data_1IZC
# 
_entry.id   1IZC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IZC         
RCSB  RCSB005434   
WWPDB D_1000005434 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IZC 
_pdbx_database_status.recvd_initial_deposition_date   2002-10-01 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ose, T.'      1 
'Watanabe, K.' 2 
'Mie, T.'      3 
'Honma, M.'    4 
'Watanabe, H.' 5 
'Yao, M.'      6 
'Oikawa, H.'   7 
'Tanaka, I.'   8 
# 
_citation.id                        primary 
_citation.title                     'Insight into a natural Diels-Alder reaction from the structure of macrophomate synthase.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            422 
_citation.page_first                185 
_citation.page_last                 189 
_citation.year                      2003 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12634789 
_citation.pdbx_database_id_DOI      10.1038/nature01454 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ose, T.'      1 
primary 'Watanabe, K.' 2 
primary 'Mie, T.'      3 
primary 'Honma, M.'    4 
primary 'Watanabe, H.' 5 
primary 'Yao, M.'      6 
primary 'Oikawa, H.'   7 
primary 'Tanaka, I.'   8 
# 
_cell.entry_id           1IZC 
_cell.length_a           106.678 
_cell.length_b           106.678 
_cell.length_c           120.755 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1IZC 
_symmetry.space_group_name_H-M             'P 63 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                182 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'macrophomate synthase intermolecular Diels-Alderase' 36271.891 1   ? I108V ? ? 
2 non-polymer syn 'MAGNESIUM ION'                                       24.305    1   ? ?     ? ? 
3 non-polymer syn 'PYRUVIC ACID'                                        88.062    1   ? ?     ? ? 
4 water       nat water                                                 18.015    360 ? ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'macrophomate synthase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAKSYSEQPELHAKAPYRSAMLTYPGNLRQALKDAMADPSKTLMGVAHGIPSTFVTKVLAATKPDFVWIDVEHGMFNRLE
LHDAIHAAQHHSEGRSLVIVRVPKHDEVSLSTALDAGAAGIVIPHVETVEEVREFVKEMYYGPIGRRSFSPWTFSPGIAD
ASLFPNDPYNVATSNNHVCIIPQIESVKGVENVDAIAAMPEIHGLMFGPGDYMIDAGLDLNGALSGVPHPTFVEAMTKFS
TAAQRNGVPIFGGALSVDMVPSLIEQGYRAIAVQFDVWGLSRLVHGSLAQARASAKQFAGQGKAATDGTTDETVDGAAEE
VANGVSKVKLDEAGDEDKA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAKSYSEQPELHAKAPYRSAMLTYPGNLRQALKDAMADPSKTLMGVAHGIPSTFVTKVLAATKPDFVWIDVEHGMFNRLE
LHDAIHAAQHHSEGRSLVIVRVPKHDEVSLSTALDAGAAGIVIPHVETVEEVREFVKEMYYGPIGRRSFSPWTFSPGIAD
ASLFPNDPYNVATSNNHVCIIPQIESVKGVENVDAIAAMPEIHGLMFGPGDYMIDAGLDLNGALSGVPHPTFVEAMTKFS
TAAQRNGVPIFGGALSVDMVPSLIEQGYRAIAVQFDVWGLSRLVHGSLAQARASAKQFAGQGKAATDGTTDETVDGAAEE
VANGVSKVKLDEAGDEDKA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   LYS n 
1 4   SER n 
1 5   TYR n 
1 6   SER n 
1 7   GLU n 
1 8   GLN n 
1 9   PRO n 
1 10  GLU n 
1 11  LEU n 
1 12  HIS n 
1 13  ALA n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  TYR n 
1 18  ARG n 
1 19  SER n 
1 20  ALA n 
1 21  MET n 
1 22  LEU n 
1 23  THR n 
1 24  TYR n 
1 25  PRO n 
1 26  GLY n 
1 27  ASN n 
1 28  LEU n 
1 29  ARG n 
1 30  GLN n 
1 31  ALA n 
1 32  LEU n 
1 33  LYS n 
1 34  ASP n 
1 35  ALA n 
1 36  MET n 
1 37  ALA n 
1 38  ASP n 
1 39  PRO n 
1 40  SER n 
1 41  LYS n 
1 42  THR n 
1 43  LEU n 
1 44  MET n 
1 45  GLY n 
1 46  VAL n 
1 47  ALA n 
1 48  HIS n 
1 49  GLY n 
1 50  ILE n 
1 51  PRO n 
1 52  SER n 
1 53  THR n 
1 54  PHE n 
1 55  VAL n 
1 56  THR n 
1 57  LYS n 
1 58  VAL n 
1 59  LEU n 
1 60  ALA n 
1 61  ALA n 
1 62  THR n 
1 63  LYS n 
1 64  PRO n 
1 65  ASP n 
1 66  PHE n 
1 67  VAL n 
1 68  TRP n 
1 69  ILE n 
1 70  ASP n 
1 71  VAL n 
1 72  GLU n 
1 73  HIS n 
1 74  GLY n 
1 75  MET n 
1 76  PHE n 
1 77  ASN n 
1 78  ARG n 
1 79  LEU n 
1 80  GLU n 
1 81  LEU n 
1 82  HIS n 
1 83  ASP n 
1 84  ALA n 
1 85  ILE n 
1 86  HIS n 
1 87  ALA n 
1 88  ALA n 
1 89  GLN n 
1 90  HIS n 
1 91  HIS n 
1 92  SER n 
1 93  GLU n 
1 94  GLY n 
1 95  ARG n 
1 96  SER n 
1 97  LEU n 
1 98  VAL n 
1 99  ILE n 
1 100 VAL n 
1 101 ARG n 
1 102 VAL n 
1 103 PRO n 
1 104 LYS n 
1 105 HIS n 
1 106 ASP n 
1 107 GLU n 
1 108 VAL n 
1 109 SER n 
1 110 LEU n 
1 111 SER n 
1 112 THR n 
1 113 ALA n 
1 114 LEU n 
1 115 ASP n 
1 116 ALA n 
1 117 GLY n 
1 118 ALA n 
1 119 ALA n 
1 120 GLY n 
1 121 ILE n 
1 122 VAL n 
1 123 ILE n 
1 124 PRO n 
1 125 HIS n 
1 126 VAL n 
1 127 GLU n 
1 128 THR n 
1 129 VAL n 
1 130 GLU n 
1 131 GLU n 
1 132 VAL n 
1 133 ARG n 
1 134 GLU n 
1 135 PHE n 
1 136 VAL n 
1 137 LYS n 
1 138 GLU n 
1 139 MET n 
1 140 TYR n 
1 141 TYR n 
1 142 GLY n 
1 143 PRO n 
1 144 ILE n 
1 145 GLY n 
1 146 ARG n 
1 147 ARG n 
1 148 SER n 
1 149 PHE n 
1 150 SER n 
1 151 PRO n 
1 152 TRP n 
1 153 THR n 
1 154 PHE n 
1 155 SER n 
1 156 PRO n 
1 157 GLY n 
1 158 ILE n 
1 159 ALA n 
1 160 ASP n 
1 161 ALA n 
1 162 SER n 
1 163 LEU n 
1 164 PHE n 
1 165 PRO n 
1 166 ASN n 
1 167 ASP n 
1 168 PRO n 
1 169 TYR n 
1 170 ASN n 
1 171 VAL n 
1 172 ALA n 
1 173 THR n 
1 174 SER n 
1 175 ASN n 
1 176 ASN n 
1 177 HIS n 
1 178 VAL n 
1 179 CYS n 
1 180 ILE n 
1 181 ILE n 
1 182 PRO n 
1 183 GLN n 
1 184 ILE n 
1 185 GLU n 
1 186 SER n 
1 187 VAL n 
1 188 LYS n 
1 189 GLY n 
1 190 VAL n 
1 191 GLU n 
1 192 ASN n 
1 193 VAL n 
1 194 ASP n 
1 195 ALA n 
1 196 ILE n 
1 197 ALA n 
1 198 ALA n 
1 199 MET n 
1 200 PRO n 
1 201 GLU n 
1 202 ILE n 
1 203 HIS n 
1 204 GLY n 
1 205 LEU n 
1 206 MET n 
1 207 PHE n 
1 208 GLY n 
1 209 PRO n 
1 210 GLY n 
1 211 ASP n 
1 212 TYR n 
1 213 MET n 
1 214 ILE n 
1 215 ASP n 
1 216 ALA n 
1 217 GLY n 
1 218 LEU n 
1 219 ASP n 
1 220 LEU n 
1 221 ASN n 
1 222 GLY n 
1 223 ALA n 
1 224 LEU n 
1 225 SER n 
1 226 GLY n 
1 227 VAL n 
1 228 PRO n 
1 229 HIS n 
1 230 PRO n 
1 231 THR n 
1 232 PHE n 
1 233 VAL n 
1 234 GLU n 
1 235 ALA n 
1 236 MET n 
1 237 THR n 
1 238 LYS n 
1 239 PHE n 
1 240 SER n 
1 241 THR n 
1 242 ALA n 
1 243 ALA n 
1 244 GLN n 
1 245 ARG n 
1 246 ASN n 
1 247 GLY n 
1 248 VAL n 
1 249 PRO n 
1 250 ILE n 
1 251 PHE n 
1 252 GLY n 
1 253 GLY n 
1 254 ALA n 
1 255 LEU n 
1 256 SER n 
1 257 VAL n 
1 258 ASP n 
1 259 MET n 
1 260 VAL n 
1 261 PRO n 
1 262 SER n 
1 263 LEU n 
1 264 ILE n 
1 265 GLU n 
1 266 GLN n 
1 267 GLY n 
1 268 TYR n 
1 269 ARG n 
1 270 ALA n 
1 271 ILE n 
1 272 ALA n 
1 273 VAL n 
1 274 GLN n 
1 275 PHE n 
1 276 ASP n 
1 277 VAL n 
1 278 TRP n 
1 279 GLY n 
1 280 LEU n 
1 281 SER n 
1 282 ARG n 
1 283 LEU n 
1 284 VAL n 
1 285 HIS n 
1 286 GLY n 
1 287 SER n 
1 288 LEU n 
1 289 ALA n 
1 290 GLN n 
1 291 ALA n 
1 292 ARG n 
1 293 ALA n 
1 294 SER n 
1 295 ALA n 
1 296 LYS n 
1 297 GLN n 
1 298 PHE n 
1 299 ALA n 
1 300 GLY n 
1 301 GLN n 
1 302 GLY n 
1 303 LYS n 
1 304 ALA n 
1 305 ALA n 
1 306 THR n 
1 307 ASP n 
1 308 GLY n 
1 309 THR n 
1 310 THR n 
1 311 ASP n 
1 312 GLU n 
1 313 THR n 
1 314 VAL n 
1 315 ASP n 
1 316 GLY n 
1 317 ALA n 
1 318 ALA n 
1 319 GLU n 
1 320 GLU n 
1 321 VAL n 
1 322 ALA n 
1 323 ASN n 
1 324 GLY n 
1 325 VAL n 
1 326 SER n 
1 327 LYS n 
1 328 VAL n 
1 329 LYS n 
1 330 LEU n 
1 331 ASP n 
1 332 GLU n 
1 333 ALA n 
1 334 GLY n 
1 335 ASP n 
1 336 GLU n 
1 337 ASP n 
1 338 LYS n 
1 339 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Macrophoma 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Macrophoma commelinae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     108330 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET30B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q9UVD4_9ASCO 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAKSYSEQPELHAKAPYRSAMLTYPGNLRQALKDAMADPSKTLMGVAHGIPSTFVTKVLAATKPDFVWIDVEHGMFNRLE
LHDAIHAAQHHSEGRSLVIVRVPKHDEISLSTALDAGAAGIVIPHVETVEEVREFVKEMYYGPIGRRSFSPWTFSPGIAD
ASLFPNDPYNVATSNNHVCIIPQIESVKGVENVDAIAAMPEIHGLMFGPGDYMIDAGLDLNGALSGVPHPTFVEAMTKFS
TAAQRNGVPIFGGALSVDMVPSLIEQGYRAIAVQFDVWGLSRLVHGSLAQARASAKQFAGQGKAATDGTTDETVDGAAEE
VANGVSKVKLDEAGDEDKA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          Q9UVD4 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1IZC 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 339 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UVD4 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  339 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       339 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1IZC 
_struct_ref_seq_dif.mon_id                       VAL 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      108 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q9UVD4 
_struct_ref_seq_dif.db_mon_id                    ILE 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          108 
_struct_ref_seq_dif.details                      ENGINEERED 
_struct_ref_seq_dif.pdbx_auth_seq_num            108 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION' ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
PYR non-polymer         . 'PYRUVIC ACID'  ? 'C3 H4 O3'       88.062  
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1IZC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   54.99 
_exptl_crystal.density_Matthews      2.73 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'PIPES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2000-11-25 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    silicon 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-18B' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-18B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     1IZC 
_reflns.observed_criterion_sigma_F   2.0 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.d_resolution_high            1.7 
_reflns.d_resolution_low             20 
_reflns.number_all                   ? 
_reflns.number_obs                   41139 
_reflns.percent_possible_obs         91.3 
_reflns.pdbx_Rmerge_I_obs            0.081 
_reflns.pdbx_Rsym_value              0.075 
_reflns.pdbx_netI_over_sigmaI        6.5 
_reflns.B_iso_Wilson_estimate        23.099 
_reflns.pdbx_redundancy              6.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.7 
_reflns_shell.d_res_low              1.79 
_reflns_shell.percent_possible_all   61.0 
_reflns_shell.Rmerge_I_obs           0.315 
_reflns_shell.pdbx_Rsym_value        0.281 
_reflns_shell.meanI_over_sigI_obs    2.5 
_reflns_shell.pdbx_redundancy        4.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3901 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1IZC 
_refine.ls_d_res_high                            1.7 
_refine.ls_d_res_low                             20 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     45083 
_refine.ls_number_reflns_obs                     41102 
_refine.ls_number_reflns_R_free                  4121 
_refine.ls_percent_reflns_obs                    91.2 
_refine.ls_R_factor_all                          0.1777 
_refine.ls_R_factor_obs                          0.1777 
_refine.ls_R_factor_R_work                       0.1757 
_refine.ls_R_factor_R_free                       0.2031 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.B_iso_mean                               19.48 
_refine.aniso_B[1][1]                            -1.330 
_refine.aniso_B[1][2]                            -0.244 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][2]                            -1.330 
_refine.aniso_B[2][3]                            0.000 
_refine.aniso_B[3][3]                            2.661 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1IZC 
_refine_analyze.Luzzati_coordinate_error_obs    0.17 
_refine_analyze.Luzzati_sigma_a_obs             0.10 
_refine_analyze.Luzzati_d_res_low_obs           5.0 
_refine_analyze.Luzzati_coordinate_error_free   0.20 
_refine_analyze.Luzzati_sigma_a_free            0.13 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2270 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         7 
_refine_hist.number_atoms_solvent             360 
_refine_hist.number_atoms_total               2637 
_refine_hist.d_res_high                       1.7 
_refine_hist.d_res_low                        20 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007643 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.37231  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.978   ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.92035  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       1.70 
_refine_ls_shell.d_res_low                        1.76 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.236 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.2752 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             245 
_refine_ls_shell.number_reflns_obs                2350 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1IZC 
_struct.title                     'Crystal Structure Analysis of Macrophomate synthase' 
_struct.pdbx_descriptor           'Macrophomate synthase' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IZC 
_struct_keywords.pdbx_keywords   LYASE 
_struct_keywords.text            'TIM-BARREL, PYRUVATE MG(II) COMPLEX, LYASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 4   ? HIS A 12  ? SER A 4   HIS A 12  5 ? 9  
HELX_P HELX_P2  2  ASN A 27  ? ASP A 38  ? ASN A 27  ASP A 38  1 ? 12 
HELX_P HELX_P3  3  PRO A 39  ? THR A 42  ? PRO A 39  THR A 42  5 ? 4  
HELX_P HELX_P4  4  SER A 52  ? THR A 62  ? SER A 52  THR A 62  1 ? 11 
HELX_P HELX_P5  5  ASN A 77  ? SER A 92  ? ASN A 77  SER A 92  1 ? 16 
HELX_P HELX_P6  6  ASP A 106 ? GLY A 117 ? ASP A 106 GLY A 117 1 ? 12 
HELX_P HELX_P7  7  THR A 128 ? TYR A 140 ? THR A 128 TYR A 140 1 ? 13 
HELX_P HELX_P8  8  ASN A 170 ? VAL A 178 ? ASN A 170 VAL A 178 1 ? 9  
HELX_P HELX_P9  9  SER A 186 ? ASN A 192 ? SER A 186 ASN A 192 1 ? 7  
HELX_P HELX_P10 10 ASN A 192 ? ALA A 198 ? ASN A 192 ALA A 198 1 ? 7  
HELX_P HELX_P11 11 GLY A 208 ? ALA A 216 ? GLY A 208 ALA A 216 1 ? 9  
HELX_P HELX_P12 12 HIS A 229 ? ASN A 246 ? HIS A 229 ASN A 246 1 ? 18 
HELX_P HELX_P13 13 SER A 256 ? ASP A 258 ? SER A 256 ASP A 258 5 ? 3  
HELX_P HELX_P14 14 MET A 259 ? GLN A 266 ? MET A 259 GLN A 266 1 ? 8  
HELX_P HELX_P15 15 ASP A 276 ? LYS A 296 ? ASP A 276 LYS A 296 1 ? 21 
HELX_P HELX_P16 16 GLN A 297 ? ALA A 299 ? GLN A 297 ALA A 299 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MG . MG ? ? ? 1_555 A GLU 185 OE1 ? ? A MG 1001 A GLU 185  1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc2 metalc ? ? B MG . MG ? ? ? 1_555 A ASP 211 OD2 ? ? A MG 1001 A ASP 211  1_555 ? ? ? ? ? ? ? 2.125 ? 
metalc3 metalc ? ? B MG . MG ? ? ? 1_555 C PYR .   O3  ? ? A MG 1001 A PYR 2001 1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc4 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .   O   ? ? A MG 1001 A HOH 2036 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc5 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .   O   ? ? A MG 1001 A HOH 2245 1_555 ? ? ? ? ? ? ? 2.270 ? 
metalc6 metalc ? ? B MG . MG ? ? ? 1_555 C PYR .   O1  ? ? A MG 1001 A PYR 2001 1_555 ? ? ? ? ? ? ? 2.170 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           142 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            142 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    143 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     143 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.32 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   9 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
A 5 6 ? parallel 
A 6 7 ? parallel 
A 7 8 ? parallel 
A 8 9 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 43  ? HIS A 48  ? LEU A 43  HIS A 48  
A 2 PHE A 66  ? ASP A 70  ? PHE A 66  ASP A 70  
A 3 LEU A 97  ? ARG A 101 ? LEU A 97  ARG A 101 
A 4 GLY A 120 ? ILE A 123 ? GLY A 120 ILE A 123 
A 5 CYS A 179 ? ILE A 184 ? CYS A 179 ILE A 184 
A 6 LEU A 205 ? PHE A 207 ? LEU A 205 PHE A 207 
A 7 ILE A 250 ? GLY A 253 ? ILE A 250 GLY A 253 
A 8 TYR A 268 ? PHE A 275 ? TYR A 268 PHE A 275 
A 9 LEU A 43  ? HIS A 48  ? LEU A 43  HIS A 48  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N HIS A 48  ? N HIS A 48  O TRP A 68  ? O TRP A 68  
A 2 3 N ILE A 69  ? N ILE A 69  O ILE A 99  ? O ILE A 99  
A 3 4 N VAL A 100 ? N VAL A 100 O GLY A 120 ? O GLY A 120 
A 4 5 N ILE A 121 ? N ILE A 121 O ILE A 181 ? O ILE A 181 
A 5 6 N ILE A 184 ? N ILE A 184 O MET A 206 ? O MET A 206 
A 6 7 N LEU A 205 ? N LEU A 205 O PHE A 251 ? O PHE A 251 
A 7 8 N ILE A 250 ? N ILE A 250 O ARG A 269 ? O ARG A 269 
A 8 9 O ILE A 271 ? O ILE A 271 N LEU A 43  ? N LEU A 43  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG A 1001'  
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE PYR A 2001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  GLU A 185 ? GLU A 185  . ? 1_555 ? 
2  AC1 5  ASP A 211 ? ASP A 211  . ? 1_555 ? 
3  AC1 5  PYR C .   ? PYR A 2001 . ? 1_555 ? 
4  AC1 5  HOH D .   ? HOH A 2036 . ? 1_555 ? 
5  AC1 5  HOH D .   ? HOH A 2245 . ? 1_555 ? 
6  AC2 11 ARG A 101 ? ARG A 101  . ? 1_555 ? 
7  AC2 11 GLN A 183 ? GLN A 183  . ? 1_555 ? 
8  AC2 11 GLU A 185 ? GLU A 185  . ? 1_555 ? 
9  AC2 11 GLY A 208 ? GLY A 208  . ? 1_555 ? 
10 AC2 11 PRO A 209 ? PRO A 209  . ? 1_555 ? 
11 AC2 11 GLY A 210 ? GLY A 210  . ? 1_555 ? 
12 AC2 11 ASP A 211 ? ASP A 211  . ? 1_555 ? 
13 AC2 11 MG  B .   ? MG  A 1001 . ? 1_555 ? 
14 AC2 11 HOH D .   ? HOH A 2068 . ? 2_655 ? 
15 AC2 11 HOH D .   ? HOH A 2245 . ? 1_555 ? 
16 AC2 11 HOH D .   ? HOH A 2271 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1IZC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IZC 
_atom_sites.fract_transf_matrix[1][1]   0.009374 
_atom_sites.fract_transf_matrix[1][2]   0.005412 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010824 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008281 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ALA A 1 2   ? 88.786 50.325 14.951 1.00 54.16 ? 2    ALA A N   1 
ATOM   2    C  CA  . ALA A 1 2   ? 88.762 51.789 15.263 1.00 51.32 ? 2    ALA A CA  1 
ATOM   3    C  C   . ALA A 1 2   ? 87.349 52.257 15.624 1.00 47.95 ? 2    ALA A C   1 
ATOM   4    O  O   . ALA A 1 2   ? 87.144 53.413 16.015 1.00 45.43 ? 2    ALA A O   1 
ATOM   5    C  CB  . ALA A 1 2   ? 89.288 52.583 14.058 1.00 49.48 ? 2    ALA A CB  1 
ATOM   6    N  N   . LYS A 1 3   ? 86.380 51.349 15.505 1.00 42.11 ? 3    LYS A N   1 
ATOM   7    C  CA  . LYS A 1 3   ? 84.993 51.680 15.794 1.00 28.86 ? 3    LYS A CA  1 
ATOM   8    C  C   . LYS A 1 3   ? 84.218 50.572 16.509 1.00 24.57 ? 3    LYS A C   1 
ATOM   9    O  O   . LYS A 1 3   ? 82.992 50.561 16.473 1.00 23.65 ? 3    LYS A O   1 
ATOM   10   C  CB  . LYS A 1 3   ? 84.271 52.034 14.499 1.00 20.98 ? 3    LYS A CB  1 
ATOM   11   C  CG  . LYS A 1 3   ? 84.232 50.907 13.493 1.00 28.29 ? 3    LYS A CG  1 
ATOM   12   C  CD  . LYS A 1 3   ? 83.474 51.342 12.250 1.00 38.95 ? 3    LYS A CD  1 
ATOM   13   C  CE  . LYS A 1 3   ? 83.461 50.248 11.208 1.00 39.22 ? 3    LYS A CE  1 
ATOM   14   N  NZ  . LYS A 1 3   ? 82.667 50.640 10.015 1.00 50.36 ? 3    LYS A NZ  1 
ATOM   15   N  N   . SER A 1 4   ? 84.921 49.641 17.141 1.00 21.22 ? 4    SER A N   1 
ATOM   16   C  CA  . SER A 1 4   ? 84.244 48.572 17.875 1.00 19.71 ? 4    SER A CA  1 
ATOM   17   C  C   . SER A 1 4   ? 83.692 49.193 19.161 1.00 18.40 ? 4    SER A C   1 
ATOM   18   O  O   . SER A 1 4   ? 84.036 50.321 19.512 1.00 16.08 ? 4    SER A O   1 
ATOM   19   C  CB  . SER A 1 4   ? 85.230 47.462 18.239 1.00 18.88 ? 4    SER A CB  1 
ATOM   20   O  OG  . SER A 1 4   ? 86.182 47.938 19.170 1.00 22.55 ? 4    SER A OG  1 
ATOM   21   N  N   . TYR A 1 5   ? 82.842 48.456 19.868 1.00 15.86 ? 5    TYR A N   1 
ATOM   22   C  CA  . TYR A 1 5   ? 82.272 48.958 21.111 1.00 15.67 ? 5    TYR A CA  1 
ATOM   23   C  C   . TYR A 1 5   ? 83.367 49.340 22.110 1.00 16.43 ? 5    TYR A C   1 
ATOM   24   O  O   . TYR A 1 5   ? 83.313 50.403 22.735 1.00 15.72 ? 5    TYR A O   1 
ATOM   25   C  CB  . TYR A 1 5   ? 81.379 47.887 21.742 1.00 12.78 ? 5    TYR A CB  1 
ATOM   26   C  CG  . TYR A 1 5   ? 80.740 48.305 23.046 1.00 13.01 ? 5    TYR A CG  1 
ATOM   27   C  CD1 . TYR A 1 5   ? 79.623 49.147 23.061 1.00 11.96 ? 5    TYR A CD1 1 
ATOM   28   C  CD2 . TYR A 1 5   ? 81.223 47.822 24.266 1.00 13.70 ? 5    TYR A CD2 1 
ATOM   29   C  CE1 . TYR A 1 5   ? 78.994 49.490 24.259 1.00 13.81 ? 5    TYR A CE1 1 
ATOM   30   C  CE2 . TYR A 1 5   ? 80.599 48.160 25.472 1.00 14.14 ? 5    TYR A CE2 1 
ATOM   31   C  CZ  . TYR A 1 5   ? 79.487 48.988 25.459 1.00 13.44 ? 5    TYR A CZ  1 
ATOM   32   O  OH  . TYR A 1 5   ? 78.846 49.288 26.642 1.00 14.17 ? 5    TYR A OH  1 
ATOM   33   N  N   . SER A 1 6   ? 84.358 48.467 22.262 1.00 19.12 ? 6    SER A N   1 
ATOM   34   C  CA  . SER A 1 6   ? 85.438 48.720 23.205 1.00 22.51 ? 6    SER A CA  1 
ATOM   35   C  C   . SER A 1 6   ? 86.208 49.991 22.870 1.00 24.47 ? 6    SER A C   1 
ATOM   36   O  O   . SER A 1 6   ? 86.779 50.617 23.760 1.00 25.03 ? 6    SER A O   1 
ATOM   37   C  CB  . SER A 1 6   ? 86.400 47.526 23.260 1.00 28.19 ? 6    SER A CB  1 
ATOM   38   O  OG  . SER A 1 6   ? 87.030 47.300 22.009 1.00 34.59 ? 6    SER A OG  1 
ATOM   39   N  N   . GLU A 1 7   ? 86.206 50.374 21.595 1.00 21.30 ? 7    GLU A N   1 
ATOM   40   C  CA  . GLU A 1 7   ? 86.910 51.575 21.146 1.00 23.41 ? 7    GLU A CA  1 
ATOM   41   C  C   . GLU A 1 7   ? 86.028 52.818 21.183 1.00 23.40 ? 7    GLU A C   1 
ATOM   42   O  O   . GLU A 1 7   ? 86.434 53.883 20.718 1.00 23.87 ? 7    GLU A O   1 
ATOM   43   C  CB  . GLU A 1 7   ? 87.433 51.395 19.717 1.00 28.95 ? 7    GLU A CB  1 
ATOM   44   C  CG  . GLU A 1 7   ? 88.333 50.192 19.504 1.00 34.51 ? 7    GLU A CG  1 
ATOM   45   C  CD  . GLU A 1 7   ? 88.792 50.077 18.058 1.00 43.50 ? 7    GLU A CD  1 
ATOM   46   O  OE1 . GLU A 1 7   ? 89.825 50.691 17.705 1.00 49.85 ? 7    GLU A OE1 1 
ATOM   47   O  OE2 . GLU A 1 7   ? 88.112 49.386 17.265 1.00 42.72 ? 7    GLU A OE2 1 
ATOM   48   N  N   . GLN A 1 8   ? 84.818 52.687 21.720 1.00 18.83 ? 8    GLN A N   1 
ATOM   49   C  CA  . GLN A 1 8   ? 83.903 53.819 21.810 1.00 17.88 ? 8    GLN A CA  1 
ATOM   50   C  C   . GLN A 1 8   ? 83.422 53.989 23.252 1.00 19.69 ? 8    GLN A C   1 
ATOM   51   O  O   . GLN A 1 8   ? 82.266 53.716 23.572 1.00 17.12 ? 8    GLN A O   1 
ATOM   52   C  CB  . GLN A 1 8   ? 82.704 53.623 20.869 1.00 16.60 ? 8    GLN A CB  1 
ATOM   53   C  CG  . GLN A 1 8   ? 83.063 53.651 19.385 1.00 13.62 ? 8    GLN A CG  1 
ATOM   54   C  CD  . GLN A 1 8   ? 81.842 53.795 18.491 1.00 14.33 ? 8    GLN A CD  1 
ATOM   55   O  OE1 . GLN A 1 8   ? 81.054 54.731 18.641 1.00 18.24 ? 8    GLN A OE1 1 
ATOM   56   N  NE2 . GLN A 1 8   ? 81.682 52.872 17.551 1.00 15.42 ? 8    GLN A NE2 1 
ATOM   57   N  N   . PRO A 1 9   ? 84.313 54.466 24.140 1.00 22.44 ? 9    PRO A N   1 
ATOM   58   C  CA  . PRO A 1 9   ? 84.036 54.688 25.569 1.00 20.09 ? 9    PRO A CA  1 
ATOM   59   C  C   . PRO A 1 9   ? 82.757 55.458 25.880 1.00 18.92 ? 9    PRO A C   1 
ATOM   60   O  O   . PRO A 1 9   ? 82.123 55.243 26.917 1.00 20.10 ? 9    PRO A O   1 
ATOM   61   C  CB  . PRO A 1 9   ? 85.278 55.442 26.053 1.00 25.60 ? 9    PRO A CB  1 
ATOM   62   C  CG  . PRO A 1 9   ? 86.359 54.964 25.121 1.00 28.91 ? 9    PRO A CG  1 
ATOM   63   C  CD  . PRO A 1 9   ? 85.663 54.940 23.783 1.00 24.50 ? 9    PRO A CD  1 
ATOM   64   N  N   . GLU A 1 10  ? 82.381 56.366 24.992 1.00 19.72 ? 10   GLU A N   1 
ATOM   65   C  CA  . GLU A 1 10  ? 81.183 57.160 25.204 1.00 21.38 ? 10   GLU A CA  1 
ATOM   66   C  C   . GLU A 1 10  ? 79.928 56.286 25.243 1.00 20.32 ? 10   GLU A C   1 
ATOM   67   O  O   . GLU A 1 10  ? 78.910 56.680 25.806 1.00 20.40 ? 10   GLU A O   1 
ATOM   68   C  CB  . GLU A 1 10  ? 81.049 58.208 24.099 1.00 27.52 ? 10   GLU A CB  1 
ATOM   69   C  CG  . GLU A 1 10  ? 82.384 58.773 23.614 1.00 39.54 ? 10   GLU A CG  1 
ATOM   70   C  CD  . GLU A 1 10  ? 82.939 58.024 22.397 1.00 41.00 ? 10   GLU A CD  1 
ATOM   71   O  OE1 . GLU A 1 10  ? 83.281 56.827 22.506 1.00 34.11 ? 10   GLU A OE1 1 
ATOM   72   O  OE2 . GLU A 1 10  ? 83.030 58.645 21.318 1.00 51.06 ? 10   GLU A OE2 1 
ATOM   73   N  N   . LEU A 1 11  ? 80.011 55.097 24.653 1.00 16.25 ? 11   LEU A N   1 
ATOM   74   C  CA  . LEU A 1 11  ? 78.873 54.179 24.620 1.00 16.88 ? 11   LEU A CA  1 
ATOM   75   C  C   . LEU A 1 11  ? 78.841 53.234 25.816 1.00 19.52 ? 11   LEU A C   1 
ATOM   76   O  O   . LEU A 1 11  ? 77.847 52.539 26.038 1.00 16.68 ? 11   LEU A O   1 
ATOM   77   C  CB  . LEU A 1 11  ? 78.921 53.327 23.351 1.00 15.18 ? 11   LEU A CB  1 
ATOM   78   C  CG  . LEU A 1 11  ? 78.850 54.077 22.022 1.00 15.65 ? 11   LEU A CG  1 
ATOM   79   C  CD1 . LEU A 1 11  ? 78.992 53.093 20.868 1.00 18.01 ? 11   LEU A CD1 1 
ATOM   80   C  CD2 . LEU A 1 11  ? 77.531 54.815 21.935 1.00 20.31 ? 11   LEU A CD2 1 
ATOM   81   N  N   . HIS A 1 12  ? 79.922 53.202 26.588 1.00 17.15 ? 12   HIS A N   1 
ATOM   82   C  CA  . HIS A 1 12  ? 79.986 52.281 27.713 1.00 18.93 ? 12   HIS A CA  1 
ATOM   83   C  C   . HIS A 1 12  ? 79.030 52.609 28.841 1.00 18.55 ? 12   HIS A C   1 
ATOM   84   O  O   . HIS A 1 12  ? 78.749 53.772 29.122 1.00 18.59 ? 12   HIS A O   1 
ATOM   85   C  CB  . HIS A 1 12  ? 81.422 52.195 28.230 1.00 16.73 ? 12   HIS A CB  1 
ATOM   86   C  CG  . HIS A 1 12  ? 82.391 51.714 27.199 1.00 17.62 ? 12   HIS A CG  1 
ATOM   87   N  ND1 . HIS A 1 12  ? 83.746 51.620 27.430 1.00 25.10 ? 12   HIS A ND1 1 
ATOM   88   C  CD2 . HIS A 1 12  ? 82.197 51.292 25.927 1.00 18.73 ? 12   HIS A CD2 1 
ATOM   89   C  CE1 . HIS A 1 12  ? 84.345 51.161 26.345 1.00 22.38 ? 12   HIS A CE1 1 
ATOM   90   N  NE2 . HIS A 1 12  ? 83.427 50.954 25.418 1.00 19.82 ? 12   HIS A NE2 1 
ATOM   91   N  N   . ALA A 1 13  ? 78.523 51.568 29.489 1.00 17.83 ? 13   ALA A N   1 
ATOM   92   C  CA  . ALA A 1 13  ? 77.585 51.761 30.581 1.00 18.42 ? 13   ALA A CA  1 
ATOM   93   C  C   . ALA A 1 13  ? 78.248 52.287 31.846 1.00 17.88 ? 13   ALA A C   1 
ATOM   94   O  O   . ALA A 1 13  ? 79.353 51.889 32.202 1.00 20.69 ? 13   ALA A O   1 
ATOM   95   C  CB  . ALA A 1 13  ? 76.856 50.443 30.887 1.00 18.60 ? 13   ALA A CB  1 
ATOM   96   N  N   . LYS A 1 14  ? 77.563 53.191 32.525 1.00 18.38 ? 14   LYS A N   1 
ATOM   97   C  CA  . LYS A 1 14  ? 78.077 53.726 33.773 1.00 25.55 ? 14   LYS A CA  1 
ATOM   98   C  C   . LYS A 1 14  ? 77.260 53.008 34.835 1.00 22.92 ? 14   LYS A C   1 
ATOM   99   O  O   . LYS A 1 14  ? 76.097 53.327 35.061 1.00 26.85 ? 14   LYS A O   1 
ATOM   100  C  CB  . LYS A 1 14  ? 77.863 55.239 33.839 1.00 34.03 ? 14   LYS A CB  1 
ATOM   101  C  CG  . LYS A 1 14  ? 78.662 55.999 32.784 1.00 39.07 ? 14   LYS A CG  1 
ATOM   102  C  CD  . LYS A 1 14  ? 78.501 57.504 32.941 1.00 45.10 ? 14   LYS A CD  1 
ATOM   103  C  CE  . LYS A 1 14  ? 79.333 58.258 31.911 1.00 46.36 ? 14   LYS A CE  1 
ATOM   104  N  NZ  . LYS A 1 14  ? 79.212 59.730 32.093 1.00 51.28 ? 14   LYS A NZ  1 
ATOM   105  N  N   . ALA A 1 15  ? 77.869 52.007 35.455 1.00 18.91 ? 15   ALA A N   1 
ATOM   106  C  CA  . ALA A 1 15  ? 77.184 51.213 36.467 1.00 15.44 ? 15   ALA A CA  1 
ATOM   107  C  C   . ALA A 1 15  ? 78.099 51.165 37.686 1.00 12.59 ? 15   ALA A C   1 
ATOM   108  O  O   . ALA A 1 15  ? 78.741 50.159 37.953 1.00 12.47 ? 15   ALA A O   1 
ATOM   109  C  CB  . ALA A 1 15  ? 76.938 49.812 35.919 1.00 12.41 ? 15   ALA A CB  1 
ATOM   110  N  N   . PRO A 1 16  ? 78.143 52.263 38.448 1.00 13.58 ? 16   PRO A N   1 
ATOM   111  C  CA  . PRO A 1 16  ? 78.968 52.426 39.648 1.00 14.45 ? 16   PRO A CA  1 
ATOM   112  C  C   . PRO A 1 16  ? 78.842 51.348 40.720 1.00 15.08 ? 16   PRO A C   1 
ATOM   113  O  O   . PRO A 1 16  ? 79.804 51.073 41.443 1.00 16.37 ? 16   PRO A O   1 
ATOM   114  C  CB  . PRO A 1 16  ? 78.528 53.786 40.193 1.00 16.46 ? 16   PRO A CB  1 
ATOM   115  C  CG  . PRO A 1 16  ? 78.001 54.496 39.020 1.00 24.69 ? 16   PRO A CG  1 
ATOM   116  C  CD  . PRO A 1 16  ? 77.266 53.430 38.259 1.00 16.80 ? 16   PRO A CD  1 
ATOM   117  N  N   . TYR A 1 17  ? 77.666 50.746 40.827 1.00 10.24 ? 17   TYR A N   1 
ATOM   118  C  CA  . TYR A 1 17  ? 77.426 49.761 41.879 1.00 8.14  ? 17   TYR A CA  1 
ATOM   119  C  C   . TYR A 1 17  ? 77.196 48.317 41.452 1.00 10.85 ? 17   TYR A C   1 
ATOM   120  O  O   . TYR A 1 17  ? 76.874 47.474 42.295 1.00 10.44 ? 17   TYR A O   1 
ATOM   121  C  CB  . TYR A 1 17  ? 76.237 50.240 42.720 1.00 10.78 ? 17   TYR A CB  1 
ATOM   122  C  CG  . TYR A 1 17  ? 76.413 51.658 43.203 1.00 10.10 ? 17   TYR A CG  1 
ATOM   123  C  CD1 . TYR A 1 17  ? 77.335 51.954 44.211 1.00 14.07 ? 17   TYR A CD1 1 
ATOM   124  C  CD2 . TYR A 1 17  ? 75.705 52.712 42.624 1.00 12.11 ? 17   TYR A CD2 1 
ATOM   125  C  CE1 . TYR A 1 17  ? 77.547 53.263 44.622 1.00 12.21 ? 17   TYR A CE1 1 
ATOM   126  C  CE2 . TYR A 1 17  ? 75.908 54.030 43.035 1.00 12.44 ? 17   TYR A CE2 1 
ATOM   127  C  CZ  . TYR A 1 17  ? 76.832 54.292 44.035 1.00 12.06 ? 17   TYR A CZ  1 
ATOM   128  O  OH  . TYR A 1 17  ? 77.043 55.584 44.462 1.00 12.38 ? 17   TYR A OH  1 
ATOM   129  N  N   . ARG A 1 18  ? 77.374 47.998 40.173 1.00 8.82  ? 18   ARG A N   1 
ATOM   130  C  CA  . ARG A 1 18  ? 77.122 46.616 39.751 1.00 9.76  ? 18   ARG A CA  1 
ATOM   131  C  C   . ARG A 1 18  ? 78.102 45.608 40.334 1.00 11.19 ? 18   ARG A C   1 
ATOM   132  O  O   . ARG A 1 18  ? 79.245 45.951 40.666 1.00 10.25 ? 18   ARG A O   1 
ATOM   133  C  CB  . ARG A 1 18  ? 77.141 46.492 38.225 1.00 10.11 ? 18   ARG A CB  1 
ATOM   134  C  CG  . ARG A 1 18  ? 78.490 46.841 37.583 1.00 9.71  ? 18   ARG A CG  1 
ATOM   135  C  CD  . ARG A 1 18  ? 78.565 46.246 36.178 1.00 11.00 ? 18   ARG A CD  1 
ATOM   136  N  NE  . ARG A 1 18  ? 78.771 44.804 36.236 1.00 9.13  ? 18   ARG A NE  1 
ATOM   137  C  CZ  . ARG A 1 18  ? 78.761 44.004 35.175 1.00 10.11 ? 18   ARG A CZ  1 
ATOM   138  N  NH1 . ARG A 1 18  ? 78.546 44.509 33.963 1.00 10.88 ? 18   ARG A NH1 1 
ATOM   139  N  NH2 . ARG A 1 18  ? 78.980 42.703 35.326 1.00 8.49  ? 18   ARG A NH2 1 
ATOM   140  N  N   . SER A 1 19  ? 77.647 44.368 40.478 1.00 10.97 ? 19   SER A N   1 
ATOM   141  C  CA  . SER A 1 19  ? 78.506 43.299 40.988 1.00 12.56 ? 19   SER A CA  1 
ATOM   142  C  C   . SER A 1 19  ? 79.324 42.740 39.824 1.00 10.63 ? 19   SER A C   1 
ATOM   143  O  O   . SER A 1 19  ? 79.171 43.188 38.687 1.00 12.02 ? 19   SER A O   1 
ATOM   144  C  CB  . SER A 1 19  ? 77.662 42.182 41.600 1.00 11.61 ? 19   SER A CB  1 
ATOM   145  O  OG  . SER A 1 19  ? 78.486 41.262 42.286 1.00 15.59 ? 19   SER A OG  1 
ATOM   146  N  N   . ALA A 1 20  ? 80.184 41.763 40.100 1.00 10.54 ? 20   ALA A N   1 
ATOM   147  C  CA  . ALA A 1 20  ? 81.007 41.170 39.048 1.00 8.42  ? 20   ALA A CA  1 
ATOM   148  C  C   . ALA A 1 20  ? 80.115 40.500 38.006 1.00 11.77 ? 20   ALA A C   1 
ATOM   149  O  O   . ALA A 1 20  ? 80.451 40.468 36.829 1.00 13.32 ? 20   ALA A O   1 
ATOM   150  C  CB  . ALA A 1 20  ? 81.978 40.151 39.639 1.00 12.63 ? 20   ALA A CB  1 
ATOM   151  N  N   . MET A 1 21  ? 78.996 39.939 38.456 1.00 9.61  ? 21   MET A N   1 
ATOM   152  C  CA  . MET A 1 21  ? 78.043 39.292 37.550 1.00 11.48 ? 21   MET A CA  1 
ATOM   153  C  C   . MET A 1 21  ? 76.675 39.909 37.783 1.00 11.14 ? 21   MET A C   1 
ATOM   154  O  O   . MET A 1 21  ? 76.263 40.122 38.928 1.00 9.51  ? 21   MET A O   1 
ATOM   155  C  CB  . MET A 1 21  ? 77.998 37.786 37.796 1.00 13.18 ? 21   MET A CB  1 
ATOM   156  C  CG  . MET A 1 21  ? 79.367 37.115 37.627 1.00 14.74 ? 21   MET A CG  1 
ATOM   157  S  SD  . MET A 1 21  ? 79.247 35.335 37.500 1.00 15.70 ? 21   MET A SD  1 
ATOM   158  C  CE  . MET A 1 21  ? 78.441 34.944 39.032 1.00 11.74 ? 21   MET A CE  1 
ATOM   159  N  N   . LEU A 1 22  ? 75.954 40.171 36.700 1.00 8.47  ? 22   LEU A N   1 
ATOM   160  C  CA  . LEU A 1 22  ? 74.658 40.831 36.815 1.00 10.41 ? 22   LEU A CA  1 
ATOM   161  C  C   . LEU A 1 22  ? 73.523 39.970 37.354 1.00 9.28  ? 22   LEU A C   1 
ATOM   162  O  O   . LEU A 1 22  ? 72.395 40.442 37.494 1.00 11.36 ? 22   LEU A O   1 
ATOM   163  C  CB  . LEU A 1 22  ? 74.286 41.465 35.471 1.00 9.46  ? 22   LEU A CB  1 
ATOM   164  C  CG  . LEU A 1 22  ? 75.283 42.538 35.004 1.00 7.99  ? 22   LEU A CG  1 
ATOM   165  C  CD1 . LEU A 1 22  ? 74.853 43.047 33.637 1.00 11.18 ? 22   LEU A CD1 1 
ATOM   166  C  CD2 . LEU A 1 22  ? 75.353 43.692 36.003 1.00 8.60  ? 22   LEU A CD2 1 
ATOM   167  N  N   . THR A 1 23  ? 73.840 38.716 37.661 1.00 9.33  ? 23   THR A N   1 
ATOM   168  C  CA  . THR A 1 23  ? 72.899 37.779 38.265 1.00 6.80  ? 23   THR A CA  1 
ATOM   169  C  C   . THR A 1 23  ? 72.970 37.943 39.784 1.00 9.17  ? 23   THR A C   1 
ATOM   170  O  O   . THR A 1 23  ? 72.232 37.290 40.528 1.00 9.27  ? 23   THR A O   1 
ATOM   171  C  CB  . THR A 1 23  ? 73.259 36.327 37.927 1.00 10.60 ? 23   THR A CB  1 
ATOM   172  O  OG1 . THR A 1 23  ? 74.669 36.142 38.099 1.00 10.74 ? 23   THR A OG1 1 
ATOM   173  C  CG2 . THR A 1 23  ? 72.870 35.998 36.490 1.00 13.30 ? 23   THR A CG2 1 
ATOM   174  N  N   . TYR A 1 24  ? 73.869 38.816 40.234 1.00 8.71  ? 24   TYR A N   1 
ATOM   175  C  CA  . TYR A 1 24  ? 74.035 39.095 41.662 1.00 10.45 ? 24   TYR A CA  1 
ATOM   176  C  C   . TYR A 1 24  ? 73.663 40.540 41.958 1.00 8.95  ? 24   TYR A C   1 
ATOM   177  O  O   . TYR A 1 24  ? 73.755 41.407 41.086 1.00 9.76  ? 24   TYR A O   1 
ATOM   178  C  CB  . TYR A 1 24  ? 75.467 38.790 42.115 1.00 11.30 ? 24   TYR A CB  1 
ATOM   179  C  CG  . TYR A 1 24  ? 75.647 37.326 42.393 1.00 9.32  ? 24   TYR A CG  1 
ATOM   180  C  CD1 . TYR A 1 24  ? 76.017 36.440 41.386 1.00 14.58 ? 24   TYR A CD1 1 
ATOM   181  C  CD2 . TYR A 1 24  ? 75.343 36.803 43.649 1.00 12.17 ? 24   TYR A CD2 1 
ATOM   182  C  CE1 . TYR A 1 24  ? 76.078 35.064 41.624 1.00 19.52 ? 24   TYR A CE1 1 
ATOM   183  C  CE2 . TYR A 1 24  ? 75.397 35.434 43.895 1.00 17.63 ? 24   TYR A CE2 1 
ATOM   184  C  CZ  . TYR A 1 24  ? 75.767 34.568 42.879 1.00 18.79 ? 24   TYR A CZ  1 
ATOM   185  O  OH  . TYR A 1 24  ? 75.843 33.205 43.124 1.00 18.10 ? 24   TYR A OH  1 
ATOM   186  N  N   . PRO A 1 25  ? 73.243 40.828 43.202 1.00 10.12 ? 25   PRO A N   1 
ATOM   187  C  CA  . PRO A 1 25  ? 72.858 42.202 43.529 1.00 9.36  ? 25   PRO A CA  1 
ATOM   188  C  C   . PRO A 1 25  ? 73.944 43.252 43.450 1.00 9.77  ? 25   PRO A C   1 
ATOM   189  O  O   . PRO A 1 25  ? 75.084 43.016 43.852 1.00 9.78  ? 25   PRO A O   1 
ATOM   190  C  CB  . PRO A 1 25  ? 72.313 42.085 44.951 1.00 8.85  ? 25   PRO A CB  1 
ATOM   191  C  CG  . PRO A 1 25  ? 73.215 41.042 45.550 1.00 9.49  ? 25   PRO A CG  1 
ATOM   192  C  CD  . PRO A 1 25  ? 73.271 39.988 44.413 1.00 9.65  ? 25   PRO A CD  1 
ATOM   193  N  N   . GLY A 1 26  ? 73.572 44.411 42.919 1.00 9.52  ? 26   GLY A N   1 
ATOM   194  C  CA  . GLY A 1 26  ? 74.491 45.528 42.857 1.00 9.09  ? 26   GLY A CA  1 
