAL C . n 
C 2 27  TYR 27  27  27  TYR TYR C . n 
C 2 28  LEU 28  28  28  LEU LEU C . n 
C 2 29  GLU 29  29  29  GLU GLU C . n 
C 2 30  ALA 30  30  30  ALA ALA C . n 
C 2 31  ALA 31  31  31  ALA ALA C . n 
C 2 32  LYS 32  32  32  LYS LYS C . n 
C 2 33  ALA 33  33  33  ALA ALA C . n 
C 2 34  ARG 34  34  34  ARG ARG C . n 
C 2 35  LYS 35  35  35  LYS LYS C . n 
C 2 36  GLU 36  36  36  GLU GLU C . n 
C 2 37  PRO 37  37  37  PRO PRO C . n 
C 2 38  LEU 38  38  38  LEU LEU C . n 
C 2 39  GLU 39  39  39  GLU GLU C . n 
C 2 40  HIS 40  40  40  HIS HIS C . n 
C 2 41  LEU 41  41  41  LEU LEU C . n 
C 2 42  LEU 42  42  42  LEU LEU C . n 
C 2 43  LEU 43  43  43  LEU LEU C . n 
C 2 44  PHE 44  44  44  PHE PHE C . n 
C 2 45  GLY 45  45  45  GLY GLY C . n 
C 2 46  PRO 46  46  46  PRO PRO C . n 
C 2 47  PRO 47  47  47  PRO PRO C . n 
C 2 48  GLY 48  48  48  GLY GLY C . n 
C 2 49  LEU 49  49  49  LEU LEU C . n 
C 2 50  GLY 50  50  50  GLY GLY C . n 
C 2 51  LYS 51  51  51  LYS LYS C . n 
C 2 52  THR 52  52  52  THR THR C . n 
C 2 53  THR 53  53  53  THR THR C . n 
C 2 54  LEU 54  54  54  LEU LEU C . n 
C 2 55  ALA 55  55  55  ALA ALA C . n 
C 2 56  HIS 56  56  56  HIS HIS C . n 
C 2 57  VAL 57  57  57  VAL VAL C . n 
C 2 58  ILE 58  58  58  ILE ILE C . n 
C 2 59  ALA 59  59  59  ALA ALA C . n 
C 2 60  HIS 60  60  60  HIS HIS C . n 
C 2 61  GLU 61  61  61  GLU GLU C . n 
C 2 62  LEU 62  62  62  LEU LEU C . n 
C 2 63  GLY 63  63  63  GLY GLY C . n 
C 2 64  VAL 64  64  64  VAL VAL C . n 
C 2 65  ASN 65  65  65  ASN ASN C . n 
C 2 66  LEU 66  66  66  LEU LEU C . n 
C 2 67  ARG 67  67  67  ARG ARG C . n 
C 2 68  VAL 68  68  68  VAL VAL C . n 
C 2 69  THR 69  69  69  THR THR C . n 
C 2 70  SER 70  70  70  SER SER C . n 
C 2 71  GLY 71  71  71  GLY GLY C . n 
C 2 72  PRO 72  72  72  PRO PRO C . n 
C 2 73  ALA 73  73  73  ALA ALA C . n 
C 2 74  ILE 74  74  74  ILE ILE C . n 
C 2 75  GLU 75  75  75  GLU GLU C . n 
C 2 76  LYS 76  76  76  LYS LYS C . n 
C 2 77  PRO 77  77  77  PRO PRO C . n 
C 2 78  GLY 78  78  78  GLY GLY C . n 
C 2 79  ASP 79  79  79  ASP ASP C . n 
C 2 80  LEU 80  80  80  LEU LEU C . n 
C 2 81  ALA 81  81  81  ALA ALA C . n 
C 2 82  ALA 82  82  82  ALA ALA C . n 
C 2 83  ILE 83  83  83  ILE ILE C . n 
C 2 84  LEU 84  84  84  LEU LEU C . n 
C 2 85  ALA 85  85  85  ALA ALA C . n 
C 2 86  ASN 86  86  86  ASN ASN C . n 
C 2 87  SER 87  87  87  SER SER C . n 
C 2 88  LEU 88  88  88  LEU LEU C . n 
C 2 89  GLU 89  89  89  GLU GLU C . n 
C 2 90  GLU 90  90  90  GLU GLU C . n 
