data_1IZL
# 
_entry.id   1IZL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1IZL         
RCSB  RCSB005443   
WWPDB D_1000005443 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1FE1 '1FE1 contains the same protein complex from another organism.' unspecified 
PDB 1ILX '1ILX contains the same chromophores from another organism.'    unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1IZL 
_pdbx_database_status.recvd_initial_deposition_date   2002-10-04 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kamiya, N.'  1 
'Shen, J.-R.' 2 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of oxygen-evolving photosystem II from Thermosynechococcus vulcanus at 3.7-A resolution' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            100 
_citation.page_first                98 
_citation.page_last                 103 
_citation.year                      2003 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12518057 
_citation.pdbx_database_id_DOI      10.1073/pnas.0135651100 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kamiya, N.'  1 ? 
primary 'Shen, J.-R.' 2 ? 
# 
_cell.entry_id           1IZL 
_cell.length_a           129.377 
_cell.length_b           225.192 
_cell.length_c           308.672 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1IZL 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'Photosystem II: Subunit PsbA'                                                                  39792.367 2  ? 
? ? ? 
2  polymer     nat 'Photosystem II: Subunit PsbB'                                                                  49478.602 2  ? 
? ? ? 
3  polymer     nat 'Photosystem II: Subunit PsbC'                                                                  49868.855 2  ? 
? ? ? 
4  polymer     nat 'Photosystem II: Subunit PsbD'                                                                  39388.156 2  ? 
? ? ? 
5  polymer     nat 'Photosystem II: Subunit PsbE'                                                                  9449.645  2  ? 
? ? ? 
6  polymer     nat 'Photosystem II: Subunit PsbF'                                                                  4936.704  2  ? 
? ? ? 
7  polymer     nat 'Photosystem II: Subunit PsbG'                                                                  18741.035 2  ? 
? ? ? 
8  polymer     nat 'Photosystem II: Subunit PsbH'                                                                  2826.475  2  ? 
? ? ? 
9  polymer     nat 'Photosystem II: Subunit PsbI'                                                                  2230.741  2  ? 
? ? ? 
10 polymer     nat 'Photosystem II: Subunit PsbK'                                                                  4101.911  2  ? 
? ? ? 
11 polymer     nat 'Photosystem II: Subunit PsbO'                                                                  17464.475 2  ? 
? ? ? 
12 polymer     nat 'Photosystem II: Subunit PsbU'                                                                  8273.189  2  ? 
? ? ? 
13 polymer     nat 'Photosystem II: Subunit PsbV'                                                                  15148.255 2  ? 
? ? ? 
14 polymer     nat 'Photosystem II: Subunit PsbX'                                                                  2145.636  2  ? 
? ? ? 
15 non-polymer syn 'MANGANESE (II) ION'                                                                            54.938    8  ? 
? ? ? 
16 non-polymer syn 'CHLOROPHYLL A'                                                                                 893.489   72 ? 
? ? ? 
17 non-polymer syn 'PHEOPHYTIN A'                                                                                  871.200   4  ? 
? ? ? 
18 non-polymer syn 'FE (III) ION'                                                                                  55.845    2  ? 
? ? ? 
19 non-polymer syn '2-[(3-HYDROXY-2-METHYL-5-PHOSPHONOOXYMETHYL-PYRIDIN-4-YLMETHYL)-AMINO]-2-METHYL-SUCCINIC ACID' 378.272   2  ? 
? ? ? 
20 non-polymer syn BETA-CAROTENE                                                                                   536.873   2  ? 
? ? ? 
21 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'                                                               616.487   4  ? 
? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'Photosystem Q(B) protein'                     
2  'photosystem II core light harvesting protein' 
3  'photosystem II CP43 protein'                  
4  'photosystem II reaction center D2 protein'    
5  'cytochrome b559 alpha subunit'                
6  'cytochrome b559 beta subunit'                 
10 'Photosystem II reaction center protein K'     
13 'Cytochrome c-550'                             
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITG
AVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLI
YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWRVVGVWFAALGISTMAFNLNGFNFNHSVIDAKGNVINTWADI
INRANLGMEVMHERNAHNFPLDLASAESAPVAMIAPSING
;
;MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITG
AVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLI
YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWRVVGVWFAALGISTMAFNLNGFNFNHSVIDAKGNVINTWADI
INRANLGMEVMHERNAHNFPLDLASAESAPVAMIAPSING
;
A,J ? 
2  'polypeptide(L)' no no 
;MGLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSI
TGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTG
LFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSS
SIAAVFFAAFVVAGTMWY(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)GGELNGQTFT
DPPTVKSYARKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVE
WGFYQKVGDVTTRRKEAV
;
;MGLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSI
TGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTG
LFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSS
SIAAVFFAAFVVAGTMWYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLN
SDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTRRKEAV
;
B,L ? 
3  'polypeptide(L)' no no 
;MKTLSSQKRYSPVVTLSSNSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKP
MYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTI
LGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWI
GLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYP(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)DLNKIKNDIQPWQERRAAEYMTHAPLGSLNSVGGV
ATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
;
;MKTLSSQKRYSPVVTLSSNSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKP
MYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTI
LGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWI
GLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLNKIKNDIQPWQERRAAEYMTHAP
LGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
;
C,M ? 
4  'polypeptide(L)' no no 
;MTIAIGRAPAERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVST
PANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIY
PLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQA
EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLL
LNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
;
;MTIAIGRAPAERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVST
PANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIY
PLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQA
EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLL
LNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
;
D,N ? 
5  'polypeptide(L)' no no 
;AGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLE
QLK
;
;AGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLE
QLK
;
E,P ? 
6  'polypeptide(L)' no no TSNTPNQEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR TSNTPNQEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR F,Q ? 
7  'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
;
;XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
;
G,R ? 
8  'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)
;
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX H,S ? 
9  'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
;
XXXXXXXXXXXXXXXXXXXXXXXXXX I,T ? 
10 'polypeptide(L)' no no KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR K,W ? 
11 'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
;
;XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
;
O,Y ? 
12 'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)
;
;XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXX
;
U,Z ? 
13 'polypeptide(L)' no no 
;AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPT
TYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
;
;AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPT
TYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
;
V,0 ? 
14 'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
;
XXXXXXXXXXXXXXXXXXXXXXXXX X,1 ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   MET n 
1  2   THR n 
1  3   THR n 
1  4   THR n 
1  5   LEU n 
1  6   GLN n 
1  7   ARG n 
1  8   ARG n 
1  9   GLU n 
1  10  SER n 
1  11  ALA n 
1  12  ASN n 
1  13  LEU n 
1  14  TRP n 
1  15  GLU n 
1  16  ARG n 
1  17  PHE n 
1  18  CYS n 
1  19  ASN n 
1  20  TRP n 
1  21  VAL n 
1  22  THR n 
1  23  SER n 
1  24  THR n 
1  25  ASP n 
1  26  ASN n 
1  27  ARG n 
1  28  LEU n 
1  29  TYR n 
1  30  VAL n 
1  31  GLY n 
1  32  TRP n 
1  33  PHE n 
1  34  GLY n 
1  35  VAL n 
1  36  ILE n 
1  37  MET n 
1  38  ILE n 
1  39  PRO n 
1  40  THR n 
1  41  LEU n 
1  42  LEU n 
1  43  ALA n 
1  44  ALA n 
1  45  THR n 
1  46  ILE n 
1  47  CYS n 
1  48  PHE n 
1  49  VAL n 
1  50  ILE n 
1  51  ALA n 
1  52  PHE n 
1  53  ILE n 
1  54  ALA n 
1  55  ALA n 
1  56  PRO n 
1  57  PRO n 
1  58  VAL n 
1  59  ASP n 
1  60  ILE n 
1  61  ASP n 
1  62  GLY n 
1  63  ILE n 
1  64  ARG n 
1  65  GLU n 
1  66  PRO n 
1  67  VAL n 
1  68  SER n 
1  69  GLY n 
1  70  SER n 
1  71  LEU n 
1  72  LEU n 
1  73  TYR n 
1  74  GLY n 
1  75  ASN n 
1  76  ASN n 
1  77  ILE n 
1  78  ILE n 
1  79  THR n 
1  80  GLY n 
1  81  ALA n 
1  82  VAL n 
1  83  VAL n 
1  84  PRO n 
1  85  SER n 
1  86  SER n 
1  87  ASN n 
1  88  ALA n 
1  89  ILE n 
1  90  GLY n 
1  91  LEU n 
1  92  HIS n 
1  93  PHE n 
1  94  TYR n 
1  95  PRO n 
1  96  ILE n 
1  97  TRP n 
1  98  GLU n 
1  99  ALA n 
1  100 ALA n 
1  101 SER n 
1  102 LEU n 
1  103 ASP n 
1  104 GLU n 
1  105 TRP n 
1  106 LEU n 
1  107 TYR n 
1  108 ASN n 
1  109 GLY n 
1  110 GLY n 
1  111 PRO n 
1  112 TYR n 
1  113 GLN n 
1  114 LEU n 
1  115 ILE n 
1  116 ILE n 
1  117 PHE n 
1  118 HIS n 
1  119 PHE n 
1  120 LEU n 
1  121 LEU n 
1  122 GLY n 
1  123 ALA n 
1  124 SER n 
1  125 CYS n 
1  126 TYR n 
1  127 MET n 
1  128 GLY n 
1  129 ARG n 
1  130 GLN n 
1  131 TRP n 
1  132 GLU n 
1  133 LEU n 
1  134 SER n 
1  135 TYR n 
1  136 ARG n 
1  137 LEU n 
1  138 GLY n 
1  139 MET n 
1  140 ARG n 
1  141 PRO n 
1  142 TRP n 
1  143 ILE n 
1  144 CYS n 
1  145 VAL n 
1  146 ALA n 
1  147 TYR n 
1  148 SER n 
1  149 ALA n 
1  150 PRO n 
1  151 LEU n 
1  152 ALA n 
1  153 SER n 
1  154 ALA n 
1  155 PHE n 
1  156 ALA n 
1  157 VAL n 
1  158 PHE n 
1  159 LEU n 
1  160 ILE n 
1  161 TYR n 
1  162 PRO n 
1  163 ILE n 
1  164 GLY n 
1  165 GLN n 
1  166 GLY n 
1  167 SER n 
1  168 PHE n 
1  169 SER n 
1  170 ASP n 
1  171 GLY n 
1  172 MET n 
1  173 PRO n 
1  174 LEU n 
1  175 GLY n 
1  176 ILE n 
1  177 SER n 
1  178 GLY n 
1  179 THR n 
1  180 PHE n 
1  181 ASN n 
1  182 PHE n 
1  183 MET n 
1  184 ILE n 
1  185 VAL n 
1  186 PHE n 
1  187 GLN n 
1  188 ALA n 
1  189 GLU n 
1  190 HIS n 
1  191 ASN n 
1  192 ILE n 
1  193 LEU n 
1  194 MET n 
1  195 HIS n 
1  196 PRO n 
1  197 PHE n 
1  198 HIS n 
1  199 GLN n 
1  200 LEU n 
1  201 GLY n 
1  202 VAL n 
1  203 ALA n 
1  204 GLY n 
1  205 VAL n 
1  206 PHE n 
1  207 GLY n 
1  208 GLY n 
1  209 ALA n 
1  210 LEU n 
1  211 PHE n 
1  212 CYS n 
1  213 ALA n 
1  214 MET n 
1  215 HIS n 
1  216 GLY n 
1  217 SER n 
1  218 LEU n 
1  219 VAL n 
1  220 THR n 
1  221 SER n 
1  222 SER n 
1  223 LEU n 
1  224 ILE n 
1  225 ARG n 
1  226 GLU n 
1  227 THR n 
1  228 THR n 
1  229 GLU n 
1  230 THR n 
1  231 GLU n 
1  232 SER n 
1  233 ALA n 
1  234 ASN n 
1  235 TYR n 
1  236 GLY n 
1  237 TYR n 
1  238 LYS n 
1  239 PHE n 
1  240 GLY n 
1  241 GLN n 
1  242 GLU n 
1  243 GLU n 
1  244 GLU n 
1  245 THR n 
1  246 TYR n 
1  247 ASN n 
1  248 ILE n 
1  249 VAL n 
1  250 ALA n 
1  251 ALA n 
1  252 HIS n 
1  253 GLY n 
1  254 TYR n 
1  255 PHE n 
1  256 GLY n 
1  257 ARG n 
1  258 LEU n 
1  259 ILE n 
1  260 PHE n 
1  261 GLN n 
1  262 TYR n 
1  263 ALA n 
1  264 SER n 
1  265 PHE n 
1  266 ASN n 
1  267 ASN n 
1  268 SER n 
1  269 ARG n 
1  270 SER n 
1  271 LEU n 
1  272 HIS n 
1  273 PHE n 
1  274 PHE n 
1  275 LEU n 
1  276 ALA n 
1  277 ALA n 
1  278 TRP n 
1  279 ARG n 
1  280 VAL n 
1  281 VAL n 
1  282 GLY n 
1  283 VAL n 
1  284 TRP n 
1  285 PHE n 
1  286 ALA n 
1  287 ALA n 
1  288 LEU n 
1  289 GLY n 
1  290 ILE n 
1  291 SER n 
1  292 THR n 
1  293 MET n 
1  294 ALA n 
1  295 PHE n 
1  296 ASN n 
1  297 LEU n 
1  298 ASN n 
1  299 GLY n 
1  300 PHE n 
1  301 ASN n 
1  302 PHE n 
1  303 ASN n 
1  304 HIS n 
1  305 SER n 
1  306 VAL n 
1  307 ILE n 
1  308 ASP n 
1  309 ALA n 
1  310 LYS n 
1  311 GLY n 
1  312 ASN n 
1  313 VAL n 
1  314 ILE n 
1  315 ASN n 
1  316 THR n 
1  317 TRP n 
1  318 ALA n 
1  319 ASP n 
1  320 ILE n 
1  321 ILE n 
1  322 ASN n 
1  323 ARG n 
1  324 ALA n 
1  325 ASN n 
1  326 LEU n 
1  327 GLY n 
1  328 MET n 
1  329 GLU n 
1  330 VAL n 
1  331 MET n 
1  332 HIS n 
1  333 GLU n 
1  334 ARG n 
1  335 ASN n 
1  336 ALA n 
1  337 HIS n 
1  338 ASN n 
1  339 PHE n 
1  340 PRO n 
1  341 LEU n 
1  342 ASP n 
1  343 LEU n 
1  344 ALA n 
1  345 SER n 
1  346 ALA n 
1  347 GLU n 
1  348 SER n 
1  349 ALA n 
1  350 PRO n 
1  351 VAL n 
1  352 ALA n 
1  353 MET n 
1  354 ILE n 
1  355 ALA n 
1  356 PRO n 
1  357 SER n 
1  358 ILE n 
1  359 ASN n 
1  360 GLY n 
2  1   MET n 
2  2   GLY n 
2  3   LEU n 
2  4   PRO n 
2  5   TRP n 
2  6   TYR n 
2  7   ARG n 
2  8   VAL n 
2  9   HIS n 
2  10  THR n 
2  11  VAL n 
2  12  LEU n 
2  13  ILE n 
2  14  ASN n 
2  15  ASP n 
2  16  PRO n 
2  17  GLY n 
2  18  ARG n 
2  19  LEU n 
2  20  ILE n 
2  21  ALA n 
2  22  ALA n 
2  23  HIS n 
2  24  LEU n 
2  25  MET n 
2  26  HIS n 
2  27  THR n 
2  28  ALA n 
2  29  LEU n 
2  30  VAL n 
2  31  ALA n 
2  32  GLY n 
2  33  TRP n 
2  34  ALA n 
2  35  GLY n 
2  36  SER n 
2  37  MET n 
2  38  ALA n 
2  39  LEU n 
2  40  TYR n 
2  41  GLU n 
2  42  LEU n 
2  43  ALA n 
2  44  THR n 
2  45  PHE n 
2  46  ASP n 
2  47  PRO n 
2  48  SER n 
2  49  ASP n 
2  50  PRO n 
2  51  VAL n 
2  52  LEU n 
2  53  ASN n 
2  54  PRO n 
2  55  MET n 
2  56  TRP n 
2  57  ARG n 
2  58  GLN n 
2  59  GLY n 
2  60  MET n 
2  61  PHE n 
2  62  VAL n 
2  63  LEU n 
2  64  PRO n 
2  65  PHE n 
2  66  MET n 
2  67  ALA n 
2  68  ARG n 
2  69  LEU n 
2  70  GLY n 
2  71  VAL n 
2  72  THR n 
2  73  GLY n 
2  74  SER n 
2  75  TRP n 
2  76  SER n 
2  77  GLY n 
2  78  TRP n 
2  79  SER n 
2  80  ILE n 
2  81  THR n 
2  82  GLY n 
2  83  GLU n 
2  84  THR n 
2  85  GLY n 
2  86  ILE n 
2  87  ASP n 
2  88  PRO n 
2  89  GLY n 
2  90  PHE n 
2  91  TRP n 
2  92  SER n 
2  93  PHE n 
2  94  GLU n 
2  95  GLY n 
2  96  VAL n 
2  97  ALA n 
2  98  LEU n 
2  99  ALA n 
2  100 HIS n 
2  101 ILE n 
2  102 VAL n 
2  103 LEU n 
2  104 SER n 
2  105 GLY n 
2  106 LEU n 
2  107 LEU n 
2  108 PHE n 
2  109 LEU n 
2  110 ALA n 
2  111 ALA n 
2  112 CYS n 
2  113 TRP n 
2  114 HIS n 
2  115 TRP n 
2  116 VAL n 
2  117 TYR n 
2  118 TRP n 
2  119 ASP n 
2  120 LEU n 
2  121 GLU n 
2  122 LEU n 
2  123 PHE n 
2  124 ARG n 
2  125 ASP n 
2  126 PRO n 
2  127 ARG n 
2  128 THR n 
2  129 GLY n 
2  130 GLU n 
2  131 PRO n 
2  132 ALA n 
2  133 LEU n 
2  134 ASP n 
2  135 LEU n 
2  136 PRO n 
2  137 LYS n 
2  138 MET n 
2  139 PHE n 
2  140 GLY n 
2  141 ILE n 
2  142 HIS n 
2  143 LEU n 
2  144 PHE n 
2  145 LEU n 
2  146 ALA n 
2  147 GLY n 
2  148 LEU n 
2  149 LEU n 
2  150 CYS n 
2  151 PHE n 
2  152 GLY n 
2  153 PHE n 
2  154 GLY n 
2  155 ALA n 
2  156 PHE n 
2  157 HIS n 
2  158 LEU n 
2  159 THR n 
2  160 GLY n 
2  161 LEU n 
2  162 PHE n 
2  163 GLY n 
2  164 PRO n 
2  165 GLY n 
2  166 MET n 
2  167 TRP n 
2  168 VAL n 
2  169 SER n 
2  170 ASP n 
2  171 PRO n 
2  172 TYR n 
2  173 GLY n 
2  174 LEU n 
2  175 THR n 
2  176 GLY n 
2  177 SER n 
2  178 VAL n 
2  179 GLN n 
2  180 PRO n 
2  181 VAL n 
2  182 ALA n 
2  183 PRO n 
2  184 GLU n 
2  185 TRP n 
2  186 GLY n 
2  187 PRO n 
2  188 ASP n 
2  189 GLY n 
2  190 PHE n 
2  191 ASN n 
2  192 PRO n 
2  193 TYR n 
2  194 ASN n 
2  195 PRO n 
2  196 GLY n 
2  197 GLY n 
2  198 VAL n 
2  199 VAL n 
2  200 ALA n 
2  201 HIS n 
2  202 HIS n 
2  203 ILE n 
2  204 ALA n 
2  205 ALA n 
2  206 GLY n 
2  207 ILE n 
2  208 VAL n 
2  209 GLY n 
2  210 ILE n 
2  211 ILE n 
2  212 ALA n 
2  213 GLY n 
2  214 LEU n 
2  215 PHE n 
2  216 HIS n 
2  217 ILE n 
2  218 LEU n 
2  219 VAL n 
2  220 ARG n 
2  221 PRO n 
2  222 PRO n 
2  223 GLN n 
2  224 ARG n 
2  225 LEU n 
2  226 TYR n 
2  227 LYS n 
2  228 ALA n 
2  229 LEU n 
2  230 ARG n 
2  231 MET n 
2  232 GLY n 
2  233 ASN n 
2  234 ILE n 
2  235 GLU n 
2  236 THR n 
2  237 VAL n 
2  238 LEU n 
2  239 SER n 
2  240 SER n 
2  241 SER n 
2  242 ILE n 
2  243 ALA n 
2  244 ALA n 
2  245 VAL n 
2  246 PHE n 
2  247 PHE n 
2  248 ALA n 
2  249 ALA n 
2  250 PHE n 
2  251 VAL n 
2  252 VAL n 
2  253 ALA n 
2  254 GLY n 
2  255 THR n 
2  256 MET n 
2  257 TRP n 
2  258 TYR n 
2  259 UNK n 
2  260 UNK n 
2  261 UNK n 
2  262 UNK n 
2  263 UNK n 
2  264 UNK n 
2  265 UNK n 
2  266 UNK n 
2  267 UNK n 
2  268 UNK n 
2  269 UNK n 
2  270 UNK n 
2  271 UNK n 
2  272 UNK n 
2  273 UNK n 
2  274 UNK n 
2  275 UNK n 
2  276 UNK n 
2  277 UNK n 
2  278 UNK n 
2  279 UNK n 
2  280 UNK n 
2  281 UNK n 
2  282 UNK n 
2  283 UNK n 
2  284 UNK n 
2  285 UNK n 
2  286 UNK n 
2  287 UNK n 
2  288 UNK n 
2  289 UNK n 
2  290 UNK n 
2  291 UNK n 
2  292 UNK n 
2  293 UNK n 
2  294 UNK n 
2  295 UNK n 
2  296 UNK n 
2  297 UNK n 
2  298 UNK n 
2  299 UNK n 
2  300 UNK n 
2  301 UNK n 
2  302 UNK n 
2  303 UNK n 
2  304 UNK n 
2  305 UNK n 
2  306 UNK n 
2  307 UNK n 
2  308 UNK n 
2  309 UNK n 
2  310 UNK n 
2  311 UNK n 
2  312 UNK n 
2  313 UNK n 
2  314 UNK n 
2  315 UNK n 
2  316 UNK n 
2  317 UNK n 
2  318 UNK n 
2  319 UNK n 
2  320 UNK n 
2  321 UNK n 
2  322 UNK n 
2  323 UNK n 
2  324 UNK n 
2  325 UNK n 
2  326 UNK n 
2  327 UNK n 
2  328 UNK n 
2  329 UNK n 
2  330 UNK n 
2  331 UNK n 
2  332 UNK n 
2  333 UNK n 
2  334 UNK n 
2  335 UNK n 
2  336 UNK n 
2  337 UNK n 
2  338 UNK n 
2  339 UNK n 
2  340 UNK n 
2  341 UNK n 
2  342 UNK n 
2  343 UNK n 
2  344 UNK n 
2  345 UNK n 
2  346 UNK n 
2  347 UNK n 
2  348 UNK n 
2  349 UNK n 
2  350 UNK n 
2  351 UNK n 
2  352 UNK n 
2  353 UNK n 
2  354 UNK n 
2  355 UNK n 
2  356 UNK n 
2  357 UNK n 
2  358 UNK n 
2  359 UNK n 
2  360 UNK n 
2  361 UNK n 
2  362 UNK n 
2  363 UNK n 
2  364 UNK n 
2  365 GLY n 
2  366 GLY n 
2  367 GLU n 
2  368 LEU n 
2  369 ASN n 
2  370 GLY n 
2  371 GLN n 
2  372 THR n 
2  373 PHE n 
2  374 THR n 
2  375 ASP n 
2  376 PRO n 
2  377 PRO n 
2  378 THR n 
2  379 VAL n 
2  380 LYS n 
2  381 SER n 
2  382 TYR n 
2  383 ALA n 
2  384 ARG n 
2  385 LYS n 
2  386 ALA n 
2  387 ILE n 
2  388 PHE n 
2  389 GLY n 
2  390 GLU n 
2  391 ILE n 
2  392 PHE n 
2  393 GLU n 
2  394 PHE n 
2  395 ASP n 
2  396 THR n 
2  397 GLU n 
2  398 THR n 
2  399 LEU n 
2  400 ASN n 
2  401 SER n 
2  402 ASP n 
2  403 GLY n 
2  404 ILE n 
2  405 PHE n 
2  406 ARG n 
2  407 THR n 
2  408 SER n 
2  409 PRO n 
2  410 ARG n 
2  411 GLY n 
2  412 TRP n 
2  413 PHE n 
2  414 THR n 
2  415 PHE n 
2  416 ALA n 
2  417 HIS n 
2  418 ALA n 
2  419 VAL n 
2  420 PHE n 
2  421 ALA n 
2  422 LEU n 
2  423 LEU n 
2  424 PHE n 
2  425 PHE n 
2  426 PHE n 
2  427 GLY n 
2  428 HIS n 
2  429 ILE n 
2  430 TRP n 
2  431 HIS n 
2  432 GLY n 
2  433 ALA n 
2  434 ARG n 
2  435 THR n 
2  436 LEU n 
2  437 PHE n 
2  438 ARG n 
2  439 ASP n 
2  440 VAL n 
2  441 PHE n 
2  442 SER n 
2  443 GLY n 
2  444 ILE n 
2  445 ASP n 
2  446 PRO n 
2  447 GLU n 
2  448 LEU n 
2  449 SER n 
2  450 PRO n 
2  451 GLU n 
2  452 GLN n 
2  453 VAL n 
2  454 GLU n 
2  455 TRP n 
2  456 GLY n 
2  457 PHE n 
2  458 TYR n 
2  459 GLN n 
2  460 LYS n 
2  461 VAL n 
2  462 GLY n 
2  463 ASP n 
2  464 VAL n 
2  465 THR n 
2  466 THR n 
2  467 ARG n 
2  468 ARG n 
2  469 LYS n 
2  470 GLU n 
2  471 ALA n 
2  472 VAL n 
3  1   MET n 
3  2   LYS n 
3  3   THR n 
3  4   LEU n 
3  5   SER n 
3  6   SER n 
3  7   GLN n 
3  8   LYS n 
3  9   ARG n 
3  10  TYR n 
3  11  SER n 
3  12  PRO n 
3  13  VAL n 
3  14  VAL n 
3  15  THR n 
3  16  LEU n 
3  17  SER n 
3  18  SER n 
3  19  ASN n 
3  20  SER n 
3  21  ILE n 
3  22  PHE n 
3  23  ALA n 
3  24  THR n 
3  25  ASN n 
3  26  ARG n 
3  27  ASP n 
3  28  GLN n 
3  29  GLU n 
3  30  SER n 
3  31  SER n 
3  32  GLY n 
3  33  PHE n 
3  34  ALA n 
3  35  TRP n 
3  36  TRP n 
3  37  ALA n 
3  38  GLY n 
3  39  ASN n 
3  40  ALA n 
3  41  ARG n 
3  42  LEU n 
3  43  ILE n 
3  44  ASN n 
3  45  LEU n 
3  46  SER n 
3  47  GLY n 
3  48  LYS n 
3  49  LEU n 
3  50  LEU n 
3  51  GLY n 
3  52  ALA n 
3  53  HIS n 
3  54  VAL n 
3  55  ALA n 
3  56  HIS n 
3  57  ALA n 
3  58  GLY n 
3  59  LEU n 
3  60  ILE n 
3  61  VAL n 
3  62  PHE n 
3  63  TRP n 
3  64  ALA n 
3  65  GLY n 
3  66  ALA n 
3  67  MET n 
3  68  THR n 
3  69  LEU n 
3  70  PHE n 
3  71  GLU n 
3  72  LEU n 
3  73  ALA n 
3  74  HIS n 
3  75  PHE n 
3  76  ILE n 
3  77  PRO n 
3  78  GLU n 
3  79  LYS n 
3  80  PRO n 
3  81  MET n 
3  82  TYR n 
3  83  GLU n 
3  84  GLN n 
3  85  GLY n 
3  86  LEU n 
3  87  ILE n 
3  88  LEU n 
3  89  ILE n 
3  90  PRO n 
3  91  HIS n 
3  92  ILE n 
3  93  ALA n 
3  94  THR n 
3  95  LEU n 
3  96  GLY n 
3  97  TRP n 
3  98  GLY n 
3  99  VAL n 
3  100 GLY n 
3  101 PRO n 
3  102 GLY n 
3  103 GLY n 
3  104 GLU n 
3  105 VAL n 
3  106 VAL n 
3  107 ASP n 
3  108 THR n 
3  109 PHE n 
3  110 PRO n 
3  111 PHE n 
3  112 PHE n 
3  113 VAL n 
3  114 VAL n 
3  115 GLY n 
3  116 VAL n 
3  117 VAL n 
3  118 HIS n 
3  119 LEU n 
3  120 ILE n 
3  121 SER n 
3  122 SER n 
3  123 ALA n 
3  124 VAL n 
3  125 LEU n 
3  126 GLY n 
3  127 PHE n 
3  128 GLY n 
3  129 GLY n 
3  130 VAL n 
3  131 TYR n 
3  132 HIS n 
3  133 ALA n 
3  134 ILE n 
3  135 ARG n 
3  136 GLY n 
3  137 PRO n 
3  138 GLU n 
3  139 THR n 
3  140 LEU n 
3  141 GLU n 
3  142 GLU n 
3  143 TYR n 
3  144 SER n 
3  145 SER n 
3  146 PHE n 
3  147 PHE n 
3  148 GLY n 
3  149 TYR n 
3  150 ASP n 
3  151 TRP n 
3  152 LYS n 
3  153 ASP n 
3  154 LYS n 
3  155 ASN n 
3  156 LYS n 
3  157 MET n 
3  158 THR n 
3  159 THR n 
3  160 ILE n 
3  161 LEU n 
3  162 GLY n 
3  163 PHE n 
3  164 HIS n 
3  165 LEU n 
3  166 ILE n 
3  167 VAL n 
3  168 LEU n 
3  169 GLY n 
3  170 ILE n 
3  171 GLY n 
3  172 ALA n 
3  173 LEU n 
3  174 LEU n 
3  175 LEU n 
3  176 VAL n 
3  177 ALA n 
3  178 LYS n 
3  179 ALA n 
3  180 MET n 
3  181 PHE n 
3  182 PHE n 
3  183 GLY n 
3  184 GLY n 
3  185 LEU n 
3  186 TYR n 
3  187 ASP n 
3  188 THR n 
3  189 TRP n 
3  190 ALA n 
3  191 PRO n 
3  192 GLY n 
3  193 GLY n 
3  194 GLY n 
3  195 ASP n 
3  196 VAL n 
3  197 ARG n 
3  198 VAL n 
3  199 ILE n 
3  200 THR n 
3  201 ASN n 
3  202 PRO n 
3  203 THR n 
3  204 LEU n 
3  205 ASP n 
3  206 PRO n 
3  207 ARG n 
3  208 VAL n 
3  209 ILE n 
3  210 PHE n 
3  211 GLY n 
3  212 TYR n 
3  213 LEU n 
3  214 LEU n 
3  215 LYS n 
3  216 SER n 
3  217 PRO n 
3  218 PHE n 
3  219 GLY n 
3  220 GLY n 
3  221 GLU n 
3  222 GLY n 
3  223 TRP n 
3  224 ILE n 
3  225 VAL n 
3  226 SER n 
3  227 VAL n 
3  228 ASN n 
3  229 ASN n 
3  230 LEU n 
3  231 GLU n 
3  232 ASP n 
3  233 VAL n 
3  234 VAL n 
3  235 GLY n 
3  236 GLY n 
3  237 HIS n 
3  238 ILE n 
3  239 TRP n 
3  240 ILE n 
3  241 GLY n 
3  242 LEU n 
3  243 ILE n 
3  244 CYS n 
3  245 ILE n 
3  246 ALA n 
3  247 GLY n 
3  248 GLY n 
3  249 ILE n 
3  250 TRP n 
3  251 HIS n 
3  252 ILE n 
3  253 LEU n 
3  254 THR n 
3  255 THR n 
3  256 PRO n 
3  257 PHE n 
3  258 GLY n 
3  259 TRP n 
3  260 ALA n 
3  261 ARG n 
3  262 ARG n 
3  263 ALA n 
3  264 PHE n 
3  265 ILE n 
3  266 TRP n 
3  267 SER n 
3  268 GLY n 
3  269 GLU n 
3  270 ALA n 
3  271 TYR n 
3  272 LEU n 
3  273 SER n 
3  274 TYR n 
3  275 SER n 
3  276 LEU n 
3  277 GLY n 
3  278 ALA n 
3  279 LEU n 
3  280 SER n 
3  281 MET n 
3  282 MET n 
3  283 GLY n 
3  284 PHE n 
3  285 ILE n 
3  286 ALA n 
3  287 THR n 
3  288 CYS n 
3  289 PHE n 
3  290 VAL n 
3  291 TRP n 
3  292 PHE n 
3  293 ASN n 
3  294 ASN n 
3  295 THR n 
3  296 VAL n 
3  297 TYR n 
3  298 PRO n 
3  299 UNK n 
3  300 UNK n 
3  301 UNK n 
3  302 UNK n 
3  303 UNK n 
3  304 UNK n 
3  305 UNK n 
3  306 UNK n 
3  307 UNK n 
3  308 UNK n 
3  309 UNK n 
3  310 UNK n 
3  311 UNK n 
3  312 UNK n 
3  313 UNK n 
3  314 UNK n 
3  315 UNK n 
3  316 UNK n 
3  317 UNK n 
3  318 UNK n 
3  319 UNK n 
3  320 UNK n 
3  321 UNK n 
3  322 UNK n 
3  323 UNK n 
3  324 UNK n 
3  325 UNK n 
3  326 UNK n 
3  327 UNK n 
3  328 UNK n 
3  329 UNK n 
3  330 UNK n 
3  331 UNK n 
3  332 UNK n 
3  333 UNK n 
3  334 UNK n 
3  335 UNK n 
3  336 UNK n 
3  337 UNK n 
3  338 UNK n 
3  339 UNK n 
3  340 UNK n 
3  341 UNK n 
3  342 UNK n 
3  343 UNK n 
3  344 UNK n 
3  345 UNK n 
3  346 UNK n 
3  347 UNK n 
3  348 UNK n 
3  349 UNK n 
3  350 UNK n 
3  351 UNK n 
3  352 UNK n 
3  353 UNK n 
3  354 UNK n 
3  355 UNK n 
3  356 UNK n 
3  357 UNK n 
3  358 UNK n 
3  359 UNK n 
3  360 UNK n 
3  361 UNK n 
3  362 UNK n 
3  363 UNK n 
3  364 UNK n 
3  365 UNK n 
3  366 UNK n 
3  367 UNK n 
3  368 UNK n 
3  369 UNK n 
3  370 UNK n 
3  371 UNK n 
3  372 UNK n 
3  373 UNK n 
3  374 UNK n 
3  375 UNK n 
3  376 ASP n 
3  377 LEU n 
3  378 ASN n 
3  379 LYS n 
3  380 ILE n 
3  381 LYS n 
3  382 ASN n 
3  383 ASP n 
3  384 ILE n 
3  385 GLN n 
3  386 PRO n 
3  387 TRP n 
3  388 GLN n 
3  389 GLU n 
3  390 ARG n 
3  391 ARG n 
3  392 ALA n 
3  393 ALA n 
3  394 GLU n 
3  395 TYR n 
3  396 MET n 
3  397 THR n 
3  398 HIS n 
3  399 ALA n 
3  400 PRO n 
3  401 LEU n 
3  402 GLY n 
3  403 SER n 
3  404 LEU n 
3  405 ASN n 
3  406 SER n 
3  407 VAL n 
3  408 GLY n 
3  409 GLY n 
3  410 VAL n 
3  411 ALA n 
3  412 THR n 
3  413 GLU n 
3  414 ILE n 
3  415 ASN n 
3  416 SER n 
3  417 VAL n 
3  418 ASN n 
3  419 PHE n 
3  420 VAL n 
3  421 SER n 
3  422 PRO n 
3  423 ARG n 
3  424 SER n 
3  425 TRP n 
3  426 LEU n 
3  427 ALA n 
3  428 THR n 
3  429 SER n 
3  430 HIS n 
3  431 PHE n 
3  432 VAL n 
3  433 LEU n 
3  434 ALA n 
3  435 PHE n 
3  436 PHE n 
3  437 PHE n 
3  438 LEU n 
3  439 VAL n 
3  440 GLY n 
3  441 HIS n 
3  442 LEU n 
3  443 TRP n 
3  444 HIS n 
3  445 ALA n 
3  446 GLY n 
3  447 ARG n 
3  448 ALA n 
3  449 ARG n 
3  450 ALA n 
3  451 ALA n 
3  452 ALA n 
3  453 ALA n 
3  454 GLY n 
3  455 PHE n 
3  456 GLU n 
3  457 LYS n 
3  458 GLY n 
3  459 ILE n 
3  460 ASP n 
3  461 ARG n 
3  462 GLU n 
3  463 SER n 
3  464 GLU n 
3  465 PRO n 
3  466 VAL n 
3  467 LEU n 
3  468 SER n 
3  469 MET n 
3  470 PRO n 
3  471 SER n 
3  472 LEU n 
3  473 ASP n 
4  1   MET n 
4  2   THR n 
4  3   ILE n 
4  4   ALA n 
4  5   ILE n 
4  6   GLY n 
4  7   ARG n 
4  8   ALA n 
4  9   PRO n 
4  10  ALA n 
4  11  GLU n 
4  12  ARG n 
4  13  GLY n 
4  14  TRP n 
4  15  PHE n 
4  16  ASP n 
4  17  ILE n 
4  18  LEU n 
4  19  ASP n 
4  20  ASP n 
4  21  TRP n 
4  22  LEU n 
4  23  LYS n 
4  24  ARG n 
4  25  ASP n 
4  26  ARG n 
4  27  PHE n 
4  28  VAL n 
4  29  PHE n 
4  30  VAL n 
4  31  GLY n 
4  32  TRP n 
4  33  SER n 
4  34  GLY n 
4  35  ILE n 
4  36  LEU n 
4  37  LEU n 
4  38  PHE n 
4  39  PRO n 
4  40  CYS n 
4  41  ALA n 
4  42  TYR n 
4  43  LEU n 
4  44  ALA n 
4  45  LEU n 
4  46  GLY n 
4  47  GLY n 
4  48  TRP n 
4  49  LEU n 
4  50  THR n 
4  51  GLY n 
4  52  THR n 
4  53  THR n 
4  54  PHE n 
4  55  VAL n 
4  56  THR n 
4  57  SER n 
4  58  TRP n 
4  59  TYR n 
4  60  THR n 
4  61  HIS n 
4  62  GLY n 
4  63  LEU n 
4  64  ALA n 
4  65  SER n 
4  66  SER n 
4  67  TYR n 
4  68  LEU n 
4  69  GLU n 
4  70  GLY n 
4  71  CYS n 
4  72  ASN n 
4  73  PHE n 
4  74  LEU n 
4  75  THR n 
4  76  VAL n 
4  77  ALA n 
4  78  VAL n 
4  79  SER n 
4  80  THR n 
4  81  PRO n 
4  82  ALA n 
4  83  ASN n 
4  84  SER n 
4  85  MET n 
4  86  GLY n 
4  87  HIS n 
4  88  SER n 
4  89  LEU n 
4  90  LEU n 
4  91  LEU n 
4  92  LEU n 
4  93  TRP n 
4  94  GLY n 
4  95  PRO n 
4  96  GLU n 
4  97  ALA n 
4  98  GLN n 
4  99  GLY n 
4  100 ASP n 
4  101 PHE n 
4  102 THR n 
4  103 ARG n 
4  104 TRP n 
4  105 CYS n 
4  106 GLN n 
4  107 LEU n 
4  108 GLY n 
4  109 GLY n 
4  110 LEU n 
4  111 TRP n 
4  112 THR n 
4  113 PHE n 
4  114 ILE n 
4  115 ALA n 
4  116 LEU n 
4  117 HIS n 
4  118 GLY n 
4  119 ALA n 
4  120 PHE n 
4  121 GLY n 
4  122 LEU n 
4  123 ILE n 
4  124 GLY n 
4  125 PHE n 
4  126 MET n 
4  127 LEU n 
4  128 ARG n 
4  129 GLN n 
4  130 PHE n 
4  131 GLU n 
4  132 ILE n 
4  133 ALA n 
4  134 ARG n 
4  135 LEU n 
4  136 VAL n 
4  137 GLY n 
4  138 VAL n 
4  139 ARG n 
4  140 PRO n 
4  141 TYR n 
4  142 ASN n 
4  143 ALA n 
4  144 ILE n 
4  145 ALA n 
4  146 PHE n 
4  147 SER n 
4  148 ALA n 
4  149 PRO n 
4  150 ILE n 
4  151 ALA n 
4  152 VAL n 
4  153 PHE n 
4  154 VAL n 
4  155 SER n 
4  156 VAL n 
4  157 PHE n 
4  158 LEU n 
4  159 ILE n 
4  160 TYR n 
4  161 PRO n 
4  162 LEU n 
4  163 GLY n 
4  164 GLN n 
4  165 SER n 
4  166 SER n 
4  167 TRP n 
4  168 PHE n 
4  169 PHE n 
4  170 ALA n 
4  171 PRO n 
4  172 SER n 
4  173 PHE n 
4  174 GLY n 
4  175 VAL n 
4  176 ALA n 
4  177 ALA n 
4  178 ILE n 
4  179 PHE n 
4  180 ARG n 
4  181 PHE n 
4  182 LEU n 
4  183 LEU n 
4  184 PHE n 
4  185 PHE n 
4  186 GLN n 
4  187 GLY n 
4  188 PHE n 
4  189 HIS n 
4  190 ASN n 
4  191 TRP n 
4  192 THR n 
4  193 LEU n 
4  194 ASN n 
4  195 PRO n 
4  196 PHE n 
4  197 HIS n 
4  198 MET n 
4  199 MET n 
4  200 GLY n 
4  201 VAL n 
4  202 ALA n 
4  203 GLY n 
4  204 VAL n 
4  205 LEU n 
4  206 GLY n 
4  207 GLY n 
4  208 ALA n 
4  209 LEU n 
4  210 LEU n 
4  211 CYS n 
4  212 ALA n 
4  213 ILE n 
4  214 HIS n 
4  215 GLY n 
4  216 ALA n 
4  217 THR n 
4  218 VAL n 
4  219 GLU n 
4  220 ASN n 
4  221 THR n 
4  222 LEU n 
4  223 PHE n 
4  224 GLN n 
4  225 ASP n 
4  226 GLY n 
4  227 GLU n 
4  228 GLY n 
4  229 ALA n 
4  230 SER n 
4  231 THR n 
4  232 PHE n 
4  233 ARG n 
4  234 ALA n 
4  235 PHE n 
4  236 ASN n 
4  237 PRO n 
4  238 THR n 
4  239 GLN n 
4  240 ALA n 
4  241 GLU n 
4  242 GLU n 
4  243 THR n 
4  244 TYR n 
4  245 SER n 
4  246 MET n 
4  247 VAL n 
4  248 THR n 
4  249 ALA n 
4  250 ASN n 
4  251 ARG n 
4  252 PHE n 
4  253 TRP n 
4  254 SER n 
4  255 GLN n 
4  256 ILE n 
4  257 PHE n 
4  258 GLY n 
4  259 ILE n 
4  260 ALA n 
4  261 PHE n 
4  262 SER n 
4  263 ASN n 
4  264 LYS n 
4  265 ARG n 
4  266 TRP n 
4  267 LEU n 
4  268 HIS n 
4  269 PHE n 
4  270 PHE n 
4  271 MET n 
4  272 LEU n 
4  273 PHE n 
4  274 VAL n 
4  275 PRO n 
4  276 VAL n 
4  277 THR n 
4  278 GLY n 
4  279 LEU n 
4  280 TRP n 
4  281 MET n 
4  282 SER n 
4  283 ALA n 
4  284 ILE n 
4  285 GLY n 
4  286 VAL n 
4  287 VAL n 
4  288 GLY n 
4  289 LEU n 
4  290 ALA n 
4  291 LEU n 
4  292 ASN n 
4  293 LEU n 
4  294 ARG n 
4  295 SER n 
4  296 TYR n 
4  297 ASP n 
4  298 PHE n 
4  299 ILE n 
4  300 SER n 
4  301 GLN n 
4  302 GLU n 
4  303 ILE n 
4  304 ARG n 
4  305 ALA n 
4  306 ALA n 
4  307 GLU n 
4  308 ASP n 
4  309 PRO n 
4  310 GLU n 
4  311 PHE n 
4  312 GLU n 
4  313 THR n 
4  314 PHE n 
4  315 TYR n 
4  316 THR n 
4  317 LYS n 
4  318 ASN n 
4  319 LEU n 
4  320 LEU n 
4  321 LEU n 
4  322 ASN n 
4  323 GLU n 
4  324 GLY n 
4  325 ILE n 
4  326 ARG n 
4  327 ALA n 
4  328 TRP n 
4  329 MET n 
4  330 ALA n 
4  331 PRO n 
4  332 GLN n 
4  333 ASP n 
4  334 GLN n 
4  335 PRO n 
4  336 HIS n 
4  337 GLU n 
4  338 ASN n 
4  339 PHE n 
4  340 VAL n 
4  341 PHE n 
4  342 PRO n 
4  343 GLU n 
4  344 GLU n 
4  345 VAL n 
4  346 LEU n 
4  347 PRO n 
4  348 ARG n 
4  349 GLY n 
4  350 ASN n 
4  351 ALA n 
4  352 LEU n 
5  1   ALA n 
5  2   GLY n 
5  3   THR n 
5  4   THR n 
5  5   GLY n 
5  6   GLU n 
5  7   ARG n 
5  8   PRO n 
5  9   PHE n 
5  10  SER n 
5  11  ASP n 
5  12  ILE n 
5  13  ILE n 
5  14  THR n 
5  15  SER n 
5  16  VAL n 
5  17  ARG n 
5  18  TYR n 
5  19  TRP n 
5  20  VAL n 
5  21  ILE n 
5  22  HIS n 
5  23  SER n 
5  24  ILE n 
5  25  THR n 
5  26  ILE n 
5  27  PRO n 
5  28  ALA n 
5  29  LEU n 
5  30  PHE n 
5  31  ILE n 
5  32  ALA n 
5  33  GLY n 
5  34  TRP n 
5  35  LEU n 
5  36  PHE n 
5  37  VAL n 
5  38  SER n 
5  39  THR n 
5  40  GLY n 
5  41  LEU n 
5  42  ALA n 
5  43  TYR n 
5  44  ASP n 
5  45  VAL n 
5  46  PHE n 
5  47  GLY n 
5  48  THR n 
5  49  PRO n 
5  50  ARG n 
5  51  PRO n 
5  52  ASP n 
5  53  SER n 
5  54  TYR n 
5  55  TYR n 
5  56  ALA n 
5  57  GLN n 
5  58  GLU n 
5  59  GLN n 
5  60  ARG n 
5  61  SER n 
5  62  ILE n 
5  63  PRO n 
5  64  LEU n 
5  65  VAL n 
5  66  THR n 
5  67  ASP n 
5  68  ARG n 
5  69  PHE n 
5  70  GLU n 
5  71  ALA n 
5  72  LYS n 
5  73  GLN n 
5  74  GLN n 
5  75  VAL n 
5  76  GLU n 
5  77  THR n 
5  78  PHE n 
5  79  LEU n 
5  80  GLU n 
5  81  GLN n 
5  82  LEU n 
5  83  LYS n 
6  1   THR n 
6  2   SER n 
6  3   ASN n 
6  4   THR n 
6  5   PRO n 
6  6   ASN n 
6  7   GLN n 
6  8   GLU n 
6  9   PRO n 
6  10  VAL n 
6  11  SER n 
6  12  TYR n 
6  13  PRO n 
6  14  ILE n 
6  15  PHE n 
6  16  THR n 
6  17  VAL n 
6  18  ARG n 
6  19  TRP n 
6  20  VAL n 
6  21  ALA n 
6  22  VAL n 
6  23  HIS n 
6  24  THR n 
6  25  LEU n 
6  26  ALA n 
6  27  VAL n 
6  28  PRO n 
6  29  THR n 
6  30  ILE n 
6  31  PHE n 
6  32  PHE n 
6  33  LEU n 
6  34  GLY n 
6  35  ALA n 
6  36  ILE n 
6  37  ALA n 
6  38  ALA n 
6  39  MET n 
6  40  GLN n 
6  41  PHE n 
6  42  ILE n 
6  43  GLN n 
6  44  ARG n 
7  1   UNK n 
7  2   UNK n 
7  3   UNK n 
7  4   UNK n 
7  5   UNK n 
7  6   UNK n 
7  7   UNK n 
7  8   UNK n 
7  9   UNK n 
7  10  UNK n 
7  11  UNK n 
7  12  UNK n 
7  13  UNK n 
7  14  UNK n 
7  15  UNK n 
7  16  UNK n 
7  17  UNK n 
7  18  UNK n 
7  19  UNK n 
7  20  UNK n 
7  21  UNK n 
7  22  UNK n 
7  23  UNK n 
7  24  UNK n 
7  25  UNK n 
7  26  UNK n 
7  27  UNK n 
7  28  UNK n 
7  29  UNK n 
7  30  UNK n 
7  31  UNK n 
7  32  UNK n 
7  33  UNK n 
7  34  UNK n 
7  35  UNK n 
7  36  UNK n 
7  37  UNK n 
7  38  UNK n 
7  39  UNK n 
7  40  UNK n 
7  41  UNK n 
7  42  UNK n 
7  43  UNK n 
7  44  UNK n 
7  45  UNK n 
7  46  UNK n 
7  47  UNK n 
7  48  UNK n 
7  49  UNK n 
7  50  UNK n 
7  51  UNK n 
7  52  UNK n 
7  53  UNK n 
7  54  UNK n 
7  55  UNK n 
7  56  UNK n 
7  57  UNK n 
7  58  UNK n 
7  59  UNK n 
7  60  UNK n 
7  61  UNK n 
7  62  UNK n 
7  63  UNK n 
7  64  UNK n 
7  65  UNK n 
7  66  UNK n 
7  67  UNK n 
7  68  UNK n 
7  69  UNK n 
7  70  UNK n 
7  71  UNK n 
7  72  UNK n 
7  73  UNK n 
7  74  UNK n 
7  75  UNK n 
7  76  UNK n 
7  77  UNK n 
7  78  UNK n 
7  79  UNK n 
7  80  UNK n 
7  81  UNK n 
7  82  UNK n 
7  83  UNK n 
7  84  UNK n 
7  85  UNK n 
7  86  UNK n 
7  87  UNK n 
7  88  UNK n 
7  89  UNK n 
7  90  UNK n 
7  91  UNK n 
7  92  UNK n 
7  93  UNK n 
7  94  UNK n 
7  95  UNK n 
7  96  UNK n 
7  97  UNK n 
7  98  UNK n 
7  99  UNK n 
7  100 UNK n 
7  101 UNK n 
7  102 UNK n 
7  103 UNK n 
7  104 UNK n 
7  105 UNK n 
7  106 UNK n 
7  107 UNK n 
7  108 UNK n 
7  109 UNK n 
7  110 UNK n 
7  111 UNK n 
7  112 UNK n 
7  113 UNK n 
7  114 UNK n 
7  115 UNK n 
7  116 UNK n 
7  117 UNK n 
7  118 UNK n 
7  119 UNK n 
7  120 UNK n 
7  121 UNK n 
7  122 UNK n 
7  123 UNK n 
7  124 UNK n 
7  125 UNK n 
7  126 UNK n 
7  127 UNK n 
7  128 UNK n 
7  129 UNK n 
7  130 UNK n 
7  131 UNK n 
7  132 UNK n 
7  133 UNK n 
7  134 UNK n 
7  135 UNK n 
7  136 UNK n 
7  137 UNK n 
7  138 UNK n 
7  139 UNK n 
7  140 UNK n 
7  141 UNK n 
7  142 UNK n 
7  143 UNK n 
7  144 UNK n 
7  145 UNK n 
7  146 UNK n 
7  147 UNK n 
7  148 UNK n 
7  149 UNK n 
7  150 UNK n 
7  151 UNK n 
7  152 UNK n 
7  153 UNK n 
7  154 UNK n 
7  155 UNK n 
7  156 UNK n 
7  157 UNK n 
7  158 UNK n 
7  159 UNK n 
7  160 UNK n 
7  161 UNK n 
7  162 UNK n 
7  163 UNK n 
7  164 UNK n 
7  165 UNK n 
7  166 UNK n 
7  167 UNK n 
7  168 UNK n 
7  169 UNK n 
7  170 UNK n 
7  171 UNK n 
7  172 UNK n 
7  173 UNK n 
7  174 UNK n 
7  175 UNK n 
7  176 UNK n 
7  177 UNK n 
7  178 UNK n 
7  179 UNK n 
7  180 UNK n 
7  181 UNK n 
7  182 UNK n 
7  183 UNK n 
7  184 UNK n 
7  185 UNK n 
7  186 UNK n 
7  187 UNK n 
7  188 UNK n 
7  189 UNK n 
7  190 UNK n 
7  191 UNK n 
7  192 UNK n 
7  193 UNK n 
7  194 UNK n 
7  195 UNK n 
7  196 UNK n 
7  197 UNK n 
7  198 UNK n 
7  199 UNK n 
7  200 UNK n 
7  201 UNK n 
7  202 UNK n 
7  203 UNK n 
7  204 UNK n 
7  205 UNK n 
7  206 UNK n 
7  207 UNK n 
7  208 UNK n 
7  209 UNK n 
7  210 UNK n 
7  211 UNK n 
7  212 UNK n 
7  213 UNK n 
7  214 UNK n 
7  215 UNK n 
7  216 UNK n 
7  217 UNK n 
7  218 UNK n 
7  219 UNK n 
7  220 UNK n 
8  1   UNK n 
8  2   UNK n 
8  3   UNK n 
8  4   UNK n 
8  5   UNK n 
8  6   UNK n 
8  7   UNK n 
8  8   UNK n 
8  9   UNK n 
8  10  UNK n 
8  11  UNK n 
8  12  UNK n 
8  13  UNK n 
8  14  UNK n 
8  15  UNK n 
8  16  UNK n 
8  17  UNK n 
8  18  UNK n 
8  19  UNK n 
8  20  UNK n 
8  21  UNK n 
8  22  UNK n 
8  23  UNK n 
8  24  UNK n 
8  25  UNK n 
8  26  UNK n 
8  27  UNK n 
8  28  UNK n 
8  29  UNK n 
8  30  UNK n 
8  31  UNK n 
8  32  UNK n 
8  33  UNK n 
9  1   UNK n 
9  2   UNK n 
9  3   UNK n 
9  4   UNK n 
9  5   UNK n 
9  6   UNK n 
9  7   UNK n 
9  8   UNK n 
9  9   UNK n 
9  10  UNK n 
9  11  UNK n 
9  12  UNK n 
9  13  UNK n 
9  14  UNK n 
9  15  UNK n 
9  16  UNK n 
9  17  UNK n 
9  18  UNK n 
9  19  UNK n 
9  20  UNK n 
9  21  UNK n 
9  22  UNK n 
9  23  UNK n 
9  24  UNK n 
9  25  UNK n 
9  26  UNK n 
10 1   LYS n 
10 2   LEU n 
10 3   PRO n 
10 4   GLU n 
10 5   ALA n 
10 6   TYR n 
10 7   ALA n 
10 8   ILE n 
10 9   PHE n 
10 10  ASP n 
10 11  PRO n 
10 12  LEU n 
10 13  VAL n 
10 14  ASP n 
10 15  VAL n 
10 16  LEU n 
10 17  PRO n 
10 18  VAL n 
10 19  ILE n 
10 20  PRO n 
10 21  VAL n 
10 22  LEU n 
10 23  PHE n 
10 24  LEU n 
10 25  ALA n 
10 26  LEU n 
10 27  ALA n 
10 28  PHE n 
10 29  VAL n 
10 30  TRP n 
10 31  GLN n 
10 32  ALA n 
10 33  ALA n 
10 34  VAL n 
10 35  GLY n 
10 36  PHE n 
10 37  ARG n 
11 1   UNK n 
11 2   UNK n 
11 3   UNK n 
11 4   UNK n 
11 5   UNK n 
11 6   UNK n 
11 7   UNK n 
11 8   UNK n 
11 9   UNK n 
11 10  UNK n 
11 11  UNK n 
11 12  UNK n 
11 13  UNK n 
11 14  UNK n 
11 15  UNK n 
11 16  UNK n 
11 17  UNK n 
11 18  UNK n 
11 19  UNK n 
11 20  UNK n 
11 21  UNK n 
11 22  UNK n 
11 23  UNK n 
11 24  UNK n 
11 25  UNK n 
11 26  UNK n 
11 27  UNK n 
11 28  UNK n 
11 29  UNK n 
11 30  UNK n 
11 31  UNK n 
11 32  UNK n 
11 33  UNK n 
11 34  UNK n 
11 35  UNK n 
11 36  UNK n 
11 37  UNK n 
11 38  UNK n 
11 39  UNK n 
11 40  UNK n 
11 41  UNK n 
11 42  UNK n 
11 43  UNK n 
11 44  UNK n 
11 45  UNK n 
11 46  UNK n 
11 47  UNK n 
11 48  UNK n 
11 49  UNK n 
11 50  UNK n 
11 51  UNK n 
11 52  UNK n 
11 53  UNK n 
11 54  UNK n 
11 55  UNK n 
11 56  UNK n 
11 57  UNK n 
11 58  UNK n 
11 59  UNK n 
11 60  UNK n 
11 61  UNK n 
11 62  UNK n 
11 63  UNK n 
11 64  UNK n 
11 65  UNK n 
11 66  UNK n 
11 67  UNK n 
11 68  UNK n 
11 69  UNK n 
11 70  UNK n 
11 71  UNK n 
11 72  UNK n 
11 73  UNK n 
11 74  UNK n 
11 75  UNK n 
11 76  UNK n 
11 77  UNK n 
11 78  UNK n 
11 79  UNK n 
11 80  UNK n 
11 81  UNK n 
11 82  UNK n 
11 83  UNK n 
11 84  UNK n 
11 85  UNK n 
11 86  UNK n 
11 87  UNK n 
11 88  UNK n 
11 89  UNK n 
11 90  UNK n 
11 91  UNK n 
11 92  UNK n 
11 93  UNK n 
11 94  UNK n 
11 95  UNK n 
11 96  UNK n 
11 97  UNK n 
11 98  UNK n 
11 99  UNK n 
11 100 UNK n 
11 101 UNK n 
11 102 UNK n 
11 103 UNK n 
11 104 UNK n 
11 105 UNK n 
11 106 UNK n 
11 107 UNK n 
11 108 UNK n 
11 109 UNK n 
11 110 UNK n 
11 111 UNK n 
11 112 UNK n 
11 113 UNK n 
11 114 UNK n 
11 115 UNK n 
11 116 UNK n 
11 117 UNK n 
11 118 UNK n 
11 119 UNK n 
11 120 UNK n 
11 121 UNK n 
11 122 UNK n 
11 123 UNK n 
11 124 UNK n 
11 125 UNK n 
11 126 UNK n 
11 127 UNK n 
11 128 UNK n 
11 129 UNK n 
11 130 UNK n 
11 131 UNK n 
11 132 UNK n 
11 133 UNK n 
11 134 UNK n 
11 135 UNK n 
11 136 UNK n 
11 137 UNK n 
11 138 UNK n 
11 139 UNK n 
11 140 UNK n 
11 141 UNK n 
11 142 UNK n 
11 143 UNK n 
11 144 UNK n 
11 145 UNK n 
11 146 UNK n 
11 147 UNK n 
11 148 UNK n 
11 149 UNK n 
11 150 UNK n 
11 151 UNK n 
11 152 UNK n 
11 153 UNK n 
11 154 UNK n 
11 155 UNK n 
11 156 UNK n 
11 157 UNK n 
11 158 UNK n 
11 159 UNK n 
11 160 UNK n 
11 161 UNK n 
11 162 UNK n 
11 163 UNK n 
11 164 UNK n 
11 165 UNK n 
11 166 UNK n 
11 167 UNK n 
11 168 UNK n 
11 169 UNK n 
11 170 UNK n 
11 171 UNK n 
11 172 UNK n 
11 173 UNK n 
11 174 UNK n 
11 175 UNK n 
11 176 UNK n 
11 177 UNK n 
11 178 UNK n 
11 179 UNK n 
11 180 UNK n 
11 181 UNK n 
11 182 UNK n 
11 183 UNK n 
11 184 UNK n 
11 185 UNK n 
11 186 UNK n 
11 187 UNK n 
11 188 UNK n 
11 189 UNK n 
11 190 UNK n 
11 191 UNK n 
11 192 UNK n 
11 193 UNK n 
11 194 UNK n 
11 195 UNK n 
11 196 UNK n 
11 197 UNK n 
11 198 UNK n 
11 199 UNK n 
11 200 UNK n 
11 201 UNK n 
11 202 UNK n 
11 203 UNK n 
11 204 UNK n 
11 205 UNK n 
12 1   UNK n 
12 2   UNK n 
12 3   UNK n 
12 4   UNK n 
12 5   UNK n 
12 6   UNK n 
12 7   UNK n 
12 8   UNK n 
12 9   UNK n 
12 10  UNK n 
12 11  UNK n 
12 12  UNK n 
12 13  UNK n 
12 14  UNK n 
12 15  UNK n 
12 16  UNK n 
12 17  UNK n 
12 18  UNK n 
12 19  UNK n 
12 20  UNK n 
12 21  UNK n 
12 22  UNK n 
12 23  UNK n 
12 24  UNK n 
12 25  UNK n 
12 26  UNK n 
12 27  UNK n 
12 28  UNK n 
12 29  UNK n 
12 30  UNK n 
12 31  UNK n 
12 32  UNK n 
12 33  UNK n 
12 34  UNK n 
12 35  UNK n 
12 36  UNK n 
12 37  UNK n 
12 38  UNK n 
12 39  UNK n 
12 40  UNK n 
12 41  UNK n 
12 42  UNK n 
12 43  UNK n 
12 44  UNK n 
12 45  UNK n 
12 46  UNK n 
12 47  UNK n 
12 48  UNK n 
12 49  UNK n 
12 50  UNK n 
12 51  UNK n 
12 52  UNK n 
12 53  UNK n 
12 54  UNK n 
12 55  UNK n 
12 56  UNK n 
12 57  UNK n 
12 58  UNK n 
12 59  UNK n 
12 60  UNK n 
12 61  UNK n 
12 62  UNK n 
12 63  UNK n 
12 64  UNK n 
12 65  UNK n 
12 66  UNK n 
12 67  UNK n 
12 68  UNK n 
12 69  UNK n 
12 70  UNK n 
12 71  UNK n 
12 72  UNK n 
12 73  UNK n 
12 74  UNK n 
12 75  UNK n 
12 76  UNK n 
12 77  UNK n 
12 78  UNK n 
12 79  UNK n 
12 80  UNK n 
12 81  UNK n 
12 82  UNK n 
12 83  UNK n 
12 84  UNK n 
12 85  UNK n 
12 86  UNK n 
12 87  UNK n 
12 88  UNK n 
12 89  UNK n 
12 90  UNK n 
12 91  UNK n 
12 92  UNK n 
12 93  UNK n 
12 94  UNK n 
12 95  UNK n 
12 96  UNK n 
12 97  UNK n 
13 1   ALA n 
13 2   GLU n 
13 3   LEU n 
13 4   THR n 
13 5   PRO n 
13 6   GLU n 
13 7   VAL n 
13 8   LEU n 
13 9   THR n 
13 10  VAL n 
13 11  PRO n 
13 12  LEU n 
13 13  ASN n 
13 14  SER n 
13 15  GLU n 
13 16  GLY n 
13 17  LYS n 
13 18  THR n 
13 19  ILE n 
13 20  THR n 
13 21  LEU n 
13 22  THR n 
13 23  GLU n 
13 24  LYS n 
13 25  GLN n 
13 26  TYR n 
13 27  LEU n 
13 28  GLU n 
13 29  GLY n 
13 30  LYS n 
13 31  ARG n 
13 32  LEU n 
13 33  PHE n 
13 34  GLN n 
13 35  TYR n 
13 36  ALA n 
13 37  CYS n 
13 38  ALA n 
13 39  SER n 
13 40  CYS n 
13 41  HIS n 
13 42  VAL n 
13 43  GLY n 
13 44  GLY n 
13 45  ILE n 
13 46  THR n 
13 47  LYS n 
13 48  THR n 
13 49  ASN n 
13 50  PRO n 
13 51  SER n 
13 52  LEU n 
13 53  ASP n 
13 54  LEU n 
13 55  ARG n 
13 56  THR n 
13 57  GLU n 
13 58  THR n 
13 59  LEU n 
13 60  ALA n 
13 61  LEU n 
13 62  ALA n 
13 63  THR n 
13 64  PRO n 
13 65  PRO n 
13 66  ARG n 
13 67  ASP n 
13 68  ASN n 
13 69  ILE n 
13 70  GLU n 
13 71  GLY n 
13 72  LEU n 
13 73  VAL n 
13 74  ASP n 
13 75  TYR n 
13 76  MET n 
13 77  LYS n 
13 78  ASN n 
13 79  PRO n 
13 80  THR n 
13 81  THR n 
13 82  TYR n 
13 83  ASP n 
13 84  GLY n 
13 85  GLU n 
13 86  GLN n 
13 87  GLU n 
13 88  ILE n 
13 89  ALA n 
13 90  GLU n 
13 91  VAL n 
13 92  HIS n 
13 93  PRO n 
13 94  SER n 
13 95  LEU n 
13 96  ARG n 
13 97  SER n 
13 98  ALA n 
13 99  ASP n 
13 100 ILE n 
13 101 PHE n 
13 102 PRO n 
13 103 LYS n 
13 104 MET n 
13 105 ARG n 
13 106 ASN n 
13 107 LEU n 
13 108 THR n 
13 109 GLU n 
13 110 LYS n 
13 111 ASP n 
13 112 LEU n 
13 113 VAL n 
13 114 ALA n 
13 115 ILE n 
13 116 ALA n 
13 117 GLY n 
13 118 HIS n 
13 119 ILE n 
13 120 LEU n 
13 121 VAL n 
13 122 GLU n 
13 123 PRO n 
13 124 LYS n 
13 125 ILE n 
13 126 LEU n 
13 127 GLY n 
13 128 ASP n 
13 129 LYS n 
13 130 TRP n 
13 131 GLY n 
13 132 GLY n 
13 133 GLY n 
13 134 LYS n 
13 135 VAL n 
13 136 TYR n 
13 137 TYR n 
14 1   UNK n 
14 2   UNK n 
14 3   UNK n 
14 4   UNK n 
14 5   UNK n 
14 6   UNK n 
14 7   UNK n 
14 8   UNK n 
14 9   UNK n 
14 10  UNK n 
14 11  UNK n 
14 12  UNK n 
14 13  UNK n 
14 14  UNK n 
14 15  UNK n 
14 16  UNK n 
14 17  UNK n 
14 18  UNK n 
14 19  UNK n 
14 20  UNK n 
14 21  UNK n 
14 22  UNK n 
14 23  UNK n 
14 24  UNK n 
14 25  UNK n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? ? 'Thermosynechococcus vulcanus'  32053  Thermosynechococcus ?                               ?    ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
2  1 sample ? ? ? 'Thermosynechococcus elongatus' 197221 Thermosynechococcus 'Thermosynechococcus elongatus' BP-1 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
3  1 sample ? ? ? 'Thermosynechococcus elongatus' 197221 Thermosynechococcus 'Thermosynechococcus elongatus' BP-1 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
4  1 sample ? ? ? 'Thermosynechococcus elongatus' 197221 Thermosynechococcus 'Thermosynechococcus elongatus' BP-1 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
5  1 sample ? ? ? 'Thermosynechococcus elongatus' 197221 Thermosynechococcus 'Thermosynechococcus elongatus' BP-1 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
6  1 sample ? ? ? 'Thermosynechococcus elongatus' 197221 Thermosynechococcus 'Thermosynechococcus elongatus' BP-1 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
7  1 sample ? ? ? 'Thermosynechococcus elongatus' 197221 Thermosynechococcus 'Thermosynechococcus elongatus' BP-1 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
8  1 sample ? ? ? 'Thermosynechococcus elongatus' 197221 Thermosynechococcus 'Thermosynechococcus elongatus' BP-1 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
9  1 sample ? ? ? 'Thermosynechococcus elongatus' 197221 Thermosynechococcus 'Thermosynechococcus elongatus' BP-1 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
10 1 sample ? ? ? 'Thermosynechococcus elongatus' 197221 Thermosynechococcus 'Thermosynechococcus elongatus' BP-1 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
11 1 sample ? ? ? 'Thermosynechococcus elongatus' 197221 Thermosynechococcus 'Thermosynechococcus elongatus' BP-1 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
12 1 sample ? ? ? 'Thermosynechococcus elongatus' 197221 Thermosynechococcus 'Thermosynechococcus elongatus' BP-1 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
13 1 sample ? ? ? 'Thermosynechococcus vulcanus'  32053  Thermosynechococcus ?                               ?    ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
14 1 sample ? ? ? 'Thermosynechococcus elongatus' 197221 Thermosynechococcus 'Thermosynechococcus elongatus' BP-1 ? ? ? ? ? ? ? ? 
? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1  UNP PSB1_SYNVU 1  
;MTTTLQRRESANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGSLLYGNNIITG
AVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQWELSYRLGMRPWICVAYSAPLASAFAVFLI
YPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFG
QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWRVVGVWFAALGISTMAFNLNGFNFNHSVIDAKGNVINTWADI
INRANLGMEVMHERNAHNFPLDLASAESAPVAMIAPSING
;
1  P51765   ? 
2  PDB 1IZL       2  
;MGLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSI
TGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTG
LFGPGMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSS
SIAAVFFAAFVVAGTMWYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLN
SDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDPELSPEQVEWGFYQKVGDVTTRRKEAV
;
1  1IZL     ? 
3  PDB 1IZL       3  
;MKTLSSQKRYSPVVTLSSNSIFATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKP
MYEQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEEYSSFFGYDWKDKNKMTTI
LGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNPTLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWI
GLICIAGGIWHILTTPFGWARRAFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLNKIKNDIQPWQERRAAEYMTHAP
LGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHLWHAGRARAAAAGFEKGIDRESEPVLSMPSLD
;
1  1IZL     ? 
4  GB  NP_681245  4  
;MTIAIGRAPAERGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGCNFLTVAVST
PANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIY
PLGQSSWFFAPSFGVAAIFRFLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQA
EETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEFETFYTKNLL
LNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
;
1  22297998 ? 
5  GB  NP_682331  5  
;AGTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLE
QLK
;
2  22299084 ? 
6  GB  NP_682332  6  TSNTPNQEPVSYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR 2  22299085 ? 
7  PDB 1IZL       7  
;XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
;
1  1IZL     ? 
8  PDB 1IZL       8  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1  1IZL     ? 
9  PDB 1IZL       9  XXXXXXXXXXXXXXXXXXXXXXXXXX 1  1IZL     ? 
10 UNP PSBK_SYNEL 10 KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR 10 Q9F1K9   ? 
11 PDB 1IZL       11 
;XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
;
1  1IZL     ? 
12 PDB 1IZL       12 
;XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXX
;
1  1IZL     ? 
13 UNP C550_SYNEL 13 
;AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPT
TYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
;
27 P56150   ? 
14 PDB 1IZL       14 XXXXXXXXXXXXXXXXXXXXXXXXX 1  1IZL     ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1IZL A 1 ? 360 ? P51765   1  ? 360 ? 1 360 
2  2  1IZL B 1 ? 472 ? 1IZL     1  ? 510 ? 1 510 
3  3  1IZL C 1 ? 473 ? 1IZL     1  ? 473 ? 1 473 
4  4  1IZL D 1 ? 352 ? 22297998 1  ? 352 ? 1 352 
5  5  1IZL E 1 ? 83  ? 22299084 2  ? 84  ? 1 83  
6  6  1IZL F 1 ? 44  ? 22299085 2  ? 45  ? 1 44  
7  7  1IZL G 1 ? 220 ? 1IZL     1  ? 220 ? 1 220 
8  8  1IZL H 1 ? 33  ? 1IZL     1  ? 33  ? 1 33  
9  9  1IZL I 1 ? 26  ? 1IZL     1  ? 26  ? 1 26  
10 10 1IZL K 1 ? 37  ? Q9F1K9   10 ? 46  ? 1 37  
11 11 1IZL O 1 ? 205 ? 1IZL     1  ? 205 ? 1 205 
12 12 1IZL U 1 ? 97  ? 1IZL     1  ? 97  ? 1 97  
13 13 1IZL V 1 ? 137 ? P56150   27 ? 163 ? 1 137 
14 14 1IZL X 1 ? 25  ? 1IZL     1  ? 25  ? 1 25  
15 1  1IZL J 1 ? 360 ? P51765   1  ? 360 ? 1 360 
16 2  1IZL L 1 ? 472 ? 1IZL     1  ? 510 ? 1 510 
17 3  1IZL M 1 ? 473 ? 1IZL     1  ? 473 ? 1 473 
18 4  1IZL N 1 ? 352 ? 22297998 1  ? 352 ? 1 352 
19 5  1IZL P 1 ? 83  ? 22299084 2  ? 84  ? 1 83  
20 6  1IZL Q 1 ? 44  ? 22299085 2  ? 45  ? 1 44  
21 7  1IZL R 1 ? 220 ? 1IZL     1  ? 220 ? 1 220 
22 8  1IZL S 1 ? 33  ? 1IZL     1  ? 33  ? 1 33  
23 9  1IZL T 1 ? 26  ? 1IZL     1  ? 26  ? 1 26  
24 10 1IZL W 1 ? 37  ? Q9F1K9   10 ? 46  ? 1 37  
25 11 1IZL Y 1 ? 205 ? 1IZL     1  ? 205 ? 1 205 
26 12 1IZL Z 1 ? 97  ? 1IZL     1  ? 97  ? 1 97  
27 13 1IZL 0 1 ? 137 ? P56150   27 ? 163 ? 1 137 
28 14 1IZL 1 1 ? 25  ? 1IZL     1  ? 25  ? 1 25  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                         ? 
'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE                                                                                        ? 
'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                      ? 
'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                 ? 
'C4 H7 N O4'         133.103 
BCR non-polymer         . BETA-CAROTENE                                                                                   ? 
'C40 H56'            536.873 
CLA non-polymer         . 'CHLOROPHYLL A'                                                                                 ? 
'C55 H72 Mg N4 O5 2' 893.489 
CYS 'L-peptide linking' y CYSTEINE                                                                                        ? 
'C3 H7 N O2 S'       121.158 
FE  non-polymer         . 'FE (III) ION'                                                                                  ? 'Fe 3' 
55.845  
GLN 'L-peptide linking' y GLUTAMINE                                                                                       ? 
'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                 ? 
'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE                                                                                         ? 
'C2 H5 N O2'         75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE'                                                               HEME 
'C34 H32 Fe N4 O4'   616.487 
HIS 'L-peptide linking' y HISTIDINE                                                                                       ? 
'C6 H10 N3 O2 1'     156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                                      ? 
'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                         ? 
'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE                                                                                          ? 
'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE                                                                                      ? 
'C5 H11 N O2 S'      149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                                                                            ? 'Mn 2' 
54.938  
PHE 'L-peptide linking' y PHENYLALANINE                                                                                   ? 
'C9 H11 N O2'        165.189 
PHO non-polymer         . 'PHEOPHYTIN A'                                                                                  ? 
'C55 H74 N4 O5'      871.200 
PLA non-polymer         . '2-[(3-HYDROXY-2-METHYL-5-PHOSPHONOOXYMETHYL-PYRIDIN-4-YLMETHYL)-AMINO]-2-METHYL-SUCCINIC ACID' 
'N-PYRIDOXYL-2-METHYLASPARTIC ACID-5-MONOPHOSPHATE' 'C13 H19 N2 O9 P'    378.272 
PRO 'L-peptide linking' y PROLINE                                                                                         ? 
'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE                                                                                          ? 
'C3 H7 N O3'         105.093 
THR 'L-peptide linking' y THREONINE                                                                                       ? 
'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                      ? 
'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                        ? 
'C9 H11 N O3'        181.189 
UNK 'L-peptide linking' . UNKNOWN                                                                                         ? 
'C4 H9 N O2'         103.120 
VAL 'L-peptide linking' y VALINE                                                                                          ? 
'C5 H11 N O2'        117.146 
# 
_exptl.entry_id          1IZL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   100 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.26 
_exptl_crystal.density_percent_sol   71.12 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          MICRODIALYSIS 
_exptl_crystal_grow.temp            293.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'PEG 1450, MES, calcium chloride, magnesium sulfate, dodecyl maltoside, pH 6.5, MICRODIALYSIS, temperature 293.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2001-04-21 
_diffrn_detector.details                'KB mirrors' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Rotated Inclined Double Crystal Monochromator' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.entry_id                     1IZL 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25.0 
_reflns.d_resolution_high            3.7 
_reflns.number_obs                   ? 
_reflns.number_all                   94859 
_reflns.percent_possible_obs         98.0 
_reflns.pdbx_Rmerge_I_obs            0.071 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              12.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
# 
_reflns_shell.d_res_high             3.7 
_reflns_shell.d_res_low              3.9 
_reflns_shell.percent_possible_all   95.0 
_reflns_shell.Rmerge_I_obs           0.261 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.8 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      94859 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
# 
_refine.entry_id                                 1IZL 
_refine.ls_number_reflns_obs                     96299 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             25.00 
_refine.ls_d_res_high                            3.70 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.53045 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.53045 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.485 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               49.095 
_refine.aniso_B[1][1]                            6.11 
_refine.aniso_B[2][2]                            0.88 
_refine.aniso_B[3][3]                            -6.99 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
'the missing atom list was suppressed. each unkown atom has C, CA, N, O atom only.' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             1.02 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD WITH PHASES' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             246.899 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            2.608 
_refine.pdbx_overall_ESU_R                       1.006 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        19964 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2840 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               22804 
_refine_hist.d_res_high                       3.70 
_refine_hist.d_res_low                        25.00 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       3.700 
_refine_ls_shell.d_res_low                        3.794 
_refine_ls_shell.number_reflns_R_work             6812 
_refine_ls_shell.R_factor_R_work                  0.57 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1IZL 
_struct.title                     'Crystal Structure of Photosystem II' 
_struct.pdbx_descriptor           
;Photosystem II: Subunit PsbA/Subunit PsbB/Subunit PsbC/Subunit PsbD/Subunit PsbE/Subunit PsbF/Subunit PsbG/Subunit PsbH/Subunit PsbI/Subunit PsbK/Subunit PsbO/Subunit PsbU/Subunit PsbV/Subunit PsbX
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1IZL 
_struct_keywords.pdbx_keywords   PHOTOSYNTHESIS 
_struct_keywords.text            
;Photosynthesis, Photosynthetic reaction center, Core-antenna, Thermophilic cyanobacterium, Membrane protein complex, Electron transfer, Energy transfer
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 1  ? 
P  N N 2  ? 
Q  N N 3  ? 
R  N N 4  ? 
S  N N 5  ? 
T  N N 6  ? 
U  N N 7  ? 
V  N N 8  ? 
W  N N 9  ? 
X  N N 10 ? 
Y  N N 11 ? 
Z  N N 12 ? 
AA N N 13 ? 
BA N N 14 ? 
CA N N 15 ? 
DA N N 15 ? 
EA N N 15 ? 
FA N N 15 ? 
GA N N 16 ? 
HA N N 16 ? 
IA N N 17 ? 
JA N N 16 ? 
KA N N 16 ? 
LA N N 16 ? 
MA N N 16 ? 
NA N N 16 ? 
OA N N 16 ? 
PA N N 16 ? 
QA N N 16 ? 
RA N N 16 ? 
SA N N 16 ? 
TA N N 16 ? 
UA N N 16 ? 
VA N N 16 ? 
WA N N 16 ? 
XA N N 16 ? 
YA N N 16 ? 
ZA N N 16 ? 
AB N N 16 ? 
BB N N 16 ? 
CB N N 16 ? 
DB N N 16 ? 
EB N N 16 ? 
FB N N 16 ? 
GB N N 16 ? 
HB N N 16 ? 
IB N N 16 ? 
JB N N 16 ? 
KB N N 16 ? 
LB N N 16 ? 
MB N N 16 ? 
NB N N 18 ? 
OB N N 16 ? 
PB N N 16 ? 
QB N N 17 ? 
RB N N 16 ? 
SB N N 19 ? 
TB N N 20 ? 
UB N N 21 ? 
VB N N 16 ? 
WB N N 20 ? 
XB N N 21 ? 
YB N N 15 ? 
ZB N N 15 ? 
AC N N 15 ? 
BC N N 15 ? 
CC N N 16 ? 
DC N N 17 ? 
EC N N 16 ? 
FC N N 16 ? 
GC N N 16 ? 
HC N N 16 ? 
IC N N 16 ? 
JC N N 16 ? 
KC N N 16 ? 
LC N N 16 ? 
MC N N 16 ? 
NC N N 16 ? 
OC N N 16 ? 
PC N N 16 ? 
QC N N 16 ? 
RC N N 16 ? 
SC N N 16 ? 
TC N N 16 ? 
UC N N 16 ? 
VC N N 16 ? 
WC N N 16 ? 
XC N N 16 ? 
YC N N 16 ? 
ZC N N 16 ? 
AD N N 16 ? 
BD N N 16 ? 
CD N N 16 ? 
DD N N 16 ? 
ED N N 16 ? 
FD N N 16 ? 
GD N N 16 ? 
HD N N 18 ? 
ID N N 16 ? 
JD N N 16 ? 
KD N N 16 ? 
LD N N 17 ? 
MD N N 16 ? 
ND N N 19 ? 
OD N N 21 ? 
PD N N 16 ? 
QD N N 16 ? 
RD N N 21 ? 
# 
loop_
_struct_biol.id 
_struct_biol.pdbx_parent_biol_id 
_struct_biol.details 
1 ? ? 
2 ? ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ILE A  36  ? LEU A  41  ? ILE A 36  LEU A 41  1 ? 6  
HELX_P HELX_P2   2   LEU A  42  ? CYS A  47  ? LEU A 42  CYS A 47  1 ? 6  
HELX_P HELX_P3   3   CYS A  47  ? PHE A  52  ? CYS A 47  PHE A 52  1 ? 6  
HELX_P HELX_P4   4   PRO A  111 ? ARG A  129 ? PRO A 111 ARG A 129 1 ? 19 
HELX_P HELX_P5   5   TYR A  147 ? ALA A  156 ? TYR A 147 ALA A 156 1 ? 10 
HELX_P HELX_P6   6   ALA A  156 ? TYR A  161 ? ALA A 156 TYR A 161 1 ? 6  
HELX_P HELX_P7   7   PHE A  180 ? MET A  183 ? PHE A 180 MET A 183 5 ? 4  
HELX_P HELX_P8   8   ILE A  184 ? GLU A  189 ? ILE A 184 GLU A 189 1 ? 6  
HELX_P HELX_P9   9   PHE A  197 ? VAL A  202 ? PHE A 197 VAL A 202 1 ? 6  
HELX_P HELX_P10  10  GLY A  207 ? VAL A  219 ? GLY A 207 VAL A 219 1 ? 13 
HELX_P HELX_P11  11  HIS A  272 ? ALA A  277 ? HIS A 272 ALA A 277 1 ? 6  
HELX_P HELX_P12  12  VAL A  283 ? ALA A  294 ? VAL A 283 ALA A 294 1 ? 12 
HELX_P HELX_P13  13  ASP B  15  ? MET B  25  ? ASP B 15  MET B 25  1 ? 11 
HELX_P HELX_P14  14  GLY B  32  ? MET B  37  ? GLY B 32  MET B 37  1 ? 6  
HELX_P HELX_P15  15  VAL B  62  ? LEU B  69  ? VAL B 62  LEU B 69  1 ? 8  
HELX_P HELX_P16  16  GLU B  94  ? ILE B  101 ? GLU B 94  ILE B 101 1 ? 8  
HELX_P HELX_P17  17  LEU B  106 ? TYR B  117 ? LEU B 106 TYR B 117 1 ? 12 
HELX_P HELX_P18  18  LEU B  135 ? MET B  138 ? LEU B 135 MET B 138 5 ? 4  
HELX_P HELX_P19  19  PHE B  139 ? PHE B  151 ? PHE B 139 PHE B 151 1 ? 13 
HELX_P HELX_P20  20  GLY B  152 ? ALA B  155 ? GLY B 152 ALA B 155 5 ? 4  
HELX_P HELX_P21  21  ALA B  204 ? GLY B  213 ? ALA B 204 GLY B 213 1 ? 10 
HELX_P HELX_P22  22  ILE B  234 ? ALA B  243 ? ILE B 234 ALA B 243 1 ? 10 
HELX_P HELX_P23  23  ALA B  248 ? GLY B  254 ? ALA B 248 GLY B 254 1 ? 7  
HELX_P HELX_P24  25  THR B  378 ? GLY B  389 ? THR B 416 GLY B 427 1 ? 12 
HELX_P HELX_P25  26  PRO B  409 ? THR B  414 ? PRO B 447 THR B 452 1 ? 6  
HELX_P HELX_P26  27  THR B  414 ? PHE B  425 ? THR B 452 PHE B 463 1 ? 12 
HELX_P HELX_P27  28  PHE B  426 ? ARG B  434 ? PHE B 464 ARG B 472 1 ? 9  
HELX_P HELX_P28  29  LEU C  50  ? ALA C  73  ? LEU C 50  ALA C 73  1 ? 24 
HELX_P HELX_P29  30  LEU C  88  ? ALA C  93  ? LEU C 88  ALA C 93  1 ? 6  
HELX_P HELX_P30  31  THR C  108 ? ILE C  120 ? THR C 108 ILE C 120 1 ? 13 
HELX_P HELX_P31  32  SER C  122 ? GLY C  128 ? SER C 122 GLY C 128 1 ? 7  
HELX_P HELX_P32  33  LYS C  154 ? LEU C  161 ? LYS C 154 LEU C 161 1 ? 8  
HELX_P HELX_P33  34  HIS C  164 ? LEU C  173 ? HIS C 164 LEU C 173 1 ? 10 
HELX_P HELX_P34  35  LYS C  178 ? PHE C  182 ? LYS C 178 PHE C 182 5 ? 5  
HELX_P HELX_P35  36  GLU C  231 ? ILE C  249 ? GLU C 231 ILE C 249 1 ? 19 
HELX_P HELX_P36  37  GLU C  269 ? SER C  280 ? GLU C 269 SER C 280 1 ? 12 
HELX_P HELX_P37  38  MET C  282 ? VAL C  290 ? MET C 282 VAL C 290 1 ? 9  
HELX_P HELX_P38  42  HIS C  430 ? LEU C  442 ? HIS C 430 LEU C 442 1 ? 13 
HELX_P HELX_P39  43  HIS C  444 ? ALA C  448 ? HIS C 444 ALA C 448 5 ? 5  
HELX_P HELX_P40  44  LEU D  36  ? ALA D  41  ? LEU D 36  ALA D 41  1 ? 6  
HELX_P HELX_P41  45  LEU D  43  ? THR D  52  ? LEU D 43  THR D 52  1 ? 10 
HELX_P HELX_P42  46  ARG D  103 ? GLY D  108 ? ARG D 103 GLY D 108 1 ? 6  
HELX_P HELX_P43  47  LEU D  110 ? ALA D  115 ? LEU D 110 ALA D 115 1 ? 6  
HELX_P HELX_P44  48  GLY D  124 ? GLN D  129 ? GLY D 124 GLN D 129 1 ? 6  
HELX_P HELX_P45  49  PRO D  140 ? PHE D  146 ? PRO D 140 PHE D 146 1 ? 7  
HELX_P HELX_P46  50  ILE D  150 ? SER D  155 ? ILE D 150 SER D 155 1 ? 6  
HELX_P HELX_P47  51  ILE D  178 ? GLY D  187 ? ILE D 178 GLY D 187 1 ? 10 
HELX_P HELX_P48  52  PHE D  196 ? VAL D  204 ? PHE D 196 VAL D 204 1 ? 9  
HELX_P HELX_P49  53  GLY D  206 ? ALA D  216 ? GLY D 206 ALA D 216 1 ? 11 
HELX_P HELX_P50  54  HIS D  268 ? PHE D  273 ? HIS D 268 PHE D 273 1 ? 6  
HELX_P HELX_P51  55  VAL D  274 ? ARG D  294 ? VAL D 274 ARG D 294 1 ? 21 
HELX_P HELX_P52  56  THR E  25  ? PHE E  30  ? THR E 25  PHE E 30  1 ? 6  
HELX_P HELX_P53  57  LEU E  35  ? GLY E  40  ? LEU E 35  GLY E 40  1 ? 6  
HELX_P HELX_P54  58  VAL F  27  ? MET F  39  ? VAL F 27  MET F 39  1 ? 13 
HELX_P HELX_P55  59  UNK H  2   ? UNK H  14  ? UNK H 2   UNK H 14  1 ? 13 
HELX_P HELX_P56  60  UNK H  15  ? UNK H  17  ? UNK H 15  UNK H 17  5 ? 3  
HELX_P HELX_P57  61  UNK I  11  ? UNK I  23  ? UNK I 11  UNK I 23  1 ? 13 
HELX_P HELX_P58  62  UNK L  41  ? UNK L  49  ? UNK U 41  UNK U 49  1 ? 9  
HELX_P HELX_P59  63  THR M  22  ? LYS M  30  ? THR V 22  LYS V 30  1 ? 9  
HELX_P HELX_P60  64  HIS M  41  ? ILE M  45  ? HIS V 41  ILE V 45  5 ? 5  
HELX_P HELX_P61  65  GLY M  71  ? ASN M  78  ? GLY V 71  ASN V 78  1 ? 8  
HELX_P HELX_P62  66  ASP M  111 ? GLU M  122 ? ASP V 111 GLU V 122 1 ? 12 
HELX_P HELX_P63  67  PRO M  123 ? ILE M  125 ? PRO V 123 ILE V 125 5 ? 3  
HELX_P HELX_P64  68  ILE O  36  ? LEU O  41  ? ILE J 36  LEU J 41  1 ? 6  
HELX_P HELX_P65  69  LEU O  42  ? CYS O  47  ? LEU J 42  CYS J 47  1 ? 6  
HELX_P HELX_P66  70  CYS O  47  ? PHE O  52  ? CYS J 47  PHE J 52  1 ? 6  
HELX_P HELX_P67  71  PRO O  111 ? ARG O  129 ? PRO J 111 ARG J 129 1 ? 19 
HELX_P HELX_P68  72  TYR O  147 ? ALA O  156 ? TYR J 147 ALA J 156 1 ? 10 
HELX_P HELX_P69  73  ALA O  156 ? TYR O  161 ? ALA J 156 TYR J 161 1 ? 6  
HELX_P HELX_P70  74  PHE O  180 ? MET O  183 ? PHE J 180 MET J 183 5 ? 4  
HELX_P HELX_P71  75  ILE O  184 ? GLU O  189 ? ILE J 184 GLU J 189 1 ? 6  
HELX_P HELX_P72  76  PHE O  197 ? VAL O  202 ? PHE J 197 VAL J 202 1 ? 6  
HELX_P HELX_P73  77  GLY O  207 ? VAL O  219 ? GLY J 207 VAL J 219 1 ? 13 
HELX_P HELX_P74  78  HIS O  272 ? ALA O  277 ? HIS J 272 ALA J 277 1 ? 6  
HELX_P HELX_P75  79  VAL O  283 ? ALA O  294 ? VAL J 283 ALA J 294 1 ? 12 
HELX_P HELX_P76  80  ASP P  15  ? SER P  36  ? ASP L 15  SER L 36  1 ? 22 
HELX_P HELX_P77  81  VAL P  62  ? ALA P  67  ? VAL L 62  ALA L 67  1 ? 6  
HELX_P HELX_P78  82  GLU P  94  ? SER P  104 ? GLU L 94  SER L 104 1 ? 11 
HELX_P HELX_P79  83  LEU P  106 ? VAL P  116 ? LEU L 106 VAL L 116 1 ? 11 
HELX_P HELX_P80  84  LEU P  135 ? MET P  138 ? LEU L 135 MET L 138 5 ? 4  
HELX_P HELX_P81  85  PHE P  139 ? PHE P  151 ? PHE L 139 PHE L 151 1 ? 13 
HELX_P HELX_P82  86  GLY P  152 ? ALA P  155 ? GLY L 152 ALA L 155 5 ? 4  
HELX_P HELX_P83  87  ALA P  204 ? GLY P  213 ? ALA L 204 GLY L 213 1 ? 10 
HELX_P HELX_P84  88  ILE P  234 ? ALA P  243 ? ILE L 234 ALA L 243 1 ? 10 
HELX_P HELX_P85  89  ALA P  248 ? TRP P  257 ? ALA L 248 TRP L 257 1 ? 10 
HELX_P HELX_P86  90  THR P  378 ? GLY P  389 ? THR L 416 GLY L 427 1 ? 12 
HELX_P HELX_P87  91  PRO P  409 ? THR P  414 ? PRO L 447 THR L 452 1 ? 6  
HELX_P HELX_P88  92  PHE P  415 ? ALA P  421 ? PHE L 453 ALA L 459 1 ? 7  
HELX_P HELX_P89  93  PHE P  426 ? ARG P  434 ? PHE L 464 ARG L 472 1 ? 9  
HELX_P HELX_P90  94  GLY Q  47  ? GLY Q  51  ? GLY M 47  GLY M 51  5 ? 5  
HELX_P HELX_P91  95  ALA Q  57  ? ALA Q  73  ? ALA M 57  ALA M 73  1 ? 17 
HELX_P HELX_P92  96  LEU Q  88  ? ALA Q  93  ? LEU M 88  ALA M 93  1 ? 6  
HELX_P HELX_P93  97  PHE Q  111 ? ILE Q  120 ? PHE M 111 ILE M 120 1 ? 10 
HELX_P HELX_P94  98  SER Q  122 ? VAL Q  130 ? SER M 122 VAL M 130 1 ? 9  
HELX_P HELX_P95  99  TYR Q  131 ? ALA Q  133 ? TYR M 131 ALA M 133 5 ? 3  
HELX_P HELX_P96  100 LYS Q  154 ? LEU Q  161 ? LYS M 154 LEU M 161 1 ? 8  
HELX_P HELX_P97  101 HIS Q  164 ? GLY Q  169 ? HIS M 164 GLY M 169 1 ? 6  
HELX_P HELX_P98  102 GLU Q  231 ? ALA Q  246 ? GLU M 231 ALA M 246 1 ? 16 
HELX_P HELX_P99  103 GLU Q  269 ? SER Q  280 ? GLU M 269 SER M 280 1 ? 12 
HELX_P HELX_P100 104 MET Q  282 ? VAL Q  290 ? MET M 282 VAL M 290 1 ? 9  
HELX_P HELX_P101 108 HIS Q  430 ? LEU Q  442 ? HIS M 430 LEU M 442 1 ? 13 
HELX_P HELX_P102 109 LEU R  36  ? ALA R  41  ? LEU N 36  ALA N 41  1 ? 6  
HELX_P HELX_P103 110 LEU R  43  ? THR R  52  ? LEU N 43  THR N 52  1 ? 10 
HELX_P HELX_P104 111 ARG R  103 ? GLY R  108 ? ARG N 103 GLY N 108 1 ? 6  
HELX_P HELX_P105 112 LEU R  110 ? ALA R  115 ? LEU N 110 ALA N 115 1 ? 6  
HELX_P HELX_P106 113 GLY R  124 ? GLN R  129 ? GLY N 124 GLN N 129 1 ? 6  
HELX_P HELX_P107 114 PRO R  140 ? PHE R  146 ? PRO N 140 PHE N 146 1 ? 7  
HELX_P HELX_P108 115 ILE R  150 ? SER R  155 ? ILE N 150 SER N 155 1 ? 6  
HELX_P HELX_P109 116 ILE R  178 ? GLY R  187 ? ILE N 178 GLY N 187 1 ? 10 
HELX_P HELX_P110 117 PHE R  196 ? GLY R  203 ? PHE N 196 GLY N 203 1 ? 8  
HELX_P HELX_P111 118 GLY R  206 ? ALA R  216 ? GLY N 206 ALA N 216 1 ? 11 
HELX_P HELX_P112 119 HIS R  268 ? PHE R  273 ? HIS N 268 PHE N 273 1 ? 6  
HELX_P HELX_P113 120 VAL R  274 ? LEU R  293 ? VAL N 274 LEU N 293 1 ? 20 
HELX_P HELX_P114 121 THR S  25  ? PHE S  30  ? THR P 25  PHE P 30  1 ? 6  
HELX_P HELX_P115 122 LEU S  35  ? GLY S  40  ? LEU P 35  GLY P 40  1 ? 6  
HELX_P HELX_P116 123 ALA T  26  ? ILE T  30  ? ALA Q 26  ILE Q 30  5 ? 5  
HELX_P HELX_P117 124 GLY T  34  ? MET T  39  ? GLY Q 34  MET Q 39  1 ? 6  
HELX_P HELX_P118 125 UNK V  6   ? UNK V  14  ? UNK S 6   UNK S 14  1 ? 9  
HELX_P HELX_P119 126 UNK V  15  ? UNK V  17  ? UNK S 15  UNK S 17  5 ? 3  
HELX_P HELX_P120 127 UNK W  6   ? UNK W  23  ? UNK T 6   UNK T 23  1 ? 18 
HELX_P HELX_P121 128 UNK Z  41  ? UNK Z  49  ? UNK Z 41  UNK Z 49  1 ? 9  
HELX_P HELX_P122 129 THR AA 22  ? LYS AA 30  ? THR 0 22  LYS 0 30  1 ? 9  
HELX_P HELX_P123 130 GLY AA 71  ? ASN AA 78  ? GLY 0 71  ASN 0 78  1 ? 8  
HELX_P HELX_P124 131 ASP AA 111 ? GLU AA 122 ? ASP 0 111 GLU 0 122 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ?    ? A  ASP 170 OD1 ? ? ? 1_555 EA MN  . MN  ? ? A ASP 170 A MN  363  1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc2 metalc ?    ? A  ALA 344 O   ? ? ? 1_555 CA MN  . MN  ? ? A ALA 344 A MN  361  1_555 ? ? ? ? ? ? ? 2.303 ? 
covale1 covale none ? B  PHE 65  CE2 ? ? ? 1_555 SA CLA . C3C ? ? B PHE 65  B CLA 1114 1_555 ? ? ? ? ? ? ? 1.559 ? 
covale2 covale none ? C  TYR 274 CD2 ? ? ? 1_555 MB CLA . CBD ? ? C TYR 274 C CLA 1089 1_555 ? ? ? ? ? ? ? 1.243 ? 
covale3 covale none ? C  TYR 274 CE2 ? ? ? 1_555 MB CLA . CBD ? ? C TYR 274 C CLA 1089 1_555 ? ? ? ? ? ? ? 1.643 ? 
covale4 covale none ? D  PHE 188 CB  ? ? ? 1_555 OB CLA . CAC ? ? D PHE 188 D CLA 354  1_555 ? ? ? ? ? ? ? 1.345 ? 
metalc3 metalc ?    ? M  HIS 41  NE2 ? ? ? 1_555 XB HEM . FE  ? ? V HIS 41  V HEM 138  1_555 ? ? ? ? ? ? ? 2.784 ? 
metalc4 metalc ?    ? M  HIS 92  NE2 ? ? ? 1_555 XB HEM . FE  ? ? V HIS 92  V HEM 138  1_555 ? ? ? ? ? ? ? 2.566 ? 
metalc5 metalc ?    ? O  ASP 170 OD1 ? ? ? 1_555 AC MN  . MN  ? ? J ASP 170 J MN  363  1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc6 metalc ?    ? O  ALA 344 O   ? ? ? 1_555 YB MN  . MN  ? ? J ALA 344 J MN  361  1_555 ? ? ? ? ? ? ? 2.506 ? 
covale5 covale none ? Q  GLY 129 CA  ? ? ? 1_555 FD CLA . CAB ? ? M GLY 129 M CLA 1087 1_555 ? ? ? ? ? ? ? 1.401 ? 
covale6 covale none ? R  PHE 188 CB  ? ? ? 1_555 ID CLA . CAC ? ? N PHE 188 N CLA 354  1_555 ? ? ? ? ? ? ? 1.466 ? 
metalc7 metalc ?    ? AA HIS 41  NE2 ? ? ? 1_555 RD HEM . FE  ? ? 0 HIS 41  0 HEM 138  1_555 ? ? ? ? ? ? ? 2.780 ? 
metalc8 metalc ?    ? AA HIS 92  NE2 ? ? ? 1_555 RD HEM . FE  ? ? 0 HIS 92  0 HEM 138  1_555 ? ? ? ? ? ? ? 2.564 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 63 M  . ? THR 63 V PRO 64 M  ? PRO 64 V 1 -0.14 
2 THR 63 AA . ? THR 63 0 PRO 64 AA ? PRO 64 0 1 -0.07 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MN A 361'   
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN A 362'   
AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN A 363'   
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN A 364'   
AC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE FE D 353'   
AC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MN J 361'   
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN J 362'   
AC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MN J 363'   
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MN J 364'   
BC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE FE N 353'   
BC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CLA A 365'  
BC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CLA D 354'  
BC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CLA A 366'  
BC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CLA D 355'  
BC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PHO D 356'  
BC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PHO A 367'  
BC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CLA A 368'  
BC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CLA D 357'  
CC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CLA C 1078' 
CC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CLA C 1079' 
CC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE CLA C 1080' 
CC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CLA C 1081' 
CC5 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE CLA C 1082' 
CC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CLA C 1083' 
CC7 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CLA C 1084' 
CC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CLA C 1085' 
CC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CLA C 1086' 
DC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CLA C 1087' 
DC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CLA C 1088' 
DC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CLA A 369'  
DC4 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE CLA C 1089' 
DC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CLA B 1107' 
DC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CLA B 1108' 
DC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CLA B 1109' 
DC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CLA B 1110' 
DC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CLA B 1111' 
EC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CLA B 1112' 
EC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CLA B 1113' 
EC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CLA B 1114' 
EC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CLA B 1116' 
EC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CLA B 1117' 
EC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CLA B 1118' 
EC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CLA B 1119' 
EC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CLA B 1120' 
EC9 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CLA B 1121' 
FC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE HEM E 84'   
FC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE HEM V 138'  
FC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PLA D 358'  
FC4 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE BCR K 47'   
FC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE BCR D 359'  
FC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CLA J 365'  
FC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CLA N 354'  
FC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CLA N 355'  
FC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CLA N 356'  
GC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE PHO N 357'  
GC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PHO J 366'  
GC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CLA J 367'  
GC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CLA N 358'  
GC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CLA M 1078' 
GC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CLA M 1079' 
GC7 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE CLA W 64'   
GC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CLA M 1080' 
GC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE CLA M 1081' 
HC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CLA M 1082' 
HC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CLA M 1084' 
HC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CLA M 1085' 
HC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CLA M 1086' 
HC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CLA M 1087' 
HC6 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CLA J 368'  
HC7 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE CLA M 1088' 
HC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CLA L 1107' 
HC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CLA L 1108' 
IC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CLA L 1109' 
IC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CLA L 1110' 
IC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CLA L 1111' 
IC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CLA L 1112' 
IC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CLA L 1113' 
IC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CLA L 1114' 
IC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CLA L 1115' 
IC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CLA L 1116' 
IC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CLA L 1117' 
JC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CLA L 1118' 
JC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CLA L 1119' 
JC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CLA L 1120' 
JC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CLA L 1121' 
JC5 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE HEM P 92'   
JC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE HEM 0 138'  
JC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PLA N 359'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 3 ALA A  344 ? ALA A 344  . ? 1_555 ? 