ATOM   195  C  C   . GLY A 1 26  ? 74.586 46.077 44.272 1.00 11.08 ? 26   GLY A C   1 
ATOM   196  O  O   . GLY A 1 26  ? 73.793 45.702 45.147 1.00 8.63  ? 26   GLY A O   1 
ATOM   197  N  N   . ASN A 1 27  ? 75.529 46.981 44.510 1.00 10.15 ? 27   ASN A N   1 
ATOM   198  C  CA  . ASN A 1 27  ? 75.715 47.496 45.866 1.00 9.91  ? 27   ASN A CA  1 
ATOM   199  C  C   . ASN A 1 27  ? 74.793 48.641 46.281 1.00 9.64  ? 27   ASN A C   1 
ATOM   200  O  O   . ASN A 1 27  ? 75.205 49.811 46.315 1.00 10.91 ? 27   ASN A O   1 
ATOM   201  C  CB  . ASN A 1 27  ? 77.172 47.913 46.071 1.00 11.11 ? 27   ASN A CB  1 
ATOM   202  C  CG  . ASN A 1 27  ? 77.532 48.012 47.541 1.00 11.78 ? 27   ASN A CG  1 
ATOM   203  O  OD1 . ASN A 1 27  ? 76.647 48.077 48.393 1.00 10.76 ? 27   ASN A OD1 1 
ATOM   204  N  ND2 . ASN A 1 27  ? 78.829 48.031 47.845 1.00 16.39 ? 27   ASN A ND2 1 
ATOM   205  N  N   . LEU A 1 28  ? 73.552 48.302 46.621 1.00 6.88  ? 28   LEU A N   1 
ATOM   206  C  CA  . LEU A 1 28  ? 72.587 49.307 47.049 1.00 9.67  ? 28   LEU A CA  1 
ATOM   207  C  C   . LEU A 1 28  ? 73.031 49.900 48.387 1.00 10.01 ? 28   LEU A C   1 
ATOM   208  O  O   . LEU A 1 28  ? 72.785 51.074 48.668 1.00 9.25  ? 28   LEU A O   1 
ATOM   209  C  CB  . LEU A 1 28  ? 71.182 48.691 47.163 1.00 8.24  ? 28   LEU A CB  1 
ATOM   210  C  CG  . LEU A 1 28  ? 70.077 49.586 47.739 1.00 7.10  ? 28   LEU A CG  1 
ATOM   211  C  CD1 . LEU A 1 28  ? 69.904 50.832 46.835 1.00 9.77  ? 28   LEU A CD1 1 
ATOM   212  C  CD2 . LEU A 1 28  ? 68.765 48.799 47.845 1.00 9.34  ? 28   LEU A CD2 1 
ATOM   213  N  N   . ARG A 1 29  ? 73.689 49.084 49.210 1.00 8.07  ? 29   ARG A N   1 
ATOM   214  C  CA  . ARG A 1 29  ? 74.176 49.553 50.508 1.00 8.35  ? 29   ARG A CA  1 
ATOM   215  C  C   . ARG A 1 29  ? 75.049 50.804 50.312 1.00 11.61 ? 29   ARG A C   1 
ATOM   216  O  O   . ARG A 1 29  ? 74.856 51.838 50.979 1.00 11.40 ? 29   ARG A O   1 
ATOM   217  C  CB  . ARG A 1 29  ? 74.994 48.437 51.184 1.00 10.94 ? 29   ARG A CB  1 
ATOM   218  C  CG  . ARG A 1 29  ? 75.412 48.698 52.647 1.00 15.52 ? 29   ARG A CG  1 
ATOM   219  C  CD  . ARG A 1 29  ? 74.318 48.264 53.645 1.00 19.16 ? 29   ARG A CD  1 
ATOM   220  N  NE  . ARG A 1 29  ? 74.001 46.844 53.519 1.00 19.22 ? 29   ARG A NE  1 
ATOM   221  C  CZ  . ARG A 1 29  ? 74.712 45.837 54.036 1.00 15.56 ? 29   ARG A CZ  1 
ATOM   222  N  NH1 . ARG A 1 29  ? 75.817 46.050 54.754 1.00 13.51 ? 29   ARG A NH1 1 
ATOM   223  N  NH2 . ARG A 1 29  ? 74.318 44.593 53.817 1.00 12.78 ? 29   ARG A NH2 1 
ATOM   224  N  N   . GLN A 1 30  ? 76.004 50.714 49.388 1.00 9.62  ? 30   GLN A N   1 
ATOM   225  C  CA  . GLN A 1 30  ? 76.902 51.832 49.131 1.00 9.75  ? 30   GLN A CA  1 
ATOM   226  C  C   . GLN A 1 30  ? 76.189 52.964 48.405 1.00 10.06 ? 30   GLN A C   1 
ATOM   227  O  O   . GLN A 1 30  ? 76.464 54.140 48.646 1.00 9.75  ? 30   GLN A O   1 
ATOM   228  C  CB  . GLN A 1 30  ? 78.112 51.381 48.306 1.00 9.63  ? 30   GLN A CB  1 
ATOM   229  C  CG  . GLN A 1 30  ? 79.215 52.432 48.247 1.00 10.39 ? 30   GLN A CG  1 
ATOM   230  C  CD  . GLN A 1 30  ? 79.730 52.769 49.641 1.00 14.30 ? 30   GLN A CD  1 
ATOM   231  O  OE1 . GLN A 1 30  ? 80.089 51.872 50.404 1.00 15.50 ? 30   GLN A OE1 1 
ATOM   232  N  NE2 . GLN A 1 30  ? 79.758 54.055 49.982 1.00 14.59 ? 30   GLN A NE2 1 
ATOM   233  N  N   . ALA A 1 31  ? 75.271 52.620 47.506 1.00 8.63  ? 31   ALA A N   1 
ATOM   234  C  CA  . ALA A 1 31  ? 74.547 53.661 46.780 1.00 10.43 ? 31   ALA A CA  1 
ATOM   235  C  C   . ALA A 1 31  ? 73.801 54.551 47.762 1.00 10.98 ? 31   ALA A C   1 
ATOM   236  O  O   . ALA A 1 31  ? 73.773 55.775 47.609 1.00 10.03 ? 31   ALA A O   1 
ATOM   237  C  CB  . ALA A 1 31  ? 73.563 53.037 45.784 1.00 9.08  ? 31   ALA A CB  1 
ATOM   238  N  N   . LEU A 1 32  ? 73.194 53.935 48.775 1.00 9.48  ? 32   LEU A N   1 
ATOM   239  C  CA  . LEU A 1 32  ? 72.463 54.706 49.774 1.00 8.65  ? 32   LEU A CA  1 
ATOM   240  C  C   . LEU A 1 32  ? 73.414 55.561 50.601 1.00 9.12  ? 32   LEU A C   1 
ATOM   241  O  O   . LEU A 1 32  ? 73.111 56.716 50.888 1.00 11.70 ? 32   LEU A O   1 
ATOM   242  C  CB  . LEU A 1 32  ? 71.657 53.788 50.691 1.00 9.05  ? 32   LEU A CB  1 
ATOM   243  C  CG  . LEU A 1 32  ? 70.472 53.112 49.987 1.00 10.04 ? 32   LEU A CG  1 
ATOM   244  C  CD1 . LEU A 1 32  ? 69.868 52.045 50.902 1.00 10.23 ? 32   LEU A CD1 1 
ATOM   245  C  CD2 . LEU A 1 32  ? 69.433 54.165 49.613 1.00 14.98 ? 32   LEU A CD2 1 
ATOM   246  N  N   . LYS A 1 33  ? 74.554 55.001 50.991 1.00 9.18  ? 33   LYS A N   1 
ATOM   247  C  CA  . LYS A 1 33  ? 75.516 55.774 51.770 1.00 9.24  ? 33   LYS A CA  1 
ATOM   248  C  C   . LYS A 1 33  ? 76.013 56.961 50.949 1.00 14.06 ? 33   LYS A C   1 
ATOM   249  O  O   . LYS A 1 33  ? 76.181 58.067 51.479 1.00 12.39 ? 33   LYS A O   1 
ATOM   250  C  CB  . LYS A 1 33  ? 76.697 54.895 52.195 1.00 8.08  ? 33   LYS A CB  1 
ATOM   251  C  CG  . LYS A 1 33  ? 76.337 53.898 53.304 1.00 14.48 ? 33   LYS A CG  1 
ATOM   252  C  CD  . LYS A 1 33  ? 77.388 52.806 53.465 1.00 29.74 ? 33   LYS A CD  1 
ATOM   253  C  CE  . LYS A 1 33  ? 76.954 51.788 54.530 1.00 35.68 ? 33   LYS A CE  1 
ATOM   254  N  NZ  . LYS A 1 33  ? 77.616 50.451 54.409 1.00 26.96 ? 33   LYS A NZ  1 
ATOM   255  N  N   . ASP A 1 34  ? 76.237 56.741 49.654 1.00 11.11 ? 34   ASP A N   1 
ATOM   256  C  CA  . ASP A 1 34  ? 76.710 57.818 48.786 1.00 11.10 ? 34   ASP A CA  1 
ATOM   257  C  C   . ASP A 1 34  ? 75.660 58.918 48.623 1.00 11.78 ? 34   ASP A C   1 
ATOM   258  O  O   . ASP A 1 34  ? 76.003 60.105 48.551 1.00 12.49 ? 34   ASP A O   1 
ATOM   259  C  CB  . ASP A 1 34  ? 77.119 57.269 47.412 1.00 10.28 ? 34   ASP A CB  1 
ATOM   260  C  CG  . ASP A 1 34  ? 78.363 56.402 47.472 1.00 12.26 ? 34   ASP A CG  1 
ATOM   261  O  OD1 . ASP A 1 34  ? 79.074 56.417 48.503 1.00 14.39 ? 34   ASP A OD1 1 
ATOM   262  O  OD2 . ASP A 1 34  ? 78.646 55.699 46.480 1.00 14.69 ? 34   ASP A OD2 1 
ATOM   263  N  N   . ALA A 1 35  ? 74.383 58.536 48.577 1.00 12.01 ? 35   ALA A N   1 
ATOM   264  C  CA  . ALA A 1 35  ? 73.299 59.508 48.450 1.00 11.08 ? 35   ALA A CA  1 
ATOM   265  C  C   . ALA A 1 35  ? 73.154 60.302 49.755 1.00 12.00 ? 35   ALA A C   1 
ATOM   266  O  O   . ALA A 1 35  ? 72.800 61.480 49.745 1.00 11.65 ? 35   ALA A O   1 
ATOM   267  C  CB  . ALA A 1 35  ? 71.979 58.800 48.104 1.00 14.54 ? 35   ALA A CB  1 
ATOM   268  N  N   . MET A 1 36  ? 73.421 59.657 50.886 1.00 11.78 ? 36   MET A N   1 
ATOM   269  C  CA  . MET A 1 36  ? 73.354 60.363 52.158 1.00 12.30 ? 36   MET A CA  1 
ATOM   270  C  C   . MET A 1 36  ? 74.479 61.398 52.225 1.00 12.12 ? 36   MET A C   1 
ATOM   271  O  O   . MET A 1 36  ? 74.270 62.518 52.679 1.00 15.04 ? 36   MET A O   1 
ATOM   272  C  CB  . MET A 1 36  ? 73.472 59.376 53.314 1.00 11.41 ? 36   MET A CB  1 
ATOM   273  C  CG  . MET A 1 36  ? 72.234 58.526 53.451 1.00 13.86 ? 36   MET A CG  1 
ATOM   274  S  SD  . MET A 1 36  ? 72.391 57.369 54.791 1.00 19.39 ? 36   MET A SD  1 
ATOM   275  C  CE  . MET A 1 36  ? 73.119 55.967 53.987 1.00 35.03 ? 36   MET A CE  1 
ATOM   276  N  N   . ALA A 1 37  ? 75.658 61.024 51.745 1.00 12.76 ? 37   ALA A N   1 
ATOM   277  C  CA  . ALA A 1 37  ? 76.812 61.923 51.749 1.00 13.17 ? 37   ALA A CA  1 
ATOM   278  C  C   . ALA A 1 37  ? 76.628 63.084 50.778 1.00 16.87 ? 37   ALA A C   1 
ATOM   279  O  O   . ALA A 1 37  ? 77.089 64.198 51.035 1.00 14.18 ? 37   ALA A O   1 
ATOM   280  C  CB  . ALA A 1 37  ? 78.077 61.154 51.384 1.00 12.43 ? 37   ALA A CB  1 
ATOM   281  N  N   . ASP A 1 38  ? 75.959 62.812 49.656 1.00 12.67 ? 38   ASP A N   1 
ATOM   282  C  CA  . ASP A 1 38  ? 75.716 63.831 48.638 1.00 13.24 ? 38   ASP A CA  1 
ATOM   283  C  C   . ASP A 1 38  ? 74.304 63.617 48.104 1.00 12.36 ? 38   ASP A C   1 
ATOM   284  O  O   . ASP A 1 38  ? 74.101 62.825 47.193 1.00 12.88 ? 38   ASP A O   1 
ATOM   285  C  CB  . ASP A 1 38  ? 76.737 63.681 47.507 1.00 15.38 ? 38   ASP A CB  1 
ATOM   286  C  CG  . ASP A 1 38  ? 76.526 64.686 46.385 1.00 20.27 ? 38   ASP A CG  1 
ATOM   287  O  OD1 . ASP A 1 38  ? 75.524 65.422 46.431 1.00 15.49 ? 38   ASP A OD1 1 
ATOM   288  O  OD2 . ASP A 1 38  ? 77.370 64.727 45.464 1.00 20.90 ? 38   ASP A OD2 1 
ATOM   289  N  N   . PRO A 1 39  ? 73.315 64.328 48.671 1.00 14.65 ? 39   PRO A N   1 
ATOM   290  C  CA  . PRO A 1 39  ? 71.912 64.206 48.259 1.00 13.07 ? 39   PRO A CA  1 
ATOM   291  C  C   . PRO A 1 39  ? 71.592 64.474 46.794 1.00 14.75 ? 39   PRO A C   1 
ATOM   292  O  O   . PRO A 1 39  ? 70.482 64.176 46.354 1.00 12.74 ? 39   PRO A O   1 
ATOM   293  C  CB  . PRO A 1 39  ? 71.185 65.157 49.207 1.00 14.11 ? 39   PRO A CB  1 
ATOM   294  C  CG  . PRO A 1 39  ? 72.055 65.095 50.450 1.00 13.32 ? 39   PRO A CG  1 
ATOM   295  C  CD  . PRO A 1 39  ? 73.434 65.193 49.858 1.00 12.55 ? 39   PRO A CD  1 
ATOM   296  N  N   . SER A 1 40  ? 72.536 65.039 46.042 1.00 13.22 ? 40   SER A N   1 
ATOM   297  C  CA  . SER A 1 40  ? 72.282 65.261 44.621 1.00 14.95 ? 40   SER A CA  1 
ATOM   298  C  C   . SER A 1 40  ? 72.312 63.882 43.964 1.00 14.54 ? 40   SER A C   1 
ATOM   299  O  O   . SER A 1 40  ? 71.891 63.719 42.811 1.00 15.17 ? 40   SER A O   1 
ATOM   300  C  CB  . SER A 1 40  ? 73.349 66.171 43.991 1.00 12.57 ? 40   SER A CB  1 
ATOM   301  O  OG  . SER A 1 40  ? 74.597 65.514 43.836 1.00 15.96 ? 40   SER A OG  1 
ATOM   302  N  N   . LYS A 1 41  ? 72.803 62.886 44.704 1.00 12.79 ? 41   LYS A N   1 
ATOM   303  C  CA  . LYS A 1 41  ? 72.873 61.520 44.192 1.00 12.10 ? 41   LYS A CA  1 
ATOM   304  C  C   . LYS A 1 41  ? 71.688 60.659 44.654 1.00 12.66 ? 41   LYS A C   1 
ATOM   305  O  O   . LYS A 1 41  ? 71.710 59.433 44.521 1.00 12.16 ? 41   LYS A O   1 
ATOM   306  C  CB  . LYS A 1 41  ? 74.185 60.856 44.607 1.00 13.96 ? 41   LYS A CB  1 
ATOM   307  C  CG  . LYS A 1 41  ? 75.414 61.439 43.935 1.00 18.67 ? 41   LYS A CG  1 
ATOM   308  C  CD  . LYS A 1 41  ? 76.666 60.741 44.452 1.00 28.70 ? 41   LYS A CD  1 
ATOM   309  C  CE  . LYS A 1 41  ? 77.904 61.184 43.695 1.00 36.75 ? 41   LYS A CE  1 
ATOM   310  N  NZ  . LYS A 1 41  ? 79.106 60.455 44.202 1.00 45.10 ? 41   LYS A NZ  1 
ATOM   311  N  N   . THR A 1 42  ? 70.670 61.306 45.208 1.00 9.82  ? 42   THR A N   1 
ATOM   312  C  CA  . THR A 1 42  ? 69.458 60.619 45.641 1.00 10.94 ? 42   THR A CA  1 
ATOM   313  C  C   . THR A 1 42  ? 69.034 59.710 44.485 1.00 12.11 ? 42   THR A C   1 
ATOM   314  O  O   . THR A 1 42  ? 68.997 60.148 43.339 1.00 12.60 ? 42   THR A O   1 
ATOM   315  C  CB  . THR A 1 42  ? 68.340 61.643 45.942 1.00 13.10 ? 42   THR A CB  1 
ATOM   316  O  OG1 . THR A 1 42  ? 68.629 62.304 47.184 1.00 12.52 ? 42   THR A OG1 1 
ATOM   317  C  CG2 . THR A 1 42  ? 66.972 60.967 46.026 1.00 11.01 ? 42   THR A CG2 1 
ATOM   318  N  N   . LEU A 1 43  ? 68.738 58.448 44.790 1.00 9.15  ? 43   LEU A N   1 
ATOM   319  C  CA  . LEU A 1 43  ? 68.347 57.487 43.756 1.00 10.01 ? 43   LEU A CA  1 
ATOM   320  C  C   . LEU A 1 43  ? 66.965 57.763 43.196 1.00 9.45  ? 43   LEU A C   1 
ATOM   321  O  O   . LEU A 1 43  ? 65.988 57.839 43.941 1.00 8.46  ? 43   LEU A O   1 
ATOM   322  C  CB  . LEU A 1 43  ? 68.380 56.063 44.313 1.00 10.03 ? 43   LEU A CB  1 
ATOM   323  C  CG  . LEU A 1 43  ? 69.762 55.484 44.611 1.00 17.78 ? 43   LEU A CG  1 
ATOM   324  C  CD1 . LEU A 1 43  ? 70.425 56.291 45.703 1.00 18.60 ? 43   LEU A CD1 1 
ATOM   325  C  CD2 . LEU A 1 43  ? 69.629 54.023 45.044 1.00 18.67 ? 43   LEU A CD2 1 
ATOM   326  N  N   . MET A 1 44  ? 66.890 57.915 41.878 1.00 9.68  ? 44   MET A N   1 
ATOM   327  C  CA  . MET A 1 44  ? 65.610 58.161 41.223 1.00 8.37  ? 44   MET A CA  1 
ATOM   328  C  C   . MET A 1 44  ? 65.248 56.872 40.477 1.00 7.22  ? 44   MET A C   1 
ATOM   329  O  O   . MET A 1 44  ? 65.989 56.432 39.594 1.00 9.72  ? 44   MET A O   1 
ATOM   330  C  CB  . MET A 1 44  ? 65.740 59.333 40.249 1.00 10.23 ? 44   MET A CB  1 
ATOM   331  C  CG  . MET A 1 44  ? 66.313 60.602 40.885 1.00 10.13 ? 44   MET A CG  1 
ATOM   332  S  SD  . MET A 1 44  ? 65.337 61.168 42.283 1.00 11.60 ? 44   MET A SD  1 
ATOM   333  C  CE  . MET A 1 44  ? 66.336 62.629 42.781 1.00 13.12 ? 44   MET A CE  1 
ATOM   334  N  N   . GLY A 1 45  ? 64.123 56.266 40.859 1.00 10.09 ? 45   GLY A N   1 
ATOM   335  C  CA  . GLY A 1 45  ? 63.727 55.018 40.234 1.00 10.95 ? 45   GLY A CA  1 
ATOM   336  C  C   . GLY A 1 45  ? 62.289 54.968 39.757 1.00 9.46  ? 45   GLY A C   1 
ATOM   337  O  O   . GLY A 1 45  ? 61.588 55.981 39.720 1.00 11.10 ? 45   GLY A O   1 
ATOM   338  N  N   . VAL A 1 46  ? 61.849 53.762 39.415 1.00 8.16  ? 46   VAL A N   1 
ATOM   339  C  CA  . VAL A 1 46  ? 60.507 53.549 38.897 1.00 9.44  ? 46   VAL A CA  1 
ATOM   340  C  C   . VAL A 1 46  ? 59.864 52.353 39.584 1.00 9.45  ? 46   VAL A C   1 
ATOM   341  O  O   . VAL A 1 46  ? 60.530 51.335 39.843 1.00 9.03  ? 46   VAL A O   1 
ATOM   342  C  CB  . VAL A 1 46  ? 60.564 53.340 37.344 1.00 6.96  ? 46   VAL A CB  1 
ATOM   343  C  CG1 . VAL A 1 46  ? 61.400 52.106 36.995 1.00 9.43  ? 46   VAL A CG1 1 
ATOM   344  C  CG2 . VAL A 1 46  ? 59.156 53.224 36.765 1.00 8.96  ? 46   VAL A CG2 1 
ATOM   345  N  N   . ALA A 1 47  ? 58.578 52.493 39.907 1.00 8.07  ? 47   ALA A N   1 
ATOM   346  C  CA  . ALA A 1 47  ? 57.821 51.426 40.567 1.00 8.76  ? 47   ALA A CA  1 
ATOM   347  C  C   . ALA A 1 47  ? 57.261 50.550 39.452 1.00 10.97 ? 47   ALA A C   1 
ATOM   348  O  O   . ALA A 1 47  ? 56.741 51.057 38.463 1.00 10.41 ? 47   ALA A O   1 
ATOM   349  C  CB  . ALA A 1 47  ? 56.704 52.020 41.411 1.00 9.51  ? 47   ALA A CB  1 
ATOM   350  N  N   . HIS A 1 48  ? 57.373 49.239 39.635 1.00 8.69  ? 48   HIS A N   1 
ATOM   351  C  CA  . HIS A 1 48  ? 56.990 48.248 38.622 1.00 7.76  ? 48   HIS A CA  1 
ATOM   352  C  C   . HIS A 1 48  ? 55.981 47.239 39.188 1.00 10.55 ? 48   HIS A C   1 
ATOM   353  O  O   . HIS A 1 48  ? 56.319 46.370 40.009 1.00 8.68  ? 48   HIS A O   1 
ATOM   354  C  CB  . HIS A 1 48  ? 58.317 47.609 38.153 1.00 7.31  ? 48   HIS A CB  1 
ATOM   355  C  CG  . HIS A 1 48  ? 58.198 46.513 37.136 1.00 7.62  ? 48   HIS A CG  1 
ATOM   356  N  ND1 . HIS A 1 48  ? 57.231 46.491 36.150 1.00 9.37  ? 48   HIS A ND1 1 
ATOM   357  C  CD2 . HIS A 1 48  ? 59.028 45.476 36.867 1.00 9.57  ? 48   HIS A CD2 1 
ATOM   358  C  CE1 . HIS A 1 48  ? 57.476 45.493 35.318 1.00 9.12  ? 48   HIS A CE1 1 
ATOM   359  N  NE2 . HIS A 1 48  ? 58.562 44.860 35.729 1.00 10.00 ? 48   HIS A NE2 1 
ATOM   360  N  N   . GLY A 1 49  ? 54.725 47.384 38.751 1.00 8.73  ? 49   GLY A N   1 
ATOM   361  C  CA  . GLY A 1 49  ? 53.647 46.520 39.205 1.00 7.74  ? 49   GLY A CA  1 
ATOM   362  C  C   . GLY A 1 49  ? 53.008 45.712 38.081 1.00 11.31 ? 49   GLY A C   1 
ATOM   363  O  O   . GLY A 1 49  ? 52.156 44.867 38.338 1.00 11.46 ? 49   GLY A O   1 
ATOM   364  N  N   . ILE A 1 50  ? 53.403 45.978 36.839 1.00 8.63  ? 50   ILE A N   1 
ATOM   365  C  CA  . ILE A 1 50  ? 52.868 45.229 35.693 1.00 10.24 ? 50   ILE A CA  1 
ATOM   366  C  C   . ILE A 1 50  ? 53.688 43.947 35.596 1.00 9.08  ? 50   ILE A C   1 
ATOM   367  O  O   . ILE A 1 50  ? 54.900 44.002 35.372 1.00 12.03 ? 50   ILE A O   1 
ATOM   368  C  CB  . ILE A 1 50  ? 53.026 46.022 34.381 1.00 6.98  ? 50   ILE A CB  1 
ATOM   369  C  CG1 . ILE A 1 50  ? 52.181 47.301 34.443 1.00 8.21  ? 50   ILE A CG1 1 
ATOM   370  C  CG2 . ILE A 1 50  ? 52.587 45.160 33.199 1.00 9.73  ? 50   ILE A CG2 1 
ATOM   371  C  CD1 . ILE A 1 50  ? 52.452 48.283 33.297 1.00 8.55  ? 50   ILE A CD1 1 
ATOM   372  N  N   . PRO A 1 51  ? 53.038 42.774 35.742 1.00 10.14 ? 51   PRO A N   1 
ATOM   373  C  CA  . PRO A 1 51  ? 53.735 41.486 35.685 1.00 10.65 ? 51   PRO A CA  1 
ATOM   374  C  C   . PRO A 1 51  ? 54.120 41.060 34.283 1.00 11.85 ? 51   PRO A C   1 
ATOM   375  O  O   . PRO A 1 51  ? 53.538 40.134 33.712 1.00 10.65 ? 51   PRO A O   1 
ATOM   376  C  CB  . PRO A 1 51  ? 52.735 40.539 36.343 1.00 11.64 ? 51   PRO A CB  1 
ATOM   377  C  CG  . PRO A 1 51  ? 51.425 41.066 35.822 1.00 11.36 ? 51   PRO A CG  1 
ATOM   378  C  CD  . PRO A 1 51  ? 51.586 42.580 35.946 1.00 7.53  ? 51   PRO A CD  1 
ATOM   379  N  N   . SER A 1 52  ? 55.117 41.747 33.734 1.00 8.77  ? 52   SER A N   1 
ATOM   380  C  CA  . SER A 1 52  ? 55.583 41.462 32.384 1.00 10.47 ? 52   SER A CA  1 
ATOM   381  C  C   . SER A 1 52  ? 57.072 41.767 32.311 1.00 12.09 ? 52   SER A C   1 
ATOM   382  O  O   . SER A 1 52  ? 57.486 42.904 32.567 1.00 7.42  ? 52   SER A O   1 
ATOM   383  C  CB  . SER A 1 52  ? 54.833 42.353 31.382 1.00 9.26  ? 52   SER A CB  1 
ATOM   384  O  OG  . SER A 1 52  ? 55.496 42.351 30.134 1.00 8.24  ? 52   SER A OG  1 
ATOM   385  N  N   . THR A 1 53  ? 57.877 40.762 31.977 1.00 10.30 ? 53   THR A N   1 
ATOM   386  C  CA  . THR A 1 53  ? 59.310 41.004 31.872 1.00 9.20  ? 53   THR A CA  1 
ATOM   387  C  C   . THR A 1 53  ? 59.594 41.922 30.687 1.00 9.30  ? 53   THR A C   1 
ATOM   388  O  O   . THR A 1 53  ? 60.605 42.615 30.681 1.00 9.02  ? 53   THR A O   1 
ATOM   389  C  CB  . THR A 1 53  ? 60.110 39.702 31.723 1.00 14.73 ? 53   THR A CB  1 
ATOM   390  O  OG1 . THR A 1 53  ? 59.681 39.014 30.547 1.00 17.89 ? 53   THR A OG1 1 
ATOM   391  C  CG2 . THR A 1 53  ? 59.894 38.809 32.941 1.00 11.55 ? 53   THR A CG2 1 
ATOM   392  N  N   . PHE A 1 54  ? 58.709 41.943 29.688 1.00 6.90  ? 54   PHE A N   1 
ATOM   393  C  CA  . PHE A 1 54  ? 58.915 42.834 28.541 1.00 9.62  ? 54   PHE A CA  1 
ATOM   394  C  C   . PHE A 1 54  ? 58.868 44.267 29.078 1.00 9.63  ? 54   PHE A C   1 
ATOM   395  O  O   . PHE A 1 54  ? 59.683 45.110 28.707 1.00 8.51  ? 54   PHE A O   1 
ATOM   396  C  CB  . PHE A 1 54  ? 57.825 42.606 27.475 1.00 9.31  ? 54   PHE A CB  1 
ATOM   397  C  CG  . PHE A 1 54  ? 58.068 43.338 26.189 1.00 9.75  ? 54   PHE A CG  1 
ATOM   398  C  CD1 . PHE A 1 54  ? 57.819 44.699 26.086 1.00 11.79 ? 54   PHE A CD1 1 
ATOM   399  C  CD2 . PHE A 1 54  ? 58.573 42.657 25.073 1.00 12.60 ? 54   PHE A CD2 1 
ATOM   400  C  CE1 . PHE A 1 54  ? 58.072 45.385 24.883 1.00 9.07  ? 54   PHE A CE1 1 
ATOM   401  C  CE2 . PHE A 1 54  ? 58.828 43.318 23.885 1.00 11.74 ? 54   PHE A CE2 1 
ATOM   402  C  CZ  . PHE A 1 54  ? 58.581 44.686 23.780 1.00 13.10 ? 54   PHE A CZ  1 
ATOM   403  N  N   . VAL A 1 55  ? 57.915 44.543 29.966 1.00 6.85  ? 55   VAL A N   1 
ATOM   404  C  CA  . VAL A 1 55  ? 57.830 45.872 30.569 1.00 6.85  ? 55   VAL A CA  1 
ATOM   405  C  C   . VAL A 1 55  ? 59.101 46.160 31.379 1.00 5.83  ? 55   VAL A C   1 
ATOM   406  O  O   . VAL A 1 55  ? 59.637 47.264 31.327 1.00 7.01  ? 55   VAL A O   1 
ATOM   407  C  CB  . VAL A 1 55  ? 56.589 45.987 31.481 1.00 4.68  ? 55   VAL A CB  1 
ATOM   408  C  CG1 . VAL A 1 55  ? 56.623 47.310 32.271 1.00 7.44  ? 55   VAL A CG1 1 
ATOM   409  C  CG2 . VAL A 1 55  ? 55.328 45.954 30.617 1.00 7.51  ? 55   VAL A CG2 1 
ATOM   410  N  N   . THR A 1 56  ? 59.594 45.174 32.126 1.00 6.87  ? 56   THR A N   1 
ATOM   411  C  CA  . THR A 1 56  ? 60.808 45.404 32.902 1.00 8.18  ? 56   THR A CA  1 
ATOM   412  C  C   . THR A 1 56  ? 61.928 45.840 31.963 1.00 7.10  ? 56   THR A C   1 
ATOM   413  O  O   . THR A 1 56  ? 62.724 46.719 32.285 1.00 6.42  ? 56   THR A O   1 
ATOM   414  C  CB  . THR A 1 56  ? 61.300 44.129 33.611 1.00 9.02  ? 56   THR A CB  1 
ATOM   415  O  OG1 . THR A 1 56  ? 60.178 43.401 34.124 1.00 7.96  ? 56   THR A OG1 1 
ATOM   416  C  CG2 . THR A 1 56  ? 62.232 44.505 34.762 1.00 8.20  ? 56   THR A CG2 1 
ATOM   417  N  N   . LYS A 1 57  ? 62.006 45.192 30.808 1.00 5.17  ? 57   LYS A N   1 
ATOM   418  C  CA  . LYS A 1 57  ? 63.044 45.540 29.841 1.00 6.35  ? 57   LYS A CA  1 
ATOM   419  C  C   . LYS A 1 57  ? 62.902 46.977 29.327 1.00 8.60  ? 57   LYS A C   1 
ATOM   420  O  O   . LYS A 1 57  ? 63.898 47.679 29.137 1.00 10.38 ? 57   LYS A O   1 
ATOM   421  C  CB  . LYS A 1 57  ? 63.003 44.555 28.674 1.00 8.61  ? 57   LYS A CB  1 
ATOM   422  C  CG  . LYS A 1 57  ? 63.452 43.148 29.065 1.00 6.30  ? 57   LYS A CG  1 
ATOM   423  C  CD  . LYS A 1 57  ? 63.255 42.172 27.898 1.00 7.46  ? 57   LYS A CD  1 
ATOM   424  C  CE  . LYS A 1 57  ? 63.792 40.787 28.241 1.00 7.52  ? 57   LYS A CE  1 
ATOM   425  N  NZ  . LYS A 1 57  ? 63.553 39.834 27.103 1.00 8.03  ? 57   LYS A NZ  1 
ATOM   426  N  N   . VAL A 1 58  ? 61.669 47.406 29.078 1.00 7.10  ? 58   VAL A N   1 
ATOM   427  C  CA  . VAL A 1 58  ? 61.433 48.775 28.606 1.00 7.64  ? 58   VAL A CA  1 
ATOM   428  C  C   . VAL A 1 58  ? 61.843 49.749 29.715 1.00 10.22 ? 58   VAL A C   1 
ATOM   429  O  O   . VAL A 1 58  ? 62.497 50.755 29.465 1.00 9.23  ? 58   VAL A O   1 
ATOM   430  C  CB  . VAL A 1 58  ? 59.950 48.992 28.260 1.00 9.66  ? 58   VAL A CB  1 
ATOM   431  C  CG1 . VAL A 1 58  ? 59.689 50.467 27.927 1.00 11.11 ? 58   VAL A CG1 1 
ATOM   432  C  CG2 . VAL A 1 58  ? 59.567 48.103 27.068 1.00 9.39  ? 58   VAL A CG2 1 
ATOM   433  N  N   . LEU A 1 59  ? 61.463 49.439 30.952 1.00 7.60  ? 59   LEU A N   1 
ATOM   434  C  CA  . LEU A 1 59  ? 61.828 50.299 32.080 1.00 6.31  ? 59   LEU A CA  1 
ATOM   435  C  C   . LEU A 1 59  ? 63.352 50.324 32.273 1.00 7.85  ? 59   LEU A C   1 
ATOM   436  O  O   . LEU A 1 59  ? 63.944 51.385 32.499 1.00 9.64  ? 59   LEU A O   1 
ATOM   437  C  CB  . LEU A 1 59  ? 61.168 49.791 33.367 1.00 6.37  ? 59   LEU A CB  1 
ATOM   438  C  CG  . LEU A 1 59  ? 59.638 49.783 33.378 1.00 7.60  ? 59   LEU A CG  1 
ATOM   439  C  CD1 . LEU A 1 59  ? 59.155 49.231 34.722 1.00 8.13  ? 59   LEU A CD1 1 
ATOM   440  C  CD2 . LEU A 1 59  ? 59.111 51.206 33.157 1.00 10.27 ? 59   LEU A CD2 1 
ATOM   441  N  N   . ALA A 1 60  ? 63.987 49.160 32.193 1.00 8.41  ? 60   ALA A N   1 
ATOM   442  C  CA  . ALA A 1 60  ? 65.434 49.092 32.388 1.00 8.30  ? 60   ALA A CA  1 
ATOM   443  C  C   . ALA A 1 60  ? 66.193 49.907 31.337 1.00 10.69 ? 60   ALA A C   1 
ATOM   444  O  O   . ALA A 1 60  ? 67.231 50.498 31.637 1.00 9.78  ? 60   ALA A O   1 
ATOM   445  C  CB  . ALA A 1 60  ? 65.911 47.634 32.359 1.00 10.09 ? 60   ALA A CB  1 
ATOM   446  N  N   . ALA A 1 61  ? 65.666 49.953 30.119 1.00 8.22  ? 61   ALA A N   1 
ATOM   447  C  CA  . ALA A 1 61  ? 66.335 50.694 29.046 1.00 10.27 ? 61   ALA A CA  1 
ATOM   448  C  C   . ALA A 1 61  ? 66.348 52.208 29.277 1.00 10.33 ? 61   ALA A C   1 
ATOM   449  O  O   . ALA A 1 61  ? 67.136 52.917 28.644 1.00 11.39 ? 61   ALA A O   1 
ATOM   450  C  CB  . ALA A 1 61  ? 65.694 50.361 27.685 1.00 9.52  ? 61   ALA A CB  1 
ATOM   451  N  N   . THR A 1 62  ? 65.490 52.706 30.168 1.00 8.02  ? 62   THR A N   1 
ATOM   452  C  CA  . THR A 1 62  ? 65.468 54.145 30.465 1.00 7.40  ? 62   THR A CA  1 
ATOM   453  C  C   . THR A 1 62  ? 66.520 54.479 31.525 1.00 11.00 ? 62   THR A C   1 
ATOM   454  O  O   . THR A 1 62  ? 66.671 55.636 31.919 1.00 10.08 ? 62   THR A O   1 
ATOM   455  C  CB  . THR A 1 62  ? 64.092 54.640 30.976 1.00 11.95 ? 62   THR A CB  1 
ATOM   456  O  OG1 . THR A 1 62  ? 63.821 54.084 32.269 1.00 9.30  ? 62   THR A OG1 1 
ATOM   457  C  CG2 . THR A 1 62  ? 62.975 54.247 29.981 1.00 9.88  ? 62   THR A CG2 1 
ATOM   458  N  N   . LYS A 1 63  ? 67.211 53.442 31.995 1.00 8.98  ? 63   LYS A N   1 
ATOM   459  C  CA  . LYS A 1 63  ? 68.285 53.576 32.972 1.00 10.65 ? 63   LYS A CA  1 
ATOM   460  C  C   . LYS A 1 63  ? 67.965 54.244 34.309 1.00 11.51 ? 63   LYS A C   1 
ATOM   461  O  O   . LYS A 1 63  ? 68.642 55.183 34.728 1.00 11.74 ? 63   LYS A O   1 
ATOM   462  C  CB  . LYS A 1 63  ? 69.487 54.262 32.298 1.00 15.33 ? 63   LYS A CB  1 
ATOM   463  C  CG  . LYS A 1 63  ? 70.090 53.388 31.181 1.00 20.59 ? 63   LYS A CG  1 
ATOM   464  C  CD  . LYS A 1 63  ? 71.324 53.990 30.508 1.00 31.58 ? 63   LYS A CD  1 
ATOM   465  C  CE  . LYS A 1 63  ? 70.959 54.893 29.341 1.00 38.26 ? 63   LYS A CE  1 
ATOM   466  N  NZ  . LYS A 1 63  ? 70.247 56.135 29.771 1.00 45.65 ? 63   LYS A NZ  1 
ATOM   467  N  N   . PRO A 1 64  ? 66.931 53.751 35.014 1.00 7.94  ? 64   PRO A N   1 
ATOM   468  C  CA  . PRO A 1 64  ? 66.584 54.333 36.312 1.00 9.03  ? 64   PRO A CA  1 
ATOM   469  C  C   . PRO A 1 64  ? 67.651 53.878 37.311 1.00 8.58  ? 64   PRO A C   1 
ATOM   470  O  O   . PRO A 1 64  ? 68.355 52.894 37.062 1.00 10.45 ? 64   PRO A O   1 
ATOM   471  C  CB  . PRO A 1 64  ? 65.233 53.698 36.617 1.00 11.72 ? 64   PRO A CB  1 
ATOM   472  C  CG  . PRO A 1 64  ? 65.421 52.314 36.072 1.00 8.42  ? 64   PRO A CG  1 
ATOM   473  C  CD  . PRO A 1 64  ? 66.053 52.610 34.701 1.00 9.26  ? 64   PRO A CD  1 
ATOM   474  N  N   . ASP A 1 65  ? 67.782 54.592 38.426 1.00 9.44  ? 65   ASP A N   1 
ATOM   475  C  CA  . ASP A 1 65  ? 68.759 54.201 39.435 1.00 7.99  ? 65   ASP A CA  1 
ATOM   476  C  C   . ASP A 1 65  ? 68.308 52.900 40.098 1.00 9.46  ? 65   ASP A C   1 
ATOM   477  O  O   . ASP A 1 65  ? 69.112 52.180 40.675 1.00 10.43 ? 65   ASP A O   1 
ATOM   478  C  CB  . ASP A 1 65  ? 68.926 55.308 40.484 1.00 9.57  ? 65   ASP A CB  1 
ATOM   479  C  CG  . ASP A 1 65  ? 69.534 56.576 39.902 1.00 14.43 ? 65   ASP A CG  1 
ATOM   480  O  OD1 . ASP A 1 65  ? 70.322 56.462 38.934 1.00 14.06 ? 65   ASP A OD1 1 
ATOM   481  O  OD2 . ASP A 1 65  ? 69.237 57.677 40.421 1.00 13.08 ? 65   ASP A OD2 1 
ATOM   482  N  N   . PHE A 1 66  ? 67.009 52.618 40.032 1.00 10.26 ? 66   PHE A N   1 
ATOM   483  C  CA  . PHE A 1 66  ? 66.479 51.369 40.562 1.00 6.82  ? 66   PHE A CA  1 
ATOM   484  C  C   . PHE A 1 66  ? 65.109 51.063 39.981 1.00 7.65  ? 66   PHE A C   1 
ATOM   485  O  O   . PHE A 1 66  ? 64.414 51.959 39.508 1.00 8.64  ? 66   PHE A O   1 
ATOM   486  C  CB  . PHE A 1 66  ? 66.368 51.396 42.106 1.00 8.07  ? 66   PHE A CB  1 
ATOM   487  C  CG  . PHE A 1 66  ? 65.332 52.364 42.650 1.00 12.07 ? 66   PHE A CG  1 
ATOM   488  C  CD1 . PHE A 1 66  ? 63.982 52.016 42.714 1.00 8.98  ? 66   PHE A CD1 1 
ATOM   489  C  CD2 . PHE A 1 66  ? 65.719 53.616 43.120 1.00 9.31  ? 66   PHE A CD2 1 
ATOM   490  C  CE1 . PHE A 1 66  ? 63.033 52.899 43.244 1.00 9.98  ? 66   PHE A CE1 1 
ATOM   491  C  CE2 . PHE A 1 66  ? 64.782 54.514 43.655 1.00 9.87  ? 66   PHE A CE2 1 
ATOM   492  C  CZ  . PHE A 1 66  ? 63.439 54.157 43.720 1.00 11.17 ? 66   PHE A CZ  1 
ATOM   493  N  N   . VAL A 1 67  ? 64.744 49.784 40.002 1.00 9.25  ? 67   VAL A N   1 
ATOM   494  C  CA  . VAL A 1 67  ? 63.415 49.353 39.577 1.00 8.05  ? 67   VAL A CA  1 
ATOM   495  C  C   . VAL A 1 67  ? 62.886 48.742 40.868 1.00 7.98  ? 67   VAL A C   1 
ATOM   496  O  O   . VAL A 1 67  ? 63.529 47.872 41.456 1.00 9.83  ? 67   VAL A O   1 
ATOM   497  C  CB  . VAL A 1 67  ? 63.458 48.263 38.481 1.00 9.72  ? 67   VAL A CB  1 
ATOM   498  C  CG1 . VAL A 1 67  ? 62.026 47.781 38.184 1.00 8.12  ? 67   VAL A CG1 1 
ATOM   499  C  CG2 . VAL A 1 67  ? 64.088 48.834 37.205 1.00 11.04 ? 67   VAL A CG2 1 
ATOM   500  N  N   . TRP A 1 68  ? 61.741 49.237 41.321 1.00 7.33  ? 68   TRP A N   1 
ATOM   501  C  CA  . TRP A 1 68  ? 61.101 48.796 42.553 1.00 8.75  ? 68   TRP A CA  1 
ATOM   502  C  C   . TRP A 1 68  ? 59.979 47.846 42.143 1.00 10.06 ? 68   TRP A C   1 
ATOM   503  O  O   . TRP A 1 68  ? 58.951 48.280 41.632 1.00 10.35 ? 68   TRP A O   1 
ATOM   504  C  CB  . TRP A 1 68  ? 60.540 50.038 43.251 1.00 10.71 ? 68   TRP A CB  1 
ATOM   505  C  CG  . TRP A 1 68  ? 60.070 49.882 44.645 1.00 17.77 ? 68   TRP A CG  1 
ATOM   506  C  CD1 . TRP A 1 68  ? 60.809 50.046 45.785 1.00 25.12 ? 68   TRP A CD1 1 
ATOM   507  C  CD2 . TRP A 1 68  ? 58.728 49.626 45.068 1.00 18.47 ? 68   TRP A CD2 1 
ATOM   508  N  NE1 . TRP A 1 68  ? 60.002 49.913 46.893 1.00 23.38 ? 68   TRP A NE1 1 
ATOM   509  C  CE2 . TRP A 1 68  ? 58.721 49.651 46.479 1.00 24.34 ? 68   TRP A CE2 1 
ATOM   510  C  CE3 . TRP A 1 68  ? 57.528 49.383 44.389 1.00 24.30 ? 68   TRP A CE3 1 
ATOM   511  C  CZ2 . TRP A 1 68  ? 57.554 49.438 47.229 1.00 24.27 ? 68   TRP A CZ2 1 
ATOM   512  C  CZ3 . TRP A 1 68  ? 56.363 49.172 45.137 1.00 29.08 ? 68   TRP A CZ3 1 
ATOM   513  C  CH2 . TRP A 1 68  ? 56.390 49.200 46.539 1.00 23.77 ? 68   TRP A CH2 1 
ATOM   514  N  N   . ILE A 1 69  ? 60.179 46.551 42.369 1.00 9.03  ? 69   ILE A N   1 
ATOM   515  C  CA  . ILE A 1 69  ? 59.179 45.558 41.982 1.00 6.43  ? 69   ILE A CA  1 
ATOM   516  C  C   . ILE A 1 69  ? 58.295 45.207 43.169 1.00 8.42  ? 69   ILE A C   1 
ATOM   517  O  O   . ILE A 1 69  ? 58.790 44.825 44.226 1.00 8.00  ? 69   ILE A O   1 
ATOM   518  C  CB  . ILE A 1 69  ? 59.862 44.288 41.443 1.00 6.16  ? 69   ILE A CB  1 
ATOM   519  C  CG1 . ILE A 1 69  ? 60.802 44.668 40.293 1.00 10.34 ? 69   ILE A CG1 1 
ATOM   520  C  CG2 . ILE A 1 69  ? 58.808 43.265 40.993 1.00 10.38 ? 69   ILE A CG2 1 
ATOM   521  C  CD1 . ILE A 1 69  ? 61.589 43.493 39.716 1.00 13.90 ? 69   ILE A CD1 1 
ATOM   522  N  N   . ASP A 1 70  ? 56.983 45.336 42.989 1.00 7.88  ? 70   ASP A N   1 
ATOM   523  C  CA  . ASP A 1 70  ? 56.045 45.049 44.064 1.00 8.83  ? 70   ASP A CA  1 
ATOM   524  C  C   . ASP A 1 70  ? 55.473 43.641 43.961 1.00 11.20 ? 70   ASP A C   1 
ATOM   525  O  O   . ASP A 1 70  ? 54.644 43.352 43.094 1.00 11.67 ? 70   ASP A O   1 
ATOM   526  C  CB  . ASP A 1 70  ? 54.914 46.082 44.052 1.00 9.01  ? 70   ASP A CB  1 
ATOM   527  C  CG  . ASP A 1 70  ? 53.930 45.883 45.187 1.00 13.42 ? 70   ASP A CG  1 
ATOM   528  O  OD1 . ASP A 1 70  ? 54.235 45.115 46.118 1.00 14.67 ? 70   ASP A OD1 1 
ATOM   529  O  OD2 . ASP A 1 70  ? 52.857 46.517 45.152 1.00 20.34 ? 70   ASP A OD2 1 
ATOM   530  N  N   . VAL A 1 71  ? 55.920 42.762 44.850 1.00 10.38 ? 71   VAL A N   1 
ATOM   531  C  CA  . VAL A 1 71  ? 55.434 41.401 44.854 1.00 12.47 ? 71   VAL A CA  1 
ATOM   532  C  C   . VAL A 1 71  ? 54.328 41.267 45.890 1.00 12.81 ? 71   VAL A C   1 
ATOM   533  O  O   . VAL A 1 71  ? 53.596 40.284 45.888 1.00 11.66 ? 71   VAL A O   1 
ATOM   534  C  CB  . VAL A 1 71  ? 56.581 40.398 45.147 1.00 17.37 ? 71   VAL A CB  1 
ATOM   535  C  CG1 . VAL A 1 71  ? 56.066 38.982 45.123 1.00 19.79 ? 71   VAL A CG1 1 
ATOM   536  C  CG2 . VAL A 1 71  ? 57.663 40.558 44.112 1.00 21.73 ? 71   VAL A CG2 1 
ATOM   537  N  N   . GLU A 1 72  ? 54.192 42.245 46.785 1.00 8.47  ? 72   GLU A N   1 
ATOM   538  C  CA  . GLU A 1 72  ? 53.106 42.126 47.753 1.00 6.55  ? 72   GLU A CA  1 
ATOM   539  C  C   . GLU A 1 72  ? 51.788 42.204 47.000 1.00 6.96  ? 72   GLU A C   1 
ATOM   540  O  O   . GLU A 1 72  ? 50.875 41.413 47.251 1.00 10.88 ? 72   GLU A O   1 
ATOM   541  C  CB  . GLU A 1 72  ? 53.121 43.228 48.817 1.00 8.67  ? 72   GLU A CB  1 
ATOM   542  C  CG  . GLU A 1 72  ? 51.916 43.078 49.775 1.00 11.92 ? 72   GLU A CG  1 
ATOM   543  C  CD  . GLU A 1 72  ? 51.778 44.201 50.802 1.00 14.32 ? 72   GLU A CD  1 
ATOM   544  O  OE1 . GLU A 1 72  ? 52.247 45.332 50.543 1.00 11.35 ? 72   GLU A OE1 1 
ATOM   545  O  OE2 . GLU A 1 72  ? 51.169 43.942 51.862 1.00 12.87 ? 72   GLU A OE2 1 
ATOM   546  N  N   . HIS A 1 73  ? 51.705 43.149 46.066 1.00 8.44  ? 73   HIS A N   1 
ATOM   547  C  CA  . HIS A 1 73  ? 50.476 43.341 45.300 1.00 12.43 ? 73   HIS A CA  1 
ATOM   548  C  C   . HIS A 1 73  ? 50.604 43.176 43.790 1.00 15.76 ? 73   HIS A C   1 
ATOM   549  O  O   . HIS A 1 73  ? 49.596 43.242 43.078 1.00 19.05 ? 73   HIS A O   1 
ATOM   550  C  CB  . HIS A 1 73  ? 49.888 44.711 45.620 1.00 14.12 ? 73   HIS A CB  1 
ATOM   551  C  CG  . HIS A 1 73  ? 49.373 44.824 47.022 1.00 11.96 ? 73   HIS A CG  1 
ATOM   552  N  ND1 . HIS A 1 73  ? 48.307 44.083 47.480 1.00 12.62 ? 73   HIS A ND1 1 
ATOM   553  C  CD2 . HIS A 1 73  ? 49.770 45.596 48.059 1.00 13.31 ? 73   HIS A CD2 1 
ATOM   554  C  CE1 . HIS A 1 73  ? 48.068 44.397 48.742 1.00 16.08 ? 73   HIS A CE1 1 
ATOM   555  N  NE2 . HIS A 1 73  ? 48.941 45.312 49.117 1.00 11.68 ? 73   HIS A NE2 1 
ATOM   556  N  N   . GLY A 1 74  ? 51.827 43.000 43.300 1.00 10.14 ? 74   GLY A N   1 
ATOM   557  C  CA  . GLY A 1 74  ? 52.041 42.790 41.874 1.00 10.73 ? 74   GLY A CA  1 
ATOM   558  C  C   . GLY A 1 74  ? 51.846 41.313 41.583 1.00 10.94 ? 74   GLY A C   1 
ATOM   559  O  O   . GLY A 1 74  ? 52.329 40.449 42.315 1.00 12.15 ? 74   GLY A O   1 
ATOM   560  N  N   . MET A 1 75  ? 51.150 41.009 40.495 1.00 9.03  ? 75   MET A N   1 
ATOM   561  C  CA  . MET A 1 75  ? 50.844 39.630 40.144 1.00 10.81 ? 75   MET A CA  1 
ATOM   562  C  C   . MET A 1 75  ? 51.977 38.841 39.481 1.00 12.51 ? 75   MET A C   1 
ATOM   563  O  O   . MET A 1 75  ? 51.769 38.164 38.480 1.00 11.73 ? 75   MET A O   1 
ATOM   564  C  CB  . MET A 1 75  ? 49.604 39.613 39.245 1.00 10.21 ? 75   MET A CB  1 
ATOM   565  C  CG  . MET A 1 75  ? 48.363 40.227 39.872 1.00 10.81 ? 75   MET A CG  1 
ATOM   566  S  SD  . MET A 1 75  ? 47.816 39.298 41.336 1.00 15.39 ? 75   MET A SD  1 
ATOM   567  C  CE  . MET A 1 75  ? 48.336 40.398 42.622 1.00 21.43 ? 75   MET A CE  1 
ATOM   568  N  N   . PHE A 1 76  ? 53.176 38.911 40.046 1.00 9.69  ? 76   PHE A N   1 
ATOM   569  C  CA  . PHE A 1 76  ? 54.301 38.181 39.482 1.00 12.44 ? 76   PHE A CA  1 
ATOM   570  C  C   . PHE A 1 76  ? 54.337 36.725 39.946 1.00 11.64 ? 76   PHE A C   1 
ATOM   571  O  O   . PHE A 1 76  ? 54.269 36.461 41.148 1.00 16.19 ? 76   PHE A O   1 
ATOM   572  C  CB  . PHE A 1 76  ? 55.641 38.804 39.913 1.00 15.17 ? 76   PHE A CB  1 
ATOM   573  C  CG  . PHE A 1 76  ? 55.870 40.199 39.414 1.00 17.41 ? 76   PHE A CG  1 
ATOM   574  C  CD1 . PHE A 1 76  ? 55.354 41.298 40.098 1.00 14.62 ? 76   PHE A CD1 1 
ATOM   575  C  CD2 . PHE A 1 76  ? 56.614 40.412 38.257 1.00 13.49 ? 76   PHE A CD2 1 
ATOM   576  C  CE1 . PHE A 1 76  ? 55.577 42.600 39.632 1.00 16.78 ? 76   PHE A CE1 1 
ATOM   577  C  CE2 . PHE A 1 76  ? 56.845 41.698 37.780 1.00 12.62 ? 76   PHE A CE2 1 
ATOM   578  C  CZ  . PHE A 1 76  ? 56.326 42.799 38.465 1.00 17.17 ? 76   PHE A CZ  1 
ATOM   579  N  N   . ASN A 1 77  ? 54.441 35.793 39.000 1.00 10.07 ? 77   ASN A N   1 
ATOM   580  C  CA  . ASN A 1 77  ? 54.609 34.382 39.351 1.00 10.28 ? 77   ASN A CA  1 
ATOM   581  C  C   . ASN A 1 77  ? 56.074 34.269 39.775 1.00 9.55  ? 77   ASN A C   1 
ATOM   582  O  O   . ASN A 1 77  ? 56.869 35.179 39.539 1.00 9.46  ? 77   ASN A O   1 
ATOM   583  C  CB  . ASN A 1 77  ? 54.387 33.460 38.151 1.00 7.12  ? 77   ASN A CB  1 
ATOM   584  C  CG  . ASN A 1 77  ? 52.932 33.348 37.758 1.00 9.19  ? 77   ASN A CG  1 
ATOM   585  O  OD1 . ASN A 1 77  ? 52.040 33.547 38.583 1.00 9.25  ? 77   ASN A OD1 1 
ATOM   586  N  ND2 . ASN A 1 77  ? 52.684 32.999 36.492 1.00 8.66  ? 77   ASN A ND2 1 
ATOM   587  N  N   . ARG A 1 78  ? 56.440 33.137 40.358 1.00 7.20  ? 78   ARG A N   1 
ATOM   588  C  CA  . ARG A 1 78  ? 57.797 32.942 40.824 1.00 7.71  ? 78   ARG A CA  1 
ATOM   589  C  C   . ARG A 1 78  ? 58.868 33.077 39.743 1.00 8.38  ? 78   ARG A C   1 
ATOM   590  O  O   . ARG A 1 78  ? 59.806 33.861 39.890 1.00 8.09  ? 78   ARG A O   1 
ATOM   591  C  CB  . ARG A 1 78  ? 57.922 31.576 41.491 1.00 9.88  ? 78   ARG A CB  1 