C 2 91  GLY 91  91  91  GLY GLY C . n 
C 2 92  ASP 92  92  92  ASP ASP C . n 
C 2 93  ILE 93  93  93  ILE ILE C . n 
C 2 94  LEU 94  94  94  LEU LEU C . n 
C 2 95  PHE 95  95  95  PHE PHE C . n 
C 2 96  ILE 96  96  96  ILE ILE C . n 
C 2 97  ASP 97  97  97  ASP ASP C . n 
C 2 98  GLU 98  98  98  GLU GLU C . n 
C 2 99  ILE 99  99  99  ILE ILE C . n 
C 2 100 HIS 100 100 100 HIS HIS C . n 
C 2 101 ARG 101 101 101 ARG ARG C . n 
C 2 102 LEU 102 102 102 LEU LEU C . n 
C 2 103 SER 103 103 103 SER SER C . n 
C 2 104 ARG 104 104 104 ARG ARG C . n 
C 2 105 GLN 105 105 105 GLN GLN C . n 
C 2 106 ALA 106 106 106 ALA ALA C . n 
C 2 107 GLU 107 107 107 GLU GLU C . n 
C 2 108 GLU 108 108 108 GLU GLU C . n 
C 2 109 HIS 109 109 109 HIS HIS C . n 
C 2 110 LEU 110 110 110 LEU LEU C . n 
C 2 111 TYR 111 111 111 TYR TYR C . n 
C 2 112 PRO 112 112 112 PRO PRO C . n 
C 2 113 ALA 113 113 113 ALA ALA C . n 
C 2 114 MET 114 114 114 MET MET C . n 
C 2 115 GLU 115 115 115 GLU GLU C . n 
C 2 116 ASP 116 116 116 ASP ASP C . n 
C 2 117 PHE 117 117 117 PHE PHE C . n 
C 2 118 VAL 118 118 118 VAL VAL C . n 
C 2 119 MET 119 119 119 MET MET C . n 
C 2 120 ASP 120 120 120 ASP ASP C . n 
C 2 121 ILE 121 121 121 ILE ILE C . n 
C 2 122 VAL 122 122 122 VAL VAL C . n 
C 2 123 ILE 123 123 123 ILE ILE C . n 
C 2 124 GLY 124 124 124 GLY GLY C . n 
C 2 125 GLN 125 125 125 GLN GLN C . n 
C 2 126 GLY 126 126 126 GLY GLY C . n 
C 2 127 PRO 127 127 127 PRO PRO C . n 
C 2 128 ALA 128 128 128 ALA ALA C . n 
C 2 129 ALA 129 129 129 ALA ALA C . n 
C 2 130 ARG 130 130 130 ARG ARG C . n 
C 2 131 THR 131 131 131 THR THR C . n 
C 2 132 ILE 132 132 132 ILE ILE C . n 
C 2 133 ARG 133 133 133 ARG ARG C . n 
C 2 134 LEU 134 134 134 LEU LEU C . n 
C 2 135 GLU 135 135 135 GLU GLU C . n 
C 2 136 LEU 136 136 136 LEU LEU C . n 
C 2 137 PRO 137 137 137 PRO PRO C . n 
C 2 138 ARG 138 138 138 ARG ARG C . n 
C 2 139 PHE 139 139 139 PHE PHE C . n 
C 2 140 THR 140 140 140 THR THR C . n 
C 2 141 LEU 141 141 141 LEU LEU C . n 
C 2 142 ILE 142 142 142 ILE ILE C . n 
C 2 143 GLY 143 143 143 GLY GLY C . n 
C 2 144 ALA 144 144 144 ALA ALA C . n 
C 2 145 THR 145 145 145 THR THR C . n 
C 2 146 THR 146 146 146 THR THR C . n 
C 2 147 ARG 147 147 147 ARG ARG C . n 
C 2 148 PRO 148 148 148 PRO PRO C . n 
C 2 149 GLY 149 149 149 GLY GLY C . n 
C 2 150 LEU 150 150 150 LEU LEU C . n 
C 2 151 ILE 151 151 151 ILE ILE C . n 
C 2 152 THR 152 152 152 THR THR C . n 
C 2 153 ALA 153 153 153 ALA ALA C . n 
C 2 154 PRO 154 154 154 PRO PRO C . n 
C 2 155 LEU 155 155 155 LEU LEU C . n 