2   AC1 3 MN  DA .   ? MN  A 362  . ? 1_555 ? 
3   AC1 3 MN  FA .   ? MN  A 364  . ? 1_555 ? 
4   AC2 4 GLU A  333 ? GLU A 333  . ? 1_555 ? 
5   AC2 4 MN  CA .   ? MN  A 361  . ? 1_555 ? 
6   AC2 4 MN  EA .   ? MN  A 363  . ? 1_555 ? 
7   AC2 4 MN  FA .   ? MN  A 364  . ? 1_555 ? 
8   AC3 2 ASP A  170 ? ASP A 170  . ? 1_555 ? 
9   AC3 2 MN  DA .   ? MN  A 362  . ? 1_555 ? 
10  AC4 4 GLU A  333 ? GLU A 333  . ? 1_555 ? 
11  AC4 4 ALA A  344 ? ALA A 344  . ? 1_555 ? 
12  AC4 4 MN  CA .   ? MN  A 361  . ? 1_555 ? 
13  AC4 4 MN  DA .   ? MN  A 362  . ? 1_555 ? 
14  AC5 1 HIS D  214 ? HIS D 214  . ? 1_555 ? 
15  AC6 3 ALA O  344 ? ALA J 344  . ? 1_555 ? 
16  AC6 3 MN  ZB .   ? MN  J 362  . ? 1_555 ? 
17  AC6 3 MN  BC .   ? MN  J 364  . ? 1_555 ? 
18  AC7 4 GLU O  333 ? GLU J 333  . ? 1_555 ? 
19  AC7 4 MN  YB .   ? MN  J 361  . ? 1_555 ? 
20  AC7 4 MN  AC .   ? MN  J 363  . ? 1_555 ? 
21  AC7 4 MN  BC .   ? MN  J 364  . ? 1_555 ? 
22  AC8 2 ASP O  170 ? ASP J 170  . ? 1_555 ? 
23  AC8 2 MN  ZB .   ? MN  J 362  . ? 1_555 ? 
24  AC9 4 GLU O  189 ? GLU J 189  . ? 1_555 ? 
25  AC9 4 ALA O  344 ? ALA J 344  . ? 1_555 ? 
26  AC9 4 MN  YB .   ? MN  J 361  . ? 1_555 ? 
27  AC9 4 MN  ZB .   ? MN  J 362  . ? 1_555 ? 
28  BC1 1 HIS R  214 ? HIS N 214  . ? 1_555 ? 
29  BC2 4 PHE A  182 ? PHE A 182  . ? 1_555 ? 
30  BC2 4 MET A  183 ? MET A 183  . ? 1_555 ? 
31  BC2 4 PHE A  186 ? PHE A 186  . ? 1_555 ? 
32  BC2 4 CLA OB .   ? CLA D 354  . ? 1_555 ? 
33  BC3 6 CLA GA .   ? CLA A 365  . ? 1_555 ? 
34  BC3 6 CLA HA .   ? CLA A 366  . ? 1_555 ? 
35  BC3 6 PHE D  184 ? PHE D 184  . ? 1_555 ? 
36  BC3 6 PHE D  188 ? PHE D 188  . ? 1_555 ? 
37  BC3 6 GLY D  200 ? GLY D 200  . ? 1_555 ? 
38  BC3 6 VAL D  201 ? VAL D 201  . ? 1_555 ? 
39  BC4 4 PHE A  158 ? PHE A 158  . ? 1_555 ? 
40  BC4 4 VAL D  201 ? VAL D 201  . ? 1_555 ? 
41  BC4 4 CLA OB .   ? CLA D 354  . ? 1_555 ? 
42  BC4 4 PHO QB .   ? PHO D 356  . ? 1_555 ? 
43  BC5 3 VAL A  202 ? VAL A 202  . ? 1_555 ? 
44  BC5 3 PHO IA .   ? PHO A 367  . ? 1_555 ? 
45  BC5 3 PHE D  173 ? PHE D 173  . ? 1_555 ? 
46  BC6 5 TYR A  147 ? TYR A 147  . ? 1_555 ? 
47  BC6 5 CLA HA .   ? CLA A 366  . ? 1_555 ? 
48  BC6 5 ALA D  208 ? ALA D 208  . ? 1_555 ? 
49  BC6 5 LEU D  209 ? LEU D 209  . ? 1_555 ? 
50  BC6 5 ALA D  212 ? ALA D 212  . ? 1_555 ? 
51  BC7 5 LEU A  210 ? LEU A 210  . ? 1_555 ? 
52  BC7 5 ILE D  144 ? ILE D 144  . ? 1_555 ? 
53  BC7 5 ALA D  145 ? ALA D 145  . ? 1_555 ? 
54  BC7 5 ALA D  148 ? ALA D 148  . ? 1_555 ? 
55  BC7 5 CLA PB .   ? CLA D 355  . ? 1_555 ? 
56  BC8 5 PRO A  39  ? PRO A 39   . ? 1_555 ? 
57  BC8 5 HIS A  92  ? HIS A 92   . ? 1_555 ? 
58  BC8 5 TYR A  94  ? TYR A 94   . ? 1_555 ? 
59  BC8 5 PRO A  95  ? PRO A 95   . ? 1_555 ? 
60  BC8 5 LEU A  114 ? LEU A 114  . ? 1_555 ? 
61  BC9 2 PHE D  113 ? PHE D 113  . ? 1_555 ? 
62  BC9 2 UNK H  17  ? UNK H 17   . ? 1_555 ? 
63  CC1 4 GLY C  247 ? GLY C 247  . ? 1_555 ? 
64  CC1 4 GLY C  248 ? GLY C 248  . ? 1_555 ? 
65  CC1 4 TRP C  266 ? TRP C 266  . ? 1_555 ? 
66  CC1 4 CLA MB .   ? CLA C 1089 . ? 1_555 ? 
67  CC2 5 TRP C  425 ? TRP C 425  . ? 1_555 ? 
68  CC2 5 LEU C  426 ? LEU C 426  . ? 1_555 ? 
69  CC2 5 SER C  429 ? SER C 429  . ? 1_555 ? 
70  CC2 5 CLA DB .   ? CLA C 1080 . ? 1_555 ? 
71  CC2 5 ASP J  14  ? ASP K 14   . ? 1_555 ? 
72  CC3 8 HIS C  56  ? HIS C 56   . ? 1_555 ? 
73  CC3 8 ILE C  60  ? ILE C 60   . ? 1_555 ? 
74  CC3 8 CLA CB .   ? CLA C 1079 . ? 1_555 ? 
75  CC3 8 CLA FB .   ? CLA C 1082 . ? 1_555 ? 
76  CC3 8 CLA KB .   ? CLA C 1087 . ? 1_555 ? 
77  CC3 8 PRO J  17  ? PRO K 17   . ? 1_555 ? 
78  CC3 8 PRO J  20  ? PRO K 20   . ? 1_555 ? 
79  CC3 8 VAL J  21  ? VAL K 21   . ? 1_555 ? 
80  CC4 4 SER A  124 ? SER A 124  . ? 1_555 ? 
81  CC4 4 CLA KA .   ? CLA A 369  . ? 1_555 ? 
82  CC4 4 PHE C  264 ? PHE C 264  . ? 1_555 ? 
83  CC4 4 TYR C  274 ? TYR C 274  . ? 1_555 ? 
84  CC5 8 ALA C  52  ? ALA C 52   . ? 1_555 ? 
85  CC5 8 HIS C  56  ? HIS C 56   . ? 1_555 ? 
86  CC5 8 GLY C  268 ? GLY C 268  . ? 1_555 ? 
87  CC5 8 TYR C  271 ? TYR C 271  . ? 1_555 ? 
88  CC5 8 LEU C  272 ? LEU C 272  . ? 1_555 ? 
89  CC5 8 SER C  275 ? SER C 275  . ? 1_555 ? 
90  CC5 8 CLA DB .   ? CLA C 1080 . ? 1_555 ? 
91  CC5 8 CLA MB .   ? CLA C 1089 . ? 1_555 ? 
92  CC6 2 ALA C  172 ? ALA C 172  . ? 1_555 ? 
93  CC6 2 HIS C  237 ? HIS C 237  . ? 1_555 ? 
94  CC7 1 ILE C  87  ? ILE C 87   . ? 1_555 ? 
95  CC8 3 MET C  282 ? MET C 282  . ? 1_555 ? 
96  CC8 3 GLY C  283 ? GLY C 283  . ? 1_555 ? 
97  CC8 3 ALA C  286 ? ALA C 286  . ? 1_555 ? 
98  CC9 7 LEU C  49  ? LEU C 49   . ? 1_555 ? 
99  CC9 7 LEU C  50  ? LEU C 50   . ? 1_555 ? 
100 CC9 7 HIS C  53  ? HIS C 53   . ? 1_555 ? 
101 CC9 7 PHE C  163 ? PHE C 163  . ? 1_555 ? 
102 CC9 7 HIS C  164 ? HIS C 164  . ? 1_555 ? 
103 CC9 7 VAL C  167 ? VAL C 167  . ? 1_555 ? 
104 CC9 7 CLA LB .   ? CLA C 1088 . ? 1_555 ? 
105 DC1 4 PHE C  436 ? PHE C 436  . ? 1_555 ? 
106 DC1 4 PHE C  437 ? PHE C 437  . ? 1_555 ? 
107 DC1 4 GLY C  440 ? GLY C 440  . ? 1_555 ? 
108 DC1 4 CLA DB .   ? CLA C 1080 . ? 1_555 ? 
109 DC2 4 GLY C  128 ? GLY C 128  . ? 1_555 ? 
110 DC2 4 GLY C  129 ? GLY C 129  . ? 1_555 ? 
111 DC2 4 TYR C  131 ? TYR C 131  . ? 1_555 ? 
112 DC2 4 CLA JB .   ? CLA C 1086 . ? 1_555 ? 
113 DC3 1 CLA EB .   ? CLA C 1081 . ? 1_555 ? 
114 DC4 9 GLY C  162 ? GLY C 162  . ? 1_555 ? 
115 DC4 9 TRP C  266 ? TRP C 266  . ? 1_555 ? 
116 DC4 9 TYR C  271 ? TYR C 271  . ? 1_555 ? 
117 DC4 9 TYR C  274 ? TYR C 274  . ? 1_555 ? 
118 DC4 9 SER C  275 ? SER C 275  . ? 1_555 ? 
119 DC4 9 ALA C  278 ? ALA C 278  . ? 1_555 ? 
120 DC4 9 LEU C  279 ? LEU C 279  . ? 1_555 ? 
121 DC4 9 CLA BB .   ? CLA C 1078 . ? 1_555 ? 
122 DC4 9 CLA FB .   ? CLA C 1082 . ? 1_555 ? 
123 DC5 2 ALA B  212 ? ALA B 212  . ? 1_555 ? 
124 DC5 2 CLA YA .   ? CLA B 1120 . ? 1_555 ? 
125 DC6 5 VAL B  30  ? VAL B 30   . ? 1_555 ? 
126 DC6 5 CLA NA .   ? CLA B 1109 . ? 1_555 ? 
127 DC6 5 CLA QA .   ? CLA B 1112 . ? 1_555 ? 
128 DC6 5 CLA UA .   ? CLA B 1116 . ? 1_555 ? 
129 DC6 5 CLA XA .   ? CLA B 1119 . ? 1_555 ? 
130 DC7 6 ALA B  22  ? ALA B 22   . ? 1_555 ? 
131 DC7 6 HIS B  26  ? HIS B 26   . ? 1_555 ? 
132 DC7 6 LEU B  238 ? LEU B 238  . ? 1_555 ? 
133 DC7 6 SER B  241 ? SER B 241  . ? 1_555 ? 
134 DC7 6 CLA MA .   ? CLA B 1108 . ? 1_555 ? 
135 DC7 6 CLA YA .   ? CLA B 1120 . ? 1_555 ? 
136 DC8 3 MET B  60  ? MET B 60   . ? 1_555 ? 
137 DC8 3 TRP B  412 ? TRP B 450  . ? 1_555 ? 
138 DC8 3 UNK B  308 ? UNK B 1050 . ? 1_555 ? 
139 DC9 6 ARG B  68  ? ARG B 68   . ? 1_555 ? 
140 DC9 6 LEU B  69  ? LEU B 69   . ? 1_555 ? 
141 DC9 6 GLY B  152 ? GLY B 152  . ? 1_555 ? 
142 DC9 6 ALA B  155 ? ALA B 155  . ? 1_555 ? 
143 DC9 6 CLA RA .   ? CLA B 1113 . ? 1_555 ? 
144 DC9 6 CLA SA .   ? CLA B 1114 . ? 1_555 ? 
145 EC1 2 ALA B  248 ? ALA B 248  . ? 1_555 ? 
146 EC1 2 CLA MA .   ? CLA B 1108 . ? 1_555 ? 
147 EC2 6 ALA B  146 ? ALA B 146  . ? 1_555 ? 
148 EC2 6 LEU B  149 ? LEU B 149  . ? 1_555 ? 
149 EC2 6 CYS B  150 ? CYS B 150  . ? 1_555 ? 
150 EC2 6 TYR B  193 ? TYR B 193  . ? 1_555 ? 
151 EC2 6 HIS B  201 ? HIS B 201  . ? 1_555 ? 
152 EC2 6 CLA PA .   ? CLA B 1111 . ? 1_555 ? 
153 EC3 5 ALA B  31  ? ALA B 31   . ? 1_555 ? 
154 EC3 5 PHE B  61  ? PHE B 61   . ? 1_555 ? 
155 EC3 5 PRO B  64  ? PRO B 64   . ? 1_555 ? 
156 EC3 5 PHE B  65  ? PHE B 65   . ? 1_555 ? 
157 EC3 5 CLA PA .   ? CLA B 1111 . ? 1_555 ? 
158 EC4 2 HIS B  9   ? HIS B 9    . ? 1_555 ? 
159 EC4 2 CLA MA .   ? CLA B 1108 . ? 1_555 ? 
160 EC5 3 VAL B  198 ? VAL B 198  . ? 1_555 ? 
161 EC5 3 ALA B  200 ? ALA B 200  . ? 1_555 ? 
162 EC5 3 ALA B  204 ? ALA B 204  . ? 1_555 ? 
163 EC6 6 LEU B  19  ? LEU B 19   . ? 1_555 ? 
164 EC6 6 ILE B  20  ? ILE B 20   . ? 1_555 ? 
165 EC6 6 HIS B  23  ? HIS B 23   . ? 1_555 ? 
166 EC6 6 MET B  138 ? MET B 138  . ? 1_555 ? 
167 EC6 6 ILE B  141 ? ILE B 141  . ? 1_555 ? 
168 EC6 6 LEU B  145 ? LEU B 145  . ? 1_555 ? 
169 EC7 7 HIS B  9   ? HIS B 9    . ? 1_555 ? 
170 EC7 7 THR B  10  ? THR B 10   . ? 1_555 ? 
171 EC7 7 PHE B  426 ? PHE B 464  . ? 1_555 ? 
172 EC7 7 GLY B  427 ? GLY B 465  . ? 1_555 ? 
173 EC7 7 HIS B  428 ? HIS B 466  . ? 1_555 ? 
174 EC7 7 TRP B  430 ? TRP B 468  . ? 1_555 ? 
175 EC7 7 CLA MA .   ? CLA B 1108 . ? 1_555 ? 
176 EC8 6 PRO B  136 ? PRO B 136  . ? 1_555 ? 
177 EC8 6 PHE B  139 ? PHE B 139  . ? 1_555 ? 
178 EC8 6 SER B  240 ? SER B 240  . ? 1_555 ? 
179 EC8 6 ALA B  244 ? ALA B 244  . ? 1_555 ? 
180 EC8 6 CLA LA .   ? CLA B 1107 . ? 1_555 ? 
181 EC8 6 CLA NA .   ? CLA B 1109 . ? 1_555 ? 
182 EC9 1 ALA B  110 ? ALA B 110  . ? 1_555 ? 
183 FC1 1 ILE E  26  ? ILE E 26   . ? 1_555 ? 
184 FC2 5 PHE M  33  ? PHE V 33   . ? 1_555 ? 
185 FC2 5 CYS M  37  ? CYS V 37   . ? 1_555 ? 
186 FC2 5 CYS M  40  ? CYS V 40   . ? 1_555 ? 
187 FC2 5 HIS M  41  ? HIS V 41   . ? 1_555 ? 
188 FC2 5 HIS M  92  ? HIS V 92   . ? 1_555 ? 
189 FC3 5 ILE D  213 ? ILE D 213  . ? 1_555 ? 
190 FC3 5 HIS D  214 ? HIS D 214  . ? 1_555 ? 
191 FC3 5 THR D  217 ? THR D 217  . ? 1_555 ? 
192 FC3 5 PHE D  257 ? PHE D 257  . ? 1_555 ? 
193 FC3 5 LYS D  264 ? LYS D 264  . ? 1_555 ? 
194 FC4 1 BCR TB .   ? BCR D 359  . ? 1_555 ? 
195 FC5 2 TRP D  48  ? TRP D 48   . ? 1_555 ? 
196 FC5 2 BCR WB .   ? BCR K 47   . ? 1_555 ? 
197 FC6 5 PHE O  182 ? PHE J 182  . ? 1_555 ? 
198 FC6 5 MET O  183 ? MET J 183  . ? 1_555 ? 
199 FC6 5 PHE O  186 ? PHE J 186  . ? 1_555 ? 
200 FC6 5 PHE O  206 ? PHE J 206  . ? 1_555 ? 
201 FC6 5 CLA ID .   ? CLA N 354  . ? 1_555 ? 
202 FC7 4 CLA CC .   ? CLA J 365  . ? 1_555 ? 
203 FC7 4 PHE R  184 ? PHE N 184  . ? 1_555 ? 
204 FC7 4 PHE R  188 ? PHE N 188  . ? 1_555 ? 
205 FC7 4 GLY R  200 ? GLY N 200  . ? 1_555 ? 
206 FC8 4 PHE O  158 ? PHE J 158  . ? 1_555 ? 
207 FC8 4 MET R  198 ? MET N 198  . ? 1_555 ? 
208 FC8 4 VAL R  201 ? VAL N 201  . ? 1_555 ? 
209 FC8 4 PHO LD .   ? PHO N 357  . ? 1_555 ? 
210 FC9 2 PHO DC .   ? PHO J 366  . ? 1_555 ? 
211 FC9 2 PHE R  173 ? PHE N 173  . ? 1_555 ? 
212 GC1 7 TYR O  147 ? TYR J 147  . ? 1_555 ? 
213 GC1 7 LEU R  205 ? LEU N 205  . ? 1_555 ? 
214 GC1 7 ALA R  208 ? ALA N 208  . ? 1_555 ? 
215 GC1 7 LEU R  209 ? LEU N 209  . ? 1_555 ? 
216 GC1 7 ALA R  212 ? ALA N 212  . ? 1_555 ? 
217 GC1 7 ILE R  213 ? ILE N 213  . ? 1_555 ? 
218 GC1 7 CLA JD .   ? CLA N 355  . ? 1_555 ? 
219 GC2 5 LEU O  210 ? LEU J 210  . ? 1_555 ? 
220 GC2 5 ALA O  213 ? ALA J 213  . ? 1_555 ? 
221 GC2 5 MET O  214 ? MET J 214  . ? 1_555 ? 
222 GC2 5 ALA R  148 ? ALA N 148  . ? 1_555 ? 
223 GC2 5 CLA KD .   ? CLA N 356  . ? 1_555 ? 
224 GC3 5 PRO O  39  ? PRO J 39   . ? 1_555 ? 
225 GC3 5 TYR O  94  ? TYR J 94   . ? 1_555 ? 
226 GC3 5 PRO O  95  ? PRO J 95   . ? 1_555 ? 
227 GC3 5 LEU O  114 ? LEU J 114  . ? 1_555 ? 
228 GC3 5 HIS O  118 ? HIS J 118  . ? 1_555 ? 
229 GC4 2 PRO R  39  ? PRO N 39   . ? 1_555 ? 
230 GC4 2 HIS R  117 ? HIS N 117  . ? 1_555 ? 
231 GC5 4 GLY Q  247 ? GLY M 247  . ? 1_555 ? 
232 GC5 4 GLY Q  248 ? GLY M 248  . ? 1_555 ? 
233 GC5 4 THR Q  255 ? THR M 255  . ? 1_555 ? 
234 GC5 4 CLA GD .   ? CLA M 1088 . ? 1_555 ? 
235 GC6 6 TRP Q  425 ? TRP M 425  . ? 1_555 ? 
236 GC6 6 LEU Q  426 ? LEU M 426  . ? 1_555 ? 
237 GC6 6 SER Q  429 ? SER M 429  . ? 1_555 ? 
238 GC6 6 CLA CD .   ? CLA M 1084 . ? 1_555 ? 
239 GC6 6 ASP X  14  ? ASP W 14   . ? 1_555 ? 
240 GC6 6 CLA QD .   ? CLA W 64   . ? 1_555 ? 
241 GC7 8 ILE Q  60  ? ILE M 60   . ? 1_555 ? 
242 GC7 8 CLA XC .   ? CLA M 1079 . ? 1_555 ? 
243 GC7 8 CLA ZC .   ? CLA M 1081 . ? 1_555 ? 
244 GC7 8 CLA CD .   ? CLA M 1084 . ? 1_555 ? 
245 GC7 8 CLA ED .   ? CLA M 1086 . ? 1_555 ? 
246 GC7 8 PRO X  17  ? PRO W 17   . ? 1_555 ? 
247 GC7 8 PRO X  20  ? PRO W 20   . ? 1_555 ? 
248 GC7 8 VAL X  21  ? VAL W 21   . ? 1_555 ? 
249 GC8 4 SER O  124 ? SER J 124  . ? 1_555 ? 
250 GC8 4 CLA FC .   ? CLA J 368  . ? 1_555 ? 
251 GC8 4 TYR Q  274 ? TYR M 274  . ? 1_555 ? 
252 GC8 4 GLY Q  277 ? GLY M 277  . ? 1_555 ? 
253 GC9 7 ALA Q  52  ? ALA M 52   . ? 1_555 ? 
254 GC9 7 HIS Q  56  ? HIS M 56   . ? 1_555 ? 
255 GC9 7 LEU Q  272 ? LEU M 272  . ? 1_555 ? 
256 GC9 7 SER Q  275 ? SER M 275  . ? 1_555 ? 
257 GC9 7 CLA ED .   ? CLA M 1086 . ? 1_555 ? 
258 GC9 7 CLA GD .   ? CLA M 1088 . ? 1_555 ? 
259 GC9 7 CLA QD .   ? CLA W 64   . ? 1_555 ? 
260 HC1 2 ALA Q  172 ? ALA M 172  . ? 1_555 ? 
261 HC1 2 HIS Q  237 ? HIS M 237  . ? 1_555 ? 
262 HC2 4 LEU Q  279 ? LEU M 279  . ? 1_555 ? 
263 HC2 4 ALA Q  286 ? ALA M 286  . ? 1_555 ? 
264 HC2 4 CLA XC .   ? CLA M 1079 . ? 1_555 ? 
265 HC2 4 CLA QD .   ? CLA W 64   . ? 1_555 ? 
266 HC3 4 HIS Q  53  ? HIS M 53   . ? 1_555 ? 
267 HC3 4 PHE Q  163 ? PHE M 163  . ? 1_555 ? 
268 HC3 4 HIS Q  164 ? HIS M 164  . ? 1_555 ? 
269 HC3 4 VAL Q  167 ? VAL M 167  . ? 1_555 ? 
270 HC4 5 PHE Q  436 ? PHE M 436  . ? 1_555 ? 
271 HC4 5 PHE Q  437 ? PHE M 437  . ? 1_555 ? 
272 HC4 5 GLY Q  440 ? GLY M 440  . ? 1_555 ? 
273 HC4 5 CLA ZC .   ? CLA M 1081 . ? 1_555 ? 
274 HC4 5 CLA QD .   ? CLA W 64   . ? 1_555 ? 
275 HC5 5 LEU Q  125 ? LEU M 125  . ? 1_555 ? 
276 HC5 5 GLY Q  128 ? GLY M 128  . ? 1_555 ? 
277 HC5 5 GLY Q  129 ? GLY M 129  . ? 1_555 ? 
278 HC5 5 VAL Q  130 ? VAL M 130  . ? 1_555 ? 
279 HC5 5 TYR Q  131 ? TYR M 131  . ? 1_555 ? 
280 HC6 1 CLA YC .   ? CLA M 1080 . ? 1_555 ? 
281 HC7 8 HIS Q  164 ? HIS M 164  . ? 1_555 ? 
282 HC7 8 TYR Q  271 ? TYR M 271  . ? 1_555 ? 
283 HC7 8 TYR Q  274 ? TYR M 274  . ? 1_555 ? 
284 HC7 8 SER Q  275 ? SER M 275  . ? 1_555 ? 
285 HC7 8 ALA Q  278 ? ALA M 278  . ? 1_555 ? 
286 HC7 8 LEU Q  279 ? LEU M 279  . ? 1_555 ? 
287 HC7 8 CLA WC .   ? CLA M 1078 . ? 1_555 ? 
288 HC7 8 CLA ZC .   ? CLA M 1081 . ? 1_555 ? 
289 HC8 1 ALA P  212 ? ALA L 212  . ? 1_555 ? 
290 HC9 5 VAL P  30  ? VAL L 30   . ? 1_555 ? 
291 HC9 5 CLA IC .   ? CLA L 1109 . ? 1_555 ? 
292 HC9 5 CLA LC .   ? CLA L 1112 . ? 1_555 ? 
293 HC9 5 CLA PC .   ? CLA L 1116 . ? 1_555 ? 
294 HC9 5 CLA SC .   ? CLA L 1119 . ? 1_555 ? 
295 IC1 5 ALA P  22  ? ALA L 22   . ? 1_555 ? 
296 IC1 5 HIS P  26  ? HIS L 26   . ? 1_555 ? 
297 IC1 5 LEU P  238 ? LEU L 238  . ? 1_555 ? 
298 IC1 5 SER P  241 ? SER L 241  . ? 1_555 ? 
299 IC1 5 CLA HC .   ? CLA L 1108 . ? 1_555 ? 
300 IC2 2 MET P  60  ? MET L 60   . ? 1_555 ? 
301 IC2 2 TRP P  412 ? TRP L 450  . ? 1_555 ? 
302 IC3 6 ARG P  68  ? ARG L 68   . ? 1_555 ? 
303 IC3 6 LEU P  69  ? LEU L 69   . ? 1_555 ? 
304 IC3 6 GLY P  152 ? GLY L 152  . ? 1_555 ? 
305 IC3 6 ALA P  155 ? ALA L 155  . ? 1_555 ? 
306 IC3 6 CLA MC .   ? CLA L 1113 . ? 1_555 ? 
307 IC3 6 CLA NC .   ? CLA L 1114 . ? 1_555 ? 
308 IC4 2 ALA P  248 ? ALA L 248  . ? 1_555 ? 
309 IC4 2 CLA HC .   ? CLA L 1108 . ? 1_555 ? 
310 IC5 6 ALA P  146 ? ALA L 146  . ? 1_555 ? 
311 IC5 6 LEU P  149 ? LEU L 149  . ? 1_555 ? 
312 IC5 6 CYS P  150 ? CYS L 150  . ? 1_555 ? 
313 IC5 6 TYR P  193 ? TYR L 193  . ? 1_555 ? 
314 IC5 6 HIS P  201 ? HIS L 201  . ? 1_555 ? 
315 IC5 6 CLA KC .   ? CLA L 1111 . ? 1_555 ? 
316 IC6 5 ALA P  31  ? ALA L 31   . ? 1_555 ? 
317 IC6 5 PHE P  61  ? PHE L 61   . ? 1_555 ? 
318 IC6 5 PRO P  64  ? PRO L 64   . ? 1_555 ? 
319 IC6 5 PHE P  65  ? PHE L 65   . ? 1_555 ? 
320 IC6 5 CLA KC .   ? CLA L 1111 . ? 1_555 ? 
321 IC7 2 ALA P  243 ? ALA L 243  . ? 1_555 ? 
322 IC7 2 CLA TC .   ? CLA L 1120 . ? 1_555 ? 
323 IC8 1 CLA HC .   ? CLA L 1108 . ? 1_555 ? 
324 IC9 3 VAL P  198 ? VAL L 198  . ? 1_555 ? 
325 IC9 3 ALA P  200 ? ALA L 200  . ? 1_555 ? 
326 IC9 3 ALA P  204 ? ALA L 204  . ? 1_555 ? 
327 JC1 6 LEU P  19  ? LEU L 19   . ? 1_555 ? 
328 JC1 6 ILE P  20  ? ILE L 20   . ? 1_555 ? 
329 JC1 6 HIS P  23  ? HIS L 23   . ? 1_555 ? 
330 JC1 6 MET P  138 ? MET L 138  . ? 1_555 ? 
331 JC1 6 ILE P  141 ? ILE L 141  . ? 1_555 ? 
332 JC1 6 LEU P  145 ? LEU L 145  . ? 1_555 ? 
333 JC2 5 HIS P  9   ? HIS L 9    . ? 1_555 ? 
334 JC2 5 PHE P  426 ? PHE L 464  . ? 1_555 ? 
335 JC2 5 GLY P  427 ? GLY L 465  . ? 1_555 ? 
336 JC2 5 TRP P  430 ? TRP L 468  . ? 1_555 ? 
337 JC2 5 CLA HC .   ? CLA L 1108 . ? 1_555 ? 
338 JC3 6 PRO P  136 ? PRO L 136  . ? 1_555 ? 
339 JC3 6 PHE P  139 ? PHE L 139  . ? 1_555 ? 
340 JC3 6 HIS P  142 ? HIS L 142  . ? 1_555 ? 
341 JC3 6 SER P  240 ? SER L 240  . ? 1_555 ? 
342 JC3 6 ALA P  244 ? ALA L 244  . ? 1_555 ? 
343 JC3 6 CLA OC .   ? CLA L 1115 . ? 1_555 ? 
344 JC4 2 ALA P  110 ? ALA L 110  . ? 1_555 ? 
345 JC4 2 HIS P  114 ? HIS L 114  . ? 1_555 ? 
346 JC5 1 ILE S  26  ? ILE P 26   . ? 1_555 ? 
347 JC6 5 PHE AA 33  ? PHE 0 33   . ? 1_555 ? 
348 JC6 5 CYS AA 37  ? CYS 0 37   . ? 1_555 ? 
349 JC6 5 CYS AA 40  ? CYS 0 40   . ? 1_555 ? 
350 JC6 5 HIS AA 41  ? HIS 0 41   . ? 1_555 ? 
351 JC6 5 HIS AA 92  ? HIS 0 92   . ? 1_555 ? 
352 JC7 5 ILE R  213 ? ILE N 213  . ? 1_555 ? 
353 JC7 5 HIS R  214 ? HIS N 214  . ? 1_555 ? 
354 JC7 5 THR R  217 ? THR N 217  . ? 1_555 ? 
355 JC7 5 PHE R  257 ? PHE N 257  . ? 1_555 ? 
356 JC7 5 LYS R  264 ? LYS N 264  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1IZL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1IZL 
_atom_sites.fract_transf_matrix[1][1]   0.007729 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004441 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003240 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
MG 
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . TRP A  1  32  ? 51.348  46.819  36.005  1.00 46.91 ? 32   TRP A N   1 
ATOM   2     C  CA  . TRP A  1  32  ? 52.713  46.410  35.565  1.00 46.91 ? 32   TRP A CA  1 
ATOM   3     C  C   . TRP A  1  32  ? 53.813  47.145  36.330  1.00 46.91 ? 32   TRP A C   1 
ATOM   4     O  O   . TRP A  1  32  ? 54.928  46.638  36.466  1.00 46.91 ? 32   TRP A O   1 
ATOM   5     C  CB  . TRP A  1  32  ? 52.880  46.653  34.063  1.00 46.91 ? 32   TRP A CB  1 
ATOM   6     N  N   . PHE A  1  33  ? 53.504  48.354  36.791  1.00 46.91 ? 33   PHE A N   1 
ATOM   7     C  CA  . PHE A  1  33  ? 54.457  49.165  37.542  1.00 46.91 ? 33   PHE A CA  1 
ATOM   8     C  C   . PHE A  1  33  ? 54.742  48.550  38.909  1.00 46.91 ? 33   PHE A C   1 
ATOM   9     O  O   . PHE A  1  33  ? 55.900  48.351  39.283  1.00 46.91 ? 33   PHE A O   1 
ATOM   10    C  CB  . PHE A  1  33  ? 53.920  50.589  37.710  1.00 46.91 ? 33   PHE A CB  1 
ATOM   11    N  N   . GLY A  1  34  ? 53.678  48.273  39.658  1.00 46.91 ? 34   GLY A N   1 
ATOM   12    C  CA  . GLY A  1  34  ? 53.825  47.680  40.975  1.00 46.91 ? 34   GLY A CA  1 
ATOM   13    C  C   . GLY A  1  34  ? 53.764  46.166  40.925  1.00 46.91 ? 34   GLY A C   1 
ATOM   14    O  O   . GLY A  1  34  ? 52.749  45.593  40.531  1.00 46.91 ? 34   GLY A O   1 
ATOM   15    N  N   . VAL A  1  35  ? 54.861  45.519  41.307  1.00 46.91 ? 35   VAL A N   1 
ATOM   16    C  CA  . VAL A  1  35  ? 54.931  44.062  41.307  1.00 46.91 ? 35   VAL A CA  1 
ATOM   17    C  C   . VAL A  1  35  ? 54.297  43.493  42.576  1.00 46.91 ? 35   VAL A C   1 
ATOM   18    O  O   . VAL A  1  35  ? 54.992  43.157  43.539  1.00 46.91 ? 35   VAL A O   1 
ATOM   19    C  CB  . VAL A  1  35  ? 56.389  43.571  41.197  1.00 46.91 ? 35   VAL A CB  1 
ATOM   20    N  N   . ILE A  1  36  ? 52.971  43.394  42.567  1.00 46.91 ? 36   ILE A N   1 
ATOM   21    C  CA  . ILE A  1  36  ? 52.217  42.873  43.703  1.00 46.91 ? 36   ILE A CA  1 
ATOM   22    C  C   . ILE A  1  36  ? 50.806  42.475  43.283  1.00 46.91 ? 36   ILE A C   1 
ATOM   23    O  O   . ILE A  1  36  ? 50.248  41.509  43.801  1.00 46.91 ? 36   ILE A O   1 
ATOM   24    C  CB  . ILE A  1  36  ? 52.116  43.915  44.836  1.00 46.91 ? 36   ILE A CB  1 
ATOM   25    N  N   . MET A  1  37  ? 50.237  43.229  42.346  1.00 46.91 ? 37   MET A N   1 
ATOM   26    C  CA  . MET A  1  37  ? 48.889  42.977  41.845  1.00 46.91 ? 37   MET A CA  1 
ATOM   27    C  C   . MET A  1  37  ? 48.782  41.638  41.117  1.00 46.91 ? 37   MET A C   1 
ATOM   28    O  O   . MET A  1  37  ? 47.701  41.046  41.046  1.00 46.91 ? 37   MET A O   1 
ATOM   29    C  CB  . MET A  1  37  ? 48.452  44.104  40.910  1.00 46.91 ? 37   MET A CB  1 
ATOM   30    N  N   . ILE A  1  38  ? 49.891  41.187  40.538  1.00 46.91 ? 38   ILE A N   1 
ATOM   31    C  CA  . ILE A  1  38  ? 49.918  39.918  39.821  1.00 46.91 ? 38   ILE A CA  1 
ATOM   32    C  C   . ILE A  1  38  ? 50.048  38.736  40.774  1.00 46.91 ? 38   ILE A C   1 
ATOM   33    O  O   . ILE A  1  38  ? 49.837  37.587  40.385  1.00 46.91 ? 38   ILE A O   1 
ATOM   34    C  CB  . ILE A  1  38  ? 51.082  39.878  38.809  1.00 46.91 ? 38   ILE A CB  1 
ATOM   35    N  N   . PRO A  1  39  ? 50.434  39.006  42.028  1.00 46.91 ? 39   PRO A N   1 
ATOM   36    C  CA  . PRO A  1  39  ? 50.613  37.999  43.080  1.00 46.91 ? 39   PRO A CA  1 
ATOM   37    C  C   . PRO A  1  39  ? 49.538  38.072  44.165  1.00 46.91 ? 39   PRO A C   1 
ATOM   38    O  O   . PRO A  1  39  ? 49.559  37.294  45.123  1.00 46.91 ? 39   PRO A O   1 
ATOM   39    C  CB  . PRO A  1  39  ? 51.996  38.328  43.651  1.00 46.91 ? 39   PRO A CB  1 
ATOM   40    N  N   . THR A  1  40  ? 48.612  39.013  44.017  1.00 46.91 ? 40   THR A N   1 
ATOM   41    C  CA  . THR A  1  40  ? 47.527  39.190  44.975  1.00 46.91 ? 40   THR A CA  1 
ATOM   42    C  C   . THR A  1  40  ? 46.183  38.812  44.366  1.00 46.91 ? 40   THR A C   1 
ATOM   43    O  O   . THR A  1  40  ? 45.422  38.044  44.953  1.00 46.91 ? 40   THR A O   1 
ATOM   44    C  CB  . THR A  1  40  ? 47.454  40.644  45.476  1.00 46.91 ? 40   THR A CB  1 
ATOM   45    N  N   . LEU A  1  41  ? 45.894  39.369  43.193  1.00 46.91 ? 41   LEU A N   1 
ATOM   46    C  CA  . LEU A  1  41  ? 44.643  39.101  42.492  1.00 46.91 ? 41   LEU A CA  1 
ATOM   47    C  C   . LEU A  1  41  ? 44.585  37.675  41.949  1.00 46.91 ? 41   LEU A C   1 
ATOM   48    O  O   . LEU A  1  41  ? 43.503  37.147  41.685  1.00 46.91 ? 41   LEU A O   1 
ATOM   49    C  CB  . LEU A  1  41  ? 44.455  40.100  41.346  1.00 46.91 ? 41   LEU A CB  1 
ATOM   50    N  N   . LEU A  1  42  ? 45.754  37.077  41.740  1.00 46.91 ? 42   LEU A N   1 
ATOM   51    C  CA  . LEU A  1  42  ? 45.846  35.715  41.227  1.00 46.91 ? 42   LEU A CA  1 
ATOM   52    C  C   . LEU A  1  42  ? 45.683  34.692  42.349  1.00 46.91 ? 42   LEU A C   1 
ATOM   53    O  O   . LEU A  1  42  ? 45.191  33.586  42.124  1.00 46.91 ? 42   LEU A O   1 
ATOM   54    C  CB  . LEU A  1  42  ? 47.188  35.503  40.524  1.00 46.91 ? 42   LEU A CB  1 
ATOM   55    N  N   . ALA A  1  43  ? 46.142  35.056  43.543  1.00 46.91 ? 43   ALA A N   1 
ATOM   56    C  CA  . ALA A  1  43  ? 46.049  34.185  44.708  1.00 46.91 ? 43   ALA A CA  1 
ATOM   57    C  C   . ALA A  1  43  ? 44.689  34.309  45.392  1.00 46.91 ? 43   ALA A C   1 
ATOM   58    O  O   . ALA A  1  43  ? 44.285  33.426  46.149  1.00 46.91 ? 43   ALA A O   1 
ATOM   59    C  CB  . ALA A  1  43  ? 47.167  34.504  45.690  1.00 46.91 ? 43   ALA A CB  1 
ATOM   60    N  N   . ALA A  1  44  ? 44.006  35.424  45.146  1.00 46.91 ? 44   ALA A N   1 
ATOM   61    C  CA  . ALA A  1  44  ? 42.692  35.676  45.732  1.00 46.91 ? 44   ALA A CA  1 
ATOM   62    C  C   . ALA A  1  44  ? 41.568  35.272  44.781  1.00 46.91 ? 44   ALA A C   1 
ATOM   63    O  O   . ALA A  1  44  ? 40.388  35.471  45.078  1.00 46.91 ? 44   ALA A O   1 
ATOM   64    C  CB  . ALA A  1  44  ? 42.560  37.144  46.108  1.00 46.91 ? 44   ALA A CB  1 
ATOM   65    N  N   . THR A  1  45  ? 41.940  34.740  43.623  1.00 46.91 ? 45   THR A N   1 
ATOM   66    C  CA  . THR A  1  45  ? 40.973  34.306  42.624  1.00 46.91 ? 45   THR A CA  1 
ATOM   67    C  C   . THR A  1  45  ? 41.050  32.796  42.429  1.00 46.91 ? 45   THR A C   1 
ATOM   68    O  O   . THR A  1  45  ? 40.072  32.163  42.024  1.00 46.91 ? 45   THR A O   1 
ATOM   69    C  CB  . THR A  1  45  ? 41.219  34.993  41.272  1.00 46.91 ? 45   THR A CB  1 
ATOM   70    N  N   . ILE A  1  46  ? 42.233  32.234  42.669  1.00 46.91 ? 46   ILE A N   1 
ATOM   71    C  CA  . ILE A  1  46  ? 42.456  30.802  42.536  1.00 46.91 ? 46   ILE A CA  1 
ATOM   72    C  C   . ILE A  1  46  ? 42.060  30.089  43.825  1.00 46.91 ? 46   ILE A C   1 
ATOM   73    O  O   . ILE A  1  46  ? 41.635  28.933  43.800  1.00 46.91 ? 46   ILE A O   1 
ATOM   74    C  CB  . ILE A  1  46  ? 43.936  30.493  42.230  1.00 46.91 ? 46   ILE A CB  1 
ATOM   75    N  N   . CYS A  1  47  ? 42.255  30.772  44.949  1.00 46.91 ? 47   CYS A N   1 
ATOM   76    C  CA  . CYS A  1  47  ? 41.916  30.232  46.261  1.00 46.91 ? 47   CYS A CA  1 
ATOM   77    C  C   . CYS A  1  47  ? 40.430  30.437  46.543  1.00 46.91 ? 47   CYS A C   1 
ATOM   78    O  O   . CYS A  1  47  ? 39.855  29.768  47.403  1.00 46.91 ? 47   CYS A O   1 
ATOM   79    C  CB  . CYS A  1  47  ? 42.745  30.921  47.346  1.00 46.91 ? 47   CYS A CB  1 
ATOM   80    N  N   . PHE A  1  48  ? 39.830  31.391  45.837  1.00 46.91 ? 48   PHE A N   1 
ATOM   81    C  CA  . PHE A  1  48  ? 38.415  31.706  45.985  1.00 46.91 ? 48   PHE A CA  1 
ATOM   82    C  C   . PHE A  1  48  ? 37.580  30.699  45.198  1.00 46.91 ? 48   PHE A C   1 
ATOM   83    O  O   . PHE A  1  48  ? 36.471  30.347  45.601  1.00 46.91 ? 48   PHE A O   1 
ATOM   84    C  CB  . PHE A  1  48  ? 38.148  33.127  45.478  1.00 46.91 ? 48   PHE A CB  1 
ATOM   85    C  CG  . PHE A  1  48  ? 36.802  33.671  45.866  1.00 46.91 ? 48   PHE A CG  1 
ATOM   86    C  CD1 . PHE A  1  48  ? 36.614  34.269  47.109  1.00 46.91 ? 48   PHE A CD1 1 
ATOM   87    C  CD2 . PHE A  1  48  ? 35.728  33.606  44.985  1.00 46.91 ? 48   PHE A CD2 1 
ATOM   88    C  CE1 . PHE A  1  48  ? 35.376  34.794  47.468  1.00 46.91 ? 48   PHE A CE1 1 
ATOM   89    C  CE2 . PHE A  1  48  ? 34.485  34.128  45.334  1.00 46.91 ? 48   PHE A CE2 1 
ATOM   90    C  CZ  . PHE A  1  48  ? 34.308  34.723  46.578  1.00 46.91 ? 48   PHE A CZ  1 
ATOM   91    N  N   . VAL A  1  49  ? 38.106  30.277  44.052  1.00 46.91 ? 49   VAL A N   1 
ATOM   92    C  CA  . VAL A  1  49  ? 37.427  29.312  43.194  1.00 46.91 ? 49   VAL A CA  1 
ATOM   93    C  C   . VAL A  1  49  ? 37.645  27.883  43.695  1.00 46.91 ? 49   VAL A C   1 
ATOM   94    O  O   . VAL A  1  49  ? 36.936  26.959  43.290  1.00 46.91 ? 49   VAL A O   1 
ATOM   95    C  CB  . VAL A  1  49  ? 37.928  29.407  41.740  1.00 46.91 ? 49   VAL A CB  1 
ATOM   96    N  N   . ILE A  1  50  ? 38.654  27.708  44.544  1.00 46.91 ? 50   ILE A N   1 
ATOM   97    C  CA  . ILE A  1  50  ? 38.979  26.403  45.109  1.00 46.91 ? 50   ILE A CA  1 
ATOM   98    C  C   . ILE A  1  50  ? 38.180  26.119  46.378  1.00 46.91 ? 50   ILE A C   1 
ATOM   99    O  O   . ILE A  1  50  ? 37.886  24.964  46.688  1.00 46.91 ? 50   ILE A O   1 
ATOM   100   C  CB  . ILE A  1  50  ? 40.481  26.296  45.437  1.00 46.91 ? 50   ILE A CB  1 
ATOM   101   N  N   . ALA A  1  51  ? 37.875  27.174  47.127  1.00 46.91 ? 51   ALA A N   1 
ATOM   102   C  CA  . ALA A  1  51  ? 37.115  27.050  48.366  1.00 46.91 ? 51   ALA A CA  1 
ATOM   103   C  C   . ALA A  1  51  ? 35.627  26.860  48.092  1.00 46.91 ? 51   ALA A C   1 
ATOM   104   O  O   . ALA A  1  51  ? 34.951  26.099  48.787  1.00 46.91 ? 51   ALA A O   1 
ATOM   105   C  CB  . ALA A  1  51  ? 37.337  28.276  49.245  1.00 46.91 ? 51   ALA A CB  1 
ATOM   106   N  N   . PHE A  1  52  ? 35.121  27.568  47.085  1.00 46.91 ? 52   PHE A N   1 
ATOM   107   C  CA  . PHE A  1  52  ? 33.713  27.495  46.707  1.00 46.91 ? 52   PHE A CA  1 
ATOM   108   C  C   . PHE A  1  52  ? 33.337  26.150  46.089  1.00 46.91 ? 52   PHE A C   1 
ATOM   109   O  O   . PHE A  1  52  ? 32.153  25.811  45.998  1.00 46.91 ? 52   PHE A O   1 
ATOM   110   C  CB  . PHE A  1  52  ? 33.368  28.627  45.735  1.00 46.91 ? 52   PHE A CB  1 
ATOM   111   N  N   . ILE A  1  53  ? 34.338  25.407  45.627  1.00 46.91 ? 53   ILE A N   1 
ATOM   112   C  CA  . ILE A  1  53  ? 34.108  24.099  45.021  1.00 46.91 ? 53   ILE A CA  1 
ATOM   113   C  C   . ILE A  1  53  ? 34.013  23.013  46.087  1.00 46.91 ? 53   ILE A C   1 
ATOM   114   O  O   . ILE A  1  53  ? 33.436  21.948  45.855  1.00 46.91 ? 53   ILE A O   1 
ATOM   115   C  CB  . ILE A  1  53  ? 35.241  23.730  44.044  1.00 46.91 ? 53   ILE A CB  1 
ATOM   116   N  N   . ALA A  1  54  ? 34.599  23.284  47.249  1.00 46.91 ? 54   ALA A N   1 
ATOM   117   C  CA  . ALA A  1  54  ? 34.601  22.339  48.359  1.00 46.91 ? 54   ALA A CA  1 
ATOM   118   C  C   . ALA A  1  54  ? 33.322  22.370  49.194  1.00 46.91 ? 54   ALA A C   1 
ATOM   119   O  O   . ALA A  1  54  ? 33.207  21.641  50.186  1.00 46.91 ? 54   ALA A O   1 
ATOM   120   C  CB  . ALA A  1  54  ? 35.810  22.586  49.246  1.00 46.91 ? 54   ALA A CB  1 
ATOM   121   N  N   . ALA A  1  55  ? 32.360  23.194  48.790  1.00 46.91 ? 55   ALA A N   1 
ATOM   122   C  CA  . ALA A  1  55  ? 31.104  23.313  49.524  1.00 46.91 ? 55   ALA A CA  1 
ATOM   123   C  C   . ALA A  1  55  ? 29.875  22.993  48.672  1.00 46.91 ? 55   ALA A C   1 
ATOM   124   O  O   . ALA A  1  55  ? 28.763  23.423  48.984  1.00 46.91 ? 55   ALA A O   1 
ATOM   125   C  CB  . ALA A  1  55  ? 30.984  24.708  50.125  1.00 46.91 ? 55   ALA A CB  1 
ATOM   126   N  N   . PRO A  1  56  ? 30.058  22.196  47.606  1.00 46.91 ? 56   PRO A N   1 
ATOM   127   C  CA  . PRO A  1  56  ? 28.987  21.791  46.687  1.00 46.91 ? 56   PRO A CA  1 
ATOM   128   C  C   . PRO A  1  56  ? 28.000  20.815  47.321  1.00 46.91 ? 56   PRO A C   1 
ATOM   129   O  O   . PRO A  1  56  ? 27.191  20.190  46.630  1.00 46.91 ? 56   PRO A O   1 
ATOM   130   C  CB  . PRO A  1  56  ? 29.741  21.154  45.520  1.00 46.91 ? 56   PRO A CB  1 
ATOM   131   N  N   . PRO A  1  57  ? 28.095  20.630  48.647  1.00 46.91 ? 57   PRO A N   1 
ATOM   132   C  CA  . PRO A  1  57  ? 27.220  19.735  49.404  1.00 46.91 ? 57   PRO A CA  1 
ATOM   133   C  C   . PRO A  1  57  ? 25.843  20.377  49.546  1.00 46.91 ? 57   PRO A C   1 
ATOM   134   O  O   . PRO A  1  57  ? 24.822  19.686  49.527  1.00 46.91 ? 57   PRO A O   1 
ATOM   135   C  CB  . PRO A  1  57  ? 27.923  19.615  50.755  1.00 46.91 ? 57   PRO A CB  1 
ATOM   136   N  N   . VAL A  1  58  ? 25.828  21.703  49.661  1.00 46.91 ? 58   VAL A N   1 
ATOM   137   C  CA  . VAL A  1  58  ? 24.587  22.457  49.802  1.00 46.91 ? 58   VAL A CA  1 
ATOM   138   C  C   . VAL A  1  58  ? 24.769  23.938  49.466  1.00 46.91 ? 58   VAL A C   1 
ATOM   139   O  O   . VAL A  1  58  ? 24.564  24.806  50.317  1.00 46.91 ? 58   VAL A O   1 
ATOM   140   C  CB  . VAL A  1  58  ? 24.024  22.341  51.233  1.00 46.91 ? 58   VAL A CB  1 
ATOM   141   N  N   . ASP A  1  59  ? 25.121  24.220  48.215  1.00 46.91 ? 59   ASP A N   1 
ATOM   142   C  CA  . ASP A  1  59  ? 25.327  25.594  47.764  1.00 46.91 ? 59   ASP A CA  1 
ATOM   143   C  C   . ASP A  1  59  ? 24.085  26.185  47.103  1.00 46.91 ? 59   ASP A C   1 
ATOM   144   O  O   . ASP A  1  59  ? 23.468  27.107  47.637  1.00 46.91 ? 59   ASP A O   1 
ATOM   145   C  CB  . ASP A  1  59  ? 26.507  25.658  46.788  1.00 46.91 ? 59   ASP A CB  1 
ATOM   146   N  N   . ILE A  1  60  ? 23.723  25.635  45.943  1.00 46.91 ? 60   ILE A N   1 
ATOM   147   C  CA  . ILE A  1  60  ? 22.572  26.090  45.162  1.00 46.91 ? 60   ILE A CA  1 
ATOM   148   C  C   . ILE A  1  60  ? 22.755  27.532  44.683  1.00 46.91 ? 60   ILE A C   1 
ATOM   149   O  O   . ILE A  1  60  ? 21.781  28.217  44.356  1.00 46.91 ? 60   ILE A O   1 
ATOM   150   C  CB  . ILE A  1  60  ? 21.254  25.977  45.968  1.00 46.91 ? 60   ILE A CB  1 
ATOM   151   N  N   . ASP A  1  61  ? 24.018  27.949  44.580  1.00 46.91 ? 61   ASP A N   1 
ATOM   152   C  CA  . ASP A  1  61  ? 24.397  29.295  44.152  1.00 46.91 ? 61   ASP A CA  1 
ATOM   153   C  C   . ASP A  1  61  ? 23.681  30.360  44.979  1.00 46.91 ? 61   ASP A C   1 
ATOM   154   O  O   . ASP A  1  61  ? 22.816  31.086  44.480  1.00 46.91 ? 61   ASP A O   1 
ATOM   155   C  CB  . ASP A  1  61  ? 24.128  29.499  42.657  1.00 46.91 ? 61   ASP A CB  1 
ATOM   156   N  N   . GLY A  1  62  ? 24.062  30.453  46.246  1.00 46.91 ? 62   GLY A N   1 
ATOM   157   C  CA  . GLY A  1  62  ? 23.449  31.423  47.131  1.00 46.91 ? 62   GLY A CA  1 
ATOM   158   C  C   . GLY A  1  62  ? 24.083  31.493  48.506  1.00 46.91 ? 62   GLY A C   1 
ATOM   159   O  O   . GLY A  1  62  ? 24.691  32.504  48.855  1.00 46.91 ? 62   GLY A O   1 
ATOM   160   N  N   . ILE A  1  63  ? 23.927  30.431  49.291  1.00 46.91 ? 63   ILE A N   1 
ATOM   161   C  CA  . ILE A  1  63  ? 24.474  30.386  50.645  1.00 46.91 ? 63   ILE A CA  1 
ATOM   162   C  C   . ILE A  1  63  ? 25.868  29.774  50.731  1.00 46.91 ? 63   ILE A C   1 
ATOM   163   O  O   . ILE A  1  63  ? 26.856  30.489  50.905  1.00 46.91 ? 63   ILE A O   1 
ATOM   164   C  CB  . ILE A  1  63  ? 23.537  29.620  51.602  1.00 46.91 ? 63   ILE A CB  1 
ATOM   165   N  N   . ARG A  1  64  ? 25.934  28.447  50.635  1.00 46.91 ? 64   ARG A N   1 
ATOM   166   C  CA  . ARG A  1  64  ? 27.191  27.701  50.708  1.00 46.91 ? 64   ARG A CA  1 
ATOM   167   C  C   . ARG A  1  64  ? 27.903  27.892  52.054  1.00 46.91 ? 64   ARG A C   1 
ATOM   168   O  O   . ARG A  1  64  ? 27.262  28.225  53.054  1.00 46.91 ? 64   ARG A O   1 
ATOM   169   C  CB  . ARG A  1  64  ? 28.110  28.081  49.538  1.00 46.91 ? 64   ARG A CB  1 
ATOM   170   N  N   . GLU A  1  65  ? 29.214  27.641  52.082  1.00 46.91 ? 65   GLU A N   1 
ATOM   171   C  CA  . GLU A  1  65  ? 30.038  27.773  53.292  1.00 46.91 ? 65   GLU A CA  1 
ATOM   172   C  C   . GLU A  1  65  ? 29.410  27.132  54.533  1.00 46.91 ? 65   GLU A C   1 
ATOM   173   O  O   . GLU A  1  65  ? 29.266  27.769  55.578  1.00 46.91 ? 65   GLU A O   1 
ATOM   174   C  CB  . GLU A  1  65  ? 30.368  29.245  53.561  1.00 46.91 ? 65   GLU A CB  1 
ATOM   175   N  N   . PRO A  1  66  ? 29.057  25.842  54.437  1.00 46.91 ? 66   PRO A N   1 
ATOM   176   C  CA  . PRO A  1  66  ? 28.442  25.094  55.537  1.00 46.91 ? 66   PRO A CA  1 
ATOM   177   C  C   . PRO A  1  66  ? 29.402  24.620  56.631  1.00 46.91 ? 66   PRO A C   1 
ATOM   178   O  O   . PRO A  1  66  ? 29.024  23.808  57.477  1.00 46.91 ? 66   PRO A O   1 
ATOM   179   C  CB  . PRO A  1  66  ? 27.771  23.915  54.830  1.00 46.91 ? 66   PRO A CB  1 
ATOM   180   N  N   . VAL A  1  67  ? 30.643  25.100  56.605  1.00 46.91 ? 67   VAL A N   1 
ATOM   181   C  CA  . VAL A  1  67  ? 31.624  24.714  57.617  1.00 46.91 ? 67   VAL A CA  1 
ATOM   182   C  C   . VAL A  1  67  ? 31.744  25.785  58.702  1.00 46.91 ? 67   VAL A C   1 
ATOM   183   O  O   . VAL A  1  67  ? 32.643  26.625  58.657  1.00 46.91 ? 67   VAL A O   1 
ATOM   184   C  CB  . VAL A  1  67  ? 33.016  24.465  56.996  1.00 46.91 ? 67   VAL A CB  1 
ATOM   185   N  N   . SER A  1  68  ? 30.829  25.755  59.668  1.00 46.91 ? 68   SER A N   1 
ATOM   186   C  CA  . SER A  1  68  ? 30.832  26.720  60.765  1.00 46.91 ? 68   SER A CA  1 
ATOM   187   C  C   . SER A  1  68  ? 29.865  26.318  61.877  1.00 46.91 ? 68   SER A C   1 
ATOM   188   O  O   . SER A  1  68  ? 29.318  27.170  62.579  1.00 46.91 ? 68   SER A O   1 
ATOM   189   C  CB  . SER A  1  68  ? 30.482  28.119  60.246  1.00 46.91 ? 68   SER A CB  1 
ATOM   190   N  N   . GLY A  1  69  ? 29.644  25.015  62.019  1.00 46.91 ? 69   GLY A N   1 
ATOM   191   C  CA  . GLY A  1  69  ? 28.750  24.519  63.049  1.00 46.91 ? 69   GLY A CA  1 
ATOM   192   C  C   . GLY A  1  69  ? 29.499  23.671  64.057  1.00 46.91 ? 69   GLY A C   1 
ATOM   193   O  O   . GLY A  1  69  ? 29.163  22.505  64.278  1.00 46.91 ? 69   GLY A O   1 
ATOM   194   N  N   . SER A  1  70  ? 30.526  24.255  64.666  1.00 46.91 ? 70   SER A N   1 
ATOM   195   C  CA  . SER A  1  70  ? 31.336  23.554  65.652  1.00 46.91 ? 70   SER A CA  1 
ATOM   196   C  C   . SER A  1  70  ? 32.043  24.540  66.570  1.00 46.91 ? 70   SER A C   1 
ATOM   197   O  O   . SER A  1  70  ? 32.949  25.254  66.144  1.00 46.91 ? 70   SER A O   1 
ATOM   198   C  CB  . SER A  1  70  ? 32.368  22.667  64.949  1.00 46.91 ? 70   SER A CB  1 
ATOM   199   N  N   . LEU A  1  71  ? 31.636  24.540  67.837  1.00 46.91 ? 71   LEU A N   1 
ATOM   200   C  CA  . LEU A  1  71  ? 32.196  25.419  68.866  1.00 46.91 ? 71   LEU A CA  1 
ATOM   201   C  C   . LEU A  1  71  ? 31.780  26.883  68.720  1.00 46.91 ? 71   LEU A C   1 
ATOM   202   O  O   . LEU A  1  71  ? 31.161  27.442  69.628  1.00 46.91 ? 71   LEU A O   1 
ATOM   203   C  CB  . LEU A  1  71  ? 33.727  25.307  68.913  1.00 46.91 ? 71   LEU A CB  1 
ATOM   204   N  N   . LEU A  1  72  ? 32.125  27.495  67.591  1.00 46.91 ? 72   LEU A N   1 
ATOM   205   C  CA  . LEU A  1  72  ? 31.791  28.896  67.335  1.00 46.91 ? 72   LEU A CA  1 
ATOM   206   C  C   . LEU A  1  72  ? 31.899  29.254  65.854  1.00 46.91 ? 72   LEU A C   1 
ATOM   207   O  O   . LEU A  1  72  ? 32.243  28.413  65.022  1.00 46.91 ? 72   LEU A O   1 
ATOM   208   C  CB  . LEU A  1  72  ? 32.700  29.815  68.151  1.00 46.91 ? 72   LEU A CB  1 
ATOM   209   N  N   . TYR A  1  73  ? 31.605  30.514  65.537  1.00 46.91 ? 73   TYR A N   1 
ATOM   210   C  CA  . TYR A  1  73  ? 31.662  31.009  64.165  1.00 46.91 ? 73   TYR A CA  1 
ATOM   211   C  C   . TYR A  1  73  ? 33.085  31.108  63.609  1.00 46.91 ? 73   TYR A C   1 
ATOM   212   O  O   . TYR A  1  73  ? 33.327  30.746  62.457  1.00 46.91 ? 73   TYR A O   1 
ATOM   213   C  CB  . TYR A  1  73  ? 30.951  32.364  64.053  1.00 46.91 ? 73   TYR A CB  1 
ATOM   214   C  CG  . TYR A  1  73  ? 29.436  32.276  64.054  1.00 46.91 ? 73   TYR A CG  1 
ATOM   215   C  CD1 . TYR A  1  73  ? 28.700  32.513  65.216  1.00 46.91 ? 73   TYR A CD1 1 
ATOM   216   C  CD2 . TYR A  1  73  ? 28.740  31.957  62.888  1.00 46.91 ? 73   TYR A CD2 1 
ATOM   217   C  CE1 . TYR A  1  73  ? 27.303  32.436  65.214  1.00 46.91 ? 73   TYR A CE1 1 
ATOM   218   C  CE2 . TYR A  1  73  ? 27.349  31.877  62.876  1.00 46.91 ? 73   TYR A CE2 1 
ATOM   219   C  CZ  . TYR A  1  73  ? 26.636  32.115  64.039  1.00 46.91 ? 73   TYR A CZ  1 
ATOM   220   O  OH  . TYR A  1  73  ? 25.261  32.024  64.014  1.00 46.91 ? 73   TYR A OH  1 
ATOM   221   N  N   . GLY A  1  74  ? 34.021  31.587  64.426  1.00 46.91 ? 74   GLY A N   1 
ATOM   222   C  CA  . GLY A  1  74  ? 35.398  31.711  63.973  1.00 46.91 ? 74   GLY A CA  1 
ATOM   223   C  C   . GLY A  1  74  ? 36.341  32.379  64.957  1.00 46.91 ? 74   GLY A C   1 
ATOM   224   O  O   . GLY A  1  74  ? 37.294  33.048  64.554  1.00 46.91 ? 74   GLY A O   1 
ATOM   225   N  N   . ASN A  1  75  ? 36.093  32.178  66.248  1.00 46.91 ? 75   ASN A N   1 
ATOM   226   C  CA  . ASN A  1  75  ? 36.920  32.767  67.298  1.00 46.91 ? 75   ASN A CA  1 
ATOM   227   C  C   . ASN A  1  75  ? 38.304  32.124  67.376  1.00 46.91 ? 75   ASN A C   1 
ATOM   228   O  O   . ASN A  1  75  ? 38.444  30.972  67.796  1.00 46.91 ? 75   ASN A O   1 
ATOM   229   C  CB  . ASN A  1  75  ? 36.214  32.651  68.651  1.00 46.91 ? 75   ASN A CB  1 
ATOM   230   N  N   . ASN A  1  76  ? 39.326  32.888  67.002  1.00 46.91 ? 76   ASN A N   1 
ATOM   231   C  CA  . ASN A  1  76  ? 40.703  32.399  67.022  1.00 46.91 ? 76   ASN A CA  1 
ATOM   232   C  C   . ASN A  1  76  ? 41.655  33.403  67.670  1.00 46.91 ? 76   ASN A C   1 
ATOM   233   O  O   . ASN A  1  76  ? 42.736  33.030  68.131  1.00 46.91 ? 76   ASN A O   1 
ATOM   234   C  CB  . ASN A  1  76  ? 41.175  32.085  65.601  1.00 46.91 ? 76   ASN A CB  1 
ATOM   235   N  N   . ILE A  1  77  ? 41.240  34.668  67.713  1.00 46.91 ? 77   ILE A N   1 
ATOM   236   C  CA  . ILE A  1  77  ? 42.035  35.749  68.296  1.00 46.91 ? 77   ILE A CA  1 
ATOM   237   C  C   . ILE A  1  77  ? 43.389  35.917  67.601  1.00 46.91 ? 77   ILE A C   1 
ATOM   238   O  O   . ILE A  1  77  ? 44.445  35.835  68.234  1.00 46.91 ? 77   ILE A O   1 
ATOM   239   C  CB  . ILE A  1  77  ? 42.254  35.539  69.813  1.00 46.91 ? 77   ILE A CB  1 
ATOM   240   N  N   . ILE A  1  78  ? 43.341  36.148  66.292  1.00 46.91 ? 78   ILE A N   1 
ATOM   241   C  CA  . ILE A  1  78  ? 44.545  36.331  65.489  1.00 46.91 ? 78   ILE A CA  1 
ATOM   242   C  C   . ILE A  1  78  ? 45.151  37.719  65.701  1.00 46.91 ? 78   ILE A C   1 
ATOM   243   O  O   . ILE A  1  78  ? 44.558  38.730  65.323  1.00 46.91 ? 78   ILE A O   1 
ATOM   244   C  CB  . ILE A  1  78  ? 44.247  36.133  63.989  1.00 46.91 ? 78   ILE A CB  1 
ATOM   245   N  N   . THR A  1  79  ? 46.353  37.752  66.272  1.00 46.91 ? 79   THR A N   1 
ATOM   246   C  CA  . THR A  1  79  ? 47.068  39.002  66.549  1.00 46.91 ? 79   THR A CA  1 
ATOM   247   C  C   . THR A  1  79  ? 46.442  39.798  67.695  1.00 46.91 ? 79   THR A C   1 
ATOM   248   O  O   . THR A  1  79  ? 45.328  39.505  68.132  1.00 46.91 ? 79   THR A O   1 
ATOM   249   C  CB  . THR A  1  79  ? 47.155  39.904  65.301  1.00 46.91 ? 79   THR A CB  1 
ATOM   250   N  N   . GLY A  1  80  ? 47.169  40.799  68.185  1.00 46.91 ? 80   GLY A N   1 
ATOM   251   C  CA  . GLY A  1  80  ? 46.663  41.606  69.282  1.00 46.91 ? 80   GLY A CA  1 
ATOM   252   C  C   . GLY A  1  80  ? 47.096  43.060  69.257  1.00 46.91 ? 80   GLY A C   1 
ATOM   253   O  O   . GLY A  1  80  ? 48.279  43.362  69.427  1.00 46.91 ? 80   GLY A O   1 
ATOM   254   N  N   . ALA A  1  81  ? 46.119  43.951  69.102  1.00 46.91 ? 81   ALA A N   1 
ATOM   255   C  CA  . ALA A  1  81  ? 46.336  45.398  69.060  1.00 46.91 ? 81   ALA A CA  1 
ATOM   256   C  C   . ALA A  1  81  ? 47.114  45.879  67.838  1.00 46.91 ? 81   ALA A C   1 
ATOM   257   O  O   . ALA A  1  81  ? 48.336  45.743  67.778  1.00 46.91 ? 81   ALA A O   1 
ATOM   258   C  CB  . ALA A  1  81  ? 47.008  45.879  70.350  1.00 46.91 ? 81   ALA A CB  1 
ATOM   259   N  N   . VAL A  1  82  ? 46.395  46.493  66.905  1.00 46.91 ? 82   VAL A N   1 
ATOM   260   C  CA  . VAL A  1  82  ? 46.979  47.019  65.672  1.00 46.91 ? 82   VAL A CA  1 
ATOM   261   C  C   . VAL A  1  82  ? 47.641  45.930  64.832  1.00 46.91 ? 82   VAL A C   1 
ATOM   262   O  O   . VAL A  1  82  ? 48.599  46.188  64.096  1.00 46.91 ? 82   VAL A O   1 
ATOM   263   C  CB  . VAL A  1  82  ? 48.000  48.142  65.962  1.00 46.91 ? 82   VAL A CB  1 
ATOM   264   N  N   . VAL A  1  83  ? 47.092  44.720  64.925  1.00 46.91 ? 83   VAL A N   1 
ATOM   265   C  CA  . VAL A  1  83  ? 47.588  43.557  64.194  1.00 46.91 ? 83   VAL A CA  1 
ATOM   266   C  C   . VAL A  1  83  ? 49.024  43.184  64.563  1.00 46.91 ? 83   VAL A C   1 
ATOM   267   O  O   . VAL A  1  83  ? 49.656  43.829  65.400  1.00 46.91 ? 83   VAL A O   1 
ATOM   268   C  CB  . VAL A  1  83  ? 47.485  43.760  62.664  1.00 46.91 ? 83   VAL A CB  1 
ATOM   269   N  N   . PRO A  1  84  ? 49.534  42.090  63.976  1.00 46.91 ? 84   PRO A N   1 
ATOM   270   C  CA  . PRO A  1  84  ? 50.899  41.630  64.247  1.00 46.91 ? 84   PRO A CA  1 
ATOM   271   C  C   . PRO A  1  84  ? 51.923  42.571  63.620  1.00 46.91 ? 84   PRO A C   1 
ATOM   272   O  O   . PRO A  1  84  ? 51.742  43.038  62.493  1.00 46.91 ? 84   PRO A O   1 
ATOM   273   C  CB  . PRO A  1  84  ? 50.942  40.247  63.596  1.00 46.91 ? 84   PRO A CB  1 
ATOM   274   N  N   . SER A  1  85  ? 52.999  42.842  64.350  1.00 46.91 ? 85   SER A N   1 
ATOM   275   C  CA  . SER A  1  85  ? 54.048  43.730  63.864  1.00 46.91 ? 85   SER A CA  1 
ATOM   276   C  C   . SER A  1  85  ? 55.389  43.416  64.515  1.00 46.91 ? 85   SER A C   1 
ATOM   277   O  O   . SER A  1  85  ? 56.437  43.533  63.879  1.00 46.91 ? 85   SER A O   1 
ATOM   278   C  CB  . SER A  1  85  ? 53.668  45.190  64.128  1.00 46.91 ? 85   SER A CB  1 
ATOM   279   N  N   . SER A  1  86  ? 55.354  43.043  65.791  1.00 46.91 ? 86   SER A N   1 
ATOM   280   C  CA  . SER A  1  86  ? 56.570  42.706  66.523  1.00 46.91 ? 86   SER A CA  1 
ATOM   281   C  C   . SER A  1  86  ? 56.955  41.255  66.253  1.00 46.91 ? 86   SER A C   1 
ATOM   282   O  O   . SER A  1  86  ? 56.182  40.336  66.537  1.00 46.91 ? 86   SER A O   1 
ATOM   283   C  CB  . SER A  1  86  ? 56.365  42.917  68.023  1.00 46.91 ? 86   SER A CB  1 
ATOM   284   N  N   . ASN A  1  87  ? 58.155  41.055  65.717  1.00 46.91 ? 87   ASN A N   1 
ATOM   285   C  CA  . ASN A  1  87  ? 58.645  39.717  65.404  1.00 46.91 ? 87   ASN A CA  1 
ATOM   286   C  C   . ASN A  1  87  ? 60.171  39.657  65.394  1.00 46.91 ? 87   ASN A C   1 
ATOM   287   O  O   . ASN A  1  87  ? 60.790  40.642  64.939  1.00 46.91 ? 87   ASN A O   1 
ATOM   288   C  CB  . ASN A  1  87  ? 58.098  39.255  64.051  1.00 46.91 ? 87   ASN A CB  1 
ATOM   289   N  N   . HIS A  1  92  ? 48.944  33.544  64.107  1.00 46.91 ? 92   HIS A N   1 
ATOM   290   C  CA  . HIS A  1  92  ? 48.411  34.426  63.040  1.00 46.91 ? 92   HIS A CA  1 
ATOM   291   C  C   . HIS A  1  92  ? 47.658  33.636  61.969  1.00 46.91 ? 92   HIS A C   1 