ATOM   592  C  CG  . ARG A 1 78  ? 59.278 31.384 42.174 1.00 8.04  ? 78   ARG A CG  1 
ATOM   593  C  CD  . ARG A 1 78  ? 59.353 30.039 42.865 1.00 8.52  ? 78   ARG A CD  1 
ATOM   594  N  NE  . ARG A 1 78  ? 60.585 29.911 43.641 1.00 7.71  ? 78   ARG A NE  1 
ATOM   595  C  CZ  . ARG A 1 78  ? 60.890 28.841 44.369 1.00 9.88  ? 78   ARG A CZ  1 
ATOM   596  N  NH1 . ARG A 1 78  ? 60.054 27.811 44.405 1.00 10.02 ? 78   ARG A NH1 1 
ATOM   597  N  NH2 . ARG A 1 78  ? 62.012 28.817 45.088 1.00 8.99  ? 78   ARG A NH2 1 
ATOM   598  N  N   . LEU A 1 79  ? 58.733 32.314 38.663 1.00 7.19  ? 79   LEU A N   1 
ATOM   599  C  CA  . LEU A 1 79  ? 59.731 32.363 37.606 1.00 9.17  ? 79   LEU A CA  1 
ATOM   600  C  C   . LEU A 1 79  ? 59.757 33.735 36.947 1.00 8.60  ? 79   LEU A C   1 
ATOM   601  O  O   . LEU A 1 79  ? 60.830 34.250 36.623 1.00 9.13  ? 79   LEU A O   1 
ATOM   602  C  CB  . LEU A 1 79  ? 59.465 31.266 36.566 1.00 8.95  ? 79   LEU A CB  1 
ATOM   603  C  CG  . LEU A 1 79  ? 60.459 31.217 35.392 1.00 10.88 ? 79   LEU A CG  1 
ATOM   604  C  CD1 . LEU A 1 79  ? 61.880 31.122 35.911 1.00 15.20 ? 79   LEU A CD1 1 
ATOM   605  C  CD2 . LEU A 1 79  ? 60.130 30.012 34.506 1.00 12.87 ? 79   LEU A CD2 1 
ATOM   606  N  N   . GLU A 1 80  ? 58.582 34.327 36.759 1.00 8.59  ? 80   GLU A N   1 
ATOM   607  C  CA  . GLU A 1 80  ? 58.494 35.648 36.142 1.00 11.14 ? 80   GLU A CA  1 
ATOM   608  C  C   . GLU A 1 80  ? 59.146 36.735 37.009 1.00 7.50  ? 80   GLU A C   1 
ATOM   609  O  O   . GLU A 1 80  ? 59.721 37.683 36.478 1.00 8.27  ? 80   GLU A O   1 
ATOM   610  C  CB  . GLU A 1 80  ? 57.032 35.981 35.835 1.00 10.58 ? 80   GLU A CB  1 
ATOM   611  C  CG  . GLU A 1 80  ? 56.456 35.265 34.576 1.00 19.69 ? 80   GLU A CG  1 
ATOM   612  C  CD  . GLU A 1 80  ? 56.408 33.727 34.652 1.00 28.37 ? 80   GLU A CD  1 
ATOM   613  O  OE1 . GLU A 1 80  ? 56.306 33.153 35.753 1.00 18.74 ? 80   GLU A OE1 1 
ATOM   614  O  OE2 . GLU A 1 80  ? 56.448 33.079 33.580 1.00 35.35 ? 80   GLU A OE2 1 
ATOM   615  N  N   . LEU A 1 81  ? 59.056 36.596 38.334 1.00 7.96  ? 81   LEU A N   1 
ATOM   616  C  CA  . LEU A 1 81  ? 59.695 37.542 39.259 1.00 6.76  ? 81   LEU A CA  1 
ATOM   617  C  C   . LEU A 1 81  ? 61.211 37.424 39.062 1.00 6.54  ? 81   LEU A C   1 
ATOM   618  O  O   . LEU A 1 81  ? 61.932 38.419 38.946 1.00 7.14  ? 81   LEU A O   1 
ATOM   619  C  CB  . LEU A 1 81  ? 59.350 37.197 40.712 1.00 5.60  ? 81   LEU A CB  1 
ATOM   620  C  CG  . LEU A 1 81  ? 60.151 37.955 41.784 1.00 8.70  ? 81   LEU A CG  1 
ATOM   621  C  CD1 . LEU A 1 81  ? 59.976 39.482 41.609 1.00 10.31 ? 81   LEU A CD1 1 
ATOM   622  C  CD2 . LEU A 1 81  ? 59.659 37.524 43.167 1.00 8.78  ? 81   LEU A CD2 1 
ATOM   623  N  N   . HIS A 1 82  ? 61.687 36.187 39.062 1.00 7.92  ? 82   HIS A N   1 
ATOM   624  C  CA  . HIS A 1 82  ? 63.105 35.893 38.846 1.00 7.44  ? 82   HIS A CA  1 
ATOM   625  C  C   . HIS A 1 82  ? 63.561 36.514 37.522 1.00 8.10  ? 82   HIS A C   1 
ATOM   626  O  O   . HIS A 1 82  ? 64.600 37.173 37.464 1.00 7.23  ? 82   HIS A O   1 
ATOM   627  C  CB  . HIS A 1 82  ? 63.294 34.363 38.847 1.00 7.21  ? 82   HIS A CB  1 
ATOM   628  C  CG  . HIS A 1 82  ? 64.594 33.877 38.267 1.00 7.57  ? 82   HIS A CG  1 
ATOM   629  N  ND1 . HIS A 1 82  ? 64.755 33.618 36.923 1.00 10.94 ? 82   HIS A ND1 1 
ATOM   630  C  CD2 . HIS A 1 82  ? 65.757 33.508 38.862 1.00 11.04 ? 82   HIS A CD2 1 
ATOM   631  C  CE1 . HIS A 1 82  ? 65.956 33.105 36.713 1.00 12.41 ? 82   HIS A CE1 1 
ATOM   632  N  NE2 . HIS A 1 82  ? 66.584 33.026 37.873 1.00 12.71 ? 82   HIS A NE2 1 
ATOM   633  N  N   . ASP A 1 83  ? 62.776 36.327 36.466 1.00 6.03  ? 83   ASP A N   1 
ATOM   634  C  CA  . ASP A 1 83  ? 63.154 36.867 35.166 1.00 8.63  ? 83   ASP A CA  1 
ATOM   635  C  C   . ASP A 1 83  ? 63.105 38.386 35.122 1.00 7.01  ? 83   ASP A C   1 
ATOM   636  O  O   . ASP A 1 83  ? 63.914 39.007 34.428 1.00 6.13  ? 83   ASP A O   1 
ATOM   637  C  CB  . ASP A 1 83  ? 62.253 36.299 34.055 1.00 8.16  ? 83   ASP A CB  1 
ATOM   638  C  CG  . ASP A 1 83  ? 62.530 34.820 33.762 1.00 11.89 ? 83   ASP A CG  1 
ATOM   639  O  OD1 . ASP A 1 83  ? 63.531 34.274 34.254 1.00 11.72 ? 83   ASP A OD1 1 
ATOM   640  O  OD2 . ASP A 1 83  ? 61.745 34.206 33.011 1.00 15.36 ? 83   ASP A OD2 1 
ATOM   641  N  N   . ALA A 1 84  ? 62.172 38.991 35.857 1.00 6.92  ? 84   ALA A N   1 
ATOM   642  C  CA  . ALA A 1 84  ? 62.054 40.444 35.860 1.00 7.02  ? 84   ALA A CA  1 
ATOM   643  C  C   . ALA A 1 84  ? 63.270 41.046 36.568 1.00 6.81  ? 84   ALA A C   1 
ATOM   644  O  O   . ALA A 1 84  ? 63.840 42.045 36.124 1.00 7.27  ? 84   ALA A O   1 
ATOM   645  C  CB  . ALA A 1 84  ? 60.753 40.875 36.578 1.00 7.33  ? 84   ALA A CB  1 
ATOM   646  N  N   . ILE A 1 85  ? 63.688 40.421 37.660 1.00 5.10  ? 85   ILE A N   1 
ATOM   647  C  CA  . ILE A 1 85  ? 64.840 40.938 38.394 1.00 5.54  ? 85   ILE A CA  1 
ATOM   648  C  C   . ILE A 1 85  ? 66.086 40.844 37.502 1.00 6.76  ? 85   ILE A C   1 
ATOM   649  O  O   . ILE A 1 85  ? 66.856 41.807 37.394 1.00 6.91  ? 85   ILE A O   1 
ATOM   650  C  CB  . ILE A 1 85  ? 65.030 40.173 39.715 1.00 6.53  ? 85   ILE A CB  1 
ATOM   651  C  CG1 . ILE A 1 85  ? 63.832 40.474 40.634 1.00 5.12  ? 85   ILE A CG1 1 
ATOM   652  C  CG2 . ILE A 1 85  ? 66.343 40.616 40.403 1.00 6.37  ? 85   ILE A CG2 1 
ATOM   653  C  CD1 . ILE A 1 85  ? 63.776 39.606 41.909 1.00 9.02  ? 85   ILE A CD1 1 
ATOM   654  N  N   . HIS A 1 86  ? 66.271 39.698 36.851 1.00 5.80  ? 86   HIS A N   1 
ATOM   655  C  CA  . HIS A 1 86  ? 67.401 39.524 35.935 1.00 6.78  ? 86   HIS A CA  1 
ATOM   656  C  C   . HIS A 1 86  ? 67.309 40.573 34.824 1.00 8.22  ? 86   HIS A C   1 
ATOM   657  O  O   . HIS A 1 86  ? 68.292 41.216 34.489 1.00 6.08  ? 86   HIS A O   1 
ATOM   658  C  CB  . HIS A 1 86  ? 67.376 38.157 35.253 1.00 6.59  ? 86   HIS A CB  1 
ATOM   659  C  CG  . HIS A 1 86  ? 67.978 37.052 36.063 1.00 8.53  ? 86   HIS A CG  1 
ATOM   660  N  ND1 . HIS A 1 86  ? 68.060 35.759 35.597 1.00 8.46  ? 86   HIS A ND1 1 
ATOM   661  C  CD2 . HIS A 1 86  ? 68.540 37.049 37.296 1.00 11.16 ? 86   HIS A CD2 1 
ATOM   662  C  CE1 . HIS A 1 86  ? 68.651 35.004 36.508 1.00 9.11  ? 86   HIS A CE1 1 
ATOM   663  N  NE2 . HIS A 1 86  ? 68.953 35.764 37.548 1.00 9.14  ? 86   HIS A NE2 1 
ATOM   664  N  N   . ALA A 1 87  ? 66.130 40.727 34.233 1.00 6.65  ? 87   ALA A N   1 
ATOM   665  C  CA  . ALA A 1 87  ? 66.000 41.701 33.139 1.00 6.48  ? 87   ALA A CA  1 
ATOM   666  C  C   . ALA A 1 87  ? 66.327 43.135 33.565 1.00 7.67  ? 87   ALA A C   1 
ATOM   667  O  O   . ALA A 1 87  ? 66.981 43.879 32.817 1.00 8.23  ? 87   ALA A O   1 
ATOM   668  C  CB  . ALA A 1 87  ? 64.596 41.639 32.538 1.00 6.34  ? 87   ALA A CB  1 
ATOM   669  N  N   . ALA A 1 88  ? 65.876 43.539 34.749 1.00 5.61  ? 88   ALA A N   1 
ATOM   670  C  CA  . ALA A 1 88  ? 66.166 44.900 35.218 1.00 6.25  ? 88   ALA A CA  1 
ATOM   671  C  C   . ALA A 1 88  ? 67.668 45.159 35.275 1.00 7.69  ? 88   ALA A C   1 
ATOM   672  O  O   . ALA A 1 88  ? 68.153 46.200 34.824 1.00 8.72  ? 88   ALA A O   1 
ATOM   673  C  CB  . ALA A 1 88  ? 65.556 45.131 36.607 1.00 5.42  ? 88   ALA A CB  1 
ATOM   674  N  N   . GLN A 1 89  ? 68.412 44.223 35.847 1.00 7.99  ? 89   GLN A N   1 
ATOM   675  C  CA  . GLN A 1 89  ? 69.839 44.418 35.954 1.00 6.64  ? 89   GLN A CA  1 
ATOM   676  C  C   . GLN A 1 89  ? 70.597 44.217 34.650 1.00 9.47  ? 89   GLN A C   1 
ATOM   677  O  O   . GLN A 1 89  ? 71.527 44.955 34.368 1.00 10.53 ? 89   GLN A O   1 
ATOM   678  C  CB  . GLN A 1 89  ? 70.418 43.519 37.059 1.00 8.24  ? 89   GLN A CB  1 
ATOM   679  C  CG  . GLN A 1 89  ? 69.987 43.970 38.453 1.00 12.48 ? 89   GLN A CG  1 
ATOM   680  C  CD  . GLN A 1 89  ? 71.011 43.645 39.540 1.00 13.41 ? 89   GLN A CD  1 
ATOM   681  O  OE1 . GLN A 1 89  ? 71.560 44.546 40.189 1.00 15.49 ? 89   GLN A OE1 1 
ATOM   682  N  NE2 . GLN A 1 89  ? 71.260 42.363 39.751 1.00 12.81 ? 89   GLN A NE2 1 
ATOM   683  N  N   . HIS A 1 90  ? 70.190 43.248 33.835 1.00 10.02 ? 90   HIS A N   1 
ATOM   684  C  CA  . HIS A 1 90  ? 70.914 43.001 32.584 1.00 7.56  ? 90   HIS A CA  1 
ATOM   685  C  C   . HIS A 1 90  ? 70.612 44.022 31.491 1.00 8.07  ? 90   HIS A C   1 
ATOM   686  O  O   . HIS A 1 90  ? 71.528 44.472 30.810 1.00 8.95  ? 90   HIS A O   1 
ATOM   687  C  CB  . HIS A 1 90  ? 70.618 41.578 32.068 1.00 10.75 ? 90   HIS A CB  1 
ATOM   688  C  CG  . HIS A 1 90  ? 71.203 40.486 32.919 1.00 9.52  ? 90   HIS A CG  1 
ATOM   689  N  ND1 . HIS A 1 90  ? 72.390 39.852 32.609 1.00 13.38 ? 90   HIS A ND1 1 
ATOM   690  C  CD2 . HIS A 1 90  ? 70.783 39.943 34.090 1.00 4.37  ? 90   HIS A CD2 1 
ATOM   691  C  CE1 . HIS A 1 90  ? 72.675 38.970 33.554 1.00 5.46  ? 90   HIS A CE1 1 
ATOM   692  N  NE2 . HIS A 1 90  ? 71.717 39.008 34.460 1.00 12.94 ? 90   HIS A NE2 1 
ATOM   693  N  N   . HIS A 1 91  ? 69.344 44.402 31.325 1.00 8.03  ? 91   HIS A N   1 
ATOM   694  C  CA  . HIS A 1 91  ? 68.988 45.371 30.292 1.00 7.86  ? 91   HIS A CA  1 
ATOM   695  C  C   . HIS A 1 91  ? 69.367 46.827 30.612 1.00 11.80 ? 91   HIS A C   1 
ATOM   696  O  O   . HIS A 1 91  ? 69.258 47.714 29.754 1.00 13.02 ? 91   HIS A O   1 
ATOM   697  C  CB  . HIS A 1 91  ? 67.504 45.230 29.941 1.00 7.30  ? 91   HIS A CB  1 
ATOM   698  C  CG  . HIS A 1 91  ? 67.213 44.055 29.054 1.00 10.34 ? 91   HIS A CG  1 
ATOM   699  N  ND1 . HIS A 1 91  ? 67.475 42.749 29.421 1.00 13.43 ? 91   HIS A ND1 1 
ATOM   700  C  CD2 . HIS A 1 91  ? 66.722 43.997 27.793 1.00 5.09  ? 91   HIS A CD2 1 
ATOM   701  C  CE1 . HIS A 1 91  ? 67.158 41.939 28.422 1.00 5.32  ? 91   HIS A CE1 1 
ATOM   702  N  NE2 . HIS A 1 91  ? 66.701 42.673 27.422 1.00 11.76 ? 91   HIS A NE2 1 
ATOM   703  N  N   . SER A 1 92  ? 69.814 47.075 31.842 1.00 8.75  ? 92   SER A N   1 
ATOM   704  C  CA  . SER A 1 92  ? 70.301 48.405 32.227 1.00 9.45  ? 92   SER A CA  1 
ATOM   705  C  C   . SER A 1 92  ? 71.828 48.269 32.361 1.00 10.35 ? 92   SER A C   1 
ATOM   706  O  O   . SER A 1 92  ? 72.521 49.223 32.735 1.00 10.15 ? 92   SER A O   1 
ATOM   707  C  CB  . SER A 1 92  ? 69.743 48.838 33.585 1.00 7.40  ? 92   SER A CB  1 
ATOM   708  O  OG  . SER A 1 92  ? 70.228 47.984 34.608 1.00 7.54  ? 92   SER A OG  1 
ATOM   709  N  N   . GLU A 1 93  ? 72.326 47.075 32.046 1.00 7.92  ? 93   GLU A N   1 
ATOM   710  C  CA  . GLU A 1 93  ? 73.747 46.707 32.151 1.00 8.87  ? 93   GLU A CA  1 
ATOM   711  C  C   . GLU A 1 93  ? 74.322 47.069 33.511 1.00 11.69 ? 93   GLU A C   1 
ATOM   712  O  O   . GLU A 1 93  ? 75.433 47.583 33.623 1.00 11.65 ? 93   GLU A O   1 
ATOM   713  C  CB  . GLU A 1 93  ? 74.586 47.325 31.018 1.00 12.20 ? 93   GLU A CB  1 
ATOM   714  C  CG  . GLU A 1 93  ? 74.161 46.783 29.650 1.00 11.11 ? 93   GLU A CG  1 
ATOM   715  C  CD  . GLU A 1 93  ? 75.212 46.960 28.566 1.00 15.03 ? 93   GLU A CD  1 
ATOM   716  O  OE1 . GLU A 1 93  ? 76.335 46.451 28.751 1.00 14.78 ? 93   GLU A OE1 1 
ATOM   717  O  OE2 . GLU A 1 93  ? 74.906 47.595 27.534 1.00 14.60 ? 93   GLU A OE2 1 
ATOM   718  N  N   . GLY A 1 94  ? 73.530 46.790 34.542 1.00 9.50  ? 94   GLY A N   1 
ATOM   719  C  CA  . GLY A 1 94  ? 73.957 47.026 35.909 1.00 9.24  ? 94   GLY A CA  1 
ATOM   720  C  C   . GLY A 1 94  ? 73.674 48.388 36.509 1.00 9.79  ? 94   GLY A C   1 
ATOM   721  O  O   . GLY A 1 94  ? 73.920 48.595 37.702 1.00 10.05 ? 94   GLY A O   1 
ATOM   722  N  N   . ARG A 1 95  ? 73.165 49.318 35.714 1.00 10.46 ? 95   ARG A N   1 
ATOM   723  C  CA  . ARG A 1 95  ? 72.885 50.648 36.246 1.00 12.76 ? 95   ARG A CA  1 
ATOM   724  C  C   . ARG A 1 95  ? 71.658 50.699 37.154 1.00 12.60 ? 95   ARG A C   1 
ATOM   725  O  O   . ARG A 1 95  ? 71.594 51.530 38.072 1.00 13.40 ? 95   ARG A O   1 
ATOM   726  C  CB  . ARG A 1 95  ? 72.729 51.651 35.101 1.00 13.60 ? 95   ARG A CB  1 
ATOM   727  C  CG  . ARG A 1 95  ? 72.379 53.056 35.571 1.00 28.74 ? 95   ARG A CG  1 
ATOM   728  C  CD  . ARG A 1 95  ? 72.641 54.057 34.464 1.00 36.24 ? 95   ARG A CD  1 
ATOM   729  N  NE  . ARG A 1 95  ? 71.982 55.340 34.693 1.00 39.54 ? 95   ARG A NE  1 
ATOM   730  C  CZ  . ARG A 1 95  ? 72.042 56.350 33.834 1.00 41.58 ? 95   ARG A CZ  1 
ATOM   731  N  NH1 . ARG A 1 95  ? 72.734 56.214 32.705 1.00 38.28 ? 95   ARG A NH1 1 
ATOM   732  N  NH2 . ARG A 1 95  ? 71.402 57.481 34.088 1.00 45.49 ? 95   ARG A NH2 1 
ATOM   733  N  N   . SER A 1 96  ? 70.691 49.811 36.918 1.00 8.44  ? 96   SER A N   1 
ATOM   734  C  CA  . SER A 1 96  ? 69.467 49.788 37.714 1.00 7.35  ? 96   SER A CA  1 
ATOM   735  C  C   . SER A 1 96  ? 69.460 48.733 38.804 1.00 10.24 ? 96   SER A C   1 
ATOM   736  O  O   . SER A 1 96  ? 69.343 47.542 38.526 1.00 12.42 ? 96   SER A O   1 
ATOM   737  C  CB  . SER A 1 96  ? 68.251 49.554 36.815 1.00 8.55  ? 96   SER A CB  1 
ATOM   738  O  OG  . SER A 1 96  ? 68.242 50.484 35.741 1.00 9.27  ? 96   SER A OG  1 
ATOM   739  N  N   . LEU A 1 97  ? 69.567 49.170 40.051 1.00 8.47  ? 97   LEU A N   1 
ATOM   740  C  CA  . LEU A 1 97  ? 69.522 48.226 41.161 1.00 8.20  ? 97   LEU A CA  1 
ATOM   741  C  C   . LEU A 1 97  ? 68.070 47.774 41.318 1.00 9.98  ? 97   LEU A C   1 
ATOM   742  O  O   . LEU A 1 97  ? 67.151 48.474 40.890 1.00 13.40 ? 97   LEU A O   1 
ATOM   743  C  CB  . LEU A 1 97  ? 70.002 48.910 42.435 1.00 8.55  ? 97   LEU A CB  1 
ATOM   744  C  CG  . LEU A 1 97  ? 71.437 49.414 42.287 1.00 12.37 ? 97   LEU A CG  1 
ATOM   745  C  CD1 . LEU A 1 97  ? 71.849 50.127 43.558 1.00 13.78 ? 97   LEU A CD1 1 
ATOM   746  C  CD2 . LEU A 1 97  ? 72.368 48.234 41.981 1.00 15.91 ? 97   LEU A CD2 1 
ATOM   747  N  N   . VAL A 1 98  ? 67.854 46.614 41.931 1.00 8.20  ? 98   VAL A N   1 
ATOM   748  C  CA  . VAL A 1 98  ? 66.494 46.128 42.094 1.00 8.08  ? 98   VAL A CA  1 
ATOM   749  C  C   . VAL A 1 98  ? 66.079 46.048 43.549 1.00 8.69  ? 98   VAL A C   1 
ATOM   750  O  O   . VAL A 1 98  ? 66.789 45.476 44.378 1.00 10.98 ? 98   VAL A O   1 
ATOM   751  C  CB  . VAL A 1 98  ? 66.310 44.722 41.461 1.00 11.75 ? 98   VAL A CB  1 
ATOM   752  C  CG1 . VAL A 1 98  ? 64.890 44.225 41.710 1.00 11.86 ? 98   VAL A CG1 1 
ATOM   753  C  CG2 . VAL A 1 98  ? 66.609 44.773 39.978 1.00 10.08 ? 98   VAL A CG2 1 
ATOM   754  N  N   . ILE A 1 99  ? 64.935 46.653 43.852 1.00 7.29  ? 99   ILE A N   1 
ATOM   755  C  CA  . ILE A 1 99  ? 64.368 46.637 45.202 1.00 7.82  ? 99   ILE A CA  1 
ATOM   756  C  C   . ILE A 1 99  ? 63.043 45.907 45.058 1.00 10.03 ? 99   ILE A C   1 
ATOM   757  O  O   . ILE A 1 99  ? 62.281 46.160 44.106 1.00 9.31  ? 99   ILE A O   1 
ATOM   758  C  CB  . ILE A 1 99  ? 64.123 48.065 45.720 1.00 9.50  ? 99   ILE A CB  1 
ATOM   759  C  CG1 . ILE A 1 99  ? 65.467 48.791 45.844 1.00 11.16 ? 99   ILE A CG1 1 
ATOM   760  C  CG2 . ILE A 1 99  ? 63.403 48.023 47.074 1.00 9.63  ? 99   ILE A CG2 1 
ATOM   761  C  CD1 . ILE A 1 99  ? 65.335 50.313 45.981 1.00 14.08 ? 99   ILE A CD1 1 
ATOM   762  N  N   . VAL A 1 100 ? 62.758 45.001 45.986 1.00 6.67  ? 100  VAL A N   1 
ATOM   763  C  CA  . VAL A 1 100 ? 61.532 44.240 45.894 1.00 8.22  ? 100  VAL A CA  1 
ATOM   764  C  C   . VAL A 1 100 ? 60.737 44.344 47.171 1.00 10.04 ? 100  VAL A C   1 
ATOM   765  O  O   . VAL A 1 100 ? 61.281 44.140 48.258 1.00 10.46 ? 100  VAL A O   1 
ATOM   766  C  CB  . VAL A 1 100 ? 61.813 42.729 45.639 1.00 7.62  ? 100  VAL A CB  1 
ATOM   767  C  CG1 . VAL A 1 100 ? 60.489 41.957 45.585 1.00 10.74 ? 100  VAL A CG1 1 
ATOM   768  C  CG2 . VAL A 1 100 ? 62.572 42.552 44.338 1.00 6.67  ? 100  VAL A CG2 1 
ATOM   769  N  N   . ARG A 1 101 ? 59.469 44.720 47.049 1.00 9.36  ? 101  ARG A N   1 
ATOM   770  C  CA  . ARG A 1 101 ? 58.621 44.731 48.234 1.00 8.94  ? 101  ARG A CA  1 
ATOM   771  C  C   . ARG A 1 101 ? 57.947 43.372 48.211 1.00 13.50 ? 101  ARG A C   1 
ATOM   772  O  O   . ARG A 1 101 ? 57.221 43.032 47.272 1.00 11.82 ? 101  ARG A O   1 
ATOM   773  C  CB  . ARG A 1 101 ? 57.543 45.805 48.217 1.00 10.78 ? 101  ARG A CB  1 
ATOM   774  C  CG  . ARG A 1 101 ? 56.561 45.479 49.334 1.00 13.34 ? 101  ARG A CG  1 
ATOM   775  C  CD  . ARG A 1 101 ? 55.622 46.551 49.632 1.00 16.41 ? 101  ARG A CD  1 
ATOM   776  N  NE  . ARG A 1 101 ? 54.624 46.746 48.590 1.00 13.51 ? 101  ARG A NE  1 
ATOM   777  C  CZ  . ARG A 1 101 ? 53.742 47.728 48.655 1.00 14.82 ? 101  ARG A CZ  1 
ATOM   778  N  NH1 . ARG A 1 101 ? 53.777 48.549 49.697 1.00 13.43 ? 101  ARG A NH1 1 
ATOM   779  N  NH2 . ARG A 1 101 ? 52.849 47.907 47.690 1.00 13.98 ? 101  ARG A NH2 1 
ATOM   780  N  N   . VAL A 1 102 ? 58.184 42.595 49.254 1.00 8.51  ? 102  VAL A N   1 
ATOM   781  C  CA  . VAL A 1 102 ? 57.663 41.252 49.332 1.00 9.47  ? 102  VAL A CA  1 
ATOM   782  C  C   . VAL A 1 102 ? 56.450 41.120 50.227 1.00 10.65 ? 102  VAL A C   1 
ATOM   783  O  O   . VAL A 1 102 ? 56.160 42.006 51.016 1.00 13.09 ? 102  VAL A O   1 
ATOM   784  C  CB  . VAL A 1 102 ? 58.745 40.295 49.890 1.00 13.40 ? 102  VAL A CB  1 
ATOM   785  C  CG1 . VAL A 1 102 ? 59.972 40.306 48.986 1.00 11.18 ? 102  VAL A CG1 1 
ATOM   786  C  CG2 . VAL A 1 102 ? 59.140 40.728 51.310 1.00 15.70 ? 102  VAL A CG2 1 
ATOM   787  N  N   . PRO A 1 103 ? 55.699 40.020 50.072 1.00 10.95 ? 103  PRO A N   1 
ATOM   788  C  CA  . PRO A 1 103 ? 54.525 39.809 50.927 1.00 9.28  ? 103  PRO A CA  1 
ATOM   789  C  C   . PRO A 1 103 ? 55.155 39.625 52.317 1.00 10.96 ? 103  PRO A C   1 
ATOM   790  O  O   . PRO A 1 103 ? 56.203 38.997 52.433 1.00 13.53 ? 103  PRO A O   1 
ATOM   791  C  CB  . PRO A 1 103 ? 53.938 38.499 50.402 1.00 10.15 ? 103  PRO A CB  1 
ATOM   792  C  CG  . PRO A 1 103 ? 54.409 38.438 48.970 1.00 10.03 ? 103  PRO A CG  1 
ATOM   793  C  CD  . PRO A 1 103 ? 55.813 38.978 49.037 1.00 11.43 ? 103  PRO A CD  1 
ATOM   794  N  N   . LYS A 1 104 ? 54.522 40.133 53.370 1.00 13.67 ? 104  LYS A N   1 
ATOM   795  C  CA  . LYS A 1 104 ? 55.116 40.037 54.699 1.00 14.92 ? 104  LYS A CA  1 
ATOM   796  C  C   . LYS A 1 104 ? 55.520 38.658 55.246 1.00 16.79 ? 104  LYS A C   1 
ATOM   797  O  O   . LYS A 1 104 ? 56.496 38.555 56.007 1.00 17.12 ? 104  LYS A O   1 
ATOM   798  C  CB  . LYS A 1 104 ? 54.210 40.729 55.718 1.00 15.74 ? 104  LYS A CB  1 
ATOM   799  C  CG  . LYS A 1 104 ? 54.928 40.975 57.039 1.00 21.74 ? 104  LYS A CG  1 
ATOM   800  C  CD  . LYS A 1 104 ? 54.007 41.627 58.042 1.00 30.28 ? 104  LYS A CD  1 
ATOM   801  C  CE  . LYS A 1 104 ? 54.791 42.283 59.165 1.00 26.96 ? 104  LYS A CE  1 
ATOM   802  N  NZ  . LYS A 1 104 ? 53.803 42.730 60.197 1.00 28.18 ? 104  LYS A NZ  1 
ATOM   803  N  N   . HIS A 1 105 ? 54.804 37.599 54.882 1.00 15.08 ? 105  HIS A N   1 
ATOM   804  C  CA  . HIS A 1 105 ? 55.139 36.274 55.410 1.00 17.84 ? 105  HIS A CA  1 
ATOM   805  C  C   . HIS A 1 105 ? 55.486 35.216 54.369 1.00 18.75 ? 105  HIS A C   1 
ATOM   806  O  O   . HIS A 1 105 ? 55.506 34.028 54.680 1.00 23.34 ? 105  HIS A O   1 
ATOM   807  C  CB  . HIS A 1 105 ? 53.980 35.742 56.266 1.00 18.34 ? 105  HIS A CB  1 
ATOM   808  C  CG  . HIS A 1 105 ? 53.655 36.606 57.443 1.00 21.47 ? 105  HIS A CG  1 
ATOM   809  N  ND1 . HIS A 1 105 ? 54.584 36.922 58.410 1.00 30.17 ? 105  HIS A ND1 1 
ATOM   810  C  CD2 . HIS A 1 105 ? 52.516 37.248 57.791 1.00 23.88 ? 105  HIS A CD2 1 
ATOM   811  C  CE1 . HIS A 1 105 ? 54.031 37.725 59.303 1.00 25.57 ? 105  HIS A CE1 1 
ATOM   812  N  NE2 . HIS A 1 105 ? 52.777 37.939 58.950 1.00 29.38 ? 105  HIS A NE2 1 
ATOM   813  N  N   . ASP A 1 106 ? 55.798 35.631 53.153 1.00 14.13 ? 106  ASP A N   1 
ATOM   814  C  CA  . ASP A 1 106 ? 56.080 34.646 52.116 1.00 14.15 ? 106  ASP A CA  1 
ATOM   815  C  C   . ASP A 1 106 ? 57.567 34.382 51.913 1.00 15.30 ? 106  ASP A C   1 
ATOM   816  O  O   . ASP A 1 106 ? 58.255 35.158 51.250 1.00 12.87 ? 106  ASP A O   1 
ATOM   817  C  CB  . ASP A 1 106 ? 55.453 35.099 50.799 1.00 14.76 ? 106  ASP A CB  1 
ATOM   818  C  CG  . ASP A 1 106 ? 55.370 33.975 49.796 1.00 27.21 ? 106  ASP A CG  1 
ATOM   819  O  OD1 . ASP A 1 106 ? 54.291 33.357 49.662 1.00 37.17 ? 106  ASP A OD1 1 
ATOM   820  O  OD2 . ASP A 1 106 ? 56.395 33.687 49.163 1.00 29.18 ? 106  ASP A OD2 1 
ATOM   821  N  N   . GLU A 1 107 ? 58.056 33.276 52.474 1.00 13.38 ? 107  GLU A N   1 
ATOM   822  C  CA  . GLU A 1 107 ? 59.468 32.934 52.370 1.00 14.18 ? 107  GLU A CA  1 
ATOM   823  C  C   . GLU A 1 107 ? 59.931 32.671 50.941 1.00 14.31 ? 107  GLU A C   1 
ATOM   824  O  O   . GLU A 1 107 ? 61.069 32.993 50.592 1.00 13.17 ? 107  GLU A O   1 
ATOM   825  C  CB  . GLU A 1 107 ? 59.788 31.716 53.258 1.00 18.75 ? 107  GLU A CB  1 
ATOM   826  C  CG  . GLU A 1 107 ? 59.520 31.983 54.743 1.00 28.00 ? 107  GLU A CG  1 
ATOM   827  C  CD  . GLU A 1 107 ? 60.083 30.910 55.672 1.00 28.30 ? 107  GLU A CD  1 
ATOM   828  O  OE1 . GLU A 1 107 ? 60.428 29.811 55.199 1.00 28.60 ? 107  GLU A OE1 1 
ATOM   829  O  OE2 . GLU A 1 107 ? 60.166 31.171 56.889 1.00 35.00 ? 107  GLU A OE2 1 
ATOM   830  N  N   . VAL A 1 108 ? 59.056 32.111 50.113 1.00 12.68 ? 108  VAL A N   1 
ATOM   831  C  CA  . VAL A 1 108 ? 59.428 31.799 48.735 1.00 12.10 ? 108  VAL A CA  1 
ATOM   832  C  C   . VAL A 1 108 ? 59.600 33.073 47.916 1.00 10.95 ? 108  VAL A C   1 
ATOM   833  O  O   . VAL A 1 108 ? 60.527 33.181 47.111 1.00 11.75 ? 108  VAL A O   1 
ATOM   834  C  CB  . VAL A 1 108 ? 58.381 30.873 48.068 1.00 14.07 ? 108  VAL A CB  1 
ATOM   835  C  CG1 . VAL A 1 108 ? 58.732 30.658 46.596 1.00 15.18 ? 108  VAL A CG1 1 
ATOM   836  C  CG2 . VAL A 1 108 ? 58.358 29.519 48.789 1.00 17.81 ? 108  VAL A CG2 1 
ATOM   837  N  N   . SER A 1 109 ? 58.727 34.054 48.120 1.00 9.54  ? 109  SER A N   1 
ATOM   838  C  CA  . SER A 1 109 ? 58.883 35.308 47.373 1.00 9.56  ? 109  SER A CA  1 
ATOM   839  C  C   . SER A 1 109 ? 60.230 35.929 47.754 1.00 8.93  ? 109  SER A C   1 
ATOM   840  O  O   . SER A 1 109 ? 60.962 36.439 46.910 1.00 7.11  ? 109  SER A O   1 
ATOM   841  C  CB  . SER A 1 109 ? 57.764 36.300 47.720 1.00 13.78 ? 109  SER A CB  1 
ATOM   842  O  OG  . SER A 1 109 ? 56.494 35.846 47.276 1.00 18.39 ? 109  SER A OG  1 
ATOM   843  N  N   . LEU A 1 110 ? 60.553 35.877 49.043 1.00 9.18  ? 110  LEU A N   1 
ATOM   844  C  CA  . LEU A 1 110 ? 61.797 36.455 49.533 1.00 9.78  ? 110  LEU A CA  1 
ATOM   845  C  C   . LEU A 1 110 ? 63.025 35.752 48.976 1.00 10.49 ? 110  LEU A C   1 
ATOM   846  O  O   . LEU A 1 110 ? 63.930 36.405 48.474 1.00 8.10  ? 110  LEU A O   1 
ATOM   847  C  CB  . LEU A 1 110 ? 61.841 36.405 51.061 1.00 12.41 ? 110  LEU A CB  1 
ATOM   848  C  CG  . LEU A 1 110 ? 63.137 36.927 51.692 1.00 8.66  ? 110  LEU A CG  1 
ATOM   849  C  CD1 . LEU A 1 110 ? 63.320 38.420 51.368 1.00 8.90  ? 110  LEU A CD1 1 
ATOM   850  C  CD2 . LEU A 1 110 ? 63.062 36.711 53.204 1.00 10.26 ? 110  LEU A CD2 1 
ATOM   851  N  N   . SER A 1 111 ? 63.062 34.422 49.056 1.00 9.61  ? 111  SER A N   1 
ATOM   852  C  CA  . SER A 1 111 ? 64.235 33.715 48.550 1.00 11.32 ? 111  SER A CA  1 
ATOM   853  C  C   . SER A 1 111 ? 64.351 33.874 47.041 1.00 9.54  ? 111  SER A C   1 
ATOM   854  O  O   . SER A 1 111 ? 65.453 33.966 46.509 1.00 8.82  ? 111  SER A O   1 
ATOM   855  C  CB  . SER A 1 111 ? 64.196 32.232 48.935 1.00 12.89 ? 111  SER A CB  1 
ATOM   856  O  OG  . SER A 1 111 ? 63.144 31.564 48.284 1.00 15.23 ? 111  SER A OG  1 
ATOM   857  N  N   . THR A 1 112 ? 63.217 33.937 46.351 1.00 7.62  ? 112  THR A N   1 
ATOM   858  C  CA  . THR A 1 112 ? 63.246 34.110 44.902 1.00 8.97  ? 112  THR A CA  1 
ATOM   859  C  C   . THR A 1 112 ? 63.845 35.474 44.561 1.00 8.77  ? 112  THR A C   1 
ATOM   860  O  O   . THR A 1 112 ? 64.711 35.592 43.684 1.00 6.73  ? 112  THR A O   1 
ATOM   861  C  CB  . THR A 1 112 ? 61.822 34.031 44.313 1.00 10.53 ? 112  THR A CB  1 
ATOM   862  O  OG1 . THR A 1 112 ? 61.286 32.717 44.541 1.00 11.09 ? 112  THR A OG1 1 
ATOM   863  C  CG2 . THR A 1 112 ? 61.843 34.338 42.806 1.00 8.24  ? 112  THR A CG2 1 
ATOM   864  N  N   . ALA A 1 113 ? 63.388 36.511 45.261 1.00 8.01  ? 113  ALA A N   1 
ATOM   865  C  CA  . ALA A 1 113 ? 63.884 37.855 45.007 1.00 7.60  ? 113  ALA A CA  1 
ATOM   866  C  C   . ALA A 1 113 ? 65.380 37.925 45.271 1.00 7.90  ? 113  ALA A C   1 
ATOM   867  O  O   . ALA A 1 113 ? 66.132 38.471 44.472 1.00 7.69  ? 113  ALA A O   1 
ATOM   868  C  CB  . ALA A 1 113 ? 63.149 38.871 45.884 1.00 6.60  ? 113  ALA A CB  1 
ATOM   869  N  N   . LEU A 1 114 ? 65.830 37.352 46.384 1.00 7.24  ? 114  LEU A N   1 
ATOM   870  C  CA  . LEU A 1 114 ? 67.259 37.403 46.691 1.00 7.88  ? 114  LEU A CA  1 
ATOM   871  C  C   . LEU A 1 114 ? 68.098 36.565 45.719 1.00 7.31  ? 114  LEU A C   1 
ATOM   872  O  O   . LEU A 1 114 ? 69.109 37.047 45.181 1.00 10.40 ? 114  LEU A O   1 
ATOM   873  C  CB  . LEU A 1 114 ? 67.504 36.919 48.123 1.00 8.38  ? 114  LEU A CB  1 
ATOM   874  C  CG  . LEU A 1 114 ? 66.900 37.776 49.246 1.00 9.23  ? 114  LEU A CG  1 
ATOM   875  C  CD1 . LEU A 1 114 ? 66.997 36.991 50.555 1.00 12.04 ? 114  LEU A CD1 1 
ATOM   876  C  CD2 . LEU A 1 114 ? 67.612 39.120 49.351 1.00 16.44 ? 114  LEU A CD2 1 
ATOM   877  N  N   . ASP A 1 115 ? 67.679 35.326 45.491 1.00 8.69  ? 115  ASP A N   1 
ATOM   878  C  CA  . ASP A 1 115 ? 68.412 34.426 44.587 1.00 9.89  ? 115  ASP A CA  1 
ATOM   879  C  C   . ASP A 1 115 ? 68.532 35.037 43.181 1.00 10.76 ? 115  ASP A C   1 
ATOM   880  O  O   . ASP A 1 115 ? 69.522 34.796 42.487 1.00 10.02 ? 115  ASP A O   1 
ATOM   881  C  CB  . ASP A 1 115 ? 67.730 33.044 44.474 1.00 15.31 ? 115  ASP A CB  1 
ATOM   882  C  CG  . ASP A 1 115 ? 67.927 32.153 45.716 1.00 21.85 ? 115  ASP A CG  1 
ATOM   883  O  OD1 . ASP A 1 115 ? 68.782 32.473 46.568 1.00 18.81 ? 115  ASP A OD1 1 
ATOM   884  O  OD2 . ASP A 1 115 ? 67.220 31.112 45.825 1.00 22.18 ? 115  ASP A OD2 1 
ATOM   885  N  N   . ALA A 1 116 ? 67.536 35.824 42.761 1.00 9.28  ? 116  ALA A N   1 
ATOM   886  C  CA  . ALA A 1 116 ? 67.580 36.451 41.438 1.00 9.85  ? 116  ALA A CA  1 
ATOM   887  C  C   . ALA A 1 116 ? 68.442 37.709 41.375 1.00 10.21 ? 116  ALA A C   1 
ATOM   888  O  O   . ALA A 1 116 ? 68.715 38.213 40.289 1.00 9.14  ? 116  ALA A O   1 
ATOM   889  C  CB  . ALA A 1 116 ? 66.149 36.779 40.940 1.00 7.26  ? 116  ALA A CB  1 
ATOM   890  N  N   . GLY A 1 117 ? 68.850 38.245 42.523 1.00 8.54  ? 117  GLY A N   1 
ATOM   891  C  CA  . GLY A 1 117 ? 69.701 39.422 42.490 1.00 8.50  ? 117  GLY A CA  1 
ATOM   892  C  C   . GLY A 1 117 ? 69.148 40.719 43.058 1.00 7.11  ? 117  GLY A C   1 
ATOM   893  O  O   . GLY A 1 117 ? 69.711 41.780 42.818 1.00 9.83  ? 117  GLY A O   1 
ATOM   894  N  N   . ALA A 1 118 ? 68.053 40.661 43.808 1.00 6.93  ? 118  ALA A N   1 
ATOM   895  C  CA  . ALA A 1 118 ? 67.507 41.894 44.379 1.00 6.85  ? 118  ALA A CA  1 
ATOM   896  C  C   . ALA A 1 118 ? 68.494 42.455 45.395 1.00 7.45  ? 118  ALA A C   1 
ATOM   897  O  O   . ALA A 1 118 ? 69.033 41.706 46.210 1.00 9.03  ? 118  ALA A O   1 
ATOM   898  C  CB  . ALA A 1 118 ? 66.161 41.622 45.056 1.00 6.93  ? 118  ALA A CB  1 
ATOM   899  N  N   . ALA A 1 119 ? 68.712 43.768 45.358 1.00 6.06  ? 119  ALA A N   1 
ATOM   900  C  CA  . ALA A 1 119 ? 69.652 44.416 46.286 1.00 8.06  ? 119  ALA A CA  1 
ATOM   901  C  C   . ALA A 1 119 ? 68.961 45.016 47.505 1.00 10.49 ? 119  ALA A C   1 
ATOM   902  O  O   . ALA A 1 119 ? 69.614 45.375 48.479 1.00 10.47 ? 119  ALA A O   1 
ATOM   903  C  CB  . ALA A 1 119 ? 70.441 45.506 45.548 1.00 8.45  ? 119  ALA A CB  1 
ATOM   904  N  N   . GLY A 1 120 ? 67.643 45.127 47.446 1.00 8.71  ? 120  GLY A N   1 
ATOM   905  C  CA  . GLY A 1 120 ? 66.892 45.686 48.558 1.00 8.74  ? 120  GLY A CA  1 
ATOM   906  C  C   . GLY A 1 120 ? 65.555 44.984 48.731 1.00 10.39 ? 120  GLY A C   1 
ATOM   907  O  O   . GLY A 1 120 ? 64.895 44.609 47.754 1.00 7.21  ? 120  GLY A O   1 
ATOM   908  N  N   . ILE A 1 121 ? 65.158 44.793 49.982 1.00 7.53  ? 121  ILE A N   1 
ATOM   909  C  CA  . ILE A 1 121 ? 63.887 44.163 50.295 1.00 8.52  ? 121  ILE A CA  1 
ATOM   910  C  C   . ILE A 1 121 ? 63.096 45.124 51.180 1.00 8.72  ? 121  ILE A C   1 
ATOM   911  O  O   . ILE A 1 121 ? 63.595 45.584 52.210 1.00 8.74  ? 121  ILE A O   1 
ATOM   912  C  CB  . ILE A 1 121 ? 64.088 42.833 51.063 1.00 8.16  ? 121  ILE A CB  1 
ATOM   913  C  CG1 . ILE A 1 121 ? 64.875 41.833 50.207 1.00 6.96  ? 121  ILE A CG1 1 
ATOM   914  C  CG2 . ILE A 1 121 ? 62.750 42.260 51.490 1.00 9.47  ? 121  ILE A CG2 1 
ATOM   915  C  CD1 . ILE A 1 121 ? 64.136 41.311 48.954 1.00 8.19  ? 121  ILE A CD1 1 
ATOM   916  N  N   . VAL A 1 122 ? 61.874 45.438 50.760 1.00 8.57  ? 122  VAL A N   1 
ATOM   917  C  CA  . VAL A 1 122 ? 60.992 46.298 51.539 1.00 9.02  ? 122  VAL A CA  1 
ATOM   918  C  C   . VAL A 1 122 ? 59.981 45.375 52.220 1.00 10.43 ? 122  VAL A C   1 
ATOM   919  O  O   . VAL A 1 122 ? 59.334 44.541 51.573 1.00 8.69  ? 122  VAL A O   1 
ATOM   920  C  CB  . VAL A 1 122 ? 60.256 47.329 50.646 1.00 7.98  ? 122  VAL A CB  1 
ATOM   921  C  CG1 . VAL A 1 122 ? 59.200 48.077 51.481 1.00 9.94  ? 122  VAL A CG1 1 
ATOM   922  C  CG2 . VAL A 1 122 ? 61.269 48.308 50.046 1.00 9.54  ? 122  VAL A CG2 1 
ATOM   923  N  N   . ILE A 1 123 ? 59.860 45.519 53.536 1.00 7.56  ? 123  ILE A N   1 
ATOM   924  C  CA  . ILE A 1 123 ? 58.970 44.677 54.334 1.00 8.23  ? 123  ILE A CA  1 
ATOM   925  C  C   . ILE A 1 123 ? 57.713 45.457 54.674 1.00 10.25 ? 123  ILE A C   1 
ATOM   926  O  O   . ILE A 1 123 ? 57.773 46.466 55.379 1.00 9.63  ? 123  ILE A O   1 
ATOM   927  C  CB  . ILE A 1 123 ? 59.650 44.282 55.664 1.00 10.66 ? 123  ILE A CB  1 
ATOM   928  C  CG1 . ILE A 1 123 ? 60.994 43.608 55.383 1.00 11.34 ? 123  ILE A CG1 1 
ATOM   929  C  CG2 . ILE A 1 123 ? 58.720 43.350 56.464 1.00 10.53 ? 123  ILE A CG2 1 
ATOM   930  C  CD1 . ILE A 1 123 ? 61.908 43.594 56.605 1.00 11.91 ? 123  ILE A CD1 1 
ATOM   931  N  N   . PRO A 1 124 ? 56.553 45.009 54.173 1.00 8.21  ? 124  PRO A N   1 
ATOM   932  C  CA  . PRO A 1 124 ? 55.347 45.767 54.499 1.00 10.40 ? 124  PRO A CA  1 
ATOM   933  C  C   . PRO A 1 124 ? 54.787 45.546 55.903 1.00 7.93  ? 124  PRO A C   1 
ATOM   934  O  O   . PRO A 1 124 ? 55.078 44.548 56.566 1.00 9.91  ? 124  PRO A O   1 
ATOM   935  C  CB  . PRO A 1 124 ? 54.361 45.341 53.409 1.00 12.78 ? 124  PRO A CB  1 
ATOM   936  C  CG  . PRO A 1 124 ? 54.748 43.919 53.118 1.00 10.48 ? 124  PRO A CG  1 
ATOM   937  C  CD  . PRO A 1 124 ? 56.278 43.899 53.241 1.00 10.66 ? 124  PRO A CD  1 
ATOM   938  N  N   . HIS A 1 125 ? 54.008 46.529 56.347 1.00 9.96  ? 125  HIS A N   1 
ATOM   939  C  CA  . HIS A 1 125 ? 53.305 46.483 57.622 1.00 11.65 ? 125  HIS A CA  1 
ATOM   940  C  C   . HIS A 1 125 ? 54.169 46.151 58.829 1.00 12.11 ? 125  HIS A C   1 
ATOM   941  O  O   . HIS A 1 125 ? 53.751 45.384 59.685 1.00 11.33 ? 125  HIS A O   1 
ATOM   942  C  CB  . HIS A 1 125 ? 52.170 45.459 57.520 1.00 13.06 ? 125  HIS A CB  1 
ATOM   943  C  CG  . HIS A 1 125 ? 51.448 45.501 56.208 1.00 20.42 ? 125  HIS A CG  1 
ATOM   944  N  ND1 . HIS A 1 125 ? 50.611 46.538 55.852 1.00 22.13 ? 125  HIS A ND1 1 
ATOM   945  C  CD2 . HIS A 1 125 ? 51.519 44.686 55.126 1.00 23.88 ? 125  HIS A CD2 1 
ATOM   946  C  CE1 . HIS A 1 125 ? 50.205 46.364 54.605 1.00 25.34 ? 125  HIS A CE1 1 
ATOM   947  N  NE2 . HIS A 1 125 ? 50.742 45.248 54.142 1.00 16.48 ? 125  HIS A NE2 1 
ATOM   948  N  N   . VAL A 1 126 ? 55.358 46.733 58.908 1.00 9.28  ? 126  VAL A N   1 
ATOM   949  C  CA  . VAL A 1 126 ? 56.233 46.449 60.047 1.00 8.68  ? 126  VAL A CA  1 
ATOM   950  C  C   . VAL A 1 126 ? 55.729 47.161 61.295 1.00 9.35  ? 126  VAL A C   1 
ATOM   951  O  O   . VAL A 1 126 ? 55.431 48.354 61.257 1.00 11.21 ? 126  VAL A O   1 
ATOM   952  C  CB  . VAL A 1 126 ? 57.681 46.889 59.752 1.00 8.41  ? 126  VAL A CB  1 
ATOM   953  C  CG1 . VAL A 1 126 ? 58.535 46.788 61.022 1.00 8.93  ? 126  VAL A CG1 1 
ATOM   954  C  CG2 . VAL A 1 126 ? 58.279 45.980 58.698 1.00 9.69  ? 126  VAL A CG2 1 
ATOM   955  N  N   . GLU A 1 127 ? 55.634 46.422 62.397 1.00 9.64  ? 127  GLU A N   1 
ATOM   956  C  CA  . GLU A 1 127 ? 55.169 47.009 63.656 1.00 11.18 ? 127  GLU A CA  1 
ATOM   957  C  C   . GLU A 1 127 ? 56.088 46.702 64.837 1.00 14.25 ? 127  GLU A C   1 
ATOM   958  O  O   . GLU A 1 127 ? 55.997 47.361 65.881 1.00 15.35 ? 127  GLU A O   1 
ATOM   959  C  CB  . GLU A 1 127 ? 53.745 46.527 63.966 1.00 12.62 ? 127  GLU A CB  1 
ATOM   960  C  CG  . GLU A 1 127 ? 52.744 46.891 62.877 1.00 14.72 ? 127  GLU A CG  1 
ATOM   961  C  CD  . GLU A 1 127 ? 51.318 46.524 63.220 1.00 19.27 ? 127  GLU A CD  1 
ATOM   962  O  OE1 . GLU A 1 127 ? 51.111 45.533 63.949 1.00 19.78 ? 127  GLU A OE1 1 
ATOM   963  O  OE2 . GLU A 1 127 ? 50.406 47.224 62.744 1.00 15.19 ? 127  GLU A OE2 1 
ATOM   964  N  N   . THR A 1 128 ? 56.968 45.714 64.675 1.00 13.18 ? 128  THR A N   1 
ATOM   965  C  CA  . THR A 1 128 ? 57.885 45.332 65.750 1.00 15.34 ? 128  THR A CA  1 
ATOM   966  C  C   . THR A 1 128 ? 59.300 45.053 65.263 1.00 15.01 ? 128  THR A C   1 
ATOM   967  O  O   . THR A 1 128 ? 59.528 44.699 64.102 1.00 11.81 ? 128  THR A O   1 
ATOM   968  C  CB  . THR A 1 128 ? 57.408 44.057 66.506 1.00 16.44 ? 128  THR A CB  1 
ATOM   969  O  OG1 . THR A 1 128 ? 57.571 42.906 65.666 1.00 16.32 ? 128  THR A OG1 1 
ATOM   970  C  CG2 . THR A 1 128 ? 55.949 44.172 66.917 1.00 15.09 ? 128  THR A CG2 1 
ATOM   971  N  N   . VAL A 1 129 ? 60.258 45.196 66.170 1.00 15.61 ? 129  VAL A N   1 
ATOM   972  C  CA  . VAL A 1 129 ? 61.639 44.930 65.824 1.00 14.33 ? 129  VAL A CA  1 
ATOM   973  C  C   . VAL A 1 129 ? 61.781 43.432 65.541 1.00 13.27 ? 129  VAL A C   1 
ATOM   974  O  O   . VAL A 1 129 ? 62.592 43.025 64.708 1.00 13.97 ? 129  VAL A O   1 
ATOM   975  C  CB  . VAL A 1 129 ? 62.580 45.362 66.980 1.00 19.72 ? 129  VAL A CB  1 
ATOM   976  C  CG1 . VAL A 1 129 ? 63.984 44.895 66.702 1.00 27.83 ? 129  VAL A CG1 1 
ATOM   977  C  CG2 . VAL A 1 129 ? 62.556 46.877 67.129 1.00 14.63 ? 129  VAL A CG2 1 
ATOM   978  N  N   . GLU A 1 130 ? 60.982 42.610 66.220 1.00 15.11 ? 130  GLU A N   1 
ATOM   979  C  CA  . GLU A 1 130 ? 61.045 41.163 66.005 1.00 14.23 ? 130  GLU A CA  1 
ATOM   980  C  C   . GLU A 1 130 ? 60.682 40.786 64.570 1.00 14.70 ? 130  GLU A C   1 
ATOM   981  O  O   . GLU A 1 130 ? 61.282 39.873 63.994 1.00 17.11 ? 130  GLU A O   1 
ATOM   982  C  CB  . GLU A 1 130 ? 60.102 40.412 66.958 1.00 19.17 ? 130  GLU A CB  1 
ATOM   983  C  CG  . GLU A 1 130 ? 60.505 40.429 68.439 1.00 23.66 ? 130  GLU A CG  1 
ATOM   984  C  CD  . GLU A 1 130 ? 60.306 41.782 69.119 1.00 26.95 ? 130  GLU A CD  1 
ATOM   985  O  OE1 . GLU A 1 130 ? 59.497 42.598 68.637 1.00 19.80 ? 130  GLU A OE1 1 
ATOM   986  O  OE2 . GLU A 1 130 ? 60.953 42.025 70.165 1.00 30.71 ? 130  GLU A OE2 1 
ATOM   987  N  N   . GLU A 1 131 ? 59.699 41.468 63.992 1.00 13.60 ? 131  GLU A N   1 
ATOM   988  C  CA  . GLU A 1 131 ? 59.307 41.151 62.613 1.00 13.14 ? 131  GLU A CA  1 