C 2 156 LEU 156 156 156 LEU LEU C . n 
C 2 157 SER 157 157 157 SER SER C . n 
C 2 158 ARG 158 158 158 ARG ARG C . n 
C 2 159 PHE 159 159 159 PHE PHE C . n 
C 2 160 GLY 160 160 160 GLY GLY C . n 
C 2 161 ILE 161 161 161 ILE ILE C . n 
C 2 162 VAL 162 162 162 VAL VAL C . n 
C 2 163 GLU 163 163 163 GLU GLU C . n 
C 2 164 HIS 164 164 164 HIS HIS C . n 
C 2 165 LEU 165 165 165 LEU LEU C . n 
C 2 166 GLU 166 166 166 GLU GLU C . n 
C 2 167 TYR 167 167 167 TYR TYR C . n 
C 2 168 TYR 168 168 168 TYR TYR C . n 
C 2 169 THR 169 169 169 THR THR C . n 
C 2 170 PRO 170 170 170 PRO PRO C . n 
C 2 171 GLU 171 171 171 GLU GLU C . n 
C 2 172 GLU 172 172 172 GLU GLU C . n 
C 2 173 LEU 173 173 173 LEU LEU C . n 
C 2 174 ALA 174 174 174 ALA ALA C . n 
C 2 175 GLN 175 175 175 GLN GLN C . n 
C 2 176 GLY 176 176 176 GLY GLY C . n 
C 2 177 VAL 177 177 177 VAL VAL C . n 
C 2 178 MET 178 178 178 MET MET C . n 
C 2 179 ARG 179 179 179 ARG ARG C . n 
C 2 180 ASP 180 180 180 ASP ASP C . n 
C 2 181 ALA 181 181 181 ALA ALA C . n 
C 2 182 ARG 182 182 182 ARG ARG C . n 
C 2 183 LEU 183 183 183 LEU LEU C . n 
C 2 184 LEU 184 184 184 LEU LEU C . n 
C 2 185 GLY 185 185 185 GLY GLY C . n 
C 2 186 VAL 186 186 186 VAL VAL C . n 
C 2 187 ARG 187 187 187 ARG ARG C . n 
C 2 188 ILE 188 188 188 ILE ILE C . n 
C 2 189 THR 189 189 189 THR THR C . n 
C 2 190 GLU 190 190 190 GLU GLU C . n 
C 2 191 GLU 191 191 191 GLU GLU C . n 
C 2 192 ALA 192 192 192 ALA ALA C . n 
C 2 193 ALA 193 193 193 ALA ALA C . n 
C 2 194 LEU 194 194 194 LEU LEU C . n 
C 2 195 GLU 195 195 195 GLU GLU C . n 
C 2 196 ILE 196 196 196 ILE ILE C . n 
C 2 197 GLY 197 197 197 GLY GLY C . n 
C 2 198 ARG 198 198 198 ARG ARG C . n 
C 2 199 ARG 199 199 199 ARG ARG C . n 
C 2 200 SER 200 200 200 SER SER C . n 
C 2 201 ARG 201 201 201 ARG ARG C . n 
C 2 202 GLY 202 202 202 GLY GLY C . n 
C 2 203 THR 203 203 203 THR THR C . n 
C 2 204 MET 204 204 204 MET MET C . n 
C 2 205 ARG 205 205 205 ARG ARG C . n 
C 2 206 VAL 206 206 206 VAL VAL C . n 
C 2 207 ALA 207 207 207 ALA ALA C . n 
C 2 208 LYS 208 208 208 LYS LYS C . n 
C 2 209 ARG 209 209 209 ARG ARG C . n 
C 2 210 LEU 210 210 210 LEU LEU C . n 
C 2 211 PHE 211 211 211 PHE PHE C . n 
C 2 212 ARG 212 212 212 ARG ARG C . n 
C 2 213 ARG 213 213 213 ARG ARG C . n 
C 2 214 VAL 214 214 214 VAL VAL C . n 
C 2 215 ARG 215 215 215 ARG ARG C . n 
C 2 216 ASP 216 216 216 ASP ASP C . n 
C 2 217 PHE 217 217 217 PHE PHE C . n 
C 2 218 ALA 218 218 218 ALA ALA C . n 
C 2 219 GLN 219 219 219 GLN GLN C . n 