ATOM   292   O  O   . HIS A  1  92  ? 46.632  34.086  61.466  1.00 46.91 ? 92   HIS A O   1 
ATOM   293   C  CB  . HIS A  1  92  ? 49.549  35.226  62.400  1.00 46.91 ? 92   HIS A CB  1 
ATOM   294   C  CG  . HIS A  1  92  ? 49.098  36.156  61.310  1.00 46.91 ? 92   HIS A CG  1 
ATOM   295   N  ND1 . HIS A  1  92  ? 49.621  36.116  60.035  1.00 46.91 ? 92   HIS A ND1 1 
ATOM   296   C  CD2 . HIS A  1  92  ? 48.173  37.146  61.303  1.00 46.91 ? 92   HIS A CD2 1 
ATOM   297   C  CE1 . HIS A  1  92  ? 49.038  37.040  59.289  1.00 46.91 ? 92   HIS A CE1 1 
ATOM   298   N  NE2 . HIS A  1  92  ? 48.155  37.679  60.036  1.00 46.91 ? 92   HIS A NE2 1 
ATOM   299   N  N   . PHE A  1  93  ? 48.192  32.465  61.623  1.00 46.91 ? 93   PHE A N   1 
ATOM   300   C  CA  . PHE A  1  93  ? 47.600  31.581  60.620  1.00 46.91 ? 93   PHE A CA  1 
ATOM   301   C  C   . PHE A  1  93  ? 47.381  32.258  59.265  1.00 46.91 ? 93   PHE A C   1 
ATOM   302   O  O   . PHE A  1  93  ? 46.349  32.885  59.032  1.00 46.91 ? 93   PHE A O   1 
ATOM   303   C  CB  . PHE A  1  93  ? 46.277  30.999  61.135  1.00 46.91 ? 93   PHE A CB  1 
ATOM   304   N  N   . TYR A  1  94  ? 48.373  32.149  58.388  1.00 46.91 ? 94   TYR A N   1 
ATOM   305   C  CA  . TYR A  1  94  ? 48.294  32.733  57.053  1.00 46.91 ? 94   TYR A CA  1 
ATOM   306   C  C   . TYR A  1  94  ? 49.100  31.894  56.063  1.00 46.91 ? 94   TYR A C   1 
ATOM   307   O  O   . TYR A  1  94  ? 48.611  30.887  55.551  1.00 46.91 ? 94   TYR A O   1 
ATOM   308   C  CB  . TYR A  1  94  ? 48.797  34.180  57.065  1.00 46.91 ? 94   TYR A CB  1 
ATOM   309   N  N   . PRO A  1  95  ? 50.346  32.304  55.776  1.00 46.91 ? 95   PRO A N   1 
ATOM   310   C  CA  . PRO A  1  95  ? 51.192  31.556  54.837  1.00 46.91 ? 95   PRO A CA  1 
ATOM   311   C  C   . PRO A  1  95  ? 51.696  30.249  55.449  1.00 46.91 ? 95   PRO A C   1 
ATOM   312   O  O   . PRO A  1  95  ? 52.053  29.313  54.730  1.00 46.91 ? 95   PRO A O   1 
ATOM   313   C  CB  . PRO A  1  95  ? 52.347  32.520  54.557  1.00 46.91 ? 95   PRO A CB  1 
ATOM   314   N  N   . ILE A  1  96  ? 51.766  30.217  56.777  1.00 46.91 ? 96   ILE A N   1 
ATOM   315   C  CA  . ILE A  1  96  ? 52.220  29.038  57.506  1.00 46.91 ? 96   ILE A CA  1 
ATOM   316   C  C   . ILE A  1  96  ? 51.085  28.477  58.357  1.00 46.91 ? 96   ILE A C   1 
ATOM   317   O  O   . ILE A  1  96  ? 50.867  28.921  59.488  1.00 46.91 ? 96   ILE A O   1 
ATOM   318   C  CB  . ILE A  1  96  ? 53.419  29.369  58.416  1.00 46.91 ? 96   ILE A CB  1 
ATOM   319   N  N   . TRP A  1  97  ? 50.374  27.497  57.806  1.00 46.91 ? 97   TRP A N   1 
ATOM   320   C  CA  . TRP A  1  97  ? 49.251  26.868  58.495  1.00 46.91 ? 97   TRP A CA  1 
ATOM   321   C  C   . TRP A  1  97  ? 49.677  26.175  59.790  1.00 46.91 ? 97   TRP A C   1 
ATOM   322   O  O   . TRP A  1  97  ? 49.080  26.396  60.845  1.00 46.91 ? 97   TRP A O   1 
ATOM   323   C  CB  . TRP A  1  97  ? 48.557  25.851  57.583  1.00 46.91 ? 97   TRP A CB  1 
ATOM   324   C  CG  . TRP A  1  97  ? 48.113  26.379  56.240  1.00 46.91 ? 97   TRP A CG  1 
ATOM   325   C  CD1 . TRP A  1  97  ? 48.494  25.909  55.017  1.00 46.91 ? 97   TRP A CD1 1 
ATOM   326   C  CD2 . TRP A  1  97  ? 47.167  27.432  55.988  1.00 46.91 ? 97   TRP A CD2 1 
ATOM   327   N  NE1 . TRP A  1  97  ? 47.843  26.594  54.019  1.00 46.91 ? 97   TRP A NE1 1 
ATOM   328   C  CE2 . TRP A  1  97  ? 47.024  27.534  54.585  1.00 46.91 ? 97   TRP A CE2 1 
ATOM   329   C  CE3 . TRP A  1  97  ? 46.428  28.296  56.807  1.00 46.91 ? 97   TRP A CE3 1 
ATOM   330   C  CZ2 . TRP A  1  97  ? 46.169  28.465  53.983  1.00 46.91 ? 97   TRP A CZ2 1 
ATOM   331   C  CZ3 . TRP A  1  97  ? 45.575  29.225  56.205  1.00 46.91 ? 97   TRP A CZ3 1 
ATOM   332   C  CH2 . TRP A  1  97  ? 45.456  29.299  54.806  1.00 46.91 ? 97   TRP A CH2 1 
ATOM   333   N  N   . GLU A  1  98  ? 50.718  25.348  59.703  1.00 46.91 ? 98   GLU A N   1 
ATOM   334   C  CA  . GLU A  1  98  ? 51.234  24.604  60.853  1.00 46.91 ? 98   GLU A CA  1 
ATOM   335   C  C   . GLU A  1  98  ? 50.188  23.610  61.368  1.00 46.91 ? 98   GLU A C   1 
ATOM   336   O  O   . GLU A  1  98  ? 49.595  22.879  60.576  1.00 46.91 ? 98   GLU A O   1 
ATOM   337   C  CB  . GLU A  1  98  ? 51.675  25.562  61.968  1.00 46.91 ? 98   GLU A CB  1 
ATOM   338   N  N   . ALA A  1  99  ? 49.989  23.570  62.686  1.00 46.91 ? 99   ALA A N   1 
ATOM   339   C  CA  . ALA A  1  99  ? 49.015  22.677  63.317  1.00 46.91 ? 99   ALA A CA  1 
ATOM   340   C  C   . ALA A  1  99  ? 49.126  21.228  62.837  1.00 46.91 ? 99   ALA A C   1 
ATOM   341   O  O   . ALA A  1  99  ? 49.932  20.455  63.362  1.00 46.91 ? 99   ALA A O   1 
ATOM   342   C  CB  . ALA A  1  99  ? 47.596  23.211  63.102  1.00 46.91 ? 99   ALA A CB  1 
ATOM   343   N  N   . ALA A  1  100 ? 48.286  20.858  61.873  1.00 46.91 ? 100  ALA A N   1 
ATOM   344   C  CA  . ALA A  1  100 ? 48.287  19.513  61.309  1.00 46.91 ? 100  ALA A CA  1 
ATOM   345   C  C   . ALA A  1  100 ? 48.562  19.585  59.808  1.00 46.91 ? 100  ALA A C   1 
ATOM   346   O  O   . ALA A  1  100 ? 49.693  19.359  59.366  1.00 46.91 ? 100  ALA A O   1 
ATOM   347   C  CB  . ALA A  1  100 ? 46.948  18.827  61.574  1.00 46.91 ? 100  ALA A CB  1 
ATOM   348   N  N   . SER A  1  101 ? 47.520  19.879  59.031  1.00 46.91 ? 101  SER A N   1 
ATOM   349   C  CA  . SER A  1  101 ? 47.625  19.994  57.577  1.00 46.91 ? 101  SER A CA  1 
ATOM   350   C  C   . SER A  1  101 ? 46.275  20.323  56.944  1.00 46.91 ? 101  SER A C   1 
ATOM   351   O  O   . SER A  1  101 ? 46.022  21.464  56.557  1.00 46.91 ? 101  SER A O   1 
ATOM   352   C  CB  . SER A  1  101 ? 48.177  18.704  56.967  1.00 46.91 ? 101  SER A CB  1 
ATOM   353   N  N   . LEU A  1  102 ? 45.427  19.307  56.803  1.00 46.91 ? 102  LEU A N   1 
ATOM   354   C  CA  . LEU A  1  102 ? 44.106  19.484  56.211  1.00 46.91 ? 102  LEU A CA  1 
ATOM   355   C  C   . LEU A  1  102 ? 43.038  19.826  57.248  1.00 46.91 ? 102  LEU A C   1 
ATOM   356   O  O   . LEU A  1  102 ? 41.958  20.302  56.897  1.00 46.91 ? 102  LEU A O   1 
ATOM   357   C  CB  . LEU A  1  102 ? 43.697  18.223  55.443  1.00 46.91 ? 102  LEU A CB  1 
ATOM   358   N  N   . ASP A  1  103 ? 43.322  19.532  58.514  1.00 46.91 ? 103  ASP A N   1 
ATOM   359   C  CA  . ASP A  1  103 ? 42.382  19.817  59.594  1.00 46.91 ? 103  ASP A CA  1 
ATOM   360   C  C   . ASP A  1  103 ? 42.499  21.262  60.083  1.00 46.91 ? 103  ASP A C   1 
ATOM   361   O  O   . ASP A  1  103 ? 41.714  21.705  60.926  1.00 46.91 ? 103  ASP A O   1 
ATOM   362   C  CB  . ASP A  1  103 ? 42.606  18.850  60.761  1.00 46.91 ? 103  ASP A CB  1 
ATOM   363   N  N   . GLU A  1  104 ? 43.497  21.975  59.569  1.00 46.91 ? 104  GLU A N   1 
ATOM   364   C  CA  . GLU A  1  104 ? 43.731  23.367  59.942  1.00 46.91 ? 104  GLU A CA  1 
ATOM   365   C  C   . GLU A  1  104 ? 43.004  24.332  59.012  1.00 46.91 ? 104  GLU A C   1 
ATOM   366   O  O   . GLU A  1  104 ? 42.416  25.317  59.461  1.00 46.91 ? 104  GLU A O   1 
ATOM   367   C  CB  . GLU A  1  104 ? 45.231  23.669  59.933  1.00 46.91 ? 104  GLU A CB  1 
ATOM   368   N  N   . TRP A  1  105 ? 43.065  24.053  57.713  1.00 46.91 ? 105  TRP A N   1 
ATOM   369   C  CA  . TRP A  1  105 ? 42.421  24.891  56.707  1.00 46.91 ? 105  TRP A CA  1 
ATOM   370   C  C   . TRP A  1  105 ? 40.902  24.709  56.664  1.00 46.91 ? 105  TRP A C   1 
ATOM   371   O  O   . TRP A  1  105 ? 40.210  25.417  55.929  1.00 46.91 ? 105  TRP A O   1 
ATOM   372   C  CB  . TRP A  1  105 ? 43.017  24.602  55.326  1.00 46.91 ? 105  TRP A CB  1 
ATOM   373   N  N   . LEU A  1  106 ? 40.393  23.739  57.418  1.00 46.91 ? 106  LEU A N   1 
ATOM   374   C  CA  . LEU A  1  106 ? 38.958  23.474  57.459  1.00 46.91 ? 106  LEU A CA  1 
ATOM   375   C  C   . LEU A  1  106 ? 38.341  23.895  58.794  1.00 46.91 ? 106  LEU A C   1 
ATOM   376   O  O   . LEU A  1  106 ? 37.335  23.326  59.234  1.00 46.91 ? 106  LEU A O   1 
ATOM   377   C  CB  . LEU A  1  106 ? 38.683  21.992  57.194  1.00 46.91 ? 106  LEU A CB  1 
ATOM   378   N  N   . TYR A  1  107 ? 38.943  24.894  59.431  1.00 46.91 ? 107  TYR A N   1 
ATOM   379   C  CA  . TYR A  1  107 ? 38.461  25.396  60.712  1.00 46.91 ? 107  TYR A CA  1 
ATOM   380   C  C   . TYR A  1  107 ? 38.442  26.922  60.738  1.00 46.91 ? 107  TYR A C   1 
ATOM   381   O  O   . TYR A  1  107 ? 39.431  27.568  60.387  1.00 46.91 ? 107  TYR A O   1 
ATOM   382   C  CB  . TYR A  1  107 ? 39.335  24.866  61.850  1.00 46.91 ? 107  TYR A CB  1 
ATOM   383   N  N   . ASN A  1  108 ? 37.321  27.484  61.182  1.00 46.91 ? 108  ASN A N   1 
ATOM   384   C  CA  . ASN A  1  108 ? 37.143  28.933  61.267  1.00 46.91 ? 108  ASN A CA  1 
ATOM   385   C  C   . ASN A  1  108 ? 37.344  29.621  59.914  1.00 46.91 ? 108  ASN A C   1 
ATOM   386   O  O   . ASN A  1  108 ? 36.824  29.158  58.896  1.00 46.91 ? 108  ASN A O   1 
ATOM   387   C  CB  . ASN A  1  108 ? 38.083  29.530  62.323  1.00 46.91 ? 108  ASN A CB  1 
ATOM   388   N  N   . GLY A  1  109 ? 38.081  30.731  59.912  1.00 46.91 ? 109  GLY A N   1 
ATOM   389   C  CA  . GLY A  1  109 ? 38.334  31.461  58.681  1.00 46.91 ? 109  GLY A CA  1 
ATOM   390   C  C   . GLY A  1  109 ? 39.030  30.618  57.630  1.00 46.91 ? 109  GLY A C   1 
ATOM   391   O  O   . GLY A  1  109 ? 38.629  30.614  56.463  1.00 46.91 ? 109  GLY A O   1 
ATOM   392   N  N   . GLY A  1  110 ? 40.075  29.909  58.042  1.00 46.91 ? 110  GLY A N   1 
ATOM   393   C  CA  . GLY A  1  110 ? 40.813  29.062  57.122  1.00 46.91 ? 110  GLY A CA  1 
ATOM   394   C  C   . GLY A  1  110 ? 41.524  29.828  56.023  1.00 46.91 ? 110  GLY A C   1 
ATOM   395   O  O   . GLY A  1  110 ? 42.465  30.576  56.294  1.00 46.91 ? 110  GLY A O   1 
ATOM   396   N  N   . PRO A  1  111 ? 41.104  29.645  54.761  1.00 46.91 ? 111  PRO A N   1 
ATOM   397   C  CA  . PRO A  1  111 ? 41.666  30.292  53.571  1.00 46.91 ? 111  PRO A CA  1 
ATOM   398   C  C   . PRO A  1  111 ? 41.356  31.785  53.466  1.00 46.91 ? 111  PRO A C   1 
ATOM   399   O  O   . PRO A  1  111 ? 41.970  32.492  52.665  1.00 46.91 ? 111  PRO A O   1 
ATOM   400   C  CB  . PRO A  1  111 ? 41.033  29.518  52.414  1.00 46.91 ? 111  PRO A CB  1 
ATOM   401   N  N   . TYR A  1  112 ? 40.383  32.252  54.245  1.00 46.91 ? 112  TYR A N   1 
ATOM   402   C  CA  . TYR A  1  112 ? 39.997  33.660  54.228  1.00 46.91 ? 112  TYR A CA  1 
ATOM   403   C  C   . TYR A  1  112 ? 41.072  34.547  54.855  1.00 46.91 ? 112  TYR A C   1 
ATOM   404   O  O   . TYR A  1  112 ? 41.147  35.741  54.567  1.00 46.91 ? 112  TYR A O   1 
ATOM   405   C  CB  . TYR A  1  112 ? 38.663  33.862  54.956  1.00 46.91 ? 112  TYR A CB  1 
ATOM   406   C  CG  . TYR A  1  112 ? 38.026  35.213  54.705  1.00 46.91 ? 112  TYR A CG  1 
ATOM   407   C  CD1 . TYR A  1  112 ? 37.970  36.180  55.708  1.00 46.91 ? 112  TYR A CD1 1 
ATOM   408   C  CD2 . TYR A  1  112 ? 37.487  35.526  53.457  1.00 46.91 ? 112  TYR A CD2 1 
ATOM   409   C  CE1 . TYR A  1  112 ? 37.392  37.428  55.475  1.00 46.91 ? 112  TYR A CE1 1 
ATOM   410   C  CE2 . TYR A  1  112 ? 36.907  36.767  53.214  1.00 46.91 ? 112  TYR A CE2 1 
ATOM   411   C  CZ  . TYR A  1  112 ? 36.863  37.713  54.224  1.00 46.91 ? 112  TYR A CZ  1 
ATOM   412   O  OH  . TYR A  1  112 ? 36.292  38.942  53.977  1.00 46.91 ? 112  TYR A OH  1 
ATOM   413   N  N   . GLN A  1  113 ? 41.883  33.961  55.730  1.00 46.91 ? 113  GLN A N   1 
ATOM   414   C  CA  . GLN A  1  113 ? 42.957  34.688  56.400  1.00 46.91 ? 113  GLN A CA  1 
ATOM   415   C  C   . GLN A  1  113 ? 44.045  35.104  55.409  1.00 46.91 ? 113  GLN A C   1 
ATOM   416   O  O   . GLN A  1  113 ? 44.773  36.074  55.639  1.00 46.91 ? 113  GLN A O   1 
ATOM   417   C  CB  . GLN A  1  113 ? 43.562  33.828  57.511  1.00 46.91 ? 113  GLN A CB  1 
ATOM   418   N  N   . LEU A  1  114 ? 44.172  34.341  54.327  1.00 46.91 ? 114  LEU A N   1 
ATOM   419   C  CA  . LEU A  1  114 ? 45.156  34.618  53.287  1.00 46.91 ? 114  LEU A CA  1 
ATOM   420   C  C   . LEU A  1  114 ? 44.549  35.503  52.199  1.00 46.91 ? 114  LEU A C   1 
ATOM   421   O  O   . LEU A  1  114 ? 45.248  36.311  51.584  1.00 46.91 ? 114  LEU A O   1 
ATOM   422   C  CB  . LEU A  1  114 ? 45.658  33.309  52.672  1.00 46.91 ? 114  LEU A CB  1 
ATOM   423   N  N   . ILE A  1  115 ? 43.253  35.322  51.953  1.00 46.91 ? 115  ILE A N   1 
ATOM   424   C  CA  . ILE A  1  115 ? 42.529  36.086  50.941  1.00 46.91 ? 115  ILE A CA  1 
ATOM   425   C  C   . ILE A  1  115 ? 42.305  37.537  51.360  1.00 46.91 ? 115  ILE A C   1 
ATOM   426   O  O   . ILE A  1  115 ? 42.300  38.437  50.518  1.00 46.91 ? 115  ILE A O   1 
ATOM   427   C  CB  . ILE A  1  115 ? 41.162  35.446  50.631  1.00 46.91 ? 115  ILE A CB  1 
ATOM   428   N  N   . ILE A  1  116 ? 42.084  37.749  52.654  1.00 46.91 ? 116  ILE A N   1 
ATOM   429   C  CA  . ILE A  1  116 ? 41.864  39.087  53.194  1.00 46.91 ? 116  ILE A CA  1 
ATOM   430   C  C   . ILE A  1  116 ? 43.142  39.911  53.092  1.00 46.91 ? 116  ILE A C   1 
ATOM   431   O  O   . ILE A  1  116 ? 43.098  41.134  52.949  1.00 46.91 ? 116  ILE A O   1 
ATOM   432   C  CB  . ILE A  1  116 ? 41.425  39.033  54.670  1.00 46.91 ? 116  ILE A CB  1 
ATOM   433   N  N   . PHE A  1  117 ? 44.282  39.234  53.206  1.00 46.91 ? 117  PHE A N   1 
ATOM   434   C  CA  . PHE A  1  117 ? 45.581  39.888  53.114  1.00 46.91 ? 117  PHE A CA  1 
ATOM   435   C  C   . PHE A  1  117 ? 45.855  40.331  51.679  1.00 46.91 ? 117  PHE A C   1 
ATOM   436   O  O   . PHE A  1  117 ? 46.708  41.186  51.435  1.00 46.91 ? 117  PHE A O   1 
ATOM   437   C  CB  . PHE A  1  117 ? 46.686  38.939  53.585  1.00 46.91 ? 117  PHE A CB  1 
ATOM   438   N  N   . HIS A  1  118 ? 45.148  39.717  50.733  1.00 46.91 ? 118  HIS A N   1 
ATOM   439   C  CA  . HIS A  1  118 ? 45.298  40.037  49.319  1.00 46.91 ? 118  HIS A CA  1 
ATOM   440   C  C   . HIS A  1  118 ? 44.439  41.225  48.907  1.00 46.91 ? 118  HIS A C   1 
ATOM   441   O  O   . HIS A  1  118 ? 44.690  41.843  47.872  1.00 46.91 ? 118  HIS A O   1 
ATOM   442   C  CB  . HIS A  1  118 ? 44.945  38.823  48.459  1.00 46.91 ? 118  HIS A CB  1 
ATOM   443   C  CG  . HIS A  1  118 ? 45.831  37.639  48.691  1.00 46.91 ? 118  HIS A CG  1 
ATOM   444   N  ND1 . HIS A  1  118 ? 47.121  37.757  49.162  1.00 46.91 ? 118  HIS A ND1 1 
ATOM   445   C  CD2 . HIS A  1  118 ? 45.610  36.315  48.522  1.00 46.91 ? 118  HIS A CD2 1 
ATOM   446   C  CE1 . HIS A  1  118 ? 47.656  36.554  49.274  1.00 46.91 ? 118  HIS A CE1 1 
ATOM   447   N  NE2 . HIS A  1  118 ? 46.762  35.662  48.892  1.00 46.91 ? 118  HIS A NE2 1 
ATOM   448   N  N   . PHE A  1  119 ? 43.404  41.515  49.690  1.00 46.91 ? 119  PHE A N   1 
ATOM   449   C  CA  . PHE A  1  119 ? 42.516  42.637  49.404  1.00 46.91 ? 119  PHE A CA  1 
ATOM   450   C  C   . PHE A  1  119 ? 43.208  43.969  49.675  1.00 46.91 ? 119  PHE A C   1 
ATOM   451   O  O   . PHE A  1  119 ? 42.902  44.976  49.036  1.00 46.91 ? 119  PHE A O   1 
ATOM   452   C  CB  . PHE A  1  119 ? 41.226  42.534  50.224  1.00 46.91 ? 119  PHE A CB  1 
ATOM   453   C  CG  . PHE A  1  119 ? 40.292  41.445  49.764  1.00 46.91 ? 119  PHE A CG  1 
ATOM   454   C  CD1 . PHE A  1  119 ? 39.577  40.691  50.688  1.00 46.91 ? 119  PHE A CD1 1 
ATOM   455   C  CD2 . PHE A  1  119 ? 40.123  41.177  48.408  1.00 46.91 ? 119  PHE A CD2 1 
ATOM   456   C  CE1 . PHE A  1  119 ? 38.704  39.685  50.270  1.00 46.91 ? 119  PHE A CE1 1 
ATOM   457   C  CE2 . PHE A  1  119 ? 39.253  40.175  47.979  1.00 46.91 ? 119  PHE A CE2 1 
ATOM   458   C  CZ  . PHE A  1  119 ? 38.543  39.428  48.913  1.00 46.91 ? 119  PHE A CZ  1 
ATOM   459   N  N   . LEU A  1  120 ? 44.120  43.978  50.643  1.00 46.91 ? 120  LEU A N   1 
ATOM   460   C  CA  . LEU A  1  120 ? 44.861  45.185  50.992  1.00 46.91 ? 120  LEU A CA  1 
ATOM   461   C  C   . LEU A  1  120 ? 46.009  45.399  50.007  1.00 46.91 ? 120  LEU A C   1 
ATOM   462   O  O   . LEU A  1  120 ? 46.511  46.515  49.854  1.00 46.91 ? 120  LEU A O   1 
ATOM   463   C  CB  . LEU A  1  120 ? 45.411  45.080  52.416  1.00 46.91 ? 120  LEU A CB  1 
ATOM   464   N  N   . LEU A  1  121 ? 46.447  44.312  49.378  1.00 46.91 ? 121  LEU A N   1 
ATOM   465   C  CA  . LEU A  1  121 ? 47.530  44.350  48.404  1.00 46.91 ? 121  LEU A CA  1 
ATOM   466   C  C   . LEU A  1  121 ? 46.991  44.533  46.988  1.00 46.91 ? 121  LEU A C   1 
ATOM   467   O  O   . LEU A  1  121 ? 47.670  45.086  46.122  1.00 46.91 ? 121  LEU A O   1 
ATOM   468   C  CB  . LEU A  1  121 ? 48.351  43.061  48.479  1.00 46.91 ? 121  LEU A CB  1 
ATOM   469   N  N   . GLY A  1  122 ? 45.780  44.032  46.758  1.00 46.91 ? 122  GLY A N   1 
ATOM   470   C  CA  . GLY A  1  122 ? 45.156  44.137  45.453  1.00 46.91 ? 122  GLY A CA  1 
ATOM   471   C  C   . GLY A  1  122 ? 44.493  45.481  45.222  1.00 46.91 ? 122  GLY A C   1 
ATOM   472   O  O   . GLY A  1  122 ? 44.538  46.013  44.112  1.00 46.91 ? 122  GLY A O   1 
ATOM   473   N  N   . ALA A  1  123 ? 43.841  46.008  46.255  1.00 46.91 ? 123  ALA A N   1 
ATOM   474   C  CA  . ALA A  1  123 ? 43.172  47.300  46.167  1.00 46.91 ? 123  ALA A CA  1 
ATOM   475   C  C   . ALA A  1  123 ? 44.193  48.430  46.162  1.00 46.91 ? 123  ALA A C   1 
ATOM   476   O  O   . ALA A  1  123 ? 43.977  49.471  45.545  1.00 46.91 ? 123  ALA A O   1 
ATOM   477   C  CB  . ALA A  1  123 ? 42.201  47.470  47.327  1.00 46.91 ? 123  ALA A CB  1 
ATOM   478   N  N   . SER A  1  124 ? 45.285  48.231  46.894  1.00 46.91 ? 124  SER A N   1 
ATOM   479   C  CA  . SER A  1  124 ? 46.349  49.223  46.977  1.00 46.91 ? 124  SER A CA  1 
ATOM   480   C  C   . SER A  1  124 ? 47.117  49.281  45.660  1.00 46.91 ? 124  SER A C   1 
ATOM   481   O  O   . SER A  1  124 ? 47.693  50.315  45.310  1.00 46.91 ? 124  SER A O   1 
ATOM   482   C  CB  . SER A  1  124 ? 47.302  48.880  48.122  1.00 46.91 ? 124  SER A CB  1 
ATOM   483   N  N   . CYS A  1  125 ? 47.157  48.150  44.963  1.00 46.91 ? 125  CYS A N   1 
ATOM   484   C  CA  . CYS A  1  125 ? 47.833  48.042  43.677  1.00 46.91 ? 125  CYS A CA  1 
ATOM   485   C  C   . CYS A  1  125 ? 46.896  48.481  42.554  1.00 46.91 ? 125  CYS A C   1 
ATOM   486   O  O   . CYS A  1  125 ? 47.345  48.860  41.474  1.00 46.91 ? 125  CYS A O   1 
ATOM   487   C  CB  . CYS A  1  125 ? 48.291  46.601  43.445  1.00 46.91 ? 125  CYS A CB  1 
ATOM   488   N  N   . TYR A  1  126 ? 45.593  48.392  42.809  1.00 46.91 ? 126  TYR A N   1 
ATOM   489   C  CA  . TYR A  1  126 ? 44.579  48.786  41.838  1.00 46.91 ? 126  TYR A CA  1 
ATOM   490   C  C   . TYR A  1  126 ? 44.448  50.307  41.793  1.00 46.91 ? 126  TYR A C   1 
ATOM   491   O  O   . TYR A  1  126 ? 43.807  50.860  40.895  1.00 46.91 ? 126  TYR A O   1 
ATOM   492   C  CB  . TYR A  1  126 ? 43.227  48.165  42.196  1.00 46.91 ? 126  TYR A CB  1 
ATOM   493   N  N   . MET A  1  127 ? 45.019  50.968  42.795  1.00 46.91 ? 127  MET A N   1 
ATOM   494   C  CA  . MET A  1  127 ? 44.996  52.424  42.896  1.00 46.91 ? 127  MET A CA  1 
ATOM   495   C  C   . MET A  1  127 ? 46.390  52.994  42.653  1.00 46.91 ? 127  MET A C   1 
ATOM   496   O  O   . MET A  1  127 ? 46.536  54.157  42.274  1.00 46.91 ? 127  MET A O   1 
ATOM   497   C  CB  . MET A  1  127 ? 44.505  52.849  44.280  1.00 46.91 ? 127  MET A CB  1 
ATOM   498   N  N   . GLY A  1  128 ? 47.407  52.184  42.934  1.00 46.91 ? 128  GLY A N   1 
ATOM   499   C  CA  . GLY A  1  128 ? 48.781  52.609  42.739  1.00 46.91 ? 128  GLY A CA  1 
ATOM   500   C  C   . GLY A  1  128 ? 49.212  52.512  41.288  1.00 46.91 ? 128  GLY A C   1 
ATOM   501   O  O   . GLY A  1  128 ? 49.997  53.334  40.813  1.00 46.91 ? 128  GLY A O   1 
ATOM   502   N  N   . ARG A  1  129 ? 48.737  51.477  40.600  1.00 46.91 ? 129  ARG A N   1 
ATOM   503   C  CA  . ARG A  1  129 ? 49.057  51.265  39.192  1.00 46.91 ? 129  ARG A CA  1 
ATOM   504   C  C   . ARG A  1  129 ? 48.129  52.083  38.300  1.00 46.91 ? 129  ARG A C   1 
ATOM   505   O  O   . ARG A  1  129 ? 48.426  52.311  37.126  1.00 46.91 ? 129  ARG A O   1 
ATOM   506   C  CB  . ARG A  1  129 ? 48.948  49.780  38.836  1.00 46.91 ? 129  ARG A CB  1 
ATOM   507   N  N   . GLN A  1  130 ? 46.981  52.473  38.847  1.00 46.91 ? 130  GLN A N   1 
ATOM   508   C  CA  . GLN A  1  130 ? 46.009  53.272  38.112  1.00 46.91 ? 130  GLN A CA  1 
ATOM   509   C  C   . GLN A  1  130 ? 46.494  54.718  38.025  1.00 46.91 ? 130  GLN A C   1 
ATOM   510   O  O   . GLN A  1  130 ? 46.225  55.416  37.046  1.00 46.91 ? 130  GLN A O   1 
ATOM   511   C  CB  . GLN A  1  130 ? 44.646  53.226  38.806  1.00 46.91 ? 130  GLN A CB  1 
ATOM   512   N  N   . TRP A  1  131 ? 47.188  55.163  39.069  1.00 46.91 ? 131  TRP A N   1 
ATOM   513   C  CA  . TRP A  1  131 ? 47.728  56.516  39.135  1.00 46.91 ? 131  TRP A CA  1 
ATOM   514   C  C   . TRP A  1  131 ? 49.132  56.592  38.541  1.00 46.91 ? 131  TRP A C   1 
ATOM   515   O  O   . TRP A  1  131 ? 49.762  57.653  38.551  1.00 46.91 ? 131  TRP A O   1 
ATOM   516   C  CB  . TRP A  1  131 ? 47.748  57.003  40.586  1.00 46.91 ? 131  TRP A CB  1 
ATOM   517   N  N   . GLU A  1  132 ? 49.629  55.457  38.060  1.00 46.91 ? 132  GLU A N   1 
ATOM   518   C  CA  . GLU A  1  132 ? 50.956  55.380  37.458  1.00 46.91 ? 132  GLU A CA  1 
ATOM   519   C  C   . GLU A  1  132 ? 50.848  55.169  35.951  1.00 46.91 ? 132  GLU A C   1 
ATOM   520   O  O   . GLU A  1  132 ? 51.760  55.516  35.198  1.00 46.91 ? 132  GLU A O   1 
ATOM   521   C  CB  . GLU A  1  132 ? 51.753  54.236  38.085  1.00 46.91 ? 132  GLU A CB  1 
ATOM   522   N  N   . LEU A  1  133 ? 49.750  54.552  35.525  1.00 46.91 ? 133  LEU A N   1 
ATOM   523   C  CA  . LEU A  1  133 ? 49.502  54.295  34.113  1.00 46.91 ? 133  LEU A CA  1 
ATOM   524   C  C   . LEU A  1  133 ? 48.532  55.342  33.570  1.00 46.91 ? 133  LEU A C   1 
ATOM   525   O  O   . LEU A  1  133 ? 47.726  55.060  32.676  1.00 46.91 ? 133  LEU A O   1 
ATOM   526   C  CB  . LEU A  1  133 ? 48.926  52.889  33.925  1.00 46.91 ? 133  LEU A CB  1 
ATOM   527   N  N   . SER A  1  134 ? 48.626  56.553  34.110  1.00 46.91 ? 134  SER A N   1 
ATOM   528   C  CA  . SER A  1  134 ? 47.773  57.662  33.705  1.00 46.91 ? 134  SER A CA  1 
ATOM   529   C  C   . SER A  1  134 ? 48.590  58.946  33.607  1.00 46.91 ? 134  SER A C   1 
ATOM   530   O  O   . SER A  1  134 ? 48.422  59.731  32.672  1.00 46.91 ? 134  SER A O   1 
ATOM   531   C  CB  . SER A  1  134 ? 46.645  57.851  34.717  1.00 46.91 ? 134  SER A CB  1 
ATOM   532   N  N   . TYR A  1  135 ? 49.460  59.159  34.589  1.00 46.91 ? 135  TYR A N   1 
ATOM   533   C  CA  . TYR A  1  135 ? 50.314  60.341  34.626  1.00 46.91 ? 135  TYR A CA  1 
ATOM   534   C  C   . TYR A  1  135 ? 51.603  60.100  33.845  1.00 46.91 ? 135  TYR A C   1 
ATOM   535   O  O   . TYR A  1  135 ? 52.174  61.029  33.272  1.00 46.91 ? 135  TYR A O   1 
ATOM   536   C  CB  . TYR A  1  135 ? 50.648  60.705  36.074  1.00 46.91 ? 135  TYR A CB  1 
ATOM   537   N  N   . ARG A  1  136 ? 52.083  58.862  33.878  1.00 46.91 ? 136  ARG A N   1 
ATOM   538   C  CA  . ARG A  1  136 ? 53.304  58.491  33.174  1.00 46.91 ? 136  ARG A CA  1 
ATOM   539   C  C   . ARG A  1  136 ? 53.001  58.070  31.738  1.00 46.91 ? 136  ARG A C   1 
ATOM   540   O  O   . ARG A  1  136 ? 53.889  58.074  30.880  1.00 46.91 ? 136  ARG A O   1 
ATOM   541   C  CB  . ARG A  1  136 ? 54.017  57.358  33.914  1.00 46.91 ? 136  ARG A CB  1 
ATOM   542   N  N   . LEU A  1  137 ? 51.752  57.684  31.492  1.00 46.91 ? 137  LEU A N   1 
ATOM   543   C  CA  . LEU A  1  137 ? 51.308  57.262  30.168  1.00 46.91 ? 137  LEU A CA  1 
ATOM   544   C  C   . LEU A  1  137 ? 50.925  58.458  29.299  1.00 46.91 ? 137  LEU A C   1 
ATOM   545   O  O   . LEU A  1  137 ? 51.034  58.404  28.071  1.00 46.91 ? 137  LEU A O   1 
ATOM   546   C  CB  . LEU A  1  137 ? 50.119  56.308  30.290  1.00 46.91 ? 137  LEU A CB  1 
ATOM   547   N  N   . GLY A  1  138 ? 50.467  59.528  29.939  1.00 46.91 ? 138  GLY A N   1 
ATOM   548   C  CA  . GLY A  1  138 ? 50.075  60.720  29.210  1.00 46.91 ? 138  GLY A CA  1 
ATOM   549   C  C   . GLY A  1  138 ? 49.840  61.907  30.122  1.00 46.91 ? 138  GLY A C   1 
ATOM   550   O  O   . GLY A  1  138 ? 50.781  62.614  30.492  1.00 46.91 ? 138  GLY A O   1 
ATOM   551   N  N   . MET A  1  139 ? 48.576  62.151  30.454  1.00 46.91 ? 139  MET A N   1 
ATOM   552   C  CA  . MET A  1  139 ? 48.205  63.259  31.326  1.00 46.91 ? 139  MET A CA  1 
ATOM   553   C  C   . MET A  1  139 ? 46.819  63.028  31.914  1.00 46.91 ? 139  MET A C   1 
ATOM   554   O  O   . MET A  1  139 ? 45.804  63.355  31.289  1.00 46.91 ? 139  MET A O   1 
ATOM   555   C  CB  . MET A  1  139 ? 48.230  64.582  30.551  1.00 46.91 ? 139  MET A CB  1 
ATOM   556   N  N   . ARG A  1  140 ? 46.782  62.482  33.126  1.00 46.91 ? 140  ARG A N   1 
ATOM   557   C  CA  . ARG A  1  140 ? 45.525  62.200  33.808  1.00 46.91 ? 140  ARG A CA  1 
ATOM   558   C  C   . ARG A  1  140 ? 45.723  62.124  35.322  1.00 46.91 ? 140  ARG A C   1 
ATOM   559   O  O   . ARG A  1  140 ? 45.732  61.040  35.907  1.00 46.91 ? 140  ARG A O   1 
ATOM   560   C  CB  . ARG A  1  140 ? 44.924  60.890  33.291  1.00 46.91 ? 140  ARG A CB  1 
ATOM   561   N  N   . PRO A  1  141 ? 45.895  63.287  35.971  1.00 46.91 ? 141  PRO A N   1 
ATOM   562   C  CA  . PRO A  1  141 ? 46.097  63.392  37.420  1.00 46.91 ? 141  PRO A CA  1 
ATOM   563   C  C   . PRO A  1  141 ? 44.836  63.059  38.214  1.00 46.91 ? 141  PRO A C   1 
ATOM   564   O  O   . PRO A  1  141 ? 43.717  63.313  37.757  1.00 46.91 ? 141  PRO A O   1 
ATOM   565   C  CB  . PRO A  1  141 ? 46.516  64.849  37.615  1.00 46.91 ? 141  PRO A CB  1 
ATOM   566   N  N   . TRP A  1  142 ? 45.036  62.548  39.428  1.00 46.91 ? 142  TRP A N   1 
ATOM   567   C  CA  . TRP A  1  142 ? 43.947  62.154  40.322  1.00 46.91 ? 142  TRP A CA  1 
ATOM   568   C  C   . TRP A  1  142 ? 43.071  61.084  39.664  1.00 46.91 ? 142  TRP A C   1 
ATOM   569   O  O   . TRP A  1  142 ? 43.568  60.269  38.884  1.00 46.91 ? 142  TRP A O   1 
ATOM   570   C  CB  . TRP A  1  142 ? 43.106  63.370  40.739  1.00 46.91 ? 142  TRP A CB  1 
ATOM   571   C  CG  . TRP A  1  142 ? 43.893  64.465  41.403  1.00 46.91 ? 142  TRP A CG  1 
ATOM   572   C  CD1 . TRP A  1  142 ? 44.739  64.348  42.469  1.00 46.91 ? 142  TRP A CD1 1 
ATOM   573   C  CD2 . TRP A  1  142 ? 43.908  65.849  41.033  1.00 46.91 ? 142  TRP A CD2 1 
ATOM   574   N  NE1 . TRP A  1  142 ? 45.281  65.573  42.785  1.00 46.91 ? 142  TRP A NE1 1 
ATOM   575   C  CE2 . TRP A  1  142 ? 44.786  66.513  41.919  1.00 46.91 ? 142  TRP A CE2 1 
ATOM   576   C  CE3 . TRP A  1  142 ? 43.260  66.596  40.039  1.00 46.91 ? 142  TRP A CE3 1 
ATOM   577   C  CZ2 . TRP A  1  142 ? 45.037  67.887  41.839  1.00 46.91 ? 142  TRP A CZ2 1 
ATOM   578   C  CZ3 . TRP A  1  142 ? 43.509  67.962  39.959  1.00 46.91 ? 142  TRP A CZ3 1 
ATOM   579   C  CH2 . TRP A  1  142 ? 44.391  68.591  40.855  1.00 46.91 ? 142  TRP A CH2 1 
ATOM   580   N  N   . ILE A  1  143 ? 41.779  61.080  39.990  1.00 46.91 ? 143  ILE A N   1 
ATOM   581   C  CA  . ILE A  1  143 ? 40.827  60.110  39.442  1.00 46.91 ? 143  ILE A CA  1 
ATOM   582   C  C   . ILE A  1  143 ? 41.164  58.667  39.826  1.00 46.91 ? 143  ILE A C   1 
ATOM   583   O  O   . ILE A  1  143 ? 40.497  57.725  39.390  1.00 46.91 ? 143  ILE A O   1 
ATOM   584   C  CB  . ILE A  1  143 ? 40.729  60.212  37.903  1.00 46.91 ? 143  ILE A CB  1 
ATOM   585   N  N   . CYS A  1  144 ? 42.200  58.506  40.644  1.00 46.91 ? 144  CYS A N   1 
ATOM   586   C  CA  . CYS A  1  144 ? 42.634  57.194  41.103  1.00 46.91 ? 144  CYS A CA  1 
ATOM   587   C  C   . CYS A  1  144 ? 42.525  57.136  42.621  1.00 46.91 ? 144  CYS A C   1 
ATOM   588   O  O   . CYS A  1  144 ? 42.188  56.099  43.189  1.00 46.91 ? 144  CYS A O   1 
ATOM   589   C  CB  . CYS A  1  144 ? 44.077  56.928  40.670  1.00 46.91 ? 144  CYS A CB  1 
ATOM   590   N  N   . VAL A  1  145 ? 42.835  58.255  43.271  1.00 46.91 ? 145  VAL A N   1 
ATOM   591   C  CA  . VAL A  1  145 ? 42.759  58.348  44.725  1.00 46.91 ? 145  VAL A CA  1 
ATOM   592   C  C   . VAL A  1  145 ? 41.308  58.543  45.158  1.00 46.91 ? 145  VAL A C   1 
ATOM   593   O  O   . VAL A  1  145 ? 40.938  58.215  46.285  1.00 46.91 ? 145  VAL A O   1 
ATOM   594   C  CB  . VAL A  1  145 ? 43.597  59.529  45.254  1.00 46.91 ? 145  VAL A CB  1 
ATOM   595   N  N   . ALA A  1  146 ? 40.508  59.117  44.264  1.00 46.91 ? 146  ALA A N   1 
ATOM   596   C  CA  . ALA A  1  146 ? 39.095  59.364  44.526  1.00 46.91 ? 146  ALA A CA  1 
ATOM   597   C  C   . ALA A  1  146 ? 38.250  58.144  44.169  1.00 46.91 ? 146  ALA A C   1 
ATOM   598   O  O   . ALA A  1  146 ? 37.312  57.802  44.887  1.00 46.91 ? 146  ALA A O   1 
ATOM   599   C  CB  . ALA A  1  146 ? 38.622  60.581  43.742  1.00 46.91 ? 146  ALA A CB  1 
ATOM   600   N  N   . TYR A  1  147 ? 38.570  57.511  43.045  1.00 46.91 ? 147  TYR A N   1 
ATOM   601   C  CA  . TYR A  1  147 ? 37.845  56.326  42.594  1.00 46.91 ? 147  TYR A CA  1 
ATOM   602   C  C   . TYR A  1  147 ? 38.129  55.133  43.503  1.00 46.91 ? 147  TYR A C   1 
ATOM   603   O  O   . TYR A  1  147 ? 37.301  54.228  43.632  1.00 46.91 ? 147  TYR A O   1 
ATOM   604   C  CB  . TYR A  1  147 ? 38.226  55.984  41.151  1.00 46.91 ? 147  TYR A CB  1 
ATOM   605   N  N   . SER A  1  148 ? 39.320  55.119  44.092  1.00 46.91 ? 148  SER A N   1 
ATOM   606   C  CA  . SER A  1  148 ? 39.723  54.047  44.994  1.00 46.91 ? 148  SER A CA  1 
ATOM   607   C  C   . SER A  1  148 ? 39.113  54.245  46.377  1.00 46.91 ? 148  SER A C   1 
ATOM   608   O  O   . SER A  1  148 ? 39.126  53.334  47.204  1.00 46.91 ? 148  SER A O   1 
ATOM   609   C  CB  . SER A  1  148 ? 41.245  53.987  45.109  1.00 46.91 ? 148  SER A CB  1 
ATOM   610   N  N   . ALA A  1  149 ? 38.612  55.450  46.635  1.00 59.16 ? 149  ALA A N   1 
ATOM   611   C  CA  . ALA A  1  149 ? 37.990  55.768  47.915  1.00 59.97 ? 149  ALA A CA  1 
ATOM   612   C  C   . ALA A  1  149 ? 36.733  54.929  48.122  1.00 60.48 ? 149  ALA A C   1 
ATOM   613   O  O   . ALA A  1  149 ? 36.334  54.660  49.256  1.00 59.14 ? 149  ALA A O   1 
ATOM   614   C  CB  . ALA A  1  149 ? 37.655  57.251  47.985  1.00 58.16 ? 149  ALA A CB  1 
ATOM   615   N  N   . PRO A  1  150 ? 36.088  54.518  47.020  1.00 46.91 ? 150  PRO A N   1 
ATOM   616   C  CA  . PRO A  1  150 ? 34.868  53.706  46.972  1.00 46.91 ? 150  PRO A CA  1 
ATOM   617   C  C   . PRO A  1  150 ? 35.174  52.210  47.016  1.00 46.91 ? 150  PRO A C   1 
ATOM   618   O  O   . PRO A  1  150 ? 34.378  51.420  47.531  1.00 46.91 ? 150  PRO A O   1 
ATOM   619   C  CB  . PRO A  1  150 ? 34.233  54.101  45.638  1.00 46.91 ? 150  PRO A CB  1 
ATOM   620   N  N   . LEU A  1  151 ? 36.305  51.824  46.434  1.00 46.91 ? 151  LEU A N   1 
ATOM   621   C  CA  . LEU A  1  151 ? 36.725  50.427  46.408  1.00 46.91 ? 151  LEU A CA  1 
ATOM   622   C  C   . LEU A  1  151 ? 37.314  50.023  47.756  1.00 46.91 ? 151  LEU A C   1 
ATOM   623   O  O   . LEU A  1  151 ? 37.017  48.944  48.272  1.00 46.91 ? 151  LEU A O   1 
ATOM   624   C  CB  . LEU A  1  151 ? 37.757  50.202  45.300  1.00 46.91 ? 151  LEU A CB  1 
ATOM   625   N  N   . ALA A  1  152 ? 38.167  50.885  48.301  1.00 46.91 ? 152  ALA A N   1 
ATOM   626   C  CA  . ALA A  1  152 ? 38.805  50.642  49.589  1.00 46.91 ? 152  ALA A CA  1 
ATOM   627   C  C   . ALA A  1  152 ? 37.911  51.092  50.744  1.00 46.91 ? 152  ALA A C   1 
ATOM   628   O  O   . ALA A  1  152 ? 38.366  51.209  51.883  1.00 46.91 ? 152  ALA A O   1 
ATOM   629   C  CB  . ALA A  1  152 ? 40.151  51.355  49.651  1.00 46.91 ? 152  ALA A CB  1 
ATOM   630   N  N   . SER A  1  153 ? 36.650  51.382  50.435  1.00 46.91 ? 153  SER A N   1 
ATOM   631   C  CA  . SER A  1  153 ? 35.688  51.814  51.444  1.00 46.91 ? 153  SER A CA  1 
ATOM   632   C  C   . SER A  1  153 ? 35.075  50.600  52.133  1.00 46.91 ? 153  SER A C   1 
ATOM   633   O  O   . SER A  1  153 ? 34.734  50.650  53.314  1.00 46.91 ? 153  SER A O   1 
ATOM   634   C  CB  . SER A  1  153 ? 34.582  52.655  50.803  1.00 46.91 ? 153  SER A CB  1 
ATOM   635   N  N   . ALA A  1  154 ? 34.899  49.526  51.370  1.00 46.91 ? 154  ALA A N   1 
ATOM   636   C  CA  . ALA A  1  154 ? 34.337  48.288  51.894  1.00 46.91 ? 154  ALA A CA  1 
ATOM   637   C  C   . ALA A  1  154 ? 35.443  47.276  52.172  1.00 46.91 ? 154  ALA A C   1 
ATOM   638   O  O   . ALA A  1  154 ? 35.279  46.380  52.997  1.00 46.91 ? 154  ALA A O   1 
ATOM   639   C  CB  . ALA A  1  154 ? 33.329  47.712  50.907  1.00 46.91 ? 154  ALA A CB  1 
ATOM   640   N  N   . PHE A  1  155 ? 36.553  47.411  51.452  1.00 46.91 ? 155  PHE A N   1 
ATOM   641   C  CA  . PHE A  1  155 ? 37.698  46.518  51.609  1.00 46.91 ? 155  PHE A CA  1 
ATOM   642   C  C   . PHE A  1  155 ? 38.445  46.791  52.911  1.00 46.91 ? 155  PHE A C   1 
ATOM   643   O  O   . PHE A  1  155 ? 38.851  45.862  53.610  1.00 46.91 ? 155  PHE A O   1 
ATOM   644   C  CB  . PHE A  1  155 ? 38.653  46.670  50.422  1.00 46.91 ? 155  PHE A CB  1 
ATOM   645   N  N   . ALA A  1  156 ? 38.659  48.070  53.206  1.00 46.91 ? 156  ALA A N   1 
ATOM   646   C  CA  . ALA A  1  156 ? 39.355  48.473  54.423  1.00 46.91 ? 156  ALA A CA  1 
ATOM   647   C  C   . ALA A  1  156 ? 38.416  48.460  55.625  1.00 46.91 ? 156  ALA A C   1 
ATOM   648   O  O   . ALA A  1  156 ? 38.860  48.577  56.767  1.00 46.91 ? 156  ALA A O   1 
ATOM   649   C  CB  . ALA A  1  156 ? 39.965  49.857  54.246  1.00 46.91 ? 156  ALA A CB  1 
ATOM   650   N  N   . VAL A  1  157 ? 37.119  48.356  55.354  1.00 46.91 ? 157  VAL A N   1 
ATOM   651   C  CA  . VAL A  1  157 ? 36.106  48.323  56.403  1.00 46.91 ? 157  VAL A CA  1 
ATOM   652   C  C   . VAL A  1  157 ? 36.037  46.948  57.060  1.00 46.91 ? 157  VAL A C   1 
ATOM   653   O  O   . VAL A  1  157 ? 35.589  46.816  58.200  1.00 46.91 ? 157  VAL A O   1 
ATOM   654   C  CB  . VAL A  1  157 ? 34.713  48.674  55.846  1.00 46.91 ? 157  VAL A CB  1 
ATOM   655   N  N   . PHE A  1  158 ? 36.450  45.923  56.322  1.00 46.91 ? 158  PHE A N   1 
ATOM   656   C  CA  . PHE A  1  158 ? 36.441  44.556  56.832  1.00 46.91 ? 158  PHE A CA  1 
ATOM   657   C  C   . PHE A  1  158 ? 37.654  44.300  57.724  1.00 46.91 ? 158  PHE A C   1 
ATOM   658   O  O   . PHE A  1  158 ? 37.645  43.388  58.552  1.00 46.91 ? 158  PHE A O   1 
ATOM   659   C  CB  . PHE A  1  158 ? 36.422  43.552  55.671  1.00 46.91 ? 158  PHE A CB  1 
ATOM   660   C  CG  . PHE A  1  158 ? 35.237  43.698  54.749  1.00 46.91 ? 158  PHE A CG  1 
ATOM   661   C  CD1 . PHE A  1  158 ? 35.268  43.144  53.472  1.00 46.91 ? 158  PHE A CD1 1 
ATOM   662   C  CD2 . PHE A  1  158 ? 34.094  44.388  55.150  1.00 46.91 ? 158  PHE A CD2 1 
ATOM   663   C  CE1 . PHE A  1  158 ? 34.180  43.274  52.609  1.00 46.91 ? 158  PHE A CE1 1 
ATOM   664   C  CE2 . PHE A  1  158 ? 33.002  44.523  54.294  1.00 46.91 ? 158  PHE A CE2 1 
ATOM   665   C  CZ  . PHE A  1  158 ? 33.046  43.965  53.021  1.00 46.91 ? 158  PHE A CZ  1 
ATOM   666   N  N   . LEU A  1  159 ? 38.700  45.100  57.541  1.00 46.91 ? 159  LEU A N   1 
ATOM   667   C  CA  . LEU A  1  159 ? 39.925  44.966  58.322  1.00 46.91 ? 159  LEU A CA  1 
ATOM   668   C  C   . LEU A  1  159 ? 39.972  45.939  59.497  1.00 46.91 ? 159  LEU A C   1 
ATOM   669   O  O   . LEU A  1  159 ? 40.582  45.648  60.529  1.00 46.91 ? 159  LEU A O   1 
ATOM   670   C  CB  . LEU A  1  159 ? 41.146  45.180  57.425  1.00 46.91 ? 159  LEU A CB  1 
ATOM   671   N  N   . ILE A  1  160 ? 39.366  47.110  59.317  1.00 46.91 ? 160  ILE A N   1 
ATOM   672   C  CA  . ILE A  1  160 ? 39.329  48.138  60.352  1.00 46.91 ? 160  ILE A CA  1 
ATOM   673   C  C   . ILE A  1  160 ? 38.423  47.750  61.516  1.00 46.91 ? 160  ILE A C   1 
ATOM   674   O  O   . ILE A  1  160 ? 38.670  48.140  62.658  1.00 46.91 ? 160  ILE A O   1 
ATOM   675   C  CB  . ILE A  1  160 ? 38.844  49.487  59.786  1.00 46.91 ? 160  ILE A CB  1 
ATOM   676   N  N   . TYR A  1  161 ? 37.362  47.009  61.209  1.00 46.91 ? 161  TYR A N   1 
ATOM   677   C  CA  . TYR A  1  161 ? 36.403  46.560  62.215  1.00 46.91 ? 161  TYR A CA  1 
ATOM   678   C  C   . TYR A  1  161 ? 37.053  45.633  63.243  1.00 46.91 ? 161  TYR A C   1 
ATOM   679   O  O   . TYR A  1  161 ? 36.850  45.785  64.449  1.00 46.91 ? 161  TYR A O   1 
ATOM   680   C  CB  . TYR A  1  161 ? 35.224  45.859  61.531  1.00 46.91 ? 161  TYR A CB  1 
ATOM   681   C  CG  . TYR A  1  161 ? 34.100  45.464  62.463  1.00 46.91 ? 161  TYR A CG  1 
ATOM   682   C  CD1 . TYR A  1  161 ? 33.441  46.417  63.242  1.00 46.91 ? 161  TYR A CD1 1 
ATOM   683   C  CD2 . TYR A  1  161 ? 33.703  44.132  62.576  1.00 46.91 ? 161  TYR A CD2 1 
ATOM   684   C  CE1 . TYR A  1  161 ? 32.421  46.051  64.114  1.00 46.91 ? 161  TYR A CE1 1 
ATOM   685   C  CE2 . TYR A  1  161 ? 32.684  43.755  63.444  1.00 46.91 ? 161  TYR A CE2 1 
ATOM   686   C  CZ  . TYR A  1  161 ? 32.048  44.719  64.212  1.00 46.91 ? 161  TYR A CZ  1 
ATOM   687   O  OH  . TYR A  1  161 ? 31.045  44.350  65.080  1.00 46.91 ? 161  TYR A OH  1 
ATOM   688   N  N   . PRO A  1  162 ? 37.828  44.646  62.769  1.00 46.91 ? 162  PRO A N   1 
ATOM   689   C  CA  . PRO A  1  162 ? 38.523  43.674  63.620  1.00 46.91 ? 162  PRO A CA  1 
ATOM   690   C  C   . PRO A  1  162 ? 39.615  44.324  64.473  1.00 46.91 ? 162  PRO A C   1 
ATOM   691   O  O   . PRO A  1  162 ? 40.058  43.755  65.472  1.00 46.91 ? 162  PRO A O   1 
ATOM   692   C  CB  . PRO A  1  162 ? 39.118  42.687  62.614  1.00 46.91 ? 162  PRO A CB  1 
ATOM   693   N  N   . ILE A  1  163 ? 40.062  45.506  64.058  1.00 46.91 ? 163  ILE A N   1 
ATOM   694   C  CA  . ILE A  1  163 ? 41.102  46.233  64.780  1.00 46.91 ? 163  ILE A CA  1 
ATOM   695   C  C   . ILE A  1  163 ? 40.570  46.972  66.007  1.00 46.91 ? 163  ILE A C   1 
ATOM   696   O  O   . ILE A  1  163 ? 41.339  47.593  66.749  1.00 46.91 ? 163  ILE A O   1 
ATOM   697   C  CB  . ILE A  1  163 ? 41.816  47.245  63.861  1.00 46.91 ? 163  ILE A CB  1 
ATOM   698   N  N   . GLY A  1  164 ? 39.259  46.909  66.218  1.00 46.91 ? 164  GLY A N   1 
ATOM   699   C  CA  . GLY A  1  164 ? 38.658  47.580  67.355  1.00 46.91 ? 164  GLY A CA  1 
ATOM   700   C  C   . GLY A  1  164 ? 37.879  46.649  68.266  1.00 46.91 ? 164  GLY A C   1 
ATOM   701   O  O   . GLY A  1  164 ? 38.111  46.621  69.479  1.00 46.91 ? 164  GLY A O   1 
ATOM   702   N  N   . GLN A  1  165 ? 36.955  45.893  67.684  1.00 46.91 ? 165  GLN A N   1 
ATOM   703   C  CA  . GLN A  1  165 ? 36.118  44.960  68.433  1.00 46.91 ? 165  GLN A CA  1 
ATOM   704   C  C   . GLN A  1  165 ? 36.810  43.633  68.740  1.00 46.91 ? 165  GLN A C   1 
ATOM   705   O  O   . GLN A  1  165 ? 37.155  43.354  69.893  1.00 46.91 ? 165  GLN A O   1 
ATOM   706   C  CB  . GLN A  1  165 ? 34.814  44.701  67.673  1.00 46.91 ? 165  GLN A CB  1 
ATOM   707   N  N   . GLY A  1  166 ? 36.984  42.809  67.710  1.00 46.91 ? 166  GLY A N   1 
ATOM   708   C  CA  . GLY A  1  166 ? 37.626  41.519  67.885  1.00 46.91 ? 166  GLY A CA  1 
ATOM   709   C  C   . GLY A  1  166 ? 38.585  41.191  66.758  1.00 46.91 ? 166  GLY A C   1 
ATOM   710   O  O   . GLY A  1  166 ? 38.188  41.113  65.596  1.00 46.91 ? 166  GLY A O   1 
ATOM   711   N  N   . SER A  1  167 ? 39.848  40.976  67.109  1.00 46.91 ? 167  SER A N   1 
ATOM   712   C  CA  . SER A  1  167 ? 40.879  40.663  66.123  1.00 46.91 ? 167  SER A CA  1 
ATOM   713   C  C   . SER A  1  167 ? 40.810  39.228  65.602  1.00 46.91 ? 167  SER A C   1 
ATOM   714   O  O   . SER A  1  167 ? 41.733  38.765  64.932  1.00 46.91 ? 167  SER A O   1 
ATOM   715   C  CB  . SER A  1  167 ? 42.267  40.934  66.707  1.00 46.91 ? 167  SER A CB  1 
ATOM   716   N  N   . PHE A  1  168 ? 39.722  38.529  65.916  1.00 46.91 ? 168  PHE A N   1 
ATOM   717   C  CA  . PHE A  1  168 ? 39.535  37.148  65.475  1.00 46.91 ? 168  PHE A CA  1 
ATOM   718   C  C   . PHE A  1  168 ? 39.424  37.051  63.951  1.00 46.91 ? 168  PHE A C   1 
ATOM   719   O  O   . PHE A  1  168 ? 40.434  37.080  63.246  1.00 46.91 ? 168  PHE A O   1 
ATOM   720   C  CB  . PHE A  1  168 ? 38.296  36.544  66.143  1.00 46.91 ? 168  PHE A CB  1 
ATOM   721   N  N   . SER A  1  169 ? 38.199  36.928  63.450  1.00 46.91 ? 169  SER A N   1 
ATOM   722   C  CA  . SER A  1  169 ? 37.952  36.830  62.013  1.00 46.91 ? 169  SER A CA  1 
ATOM   723   C  C   . SER A  1  169 ? 36.460  36.783  61.696  1.00 46.91 ? 169  SER A C   1 
ATOM   724   O  O   . SER A  1  169 ? 36.069  36.479  60.567  1.00 46.91 ? 169  SER A O   1 
ATOM   725   C  CB  . SER A  1  169 ? 38.639  35.589  61.432  1.00 46.91 ? 169  SER A CB  1 
ATOM   726   N  N   . ASP A  1  170 ? 35.636  37.066  62.700  1.00 46.91 ? 170  ASP A N   1 
ATOM   727   C  CA  . ASP A  1  170 ? 34.185  37.059  62.539  1.00 46.91 ? 170  ASP A CA  1 
ATOM   728   C  C   . ASP A  1  170 ? 33.700  38.334  61.843  1.00 46.91 ? 170  ASP A C   1 
ATOM   729   O  O   . ASP A  1  170 ? 34.316  39.397  61.966  1.00 46.91 ? 170  ASP A O   1 
ATOM   730   C  CB  . ASP A  1  170 ? 33.504  36.904  63.903  1.00 46.91 ? 170  ASP A CB  1 
ATOM   731   C  CG  . ASP A  1  170 ? 31.995  36.795  63.795  1.00 46.91 ? 170  ASP A CG  1 
ATOM   732   O  OD1 . ASP A  1  170 ? 31.298  37.707  64.286  1.00 46.91 ? 170  ASP A OD1 1 
ATOM   733   O  OD2 . ASP A  1  170 ? 31.504  35.794  63.229  1.00 46.91 ? 170  ASP A OD2 1 
ATOM   734   N  N   . GLY A  1  171 ? 32.605  38.210  61.096  1.00 46.91 ? 171  GLY A N   1 
ATOM   735   C  CA  . GLY A  1  171 ? 32.047  39.341  60.378  1.00 46.91 ? 171  GLY A CA  1 
ATOM   736   C  C   . GLY A  1  171 ? 31.707  38.924  58.961  1.00 46.91 ? 171  GLY A C   1 
ATOM   737   O  O   . GLY A  1  171 ? 30.543  38.692  58.627  1.00 46.91 ? 171  GLY A O   1 
ATOM   738   N  N   . MET A  1  172 ? 32.730  38.861  58.114  1.00 46.91 ? 172  MET A N   1 
ATOM   739   C  CA  . MET A  1  172 ? 32.547  38.448  56.730  1.00 46.91 ? 172  MET A CA  1 
ATOM   740   C  C   . MET A  1  172 ? 32.629  36.926  56.672  1.00 46.91 ? 172  MET A C   1 
ATOM   741   O  O   . MET A  1  172 ? 33.668  36.336  56.976  1.00 46.91 ? 172  MET A O   1 
ATOM   742   C  CB  . MET A  1  172 ? 33.628  39.065  55.840  1.00 46.91 ? 172  MET A CB  1 
ATOM   743   N  N   . PRO A  1  173 ? 31.514  36.271  56.312  1.00 46.91 ? 173  PRO A N   1 
ATOM   744   C  CA  . PRO A  1  173 ? 31.428  34.810  56.210  1.00 46.91 ? 173  PRO A CA  1 
ATOM   745   C  C   . PRO A  1  173 ? 32.509  34.235  55.303  1.00 46.91 ? 173  PRO A C   1 
ATOM   746   O  O   . PRO A  1  173 ? 32.816  34.805  54.254  1.00 46.91 ? 173  PRO A O   1 
ATOM   747   C  CB  . PRO A  1  173 ? 30.035  34.576  55.627  1.00 46.91 ? 173  PRO A CB  1 
ATOM   748   N  N   . LEU A  1  174 ? 33.084  33.110  55.720  1.00 46.91 ? 174  LEU A N   1 
ATOM   749   C  CA  . LEU A  1  174 ? 34.130  32.442  54.956  1.00 46.91 ? 174  LEU A CA  1 
ATOM   750   C  C   . LEU A  1  174 ? 33.601  32.031  53.586  1.00 46.91 ? 174  LEU A C   1 
ATOM   751   O  O   . LEU A  1  174 ? 32.490  31.511  53.471  1.00 46.91 ? 174  LEU A O   1 
ATOM   752   C  CB  . LEU A  1  174 ? 34.630  31.208  55.711  1.00 46.91 ? 174  LEU A CB  1 
ATOM   753   N  N   . GLY A  1  175 ? 34.409  32.252  52.554  1.00 46.91 ? 175  GLY A N   1 
ATOM   754   C  CA  . GLY A  1  175 ? 33.998  31.906  51.206  1.00 46.91 ? 175  GLY A CA  1 
ATOM   755   C  C   . GLY A  1  175 ? 33.311  33.063  50.508  1.00 46.91 ? 175  GLY A C   1 
ATOM   756   O  O   . GLY A  1  175 ? 33.466  33.242  49.300  1.00 46.91 ? 175  GLY A O   1 
ATOM   757   N  N   . ILE A  1  176 ? 32.560  33.852  51.274  1.00 46.91 ? 176  ILE A N   1 
ATOM   758   C  CA  . ILE A  1  176 ? 31.831  35.016  50.769  1.00 46.91 ? 176  ILE A CA  1 
ATOM   759   C  C   . ILE A  1  176 ? 30.779  34.673  49.716  1.00 46.91 ? 176  ILE A C   1 
ATOM   760   O  O   . ILE A  1  176 ? 31.095  34.474  48.543  1.00 46.91 ? 176  ILE A O   1 
ATOM   761   C  CB  . ILE A  1  176 ? 32.789  36.087  50.200  1.00 46.91 ? 176  ILE A CB  1 
ATOM   762   N  N   . SER A  1  177 ? 29.517  34.646  50.135  1.00 46.91 ? 177  SER A N   1 
ATOM   763   C  CA  . SER A  1  177 ? 28.414  34.330  49.231  1.00 46.91 ? 177  SER A CA  1 
ATOM   764   C  C   . SER A  1  177 ? 27.145  35.083  49.614  1.00 46.91 ? 177  SER A C   1 
ATOM   765   O  O   . SER A  1  177 ? 26.579  34.863  50.687  1.00 46.91 ? 177  SER A O   1 
ATOM   766   C  CB  . SER A  1  177 ? 28.143  32.823  49.225  1.00 46.91 ? 177  SER A CB  1 