ATOM   989  C  C   . GLU A 1 131 ? 60.467 41.422 61.664 1.00 13.44 ? 131  GLU A C   1 
ATOM   990  O  O   . GLU A 1 131 ? 60.687 40.681 60.706 1.00 12.72 ? 131  GLU A O   1 
ATOM   991  C  CB  . GLU A 1 131 ? 58.100 41.989 62.178 1.00 14.77 ? 131  GLU A CB  1 
ATOM   992  C  CG  . GLU A 1 131 ? 56.846 41.678 62.973 1.00 19.26 ? 131  GLU A CG  1 
ATOM   993  C  CD  . GLU A 1 131 ? 55.696 42.601 62.649 1.00 25.62 ? 131  GLU A CD  1 
ATOM   994  O  OE1 . GLU A 1 131 ? 55.933 43.796 62.392 1.00 22.04 ? 131  GLU A OE1 1 
ATOM   995  O  OE2 . GLU A 1 131 ? 54.543 42.125 62.666 1.00 30.65 ? 131  GLU A OE2 1 
ATOM   996  N  N   . VAL A 1 132 ? 61.203 42.496 61.930 1.00 12.14 ? 132  VAL A N   1 
ATOM   997  C  CA  . VAL A 1 132 ? 62.334 42.837 61.085 1.00 13.80 ? 132  VAL A CA  1 
ATOM   998  C  C   . VAL A 1 132 ? 63.451 41.810 61.262 1.00 12.15 ? 132  VAL A C   1 
ATOM   999  O  O   . VAL A 1 132 ? 64.092 41.408 60.295 1.00 13.68 ? 132  VAL A O   1 
ATOM   1000 C  CB  . VAL A 1 132 ? 62.865 44.251 61.411 1.00 11.54 ? 132  VAL A CB  1 
ATOM   1001 C  CG1 . VAL A 1 132 ? 64.068 44.569 60.533 1.00 12.21 ? 132  VAL A CG1 1 
ATOM   1002 C  CG2 . VAL A 1 132 ? 61.758 45.283 61.192 1.00 10.68 ? 132  VAL A CG2 1 
ATOM   1003 N  N   . ARG A 1 133 ? 63.687 41.369 62.491 1.00 13.48 ? 133  ARG A N   1 
ATOM   1004 C  CA  . ARG A 1 133 ? 64.745 40.393 62.704 1.00 15.45 ? 133  ARG A CA  1 
ATOM   1005 C  C   . ARG A 1 133 ? 64.456 39.039 62.060 1.00 14.21 ? 133  ARG A C   1 
ATOM   1006 O  O   . ARG A 1 133 ? 65.379 38.283 61.767 1.00 15.83 ? 133  ARG A O   1 
ATOM   1007 C  CB  . ARG A 1 133 ? 65.064 40.273 64.200 1.00 13.91 ? 133  ARG A CB  1 
ATOM   1008 C  CG  . ARG A 1 133 ? 65.651 41.592 64.690 1.00 18.98 ? 133  ARG A CG  1 
ATOM   1009 C  CD  . ARG A 1 133 ? 66.396 41.546 66.009 1.00 26.00 ? 133  ARG A CD  1 
ATOM   1010 N  NE  . ARG A 1 133 ? 67.153 42.792 66.118 1.00 31.48 ? 133  ARG A NE  1 
ATOM   1011 C  CZ  . ARG A 1 133 ? 66.947 43.736 67.032 1.00 33.20 ? 133  ARG A CZ  1 
ATOM   1012 N  NH1 . ARG A 1 133 ? 66.007 43.580 67.957 1.00 29.50 ? 133  ARG A NH1 1 
ATOM   1013 N  NH2 . ARG A 1 133 ? 67.647 44.867 66.978 1.00 25.72 ? 133  ARG A NH2 1 
ATOM   1014 N  N   . GLU A 1 134 ? 63.184 38.736 61.818 1.00 15.14 ? 134  GLU A N   1 
ATOM   1015 C  CA  . GLU A 1 134 ? 62.857 37.484 61.147 1.00 14.92 ? 134  GLU A CA  1 
ATOM   1016 C  C   . GLU A 1 134 ? 63.343 37.601 59.707 1.00 13.66 ? 134  GLU A C   1 
ATOM   1017 O  O   . GLU A 1 134 ? 63.795 36.618 59.111 1.00 12.76 ? 134  GLU A O   1 
ATOM   1018 C  CB  . GLU A 1 134 ? 61.353 37.210 61.190 1.00 19.10 ? 134  GLU A CB  1 
ATOM   1019 C  CG  . GLU A 1 134 ? 60.886 36.706 62.545 1.00 24.25 ? 134  GLU A CG  1 
ATOM   1020 C  CD  . GLU A 1 134 ? 61.676 35.484 63.015 1.00 31.54 ? 134  GLU A CD  1 
ATOM   1021 O  OE1 . GLU A 1 134 ? 61.665 34.446 62.312 1.00 26.82 ? 134  GLU A OE1 1 
ATOM   1022 O  OE2 . GLU A 1 134 ? 62.314 35.566 64.086 1.00 33.75 ? 134  GLU A OE2 1 
ATOM   1023 N  N   . PHE A 1 135 ? 63.265 38.807 59.143 1.00 13.45 ? 135  PHE A N   1 
ATOM   1024 C  CA  . PHE A 1 135 ? 63.749 38.999 57.779 1.00 13.60 ? 135  PHE A CA  1 
ATOM   1025 C  C   . PHE A 1 135 ? 65.269 38.983 57.759 1.00 12.44 ? 135  PHE A C   1 
ATOM   1026 O  O   . PHE A 1 135 ? 65.882 38.480 56.823 1.00 13.75 ? 135  PHE A O   1 
ATOM   1027 C  CB  . PHE A 1 135 ? 63.234 40.312 57.162 1.00 12.95 ? 135  PHE A CB  1 
ATOM   1028 C  CG  . PHE A 1 135 ? 61.914 40.158 56.457 1.00 12.63 ? 135  PHE A CG  1 
ATOM   1029 C  CD1 . PHE A 1 135 ? 60.717 40.180 57.176 1.00 11.51 ? 135  PHE A CD1 1 
ATOM   1030 C  CD2 . PHE A 1 135 ? 61.873 39.903 55.091 1.00 15.70 ? 135  PHE A CD2 1 
ATOM   1031 C  CE1 . PHE A 1 135 ? 59.497 39.939 56.541 1.00 9.75  ? 135  PHE A CE1 1 
ATOM   1032 C  CE2 . PHE A 1 135 ? 60.652 39.661 54.443 1.00 14.50 ? 135  PHE A CE2 1 
ATOM   1033 C  CZ  . PHE A 1 135 ? 59.471 39.676 55.164 1.00 12.39 ? 135  PHE A CZ  1 
ATOM   1034 N  N   . VAL A 1 136 ? 65.896 39.534 58.790 1.00 10.60 ? 136  VAL A N   1 
ATOM   1035 C  CA  . VAL A 1 136 ? 67.350 39.500 58.812 1.00 11.61 ? 136  VAL A CA  1 
ATOM   1036 C  C   . VAL A 1 136 ? 67.807 38.038 58.760 1.00 11.84 ? 136  VAL A C   1 
ATOM   1037 O  O   . VAL A 1 136 ? 68.726 37.691 58.011 1.00 13.53 ? 136  VAL A O   1 
ATOM   1038 C  CB  . VAL A 1 136 ? 67.894 40.183 60.073 1.00 11.21 ? 136  VAL A CB  1 
ATOM   1039 C  CG1 . VAL A 1 136 ? 69.419 40.030 60.153 1.00 12.54 ? 136  VAL A CG1 1 
ATOM   1040 C  CG2 . VAL A 1 136 ? 67.517 41.649 60.048 1.00 13.09 ? 136  VAL A CG2 1 
ATOM   1041 N  N   . LYS A 1 137 ? 67.151 37.171 59.528 1.00 12.54 ? 137  LYS A N   1 
ATOM   1042 C  CA  . LYS A 1 137 ? 67.529 35.756 59.542 1.00 12.09 ? 137  LYS A CA  1 
ATOM   1043 C  C   . LYS A 1 137 ? 67.455 35.108 58.164 1.00 12.88 ? 137  LYS A C   1 
ATOM   1044 O  O   . LYS A 1 137 ? 68.330 34.325 57.793 1.00 14.28 ? 137  LYS A O   1 
ATOM   1045 C  CB  . LYS A 1 137 ? 66.634 34.954 60.502 1.00 16.79 ? 137  LYS A CB  1 
ATOM   1046 C  CG  . LYS A 1 137 ? 66.775 35.316 61.974 1.00 19.99 ? 137  LYS A CG  1 
ATOM   1047 C  CD  . LYS A 1 137 ? 65.761 34.527 62.803 1.00 26.98 ? 137  LYS A CD  1 
ATOM   1048 C  CE  . LYS A 1 137 ? 65.751 34.972 64.265 1.00 28.90 ? 137  LYS A CE  1 
ATOM   1049 N  NZ  . LYS A 1 137 ? 64.601 34.358 65.003 1.00 28.11 ? 137  LYS A NZ  1 
ATOM   1050 N  N   . GLU A 1 138 ? 66.415 35.437 57.402 1.00 12.74 ? 138  GLU A N   1 
ATOM   1051 C  CA  . GLU A 1 138 ? 66.237 34.838 56.082 1.00 12.82 ? 138  GLU A CA  1 
ATOM   1052 C  C   . GLU A 1 138 ? 66.989 35.522 54.945 1.00 11.45 ? 138  GLU A C   1 
ATOM   1053 O  O   . GLU A 1 138 ? 67.209 34.918 53.890 1.00 12.99 ? 138  GLU A O   1 
ATOM   1054 C  CB  . GLU A 1 138 ? 64.747 34.802 55.726 1.00 17.32 ? 138  GLU A CB  1 
ATOM   1055 C  CG  . GLU A 1 138 ? 63.894 33.932 56.642 1.00 25.78 ? 138  GLU A CG  1 
ATOM   1056 C  CD  . GLU A 1 138 ? 64.375 32.493 56.679 1.00 38.01 ? 138  GLU A CD  1 
ATOM   1057 O  OE1 . GLU A 1 138 ? 64.644 31.926 55.595 1.00 47.26 ? 138  GLU A OE1 1 
ATOM   1058 O  OE2 . GLU A 1 138 ? 64.482 31.927 57.788 1.00 42.74 ? 138  GLU A OE2 1 
ATOM   1059 N  N   . MET A 1 139 ? 67.385 36.770 55.158 1.00 11.52 ? 139  MET A N   1 
ATOM   1060 C  CA  . MET A 1 139 ? 68.053 37.553 54.121 1.00 10.24 ? 139  MET A CA  1 
ATOM   1061 C  C   . MET A 1 139 ? 69.562 37.482 54.052 1.00 11.88 ? 139  MET A C   1 
ATOM   1062 O  O   . MET A 1 139 ? 70.165 37.750 53.009 1.00 10.68 ? 139  MET A O   1 
ATOM   1063 C  CB  . MET A 1 139 ? 67.665 39.019 54.265 1.00 10.18 ? 139  MET A CB  1 
ATOM   1064 C  CG  . MET A 1 139 ? 66.262 39.343 53.795 1.00 11.32 ? 139  MET A CG  1 
ATOM   1065 S  SD  . MET A 1 139 ? 65.815 41.067 54.062 1.00 10.38 ? 139  MET A SD  1 
ATOM   1066 C  CE  . MET A 1 139 ? 67.029 41.903 52.962 1.00 8.19  ? 139  MET A CE  1 
ATOM   1067 N  N   . TYR A 1 140 ? 70.186 37.135 55.164 1.00 10.67 ? 140  TYR A N   1 
ATOM   1068 C  CA  . TYR A 1 140 ? 71.632 37.112 55.191 1.00 10.58 ? 140  TYR A CA  1 
ATOM   1069 C  C   . TYR A 1 140 ? 72.185 35.778 55.625 1.00 9.52  ? 140  TYR A C   1 
ATOM   1070 O  O   . TYR A 1 140 ? 71.581 35.077 56.439 1.00 10.77 ? 140  TYR A O   1 
ATOM   1071 C  CB  . TYR A 1 140 ? 72.148 38.218 56.125 1.00 9.99  ? 140  TYR A CB  1 
ATOM   1072 C  CG  . TYR A 1 140 ? 71.694 39.610 55.726 1.00 12.28 ? 140  TYR A CG  1 
ATOM   1073 C  CD1 . TYR A 1 140 ? 70.524 40.164 56.249 1.00 10.27 ? 140  TYR A CD1 1 
ATOM   1074 C  CD2 . TYR A 1 140 ? 72.420 40.357 54.797 1.00 11.66 ? 140  TYR A CD2 1 
ATOM   1075 C  CE1 . TYR A 1 140 ? 70.084 41.434 55.855 1.00 10.95 ? 140  TYR A CE1 1 
ATOM   1076 C  CE2 . TYR A 1 140 ? 71.989 41.621 54.391 1.00 12.84 ? 140  TYR A CE2 1 
ATOM   1077 C  CZ  . TYR A 1 140 ? 70.822 42.155 54.924 1.00 10.39 ? 140  TYR A CZ  1 
ATOM   1078 O  OH  . TYR A 1 140 ? 70.406 43.405 54.506 1.00 10.05 ? 140  TYR A OH  1 
ATOM   1079 N  N   . TYR A 1 141 ? 73.337 35.431 55.064 1.00 11.03 ? 141  TYR A N   1 
ATOM   1080 C  CA  . TYR A 1 141 ? 74.009 34.186 55.411 1.00 11.24 ? 141  TYR A CA  1 
ATOM   1081 C  C   . TYR A 1 141 ? 74.669 34.319 56.775 1.00 10.55 ? 141  TYR A C   1 
ATOM   1082 O  O   . TYR A 1 141 ? 74.905 35.425 57.255 1.00 12.28 ? 141  TYR A O   1 
ATOM   1083 C  CB  . TYR A 1 141 ? 75.105 33.881 54.390 1.00 9.78  ? 141  TYR A CB  1 
ATOM   1084 C  CG  . TYR A 1 141 ? 74.592 33.683 52.991 1.00 11.29 ? 141  TYR A CG  1 
ATOM   1085 C  CD1 . TYR A 1 141 ? 73.846 32.558 52.663 1.00 13.57 ? 141  TYR A CD1 1 
ATOM   1086 C  CD2 . TYR A 1 141 ? 74.865 34.614 51.992 1.00 13.11 ? 141  TYR A CD2 1 
ATOM   1087 C  CE1 . TYR A 1 141 ? 73.383 32.356 51.370 1.00 16.20 ? 141  TYR A CE1 1 
ATOM   1088 C  CE2 . TYR A 1 141 ? 74.406 34.422 50.696 1.00 13.18 ? 141  TYR A CE2 1 
ATOM   1089 C  CZ  . TYR A 1 141 ? 73.672 33.296 50.395 1.00 15.23 ? 141  TYR A CZ  1 
ATOM   1090 O  OH  . TYR A 1 141 ? 73.247 33.097 49.109 1.00 15.15 ? 141  TYR A OH  1 
ATOM   1091 N  N   . GLY A 1 142 ? 74.950 33.185 57.399 1.00 13.96 ? 142  GLY A N   1 
ATOM   1092 C  CA  . GLY A 1 142 ? 75.641 33.222 58.673 1.00 12.82 ? 142  GLY A CA  1 
ATOM   1093 C  C   . GLY A 1 142 ? 76.970 33.909 58.411 1.00 16.15 ? 142  GLY A C   1 
ATOM   1094 O  O   . GLY A 1 142 ? 77.499 33.835 57.298 1.00 17.76 ? 142  GLY A O   1 
ATOM   1095 N  N   . PRO A 1 143 ? 77.566 34.559 59.418 1.00 18.21 ? 143  PRO A N   1 
ATOM   1096 C  CA  . PRO A 1 143 ? 77.101 34.703 60.799 1.00 17.66 ? 143  PRO A CA  1 
ATOM   1097 C  C   . PRO A 1 143 ? 75.973 35.706 61.053 1.00 17.63 ? 143  PRO A C   1 
ATOM   1098 O  O   . PRO A 1 143 ? 75.477 35.802 62.168 1.00 18.67 ? 143  PRO A O   1 
ATOM   1099 C  CB  . PRO A 1 143 ? 78.378 35.093 61.539 1.00 16.44 ? 143  PRO A CB  1 
ATOM   1100 C  CG  . PRO A 1 143 ? 79.075 35.955 60.524 1.00 18.09 ? 143  PRO A CG  1 
ATOM   1101 C  CD  . PRO A 1 143 ? 78.890 35.188 59.234 1.00 19.17 ? 143  PRO A CD  1 
ATOM   1102 N  N   . ILE A 1 144 ? 75.557 36.445 60.032 1.00 15.52 ? 144  ILE A N   1 
ATOM   1103 C  CA  . ILE A 1 144 ? 74.509 37.440 60.227 1.00 17.20 ? 144  ILE A CA  1 
ATOM   1104 C  C   . ILE A 1 144 ? 73.125 36.818 60.372 1.00 18.63 ? 144  ILE A C   1 
ATOM   1105 O  O   . ILE A 1 144 ? 72.354 37.182 61.272 1.00 20.93 ? 144  ILE A O   1 
ATOM   1106 C  CB  . ILE A 1 144 ? 74.504 38.457 59.066 1.00 17.75 ? 144  ILE A CB  1 
ATOM   1107 C  CG1 . ILE A 1 144 ? 75.883 39.124 58.974 1.00 21.82 ? 144  ILE A CG1 1 
ATOM   1108 C  CG2 . ILE A 1 144 ? 73.390 39.487 59.275 1.00 18.15 ? 144  ILE A CG2 1 
ATOM   1109 C  CD1 . ILE A 1 144 ? 76.017 40.141 57.850 1.00 23.95 ? 144  ILE A CD1 1 
ATOM   1110 N  N   . GLY A 1 145 ? 72.811 35.875 59.495 1.00 16.37 ? 145  GLY A N   1 
ATOM   1111 C  CA  . GLY A 1 145 ? 71.518 35.226 59.552 1.00 18.25 ? 145  GLY A CA  1 
ATOM   1112 C  C   . GLY A 1 145 ? 71.645 33.742 59.283 1.00 16.82 ? 145  GLY A C   1 
ATOM   1113 O  O   . GLY A 1 145 ? 72.661 33.130 59.618 1.00 14.96 ? 145  GLY A O   1 
ATOM   1114 N  N   . ARG A 1 146 ? 70.621 33.154 58.674 1.00 11.20 ? 146  ARG A N   1 
ATOM   1115 C  CA  . ARG A 1 146 ? 70.652 31.736 58.364 1.00 15.49 ? 146  ARG A CA  1 
ATOM   1116 C  C   . ARG A 1 146 ? 70.103 31.471 56.976 1.00 14.20 ? 146  ARG A C   1 
ATOM   1117 O  O   . ARG A 1 146 ? 69.588 30.390 56.686 1.00 14.22 ? 146  ARG A O   1 
ATOM   1118 C  CB  . ARG A 1 146 ? 69.873 30.939 59.413 1.00 24.02 ? 146  ARG A CB  1 
ATOM   1119 C  CG  . ARG A 1 146 ? 68.452 31.391 59.648 1.00 30.34 ? 146  ARG A CG  1 
ATOM   1120 C  CD  . ARG A 1 146 ? 67.933 30.792 60.958 1.00 41.36 ? 146  ARG A CD  1 
ATOM   1121 N  NE  . ARG A 1 146 ? 66.584 31.248 61.277 1.00 47.83 ? 146  ARG A NE  1 
ATOM   1122 C  CZ  . ARG A 1 146 ? 65.511 30.950 60.554 1.00 46.31 ? 146  ARG A CZ  1 
ATOM   1123 N  NH1 . ARG A 1 146 ? 65.633 30.190 59.473 1.00 45.61 ? 146  ARG A NH1 1 
ATOM   1124 N  NH2 . ARG A 1 146 ? 64.320 31.420 60.904 1.00 46.99 ? 146  ARG A NH2 1 
ATOM   1125 N  N   . ARG A 1 147 ? 70.226 32.473 56.113 1.00 11.77 ? 147  ARG A N   1 
ATOM   1126 C  CA  . ARG A 1 147 ? 69.754 32.344 54.740 1.00 12.28 ? 147  ARG A CA  1 
ATOM   1127 C  C   . ARG A 1 147 ? 70.338 31.086 54.115 1.00 12.81 ? 147  ARG A C   1 
ATOM   1128 O  O   . ARG A 1 147 ? 71.514 30.770 54.297 1.00 12.19 ? 147  ARG A O   1 
ATOM   1129 C  CB  . ARG A 1 147 ? 70.169 33.564 53.912 1.00 11.50 ? 147  ARG A CB  1 
ATOM   1130 C  CG  . ARG A 1 147 ? 69.822 33.434 52.415 1.00 14.87 ? 147  ARG A CG  1 
ATOM   1131 C  CD  . ARG A 1 147 ? 70.292 34.643 51.620 1.00 12.97 ? 147  ARG A CD  1 
ATOM   1132 N  NE  . ARG A 1 147 ? 70.102 34.441 50.183 1.00 11.81 ? 147  ARG A NE  1 
ATOM   1133 C  CZ  . ARG A 1 147 ? 70.617 35.233 49.243 1.00 14.99 ? 147  ARG A CZ  1 
ATOM   1134 N  NH1 . ARG A 1 147 ? 71.341 36.283 49.591 1.00 14.89 ? 147  ARG A NH1 1 
ATOM   1135 N  NH2 . ARG A 1 147 ? 70.438 34.954 47.959 1.00 13.18 ? 147  ARG A NH2 1 
ATOM   1136 N  N   . SER A 1 148 ? 69.500 30.371 53.371 1.00 13.47 ? 148  SER A N   1 
ATOM   1137 C  CA  . SER A 1 148 ? 69.919 29.155 52.702 1.00 11.79 ? 148  SER A CA  1 
ATOM   1138 C  C   . SER A 1 148 ? 70.626 29.483 51.397 1.00 16.51 ? 148  SER A C   1 
ATOM   1139 O  O   . SER A 1 148 ? 70.167 30.310 50.607 1.00 15.15 ? 148  SER A O   1 
ATOM   1140 C  CB  . SER A 1 148 ? 68.707 28.267 52.423 1.00 14.70 ? 148  SER A CB  1 
ATOM   1141 O  OG  . SER A 1 148 ? 69.103 27.081 51.767 1.00 12.39 ? 148  SER A OG  1 
ATOM   1142 N  N   . PHE A 1 149 ? 71.737 28.802 51.170 1.00 13.40 ? 149  PHE A N   1 
ATOM   1143 C  CA  . PHE A 1 149 ? 72.544 28.996 49.982 1.00 17.78 ? 149  PHE A CA  1 
ATOM   1144 C  C   . PHE A 1 149 ? 72.003 28.178 48.793 1.00 20.58 ? 149  PHE A C   1 
ATOM   1145 O  O   . PHE A 1 149 ? 71.852 26.960 48.894 1.00 22.45 ? 149  PHE A O   1 
ATOM   1146 C  CB  . PHE A 1 149 ? 73.972 28.569 50.314 1.00 22.91 ? 149  PHE A CB  1 
ATOM   1147 C  CG  . PHE A 1 149 ? 74.967 28.940 49.275 1.00 21.30 ? 149  PHE A CG  1 
ATOM   1148 C  CD1 . PHE A 1 149 ? 75.524 30.216 49.255 1.00 27.00 ? 149  PHE A CD1 1 
ATOM   1149 C  CD2 . PHE A 1 149 ? 75.333 28.026 48.293 1.00 29.42 ? 149  PHE A CD2 1 
ATOM   1150 C  CE1 . PHE A 1 149 ? 76.439 30.584 48.262 1.00 26.68 ? 149  PHE A CE1 1 
ATOM   1151 C  CE2 . PHE A 1 149 ? 76.246 28.384 47.298 1.00 27.41 ? 149  PHE A CE2 1 
ATOM   1152 C  CZ  . PHE A 1 149 ? 76.797 29.666 47.286 1.00 26.68 ? 149  PHE A CZ  1 
ATOM   1153 N  N   . SER A 1 150 ? 71.714 28.839 47.674 1.00 15.58 ? 150  SER A N   1 
ATOM   1154 C  CA  . SER A 1 150 ? 71.205 28.143 46.490 1.00 16.60 ? 150  SER A CA  1 
ATOM   1155 C  C   . SER A 1 150 ? 72.343 27.684 45.598 1.00 21.19 ? 150  SER A C   1 
ATOM   1156 O  O   . SER A 1 150 ? 73.280 28.433 45.348 1.00 23.88 ? 150  SER A O   1 
ATOM   1157 C  CB  . SER A 1 150 ? 70.293 29.050 45.661 1.00 16.86 ? 150  SER A CB  1 
ATOM   1158 O  OG  . SER A 1 150 ? 69.935 28.432 44.430 1.00 15.37 ? 150  SER A OG  1 
ATOM   1159 N  N   . PRO A 1 151 ? 72.268 26.446 45.098 1.00 18.25 ? 151  PRO A N   1 
ATOM   1160 C  CA  . PRO A 1 151 ? 73.332 25.951 44.229 1.00 22.02 ? 151  PRO A CA  1 
ATOM   1161 C  C   . PRO A 1 151 ? 73.118 26.335 42.770 1.00 21.54 ? 151  PRO A C   1 
ATOM   1162 O  O   . PRO A 1 151 ? 74.081 26.394 42.002 1.00 24.75 ? 151  PRO A O   1 
ATOM   1163 C  CB  . PRO A 1 151 ? 73.253 24.441 44.431 1.00 22.09 ? 151  PRO A CB  1 
ATOM   1164 C  CG  . PRO A 1 151 ? 71.773 24.219 44.523 1.00 21.04 ? 151  PRO A CG  1 
ATOM   1165 C  CD  . PRO A 1 151 ? 71.338 25.356 45.458 1.00 20.75 ? 151  PRO A CD  1 
ATOM   1166 N  N   . TRP A 1 152 ? 71.868 26.627 42.397 1.00 17.83 ? 152  TRP A N   1 
ATOM   1167 C  CA  . TRP A 1 152 ? 71.531 26.921 41.004 1.00 18.67 ? 152  TRP A CA  1 
ATOM   1168 C  C   . TRP A 1 152 ? 71.760 28.335 40.471 1.00 17.77 ? 152  TRP A C   1 
ATOM   1169 O  O   . TRP A 1 152 ? 71.551 28.575 39.283 1.00 22.31 ? 152  TRP A O   1 
ATOM   1170 C  CB  . TRP A 1 152 ? 70.068 26.565 40.721 1.00 18.51 ? 152  TRP A CB  1 
ATOM   1171 C  CG  . TRP A 1 152 ? 69.523 25.388 41.484 1.00 23.00 ? 152  TRP A CG  1 
ATOM   1172 C  CD1 . TRP A 1 152 ? 68.715 25.431 42.585 1.00 22.59 ? 152  TRP A CD1 1 
ATOM   1173 C  CD2 . TRP A 1 152 ? 69.713 24.002 41.181 1.00 25.12 ? 152  TRP A CD2 1 
ATOM   1174 N  NE1 . TRP A 1 152 ? 68.386 24.158 42.985 1.00 21.60 ? 152  TRP A NE1 1 
ATOM   1175 C  CE2 . TRP A 1 152 ? 68.986 23.260 42.143 1.00 19.93 ? 152  TRP A CE2 1 
ATOM   1176 C  CE3 . TRP A 1 152 ? 70.421 23.312 40.188 1.00 29.52 ? 152  TRP A CE3 1 
ATOM   1177 C  CZ2 . TRP A 1 152 ? 68.948 21.862 42.141 1.00 27.80 ? 152  TRP A CZ2 1 
ATOM   1178 C  CZ3 . TRP A 1 152 ? 70.383 21.913 40.185 1.00 30.83 ? 152  TRP A CZ3 1 
ATOM   1179 C  CH2 . TRP A 1 152 ? 69.650 21.207 41.158 1.00 27.31 ? 152  TRP A CH2 1 
ATOM   1180 N  N   . THR A 1 153 ? 72.186 29.251 41.330 1.00 17.77 ? 153  THR A N   1 
ATOM   1181 C  CA  . THR A 1 153 ? 72.393 30.643 40.927 1.00 17.52 ? 153  THR A CA  1 
ATOM   1182 C  C   . THR A 1 153 ? 73.720 30.897 40.231 1.00 19.89 ? 153  THR A C   1 
ATOM   1183 O  O   . THR A 1 153 ? 73.896 31.920 39.566 1.00 15.66 ? 153  THR A O   1 
ATOM   1184 C  CB  . THR A 1 153 ? 72.330 31.580 42.138 1.00 18.88 ? 153  THR A CB  1 
ATOM   1185 O  OG1 . THR A 1 153 ? 73.333 31.191 43.088 1.00 25.72 ? 153  THR A OG1 1 
ATOM   1186 C  CG2 . THR A 1 153 ? 70.955 31.510 42.796 1.00 20.57 ? 153  THR A CG2 1 
ATOM   1187 N  N   . PHE A 1 154 ? 74.653 29.969 40.387 1.00 18.54 ? 154  PHE A N   1 
ATOM   1188 C  CA  . PHE A 1 154 ? 75.972 30.126 39.791 1.00 15.63 ? 154  PHE A CA  1 
ATOM   1189 C  C   . PHE A 1 154 ? 76.520 28.782 39.348 1.00 14.43 ? 154  PHE A C   1 
ATOM   1190 O  O   . PHE A 1 154 ? 75.855 27.760 39.469 1.00 14.32 ? 154  PHE A O   1 
ATOM   1191 C  CB  . PHE A 1 154 ? 76.924 30.751 40.808 1.00 15.32 ? 154  PHE A CB  1 
ATOM   1192 C  CG  . PHE A 1 154 ? 77.215 29.860 41.989 1.00 17.82 ? 154  PHE A CG  1 
ATOM   1193 C  CD1 . PHE A 1 154 ? 76.207 29.519 42.886 1.00 20.82 ? 154  PHE A CD1 1 
ATOM   1194 C  CD2 . PHE A 1 154 ? 78.486 29.326 42.178 1.00 17.29 ? 154  PHE A CD2 1 
ATOM   1195 C  CE1 . PHE A 1 154 ? 76.460 28.658 43.952 1.00 19.22 ? 154  PHE A CE1 1 
ATOM   1196 C  CE2 . PHE A 1 154 ? 78.750 28.461 43.245 1.00 18.64 ? 154  PHE A CE2 1 
ATOM   1197 C  CZ  . PHE A 1 154 ? 77.731 28.128 44.133 1.00 18.83 ? 154  PHE A CZ  1 
ATOM   1198 N  N   . SER A 1 155 ? 77.740 28.793 38.830 1.00 12.80 ? 155  SER A N   1 
ATOM   1199 C  CA  . SER A 1 155 ? 78.381 27.569 38.378 1.00 14.03 ? 155  SER A CA  1 
ATOM   1200 C  C   . SER A 1 155 ? 79.833 27.629 38.826 1.00 13.73 ? 155  SER A C   1 
ATOM   1201 O  O   . SER A 1 155 ? 80.615 28.428 38.321 1.00 12.21 ? 155  SER A O   1 
ATOM   1202 C  CB  . SER A 1 155 ? 78.309 27.457 36.855 1.00 14.78 ? 155  SER A CB  1 
ATOM   1203 O  OG  . SER A 1 155 ? 78.841 26.215 36.437 1.00 11.35 ? 155  SER A OG  1 
ATOM   1204 N  N   . PRO A 1 156 ? 80.207 26.787 39.798 1.00 16.47 ? 156  PRO A N   1 
ATOM   1205 C  CA  . PRO A 1 156 ? 81.576 26.749 40.323 1.00 18.52 ? 156  PRO A CA  1 
ATOM   1206 C  C   . PRO A 1 156 ? 82.656 26.665 39.248 1.00 17.10 ? 156  PRO A C   1 
ATOM   1207 O  O   . PRO A 1 156 ? 82.616 25.771 38.398 1.00 17.54 ? 156  PRO A O   1 
ATOM   1208 C  CB  . PRO A 1 156 ? 81.560 25.509 41.224 1.00 16.09 ? 156  PRO A CB  1 
ATOM   1209 C  CG  . PRO A 1 156 ? 80.165 25.519 41.747 1.00 16.79 ? 156  PRO A CG  1 
ATOM   1210 C  CD  . PRO A 1 156 ? 79.354 25.809 40.493 1.00 18.29 ? 156  PRO A CD  1 
ATOM   1211 N  N   . GLY A 1 157 ? 83.600 27.609 39.297 1.00 15.36 ? 157  GLY A N   1 
ATOM   1212 C  CA  . GLY A 1 157 ? 84.716 27.664 38.362 1.00 15.50 ? 157  GLY A CA  1 
ATOM   1213 C  C   . GLY A 1 157 ? 84.399 28.124 36.951 1.00 17.46 ? 157  GLY A C   1 
ATOM   1214 O  O   . GLY A 1 157 ? 85.288 28.192 36.094 1.00 15.93 ? 157  GLY A O   1 
ATOM   1215 N  N   . ILE A 1 158 ? 83.135 28.472 36.725 1.00 13.94 ? 158  ILE A N   1 
ATOM   1216 C  CA  . ILE A 1 158 ? 82.648 28.873 35.411 1.00 13.77 ? 158  ILE A CA  1 
ATOM   1217 C  C   . ILE A 1 158 ? 81.950 30.226 35.440 1.00 13.53 ? 158  ILE A C   1 
ATOM   1218 O  O   . ILE A 1 158 ? 82.257 31.107 34.640 1.00 14.02 ? 158  ILE A O   1 
ATOM   1219 C  CB  . ILE A 1 158 ? 81.690 27.775 34.886 1.00 12.20 ? 158  ILE A CB  1 
ATOM   1220 C  CG1 . ILE A 1 158 ? 82.498 26.504 34.616 1.00 14.44 ? 158  ILE A CG1 1 
ATOM   1221 C  CG2 . ILE A 1 158 ? 80.923 28.257 33.653 1.00 13.61 ? 158  ILE A CG2 1 
ATOM   1222 C  CD1 . ILE A 1 158 ? 81.655 25.278 34.365 1.00 13.04 ? 158  ILE A CD1 1 
ATOM   1223 N  N   . ALA A 1 159 ? 81.000 30.375 36.355 1.00 11.46 ? 159  ALA A N   1 
ATOM   1224 C  CA  . ALA A 1 159 ? 80.272 31.627 36.518 1.00 13.55 ? 159  ALA A CA  1 
ATOM   1225 C  C   . ALA A 1 159 ? 80.119 31.827 38.017 1.00 13.06 ? 159  ALA A C   1 
ATOM   1226 O  O   . ALA A 1 159 ? 79.112 31.435 38.598 1.00 13.64 ? 159  ALA A O   1 
ATOM   1227 C  CB  . ALA A 1 159 ? 78.893 31.540 35.841 1.00 16.27 ? 159  ALA A CB  1 
ATOM   1228 N  N   . ASP A 1 160 ? 81.141 32.413 38.638 1.00 11.72 ? 160  ASP A N   1 
ATOM   1229 C  CA  . ASP A 1 160 ? 81.143 32.646 40.079 1.00 13.83 ? 160  ASP A CA  1 
ATOM   1230 C  C   . ASP A 1 160 ? 81.958 33.868 40.482 1.00 16.12 ? 160  ASP A C   1 
ATOM   1231 O  O   . ASP A 1 160 ? 82.413 33.973 41.621 1.00 15.29 ? 160  ASP A O   1 
ATOM   1232 C  CB  . ASP A 1 160 ? 81.684 31.406 40.818 1.00 14.13 ? 160  ASP A CB  1 
ATOM   1233 C  CG  . ASP A 1 160 ? 83.118 31.029 40.400 1.00 17.35 ? 160  ASP A CG  1 
ATOM   1234 O  OD1 . ASP A 1 160 ? 83.766 31.800 39.660 1.00 13.00 ? 160  ASP A OD1 1 
ATOM   1235 O  OD2 . ASP A 1 160 ? 83.607 29.954 40.841 1.00 18.25 ? 160  ASP A OD2 1 
ATOM   1236 N  N   . ALA A 1 161 ? 82.121 34.811 39.563 1.00 13.56 ? 161  ALA A N   1 
ATOM   1237 C  CA  . ALA A 1 161 ? 82.903 36.007 39.850 1.00 12.65 ? 161  ALA A CA  1 
ATOM   1238 C  C   . ALA A 1 161 ? 82.278 36.861 40.940 1.00 13.96 ? 161  ALA A C   1 
ATOM   1239 O  O   . ALA A 1 161 ? 81.065 36.939 41.060 1.00 10.86 ? 161  ALA A O   1 
ATOM   1240 C  CB  . ALA A 1 161 ? 83.082 36.835 38.578 1.00 14.63 ? 161  ALA A CB  1 
ATOM   1241 N  N   . SER A 1 162 ? 83.132 37.511 41.722 1.00 12.64 ? 162  SER A N   1 
ATOM   1242 C  CA  . SER A 1 162 ? 82.691 38.375 42.817 1.00 12.73 ? 162  SER A CA  1 
ATOM   1243 C  C   . SER A 1 162 ? 83.649 39.559 42.904 1.00 11.68 ? 162  SER A C   1 
ATOM   1244 O  O   . SER A 1 162 ? 84.801 39.463 42.482 1.00 13.82 ? 162  SER A O   1 
ATOM   1245 C  CB  . SER A 1 162 ? 82.721 37.606 44.147 1.00 12.49 ? 162  SER A CB  1 
ATOM   1246 O  OG  . SER A 1 162 ? 82.560 38.493 45.254 1.00 10.14 ? 162  SER A OG  1 
ATOM   1247 N  N   . LEU A 1 163 ? 83.178 40.674 43.447 1.00 14.44 ? 163  LEU A N   1 
ATOM   1248 C  CA  . LEU A 1 163 ? 84.032 41.849 43.611 1.00 12.33 ? 163  LEU A CA  1 
ATOM   1249 C  C   . LEU A 1 163 ? 84.927 41.642 44.820 1.00 13.83 ? 163  LEU A C   1 
ATOM   1250 O  O   . LEU A 1 163 ? 85.935 42.325 44.967 1.00 16.71 ? 163  LEU A O   1 
ATOM   1251 C  CB  . LEU A 1 163 ? 83.208 43.102 43.875 1.00 12.04 ? 163  LEU A CB  1 
ATOM   1252 C  CG  . LEU A 1 163 ? 82.283 43.606 42.767 1.00 11.92 ? 163  LEU A CG  1 
ATOM   1253 C  CD1 . LEU A 1 163 ? 81.518 44.813 43.287 1.00 10.15 ? 163  LEU A CD1 1 
ATOM   1254 C  CD2 . LEU A 1 163 ? 83.105 43.969 41.532 1.00 12.21 ? 163  LEU A CD2 1 
ATOM   1255 N  N   . PHE A 1 164 ? 84.540 40.707 45.681 1.00 12.44 ? 164  PHE A N   1 
ATOM   1256 C  CA  . PHE A 1 164 ? 85.288 40.440 46.910 1.00 13.48 ? 164  PHE A CA  1 
ATOM   1257 C  C   . PHE A 1 164 ? 86.298 39.314 46.772 1.00 21.07 ? 164  PHE A C   1 
ATOM   1258 O  O   . PHE A 1 164 ? 86.111 38.394 45.987 1.00 18.92 ? 164  PHE A O   1 
ATOM   1259 C  CB  . PHE A 1 164 ? 84.311 40.134 48.045 1.00 12.42 ? 164  PHE A CB  1 
ATOM   1260 C  CG  . PHE A 1 164 ? 83.348 41.249 48.308 1.00 15.75 ? 164  PHE A CG  1 
ATOM   1261 C  CD1 . PHE A 1 164 ? 82.197 41.389 47.539 1.00 14.81 ? 164  PHE A CD1 1 
ATOM   1262 C  CD2 . PHE A 1 164 ? 83.635 42.214 49.271 1.00 18.81 ? 164  PHE A CD2 1 
ATOM   1263 C  CE1 . PHE A 1 164 ? 81.347 42.481 47.722 1.00 17.22 ? 164  PHE A CE1 1 
ATOM   1264 C  CE2 . PHE A 1 164 ? 82.793 43.310 49.463 1.00 21.61 ? 164  PHE A CE2 1 
ATOM   1265 C  CZ  . PHE A 1 164 ? 81.647 43.446 48.686 1.00 23.46 ? 164  PHE A CZ  1 
ATOM   1266 N  N   . PRO A 1 165 ? 87.396 39.380 47.549 1.00 22.66 ? 165  PRO A N   1 
ATOM   1267 C  CA  . PRO A 1 165 ? 88.465 38.371 47.533 1.00 22.53 ? 165  PRO A CA  1 
ATOM   1268 C  C   . PRO A 1 165 ? 87.996 37.015 48.044 1.00 22.30 ? 165  PRO A C   1 
ATOM   1269 O  O   . PRO A 1 165 ? 87.204 36.944 48.985 1.00 21.49 ? 165  PRO A O   1 
ATOM   1270 C  CB  . PRO A 1 165 ? 89.531 38.962 48.466 1.00 24.05 ? 165  PRO A CB  1 
ATOM   1271 C  CG  . PRO A 1 165 ? 89.214 40.419 48.526 1.00 31.58 ? 165  PRO A CG  1 
ATOM   1272 C  CD  . PRO A 1 165 ? 87.710 40.464 48.495 1.00 23.34 ? 165  PRO A CD  1 
ATOM   1273 N  N   . ASN A 1 166 ? 88.501 35.948 47.428 1.00 24.36 ? 166  ASN A N   1 
ATOM   1274 C  CA  . ASN A 1 166 ? 88.168 34.579 47.818 1.00 26.75 ? 166  ASN A CA  1 
ATOM   1275 C  C   . ASN A 1 166 ? 86.709 34.453 48.212 1.00 26.70 ? 166  ASN A C   1 
ATOM   1276 O  O   . ASN A 1 166 ? 86.385 33.964 49.296 1.00 25.62 ? 166  ASN A O   1 
ATOM   1277 C  CB  . ASN A 1 166 ? 89.047 34.143 48.994 1.00 33.03 ? 166  ASN A CB  1 
ATOM   1278 C  CG  . ASN A 1 166 ? 90.516 34.411 48.747 1.00 42.00 ? 166  ASN A CG  1 
ATOM   1279 O  OD1 . ASN A 1 166 ? 91.116 33.856 47.821 1.00 45.77 ? 166  ASN A OD1 1 
ATOM   1280 N  ND2 . ASN A 1 166 ? 91.106 35.270 49.572 1.00 44.19 ? 166  ASN A ND2 1 
ATOM   1281 N  N   . ASP A 1 167 ? 85.830 34.881 47.313 1.00 23.71 ? 167  ASP A N   1 
ATOM   1282 C  CA  . ASP A 1 167 ? 84.397 34.844 47.566 1.00 19.63 ? 167  ASP A CA  1 
ATOM   1283 C  C   . ASP A 1 167 ? 83.703 34.105 46.419 1.00 25.43 ? 167  ASP A C   1 
ATOM   1284 O  O   . ASP A 1 167 ? 82.807 34.651 45.774 1.00 21.23 ? 167  ASP A O   1 
ATOM   1285 C  CB  . ASP A 1 167 ? 83.897 36.289 47.678 1.00 16.18 ? 167  ASP A CB  1 
ATOM   1286 C  CG  . ASP A 1 167 ? 82.451 36.386 48.118 1.00 14.39 ? 167  ASP A CG  1 
ATOM   1287 O  OD1 . ASP A 1 167 ? 82.060 35.651 49.042 1.00 16.19 ? 167  ASP A OD1 1 
ATOM   1288 O  OD2 . ASP A 1 167 ? 81.714 37.218 47.539 1.00 13.71 ? 167  ASP A OD2 1 
ATOM   1289 N  N   . PRO A 1 168 ? 84.105 32.842 46.165 1.00 30.01 ? 168  PRO A N   1 
ATOM   1290 C  CA  . PRO A 1 168 ? 83.580 31.962 45.107 1.00 30.45 ? 168  PRO A CA  1 
ATOM   1291 C  C   . PRO A 1 168 ? 82.082 31.682 45.184 1.00 26.66 ? 168  PRO A C   1 
ATOM   1292 O  O   . PRO A 1 168 ? 81.463 31.264 44.199 1.00 25.08 ? 168  PRO A O   1 
ATOM   1293 C  CB  . PRO A 1 168 ? 84.392 30.673 45.288 1.00 34.24 ? 168  PRO A CB  1 
ATOM   1294 C  CG  . PRO A 1 168 ? 85.635 31.124 45.961 1.00 34.32 ? 168  PRO A CG  1 
ATOM   1295 C  CD  . PRO A 1 168 ? 85.113 32.120 46.960 1.00 34.10 ? 168  PRO A CD  1 
ATOM   1296 N  N   . TYR A 1 169 ? 81.498 31.903 46.352 1.00 22.66 ? 169  TYR A N   1 
ATOM   1297 C  CA  . TYR A 1 169 ? 80.084 31.652 46.529 1.00 17.22 ? 169  TYR A CA  1 
ATOM   1298 C  C   . TYR A 1 169 ? 79.276 32.929 46.670 1.00 14.54 ? 169  TYR A C   1 
ATOM   1299 O  O   . TYR A 1 169 ? 78.064 32.899 46.883 1.00 13.99 ? 169  TYR A O   1 
ATOM   1300 C  CB  . TYR A 1 169 ? 79.909 30.727 47.721 1.00 26.95 ? 169  TYR A CB  1 
ATOM   1301 C  CG  . TYR A 1 169 ? 80.732 29.480 47.505 1.00 30.74 ? 169  TYR A CG  1 
ATOM   1302 C  CD1 . TYR A 1 169 ? 82.066 29.417 47.922 1.00 32.12 ? 169  TYR A CD1 1 
ATOM   1303 C  CD2 . TYR A 1 169 ? 80.220 28.413 46.767 1.00 24.84 ? 169  TYR A CD2 1 
ATOM   1304 C  CE1 . TYR A 1 169 ? 82.875 28.321 47.599 1.00 34.58 ? 169  TYR A CE1 1 
ATOM   1305 C  CE2 . TYR A 1 169 ? 81.016 27.317 46.434 1.00 33.50 ? 169  TYR A CE2 1 
ATOM   1306 C  CZ  . TYR A 1 169 ? 82.342 27.277 46.850 1.00 31.47 ? 169  TYR A CZ  1 
ATOM   1307 O  OH  . TYR A 1 169 ? 83.136 26.206 46.492 1.00 36.29 ? 169  TYR A OH  1 
ATOM   1308 N  N   . ASN A 1 170 ? 79.971 34.051 46.536 1.00 12.84 ? 170  ASN A N   1 
ATOM   1309 C  CA  . ASN A 1 170 ? 79.352 35.362 46.615 1.00 10.61 ? 170  ASN A CA  1 
ATOM   1310 C  C   . ASN A 1 170 ? 78.603 35.615 47.917 1.00 14.17 ? 170  ASN A C   1 
ATOM   1311 O  O   . ASN A 1 170 ? 77.627 36.357 47.968 1.00 10.67 ? 170  ASN A O   1 
ATOM   1312 C  CB  . ASN A 1 170 ? 78.444 35.567 45.386 1.00 11.02 ? 170  ASN A CB  1 
ATOM   1313 C  CG  . ASN A 1 170 ? 79.205 36.169 44.206 1.00 11.94 ? 170  ASN A CG  1 
ATOM   1314 O  OD1 . ASN A 1 170 ? 79.439 37.370 44.173 1.00 12.52 ? 170  ASN A OD1 1 
ATOM   1315 N  ND2 . ASN A 1 170 ? 79.613 35.329 43.247 1.00 11.34 ? 170  ASN A ND2 1 
ATOM   1316 N  N   . VAL A 1 171 ? 79.073 34.987 48.986 1.00 12.75 ? 171  VAL A N   1 
ATOM   1317 C  CA  . VAL A 1 171 ? 78.471 35.199 50.289 1.00 14.91 ? 171  VAL A CA  1 
ATOM   1318 C  C   . VAL A 1 171 ? 78.770 36.630 50.742 1.00 12.27 ? 171  VAL A C   1 
ATOM   1319 O  O   . VAL A 1 171 ? 77.931 37.277 51.359 1.00 14.19 ? 171  VAL A O   1 
ATOM   1320 C  CB  . VAL A 1 171 ? 79.043 34.200 51.324 1.00 13.68 ? 171  VAL A CB  1 
ATOM   1321 C  CG1 . VAL A 1 171 ? 78.770 34.690 52.739 1.00 19.59 ? 171  VAL A CG1 1 
ATOM   1322 C  CG2 . VAL A 1 171 ? 78.405 32.837 51.113 1.00 16.78 ? 171  VAL A CG2 1 
ATOM   1323 N  N   . ALA A 1 172 ? 79.965 37.124 50.434 1.00 13.37 ? 172  ALA A N   1 
ATOM   1324 C  CA  . ALA A 1 172 ? 80.341 38.481 50.824 1.00 14.85 ? 172  ALA A CA  1 
ATOM   1325 C  C   . ALA A 1 172 ? 79.511 39.479 50.024 1.00 14.50 ? 172  ALA A C   1 
ATOM   1326 O  O   . ALA A 1 172 ? 79.041 40.492 50.547 1.00 12.54 ? 172  ALA A O   1 
ATOM   1327 C  CB  . ALA A 1 172 ? 81.841 38.715 50.567 1.00 15.00 ? 172  ALA A CB  1 
ATOM   1328 N  N   . THR A 1 173 ? 79.342 39.185 48.741 1.00 11.49 ? 173  THR A N   1 
ATOM   1329 C  CA  . THR A 1 173 ? 78.559 40.056 47.869 1.00 11.28 ? 173  THR A CA  1 
ATOM   1330 C  C   . THR A 1 173 ? 77.178 40.239 48.468 1.00 13.81 ? 173  THR A C   1 
ATOM   1331 O  O   . THR A 1 173 ? 76.693 41.365 48.648 1.00 12.56 ? 173  THR A O   1 
ATOM   1332 C  CB  . THR A 1 173 ? 78.411 39.431 46.480 1.00 9.12  ? 173  THR A CB  1 
ATOM   1333 O  OG1 . THR A 1 173 ? 79.702 39.320 45.883 1.00 11.38 ? 173  THR A OG1 1 
ATOM   1334 C  CG2 . THR A 1 173 ? 77.502 40.294 45.595 1.00 9.48  ? 173  THR A CG2 1 
ATOM   1335 N  N   . SER A 1 174 ? 76.543 39.120 48.789 1.00 12.01 ? 174  SER A N   1 
ATOM   1336 C  CA  . SER A 1 174 ? 75.209 39.160 49.347 1.00 14.22 ? 174  SER A CA  1 
ATOM   1337 C  C   . SER A 1 174 ? 75.120 39.865 50.691 1.00 16.24 ? 174  SER A C   1 
ATOM   1338 O  O   . SER A 1 174 ? 74.254 40.714 50.909 1.00 15.53 ? 174  SER A O   1 
ATOM   1339 C  CB  . SER A 1 174 ? 74.663 37.740 49.469 1.00 12.41 ? 174  SER A CB  1 
ATOM   1340 O  OG  . SER A 1 174 ? 74.508 37.165 48.173 1.00 16.48 ? 174  SER A OG  1 
ATOM   1341 N  N   . ASN A 1 175 ? 76.019 39.535 51.605 1.00 12.42 ? 175  ASN A N   1 
ATOM   1342 C  CA  . ASN A 1 175 ? 75.926 40.158 52.915 1.00 12.03 ? 175  ASN A CA  1 
ATOM   1343 C  C   . ASN A 1 175 ? 76.359 41.628 52.967 1.00 11.51 ? 175  ASN A C   1 
ATOM   1344 O  O   . ASN A 1 175 ? 75.957 42.363 53.876 1.00 13.46 ? 175  ASN A O   1 
ATOM   1345 C  CB  . ASN A 1 175 ? 76.683 39.302 53.943 1.00 14.36 ? 175  ASN A CB  1 
ATOM   1346 C  CG  . ASN A 1 175 ? 75.872 38.070 54.399 1.00 19.16 ? 175  ASN A CG  1 
ATOM   1347 O  OD1 . ASN A 1 175 ? 74.803 37.759 53.851 1.00 13.61 ? 175  ASN A OD1 1 
ATOM   1348 N  ND2 . ASN A 1 175 ? 76.390 37.363 55.403 1.00 16.43 ? 175  ASN A ND2 1 
ATOM   1349 N  N   . ASN A 1 176 ? 77.141 42.067 51.983 1.00 11.84 ? 176  ASN A N   1 
ATOM   1350 C  CA  . ASN A 1 176 ? 77.597 43.449 51.947 1.00 10.36 ? 176  ASN A CA  1 
ATOM   1351 C  C   . ASN A 1 176 ? 76.760 44.367 51.055 1.00 8.61  ? 176  ASN A C   1 
ATOM   1352 O  O   . ASN A 1 176 ? 76.754 45.576 51.250 1.00 10.89 ? 176  ASN A O   1 
ATOM   1353 C  CB  . ASN A 1 176 ? 79.049 43.534 51.460 1.00 11.73 ? 176  ASN A CB  1 
ATOM   1354 C  CG  . ASN A 1 176 ? 80.017 42.806 52.367 1.00 19.73 ? 176  ASN A CG  1 
ATOM   1355 O  OD1 . ASN A 1 176 ? 79.817 42.735 53.573 1.00 24.64 ? 176  ASN A OD1 1 
ATOM   1356 N  ND2 . ASN A 1 176 ? 81.083 42.277 51.789 1.00 25.57 ? 176  ASN A ND2 1 
ATOM   1357 N  N   . HIS A 1 177 ? 76.060 43.799 50.079 1.00 9.54  ? 177  HIS A N   1 
ATOM   1358 C  CA  . HIS A 1 177 ? 75.291 44.629 49.144 1.00 9.20  ? 177  HIS A CA  1 
ATOM   1359 C  C   . HIS A 1 177 ? 73.807 44.781 49.440 1.00 11.32 ? 177  HIS A C   1 
ATOM   1360 O  O   . HIS A 1 177 ? 73.216 45.823 49.135 1.00 9.13  ? 177  HIS A O   1 
ATOM   1361 C  CB  . HIS A 1 177 ? 75.399 44.063 47.722 1.00 6.60  ? 177  HIS A CB  1 
ATOM   1362 C  CG  . HIS A 1 177 ? 76.735 44.261 47.075 1.00 11.30 ? 177  HIS A CG  1 
ATOM   1363 N  ND1 . HIS A 1 177 ? 76.959 43.972 45.745 1.00 11.11 ? 177  HIS A ND1 1 
ATOM   1364 C  CD2 . HIS A 1 177 ? 77.916 44.710 47.566 1.00 10.07 ? 177  HIS A CD2 1 
ATOM   1365 C  CE1 . HIS A 1 177 ? 78.218 44.237 45.443 1.00 12.85 ? 177  HIS A CE1 1 
ATOM   1366 N  NE2 . HIS A 1 177 ? 78.822 44.686 46.529 1.00 9.16  ? 177  HIS A NE2 1 
ATOM   1367 N  N   . VAL A 1 178 ? 73.215 43.734 50.012 1.00 10.09 ? 178  VAL A N   1 
ATOM   1368 C  CA  . VAL A 1 178 ? 71.774 43.682 50.265 1.00 11.49 ? 178  VAL A CA  1 
ATOM   1369 C  C   . VAL A 1 178 ? 71.266 44.521 51.431 1.00 11.38 ? 178  VAL A C   1 
ATOM   1370 O  O   . VAL A 1 178 ? 71.851 44.511 52.519 1.00 10.87 ? 178  VAL A O   1 
ATOM   1371 C  CB  . VAL A 1 178 ? 71.329 42.213 50.443 1.00 12.66 ? 178  VAL A CB  1 
ATOM   1372 C  CG1 . VAL A 1 178 ? 69.834 42.146 50.759 1.00 13.24 ? 178  VAL A CG1 1 
ATOM   1373 C  CG2 . VAL A 1 178 ? 71.634 41.425 49.158 1.00 11.43 ? 178  VAL A CG2 1 
ATOM   1374 N  N   . CYS A 1 179 ? 70.154 45.215 51.191 1.00 8.47  ? 179  CYS A N   1 
ATOM   1375 C  CA  . CYS A 1 179 ? 69.542 46.111 52.179 1.00 6.04  ? 179  CYS A CA  1 
ATOM   1376 C  C   . CYS A 1 179 ? 68.139 45.716 52.625 1.00 10.41 ? 179  CYS A C   1 
ATOM   1377 O  O   . CYS A 1 179 ? 67.372 45.113 51.857 1.00 9.62  ? 179  CYS A O   1 
ATOM   1378 C  CB  . CYS A 1 179 ? 69.472 47.529 51.612 1.00 11.77 ? 179  CYS A CB  1 
ATOM   1379 S  SG  . CYS A 1 179 ? 71.064 48.220 51.105 1.00 14.11 ? 179  CYS A SG  1 
ATOM   1380 N  N   . ILE A 1 180 ? 67.814 46.075 53.870 1.00 8.47  ? 180  ILE A N   1 
ATOM   1381 C  CA  . ILE A 1 180 ? 66.503 45.816 54.458 1.00 11.51 ? 180  ILE A CA  1 
ATOM   1382 C  C   . ILE A 1 180 ? 65.835 47.164 54.735 1.00 12.35 ? 180  ILE A C   1 
ATOM   1383 O  O   . ILE A 1 180 ? 66.424 48.052 55.370 1.00 11.40 ? 180  ILE A O   1 
ATOM   1384 C  CB  . ILE A 1 180 ? 66.587 45.026 55.792 1.00 17.00 ? 180  ILE A CB  1 
ATOM   1385 C  CG1 . ILE A 1 180 ? 67.245 43.678 55.579 1.00 28.49 ? 180  ILE A CG1 1 
ATOM   1386 C  CG2 . ILE A 1 180 ? 65.187 44.777 56.328 1.00 21.47 ? 180  ILE A CG2 1 