C 2 220 VAL 220 220 220 VAL VAL C . n 
C 2 221 ALA 221 221 221 ALA ALA C . n 
C 2 222 GLY 222 222 222 GLY GLY C . n 
C 2 223 GLU 223 223 223 GLU GLU C . n 
C 2 224 GLU 224 224 224 GLU GLU C . n 
C 2 225 VAL 225 225 225 VAL VAL C . n 
C 2 226 ILE 226 226 226 ILE ILE C . n 
C 2 227 THR 227 227 227 THR THR C . n 
C 2 228 ARG 228 228 228 ARG ARG C . n 
C 2 229 GLU 229 229 229 GLU GLU C . n 
C 2 230 ARG 230 230 230 ARG ARG C . n 
C 2 231 ALA 231 231 231 ALA ALA C . n 
C 2 232 LEU 232 232 232 LEU LEU C . n 
C 2 233 GLU 233 233 233 GLU GLU C . n 
C 2 234 ALA 234 234 234 ALA ALA C . n 
C 2 235 LEU 235 235 235 LEU LEU C . n 
C 2 236 ALA 236 236 236 ALA ALA C . n 
C 2 237 ALA 237 237 237 ALA ALA C . n 
C 2 238 LEU 238 238 238 LEU LEU C . n 
C 2 239 GLY 239 239 239 GLY GLY C . n 
C 2 240 LEU 240 240 240 LEU LEU C . n 
C 2 241 ASP 241 241 241 ASP ASP C . n 
C 2 242 GLU 242 242 242 GLU GLU C . n 
C 2 243 LEU 243 243 243 LEU LEU C . n 
C 2 244 GLY 244 244 244 GLY GLY C . n 
C 2 245 LEU 245 245 245 LEU LEU C . n 
C 2 246 GLU 246 246 246 GLU GLU C . n 
C 2 247 LYS 247 247 247 LYS LYS C . n 
C 2 248 ARG 248 248 248 ARG ARG C . n 
C 2 249 ASP 249 249 249 ASP ASP C . n 
C 2 250 ARG 250 250 250 ARG ARG C . n 
C 2 251 GLU 251 251 251 GLU GLU C . n 
C 2 252 ILE 252 252 252 ILE ILE C . n 
C 2 253 LEU 253 253 253 LEU LEU C . n 
C 2 254 GLU 254 254 254 GLU GLU C . n 
C 2 255 VAL 255 255 255 VAL VAL C . n 
C 2 256 LEU 256 256 256 LEU LEU C . n 
C 2 257 ILE 257 257 257 ILE ILE C . n 
C 2 258 LEU 258 258 258 LEU LEU C . n 
C 2 259 ARG 259 259 259 ARG ARG C . n 
C 2 260 PHE 260 260 260 PHE PHE C . n 
C 2 261 GLY 261 261 261 GLY GLY C . n 
C 2 262 GLY 262 262 262 GLY GLY C . n 
C 2 263 GLY 263 263 263 GLY GLY C . n 
C 2 264 PRO 264 264 264 PRO PRO C . n 
C 2 265 VAL 265 265 265 VAL VAL C . n 
C 2 266 GLY 266 266 266 GLY GLY C . n 
C 2 267 LEU 267 267 267 LEU LEU C . n 
C 2 268 ALA 268 268 268 ALA ALA C . n 
C 2 269 THR 269 269 269 THR THR C . n 
C 2 270 LEU 270 270 270 LEU LEU C . n 
C 2 271 ALA 271 271 271 ALA ALA C . n 
C 2 272 THR 272 272 272 THR THR C . n 
C 2 273 ALA 273 273 273 ALA ALA C . n 
C 2 274 LEU 274 274 274 LEU LEU C . n 
C 2 275 SER 275 275 275 SER SER C . n 
C 2 276 GLU 276 276 276 GLU GLU C . n 
C 2 277 ASP 277 277 277 ASP ASP C . n 
C 2 278 PRO 278 278 278 PRO PRO C . n 
C 2 279 GLY 279 279 279 GLY GLY C . n 
C 2 280 THR 280 280 280 THR THR C . n 
C 2 281 LEU 281 281 281 LEU LEU C . n 
C 2 282 GLU 282 282 282 GLU GLU C . n 
C 2 283 GLU 283 283 283 GLU GLU C . n 
C 2 284 VAL 284 284 284 VAL VAL C . n 