ATOM   767   N  N   . GLY A  1  178 ? 26.709  35.979  48.733  1.00 46.91 ? 178  GLY A N   1 
ATOM   768   C  CA  . GLY A  1  178 ? 25.509  36.756  48.994  1.00 46.91 ? 178  GLY A CA  1 
ATOM   769   C  C   . GLY A  1  178 ? 25.726  37.867  50.003  1.00 46.91 ? 178  GLY A C   1 
ATOM   770   O  O   . GLY A  1  178 ? 25.403  39.025  49.735  1.00 46.91 ? 178  GLY A O   1 
ATOM   771   N  N   . THR A  1  179 ? 26.294  37.513  51.154  1.00 46.91 ? 179  THR A N   1 
ATOM   772   C  CA  . THR A  1  179 ? 26.571  38.457  52.234  1.00 46.91 ? 179  THR A CA  1 
ATOM   773   C  C   . THR A  1  179 ? 25.299  39.068  52.821  1.00 46.91 ? 179  THR A C   1 
ATOM   774   O  O   . THR A  1  179 ? 25.036  40.262  52.662  1.00 46.91 ? 179  THR A O   1 
ATOM   775   C  CB  . THR A  1  179 ? 27.524  39.585  51.780  1.00 46.91 ? 179  THR A CB  1 
ATOM   776   N  N   . PHE A  1  180 ? 24.500  38.229  53.472  1.00 46.91 ? 180  PHE A N   1 
ATOM   777   C  CA  . PHE A  1  180 ? 23.261  38.671  54.100  1.00 46.91 ? 180  PHE A CA  1 
ATOM   778   C  C   . PHE A  1  180 ? 23.426  38.817  55.609  1.00 46.91 ? 180  PHE A C   1 
ATOM   779   O  O   . PHE A  1  180 ? 22.509  39.255  56.304  1.00 46.91 ? 180  PHE A O   1 
ATOM   780   C  CB  . PHE A  1  180 ? 22.121  37.696  53.786  1.00 46.91 ? 180  PHE A CB  1 
ATOM   781   C  CG  . PHE A  1  180 ? 21.605  37.804  52.383  1.00 46.91 ? 180  PHE A CG  1 
ATOM   782   C  CD1 . PHE A  1  180 ? 21.994  36.892  51.407  1.00 46.91 ? 180  PHE A CD1 1 
ATOM   783   C  CD2 . PHE A  1  180 ? 20.733  38.829  52.031  1.00 46.91 ? 180  PHE A CD2 1 
ATOM   784   C  CE1 . PHE A  1  180 ? 21.524  37.001  50.100  1.00 46.91 ? 180  PHE A CE1 1 
ATOM   785   C  CE2 . PHE A  1  180 ? 20.258  38.949  50.728  1.00 46.91 ? 180  PHE A CE2 1 
ATOM   786   C  CZ  . PHE A  1  180 ? 20.654  38.033  49.760  1.00 46.91 ? 180  PHE A CZ  1 
ATOM   787   N  N   . ASN A  1  181 ? 24.589  38.409  56.112  1.00 46.91 ? 181  ASN A N   1 
ATOM   788   C  CA  . ASN A  1  181 ? 24.894  38.502  57.535  1.00 46.91 ? 181  ASN A CA  1 
ATOM   789   C  C   . ASN A  1  181 ? 25.330  39.921  57.890  1.00 46.91 ? 181  ASN A C   1 
ATOM   790   O  O   . ASN A  1  181 ? 25.127  40.379  59.011  1.00 46.91 ? 181  ASN A O   1 
ATOM   791   C  CB  . ASN A  1  181 ? 25.999  37.512  57.909  1.00 46.91 ? 181  ASN A CB  1 
ATOM   792   N  N   . PHE A  1  182 ? 25.957  40.598  56.931  1.00 46.91 ? 182  PHE A N   1 
ATOM   793   C  CA  . PHE A  1  182 ? 26.417  41.970  57.125  1.00 46.91 ? 182  PHE A CA  1 
ATOM   794   C  C   . PHE A  1  182 ? 25.288  42.969  56.874  1.00 46.91 ? 182  PHE A C   1 
ATOM   795   O  O   . PHE A  1  182 ? 25.528  44.168  56.709  1.00 46.91 ? 182  PHE A O   1 
ATOM   796   C  CB  . PHE A  1  182 ? 27.599  42.272  56.197  1.00 46.91 ? 182  PHE A CB  1 
ATOM   797   C  CG  . PHE A  1  182 ? 28.909  42.449  56.914  1.00 46.91 ? 182  PHE A CG  1 
ATOM   798   C  CD1 . PHE A  1  182 ? 30.077  41.898  56.399  1.00 46.91 ? 182  PHE A CD1 1 
ATOM   799   C  CD2 . PHE A  1  182 ? 28.979  43.178  58.098  1.00 46.91 ? 182  PHE A CD2 1 
ATOM   800   C  CE1 . PHE A  1  182 ? 31.297  42.071  57.051  1.00 46.91 ? 182  PHE A CE1 1 
ATOM   801   C  CE2 . PHE A  1  182 ? 30.194  43.356  58.758  1.00 46.91 ? 182  PHE A CE2 1 
ATOM   802   C  CZ  . PHE A  1  182 ? 31.355  42.800  58.232  1.00 46.91 ? 182  PHE A CZ  1 
ATOM   803   N  N   . MET A  1  183 ? 24.065  42.454  56.787  1.00 46.91 ? 183  MET A N   1 
ATOM   804   C  CA  . MET A  1  183 ? 22.882  43.275  56.564  1.00 46.91 ? 183  MET A CA  1 
ATOM   805   C  C   . MET A  1  183 ? 21.888  43.053  57.701  1.00 46.91 ? 183  MET A C   1 
ATOM   806   O  O   . MET A  1  183 ? 20.839  43.702  57.761  1.00 46.91 ? 183  MET A O   1 
ATOM   807   C  CB  . MET A  1  183 ? 22.231  42.913  55.226  1.00 46.91 ? 183  MET A CB  1 
ATOM   808   N  N   . ILE A  1  184 ? 22.219  42.115  58.584  1.00 46.91 ? 184  ILE A N   1 
ATOM   809   C  CA  . ILE A  1  184 ? 21.383  41.780  59.729  1.00 46.91 ? 184  ILE A CA  1 
ATOM   810   C  C   . ILE A  1  184 ? 22.126  42.045  61.037  1.00 46.91 ? 184  ILE A C   1 
ATOM   811   O  O   . ILE A  1  184 ? 21.547  42.567  61.989  1.00 46.91 ? 184  ILE A O   1 
ATOM   812   C  CB  . ILE A  1  184 ? 20.960  40.299  59.698  1.00 46.91 ? 184  ILE A CB  1 
ATOM   813   N  N   . VAL A  1  185 ? 23.393  41.643  61.086  1.00 46.91 ? 185  VAL A N   1 
ATOM   814   C  CA  . VAL A  1  185 ? 24.219  41.842  62.271  1.00 46.91 ? 185  VAL A CA  1 
ATOM   815   C  C   . VAL A  1  185 ? 24.595  43.313  62.401  1.00 46.91 ? 185  VAL A C   1 
ATOM   816   O  O   . VAL A  1  185 ? 24.561  43.876  63.494  1.00 46.91 ? 185  VAL A O   1 
ATOM   817   C  CB  . VAL A  1  185 ? 25.510  41.003  62.208  1.00 46.91 ? 185  VAL A CB  1 
ATOM   818   N  N   . PHE A  1  186 ? 24.948  43.928  61.275  1.00 46.91 ? 186  PHE A N   1 
ATOM   819   C  CA  . PHE A  1  186 ? 25.329  45.337  61.247  1.00 46.91 ? 186  PHE A CA  1 
ATOM   820   C  C   . PHE A  1  186 ? 24.121  46.244  61.467  1.00 46.91 ? 186  PHE A C   1 
ATOM   821   O  O   . PHE A  1  186 ? 24.205  47.460  61.285  1.00 46.91 ? 186  PHE A O   1 
ATOM   822   C  CB  . PHE A  1  186 ? 26.001  45.676  59.913  1.00 46.91 ? 186  PHE A CB  1 
ATOM   823   N  N   . GLN A  1  187 ? 22.983  45.636  61.788  1.00 46.91 ? 187  GLN A N   1 
ATOM   824   C  CA  . GLN A  1  187 ? 21.752  46.371  62.040  1.00 46.91 ? 187  GLN A CA  1 
ATOM   825   C  C   . GLN A  1  187 ? 21.507  46.483  63.543  1.00 46.91 ? 187  GLN A C   1 
ATOM   826   O  O   . GLN A  1  187 ? 21.028  47.510  64.025  1.00 46.91 ? 187  GLN A O   1 
ATOM   827   C  CB  . GLN A  1  187 ? 20.568  45.661  61.377  1.00 46.91 ? 187  GLN A CB  1 
ATOM   828   N  N   . ALA A  1  188 ? 21.801  45.407  64.268  1.00 46.91 ? 188  ALA A N   1 
ATOM   829   C  CA  . ALA A  1  188 ? 21.616  45.368  65.715  1.00 46.91 ? 188  ALA A CA  1 
ATOM   830   C  C   . ALA A  1  188 ? 22.702  46.159  66.439  1.00 46.91 ? 188  ALA A C   1 
ATOM   831   O  O   . ALA A  1  188 ? 22.421  47.189  67.057  1.00 46.91 ? 188  ALA A O   1 
ATOM   832   C  CB  . ALA A  1  188 ? 21.592  43.927  66.202  1.00 46.91 ? 188  ALA A CB  1 
ATOM   833   N  N   . GLU A  1  189 ? 23.930  45.652  66.398  1.00 46.91 ? 189  GLU A N   1 
ATOM   834   C  CA  . GLU A  1  189 ? 25.060  46.318  67.034  1.00 46.91 ? 189  GLU A CA  1 
ATOM   835   C  C   . GLU A  1  189 ? 26.301  46.304  66.142  1.00 46.91 ? 189  GLU A C   1 
ATOM   836   O  O   . GLU A  1  189 ? 26.227  45.918  64.974  1.00 46.91 ? 189  GLU A O   1 
ATOM   837   C  CB  . GLU A  1  189 ? 25.354  45.721  68.418  1.00 46.91 ? 189  GLU A CB  1 
ATOM   838   C  CG  . GLU A  1  189 ? 25.596  44.219  68.468  1.00 46.91 ? 189  GLU A CG  1 
ATOM   839   C  CD  . GLU A  1  189 ? 25.901  43.743  69.876  1.00 46.91 ? 189  GLU A CD  1 
ATOM   840   O  OE1 . GLU A  1  189 ? 27.094  43.691  70.244  1.00 46.91 ? 189  GLU A OE1 1 
ATOM   841   O  OE2 . GLU A  1  189 ? 24.947  43.440  70.628  1.00 46.91 ? 189  GLU A OE2 1 
ATOM   842   N  N   . HIS A  1  190 ? 27.431  46.756  66.685  1.00 46.91 ? 190  HIS A N   1 
ATOM   843   C  CA  . HIS A  1  190 ? 28.691  46.825  65.938  1.00 46.91 ? 190  HIS A CA  1 
ATOM   844   C  C   . HIS A  1  190 ? 28.547  47.820  64.784  1.00 46.91 ? 190  HIS A C   1 
ATOM   845   O  O   . HIS A  1  190 ? 29.333  47.818  63.836  1.00 46.91 ? 190  HIS A O   1 
ATOM   846   C  CB  . HIS A  1  190 ? 29.080  45.443  65.396  1.00 46.91 ? 190  HIS A CB  1 
ATOM   847   N  N   . ASN A  1  191 ? 27.544  48.683  64.906  1.00 46.91 ? 191  ASN A N   1 
ATOM   848   C  CA  . ASN A  1  191 ? 27.206  49.712  63.926  1.00 46.91 ? 191  ASN A CA  1 
ATOM   849   C  C   . ASN A  1  191 ? 25.856  50.248  64.378  1.00 46.91 ? 191  ASN A C   1 
ATOM   850   O  O   . ASN A  1  191 ? 25.552  51.437  64.228  1.00 46.91 ? 191  ASN A O   1 
ATOM   851   C  CB  . ASN A  1  191 ? 27.072  49.111  62.521  1.00 46.91 ? 191  ASN A CB  1 
ATOM   852   N  N   . ILE A  1  192 ? 25.074  49.347  64.970  1.00 46.91 ? 192  ILE A N   1 
ATOM   853   C  CA  . ILE A  1  192 ? 23.746  49.637  65.489  1.00 46.91 ? 192  ILE A CA  1 
ATOM   854   C  C   . ILE A  1  192 ? 22.791  50.174  64.430  1.00 46.91 ? 192  ILE A C   1 
ATOM   855   O  O   . ILE A  1  192 ? 23.040  50.053  63.226  1.00 46.91 ? 192  ILE A O   1 
ATOM   856   C  CB  . ILE A  1  192 ? 23.814  50.623  66.678  1.00 46.91 ? 192  ILE A CB  1 
ATOM   857   N  N   . LEU A  1  193 ? 21.682  50.742  64.891  1.00 46.91 ? 193  LEU A N   1 
ATOM   858   C  CA  . LEU A  1  193 ? 20.676  51.297  64.002  1.00 46.91 ? 193  LEU A CA  1 
ATOM   859   C  C   . LEU A  1  193 ? 21.226  52.459  63.186  1.00 46.91 ? 193  LEU A C   1 
ATOM   860   O  O   . LEU A  1  193 ? 21.622  53.491  63.736  1.00 46.91 ? 193  LEU A O   1 
ATOM   861   C  CB  . LEU A  1  193 ? 19.456  51.757  64.801  1.00 46.91 ? 193  LEU A CB  1 
ATOM   862   N  N   . MET A  1  194 ? 21.262  52.272  61.870  1.00 46.91 ? 194  MET A N   1 
ATOM   863   C  CA  . MET A  1  194 ? 21.749  53.294  60.954  1.00 46.91 ? 194  MET A CA  1 
ATOM   864   C  C   . MET A  1  194 ? 20.746  54.446  60.941  1.00 46.91 ? 194  MET A C   1 
ATOM   865   O  O   . MET A  1  194 ? 19.573  54.251  60.610  1.00 46.91 ? 194  MET A O   1 
ATOM   866   C  CB  . MET A  1  194 ? 21.891  52.703  59.549  1.00 46.91 ? 194  MET A CB  1 
ATOM   867   N  N   . HIS A  1  195 ? 21.208  55.642  61.301  1.00 46.91 ? 195  HIS A N   1 
ATOM   868   C  CA  . HIS A  1  195 ? 20.343  56.820  61.339  1.00 46.91 ? 195  HIS A CA  1 
ATOM   869   C  C   . HIS A  1  195 ? 21.119  58.106  61.620  1.00 46.91 ? 195  HIS A C   1 
ATOM   870   O  O   . HIS A  1  195 ? 20.564  59.081  62.134  1.00 46.91 ? 195  HIS A O   1 
ATOM   871   C  CB  . HIS A  1  195 ? 19.253  56.641  62.401  1.00 46.91 ? 195  HIS A CB  1 
ATOM   872   N  N   . PRO A  1  196 ? 22.416  58.124  61.277  1.00 46.91 ? 196  PRO A N   1 
ATOM   873   C  CA  . PRO A  1  196 ? 23.303  59.276  61.476  1.00 46.91 ? 196  PRO A CA  1 
ATOM   874   C  C   . PRO A  1  196 ? 24.184  59.542  60.257  1.00 46.91 ? 196  PRO A C   1 
ATOM   875   O  O   . PRO A  1  196 ? 23.857  60.386  59.423  1.00 46.91 ? 196  PRO A O   1 
ATOM   876   C  CB  . PRO A  1  196 ? 24.136  58.873  62.696  1.00 46.91 ? 196  PRO A CB  1 
ATOM   877   N  N   . PHE A  1  197 ? 25.312  58.838  60.180  1.00 46.91 ? 197  PHE A N   1 
ATOM   878   C  CA  . PHE A  1  197 ? 26.242  58.988  59.067  1.00 46.91 ? 197  PHE A CA  1 
ATOM   879   C  C   . PHE A  1  197 ? 25.950  57.995  57.948  1.00 46.91 ? 197  PHE A C   1 
ATOM   880   O  O   . PHE A  1  197 ? 26.219  58.276  56.783  1.00 46.91 ? 197  PHE A O   1 
ATOM   881   C  CB  . PHE A  1  197 ? 27.685  58.832  59.550  1.00 46.91 ? 197  PHE A CB  1 
ATOM   882   N  N   . HIS A  1  198 ? 25.416  56.831  58.307  1.00 46.91 ? 198  HIS A N   1 
ATOM   883   C  CA  . HIS A  1  198 ? 25.082  55.806  57.321  1.00 46.91 ? 198  HIS A CA  1 
ATOM   884   C  C   . HIS A  1  198 ? 23.770  56.131  56.605  1.00 46.91 ? 198  HIS A C   1 
ATOM   885   O  O   . HIS A  1  198 ? 23.337  55.396  55.715  1.00 46.91 ? 198  HIS A O   1 
ATOM   886   C  CB  . HIS A  1  198 ? 24.997  54.428  57.986  1.00 46.91 ? 198  HIS A CB  1 
ATOM   887   N  N   . GLN A  1  199 ? 23.114  57.204  57.038  1.00 46.91 ? 199  GLN A N   1 
ATOM   888   C  CA  . GLN A  1  199 ? 21.862  57.644  56.429  1.00 46.91 ? 199  GLN A CA  1 
ATOM   889   C  C   . GLN A  1  199 ? 22.144  58.674  55.334  1.00 46.91 ? 199  GLN A C   1 
ATOM   890   O  O   . GLN A  1  199 ? 21.249  59.043  54.570  1.00 46.91 ? 199  GLN A O   1 
ATOM   891   C  CB  . GLN A  1  199 ? 20.933  58.241  57.488  1.00 46.91 ? 199  GLN A CB  1 
ATOM   892   N  N   . LEU A  1  200 ? 23.382  59.159  55.294  1.00 46.91 ? 200  LEU A N   1 
ATOM   893   C  CA  . LEU A  1  200 ? 23.810  60.142  54.302  1.00 46.91 ? 200  LEU A CA  1 
ATOM   894   C  C   . LEU A  1  200 ? 24.397  59.460  53.070  1.00 46.91 ? 200  LEU A C   1 
ATOM   895   O  O   . LEU A  1  200 ? 24.083  59.831  51.938  1.00 46.91 ? 200  LEU A O   1 
ATOM   896   C  CB  . LEU A  1  200 ? 24.853  61.086  54.906  1.00 46.91 ? 200  LEU A CB  1 
ATOM   897   N  N   . GLY A  1  201 ? 25.263  58.479  53.307  1.00 46.91 ? 201  GLY A N   1 
ATOM   898   C  CA  . GLY A  1  201 ? 25.901  57.755  52.222  1.00 46.91 ? 201  GLY A CA  1 
ATOM   899   C  C   . GLY A  1  201 ? 24.995  56.798  51.466  1.00 46.91 ? 201  GLY A C   1 
ATOM   900   O  O   . GLY A  1  201 ? 25.219  56.536  50.284  1.00 46.91 ? 201  GLY A O   1 
ATOM   901   N  N   . VAL A  1  202 ? 23.998  56.240  52.148  1.00 46.91 ? 202  VAL A N   1 
ATOM   902   C  CA  . VAL A  1  202 ? 23.071  55.306  51.514  1.00 46.91 ? 202  VAL A CA  1 
ATOM   903   C  C   . VAL A  1  202 ? 22.066  56.018  50.608  1.00 46.91 ? 202  VAL A C   1 
ATOM   904   O  O   . VAL A  1  202 ? 21.382  55.376  49.804  1.00 46.91 ? 202  VAL A O   1 
ATOM   905   C  CB  . VAL A  1  202 ? 22.299  54.478  52.561  1.00 46.91 ? 202  VAL A CB  1 
ATOM   906   N  N   . ALA A  1  203 ? 21.945  57.331  50.777  1.00 46.91 ? 203  ALA A N   1 
ATOM   907   C  CA  . ALA A  1  203 ? 21.029  58.135  49.976  1.00 46.91 ? 203  ALA A CA  1 
ATOM   908   C  C   . ALA A  1  203 ? 21.731  58.751  48.767  1.00 46.91 ? 203  ALA A C   1 
ATOM   909   O  O   . ALA A  1  203 ? 21.077  59.266  47.856  1.00 46.91 ? 203  ALA A O   1 
ATOM   910   C  CB  . ALA A  1  203 ? 20.403  59.227  50.837  1.00 46.91 ? 203  ALA A CB  1 
ATOM   911   N  N   . GLY A  1  204 ? 23.060  58.728  48.788  1.00 46.91 ? 204  GLY A N   1 
ATOM   912   C  CA  . GLY A  1  204 ? 23.840  59.281  47.695  1.00 46.91 ? 204  GLY A CA  1 
ATOM   913   C  C   . GLY A  1  204 ? 24.180  58.251  46.635  1.00 46.91 ? 204  GLY A C   1 
ATOM   914   O  O   . GLY A  1  204 ? 24.186  58.558  45.441  1.00 46.91 ? 204  GLY A O   1 
ATOM   915   N  N   . VAL A  1  205 ? 24.488  57.033  47.071  1.00 46.91 ? 205  VAL A N   1 
ATOM   916   C  CA  . VAL A  1  205 ? 24.833  55.947  46.157  1.00 46.91 ? 205  VAL A CA  1 
ATOM   917   C  C   . VAL A  1  205 ? 23.597  55.396  45.448  1.00 46.91 ? 205  VAL A C   1 
ATOM   918   O  O   . VAL A  1  205 ? 23.688  54.891  44.326  1.00 46.91 ? 205  VAL A O   1 
ATOM   919   C  CB  . VAL A  1  205 ? 25.536  54.794  46.900  1.00 46.91 ? 205  VAL A CB  1 
ATOM   920   N  N   . PHE A  1  206 ? 22.457  55.444  46.130  1.00 46.91 ? 206  PHE A N   1 
ATOM   921   C  CA  . PHE A  1  206 ? 21.202  54.960  45.568  1.00 46.91 ? 206  PHE A CA  1 
ATOM   922   C  C   . PHE A  1  206 ? 20.487  56.069  44.802  1.00 46.91 ? 206  PHE A C   1 
ATOM   923   O  O   . PHE A  1  206 ? 19.835  55.814  43.785  1.00 46.91 ? 206  PHE A O   1 
ATOM   924   C  CB  . PHE A  1  206 ? 20.293  54.425  46.678  1.00 46.91 ? 206  PHE A CB  1 
ATOM   925   N  N   . GLY A  1  207 ? 20.571  57.287  45.329  1.00 46.91 ? 207  GLY A N   1 
ATOM   926   C  CA  . GLY A  1  207 ? 19.941  58.429  44.691  1.00 46.91 ? 207  GLY A CA  1 
ATOM   927   C  C   . GLY A  1  207 ? 20.756  58.957  43.526  1.00 46.91 ? 207  GLY A C   1 
ATOM   928   O  O   . GLY A  1  207 ? 20.229  59.659  42.659  1.00 46.91 ? 207  GLY A O   1 
ATOM   929   N  N   . GLY A  1  208 ? 22.051  58.651  43.532  1.00 46.91 ? 208  GLY A N   1 
ATOM   930   C  CA  . GLY A  1  208 ? 22.935  59.089  42.468  1.00 46.91 ? 208  GLY A CA  1 
ATOM   931   C  C   . GLY A  1  208 ? 22.868  58.169  41.264  1.00 46.91 ? 208  GLY A C   1 
ATOM   932   O  O   . GLY A  1  208 ? 23.359  58.509  40.185  1.00 46.91 ? 208  GLY A O   1 
ATOM   933   N  N   . ALA A  1  209 ? 22.302  56.982  41.462  1.00 46.91 ? 209  ALA A N   1 
ATOM   934   C  CA  . ALA A  1  209 ? 22.157  56.006  40.389  1.00 46.91 ? 209  ALA A CA  1 
ATOM   935   C  C   . ALA A  1  209 ? 20.948  56.364  39.529  1.00 46.91 ? 209  ALA A C   1 
ATOM   936   O  O   . ALA A  1  209 ? 20.841  55.932  38.380  1.00 46.91 ? 209  ALA A O   1 
ATOM   937   C  CB  . ALA A  1  209 ? 21.996  54.607  40.970  1.00 46.91 ? 209  ALA A CB  1 
ATOM   938   N  N   . LEU A  1  210 ? 20.022  57.120  40.113  1.00 46.91 ? 210  LEU A N   1 
ATOM   939   C  CA  . LEU A  1  210 ? 18.815  57.551  39.420  1.00 46.91 ? 210  LEU A CA  1 
ATOM   940   C  C   . LEU A  1  210 ? 19.018  58.914  38.766  1.00 46.91 ? 210  LEU A C   1 
ATOM   941   O  O   . LEU A  1  210 ? 18.356  59.243  37.779  1.00 46.91 ? 210  LEU A O   1 
ATOM   942   C  CB  . LEU A  1  210 ? 17.639  57.615  40.399  1.00 46.91 ? 210  LEU A CB  1 
ATOM   943   N  N   . PHE A  1  211 ? 19.902  59.720  39.349  1.00 46.91 ? 211  PHE A N   1 
ATOM   944   C  CA  . PHE A  1  211 ? 20.201  61.048  38.831  1.00 46.91 ? 211  PHE A CA  1 
ATOM   945   C  C   . PHE A  1  211 ? 21.181  60.969  37.664  1.00 46.91 ? 211  PHE A C   1 
ATOM   946   O  O   . PHE A  1  211 ? 21.128  61.783  36.740  1.00 46.91 ? 211  PHE A O   1 
ATOM   947   C  CB  . PHE A  1  211 ? 20.783  61.930  39.938  1.00 46.91 ? 211  PHE A CB  1 
ATOM   948   N  N   . CYS A  1  212 ? 22.098  60.008  37.738  1.00 46.91 ? 212  CYS A N   1 
ATOM   949   C  CA  . CYS A  1  212 ? 23.096  59.805  36.695  1.00 46.91 ? 212  CYS A CA  1 
ATOM   950   C  C   . CYS A  1  212 ? 22.498  59.031  35.524  1.00 46.91 ? 212  CYS A C   1 
ATOM   951   O  O   . CYS A  1  212 ? 23.033  59.058  34.413  1.00 46.91 ? 212  CYS A O   1 
ATOM   952   C  CB  . CYS A  1  212 ? 24.303  59.050  37.256  1.00 46.91 ? 212  CYS A CB  1 
ATOM   953   N  N   . ALA A  1  213 ? 21.415  58.306  35.791  1.00 46.91 ? 213  ALA A N   1 
ATOM   954   C  CA  . ALA A  1  213 ? 20.730  57.529  34.766  1.00 46.91 ? 213  ALA A CA  1 
ATOM   955   C  C   . ALA A  1  213 ? 19.987  58.471  33.823  1.00 46.91 ? 213  ALA A C   1 
ATOM   956   O  O   . ALA A  1  213 ? 19.764  58.149  32.654  1.00 46.91 ? 213  ALA A O   1 
ATOM   957   C  CB  . ALA A  1  213 ? 19.758  56.550  35.409  1.00 46.91 ? 213  ALA A CB  1 
ATOM   958   N  N   . MET A  1  214 ? 19.578  59.618  34.356  1.00 46.91 ? 214  MET A N   1 
ATOM   959   C  CA  . MET A  1  214 ? 18.865  60.626  33.583  1.00 46.91 ? 214  MET A CA  1 
ATOM   960   C  C   . MET A  1  214 ? 19.853  61.532  32.852  1.00 46.91 ? 214  MET A C   1 
ATOM   961   O  O   . MET A  1  214 ? 19.584  61.986  31.740  1.00 46.91 ? 214  MET A O   1 
ATOM   962   C  CB  . MET A  1  214 ? 17.972  61.464  34.500  1.00 46.91 ? 214  MET A CB  1 
ATOM   963   N  N   . HIS A  1  215 ? 20.982  61.808  33.499  1.00 46.91 ? 215  HIS A N   1 
ATOM   964   C  CA  . HIS A  1  215 ? 22.022  62.659  32.929  1.00 46.91 ? 215  HIS A CA  1 
ATOM   965   C  C   . HIS A  1  215 ? 22.732  61.970  31.767  1.00 46.91 ? 215  HIS A C   1 
ATOM   966   O  O   . HIS A  1  215 ? 23.156  62.622  30.812  1.00 46.91 ? 215  HIS A O   1 
ATOM   967   C  CB  . HIS A  1  215 ? 23.038  63.044  34.007  1.00 46.91 ? 215  HIS A CB  1 
ATOM   968   N  N   . GLY A  1  216 ? 22.903  60.656  31.880  1.00 46.91 ? 216  GLY A N   1 
ATOM   969   C  CA  . GLY A  1  216 ? 23.554  59.895  30.831  1.00 46.91 ? 216  GLY A CA  1 
ATOM   970   C  C   . GLY A  1  216 ? 22.584  59.491  29.738  1.00 46.91 ? 216  GLY A C   1 
ATOM   971   O  O   . GLY A  1  216 ? 22.985  58.921  28.719  1.00 46.91 ? 216  GLY A O   1 
ATOM   972   N  N   . SER A  1  217 ? 21.302  59.760  29.963  1.00 46.91 ? 217  SER A N   1 
ATOM   973   C  CA  . SER A  1  217 ? 20.257  59.432  29.001  1.00 46.91 ? 217  SER A CA  1 
ATOM   974   C  C   . SER A  1  217 ? 19.873  60.644  28.158  1.00 46.91 ? 217  SER A C   1 
ATOM   975   O  O   . SER A  1  217 ? 19.445  60.500  27.010  1.00 46.91 ? 217  SER A O   1 
ATOM   976   C  CB  . SER A  1  217 ? 19.022  58.898  29.725  1.00 46.91 ? 217  SER A CB  1 
ATOM   977   N  N   . LEU A  1  218 ? 19.985  61.831  28.749  1.00 46.91 ? 218  LEU A N   1 
ATOM   978   C  CA  . LEU A  1  218 ? 19.658  63.076  28.064  1.00 46.91 ? 218  LEU A CA  1 
ATOM   979   C  C   . LEU A  1  218 ? 20.745  63.432  27.056  1.00 46.91 ? 218  LEU A C   1 
ATOM   980   O  O   . LEU A  1  218 ? 20.453  63.734  25.898  1.00 46.91 ? 218  LEU A O   1 
ATOM   981   C  CB  . LEU A  1  218 ? 19.497  64.212  29.076  1.00 46.91 ? 218  LEU A CB  1 
ATOM   982   N  N   . VAL A  1  219 ? 21.995  63.402  27.511  1.00 46.91 ? 219  VAL A N   1 
ATOM   983   C  CA  . VAL A  1  219 ? 23.141  63.714  26.664  1.00 46.91 ? 219  VAL A CA  1 
ATOM   984   C  C   . VAL A  1  219 ? 23.298  62.682  25.551  1.00 46.91 ? 219  VAL A C   1 
ATOM   985   O  O   . VAL A  1  219 ? 23.699  63.014  24.436  1.00 46.91 ? 219  VAL A O   1 
ATOM   986   C  CB  . VAL A  1  219 ? 24.444  63.765  27.484  1.00 46.91 ? 219  VAL A CB  1 
ATOM   987   N  N   . THR A  1  220 ? 23.008  61.425  25.867  1.00 46.91 ? 220  THR A N   1 
ATOM   988   C  CA  . THR A  1  220 ? 23.109  60.346  24.891  1.00 46.91 ? 220  THR A CA  1 
ATOM   989   C  C   . THR A  1  220 ? 21.922  60.362  23.930  1.00 46.91 ? 220  THR A C   1 
ATOM   990   O  O   . THR A  1  220 ? 21.866  59.574  22.983  1.00 46.91 ? 220  THR A O   1 
ATOM   991   C  CB  . THR A  1  220 ? 23.174  58.973  25.579  1.00 46.91 ? 220  THR A CB  1 
ATOM   992   N  N   . SER A  1  221 ? 20.961  61.240  24.202  1.00 46.91 ? 221  SER A N   1 
ATOM   993   C  CA  . SER A  1  221 ? 19.772  61.373  23.370  1.00 46.91 ? 221  SER A CA  1 
ATOM   994   C  C   . SER A  1  221 ? 19.998  62.379  22.245  1.00 46.91 ? 221  SER A C   1 
ATOM   995   O  O   . SER A  1  221 ? 19.513  62.191  21.128  1.00 46.91 ? 221  SER A O   1 
ATOM   996   C  CB  . SER A  1  221 ? 18.578  61.808  24.222  1.00 46.91 ? 221  SER A CB  1 
ATOM   997   N  N   . SER A  1  222 ? 20.720  63.454  22.551  1.00 46.91 ? 222  SER A N   1 
ATOM   998   C  CA  . SER A  1  222 ? 21.012  64.498  21.574  1.00 46.91 ? 222  SER A CA  1 
ATOM   999   C  C   . SER A  1  222 ? 22.063  65.470  22.099  1.00 46.91 ? 222  SER A C   1 
ATOM   1000  O  O   . SER A  1  222 ? 21.739  66.417  22.817  1.00 46.91 ? 222  SER A O   1 
ATOM   1001  C  CB  . SER A  1  222 ? 19.735  65.266  21.222  1.00 46.91 ? 222  SER A CB  1 
ATOM   1002  N  N   . LEU A  1  223 ? 23.313  65.252  21.705  1.00 46.91 ? 223  LEU A N   1 
ATOM   1003  C  CA  . LEU A  1  223 ? 24.418  66.106  22.134  1.00 46.91 ? 223  LEU A CA  1 
ATOM   1004  C  C   . LEU A  1  223 ? 25.609  65.979  21.184  1.00 46.91 ? 223  LEU A C   1 
ATOM   1005  O  O   . LEU A  1  223 ? 25.436  65.967  19.963  1.00 46.91 ? 223  LEU A O   1 
ATOM   1006  C  CB  . LEU A  1  223 ? 24.836  65.751  23.564  1.00 46.91 ? 223  LEU A CB  1 
ATOM   1007  N  N   . ILE A  1  224 ? 26.816  65.921  21.743  1.00 46.91 ? 224  ILE A N   1 
ATOM   1008  C  CA  . ILE A  1  224 ? 28.030  65.795  20.943  1.00 46.91 ? 224  ILE A CA  1 
ATOM   1009  C  C   . ILE A  1  224 ? 28.470  64.335  20.834  1.00 46.91 ? 224  ILE A C   1 
ATOM   1010  O  O   . ILE A  1  224 ? 29.629  63.998  21.097  1.00 46.91 ? 224  ILE A O   1 
ATOM   1011  C  CB  . ILE A  1  224 ? 29.180  66.636  21.535  1.00 46.91 ? 224  ILE A CB  1 
ATOM   1012  N  N   . ARG A  1  225 ? 27.532  63.474  20.452  1.00 46.91 ? 225  ARG A N   1 
ATOM   1013  C  CA  . ARG A  1  225 ? 27.796  62.047  20.298  1.00 46.91 ? 225  ARG A CA  1 
ATOM   1014  C  C   . ARG A  1  225 ? 26.997  61.481  19.126  1.00 46.91 ? 225  ARG A C   1 
ATOM   1015  O  O   . ARG A  1  225 ? 27.298  60.398  18.620  1.00 46.91 ? 225  ARG A O   1 
ATOM   1016  C  CB  . ARG A  1  225 ? 27.434  61.300  21.584  1.00 46.91 ? 225  ARG A CB  1 
ATOM   1017  N  N   . GLU A  1  226 ? 25.972  62.224  18.715  1.00 46.91 ? 226  GLU A N   1 
ATOM   1018  C  CA  . GLU A  1  226 ? 25.100  61.850  17.606  1.00 46.91 ? 226  GLU A CA  1 
ATOM   1019  C  C   . GLU A  1  226 ? 24.187  63.039  17.297  1.00 46.91 ? 226  GLU A C   1 
ATOM   1020  O  O   . GLU A  1  226 ? 24.667  64.110  16.916  1.00 46.91 ? 226  GLU A O   1 
ATOM   1021  C  CB  . GLU A  1  226 ? 24.267  60.615  17.970  1.00 46.91 ? 226  GLU A CB  1 
ATOM   1022  N  N   . THR A  1  227 ? 22.878  62.850  17.459  1.00 46.91 ? 227  THR A N   1 
ATOM   1023  C  CA  . THR A  1  227 ? 21.893  63.904  17.218  1.00 46.91 ? 227  THR A CA  1 
ATOM   1024  C  C   . THR A  1  227 ? 21.889  64.461  15.795  1.00 46.91 ? 227  THR A C   1 
ATOM   1025  O  O   . THR A  1  227 ? 21.082  65.335  15.470  1.00 46.91 ? 227  THR A O   1 
ATOM   1026  C  CB  . THR A  1  227 ? 22.090  65.080  18.196  1.00 46.91 ? 227  THR A CB  1 
ATOM   1027  N  N   . THR A  1  228 ? 22.773  63.947  14.948  1.00 46.91 ? 228  THR A N   1 
ATOM   1028  C  CA  . THR A  1  228 ? 22.875  64.405  13.569  1.00 46.91 ? 228  THR A CA  1 
ATOM   1029  C  C   . THR A  1  228 ? 23.660  63.410  12.723  1.00 46.91 ? 228  THR A C   1 
ATOM   1030  O  O   . THR A  1  228 ? 24.501  63.797  11.907  1.00 46.91 ? 228  THR A O   1 
ATOM   1031  C  CB  . THR A  1  228 ? 23.564  65.783  13.490  1.00 46.91 ? 228  THR A CB  1 
ATOM   1032  N  N   . GLU A  1  229 ? 23.375  62.126  12.917  1.00 46.91 ? 229  GLU A N   1 
ATOM   1033  C  CA  . GLU A  1  229 ? 24.049  61.067  12.174  1.00 46.91 ? 229  GLU A CA  1 
ATOM   1034  C  C   . GLU A  1  229 ? 23.037  60.028  11.692  1.00 46.91 ? 229  GLU A C   1 
ATOM   1035  O  O   . GLU A  1  229 ? 22.278  60.282  10.755  1.00 46.91 ? 229  GLU A O   1 
ATOM   1036  C  CB  . GLU A  1  229 ? 25.126  60.410  13.045  1.00 46.91 ? 229  GLU A CB  1 
ATOM   1037  N  N   . THR A  1  230 ? 23.023  58.863  12.334  1.00 46.91 ? 230  THR A N   1 
ATOM   1038  C  CA  . THR A  1  230 ? 22.102  57.794  11.966  1.00 46.91 ? 230  THR A CA  1 
ATOM   1039  C  C   . THR A  1  230 ? 20.699  58.057  12.504  1.00 46.91 ? 230  THR A C   1 
ATOM   1040  O  O   . THR A  1  230 ? 20.472  58.030  13.716  1.00 46.91 ? 230  THR A O   1 
ATOM   1041  C  CB  . THR A  1  230 ? 22.586  56.430  12.488  1.00 46.91 ? 230  THR A CB  1 
ATOM   1042  N  N   . GLU A  1  231 ? 19.765  58.314  11.595  1.00 46.91 ? 231  GLU A N   1 
ATOM   1043  C  CA  . GLU A  1  231 ? 18.376  58.581  11.956  1.00 46.91 ? 231  GLU A CA  1 
ATOM   1044  C  C   . GLU A  1  231 ? 17.462  58.271  10.772  1.00 46.91 ? 231  GLU A C   1 
ATOM   1045  O  O   . GLU A  1  231 ? 16.453  58.946  10.552  1.00 46.91 ? 231  GLU A O   1 
ATOM   1046  C  CB  . GLU A  1  231 ? 18.207  60.042  12.385  1.00 46.91 ? 231  GLU A CB  1 
ATOM   1047  N  N   . SER A  1  232 ? 17.833  57.249  10.007  1.00 46.91 ? 232  SER A N   1 
ATOM   1048  C  CA  . SER A  1  232 ? 17.065  56.832  8.842   1.00 46.91 ? 232  SER A CA  1 
ATOM   1049  C  C   . SER A  1  232 ? 16.063  55.737  9.200   1.00 46.91 ? 232  SER A C   1 
ATOM   1050  O  O   . SER A  1  232 ? 15.793  54.841  8.394   1.00 46.91 ? 232  SER A O   1 
ATOM   1051  C  CB  . SER A  1  232 ? 18.008  56.339  7.742   1.00 46.91 ? 232  SER A CB  1 
ATOM   1052  N  N   . ALA A  1  233 ? 15.502  55.828  10.404  1.00 46.91 ? 233  ALA A N   1 
ATOM   1053  C  CA  . ALA A  1  233 ? 14.528  54.856  10.902  1.00 46.91 ? 233  ALA A CA  1 
ATOM   1054  C  C   . ALA A  1  233 ? 15.112  53.445  10.986  1.00 46.91 ? 233  ALA A C   1 
ATOM   1055  O  O   . ALA A  1  233 ? 14.378  52.455  10.979  1.00 46.91 ? 233  ALA A O   1 
ATOM   1056  C  CB  . ALA A  1  233 ? 13.270  54.868  10.032  1.00 46.91 ? 233  ALA A CB  1 
ATOM   1057  N  N   . ASN A  1  234 ? 16.436  53.369  11.092  1.00 46.91 ? 234  ASN A N   1 
ATOM   1058  C  CA  . ASN A  1  234 ? 17.148  52.098  11.185  1.00 46.91 ? 234  ASN A CA  1 
ATOM   1059  C  C   . ASN A  1  234 ? 18.579  52.345  11.673  1.00 46.91 ? 234  ASN A C   1 
ATOM   1060  O  O   . ASN A  1  234 ? 18.792  52.669  12.843  1.00 46.91 ? 234  ASN A O   1 
ATOM   1061  C  CB  . ASN A  1  234 ? 17.158  51.389  9.826   1.00 46.91 ? 234  ASN A CB  1 
ATOM   1062  N  N   . TYR A  1  235 ? 19.552  52.199  10.777  1.00 46.91 ? 235  TYR A N   1 
ATOM   1063  C  CA  . TYR A  1  235 ? 20.955  52.412  11.123  1.00 46.91 ? 235  TYR A CA  1 
ATOM   1064  C  C   . TYR A  1  235 ? 21.754  52.985  9.953   1.00 46.91 ? 235  TYR A C   1 
ATOM   1065  O  O   . TYR A  1  235 ? 22.425  52.257  9.219   1.00 46.91 ? 235  TYR A O   1 
ATOM   1066  C  CB  . TYR A  1  235 ? 21.596  51.113  11.648  1.00 46.91 ? 235  TYR A CB  1 
ATOM   1067  C  CG  . TYR A  1  235 ? 21.299  49.863  10.841  1.00 46.91 ? 235  TYR A CG  1 
ATOM   1068  C  CD1 . TYR A  1  235 ? 22.249  49.325  9.973   1.00 46.91 ? 235  TYR A CD1 1 
ATOM   1069  C  CD2 . TYR A  1  235 ? 20.079  49.198  10.972  1.00 46.91 ? 235  TYR A CD2 1 
ATOM   1070  C  CE1 . TYR A  1  235 ? 21.995  48.157  9.257   1.00 46.91 ? 235  TYR A CE1 1 
ATOM   1071  C  CE2 . TYR A  1  235 ? 19.813  48.028  10.262  1.00 46.91 ? 235  TYR A CE2 1 
ATOM   1072  C  CZ  . TYR A  1  235 ? 20.775  47.513  9.407   1.00 46.91 ? 235  TYR A CZ  1 
ATOM   1073  O  OH  . TYR A  1  235 ? 20.522  46.354  8.707   1.00 46.91 ? 235  TYR A OH  1 
ATOM   1074  N  N   . GLY A  1  236 ? 21.663  54.300  9.783   1.00 46.91 ? 236  GLY A N   1 
ATOM   1075  C  CA  . GLY A  1  236 ? 22.372  54.966  8.705   1.00 46.91 ? 236  GLY A CA  1 
ATOM   1076  C  C   . GLY A  1  236 ? 23.857  55.158  8.960   1.00 46.91 ? 236  GLY A C   1 
ATOM   1077  O  O   . GLY A  1  236 ? 24.318  55.080  10.101  1.00 46.91 ? 236  GLY A O   1 
ATOM   1078  N  N   . TYR A  1  237 ? 24.603  55.413  7.888   1.00 46.91 ? 237  TYR A N   1 
ATOM   1079  C  CA  . TYR A  1  237 ? 26.046  55.624  7.972   1.00 46.91 ? 237  TYR A CA  1 
ATOM   1080  C  C   . TYR A  1  237 ? 26.379  56.896  8.752   1.00 46.91 ? 237  TYR A C   1 
ATOM   1081  O  O   . TYR A  1  237 ? 25.918  57.984  8.402   1.00 46.91 ? 237  TYR A O   1 
ATOM   1082  C  CB  . TYR A  1  237 ? 26.648  55.701  6.565   1.00 46.91 ? 237  TYR A CB  1 
ATOM   1083  N  N   . LYS A  1  238 ? 27.190  56.752  9.797   1.00 46.91 ? 238  LYS A N   1 
ATOM   1084  C  CA  . LYS A  1  238 ? 27.586  57.880  10.640  1.00 46.91 ? 238  LYS A CA  1 
ATOM   1085  C  C   . LYS A  1  238 ? 28.956  58.457  10.283  1.00 46.91 ? 238  LYS A C   1 
ATOM   1086  O  O   . LYS A  1  238 ? 29.885  57.717  9.941   1.00 46.91 ? 238  LYS A O   1 
ATOM   1087  C  CB  . LYS A  1  238 ? 27.571  57.462  12.112  1.00 46.91 ? 238  LYS A CB  1 
ATOM   1088  N  N   . PHE A  1  239 ? 29.080  59.777  10.403  1.00 46.91 ? 239  PHE A N   1 
ATOM   1089  C  CA  . PHE A  1  239 ? 30.330  60.472  10.096  1.00 46.91 ? 239  PHE A CA  1 
ATOM   1090  C  C   . PHE A  1  239 ? 30.512  61.742  10.928  1.00 46.91 ? 239  PHE A C   1 
ATOM   1091  O  O   . PHE A  1  239 ? 29.638  62.614  10.953  1.00 46.91 ? 239  PHE A O   1 
ATOM   1092  C  CB  . PHE A  1  239 ? 30.390  60.817  8.605   1.00 46.91 ? 239  PHE A CB  1 
ATOM   1093  N  N   . GLY A  1  240 ? 31.656  61.836  11.604  1.00 46.91 ? 240  GLY A N   1 
ATOM   1094  C  CA  . GLY A  1  240 ? 31.947  62.994  12.429  1.00 46.91 ? 240  GLY A CA  1 
ATOM   1095  C  C   . GLY A  1  240 ? 32.807  64.017  11.708  1.00 46.91 ? 240  GLY A C   1 
ATOM   1096  O  O   . GLY A  1  240 ? 32.556  65.232  11.867  1.00 46.91 ? 240  GLY A O   1 
ATOM   1097  N  N   . ALA A  1  251 ? 24.955  70.375  19.755  1.00 46.91 ? 251  ALA A N   1 
ATOM   1098  C  CA  . ALA A  1  251 ? 23.695  70.234  20.547  1.00 46.91 ? 251  ALA A CA  1 
ATOM   1099  C  C   . ALA A  1  251 ? 23.966  70.084  22.044  1.00 46.91 ? 251  ALA A C   1 
ATOM   1100  O  O   . ALA A  1  251 ? 23.059  70.231  22.861  1.00 46.91 ? 251  ALA A O   1 
ATOM   1101  C  CB  . ALA A  1  251 ? 22.889  69.044  20.040  1.00 46.91 ? 251  ALA A CB  1 
ATOM   1102  N  N   . HIS A  1  252 ? 25.221  69.808  22.392  1.00 46.91 ? 252  HIS A N   1 
ATOM   1103  C  CA  . HIS A  1  252 ? 25.626  69.626  23.784  1.00 46.91 ? 252  HIS A CA  1 
ATOM   1104  C  C   . HIS A  1  252 ? 25.604  70.938  24.576  1.00 46.91 ? 252  HIS A C   1 
ATOM   1105  O  O   . HIS A  1  252 ? 25.553  70.929  25.808  1.00 46.91 ? 252  HIS A O   1 
ATOM   1106  C  CB  . HIS A  1  252 ? 27.028  69.011  23.831  1.00 46.91 ? 252  HIS A CB  1 
ATOM   1107  C  CG  . HIS A  1  252 ? 27.308  68.225  25.076  1.00 46.91 ? 252  HIS A CG  1 
ATOM   1108  N  ND1 . HIS A  1  252 ? 27.051  68.709  26.341  1.00 46.91 ? 252  HIS A ND1 1 
ATOM   1109  C  CD2 . HIS A  1  252 ? 27.822  66.983  25.248  1.00 46.91 ? 252  HIS A CD2 1 
ATOM   1110  C  CE1 . HIS A  1  252 ? 27.392  67.802  27.237  1.00 46.91 ? 252  HIS A CE1 1 
ATOM   1111  N  NE2 . HIS A  1  252 ? 27.864  66.745  26.601  1.00 46.91 ? 252  HIS A NE2 1 
ATOM   1112  N  N   . GLY A  1  253 ? 25.679  72.059  23.863  1.00 46.91 ? 253  GLY A N   1 
ATOM   1113  C  CA  . GLY A  1  253 ? 25.666  73.358  24.514  1.00 46.91 ? 253  GLY A CA  1 
ATOM   1114  C  C   . GLY A  1  253 ? 24.281  73.964  24.654  1.00 46.91 ? 253  GLY A C   1 
ATOM   1115  O  O   . GLY A  1  253 ? 24.118  75.001  25.301  1.00 46.91 ? 253  GLY A O   1 
ATOM   1116  N  N   . TYR A  1  254 ? 23.294  73.350  24.011  1.00 46.91 ? 254  TYR A N   1 
ATOM   1117  C  CA  . TYR A  1  254 ? 21.919  73.833  24.065  1.00 46.91 ? 254  TYR A CA  1 
ATOM   1118  C  C   . TYR A  1  254 ? 21.019  72.908  24.881  1.00 46.91 ? 254  TYR A C   1 
ATOM   1119  O  O   . TYR A  1  254 ? 19.985  73.334  25.395  1.00 46.91 ? 254  TYR A O   1 
ATOM   1120  C  CB  . TYR A  1  254 ? 21.355  73.985  22.651  1.00 46.91 ? 254  TYR A CB  1 
ATOM   1121  N  N   . PHE A  1  255 ? 21.399  71.637  24.960  1.00 46.91 ? 255  PHE A N   1 
ATOM   1122  C  CA  . PHE A  1  255 ? 20.633  70.646  25.711  1.00 46.91 ? 255  PHE A CA  1 
ATOM   1123  C  C   . PHE A  1  255 ? 21.073  70.568  27.173  1.00 46.91 ? 255  PHE A C   1 
ATOM   1124  O  O   . PHE A  1  255 ? 20.532  69.778  27.948  1.00 46.91 ? 255  PHE A O   1 
ATOM   1125  C  CB  . PHE A  1  255 ? 20.763  69.269  25.054  1.00 46.91 ? 255  PHE A CB  1 
ATOM   1126  N  N   . GLY A  1  256 ? 22.069  71.371  27.534  1.00 46.91 ? 256  GLY A N   1 
ATOM   1127  C  CA  . GLY A  1  256 ? 22.561  71.373  28.900  1.00 46.91 ? 256  GLY A CA  1 
ATOM   1128  C  C   . GLY A  1  256 ? 21.924  72.430  29.783  1.00 46.91 ? 256  GLY A C   1 
ATOM   1129  O  O   . GLY A  1  256 ? 22.264  72.542  30.963  1.00 46.91 ? 256  GLY A O   1 
ATOM   1130  N  N   . ARG A  1  257 ? 21.010  73.212  29.215  1.00 46.91 ? 257  ARG A N   1 
ATOM   1131  C  CA  . ARG A  1  257 ? 20.332  74.269  29.958  1.00 46.91 ? 257  ARG A CA  1 
ATOM   1132  C  C   . ARG A  1  257 ? 18.843  74.353  29.627  1.00 46.91 ? 257  ARG A C   1 
ATOM   1133  O  O   . ARG A  1  257 ? 18.111  75.143  30.227  1.00 46.91 ? 257  ARG A O   1 
ATOM   1134  C  CB  . ARG A  1  257 ? 20.996  75.618  29.679  1.00 46.91 ? 257  ARG A CB  1 
ATOM   1135  N  N   . LEU A  1  258 ? 18.407  73.566  28.649  1.00 46.91 ? 258  LEU A N   1 
ATOM   1136  C  CA  . LEU A  1  258 ? 17.007  73.555  28.241  1.00 46.91 ? 258  LEU A CA  1 
ATOM   1137  C  C   . LEU A  1  258 ? 16.256  72.364  28.830  1.00 46.91 ? 258  LEU A C   1 
ATOM   1138  O  O   . LEU A  1  258 ? 15.048  72.437  29.065  1.00 46.91 ? 258  LEU A O   1 
ATOM   1139  C  CB  . LEU A  1  258 ? 16.900  73.535  26.714  1.00 46.91 ? 258  LEU A CB  1 
ATOM   1140  N  N   . ILE A  1  259 ? 16.970  71.259  29.031  1.00 46.91 ? 259  ILE A N   1 
ATOM   1141  C  CA  . ILE A  1  259 ? 16.385  70.042  29.582  1.00 46.91 ? 259  ILE A CA  1 
ATOM   1142  C  C   . ILE A  1  259 ? 16.486  69.981  31.105  1.00 46.91 ? 259  ILE A C   1 
ATOM   1143  O  O   . ILE A  1  259 ? 15.581  69.472  31.773  1.00 46.91 ? 259  ILE A O   1 
ATOM   1144  C  CB  . ILE A  1  259 ? 17.053  68.786  28.988  1.00 46.91 ? 259  ILE A CB  1 
ATOM   1145  N  N   . PHE A  1  260 ? 17.604  70.458  31.645  1.00 46.91 ? 260  PHE A N   1 
ATOM   1146  C  CA  . PHE A  1  260 ? 17.824  70.461  33.088  1.00 46.91 ? 260  PHE A CA  1 
ATOM   1147  C  C   . PHE A  1  260 ? 17.420  71.797  33.708  1.00 46.91 ? 260  PHE A C   1 
ATOM   1148  O  O   . PHE A  1  260 ? 18.032  72.254  34.677  1.00 46.91 ? 260  PHE A O   1 
ATOM   1149  C  CB  . PHE A  1  260 ? 19.294  70.163  33.398  1.00 46.91 ? 260  PHE A CB  1 
ATOM   1150  N  N   . GLN A  1  261 ? 16.381  72.409  33.148  1.00 46.91 ? 261  GLN A N   1 
ATOM   1151  C  CA  . GLN A  1  261 ? 15.884  73.695  33.623  1.00 46.91 ? 261  GLN A CA  1 
ATOM   1152  C  C   . GLN A  1  261 ? 15.033  73.567  34.890  1.00 46.91 ? 261  GLN A C   1 
ATOM   1153  O  O   . GLN A  1  261 ? 15.454  72.957  35.878  1.00 46.91 ? 261  GLN A O   1 
ATOM   1154  C  CB  . GLN A  1  261 ? 15.083  74.384  32.513  1.00 46.91 ? 261  GLN A CB  1 
ATOM   1155  N  N   . TYR A  1  262 ? 13.833  74.147  34.848  1.00 46.91 ? 262  TYR A N   1 
ATOM   1156  C  CA  . TYR A  1  262 ? 12.891  74.130  35.966  1.00 46.91 ? 262  TYR A CA  1 
ATOM   1157  C  C   . TYR A  1  262 ? 13.329  74.965  37.168  1.00 46.91 ? 262  TYR A C   1 
ATOM   1158  O  O   . TYR A  1  262 ? 12.529  75.219  38.072  1.00 46.91 ? 262  TYR A O   1 
ATOM   1159  C  CB  . TYR A  1  262 ? 12.583  72.691  36.405  1.00 46.91 ? 262  TYR A CB  1 
ATOM   1160  C  CG  . TYR A  1  262 ? 11.776  71.904  35.395  1.00 46.91 ? 262  TYR A CG  1 
ATOM   1161  C  CD1 . TYR A  1  262 ? 12.366  70.892  34.636  1.00 46.91 ? 262  TYR A CD1 1 
ATOM   1162  C  CD2 . TYR A  1  262 ? 10.424  72.177  35.193  1.00 46.91 ? 262  TYR A CD2 1 
ATOM   1163  C  CE1 . TYR A  1  262 ? 11.626  70.171  33.697  1.00 46.91 ? 262  TYR A CE1 1 
ATOM   1164  C  CE2 . TYR A  1  262 ? 9.678   71.466  34.260  1.00 46.91 ? 262  TYR A CE2 1 
ATOM   1165  C  CZ  . TYR A  1  262 ? 10.283  70.465  33.515  1.00 46.91 ? 262  TYR A CZ  1 
ATOM   1166  O  OH  . TYR A  1  262 ? 9.532   69.771  32.591  1.00 46.91 ? 262  TYR A OH  1 
ATOM   1167  N  N   . ALA A  1  263 ? 14.580  75.417  37.165  1.00 46.91 ? 263  ALA A N   1 
ATOM   1168  C  CA  . ALA A  1  263 ? 15.113  76.219  38.262  1.00 46.91 ? 263  ALA A CA  1 
ATOM   1169  C  C   . ALA A  1  263 ? 16.454  76.854  37.910  1.00 46.91 ? 263  ALA A C   1 
ATOM   1170  O  O   . ALA A  1  263 ? 16.750  77.972  38.341  1.00 46.91 ? 263  ALA A O   1 
ATOM   1171  C  CB  . ALA A  1  263 ? 15.249  75.366  39.521  1.00 46.91 ? 263  ALA A CB  1 
ATOM   1172  N  N   . SER A  1  264 ? 17.266  76.134  37.141  1.00 46.91 ? 264  SER A N   1 
ATOM   1173  C  CA  . SER A  1  264 ? 18.581  76.619  36.735  1.00 46.91 ? 264  SER A CA  1 
ATOM   1174  C  C   . SER A  1  264 ? 19.189  75.730  35.649  1.00 46.91 ? 264  SER A C   1 
ATOM   1175  O  O   . SER A  1  264 ? 18.571  75.504  34.608  1.00 46.91 ? 264  SER A O   1 
ATOM   1176  C  CB  . SER A  1  264 ? 19.516  76.676  37.947  1.00 46.91 ? 264  SER A CB  1 
ATOM   1177  N  N   . PHE A  1  265 ? 20.413  75.262  35.891  1.00 46.91 ? 265  PHE A N   1 
ATOM   1178  C  CA  . PHE A  1  265 ? 21.145  74.396  34.966  1.00 46.91 ? 265  PHE A CA  1 
ATOM   1179  C  C   . PHE A  1  265 ? 22.514  74.032  35.540  1.00 46.91 ? 265  PHE A C   1 
ATOM   1180  O  O   . PHE A  1  265 ? 22.816  74.335  36.700  1.00 46.91 ? 265  PHE A O   1 
ATOM   1181  C  CB  . PHE A  1  265 ? 21.328  75.086  33.608  1.00 46.91 ? 265  PHE A CB  1 
ATOM   1182  N  N   . ASN A  1  266 ? 23.335  73.373  34.726  1.00 46.91 ? 266  ASN A N   1 
ATOM   1183  C  CA  . ASN A  1  266 ? 24.678  72.965  35.129  1.00 46.91 ? 266  ASN A CA  1 
ATOM   1184  C  C   . ASN A  1  266 ? 25.588  74.181  35.302  1.00 46.91 ? 266  ASN A C   1 
ATOM   1185  O  O   . ASN A  1  266 ? 26.398  74.235  36.228  1.00 46.91 ? 266  ASN A O   1 
ATOM   1186  C  CB  . ASN A  1  266 ? 25.274  72.012  34.090  1.00 46.91 ? 266  ASN A CB  1 
ATOM   1187  N  N   . ASN A  1  267 ? 25.444  75.150  34.398  1.00 46.91 ? 267  ASN A N   1 
ATOM   1188  C  CA  . ASN A  1  267 ? 26.228  76.384  34.415  1.00 46.91 ? 267  ASN A CA  1 
ATOM   1189  C  C   . ASN A  1  267 ? 27.738  76.147  34.378  1.00 46.91 ? 267  ASN A C   1 
ATOM   1190  O  O   . ASN A  1  267 ? 28.524  77.038  34.716  1.00 46.91 ? 267  ASN A O   1 
ATOM   1191  C  CB  . ASN A  1  267 ? 25.861  77.235  35.636  1.00 46.91 ? 267  ASN A CB  1 
ATOM   1192  N  N   . SER A  1  268 ? 28.142  74.958  33.940  1.00 46.91 ? 268  SER A N   1 
ATOM   1193  C  CA  . SER A  1  268 ? 29.555  74.605  33.862  1.00 46.91 ? 268  SER A CA  1 
ATOM   1194  C  C   . SER A  1  268 ? 29.788  73.337  33.050  1.00 46.91 ? 268  SER A C   1 
ATOM   1195  O  O   . SER A  1  268 ? 28.991  72.399  33.095  1.00 46.91 ? 268  SER A O   1 
ATOM   1196  C  CB  . SER A  1  268 ? 30.140  74.432  35.266  1.00 46.91 ? 268  SER A CB  1 
ATOM   1197  N  N   . ARG A  1  269 ? 30.884  73.329  32.297  1.00 46.91 ? 269  ARG A N   1 
ATOM   1198  C  CA  . ARG A  1  269 ? 31.249  72.181  31.473  1.00 46.91 ? 269  ARG A CA  1 
ATOM   1199  C  C   . ARG A  1  269 ? 31.777  71.043  32.343  1.00 46.91 ? 269  ARG A C   1 
ATOM   1200  O  O   . ARG A  1  269 ? 31.823  69.891  31.912  1.00 46.91 ? 269  ARG A O   1 
ATOM   1201  C  CB  . ARG A  1  269 ? 32.311  72.586  30.448  1.00 46.91 ? 269  ARG A CB  1 
ATOM   1202  N  N   . SER A  1  270 ? 32.218  71.387  33.549  1.00 46.91 ? 270  SER A N   1 
ATOM   1203  C  CA  . SER A  1  270 ? 32.744  70.402  34.485  1.00 46.91 ? 270  SER A CA  1 
ATOM   1204  C  C   . SER A  1  270 ? 31.826  70.242  35.693  1.00 46.91 ? 270  SER A C   1 
ATOM   1205  O  O   . SER A  1  270 ? 32.246  69.743  36.739  1.00 46.91 ? 270  SER A O   1 
ATOM   1206  C  CB  . SER A  1  270 ? 34.147  70.805  34.944  1.00 46.91 ? 270  SER A CB  1 
ATOM   1207  N  N   . LEU A  1  271 ? 30.590  70.715  35.560  1.00 46.91 ? 271  LEU A N   1 
ATOM   1208  C  CA  . LEU A  1  271 ? 29.605  70.613  36.632  1.00 46.91 ? 271  LEU A CA  1 
ATOM   1209  C  C   . LEU A  1  271 ? 29.056  69.194  36.693  1.00 46.91 ? 271  LEU A C   1 
ATOM   1210  O  O   . LEU A  1  271 ? 28.610  68.734  37.743  1.00 46.91 ? 271  LEU A O   1 
ATOM   1211  C  CB  . LEU A  1  271 ? 28.460  71.601  36.403  1.00 46.91 ? 271  LEU A CB  1 
ATOM   1212  N  N   . HIS A  1  272 ? 29.059  68.521  35.545  1.00 46.91 ? 272  HIS A N   1 
ATOM   1213  C  CA  . HIS A  1  272 ? 28.573  67.151  35.448  1.00 46.91 ? 272  HIS A CA  1 
ATOM   1214  C  C   . HIS A  1  272 ? 29.601  66.189  36.037  1.00 46.91 ? 272  HIS A C   1 
ATOM   1215  O  O   . HIS A  1  272 ? 29.261  65.084  36.458  1.00 46.91 ? 272  HIS A O   1 
ATOM   1216  C  CB  . HIS A  1  272 ? 28.296  66.792  33.988  1.00 46.91 ? 272  HIS A CB  1 
ATOM   1217  N  N   . PHE A  1  273 ? 30.866  66.599  36.005  1.00 46.91 ? 273  PHE A N   1 
ATOM   1218  C  CA  . PHE A  1  273 ? 31.958  65.798  36.545  1.00 46.91 ? 273  PHE A CA  1 
ATOM   1219  C  C   . PHE A  1  273 ? 32.054  65.999  38.057  1.00 46.91 ? 273  PHE A C   1 
ATOM   1220  O  O   . PHE A  1  273 ? 32.671  65.197  38.761  1.00 46.91 ? 273  PHE A O   1 
ATOM   1221  C  CB  . PHE A  1  273 ? 33.279  66.190  35.875  1.00 46.91 ? 273  PHE A CB  1 
ATOM   1222  N  N   . PHE A  1  274 ? 31.484  67.102  38.533  1.00 46.91 ? 274  PHE A N   1 
ATOM   1223  C  CA  . PHE A  1  274 ? 31.475  67.430  39.955  1.00 46.91 ? 274  PHE A CA  1 
ATOM   1224  C  C   . PHE A  1  274 ? 30.325  66.711  40.652  1.00 46.91 ? 274  PHE A C   1 
ATOM   1225  O  O   . PHE A  1  274 ? 30.296  66.611  41.881  1.00 46.91 ? 274  PHE A O   1 
ATOM   1226  C  CB  . PHE A  1  274 ? 31.330  68.941  40.150  1.00 46.91 ? 274  PHE A CB  1 
ATOM   1227  N  N   . LEU A  1  275 ? 29.347  66.272  39.864  1.00 46.91 ? 275  LEU A N   1 
ATOM   1228  C  CA  . LEU A  1  275 ? 28.193  65.554  40.392  1.00 46.91 ? 275  LEU A CA  1 
ATOM   1229  C  C   . LEU A  1  275 ? 28.488  64.059  40.435  1.00 46.91 ? 275  LEU A C   1 
ATOM   1230  O  O   . LEU A  1  275 ? 27.991  63.345  41.304  1.00 46.91 ? 275  LEU A O   1 
ATOM   1231  C  CB  . LEU A  1  275 ? 26.960  65.817  39.524  1.00 46.91 ? 275  LEU A CB  1 
ATOM   1232  N  N   . ALA A  1  276 ? 29.268  63.590  39.464  1.00 46.91 ? 276  ALA A N   1 
ATOM   1233  C  CA  . ALA A  1  276 ? 29.642  62.184  39.379  1.00 46.91 ? 276  ALA A CA  1 
ATOM   1234  C  C   . ALA A  1  276 ? 30.728  61.848  40.399  1.00 46.91 ? 276  ALA A C   1 
ATOM   1235  O  O   . ALA A  1  276 ? 30.875  60.692  40.802  1.00 46.91 ? 276  ALA A O   1 
ATOM   1236  C  CB  . ALA A  1  276 ? 30.121  61.853  37.972  1.00 46.91 ? 276  ALA A CB  1 
ATOM   1237  N  N   . ALA A  1  277 ? 31.516  62.854  40.767  1.00 46.91 ? 277  ALA A N   1 
ATOM   1238  C  CA  . ALA A  1  277 ? 32.591  62.686  41.738  1.00 46.91 ? 277  ALA A CA  1 
ATOM   1239  C  C   . ALA A  1  277 ? 32.058  62.793  43.165  1.00 46.91 ? 277  ALA A C   1 
ATOM   1240  O  O   . ALA A  1  277 ? 32.729  62.392  44.116  1.00 46.91 ? 277  ALA A O   1 
ATOM   1241  C  CB  . ALA A  1  277 ? 33.676  63.728  41.505  1.00 46.91 ? 277  ALA A CB  1 