ATOM   1387 C  CD1 . ILE A 1 180 ? 67.173 42.771 56.814 1.00 35.62 ? 180  ILE A CD1 1 
ATOM   1388 N  N   . ILE A 1 181 ? 64.606 47.308 54.245 1.00 9.08  ? 181  ILE A N   1 
ATOM   1389 C  CA  . ILE A 1 181 ? 63.830 48.527 54.390 1.00 10.61 ? 181  ILE A CA  1 
ATOM   1390 C  C   . ILE A 1 181 ? 62.435 48.254 54.965 1.00 12.66 ? 181  ILE A C   1 
ATOM   1391 O  O   . ILE A 1 181 ? 61.537 47.793 54.252 1.00 10.25 ? 181  ILE A O   1 
ATOM   1392 C  CB  . ILE A 1 181 ? 63.653 49.234 53.016 1.00 10.43 ? 181  ILE A CB  1 
ATOM   1393 C  CG1 . ILE A 1 181 ? 65.022 49.573 52.422 1.00 12.36 ? 181  ILE A CG1 1 
ATOM   1394 C  CG2 . ILE A 1 181 ? 62.843 50.532 53.164 1.00 10.64 ? 181  ILE A CG2 1 
ATOM   1395 C  CD1 . ILE A 1 181 ? 65.521 48.539 51.420 1.00 15.31 ? 181  ILE A CD1 1 
ATOM   1396 N  N   . PRO A 1 182 ? 62.241 48.524 56.263 1.00 10.42 ? 182  PRO A N   1 
ATOM   1397 C  CA  . PRO A 1 182 ? 60.919 48.291 56.858 1.00 10.30 ? 182  PRO A CA  1 
ATOM   1398 C  C   . PRO A 1 182 ? 59.956 49.342 56.331 1.00 11.34 ? 182  PRO A C   1 
ATOM   1399 O  O   . PRO A 1 182 ? 60.353 50.485 56.115 1.00 12.34 ? 182  PRO A O   1 
ATOM   1400 C  CB  . PRO A 1 182 ? 61.157 48.512 58.351 1.00 12.56 ? 182  PRO A CB  1 
ATOM   1401 C  CG  . PRO A 1 182 ? 62.619 48.193 58.533 1.00 11.99 ? 182  PRO A CG  1 
ATOM   1402 C  CD  . PRO A 1 182 ? 63.242 48.826 57.303 1.00 9.93  ? 182  PRO A CD  1 
ATOM   1403 N  N   . GLN A 1 183 ? 58.699 48.961 56.128 1.00 10.90 ? 183  GLN A N   1 
ATOM   1404 C  CA  . GLN A 1 183 ? 57.699 49.918 55.692 1.00 10.72 ? 183  GLN A CA  1 
ATOM   1405 C  C   . GLN A 1 183 ? 56.720 50.100 56.853 1.00 11.44 ? 183  GLN A C   1 
ATOM   1406 O  O   . GLN A 1 183 ? 56.177 49.127 57.387 1.00 14.70 ? 183  GLN A O   1 
ATOM   1407 C  CB  . GLN A 1 183 ? 56.984 49.420 54.434 1.00 12.61 ? 183  GLN A CB  1 
ATOM   1408 C  CG  . GLN A 1 183 ? 55.867 50.325 54.004 1.00 17.02 ? 183  GLN A CG  1 
ATOM   1409 C  CD  . GLN A 1 183 ? 55.361 50.000 52.620 1.00 12.73 ? 183  GLN A CD  1 
ATOM   1410 O  OE1 . GLN A 1 183 ? 55.455 48.859 52.159 1.00 15.96 ? 183  GLN A OE1 1 
ATOM   1411 N  NE2 . GLN A 1 183 ? 54.806 51.000 51.953 1.00 15.76 ? 183  GLN A NE2 1 
ATOM   1412 N  N   . ILE A 1 184 ? 56.535 51.353 57.255 1.00 10.51 ? 184  ILE A N   1 
ATOM   1413 C  CA  . ILE A 1 184 ? 55.654 51.732 58.363 1.00 11.43 ? 184  ILE A CA  1 
ATOM   1414 C  C   . ILE A 1 184 ? 54.339 52.203 57.757 1.00 11.14 ? 184  ILE A C   1 
ATOM   1415 O  O   . ILE A 1 184 ? 54.297 53.208 57.041 1.00 13.09 ? 184  ILE A O   1 
ATOM   1416 C  CB  . ILE A 1 184 ? 56.289 52.888 59.175 1.00 12.37 ? 184  ILE A CB  1 
ATOM   1417 C  CG1 . ILE A 1 184 ? 57.657 52.459 59.707 1.00 13.15 ? 184  ILE A CG1 1 
ATOM   1418 C  CG2 . ILE A 1 184 ? 55.380 53.287 60.338 1.00 13.24 ? 184  ILE A CG2 1 
ATOM   1419 C  CD1 . ILE A 1 184 ? 57.602 51.337 60.727 1.00 13.44 ? 184  ILE A CD1 1 
ATOM   1420 N  N   . GLU A 1 185 ? 53.256 51.498 58.054 1.00 10.04 ? 185  GLU A N   1 
ATOM   1421 C  CA  . GLU A 1 185 ? 51.985 51.860 57.443 1.00 13.76 ? 185  GLU A CA  1 
ATOM   1422 C  C   . GLU A 1 185 ? 50.766 51.508 58.271 1.00 13.91 ? 185  GLU A C   1 
ATOM   1423 O  O   . GLU A 1 185 ? 49.715 51.135 57.742 1.00 14.39 ? 185  GLU A O   1 
ATOM   1424 C  CB  . GLU A 1 185 ? 51.894 51.216 56.067 1.00 15.71 ? 185  GLU A CB  1 
ATOM   1425 C  CG  . GLU A 1 185 ? 52.180 49.735 56.044 1.00 15.49 ? 185  GLU A CG  1 
ATOM   1426 C  CD  . GLU A 1 185 ? 52.253 49.216 54.624 1.00 20.00 ? 185  GLU A CD  1 
ATOM   1427 O  OE1 . GLU A 1 185 ? 51.676 49.889 53.759 1.00 15.02 ? 185  GLU A OE1 1 
ATOM   1428 O  OE2 . GLU A 1 185 ? 52.868 48.161 54.370 1.00 15.99 ? 185  GLU A OE2 1 
ATOM   1429 N  N   . SER A 1 186 ? 50.909 51.631 59.580 1.00 10.94 ? 186  SER A N   1 
ATOM   1430 C  CA  . SER A 1 186 ? 49.797 51.360 60.476 1.00 12.04 ? 186  SER A CA  1 
ATOM   1431 C  C   . SER A 1 186 ? 49.966 52.222 61.714 1.00 16.21 ? 186  SER A C   1 
ATOM   1432 O  O   . SER A 1 186 ? 51.056 52.730 61.981 1.00 13.48 ? 186  SER A O   1 
ATOM   1433 C  CB  . SER A 1 186 ? 49.758 49.888 60.882 1.00 13.22 ? 186  SER A CB  1 
ATOM   1434 O  OG  . SER A 1 186 ? 50.895 49.527 61.646 1.00 13.50 ? 186  SER A OG  1 
ATOM   1435 N  N   . VAL A 1 187 ? 48.884 52.380 62.467 1.00 15.24 ? 187  VAL A N   1 
ATOM   1436 C  CA  . VAL A 1 187 ? 48.936 53.172 63.692 1.00 17.69 ? 187  VAL A CA  1 
ATOM   1437 C  C   . VAL A 1 187 ? 49.946 52.569 64.664 1.00 15.84 ? 187  VAL A C   1 
ATOM   1438 O  O   . VAL A 1 187 ? 50.749 53.290 65.266 1.00 17.43 ? 187  VAL A O   1 
ATOM   1439 C  CB  . VAL A 1 187 ? 47.542 53.247 64.358 1.00 19.63 ? 187  VAL A CB  1 
ATOM   1440 C  CG1 . VAL A 1 187 ? 47.651 53.871 65.746 1.00 18.82 ? 187  VAL A CG1 1 
ATOM   1441 C  CG2 . VAL A 1 187 ? 46.608 54.072 63.486 1.00 20.58 ? 187  VAL A CG2 1 
ATOM   1442 N  N   . LYS A 1 188 ? 49.920 51.251 64.825 1.00 13.41 ? 188  LYS A N   1 
ATOM   1443 C  CA  . LYS A 1 188 ? 50.864 50.603 65.732 1.00 15.74 ? 188  LYS A CA  1 
ATOM   1444 C  C   . LYS A 1 188 ? 52.298 50.757 65.227 1.00 15.54 ? 188  LYS A C   1 
ATOM   1445 O  O   . LYS A 1 188 ? 53.236 50.858 66.022 1.00 17.13 ? 188  LYS A O   1 
ATOM   1446 C  CB  . LYS A 1 188 ? 50.526 49.118 65.891 1.00 18.84 ? 188  LYS A CB  1 
ATOM   1447 C  CG  . LYS A 1 188 ? 49.287 48.859 66.736 1.00 25.68 ? 188  LYS A CG  1 
ATOM   1448 C  CD  . LYS A 1 188 ? 49.126 47.371 67.032 1.00 34.24 ? 188  LYS A CD  1 
ATOM   1449 C  CE  . LYS A 1 188 ? 47.982 47.124 68.011 1.00 38.23 ? 188  LYS A CE  1 
ATOM   1450 N  NZ  . LYS A 1 188 ? 47.786 45.672 68.300 1.00 47.93 ? 188  LYS A NZ  1 
ATOM   1451 N  N   . GLY A 1 189 ? 52.469 50.767 63.905 1.00 14.61 ? 189  GLY A N   1 
ATOM   1452 C  CA  . GLY A 1 189 ? 53.803 50.923 63.344 1.00 11.69 ? 189  GLY A CA  1 
ATOM   1453 C  C   . GLY A 1 189 ? 54.372 52.294 63.681 1.00 14.10 ? 189  GLY A C   1 
ATOM   1454 O  O   . GLY A 1 189 ? 55.533 52.433 64.073 1.00 13.52 ? 189  GLY A O   1 
ATOM   1455 N  N   . VAL A 1 190 ? 53.543 53.314 63.522 1.00 14.62 ? 190  VAL A N   1 
ATOM   1456 C  CA  . VAL A 1 190 ? 53.949 54.677 63.822 1.00 16.42 ? 190  VAL A CA  1 
ATOM   1457 C  C   . VAL A 1 190 ? 54.229 54.811 65.319 1.00 18.35 ? 190  VAL A C   1 
ATOM   1458 O  O   . VAL A 1 190 ? 55.199 55.451 65.730 1.00 16.39 ? 190  VAL A O   1 
ATOM   1459 C  CB  . VAL A 1 190 ? 52.846 55.666 63.385 1.00 15.72 ? 190  VAL A CB  1 
ATOM   1460 C  CG1 . VAL A 1 190 ? 53.101 57.056 63.983 1.00 19.77 ? 190  VAL A CG1 1 
ATOM   1461 C  CG2 . VAL A 1 190 ? 52.821 55.752 61.859 1.00 15.06 ? 190  VAL A CG2 1 
ATOM   1462 N  N   . GLU A 1 191 ? 53.398 54.179 66.137 1.00 17.43 ? 191  GLU A N   1 
ATOM   1463 C  CA  . GLU A 1 191 ? 53.586 54.260 67.579 1.00 20.89 ? 191  GLU A CA  1 
ATOM   1464 C  C   . GLU A 1 191 ? 54.909 53.643 68.034 1.00 20.09 ? 191  GLU A C   1 
ATOM   1465 O  O   . GLU A 1 191 ? 55.465 54.033 69.067 1.00 19.17 ? 191  GLU A O   1 
ATOM   1466 C  CB  . GLU A 1 191 ? 52.406 53.594 68.300 1.00 23.34 ? 191  GLU A CB  1 
ATOM   1467 C  CG  . GLU A 1 191 ? 51.063 54.223 67.928 1.00 33.60 ? 191  GLU A CG  1 
ATOM   1468 C  CD  . GLU A 1 191 ? 49.870 53.672 68.702 1.00 41.27 ? 191  GLU A CD  1 
ATOM   1469 O  OE1 . GLU A 1 191 ? 49.700 52.432 68.763 1.00 40.90 ? 191  GLU A OE1 1 
ATOM   1470 O  OE2 . GLU A 1 191 ? 49.088 54.494 69.232 1.00 39.71 ? 191  GLU A OE2 1 
ATOM   1471 N  N   . ASN A 1 192 ? 55.436 52.704 67.253 1.00 17.51 ? 192  ASN A N   1 
ATOM   1472 C  CA  . ASN A 1 192 ? 56.683 52.039 67.617 1.00 15.15 ? 192  ASN A CA  1 
ATOM   1473 C  C   . ASN A 1 192 ? 57.827 52.384 66.651 1.00 13.73 ? 192  ASN A C   1 
ATOM   1474 O  O   . ASN A 1 192 ? 58.843 51.691 66.621 1.00 13.60 ? 192  ASN A O   1 
ATOM   1475 C  CB  . ASN A 1 192 ? 56.436 50.521 67.642 1.00 14.97 ? 192  ASN A CB  1 
ATOM   1476 C  CG  . ASN A 1 192 ? 57.545 49.746 68.332 1.00 19.18 ? 192  ASN A CG  1 
ATOM   1477 O  OD1 . ASN A 1 192 ? 58.153 50.221 69.296 1.00 19.21 ? 192  ASN A OD1 1 
ATOM   1478 N  ND2 . ASN A 1 192 ? 57.803 48.532 67.851 1.00 18.15 ? 192  ASN A ND2 1 
ATOM   1479 N  N   . VAL A 1 193 ? 57.682 53.465 65.889 1.00 11.77 ? 193  VAL A N   1 
ATOM   1480 C  CA  . VAL A 1 193 ? 58.711 53.815 64.903 1.00 12.79 ? 193  VAL A CA  1 
ATOM   1481 C  C   . VAL A 1 193 ? 60.068 54.190 65.495 1.00 14.45 ? 193  VAL A C   1 
ATOM   1482 O  O   . VAL A 1 193 ? 61.104 53.972 64.870 1.00 14.36 ? 193  VAL A O   1 
ATOM   1483 C  CB  . VAL A 1 193 ? 58.224 54.944 63.946 1.00 11.70 ? 193  VAL A CB  1 
ATOM   1484 C  CG1 . VAL A 1 193 ? 58.167 56.283 64.675 1.00 14.65 ? 193  VAL A CG1 1 
ATOM   1485 C  CG2 . VAL A 1 193 ? 59.152 55.040 62.742 1.00 12.92 ? 193  VAL A CG2 1 
ATOM   1486 N  N   . ASP A 1 194 ? 60.087 54.752 66.699 1.00 12.99 ? 194  ASP A N   1 
ATOM   1487 C  CA  . ASP A 1 194 ? 61.373 55.098 67.282 1.00 14.35 ? 194  ASP A CA  1 
ATOM   1488 C  C   . ASP A 1 194 ? 62.241 53.857 67.441 1.00 14.37 ? 194  ASP A C   1 
ATOM   1489 O  O   . ASP A 1 194 ? 63.438 53.893 67.152 1.00 15.42 ? 194  ASP A O   1 
ATOM   1490 C  CB  . ASP A 1 194 ? 61.194 55.790 68.640 1.00 15.58 ? 194  ASP A CB  1 
ATOM   1491 C  CG  . ASP A 1 194 ? 60.497 57.128 68.515 1.00 19.27 ? 194  ASP A CG  1 
ATOM   1492 O  OD1 . ASP A 1 194 ? 60.701 57.804 67.486 1.00 19.65 ? 194  ASP A OD1 1 
ATOM   1493 O  OD2 . ASP A 1 194 ? 59.753 57.511 69.443 1.00 25.09 ? 194  ASP A OD2 1 
ATOM   1494 N  N   . ALA A 1 195 ? 61.643 52.758 67.893 1.00 13.06 ? 195  ALA A N   1 
ATOM   1495 C  CA  . ALA A 1 195 ? 62.387 51.522 68.088 1.00 12.80 ? 195  ALA A CA  1 
ATOM   1496 C  C   . ALA A 1 195 ? 62.801 50.891 66.758 1.00 14.96 ? 195  ALA A C   1 
ATOM   1497 O  O   . ALA A 1 195 ? 63.916 50.396 66.611 1.00 13.43 ? 195  ALA A O   1 
ATOM   1498 C  CB  . ALA A 1 195 ? 61.551 50.534 68.886 1.00 13.98 ? 195  ALA A CB  1 
ATOM   1499 N  N   . ILE A 1 196 ? 61.900 50.911 65.786 1.00 12.85 ? 196  ILE A N   1 
ATOM   1500 C  CA  . ILE A 1 196 ? 62.210 50.310 64.500 1.00 11.89 ? 196  ILE A CA  1 
ATOM   1501 C  C   . ILE A 1 196 ? 63.330 51.084 63.803 1.00 11.82 ? 196  ILE A C   1 
ATOM   1502 O  O   . ILE A 1 196 ? 64.260 50.487 63.256 1.00 12.66 ? 196  ILE A O   1 
ATOM   1503 C  CB  . ILE A 1 196 ? 60.946 50.265 63.602 1.00 11.89 ? 196  ILE A CB  1 
ATOM   1504 C  CG1 . ILE A 1 196 ? 59.885 49.368 64.258 1.00 14.36 ? 196  ILE A CG1 1 
ATOM   1505 C  CG2 . ILE A 1 196 ? 61.314 49.720 62.212 1.00 11.70 ? 196  ILE A CG2 1 
ATOM   1506 C  CD1 . ILE A 1 196 ? 58.492 49.500 63.649 1.00 17.72 ? 196  ILE A CD1 1 
ATOM   1507 N  N   . ALA A 1 197 ? 63.252 52.410 63.859 1.00 11.21 ? 197  ALA A N   1 
ATOM   1508 C  CA  . ALA A 1 197 ? 64.240 53.273 63.214 1.00 12.71 ? 197  ALA A CA  1 
ATOM   1509 C  C   . ALA A 1 197 ? 65.635 53.127 63.803 1.00 10.70 ? 197  ALA A C   1 
ATOM   1510 O  O   . ALA A 1 197 ? 66.634 53.364 63.116 1.00 11.65 ? 197  ALA A O   1 
ATOM   1511 C  CB  . ALA A 1 197 ? 63.792 54.731 63.308 1.00 12.66 ? 197  ALA A CB  1 
ATOM   1512 N  N   . ALA A 1 198 ? 65.691 52.730 65.070 1.00 12.00 ? 198  ALA A N   1 
ATOM   1513 C  CA  . ALA A 1 198 ? 66.958 52.570 65.782 1.00 13.01 ? 198  ALA A CA  1 
ATOM   1514 C  C   . ALA A 1 198 ? 67.652 51.226 65.567 1.00 14.98 ? 198  ALA A C   1 
ATOM   1515 O  O   . ALA A 1 198 ? 68.764 51.011 66.062 1.00 13.44 ? 198  ALA A O   1 
ATOM   1516 C  CB  . ALA A 1 198 ? 66.735 52.795 67.290 1.00 12.00 ? 198  ALA A CB  1 
ATOM   1517 N  N   . MET A 1 199 ? 67.014 50.314 64.843 1.00 12.29 ? 199  MET A N   1 
ATOM   1518 C  CA  . MET A 1 199 ? 67.627 49.005 64.612 1.00 12.45 ? 199  MET A CA  1 
ATOM   1519 C  C   . MET A 1 199 ? 68.901 49.140 63.787 1.00 13.35 ? 199  MET A C   1 
ATOM   1520 O  O   . MET A 1 199 ? 68.893 49.723 62.711 1.00 12.22 ? 199  MET A O   1 
ATOM   1521 C  CB  . MET A 1 199 ? 66.655 48.079 63.878 1.00 8.68  ? 199  MET A CB  1 
ATOM   1522 C  CG  . MET A 1 199 ? 65.399 47.750 64.669 1.00 9.52  ? 199  MET A CG  1 
ATOM   1523 S  SD  . MET A 1 199 ? 64.368 46.614 63.734 1.00 13.73 ? 199  MET A SD  1 
ATOM   1524 C  CE  . MET A 1 199 ? 65.337 45.094 63.843 1.00 12.61 ? 199  MET A CE  1 
ATOM   1525 N  N   . PRO A 1 200 ? 70.014 48.588 64.284 1.00 15.51 ? 200  PRO A N   1 
ATOM   1526 C  CA  . PRO A 1 200 ? 71.298 48.653 63.580 1.00 17.79 ? 200  PRO A CA  1 
ATOM   1527 C  C   . PRO A 1 200 ? 71.244 47.867 62.269 1.00 15.03 ? 200  PRO A C   1 
ATOM   1528 O  O   . PRO A 1 200 ? 72.022 48.109 61.343 1.00 15.78 ? 200  PRO A O   1 
ATOM   1529 C  CB  . PRO A 1 200 ? 72.284 48.002 64.563 1.00 16.96 ? 200  PRO A CB  1 
ATOM   1530 C  CG  . PRO A 1 200 ? 71.565 47.946 65.855 1.00 26.86 ? 200  PRO A CG  1 
ATOM   1531 C  CD  . PRO A 1 200 ? 70.122 47.800 65.523 1.00 19.10 ? 200  PRO A CD  1 
ATOM   1532 N  N   . GLU A 1 201 ? 70.303 46.937 62.182 1.00 13.43 ? 201  GLU A N   1 
ATOM   1533 C  CA  . GLU A 1 201 ? 70.206 46.097 60.991 1.00 14.18 ? 201  GLU A CA  1 
ATOM   1534 C  C   . GLU A 1 201 ? 69.602 46.740 59.748 1.00 14.69 ? 201  GLU A C   1 
ATOM   1535 O  O   . GLU A 1 201 ? 69.828 46.247 58.646 1.00 18.43 ? 201  GLU A O   1 
ATOM   1536 C  CB  . GLU A 1 201 ? 69.406 44.821 61.286 1.00 15.19 ? 201  GLU A CB  1 
ATOM   1537 C  CG  . GLU A 1 201 ? 69.984 43.948 62.402 1.00 16.06 ? 201  GLU A CG  1 
ATOM   1538 C  CD  . GLU A 1 201 ? 69.372 44.259 63.753 1.00 20.69 ? 201  GLU A CD  1 
ATOM   1539 O  OE1 . GLU A 1 201 ? 68.977 45.425 63.986 1.00 15.83 ? 201  GLU A OE1 1 
ATOM   1540 O  OE2 . GLU A 1 201 ? 69.297 43.336 64.595 1.00 23.29 ? 201  GLU A OE2 1 
ATOM   1541 N  N   . ILE A 1 202 ? 68.860 47.830 59.902 1.00 11.98 ? 202  ILE A N   1 
ATOM   1542 C  CA  . ILE A 1 202 ? 68.196 48.420 58.741 1.00 10.73 ? 202  ILE A CA  1 
ATOM   1543 C  C   . ILE A 1 202 ? 68.974 49.455 57.953 1.00 10.15 ? 202  ILE A C   1 
ATOM   1544 O  O   . ILE A 1 202 ? 69.880 50.102 58.477 1.00 11.85 ? 202  ILE A O   1 
ATOM   1545 C  CB  . ILE A 1 202 ? 66.814 48.981 59.127 1.00 11.09 ? 202  ILE A CB  1 
ATOM   1546 C  CG1 . ILE A 1 202 ? 66.942 50.261 59.964 1.00 9.67  ? 202  ILE A CG1 1 
ATOM   1547 C  CG2 . ILE A 1 202 ? 66.062 47.923 59.924 1.00 11.13 ? 202  ILE A CG2 1 
ATOM   1548 C  CD1 . ILE A 1 202 ? 65.601 50.979 60.176 1.00 11.32 ? 202  ILE A CD1 1 
ATOM   1549 N  N   . HIS A 1 203 ? 68.602 49.607 56.681 1.00 9.30  ? 203  HIS A N   1 
ATOM   1550 C  CA  . HIS A 1 203 ? 69.287 50.522 55.769 1.00 9.99  ? 203  HIS A CA  1 
ATOM   1551 C  C   . HIS A 1 203 ? 68.399 51.569 55.135 1.00 10.50 ? 203  HIS A C   1 
ATOM   1552 O  O   . HIS A 1 203 ? 68.867 52.405 54.345 1.00 11.10 ? 203  HIS A O   1 
ATOM   1553 C  CB  . HIS A 1 203 ? 69.969 49.702 54.675 1.00 12.44 ? 203  HIS A CB  1 
ATOM   1554 C  CG  . HIS A 1 203 ? 70.754 48.549 55.215 1.00 12.84 ? 203  HIS A CG  1 
ATOM   1555 N  ND1 . HIS A 1 203 ? 70.297 47.248 55.171 1.00 10.71 ? 203  HIS A ND1 1 
ATOM   1556 C  CD2 . HIS A 1 203 ? 71.918 48.517 55.908 1.00 12.56 ? 203  HIS A CD2 1 
ATOM   1557 C  CE1 . HIS A 1 203 ? 71.143 46.466 55.818 1.00 14.81 ? 203  HIS A CE1 1 
ATOM   1558 N  NE2 . HIS A 1 203 ? 72.134 47.211 56.278 1.00 14.91 ? 203  HIS A NE2 1 
ATOM   1559 N  N   . GLY A 1 204 ? 67.118 51.532 55.476 1.00 10.54 ? 204  GLY A N   1 
ATOM   1560 C  CA  . GLY A 1 204 ? 66.190 52.500 54.924 1.00 9.32  ? 204  GLY A CA  1 
ATOM   1561 C  C   . GLY A 1 204 ? 64.847 52.370 55.615 1.00 8.45  ? 204  GLY A C   1 
ATOM   1562 O  O   . GLY A 1 204 ? 64.612 51.395 56.317 1.00 10.72 ? 204  GLY A O   1 
ATOM   1563 N  N   . LEU A 1 205 ? 63.981 53.357 55.429 1.00 9.00  ? 205  LEU A N   1 
ATOM   1564 C  CA  . LEU A 1 205 ? 62.636 53.330 56.013 1.00 10.59 ? 205  LEU A CA  1 
ATOM   1565 C  C   . LEU A 1 205 ? 61.654 53.884 54.991 1.00 11.39 ? 205  LEU A C   1 
ATOM   1566 O  O   . LEU A 1 205 ? 61.948 54.871 54.314 1.00 13.16 ? 205  LEU A O   1 
ATOM   1567 C  CB  . LEU A 1 205 ? 62.561 54.178 57.286 1.00 9.66  ? 205  LEU A CB  1 
ATOM   1568 C  CG  . LEU A 1 205 ? 63.021 53.481 58.568 1.00 14.95 ? 205  LEU A CG  1 
ATOM   1569 C  CD1 . LEU A 1 205 ? 63.104 54.502 59.699 1.00 18.77 ? 205  LEU A CD1 1 
ATOM   1570 C  CD2 . LEU A 1 205 ? 62.052 52.349 58.917 1.00 14.10 ? 205  LEU A CD2 1 
ATOM   1571 N  N   . MET A 1 206 ? 60.490 53.255 54.895 1.00 10.24 ? 206  MET A N   1 
ATOM   1572 C  CA  . MET A 1 206 ? 59.466 53.692 53.949 1.00 9.88  ? 206  MET A CA  1 
ATOM   1573 C  C   . MET A 1 206 ? 58.142 53.833 54.677 1.00 11.37 ? 206  MET A C   1 
ATOM   1574 O  O   . MET A 1 206 ? 57.877 53.100 55.618 1.00 10.64 ? 206  MET A O   1 
ATOM   1575 C  CB  . MET A 1 206 ? 59.311 52.658 52.825 1.00 10.29 ? 206  MET A CB  1 
ATOM   1576 C  CG  . MET A 1 206 ? 58.264 53.011 51.772 1.00 13.84 ? 206  MET A CG  1 
ATOM   1577 S  SD  . MET A 1 206 ? 58.182 51.699 50.532 1.00 18.46 ? 206  MET A SD  1 
ATOM   1578 C  CE  . MET A 1 206 ? 59.585 52.144 49.455 1.00 34.52 ? 206  MET A CE  1 
ATOM   1579 N  N   . PHE A 1 207 ? 57.310 54.770 54.227 1.00 12.26 ? 207  PHE A N   1 
ATOM   1580 C  CA  . PHE A 1 207 ? 55.999 54.970 54.839 1.00 13.99 ? 207  PHE A CA  1 
ATOM   1581 C  C   . PHE A 1 207 ? 54.954 54.514 53.822 1.00 13.58 ? 207  PHE A C   1 
ATOM   1582 O  O   . PHE A 1 207 ? 55.192 54.569 52.614 1.00 17.67 ? 207  PHE A O   1 
ATOM   1583 C  CB  . PHE A 1 207 ? 55.771 56.450 55.155 1.00 14.73 ? 207  PHE A CB  1 
ATOM   1584 C  CG  . PHE A 1 207 ? 54.689 56.700 56.182 1.00 19.02 ? 207  PHE A CG  1 
ATOM   1585 C  CD1 . PHE A 1 207 ? 54.974 56.639 57.540 1.00 15.28 ? 207  PHE A CD1 1 
ATOM   1586 C  CD2 . PHE A 1 207 ? 53.385 56.993 55.789 1.00 16.81 ? 207  PHE A CD2 1 
ATOM   1587 C  CE1 . PHE A 1 207 ? 53.975 56.868 58.498 1.00 16.80 ? 207  PHE A CE1 1 
ATOM   1588 C  CE2 . PHE A 1 207 ? 52.386 57.223 56.743 1.00 16.34 ? 207  PHE A CE2 1 
ATOM   1589 C  CZ  . PHE A 1 207 ? 52.684 57.159 58.094 1.00 17.29 ? 207  PHE A CZ  1 
ATOM   1590 N  N   . GLY A 1 208 ? 53.818 54.035 54.317 1.00 13.44 ? 208  GLY A N   1 
ATOM   1591 C  CA  . GLY A 1 208 ? 52.737 53.622 53.437 1.00 13.04 ? 208  GLY A CA  1 
ATOM   1592 C  C   . GLY A 1 208 ? 51.565 54.526 53.791 1.00 14.08 ? 208  GLY A C   1 
ATOM   1593 O  O   . GLY A 1 208 ? 50.763 54.170 54.644 1.00 13.92 ? 208  GLY A O   1 
ATOM   1594 N  N   . PRO A 1 209 ? 51.439 55.699 53.148 1.00 15.86 ? 209  PRO A N   1 
ATOM   1595 C  CA  . PRO A 1 209 ? 50.347 56.641 53.440 1.00 17.09 ? 209  PRO A CA  1 
ATOM   1596 C  C   . PRO A 1 209 ? 48.937 56.064 53.328 1.00 17.87 ? 209  PRO A C   1 
ATOM   1597 O  O   . PRO A 1 209 ? 48.089 56.302 54.183 1.00 15.96 ? 209  PRO A O   1 
ATOM   1598 C  CB  . PRO A 1 209 ? 50.557 57.768 52.428 1.00 18.31 ? 209  PRO A CB  1 
ATOM   1599 C  CG  . PRO A 1 209 ? 51.964 57.598 51.933 1.00 26.51 ? 209  PRO A CG  1 
ATOM   1600 C  CD  . PRO A 1 209 ? 52.222 56.128 51.976 1.00 15.42 ? 209  PRO A CD  1 
ATOM   1601 N  N   . GLY A 1 210 ? 48.690 55.328 52.251 1.00 18.59 ? 210  GLY A N   1 
ATOM   1602 C  CA  . GLY A 1 210 ? 47.374 54.753 52.033 1.00 17.90 ? 210  GLY A CA  1 
ATOM   1603 C  C   . GLY A 1 210 ? 46.940 53.808 53.131 1.00 18.41 ? 210  GLY A C   1 
ATOM   1604 O  O   . GLY A 1 210 ? 45.888 54.007 53.752 1.00 16.25 ? 210  GLY A O   1 
ATOM   1605 N  N   . ASP A 1 211 ? 47.734 52.767 53.371 1.00 14.50 ? 211  ASP A N   1 
ATOM   1606 C  CA  . ASP A 1 211 ? 47.380 51.826 54.417 1.00 13.60 ? 211  ASP A CA  1 
ATOM   1607 C  C   . ASP A 1 211 ? 47.324 52.527 55.766 1.00 14.37 ? 211  ASP A C   1 
ATOM   1608 O  O   . ASP A 1 211 ? 46.464 52.218 56.581 1.00 13.85 ? 211  ASP A O   1 
ATOM   1609 C  CB  . ASP A 1 211 ? 48.358 50.651 54.465 1.00 13.88 ? 211  ASP A CB  1 
ATOM   1610 C  CG  . ASP A 1 211 ? 47.996 49.559 53.463 1.00 18.60 ? 211  ASP A CG  1 
ATOM   1611 O  OD1 . ASP A 1 211 ? 46.789 49.341 53.229 1.00 19.75 ? 211  ASP A OD1 1 
ATOM   1612 O  OD2 . ASP A 1 211 ? 48.905 48.909 52.920 1.00 15.76 ? 211  ASP A OD2 1 
ATOM   1613 N  N   . TYR A 1 212 ? 48.226 53.477 56.004 1.00 13.42 ? 212  TYR A N   1 
ATOM   1614 C  CA  . TYR A 1 212 ? 48.202 54.182 57.284 1.00 13.34 ? 212  TYR A CA  1 
ATOM   1615 C  C   . TYR A 1 212 ? 46.877 54.919 57.465 1.00 12.94 ? 212  TYR A C   1 
ATOM   1616 O  O   . TYR A 1 212 ? 46.214 54.783 58.498 1.00 16.60 ? 212  TYR A O   1 
ATOM   1617 C  CB  . TYR A 1 212 ? 49.342 55.197 57.387 1.00 13.01 ? 212  TYR A CB  1 
ATOM   1618 C  CG  . TYR A 1 212 ? 49.187 56.080 58.610 1.00 13.68 ? 212  TYR A CG  1 
ATOM   1619 C  CD1 . TYR A 1 212 ? 49.497 55.603 59.887 1.00 14.15 ? 212  TYR A CD1 1 
ATOM   1620 C  CD2 . TYR A 1 212 ? 48.625 57.349 58.497 1.00 16.71 ? 212  TYR A CD2 1 
ATOM   1621 C  CE1 . TYR A 1 212 ? 49.241 56.377 61.032 1.00 14.47 ? 212  TYR A CE1 1 
ATOM   1622 C  CE2 . TYR A 1 212 ? 48.363 58.130 59.628 1.00 18.26 ? 212  TYR A CE2 1 
ATOM   1623 C  CZ  . TYR A 1 212 ? 48.669 57.638 60.885 1.00 15.99 ? 212  TYR A CZ  1 
ATOM   1624 O  OH  . TYR A 1 212 ? 48.364 58.400 62.000 1.00 19.73 ? 212  TYR A OH  1 
ATOM   1625 N  N   . MET A 1 213 ? 46.495 55.701 56.462 1.00 14.65 ? 213  MET A N   1 
ATOM   1626 C  CA  . MET A 1 213 ? 45.255 56.457 56.545 1.00 17.28 ? 213  MET A CA  1 
ATOM   1627 C  C   . MET A 1 213 ? 44.045 55.563 56.788 1.00 18.53 ? 213  MET A C   1 
ATOM   1628 O  O   . MET A 1 213 ? 43.170 55.896 57.582 1.00 18.87 ? 213  MET A O   1 
ATOM   1629 C  CB  . MET A 1 213 ? 45.060 57.289 55.281 1.00 18.24 ? 213  MET A CB  1 
ATOM   1630 C  CG  . MET A 1 213 ? 46.072 58.420 55.169 1.00 25.29 ? 213  MET A CG  1 
ATOM   1631 S  SD  . MET A 1 213 ? 45.747 59.520 53.795 1.00 29.23 ? 213  MET A SD  1 
ATOM   1632 C  CE  . MET A 1 213 ? 46.660 58.714 52.454 1.00 40.97 ? 213  MET A CE  1 
ATOM   1633 N  N   . ILE A 1 214 ? 43.993 54.416 56.124 1.00 17.88 ? 214  ILE A N   1 
ATOM   1634 C  CA  . ILE A 1 214 ? 42.866 53.518 56.335 1.00 16.58 ? 214  ILE A CA  1 
ATOM   1635 C  C   . ILE A 1 214 ? 42.869 53.021 57.775 1.00 17.74 ? 214  ILE A C   1 
ATOM   1636 O  O   . ILE A 1 214 ? 41.841 53.023 58.452 1.00 17.96 ? 214  ILE A O   1 
ATOM   1637 C  CB  . ILE A 1 214 ? 42.941 52.310 55.366 1.00 19.21 ? 214  ILE A CB  1 
ATOM   1638 C  CG1 . ILE A 1 214 ? 42.780 52.807 53.927 1.00 19.21 ? 214  ILE A CG1 1 
ATOM   1639 C  CG2 . ILE A 1 214 ? 41.870 51.280 55.714 1.00 18.75 ? 214  ILE A CG2 1 
ATOM   1640 C  CD1 . ILE A 1 214 ? 42.960 51.721 52.868 1.00 19.81 ? 214  ILE A CD1 1 
ATOM   1641 N  N   . ASP A 1 215 ? 44.041 52.623 58.256 1.00 13.67 ? 215  ASP A N   1 
ATOM   1642 C  CA  . ASP A 1 215 ? 44.163 52.096 59.596 1.00 17.24 ? 215  ASP A CA  1 
ATOM   1643 C  C   . ASP A 1 215 ? 43.865 53.154 60.649 1.00 16.17 ? 215  ASP A C   1 
ATOM   1644 O  O   . ASP A 1 215 ? 43.364 52.834 61.720 1.00 16.20 ? 215  ASP A O   1 
ATOM   1645 C  CB  . ASP A 1 215 ? 45.569 51.528 59.808 1.00 17.85 ? 215  ASP A CB  1 
ATOM   1646 C  CG  . ASP A 1 215 ? 45.684 50.714 61.084 1.00 23.74 ? 215  ASP A CG  1 
ATOM   1647 O  OD1 . ASP A 1 215 ? 44.878 49.773 61.279 1.00 22.37 ? 215  ASP A OD1 1 
ATOM   1648 O  OD2 . ASP A 1 215 ? 46.587 51.006 61.896 1.00 20.91 ? 215  ASP A OD2 1 
ATOM   1649 N  N   . ALA A 1 216 ? 44.167 54.406 60.324 1.00 18.80 ? 216  ALA A N   1 
ATOM   1650 C  CA  . ALA A 1 216 ? 43.953 55.518 61.250 1.00 22.80 ? 216  ALA A CA  1 
ATOM   1651 C  C   . ALA A 1 216 ? 42.541 56.091 61.160 1.00 25.36 ? 216  ALA A C   1 
ATOM   1652 O  O   . ALA A 1 216 ? 42.192 57.010 61.904 1.00 23.48 ? 216  ALA A O   1 
ATOM   1653 C  CB  . ALA A 1 216 ? 44.972 56.622 60.980 1.00 18.31 ? 216  ALA A CB  1 
ATOM   1654 N  N   . GLY A 1 217 ? 41.738 55.557 60.244 1.00 25.08 ? 217  GLY A N   1 
ATOM   1655 C  CA  . GLY A 1 217 ? 40.377 56.036 60.089 1.00 26.87 ? 217  GLY A CA  1 
ATOM   1656 C  C   . GLY A 1 217 ? 40.310 57.424 59.488 1.00 26.86 ? 217  GLY A C   1 
ATOM   1657 O  O   . GLY A 1 217 ? 39.365 58.174 59.742 1.00 26.36 ? 217  GLY A O   1 
ATOM   1658 N  N   . LEU A 1 218 ? 41.311 57.771 58.686 1.00 23.83 ? 218  LEU A N   1 
ATOM   1659 C  CA  . LEU A 1 218 ? 41.360 59.077 58.052 1.00 25.62 ? 218  LEU A CA  1 
ATOM   1660 C  C   . LEU A 1 218 ? 40.839 58.969 56.628 1.00 31.80 ? 218  LEU A C   1 
ATOM   1661 O  O   . LEU A 1 218 ? 41.149 58.018 55.915 1.00 35.50 ? 218  LEU A O   1 
ATOM   1662 C  CB  . LEU A 1 218 ? 42.796 59.612 58.049 1.00 24.09 ? 218  LEU A CB  1 
ATOM   1663 C  CG  . LEU A 1 218 ? 43.463 59.717 59.424 1.00 26.17 ? 218  LEU A CG  1 
ATOM   1664 C  CD1 . LEU A 1 218 ? 44.913 60.150 59.266 1.00 25.69 ? 218  LEU A CD1 1 
ATOM   1665 C  CD2 . LEU A 1 218 ? 42.700 60.707 60.291 1.00 25.72 ? 218  LEU A CD2 1 
ATOM   1666 N  N   . ASP A 1 219 ? 40.042 59.945 56.218 1.00 36.95 ? 219  ASP A N   1 
ATOM   1667 C  CA  . ASP A 1 219 ? 39.474 59.945 54.881 1.00 45.16 ? 219  ASP A CA  1 
ATOM   1668 C  C   . ASP A 1 219 ? 40.543 60.073 53.809 1.00 49.21 ? 219  ASP A C   1 
ATOM   1669 O  O   . ASP A 1 219 ? 40.949 61.178 53.452 1.00 47.61 ? 219  ASP A O   1 
ATOM   1670 C  CB  . ASP A 1 219 ? 38.455 61.077 54.754 1.00 51.21 ? 219  ASP A CB  1 
ATOM   1671 C  CG  . ASP A 1 219 ? 38.934 62.362 55.401 1.00 57.78 ? 219  ASP A CG  1 
ATOM   1672 O  OD1 . ASP A 1 219 ? 39.262 62.339 56.612 1.00 62.07 ? 219  ASP A OD1 1 
ATOM   1673 O  OD2 . ASP A 1 219 ? 38.979 63.398 54.702 1.00 60.93 ? 219  ASP A OD2 1 
ATOM   1674 N  N   . LEU A 1 220 ? 41.010 58.935 53.305 1.00 54.22 ? 220  LEU A N   1 
ATOM   1675 C  CA  . LEU A 1 220 ? 42.025 58.947 52.262 1.00 59.67 ? 220  LEU A CA  1 
ATOM   1676 C  C   . LEU A 1 220 ? 41.473 59.793 51.125 1.00 60.78 ? 220  LEU A C   1 
ATOM   1677 O  O   . LEU A 1 220 ? 40.322 59.628 50.729 1.00 63.18 ? 220  LEU A O   1 
ATOM   1678 C  CB  . LEU A 1 220 ? 42.335 57.520 51.786 1.00 57.03 ? 220  LEU A CB  1 
ATOM   1679 C  CG  . LEU A 1 220 ? 41.200 56.607 51.316 1.00 54.47 ? 220  LEU A CG  1 
ATOM   1680 C  CD1 . LEU A 1 220 ? 41.785 55.301 50.802 1.00 52.64 ? 220  LEU A CD1 1 
ATOM   1681 C  CD2 . LEU A 1 220 ? 40.238 56.340 52.459 1.00 57.85 ? 220  LEU A CD2 1 
ATOM   1682 N  N   . ASN A 1 221 ? 42.287 60.715 50.623 1.00 63.55 ? 221  ASN A N   1 
ATOM   1683 C  CA  . ASN A 1 221 ? 41.851 61.599 49.553 1.00 67.74 ? 221  ASN A CA  1 
ATOM   1684 C  C   . ASN A 1 221 ? 40.622 62.366 50.032 1.00 69.61 ? 221  ASN A C   1 
ATOM   1685 O  O   . ASN A 1 221 ? 39.606 62.433 49.339 1.00 69.28 ? 221  ASN A O   1 
ATOM   1686 C  CB  . ASN A 1 221 ? 41.504 60.786 48.307 1.00 69.71 ? 221  ASN A CB  1 
ATOM   1687 C  CG  . ASN A 1 221 ? 41.042 61.653 47.153 1.00 70.21 ? 221  ASN A CG  1 
ATOM   1688 O  OD1 . ASN A 1 221 ? 41.769 62.536 46.694 1.00 72.96 ? 221  ASN A OD1 1 
ATOM   1689 N  ND2 . ASN A 1 221 ? 39.825 61.405 46.676 1.00 69.50 ? 221  ASN A ND2 1 
ATOM   1690 N  N   . GLY A 1 222 ? 40.723 62.940 51.227 1.00 71.19 ? 222  GLY A N   1 
ATOM   1691 C  CA  . GLY A 1 222 ? 39.609 63.683 51.786 1.00 73.05 ? 222  GLY A CA  1 
ATOM   1692 C  C   . GLY A 1 222 ? 39.979 65.052 52.324 1.00 74.87 ? 222  GLY A C   1 
ATOM   1693 O  O   . GLY A 1 222 ? 39.440 65.494 53.340 1.00 75.40 ? 222  GLY A O   1 
ATOM   1694 N  N   . ALA A 1 223 ? 40.902 65.727 51.649 1.00 76.60 ? 223  ALA A N   1 
ATOM   1695 C  CA  . ALA A 1 223 ? 41.321 67.059 52.067 1.00 76.84 ? 223  ALA A CA  1 
ATOM   1696 C  C   . ALA A 1 223 ? 40.333 68.077 51.497 1.00 76.83 ? 223  ALA A C   1 
ATOM   1697 O  O   . ALA A 1 223 ? 40.510 68.566 50.379 1.00 77.27 ? 223  ALA A O   1 
ATOM   1698 C  CB  . ALA A 1 223 ? 42.736 67.346 51.564 1.00 75.97 ? 223  ALA A CB  1 
ATOM   1699 N  N   . LEU A 1 224 ? 39.289 68.378 52.267 1.00 76.66 ? 224  LEU A N   1 
ATOM   1700 C  CA  . LEU A 1 224 ? 38.253 69.325 51.853 1.00 77.91 ? 224  LEU A CA  1 
ATOM   1701 C  C   . LEU A 1 224 ? 38.852 70.553 51.176 1.00 78.16 ? 224  LEU A C   1 
ATOM   1702 O  O   . LEU A 1 224 ? 38.634 70.786 49.986 1.00 78.42 ? 224  LEU A O   1 
ATOM   1703 C  CB  . LEU A 1 224 ? 37.416 69.750 53.064 1.00 78.17 ? 224  LEU A CB  1 
ATOM   1704 C  CG  . LEU A 1 224 ? 36.613 68.631 53.738 1.00 79.29 ? 224  LEU A CG  1 
ATOM   1705 C  CD1 . LEU A 1 224 ? 35.975 69.146 55.021 1.00 78.60 ? 224  LEU A CD1 1 
ATOM   1706 C  CD2 . LEU A 1 224 ? 35.551 68.110 52.773 1.00 77.66 ? 224  LEU A CD2 1 
ATOM   1707 N  N   . SER A 1 225 ? 39.604 71.335 51.944 1.00 77.57 ? 225  SER A N   1 
ATOM   1708 C  CA  . SER A 1 225 ? 40.259 72.528 51.420 1.00 77.04 ? 225  SER A CA  1 
ATOM   1709 C  C   . SER A 1 225 ? 41.760 72.254 51.413 1.00 75.40 ? 225  SER A C   1 
ATOM   1710 O  O   . SER A 1 225 ? 42.560 73.092 51.833 1.00 75.84 ? 225  SER A O   1 
ATOM   1711 C  CB  . SER A 1 225 ? 39.951 73.738 52.306 1.00 77.71 ? 225  SER A CB  1 
ATOM   1712 O  OG  . SER A 1 225 ? 38.556 73.991 52.358 1.00 80.18 ? 225  SER A OG  1 
ATOM   1713 N  N   . GLY A 1 226 ? 42.130 71.072 50.927 1.00 73.84 ? 226  GLY A N   1 
ATOM   1714 C  CA  . GLY A 1 226 ? 43.527 70.683 50.896 1.00 70.82 ? 226  GLY A CA  1 
ATOM   1715 C  C   . GLY A 1 226 ? 43.966 70.433 52.325 1.00 69.40 ? 226  GLY A C   1 
ATOM   1716 O  O   . GLY A 1 226 ? 43.146 70.070 53.168 1.00 71.34 ? 226  GLY A O   1 
ATOM   1717 N  N   . VAL A 1 227 ? 45.252 70.622 52.604 1.00 67.05 ? 227  VAL A N   1 
ATOM   1718 C  CA  . VAL A 1 227 ? 45.776 70.436 53.955 1.00 62.74 ? 227  VAL A CA  1 
ATOM   1719 C  C   . VAL A 1 227 ? 45.483 69.050 54.533 1.00 58.66 ? 227  VAL A C   1 
ATOM   1720 O  O   . VAL A 1 227 ? 44.368 68.779 54.983 1.00 57.10 ? 227  VAL A O   1 
ATOM   1721 C  CB  . VAL A 1 227 ? 45.191 71.499 54.919 1.00 63.02 ? 227  VAL A CB  1 
ATOM   1722 C  CG1 . VAL A 1 227 ? 45.811 71.352 56.302 1.00 61.30 ? 227  VAL A CG1 1 
ATOM   1723 C  CG2 . VAL A 1 227 ? 45.435 72.894 54.360 1.00 62.00 ? 227  VAL A CG2 1 
ATOM   1724 N  N   . PRO A 1 228 ? 46.489 68.157 54.532 1.00 54.60 ? 228  PRO A N   1 
ATOM   1725 C  CA  . PRO A 1 228 ? 46.354 66.793 55.056 1.00 49.55 ? 228  PRO A CA  1 
ATOM   1726 C  C   . PRO A 1 228 ? 45.872 66.798 56.502 1.00 44.31 ? 228  PRO A C   1 
ATOM   1727 O  O   . PRO A 1 228 ? 46.012 67.798 57.205 1.00 44.70 ? 228  PRO A O   1 
ATOM   1728 C  CB  . PRO A 1 228 ? 47.767 66.238 54.929 1.00 50.14 ? 228  PRO A CB  1 
ATOM   1729 C  CG  . PRO A 1 228 ? 48.288 66.940 53.723 1.00 54.86 ? 228  PRO A CG  1 
ATOM   1730 C  CD  . PRO A 1 228 ? 47.826 68.357 53.947 1.00 54.36 ? 228  PRO A CD  1 
ATOM   1731 N  N   . HIS A 1 229 ? 45.307 65.680 56.943 1.00 38.10 ? 229  HIS A N   1 
ATOM   1732 C  CA  . HIS A 1 229 ? 44.812 65.576 58.309 1.00 35.37 ? 229  HIS A CA  1 
ATOM   1733 C  C   . HIS A 1 229 ? 45.974 65.747 59.282 1.00 33.73 ? 229  HIS A C   1 
ATOM   1734 O  O   . HIS A 1 229 ? 47.077 65.262 59.034 1.00 31.74 ? 229  HIS A O   1 
ATOM   1735 C  CB  . HIS A 1 229 ? 44.144 64.218 58.525 1.00 31.09 ? 229  HIS A CB  1 
ATOM   1736 C  CG  . HIS A 1 229 ? 43.291 64.153 59.753 1.00 29.84 ? 229  HIS A CG  1 
ATOM   1737 N  ND1 . HIS A 1 229 ? 43.815 64.142 61.027 1.00 27.17 ? 229  HIS A ND1 1 
ATOM   1738 C  CD2 . HIS A 1 229 ? 41.945 64.111 59.900 1.00 33.51 ? 229  HIS A CD2 1 
ATOM   1739 C  CE1 . HIS A 1 229 ? 42.829 64.094 61.906 1.00 30.84 ? 229  HIS A CE1 1 
ATOM   1740 N  NE2 . HIS A 1 229 ? 41.684 64.074 61.248 1.00 31.03 ? 229  HIS A NE2 1 
ATOM   1741 N  N   . PRO A 1 230 ? 45.742 66.457 60.399 1.00 32.13 ? 230  PRO A N   1 
ATOM   1742 C  CA  . PRO A 1 230 ? 46.783 66.688 61.405 1.00 29.44 ? 230  PRO A CA  1 
ATOM   1743 C  C   . PRO A 1 230 ? 47.370 65.390 61.959 1.00 28.13 ? 230  PRO A C   1 
ATOM   1744 O  O   . PRO A 1 230 ? 48.563 65.324 62.260 1.00 27.01 ? 230  PRO A O   1 
ATOM   1745 C  CB  . PRO A 1 230 ? 46.050 67.495 62.480 1.00 31.76 ? 230  PRO A CB  1 
ATOM   1746 C  CG  . PRO A 1 230 ? 45.040 68.258 61.686 1.00 34.43 ? 230  PRO A CG  1 
ATOM   1747 C  CD  . PRO A 1 230 ? 44.515 67.197 60.743 1.00 34.96 ? 230  PRO A CD  1 
ATOM   1748 N  N   . THR A 1 231 ? 46.530 64.364 62.098 1.00 26.02 ? 231  THR A N   1 
ATOM   1749 C  CA  . THR A 1 231 ? 46.983 63.077 62.616 1.00 23.76 ? 231  THR A CA  1 
ATOM   1750 C  C   . THR A 1 231 ? 48.014 62.478 61.666 1.00 20.18 ? 231  THR A C   1 
ATOM   1751 O  O   . THR A 1 231 ? 48.971 61.848 62.103 1.00 20.87 ? 231  THR A O   1 
ATOM   1752 C  CB  . THR A 1 231 ? 45.809 62.083 62.793 1.00 23.45 ? 231  THR A CB  1 
ATOM   1753 O  OG1 . THR A 1 231 ? 44.893 62.596 63.773 1.00 30.97 ? 231  THR A OG1 1 
ATOM   1754 C  CG2 . THR A 1 231 ? 46.321 60.726 63.276 1.00 22.84 ? 231  THR A CG2 1 
ATOM   1755 N  N   . PHE A 1 232 ? 47.808 62.681 60.370 1.00 18.77 ? 232  PHE A N   1 
ATOM   1756 C  CA  . PHE A 1 232 ? 48.733 62.183 59.355 1.00 22.50 ? 232  PHE A CA  1 
ATOM   1757 C  C   . PHE A 1 232 ? 50.022 63.002 59.415 1.00 24.02 ? 232  PHE A C   1 
ATOM   1758 O  O   . PHE A 1 232 ? 51.123 62.452 59.359 1.00 20.00 ? 232  PHE A O   1 
ATOM   1759 C  CB  . PHE A 1 232 ? 48.120 62.311 57.957 1.00 22.08 ? 232  PHE A CB  1 
ATOM   1760 C  CG  . PHE A 1 232 ? 49.048 61.901 56.846 1.00 19.80 ? 232  PHE A CG  1 
ATOM   1761 C  CD1 . PHE A 1 232 ? 49.278 60.559 56.571 1.00 28.90 ? 232  PHE A CD1 1 
ATOM   1762 C  CD2 . PHE A 1 232 ? 49.702 62.857 56.081 1.00 21.86 ? 232  PHE A CD2 1 
ATOM   1763 C  CE1 . PHE A 1 232 ? 50.147 60.179 55.548 1.00 26.74 ? 232  PHE A CE1 1 
ATOM   1764 C  CE2 . PHE A 1 232 ? 50.571 62.487 55.062 1.00 25.06 ? 232  PHE A CE2 1 
ATOM   1765 C  CZ  . PHE A 1 232 ? 50.793 61.142 54.795 1.00 25.82 ? 232  PHE A CZ  1 
ATOM   1766 N  N   . VAL A 1 233 ? 49.881 64.322 59.521 1.00 22.98 ? 233  VAL A N   1 
ATOM   1767 C  CA  . VAL A 1 233 ? 51.050 65.195 59.597 1.00 23.84 ? 233  VAL A CA  1 
ATOM   1768 C  C   . VAL A 1 233 ? 51.931 64.778 60.771 1.00 21.43 ? 233  VAL A C   1 
ATOM   1769 O  O   . VAL A 1 233 ? 53.148 64.641 60.625 1.00 22.46 ? 233  VAL A O   1 
ATOM   1770 C  CB  . VAL A 1 233 ? 50.636 66.681 59.768 1.00 25.77 ? 233  VAL A CB  1 
ATOM   1771 C  CG1 . VAL A 1 233 ? 51.874 67.551 59.984 1.00 25.90 ? 233  VAL A CG1 1 
ATOM   1772 C  CG2 . VAL A 1 233 ? 49.888 67.149 58.530 1.00 25.59 ? 233  VAL A CG2 1 
ATOM   1773 N  N   . GLU A 1 234 ? 51.316 64.574 61.932 1.00 20.75 ? 234  GLU A N   1 
ATOM   1774 C  CA  . GLU A 1 234 ? 52.054 64.165 63.121 1.00 19.74 ? 234  GLU A CA  1 
ATOM   1775 C  C   . GLU A 1 234 ? 52.753 62.828 62.882 1.00 19.45 ? 234  GLU A C   1 
ATOM   1776 O  O   . GLU A 1 234 ? 53.906 62.641 63.275 1.00 18.23 ? 234  GLU A O   1 
ATOM   1777 C  CB  . GLU A 1 234 ? 51.113 64.024 64.318 1.00 23.23 ? 234  GLU A CB  1 
ATOM   1778 C  CG  . GLU A 1 234 ? 50.504 65.331 64.790 1.00 34.12 ? 234  GLU A CG  1 
ATOM   1779 C  CD  . GLU A 1 234 ? 49.439 65.120 65.849 1.00 42.82 ? 234  GLU A CD  1 
ATOM   1780 O  OE1 . GLU A 1 234 ? 49.725 64.426 66.852 1.00 46.58 ? 234  GLU A OE1 1 
ATOM   1781 O  OE2 . GLU A 1 234 ? 48.318 65.651 65.681 1.00 47.24 ? 234  GLU A OE2 1 
ATOM   1782 N  N   . ALA A 1 235 ? 52.043 61.903 62.239 1.00 17.52 ? 235  ALA A N   1 
ATOM   1783 C  CA  . ALA A 1 235 ? 52.594 60.582 61.955 1.00 18.77 ? 235  ALA A CA  1 