C 2 285 HIS 285 285 285 HIS HIS C . n 
C 2 286 GLU 286 286 286 GLU GLU C . n 
C 2 287 PRO 287 287 287 PRO PRO C . n 
C 2 288 TYR 288 288 288 TYR TYR C . n 
C 2 289 LEU 289 289 289 LEU LEU C . n 
C 2 290 ILE 290 290 290 ILE ILE C . n 
C 2 291 ARG 291 291 291 ARG ARG C . n 
C 2 292 GLN 292 292 292 GLN GLN C . n 
C 2 293 GLY 293 293 293 GLY GLY C . n 
C 2 294 LEU 294 294 294 LEU LEU C . n 
C 2 295 LEU 295 295 295 LEU LEU C . n 
C 2 296 LYS 296 296 296 LYS LYS C . n 
C 2 297 ARG 297 297 297 ARG ARG C . n 
C 2 298 THR 298 298 298 THR THR C . n 
C 2 299 PRO 299 299 299 PRO PRO C . n 
C 2 300 ARG 300 300 300 ARG ARG C . n 
C 2 301 GLY 301 301 301 GLY GLY C . n 
C 2 302 ARG 302 302 302 ARG ARG C . n 
C 2 303 VAL 303 303 303 VAL VAL C . n 
C 2 304 ALA 304 304 304 ALA ALA C . n 
C 2 305 THR 305 305 305 THR THR C . n 
C 2 306 GLU 306 306 306 GLU GLU C . n 
C 2 307 LEU 307 307 307 LEU LEU C . n 
C 2 308 ALA 308 308 308 ALA ALA C . n 
C 2 309 ARG 309 309 309 ARG ARG C . n 
C 2 310 ARG 310 310 310 ARG ARG C . n 
C 2 311 HIS 311 311 311 HIS HIS C . n 
C 2 312 LEU 312 312 312 LEU LEU C . n 
# 
_pdbx_nonpoly_scheme.asym_id         D 
_pdbx_nonpoly_scheme.entity_id       3 
_pdbx_nonpoly_scheme.mon_id          ANP 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     313 
_pdbx_nonpoly_scheme.auth_seq_num    1 
_pdbx_nonpoly_scheme.pdb_mon_id      ANP 
_pdbx_nonpoly_scheme.auth_mon_id     ANP 
_pdbx_nonpoly_scheme.pdb_strand_id   C 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dodecameric 
_pdbx_struct_assembly.oligomeric_count     12 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z   1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
3 'crystal symmetry operation' 3_555 -x,y,-z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-11-06 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-11-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2         
2 4 'Structure model' struct_ref_seq_dif 
3 4 'Structure model' struct_site        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_database_2.pdbx_DOI'                
2 4 'Structure model' '_database_2.pdbx_database_accession' 
3 4 'Structure model' '_struct_ref_seq_dif.details'         
4 4 'Structure model' '_struct_site.pdbx_auth_asym_id'      
5 4 'Structure model' '_struct_site.pdbx_auth_comp_id'      
6 4 'Structure model' '_struct_site.pdbx_auth_seq_id'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
SOLVE     phasing          . ? 3 