ATOM   1242  N  N   . TRP A  1  278 ? 30.874  63.382  43.306  1.00 46.91 ? 278  TRP A N   1 
ATOM   1243  C  CA  . TRP A  1  278 ? 30.242  63.547  44.610  1.00 46.91 ? 278  TRP A CA  1 
ATOM   1244  C  C   . TRP A  1  278 ? 29.556  62.260  45.062  1.00 46.91 ? 278  TRP A C   1 
ATOM   1245  O  O   . TRP A  1  278 ? 29.338  62.053  46.256  1.00 46.91 ? 278  TRP A O   1 
ATOM   1246  C  CB  . TRP A  1  278 ? 29.228  64.691  44.566  1.00 46.91 ? 278  TRP A CB  1 
ATOM   1247  N  N   . ARG A  1  279 ? 29.173  61.428  44.098  1.00 46.91 ? 279  ARG A N   1 
ATOM   1248  C  CA  . ARG A  1  279 ? 28.522  60.154  44.388  1.00 46.91 ? 279  ARG A CA  1 
ATOM   1249  C  C   . ARG A  1  279 ? 29.571  59.080  44.669  1.00 46.91 ? 279  ARG A C   1 
ATOM   1250  O  O   . ARG A  1  279 ? 29.239  57.938  44.992  1.00 46.91 ? 279  ARG A O   1 
ATOM   1251  C  CB  . ARG A  1  279 ? 27.644  59.729  43.208  1.00 46.91 ? 279  ARG A CB  1 
ATOM   1252  N  N   . VAL A  1  280 ? 30.838  59.450  44.505  1.00 46.91 ? 280  VAL A N   1 
ATOM   1253  C  CA  . VAL A  1  280 ? 31.954  58.541  44.735  1.00 46.91 ? 280  VAL A CA  1 
ATOM   1254  C  C   . VAL A  1  280 ? 32.849  59.036  45.870  1.00 46.91 ? 280  VAL A C   1 
ATOM   1255  O  O   . VAL A  1  280 ? 33.854  58.403  46.196  1.00 46.91 ? 280  VAL A O   1 
ATOM   1256  C  CB  . VAL A  1  280 ? 32.807  58.376  43.462  1.00 46.91 ? 280  VAL A CB  1 
ATOM   1257  N  N   . VAL A  1  281 ? 32.484  60.170  46.461  1.00 46.91 ? 281  VAL A N   1 
ATOM   1258  C  CA  . VAL A  1  281 ? 33.254  60.750  47.556  1.00 46.91 ? 281  VAL A CA  1 
ATOM   1259  C  C   . VAL A  1  281 ? 32.356  61.128  48.732  1.00 46.91 ? 281  VAL A C   1 
ATOM   1260  O  O   . VAL A  1  281 ? 32.738  60.962  49.892  1.00 46.91 ? 281  VAL A O   1 
ATOM   1261  C  CB  . VAL A  1  281 ? 34.029  61.999  47.097  1.00 46.91 ? 281  VAL A CB  1 
ATOM   1262  N  N   . GLY A  1  282 ? 31.188  61.685  48.426  1.00 46.91 ? 282  GLY A N   1 
ATOM   1263  C  CA  . GLY A  1  282 ? 30.253  62.070  49.468  1.00 46.91 ? 282  GLY A CA  1 
ATOM   1264  C  C   . GLY A  1  282 ? 29.560  60.866  50.079  1.00 46.91 ? 282  GLY A C   1 
ATOM   1265  O  O   . GLY A  1  282 ? 29.125  60.913  51.231  1.00 46.91 ? 282  GLY A O   1 
ATOM   1266  N  N   . VAL A  1  283 ? 29.438  59.800  49.293  1.00 46.91 ? 283  VAL A N   1 
ATOM   1267  C  CA  . VAL A  1  283 ? 28.797  58.567  49.737  1.00 46.91 ? 283  VAL A CA  1 
ATOM   1268  C  C   . VAL A  1  283 ? 29.823  57.490  50.081  1.00 46.91 ? 283  VAL A C   1 
ATOM   1269  O  O   . VAL A  1  283 ? 29.498  56.497  50.736  1.00 46.91 ? 283  VAL A O   1 
ATOM   1270  C  CB  . VAL A  1  283 ? 27.848  58.012  48.658  1.00 46.91 ? 283  VAL A CB  1 
ATOM   1271  N  N   . TRP A  1  284 ? 31.050  57.669  49.598  1.00 46.91 ? 284  TRP A N   1 
ATOM   1272  C  CA  . TRP A  1  284 ? 32.126  56.718  49.854  1.00 46.91 ? 284  TRP A CA  1 
ATOM   1273  C  C   . TRP A  1  284 ? 32.737  56.937  51.234  1.00 46.91 ? 284  TRP A C   1 
ATOM   1274  O  O   . TRP A  1  284 ? 32.882  55.994  52.012  1.00 46.91 ? 284  TRP A O   1 
ATOM   1275  C  CB  . TRP A  1  284 ? 33.210  56.839  48.783  1.00 46.91 ? 284  TRP A CB  1 
ATOM   1276  N  N   . PHE A  1  285 ? 33.118  58.180  51.516  1.00 46.91 ? 285  PHE A N   1 
ATOM   1277  C  CA  . PHE A  1  285 ? 33.714  58.532  52.801  1.00 46.91 ? 285  PHE A CA  1 
ATOM   1278  C  C   . PHE A  1  285 ? 32.713  58.462  53.953  1.00 46.91 ? 285  PHE A C   1 
ATOM   1279  O  O   . PHE A  1  285 ? 33.103  58.484  55.121  1.00 46.91 ? 285  PHE A O   1 
ATOM   1280  C  CB  . PHE A  1  285 ? 34.336  59.932  52.739  1.00 46.91 ? 285  PHE A CB  1 
ATOM   1281  C  CG  . PHE A  1  285 ? 35.612  59.997  51.944  1.00 46.91 ? 285  PHE A CG  1 
ATOM   1282  C  CD1 . PHE A  1  285 ? 36.833  59.703  52.543  1.00 46.91 ? 285  PHE A CD1 1 
ATOM   1283  C  CD2 . PHE A  1  285 ? 35.597  60.372  50.604  1.00 46.91 ? 285  PHE A CD2 1 
ATOM   1284  C  CE1 . PHE A  1  285 ? 38.022  59.775  51.818  1.00 46.91 ? 285  PHE A CE1 1 
ATOM   1285  C  CE2 . PHE A  1  285 ? 36.779  60.448  49.869  1.00 46.91 ? 285  PHE A CE2 1 
ATOM   1286  C  CZ  . PHE A  1  285 ? 37.994  60.152  50.479  1.00 46.91 ? 285  PHE A CZ  1 
ATOM   1287  N  N   . ALA A  1  286 ? 31.426  58.437  53.618  1.00 46.91 ? 286  ALA A N   1 
ATOM   1288  C  CA  . ALA A  1  286 ? 30.368  58.356  54.621  1.00 46.91 ? 286  ALA A CA  1 
ATOM   1289  C  C   . ALA A  1  286 ? 30.152  56.903  55.032  1.00 46.91 ? 286  ALA A C   1 
ATOM   1290  O  O   . ALA A  1  286 ? 29.915  56.607  56.205  1.00 46.91 ? 286  ALA A O   1 
ATOM   1291  C  CB  . ALA A  1  286 ? 29.078  58.947  54.074  1.00 46.91 ? 286  ALA A CB  1 
ATOM   1292  N  N   . ALA A  1  287 ? 30.215  56.005  54.051  1.00 46.91 ? 287  ALA A N   1 
ATOM   1293  C  CA  . ALA A  1  287 ? 30.040  54.578  54.288  1.00 46.91 ? 287  ALA A CA  1 
ATOM   1294  C  C   . ALA A  1  287 ? 31.251  54.017  55.028  1.00 46.91 ? 287  ALA A C   1 
ATOM   1295  O  O   . ALA A  1  287 ? 31.115  53.137  55.882  1.00 46.91 ? 287  ALA A O   1 
ATOM   1296  C  CB  . ALA A  1  287 ? 29.847  53.848  52.964  1.00 46.91 ? 287  ALA A CB  1 
ATOM   1297  N  N   . LEU A  1  288 ? 32.432  54.499  54.658  1.00 46.91 ? 288  LEU A N   1 
ATOM   1298  C  CA  . LEU A  1  288 ? 33.678  54.069  55.280  1.00 46.91 ? 288  LEU A CA  1 
ATOM   1299  C  C   . LEU A  1  288 ? 33.867  54.774  56.620  1.00 46.91 ? 288  LEU A C   1 
ATOM   1300  O  O   . LEU A  1  288 ? 34.498  54.235  57.531  1.00 46.91 ? 288  LEU A O   1 
ATOM   1301  C  CB  . LEU A  1  288 ? 34.863  54.375  54.360  1.00 46.91 ? 288  LEU A CB  1 
ATOM   1302  N  N   . GLY A  1  289 ? 33.345  55.993  56.718  1.00 46.91 ? 289  GLY A N   1 
ATOM   1303  C  CA  . GLY A  1  289 ? 33.457  56.763  57.944  1.00 46.91 ? 289  GLY A CA  1 
ATOM   1304  C  C   . GLY A  1  289 ? 32.575  56.233  59.058  1.00 46.91 ? 289  GLY A C   1 
ATOM   1305  O  O   . GLY A  1  289 ? 32.960  56.270  60.229  1.00 46.91 ? 289  GLY A O   1 
ATOM   1306  N  N   . ILE A  1  290 ? 31.379  55.775  58.699  1.00 46.91 ? 290  ILE A N   1 
ATOM   1307  C  CA  . ILE A  1  290 ? 30.432  55.229  59.666  1.00 46.91 ? 290  ILE A CA  1 
ATOM   1308  C  C   . ILE A  1  290 ? 30.836  53.825  60.104  1.00 46.91 ? 290  ILE A C   1 
ATOM   1309  O  O   . ILE A  1  290 ? 30.513  53.397  61.211  1.00 46.91 ? 290  ILE A O   1 
ATOM   1310  C  CB  . ILE A  1  290 ? 29.008  55.165  59.082  1.00 46.91 ? 290  ILE A CB  1 
ATOM   1311  N  N   . SER A  1  291 ? 31.500  53.101  59.209  1.00 46.91 ? 291  SER A N   1 
ATOM   1312  C  CA  . SER A  1  291 ? 31.953  51.746  59.495  1.00 46.91 ? 291  SER A CA  1 
ATOM   1313  C  C   . SER A  1  291 ? 33.235  51.757  60.319  1.00 46.91 ? 291  SER A C   1 
ATOM   1314  O  O   . SER A  1  291 ? 33.447  50.891  61.166  1.00 46.91 ? 291  SER A O   1 
ATOM   1315  C  CB  . SER A  1  291 ? 32.184  50.980  58.190  1.00 46.91 ? 291  SER A CB  1 
ATOM   1316  N  N   . THR A  1  292 ? 34.096  52.734  60.051  1.00 46.91 ? 292  THR A N   1 
ATOM   1317  C  CA  . THR A  1  292 ? 35.365  52.870  60.760  1.00 46.91 ? 292  THR A CA  1 
ATOM   1318  C  C   . THR A  1  292 ? 35.167  53.328  62.202  1.00 46.91 ? 292  THR A C   1 
ATOM   1319  O  O   . THR A  1  292 ? 36.056  53.164  63.044  1.00 46.91 ? 292  THR A O   1 
ATOM   1320  C  CB  . THR A  1  292 ? 36.293  53.871  60.052  1.00 46.91 ? 292  THR A CB  1 
ATOM   1321  N  N   . MET A  1  293 ? 34.030  53.962  62.466  1.00 46.91 ? 293  MET A N   1 
ATOM   1322  C  CA  . MET A  1  293 ? 33.706  54.439  63.803  1.00 46.91 ? 293  MET A CA  1 
ATOM   1323  C  C   . MET A  1  293 ? 32.907  53.387  64.571  1.00 46.91 ? 293  MET A C   1 
ATOM   1324  O  O   . MET A  1  293 ? 32.854  53.415  65.801  1.00 46.91 ? 293  MET A O   1 
ATOM   1325  C  CB  . MET A  1  293 ? 32.913  55.746  63.720  1.00 46.91 ? 293  MET A CB  1 
ATOM   1326  N  N   . ALA A  1  294 ? 32.291  52.467  63.834  1.00 46.91 ? 294  ALA A N   1 
ATOM   1327  C  CA  . ALA A  1  294 ? 31.483  51.406  64.422  1.00 46.91 ? 294  ALA A CA  1 
ATOM   1328  C  C   . ALA A  1  294 ? 32.319  50.235  64.941  1.00 46.91 ? 294  ALA A C   1 
ATOM   1329  O  O   . ALA A  1  294 ? 32.196  49.105  64.465  1.00 46.91 ? 294  ALA A O   1 
ATOM   1330  C  CB  . ALA A  1  294 ? 30.455  50.918  63.412  1.00 46.91 ? 294  ALA A CB  1 
ATOM   1331  N  N   . PHE A  1  295 ? 33.178  50.513  65.918  1.00 46.91 ? 295  PHE A N   1 
ATOM   1332  C  CA  . PHE A  1  295 ? 34.030  49.486  66.507  1.00 46.91 ? 295  PHE A CA  1 
ATOM   1333  C  C   . PHE A  1  295 ? 33.495  49.056  67.869  1.00 46.91 ? 295  PHE A C   1 
ATOM   1334  O  O   . PHE A  1  295 ? 33.419  47.866  68.168  1.00 46.91 ? 295  PHE A O   1 
ATOM   1335  C  CB  . PHE A  1  295 ? 35.461  50.008  66.658  1.00 46.91 ? 295  PHE A CB  1 
ATOM   1336  N  N   . ASN A  1  296 ? 33.148  50.040  68.691  1.00 46.91 ? 296  ASN A N   1 
ATOM   1337  C  CA  . ASN A  1  296 ? 32.620  49.794  70.026  1.00 46.91 ? 296  ASN A CA  1 
ATOM   1338  C  C   . ASN A  1  296 ? 31.780  50.985  70.473  1.00 46.91 ? 296  ASN A C   1 
ATOM   1339  O  O   . ASN A  1  296 ? 30.867  50.846  71.290  1.00 46.91 ? 296  ASN A O   1 
ATOM   1340  C  CB  . ASN A  1  296 ? 33.770  49.587  71.015  1.00 46.91 ? 296  ASN A CB  1 
ATOM   1341  N  N   . LEU A  1  297 ? 32.129  52.160  69.956  1.00 46.91 ? 297  LEU A N   1 
ATOM   1342  C  CA  . LEU A  1  297 ? 31.440  53.405  70.275  1.00 46.91 ? 297  LEU A CA  1 
ATOM   1343  C  C   . LEU A  1  297 ? 30.102  53.546  69.550  1.00 46.91 ? 297  LEU A C   1 
ATOM   1344  O  O   . LEU A  1  297 ? 29.068  53.772  70.185  1.00 46.91 ? 297  LEU A O   1 
ATOM   1345  C  CB  . LEU A  1  297 ? 32.337  54.601  69.937  1.00 46.91 ? 297  LEU A CB  1 
ATOM   1346  N  N   . ASN A  1  298 ? 30.141  53.427  68.224  1.00 46.91 ? 298  ASN A N   1 
ATOM   1347  C  CA  . ASN A  1  298 ? 28.957  53.544  67.369  1.00 46.91 ? 298  ASN A CA  1 
ATOM   1348  C  C   . ASN A  1  298 ? 28.219  54.871  67.576  1.00 46.91 ? 298  ASN A C   1 
ATOM   1349  O  O   . ASN A  1  298 ? 28.841  55.902  67.853  1.00 46.91 ? 298  ASN A O   1 
ATOM   1350  C  CB  . ASN A  1  298 ? 28.009  52.359  67.592  1.00 46.91 ? 298  ASN A CB  1 
ATOM   1351  N  N   . GLY A  1  299 ? 26.899  54.843  67.423  1.00 46.91 ? 299  GLY A N   1 
ATOM   1352  C  CA  . GLY A  1  299 ? 26.103  56.043  67.596  1.00 46.91 ? 299  GLY A CA  1 
ATOM   1353  C  C   . GLY A  1  299 ? 24.647  55.696  67.821  1.00 46.91 ? 299  GLY A C   1 
ATOM   1354  O  O   . GLY A  1  299 ? 24.196  55.616  68.966  1.00 46.91 ? 299  GLY A O   1 
ATOM   1355  N  N   . PHE A  1  300 ? 23.918  55.507  66.723  1.00 46.91 ? 300  PHE A N   1 
ATOM   1356  C  CA  . PHE A  1  300 ? 22.499  55.152  66.741  1.00 46.91 ? 300  PHE A CA  1 
ATOM   1357  C  C   . PHE A  1  300 ? 21.557  56.268  67.183  1.00 46.91 ? 300  PHE A C   1 
ATOM   1358  O  O   . PHE A  1  300 ? 20.615  56.608  66.462  1.00 46.91 ? 300  PHE A O   1 
ATOM   1359  C  CB  . PHE A  1  300 ? 22.262  53.906  67.599  1.00 46.91 ? 300  PHE A CB  1 
ATOM   1360  N  N   . ASN A  1  301 ? 21.820  56.849  68.353  1.00 46.91 ? 301  ASN A N   1 
ATOM   1361  C  CA  . ASN A  1  301 ? 20.988  57.918  68.906  1.00 46.91 ? 301  ASN A CA  1 
ATOM   1362  C  C   . ASN A  1  301 ? 19.553  57.430  69.113  1.00 46.91 ? 301  ASN A C   1 
ATOM   1363  O  O   . ASN A  1  301 ? 19.337  56.280  69.497  1.00 46.91 ? 301  ASN A O   1 
ATOM   1364  C  CB  . ASN A  1  301 ? 21.018  59.151  67.996  1.00 46.91 ? 301  ASN A CB  1 
ATOM   1365  N  N   . PHE A  1  302 ? 18.584  58.315  68.877  1.00 46.91 ? 302  PHE A N   1 
ATOM   1366  C  CA  . PHE A  1  302 ? 17.158  58.006  69.019  1.00 46.91 ? 302  PHE A CA  1 
ATOM   1367  C  C   . PHE A  1  302 ? 16.751  57.662  70.458  1.00 46.91 ? 302  PHE A C   1 
ATOM   1368  O  O   . PHE A  1  302 ? 16.050  58.440  71.106  1.00 46.91 ? 302  PHE A O   1 
ATOM   1369  C  CB  . PHE A  1  302 ? 16.742  56.884  68.061  1.00 46.91 ? 302  PHE A CB  1 
ATOM   1370  N  N   . ASN A  1  303 ? 17.210  56.511  70.947  1.00 46.91 ? 303  ASN A N   1 
ATOM   1371  C  CA  . ASN A  1  303 ? 16.918  56.033  72.298  1.00 46.91 ? 303  ASN A CA  1 
ATOM   1372  C  C   . ASN A  1  303 ? 15.443  55.694  72.502  1.00 46.91 ? 303  ASN A C   1 
ATOM   1373  O  O   . ASN A  1  303 ? 15.049  54.531  72.401  1.00 46.91 ? 303  ASN A O   1 
ATOM   1374  C  CB  . ASN A  1  303 ? 17.385  57.045  73.351  1.00 46.91 ? 303  ASN A CB  1 
ATOM   1375  N  N   . HIS A  1  304 ? 14.640  56.706  72.820  1.00 46.91 ? 304  HIS A N   1 
ATOM   1376  C  CA  . HIS A  1  304 ? 13.208  56.525  73.041  1.00 46.91 ? 304  HIS A CA  1 
ATOM   1377  C  C   . HIS A  1  304 ? 12.531  57.860  73.308  1.00 46.91 ? 304  HIS A C   1 
ATOM   1378  O  O   . HIS A  1  304 ? 12.936  58.605  74.203  1.00 46.91 ? 304  HIS A O   1 
ATOM   1379  C  CB  . HIS A  1  304 ? 12.958  55.586  74.225  1.00 46.91 ? 304  HIS A CB  1 
ATOM   1380  N  N   . SER A  1  305 ? 11.517  58.171  72.509  1.00 46.91 ? 305  SER A N   1 
ATOM   1381  C  CA  . SER A  1  305 ? 10.773  59.414  72.670  1.00 46.91 ? 305  SER A CA  1 
ATOM   1382  C  C   . SER A  1  305 ? 9.979   59.328  73.971  1.00 46.91 ? 305  SER A C   1 
ATOM   1383  O  O   . SER A  1  305 ? 10.238  60.081  74.908  1.00 46.91 ? 305  SER A O   1 
ATOM   1384  C  CB  . SER A  1  305 ? 9.832   59.626  71.484  1.00 46.91 ? 305  SER A CB  1 
ATOM   1385  N  N   . VAL A  1  306 ? 9.022   58.401  74.007  1.00 46.91 ? 306  VAL A N   1 
ATOM   1386  C  CA  . VAL A  1  306 ? 8.166   58.146  75.169  1.00 46.91 ? 306  VAL A CA  1 
ATOM   1387  C  C   . VAL A  1  306 ? 7.943   59.324  76.121  1.00 46.91 ? 306  VAL A C   1 
ATOM   1388  O  O   . VAL A  1  306 ? 8.602   59.432  77.160  1.00 46.91 ? 306  VAL A O   1 
ATOM   1389  C  CB  . VAL A  1  306 ? 8.688   56.945  75.984  1.00 46.91 ? 306  VAL A CB  1 
ATOM   1390  N  N   . ILE A  1  307 ? 7.008   60.198  75.762  1.00 46.91 ? 307  ILE A N   1 
ATOM   1391  C  CA  . ILE A  1  307 ? 6.689   61.365  76.582  1.00 46.91 ? 307  ILE A CA  1 
ATOM   1392  C  C   . ILE A  1  307 ? 5.179   61.570  76.681  1.00 46.91 ? 307  ILE A C   1 
ATOM   1393  O  O   . ILE A  1  307 ? 4.555   62.115  75.766  1.00 46.91 ? 307  ILE A O   1 
ATOM   1394  C  CB  . ILE A  1  307 ? 7.335   62.645  76.014  1.00 46.91 ? 307  ILE A CB  1 
ATOM   1395  N  N   . ASP A  1  308 ? 4.597   61.121  77.790  1.00 46.91 ? 308  ASP A N   1 
ATOM   1396  C  CA  . ASP A  1  308 ? 3.159   61.250  78.016  1.00 46.91 ? 308  ASP A CA  1 
ATOM   1397  C  C   . ASP A  1  308 ? 2.814   62.483  78.852  1.00 46.91 ? 308  ASP A C   1 
ATOM   1398  O  O   . ASP A  1  308 ? 3.648   63.369  79.053  1.00 46.91 ? 308  ASP A O   1 
ATOM   1399  C  CB  . ASP A  1  308 ? 2.615   59.992  78.699  1.00 46.91 ? 308  ASP A CB  1 
ATOM   1400  N  N   . ALA A  1  309 ? 1.566   62.547  79.310  1.00 46.91 ? 309  ALA A N   1 
ATOM   1401  C  CA  . ALA A  1  309 ? 1.106   63.660  80.132  1.00 46.91 ? 309  ALA A CA  1 
ATOM   1402  C  C   . ALA A  1  309 ? 1.587   63.495  81.572  1.00 46.91 ? 309  ALA A C   1 
ATOM   1403  O  O   . ALA A  1  309 ? 2.012   64.461  82.206  1.00 46.91 ? 309  ALA A O   1 
ATOM   1404  C  CB  . ALA A  1  309 ? -0.415  63.755  80.087  1.00 46.91 ? 309  ALA A CB  1 
ATOM   1405  N  N   . LYS A  1  310 ? 1.486   62.273  82.089  1.00 46.91 ? 310  LYS A N   1 
ATOM   1406  C  CA  . LYS A  1  310 ? 1.911   61.967  83.452  1.00 46.91 ? 310  LYS A CA  1 
ATOM   1407  C  C   . LYS A  1  310 ? 3.274   61.278  83.488  1.00 46.91 ? 310  LYS A C   1 
ATOM   1408  O  O   . LYS A  1  310 ? 3.997   61.366  84.486  1.00 46.91 ? 310  LYS A O   1 
ATOM   1409  C  CB  . LYS A  1  310 ? 0.870   61.092  84.152  1.00 46.91 ? 310  LYS A CB  1 
ATOM   1410  N  N   . GLY A  1  311 ? 3.613   60.585  82.404  1.00 46.91 ? 311  GLY A N   1 
ATOM   1411  C  CA  . GLY A  1  311 ? 4.885   59.889  82.331  1.00 46.91 ? 311  GLY A CA  1 
ATOM   1412  C  C   . GLY A  1  311 ? 4.722   58.383  82.275  1.00 46.91 ? 311  GLY A C   1 
ATOM   1413  O  O   . GLY A  1  311 ? 4.655   57.718  83.311  1.00 46.91 ? 311  GLY A O   1 
ATOM   1414  N  N   . ASN A  1  312 ? 4.650   57.844  81.062  1.00 46.91 ? 312  ASN A N   1 
ATOM   1415  C  CA  . ASN A  1  312 ? 4.491   56.408  80.870  1.00 46.91 ? 312  ASN A CA  1 
ATOM   1416  C  C   . ASN A  1  312 ? 5.336   55.902  79.703  1.00 46.91 ? 312  ASN A C   1 
ATOM   1417  O  O   . ASN A  1  312 ? 6.530   55.633  79.864  1.00 46.91 ? 312  ASN A O   1 
ATOM   1418  C  CB  . ASN A  1  312 ? 3.014   56.057  80.650  1.00 46.91 ? 312  ASN A CB  1 
ATOM   1419  N  N   . VAL A  1  313 ? 4.709   55.764  78.537  1.00 46.91 ? 313  VAL A N   1 
ATOM   1420  C  CA  . VAL A  1  313 ? 5.379   55.289  77.329  1.00 46.91 ? 313  VAL A CA  1 
ATOM   1421  C  C   . VAL A  1  313 ? 4.402   55.315  76.154  1.00 46.91 ? 313  VAL A C   1 
ATOM   1422  O  O   . VAL A  1  313 ? 3.640   54.369  75.944  1.00 46.91 ? 313  VAL A O   1 
ATOM   1423  C  CB  . VAL A  1  313 ? 5.919   53.851  77.505  1.00 46.91 ? 313  VAL A CB  1 
ATOM   1424  N  N   . ILE A  1  314 ? 4.407   56.424  75.418  1.00 46.91 ? 314  ILE A N   1 
ATOM   1425  C  CA  . ILE A  1  314 ? 3.530   56.601  74.265  1.00 46.91 ? 314  ILE A CA  1 
ATOM   1426  C  C   . ILE A  1  314 ? 4.016   55.806  73.054  1.00 46.91 ? 314  ILE A C   1 
ATOM   1427  O  O   . ILE A  1  314 ? 3.213   55.221  72.325  1.00 46.91 ? 314  ILE A O   1 
ATOM   1428  C  CB  . ILE A  1  314 ? 3.422   58.089  73.874  1.00 46.91 ? 314  ILE A CB  1 
ATOM   1429  N  N   . ASN A  1  315 ? 5.335   55.789  72.859  1.00 46.91 ? 315  ASN A N   1 
ATOM   1430  C  CA  . ASN A  1  315 ? 5.982   55.088  71.747  1.00 46.91 ? 315  ASN A CA  1 
ATOM   1431  C  C   . ASN A  1  315 ? 5.651   55.689  70.379  1.00 46.91 ? 315  ASN A C   1 
ATOM   1432  O  O   . ASN A  1  315 ? 4.683   56.441  70.232  1.00 46.91 ? 315  ASN A O   1 
ATOM   1433  C  CB  . ASN A  1  315 ? 5.645   53.593  71.769  1.00 46.91 ? 315  ASN A CB  1 
ATOM   1434  N  N   . THR A  1  316 ? 6.485   55.380  69.390  1.00 46.91 ? 316  THR A N   1 
ATOM   1435  C  CA  . THR A  1  316 ? 6.305   55.882  68.031  1.00 46.91 ? 316  THR A CA  1 
ATOM   1436  C  C   . THR A  1  316 ? 7.345   55.302  67.078  1.00 46.91 ? 316  THR A C   1 
ATOM   1437  O  O   . THR A  1  316 ? 8.289   54.637  67.505  1.00 46.91 ? 316  THR A O   1 
ATOM   1438  C  CB  . THR A  1  316 ? 6.422   57.418  67.977  1.00 46.91 ? 316  THR A CB  1 
ATOM   1439  N  N   . TRP A  1  317 ? 7.167   55.567  65.787  1.00 46.91 ? 317  TRP A N   1 
ATOM   1440  C  CA  . TRP A  1  317 ? 8.089   55.079  64.765  1.00 46.91 ? 317  TRP A CA  1 
ATOM   1441  C  C   . TRP A  1  317 ? 9.384   55.882  64.763  1.00 46.91 ? 317  TRP A C   1 
ATOM   1442  O  O   . TRP A  1  317 ? 9.457   56.963  64.169  1.00 46.91 ? 317  TRP A O   1 
ATOM   1443  C  CB  . TRP A  1  317 ? 7.440   55.146  63.382  1.00 46.91 ? 317  TRP A CB  1 
ATOM   1444  C  CG  . TRP A  1  317 ? 6.300   54.194  63.188  1.00 46.91 ? 317  TRP A CG  1 
ATOM   1445  C  CD1 . TRP A  1  317 ? 5.915   53.186  64.025  1.00 46.91 ? 317  TRP A CD1 1 
ATOM   1446  C  CD2 . TRP A  1  317 ? 5.400   54.156  62.076  1.00 46.91 ? 317  TRP A CD2 1 
ATOM   1447  N  NE1 . TRP A  1  317 ? 4.831   52.523  63.502  1.00 46.91 ? 317  TRP A NE1 1 
ATOM   1448  C  CE2 . TRP A  1  317 ? 4.494   53.099  62.304  1.00 46.91 ? 317  TRP A CE2 1 
ATOM   1449  C  CE3 . TRP A  1  317 ? 5.271   54.916  60.904  1.00 46.91 ? 317  TRP A CE3 1 
ATOM   1450  C  CZ2 . TRP A  1  317 ? 3.471   52.777  61.406  1.00 46.91 ? 317  TRP A CZ2 1 
ATOM   1451  C  CZ3 . TRP A  1  317 ? 4.254   54.597  60.010  1.00 46.91 ? 317  TRP A CZ3 1 
ATOM   1452  C  CH2 . TRP A  1  317 ? 3.368   53.536  60.268  1.00 46.91 ? 317  TRP A CH2 1 
ATOM   1453  N  N   . ALA A  1  318 ? 10.399  55.345  65.433  1.00 57.92 ? 318  ALA A N   1 
ATOM   1454  C  CA  . ALA A  1  318 ? 11.706  55.984  65.530  1.00 57.82 ? 318  ALA A CA  1 
ATOM   1455  C  C   . ALA A  1  318 ? 12.701  55.040  66.192  1.00 58.73 ? 318  ALA A C   1 
ATOM   1456  O  O   . ALA A  1  318 ? 13.782  54.786  65.655  1.00 57.86 ? 318  ALA A O   1 
ATOM   1457  C  CB  . ALA A  1  318 ? 11.608  57.283  66.324  1.00 57.10 ? 318  ALA A CB  1 
ATOM   1458  N  N   . ASP A  1  319 ? 12.325  54.529  67.360  1.00 46.91 ? 319  ASP A N   1 
ATOM   1459  C  CA  . ASP A  1  319 ? 13.167  53.609  68.119  1.00 46.91 ? 319  ASP A CA  1 
ATOM   1460  C  C   . ASP A  1  319 ? 12.325  52.582  68.875  1.00 46.91 ? 319  ASP A C   1 
ATOM   1461  O  O   . ASP A  1  319 ? 12.844  51.570  69.346  1.00 46.91 ? 319  ASP A O   1 
ATOM   1462  C  CB  . ASP A  1  319 ? 14.041  54.387  69.107  1.00 46.91 ? 319  ASP A CB  1 
ATOM   1463  N  N   . ILE A  1  320 ? 11.032  52.864  69.015  1.00 46.91 ? 320  ILE A N   1 
ATOM   1464  C  CA  . ILE A  1  320 ? 10.122  51.963  69.714  1.00 46.91 ? 320  ILE A CA  1 
ATOM   1465  C  C   . ILE A  1  320 ? 9.668   50.817  68.815  1.00 46.91 ? 320  ILE A C   1 
ATOM   1466  O  O   . ILE A  1  320 ? 9.554   49.673  69.260  1.00 46.91 ? 320  ILE A O   1 
ATOM   1467  C  CB  . ILE A  1  320 ? 8.881   52.714  70.231  1.00 46.91 ? 320  ILE A CB  1 
ATOM   1468  N  N   . ILE A  1  321 ? 9.370   51.142  67.560  1.00 46.91 ? 321  ILE A N   1 
ATOM   1469  C  CA  . ILE A  1  321 ? 8.925   50.153  66.585  1.00 46.91 ? 321  ILE A CA  1 
ATOM   1470  C  C   . ILE A  1  321 ? 10.081  49.676  65.708  1.00 46.91 ? 321  ILE A C   1 
ATOM   1471  O  O   . ILE A  1  321 ? 9.966   48.665  65.010  1.00 46.91 ? 321  ILE A O   1 
ATOM   1472  C  CB  . ILE A  1  321 ? 7.816   50.721  65.681  1.00 46.91 ? 321  ILE A CB  1 
ATOM   1473  N  N   . ASN A  1  322 ? 11.172  50.436  65.711  1.00 46.91 ? 322  ASN A N   1 
ATOM   1474  C  CA  . ASN A  1  322 ? 12.352  50.097  64.924  1.00 46.91 ? 322  ASN A CA  1 
ATOM   1475  C  C   . ASN A  1  322 ? 13.189  49.034  65.629  1.00 46.91 ? 322  ASN A C   1 
ATOM   1476  O  O   . ASN A  1  322 ? 13.708  48.117  64.990  1.00 46.91 ? 322  ASN A O   1 
ATOM   1477  C  CB  . ASN A  1  322 ? 13.204  51.344  64.679  1.00 46.91 ? 322  ASN A CB  1 
ATOM   1478  N  N   . ARG A  1  323 ? 13.336  49.183  66.942  1.00 46.91 ? 323  ARG A N   1 
ATOM   1479  C  CA  . ARG A  1  323 ? 14.111  48.246  67.748  1.00 46.91 ? 323  ARG A CA  1 
ATOM   1480  C  C   . ARG A  1  323 ? 13.261  47.083  68.258  1.00 46.91 ? 323  ARG A C   1 
ATOM   1481  O  O   . ARG A  1  323 ? 13.752  46.222  68.989  1.00 46.91 ? 323  ARG A O   1 
ATOM   1482  C  CB  . ARG A  1  323 ? 14.760  48.975  68.924  1.00 46.91 ? 323  ARG A CB  1 
ATOM   1483  N  N   . ALA A  1  324 ? 11.980  47.086  67.904  1.00 46.91 ? 324  ALA A N   1 
ATOM   1484  C  CA  . ALA A  1  324 ? 11.066  46.027  68.318  1.00 46.91 ? 324  ALA A CA  1 
ATOM   1485  C  C   . ALA A  1  324 ? 11.262  44.791  67.448  1.00 46.91 ? 324  ALA A C   1 
ATOM   1486  O  O   . ALA A  1  324 ? 11.119  43.659  67.916  1.00 46.91 ? 324  ALA A O   1 
ATOM   1487  C  CB  . ALA A  1  324 ? 9.627   46.511  68.224  1.00 46.91 ? 324  ALA A CB  1 
ATOM   1488  N  N   . ASN A  1  325 ? 11.542  45.018  66.168  1.00 46.91 ? 325  ASN A N   1 
ATOM   1489  C  CA  . ASN A  1  325 ? 11.756  43.932  65.218  1.00 46.91 ? 325  ASN A CA  1 
ATOM   1490  C  C   . ASN A  1  325 ? 13.241  43.623  65.029  1.00 46.91 ? 325  ASN A C   1 
ATOM   1491  O  O   . ASN A  1  325 ? 13.601  42.735  64.254  1.00 46.91 ? 325  ASN A O   1 
ATOM   1492  C  CB  . ASN A  1  325 ? 11.121  44.281  63.870  1.00 46.91 ? 325  ASN A CB  1 
ATOM   1493  N  N   . LEU A  1  326 ? 14.094  44.377  65.714  1.00 46.91 ? 326  LEU A N   1 
ATOM   1494  C  CA  . LEU A  1  326 ? 15.538  44.185  65.630  1.00 46.91 ? 326  LEU A CA  1 
ATOM   1495  C  C   . LEU A  1  326 ? 16.105  43.727  66.971  1.00 46.91 ? 326  LEU A C   1 
ATOM   1496  O  O   . LEU A  1  326 ? 17.012  42.896  67.018  1.00 46.91 ? 326  LEU A O   1 
ATOM   1497  C  CB  . LEU A  1  326 ? 16.220  45.481  65.191  1.00 46.91 ? 326  LEU A CB  1 
ATOM   1498  N  N   . GLY A  1  327 ? 15.576  44.282  68.053  1.00 46.91 ? 327  GLY A N   1 
ATOM   1499  C  CA  . GLY A  1  327 ? 16.040  43.914  69.382  1.00 46.91 ? 327  GLY A CA  1 
ATOM   1500  C  C   . GLY A  1  327 ? 15.357  42.682  69.946  1.00 46.91 ? 327  GLY A C   1 
ATOM   1501  O  O   . GLY A  1  327 ? 15.238  42.534  71.168  1.00 46.91 ? 327  GLY A O   1 
ATOM   1502  N  N   . MET A  1  328 ? 14.913  41.793  69.064  1.00 46.91 ? 328  MET A N   1 
ATOM   1503  C  CA  . MET A  1  328 ? 14.242  40.566  69.475  1.00 46.91 ? 328  MET A CA  1 
ATOM   1504  C  C   . MET A  1  328 ? 14.426  39.465  68.429  1.00 46.91 ? 328  MET A C   1 
ATOM   1505  O  O   . MET A  1  328 ? 14.418  38.276  68.764  1.00 46.91 ? 328  MET A O   1 
ATOM   1506  C  CB  . MET A  1  328 ? 12.753  40.827  69.702  1.00 46.91 ? 328  MET A CB  1 
ATOM   1507  N  N   . GLU A  1  329 ? 14.553  39.864  67.170  1.00 46.91 ? 329  GLU A N   1 
ATOM   1508  C  CA  . GLU A  1  329 ? 14.750  38.918  66.078  1.00 46.91 ? 329  GLU A CA  1 
ATOM   1509  C  C   . GLU A  1  329 ? 16.237  38.792  65.764  1.00 46.91 ? 329  GLU A C   1 
ATOM   1510  O  O   . GLU A  1  329 ? 16.739  37.691  65.532  1.00 46.91 ? 329  GLU A O   1 
ATOM   1511  C  CB  . GLU A  1  329 ? 13.988  39.374  64.832  1.00 46.91 ? 329  GLU A CB  1 
ATOM   1512  N  N   . VAL A  1  330 ? 16.923  39.932  65.721  1.00 46.91 ? 330  VAL A N   1 
ATOM   1513  C  CA  . VAL A  1  330 ? 18.355  39.974  65.447  1.00 46.91 ? 330  VAL A CA  1 
ATOM   1514  C  C   . VAL A  1  330 ? 19.143  39.579  66.694  1.00 46.91 ? 330  VAL A C   1 
ATOM   1515  O  O   . VAL A  1  330 ? 20.224  38.997  66.594  1.00 46.91 ? 330  VAL A O   1 
ATOM   1516  C  CB  . VAL A  1  330 ? 18.802  41.376  64.989  1.00 46.91 ? 330  VAL A CB  1 
ATOM   1517  N  N   . MET A  1  331 ? 18.592  39.891  67.865  1.00 46.91 ? 331  MET A N   1 
ATOM   1518  C  CA  . MET A  1  331 ? 19.233  39.562  69.136  1.00 46.91 ? 331  MET A CA  1 
ATOM   1519  C  C   . MET A  1  331 ? 19.095  38.070  69.447  1.00 46.91 ? 331  MET A C   1 
ATOM   1520  O  O   . MET A  1  331 ? 19.288  37.639  70.587  1.00 46.91 ? 331  MET A O   1 
ATOM   1521  C  CB  . MET A  1  331 ? 18.624  40.393  70.269  1.00 46.91 ? 331  MET A CB  1 
ATOM   1522  N  N   . HIS A  1  332 ? 18.717  37.298  68.433  1.00 46.91 ? 332  HIS A N   1 
ATOM   1523  C  CA  . HIS A  1  332 ? 18.549  35.855  68.560  1.00 46.91 ? 332  HIS A CA  1 
ATOM   1524  C  C   . HIS A  1  332 ? 19.650  35.151  67.762  1.00 46.91 ? 332  HIS A C   1 
ATOM   1525  O  O   . HIS A  1  332 ? 19.368  34.322  66.894  1.00 46.91 ? 332  HIS A O   1 
ATOM   1526  C  CB  . HIS A  1  332 ? 17.160  35.450  68.046  1.00 46.91 ? 332  HIS A CB  1 
ATOM   1527  C  CG  . HIS A  1  332 ? 16.817  34.011  68.278  1.00 46.91 ? 332  HIS A CG  1 
ATOM   1528  N  ND1 . HIS A  1  332 ? 16.979  33.043  67.311  1.00 46.91 ? 332  HIS A ND1 1 
ATOM   1529  C  CD2 . HIS A  1  332 ? 16.319  33.378  69.366  1.00 46.91 ? 332  HIS A CD2 1 
ATOM   1530  C  CE1 . HIS A  1  332 ? 16.598  31.874  67.795  1.00 46.91 ? 332  HIS A CE1 1 
ATOM   1531  N  NE2 . HIS A  1  332 ? 16.193  32.049  69.040  1.00 46.91 ? 332  HIS A NE2 1 
ATOM   1532  N  N   . GLU A  1  333 ? 20.902  35.491  68.058  1.00 46.91 ? 333  GLU A N   1 
ATOM   1533  C  CA  . GLU A  1  333 ? 22.045  34.898  67.366  1.00 46.91 ? 333  GLU A CA  1 
ATOM   1534  C  C   . GLU A  1  333 ? 22.251  33.437  67.767  1.00 46.91 ? 333  GLU A C   1 
ATOM   1535  O  O   . GLU A  1  333 ? 22.703  33.145  68.873  1.00 46.91 ? 333  GLU A O   1 
ATOM   1536  C  CB  . GLU A  1  333 ? 23.323  35.703  67.634  1.00 46.91 ? 333  GLU A CB  1 
ATOM   1537  C  CG  . GLU A  1  333 ? 24.525  35.258  66.801  1.00 46.91 ? 333  GLU A CG  1 
ATOM   1538  C  CD  . GLU A  1  333 ? 25.796  36.006  67.146  1.00 46.91 ? 333  GLU A CD  1 
ATOM   1539  O  OE1 . GLU A  1  333 ? 25.973  37.139  66.653  1.00 46.91 ? 333  GLU A OE1 1 
ATOM   1540  O  OE2 . GLU A  1  333 ? 26.621  35.459  67.909  1.00 46.91 ? 333  GLU A OE2 1 
ATOM   1541  N  N   . ARG A  1  334 ? 21.865  32.535  66.865  1.00 46.91 ? 334  ARG A N   1 
ATOM   1542  C  CA  . ARG A  1  334 ? 21.981  31.085  67.041  1.00 46.91 ? 334  ARG A CA  1 
ATOM   1543  C  C   . ARG A  1  334 ? 22.042  30.583  68.485  1.00 46.91 ? 334  ARG A C   1 
ATOM   1544  O  O   . ARG A  1  334 ? 21.007  30.405  69.134  1.00 46.91 ? 334  ARG A O   1 
ATOM   1545  C  CB  . ARG A  1  334 ? 23.175  30.553  66.241  1.00 46.91 ? 334  ARG A CB  1 
ATOM   1546  N  N   . ASN A  1  335 ? 23.257  30.317  68.965  1.00 46.91 ? 335  ASN A N   1 
ATOM   1547  C  CA  . ASN A  1  335 ? 23.490  29.836  70.325  1.00 46.91 ? 335  ASN A CA  1 
ATOM   1548  C  C   . ASN A  1  335 ? 24.984  29.860  70.668  1.00 46.91 ? 335  ASN A C   1 
ATOM   1549  O  O   . ASN A  1  335 ? 25.650  28.820  70.659  1.00 46.91 ? 335  ASN A O   1 
ATOM   1550  C  CB  . ASN A  1  335 ? 22.937  28.415  70.495  1.00 46.91 ? 335  ASN A CB  1 
ATOM   1551  N  N   . ALA A  1  336 ? 25.499  31.050  70.967  1.00 46.91 ? 336  ALA A N   1 
ATOM   1552  C  CA  . ALA A  1  336 ? 26.908  31.227  71.314  1.00 46.91 ? 336  ALA A CA  1 
ATOM   1553  C  C   . ALA A  1  336 ? 27.068  31.717  72.752  1.00 46.91 ? 336  ALA A C   1 
ATOM   1554  O  O   . ALA A  1  336 ? 27.821  31.135  73.539  1.00 46.91 ? 336  ALA A O   1 
ATOM   1555  C  CB  . ALA A  1  336 ? 27.573  32.203  70.344  1.00 46.91 ? 336  ALA A CB  1 
ATOM   1556  N  N   . HIS A  1  337 ? 26.358  32.792  73.086  1.00 46.91 ? 337  HIS A N   1 
ATOM   1557  C  CA  . HIS A  1  337 ? 26.408  33.379  74.420  1.00 46.91 ? 337  HIS A CA  1 
ATOM   1558  C  C   . HIS A  1  337 ? 25.618  32.551  75.433  1.00 46.91 ? 337  HIS A C   1 
ATOM   1559  O  O   . HIS A  1  337 ? 24.748  31.758  75.063  1.00 46.91 ? 337  HIS A O   1 
ATOM   1560  C  CB  . HIS A  1  337 ? 25.878  34.816  74.379  1.00 46.91 ? 337  HIS A CB  1 
ATOM   1561  N  N   . ASN A  1  338 ? 25.942  32.724  76.711  1.00 46.91 ? 338  ASN A N   1 
ATOM   1562  C  CA  . ASN A  1  338 ? 25.277  32.000  77.791  1.00 46.91 ? 338  ASN A CA  1 
ATOM   1563  C  C   . ASN A  1  338 ? 25.589  32.635  79.141  1.00 46.91 ? 338  ASN A C   1 
ATOM   1564  O  O   . ASN A  1  338 ? 24.720  32.729  80.009  1.00 46.91 ? 338  ASN A O   1 
ATOM   1565  C  CB  . ASN A  1  338 ? 25.714  30.531  77.801  1.00 46.91 ? 338  ASN A CB  1 
ATOM   1566  N  N   . PHE A  1  339 ? 26.841  33.047  79.316  1.00 46.91 ? 339  PHE A N   1 
ATOM   1567  C  CA  . PHE A  1  339 ? 27.293  33.674  80.556  1.00 46.91 ? 339  PHE A CA  1 
ATOM   1568  C  C   . PHE A  1  339 ? 26.973  35.164  80.583  1.00 46.91 ? 339  PHE A C   1 
ATOM   1569  O  O   . PHE A  1  339 ? 26.265  35.643  81.469  1.00 46.91 ? 339  PHE A O   1 
ATOM   1570  C  CB  . PHE A  1  339 ? 28.800  33.466  80.735  1.00 46.91 ? 339  PHE A CB  1 
ATOM   1571  N  N   . PRO A  1  340 ? 27.522  35.919  79.621  1.00 46.91 ? 340  PRO A N   1 
ATOM   1572  C  CA  . PRO A  1  340 ? 27.319  37.366  79.502  1.00 46.91 ? 340  PRO A CA  1 
ATOM   1573  C  C   . PRO A  1  340 ? 25.893  37.734  79.083  1.00 46.91 ? 340  PRO A C   1 
ATOM   1574  O  O   . PRO A  1  340 ? 25.203  36.947  78.434  1.00 46.91 ? 340  PRO A O   1 
ATOM   1575  C  CB  . PRO A  1  340 ? 28.347  37.778  78.447  1.00 46.91 ? 340  PRO A CB  1 
ATOM   1576  N  N   . LEU A  1  341 ? 25.449  38.916  79.504  1.00 46.91 ? 341  LEU A N   1 
ATOM   1577  C  CA  . LEU A  1  341 ? 24.112  39.409  79.180  1.00 46.91 ? 341  LEU A CA  1 
ATOM   1578  C  C   . LEU A  1  341 ? 24.169  40.874  78.758  1.00 46.91 ? 341  LEU A C   1 
ATOM   1579  O  O   . LEU A  1  341 ? 23.222  41.397  78.163  1.00 46.91 ? 341  LEU A O   1 
ATOM   1580  C  CB  . LEU A  1  341 ? 23.178  39.253  80.384  1.00 46.91 ? 341  LEU A CB  1 
ATOM   1581  N  N   . ASP A  1  342 ? 25.266  41.538  79.112  1.00 46.91 ? 342  ASP A N   1 
ATOM   1582  C  CA  . ASP A  1  342 ? 25.470  42.943  78.776  1.00 46.91 ? 342  ASP A CA  1 
ATOM   1583  C  C   . ASP A  1  342 ? 25.796  43.126  77.294  1.00 46.91 ? 342  ASP A C   1 
ATOM   1584  O  O   . ASP A  1  342 ? 25.181  43.950  76.617  1.00 46.91 ? 342  ASP A O   1 
ATOM   1585  C  CB  . ASP A  1  342 ? 26.590  43.539  79.639  1.00 46.91 ? 342  ASP A CB  1 
ATOM   1586  N  N   . LEU A  1  343 ? 26.783  42.376  76.808  1.00 46.91 ? 343  LEU A N   1 
ATOM   1587  C  CA  . LEU A  1  343 ? 27.191  42.453  75.408  1.00 46.91 ? 343  LEU A CA  1 
ATOM   1588  C  C   . LEU A  1  343 ? 27.287  41.068  74.783  1.00 46.91 ? 343  LEU A C   1 
ATOM   1589  O  O   . LEU A  1  343 ? 27.907  40.161  75.350  1.00 46.91 ? 343  LEU A O   1 
ATOM   1590  C  CB  . LEU A  1  343 ? 28.534  43.178  75.277  1.00 46.91 ? 343  LEU A CB  1 
ATOM   1591  N  N   . ALA A  1  344 ? 26.662  40.914  73.621  1.00 46.91 ? 344  ALA A N   1 
ATOM   1592  C  CA  . ALA A  1  344 ? 26.661  39.651  72.890  1.00 46.91 ? 344  ALA A CA  1 
ATOM   1593  C  C   . ALA A  1  344 ? 28.027  39.361  72.274  1.00 46.91 ? 344  ALA A C   1 
ATOM   1594  O  O   . ALA A  1  344 ? 28.830  38.680  72.950  1.00 46.91 ? 344  ALA A O   1 
ATOM   1595  C  CB  . ALA A  1  344 ? 25.587  39.682  71.801  1.00 46.91 ? 344  ALA A CB  1 
ATOM   1596  N  N   . MET B  2  1   ? 27.432  40.738  17.484  1.00 46.91 ? 1    MET B N   1 
ATOM   1597  C  CA  . MET B  2  1   ? 27.458  42.177  17.881  1.00 46.91 ? 1    MET B CA  1 
ATOM   1598  C  C   . MET B  2  1   ? 26.973  43.099  16.760  1.00 46.91 ? 1    MET B C   1 
ATOM   1599  O  O   . MET B  2  1   ? 26.569  44.234  17.013  1.00 46.91 ? 1    MET B O   1 
ATOM   1600  C  CB  . MET B  2  1   ? 28.871  42.580  18.309  1.00 46.91 ? 1    MET B CB  1 
ATOM   1601  N  N   . GLY B  2  2   ? 27.046  42.613  15.524  1.00 46.91 ? 2    GLY B N   1 
ATOM   1602  C  CA  . GLY B  2  2   ? 26.604  43.402  14.388  1.00 46.91 ? 2    GLY B CA  1 
ATOM   1603  C  C   . GLY B  2  2   ? 25.153  43.120  14.051  1.00 46.91 ? 2    GLY B C   1 
ATOM   1604  O  O   . GLY B  2  2   ? 24.258  43.843  14.486  1.00 46.91 ? 2    GLY B O   1 
ATOM   1605  N  N   . LEU B  2  3   ? 24.930  42.047  13.291  1.00 46.91 ? 3    LEU B N   1 
ATOM   1606  C  CA  . LEU B  2  3   ? 23.592  41.620  12.870  1.00 46.91 ? 3    LEU B CA  1 
ATOM   1607  C  C   . LEU B  2  3   ? 22.890  42.608  11.934  1.00 46.91 ? 3    LEU B C   1 
ATOM   1608  O  O   . LEU B  2  3   ? 23.243  43.786  11.879  1.00 46.91 ? 3    LEU B O   1 
ATOM   1609  C  CB  . LEU B  2  3   ? 22.706  41.339  14.091  1.00 46.91 ? 3    LEU B CB  1 
ATOM   1610  N  N   . PRO B  2  4   ? 21.917  42.118  11.145  1.00 46.91 ? 4    PRO B N   1 
ATOM   1611  C  CA  . PRO B  2  4   ? 21.165  42.960  10.208  1.00 46.91 ? 4    PRO B CA  1 
ATOM   1612  C  C   . PRO B  2  4   ? 20.236  43.924  10.945  1.00 46.91 ? 4    PRO B C   1 
ATOM   1613  O  O   . PRO B  2  4   ? 19.525  43.521  11.864  1.00 46.91 ? 4    PRO B O   1 
ATOM   1614  C  CB  . PRO B  2  4   ? 20.376  41.933  9.396   1.00 46.91 ? 4    PRO B CB  1 
ATOM   1615  C  CG  . PRO B  2  4   ? 20.139  40.834  10.388  1.00 46.91 ? 4    PRO B CG  1 
ATOM   1616  C  CD  . PRO B  2  4   ? 21.493  40.711  11.036  1.00 46.91 ? 4    PRO B CD  1 
ATOM   1617  N  N   . TRP B  2  5   ? 20.216  45.178  10.494  1.00 46.91 ? 5    TRP B N   1 
ATOM   1618  C  CA  . TRP B  2  5   ? 19.389  46.229  11.089  1.00 46.91 ? 5    TRP B CA  1 
ATOM   1619  C  C   . TRP B  2  5   ? 19.884  46.648  12.474  1.00 46.91 ? 5    TRP B C   1 
ATOM   1620  O  O   . TRP B  2  5   ? 20.554  47.675  12.609  1.00 46.91 ? 5    TRP B O   1 
ATOM   1621  C  CB  . TRP B  2  5   ? 17.915  45.805  11.150  1.00 46.91 ? 5    TRP B CB  1 
ATOM   1622  N  N   . TYR B  2  6   ? 19.551  45.859  13.492  1.00 46.91 ? 6    TYR B N   1 
ATOM   1623  C  CA  . TYR B  2  6   ? 19.957  46.142  14.866  1.00 46.91 ? 6    TYR B CA  1 
ATOM   1624  C  C   . TYR B  2  6   ? 19.716  44.928  15.769  1.00 46.91 ? 6    TYR B C   1 
ATOM   1625  O  O   . TYR B  2  6   ? 20.057  43.799  15.409  1.00 46.91 ? 6    TYR B O   1 
ATOM   1626  C  CB  . TYR B  2  6   ? 19.201  47.365  15.400  1.00 46.91 ? 6    TYR B CB  1 
ATOM   1627  N  N   . ARG B  2  7   ? 19.142  45.164  16.947  1.00 46.91 ? 7    ARG B N   1 
ATOM   1628  C  CA  . ARG B  2  7   ? 18.859  44.089  17.892  1.00 46.91 ? 7    ARG B CA  1 
ATOM   1629  C  C   . ARG B  2  7   ? 17.355  43.913  18.106  1.00 46.91 ? 7    ARG B C   1 
ATOM   1630  O  O   . ARG B  2  7   ? 16.922  43.329  19.103  1.00 46.91 ? 7    ARG B O   1 
ATOM   1631  C  CB  . ARG B  2  7   ? 19.549  44.367  19.231  1.00 46.91 ? 7    ARG B CB  1 
ATOM   1632  N  N   . VAL B  2  8   ? 16.562  44.414  17.164  1.00 46.91 ? 8    VAL B N   1 
ATOM   1633  C  CA  . VAL B  2  8   ? 15.109  44.320  17.246  1.00 46.91 ? 8    VAL B CA  1 
ATOM   1634  C  C   . VAL B  2  8   ? 14.480  44.331  15.858  1.00 46.91 ? 8    VAL B C   1 
ATOM   1635  O  O   . VAL B  2  8   ? 15.002  44.962  14.937  1.00 46.91 ? 8    VAL B O   1 
ATOM   1636  C  CB  . VAL B  2  8   ? 14.518  45.485  18.065  1.00 46.91 ? 8    VAL B CB  1 
ATOM   1637  N  N   . HIS B  2  9   ? 13.360  43.626  15.715  1.00 46.91 ? 9    HIS B N   1 
ATOM   1638  C  CA  . HIS B  2  9   ? 12.647  43.546  14.442  1.00 46.91 ? 9    HIS B CA  1 
ATOM   1639  C  C   . HIS B  2  9   ? 12.122  44.918  14.027  1.00 46.91 ? 9    HIS B C   1 
ATOM   1640  O  O   . HIS B  2  9   ? 11.035  45.332  14.436  1.00 46.91 ? 9    HIS B O   1 
ATOM   1641  C  CB  . HIS B  2  9   ? 11.487  42.549  14.542  1.00 46.91 ? 9    HIS B CB  1 
ATOM   1642  C  CG  . HIS B  2  9   ? 11.915  41.158  14.900  1.00 46.91 ? 9    HIS B CG  1 
ATOM   1643  N  ND1 . HIS B  2  9   ? 12.456  40.285  13.980  1.00 46.91 ? 9    HIS B ND1 1 
ATOM   1644  C  CD2 . HIS B  2  9   ? 11.884  40.491  16.077  1.00 46.91 ? 9    HIS B CD2 1 
ATOM   1645  C  CE1 . HIS B  2  9   ? 12.739  39.141  14.576  1.00 46.91 ? 9    HIS B CE1 1 
ATOM   1646  N  NE2 . HIS B  2  9   ? 12.402  39.238  15.848  1.00 46.91 ? 9    HIS B NE2 1 
ATOM   1647  N  N   . THR B  2  10  ? 12.919  45.627  13.234  1.00 46.91 ? 10   THR B N   1 
ATOM   1648  C  CA  . THR B  2  10  ? 12.556  46.956  12.756  1.00 46.91 ? 10   THR B CA  1 
ATOM   1649  C  C   . THR B  2  10  ? 11.973  46.895  11.344  1.00 46.91 ? 10   THR B C   1 
ATOM   1650  O  O   . THR B  2  10  ? 12.152  47.818  10.548  1.00 46.91 ? 10   THR B O   1 
ATOM   1651  C  CB  . THR B  2  10  ? 13.777  47.899  12.763  1.00 46.91 ? 10   THR B CB  1 
ATOM   1652  N  N   . VAL B  2  11  ? 11.301  45.790  11.037  1.00 46.91 ? 11   VAL B N   1 
ATOM   1653  C  CA  . VAL B  2  11  ? 10.686  45.594  9.728   1.00 46.91 ? 11   VAL B CA  1 
ATOM   1654  C  C   . VAL B  2  11  ? 9.292   46.226  9.672   1.00 46.91 ? 11   VAL B C   1 
ATOM   1655  O  O   . VAL B  2  11  ? 8.995   47.157  10.422  1.00 46.91 ? 11   VAL B O   1 
ATOM   1656  C  CB  . VAL B  2  11  ? 10.585  44.094  9.380   1.00 46.91 ? 11   VAL B CB  1 
ATOM   1657  N  N   . LEU B  2  12  ? 8.444   45.699  8.789   1.00 46.91 ? 12   LEU B N   1 
ATOM   1658  C  CA  . LEU B  2  12  ? 7.077   46.186  8.608   1.00 46.91 ? 12   LEU B CA  1 
ATOM   1659  C  C   . LEU B  2  12  ? 7.036   47.642  8.140   1.00 46.91 ? 12   LEU B C   1 
ATOM   1660  O  O   . LEU B  2  12  ? 7.521   47.958  7.052   1.00 46.91 ? 12   LEU B O   1 
ATOM   1661  C  CB  . LEU B  2  12  ? 6.263   46.003  9.896   1.00 46.91 ? 12   LEU B CB  1 
ATOM   1662  N  N   . ILE B  2  13  ? 6.490   48.522  8.980   1.00 46.91 ? 13   ILE B N   1 
ATOM   1663  C  CA  . ILE B  2  13  ? 6.360   49.948  8.679   1.00 46.91 ? 13   ILE B CA  1 
ATOM   1664  C  C   . ILE B  2  13  ? 5.386   50.192  7.526   1.00 46.91 ? 13   ILE B C   1 
ATOM   1665  O  O   . ILE B  2  13  ? 4.205   50.455  7.756   1.00 46.91 ? 13   ILE B O   1 
ATOM   1666  C  CB  . ILE B  2  13  ? 7.726   50.603  8.364   1.00 46.91 ? 13   ILE B CB  1 
ATOM   1667  N  N   . ASN B  2  14  ? 5.884   50.130  6.295   1.00 46.91 ? 14   ASN B N   1 
ATOM   1668  C  CA  . ASN B  2  14  ? 5.045   50.334  5.120   1.00 46.91 ? 14   ASN B CA  1 
ATOM   1669  C  C   . ASN B  2  14  ? 4.664   48.997  4.485   1.00 46.91 ? 14   ASN B C   1 
ATOM   1670  O  O   . ASN B  2  14  ? 4.849   48.791  3.283   1.00 46.91 ? 14   ASN B O   1 
ATOM   1671  C  CB  . ASN B  2  14  ? 5.765   51.217  4.096   1.00 46.91 ? 14   ASN B CB  1 
ATOM   1672  N  N   . ASP B  2  15  ? 4.139   48.090  5.302   1.00 46.91 ? 15   ASP B N   1 
ATOM   1673  C  CA  . ASP B  2  15  ? 3.729   46.774  4.824   1.00 46.91 ? 15   ASP B CA  1 
ATOM   1674  C  C   . ASP B  2  15  ? 2.423   46.336  5.486   1.00 46.91 ? 15   ASP B C   1 
ATOM   1675  O  O   . ASP B  2  15  ? 2.432   45.751  6.570   1.00 46.91 ? 15   ASP B O   1 
ATOM   1676  C  CB  . ASP B  2  15  ? 4.833   45.742  5.090   1.00 46.91 ? 15   ASP B CB  1 
ATOM   1677  N  N   . PRO B  2  16  ? 1.280   46.645  4.850   1.00 46.91 ? 16   PRO B N   1 
ATOM   1678  C  CA  . PRO B  2  16  ? -0.039  46.283  5.378   1.00 46.91 ? 16   PRO B CA  1 
ATOM   1679  C  C   . PRO B  2  16  ? -0.344  44.788  5.263   1.00 46.91 ? 16   PRO B C   1 
ATOM   1680  O  O   . PRO B  2  16  ? -1.241  44.278  5.939   1.00 46.91 ? 16   PRO B O   1 
ATOM   1681  C  CB  . PRO B  2  16  ? -0.984  47.113  4.512   1.00 46.91 ? 16   PRO B CB  1 
ATOM   1682  C  CG  . PRO B  2  16  ? -0.278  47.144  3.196   1.00 46.91 ? 16   PRO B CG  1 
ATOM   1683  C  CD  . PRO B  2  16  ? 1.148   47.436  3.612   1.00 46.91 ? 16   PRO B CD  1 
ATOM   1684  N  N   . GLY B  2  17  ? 0.375   44.109  4.372   1.00 46.91 ? 17   GLY B N   1 
ATOM   1685  C  CA  . GLY B  2  17  ? 0.179   42.684  4.171   1.00 46.91 ? 17   GLY B CA  1 
ATOM   1686  C  C   . GLY B  2  17  ? 0.863   41.855  5.241   1.00 46.91 ? 17   GLY B C   1 
ATOM   1687  O  O   . GLY B  2  17  ? 0.272   40.921  5.783   1.00 46.91 ? 17   GLY B O   1 
ATOM   1688  N  N   . ARG B  2  18  ? 2.116   42.195  5.529   1.00 46.91 ? 18   ARG B N   1 
ATOM   1689  C  CA  . ARG B  2  18  ? 2.905   41.499  6.540   1.00 46.91 ? 18   ARG B CA  1 
ATOM   1690  C  C   . ARG B  2  18  ? 2.422   41.828  7.952   1.00 46.91 ? 18   ARG B C   1 
ATOM   1691  O  O   . ARG B  2  18  ? 2.743   41.116  8.906   1.00 46.91 ? 18   ARG B O   1 
ATOM   1692  C  CB  . ARG B  2  18  ? 4.385   41.863  6.397   1.00 46.91 ? 18   ARG B CB  1 
ATOM   1693  N  N   . LEU B  2  19  ? 1.694   42.934  8.083   1.00 46.91 ? 19   LEU B N   1 
ATOM   1694  C  CA  . LEU B  2  19  ? 1.156   43.367  9.369   1.00 46.91 ? 19   LEU B CA  1 
ATOM   1695  C  C   . LEU B  2  19  ? -0.071  42.544  9.749   1.00 46.91 ? 19   LEU B C   1 
ATOM   1696  O  O   . LEU B  2  19  ? -0.336  42.318  10.933  1.00 46.91 ? 19   LEU B O   1 
ATOM   1697  C  CB  . LEU B  2  19  ? 0.782   44.851  9.318   1.00 46.91 ? 19   LEU B CB  1 
ATOM   1698  N  N   . ILE B  2  20  ? -0.853  42.162  8.742   1.00 46.91 ? 20   ILE B N   1 
ATOM   1699  C  CA  . ILE B  2  20  ? -2.055  41.361  8.948   1.00 46.91 ? 20   ILE B CA  1 
ATOM   1700  C  C   . ILE B  2  20  ? -1.707  39.881  9.077   1.00 46.91 ? 20   ILE B C   1 
ATOM   1701  O  O   . ILE B  2  20  ? -2.456  39.110  9.680   1.00 46.91 ? 20   ILE B O   1 
ATOM   1702  C  CB  . ILE B  2  20  ? -3.059  41.542  7.792   1.00 46.91 ? 20   ILE B CB  1 
ATOM   1703  N  N   . ALA B  2  21  ? -0.586  39.488  8.477   1.00 46.91 ? 21   ALA B N   1 
ATOM   1704  C  CA  . ALA B  2  21  ? -0.123  38.105  8.518   1.00 46.91 ? 21   ALA B CA  1 
ATOM   1705  C  C   . ALA B  2  21  ? 0.526   37.789  9.863   1.00 46.91 ? 21   ALA B C   1 
ATOM   1706  O  O   . ALA B  2  21  ? 0.344   36.700  10.410  1.00 46.91 ? 21   ALA B O   1 
ATOM   1707  C  CB  . ALA B  2  21  ? 0.860   37.847  7.383   1.00 46.91 ? 21   ALA B CB  1 
ATOM   1708  N  N   . ALA B  2  22  ? 1.305   38.737  10.378  1.00 46.91 ? 22   ALA B N   1 
ATOM   1709  C  CA  . ALA B  2  22  ? 1.980   38.573  11.662  1.00 46.91 ? 22   ALA B CA  1 
ATOM   1710  C  C   . ALA B  2  22  ? 0.995   38.731  12.819  1.00 46.91 ? 22   ALA B C   1 
ATOM   1711  O  O   . ALA B  2  22  ? 1.327   38.444  13.971  1.00 46.91 ? 22   ALA B O   1 
ATOM   1712  C  CB  . ALA B  2  22  ? 3.113   39.580  11.791  1.00 46.91 ? 22   ALA B CB  1 
ATOM   1713  N  N   . HIS B  2  23  ? -0.192  39.244  12.512  1.00 46.91 ? 23   HIS B N   1 
ATOM   1714  C  CA  . HIS B  2  23  ? -1.235  39.442  13.508  1.00 46.91 ? 23   HIS B CA  1 
ATOM   1715  C  C   . HIS B  2  23  ? -2.141  38.215  13.580  1.00 46.91 ? 23   HIS B C   1 