ATOM   1784 C  C   . ALA A 1 235 ? 53.823 60.695 61.063 1.00 14.38 ? 235  ALA A C   1 
ATOM   1785 O  O   . ALA A 1 235 ? 54.850 60.070 61.327 1.00 15.26 ? 235  ALA A O   1 
ATOM   1786 C  CB  . ALA A 1 235 ? 51.538 59.703 61.284 1.00 15.14 ? 235  ALA A CB  1 
ATOM   1787 N  N   . MET A 1 236 ? 53.725 61.493 60.010 1.00 14.87 ? 236  MET A N   1 
ATOM   1788 C  CA  . MET A 1 236 ? 54.858 61.662 59.104 1.00 17.81 ? 236  MET A CA  1 
ATOM   1789 C  C   . MET A 1 236 ? 56.020 62.372 59.792 1.00 19.05 ? 236  MET A C   1 
ATOM   1790 O  O   . MET A 1 236 ? 57.188 62.103 59.501 1.00 17.48 ? 236  MET A O   1 
ATOM   1791 C  CB  . MET A 1 236 ? 54.448 62.444 57.860 1.00 19.21 ? 236  MET A CB  1 
ATOM   1792 C  CG  . MET A 1 236 ? 53.736 61.608 56.813 1.00 25.67 ? 236  MET A CG  1 
ATOM   1793 S  SD  . MET A 1 236 ? 54.670 60.104 56.441 1.00 31.97 ? 236  MET A SD  1 
ATOM   1794 C  CE  . MET A 1 236 ? 56.145 60.764 55.788 1.00 16.47 ? 236  MET A CE  1 
ATOM   1795 N  N   . THR A 1 237 ? 55.701 63.279 60.707 1.00 20.45 ? 237  THR A N   1 
ATOM   1796 C  CA  . THR A 1 237 ? 56.745 63.991 61.422 1.00 20.31 ? 237  THR A CA  1 
ATOM   1797 C  C   . THR A 1 237 ? 57.492 63.042 62.337 1.00 18.03 ? 237  THR A C   1 
ATOM   1798 O  O   . THR A 1 237 ? 58.723 63.078 62.402 1.00 21.53 ? 237  THR A O   1 
ATOM   1799 C  CB  . THR A 1 237 ? 56.169 65.147 62.256 1.00 21.59 ? 237  THR A CB  1 
ATOM   1800 O  OG1 . THR A 1 237 ? 55.659 66.151 61.371 1.00 25.81 ? 237  THR A OG1 1 
ATOM   1801 C  CG2 . THR A 1 237 ? 57.254 65.756 63.138 1.00 27.36 ? 237  THR A CG2 1 
ATOM   1802 N  N   . LYS A 1 238 ? 56.753 62.195 63.044 1.00 18.20 ? 238  LYS A N   1 
ATOM   1803 C  CA  . LYS A 1 238 ? 57.375 61.239 63.946 1.00 16.02 ? 238  LYS A CA  1 
ATOM   1804 C  C   . LYS A 1 238 ? 58.235 60.263 63.144 1.00 17.19 ? 238  LYS A C   1 
ATOM   1805 O  O   . LYS A 1 238 ? 59.365 59.951 63.524 1.00 14.37 ? 238  LYS A O   1 
ATOM   1806 C  CB  . LYS A 1 238 ? 56.312 60.480 64.730 1.00 16.97 ? 238  LYS A CB  1 
ATOM   1807 C  CG  . LYS A 1 238 ? 56.886 59.548 65.780 1.00 19.60 ? 238  LYS A CG  1 
ATOM   1808 C  CD  . LYS A 1 238 ? 55.785 58.801 66.516 1.00 19.96 ? 238  LYS A CD  1 
ATOM   1809 C  CE  . LYS A 1 238 ? 56.363 57.894 67.583 1.00 24.68 ? 238  LYS A CE  1 
ATOM   1810 N  NZ  . LYS A 1 238 ? 55.317 57.045 68.201 1.00 27.33 ? 238  LYS A NZ  1 
ATOM   1811 N  N   . PHE A 1 239 ? 57.688 59.793 62.028 1.00 15.83 ? 239  PHE A N   1 
ATOM   1812 C  CA  . PHE A 1 239 ? 58.392 58.868 61.149 1.00 12.90 ? 239  PHE A CA  1 
ATOM   1813 C  C   . PHE A 1 239 ? 59.685 59.466 60.586 1.00 14.60 ? 239  PHE A C   1 
ATOM   1814 O  O   . PHE A 1 239 ? 60.759 58.866 60.704 1.00 14.96 ? 239  PHE A O   1 
ATOM   1815 C  CB  . PHE A 1 239 ? 57.458 58.455 59.993 1.00 14.46 ? 239  PHE A CB  1 
ATOM   1816 C  CG  . PHE A 1 239 ? 58.142 57.708 58.868 1.00 12.51 ? 239  PHE A CG  1 
ATOM   1817 C  CD1 . PHE A 1 239 ? 58.302 56.328 58.916 1.00 12.59 ? 239  PHE A CD1 1 
ATOM   1818 C  CD2 . PHE A 1 239 ? 58.607 58.400 57.746 1.00 11.24 ? 239  PHE A CD2 1 
ATOM   1819 C  CE1 . PHE A 1 239 ? 58.919 55.635 57.854 1.00 10.94 ? 239  PHE A CE1 1 
ATOM   1820 C  CE2 . PHE A 1 239 ? 59.227 57.729 56.682 1.00 12.24 ? 239  PHE A CE2 1 
ATOM   1821 C  CZ  . PHE A 1 239 ? 59.381 56.345 56.735 1.00 10.16 ? 239  PHE A CZ  1 
ATOM   1822 N  N   . SER A 1 240 ? 59.590 60.647 59.978 1.00 13.87 ? 240  SER A N   1 
ATOM   1823 C  CA  . SER A 1 240 ? 60.752 61.276 59.359 1.00 15.34 ? 240  SER A CA  1 
ATOM   1824 C  C   . SER A 1 240 ? 61.820 61.673 60.364 1.00 16.03 ? 240  SER A C   1 
ATOM   1825 O  O   . SER A 1 240 ? 63.008 61.540 60.083 1.00 14.53 ? 240  SER A O   1 
ATOM   1826 C  CB  . SER A 1 240 ? 60.335 62.495 58.532 1.00 20.85 ? 240  SER A CB  1 
ATOM   1827 O  OG  . SER A 1 240 ? 59.671 63.456 59.329 1.00 31.58 ? 240  SER A OG  1 
ATOM   1828 N  N   . THR A 1 241 ? 61.398 62.161 61.525 1.00 12.92 ? 241  THR A N   1 
ATOM   1829 C  CA  . THR A 1 241 ? 62.347 62.550 62.563 1.00 14.29 ? 241  THR A CA  1 
ATOM   1830 C  C   . THR A 1 241 ? 63.085 61.315 63.085 1.00 15.22 ? 241  THR A C   1 
ATOM   1831 O  O   . THR A 1 241 ? 64.292 61.368 63.344 1.00 15.01 ? 241  THR A O   1 
ATOM   1832 C  CB  . THR A 1 241 ? 61.628 63.258 63.732 1.00 17.81 ? 241  THR A CB  1 
ATOM   1833 O  OG1 . THR A 1 241 ? 61.004 64.451 63.243 1.00 22.84 ? 241  THR A OG1 1 
ATOM   1834 C  CG2 . THR A 1 241 ? 62.627 63.640 64.817 1.00 27.95 ? 241  THR A CG2 1 
ATOM   1835 N  N   . ALA A 1 242 ? 62.371 60.200 63.233 1.00 13.28 ? 242  ALA A N   1 
ATOM   1836 C  CA  . ALA A 1 242 ? 63.002 58.973 63.712 1.00 12.16 ? 242  ALA A CA  1 
ATOM   1837 C  C   . ALA A 1 242 ? 64.059 58.512 62.709 1.00 12.63 ? 242  ALA A C   1 
ATOM   1838 O  O   . ALA A 1 242 ? 65.169 58.153 63.097 1.00 13.12 ? 242  ALA A O   1 
ATOM   1839 C  CB  . ALA A 1 242 ? 61.955 57.872 63.932 1.00 12.49 ? 242  ALA A CB  1 
ATOM   1840 N  N   . ALA A 1 243 ? 63.714 58.514 61.421 1.00 8.97  ? 243  ALA A N   1 
ATOM   1841 C  CA  . ALA A 1 243 ? 64.669 58.116 60.387 1.00 11.17 ? 243  ALA A CA  1 
ATOM   1842 C  C   . ALA A 1 243 ? 65.899 59.042 60.410 1.00 13.34 ? 243  ALA A C   1 
ATOM   1843 O  O   . ALA A 1 243 ? 67.039 58.584 60.446 1.00 12.26 ? 243  ALA A O   1 
ATOM   1844 C  CB  . ALA A 1 243 ? 63.998 58.168 58.996 1.00 10.83 ? 243  ALA A CB  1 
ATOM   1845 N  N   . GLN A 1 244 ? 65.660 60.346 60.400 1.00 13.66 ? 244  GLN A N   1 
ATOM   1846 C  CA  . GLN A 1 244 ? 66.752 61.327 60.404 1.00 13.61 ? 244  GLN A CA  1 
ATOM   1847 C  C   . GLN A 1 244 ? 67.700 61.220 61.603 1.00 11.08 ? 244  GLN A C   1 
ATOM   1848 O  O   . GLN A 1 244 ? 68.920 61.258 61.441 1.00 14.52 ? 244  GLN A O   1 
ATOM   1849 C  CB  . GLN A 1 244 ? 66.174 62.750 60.354 1.00 17.36 ? 244  GLN A CB  1 
ATOM   1850 C  CG  . GLN A 1 244 ? 65.583 63.146 59.002 1.00 26.80 ? 244  GLN A CG  1 
ATOM   1851 C  CD  . GLN A 1 244 ? 64.489 64.200 59.120 1.00 34.01 ? 244  GLN A CD  1 
ATOM   1852 O  OE1 . GLN A 1 244 ? 64.379 64.898 60.136 1.00 35.37 ? 244  GLN A OE1 1 
ATOM   1853 N  NE2 . GLN A 1 244 ? 63.674 64.323 58.077 1.00 30.40 ? 244  GLN A NE2 1 
ATOM   1854 N  N   . ARG A 1 245 ? 67.147 61.082 62.802 1.00 13.56 ? 245  ARG A N   1 
ATOM   1855 C  CA  . ARG A 1 245 ? 67.987 61.021 63.989 1.00 15.88 ? 245  ARG A CA  1 
ATOM   1856 C  C   . ARG A 1 245 ? 68.888 59.789 64.027 1.00 16.20 ? 245  ARG A C   1 
ATOM   1857 O  O   . ARG A 1 245 ? 69.975 59.824 64.614 1.00 12.62 ? 245  ARG A O   1 
ATOM   1858 C  CB  . ARG A 1 245 ? 67.125 61.076 65.257 1.00 17.77 ? 245  ARG A CB  1 
ATOM   1859 C  CG  . ARG A 1 245 ? 66.603 59.741 65.738 1.00 22.46 ? 245  ARG A CG  1 
ATOM   1860 C  CD  . ARG A 1 245 ? 66.083 59.848 67.180 1.00 29.93 ? 245  ARG A CD  1 
ATOM   1861 N  NE  . ARG A 1 245 ? 64.882 60.665 67.236 1.00 31.75 ? 245  ARG A NE  1 
ATOM   1862 C  CZ  . ARG A 1 245 ? 63.640 60.184 67.217 1.00 28.99 ? 245  ARG A CZ  1 
ATOM   1863 N  NH1 . ARG A 1 245 ? 63.413 58.874 67.164 1.00 20.22 ? 245  ARG A NH1 1 
ATOM   1864 N  NH2 . ARG A 1 245 ? 62.620 61.027 67.215 1.00 28.36 ? 245  ARG A NH2 1 
ATOM   1865 N  N   . ASN A 1 246 ? 68.444 58.703 63.394 1.00 13.67 ? 246  ASN A N   1 
ATOM   1866 C  CA  . ASN A 1 246 ? 69.205 57.458 63.378 1.00 11.29 ? 246  ASN A CA  1 
ATOM   1867 C  C   . ASN A 1 246 ? 70.076 57.277 62.143 1.00 12.44 ? 246  ASN A C   1 
ATOM   1868 O  O   . ASN A 1 246 ? 70.729 56.243 61.984 1.00 13.04 ? 246  ASN A O   1 
ATOM   1869 C  CB  . ASN A 1 246 ? 68.245 56.267 63.533 1.00 11.75 ? 246  ASN A CB  1 
ATOM   1870 C  CG  . ASN A 1 246 ? 67.706 56.140 64.952 1.00 13.04 ? 246  ASN A CG  1 
ATOM   1871 O  OD1 . ASN A 1 246 ? 68.428 55.736 65.866 1.00 11.39 ? 246  ASN A OD1 1 
ATOM   1872 N  ND2 . ASN A 1 246 ? 66.441 56.498 65.145 1.00 12.67 ? 246  ASN A ND2 1 
ATOM   1873 N  N   . GLY A 1 247 ? 70.077 58.277 61.268 1.00 11.91 ? 247  GLY A N   1 
ATOM   1874 C  CA  . GLY A 1 247 ? 70.881 58.214 60.063 1.00 12.84 ? 247  GLY A CA  1 
ATOM   1875 C  C   . GLY A 1 247 ? 70.365 57.185 59.070 1.00 14.29 ? 247  GLY A C   1 
ATOM   1876 O  O   . GLY A 1 247 ? 71.155 56.501 58.408 1.00 12.22 ? 247  GLY A O   1 
ATOM   1877 N  N   . VAL A 1 248 ? 69.039 57.084 58.973 1.00 11.10 ? 248  VAL A N   1 
ATOM   1878 C  CA  . VAL A 1 248 ? 68.395 56.135 58.060 1.00 11.15 ? 248  VAL A CA  1 
ATOM   1879 C  C   . VAL A 1 248 ? 67.738 56.896 56.911 1.00 12.19 ? 248  VAL A C   1 
ATOM   1880 O  O   . VAL A 1 248 ? 66.902 57.779 57.129 1.00 15.85 ? 248  VAL A O   1 
ATOM   1881 C  CB  . VAL A 1 248 ? 67.331 55.300 58.806 1.00 12.02 ? 248  VAL A CB  1 
ATOM   1882 C  CG1 . VAL A 1 248 ? 66.672 54.306 57.855 1.00 10.84 ? 248  VAL A CG1 1 
ATOM   1883 C  CG2 . VAL A 1 248 ? 67.996 54.544 59.943 1.00 11.29 ? 248  VAL A CG2 1 
ATOM   1884 N  N   . PRO A 1 249 ? 68.111 56.574 55.665 1.00 13.61 ? 249  PRO A N   1 
ATOM   1885 C  CA  . PRO A 1 249 ? 67.490 57.302 54.556 1.00 14.49 ? 249  PRO A CA  1 
ATOM   1886 C  C   . PRO A 1 249 ? 66.058 56.859 54.339 1.00 13.57 ? 249  PRO A C   1 
ATOM   1887 O  O   . PRO A 1 249 ? 65.718 55.704 54.585 1.00 11.04 ? 249  PRO A O   1 
ATOM   1888 C  CB  . PRO A 1 249 ? 68.381 56.952 53.375 1.00 13.50 ? 249  PRO A CB  1 
ATOM   1889 C  CG  . PRO A 1 249 ? 68.771 55.531 53.675 1.00 12.14 ? 249  PRO A CG  1 
ATOM   1890 C  CD  . PRO A 1 249 ? 69.077 55.576 55.168 1.00 10.59 ? 249  PRO A CD  1 
ATOM   1891 N  N   . ILE A 1 250 ? 65.219 57.780 53.881 1.00 12.48 ? 250  ILE A N   1 
ATOM   1892 C  CA  . ILE A 1 250 ? 63.826 57.447 53.621 1.00 13.98 ? 250  ILE A CA  1 
ATOM   1893 C  C   . ILE A 1 250 ? 63.644 57.050 52.158 1.00 13.71 ? 250  ILE A C   1 
ATOM   1894 O  O   . ILE A 1 250 ? 64.275 57.617 51.256 1.00 13.05 ? 250  ILE A O   1 
ATOM   1895 C  CB  . ILE A 1 250 ? 62.895 58.636 53.950 1.00 14.45 ? 250  ILE A CB  1 
ATOM   1896 C  CG1 . ILE A 1 250 ? 63.015 58.984 55.440 1.00 17.98 ? 250  ILE A CG1 1 
ATOM   1897 C  CG2 . ILE A 1 250 ? 61.442 58.280 53.611 1.00 15.45 ? 250  ILE A CG2 1 
ATOM   1898 C  CD1 . ILE A 1 250 ? 62.265 60.246 55.837 1.00 18.02 ? 250  ILE A CD1 1 
ATOM   1899 N  N   . PHE A 1 251 ? 62.792 56.048 51.950 1.00 12.82 ? 251  PHE A N   1 
ATOM   1900 C  CA  . PHE A 1 251 ? 62.438 55.518 50.636 1.00 12.54 ? 251  PHE A CA  1 
ATOM   1901 C  C   . PHE A 1 251 ? 60.988 55.927 50.423 1.00 13.68 ? 251  PHE A C   1 
ATOM   1902 O  O   . PHE A 1 251 ? 60.166 55.776 51.328 1.00 13.80 ? 251  PHE A O   1 
ATOM   1903 C  CB  . PHE A 1 251 ? 62.481 53.991 50.639 1.00 13.97 ? 251  PHE A CB  1 
ATOM   1904 C  CG  . PHE A 1 251 ? 63.846 53.408 50.486 1.00 14.76 ? 251  PHE A CG  1 
ATOM   1905 C  CD1 . PHE A 1 251 ? 64.878 53.753 51.356 1.00 16.26 ? 251  PHE A CD1 1 
ATOM   1906 C  CD2 . PHE A 1 251 ? 64.090 52.463 49.496 1.00 18.51 ? 251  PHE A CD2 1 
ATOM   1907 C  CE1 . PHE A 1 251 ? 66.139 53.157 51.238 1.00 20.75 ? 251  PHE A CE1 1 
ATOM   1908 C  CE2 . PHE A 1 251 ? 65.340 51.862 49.368 1.00 24.42 ? 251  PHE A CE2 1 
ATOM   1909 C  CZ  . PHE A 1 251 ? 66.369 52.209 50.243 1.00 19.60 ? 251  PHE A CZ  1 
ATOM   1910 N  N   . GLY A 1 252 ? 60.653 56.433 49.244 1.00 16.05 ? 252  GLY A N   1 
ATOM   1911 C  CA  . GLY A 1 252 ? 59.270 56.821 49.024 1.00 18.14 ? 252  GLY A CA  1 
ATOM   1912 C  C   . GLY A 1 252 ? 58.954 57.089 47.567 1.00 16.98 ? 252  GLY A C   1 
ATOM   1913 O  O   . GLY A 1 252 ? 59.782 56.846 46.698 1.00 15.66 ? 252  GLY A O   1 
ATOM   1914 N  N   . GLY A 1 253 ? 57.758 57.606 47.308 1.00 21.33 ? 253  GLY A N   1 
ATOM   1915 C  CA  . GLY A 1 253 ? 57.361 57.897 45.942 1.00 20.78 ? 253  GLY A CA  1 
ATOM   1916 C  C   . GLY A 1 253 ? 57.053 59.369 45.780 1.00 20.08 ? 253  GLY A C   1 
ATOM   1917 O  O   . GLY A 1 253 ? 56.800 60.062 46.756 1.00 22.18 ? 253  GLY A O   1 
ATOM   1918 N  N   . ALA A 1 254 ? 57.097 59.863 44.550 1.00 17.78 ? 254  ALA A N   1 
ATOM   1919 C  CA  . ALA A 1 254 ? 56.789 61.261 44.307 1.00 18.51 ? 254  ALA A CA  1 
ATOM   1920 C  C   . ALA A 1 254 ? 55.537 61.327 43.441 1.00 23.05 ? 254  ALA A C   1 
ATOM   1921 O  O   . ALA A 1 254 ? 55.581 60.960 42.272 1.00 24.46 ? 254  ALA A O   1 
ATOM   1922 C  CB  . ALA A 1 254 ? 57.945 61.942 43.606 1.00 19.50 ? 254  ALA A CB  1 
ATOM   1923 N  N   . LEU A 1 255 ? 54.435 61.793 44.027 1.00 26.91 ? 255  LEU A N   1 
ATOM   1924 C  CA  . LEU A 1 255 ? 53.161 61.919 43.319 1.00 30.86 ? 255  LEU A CA  1 
ATOM   1925 C  C   . LEU A 1 255 ? 53.367 62.719 42.037 1.00 27.20 ? 255  LEU A C   1 
ATOM   1926 O  O   . LEU A 1 255 ? 52.769 62.427 41.001 1.00 27.33 ? 255  LEU A O   1 
ATOM   1927 C  CB  . LEU A 1 255 ? 52.130 62.605 44.222 1.00 36.16 ? 255  LEU A CB  1 
ATOM   1928 C  CG  . LEU A 1 255 ? 51.888 61.924 45.576 1.00 40.97 ? 255  LEU A CG  1 
ATOM   1929 C  CD1 . LEU A 1 255 ? 50.807 62.680 46.339 1.00 41.94 ? 255  LEU A CD1 1 
ATOM   1930 C  CD2 . LEU A 1 255 ? 51.473 60.466 45.362 1.00 42.47 ? 255  LEU A CD2 1 
ATOM   1931 N  N   . SER A 1 256 ? 54.210 63.739 42.120 1.00 21.41 ? 256  SER A N   1 
ATOM   1932 C  CA  . SER A 1 256 ? 54.544 64.558 40.963 1.00 19.23 ? 256  SER A CA  1 
ATOM   1933 C  C   . SER A 1 256 ? 56.044 64.785 41.062 1.00 20.54 ? 256  SER A C   1 
ATOM   1934 O  O   . SER A 1 256 ? 56.584 64.958 42.159 1.00 20.26 ? 256  SER A O   1 
ATOM   1935 C  CB  . SER A 1 256 ? 53.783 65.887 40.981 1.00 24.25 ? 256  SER A CB  1 
ATOM   1936 O  OG  . SER A 1 256 ? 54.149 66.691 42.081 1.00 27.94 ? 256  SER A OG  1 
ATOM   1937 N  N   . VAL A 1 257 ? 56.729 64.785 39.928 1.00 20.93 ? 257  VAL A N   1 
ATOM   1938 C  CA  . VAL A 1 257 ? 58.171 64.943 39.961 1.00 22.81 ? 257  VAL A CA  1 
ATOM   1939 C  C   . VAL A 1 257 ? 58.649 66.250 40.594 1.00 25.18 ? 257  VAL A C   1 
ATOM   1940 O  O   . VAL A 1 257 ? 59.756 66.306 41.130 1.00 25.91 ? 257  VAL A O   1 
ATOM   1941 C  CB  . VAL A 1 257 ? 58.767 64.770 38.551 1.00 26.03 ? 257  VAL A CB  1 
ATOM   1942 C  CG1 . VAL A 1 257 ? 60.280 64.647 38.630 1.00 29.84 ? 257  VAL A CG1 1 
ATOM   1943 C  CG2 . VAL A 1 257 ? 58.186 63.509 37.904 1.00 30.37 ? 257  VAL A CG2 1 
ATOM   1944 N  N   . ASP A 1 258 ? 57.826 67.295 40.573 1.00 25.31 ? 258  ASP A N   1 
ATOM   1945 C  CA  . ASP A 1 258 ? 58.264 68.553 41.170 1.00 25.65 ? 258  ASP A CA  1 
ATOM   1946 C  C   . ASP A 1 258 ? 58.342 68.503 42.697 1.00 25.37 ? 258  ASP A C   1 
ATOM   1947 O  O   . ASP A 1 258 ? 58.758 69.470 43.328 1.00 24.70 ? 258  ASP A O   1 
ATOM   1948 C  CB  . ASP A 1 258 ? 57.382 69.736 40.726 1.00 29.38 ? 258  ASP A CB  1 
ATOM   1949 C  CG  . ASP A 1 258 ? 55.908 69.532 41.020 1.00 34.66 ? 258  ASP A CG  1 
ATOM   1950 O  OD1 . ASP A 1 258 ? 55.561 68.760 41.938 1.00 40.31 ? 258  ASP A OD1 1 
ATOM   1951 O  OD2 . ASP A 1 258 ? 55.086 70.170 40.329 1.00 42.31 ? 258  ASP A OD2 1 
ATOM   1952 N  N   . MET A 1 259 ? 57.961 67.373 43.286 1.00 19.22 ? 259  MET A N   1 
ATOM   1953 C  CA  . MET A 1 259 ? 58.014 67.214 44.739 1.00 20.40 ? 259  MET A CA  1 
ATOM   1954 C  C   . MET A 1 259 ? 59.402 66.763 45.200 1.00 16.45 ? 259  MET A C   1 
ATOM   1955 O  O   . MET A 1 259 ? 59.725 66.824 46.386 1.00 17.74 ? 259  MET A O   1 
ATOM   1956 C  CB  . MET A 1 259 ? 57.009 66.158 45.198 1.00 22.30 ? 259  MET A CB  1 
ATOM   1957 C  CG  . MET A 1 259 ? 55.549 66.498 44.970 1.00 33.19 ? 259  MET A CG  1 
ATOM   1958 S  SD  . MET A 1 259 ? 54.536 65.062 45.371 1.00 43.87 ? 259  MET A SD  1 
ATOM   1959 C  CE  . MET A 1 259 ? 54.599 65.084 47.206 1.00 43.34 ? 259  MET A CE  1 
ATOM   1960 N  N   . VAL A 1 260 ? 60.217 66.307 44.260 1.00 14.77 ? 260  VAL A N   1 
ATOM   1961 C  CA  . VAL A 1 260 ? 61.538 65.792 44.582 1.00 17.60 ? 260  VAL A CA  1 
ATOM   1962 C  C   . VAL A 1 260 ? 62.402 66.657 45.511 1.00 16.11 ? 260  VAL A C   1 
ATOM   1963 O  O   . VAL A 1 260 ? 62.930 66.154 46.514 1.00 16.05 ? 260  VAL A O   1 
ATOM   1964 C  CB  . VAL A 1 260 ? 62.301 65.432 43.283 1.00 16.15 ? 260  VAL A CB  1 
ATOM   1965 C  CG1 . VAL A 1 260 ? 63.751 65.118 43.583 1.00 15.74 ? 260  VAL A CG1 1 
ATOM   1966 C  CG2 . VAL A 1 260 ? 61.630 64.211 42.633 1.00 18.34 ? 260  VAL A CG2 1 
ATOM   1967 N  N   . PRO A 1 261 ? 62.557 67.957 45.212 1.00 17.49 ? 261  PRO A N   1 
ATOM   1968 C  CA  . PRO A 1 261 ? 63.387 68.767 46.115 1.00 17.83 ? 261  PRO A CA  1 
ATOM   1969 C  C   . PRO A 1 261 ? 62.911 68.728 47.559 1.00 17.46 ? 261  PRO A C   1 
ATOM   1970 O  O   . PRO A 1 261 ? 63.709 68.570 48.482 1.00 19.46 ? 261  PRO A O   1 
ATOM   1971 C  CB  . PRO A 1 261 ? 63.290 70.164 45.509 1.00 21.51 ? 261  PRO A CB  1 
ATOM   1972 C  CG  . PRO A 1 261 ? 63.234 69.863 44.041 1.00 21.88 ? 261  PRO A CG  1 
ATOM   1973 C  CD  . PRO A 1 261 ? 62.221 68.718 43.994 1.00 17.33 ? 261  PRO A CD  1 
ATOM   1974 N  N   . SER A 1 262 ? 61.608 68.861 47.756 1.00 19.12 ? 262  SER A N   1 
ATOM   1975 C  CA  . SER A 1 262 ? 61.050 68.843 49.098 1.00 19.76 ? 262  SER A CA  1 
ATOM   1976 C  C   . SER A 1 262 ? 61.284 67.484 49.757 1.00 21.26 ? 262  SER A C   1 
ATOM   1977 O  O   . SER A 1 262 ? 61.605 67.403 50.947 1.00 19.48 ? 262  SER A O   1 
ATOM   1978 C  CB  . SER A 1 262 ? 59.552 69.140 49.054 1.00 23.28 ? 262  SER A CB  1 
ATOM   1979 O  OG  . SER A 1 262 ? 59.014 69.156 50.367 1.00 32.14 ? 262  SER A OG  1 
ATOM   1980 N  N   . LEU A 1 263 ? 61.126 66.410 48.986 1.00 17.23 ? 263  LEU A N   1 
ATOM   1981 C  CA  . LEU A 1 263 ? 61.339 65.081 49.548 1.00 15.67 ? 263  LEU A CA  1 
ATOM   1982 C  C   . LEU A 1 263 ? 62.793 64.920 49.970 1.00 14.30 ? 263  LEU A C   1 
ATOM   1983 O  O   . LEU A 1 263 ? 63.074 64.352 51.021 1.00 16.88 ? 263  LEU A O   1 
ATOM   1984 C  CB  . LEU A 1 263 ? 60.955 63.995 48.530 1.00 15.14 ? 263  LEU A CB  1 
ATOM   1985 C  CG  . LEU A 1 263 ? 59.467 63.993 48.162 1.00 18.66 ? 263  LEU A CG  1 
ATOM   1986 C  CD1 . LEU A 1 263 ? 59.209 63.019 47.017 1.00 21.00 ? 263  LEU A CD1 1 
ATOM   1987 C  CD2 . LEU A 1 263 ? 58.632 63.621 49.389 1.00 24.60 ? 263  LEU A CD2 1 
ATOM   1988 N  N   . ILE A 1 264 ? 63.722 65.418 49.159 1.00 15.13 ? 264  ILE A N   1 
ATOM   1989 C  CA  . ILE A 1 264 ? 65.132 65.303 49.507 1.00 16.18 ? 264  ILE A CA  1 
ATOM   1990 C  C   . ILE A 1 264 ? 65.406 66.088 50.788 1.00 19.46 ? 264  ILE A C   1 
ATOM   1991 O  O   . ILE A 1 264 ? 66.150 65.630 51.655 1.00 19.45 ? 264  ILE A O   1 
ATOM   1992 C  CB  . ILE A 1 264 ? 66.042 65.814 48.366 1.00 13.28 ? 264  ILE A CB  1 
ATOM   1993 C  CG1 . ILE A 1 264 ? 65.980 64.821 47.190 1.00 11.28 ? 264  ILE A CG1 1 
ATOM   1994 C  CG2 . ILE A 1 264 ? 67.492 65.961 48.860 1.00 16.41 ? 264  ILE A CG2 1 
ATOM   1995 C  CD1 . ILE A 1 264 ? 66.642 65.311 45.927 1.00 11.79 ? 264  ILE A CD1 1 
ATOM   1996 N  N   . GLU A 1 265 ? 64.783 67.255 50.917 1.00 18.61 ? 265  GLU A N   1 
ATOM   1997 C  CA  . GLU A 1 265 ? 64.978 68.085 52.110 1.00 21.08 ? 265  GLU A CA  1 
ATOM   1998 C  C   . GLU A 1 265 ? 64.448 67.367 53.342 1.00 21.96 ? 265  GLU A C   1 
ATOM   1999 O  O   . GLU A 1 265 ? 64.943 67.565 54.456 1.00 24.03 ? 265  GLU A O   1 
ATOM   2000 C  CB  . GLU A 1 265 ? 64.260 69.432 51.952 1.00 22.64 ? 265  GLU A CB  1 
ATOM   2001 C  CG  . GLU A 1 265 ? 64.795 70.272 50.807 1.00 30.48 ? 265  GLU A CG  1 
ATOM   2002 C  CD  . GLU A 1 265 ? 64.022 71.569 50.612 1.00 42.05 ? 265  GLU A CD  1 
ATOM   2003 O  OE1 . GLU A 1 265 ? 62.775 71.518 50.500 1.00 41.48 ? 265  GLU A OE1 1 
ATOM   2004 O  OE2 . GLU A 1 265 ? 64.666 72.640 50.564 1.00 47.33 ? 265  GLU A OE2 1 
ATOM   2005 N  N   . GLN A 1 266 ? 63.441 66.531 53.129 1.00 21.62 ? 266  GLN A N   1 
ATOM   2006 C  CA  . GLN A 1 266 ? 62.822 65.763 54.200 1.00 22.91 ? 266  GLN A CA  1 
ATOM   2007 C  C   . GLN A 1 266 ? 63.595 64.497 54.561 1.00 24.73 ? 266  GLN A C   1 
ATOM   2008 O  O   . GLN A 1 266 ? 63.239 63.800 55.510 1.00 25.41 ? 266  GLN A O   1 
ATOM   2009 C  CB  . GLN A 1 266 ? 61.401 65.378 53.810 1.00 25.36 ? 266  GLN A CB  1 
ATOM   2010 C  CG  . GLN A 1 266 ? 60.451 66.542 53.709 1.00 29.62 ? 266  GLN A CG  1 
ATOM   2011 C  CD  . GLN A 1 266 ? 59.079 66.109 53.251 1.00 33.24 ? 266  GLN A CD  1 
ATOM   2012 O  OE1 . GLN A 1 266 ? 58.449 65.246 53.869 1.00 37.96 ? 266  GLN A OE1 1 
ATOM   2013 N  NE2 . GLN A 1 266 ? 58.603 66.704 52.162 1.00 33.40 ? 266  GLN A NE2 1 
ATOM   2014 N  N   . GLY A 1 267 ? 64.638 64.191 53.797 1.00 19.64 ? 267  GLY A N   1 
ATOM   2015 C  CA  . GLY A 1 267 ? 65.428 63.012 54.091 1.00 19.48 ? 267  GLY A CA  1 
ATOM   2016 C  C   . GLY A 1 267 ? 65.258 61.833 53.147 1.00 16.13 ? 267  GLY A C   1 
ATOM   2017 O  O   . GLY A 1 267 ? 65.829 60.775 53.396 1.00 15.66 ? 267  GLY A O   1 
ATOM   2018 N  N   . TYR A 1 268 ? 64.482 61.988 52.078 1.00 14.48 ? 268  TYR A N   1 
ATOM   2019 C  CA  . TYR A 1 268 ? 64.320 60.872 51.140 1.00 10.84 ? 268  TYR A CA  1 
ATOM   2020 C  C   . TYR A 1 268 ? 65.589 60.734 50.306 1.00 11.52 ? 268  TYR A C   1 
ATOM   2021 O  O   . TYR A 1 268 ? 66.090 61.725 49.782 1.00 13.27 ? 268  TYR A O   1 
ATOM   2022 C  CB  . TYR A 1 268 ? 63.140 61.105 50.183 1.00 10.24 ? 268  TYR A CB  1 
ATOM   2023 C  CG  . TYR A 1 268 ? 61.764 61.051 50.825 1.00 15.97 ? 268  TYR A CG  1 
ATOM   2024 C  CD1 . TYR A 1 268 ? 61.445 61.886 51.891 1.00 18.91 ? 268  TYR A CD1 1 
ATOM   2025 C  CD2 . TYR A 1 268 ? 60.769 60.204 50.331 1.00 23.29 ? 268  TYR A CD2 1 
ATOM   2026 C  CE1 . TYR A 1 268 ? 60.180 61.892 52.450 1.00 21.91 ? 268  TYR A CE1 1 
ATOM   2027 C  CE2 . TYR A 1 268 ? 59.485 60.202 50.888 1.00 23.33 ? 268  TYR A CE2 1 
ATOM   2028 C  CZ  . TYR A 1 268 ? 59.205 61.052 51.947 1.00 29.77 ? 268  TYR A CZ  1 
ATOM   2029 O  OH  . TYR A 1 268 ? 57.947 61.084 52.512 1.00 33.45 ? 268  TYR A OH  1 
ATOM   2030 N  N   . ARG A 1 269 ? 66.098 59.515 50.169 1.00 9.87  ? 269  ARG A N   1 
ATOM   2031 C  CA  . ARG A 1 269 ? 67.297 59.290 49.365 1.00 9.00  ? 269  ARG A CA  1 
ATOM   2032 C  C   . ARG A 1 269 ? 67.068 58.237 48.283 1.00 9.87  ? 269  ARG A C   1 
ATOM   2033 O  O   . ARG A 1 269 ? 67.983 57.887 47.544 1.00 10.52 ? 269  ARG A O   1 
ATOM   2034 C  CB  . ARG A 1 269 ? 68.481 58.908 50.259 1.00 9.82  ? 269  ARG A CB  1 
ATOM   2035 C  CG  . ARG A 1 269 ? 68.846 60.001 51.269 1.00 15.11 ? 269  ARG A CG  1 
ATOM   2036 C  CD  . ARG A 1 269 ? 69.473 61.227 50.602 1.00 12.44 ? 269  ARG A CD  1 
ATOM   2037 N  NE  . ARG A 1 269 ? 69.784 62.259 51.598 1.00 14.45 ? 269  ARG A NE  1 
ATOM   2038 C  CZ  . ARG A 1 269 ? 68.958 63.242 51.945 1.00 17.60 ? 269  ARG A CZ  1 
ATOM   2039 N  NH1 . ARG A 1 269 ? 67.767 63.346 51.374 1.00 15.90 ? 269  ARG A NH1 1 
ATOM   2040 N  NH2 . ARG A 1 269 ? 69.316 64.121 52.882 1.00 14.90 ? 269  ARG A NH2 1 
ATOM   2041 N  N   . ALA A 1 270 ? 65.842 57.732 48.199 1.00 10.82 ? 270  ALA A N   1 
ATOM   2042 C  CA  . ALA A 1 270 ? 65.475 56.760 47.155 1.00 13.44 ? 270  ALA A CA  1 
ATOM   2043 C  C   . ALA A 1 270 ? 64.036 57.116 46.859 1.00 10.98 ? 270  ALA A C   1 
ATOM   2044 O  O   . ALA A 1 270 ? 63.160 56.923 47.706 1.00 11.89 ? 270  ALA A O   1 
ATOM   2045 C  CB  . ALA A 1 270 ? 65.577 55.334 47.664 1.00 9.40  ? 270  ALA A CB  1 
ATOM   2046 N  N   . ILE A 1 271 ? 63.794 57.649 45.663 1.00 12.05 ? 271  ILE A N   1 
ATOM   2047 C  CA  . ILE A 1 271 ? 62.455 58.089 45.297 1.00 10.50 ? 271  ILE A CA  1 
ATOM   2048 C  C   . ILE A 1 271 ? 61.964 57.466 43.995 1.00 10.15 ? 271  ILE A C   1 
ATOM   2049 O  O   . ILE A 1 271 ? 62.652 57.533 42.983 1.00 9.61  ? 271  ILE A O   1 
ATOM   2050 C  CB  . ILE A 1 271 ? 62.424 59.621 45.105 1.00 13.91 ? 271  ILE A CB  1 
ATOM   2051 C  CG1 . ILE A 1 271 ? 63.028 60.317 46.334 1.00 11.26 ? 271  ILE A CG1 1 
ATOM   2052 C  CG2 . ILE A 1 271 ? 60.988 60.086 44.860 1.00 13.96 ? 271  ILE A CG2 1 
ATOM   2053 C  CD1 . ILE A 1 271 ? 63.183 61.827 46.154 1.00 13.65 ? 271  ILE A CD1 1 
ATOM   2054 N  N   . ALA A 1 272 ? 60.780 56.861 44.032 1.00 9.92  ? 272  ALA A N   1 
ATOM   2055 C  CA  . ALA A 1 272 ? 60.196 56.290 42.819 1.00 10.93 ? 272  ALA A CA  1 
ATOM   2056 C  C   . ALA A 1 272 ? 59.490 57.491 42.190 1.00 11.18 ? 272  ALA A C   1 
ATOM   2057 O  O   . ALA A 1 272 ? 58.536 58.016 42.766 1.00 14.68 ? 272  ALA A O   1 
ATOM   2058 C  CB  . ALA A 1 272 ? 59.194 55.212 43.178 1.00 12.77 ? 272  ALA A CB  1 
ATOM   2059 N  N   . VAL A 1 273 ? 59.967 57.927 41.026 1.00 10.81 ? 273  VAL A N   1 
ATOM   2060 C  CA  . VAL A 1 273 ? 59.399 59.100 40.375 1.00 10.72 ? 273  VAL A CA  1 
ATOM   2061 C  C   . VAL A 1 273 ? 58.346 58.824 39.314 1.00 12.45 ? 273  VAL A C   1 
ATOM   2062 O  O   . VAL A 1 273 ? 57.807 59.753 38.716 1.00 12.34 ? 273  VAL A O   1 
ATOM   2063 C  CB  . VAL A 1 273 ? 60.516 59.988 39.769 1.00 14.80 ? 273  VAL A CB  1 
ATOM   2064 C  CG1 . VAL A 1 273 ? 61.460 60.469 40.890 1.00 16.29 ? 273  VAL A CG1 1 
ATOM   2065 C  CG2 . VAL A 1 273 ? 61.280 59.227 38.708 1.00 17.01 ? 273  VAL A CG2 1 
ATOM   2066 N  N   . GLN A 1 274 ? 58.058 57.552 39.080 1.00 10.62 ? 274  GLN A N   1 
ATOM   2067 C  CA  . GLN A 1 274 ? 57.041 57.165 38.105 1.00 12.74 ? 274  GLN A CA  1 
ATOM   2068 C  C   . GLN A 1 274 ? 56.596 55.757 38.511 1.00 13.61 ? 274  GLN A C   1 
ATOM   2069 O  O   . GLN A 1 274 ? 57.345 55.026 39.163 1.00 9.60  ? 274  GLN A O   1 
ATOM   2070 C  CB  . GLN A 1 274 ? 57.656 57.197 36.701 1.00 17.54 ? 274  GLN A CB  1 
ATOM   2071 C  CG  . GLN A 1 274 ? 56.725 57.546 35.543 1.00 20.66 ? 274  GLN A CG  1 
ATOM   2072 C  CD  . GLN A 1 274 ? 55.577 58.469 35.913 1.00 19.41 ? 274  GLN A CD  1 
ATOM   2073 O  OE1 . GLN A 1 274 ? 54.527 58.011 36.368 1.00 20.78 ? 274  GLN A OE1 1 
ATOM   2074 N  NE2 . GLN A 1 274 ? 55.767 59.767 35.718 1.00 19.23 ? 274  GLN A NE2 1 
ATOM   2075 N  N   . PHE A 1 275 ? 55.369 55.393 38.153 1.00 14.11 ? 275  PHE A N   1 
ATOM   2076 C  CA  . PHE A 1 275 ? 54.802 54.093 38.498 1.00 14.17 ? 275  PHE A CA  1 
ATOM   2077 C  C   . PHE A 1 275 ? 54.269 53.564 37.176 1.00 12.28 ? 275  PHE A C   1 
ATOM   2078 O  O   . PHE A 1 275 ? 53.519 54.265 36.482 1.00 11.89 ? 275  PHE A O   1 
ATOM   2079 C  CB  . PHE A 1 275 ? 53.705 54.323 39.537 1.00 15.85 ? 275  PHE A CB  1 
ATOM   2080 C  CG  . PHE A 1 275 ? 54.101 55.349 40.574 1.00 23.92 ? 275  PHE A CG  1 
ATOM   2081 C  CD1 . PHE A 1 275 ? 54.063 56.714 40.268 1.00 28.92 ? 275  PHE A CD1 1 
ATOM   2082 C  CD2 . PHE A 1 275 ? 54.642 54.953 41.792 1.00 22.15 ? 275  PHE A CD2 1 
ATOM   2083 C  CE1 . PHE A 1 275 ? 54.569 57.669 41.156 1.00 32.60 ? 275  PHE A CE1 1 
ATOM   2084 C  CE2 . PHE A 1 275 ? 55.153 55.897 42.692 1.00 25.86 ? 275  PHE A CE2 1 
ATOM   2085 C  CZ  . PHE A 1 275 ? 55.119 57.258 42.372 1.00 28.70 ? 275  PHE A CZ  1 
ATOM   2086 N  N   . ASP A 1 276 ? 54.663 52.351 36.800 1.00 9.58  ? 276  ASP A N   1 
ATOM   2087 C  CA  . ASP A 1 276 ? 54.237 51.873 35.502 1.00 9.49  ? 276  ASP A CA  1 
ATOM   2088 C  C   . ASP A 1 276 ? 52.739 51.790 35.274 1.00 11.74 ? 276  ASP A C   1 
ATOM   2089 O  O   . ASP A 1 276 ? 52.255 52.294 34.256 1.00 9.29  ? 276  ASP A O   1 
ATOM   2090 C  CB  . ASP A 1 276 ? 54.969 50.564 35.110 1.00 9.40  ? 276  ASP A CB  1 
ATOM   2091 C  CG  . ASP A 1 276 ? 54.682 49.386 36.029 1.00 8.49  ? 276  ASP A CG  1 
ATOM   2092 O  OD1 . ASP A 1 276 ? 53.991 49.524 37.059 1.00 9.85  ? 276  ASP A OD1 1 
ATOM   2093 O  OD2 . ASP A 1 276 ? 55.168 48.293 35.681 1.00 10.72 ? 276  ASP A OD2 1 
ATOM   2094 N  N   . VAL A 1 277 ? 51.980 51.231 36.213 1.00 7.83  ? 277  VAL A N   1 
ATOM   2095 C  CA  . VAL A 1 277 ? 50.538 51.115 35.992 1.00 10.45 ? 277  VAL A CA  1 
ATOM   2096 C  C   . VAL A 1 277 ? 49.814 52.461 35.927 1.00 11.41 ? 277  VAL A C   1 
ATOM   2097 O  O   . VAL A 1 277 ? 49.120 52.770 34.945 1.00 10.07 ? 277  VAL A O   1 
ATOM   2098 C  CB  . VAL A 1 277 ? 49.873 50.244 37.082 1.00 10.82 ? 277  VAL A CB  1 
ATOM   2099 C  CG1 . VAL A 1 277 ? 48.367 50.198 36.871 1.00 12.68 ? 277  VAL A CG1 1 
ATOM   2100 C  CG2 . VAL A 1 277 ? 50.445 48.836 37.025 1.00 14.19 ? 277  VAL A CG2 1 
ATOM   2101 N  N   . TRP A 1 278 ? 49.969 53.275 36.968 1.00 9.63  ? 278  TRP A N   1 
ATOM   2102 C  CA  . TRP A 1 278 ? 49.299 54.565 36.967 1.00 9.92  ? 278  TRP A CA  1 
ATOM   2103 C  C   . TRP A 1 278 ? 49.855 55.498 35.909 1.00 10.36 ? 278  TRP A C   1 
ATOM   2104 O  O   . TRP A 1 278 ? 49.105 56.271 35.317 1.00 9.92  ? 278  TRP A O   1 
ATOM   2105 C  CB  . TRP A 1 278 ? 49.418 55.238 38.341 1.00 7.91  ? 278  TRP A CB  1 
ATOM   2106 C  CG  . TRP A 1 278 ? 48.568 54.604 39.391 1.00 12.64 ? 278  TRP A CG  1 
ATOM   2107 C  CD1 . TRP A 1 278 ? 47.773 53.501 39.254 1.00 11.92 ? 278  TRP A CD1 1 
ATOM   2108 C  CD2 . TRP A 1 278 ? 48.415 55.043 40.747 1.00 17.40 ? 278  TRP A CD2 1 
ATOM   2109 N  NE1 . TRP A 1 278 ? 47.135 53.225 40.442 1.00 13.48 ? 278  TRP A NE1 1 
ATOM   2110 C  CE2 . TRP A 1 278 ? 47.513 54.155 41.375 1.00 15.94 ? 278  TRP A CE2 1 
ATOM   2111 C  CE3 . TRP A 1 278 ? 48.954 56.101 41.491 1.00 18.59 ? 278  TRP A CE3 1 
ATOM   2112 C  CZ2 . TRP A 1 278 ? 47.137 54.291 42.714 1.00 18.13 ? 278  TRP A CZ2 1 
ATOM   2113 C  CZ3 . TRP A 1 278 ? 48.581 56.237 42.823 1.00 22.99 ? 278  TRP A CZ3 1 
ATOM   2114 C  CH2 . TRP A 1 278 ? 47.680 55.335 43.420 1.00 21.44 ? 278  TRP A CH2 1 
ATOM   2115 N  N   . GLY A 1 279 ? 51.166 55.428 35.681 1.00 8.38  ? 279  GLY A N   1 
ATOM   2116 C  CA  . GLY A 1 279 ? 51.803 56.292 34.698 1.00 10.75 ? 279  GLY A CA  1 
ATOM   2117 C  C   . GLY A 1 279 ? 51.274 56.051 33.291 1.00 9.02  ? 279  GLY A C   1 
ATOM   2118 O  O   . GLY A 1 279 ? 50.907 56.989 32.576 1.00 10.93 ? 279  GLY A O   1 
ATOM   2119 N  N   . LEU A 1 280 ? 51.243 54.786 32.889 1.00 9.61  ? 280  LEU A N   1 
ATOM   2120 C  CA  . LEU A 1 280 ? 50.744 54.439 31.561 1.00 9.04  ? 280  LEU A CA  1 
ATOM   2121 C  C   . LEU A 1 280 ? 49.263 54.793 31.458 1.00 9.15  ? 280  LEU A C   1 
ATOM   2122 O  O   . LEU A 1 280 ? 48.825 55.355 30.454 1.00 9.92  ? 280  LEU A O   1 
ATOM   2123 C  CB  . LEU A 1 280 ? 50.936 52.945 31.294 1.00 8.79  ? 280  LEU A CB  1 
ATOM   2124 C  CG  . LEU A 1 280 ? 50.422 52.385 29.956 1.00 9.84  ? 280  LEU A CG  1 
ATOM   2125 C  CD1 . LEU A 1 280 ? 51.144 53.029 28.793 1.00 10.90 ? 280  LEU A CD1 1 
ATOM   2126 C  CD2 . LEU A 1 280 ? 50.647 50.875 29.935 1.00 11.02 ? 280  LEU A CD2 1 
ATOM   2127 N  N   . SER A 1 281 ? 48.497 54.463 32.493 1.00 7.96  ? 281  SER A N   1 
ATOM   2128 C  CA  . SER A 1 281 ? 47.060 54.753 32.494 1.00 8.74  ? 281  SER A CA  1 
ATOM   2129 C  C   . SER A 1 281 ? 46.790 56.251 32.284 1.00 10.31 ? 281  SER A C   1 
ATOM   2130 O  O   . SER A 1 281 ? 46.010 56.647 31.405 1.00 9.26  ? 281  SER A O   1 
ATOM   2131 C  CB  . SER A 1 281 ? 46.442 54.280 33.811 1.00 9.45  ? 281  SER A CB  1 
ATOM   2132 O  OG  . SER A 1 281 ? 45.053 54.536 33.855 1.00 11.54 ? 281  SER A OG  1 
ATOM   2133 N  N   . ARG A 1 282 ? 47.446 57.088 33.085 1.00 10.18 ? 282  ARG A N   1 
ATOM   2134 C  CA  . ARG A 1 282 ? 47.252 58.537 32.992 1.00 10.22 ? 282  ARG A CA  1 
ATOM   2135 C  C   . ARG A 1 282 ? 47.740 59.113 31.670 1.00 11.15 ? 282  ARG A C   1 
ATOM   2136 O  O   . ARG A 1 282 ? 47.118 60.027 31.115 1.00 11.62 ? 282  ARG A O   1 
ATOM   2137 C  CB  . ARG A 1 282 ? 47.954 59.238 34.166 1.00 11.75 ? 282  ARG A CB  1 
ATOM   2138 C  CG  . ARG A 1 282 ? 47.402 58.798 35.513 1.00 19.83 ? 282  ARG A CG  1 
ATOM   2139 C  CD  . ARG A 1 282 ? 48.211 59.345 36.694 1.00 20.94 ? 282  ARG A CD  1 
ATOM   2140 N  NE  . ARG A 1 282 ? 47.627 58.936 37.971 1.00 21.89 ? 282  ARG A NE  1 
ATOM   2141 C  CZ  . ARG A 1 282 ? 48.068 59.326 39.165 1.00 31.08 ? 282  ARG A CZ  1 
ATOM   2142 N  NH1 . ARG A 1 282 ? 49.109 60.141 39.262 1.00 35.51 ? 282  ARG A NH1 1 
ATOM   2143 N  NH2 . ARG A 1 282 ? 47.458 58.909 40.267 1.00 33.36 ? 282  ARG A NH2 1 
ATOM   2144 N  N   . LEU A 1 283 ? 48.850 58.589 31.161 1.00 8.43  ? 283  LEU A N   1 
ATOM   2145 C  CA  . LEU A 1 283 ? 49.385 59.065 29.896 1.00 9.50  ? 283  LEU A CA  1 
ATOM   2146 C  C   . LEU A 1 283 ? 48.378 58.825 28.770 1.00 11.91 ? 283  LEU A C   1 
ATOM   2147 O  O   . LEU A 1 283 ? 48.068 59.731 27.989 1.00 10.33 ? 283  LEU A O   1 
ATOM   2148 C  CB  . LEU A 1 283 ? 50.691 58.339 29.569 1.00 8.11  ? 283  LEU A CB  1 
ATOM   2149 C  CG  . LEU A 1 283 ? 51.292 58.670 28.202 1.00 11.93 ? 283  LEU A CG  1 
ATOM   2150 C  CD1 . LEU A 1 283 ? 51.815 60.101 28.209 1.00 14.38 ? 283  LEU A CD1 1 
ATOM   2151 C  CD2 . LEU A 1 283 ? 52.408 57.700 27.887 1.00 13.92 ? 283  LEU A CD2 1 
ATOM   2152 N  N   . VAL A 1 284 ? 47.865 57.601 28.693 1.00 9.45  ? 284  VAL A N   1 
ATOM   2153 C  CA  . VAL A 1 284 ? 46.917 57.258 27.643 1.00 9.80  ? 284  VAL A CA  1 
ATOM   2154 C  C   . VAL A 1 284 ? 45.576 57.970 27.833 1.00 11.54 ? 284  VAL A C   1 
ATOM   2155 O  O   . VAL A 1 284 ? 45.041 58.560 26.890 1.00 8.56  ? 284  VAL A O   1 
ATOM   2156 C  CB  . VAL A 1 284 ? 46.711 55.720 27.568 1.00 8.59  ? 284  VAL A CB  1 
ATOM   2157 C  CG1 . VAL A 1 284 ? 45.655 55.375 26.523 1.00 8.59  ? 284  VAL A CG1 1 
ATOM   2158 C  CG2 . VAL A 1 284 ? 48.032 55.042 27.193 1.00 7.46  ? 284  VAL A CG2 1 
ATOM   2159 N  N   . HIS A 1 285 ? 45.040 57.942 29.051 1.00 8.14  ? 285  HIS A N   1 
ATOM   2160 C  CA  . HIS A 1 285 ? 43.760 58.594 29.312 1.00 11.49 ? 285  HIS A CA  1 
ATOM   2161 C  C   . HIS A 1 285 ? 43.838 60.090 28.992 1.00 13.74 ? 285  HIS A C   1 
ATOM   2162 O  O   . HIS A 1 285 ? 42.916 60.664 28.413 1.00 11.09 ? 285  HIS A O   1 
ATOM   2163 C  CB  . HIS A 1 285 ? 43.369 58.418 30.778 1.00 10.83 ? 285  HIS A CB  1 
ATOM   2164 C  CG  . HIS A 1 285 ? 42.021 58.977 31.113 1.00 14.77 ? 285  HIS A CG  1 
ATOM   2165 N  ND1 . HIS A 1 285 ? 40.851 58.272 30.924 1.00 18.21 ? 285  HIS A ND1 1 
ATOM   2166 C  CD2 . HIS A 1 285 ? 41.659 60.171 31.637 1.00 13.42 ? 285  HIS A CD2 1 
ATOM   2167 C  CE1 . HIS A 1 285 ? 39.827 59.007 31.324 1.00 15.91 ? 285  HIS A CE1 1 
ATOM   2168 N  NE2 . HIS A 1 285 ? 40.292 60.163 31.762 1.00 19.11 ? 285  HIS A NE2 1 
ATOM   2169 N  N   . GLY A 1 286 ? 44.947 60.718 29.376 1.00 11.79 ? 286  GLY A N   1 
ATOM   2170 C  CA  . GLY A 1 286 ? 45.110 62.138 29.122 1.00 13.56 ? 286  GLY A CA  1 
ATOM   2171 C  C   . GLY A 1 286 ? 45.217 62.462 27.649 1.00 14.28 ? 286  GLY A C   1 
ATOM   2172 O  O   . GLY A 1 286 ? 44.655 63.467 27.183 1.00 12.10 ? 286  GLY A O   1 
ATOM   2173 N  N   . SER A 1 287 ? 45.930 61.617 26.902 1.00 11.31 ? 287  SER A N   1 
ATOM   2174 C  CA  . SER A 1 287 ? 46.096 61.846 25.471 1.00 12.47 ? 287  SER A CA  1 
ATOM   2175 C  C   . SER A 1 287 ? 44.754 61.698 24.770 1.00 11.32 ? 287  SER A C   1 
ATOM   2176 O  O   . SER A 1 287 ? 44.438 62.478 23.870 1.00 12.70 ? 287  SER A O   1 
ATOM   2177 C  CB  . SER A 1 287 ? 47.110 60.868 24.876 1.00 13.43 ? 287  SER A CB  1 
ATOM   2178 O  OG  . SER A 1 287 ? 48.396 61.082 25.442 1.00 15.27 ? 287  SER A OG  1 
ATOM   2179 N  N   . LEU A 1 288 ? 43.968 60.704 25.186 1.00 9.48  ? 288  LEU A N   1 
ATOM   2180 C  CA  . LEU A 1 288 ? 42.641 60.479 24.601 1.00 12.04 ? 288  LEU A CA  1 