CNS       refinement       . ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N A GLY 79  ? ? CA A GLY 79  ? ? C  A GLY 79  ? ? 94.32  113.10 -18.78 2.50 N 
2 1 C B VAL 131 ? ? N  B PRO 132 ? ? CA B PRO 132 ? ? 149.84 127.00 22.84  2.40 Y 
3 1 C B VAL 131 ? ? N  B PRO 132 ? ? CD B PRO 132 ? ? 89.18  120.60 -31.42 2.20 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 LYS A 11  ? ? -170.24 105.92  
2   1 GLU A 13  ? ? -161.15 -30.99  
3   1 ALA A 14  ? ? -179.80 -61.07  
4   1 PRO A 33  ? ? -45.78  -74.02  
5   1 LEU A 38  ? ? -39.91  118.01  
6   1 VAL A 44  ? ? -176.96 145.06  
7   1 GLU A 55  ? ? -58.07  -74.83  
8   1 LEU A 57  ? ? -43.51  159.05  
9   1 GLU A 66  ? ? -55.37  -74.32  
10  1 VAL A 77  ? ? -141.97 -75.45  
11  1 SER A 78  ? ? 178.55  -45.08  
12  1 LYS A 83  ? ? -65.46  -73.28  
13  1 LEU A 97  ? ? -54.46  -71.12  
14  1 LEU A 101 ? ? -44.91  -72.66  
15  1 ARG A 107 ? ? -64.85  21.72   
16  1 LEU A 108 ? ? -144.27 -61.81  
17  1 LEU A 109 ? ? -28.06  -45.40  
18  1 ARG A 118 ? ? -37.96  -70.21  
19  1 ARG A 122 ? ? -96.63  38.54   
20  1 HIS A 134 ? ? -39.12  69.39   
21  1 LEU B 10  ? ? 1.44    -49.48  
22  1 PRO B 33  ? ? -40.17  -71.15  
23  1 LEU B 50  ? ? -59.23  174.13  
24  1 LEU B 51  ? ? -174.52 107.53  
25  1 LEU B 52  ? ? -64.57  -174.02 
26  1 LYS B 53  ? ? -171.44 -161.56 
27  1 GLU B 72  ? ? -67.56  -74.39  
28  1 LEU B 73  ? ? -27.97  -53.54  
29  1 ALA B 87  ? ? -43.86  -70.05  
30  1 ALA B 91  ? ? -78.91  -94.59  
31  1 SER B 111 ? ? -66.14  67.59   
32  1 ALA B 112 ? ? 174.59  135.86  
33  1 SER B 113 ? ? -32.26  145.28  
34  1 VAL B 115 ? ? -45.13  97.93   
35  1 ARG B 117 ? ? -65.75  -83.29  
36  1 ILE B 123 ? ? -39.26  -32.30  
37  1 ALA B 124 ? ? -78.15  -73.92  
38  1 LEU B 125 ? ? -39.89  -38.96  
39  1 LYS B 130 ? ? -58.86  -1.57   
40  1 PRO B 132 ? ? -172.53 146.23  
41  1 PRO B 133 ? ? -71.26  -99.99  
42  1 LEU B 135 ? ? -151.79 26.39   
43  1 GLU B 142 ? ? -77.73  -117.24 
44  1 GLU B 144 ? ? -63.15  84.22   
45  1 ALA B 145 ? ? -37.71  -37.41  
46  1 ALA B 146 ? ? -55.91  -79.01  
47  1 ALA B 149 ? ? -57.12  -72.56  
48  1 PHE B 158 ? ? -12.65  120.51  
49  1 GLU B 160 ? ? -24.98  -82.82  
50  1 ALA B 172 ? ? -68.18  -78.43  
51  1 ALA B 177 ? ? -161.54 86.89   
52  1 GLN B 180 ? ? -48.49  -85.67  
53  1 LYS B 184 ? ? -41.03  -74.97  
54  1 GLU B 185 ? ? -36.70  -15.20  
55  1 PRO C 8   ? ? -61.52  97.61   
56  1 GLN C 17  ? ? -34.33  159.07  
57  1 ARG C 19  ? ? -94.37  -60.86  
58  1 LEU C 24  ? ? -132.24 -40.68  
59  1 ALA C 31  ? ? -69.08  12.65   
60  1 LYS C 32  ? ? -145.36 10.66   