ATOM   1716  O  O   . HIS B  2  23  ? -2.859  38.019  14.564  1.00 46.91 ? 23   HIS B O   1 
ATOM   1717  C  CB  . HIS B  2  23  ? -2.066  40.680  13.168  1.00 46.91 ? 23   HIS B CB  1 
ATOM   1718  N  N   . LEU B  2  24  ? -2.130  37.418  12.516  1.00 46.91 ? 24   LEU B N   1 
ATOM   1719  C  CA  . LEU B  2  24  ? -2.937  36.207  12.434  1.00 46.91 ? 24   LEU B CA  1 
ATOM   1720  C  C   . LEU B  2  24  ? -2.150  34.984  12.896  1.00 46.91 ? 24   LEU B C   1 
ATOM   1721  O  O   . LEU B  2  24  ? -2.668  34.153  13.642  1.00 46.91 ? 24   LEU B O   1 
ATOM   1722  C  CB  . LEU B  2  24  ? -3.431  35.994  11.001  1.00 46.91 ? 24   LEU B CB  1 
ATOM   1723  N  N   . MET B  2  25  ? -0.905  34.880  12.438  1.00 46.91 ? 25   MET B N   1 
ATOM   1724  C  CA  . MET B  2  25  ? -0.029  33.768  12.794  1.00 46.91 ? 25   MET B CA  1 
ATOM   1725  C  C   . MET B  2  25  ? 0.383   33.826  14.263  1.00 46.91 ? 25   MET B C   1 
ATOM   1726  O  O   . MET B  2  25  ? 0.795   32.819  14.842  1.00 46.91 ? 25   MET B O   1 
ATOM   1727  C  CB  . MET B  2  25  ? 1.219   33.772  11.908  1.00 46.91 ? 25   MET B CB  1 
ATOM   1728  N  N   . HIS B  2  26  ? 0.331   35.023  14.842  1.00 46.91 ? 26   HIS B N   1 
ATOM   1729  C  CA  . HIS B  2  26  ? 0.683   35.216  16.243  1.00 46.91 ? 26   HIS B CA  1 
ATOM   1730  C  C   . HIS B  2  26  ? -0.564  35.127  17.119  1.00 46.91 ? 26   HIS B C   1 
ATOM   1731  O  O   . HIS B  2  26  ? -0.470  35.042  18.346  1.00 46.91 ? 26   HIS B O   1 
ATOM   1732  C  CB  . HIS B  2  26  ? 1.366   36.569  16.440  1.00 46.91 ? 26   HIS B CB  1 
ATOM   1733  N  N   . THR B  2  27  ? -1.728  35.211  16.481  1.00 46.91 ? 27   THR B N   1 
ATOM   1734  C  CA  . THR B  2  27  ? -3.008  35.127  17.176  1.00 46.91 ? 27   THR B CA  1 
ATOM   1735  C  C   . THR B  2  27  ? -3.388  33.663  17.356  1.00 46.91 ? 27   THR B C   1 
ATOM   1736  O  O   . THR B  2  27  ? -4.063  33.299  18.322  1.00 46.91 ? 27   THR B O   1 
ATOM   1737  C  CB  . THR B  2  27  ? -4.120  35.821  16.375  1.00 46.91 ? 27   THR B CB  1 
ATOM   1738  N  N   . ALA B  2  28  ? -2.984  32.842  16.392  1.00 46.91 ? 28   ALA B N   1 
ATOM   1739  C  CA  . ALA B  2  28  ? -3.259  31.412  16.415  1.00 46.91 ? 28   ALA B CA  1 
ATOM   1740  C  C   . ALA B  2  28  ? -2.165  30.668  17.174  1.00 46.91 ? 28   ALA B C   1 
ATOM   1741  O  O   . ALA B  2  28  ? -2.314  29.490  17.496  1.00 46.91 ? 28   ALA B O   1 
ATOM   1742  C  CB  . ALA B  2  28  ? -3.364  30.879  14.993  1.00 46.91 ? 28   ALA B CB  1 
ATOM   1743  N  N   . LEU B  2  29  ? -1.048  31.350  17.413  1.00 46.91 ? 29   LEU B N   1 
ATOM   1744  C  CA  . LEU B  2  29  ? 0.075   30.767  18.139  1.00 46.91 ? 29   LEU B CA  1 
ATOM   1745  C  C   . LEU B  2  29  ? -0.094  30.989  19.638  1.00 46.91 ? 29   LEU B C   1 
ATOM   1746  O  O   . LEU B  2  29  ? 0.445   30.239  20.455  1.00 46.91 ? 29   LEU B O   1 
ATOM   1747  C  CB  . LEU B  2  29  ? 1.390   31.390  17.668  1.00 46.91 ? 29   LEU B CB  1 
ATOM   1748  N  N   . VAL B  2  30  ? -0.790  32.066  19.990  1.00 46.91 ? 30   VAL B N   1 
ATOM   1749  C  CA  . VAL B  2  30  ? -1.049  32.401  21.385  1.00 46.91 ? 30   VAL B CA  1 
ATOM   1750  C  C   . VAL B  2  30  ? -2.241  31.596  21.888  1.00 46.91 ? 30   VAL B C   1 
ATOM   1751  O  O   . VAL B  2  30  ? -2.483  31.507  23.093  1.00 46.91 ? 30   VAL B O   1 
ATOM   1752  C  CB  . VAL B  2  30  ? -1.357  33.900  21.548  1.00 46.91 ? 30   VAL B CB  1 
ATOM   1753  N  N   . ALA B  2  31  ? -3.006  31.052  20.944  1.00 46.91 ? 31   ALA B N   1 
ATOM   1754  C  CA  . ALA B  2  31  ? -4.178  30.246  21.245  1.00 46.91 ? 31   ALA B CA  1 
ATOM   1755  C  C   . ALA B  2  31  ? -3.925  28.787  20.869  1.00 46.91 ? 31   ALA B C   1 
ATOM   1756  O  O   . ALA B  2  31  ? -4.667  27.893  21.279  1.00 46.91 ? 31   ALA B O   1 
ATOM   1757  C  CB  . ALA B  2  31  ? -5.386  30.781  20.491  1.00 46.91 ? 31   ALA B CB  1 
ATOM   1758  N  N   . GLY B  2  32  ? -2.888  28.563  20.067  1.00 46.91 ? 32   GLY B N   1 
ATOM   1759  C  CA  . GLY B  2  32  ? -2.540  27.220  19.639  1.00 46.91 ? 32   GLY B CA  1 
ATOM   1760  C  C   . GLY B  2  32  ? -1.564  26.548  20.585  1.00 46.91 ? 32   GLY B C   1 
ATOM   1761  O  O   . GLY B  2  32  ? -1.640  25.337  20.811  1.00 46.91 ? 32   GLY B O   1 
ATOM   1762  N  N   . TRP B  2  33  ? -0.612  27.322  21.098  1.00 46.91 ? 33   TRP B N   1 
ATOM   1763  C  CA  . TRP B  2  33  ? 0.382   26.809  22.034  1.00 46.91 ? 33   TRP B CA  1 
ATOM   1764  C  C   . TRP B  2  33  ? -0.198  26.715  23.441  1.00 46.91 ? 33   TRP B C   1 
ATOM   1765  O  O   . TRP B  2  33  ? 0.222   25.875  24.240  1.00 46.91 ? 33   TRP B O   1 
ATOM   1766  C  CB  . TRP B  2  33  ? 1.629   27.696  22.041  1.00 46.91 ? 33   TRP B CB  1 
ATOM   1767  C  CG  . TRP B  2  33  ? 2.602   27.383  20.944  1.00 46.91 ? 33   TRP B CG  1 
ATOM   1768  C  CD1 . TRP B  2  33  ? 2.931   28.180  19.882  1.00 46.91 ? 33   TRP B CD1 1 
ATOM   1769  C  CD2 . TRP B  2  33  ? 3.388   26.193  20.807  1.00 46.91 ? 33   TRP B CD2 1 
ATOM   1770  N  NE1 . TRP B  2  33  ? 3.873   27.561  19.096  1.00 46.91 ? 33   TRP B NE1 1 
ATOM   1771  C  CE2 . TRP B  2  33  ? 4.172   26.338  19.641  1.00 46.91 ? 33   TRP B CE2 1 
ATOM   1772  C  CE3 . TRP B  2  33  ? 3.508   25.014  21.559  1.00 46.91 ? 33   TRP B CE3 1 
ATOM   1773  C  CZ2 . TRP B  2  33  ? 5.063   25.350  19.207  1.00 46.91 ? 33   TRP B CZ2 1 
ATOM   1774  C  CZ3 . TRP B  2  33  ? 4.394   24.033  21.128  1.00 46.91 ? 33   TRP B CZ3 1 
ATOM   1775  C  CH2 . TRP B  2  33  ? 5.160   24.208  19.962  1.00 46.91 ? 33   TRP B CH2 1 
ATOM   1776  N  N   . ALA B  2  34  ? -1.125  27.616  23.748  1.00 46.91 ? 34   ALA B N   1 
ATOM   1777  C  CA  . ALA B  2  34  ? -1.780  27.648  25.049  1.00 46.91 ? 34   ALA B CA  1 
ATOM   1778  C  C   . ALA B  2  34  ? -3.006  26.738  25.043  1.00 46.91 ? 34   ALA B C   1 
ATOM   1779  O  O   . ALA B  2  34  ? -3.469  26.298  26.097  1.00 46.91 ? 34   ALA B O   1 
ATOM   1780  C  CB  . ALA B  2  34  ? -2.184  29.074  25.396  1.00 46.91 ? 34   ALA B CB  1 
ATOM   1781  N  N   . GLY B  2  35  ? -3.542  26.492  23.851  1.00 46.91 ? 35   GLY B N   1 
ATOM   1782  C  CA  . GLY B  2  35  ? -4.706  25.635  23.715  1.00 46.91 ? 35   GLY B CA  1 
ATOM   1783  C  C   . GLY B  2  35  ? -4.331  24.167  23.657  1.00 46.91 ? 35   GLY B C   1 
ATOM   1784  O  O   . GLY B  2  35  ? -5.079  23.307  24.126  1.00 46.91 ? 35   GLY B O   1 
ATOM   1785  N  N   . SER B  2  36  ? -3.180  23.877  23.057  1.00 46.91 ? 36   SER B N   1 
ATOM   1786  C  CA  . SER B  2  36  ? -2.696  22.507  22.937  1.00 46.91 ? 36   SER B CA  1 
ATOM   1787  C  C   . SER B  2  36  ? -2.132  22.006  24.262  1.00 46.91 ? 36   SER B C   1 
ATOM   1788  O  O   . SER B  2  36  ? -2.136  20.804  24.533  1.00 46.91 ? 36   SER B O   1 
ATOM   1789  C  CB  . SER B  2  36  ? -1.624  22.416  21.852  1.00 46.91 ? 36   SER B CB  1 
ATOM   1790  N  N   . MET B  2  37  ? -1.596  22.926  25.057  1.00 46.91 ? 37   MET B N   1 
ATOM   1791  C  CA  . MET B  2  37  ? -1.030  22.580  26.356  1.00 46.91 ? 37   MET B CA  1 
ATOM   1792  C  C   . MET B  2  37  ? -2.108  22.528  27.439  1.00 46.91 ? 37   MET B C   1 
ATOM   1793  O  O   . MET B  2  37  ? -1.820  22.228  28.600  1.00 46.91 ? 37   MET B O   1 
ATOM   1794  C  CB  . MET B  2  37  ? 0.071   23.574  26.737  1.00 46.91 ? 37   MET B CB  1 
ATOM   1795  C  CG  . MET B  2  37  ? 1.342   23.445  25.904  1.00 46.91 ? 37   MET B CG  1 
ATOM   1796  S  SD  . MET B  2  37  ? 2.252   21.924  26.250  1.00 46.91 ? 37   MET B SD  1 
ATOM   1797  C  CE  . MET B  2  37  ? 3.288   22.455  27.621  1.00 46.91 ? 37   MET B CE  1 
ATOM   1798  N  N   . ALA B  2  38  ? -3.343  22.828  27.047  1.00 46.91 ? 38   ALA B N   1 
ATOM   1799  C  CA  . ALA B  2  38  ? -4.481  22.814  27.960  1.00 46.91 ? 38   ALA B CA  1 
ATOM   1800  C  C   . ALA B  2  38  ? -5.098  21.420  28.071  1.00 46.91 ? 38   ALA B C   1 
ATOM   1801  O  O   . ALA B  2  38  ? -5.874  21.151  28.988  1.00 46.91 ? 38   ALA B O   1 
ATOM   1802  C  CB  . ALA B  2  38  ? -5.530  23.818  27.499  1.00 46.91 ? 38   ALA B CB  1 
ATOM   1803  N  N   . LEU B  2  39  ? -4.773  20.547  27.120  1.00 46.91 ? 39   LEU B N   1 
ATOM   1804  C  CA  . LEU B  2  39  ? -5.290  19.183  27.120  1.00 46.91 ? 39   LEU B CA  1 
ATOM   1805  C  C   . LEU B  2  39  ? -4.163  18.152  27.176  1.00 46.91 ? 39   LEU B C   1 
ATOM   1806  O  O   . LEU B  2  39  ? -4.387  16.954  26.976  1.00 46.91 ? 39   LEU B O   1 
ATOM   1807  C  CB  . LEU B  2  39  ? -6.165  18.940  25.888  1.00 46.91 ? 39   LEU B CB  1 
ATOM   1808  N  N   . TYR B  2  40  ? -2.951  18.624  27.451  1.00 46.91 ? 40   TYR B N   1 
ATOM   1809  C  CA  . TYR B  2  40  ? -1.783  17.754  27.535  1.00 46.91 ? 40   TYR B CA  1 
ATOM   1810  C  C   . TYR B  2  40  ? -1.174  17.758  28.935  1.00 46.91 ? 40   TYR B C   1 
ATOM   1811  O  O   . TYR B  2  40  ? -0.550  16.776  29.350  1.00 46.91 ? 40   TYR B O   1 
ATOM   1812  C  CB  . TYR B  2  40  ? -0.732  18.186  26.510  1.00 46.91 ? 40   TYR B CB  1 
ATOM   1813  N  N   . GLU B  2  41  ? -1.345  18.867  29.648  1.00 46.91 ? 41   GLU B N   1 
ATOM   1814  C  CA  . GLU B  2  41  ? -0.810  19.017  30.999  1.00 46.91 ? 41   GLU B CA  1 
ATOM   1815  C  C   . GLU B  2  41  ? -1.864  19.531  31.982  1.00 46.91 ? 41   GLU B C   1 
ATOM   1816  O  O   . GLU B  2  41  ? -1.539  19.902  33.114  1.00 46.91 ? 41   GLU B O   1 
ATOM   1817  C  CB  . GLU B  2  41  ? 0.392   19.966  30.983  1.00 46.91 ? 41   GLU B CB  1 
ATOM   1818  N  N   . LEU B  2  42  ? -3.117  19.557  31.542  1.00 46.91 ? 42   LEU B N   1 
ATOM   1819  C  CA  . LEU B  2  42  ? -4.221  20.021  32.376  1.00 46.91 ? 42   LEU B CA  1 
ATOM   1820  C  C   . LEU B  2  42  ? -5.392  19.052  32.256  1.00 46.91 ? 42   LEU B C   1 
ATOM   1821  O  O   . LEU B  2  42  ? -6.011  18.678  33.255  1.00 46.91 ? 42   LEU B O   1 
ATOM   1822  C  CB  . LEU B  2  42  ? -4.656  21.426  31.951  1.00 46.91 ? 42   LEU B CB  1 
ATOM   1823  N  N   . ALA B  2  43  ? -5.686  18.647  31.024  1.00 65.35 ? 43   ALA B N   1 
ATOM   1824  C  CA  . ALA B  2  43  ? -6.775  17.721  30.750  1.00 66.06 ? 43   ALA B CA  1 
ATOM   1825  C  C   . ALA B  2  43  ? -6.226  16.350  30.356  1.00 67.31 ? 43   ALA B C   1 
ATOM   1826  O  O   . ALA B  2  43  ? -6.739  15.704  29.438  1.00 69.31 ? 43   ALA B O   1 
ATOM   1827  C  CB  . ALA B  2  43  ? -7.674  18.279  29.646  1.00 65.97 ? 43   ALA B CB  1 
ATOM   1828  N  N   . THR B  2  44  ? -5.185  15.906  31.053  1.00 46.91 ? 44   THR B N   1 
ATOM   1829  C  CA  . THR B  2  44  ? -4.578  14.612  30.768  1.00 46.91 ? 44   THR B CA  1 
ATOM   1830  C  C   . THR B  2  44  ? -3.739  14.074  31.925  1.00 46.91 ? 44   THR B C   1 
ATOM   1831  O  O   . THR B  2  44  ? -3.905  12.921  32.328  1.00 46.91 ? 44   THR B O   1 
ATOM   1832  C  CB  . THR B  2  44  ? -3.710  14.664  29.496  1.00 46.91 ? 44   THR B CB  1 
ATOM   1833  N  N   . PHE B  2  45  ? -2.819  14.888  32.435  1.00 46.91 ? 45   PHE B N   1 
ATOM   1834  C  CA  . PHE B  2  45  ? -1.969  14.466  33.547  1.00 46.91 ? 45   PHE B CA  1 
ATOM   1835  C  C   . PHE B  2  45  ? -2.355  15.077  34.890  1.00 46.91 ? 45   PHE B C   1 
ATOM   1836  O  O   . PHE B  2  45  ? -1.797  14.705  35.929  1.00 46.91 ? 45   PHE B O   1 
ATOM   1837  C  CB  . PHE B  2  45  ? -0.494  14.746  33.248  1.00 46.91 ? 45   PHE B CB  1 
ATOM   1838  C  CG  . PHE B  2  45  ? 0.104   13.807  32.240  1.00 46.91 ? 45   PHE B CG  1 
ATOM   1839  C  CD1 . PHE B  2  45  ? 0.392   14.244  30.953  1.00 46.91 ? 45   PHE B CD1 1 
ATOM   1840  C  CD2 . PHE B  2  45  ? 0.365   12.482  32.574  1.00 46.91 ? 45   PHE B CD2 1 
ATOM   1841  C  CE1 . PHE B  2  45  ? 0.930   13.376  30.009  1.00 46.91 ? 45   PHE B CE1 1 
ATOM   1842  C  CE2 . PHE B  2  45  ? 0.904   11.604  31.637  1.00 46.91 ? 45   PHE B CE2 1 
ATOM   1843  C  CZ  . PHE B  2  45  ? 1.187   12.052  30.352  1.00 46.91 ? 45   PHE B CZ  1 
ATOM   1844  N  N   . ASP B  2  46  ? -3.299  16.013  34.869  1.00 46.91 ? 46   ASP B N   1 
ATOM   1845  C  CA  . ASP B  2  46  ? -3.756  16.665  36.092  1.00 46.91 ? 46   ASP B CA  1 
ATOM   1846  C  C   . ASP B  2  46  ? -4.890  15.890  36.761  1.00 46.91 ? 46   ASP B C   1 
ATOM   1847  O  O   . ASP B  2  46  ? -5.188  14.750  36.391  1.00 46.91 ? 46   ASP B O   1 
ATOM   1848  C  CB  . ASP B  2  46  ? -4.197  18.103  35.798  1.00 46.91 ? 46   ASP B CB  1 
ATOM   1849  N  N   . PRO B  2  47  ? -5.522  16.496  37.778  1.00 46.91 ? 47   PRO B N   1 
ATOM   1850  C  CA  . PRO B  2  47  ? -6.629  15.898  38.530  1.00 46.91 ? 47   PRO B CA  1 
ATOM   1851  C  C   . PRO B  2  47  ? -7.945  15.892  37.755  1.00 46.91 ? 47   PRO B C   1 
ATOM   1852  O  O   . PRO B  2  47  ? -8.302  16.873  37.103  1.00 46.91 ? 47   PRO B O   1 
ATOM   1853  C  CB  . PRO B  2  47  ? -6.718  16.771  39.782  1.00 46.91 ? 47   PRO B CB  1 
ATOM   1854  N  N   . SER B  2  48  ? -8.662  14.773  37.831  1.00 46.91 ? 48   SER B N   1 
ATOM   1855  C  CA  . SER B  2  48  ? -9.940  14.629  37.140  1.00 46.91 ? 48   SER B CA  1 
ATOM   1856  C  C   . SER B  2  48  ? -10.752 13.463  37.699  1.00 46.91 ? 48   SER B C   1 
ATOM   1857  O  O   . SER B  2  48  ? -11.587 12.883  37.001  1.00 46.91 ? 48   SER B O   1 
ATOM   1858  C  CB  . SER B  2  48  ? -9.715  14.434  35.637  1.00 46.91 ? 48   SER B CB  1 
ATOM   1859  N  N   . ASP B  2  49  ? -10.473 13.096  38.947  1.00 46.91 ? 49   ASP B N   1 
ATOM   1860  C  CA  . ASP B  2  49  ? -11.187 12.008  39.605  1.00 46.91 ? 49   ASP B CA  1 
ATOM   1861  C  C   . ASP B  2  49  ? -12.479 12.548  40.218  1.00 46.91 ? 49   ASP B C   1 
ATOM   1862  O  O   . ASP B  2  49  ? -13.054 13.518  39.720  1.00 46.91 ? 49   ASP B O   1 
ATOM   1863  C  CB  . ASP B  2  49  ? -10.307 11.374  40.688  1.00 46.91 ? 49   ASP B CB  1 
ATOM   1864  N  N   . PRO B  2  50  ? -12.970 11.901  41.285  1.00 46.91 ? 50   PRO B N   1 
ATOM   1865  C  CA  . PRO B  2  50  ? -14.200 12.326  41.962  1.00 46.91 ? 50   PRO B CA  1 
ATOM   1866  C  C   . PRO B  2  50  ? -13.921 13.523  42.870  1.00 46.91 ? 50   PRO B C   1 
ATOM   1867  O  O   . PRO B  2  50  ? -13.920 14.663  42.411  1.00 46.91 ? 50   PRO B O   1 
ATOM   1868  C  CB  . PRO B  2  50  ? -14.613 11.087  42.759  1.00 46.91 ? 50   PRO B CB  1 
ATOM   1869  N  N   . VAL B  2  51  ? -13.651 13.247  44.146  1.00 46.91 ? 51   VAL B N   1 
ATOM   1870  C  CA  . VAL B  2  51  ? -13.351 14.279  45.139  1.00 46.91 ? 51   VAL B CA  1 
ATOM   1871  C  C   . VAL B  2  51  ? -14.489 15.278  45.358  1.00 46.91 ? 51   VAL B C   1 
ATOM   1872  O  O   . VAL B  2  51  ? -15.192 15.212  46.370  1.00 46.91 ? 51   VAL B O   1 
ATOM   1873  C  CB  . VAL B  2  51  ? -12.061 15.050  44.781  1.00 46.91 ? 51   VAL B CB  1 
ATOM   1874  N  N   . LEU B  2  52  ? -14.659 16.191  44.403  1.00 46.91 ? 52   LEU B N   1 
ATOM   1875  C  CA  . LEU B  2  52  ? -15.691 17.227  44.444  1.00 46.91 ? 52   LEU B CA  1 
ATOM   1876  C  C   . LEU B  2  52  ? -15.410 18.292  45.504  1.00 46.91 ? 52   LEU B C   1 
ATOM   1877  O  O   . LEU B  2  52  ? -14.987 19.400  45.179  1.00 46.91 ? 52   LEU B O   1 
ATOM   1878  C  CB  . LEU B  2  52  ? -17.082 16.614  44.656  1.00 46.91 ? 52   LEU B CB  1 
ATOM   1879  N  N   . ASN B  2  53  ? -15.654 17.956  46.767  1.00 46.91 ? 53   ASN B N   1 
ATOM   1880  C  CA  . ASN B  2  53  ? -15.432 18.887  47.868  1.00 46.91 ? 53   ASN B CA  1 
ATOM   1881  C  C   . ASN B  2  53  ? -14.002 18.859  48.403  1.00 46.91 ? 53   ASN B C   1 
ATOM   1882  O  O   . ASN B  2  53  ? -13.467 19.887  48.827  1.00 46.91 ? 53   ASN B O   1 
ATOM   1883  C  CB  . ASN B  2  53  ? -16.412 18.600  49.007  1.00 46.91 ? 53   ASN B CB  1 
ATOM   1884  N  N   . PRO B  2  54  ? -13.381 17.670  48.432  1.00 46.91 ? 54   PRO B N   1 
ATOM   1885  C  CA  . PRO B  2  54  ? -12.008 17.499  48.922  1.00 46.91 ? 54   PRO B CA  1 
ATOM   1886  C  C   . PRO B  2  54  ? -10.942 17.608  47.834  1.00 46.91 ? 54   PRO B C   1 
ATOM   1887  O  O   . PRO B  2  54  ? -10.570 16.607  47.221  1.00 46.91 ? 54   PRO B O   1 
ATOM   1888  C  CB  . PRO B  2  54  ? -12.031 16.104  49.551  1.00 46.91 ? 54   PRO B CB  1 
ATOM   1889  N  N   . MET B  2  55  ? -10.439 18.825  47.630  1.00 46.91 ? 55   MET B N   1 
ATOM   1890  C  CA  . MET B  2  55  ? -9.405  19.114  46.634  1.00 46.91 ? 55   MET B CA  1 
ATOM   1891  C  C   . MET B  2  55  ? -9.827  18.897  45.181  1.00 46.91 ? 55   MET B C   1 
ATOM   1892  O  O   . MET B  2  55  ? -10.665 18.048  44.879  1.00 46.91 ? 55   MET B O   1 
ATOM   1893  C  CB  . MET B  2  55  ? -8.127  18.320  46.931  1.00 46.91 ? 55   MET B CB  1 
ATOM   1894  N  N   . TRP B  2  56  ? -9.239  19.690  44.291  1.00 46.91 ? 56   TRP B N   1 
ATOM   1895  C  CA  . TRP B  2  56  ? -9.518  19.614  42.861  1.00 46.91 ? 56   TRP B CA  1 
ATOM   1896  C  C   . TRP B  2  56  ? -8.412  20.341  42.106  1.00 46.91 ? 56   TRP B C   1 
ATOM   1897  O  O   . TRP B  2  56  ? -7.744  19.753  41.257  1.00 46.91 ? 56   TRP B O   1 
ATOM   1898  C  CB  . TRP B  2  56  ? -10.876 20.247  42.544  1.00 46.91 ? 56   TRP B CB  1 
ATOM   1899  N  N   . ARG B  2  57  ? -8.217  21.614  42.446  1.00 46.91 ? 57   ARG B N   1 
ATOM   1900  C  CA  . ARG B  2  57  ? -7.194  22.467  41.840  1.00 46.91 ? 57   ARG B CA  1 
ATOM   1901  C  C   . ARG B  2  57  ? -7.043  22.305  40.328  1.00 46.91 ? 57   ARG B C   1 
ATOM   1902  O  O   . ARG B  2  57  ? -6.130  21.626  39.851  1.00 46.91 ? 57   ARG B O   1 
ATOM   1903  C  CB  . ARG B  2  57  ? -5.846  22.247  42.533  1.00 46.91 ? 57   ARG B CB  1 
ATOM   1904  N  N   . GLN B  2  58  ? -7.943  22.936  39.583  1.00 46.91 ? 58   GLN B N   1 
ATOM   1905  C  CA  . GLN B  2  58  ? -7.914  22.871  38.126  1.00 46.91 ? 58   GLN B CA  1 
ATOM   1906  C  C   . GLN B  2  58  ? -6.708  23.626  37.569  1.00 46.91 ? 58   GLN B C   1 
ATOM   1907  O  O   . GLN B  2  58  ? -6.168  24.522  38.223  1.00 46.91 ? 58   GLN B O   1 
ATOM   1908  C  CB  . GLN B  2  58  ? -9.205  23.448  37.544  1.00 46.91 ? 58   GLN B CB  1 
ATOM   1909  N  N   . GLY B  2  59  ? -6.283  23.244  36.369  1.00 46.91 ? 59   GLY B N   1 
ATOM   1910  C  CA  . GLY B  2  59  ? -5.147  23.896  35.741  1.00 46.91 ? 59   GLY B CA  1 
ATOM   1911  C  C   . GLY B  2  59  ? -5.425  25.349  35.406  1.00 46.91 ? 59   GLY B C   1 
ATOM   1912  O  O   . GLY B  2  59  ? -6.579  25.741  35.226  1.00 46.91 ? 59   GLY B O   1 
ATOM   1913  N  N   . MET B  2  60  ? -4.368  26.151  35.323  1.00 46.91 ? 60   MET B N   1 
ATOM   1914  C  CA  . MET B  2  60  ? -4.501  27.570  35.006  1.00 46.91 ? 60   MET B CA  1 
ATOM   1915  C  C   . MET B  2  60  ? -5.148  27.784  33.636  1.00 46.91 ? 60   MET B C   1 
ATOM   1916  O  O   . MET B  2  60  ? -5.754  28.828  33.382  1.00 46.91 ? 60   MET B O   1 
ATOM   1917  C  CB  . MET B  2  60  ? -3.131  28.252  35.052  1.00 46.91 ? 60   MET B CB  1 
ATOM   1918  N  N   . PHE B  2  61  ? -4.994  26.800  32.754  1.00 46.91 ? 61   PHE B N   1 
ATOM   1919  C  CA  . PHE B  2  61  ? -5.560  26.861  31.411  1.00 46.91 ? 61   PHE B CA  1 
ATOM   1920  C  C   . PHE B  2  61  ? -6.996  26.337  31.376  1.00 46.91 ? 61   PHE B C   1 
ATOM   1921  O  O   . PHE B  2  61  ? -7.849  26.890  30.678  1.00 46.91 ? 61   PHE B O   1 
ATOM   1922  C  CB  . PHE B  2  61  ? -4.693  26.061  30.436  1.00 46.91 ? 61   PHE B CB  1 
ATOM   1923  N  N   . VAL B  2  62  ? -7.244  25.253  32.108  1.00 46.91 ? 62   VAL B N   1 
ATOM   1924  C  CA  . VAL B  2  62  ? -8.568  24.641  32.176  1.00 46.91 ? 62   VAL B CA  1 
ATOM   1925  C  C   . VAL B  2  62  ? -9.555  25.498  32.968  1.00 46.91 ? 62   VAL B C   1 
ATOM   1926  O  O   . VAL B  2  62  ? -10.766 25.283  32.901  1.00 46.91 ? 62   VAL B O   1 
ATOM   1927  C  CB  . VAL B  2  62  ? -8.507  23.238  32.816  1.00 46.91 ? 62   VAL B CB  1 
ATOM   1928  N  N   . LEU B  2  63  ? -9.029  26.460  33.721  1.00 46.91 ? 63   LEU B N   1 
ATOM   1929  C  CA  . LEU B  2  63  ? -9.853  27.354  34.527  1.00 46.91 ? 63   LEU B CA  1 
ATOM   1930  C  C   . LEU B  2  63  ? -10.674 28.301  33.654  1.00 46.91 ? 63   LEU B C   1 
ATOM   1931  O  O   . LEU B  2  63  ? -11.751 28.752  34.047  1.00 46.91 ? 63   LEU B O   1 
ATOM   1932  C  CB  . LEU B  2  63  ? -8.971  28.166  35.478  1.00 46.91 ? 63   LEU B CB  1 
ATOM   1933  N  N   . PRO B  2  64  ? -10.147 28.647  32.470  1.00 46.91 ? 64   PRO B N   1 
ATOM   1934  C  CA  . PRO B  2  64  ? -10.787 29.543  31.501  1.00 46.91 ? 64   PRO B CA  1 
ATOM   1935  C  C   . PRO B  2  64  ? -11.865 28.844  30.677  1.00 46.91 ? 64   PRO B C   1 
ATOM   1936  O  O   . PRO B  2  64  ? -12.664 29.498  30.002  1.00 46.91 ? 64   PRO B O   1 
ATOM   1937  C  CB  . PRO B  2  64  ? -9.626  29.997  30.619  1.00 46.91 ? 64   PRO B CB  1 
ATOM   1938  N  N   . PHE B  2  65  ? -11.846 27.516  30.696  1.00 46.91 ? 65   PHE B N   1 
ATOM   1939  C  CA  . PHE B  2  65  ? -12.815 26.717  29.956  1.00 46.91 ? 65   PHE B CA  1 
ATOM   1940  C  C   . PHE B  2  65  ? -13.993 26.296  30.838  1.00 46.91 ? 65   PHE B C   1 
ATOM   1941  O  O   . PHE B  2  65  ? -15.047 25.902  30.335  1.00 46.91 ? 65   PHE B O   1 
ATOM   1942  C  CB  . PHE B  2  65  ? -12.131 25.488  29.347  1.00 46.91 ? 65   PHE B CB  1 
ATOM   1943  C  CG  . PHE B  2  65  ? -11.032 25.826  28.370  1.00 46.91 ? 65   PHE B CG  1 
ATOM   1944  C  CD1 . PHE B  2  65  ? -9.788  25.208  28.460  1.00 46.91 ? 65   PHE B CD1 1 
ATOM   1945  C  CD2 . PHE B  2  65  ? -11.243 26.759  27.357  1.00 46.91 ? 65   PHE B CD2 1 
ATOM   1946  C  CE1 . PHE B  2  65  ? -8.767  25.523  27.562  1.00 46.91 ? 65   PHE B CE1 1 
ATOM   1947  C  CE2 . PHE B  2  65  ? -10.229 27.081  26.457  1.00 46.91 ? 65   PHE B CE2 1 
ATOM   1948  C  CZ  . PHE B  2  65  ? -8.989  26.458  26.556  1.00 46.91 ? 65   PHE B CZ  1 
ATOM   1949  N  N   . MET B  2  66  ? -13.802 26.375  32.152  1.00 46.91 ? 66   MET B N   1 
ATOM   1950  C  CA  . MET B  2  66  ? -14.840 26.014  33.114  1.00 46.91 ? 66   MET B CA  1 
ATOM   1951  C  C   . MET B  2  66  ? -15.695 27.226  33.485  1.00 46.91 ? 66   MET B C   1 
ATOM   1952  O  O   . MET B  2  66  ? -16.778 27.085  34.056  1.00 46.91 ? 66   MET B O   1 
ATOM   1953  C  CB  . MET B  2  66  ? -14.208 25.420  34.375  1.00 46.91 ? 66   MET B CB  1 
ATOM   1954  N  N   . ALA B  2  67  ? -15.181 28.416  33.188  1.00 46.91 ? 67   ALA B N   1 
ATOM   1955  C  CA  . ALA B  2  67  ? -15.882 29.660  33.482  1.00 46.91 ? 67   ALA B CA  1 
ATOM   1956  C  C   . ALA B  2  67  ? -16.744 30.121  32.308  1.00 46.91 ? 67   ALA B C   1 
ATOM   1957  O  O   . ALA B  2  67  ? -17.758 30.797  32.501  1.00 46.91 ? 67   ALA B O   1 
ATOM   1958  C  CB  . ALA B  2  67  ? -14.882 30.746  33.861  1.00 46.91 ? 67   ALA B CB  1 
ATOM   1959  N  N   . ARG B  2  68  ? -16.322 29.782  31.094  1.00 46.91 ? 68   ARG B N   1 
ATOM   1960  C  CA  . ARG B  2  68  ? -17.049 30.169  29.889  1.00 46.91 ? 68   ARG B CA  1 
ATOM   1961  C  C   . ARG B  2  68  ? -17.853 29.020  29.283  1.00 46.91 ? 68   ARG B C   1 
ATOM   1962  O  O   . ARG B  2  68  ? -19.042 29.173  28.988  1.00 46.91 ? 68   ARG B O   1 
ATOM   1963  C  CB  . ARG B  2  68  ? -16.079 30.732  28.846  1.00 46.91 ? 68   ARG B CB  1 
ATOM   1964  N  N   . LEU B  2  69  ? -17.184 27.897  29.036  1.00 46.91 ? 69   LEU B N   1 
ATOM   1965  C  CA  . LEU B  2  69  ? -17.832 26.720  28.464  1.00 46.91 ? 69   LEU B CA  1 
ATOM   1966  C  C   . LEU B  2  69  ? -18.457 25.857  29.561  1.00 46.91 ? 69   LEU B C   1 
ATOM   1967  O  O   . LEU B  2  69  ? -18.755 26.345  30.653  1.00 46.91 ? 69   LEU B O   1 
ATOM   1968  C  CB  . LEU B  2  69  ? -16.821 25.902  27.652  1.00 46.91 ? 69   LEU B CB  1 
ATOM   1969  N  N   . GLY B  2  70  ? -18.691 24.584  29.253  1.00 46.91 ? 70   GLY B N   1 
ATOM   1970  C  CA  . GLY B  2  70  ? -19.279 23.678  30.224  1.00 46.91 ? 70   GLY B CA  1 
ATOM   1971  C  C   . GLY B  2  70  ? -18.431 22.439  30.423  1.00 46.91 ? 70   GLY B C   1 
ATOM   1972  O  O   . GLY B  2  70  ? -18.418 21.543  29.574  1.00 46.91 ? 70   GLY B O   1 
ATOM   1973  N  N   . VAL B  2  71  ? -17.736 22.380  31.554  1.00 46.91 ? 71   VAL B N   1 
ATOM   1974  C  CA  . VAL B  2  71  ? -16.873 21.247  31.868  1.00 46.91 ? 71   VAL B CA  1 
ATOM   1975  C  C   . VAL B  2  71  ? -17.110 20.756  33.296  1.00 46.91 ? 71   VAL B C   1 
ATOM   1976  O  O   . VAL B  2  71  ? -18.234 20.827  33.802  1.00 46.91 ? 71   VAL B O   1 
ATOM   1977  C  CB  . VAL B  2  71  ? -15.386 21.624  31.691  1.00 46.91 ? 71   VAL B CB  1 
ATOM   1978  N  N   . THR B  2  72  ? -16.052 20.263  33.936  1.00 46.91 ? 72   THR B N   1 
ATOM   1979  C  CA  . THR B  2  72  ? -16.127 19.752  35.301  1.00 46.91 ? 72   THR B CA  1 
ATOM   1980  C  C   . THR B  2  72  ? -17.099 18.576  35.408  1.00 46.91 ? 72   THR B C   1 
ATOM   1981  O  O   . THR B  2  72  ? -16.897 17.542  34.769  1.00 46.91 ? 72   THR B O   1 
ATOM   1982  C  CB  . THR B  2  72  ? -16.526 20.859  36.305  1.00 46.91 ? 72   THR B CB  1 
ATOM   1983  N  N   . GLY B  2  73  ? -18.153 18.742  36.201  1.00 46.91 ? 73   GLY B N   1 
ATOM   1984  C  CA  . GLY B  2  73  ? -19.133 17.686  36.369  1.00 46.91 ? 73   GLY B CA  1 
ATOM   1985  C  C   . GLY B  2  73  ? -20.370 18.146  37.112  1.00 46.91 ? 73   GLY B C   1 
ATOM   1986  O  O   . GLY B  2  73  ? -20.377 19.213  37.730  1.00 46.91 ? 73   GLY B O   1 
ATOM   1987  N  N   . SER B  2  74  ? -21.431 17.348  37.037  1.00 46.91 ? 74   SER B N   1 
ATOM   1988  C  CA  . SER B  2  74  ? -22.682 17.676  37.709  1.00 46.91 ? 74   SER B CA  1 
ATOM   1989  C  C   . SER B  2  74  ? -22.714 17.137  39.136  1.00 46.91 ? 74   SER B C   1 
ATOM   1990  O  O   . SER B  2  74  ? -23.550 16.294  39.471  1.00 46.91 ? 74   SER B O   1 
ATOM   1991  C  CB  . SER B  2  74  ? -23.868 17.131  36.914  1.00 46.91 ? 74   SER B CB  1 
ATOM   1992  N  N   . TRP B  2  75  ? -21.811 17.646  39.972  1.00 46.91 ? 75   TRP B N   1 
ATOM   1993  C  CA  . TRP B  2  75  ? -21.700 17.238  41.370  1.00 46.91 ? 75   TRP B CA  1 
ATOM   1994  C  C   . TRP B  2  75  ? -21.623 15.720  41.533  1.00 46.91 ? 75   TRP B C   1 
ATOM   1995  O  O   . TRP B  2  75  ? -21.558 14.982  40.548  1.00 46.91 ? 75   TRP B O   1 
ATOM   1996  C  CB  . TRP B  2  75  ? -22.871 17.802  42.182  1.00 46.91 ? 75   TRP B CB  1 
ATOM   1997  N  N   . SER B  2  76  ? -21.632 15.262  42.785  1.00 46.91 ? 76   SER B N   1 
ATOM   1998  C  CA  . SER B  2  76  ? -21.577 13.835  43.102  1.00 46.91 ? 76   SER B CA  1 
ATOM   1999  C  C   . SER B  2  76  ? -20.217 13.178  42.863  1.00 46.91 ? 76   SER B C   1 
ATOM   2000  O  O   . SER B  2  76  ? -19.175 13.834  42.926  1.00 46.91 ? 76   SER B O   1 
ATOM   2001  C  CB  . SER B  2  76  ? -22.664 13.068  42.337  1.00 46.91 ? 76   SER B CB  1 
ATOM   2002  N  N   . GLY B  2  77  ? -20.243 11.866  42.641  1.00 46.91 ? 77   GLY B N   1 
ATOM   2003  C  CA  . GLY B  2  77  ? -19.037 11.081  42.407  1.00 46.91 ? 77   GLY B CA  1 
ATOM   2004  C  C   . GLY B  2  77  ? -19.386 9.782   41.679  1.00 46.91 ? 77   GLY B C   1 
ATOM   2005  O  O   . GLY B  2  77  ? -18.528 8.869   41.657  1.00 46.91 ? 77   GLY B O   1 
ATOM   2006  N  N   . THR B  2  84  ? -21.721 11.217  36.800  1.00 46.91 ? 84   THR B N   1 
ATOM   2007  C  CA  . THR B  2  84  ? -21.330 12.302  35.853  1.00 46.91 ? 84   THR B CA  1 
ATOM   2008  C  C   . THR B  2  84  ? -19.897 12.766  36.091  1.00 46.91 ? 84   THR B C   1 
ATOM   2009  O  O   . THR B  2  84  ? -19.567 13.255  37.173  1.00 46.91 ? 84   THR B O   1 
ATOM   2010  C  CB  . THR B  2  84  ? -22.294 13.480  35.970  1.00 46.91 ? 84   THR B CB  1 
ATOM   2011  N  N   . GLY B  2  85  ? -19.055 12.613  35.075  1.00 46.91 ? 85   GLY B N   1 
ATOM   2012  C  CA  . GLY B  2  85  ? -17.665 13.020  35.188  1.00 46.91 ? 85   GLY B CA  1 
ATOM   2013  C  C   . GLY B  2  85  ? -17.108 13.568  33.887  1.00 46.91 ? 85   GLY B C   1 
ATOM   2014  O  O   . GLY B  2  85  ? -17.859 13.831  32.944  1.00 46.91 ? 85   GLY B O   1 
ATOM   2015  N  N   . ILE B  2  86  ? -15.790 13.729  33.828  1.00 46.91 ? 86   ILE B N   1 
ATOM   2016  C  CA  . ILE B  2  86  ? -15.133 14.253  32.636  1.00 46.91 ? 86   ILE B CA  1 
ATOM   2017  C  C   . ILE B  2  86  ? -14.311 13.193  31.900  1.00 46.91 ? 86   ILE B C   1 
ATOM   2018  O  O   . ILE B  2  86  ? -13.107 13.360  31.686  1.00 46.91 ? 86   ILE B O   1 
ATOM   2019  C  CB  . ILE B  2  86  ? -14.234 15.460  32.976  1.00 46.91 ? 86   ILE B CB  1 
ATOM   2020  N  N   . ASP B  2  87  ? -14.965 12.092  31.534  1.00 46.91 ? 87   ASP B N   1 
ATOM   2021  C  CA  . ASP B  2  87  ? -14.302 11.010  30.812  1.00 46.91 ? 87   ASP B CA  1 
ATOM   2022  C  C   . ASP B  2  87  ? -14.614 11.064  29.312  1.00 46.91 ? 87   ASP B C   1 
ATOM   2023  O  O   . ASP B  2  87  ? -13.702 10.979  28.486  1.00 46.91 ? 87   ASP B O   1 
ATOM   2024  C  CB  . ASP B  2  87  ? -14.687 9.646   31.401  1.00 46.91 ? 87   ASP B CB  1 
ATOM   2025  N  N   . PRO B  2  88  ? -15.907 11.147  28.937  1.00 46.91 ? 88   PRO B N   1 
ATOM   2026  C  CA  . PRO B  2  88  ? -16.239 11.206  27.510  1.00 46.91 ? 88   PRO B CA  1 
ATOM   2027  C  C   . PRO B  2  88  ? -16.000 12.607  26.952  1.00 46.91 ? 88   PRO B C   1 
ATOM   2028  O  O   . PRO B  2  88  ? -15.292 13.417  27.552  1.00 46.91 ? 88   PRO B O   1 
ATOM   2029  C  CB  . PRO B  2  88  ? -17.734 10.868  27.493  1.00 46.91 ? 88   PRO B CB  1 
ATOM   2030  C  CG  . PRO B  2  88  ? -17.962 10.137  28.786  1.00 46.91 ? 88   PRO B CG  1 
ATOM   2031  C  CD  . PRO B  2  88  ? -17.131 10.950  29.731  1.00 46.91 ? 88   PRO B CD  1 
ATOM   2032  N  N   . GLY B  2  89  ? -16.622 12.892  25.813  1.00 46.91 ? 89   GLY B N   1 
ATOM   2033  C  CA  . GLY B  2  89  ? -16.479 14.200  25.203  1.00 46.91 ? 89   GLY B CA  1 
ATOM   2034  C  C   . GLY B  2  89  ? -15.892 14.201  23.805  1.00 46.91 ? 89   GLY B C   1 
ATOM   2035  O  O   . GLY B  2  89  ? -14.986 13.427  23.488  1.00 46.91 ? 89   GLY B O   1 
ATOM   2036  N  N   . PHE B  2  90  ? -16.440 15.068  22.961  1.00 46.91 ? 90   PHE B N   1 
ATOM   2037  C  CA  . PHE B  2  90  ? -15.992 15.225  21.581  1.00 46.91 ? 90   PHE B CA  1 
ATOM   2038  C  C   . PHE B  2  90  ? -16.219 16.680  21.175  1.00 46.91 ? 90   PHE B C   1 
ATOM   2039  O  O   . PHE B  2  90  ? -15.625 17.172  20.214  1.00 46.91 ? 90   PHE B O   1 
ATOM   2040  C  CB  . PHE B  2  90  ? -16.776 14.293  20.649  1.00 46.91 ? 90   PHE B CB  1 
ATOM   2041  C  CG  . PHE B  2  90  ? -16.173 14.157  19.275  1.00 46.91 ? 90   PHE B CG  1 
ATOM   2042  C  CD1 . PHE B  2  90  ? -15.127 13.268  19.049  1.00 46.91 ? 90   PHE B CD1 1 
ATOM   2043  C  CD2 . PHE B  2  90  ? -16.645 14.919  18.210  1.00 46.91 ? 90   PHE B CD2 1 
ATOM   2044  C  CE1 . PHE B  2  90  ? -14.557 13.139  17.784  1.00 46.91 ? 90   PHE B CE1 1 
ATOM   2045  C  CE2 . PHE B  2  90  ? -16.081 14.797  16.938  1.00 46.91 ? 90   PHE B CE2 1 
ATOM   2046  C  CZ  . PHE B  2  90  ? -15.036 13.906  16.727  1.00 46.91 ? 90   PHE B CZ  1 
ATOM   2047  N  N   . TRP B  2  91  ? -17.101 17.352  21.910  1.00 46.91 ? 91   TRP B N   1 
ATOM   2048  C  CA  . TRP B  2  91  ? -17.429 18.749  21.655  1.00 46.91 ? 91   TRP B CA  1 
ATOM   2049  C  C   . TRP B  2  91  ? -17.644 19.494  22.973  1.00 46.91 ? 91   TRP B C   1 
ATOM   2050  O  O   . TRP B  2  91  ? -18.478 20.399  23.059  1.00 46.91 ? 91   TRP B O   1 
ATOM   2051  C  CB  . TRP B  2  91  ? -18.683 18.844  20.784  1.00 46.91 ? 91   TRP B CB  1 
ATOM   2052  N  N   . SER B  2  92  ? -16.915 19.083  24.006  1.00 46.91 ? 92   SER B N   1 
ATOM   2053  C  CA  . SER B  2  92  ? -17.012 19.711  25.319  1.00 46.91 ? 92   SER B CA  1 
ATOM   2054  C  C   . SER B  2  92  ? -15.630 20.180  25.765  1.00 46.91 ? 92   SER B C   1 
ATOM   2055  O  O   . SER B  2  92  ? -15.185 21.264  25.386  1.00 46.91 ? 92   SER B O   1 
ATOM   2056  C  CB  . SER B  2  92  ? -17.599 18.731  26.341  1.00 46.91 ? 92   SER B CB  1 
ATOM   2057  N  N   . PHE B  2  93  ? -14.964 19.365  26.578  1.00 46.91 ? 93   PHE B N   1 
ATOM   2058  C  CA  . PHE B  2  93  ? -13.627 19.686  27.060  1.00 46.91 ? 93   PHE B CA  1 
ATOM   2059  C  C   . PHE B  2  93  ? -12.596 19.260  26.019  1.00 46.91 ? 93   PHE B C   1 
ATOM   2060  O  O   . PHE B  2  93  ? -11.545 19.888  25.877  1.00 46.91 ? 93   PHE B O   1 
ATOM   2061  C  CB  . PHE B  2  93  ? -13.355 18.983  28.392  1.00 46.91 ? 93   PHE B CB  1 
ATOM   2062  N  N   . GLU B  2  94  ? -12.899 18.177  25.309  1.00 46.91 ? 94   GLU B N   1 
ATOM   2063  C  CA  . GLU B  2  94  ? -12.016 17.663  24.268  1.00 46.91 ? 94   GLU B CA  1 
ATOM   2064  C  C   . GLU B  2  94  ? -12.160 18.488  22.990  1.00 46.91 ? 94   GLU B C   1 
ATOM   2065  O  O   . GLU B  2  94  ? -11.314 18.416  22.096  1.00 46.91 ? 94   GLU B O   1 
ATOM   2066  C  CB  . GLU B  2  94  ? -12.335 16.191  23.982  1.00 46.91 ? 94   GLU B CB  1 
ATOM   2067  N  N   . GLY B  2  95  ? -13.251 19.244  22.901  1.00 46.91 ? 95   GLY B N   1 
ATOM   2068  C  CA  . GLY B  2  95  ? -13.493 20.077  21.736  1.00 46.91 ? 95   GLY B CA  1 
ATOM   2069  C  C   . GLY B  2  95  ? -12.664 21.350  21.717  1.00 46.91 ? 95   GLY B C   1 
ATOM   2070  O  O   . GLY B  2  95  ? -12.724 22.118  20.755  1.00 46.91 ? 95   GLY B O   1 
ATOM   2071  N  N   . VAL B  2  96  ? -11.922 21.591  22.794  1.00 46.91 ? 96   VAL B N   1 
ATOM   2072  C  CA  . VAL B  2  96  ? -11.076 22.776  22.903  1.00 46.91 ? 96   VAL B CA  1 
ATOM   2073  C  C   . VAL B  2  96  ? -9.795  22.621  22.086  1.00 46.91 ? 96   VAL B C   1 
ATOM   2074  O  O   . VAL B  2  96  ? -9.355  23.564  21.425  1.00 46.91 ? 96   VAL B O   1 
ATOM   2075  C  CB  . VAL B  2  96  ? -10.699 23.065  24.369  1.00 46.91 ? 96   VAL B CB  1 
ATOM   2076  N  N   . ALA B  2  97  ? -9.189  21.440  22.163  1.00 46.91 ? 97   ALA B N   1 
ATOM   2077  C  CA  . ALA B  2  97  ? -7.960  21.151  21.431  1.00 46.91 ? 97   ALA B CA  1 
ATOM   2078  C  C   . ALA B  2  97  ? -8.251  20.864  19.960  1.00 46.91 ? 97   ALA B C   1 
ATOM   2079  O  O   . ALA B  2  97  ? -7.356  20.936  19.115  1.00 46.91 ? 97   ALA B O   1 
ATOM   2080  C  CB  . ALA B  2  97  ? -7.238  19.970  22.065  1.00 46.91 ? 97   ALA B CB  1 
ATOM   2081  N  N   . LEU B  2  98  ? -9.496  20.495  19.669  1.00 46.91 ? 98   LEU B N   1 
ATOM   2082  C  CA  . LEU B  2  98  ? -9.919  20.196  18.305  1.00 46.91 ? 98   LEU B CA  1 
ATOM   2083  C  C   . LEU B  2  98  ? -10.095 21.480  17.497  1.00 46.91 ? 98   LEU B C   1 
ATOM   2084  O  O   . LEU B  2  98  ? -9.890  21.491  16.281  1.00 46.91 ? 98   LEU B O   1 
ATOM   2085  C  CB  . LEU B  2  98  ? -11.230 19.407  18.317  1.00 46.91 ? 98   LEU B CB  1 
ATOM   2086  N  N   . ALA B  2  99  ? -10.520 22.542  18.175  1.00 46.91 ? 99   ALA B N   1 
ATOM   2087  C  CA  . ALA B  2  99  ? -10.732 23.838  17.542  1.00 46.91 ? 99   ALA B CA  1 
ATOM   2088  C  C   . ALA B  2  99  ? -9.436  24.645  17.489  1.00 46.91 ? 99   ALA B C   1 
ATOM   2089  O  O   . ALA B  2  99  ? -9.300  25.559  16.674  1.00 46.91 ? 99   ALA B O   1 
ATOM   2090  C  CB  . ALA B  2  99  ? -11.807 24.616  18.290  1.00 46.91 ? 99   ALA B CB  1 
ATOM   2091  N  N   . HIS B  2  100 ? -8.512  24.331  18.393  1.00 46.91 ? 100  HIS B N   1 
ATOM   2092  C  CA  . HIS B  2  100 ? -7.223  25.014  18.457  1.00 46.91 ? 100  HIS B CA  1 
ATOM   2093  C  C   . HIS B  2  100 ? -6.297  24.511  17.353  1.00 46.91 ? 100  HIS B C   1 
ATOM   2094  O  O   . HIS B  2  100 ? -5.494  25.269  16.807  1.00 46.91 ? 100  HIS B O   1 
ATOM   2095  C  CB  . HIS B  2  100 ? -6.569  24.789  19.823  1.00 46.91 ? 100  HIS B CB  1 
ATOM   2096  N  N   . ILE B  2  101 ? -6.390  23.217  17.055  1.00 46.91 ? 101  ILE B N   1 
ATOM   2097  C  CA  . ILE B  2  101 ? -5.573  22.604  16.015  1.00 46.91 ? 101  ILE B CA  1 
ATOM   2098  C  C   . ILE B  2  101 ? -6.057  23.025  14.630  1.00 46.91 ? 101  ILE B C   1 
ATOM   2099  O  O   . ILE B  2  101 ? -5.292  23.005  13.662  1.00 46.91 ? 101  ILE B O   1 
ATOM   2100  C  CB  . ILE B  2  101 ? -5.611  21.067  16.110  1.00 46.91 ? 101  ILE B CB  1 
ATOM   2101  N  N   . VAL B  2  102 ? -7.340  23.363  14.537  1.00 46.91 ? 102  VAL B N   1 
ATOM   2102  C  CA  . VAL B  2  102 ? -7.945  23.794  13.283  1.00 46.91 ? 102  VAL B CA  1 
ATOM   2103  C  C   . VAL B  2  102 ? -7.731  25.288  13.042  1.00 46.91 ? 102  VAL B C   1 
ATOM   2104  O  O   . VAL B  2  102 ? -7.941  25.781  11.931  1.00 46.91 ? 102  VAL B O   1 
ATOM   2105  C  CB  . VAL B  2  102 ? -9.458  23.501  13.263  1.00 46.91 ? 102  VAL B CB  1 
ATOM   2106  N  N   . LEU B  2  103 ? -7.359  26.004  14.099  1.00 46.91 ? 103  LEU B N   1 
ATOM   2107  C  CA  . LEU B  2  103 ? -7.112  27.439  14.020  1.00 46.91 ? 103  LEU B CA  1 
ATOM   2108  C  C   . LEU B  2  103 ? -5.630  27.717  13.797  1.00 46.91 ? 103  LEU B C   1 
ATOM   2109  O  O   . LEU B  2  103 ? -5.265  28.598  13.016  1.00 46.91 ? 103  LEU B O   1 
ATOM   2110  C  CB  . LEU B  2  103 ? -7.585  28.130  15.300  1.00 46.91 ? 103  LEU B CB  1 
ATOM   2111  N  N   . SER B  2  104 ? -4.783  26.985  14.515  1.00 46.91 ? 104  SER B N   1 
ATOM   2112  C  CA  . SER B  2  104 ? -3.336  27.137  14.403  1.00 46.91 ? 104  SER B CA  1 
ATOM   2113  C  C   . SER B  2  104 ? -2.795  26.374  13.196  1.00 46.91 ? 104  SER B C   1 
ATOM   2114  O  O   . SER B  2  104 ? -1.585  26.345  12.956  1.00 46.91 ? 104  SER B O   1 
ATOM   2115  C  CB  . SER B  2  104 ? -2.655  26.649  15.682  1.00 46.91 ? 104  SER B CB  1 
ATOM   2116  N  N   . GLY B  2  105 ? -3.695  25.719  12.469  1.00 46.91 ? 105  GLY B N   1 
ATOM   2117  C  CA  . GLY B  2  105 ? -3.311  24.971  11.288  1.00 46.91 ? 105  GLY B CA  1 
ATOM   2118  C  C   . GLY B  2  105 ? -3.877  25.618  10.038  1.00 46.91 ? 105  GLY B C   1 
ATOM   2119  O  O   . GLY B  2  105 ? -3.556  25.214  8.918   1.00 46.91 ? 105  GLY B O   1 
ATOM   2120  N  N   . LEU B  2  106 ? -4.739  26.610  10.240  1.00 46.91 ? 106  LEU B N   1 
ATOM   2121  C  CA  . LEU B  2  106 ? -5.370  27.336  9.145   1.00 46.91 ? 106  LEU B CA  1 
ATOM   2122  C  C   . LEU B  2  106 ? -4.717  28.697  8.947   1.00 46.91 ? 106  LEU B C   1 
ATOM   2123  O  O   . LEU B  2  106 ? -4.568  29.163  7.815   1.00 46.91 ? 106  LEU B O   1 
ATOM   2124  C  CB  . LEU B  2  106 ? -6.865  27.510  9.416   1.00 46.91 ? 106  LEU B CB  1 
ATOM   2125  N  N   . LEU B  2  107 ? -4.373  29.347  10.055  1.00 46.91 ? 107  LEU B N   1 
ATOM   2126  C  CA  . LEU B  2  107 ? -3.731  30.658  10.020  1.00 46.91 ? 107  LEU B CA  1 
ATOM   2127  C  C   . LEU B  2  107 ? -2.241  30.529  9.703   1.00 46.91 ? 107  LEU B C   1 
ATOM   2128  O  O   . LEU B  2  107 ? -1.632  31.458  9.174   1.00 46.91 ? 107  LEU B O   1 
ATOM   2129  C  CB  . LEU B  2  107 ? -3.928  31.381  11.356  1.00 46.91 ? 107  LEU B CB  1 
ATOM   2130  N  N   . PHE B  2  108 ? -1.661  29.375  10.028  1.00 46.91 ? 108  PHE B N   1 
ATOM   2131  C  CA  . PHE B  2  108 ? -0.245  29.129  9.763   1.00 46.91 ? 108  PHE B CA  1 
ATOM   2132  C  C   . PHE B  2  108 ? 0.013   29.069  8.254   1.00 46.91 ? 108  PHE B C   1 
ATOM   2133  O  O   . PHE B  2  108 ? 1.142   29.271  7.796   1.00 46.91 ? 108  PHE B O   1 
ATOM   2134  C  CB  . PHE B  2  108 ? 0.204   27.822  10.431  1.00 46.91 ? 108  PHE B CB  1 
ATOM   2135  C  CG  . PHE B  2  108 ? 1.694   27.605  10.411  1.00 46.91 ? 108  PHE B CG  1 
ATOM   2136  C  CD1 . PHE B  2  108 ? 2.546   28.458  11.108  1.00 46.91 ? 108  PHE B CD1 1 
ATOM   2137  C  CD2 . PHE B  2  108 ? 2.247   26.541  9.703   1.00 46.91 ? 108  PHE B CD2 1 
ATOM   2138  C  CE1 . PHE B  2  108 ? 3.926   28.257  11.100  1.00 46.91 ? 108  PHE B CE1 1 
ATOM   2139  C  CE2 . PHE B  2  108 ? 3.625   26.332  9.687   1.00 46.91 ? 108  PHE B CE2 1 
ATOM   2140  C  CZ  . PHE B  2  108 ? 4.466   27.190  10.388  1.00 46.91 ? 108  PHE B CZ  1 
ATOM   2141  N  N   . LEU B  2  109 ? -1.029  28.748  7.491   1.00 46.91 ? 109  LEU B N   1 
ATOM   2142  C  CA  . LEU B  2  109 ? -0.929  28.665  6.037   1.00 46.91 ? 109  LEU B CA  1 
ATOM   2143  C  C   . LEU B  2  109 ? -1.521  29.906  5.373   1.00 46.91 ? 109  LEU B C   1 
ATOM   2144  O  O   . LEU B  2  109 ? -1.163  30.244  4.243   1.00 46.91 ? 109  LEU B O   1 
ATOM   2145  C  CB  . LEU B  2  109 ? -1.646  27.414  5.525   1.00 46.91 ? 109  LEU B CB  1 
ATOM   2146  N  N   . ALA B  2  110 ? -2.456  30.551  6.066   1.00 61.08 ? 110  ALA B N   1 
ATOM   2147  C  CA  . ALA B  2  110 ? -3.112  31.756  5.566   1.00 60.72 ? 110  ALA B CA  1 
ATOM   2148  C  C   . ALA B  2  110 ? -2.161  32.946  5.604   1.00 61.17 ? 110  ALA B C   1 
ATOM   2149  O  O   . ALA B  2  110 ? -2.195  33.807  4.723   1.00 60.13 ? 110  ALA B O   1 
ATOM   2150  C  CB  . ALA B  2  110 ? -4.360  32.055  6.386   1.00 60.27 ? 110  ALA B CB  1 
ATOM   2151  N  N   . ALA B  2  111 ? -1.345  33.006  6.653   1.00 46.91 ? 111  ALA B N   1 
ATOM   2152  C  CA  . ALA B  2  111 ? -0.372  34.080  6.823   1.00 46.91 ? 111  ALA B CA  1 
ATOM   2153  C  C   . ALA B  2  111 ? 0.754   33.936  5.805   1.00 46.91 ? 111  ALA B C   1 
ATOM   2154  O  O   . ALA B  2  111 ? 1.433   34.907  5.474   1.00 46.91 ? 111  ALA B O   1 
ATOM   2155  C  CB  . ALA B  2  111 ? 0.187   34.057  8.236   1.00 46.91 ? 111  ALA B CB  1 
ATOM   2156  N  N   . CYS B  2  112 ? 0.975   32.706  5.350   1.00 46.91 ? 112  CYS B N   1 
ATOM   2157  C  CA  . CYS B  2  112 ? 2.005   32.419  4.361   1.00 46.91 ? 112  CYS B CA  1 
ATOM   2158  C  C   . CYS B  2  112 ? 1.525   32.827  2.971   1.00 46.91 ? 112  CYS B C   1 
ATOM   2159  O  O   . CYS B  2  112 ? 2.325   32.982  2.046   1.00 46.91 ? 112  CYS B O   1 
ATOM   2160  C  CB  . CYS B  2  112 ? 2.347   30.929  4.375   1.00 46.91 ? 112  CYS B CB  1 
ATOM   2161  N  N   . TRP B  2  113 ? 0.208   32.944  2.823   1.00 46.91 ? 113  TRP B N   1 
ATOM   2162  C  CA  . TRP B  2  113 ? -0.405  33.335  1.559   1.00 46.91 ? 113  TRP B CA  1 
ATOM   2163  C  C   . TRP B  2  113 ? -0.346  34.848  1.364   1.00 46.91 ? 113  TRP B C   1 
ATOM   2164  O  O   . TRP B  2  113 ? -0.464  35.340  0.240   1.00 46.91 ? 113  TRP B O   1 
ATOM   2165  C  CB  . TRP B  2  113 ? -1.859  32.861  1.508   1.00 46.91 ? 113  TRP B CB  1 
ATOM   2166  N  N   . HIS B  2  114 ? -0.212  35.577  2.467   1.00 46.91 ? 114  HIS B N   1 
ATOM   2167  C  CA  . HIS B  2  114 ? -0.134  37.034  2.434   1.00 46.91 ? 114  HIS B CA  1 
ATOM   2168  C  C   . HIS B  2  114 ? 1.318   37.503  2.484   1.00 46.91 ? 114  HIS B C   1 
ATOM   2169  O  O   . HIS B  2  114 ? 1.632   38.627  2.086   1.00 46.91 ? 114  HIS B O   1 
ATOM   2170  C  CB  . HIS B  2  114 ? -0.911  37.630  3.609   1.00 46.91 ? 114  HIS B CB  1 
ATOM   2171  N  N   . TRP B  2  115 ? 2.191   36.640  2.993   1.00 46.91 ? 115  TRP B N   1 
ATOM   2172  C  CA  . TRP B  2  115 ? 3.614   36.938  3.110   1.00 46.91 ? 115  TRP B CA  1 
ATOM   2173  C  C   . TRP B  2  115 ? 4.308   36.866  1.749   1.00 46.91 ? 115  TRP B C   1 
ATOM   2174  O  O   . TRP B  2  115 ? 5.098   37.743  1.399   1.00 46.91 ? 115  TRP B O   1 
ATOM   2175  C  CB  . TRP B  2  115 ? 4.267   35.956  4.094   1.00 46.91 ? 115  TRP B CB  1 
ATOM   2176  C  CG  . TRP B  2  115 ? 5.737   36.177  4.334   1.00 46.91 ? 115  TRP B CG  1 
ATOM   2177  C  CD1 . TRP B  2  115 ? 6.774   35.545  3.708   1.00 46.91 ? 115  TRP B CD1 1 
ATOM   2178  C  CD2 . TRP B  2  115 ? 6.329   37.072  5.282   1.00 46.91 ? 115  TRP B CD2 1 
ATOM   2179  N  NE1 . TRP B  2  115 ? 7.975   35.986  4.208   1.00 46.91 ? 115  TRP B NE1 1 
ATOM   2180  C  CE2 . TRP B  2  115 ? 7.732   36.925  5.177   1.00 46.91 ? 115  TRP B CE2 1 
ATOM   2181  C  CE3 . TRP B  2  115 ? 5.815   37.983  6.215   1.00 46.91 ? 115  TRP B CE3 1 
ATOM   2182  C  CZ2 . TRP B  2  115 ? 8.625   37.657  5.969   1.00 46.91 ? 115  TRP B CZ2 1 
ATOM   2183  C  CZ3 . TRP B  2  115 ? 6.704   38.711  7.003   1.00 46.91 ? 115  TRP B CZ3 1 
ATOM   2184  C  CH2 . TRP B  2  115 ? 8.093   38.542  6.873   1.00 46.91 ? 115  TRP B CH2 1 
ATOM   2185  N  N   . VAL B  2  116 ? 4.017   35.808  0.996   1.00 46.91 ? 116  VAL B N   1 
ATOM   2186  C  CA  . VAL B  2  116 ? 4.617   35.604  -0.318  1.00 46.91 ? 116  VAL B CA  1 
ATOM   2187  C  C   . VAL B  2  116 ? 3.890   36.328  -1.451  1.00 46.91 ? 116  VAL B C   1 
ATOM   2188  O  O   . VAL B  2  116 ? 4.524   36.829  -2.382  1.00 46.91 ? 116  VAL B O   1 
ATOM   2189  C  CB  . VAL B  2  116 ? 4.702   34.106  -0.665  1.00 46.91 ? 116  VAL B CB  1 
ATOM   2190  N  N   . TYR B  2  117 ? 2.561   36.331  -1.398  1.00 46.91 ? 117  TYR B N   1 