ATOM   2181 C  C   . LEU A 1 288 ? 41.740 61.692 24.843 1.00 13.14 ? 288  LEU A C   1 
ATOM   2182 O  O   . LEU A 1 288 ? 41.052 62.169 23.929 1.00 12.37 ? 288  LEU A O   1 
ATOM   2183 C  CB  . LEU A 1 288 ? 41.979 59.241 25.226 1.00 8.47  ? 288  LEU A CB  1 
ATOM   2184 C  CG  . LEU A 1 288 ? 42.626 57.887 24.898 1.00 7.52  ? 288  LEU A CG  1 
ATOM   2185 C  CD1 . LEU A 1 288 ? 42.049 56.815 25.835 1.00 10.24 ? 288  LEU A CD1 1 
ATOM   2186 C  CD2 . LEU A 1 288 ? 42.366 57.525 23.428 1.00 10.68 ? 288  LEU A CD2 1 
ATOM   2187 N  N   . ALA A 1 289 ? 41.743 62.185 26.078 1.00 12.03 ? 289  ALA A N   1 
ATOM   2188 C  CA  . ALA A 1 289 ? 40.920 63.332 26.438 1.00 13.35 ? 289  ALA A CA  1 
ATOM   2189 C  C   . ALA A 1 289 ? 41.283 64.555 25.603 1.00 14.14 ? 289  ALA A C   1 
ATOM   2190 O  O   . ALA A 1 289 ? 40.400 65.237 25.076 1.00 15.61 ? 289  ALA A O   1 
ATOM   2191 C  CB  . ALA A 1 289 ? 41.078 63.654 27.924 1.00 14.15 ? 289  ALA A CB  1 
ATOM   2192 N  N   . GLN A 1 290 ? 42.580 64.830 25.482 1.00 11.09 ? 290  GLN A N   1 
ATOM   2193 C  CA  . GLN A 1 290 ? 43.035 65.982 24.721 1.00 12.65 ? 290  GLN A CA  1 
ATOM   2194 C  C   . GLN A 1 290 ? 42.663 65.834 23.256 1.00 13.42 ? 290  GLN A C   1 
ATOM   2195 O  O   . GLN A 1 290 ? 42.217 66.794 22.617 1.00 14.21 ? 290  GLN A O   1 
ATOM   2196 C  CB  . GLN A 1 290 ? 44.547 66.140 24.843 1.00 14.85 ? 290  GLN A CB  1 
ATOM   2197 C  CG  . GLN A 1 290 ? 45.003 66.626 26.199 1.00 26.48 ? 290  GLN A CG  1 
ATOM   2198 C  CD  . GLN A 1 290 ? 46.511 66.593 26.340 1.00 33.64 ? 290  GLN A CD  1 
ATOM   2199 O  OE1 . GLN A 1 290 ? 47.243 66.886 25.387 1.00 36.64 ? 290  GLN A OE1 1 
ATOM   2200 N  NE2 . GLN A 1 290 ? 46.989 66.246 27.535 1.00 38.90 ? 290  GLN A NE2 1 
ATOM   2201 N  N   . ALA A 1 291 ? 42.845 64.629 22.721 1.00 12.47 ? 291  ALA A N   1 
ATOM   2202 C  CA  . ALA A 1 291 ? 42.529 64.384 21.320 1.00 15.48 ? 291  ALA A CA  1 
ATOM   2203 C  C   . ALA A 1 291 ? 41.043 64.607 21.033 1.00 14.91 ? 291  ALA A C   1 
ATOM   2204 O  O   . ALA A 1 291 ? 40.689 65.321 20.088 1.00 13.71 ? 291  ALA A O   1 
ATOM   2205 C  CB  . ALA A 1 291 ? 42.938 62.952 20.927 1.00 13.86 ? 291  ALA A CB  1 
ATOM   2206 N  N   . ARG A 1 292 ? 40.176 64.001 21.839 1.00 12.36 ? 292  ARG A N   1 
ATOM   2207 C  CA  . ARG A 1 292 ? 38.737 64.151 21.635 1.00 13.27 ? 292  ARG A CA  1 
ATOM   2208 C  C   . ARG A 1 292 ? 38.319 65.608 21.775 1.00 16.95 ? 292  ARG A C   1 
ATOM   2209 O  O   . ARG A 1 292 ? 37.504 66.117 20.995 1.00 15.43 ? 292  ARG A O   1 
ATOM   2210 C  CB  . ARG A 1 292 ? 37.952 63.296 22.632 1.00 11.98 ? 292  ARG A CB  1 
ATOM   2211 C  CG  . ARG A 1 292 ? 38.115 61.787 22.418 1.00 13.83 ? 292  ARG A CG  1 
ATOM   2212 C  CD  . ARG A 1 292 ? 37.057 61.009 23.192 1.00 15.93 ? 292  ARG A CD  1 
ATOM   2213 N  NE  . ARG A 1 292 ? 37.234 59.560 23.081 1.00 16.39 ? 292  ARG A NE  1 
ATOM   2214 C  CZ  . ARG A 1 292 ? 37.747 58.801 24.043 1.00 17.63 ? 292  ARG A CZ  1 
ATOM   2215 N  NH1 . ARG A 1 292 ? 38.132 59.356 25.187 1.00 15.67 ? 292  ARG A NH1 1 
ATOM   2216 N  NH2 . ARG A 1 292 ? 37.874 57.492 23.863 1.00 15.53 ? 292  ARG A NH2 1 
ATOM   2217 N  N   . ALA A 1 293 ? 38.885 66.285 22.767 1.00 14.17 ? 293  ALA A N   1 
ATOM   2218 C  CA  . ALA A 1 293 ? 38.564 67.690 22.988 1.00 18.06 ? 293  ALA A CA  1 
ATOM   2219 C  C   . ALA A 1 293 ? 38.926 68.533 21.769 1.00 15.09 ? 293  ALA A C   1 
ATOM   2220 O  O   . ALA A 1 293 ? 38.176 69.429 21.380 1.00 17.57 ? 293  ALA A O   1 
ATOM   2221 C  CB  . ALA A 1 293 ? 39.309 68.207 24.216 1.00 15.56 ? 293  ALA A CB  1 
ATOM   2222 N  N   . SER A 1 294 ? 40.072 68.242 21.161 1.00 13.02 ? 294  SER A N   1 
ATOM   2223 C  CA  . SER A 1 294 ? 40.534 69.001 20.012 1.00 14.85 ? 294  SER A CA  1 
ATOM   2224 C  C   . SER A 1 294 ? 39.744 68.686 18.748 1.00 15.88 ? 294  SER A C   1 
ATOM   2225 O  O   . SER A 1 294 ? 39.811 69.432 17.767 1.00 18.12 ? 294  SER A O   1 
ATOM   2226 C  CB  . SER A 1 294 ? 42.024 68.748 19.771 1.00 16.89 ? 294  SER A CB  1 
ATOM   2227 O  OG  . SER A 1 294 ? 42.258 67.459 19.233 1.00 21.79 ? 294  SER A OG  1 
ATOM   2228 N  N   . ALA A 1 295 ? 38.993 67.589 18.773 1.00 14.92 ? 295  ALA A N   1 
ATOM   2229 C  CA  . ALA A 1 295 ? 38.201 67.201 17.608 1.00 17.64 ? 295  ALA A CA  1 
ATOM   2230 C  C   . ALA A 1 295 ? 36.808 67.815 17.633 1.00 14.63 ? 295  ALA A C   1 
ATOM   2231 O  O   . ALA A 1 295 ? 36.115 67.826 16.621 1.00 17.13 ? 295  ALA A O   1 
ATOM   2232 C  CB  . ALA A 1 295 ? 38.091 65.680 17.532 1.00 16.27 ? 295  ALA A CB  1 
ATOM   2233 N  N   . LYS A 1 296 ? 36.391 68.321 18.786 1.00 16.78 ? 296  LYS A N   1 
ATOM   2234 C  CA  . LYS A 1 296 ? 35.063 68.907 18.911 1.00 16.45 ? 296  LYS A CA  1 
ATOM   2235 C  C   . LYS A 1 296 ? 34.780 70.038 17.927 1.00 17.60 ? 296  LYS A C   1 
ATOM   2236 O  O   . LYS A 1 296 ? 33.628 70.256 17.564 1.00 20.07 ? 296  LYS A O   1 
ATOM   2237 C  CB  . LYS A 1 296 ? 34.832 69.402 20.340 1.00 19.32 ? 296  LYS A CB  1 
ATOM   2238 C  CG  . LYS A 1 296 ? 34.505 68.292 21.326 1.00 24.20 ? 296  LYS A CG  1 
ATOM   2239 C  CD  . LYS A 1 296 ? 33.151 67.672 21.013 1.00 32.64 ? 296  LYS A CD  1 
ATOM   2240 C  CE  . LYS A 1 296 ? 32.837 66.491 21.917 1.00 35.64 ? 296  LYS A CE  1 
ATOM   2241 N  NZ  . LYS A 1 296 ? 32.767 66.883 23.348 1.00 44.17 ? 296  LYS A NZ  1 
ATOM   2242 N  N   . GLN A 1 297 ? 35.826 70.737 17.491 1.00 18.11 ? 297  GLN A N   1 
ATOM   2243 C  CA  . GLN A 1 297 ? 35.678 71.858 16.560 1.00 18.94 ? 297  GLN A CA  1 
ATOM   2244 C  C   . GLN A 1 297 ? 35.174 71.425 15.185 1.00 24.87 ? 297  GLN A C   1 
ATOM   2245 O  O   . GLN A 1 297 ? 34.765 72.262 14.369 1.00 21.46 ? 297  GLN A O   1 
ATOM   2246 C  CB  . GLN A 1 297 ? 37.017 72.578 16.401 1.00 19.77 ? 297  GLN A CB  1 
ATOM   2247 C  CG  . GLN A 1 297 ? 38.107 71.691 15.821 1.00 20.52 ? 297  GLN A CG  1 
ATOM   2248 C  CD  . GLN A 1 297 ? 39.449 72.384 15.701 1.00 28.14 ? 297  GLN A CD  1 
ATOM   2249 O  OE1 . GLN A 1 297 ? 39.605 73.342 14.941 1.00 28.39 ? 297  GLN A OE1 1 
ATOM   2250 N  NE2 . GLN A 1 297 ? 40.433 71.899 16.450 1.00 25.90 ? 297  GLN A NE2 1 
ATOM   2251 N  N   . PHE A 1 298 ? 35.196 70.120 14.929 1.00 18.22 ? 298  PHE A N   1 
ATOM   2252 C  CA  . PHE A 1 298 ? 34.752 69.597 13.645 1.00 20.57 ? 298  PHE A CA  1 
ATOM   2253 C  C   . PHE A 1 298 ? 33.314 69.093 13.658 1.00 18.69 ? 298  PHE A C   1 
ATOM   2254 O  O   . PHE A 1 298 ? 32.820 68.594 12.645 1.00 23.44 ? 298  PHE A O   1 
ATOM   2255 C  CB  . PHE A 1 298 ? 35.693 68.474 13.204 1.00 19.21 ? 298  PHE A CB  1 
ATOM   2256 C  CG  . PHE A 1 298 ? 37.105 68.920 13.019 1.00 21.63 ? 298  PHE A CG  1 
ATOM   2257 C  CD1 . PHE A 1 298 ? 37.471 69.659 11.898 1.00 20.58 ? 298  PHE A CD1 1 
ATOM   2258 C  CD2 . PHE A 1 298 ? 38.072 68.630 13.978 1.00 17.54 ? 298  PHE A CD2 1 
ATOM   2259 C  CE1 . PHE A 1 298 ? 38.769 70.101 11.734 1.00 23.91 ? 298  PHE A CE1 1 
ATOM   2260 C  CE2 . PHE A 1 298 ? 39.380 69.070 13.822 1.00 21.50 ? 298  PHE A CE2 1 
ATOM   2261 C  CZ  . PHE A 1 298 ? 39.731 69.807 12.697 1.00 28.14 ? 298  PHE A CZ  1 
ATOM   2262 N  N   . ALA A 1 299 ? 32.644 69.229 14.797 1.00 17.87 ? 299  ALA A N   1 
ATOM   2263 C  CA  . ALA A 1 299 ? 31.266 68.780 14.940 1.00 19.02 ? 299  ALA A CA  1 
ATOM   2264 C  C   . ALA A 1 299 ? 30.356 69.476 13.935 1.00 28.05 ? 299  ALA A C   1 
ATOM   2265 O  O   . ALA A 1 299 ? 30.619 70.607 13.520 1.00 26.88 ? 299  ALA A O   1 
ATOM   2266 C  CB  . ALA A 1 299 ? 30.775 69.038 16.348 1.00 20.53 ? 299  ALA A CB  1 
ATOM   2267 N  N   . GLY A 1 300 ? 29.285 68.784 13.562 1.00 32.53 ? 300  GLY A N   1 
ATOM   2268 C  CA  . GLY A 1 300 ? 28.343 69.309 12.593 1.00 38.90 ? 300  GLY A CA  1 
ATOM   2269 C  C   . GLY A 1 300 ? 28.624 68.704 11.226 1.00 48.32 ? 300  GLY A C   1 
ATOM   2270 O  O   . GLY A 1 300 ? 28.714 69.478 10.244 1.00 51.00 ? 300  GLY A O   1 
HETATM 2271 MG MG  . MG  B 2 .   ? 50.740 49.394 51.965 1.00 21.80 ? 1001 MG  A MG  1 
HETATM 2272 C  C1  . PYR C 3 .   ? 50.729 52.176 51.152 1.00 27.01 ? 2001 PYR A C1  1 
HETATM 2273 O  O1  . PYR C 3 .   ? 49.988 51.424 51.814 1.00 18.57 ? 2001 PYR A O1  1 
HETATM 2274 O  O2  . PYR C 3 .   ? 50.518 53.399 50.963 1.00 26.17 ? 2001 PYR A O2  1 
HETATM 2275 C  C2  . PYR C 3 .   ? 51.932 51.461 50.587 1.00 18.39 ? 2001 PYR A C2  1 
HETATM 2276 O  O3  . PYR C 3 .   ? 52.163 50.252 50.752 1.00 19.67 ? 2001 PYR A O3  1 
HETATM 2277 C  C3  . PYR C 3 .   ? 52.839 52.326 49.813 1.00 17.63 ? 2001 PYR A C3  1 
HETATM 2278 O  O   . HOH D 4 .   ? 65.272 37.667 32.415 1.00 7.62  ? 2002 HOH A O   1 
HETATM 2279 O  O   . HOH D 4 .   ? 67.642 38.941 31.593 1.00 7.29  ? 2003 HOH A O   1 
HETATM 2280 O  O   . HOH D 4 .   ? 70.007 44.634 42.390 1.00 11.11 ? 2004 HOH A O   1 
HETATM 2281 O  O   . HOH D 4 .   ? 74.996 43.549 39.643 1.00 10.17 ? 2005 HOH A O   1 
HETATM 2282 O  O   . HOH D 4 .   ? 73.390 51.491 53.411 1.00 12.38 ? 2006 HOH A O   1 
HETATM 2283 O  O   . HOH D 4 .   ? 80.707 48.150 41.455 1.00 14.39 ? 2007 HOH A O   1 
HETATM 2284 O  O   . HOH D 4 .   ? 70.405 39.343 46.051 1.00 10.37 ? 2008 HOH A O   1 
HETATM 2285 O  O   . HOH D 4 .   ? 53.228 49.291 59.860 1.00 11.08 ? 2009 HOH A O   1 
HETATM 2286 O  O   . HOH D 4 .   ? 43.911 52.163 33.385 1.00 11.07 ? 2010 HOH A O   1 
HETATM 2287 O  O   . HOH D 4 .   ? 72.587 47.157 26.163 1.00 11.27 ? 2011 HOH A O   1 
HETATM 2288 O  O   . HOH D 4 .   ? 70.560 35.128 39.894 1.00 12.52 ? 2012 HOH A O   1 
HETATM 2289 O  O   . HOH D 4 .   ? 65.750 46.565 26.934 1.00 11.96 ? 2013 HOH A O   1 
HETATM 2290 O  O   . HOH D 4 .   ? 78.422 46.904 30.301 1.00 11.92 ? 2014 HOH A O   1 
HETATM 2291 O  O   . HOH D 4 .   ? 80.371 41.248 44.235 1.00 15.95 ? 2015 HOH A O   1 
HETATM 2292 O  O   . HOH D 4 .   ? 64.034 30.817 45.609 1.00 13.99 ? 2016 HOH A O   1 
HETATM 2293 O  O   . HOH D 4 .   ? 49.984 43.193 39.138 1.00 12.01 ? 2017 HOH A O   1 
HETATM 2294 O  O   . HOH D 4 .   ? 71.502 53.129 54.296 1.00 13.75 ? 2018 HOH A O   1 
HETATM 2295 O  O   . HOH D 4 .   ? 70.076 61.932 41.509 1.00 14.01 ? 2019 HOH A O   1 
HETATM 2296 O  O   . HOH D 4 .   ? 70.799 54.860 66.671 1.00 11.95 ? 2020 HOH A O   1 
HETATM 2297 O  O   . HOH D 4 .   ? 64.846 56.305 67.575 1.00 14.99 ? 2021 HOH A O   1 
HETATM 2298 O  O   . HOH D 4 .   ? 73.648 46.137 39.409 1.00 14.93 ? 2022 HOH A O   1 
HETATM 2299 O  O   . HOH D 4 .   ? 75.111 37.564 33.479 1.00 19.32 ? 2023 HOH A O   1 
HETATM 2300 O  O   . HOH D 4 .   ? 54.908 40.168 28.691 1.00 18.05 ? 2024 HOH A O   1 
HETATM 2301 O  O   . HOH D 4 .   ? 78.903 38.657 41.672 1.00 13.49 ? 2025 HOH A O   1 
HETATM 2302 O  O   . HOH D 4 .   ? 78.136 47.266 32.972 1.00 11.23 ? 2026 HOH A O   1 
HETATM 2303 O  O   . HOH D 4 .   ? 67.943 57.856 32.745 1.00 15.18 ? 2027 HOH A O   1 
HETATM 2304 O  O   . HOH D 4 .   ? 69.953 24.673 47.796 1.00 71.50 ? 2028 HOH A O   1 
HETATM 2305 O  O   . HOH D 4 .   ? 73.326 31.015 56.337 1.00 15.54 ? 2029 HOH A O   1 
HETATM 2306 O  O   . HOH D 4 .   ? 75.312 50.684 39.193 1.00 12.48 ? 2030 HOH A O   1 
HETATM 2307 O  O   . HOH D 4 .   ? 53.698 36.665 36.391 1.00 14.32 ? 2031 HOH A O   1 
HETATM 2308 O  O   . HOH D 4 .   ? 69.153 52.452 62.673 1.00 15.97 ? 2032 HOH A O   1 
HETATM 2309 O  O   . HOH D 4 .   ? 40.023 60.260 28.217 1.00 13.04 ? 2033 HOH A O   1 
HETATM 2310 O  O   . HOH D 4 .   ? 69.836 40.187 38.540 1.00 11.16 ? 2034 HOH A O   1 
HETATM 2311 O  O   . HOH D 4 .   ? 63.089 29.109 49.481 1.00 17.63 ? 2035 HOH A O   1 
HETATM 2312 O  O   . HOH D 4 .   ? 51.725 47.439 52.042 1.00 14.91 ? 2036 HOH A O   1 
HETATM 2313 O  O   . HOH D 4 .   ? 83.081 33.559 36.663 1.00 16.56 ? 2037 HOH A O   1 
HETATM 2314 O  O   . HOH D 4 .   ? 82.205 28.794 42.986 1.00 16.64 ? 2038 HOH A O   1 
HETATM 2315 O  O   . HOH D 4 .   ? 60.289 60.354 66.267 1.00 18.38 ? 2039 HOH A O   1 
HETATM 2316 O  O   . HOH D 4 .   ? 72.200 35.332 45.647 1.00 15.40 ? 2040 HOH A O   1 
HETATM 2317 O  O   . HOH D 4 .   ? 55.383 29.589 43.330 1.00 16.32 ? 2041 HOH A O   1 
HETATM 2318 O  O   . HOH D 4 .   ? 74.459 34.646 47.297 1.00 16.57 ? 2042 HOH A O   1 
HETATM 2319 O  O   . HOH D 4 .   ? 63.100 33.151 52.624 1.00 17.03 ? 2043 HOH A O   1 
HETATM 2320 O  O   . HOH D 4 .   ? 79.014 32.517 43.324 1.00 17.04 ? 2044 HOH A O   1 
HETATM 2321 O  O   . HOH D 4 .   ? 73.406 52.416 39.828 1.00 20.31 ? 2045 HOH A O   1 
HETATM 2322 O  O   . HOH D 4 .   ? 64.814 32.255 33.130 1.00 14.60 ? 2046 HOH A O   1 
HETATM 2323 O  O   . HOH D 4 .   ? 52.048 41.453 53.041 1.00 15.80 ? 2047 HOH A O   1 
HETATM 2324 O  O   . HOH D 4 .   ? 48.868 42.184 51.222 1.00 18.25 ? 2048 HOH A O   1 
HETATM 2325 O  O   . HOH D 4 .   ? 47.578 49.659 63.998 1.00 15.82 ? 2049 HOH A O   1 
HETATM 2326 O  O   . HOH D 4 .   ? 75.725 32.613 45.747 1.00 20.24 ? 2050 HOH A O   1 
HETATM 2327 O  O   . HOH D 4 .   ? 75.632 52.202 24.424 1.00 21.48 ? 2051 HOH A O   1 
HETATM 2328 O  O   . HOH D 4 .   ? 78.734 60.623 47.532 1.00 19.64 ? 2052 HOH A O   1 
HETATM 2329 O  O   . HOH D 4 .   ? 37.838 65.025 25.985 1.00 19.02 ? 2053 HOH A O   1 
HETATM 2330 O  O   . HOH D 4 .   ? 80.810 46.517 46.287 1.00 17.62 ? 2054 HOH A O   1 
HETATM 2331 O  O   . HOH D 4 .   ? 72.055 54.257 56.803 1.00 20.51 ? 2055 HOH A O   1 
HETATM 2332 O  O   . HOH D 4 .   ? 67.552 47.822 68.048 1.00 20.54 ? 2056 HOH A O   1 
HETATM 2333 O  O   . HOH D 4 .   ? 65.384 49.297 68.625 1.00 19.22 ? 2057 HOH A O   1 
HETATM 2334 O  O   . HOH D 4 .   ? 80.095 49.012 33.460 1.00 18.69 ? 2058 HOH A O   1 
HETATM 2335 O  O   . HOH D 4 .   ? 79.997 48.725 28.944 1.00 21.01 ? 2059 HOH A O   1 
HETATM 2336 O  O   . HOH D 4 .   ? 51.439 59.712 33.198 1.00 16.27 ? 2060 HOH A O   1 
HETATM 2337 O  O   . HOH D 4 .   ? 58.317 39.162 60.044 1.00 19.03 ? 2061 HOH A O   1 
HETATM 2338 O  O   . HOH D 4 .   ? 78.785 47.440 51.016 1.00 22.42 ? 2062 HOH A O   1 
HETATM 2339 O  O   . HOH D 4 .   ? 54.224 35.642 43.606 1.00 16.86 ? 2063 HOH A O   1 
HETATM 2340 O  O   . HOH D 4 .   ? 49.706 60.529 64.484 1.00 21.34 ? 2064 HOH A O   1 
HETATM 2341 O  O   . HOH D 4 .   ? 68.777 31.744 38.887 1.00 19.01 ? 2065 HOH A O   1 
HETATM 2342 O  O   . HOH D 4 .   ? 37.370 62.222 26.479 1.00 22.30 ? 2066 HOH A O   1 
HETATM 2343 O  O   . HOH D 4 .   ? 71.407 33.048 38.423 1.00 17.18 ? 2067 HOH A O   1 
HETATM 2344 O  O   . HOH D 4 .   ? 71.619 22.953 47.904 1.00 26.87 ? 2068 HOH A O   1 
HETATM 2345 O  O   . HOH D 4 .   ? 52.264 59.981 65.572 1.00 22.65 ? 2069 HOH A O   1 
HETATM 2346 O  O   . HOH D 4 .   ? 58.086 55.203 68.935 1.00 20.46 ? 2070 HOH A O   1 
HETATM 2347 O  O   . HOH D 4 .   ? 72.027 37.929 47.490 1.00 20.22 ? 2071 HOH A O   1 
HETATM 2348 O  O   . HOH D 4 .   ? 87.415 40.399 42.644 1.00 23.04 ? 2072 HOH A O   1 
HETATM 2349 O  O   . HOH D 4 .   ? 57.346 39.360 28.700 1.00 19.98 ? 2073 HOH A O   1 
HETATM 2350 O  O   . HOH D 4 .   ? 80.223 24.292 37.869 1.00 24.93 ? 2074 HOH A O   1 
HETATM 2351 O  O   . HOH D 4 .   ? 37.800 71.446 19.503 1.00 19.93 ? 2075 HOH A O   1 
HETATM 2352 O  O   . HOH D 4 .   ? 71.673 53.045 41.678 1.00 22.60 ? 2076 HOH A O   1 
HETATM 2353 O  O   . HOH D 4 .   ? 56.531 40.561 66.431 1.00 21.84 ? 2077 HOH A O   1 
HETATM 2354 O  O   . HOH D 4 .   ? 40.287 52.009 60.386 1.00 25.47 ? 2078 HOH A O   1 
HETATM 2355 O  O   . HOH D 4 .   ? 73.602 31.099 45.768 1.00 20.23 ? 2079 HOH A O   1 
HETATM 2356 O  O   . HOH D 4 .   ? 35.077 65.240 19.862 1.00 18.84 ? 2080 HOH A O   1 
HETATM 2357 O  O   . HOH D 4 .   ? 69.209 52.169 27.028 1.00 21.94 ? 2081 HOH A O   1 
HETATM 2358 O  O   . HOH D 4 .   ? 59.432 28.343 53.311 1.00 17.20 ? 2082 HOH A O   1 
HETATM 2359 O  O   . HOH D 4 .   ? 47.110 43.937 43.121 1.00 20.07 ? 2083 HOH A O   1 
HETATM 2360 O  O   . HOH D 4 .   ? 59.442 46.444 68.808 1.00 18.15 ? 2084 HOH A O   1 
HETATM 2361 O  O   . HOH D 4 .   ? 80.091 57.936 50.539 1.00 20.60 ? 2085 HOH A O   1 
HETATM 2362 O  O   . HOH D 4 .   ? 74.176 56.965 45.062 1.00 19.46 ? 2086 HOH A O   1 
HETATM 2363 O  O   . HOH D 4 .   ? 71.779 36.373 43.238 1.00 24.32 ? 2087 HOH A O   1 
HETATM 2364 O  O   . HOH D 4 .   ? 66.491 60.386 56.649 1.00 25.59 ? 2088 HOH A O   1 
HETATM 2365 O  O   . HOH D 4 .   ? 59.739 70.088 45.972 1.00 23.69 ? 2089 HOH A O   1 
HETATM 2366 O  O   . HOH D 4 .   ? 84.140 45.726 21.263 1.00 22.55 ? 2090 HOH A O   1 
HETATM 2367 O  O   . HOH D 4 .   ? 78.310 50.045 51.859 1.00 23.30 ? 2091 HOH A O   1 
HETATM 2368 O  O   . HOH D 4 .   ? 69.832 36.739 62.258 1.00 24.11 ? 2092 HOH A O   1 
HETATM 2369 O  O   . HOH D 4 .   ? 82.507 36.476 53.635 1.00 29.48 ? 2093 HOH A O   1 
HETATM 2370 O  O   . HOH D 4 .   ? 56.462 38.201 32.081 1.00 22.50 ? 2094 HOH A O   1 
HETATM 2371 O  O   . HOH D 4 .   ? 58.019 56.803 52.391 1.00 23.00 ? 2095 HOH A O   1 
HETATM 2372 O  O   . HOH D 4 .   ? 71.434 31.692 47.774 1.00 22.16 ? 2096 HOH A O   1 
HETATM 2373 O  O   . HOH D 4 .   ? 70.437 52.220 67.613 1.00 25.20 ? 2097 HOH A O   1 
HETATM 2374 O  O   . HOH D 4 .   ? 68.092 64.252 62.307 1.00 26.31 ? 2098 HOH A O   1 
HETATM 2375 O  O   . HOH D 4 .   ? 85.926 36.696 41.163 1.00 24.35 ? 2099 HOH A O   1 
HETATM 2376 O  O   . HOH D 4 .   ? 70.433 61.459 58.968 1.00 24.90 ? 2100 HOH A O   1 
HETATM 2377 O  O   . HOH D 4 .   ? 36.617 70.821 23.252 1.00 26.12 ? 2101 HOH A O   1 
HETATM 2378 O  O   . HOH D 4 .   ? 80.622 48.368 44.271 1.00 19.76 ? 2102 HOH A O   1 
HETATM 2379 O  O   . HOH D 4 .   ? 59.269 52.969 69.631 1.00 19.73 ? 2103 HOH A O   1 
HETATM 2380 O  O   . HOH D 4 .   ? 67.747 29.404 39.927 1.00 22.71 ? 2104 HOH A O   1 
HETATM 2381 O  O   . HOH D 4 .   ? 62.013 28.870 51.987 1.00 22.21 ? 2105 HOH A O   1 
HETATM 2382 O  O   . HOH D 4 .   ? 61.341 47.136 70.644 1.00 24.21 ? 2106 HOH A O   1 
HETATM 2383 O  O   . HOH D 4 .   ? 81.931 33.080 49.020 1.00 23.47 ? 2107 HOH A O   1 
HETATM 2384 O  O   . HOH D 4 .   ? 50.957 61.815 31.641 1.00 31.54 ? 2108 HOH A O   1 
HETATM 2385 O  O   . HOH D 4 .   ? 82.050 34.617 34.452 1.00 26.52 ? 2109 HOH A O   1 
HETATM 2386 O  O   . HOH D 4 .   ? 78.971 38.227 56.490 1.00 26.83 ? 2110 HOH A O   1 
HETATM 2387 O  O   . HOH D 4 .   ? 52.032 33.114 50.599 1.00 26.75 ? 2111 HOH A O   1 
HETATM 2388 O  O   . HOH D 4 .   ? 72.067 50.088 68.005 1.00 24.82 ? 2112 HOH A O   1 
HETATM 2389 O  O   . HOH D 4 .   ? 45.487 49.575 56.211 1.00 23.74 ? 2113 HOH A O   1 
HETATM 2390 O  O   . HOH D 4 .   ? 65.865 33.747 51.929 1.00 20.43 ? 2114 HOH A O   1 
HETATM 2391 O  O   . HOH D 4 .   ? 67.760 65.864 54.364 1.00 24.87 ? 2115 HOH A O   1 
HETATM 2392 O  O   . HOH D 4 .   ? 71.108 53.679 61.059 1.00 21.80 ? 2116 HOH A O   1 
HETATM 2393 O  O   . HOH D 4 .   ? 59.667 35.774 31.579 1.00 28.76 ? 2117 HOH A O   1 
HETATM 2394 O  O   . HOH D 4 .   ? 50.325 56.026 65.883 1.00 26.43 ? 2118 HOH A O   1 
HETATM 2395 O  O   . HOH D 4 .   ? 75.594 35.125 33.405 1.00 29.47 ? 2119 HOH A O   1 
HETATM 2396 O  O   . HOH D 4 .   ? 41.766 50.220 62.082 1.00 24.86 ? 2120 HOH A O   1 
HETATM 2397 O  O   . HOH D 4 .   ? 59.159 35.879 54.985 1.00 26.72 ? 2121 HOH A O   1 
HETATM 2398 O  O   . HOH D 4 .   ? 43.286 62.212 32.367 1.00 23.88 ? 2122 HOH A O   1 
HETATM 2399 O  O   . HOH D 4 .   ? 52.013 57.804 67.221 1.00 28.11 ? 2123 HOH A O   1 
HETATM 2400 O  O   . HOH D 4 .   ? 70.819 59.692 40.089 1.00 29.36 ? 2124 HOH A O   1 
HETATM 2401 O  O   . HOH D 4 .   ? 68.754 31.989 49.260 1.00 25.12 ? 2125 HOH A O   1 
HETATM 2402 O  O   . HOH D 4 .   ? 76.208 50.323 27.145 1.00 22.76 ? 2126 HOH A O   1 
HETATM 2403 O  O   . HOH D 4 .   ? 48.730 57.733 64.473 1.00 26.52 ? 2127 HOH A O   1 
HETATM 2404 O  O   . HOH D 4 .   ? 49.623 45.724 59.867 1.00 35.22 ? 2128 HOH A O   1 
HETATM 2405 O  O   . HOH D 4 .   ? 42.651 69.509 23.484 1.00 21.75 ? 2129 HOH A O   1 
HETATM 2406 O  O   . HOH D 4 .   ? 60.897 31.882 31.920 1.00 25.28 ? 2130 HOH A O   1 
HETATM 2407 O  O   . HOH D 4 .   ? 58.118 44.468 70.145 1.00 24.20 ? 2131 HOH A O   1 
HETATM 2408 O  O   . HOH D 4 .   ? 83.947 26.980 43.956 1.00 27.54 ? 2132 HOH A O   1 
HETATM 2409 O  O   . HOH D 4 .   ? 71.821 62.899 53.541 1.00 27.08 ? 2133 HOH A O   1 
HETATM 2410 O  O   . HOH D 4 .   ? 78.316 57.153 42.142 1.00 36.63 ? 2134 HOH A O   1 
HETATM 2411 O  O   . HOH D 4 .   ? 81.739 37.541 34.522 1.00 27.40 ? 2135 HOH A O   1 
HETATM 2412 O  O   . HOH D 4 .   ? 58.012 38.569 64.849 1.00 28.02 ? 2136 HOH A O   1 
HETATM 2413 O  O   . HOH D 4 .   ? 56.028 58.349 49.640 1.00 28.27 ? 2137 HOH A O   1 
HETATM 2414 O  O   . HOH D 4 .   ? 35.919 66.149 24.480 1.00 23.41 ? 2138 HOH A O   1 
HETATM 2415 O  O   . HOH D 4 .   ? 67.998 38.515 63.385 1.00 23.64 ? 2139 HOH A O   1 
HETATM 2416 O  O   . HOH D 4 .   ? 82.444 32.240 51.872 1.00 30.13 ? 2140 HOH A O   1 
HETATM 2417 O  O   . HOH D 4 .   ? 45.897 61.872 32.686 1.00 28.07 ? 2141 HOH A O   1 
HETATM 2418 O  O   . HOH D 4 .   ? 75.005 54.507 56.855 1.00 21.73 ? 2142 HOH A O   1 
HETATM 2419 O  O   . HOH D 4 .   ? 55.917 55.820 50.180 1.00 26.05 ? 2143 HOH A O   1 
HETATM 2420 O  O   . HOH D 4 .   ? 67.782 31.736 41.544 1.00 32.74 ? 2144 HOH A O   1 
HETATM 2421 O  O   . HOH D 4 .   ? 62.557 37.916 65.379 1.00 25.87 ? 2145 HOH A O   1 
HETATM 2422 O  O   . HOH D 4 .   ? 76.943 43.616 56.201 1.00 29.02 ? 2146 HOH A O   1 
HETATM 2423 O  O   . HOH D 4 .   ? 83.844 35.994 51.185 1.00 32.68 ? 2147 HOH A O   1 
HETATM 2424 O  O   . HOH D 4 .   ? 69.845 40.725 63.891 1.00 27.97 ? 2148 HOH A O   1 
HETATM 2425 O  O   . HOH D 4 .   ? 71.812 63.521 64.095 1.00 33.73 ? 2149 HOH A O   1 
HETATM 2426 O  O   . HOH D 4 .   ? 73.059 50.025 27.654 1.00 35.68 ? 2150 HOH A O   1 
HETATM 2427 O  O   . HOH D 4 .   ? 38.107 61.766 29.038 1.00 26.99 ? 2151 HOH A O   1 
HETATM 2428 O  O   . HOH D 4 .   ? 81.378 54.267 37.489 1.00 40.56 ? 2152 HOH A O   1 
HETATM 2429 O  O   . HOH D 4 .   ? 82.137 31.277 31.906 1.00 22.96 ? 2153 HOH A O   1 
HETATM 2430 O  O   . HOH D 4 .   ? 86.380 35.778 44.666 1.00 28.80 ? 2154 HOH A O   1 
HETATM 2431 O  O   . HOH D 4 .   ? 55.651 32.092 44.510 1.00 31.09 ? 2155 HOH A O   1 
HETATM 2432 O  O   . HOH D 4 .   ? 82.880 47.719 28.531 1.00 47.77 ? 2156 HOH A O   1 
HETATM 2433 O  O   . HOH D 4 .   ? 64.010 47.743 70.533 1.00 25.72 ? 2157 HOH A O   1 
HETATM 2434 O  O   . HOH D 4 .   ? 50.501 40.509 57.162 1.00 49.06 ? 2158 HOH A O   1 
HETATM 2435 O  O   . HOH D 4 .   ? 55.223 64.813 37.537 1.00 36.20 ? 2159 HOH A O   1 
HETATM 2436 O  O   . HOH D 4 .   ? 79.934 33.452 55.955 1.00 28.11 ? 2160 HOH A O   1 
HETATM 2437 O  O   . HOH D 4 .   ? 55.488 34.252 31.284 1.00 35.11 ? 2161 HOH A O   1 
HETATM 2438 O  O   . HOH D 4 .   ? 70.717 43.528 66.856 1.00 33.65 ? 2162 HOH A O   1 
HETATM 2439 O  O   . HOH D 4 .   ? 87.216 38.024 43.453 1.00 31.89 ? 2163 HOH A O   1 
HETATM 2440 O  O   . HOH D 4 .   ? 41.031 71.404 22.458 1.00 30.10 ? 2164 HOH A O   1 
HETATM 2441 O  O   . HOH D 4 .   ? 51.916 59.897 35.906 1.00 37.66 ? 2165 HOH A O   1 
HETATM 2442 O  O   . HOH D 4 .   ? 71.691 29.943 36.570 1.00 36.91 ? 2166 HOH A O   1 
HETATM 2443 O  O   . HOH D 4 .   ? 48.884 62.576 28.585 1.00 30.96 ? 2167 HOH A O   1 
HETATM 2444 O  O   . HOH D 4 .   ? 59.349 49.033 71.279 1.00 27.65 ? 2168 HOH A O   1 
HETATM 2445 O  O   . HOH D 4 .   ? 74.033 32.826 61.811 1.00 28.33 ? 2169 HOH A O   1 
HETATM 2446 O  O   . HOH D 4 .   ? 81.567 56.894 20.229 1.00 31.38 ? 2170 HOH A O   1 
HETATM 2447 O  O   . HOH D 4 .   ? 85.655 38.171 50.808 1.00 25.90 ? 2171 HOH A O   1 
HETATM 2448 O  O   . HOH D 4 .   ? 54.645 31.979 47.097 1.00 27.80 ? 2172 HOH A O   1 
HETATM 2449 O  O   . HOH D 4 .   ? 73.424 52.722 60.516 1.00 31.02 ? 2173 HOH A O   1 
HETATM 2450 O  O   . HOH D 4 .   ? 61.751 67.453 39.987 1.00 31.09 ? 2174 HOH A O   1 
HETATM 2451 O  O   . HOH D 4 .   ? 85.777 31.126 38.133 1.00 28.07 ? 2175 HOH A O   1 
HETATM 2452 O  O   . HOH D 4 .   ? 53.442 67.328 63.693 1.00 39.65 ? 2176 HOH A O   1 
HETATM 2453 O  O   . HOH D 4 .   ? 56.569 58.942 52.286 1.00 27.19 ? 2177 HOH A O   1 
HETATM 2454 O  O   . HOH D 4 .   ? 72.448 37.963 51.570 1.00 29.51 ? 2178 HOH A O   1 
HETATM 2455 O  O   . HOH D 4 .   ? 42.143 64.523 31.403 1.00 28.96 ? 2179 HOH A O   1 
HETATM 2456 O  O   . HOH D 4 .   ? 53.065 62.018 67.330 1.00 31.69 ? 2180 HOH A O   1 
HETATM 2457 O  O   . HOH D 4 .   ? 81.110 49.956 35.622 1.00 29.58 ? 2181 HOH A O   1 
HETATM 2458 O  O   . HOH D 4 .   ? 72.420 43.912 58.293 1.00 36.68 ? 2182 HOH A O   1 
HETATM 2459 O  O   . HOH D 4 .   ? 57.983 37.152 58.277 1.00 28.82 ? 2183 HOH A O   1 
HETATM 2460 O  O   . HOH D 4 .   ? 80.687 31.594 54.014 1.00 30.67 ? 2184 HOH A O   1 
HETATM 2461 O  O   . HOH D 4 .   ? 54.617 63.856 65.842 1.00 30.45 ? 2185 HOH A O   1 
HETATM 2462 O  O   . HOH D 4 .   ? 52.600 57.702 37.857 1.00 37.41 ? 2186 HOH A O   1 
HETATM 2463 O  O   . HOH D 4 .   ? 73.435 44.847 62.782 1.00 33.40 ? 2187 HOH A O   1 
HETATM 2464 O  O   . HOH D 4 .   ? 81.154 54.707 46.357 1.00 29.49 ? 2188 HOH A O   1 
HETATM 2465 O  O   . HOH D 4 .   ? 38.948 63.718 31.027 1.00 37.36 ? 2189 HOH A O   1 
HETATM 2466 O  O   . HOH D 4 .   ? 41.368 67.275 27.639 1.00 34.01 ? 2190 HOH A O   1 
HETATM 2467 O  O   . HOH D 4 .   ? 58.559 37.643 52.116 1.00 28.49 ? 2191 HOH A O   1 
HETATM 2468 O  O   . HOH D 4 .   ? 54.123 60.466 69.357 1.00 36.52 ? 2192 HOH A O   1 
HETATM 2469 O  O   . HOH D 4 .   ? 74.325 25.194 49.617 1.00 32.72 ? 2193 HOH A O   1 
HETATM 2470 O  O   . HOH D 4 .   ? 56.671 61.575 69.118 1.00 36.05 ? 2194 HOH A O   1 
HETATM 2471 O  O   . HOH D 4 .   ? 38.953 74.010 19.151 1.00 44.36 ? 2195 HOH A O   1 
HETATM 2472 O  O   . HOH D 4 .   ? 81.414 52.360 44.850 1.00 38.70 ? 2196 HOH A O   1 
HETATM 2473 O  O   . HOH D 4 .   ? 65.763 64.346 63.519 1.00 37.65 ? 2197 HOH A O   1 
HETATM 2474 O  O   . HOH D 4 .   ? 85.118 34.551 42.381 1.00 34.32 ? 2198 HOH A O   1 
HETATM 2475 O  O   . HOH D 4 .   ? 77.668 48.164 55.462 1.00 31.07 ? 2199 HOH A O   1 
HETATM 2476 O  O   . HOH D 4 .   ? 55.166 48.523 71.631 1.00 47.47 ? 2200 HOH A O   1 
HETATM 2477 O  O   . HOH D 4 .   ? 57.572 28.396 32.137 1.00 38.90 ? 2201 HOH A O   1 
HETATM 2478 O  O   . HOH D 4 .   ? 54.740 66.062 58.643 1.00 39.45 ? 2202 HOH A O   1 
HETATM 2479 O  O   . HOH D 4 .   ? 81.762 49.962 48.191 1.00 43.77 ? 2203 HOH A O   1 
HETATM 2480 O  O   . HOH D 4 .   ? 64.235 54.678 70.712 1.00 33.19 ? 2204 HOH A O   1 
HETATM 2481 O  O   . HOH D 4 .   ? 62.852 34.086 59.964 1.00 30.73 ? 2205 HOH A O   1 
HETATM 2482 O  O   . HOH D 4 .   ? 59.625 62.935 67.090 1.00 37.59 ? 2206 HOH A O   1 
HETATM 2483 O  O   . HOH D 4 .   ? 46.042 50.383 66.007 1.00 40.72 ? 2207 HOH A O   1 
HETATM 2484 O  O   . HOH D 4 .   ? 65.189 51.684 70.584 1.00 38.00 ? 2208 HOH A O   1 
HETATM 2485 O  O   . HOH D 4 .   ? 59.924 71.587 42.379 1.00 33.73 ? 2209 HOH A O   1 
HETATM 2486 O  O   . HOH D 4 .   ? 86.417 27.888 43.489 1.00 44.34 ? 2210 HOH A O   1 
HETATM 2487 O  O   . HOH D 4 .   ? 72.076 58.503 41.923 1.00 41.62 ? 2211 HOH A O   1 
HETATM 2488 O  O   . HOH D 4 .   ? 80.690 36.019 55.854 1.00 36.07 ? 2212 HOH A O   1 
HETATM 2489 O  O   . HOH D 4 .   ? 70.422 58.067 31.777 1.00 32.66 ? 2213 HOH A O   1 
HETATM 2490 O  O   . HOH D 4 .   ? 70.134 34.358 63.477 1.00 32.79 ? 2214 HOH A O   1 
HETATM 2491 O  O   . HOH D 4 .   ? 72.541 55.651 41.946 1.00 33.61 ? 2215 HOH A O   1 
HETATM 2492 O  O   . HOH D 4 .   ? 74.887 56.896 22.079 1.00 32.79 ? 2216 HOH A O   1 
HETATM 2493 O  O   . HOH D 4 .   ? 37.800 68.959 7.802  1.00 49.79 ? 2217 HOH A O   1 
HETATM 2494 O  O   . HOH D 4 .   ? 47.886 47.117 63.018 1.00 38.84 ? 2218 HOH A O   1 
HETATM 2495 O  O   . HOH D 4 .   ? 35.605 68.988 25.083 1.00 33.44 ? 2219 HOH A O   1 
HETATM 2496 O  O   . HOH D 4 .   ? 84.441 23.423 37.287 1.00 46.80 ? 2220 HOH A O   1 
HETATM 2497 O  O   . HOH D 4 .   ? 42.197 69.557 26.298 1.00 31.90 ? 2221 HOH A O   1 
HETATM 2498 O  O   . HOH D 4 .   ? 52.924 34.611 52.986 1.00 41.18 ? 2222 HOH A O   1 
HETATM 2499 O  O   . HOH D 4 .   ? 61.868 44.868 25.087 1.00 27.80 ? 2223 HOH A O   1 
HETATM 2500 O  O   . HOH D 4 .   ? 85.485 40.448 51.848 1.00 29.31 ? 2224 HOH A O   1 
HETATM 2501 O  O   . HOH D 4 .   ? 38.474 74.241 12.215 1.00 46.96 ? 2225 HOH A O   1 
HETATM 2502 O  O   . HOH D 4 .   ? 37.271 69.202 27.383 1.00 40.92 ? 2226 HOH A O   1 
HETATM 2503 O  O   . HOH D 4 .   ? 63.129 61.286 70.685 1.00 27.08 ? 2227 HOH A O   1 
HETATM 2504 O  O   . HOH D 4 .   ? 66.872 30.947 53.194 1.00 32.03 ? 2228 HOH A O   1 
HETATM 2505 O  O   . HOH D 4 .   ? 61.860 66.001 70.837 1.00 43.32 ? 2229 HOH A O   1 
HETATM 2506 O  O   . HOH D 4 .   ? 28.306 71.486 8.969  1.00 32.44 ? 2230 HOH A O   1 
HETATM 2507 O  O   . HOH D 4 .   ? 54.107 59.200 53.250 1.00 28.64 ? 2231 HOH A O   1 
HETATM 2508 O  O   . HOH D 4 .   ? 83.481 55.063 14.971 1.00 43.50 ? 2232 HOH A O   1 
HETATM 2509 O  O   . HOH D 4 .   ? 46.926 47.662 60.097 1.00 36.63 ? 2233 HOH A O   1 
HETATM 2510 O  O   . HOH D 4 .   ? 56.732 34.839 44.613 1.00 43.29 ? 2234 HOH A O   1 
HETATM 2511 O  O   . HOH D 4 .   ? 70.712 50.048 28.829 1.00 29.31 ? 2235 HOH A O   1 
HETATM 2512 O  O   . HOH D 4 .   ? 57.237 63.462 66.685 1.00 42.56 ? 2236 HOH A O   1 
HETATM 2513 O  O   . HOH D 4 .   ? 86.237 29.552 41.459 1.00 30.85 ? 2237 HOH A O   1 
HETATM 2514 O  O   . HOH D 4 .   ? 35.593 73.000 19.891 1.00 39.16 ? 2238 HOH A O   1 
HETATM 2515 O  O   . HOH D 4 .   ? 34.837 62.062 26.080 1.00 37.26 ? 2239 HOH A O   1 
HETATM 2516 O  O   . HOH D 4 .   ? 81.031 60.002 49.121 1.00 34.29 ? 2240 HOH A O   1 
HETATM 2517 O  O   . HOH D 4 .   ? 52.715 61.069 51.979 1.00 32.58 ? 2241 HOH A O   1 
HETATM 2518 O  O   . HOH D 4 .   ? 50.617 42.433 59.807 1.00 45.59 ? 2242 HOH A O   1 
HETATM 2519 O  O   . HOH D 4 .   ? 56.697 63.474 52.926 1.00 37.06 ? 2243 HOH A O   1 
HETATM 2520 O  O   . HOH D 4 .   ? 83.282 41.165 53.364 1.00 44.25 ? 2244 HOH A O   1 
HETATM 2521 O  O   . HOH D 4 .   ? 49.669 49.007 50.001 1.00 11.36 ? 2245 HOH A O   1 
HETATM 2522 O  O   . HOH D 4 .   ? 54.142 47.373 67.866 1.00 24.21 ? 2246 HOH A O   1 
HETATM 2523 O  O   . HOH D 4 .   ? 57.266 37.867 62.244 1.00 24.79 ? 2247 HOH A O   1 
HETATM 2524 O  O   . HOH D 4 .   ? 53.154 49.857 68.559 1.00 23.94 ? 2248 HOH A O   1 
HETATM 2525 O  O   . HOH D 4 .   ? 74.015 28.313 37.501 1.00 29.51 ? 2249 HOH A O   1 
HETATM 2526 O  O   . HOH D 4 .   ? 37.043 61.109 48.006 1.00 33.23 ? 2250 HOH A O   1 
HETATM 2527 O  O   . HOH D 4 .   ? 75.908 54.948 31.508 1.00 34.23 ? 2251 HOH A O   1 
HETATM 2528 O  O   . HOH D 4 .   ? 72.569 49.491 59.234 1.00 35.72 ? 2252 HOH A O   1 
HETATM 2529 O  O   . HOH D 4 .   ? 63.290 50.335 25.028 1.00 19.34 ? 2253 HOH A O   1 
HETATM 2530 O  O   . HOH D 4 .   ? 84.950 52.688 29.598 1.00 37.87 ? 2254 HOH A O   1 
HETATM 2531 O  O   . HOH D 4 .   ? 72.274 40.066 62.652 1.00 40.63 ? 2255 HOH A O   1 
HETATM 2532 O  O   . HOH D 4 .   ? 60.943 53.270 71.852 1.00 38.80 ? 2256 HOH A O   1 
HETATM 2533 O  O   . HOH D 4 .   ? 60.763 36.208 56.803 1.00 45.35 ? 2257 HOH A O   1 
HETATM 2534 O  O   . HOH D 4 .   ? 49.692 68.142 62.741 1.00 44.84 ? 2258 HOH A O   1 
HETATM 2535 O  O   . HOH D 4 .   ? 64.481 38.397 67.123 1.00 39.50 ? 2259 HOH A O   1 
HETATM 2536 O  O   . HOH D 4 .   ? 34.019 63.160 21.552 1.00 33.44 ? 2260 HOH A O   1 
HETATM 2537 O  O   . HOH D 4 .   ? 63.866 49.497 72.773 1.00 48.20 ? 2261 HOH A O   1 
HETATM 2538 O  O   . HOH D 4 .   ? 43.316 58.279 64.061 1.00 42.60 ? 2262 HOH A O   1 
HETATM 2539 O  O   . HOH D 4 .   ? 46.269 56.316 68.201 1.00 45.73 ? 2263 HOH A O   1 
HETATM 2540 O  O   . HOH D 4 .   ? 79.563 56.492 37.275 1.00 47.53 ? 2264 HOH A O   1 
HETATM 2541 O  O   . HOH D 4 .   ? 44.682 54.065 68.008 1.00 45.14 ? 2265 HOH A O   1 
HETATM 2542 O  O   . HOH D 4 .   ? 51.062 50.473 69.993 1.00 45.27 ? 2266 HOH A O   1 
HETATM 2543 O  O   . HOH D 4 .   ? 61.245 53.478 46.948 1.00 47.28 ? 2267 HOH A O   1 
HETATM 2544 O  O   . HOH D 4 .   ? 58.685 26.781 33.848 1.00 27.89 ? 2268 HOH A O   1 
HETATM 2545 O  O   . HOH D 4 .   ? 43.181 48.706 59.580 1.00 36.21 ? 2269 HOH A O   1 
HETATM 2546 O  O   . HOH D 4 .   ? 55.676 61.359 39.600 1.00 30.96 ? 2270 HOH A O   1 
HETATM 2547 O  O   . HOH D 4 .   ? 53.694 54.761 48.933 1.00 37.03 ? 2271 HOH A O   1 
HETATM 2548 O  O   . HOH D 4 .   ? 65.464 48.831 24.338 1.00 34.27 ? 2272 HOH A O   1 
HETATM 2549 O  O   . HOH D 4 .   ? 66.700 31.532 50.800 1.00 40.21 ? 2273 HOH A O   1 
HETATM 2550 O  O   . HOH D 4 .   ? 49.474 48.243 57.641 1.00 26.61 ? 2274 HOH A O   1 
HETATM 2551 O  O   . HOH D 4 .   ? 55.590 67.526 38.479 1.00 35.48 ? 2275 HOH A O   1 
HETATM 2552 O  O   . HOH D 4 .   ? 61.250 37.049 29.989 1.00 27.40 ? 2276 HOH A O   1 
HETATM 2553 O  O   . HOH D 4 .   ? 47.201 47.466 56.154 1.00 33.20 ? 2277 HOH A O   1 
HETATM 2554 O  O   . HOH D 4 .   ? 80.437 31.321 57.627 1.00 30.21 ? 2278 HOH A O   1 
HETATM 2555 O  O   . HOH D 4 .   ? 81.131 55.291 14.284 1.00 31.93 ? 2279 HOH A O   1 
HETATM 2556 O  O   . HOH D 4 .   ? 82.072 47.761 11.666 1.00 33.76 ? 2280 HOH A O   1 
HETATM 2557 O  O   . HOH D 4 .   ? 34.069 63.797 24.163 1.00 36.36 ? 2281 HOH A O   1 
HETATM 2558 O  O   . HOH D 4 .   ? 79.473 39.010 58.874 1.00 35.06 ? 2282 HOH A O   1 
HETATM 2559 O  O   . HOH D 4 .   ? 81.586 52.957 42.217 1.00 30.21 ? 2283 HOH A O   1 
HETATM 2560 O  O   . HOH D 4 .   ? 81.468 29.959 55.794 1.00 42.49 ? 2284 HOH A O   1 
HETATM 2561 O  O   . HOH D 4 .   ? 74.337 52.973 31.351 1.00 42.22 ? 2285 HOH A O   1 
HETATM 2562 O  O   . HOH D 4 .   ? 69.845 65.372 64.152 1.00 36.13 ? 2286 HOH A O   1 
HETATM 2563 O  O   . HOH D 4 .   ? 63.141 30.644 53.746 1.00 39.45 ? 2287 HOH A O   1 
HETATM 2564 O  O   . HOH D 4 .   ? 57.468 65.158 58.137 1.00 37.95 ? 2288 HOH A O   1 
HETATM 2565 O  O   . HOH D 4 .   ? 76.247 34.671 36.362 1.00 38.60 ? 2289 HOH A O   1 
HETATM 2566 O  O   . HOH D 4 .   ? 51.311 33.007 54.106 1.00 38.34 ? 2290 HOH A O   1 
HETATM 2567 O  O   . HOH D 4 .   ? 72.460 59.440 35.379 1.00 41.29 ? 2291 HOH A O   1 
HETATM 2568 O  O   . HOH D 4 .   ? 60.008 56.311 71.953 1.00 38.18 ? 2292 HOH A O   1 
HETATM 2569 O  O   . HOH D 4 .   ? 64.080 45.883 24.613 1.00 42.17 ? 2293 HOH A O   1 
HETATM 2570 O  O   . HOH D 4 .   ? 43.872 65.608 28.925 1.00 39.88 ? 2294 HOH A O   1 
HETATM 2571 O  O   . HOH D 4 .   ? 80.575 52.520 35.742 1.00 44.14 ? 2295 HOH A O   1 
HETATM 2572 O  O   . HOH D 4 .   ? 53.999 39.357 61.816 1.00 38.59 ? 2296 HOH A O   1 
HETATM 2573 O  O   . HOH D 4 .   ? 60.897 65.957 57.166 1.00 38.15 ? 2297 HOH A O   1 
HETATM 2574 O  O   . HOH D 4 .   ? 70.895 52.812 58.582 1.00 45.74 ? 2298 HOH A O   1 
HETATM 2575 O  O   . HOH D 4 .   ? 79.610 52.021 55.640 1.00 36.72 ? 2299 HOH A O   1 
HETATM 2576 O  O   . HOH D 4 .   ? 46.120 57.781 65.597 1.00 34.81 ? 2300 HOH A O   1 
HETATM 2577 O  O   . HOH D 4 .   ? 73.698 55.570 59.471 1.00 37.55 ? 2301 HOH A O   1 
HETATM 2578 O  O   . HOH D 4 .   ? 88.237 38.008 41.196 1.00 41.69 ? 2302 HOH A O   1 