61  1 ARG C 34  ? ? -145.86 -71.97  
62  1 LYS C 35  ? ? -153.64 -152.79 
63  1 GLU C 39  ? ? -15.35  140.38  
64  1 PHE C 44  ? ? -112.35 -163.39 
65  1 PRO C 47  ? ? -50.92  -175.70 
66  1 LEU C 49  ? ? -19.24  -27.95  
67  1 LYS C 51  ? ? -120.82 -68.07  
68  1 THR C 52  ? ? -50.86  -71.03  
69  1 THR C 53  ? ? -43.74  -19.89  
70  1 GLU C 61  ? ? -89.30  38.97   
71  1 LEU C 62  ? ? -148.66 -37.69  
72  1 ASN C 65  ? ? -61.77  -175.66 
73  1 PRO C 72  ? ? -36.32  -18.45  
74  1 ALA C 73  ? ? -76.18  34.65   
75  1 GLU C 75  ? ? -90.79  -77.23  
76  1 PRO C 77  ? ? -51.27  -6.60   
77  1 ASN C 86  ? ? 59.16   101.02  
78  1 SER C 87  ? ? 174.06  -7.03   
79  1 LEU C 88  ? ? -105.84 -166.78 
80  1 GLU C 89  ? ? -153.11 44.03   
81  1 ASP C 92  ? ? -36.69  152.81  
82  1 ARG C 101 ? ? -108.56 78.00   
83  1 ARG C 104 ? ? -39.70  -37.79  
84  1 HIS C 109 ? ? -79.65  42.03   
85  1 ALA C 113 ? ? -69.34  9.89    
86  1 MET C 114 ? ? -94.00  -69.52  
87  1 ASP C 116 ? ? -156.18 -74.31  
88  1 PHE C 117 ? ? -175.96 29.85   
89  1 MET C 119 ? ? -164.39 57.20   
90  1 ALA C 128 ? ? -38.69  150.19  
91  1 ALA C 129 ? ? -97.97  -131.84 
92  1 ARG C 130 ? ? -81.12  -132.89 
93  1 THR C 131 ? ? -170.43 123.51  
94  1 LEU C 134 ? ? -114.82 -120.02 
95  1 GLU C 135 ? ? 177.40  48.27   
96  1 ARG C 147 ? ? -151.47 75.57   
97  1 ALA C 153 ? ? -32.56  175.11  
98  1 PRO C 154 ? ? -42.76  -10.35  
99  1 THR C 169 ? ? 1.45    147.04  
100 1 VAL C 177 ? ? -32.00  -39.43  
101 1 ARG C 182 ? ? -107.77 74.96   
102 1 LEU C 183 ? ? -119.11 -95.26  
103 1 GLU C 190 ? ? -60.64  -84.12  
104 1 SER C 200 ? ? -105.34 79.18   
105 1 ARG C 201 ? ? -33.19  67.18   
106 1 VAL C 206 ? ? -69.66  5.81    
107 1 LYS C 208 ? ? -140.06 -17.26  
108 1 ARG C 215 ? ? -44.88  -71.83  
109 1 ALA C 218 ? ? -53.99  -92.11  
110 1 GLN C 219 ? ? -62.51  52.03   
111 1 VAL C 220 ? ? -148.16 -20.34  
112 1 GLU C 224 ? ? -14.60  -61.40  
113 1 VAL C 225 ? ? -40.98  150.95  
114 1 ARG C 228 ? ? -52.44  0.29    
115 1 GLU C 233 ? ? -85.88  -77.38  
116 1 ALA C 234 ? ? -67.94  21.47   
117 1 ALA C 237 ? ? -86.33  -108.11 
118 1 LEU C 240 ? ? 37.20   57.93   
119 1 ASP C 241 ? ? 176.94  145.45  
120 1 GLU C 242 ? ? -83.77  -124.26 
121 1 LEU C 245 ? ? -23.31  118.93  
122 1 LYS C 247 ? ? 8.89    -81.64  
123 1 ILE C 252 ? ? -41.40  -71.02  
124 1 VAL C 265 ? ? -121.04 -68.76  
125 1 LEU C 267 ? ? -28.55  -41.32  
126 1 ALA C 268 ? ? -36.93  -89.05  
127 1 THR C 269 ? ? -55.63  -74.79  
128 1 LEU C 270 ? ? -29.33  -55.56  