HETATM 2579 O  O   . HOH D 4 .   ? 42.633 61.212 64.170 1.00 37.08 ? 2303 HOH A O   1 
HETATM 2580 O  O   . HOH D 4 .   ? 71.588 52.335 64.554 1.00 37.90 ? 2304 HOH A O   1 
HETATM 2581 O  O   . HOH D 4 .   ? 52.206 43.670 61.789 1.00 38.95 ? 2305 HOH A O   1 
HETATM 2582 O  O   . HOH D 4 .   ? 89.564 40.501 44.737 1.00 41.98 ? 2306 HOH A O   1 
HETATM 2583 O  O   . HOH D 4 .   ? 72.490 54.990 63.797 1.00 43.10 ? 2307 HOH A O   1 
HETATM 2584 O  O   . HOH D 4 .   ? 62.698 56.320 72.499 1.00 44.07 ? 2308 HOH A O   1 
HETATM 2585 O  O   . HOH D 4 .   ? 65.641 45.642 70.220 1.00 43.65 ? 2309 HOH A O   1 
HETATM 2586 O  O   . HOH D 4 .   ? 74.963 54.877 24.427 1.00 33.06 ? 2310 HOH A O   1 
HETATM 2587 O  O   . HOH D 4 .   ? 37.258 62.323 50.436 1.00 44.72 ? 2311 HOH A O   1 
HETATM 2588 O  O   . HOH D 4 .   ? 51.749 63.865 38.782 1.00 44.70 ? 2312 HOH A O   1 
HETATM 2589 O  O   . HOH D 4 .   ? 74.237 51.000 58.000 1.00 36.61 ? 2313 HOH A O   1 
HETATM 2590 O  O   . HOH D 4 .   ? 65.604 33.522 42.089 1.00 37.23 ? 2314 HOH A O   1 
HETATM 2591 O  O   . HOH D 4 .   ? 64.045 64.410 69.904 1.00 45.22 ? 2315 HOH A O   1 
HETATM 2592 O  O   . HOH D 4 .   ? 43.291 54.022 65.467 1.00 46.39 ? 2316 HOH A O   1 
HETATM 2593 O  O   . HOH D 4 .   ? 42.855 73.409 16.411 1.00 40.44 ? 2317 HOH A O   1 
HETATM 2594 O  O   . HOH D 4 .   ? 60.904 69.469 38.479 1.00 44.41 ? 2318 HOH A O   1 
HETATM 2595 O  O   . HOH D 4 .   ? 74.444 47.155 57.898 1.00 39.95 ? 2319 HOH A O   1 
HETATM 2596 O  O   . HOH D 4 .   ? 37.557 59.386 33.602 1.00 46.31 ? 2320 HOH A O   1 
HETATM 2597 O  O   . HOH D 4 .   ? 51.347 63.705 27.261 1.00 49.97 ? 2321 HOH A O   1 
HETATM 2598 O  O   . HOH D 4 .   ? 85.949 24.482 35.405 1.00 46.00 ? 2322 HOH A O   1 
HETATM 2599 O  O   . HOH D 4 .   ? 81.164 53.406 9.892  1.00 49.96 ? 2323 HOH A O   1 
HETATM 2600 O  O   . HOH D 4 .   ? 54.557 31.312 41.491 1.00 33.64 ? 2324 HOH A O   1 
HETATM 2601 O  O   . HOH D 4 .   ? 73.825 42.216 61.950 1.00 46.80 ? 2325 HOH A O   1 
HETATM 2602 O  O   . HOH D 4 .   ? 38.684 66.918 27.968 1.00 39.98 ? 2326 HOH A O   1 
HETATM 2603 O  O   . HOH D 4 .   ? 50.626 61.615 37.362 1.00 43.36 ? 2327 HOH A O   1 
HETATM 2604 O  O   . HOH D 4 .   ? 75.220 33.454 38.168 1.00 37.36 ? 2328 HOH A O   1 
HETATM 2605 O  O   . HOH D 4 .   ? 55.352 46.147 70.273 1.00 47.01 ? 2329 HOH A O   1 
HETATM 2606 O  O   . HOH D 4 .   ? 70.142 48.647 69.265 1.00 48.80 ? 2330 HOH A O   1 
HETATM 2607 O  O   . HOH D 4 .   ? 80.524 39.175 54.364 1.00 44.96 ? 2331 HOH A O   1 
HETATM 2608 O  O   . HOH D 4 .   ? 60.583 70.269 52.494 1.00 44.34 ? 2332 HOH A O   1 
HETATM 2609 O  O   . HOH D 4 .   ? 86.031 56.151 19.533 1.00 43.48 ? 2333 HOH A O   1 
HETATM 2610 O  O   . HOH D 4 .   ? 57.134 57.202 71.431 1.00 48.32 ? 2334 HOH A O   1 
HETATM 2611 O  O   . HOH D 4 .   ? 74.178 48.543 67.810 1.00 42.77 ? 2335 HOH A O   1 
HETATM 2612 O  O   . HOH D 4 .   ? 73.199 43.994 65.721 1.00 47.18 ? 2336 HOH A O   1 
HETATM 2613 O  O   . HOH D 4 .   ? 39.800 71.261 26.454 1.00 45.40 ? 2337 HOH A O   1 
HETATM 2614 O  O   . HOH D 4 .   ? 73.145 51.109 30.309 1.00 45.49 ? 2338 HOH A O   1 
HETATM 2615 O  O   . HOH D 4 .   ? 44.280 47.958 63.343 1.00 47.32 ? 2339 HOH A O   1 
HETATM 2616 O  O   . HOH D 4 .   ? 73.594 54.918 39.424 1.00 50.44 ? 2340 HOH A O   1 
HETATM 2617 O  O   . HOH D 4 .   ? 61.455 44.274 71.653 1.00 49.35 ? 2341 HOH A O   1 
HETATM 2618 O  O   . HOH D 4 .   ? 87.220 45.038 20.687 1.00 42.61 ? 2342 HOH A O   1 
HETATM 2619 O  O   . HOH D 4 .   ? 63.806 63.520 67.550 1.00 47.32 ? 2343 HOH A O   1 
HETATM 2620 O  O   . HOH D 4 .   ? 49.711 48.265 70.944 1.00 42.63 ? 2344 HOH A O   1 
HETATM 2621 O  O   . HOH D 4 .   ? 67.370 37.601 65.932 1.00 41.12 ? 2345 HOH A O   1 
HETATM 2622 O  O   . HOH D 4 .   ? 70.643 45.239 68.883 1.00 42.13 ? 2346 HOH A O   1 
HETATM 2623 O  O   . HOH D 4 .   ? 56.922 33.972 57.323 1.00 46.48 ? 2347 HOH A O   1 
HETATM 2624 O  O   . HOH D 4 .   ? 53.338 65.717 55.978 1.00 48.79 ? 2348 HOH A O   1 
HETATM 2625 O  O   . HOH D 4 .   ? 42.778 62.521 55.121 1.00 44.73 ? 2349 HOH A O   1 
HETATM 2626 O  O   . HOH D 4 .   ? 48.670 44.330 64.447 1.00 44.44 ? 2350 HOH A O   1 
HETATM 2627 O  O   . HOH D 4 .   ? 39.034 72.160 24.018 1.00 47.34 ? 2351 HOH A O   1 
HETATM 2628 O  O   . HOH D 4 .   ? 89.731 48.713 22.181 1.00 47.46 ? 2352 HOH A O   1 
HETATM 2629 O  O   . HOH D 4 .   ? 47.318 69.686 58.418 1.00 45.85 ? 2353 HOH A O   1 
HETATM 2630 O  O   . HOH D 4 .   ? 60.742 72.975 45.059 1.00 47.67 ? 2354 HOH A O   1 
HETATM 2631 O  O   . HOH D 4 .   ? 85.473 55.365 16.699 1.00 43.14 ? 2355 HOH A O   1 
HETATM 2632 O  O   . HOH D 4 .   ? 76.028 66.081 41.576 1.00 42.10 ? 2356 HOH A O   1 
HETATM 2633 O  O   . HOH D 4 .   ? 82.153 36.656 58.306 1.00 49.92 ? 2357 HOH A O   1 
HETATM 2634 O  O   . HOH D 4 .   ? 75.691 53.287 59.364 1.00 48.08 ? 2358 HOH A O   1 
HETATM 2635 O  O   . HOH D 4 .   ? 56.166 71.663 37.537 1.00 47.69 ? 2359 HOH A O   1 
HETATM 2636 O  O   . HOH D 4 .   ? 47.771 61.020 42.021 1.00 46.50 ? 2360 HOH A O   1 
HETATM 2637 O  O   . HOH D 4 .   ? 38.851 66.495 30.586 1.00 44.30 ? 2361 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   LYS 3   3   3   LYS LYS A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   TYR 5   5   5   TYR TYR A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   GLU 7   7   7   GLU GLU A . n 
A 1 8   GLN 8   8   8   GLN GLN A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  GLU 10  10  10  GLU GLU A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  HIS 12  12  12  HIS HIS A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  ALA 15  15  15  ALA ALA A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  TYR 17  17  17  TYR TYR A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  SER 19  19  19  SER SER A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  MET 21  21  21  MET MET A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  TYR 24  24  24  TYR TYR A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  ARG 29  29  29  ARG ARG A . n 
A 1 30  GLN 30  30  30  GLN GLN A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  MET 36  36  36  MET MET A . n 
A 1 37  ALA 37  37  37  ALA ALA A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  MET 44  44  44  MET MET A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  ALA 47  47  47  ALA ALA A . n 
A 1 48  HIS 48  48  48  HIS HIS A . n 
A 1 49  GLY 49  49  49  GLY GLY A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  THR 53  53  53  THR THR A . n 
A 1 54  PHE 54  54  54  PHE PHE A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  LYS 57  57  57  LYS LYS A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASP 65  65  65  ASP ASP A . n 
A 1 66  PHE 66  66  66  PHE PHE A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  TRP 68  68  68  TRP TRP A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  GLU 72  72  72  GLU GLU A . n 
A 1 73  HIS 73  73  73  HIS HIS A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  MET 75  75  75  MET MET A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  ASN 77  77  77  ASN ASN A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  HIS 82  82  82  HIS HIS A . n 
A 1 83  ASP 83  83  83  ASP ASP A . n 
A 1 84  ALA 84  84  84  ALA ALA A . n 
A 1 85  ILE 85  85  85  ILE ILE A . n 
A 1 86  HIS 86  86  86  HIS HIS A . n 
A 1 87  ALA 87  87  87  ALA ALA A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  HIS 90  90  90  HIS HIS A . n 
A 1 91  HIS 91  91  91  HIS HIS A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  ARG 95  95  95  ARG ARG A . n 
A 1 96  SER 96  96  96  SER SER A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  VAL 98  98  98  VAL VAL A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 VAL 100 100 100 VAL VAL A . n 
A 1 101 ARG 101 101 101 ARG ARG A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 PRO 103 103 103 PRO PRO A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 HIS 105 105 105 HIS HIS A . n 
A 1 106 ASP 106 106 106 ASP ASP A . n 
A 1 107 GLU 107 107 107 GLU GLU A . n 
A 1 108 VAL 108 108 108 VAL VAL A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 ASP 115 115 115 ASP ASP A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 ALA 118 118 118 ALA ALA A . n 
A 1 119 ALA 119 119 119 ALA ALA A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 ILE 123 123 123 ILE ILE A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 HIS 125 125 125 HIS HIS A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 GLU 127 127 127 GLU GLU A . n 
A 1 128 THR 128 128 128 THR THR A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 GLU 130 130 130 GLU GLU A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 ARG 133 133 133 ARG ARG A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 PHE 135 135 135 PHE PHE A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 LYS 137 137 137 LYS LYS A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 MET 139 139 139 MET MET A . n 
A 1 140 TYR 140 140 140 TYR TYR A . n 
A 1 141 TYR 141 141 141 TYR TYR A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 PRO 143 143 143 PRO PRO A . n 
A 1 144 ILE 144 144 144 ILE ILE A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 ARG 146 146 146 ARG ARG A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 PHE 149 149 149 PHE PHE A . n 
A 1 150 SER 150 150 150 SER SER A . n 
A 1 151 PRO 151 151 151 PRO PRO A . n 
A 1 152 TRP 152 152 152 TRP TRP A . n 
A 1 153 THR 153 153 153 THR THR A . n 
A 1 154 PHE 154 154 154 PHE PHE A . n 
A 1 155 SER 155 155 155 SER SER A . n 
A 1 156 PRO 156 156 156 PRO PRO A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 ALA 159 159 159 ALA ALA A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 ALA 161 161 161 ALA ALA A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 PHE 164 164 164 PHE PHE A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 ASN 166 166 166 ASN ASN A . n 
A 1 167 ASP 167 167 167 ASP ASP A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 TYR 169 169 169 TYR TYR A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 THR 173 173 173 THR THR A . n 
A 1 174 SER 174 174 174 SER SER A . n 
A 1 175 ASN 175 175 175 ASN ASN A . n 
A 1 176 ASN 176 176 176 ASN ASN A . n 
A 1 177 HIS 177 177 177 HIS HIS A . n 
A 1 178 VAL 178 178 178 VAL VAL A . n 
A 1 179 CYS 179 179 179 CYS CYS A . n 
A 1 180 ILE 180 180 180 ILE ILE A . n 
A 1 181 ILE 181 181 181 ILE ILE A . n 
A 1 182 PRO 182 182 182 PRO PRO A . n 
A 1 183 GLN 183 183 183 GLN GLN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 SER 186 186 186 SER SER A . n 
A 1 187 VAL 187 187 187 VAL VAL A . n 
A 1 188 LYS 188 188 188 LYS LYS A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 VAL 190 190 190 VAL VAL A . n 
A 1 191 GLU 191 191 191 GLU GLU A . n 
A 1 192 ASN 192 192 192 ASN ASN A . n 
A 1 193 VAL 193 193 193 VAL VAL A . n 
A 1 194 ASP 194 194 194 ASP ASP A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 ALA 198 198 198 ALA ALA A . n 
A 1 199 MET 199 199 199 MET MET A . n 
A 1 200 PRO 200 200 200 PRO PRO A . n 
A 1 201 GLU 201 201 201 GLU GLU A . n 
A 1 202 ILE 202 202 202 ILE ILE A . n 
A 1 203 HIS 203 203 203 HIS HIS A . n 
A 1 204 GLY 204 204 204 GLY GLY A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 MET 206 206 206 MET MET A . n 
A 1 207 PHE 207 207 207 PHE PHE A . n 
A 1 208 GLY 208 208 208 GLY GLY A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 ASP 211 211 211 ASP ASP A . n 
A 1 212 TYR 212 212 212 TYR TYR A . n 
A 1 213 MET 213 213 213 MET MET A . n 
A 1 214 ILE 214 214 214 ILE ILE A . n 
A 1 215 ASP 215 215 215 ASP ASP A . n 
A 1 216 ALA 216 216 216 ALA ALA A . n 
A 1 217 GLY 217 217 217 GLY GLY A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 ASP 219 219 219 ASP ASP A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 ASN 221 221 221 ASN ASN A . n 
A 1 222 GLY 222 222 222 GLY GLY A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 SER 225 225 225 SER SER A . n 
A 1 226 GLY 226 226 226 GLY GLY A . n 
A 1 227 VAL 227 227 227 VAL VAL A . n 
A 1 228 PRO 228 228 228 PRO PRO A . n 
A 1 229 HIS 229 229 229 HIS HIS A . n 
A 1 230 PRO 230 230 230 PRO PRO A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 PHE 232 232 232 PHE PHE A . n 
A 1 233 VAL 233 233 233 VAL VAL A . n 
A 1 234 GLU 234 234 234 GLU GLU A . n 
A 1 235 ALA 235 235 235 ALA ALA A . n 
A 1 236 MET 236 236 236 MET MET A . n 
A 1 237 THR 237 237 237 THR THR A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 PHE 239 239 239 PHE PHE A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 THR 241 241 241 THR THR A . n 
A 1 242 ALA 242 242 242 ALA ALA A . n 
A 1 243 ALA 243 243 243 ALA ALA A . n 
A 1 244 GLN 244 244 244 GLN GLN A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ASN 246 246 246 ASN ASN A . n 
A 1 247 GLY 247 247 247 GLY GLY A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 PRO 249 249 249 PRO PRO A . n 
A 1 250 ILE 250 250 250 ILE ILE A . n 
A 1 251 PHE 251 251 251 PHE PHE A . n 
A 1 252 GLY 252 252 252 GLY GLY A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 ALA 254 254 254 ALA ALA A . n 
A 1 255 LEU 255 255 255 LEU LEU A . n 
A 1 256 SER 256 256 256 SER SER A . n 
A 1 257 VAL 257 257 257 VAL VAL A . n 
A 1 258 ASP 258 258 258 ASP ASP A . n 
A 1 259 MET 259 259 259 MET MET A . n 
A 1 260 VAL 260 260 260 VAL VAL A . n 
A 1 261 PRO 261 261 261 PRO PRO A . n 
A 1 262 SER 262 262 262 SER SER A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 ILE 264 264 264 ILE ILE A . n 
A 1 265 GLU 265 265 265 GLU GLU A . n 
A 1 266 GLN 266 266 266 GLN GLN A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 TYR 268 268 268 TYR TYR A . n 
A 1 269 ARG 269 269 269 ARG ARG A . n 
A 1 270 ALA 270 270 270 ALA ALA A . n 
A 1 271 ILE 271 271 271 ILE ILE A . n 
A 1 272 ALA 272 272 272 ALA ALA A . n 
A 1 273 VAL 273 273 273 VAL VAL A . n 
A 1 274 GLN 274 274 274 GLN GLN A . n 
A 1 275 PHE 275 275 275 PHE PHE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 TRP 278 278 278 TRP TRP A . n 
A 1 279 GLY 279 279 279 GLY GLY A . n 
A 1 280 LEU 280 280 280 LEU LEU A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 ARG 282 282 282 ARG ARG A . n 
A 1 283 LEU 283 283 283 LEU LEU A . n 
A 1 284 VAL 284 284 284 VAL VAL A . n 
A 1 285 HIS 285 285 285 HIS HIS A . n 
A 1 286 GLY 286 286 286 GLY GLY A . n 
A 1 287 SER 287 287 287 SER SER A . n 
A 1 288 LEU 288 288 288 LEU LEU A . n 
A 1 289 ALA 289 289 289 ALA ALA A . n 
A 1 290 GLN 290 290 290 GLN GLN A . n 
A 1 291 ALA 291 291 291 ALA ALA A . n 
A 1 292 ARG 292 292 292 ARG ARG A . n 
A 1 293 ALA 293 293 293 ALA ALA A . n 
A 1 294 SER 294 294 294 SER SER A . n 
A 1 295 ALA 295 295 295 ALA ALA A . n 
A 1 296 LYS 296 296 296 LYS LYS A . n 
A 1 297 GLN 297 297 297 GLN GLN A . n 
A 1 298 PHE 298 298 298 PHE PHE A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 GLY 300 300 300 GLY GLY A . n 
A 1 301 GLN 301 301 ?   ?   ?   A . n 
A 1 302 GLY 302 302 ?   ?   ?   A . n 
A 1 303 LYS 303 303 ?   ?   ?   A . n 
A 1 304 ALA 304 304 ?   ?   ?   A . n 
A 1 305 ALA 305 305 ?   ?   ?   A . n 
A 1 306 THR 306 306 ?   ?   ?   A . n 
A 1 307 ASP 307 307 ?   ?   ?   A . n 
A 1 308 GLY 308 308 ?   ?   ?   A . n 
A 1 309 THR 309 309 ?   ?   ?   A . n 
A 1 310 THR 310 310 ?   ?   ?   A . n 
A 1 311 ASP 311 311 ?   ?   ?   A . n 
A 1 312 GLU 312 312 ?   ?   ?   A . n 
A 1 313 THR 313 313 ?   ?   ?   A . n 
A 1 314 VAL 314 314 ?   ?   ?   A . n 
A 1 315 ASP 315 315 ?   ?   ?   A . n 
A 1 316 GLY 316 316 ?   ?   ?   A . n 
A 1 317 ALA 317 317 ?   ?   ?   A . n 
A 1 318 ALA 318 318 ?   ?   ?   A . n 
A 1 319 GLU 319 319 ?   ?   ?   A . n 
A 1 320 GLU 320 320 ?   ?   ?   A . n 
A 1 321 VAL 321 321 ?   ?   ?   A . n 
A 1 322 ALA 322 322 ?   ?   ?   A . n 
A 1 323 ASN 323 323 ?   ?   ?   A . n 
A 1 324 GLY 324 324 ?   ?   ?   A . n 
A 1 325 VAL 325 325 ?   ?   ?   A . n 
A 1 326 SER 326 326 ?   ?   ?   A . n 
A 1 327 LYS 327 327 ?   ?   ?   A . n 
A 1 328 VAL 328 328 ?   ?   ?   A . n 
A 1 329 LYS 329 329 ?   ?   ?   A . n 
A 1 330 LEU 330 330 ?   ?   ?   A . n 
A 1 331 ASP 331 331 ?   ?   ?   A . n 
A 1 332 GLU 332 332 ?   ?   ?   A . n 
A 1 333 ALA 333 333 ?   ?   ?   A . n 
A 1 334 GLY 334 334 ?   ?   ?   A . n 
A 1 335 ASP 335 335 ?   ?   ?   A . n 
A 1 336 GLU 336 336 ?   ?   ?   A . n 
A 1 337 ASP 337 337 ?   ?   ?   A . n 
A 1 338 LYS 338 338 ?   ?   ?   A . n 
A 1 339 ALA 339 339 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4,5,6 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 34820 ? 
1 MORE         -252  ? 
1 'SSA (A^2)'  59040 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z            1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 2_655  -y+1,x-y,z       -0.5000000000 -0.8660254038 0.0000000000 106.6780000000 0.8660254038  
-0.5000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
3 'crystal symmetry operation' 3_665  -x+y+1,-x+1,z    -0.5000000000 0.8660254038  0.0000000000 53.3390000000  -0.8660254038 
-0.5000000000 0.0000000000 92.3858580249 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
4 'crystal symmetry operation' 10_665 -y+1,-x+1,-z+1/2 0.5000000000  -0.8660254038 0.0000000000 53.3390000000  -0.8660254038 
-0.5000000000 0.0000000000 92.3858580249 0.0000000000 0.0000000000 -1.0000000000 60.3775000000 
5 'crystal symmetry operation' 11_655 -x+y+1,y,-z+1/2  -1.0000000000 0.0000000000  0.0000000000 106.6780000000 0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 -1.0000000000 60.3775000000 
6 'crystal symmetry operation' 12_555 x,x-y,-z+1/2     0.5000000000  0.8660254038  0.0000000000 0.0000000000   0.8660254038  
-0.5000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 -1.0000000000 60.3775000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? A GLU 185 ? A GLU 185  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 OD2 ? A ASP 211 ? A ASP 211  ? 1_555 93.2  ? 
2  OE1 ? A GLU 185 ? A GLU 185  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O3  ? C PYR .   ? A PYR 2001 ? 1_555 95.6  ? 
3  OD2 ? A ASP 211 ? A ASP 211  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O3  ? C PYR .   ? A PYR 2001 ? 1_555 163.3 ? 
4  OE1 ? A GLU 185 ? A GLU 185  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? D HOH .   ? A HOH 2036 ? 1_555 88.8  ? 
5  OD2 ? A ASP 211 ? A ASP 211  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? D HOH .   ? A HOH 2036 ? 1_555 99.7  ? 
6  O3  ? C PYR .   ? A PYR 2001 ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? D HOH .   ? A HOH 2036 ? 1_555 94.7  ? 
7  OE1 ? A GLU 185 ? A GLU 185  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? D HOH .   ? A HOH 2245 ? 1_555 175.9 ? 
8  OD2 ? A ASP 211 ? A ASP 211  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? D HOH .   ? A HOH 2245 ? 1_555 86.7  ? 
9  O3  ? C PYR .   ? A PYR 2001 ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? D HOH .   ? A HOH 2245 ? 1_555 83.5  ? 
10 O   ? D HOH .   ? A HOH 2036 ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O   ? D HOH .   ? A HOH 2245 ? 1_555 95.2  ? 
11 OE1 ? A GLU 185 ? A GLU 185  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O1  ? C PYR .   ? A PYR 2001 ? 1_555 89.6  ? 
12 OD2 ? A ASP 211 ? A ASP 211  ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O1  ? C PYR .   ? A PYR 2001 ? 1_555 86.9  ? 
13 O3  ? C PYR .   ? A PYR 2001 ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O1  ? C PYR .   ? A PYR 2001 ? 1_555 79.0  ? 
14 O   ? D HOH .   ? A HOH 2036 ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O1  ? C PYR .   ? A PYR 2001 ? 1_555 173.3 ? 
15 O   ? D HOH .   ? A HOH 2245 ? 1_555 MG ? B MG . ? A MG 1001 ? 1_555 O1  ? C PYR .   ? A PYR 2001 ? 1_555 86.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-04-01 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM 'data reduction' .         ? 1 
SCALA  'data scaling'   .         ? 2 
SHARP  phasing          .         ? 3 
CNS    refinement       .         ? 4 
CCP4   'data scaling'   '(SCALA)' ? 5 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     2358 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     2358 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   9_766 
_pdbx_validate_symm_contact.dist              2.06 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 3   ? ? -141.12 19.84  
2 1 MET A 75  ? ? -79.12  47.35  
3 1 ILE A 158 ? ? -126.15 -51.28 
4 1 ASP A 160 ? ? -150.64 24.57  
5 1 ASN A 166 ? ? 38.04   54.18  
6 1 GLU A 185 ? ? -151.90 35.70  
7 1 ASP A 219 ? ? -64.79  93.17  
8 1 VAL A 227 ? ? 55.63   102.07 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLN 301 ? A GLN 301 
3  1 Y 1 A GLY 302 ? A GLY 302 
4  1 Y 1 A LYS 303 ? A LYS 303 
5  1 Y 1 A ALA 304 ? A ALA 304 
6  1 Y 1 A ALA 305 ? A ALA 305 
7  1 Y 1 A THR 306 ? A THR 306 
8  1 Y 1 A ASP 307 ? A ASP 307 
9  1 Y 1 A GLY 308 ? A GLY 308 
10 1 Y 1 A THR 309 ? A THR 309 
11 1 Y 1 A THR 310 ? A THR 310 
12 1 Y 1 A ASP 311 ? A ASP 311 
13 1 Y 1 A GLU 312 ? A GLU 312 
14 1 Y 1 A THR 313 ? A THR 313 
15 1 Y 1 A VAL 314 ? A VAL 314 
16 1 Y 1 A ASP 315 ? A ASP 315 
17 1 Y 1 A GLY 316 ? A GLY 316 
18 1 Y 1 A ALA 317 ? A ALA 317 
19 1 Y 1 A ALA 318 ? A ALA 318 
20 1 Y 1 A GLU 319 ? A GLU 319 
21 1 Y 1 A GLU 320 ? A GLU 320 
22 1 Y 1 A VAL 321 ? A VAL 321 
23 1 Y 1 A ALA 322 ? A ALA 322 
24 1 Y 1 A ASN 323 ? A ASN 323 
25 1 Y 1 A GLY 324 ? A GLY 324 
26 1 Y 1 A VAL 325 ? A VAL 325 
27 1 Y 1 A SER 326 ? A SER 326 
28 1 Y 1 A LYS 327 ? A LYS 327 
29 1 Y 1 A VAL 328 ? A VAL 328 
30 1 Y 1 A LYS 329 ? A LYS 329 
31 1 Y 1 A LEU 330 ? A LEU 330 
32 1 Y 1 A ASP 331 ? A ASP 331 
33 1 Y 1 A GLU 332 ? A GLU 332 
34 1 Y 1 A ALA 333 ? A ALA 333 
35 1 Y 1 A GLY 334 ? A GLY 334 
36 1 Y 1 A ASP 335 ? A ASP 335 
37 1 Y 1 A GLU 336 ? A GLU 336 
38 1 Y 1 A ASP 337 ? A ASP 337 
39 1 Y 1 A LYS 338 ? A LYS 338 
40 1 Y 1 A ALA 339 ? A ALA 339 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION' MG  
3 'PYRUVIC ACID'  PYR 
4 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   1001 1001 MG  MG  A . 
C 3 PYR 1   2001 2001 PYR PYR A . 
D 4 HOH 1   2002 1    HOH HOH A . 
D 4 HOH 2   2003 2    HOH HOH A . 
D 4 HOH 3   2004 3    HOH HOH A . 
D 4 HOH 4   2005 4    HOH HOH A . 
D 4 HOH 5   2006 5    HOH HOH A . 
D 4 HOH 6   2007 6    HOH HOH A . 
D 4 HOH 7   2008 7    HOH HOH A . 
D 4 HOH 8   2009 8    HOH HOH A . 
D 4 HOH 9   2010 9    HOH HOH A . 
D 4 HOH 10  2011 10   HOH HOH A . 
D 4 HOH 11  2012 11   HOH HOH A . 
D 4 HOH 12  2013 12   HOH HOH A . 
D 4 HOH 13  2014 13   HOH HOH A . 
D 4 HOH 14  2015 14   HOH HOH A . 
D 4 HOH 15  2016 15   HOH HOH A . 
D 4 HOH 16  2017 16   HOH HOH A . 
D 4 HOH 17  2018 17   HOH HOH A . 
D 4 HOH 18  2019 18   HOH HOH A . 
D 4 HOH 19  2020 19   HOH HOH A . 
D 4 HOH 20  2021 20   HOH HOH A . 
D 4 HOH 21  2022 21   HOH HOH A . 
D 4 HOH 22  2023 22   HOH HOH A . 
D 4 HOH 23  2024 23   HOH HOH A . 
D 4 HOH 24  2025 24   HOH HOH A . 
D 4 HOH 25  2026 25   HOH HOH A . 
D 4 HOH 26  2027 26   HOH HOH A . 
D 4 HOH 27  2028 27   HOH HOH A . 
D 4 HOH 28  2029 28   HOH HOH A . 
D 4 HOH 29  2030 29   HOH HOH A . 
D 4 HOH 30  2031 30   HOH HOH A . 
D 4 HOH 31  2032 31   HOH HOH A . 
D 4 HOH 32  2033 32   HOH HOH A . 
D 4 HOH 33  2034 33   HOH HOH A . 
D 4 HOH 34  2035 34   HOH HOH A . 
D 4 HOH 35  2036 35   HOH HOH A . 
D 4 HOH 36  2037 36   HOH HOH A . 
D 4 HOH 37  2038 37   HOH HOH A . 
D 4 HOH 38  2039 38   HOH HOH A . 
D 4 HOH 39  2040 39   HOH HOH A . 
D 4 HOH 40  2041 40   HOH HOH A . 
D 4 HOH 41  2042 41   HOH HOH A . 
D 4 HOH 42  2043 42   HOH HOH A . 
D 4 HOH 43  2044 43   HOH HOH A . 
D 4 HOH 44  2045 44   HOH HOH A . 
D 4 HOH 45  2046 45   HOH HOH A . 
D 4 HOH 46  2047 46   HOH HOH A . 
D 4 HOH 47  2048 47   HOH HOH A . 
D 4 HOH 48  2049 48   HOH HOH A . 
D 4 HOH 49  2050 49   HOH HOH A . 
D 4 HOH 50  2051 50   HOH HOH A . 
D 4 HOH 51  2052 51   HOH HOH A . 
D 4 HOH 52  2053 52   HOH HOH A . 
D 4 HOH 53  2054 53   HOH HOH A . 
D 4 HOH 54  2055 54   HOH HOH A . 
D 4 HOH 55  2056 55   HOH HOH A . 
D 4 HOH 56  2057 56   HOH HOH A . 
D 4 HOH 57  2058 57   HOH HOH A . 
D 4 HOH 58  2059 58   HOH HOH A . 
D 4 HOH 59  2060 59   HOH HOH A . 
D 4 HOH 60  2061 60   HOH HOH A . 
D 4 HOH 61  2062 61   HOH HOH A . 
D 4 HOH 62  2063 62   HOH HOH A . 
D 4 HOH 63  2064 63   HOH HOH A . 
D 4 HOH 64  2065 64   HOH HOH A . 
D 4 HOH 65  2066 65   HOH HOH A . 
D 4 HOH 66  2067 66   HOH HOH A . 
D 4 HOH 67  2068 67   HOH HOH A . 
D 4 HOH 68  2069 68   HOH HOH A . 
D 4 HOH 69  2070 69   HOH HOH A . 
D 4 HOH 70  2071 70   HOH HOH A . 
D 4 HOH 71  2072 71   HOH HOH A . 
D 4 HOH 72  2073 72   HOH HOH A . 
D 4 HOH 73  2074 73   HOH HOH A . 
D 4 HOH 74  2075 74   HOH HOH A . 
D 4 HOH 75  2076 75   HOH HOH A . 
D 4 HOH 76  2077 76   HOH HOH A . 
D 4 HOH 77  2078 77   HOH HOH A . 
D 4 HOH 78  2079 78   HOH HOH A . 
D 4 HOH 79  2080 79   HOH HOH A . 
D 4 HOH 80  2081 80   HOH HOH A . 
D 4 HOH 81  2082 81   HOH HOH A . 
D 4 HOH 82  2083 82   HOH HOH A . 
D 4 HOH 83  2084 83   HOH HOH A . 
D 4 HOH 84  2085 84   HOH HOH A . 
D 4 HOH 85  2086 85   HOH HOH A . 
D 4 HOH 86  2087 86   HOH HOH A . 
D 4 HOH 87  2088 87   HOH HOH A . 
D 4 HOH 88  2089 88   HOH HOH A . 
D 4 HOH 89  2090 89   HOH HOH A . 
D 4 HOH 90  2091 90   HOH HOH A . 
D 4 HOH 91  2092 91   HOH HOH A . 
D 4 HOH 92  2093 92   HOH HOH A . 
D 4 HOH 93  2094 93   HOH HOH A . 
D 4 HOH 94  2095 94   HOH HOH A . 
D 4 HOH 95  2096 95   HOH HOH A . 
D 4 HOH 96  2097 96   HOH HOH A . 
D 4 HOH 97  2098 97   HOH HOH A . 
D 4 HOH 98  2099 98   HOH HOH A . 
D 4 HOH 99  2100 99   HOH HOH A . 
D 4 HOH 100 2101 100  HOH HOH A . 
D 4 HOH 101 2102 101  HOH HOH A . 
D 4 HOH 102 2103 102  HOH HOH A . 
D 4 HOH 103 2104 103  HOH HOH A . 
D 4 HOH 104 2105 104  HOH HOH A . 
D 4 HOH 105 2106 105  HOH HOH A . 
D 4 HOH 106 2107 106  HOH HOH A . 
D 4 HOH 107 2108 107  HOH HOH A . 
D 4 HOH 108 2109 108  HOH HOH A . 
D 4 HOH 109 2110 109  HOH HOH A . 
D 4 HOH 110 2111 110  HOH HOH A . 
D 4 HOH 111 2112 111  HOH HOH A . 
D 4 HOH 112 2113 112  HOH HOH A . 
D 4 HOH 113 2114 113  HOH HOH A . 
D 4 HOH 114 2115 114  HOH HOH A . 
D 4 HOH 115 2116 115  HOH HOH A . 
D 4 HOH 116 2117 116  HOH HOH A . 
D 4 HOH 117 2118 117  HOH HOH A . 
D 4 HOH 118 2119 118  HOH HOH A . 
D 4 HOH 119 2120 119  HOH HOH A . 
D 4 HOH 120 2121 120  HOH HOH A . 
D 4 HOH 121 2122 121  HOH HOH A . 
D 4 HOH 122 2123 122  HOH HOH A . 
D 4 HOH 123 2124 123  HOH HOH A . 
D 4 HOH 124 2125 124  HOH HOH A . 
D 4 HOH 125 2126 125  HOH HOH A . 
D 4 HOH 126 2127 126  HOH HOH A . 
D 4 HOH 127 2128 127  HOH HOH A . 
D 4 HOH 128 2129 128  HOH HOH A . 
D 4 HOH 129 2130 129  HOH HOH A . 
D 4 HOH 130 2131 130  HOH HOH A . 
D 4 HOH 131 2132 131  HOH HOH A . 
D 4 HOH 132 2133 132  HOH HOH A . 
D 4 HOH 133 2134 133  HOH HOH A . 
D 4 HOH 134 2135 134  HOH HOH A . 
D 4 HOH 135 2136 135  HOH HOH A . 
D 4 HOH 136 2137 136  HOH HOH A . 
D 4 HOH 137 2138 137  HOH HOH A . 
D 4 HOH 138 2139 138  HOH HOH A . 
D 4 HOH 139 2140 139  HOH HOH A . 
D 4 HOH 140 2141 140  HOH HOH A . 
D 4 HOH 141 2142 141  HOH HOH A . 
D 4 HOH 142 2143 142  HOH HOH A . 
D 4 HOH 143 2144 143  HOH HOH A . 
D 4 HOH 144 2145 144  HOH HOH A . 
D 4 HOH 145 2146 145  HOH HOH A . 
D 4 HOH 146 2147 146  HOH HOH A . 
D 4 HOH 147 2148 147  HOH HOH A . 
D 4 HOH 148 2149 148  HOH HOH A . 
D 4 HOH 149 2150 149  HOH HOH A . 
D 4 HOH 150 2151 150  HOH HOH A . 
D 4 HOH 151 2152 151  HOH HOH A . 
D 4 HOH 152 2153 152  HOH HOH A . 
D 4 HOH 153 2154 153  HOH HOH A . 
D 4 HOH 154 2155 154  HOH HOH A . 
D 4 HOH 155 2156 155  HOH HOH A . 
D 4 HOH 156 2157 156  HOH HOH A . 
D 4 HOH 157 2158 157  HOH HOH A . 
D 4 HOH 158 2159 158  HOH HOH A . 
D 4 HOH 159 2160 159  HOH HOH A . 
D 4 HOH 160 2161 160  HOH HOH A . 
D 4 HOH 161 2162 161  HOH HOH A . 
D 4 HOH 162 2163 162  HOH HOH A . 
D 4 HOH 163 2164 163  HOH HOH A . 
D 4 HOH 164 2165 164  HOH HOH A . 
D 4 HOH 165 2166 165  HOH HOH A . 
D 4 HOH 166 2167 166  HOH HOH A . 
D 4 HOH 167 2168 167  HOH HOH A . 
D 4 HOH 168 2169 168  HOH HOH A . 
D 4 HOH 169 2170 169  HOH HOH A . 
D 4 HOH 170 2171 170  HOH HOH A . 
D 4 HOH 171 2172 171  HOH HOH A . 
D 4 HOH 172 2173 172  HOH HOH A . 
D 4 HOH 173 2174 173  HOH HOH A . 
D 4 HOH 174 2175 174  HOH HOH A . 
D 4 HOH 175 2176 175  HOH HOH A . 
D 4 HOH 176 2177 176  HOH HOH A . 
D 4 HOH 177 2178 177  HOH HOH A . 
D 4 HOH 178 2179 178  HOH HOH A . 
D 4 HOH 179 2180 179  HOH HOH A . 
D 4 HOH 180 2181 180  HOH HOH A . 
D 4 HOH 181 2182 181  HOH HOH A . 
D 4 HOH 182 2183 182  HOH HOH A . 
D 4 HOH 183 2184 183  HOH HOH A . 
D 4 HOH 184 2185 184  HOH HOH A . 
D 4 HOH 185 2186 185  HOH HOH A . 
D 4 HOH 186 2187 186  HOH HOH A . 
D 4 HOH 187 2188 187  HOH HOH A . 
D 4 HOH 188 2189 188  HOH HOH A . 
D 4 HOH 189 2190 189  HOH HOH A . 
D 4 HOH 190 2191 190  HOH HOH A . 
D 4 HOH 191 2192 191  HOH HOH A . 
D 4 HOH 192 2193 192  HOH HOH A . 
D 4 HOH 193 2194 193  HOH HOH A . 
D 4 HOH 194 2195 194  HOH HOH A . 
D 4 HOH 195 2196 195  HOH HOH A . 
D 4 HOH 196 2197 196  HOH HOH A . 
D 4 HOH 197 2198 197  HOH HOH A . 
D 4 HOH 198 2199 198  HOH HOH A . 
D 4 HOH 199 2200 199  HOH HOH A . 
D 4 HOH 200 2201 200  HOH HOH A . 
D 4 HOH 201 2202 201  HOH HOH A . 
D 4 HOH 202 2203 202  HOH HOH A . 
D 4 HOH 203 2204 203  HOH HOH A . 
D 4 HOH 204 2205 204  HOH HOH A . 
D 4 HOH 205 2206 205  HOH HOH A . 
D 4 HOH 206 2207 206  HOH HOH A . 
D 4 HOH 207 2208 207  HOH HOH A . 
D 4 HOH 208 2209 208  HOH HOH A . 
D 4 HOH 209 2210 209  HOH HOH A . 
D 4 HOH 210 2211 210  HOH HOH A . 
D 4 HOH 211 2212 211  HOH HOH A . 
D 4 HOH 212 2213 212  HOH HOH A . 
D 4 HOH 213 2214 213  HOH HOH A . 
D 4 HOH 214 2215 214  HOH HOH A . 
D 4 HOH 215 2216 215  HOH HOH A . 
D 4 HOH 216 2217 216  HOH HOH A . 
D 4 HOH 217 2218 217  HOH HOH A . 
D 4 HOH 218 2219 218  HOH HOH A . 
D 4 HOH 219 2220 219  HOH HOH A . 
D 4 HOH 220 2221 220  HOH HOH A . 
D 4 HOH 221 2222 221  HOH HOH A . 
D 4 HOH 222 2223 222  HOH HOH A . 
D 4 HOH 223 2224 223  HOH HOH A . 
D 4 HOH 224 2225 224  HOH HOH A . 
D 4 HOH 225 2226 225  HOH HOH A . 
D 4 HOH 226 2227 226  HOH HOH A . 
D 4 HOH 227 2228 227  HOH HOH A . 
D 4 HOH 228 2229 228  HOH HOH A . 
D 4 HOH 229 2230 229  HOH HOH A . 
D 4 HOH 230 2231 230  HOH HOH A . 
D 4 HOH 231 2232 231  HOH HOH A . 
D 4 HOH 232 2233 232  HOH HOH A . 
D 4 HOH 233 2234 233  HOH HOH A . 
D 4 HOH 234 2235 234  HOH HOH A . 
D 4 HOH 235 2236 235  HOH HOH A . 
D 4 HOH 236 2237 236  HOH HOH A . 
D 4 HOH 237 2238 237  HOH HOH A . 
D 4 HOH 238 2239 238  HOH HOH A . 
D 4 HOH 239 2240 239  HOH HOH A . 
D 4 HOH 240 2241 240  HOH HOH A . 
D 4 HOH 241 2242 241  HOH HOH A . 
D 4 HOH 242 2243 242  HOH HOH A . 
D 4 HOH 243 2244 243  HOH HOH A . 
D 4 HOH 244 2245 244  HOH HOH A . 
D 4 HOH 245 2246 245  HOH HOH A . 
D 4 HOH 246 2247 246  HOH HOH A . 
D 4 HOH 247 2248 247  HOH HOH A . 
D 4 HOH 248 2249 248  HOH HOH A . 
D 4 HOH 249 2250 249  HOH HOH A . 
D 4 HOH 250 2251 250  HOH HOH A . 
D 4 HOH 251 2252 251  HOH HOH A . 
D 4 HOH 252 2253 252  HOH HOH A . 
D 4 HOH 253 2254 253  HOH HOH A . 
D 4 HOH 254 2255 254  HOH HOH A . 
D 4 HOH 255 2256 255  HOH HOH A . 
D 4 HOH 256 2257 256  HOH HOH A . 
D 4 HOH 257 2258 257  HOH HOH A . 
D 4 HOH 258 2259 258  HOH HOH A . 
D 4 HOH 259 2260 259  HOH HOH A . 
D 4 HOH 260 2261 260  HOH HOH A . 
D 4 HOH 261 2262 261  HOH HOH A . 
D 4 HOH 262 2263 262  HOH HOH A . 
D 4 HOH 263 2264 263  HOH HOH A . 
D 4 HOH 264 2265 264  HOH HOH A . 
D 4 HOH 265 2266 265  HOH HOH A . 
D 4 HOH 266 2267 266  HOH HOH A . 
D 4 HOH 267 2268 267  HOH HOH A . 
D 4 HOH 268 2269 268  HOH HOH A . 
D 4 HOH 269 2270 269  HOH HOH A . 
D 4 HOH 270 2271 270  HOH HOH A . 
D 4 HOH 271 2272 271  HOH HOH A . 
D 4 HOH 272 2273 272  HOH HOH A . 
D 4 HOH 273 2274 273  HOH HOH A . 
D 4 HOH 274 2275 274  HOH HOH A . 
D 4 HOH 275 2276 275  HOH HOH A . 
D 4 HOH 276 2277 276  HOH HOH A . 
D 4 HOH 277 2278 277  HOH HOH A . 
D 4 HOH 278 2279 278  HOH HOH A . 
D 4 HOH 279 2280 279  HOH HOH A . 
D 4 HOH 280 2281 280  HOH HOH A . 
D 4 HOH 281 2282 281  HOH HOH A . 
D 4 HOH 282 2283 282  HOH HOH A . 
D 4 HOH 283 2284 283  HOH HOH A . 
D 4 HOH 284 2285 284  HOH HOH A . 
D 4 HOH 285 2286 285  HOH HOH A . 
D 4 HOH 286 2287 286  HOH HOH A . 
D 4 HOH 287 2288 287  HOH HOH A . 
D 4 HOH 288 2289 288  HOH HOH A . 
D 4 HOH 289 2290 289  HOH HOH A . 
D 4 HOH 290 2291 290  HOH HOH A . 
D 4 HOH 291 2292 291  HOH HOH A . 
D 4 HOH 292 2293 292  HOH HOH A . 
D 4 HOH 293 2294 293  HOH HOH A . 
D 4 HOH 294 2295 294  HOH HOH A . 
D 4 HOH 295 2296 295  HOH HOH A . 
D 4 HOH 296 2297 296  HOH HOH A . 
D 4 HOH 297 2298 297  HOH HOH A . 
D 4 HOH 298 2299 298  HOH HOH A . 
D 4 HOH 299 2300 299  HOH HOH A . 
D 4 HOH 300 2301 300  HOH HOH A . 
D 4 HOH 301 2302 301  HOH HOH A . 
D 4 HOH 302 2303 302  HOH HOH A . 
D 4 HOH 303 2304 303  HOH HOH A . 
D 4 HOH 304 2305 304  HOH HOH A . 
D 4 HOH 305 2306 305  HOH HOH A . 
D 4 HOH 306 2307 306  HOH HOH A . 
D 4 HOH 307 2308 307  HOH HOH A . 
D 4 HOH 308 2309 308  HOH HOH A . 
D 4 HOH 309 2310 309  HOH HOH A . 
D 4 HOH 310 2311 310  HOH HOH A . 
D 4 HOH 311 2312 311  HOH HOH A . 
D 4 HOH 312 2313 312  HOH HOH A . 
D 4 HOH 313 2314 313  HOH HOH A . 
D 4 HOH 314 2315 314  HOH HOH A . 
D 4 HOH 315 2316 315  HOH HOH A . 
D 4 HOH 316 2317 316  HOH HOH A . 
D 4 HOH 317 2318 317  HOH HOH A . 
D 4 HOH 318 2319 318  HOH HOH A . 
D 4 HOH 319 2320 319  HOH HOH A . 
D 4 HOH 320 2321 320  HOH HOH A . 
D 4 HOH 321 2322 321  HOH HOH A . 
D 4 HOH 322 2323 322  HOH HOH A . 
D 4 HOH 323 2324 323  HOH HOH A . 
D 4 HOH 324 2325 324  HOH HOH A . 
D 4 HOH 325 2326 325  HOH HOH A . 
D 4 HOH 326 2327 326  HOH HOH A . 
D 4 HOH 327 2328 327  HOH HOH A . 
D 4 HOH 328 2329 328  HOH HOH A . 
D 4 HOH 329 2330 329  HOH HOH A . 
D 4 HOH 330 2331 330  HOH HOH A . 
D 4 HOH 331 2332 331  HOH HOH A . 
D 4 HOH 332 2333 332  HOH HOH A . 
D 4 HOH 333 2334 333  HOH HOH A . 
D 4 HOH 334 2335 334  HOH HOH A . 
D 4 HOH 335 2336 335  HOH HOH A . 
D 4 HOH 336 2337 336  HOH HOH A . 
D 4 HOH 337 2338 337  HOH HOH A . 
D 4 HOH 338 2339 338  HOH HOH A . 
D 4 HOH 339 2340 339  HOH HOH A . 
D 4 HOH 340 2341 340  HOH HOH A . 
D 4 HOH 341 2342 341  HOH HOH A . 
D 4 HOH 342 2343 342  HOH HOH A . 
D 4 HOH 343 2344 343  HOH HOH A . 
D 4 HOH 344 2345 344  HOH HOH A . 
D 4 HOH 345 2346 345  HOH HOH A . 
D 4 HOH 346 2347 346  HOH HOH A . 
D 4 HOH 347 2348 347  HOH HOH A . 
D 4 HOH 348 2349 348  HOH HOH A . 
D 4 HOH 349 2350 349  HOH HOH A . 
D 4 HOH 350 2351 350  HOH HOH A . 
D 4 HOH 351 2352 351  HOH HOH A . 
D 4 HOH 352 2353 352  HOH HOH A . 
D 4 HOH 353 2354 353  HOH HOH A . 
D 4 HOH 354 2355 354  HOH HOH A . 
D 4 HOH 355 2356 355  HOH HOH A . 
D 4 HOH 356 2357 356  HOH HOH A . 
D 4 HOH 357 2358 357  HOH HOH A . 
D 4 HOH 358 2359 358  HOH HOH A . 
D 4 HOH 359 2360 359  HOH HOH A . 
D 4 HOH 360 2361 360  HOH HOH A . 
#