129 1 LEU C 281 ? ? -70.55  -85.76  
130 1 GLU C 282 ? ? -44.56  -18.44  
131 1 HIS C 285 ? ? -145.28 -63.18  
132 1 GLU C 286 ? ? -39.49  -34.55  
133 1 PRO C 287 ? ? -44.53  -91.84  
134 1 LEU C 289 ? ? -38.04  -78.89  
135 1 ARG C 291 ? ? -69.66  45.11   
136 1 GLN C 292 ? ? -178.61 71.14   
137 1 LEU C 294 ? ? -144.28 -72.81  
138 1 PRO C 299 ? ? -53.38  -9.54   
139 1 LEU C 307 ? ? -50.59  -0.38   
140 1 ARG C 309 ? ? -53.97  -70.68  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LEU 136 ? A LEU 136 
2  1 Y 1 A ALA 137 ? A ALA 137 
3  1 Y 1 A GLY 138 ? A GLY 138 
4  1 Y 1 A GLU 139 ? A GLU 139 
5  1 Y 1 A LYS 140 ? A LYS 140 
6  1 Y 1 A VAL 141 ? A VAL 141 
7  1 Y 1 A GLU 142 ? A GLU 142 
8  1 Y 1 A SER 143 ? A SER 143 
9  1 Y 1 A GLU 144 ? A GLU 144 
10 1 Y 1 A ALA 145 ? A ALA 145 
11 1 Y 1 A ALA 146 ? A ALA 146 
12 1 Y 1 A GLU 147 ? A GLU 147 
13 1 Y 1 A GLU 148 ? A GLU 148 
14 1 Y 1 A ALA 149 ? A ALA 149 
15 1 Y 1 A VAL 150 ? A VAL 150 
16 1 Y 1 A MET 151 ? A MET 151 
17 1 Y 1 A ALA 152 ? A ALA 152 
18 1 Y 1 A LEU 153 ? A LEU 153 
19 1 Y 1 A ALA 154 ? A ALA 154 
20 1 Y 1 A ALA 155 ? A ALA 155 
21 1 Y 1 A LEU 156 ? A LEU 156 
22 1 Y 1 A GLY 157 ? A GLY 157 
23 1 Y 1 A PHE 158 ? A PHE 158 
24 1 Y 1 A LYS 159 ? A LYS 159 
25 1 Y 1 A GLU 160 ? A GLU 160 
26 1 Y 1 A ALA 161 ? A ALA 161 
27 1 Y 1 A GLN 162 ? A GLN 162 
28 1 Y 1 A ALA 163 ? A ALA 163 
29 1 Y 1 A ARG 164 ? A ARG 164 
30 1 Y 1 A ALA 165 ? A ALA 165 
31 1 Y 1 A VAL 166 ? A VAL 166 
32 1 Y 1 A VAL 167 ? A VAL 167 
33 1 Y 1 A LEU 168 ? A LEU 168 
34 1 Y 1 A ASP 169 ? A ASP 169 
35 1 Y 1 A LEU 170 ? A LEU 170 
36 1 Y 1 A LEU 171 ? A LEU 171 
37 1 Y 1 A ALA 172 ? A ALA 172 
38 1 Y 1 A GLN 173 ? A GLN 173 
39 1 Y 1 A ASN 174 ? A ASN 174 
40 1 Y 1 A PRO 175 ? A PRO 175 
41 1 Y 1 A LYS 176 ? A LYS 176 
42 1 Y 1 A ALA 177 ? A ALA 177 
43 1 Y 1 A ARG 178 ? A ARG 178 
44 1 Y 1 A ALA 179 ? A ALA 179 
45 1 Y 1 A GLN 180 ? A GLN 180 
46 1 Y 1 A ASP 181 ? A ASP 181 
47 1 Y 1 A LEU 182 ? A LEU 182 
48 1 Y 1 A ILE 183 ? A ILE 183 
49 1 Y 1 A LYS 184 ? A LYS 184 
50 1 Y 1 A GLU 185 ? A GLU 185 
51 1 Y 1 A ALA 186 ? A ALA 186 
52 1 Y 1 A LEU 187 ? A LEU 187 
53 1 Y 1 A LYS 188 ? A LYS 188 
54 1 Y 1 A ARG 189 ? A ARG 189 
55 1 Y 1 A LEU 190 ? A LEU 190 
56 1 Y 1 A ARG 191 ? A ARG 191 
57 1 Y 1 C MET 1   ? C MET 1   
58 1 Y 1 C GLU 2   ? C GLU 2   
59 1 Y 1 C ASP 3   ? C ASP 3   
60 1 Y 1 C LEU 4   ? C LEU 4   
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 
_pdbx_entity_nonpoly.comp_id     ANP 
#