ATOM   2191  C  CA  . TYR B  2  117 ? 1.754   36.985  -2.426  1.00 46.91 ? 117  TYR B CA  1 
ATOM   2192  C  C   . TYR B  2  117 ? 1.448   38.444  -2.084  1.00 46.91 ? 117  TYR B C   1 
ATOM   2193  O  O   . TYR B  2  117 ? 0.347   38.935  -2.342  1.00 46.91 ? 117  TYR B O   1 
ATOM   2194  C  CB  . TYR B  2  117 ? 0.453   36.209  -2.654  1.00 46.91 ? 117  TYR B CB  1 
ATOM   2195  N  N   . TRP B  2  118 ? 2.436   39.135  -1.521  1.00 46.91 ? 118  TRP B N   1 
ATOM   2196  C  CA  . TRP B  2  118 ? 2.286   40.536  -1.145  1.00 46.91 ? 118  TRP B CA  1 
ATOM   2197  C  C   . TRP B  2  118 ? 2.450   41.448  -2.360  1.00 46.91 ? 118  TRP B C   1 
ATOM   2198  O  O   . TRP B  2  118 ? 3.561   41.881  -2.685  1.00 46.91 ? 118  TRP B O   1 
ATOM   2199  C  CB  . TRP B  2  118 ? 3.307   40.907  -0.065  1.00 46.91 ? 118  TRP B CB  1 
ATOM   2200  N  N   . ASP B  2  119 ? 1.336   41.738  -3.029  1.00 46.91 ? 119  ASP B N   1 
ATOM   2201  C  CA  . ASP B  2  119 ? 1.349   42.589  -4.215  1.00 46.91 ? 119  ASP B CA  1 
ATOM   2202  C  C   . ASP B  2  119 ? 0.406   43.786  -4.109  1.00 46.91 ? 119  ASP B C   1 
ATOM   2203  O  O   . ASP B  2  119 ? 0.640   44.819  -4.741  1.00 46.91 ? 119  ASP B O   1 
ATOM   2204  C  CB  . ASP B  2  119 ? 1.000   41.767  -5.459  1.00 46.91 ? 119  ASP B CB  1 
ATOM   2205  N  N   . LEU B  2  120 ? -0.652  43.637  -3.312  1.00 46.91 ? 120  LEU B N   1 
ATOM   2206  C  CA  . LEU B  2  120 ? -1.655  44.684  -3.106  1.00 46.91 ? 120  LEU B CA  1 
ATOM   2207  C  C   . LEU B  2  120 ? -2.533  44.900  -4.341  1.00 46.91 ? 120  LEU B C   1 
ATOM   2208  O  O   . LEU B  2  120 ? -2.162  44.531  -5.457  1.00 46.91 ? 120  LEU B O   1 
ATOM   2209  C  CB  . LEU B  2  120 ? -0.997  46.003  -2.681  1.00 46.91 ? 120  LEU B CB  1 
ATOM   2210  N  N   . GLU B  2  121 ? -3.713  45.472  -4.124  1.00 46.91 ? 121  GLU B N   1 
ATOM   2211  C  CA  . GLU B  2  121 ? -4.660  45.736  -5.202  1.00 46.91 ? 121  GLU B CA  1 
ATOM   2212  C  C   . GLU B  2  121 ? -5.756  46.683  -4.721  1.00 46.91 ? 121  GLU B C   1 
ATOM   2213  O  O   . GLU B  2  121 ? -6.147  47.608  -5.436  1.00 46.91 ? 121  GLU B O   1 
ATOM   2214  C  CB  . GLU B  2  121 ? -5.282  44.426  -5.689  1.00 46.91 ? 121  GLU B CB  1 
ATOM   2215  N  N   . LEU B  2  122 ? -6.283  46.409  -3.530  1.00 46.91 ? 122  LEU B N   1 
ATOM   2216  C  CA  . LEU B  2  122 ? -7.327  47.236  -2.931  1.00 46.91 ? 122  LEU B CA  1 
ATOM   2217  C  C   . LEU B  2  122 ? -6.695  48.471  -2.293  1.00 46.91 ? 122  LEU B C   1 
ATOM   2218  O  O   . LEU B  2  122 ? -7.185  49.589  -2.461  1.00 46.91 ? 122  LEU B O   1 
ATOM   2219  C  CB  . LEU B  2  122 ? -8.098  46.448  -1.868  1.00 46.91 ? 122  LEU B CB  1 
ATOM   2220  N  N   . PHE B  2  123 ? -5.627  48.250  -1.532  1.00 46.91 ? 123  PHE B N   1 
ATOM   2221  C  CA  . PHE B  2  123 ? -4.910  49.327  -0.859  1.00 46.91 ? 123  PHE B CA  1 
ATOM   2222  C  C   . PHE B  2  123 ? -3.670  49.695  -1.663  1.00 46.91 ? 123  PHE B C   1 
ATOM   2223  O  O   . PHE B  2  123 ? -2.688  48.950  -1.683  1.00 46.91 ? 123  PHE B O   1 
ATOM   2224  C  CB  . PHE B  2  123 ? -4.515  48.895  0.554   1.00 46.91 ? 123  PHE B CB  1 
ATOM   2225  N  N   . ARG B  2  124 ? -3.736  50.837  -2.342  1.00 46.91 ? 124  ARG B N   1 
ATOM   2226  C  CA  . ARG B  2  124 ? -2.628  51.312  -3.161  1.00 46.91 ? 124  ARG B CA  1 
ATOM   2227  C  C   . ARG B  2  124 ? -2.587  52.838  -3.224  1.00 46.91 ? 124  ARG B C   1 
ATOM   2228  O  O   . ARG B  2  124 ? -1.895  53.411  -4.070  1.00 46.91 ? 124  ARG B O   1 
ATOM   2229  C  CB  . ARG B  2  124 ? -2.733  50.733  -4.575  1.00 46.91 ? 124  ARG B CB  1 
ATOM   2230  N  N   . ASP B  2  125 ? -3.343  53.483  -2.336  1.00 46.91 ? 125  ASP B N   1 
ATOM   2231  C  CA  . ASP B  2  125 ? -3.415  54.943  -2.254  1.00 46.91 ? 125  ASP B CA  1 
ATOM   2232  C  C   . ASP B  2  125 ? -3.794  55.595  -3.586  1.00 46.91 ? 125  ASP B C   1 
ATOM   2233  O  O   . ASP B  2  125 ? -2.935  56.079  -4.324  1.00 46.91 ? 125  ASP B O   1 
ATOM   2234  C  CB  . ASP B  2  125 ? -2.092  55.514  -1.731  1.00 46.91 ? 125  ASP B CB  1 
ATOM   2235  N  N   . PRO B  2  126 ? -5.098  55.612  -3.902  1.00 46.91 ? 126  PRO B N   1 
ATOM   2236  C  CA  . PRO B  2  126 ? -5.668  56.185  -5.127  1.00 46.91 ? 126  PRO B CA  1 
ATOM   2237  C  C   . PRO B  2  126 ? -5.293  57.649  -5.351  1.00 46.91 ? 126  PRO B C   1 
ATOM   2238  O  O   . PRO B  2  126 ? -4.982  58.374  -4.403  1.00 46.91 ? 126  PRO B O   1 
ATOM   2239  C  CB  . PRO B  2  126 ? -7.174  56.027  -4.923  1.00 46.91 ? 126  PRO B CB  1 
ATOM   2240  N  N   . ARG B  2  127 ? -5.403  58.083  -6.607  1.00 46.91 ? 127  ARG B N   1 
ATOM   2241  C  CA  . ARG B  2  127 ? -5.084  59.449  -7.027  1.00 46.91 ? 127  ARG B CA  1 
ATOM   2242  C  C   . ARG B  2  127 ? -3.581  59.723  -7.060  1.00 46.91 ? 127  ARG B C   1 
ATOM   2243  O  O   . ARG B  2  127 ? -3.055  60.193  -8.071  1.00 46.91 ? 127  ARG B O   1 
ATOM   2244  C  CB  . ARG B  2  127 ? -5.798  60.488  -6.152  1.00 46.91 ? 127  ARG B CB  1 
ATOM   2245  N  N   . THR B  2  128 ? -2.892  59.430  -5.960  1.00 46.91 ? 128  THR B N   1 
ATOM   2246  C  CA  . THR B  2  128 ? -1.450  59.649  -5.875  1.00 46.91 ? 128  THR B CA  1 
ATOM   2247  C  C   . THR B  2  128 ? -0.826  58.951  -4.670  1.00 46.91 ? 128  THR B C   1 
ATOM   2248  O  O   . THR B  2  128 ? -0.839  59.483  -3.557  1.00 46.91 ? 128  THR B O   1 
ATOM   2249  C  CB  . THR B  2  128 ? -1.115  61.151  -5.797  1.00 46.91 ? 128  THR B CB  1 
ATOM   2250  N  N   . GLY B  2  129 ? -0.242  57.781  -4.910  1.00 46.91 ? 129  GLY B N   1 
ATOM   2251  C  CA  . GLY B  2  129 ? 0.382   57.028  -3.836  1.00 46.91 ? 129  GLY B CA  1 
ATOM   2252  C  C   . GLY B  2  129 ? 0.810   55.633  -4.249  1.00 46.91 ? 129  GLY B C   1 
ATOM   2253  O  O   . GLY B  2  129 ? 0.785   55.295  -5.437  1.00 46.91 ? 129  GLY B O   1 
ATOM   2254  N  N   . GLU B  2  130 ? 1.253   54.843  -3.273  1.00 46.91 ? 130  GLU B N   1 
ATOM   2255  C  CA  . GLU B  2  130 ? 1.695   53.471  -3.514  1.00 46.91 ? 130  GLU B CA  1 
ATOM   2256  C  C   . GLU B  2  130 ? 2.047   52.748  -2.216  1.00 46.91 ? 130  GLU B C   1 
ATOM   2257  O  O   . GLU B  2  130 ? 1.579   51.636  -1.961  1.00 46.91 ? 130  GLU B O   1 
ATOM   2258  C  CB  . GLU B  2  130 ? 2.913   53.453  -4.444  1.00 46.91 ? 130  GLU B CB  1 
ATOM   2259  N  N   . PRO B  2  131 ? 2.919   53.357  -1.400  1.00 46.91 ? 131  PRO B N   1 
ATOM   2260  C  CA  . PRO B  2  131 ? 3.376   52.813  -0.116  1.00 46.91 ? 131  PRO B CA  1 
ATOM   2261  C  C   . PRO B  2  131 ? 2.402   53.025  1.042   1.00 46.91 ? 131  PRO B C   1 
ATOM   2262  O  O   . PRO B  2  131 ? 1.531   53.894  0.985   1.00 46.91 ? 131  PRO B O   1 
ATOM   2263  C  CB  . PRO B  2  131 ? 4.692   53.551  0.129   1.00 46.91 ? 131  PRO B CB  1 
ATOM   2264  N  N   . ALA B  2  132 ? 2.593   52.240  2.101   1.00 46.91 ? 132  ALA B N   1 
ATOM   2265  C  CA  . ALA B  2  132 ? 1.769   52.303  3.309   1.00 46.91 ? 132  ALA B CA  1 
ATOM   2266  C  C   . ALA B  2  132 ? 0.283   52.036  3.064   1.00 46.91 ? 132  ALA B C   1 
ATOM   2267  O  O   . ALA B  2  132 ? -0.164  50.890  3.143   1.00 46.91 ? 132  ALA B O   1 
ATOM   2268  C  CB  . ALA B  2  132 ? 1.968   53.644  4.019   1.00 46.91 ? 132  ALA B CB  1 
ATOM   2269  N  N   . LEU B  2  133 ? -0.471  53.099  2.785   1.00 46.91 ? 133  LEU B N   1 
ATOM   2270  C  CA  . LEU B  2  133 ? -1.910  53.017  2.529   1.00 46.91 ? 133  LEU B CA  1 
ATOM   2271  C  C   . LEU B  2  133 ? -2.707  52.546  3.748   1.00 46.91 ? 133  LEU B C   1 
ATOM   2272  O  O   . LEU B  2  133 ? -3.898  52.243  3.646   1.00 46.91 ? 133  LEU B O   1 
ATOM   2273  C  CB  . LEU B  2  133 ? -2.196  52.106  1.329   1.00 46.91 ? 133  LEU B CB  1 
ATOM   2274  N  N   . ASP B  2  134 ? -2.047  52.518  4.903   1.00 46.91 ? 134  ASP B N   1 
ATOM   2275  C  CA  . ASP B  2  134 ? -2.673  52.091  6.150   1.00 46.91 ? 134  ASP B CA  1 
ATOM   2276  C  C   . ASP B  2  134 ? -3.502  53.214  6.775   1.00 46.91 ? 134  ASP B C   1 
ATOM   2277  O  O   . ASP B  2  134 ? -2.984  54.039  7.531   1.00 46.91 ? 134  ASP B O   1 
ATOM   2278  C  CB  . ASP B  2  134 ? -1.603  51.615  7.136   1.00 46.91 ? 134  ASP B CB  1 
ATOM   2279  N  N   . LEU B  2  135 ? -4.790  53.240  6.452   1.00 46.91 ? 135  LEU B N   1 
ATOM   2280  C  CA  . LEU B  2  135 ? -5.698  54.256  6.973   1.00 46.91 ? 135  LEU B CA  1 
ATOM   2281  C  C   . LEU B  2  135 ? -6.172  53.922  8.387   1.00 46.91 ? 135  LEU B C   1 
ATOM   2282  O  O   . LEU B  2  135 ? -6.584  52.792  8.659   1.00 46.91 ? 135  LEU B O   1 
ATOM   2283  C  CB  . LEU B  2  135 ? -6.906  54.408  6.044   1.00 46.91 ? 135  LEU B CB  1 
ATOM   2284  N  N   . PRO B  2  136 ? -6.123  54.903  9.305   1.00 46.91 ? 136  PRO B N   1 
ATOM   2285  C  CA  . PRO B  2  136 ? -6.559  54.686  10.689  1.00 46.91 ? 136  PRO B CA  1 
ATOM   2286  C  C   . PRO B  2  136 ? -8.077  54.535  10.803  1.00 46.91 ? 136  PRO B C   1 
ATOM   2287  O  O   . PRO B  2  136 ? -8.609  54.337  11.897  1.00 46.91 ? 136  PRO B O   1 
ATOM   2288  C  CB  . PRO B  2  136 ? -6.075  55.950  11.392  1.00 46.91 ? 136  PRO B CB  1 
ATOM   2289  C  CG  . PRO B  2  136 ? -6.229  56.990  10.323  1.00 46.91 ? 136  PRO B CG  1 
ATOM   2290  C  CD  . PRO B  2  136 ? -5.634  56.283  9.125   1.00 46.91 ? 136  PRO B CD  1 
ATOM   2291  N  N   . LYS B  2  137 ? -8.768  54.685  9.676   1.00 46.91 ? 137  LYS B N   1 
ATOM   2292  C  CA  . LYS B  2  137 ? -10.220 54.560  9.635   1.00 46.91 ? 137  LYS B CA  1 
ATOM   2293  C  C   . LYS B  2  137 ? -10.645 53.092  9.629   1.00 46.91 ? 137  LYS B C   1 
ATOM   2294  O  O   . LYS B  2  137 ? -11.829 52.780  9.494   1.00 46.91 ? 137  LYS B O   1 
ATOM   2295  C  CB  . LYS B  2  137 ? -10.779 55.271  8.400   1.00 46.91 ? 137  LYS B CB  1 
ATOM   2296  N  N   . MET B  2  138 ? -9.667  52.195  9.733   1.00 46.91 ? 138  MET B N   1 
ATOM   2297  C  CA  . MET B  2  138 ? -9.930  50.758  9.750   1.00 46.91 ? 138  MET B CA  1 
ATOM   2298  C  C   . MET B  2  138 ? -10.326 50.294  11.149  1.00 46.91 ? 138  MET B C   1 
ATOM   2299  O  O   . MET B  2  138 ? -10.662 49.125  11.352  1.00 46.91 ? 138  MET B O   1 
ATOM   2300  C  CB  . MET B  2  138 ? -8.695  49.988  9.275   1.00 46.91 ? 138  MET B CB  1 
ATOM   2301  N  N   . PHE B  2  139 ? -10.240 51.206  12.114  1.00 46.91 ? 139  PHE B N   1 
ATOM   2302  C  CA  . PHE B  2  139 ? -10.592 50.909  13.497  1.00 46.91 ? 139  PHE B CA  1 
ATOM   2303  C  C   . PHE B  2  139 ? -12.108 50.857  13.687  1.00 46.91 ? 139  PHE B C   1 
ATOM   2304  O  O   . PHE B  2  139 ? -12.599 50.182  14.591  1.00 46.91 ? 139  PHE B O   1 
ATOM   2305  C  CB  . PHE B  2  139 ? -9.988  51.957  14.434  1.00 46.91 ? 139  PHE B CB  1 
ATOM   2306  N  N   . GLY B  2  140 ? -12.832 51.600  12.852  1.00 46.91 ? 140  GLY B N   1 
ATOM   2307  C  CA  . GLY B  2  140 ? -14.283 51.629  12.932  1.00 46.91 ? 140  GLY B CA  1 
ATOM   2308  C  C   . GLY B  2  140 ? -14.917 50.330  12.469  1.00 46.91 ? 140  GLY B C   1 
ATOM   2309  O  O   . GLY B  2  140 ? -15.904 49.871  13.041  1.00 46.91 ? 140  GLY B O   1 
ATOM   2310  N  N   . ILE B  2  141 ? -14.363 49.752  11.407  1.00 46.91 ? 141  ILE B N   1 
ATOM   2311  C  CA  . ILE B  2  141 ? -14.865 48.492  10.869  1.00 46.91 ? 141  ILE B CA  1 
ATOM   2312  C  C   . ILE B  2  141 ? -14.504 47.340  11.802  1.00 46.91 ? 141  ILE B C   1 
ATOM   2313  O  O   . ILE B  2  141 ? -15.030 46.231  11.673  1.00 46.91 ? 141  ILE B O   1 
ATOM   2314  C  CB  . ILE B  2  141 ? -14.280 48.208  9.472   1.00 46.91 ? 141  ILE B CB  1 
ATOM   2315  N  N   . HIS B  2  142 ? -13.565 47.599  12.708  1.00 46.91 ? 142  HIS B N   1 
ATOM   2316  C  CA  . HIS B  2  142 ? -13.117 46.608  13.677  1.00 46.91 ? 142  HIS B CA  1 
ATOM   2317  C  C   . HIS B  2  142 ? -13.897 46.738  14.984  1.00 46.91 ? 142  HIS B C   1 
ATOM   2318  O  O   . HIS B  2  142 ? -13.942 45.800  15.783  1.00 46.91 ? 142  HIS B O   1 
ATOM   2319  C  CB  . HIS B  2  142 ? -11.621 46.772  13.947  1.00 46.91 ? 142  HIS B CB  1 
ATOM   2320  N  N   . LEU B  2  143 ? -14.464 47.920  15.213  1.00 46.91 ? 143  LEU B N   1 
ATOM   2321  C  CA  . LEU B  2  143 ? -15.245 48.193  16.415  1.00 46.91 ? 143  LEU B CA  1 
ATOM   2322  C  C   . LEU B  2  143 ? -16.680 47.703  16.250  1.00 46.91 ? 143  LEU B C   1 
ATOM   2323  O  O   . LEU B  2  143 ? -17.255 47.128  17.175  1.00 46.91 ? 143  LEU B O   1 
ATOM   2324  C  CB  . LEU B  2  143 ? -15.242 49.692  16.723  1.00 46.91 ? 143  LEU B CB  1 
ATOM   2325  N  N   . PHE B  2  144 ? -17.252 47.955  15.076  1.00 46.91 ? 144  PHE B N   1 
ATOM   2326  C  CA  . PHE B  2  144 ? -18.617 47.542  14.766  1.00 46.91 ? 144  PHE B CA  1 
ATOM   2327  C  C   . PHE B  2  144 ? -18.701 46.025  14.623  1.00 46.91 ? 144  PHE B C   1 
ATOM   2328  O  O   . PHE B  2  144 ? -19.789 45.445  14.654  1.00 46.91 ? 144  PHE B O   1 
ATOM   2329  C  CB  . PHE B  2  144 ? -19.094 48.216  13.477  1.00 46.91 ? 144  PHE B CB  1 
ATOM   2330  N  N   . LEU B  2  145 ? -17.550 45.397  14.394  1.00 46.91 ? 145  LEU B N   1 
ATOM   2331  C  CA  . LEU B  2  145 ? -17.473 43.948  14.257  1.00 46.91 ? 145  LEU B CA  1 
ATOM   2332  C  C   . LEU B  2  145 ? -17.386 43.322  15.646  1.00 46.91 ? 145  LEU B C   1 
ATOM   2333  O  O   . LEU B  2  145 ? -17.810 42.182  15.854  1.00 46.91 ? 145  LEU B O   1 
ATOM   2334  C  CB  . LEU B  2  145 ? -16.245 43.557  13.431  1.00 46.91 ? 145  LEU B CB  1 
ATOM   2335  N  N   . ALA B  2  146 ? -16.783 44.060  16.575  1.00 46.91 ? 146  ALA B N   1 
ATOM   2336  C  CA  . ALA B  2  146 ? -16.632 43.613  17.954  1.00 46.91 ? 146  ALA B CA  1 
ATOM   2337  C  C   . ALA B  2  146 ? -17.940 43.810  18.717  1.00 46.91 ? 146  ALA B C   1 
ATOM   2338  O  O   . ALA B  2  146 ? -18.174 43.159  19.738  1.00 46.91 ? 146  ALA B O   1 
ATOM   2339  C  CB  . ALA B  2  146 ? -15.504 44.376  18.633  1.00 46.91 ? 146  ALA B CB  1 
ATOM   2340  N  N   . GLY B  2  147 ? -18.759 44.743  18.238  1.00 46.91 ? 147  GLY B N   1 
ATOM   2341  C  CA  . GLY B  2  147 ? -20.040 45.015  18.866  1.00 46.91 ? 147  GLY B CA  1 
ATOM   2342  C  C   . GLY B  2  147 ? -21.039 43.921  18.544  1.00 46.91 ? 147  GLY B C   1 
ATOM   2343  O  O   . GLY B  2  147 ? -21.919 43.613  19.348  1.00 46.91 ? 147  GLY B O   1 
ATOM   2344  N  N   . LEU B  2  148 ? -20.916 43.353  17.348  1.00 46.91 ? 148  LEU B N   1 
ATOM   2345  C  CA  . LEU B  2  148 ? -21.792 42.276  16.904  1.00 46.91 ? 148  LEU B CA  1 
ATOM   2346  C  C   . LEU B  2  148 ? -21.503 41.014  17.714  1.00 46.91 ? 148  LEU B C   1 
ATOM   2347  O  O   . LEU B  2  148 ? -22.365 40.145  17.865  1.00 46.91 ? 148  LEU B O   1 
ATOM   2348  C  CB  . LEU B  2  148 ? -21.575 41.996  15.415  1.00 46.91 ? 148  LEU B CB  1 
ATOM   2349  N  N   . LEU B  2  149 ? -20.266 40.902  18.188  1.00 46.91 ? 149  LEU B N   1 
ATOM   2350  C  CA  . LEU B  2  149 ? -19.838 39.764  18.992  1.00 46.91 ? 149  LEU B CA  1 
ATOM   2351  C  C   . LEU B  2  149 ? -20.115 40.022  20.472  1.00 46.91 ? 149  LEU B C   1 
ATOM   2352  O  O   . LEU B  2  149 ? -20.175 39.086  21.272  1.00 46.91 ? 149  LEU B O   1 
ATOM   2353  C  CB  . LEU B  2  149 ? -18.344 39.501  18.781  1.00 46.91 ? 149  LEU B CB  1 
ATOM   2354  N  N   . CYS B  2  150 ? -20.245 41.296  20.828  1.00 46.91 ? 150  CYS B N   1 
ATOM   2355  C  CA  . CYS B  2  150 ? -20.515 41.704  22.203  1.00 46.91 ? 150  CYS B CA  1 
ATOM   2356  C  C   . CYS B  2  150 ? -21.962 41.422  22.594  1.00 46.91 ? 150  CYS B C   1 
ATOM   2357  O  O   . CYS B  2  150 ? -22.234 40.941  23.697  1.00 46.91 ? 150  CYS B O   1 
ATOM   2358  C  CB  . CYS B  2  150 ? -20.215 43.194  22.382  1.00 46.91 ? 150  CYS B CB  1 
ATOM   2359  N  N   . PHE B  2  151 ? -22.883 41.734  21.687  1.00 46.91 ? 151  PHE B N   1 
ATOM   2360  C  CA  . PHE B  2  151 ? -24.307 41.519  21.917  1.00 46.91 ? 151  PHE B CA  1 
ATOM   2361  C  C   . PHE B  2  151 ? -24.696 40.054  21.720  1.00 46.91 ? 151  PHE B C   1 
ATOM   2362  O  O   . PHE B  2  151 ? -25.873 39.731  21.542  1.00 46.91 ? 151  PHE B O   1 
ATOM   2363  C  CB  . PHE B  2  151 ? -25.132 42.411  20.983  1.00 46.91 ? 151  PHE B CB  1 
ATOM   2364  N  N   . GLY B  2  152 ? -23.697 39.175  21.746  1.00 46.91 ? 152  GLY B N   1 
ATOM   2365  C  CA  . GLY B  2  152 ? -23.939 37.753  21.575  1.00 46.91 ? 152  GLY B CA  1 
ATOM   2366  C  C   . GLY B  2  152 ? -24.656 37.118  22.753  1.00 46.91 ? 152  GLY B C   1 
ATOM   2367  O  O   . GLY B  2  152 ? -25.074 35.961  22.675  1.00 46.91 ? 152  GLY B O   1 
ATOM   2368  N  N   . PHE B  2  153 ? -24.762 37.856  23.854  1.00 46.91 ? 153  PHE B N   1 
ATOM   2369  C  CA  . PHE B  2  153 ? -25.437 37.368  25.053  1.00 46.91 ? 153  PHE B CA  1 
ATOM   2370  C  C   . PHE B  2  153 ? -26.948 37.310  24.833  1.00 46.91 ? 153  PHE B C   1 
ATOM   2371  O  O   . PHE B  2  153 ? -27.666 36.621  25.560  1.00 46.91 ? 153  PHE B O   1 
ATOM   2372  C  CB  . PHE B  2  153 ? -25.118 38.270  26.247  1.00 46.91 ? 153  PHE B CB  1 
ATOM   2373  N  N   . GLY B  2  154 ? -27.428 38.064  23.849  1.00 46.91 ? 154  GLY B N   1 
ATOM   2374  C  CA  . GLY B  2  154 ? -28.846 38.075  23.547  1.00 46.91 ? 154  GLY B CA  1 
ATOM   2375  C  C   . GLY B  2  154 ? -29.295 36.820  22.818  1.00 46.91 ? 154  GLY B C   1 
ATOM   2376  O  O   . GLY B  2  154 ? -30.482 36.667  22.511  1.00 46.91 ? 154  GLY B O   1 
ATOM   2377  N  N   . ALA B  2  155 ? -28.353 35.920  22.545  1.00 46.91 ? 155  ALA B N   1 
ATOM   2378  C  CA  . ALA B  2  155 ? -28.649 34.678  21.843  1.00 46.91 ? 155  ALA B CA  1 
ATOM   2379  C  C   . ALA B  2  155 ? -28.147 33.435  22.575  1.00 46.91 ? 155  ALA B C   1 
ATOM   2380  O  O   . ALA B  2  155 ? -26.957 33.117  22.538  1.00 46.91 ? 155  ALA B O   1 
ATOM   2381  C  CB  . ALA B  2  155 ? -28.075 34.726  20.431  1.00 46.91 ? 155  ALA B CB  1 
ATOM   2382  N  N   . PHE B  2  156 ? -29.081 32.716  23.198  1.00 46.91 ? 156  PHE B N   1 
ATOM   2383  C  CA  . PHE B  2  156 ? -28.796 31.485  23.939  1.00 46.91 ? 156  PHE B CA  1 
ATOM   2384  C  C   . PHE B  2  156 ? -28.001 31.664  25.231  1.00 46.91 ? 156  PHE B C   1 
ATOM   2385  O  O   . PHE B  2  156 ? -28.252 30.969  26.218  1.00 46.91 ? 156  PHE B O   1 
ATOM   2386  C  CB  . PHE B  2  156 ? -28.101 30.459  23.037  1.00 46.91 ? 156  PHE B CB  1 
ATOM   2387  N  N   . HIS B  2  157 ? -27.032 32.573  25.214  1.00 46.91 ? 157  HIS B N   1 
ATOM   2388  C  CA  . HIS B  2  157 ? -26.194 32.838  26.380  1.00 46.91 ? 157  HIS B CA  1 
ATOM   2389  C  C   . HIS B  2  157 ? -26.888 33.749  27.392  1.00 46.91 ? 157  HIS B C   1 
ATOM   2390  O  O   . HIS B  2  157 ? -26.462 34.884  27.615  1.00 46.91 ? 157  HIS B O   1 
ATOM   2391  C  CB  . HIS B  2  157 ? -24.864 33.456  25.939  1.00 46.91 ? 157  HIS B CB  1 
ATOM   2392  N  N   . LEU B  2  158 ? -27.943 33.237  28.018  1.00 46.91 ? 158  LEU B N   1 
ATOM   2393  C  CA  . LEU B  2  158 ? -28.695 33.997  29.008  1.00 46.91 ? 158  LEU B CA  1 
ATOM   2394  C  C   . LEU B  2  158 ? -27.900 34.173  30.302  1.00 46.91 ? 158  LEU B C   1 
ATOM   2395  O  O   . LEU B  2  158 ? -27.296 35.222  30.527  1.00 46.91 ? 158  LEU B O   1 
ATOM   2396  C  CB  . LEU B  2  158 ? -30.037 33.317  29.297  1.00 46.91 ? 158  LEU B CB  1 
ATOM   2397  N  N   . THR B  2  159 ? -27.911 33.152  31.154  1.00 46.91 ? 159  THR B N   1 
ATOM   2398  C  CA  . THR B  2  159 ? -27.190 33.206  32.424  1.00 46.91 ? 159  THR B CA  1 
ATOM   2399  C  C   . THR B  2  159 ? -27.234 31.874  33.159  1.00 46.91 ? 159  THR B C   1 
ATOM   2400  O  O   . THR B  2  159 ? -26.196 31.305  33.492  1.00 46.91 ? 159  THR B O   1 
ATOM   2401  C  CB  . THR B  2  159 ? -27.770 34.291  33.355  1.00 46.91 ? 159  THR B CB  1 
ATOM   2402  N  N   . GLY B  2  160 ? -28.447 31.405  33.440  1.00 46.91 ? 160  GLY B N   1 
ATOM   2403  C  CA  . GLY B  2  160 ? -28.615 30.143  34.134  1.00 46.91 ? 160  GLY B CA  1 
ATOM   2404  C  C   . GLY B  2  160 ? -28.191 28.971  33.274  1.00 46.91 ? 160  GLY B C   1 
ATOM   2405  O  O   . GLY B  2  160 ? -28.975 28.470  32.466  1.00 46.91 ? 160  GLY B O   1 
ATOM   2406  N  N   . LEU B  2  161 ? -26.943 28.548  33.437  1.00 46.91 ? 161  LEU B N   1 
ATOM   2407  C  CA  . LEU B  2  161 ? -26.400 27.432  32.678  1.00 46.91 ? 161  LEU B CA  1 
ATOM   2408  C  C   . LEU B  2  161 ? -25.761 26.427  33.635  1.00 46.91 ? 161  LEU B C   1 
ATOM   2409  O  O   . LEU B  2  161 ? -26.453 25.827  34.460  1.00 46.91 ? 161  LEU B O   1 
ATOM   2410  C  CB  . LEU B  2  161 ? -25.383 27.938  31.649  1.00 46.91 ? 161  LEU B CB  1 
ATOM   2411  N  N   . PHE B  2  162 ? -24.437 26.232  33.534  1.00 46.91 ? 162  PHE B N   1 
ATOM   2412  C  CA  . PHE B  2  162 ? -23.703 25.295  34.395  1.00 46.91 ? 162  PHE B CA  1 
ATOM   2413  C  C   . PHE B  2  162 ? -23.609 25.795  35.834  1.00 46.91 ? 162  PHE B C   1 
ATOM   2414  O  O   . PHE B  2  162 ? -23.929 25.069  36.778  1.00 46.91 ? 162  PHE B O   1 
ATOM   2415  C  CB  . PHE B  2  162 ? -22.324 25.215  33.738  1.00 46.91 ? 162  PHE B CB  1 
ATOM   2416  N  N   . GLY B  2  163 ? -23.175 27.042  35.989  1.00 46.91 ? 163  GLY B N   1 
ATOM   2417  C  CA  . GLY B  2  163 ? -23.048 27.633  37.309  1.00 46.91 ? 163  GLY B CA  1 
ATOM   2418  C  C   . GLY B  2  163 ? -22.180 28.878  37.301  1.00 46.91 ? 163  GLY B C   1 
ATOM   2419  O  O   . GLY B  2  163 ? -21.116 28.884  37.922  1.00 46.91 ? 163  GLY B O   1 
ATOM   2420  N  N   . PRO B  2  164 ? -22.590 29.942  36.589  1.00 46.91 ? 164  PRO B N   1 
ATOM   2421  C  CA  . PRO B  2  164 ? -21.807 31.183  36.532  1.00 46.91 ? 164  PRO B CA  1 
ATOM   2422  C  C   . PRO B  2  164 ? -21.624 31.815  37.910  1.00 46.91 ? 164  PRO B C   1 
ATOM   2423  O  O   . PRO B  2  164 ? -20.634 32.506  38.160  1.00 46.91 ? 164  PRO B O   1 
ATOM   2424  C  CB  . PRO B  2  164 ? -22.653 32.072  35.622  1.00 46.91 ? 164  PRO B CB  1 
ATOM   2425  C  CG  . PRO B  2  164 ? -23.338 31.091  34.728  1.00 46.91 ? 164  PRO B CG  1 
ATOM   2426  C  CD  . PRO B  2  164 ? -23.767 30.033  35.708  1.00 46.91 ? 164  PRO B CD  1 
ATOM   2427  N  N   . GLY B  2  165 ? -22.598 31.591  38.787  1.00 46.91 ? 165  GLY B N   1 
ATOM   2428  C  CA  . GLY B  2  165 ? -22.543 32.130  40.136  1.00 46.91 ? 165  GLY B CA  1 
ATOM   2429  C  C   . GLY B  2  165 ? -23.288 31.231  41.104  1.00 46.91 ? 165  GLY B C   1 
ATOM   2430  O  O   . GLY B  2  165 ? -23.859 31.696  42.091  1.00 46.91 ? 165  GLY B O   1 
ATOM   2431  N  N   . MET B  2  166 ? -23.289 29.936  40.801  1.00 46.91 ? 166  MET B N   1 
ATOM   2432  C  CA  . MET B  2  166 ? -23.963 28.934  41.620  1.00 46.91 ? 166  MET B CA  1 
ATOM   2433  C  C   . MET B  2  166 ? -23.576 27.536  41.144  1.00 46.91 ? 166  MET B C   1 
ATOM   2434  O  O   . MET B  2  166 ? -24.427 26.762  40.700  1.00 46.91 ? 166  MET B O   1 
ATOM   2435  C  CB  . MET B  2  166 ? -25.484 29.112  41.531  1.00 46.91 ? 166  MET B CB  1 
ATOM   2436  N  N   . TRP B  2  167 ? -22.285 27.227  41.225  1.00 46.91 ? 167  TRP B N   1 
ATOM   2437  C  CA  . TRP B  2  167 ? -21.769 25.927  40.803  1.00 46.91 ? 167  TRP B CA  1 
ATOM   2438  C  C   . TRP B  2  167 ? -22.288 24.801  41.694  1.00 46.91 ? 167  TRP B C   1 
ATOM   2439  O  O   . TRP B  2  167 ? -22.541 23.690  41.222  1.00 46.91 ? 167  TRP B O   1 
ATOM   2440  C  CB  . TRP B  2  167 ? -20.238 25.935  40.810  1.00 46.91 ? 167  TRP B CB  1 
ATOM   2441  N  N   . VAL B  2  168 ? -22.435 25.094  42.982  1.00 46.91 ? 168  VAL B N   1 
ATOM   2442  C  CA  . VAL B  2  168 ? -22.929 24.116  43.944  1.00 46.91 ? 168  VAL B CA  1 
ATOM   2443  C  C   . VAL B  2  168 ? -23.744 24.787  45.045  1.00 46.91 ? 168  VAL B C   1 
ATOM   2444  O  O   . VAL B  2  168 ? -24.805 24.293  45.432  1.00 46.91 ? 168  VAL B O   1 
ATOM   2445  C  CB  . VAL B  2  168 ? -21.778 23.324  44.594  1.00 46.91 ? 168  VAL B CB  1 
ATOM   2446  N  N   . SER B  2  169 ? -23.236 25.905  45.556  1.00 46.91 ? 169  SER B N   1 
ATOM   2447  C  CA  . SER B  2  169 ? -23.903 26.657  46.620  1.00 46.91 ? 169  SER B CA  1 
ATOM   2448  C  C   . SER B  2  169 ? -23.250 28.024  46.812  1.00 46.91 ? 169  SER B C   1 
ATOM   2449  O  O   . SER B  2  169 ? -22.426 28.208  47.706  1.00 46.91 ? 169  SER B O   1 
ATOM   2450  C  CB  . SER B  2  169 ? -23.846 25.875  47.932  1.00 46.91 ? 169  SER B CB  1 
ATOM   2451  N  N   . ASP B  2  170 ? -23.643 28.986  45.985  1.00 46.91 ? 170  ASP B N   1 
ATOM   2452  C  CA  . ASP B  2  170 ? -23.080 30.331  46.056  1.00 46.91 ? 170  ASP B CA  1 
ATOM   2453  C  C   . ASP B  2  170 ? -24.148 31.424  46.132  1.00 46.91 ? 170  ASP B C   1 
ATOM   2454  O  O   . ASP B  2  170 ? -25.218 31.231  46.714  1.00 46.91 ? 170  ASP B O   1 
ATOM   2455  C  CB  . ASP B  2  170 ? -22.165 30.582  44.854  1.00 46.91 ? 170  ASP B CB  1 
ATOM   2456  N  N   . PRO B  2  171 ? -23.842 32.605  45.575  1.00 46.91 ? 171  PRO B N   1 
ATOM   2457  C  CA  . PRO B  2  171 ? -24.684 33.805  45.514  1.00 46.91 ? 171  PRO B CA  1 
ATOM   2458  C  C   . PRO B  2  171 ? -25.817 33.629  44.512  1.00 46.91 ? 171  PRO B C   1 
ATOM   2459  O  O   . PRO B  2  171 ? -26.984 33.901  44.906  1.00 46.91 ? 171  PRO B O   1 
ATOM   2460  C  CB  . PRO B  2  171 ? -23.714 34.897  45.063  1.00 46.91 ? 171  PRO B CB  1 
ATOM   2461  N  N   . GLN B  2  179 ? -25.242 28.730  57.127  1.00 46.91 ? 179  GLN B N   1 
ATOM   2462  C  CA  . GLN B  2  179 ? -23.932 28.640  56.416  1.00 46.91 ? 179  GLN B CA  1 
ATOM   2463  C  C   . GLN B  2  179 ? -23.153 29.954  56.496  1.00 46.91 ? 179  GLN B C   1 
ATOM   2464  O  O   . GLN B  2  179 ? -23.422 30.799  57.353  1.00 46.91 ? 179  GLN B O   1 
ATOM   2465  C  CB  . GLN B  2  179 ? -24.152 28.246  54.952  1.00 46.91 ? 179  GLN B CB  1 
ATOM   2466  N  N   . PRO B  2  180 ? -22.136 30.108  55.637  1.00 46.91 ? 180  PRO B N   1 
ATOM   2467  C  CA  . PRO B  2  180 ? -21.277 31.295  55.561  1.00 46.91 ? 180  PRO B CA  1 
ATOM   2468  C  C   . PRO B  2  180 ? -21.644 32.166  54.360  1.00 46.91 ? 180  PRO B C   1 
ATOM   2469  O  O   . PRO B  2  180 ? -22.820 32.303  54.025  1.00 46.91 ? 180  PRO B O   1 
ATOM   2470  C  CB  . PRO B  2  180 ? -19.873 30.705  55.421  1.00 46.91 ? 180  PRO B CB  1 
ATOM   2471  N  N   . VAL B  2  181 ? -20.637 32.767  53.735  1.00 46.91 ? 181  VAL B N   1 
ATOM   2472  C  CA  . VAL B  2  181 ? -20.853 33.615  52.568  1.00 46.91 ? 181  VAL B CA  1 
ATOM   2473  C  C   . VAL B  2  181 ? -21.186 32.765  51.345  1.00 46.91 ? 181  VAL B C   1 
ATOM   2474  O  O   . VAL B  2  181 ? -22.184 33.005  50.668  1.00 46.91 ? 181  VAL B O   1 
ATOM   2475  C  CB  . VAL B  2  181 ? -19.611 34.474  52.257  1.00 46.91 ? 181  VAL B CB  1 
ATOM   2476  N  N   . ALA B  2  182 ? -20.343 31.770  51.080  1.00 46.91 ? 182  ALA B N   1 
ATOM   2477  C  CA  . ALA B  2  182 ? -20.529 30.869  49.944  1.00 46.91 ? 182  ALA B CA  1 
ATOM   2478  C  C   . ALA B  2  182 ? -19.577 29.677  50.021  1.00 46.91 ? 182  ALA B C   1 
ATOM   2479  O  O   . ALA B  2  182 ? -18.476 29.778  50.572  1.00 46.91 ? 182  ALA B O   1 
ATOM   2480  C  CB  . ALA B  2  182 ? -20.322 31.622  48.633  1.00 46.91 ? 182  ALA B CB  1 
ATOM   2481  N  N   . PRO B  2  183 ? -20.012 28.517  49.507  1.00 46.91 ? 183  PRO B N   1 
ATOM   2482  C  CA  . PRO B  2  183 ? -19.230 27.277  49.495  1.00 46.91 ? 183  PRO B CA  1 
ATOM   2483  C  C   . PRO B  2  183 ? -18.790 26.913  48.074  1.00 46.91 ? 183  PRO B C   1 
ATOM   2484  O  O   . PRO B  2  183 ? -17.999 27.634  47.464  1.00 46.91 ? 183  PRO B O   1 
ATOM   2485  C  CB  . PRO B  2  183 ? -20.197 26.243  50.078  1.00 46.91 ? 183  PRO B CB  1 
ATOM   2486  N  N   . GLU B  2  184 ? -19.305 25.793  47.565  1.00 46.91 ? 184  GLU B N   1 
ATOM   2487  C  CA  . GLU B  2  184 ? -18.991 25.312  46.218  1.00 46.91 ? 184  GLU B CA  1 
ATOM   2488  C  C   . GLU B  2  184 ? -17.493 25.081  46.003  1.00 46.91 ? 184  GLU B C   1 
ATOM   2489  O  O   . GLU B  2  184 ? -16.772 24.726  46.940  1.00 46.91 ? 184  GLU B O   1 
ATOM   2490  C  CB  . GLU B  2  184 ? -19.537 26.287  45.168  1.00 46.91 ? 184  GLU B CB  1 
ATOM   2491  N  N   . TRP B  2  185 ? -17.042 25.260  44.764  1.00 46.91 ? 185  TRP B N   1 
ATOM   2492  C  CA  . TRP B  2  185 ? -15.639 25.080  44.405  1.00 46.91 ? 185  TRP B CA  1 
ATOM   2493  C  C   . TRP B  2  185 ? -15.241 26.070  43.312  1.00 46.91 ? 185  TRP B C   1 
ATOM   2494  O  O   . TRP B  2  185 ? -14.094 26.514  43.257  1.00 46.91 ? 185  TRP B O   1 
ATOM   2495  C  CB  . TRP B  2  185 ? -15.391 23.648  43.921  1.00 46.91 ? 185  TRP B CB  1 
ATOM   2496  N  N   . GLY B  2  186 ? -16.199 26.413  42.454  1.00 46.91 ? 186  GLY B N   1 
ATOM   2497  C  CA  . GLY B  2  186 ? -15.945 27.351  41.372  1.00 46.91 ? 186  GLY B CA  1 
ATOM   2498  C  C   . GLY B  2  186 ? -15.038 26.807  40.283  1.00 46.91 ? 186  GLY B C   1 
ATOM   2499  O  O   . GLY B  2  186 ? -14.983 25.594  40.072  1.00 46.91 ? 186  GLY B O   1 
ATOM   2500  N  N   . PRO B  2  187 ? -14.342 27.687  39.546  1.00 46.91 ? 187  PRO B N   1 
ATOM   2501  C  CA  . PRO B  2  187 ? -13.425 27.319  38.460  1.00 46.91 ? 187  PRO B CA  1 
ATOM   2502  C  C   . PRO B  2  187 ? -11.980 27.213  38.946  1.00 46.91 ? 187  PRO B C   1 
ATOM   2503  O  O   . PRO B  2  187 ? -11.326 26.184  38.766  1.00 46.91 ? 187  PRO B O   1 
ATOM   2504  C  CB  . PRO B  2  187 ? -13.589 28.458  37.452  1.00 46.91 ? 187  PRO B CB  1 
ATOM   2505  N  N   . ASP B  2  188 ? -11.496 28.288  39.561  1.00 46.91 ? 188  ASP B N   1 
ATOM   2506  C  CA  . ASP B  2  188 ? -10.135 28.349  40.084  1.00 46.91 ? 188  ASP B CA  1 
ATOM   2507  C  C   . ASP B  2  188 ? -10.060 29.396  41.195  1.00 46.91 ? 188  ASP B C   1 
ATOM   2508  O  O   . ASP B  2  188 ? -10.264 30.587  40.947  1.00 46.91 ? 188  ASP B O   1 
ATOM   2509  C  CB  . ASP B  2  188 ? -9.154  28.711  38.964  1.00 46.91 ? 188  ASP B CB  1 
ATOM   2510  N  N   . GLY B  2  189 ? -9.743  28.952  42.410  1.00 46.91 ? 189  GLY B N   1 
ATOM   2511  C  CA  . GLY B  2  189 ? -9.653  29.863  43.540  1.00 46.91 ? 189  GLY B CA  1 
ATOM   2512  C  C   . GLY B  2  189 ? -10.984 30.527  43.845  1.00 46.91 ? 189  GLY B C   1 
ATOM   2513  O  O   . GLY B  2  189 ? -11.104 31.752  43.763  1.00 46.91 ? 189  GLY B O   1 
ATOM   2514  N  N   . PHE B  2  190 ? -11.954 29.721  44.277  1.00 46.91 ? 190  PHE B N   1 
ATOM   2515  C  CA  . PHE B  2  190 ? -13.307 30.187  44.589  1.00 46.91 ? 190  PHE B CA  1 
ATOM   2516  C  C   . PHE B  2  190 ? -13.981 30.690  43.315  1.00 46.91 ? 190  PHE B C   1 
ATOM   2517  O  O   . PHE B  2  190 ? -14.107 29.948  42.341  1.00 46.91 ? 190  PHE B O   1 
ATOM   2518  C  CB  . PHE B  2  190 ? -13.288 31.282  45.666  1.00 46.91 ? 190  PHE B CB  1 
ATOM   2519  N  N   . ASN B  2  191 ? -14.404 31.950  43.315  1.00 46.91 ? 191  ASN B N   1 
ATOM   2520  C  CA  . ASN B  2  191 ? -15.053 32.531  42.144  1.00 46.91 ? 191  ASN B CA  1 
ATOM   2521  C  C   . ASN B  2  191 ? -15.036 34.058  42.169  1.00 46.91 ? 191  ASN B C   1 
ATOM   2522  O  O   . ASN B  2  191 ? -15.347 34.681  43.189  1.00 46.91 ? 191  ASN B O   1 
ATOM   2523  C  CB  . ASN B  2  191 ? -16.493 32.026  42.023  1.00 46.91 ? 191  ASN B CB  1 
ATOM   2524  N  N   . PRO B  2  192 ? -14.593 34.677  41.062  1.00 46.91 ? 192  PRO B N   1 
ATOM   2525  C  CA  . PRO B  2  192 ? -14.521 36.135  40.927  1.00 46.91 ? 192  PRO B CA  1 
ATOM   2526  C  C   . PRO B  2  192 ? -15.921 36.738  40.808  1.00 46.91 ? 192  PRO B C   1 
ATOM   2527  O  O   . PRO B  2  192 ? -16.910 36.114  41.197  1.00 46.91 ? 192  PRO B O   1 
ATOM   2528  C  CB  . PRO B  2  192 ? -13.741 36.314  39.622  1.00 46.91 ? 192  PRO B CB  1 
ATOM   2529  C  CG  . PRO B  2  192 ? -12.913 35.066  39.532  1.00 46.91 ? 192  PRO B CG  1 
ATOM   2530  C  CD  . PRO B  2  192 ? -13.912 34.020  39.935  1.00 46.91 ? 192  PRO B CD  1 
ATOM   2531  N  N   . TYR B  2  193 ? -15.996 37.927  40.213  1.00 46.91 ? 193  TYR B N   1 
ATOM   2532  C  CA  . TYR B  2  193 ? -17.256 38.646  40.011  1.00 46.91 ? 193  TYR B CA  1 
ATOM   2533  C  C   . TYR B  2  193 ? -18.021 38.879  41.311  1.00 46.91 ? 193  TYR B C   1 
ATOM   2534  O  O   . TYR B  2  193 ? -18.792 38.029  41.755  1.00 46.91 ? 193  TYR B O   1 
ATOM   2535  C  CB  . TYR B  2  193 ? -18.148 37.911  39.003  1.00 46.91 ? 193  TYR B CB  1 
ATOM   2536  C  CG  . TYR B  2  193 ? -17.538 37.758  37.628  1.00 46.91 ? 193  TYR B CG  1 
ATOM   2537  C  CD1 . TYR B  2  193 ? -17.125 36.511  37.163  1.00 46.91 ? 193  TYR B CD1 1 
ATOM   2538  C  CD2 . TYR B  2  193 ? -17.385 38.858  36.787  1.00 46.91 ? 193  TYR B CD2 1 
ATOM   2539  C  CE1 . TYR B  2  193 ? -16.573 36.362  35.893  1.00 46.91 ? 193  TYR B CE1 1 
ATOM   2540  C  CE2 . TYR B  2  193 ? -16.837 38.723  35.517  1.00 46.91 ? 193  TYR B CE2 1 
ATOM   2541  C  CZ  . TYR B  2  193 ? -16.433 37.474  35.075  1.00 46.91 ? 193  TYR B CZ  1 
ATOM   2542  O  OH  . TYR B  2  193 ? -15.898 37.349  33.815  1.00 46.91 ? 193  TYR B OH  1 
ATOM   2543  N  N   . ASN B  2  194 ? -17.817 40.051  41.905  1.00 46.91 ? 194  ASN B N   1 
ATOM   2544  C  CA  . ASN B  2  194 ? -18.483 40.402  43.154  1.00 46.91 ? 194  ASN B CA  1 
ATOM   2545  C  C   . ASN B  2  194 ? -20.009 40.513  43.036  1.00 46.91 ? 194  ASN B C   1 
ATOM   2546  O  O   . ASN B  2  194 ? -20.732 40.026  43.906  1.00 46.91 ? 194  ASN B O   1 
ATOM   2547  C  CB  . ASN B  2  194 ? -17.896 41.697  43.730  1.00 46.91 ? 194  ASN B CB  1 
ATOM   2548  N  N   . PRO B  2  195 ? -20.514 41.210  41.998  1.00 46.91 ? 195  PRO B N   1 
ATOM   2549  C  CA  . PRO B  2  195 ? -21.966 41.351  41.830  1.00 46.91 ? 195  PRO B CA  1 
ATOM   2550  C  C   . PRO B  2  195 ? -22.631 40.080  41.312  1.00 46.91 ? 195  PRO B C   1 
ATOM   2551  O  O   . PRO B  2  195 ? -22.051 39.351  40.509  1.00 46.91 ? 195  PRO B O   1 
ATOM   2552  C  CB  . PRO B  2  195 ? -22.082 42.467  40.788  1.00 46.91 ? 195  PRO B CB  1 
ATOM   2553  C  CG  . PRO B  2  195 ? -20.793 43.221  40.922  1.00 46.91 ? 195  PRO B CG  1 
ATOM   2554  C  CD  . PRO B  2  195 ? -19.808 42.104  41.066  1.00 46.91 ? 195  PRO B CD  1 
ATOM   2555  N  N   . GLY B  2  196 ? -23.865 39.841  41.749  1.00 46.91 ? 196  GLY B N   1 
ATOM   2556  C  CA  . GLY B  2  196 ? -24.593 38.668  41.299  1.00 46.91 ? 196  GLY B CA  1 
ATOM   2557  C  C   . GLY B  2  196 ? -25.051 38.835  39.861  1.00 46.91 ? 196  GLY B C   1 
ATOM   2558  O  O   . GLY B  2  196 ? -24.754 38.001  39.004  1.00 46.91 ? 196  GLY B O   1 
ATOM   2559  N  N   . GLY B  2  197 ? -25.796 39.906  39.604  1.00 46.91 ? 197  GLY B N   1 
ATOM   2560  C  CA  . GLY B  2  197 ? -26.282 40.176  38.263  1.00 46.91 ? 197  GLY B CA  1 
ATOM   2561  C  C   . GLY B  2  197 ? -25.203 40.813  37.409  1.00 46.91 ? 197  GLY B C   1 
ATOM   2562  O  O   . GLY B  2  197 ? -24.986 42.026  37.477  1.00 46.91 ? 197  GLY B O   1 
ATOM   2563  N  N   . VAL B  2  198 ? -24.528 39.992  36.611  1.00 46.91 ? 198  VAL B N   1 
ATOM   2564  C  CA  . VAL B  2  198 ? -23.452 40.462  35.743  1.00 46.91 ? 198  VAL B CA  1 
ATOM   2565  C  C   . VAL B  2  198 ? -23.957 41.147  34.473  1.00 46.91 ? 198  VAL B C   1 
ATOM   2566  O  O   . VAL B  2  198 ? -24.266 42.339  34.489  1.00 46.91 ? 198  VAL B O   1 
ATOM   2567  C  CB  . VAL B  2  198 ? -22.503 39.306  35.358  1.00 46.91 ? 198  VAL B CB  1 
ATOM   2568  N  N   . VAL B  2  199 ? -24.040 40.386  33.382  1.00 46.91 ? 199  VAL B N   1 
ATOM   2569  C  CA  . VAL B  2  199 ? -24.494 40.903  32.092  1.00 46.91 ? 199  VAL B CA  1 
ATOM   2570  C  C   . VAL B  2  199 ? -23.652 42.104  31.652  1.00 46.91 ? 199  VAL B C   1 
ATOM   2571  O  O   . VAL B  2  199 ? -22.432 41.990  31.509  1.00 46.91 ? 199  VAL B O   1 
ATOM   2572  C  CB  . VAL B  2  199 ? -25.994 41.286  32.128  1.00 46.91 ? 199  VAL B CB  1 
ATOM   2573  N  N   . ALA B  2  200 ? -24.309 43.243  31.436  1.00 46.91 ? 200  ALA B N   1 
ATOM   2574  C  CA  . ALA B  2  200 ? -23.650 44.481  31.021  1.00 46.91 ? 200  ALA B CA  1 
ATOM   2575  C  C   . ALA B  2  200 ? -22.988 44.419  29.644  1.00 46.91 ? 200  ALA B C   1 
ATOM   2576  O  O   . ALA B  2  200 ? -22.518 45.437  29.134  1.00 46.91 ? 200  ALA B O   1 
ATOM   2577  C  CB  . ALA B  2  200 ? -22.645 44.931  32.080  1.00 46.91 ? 200  ALA B CB  1 
ATOM   2578  N  N   . HIS B  2  201 ? -22.920 43.226  29.061  1.00 46.91 ? 201  HIS B N   1 
ATOM   2579  C  CA  . HIS B  2  201 ? -22.324 43.051  27.738  1.00 46.91 ? 201  HIS B CA  1 
ATOM   2580  C  C   . HIS B  2  201 ? -23.363 43.253  26.640  1.00 46.91 ? 201  HIS B C   1 
ATOM   2581  O  O   . HIS B  2  201 ? -23.028 43.657  25.528  1.00 46.91 ? 201  HIS B O   1 
ATOM   2582  C  CB  . HIS B  2  201 ? -21.688 41.665  27.603  1.00 46.91 ? 201  HIS B CB  1 
ATOM   2583  C  CG  . HIS B  2  201 ? -20.404 41.508  28.359  1.00 46.91 ? 201  HIS B CG  1 
ATOM   2584  N  ND1 . HIS B  2  201 ? -19.192 41.951  27.869  1.00 46.91 ? 201  HIS B ND1 1 
ATOM   2585  C  CD2 . HIS B  2  201 ? -20.140 40.946  29.562  1.00 46.91 ? 201  HIS B CD2 1 
ATOM   2586  C  CE1 . HIS B  2  201 ? -18.239 41.667  28.738  1.00 46.91 ? 201  HIS B CE1 1 
ATOM   2587  N  NE2 . HIS B  2  201 ? -18.786 41.057  29.773  1.00 46.91 ? 201  HIS B NE2 1 
ATOM   2588  N  N   . HIS B  2  202 ? -24.617 42.939  26.952  1.00 46.91 ? 202  HIS B N   1 
ATOM   2589  C  CA  . HIS B  2  202 ? -25.704 43.093  25.991  1.00 46.91 ? 202  HIS B CA  1 
ATOM   2590  C  C   . HIS B  2  202 ? -26.588 44.291  26.335  1.00 46.91 ? 202  HIS B C   1 
ATOM   2591  O  O   . HIS B  2  202 ? -27.456 44.678  25.550  1.00 46.91 ? 202  HIS B O   1 
ATOM   2592  C  CB  . HIS B  2  202 ? -26.549 41.816  25.937  1.00 46.91 ? 202  HIS B CB  1 
ATOM   2593  N  N   . ILE B  2  203 ? -26.379 44.861  27.520  1.00 46.91 ? 203  ILE B N   1 
ATOM   2594  C  CA  . ILE B  2  203 ? -27.158 46.013  27.963  1.00 46.91 ? 203  ILE B CA  1 
ATOM   2595  C  C   . ILE B  2  203 ? -26.378 47.321  27.858  1.00 46.91 ? 203  ILE B C   1 
ATOM   2596  O  O   . ILE B  2  203 ? -26.910 48.332  27.396  1.00 46.91 ? 203  ILE B O   1 
ATOM   2597  C  CB  . ILE B  2  203 ? -27.637 45.839  29.419  1.00 46.91 ? 203  ILE B CB  1 
ATOM   2598  N  N   . ALA B  2  204 ? -25.133 47.304  28.328  1.00 46.91 ? 204  ALA B N   1 
ATOM   2599  C  CA  . ALA B  2  204 ? -24.279 48.488  28.300  1.00 46.91 ? 204  ALA B CA  1 
ATOM   2600  C  C   . ALA B  2  204 ? -23.327 48.514  27.108  1.00 46.91 ? 204  ALA B C   1 
ATOM   2601  O  O   . ALA B  2  204 ? -23.101 49.568  26.510  1.00 46.91 ? 204  ALA B O   1 
ATOM   2602  C  CB  . ALA B  2  204 ? -23.492 48.595  29.600  1.00 46.91 ? 204  ALA B CB  1 
ATOM   2603  N  N   . ALA B  2  205 ? -22.729 47.364  26.807  1.00 46.91 ? 205  ALA B N   1 
ATOM   2604  C  CA  . ALA B  2  205 ? -21.788 47.248  25.698  1.00 46.91 ? 205  ALA B CA  1 
ATOM   2605  C  C   . ALA B  2  205 ? -22.484 46.985  24.365  1.00 46.91 ? 205  ALA B C   1 
ATOM   2606  O  O   . ALA B  2  205 ? -21.893 47.182  23.301  1.00 46.91 ? 205  ALA B O   1 
ATOM   2607  C  CB  . ALA B  2  205 ? -20.772 46.152  25.986  1.00 46.91 ? 205  ALA B CB  1 
ATOM   2608  N  N   . GLY B  2  206 ? -23.722 46.506  24.430  1.00 46.91 ? 206  GLY B N   1 
ATOM   2609  C  CA  . GLY B  2  206 ? -24.477 46.230  23.221  1.00 46.91 ? 206  GLY B CA  1 
ATOM   2610  C  C   . GLY B  2  206 ? -25.119 47.483  22.658  1.00 46.91 ? 206  GLY B C   1 
ATOM   2611  O  O   . GLY B  2  206 ? -25.505 47.525  21.487  1.00 46.91 ? 206  GLY B O   1 
ATOM   2612  N  N   . ILE B  2  207 ? -25.275 48.492  23.511  1.00 46.91 ? 207  ILE B N   1 
ATOM   2613  C  CA  . ILE B  2  207 ? -25.871 49.761  23.115  1.00 46.91 ? 207  ILE B CA  1 
ATOM   2614  C  C   . ILE B  2  207 ? -24.801 50.802  22.797  1.00 46.91 ? 207  ILE B C   1 
ATOM   2615  O  O   . ILE B  2  207 ? -25.044 51.738  22.033  1.00 46.91 ? 207  ILE B O   1 
ATOM   2616  C  CB  . ILE B  2  207 ? -26.788 50.317  24.224  1.00 46.91 ? 207  ILE B CB  1 
ATOM   2617  N  N   . VAL B  2  208 ? -23.638 50.657  23.426  1.00 46.91 ? 208  VAL B N   1 
ATOM   2618  C  CA  . VAL B  2  208 ? -22.524 51.576  23.215  1.00 46.91 ? 208  VAL B CA  1 
ATOM   2619  C  C   . VAL B  2  208 ? -21.637 51.133  22.054  1.00 46.91 ? 208  VAL B C   1 
ATOM   2620  O  O   . VAL B  2  208 ? -20.842 51.919  21.538  1.00 46.91 ? 208  VAL B O   1 
ATOM   2621  C  CB  . VAL B  2  208 ? -21.653 51.699  24.481  1.00 46.91 ? 208  VAL B CB  1 
ATOM   2622  N  N   . GLY B  2  209 ? -21.751 49.862  21.677  1.00 46.91 ? 209  GLY B N   1 
ATOM   2623  C  CA  . GLY B  2  209 ? -20.957 49.334  20.581  1.00 46.91 ? 209  GLY B CA  1 
ATOM   2624  C  C   . GLY B  2  209 ? -21.522 49.702  19.221  1.00 46.91 ? 209  GLY B C   1 
ATOM   2625  O  O   . GLY B  2  209 ? -20.774 49.903  18.263  1.00 46.91 ? 209  GLY B O   1 
ATOM   2626  N  N   . ILE B  2  210 ? -22.847 49.770  19.135  1.00 46.91 ? 210  ILE B N   1 
ATOM   2627  C  CA  . ILE B  2  210 ? -23.524 50.111  17.888  1.00 46.91 ? 210  ILE B CA  1 
ATOM   2628  C  C   . ILE B  2  210 ? -23.843 51.604  17.795  1.00 46.91 ? 210  ILE B C   1 
ATOM   2629  O  O   . ILE B  2  210 ? -24.612 52.029  16.928  1.00 46.91 ? 210  ILE B O   1 
ATOM   2630  C  CB  . ILE B  2  210 ? -24.831 49.310  17.731  1.00 46.91 ? 210  ILE B CB  1 
ATOM   2631  N  N   . ILE B  2  211 ? -23.263 52.392  18.695  1.00 46.91 ? 211  ILE B N   1 
ATOM   2632  C  CA  . ILE B  2  211 ? -23.481 53.833  18.716  1.00 46.91 ? 211  ILE B CA  1 
ATOM   2633  C  C   . ILE B  2  211 ? -22.157 54.586  18.628  1.00 46.91 ? 211  ILE B C   1 
ATOM   2634  O  O   . ILE B  2  211 ? -22.089 55.678  18.056  1.00 46.91 ? 211  ILE B O   1 
ATOM   2635  C  CB  . ILE B  2  211 ? -24.220 54.269  19.995  1.00 46.91 ? 211  ILE B CB  1 
ATOM   2636  N  N   . ALA B  2  212 ? -21.125 54.023  19.247  1.00 46.91 ? 212  ALA B N   1 
ATOM   2637  C  CA  . ALA B  2  212 ? -19.794 54.617  19.237  1.00 46.91 ? 212  ALA B CA  1 
ATOM   2638  C  C   . ALA B  2  212 ? -18.934 53.969  18.155  1.00 46.91 ? 212  ALA B C   1 
ATOM   2639  O  O   . ALA B  2  212 ? -17.871 54.486  17.803  1.00 46.91 ? 212  ALA B O   1 
ATOM   2640  C  CB  . ALA B  2  212 ? -19.137 54.454  20.602  1.00 46.91 ? 212  ALA B CB  1 
ATOM   2641  N  N   . GLY B  2  213 ? -19.389 52.821  17.658  1.00 46.91 ? 213  GLY B N   1 
ATOM   2642  C  CA  . GLY B  2  213 ? -18.664 52.105  16.623  1.00 46.91 ? 213  GLY B CA  1 
ATOM   2643  C  C   . GLY B  2  213 ? -19.260 52.314  15.244  1.00 46.91 ? 213  GLY B C   1 
ATOM   2644  O  O   . GLY B  2  213 ? -18.532 52.445  14.258  1.00 46.91 ? 213  GLY B O   1 
ATOM   2645  N  N   . LEU B  2  214 ? -20.587 52.327  15.171  1.00 46.91 ? 214  LEU B N   1 
ATOM   2646  C  CA  . LEU B  2  214 ? -21.293 52.523  13.908  1.00 46.91 ? 214  LEU B CA  1 
ATOM   2647  C  C   . LEU B  2  214 ? -21.100 53.947  13.394  1.00 46.91 ? 214  LEU B C   1 
ATOM   2648  O  O   . LEU B  2  214 ? -21.202 54.206  12.191  1.00 46.91 ? 214  LEU B O   1 
ATOM   2649  C  CB  . LEU B  2  214 ? -22.785 52.235  14.089  1.00 46.91 ? 214  LEU B CB  1 
ATOM   2650  N  N   . PHE B  2  215 ? -20.883 54.874  14.323  1.00 46.91 ? 215  PHE B N   1 
ATOM   2651  C  CA  . PHE B  2  215 ? -20.667 56.277  13.997  1.00 46.91 ? 215  PHE B CA  1 
ATOM   2652  C  C   . PHE B  2  215 ? -19.196 56.531  13.683  1.00 46.91 ? 215  PHE B C   1 
ATOM   2653  O  O   . PHE B  2  215 ? -18.843 57.564  13.109  1.00 46.91 ? 215  PHE B O   1 
ATOM   2654  C  CB  . PHE B  2  215 ? -21.110 57.163  15.162  1.00 46.91 ? 215  PHE B CB  1 
ATOM   2655  N  N   . HIS B  2  216 ? -18.342 55.607  14.115  1.00 46.91 ? 216  HIS B N   1 
ATOM   2656  C  CA  . HIS B  2  216 ? -16.905 55.702  13.887  1.00 46.91 ? 216  HIS B CA  1 
ATOM   2657  C  C   . HIS B  2  216 ? -16.537 55.256  12.475  1.00 46.91 ? 216  HIS B C   1 
ATOM   2658  O  O   . HIS B  2  216 ? -15.515 55.678  11.929  1.00 46.91 ? 216  HIS B O   1 
ATOM   2659  C  CB  . HIS B  2  216 ? -16.151 54.848  14.911  1.00 46.91 ? 216  HIS B CB  1 
ATOM   2660  N  N   . ILE B  2  217 ? -17.360 54.383  11.902  1.00 46.91 ? 217  ILE B N   1 
ATOM   2661  C  CA  . ILE B  2  217 ? -17.133 53.873  10.553  1.00 46.91 ? 217  ILE B CA  1 
ATOM   2662  C  C   . ILE B  2  217 ? -17.362 54.965  9.510   1.00 46.91 ? 217  ILE B C   1 
ATOM   2663  O  O   . ILE B  2  217 ? -16.904 54.857  8.369   1.00 46.91 ? 217  ILE B O   1 
ATOM   2664  C  CB  . ILE B  2  217 ? -18.063 52.684  10.241  1.00 46.91 ? 217  ILE B CB  1 
ATOM   2665  N  N   . LEU B  2  218 ? -18.098 56.001  9.902   1.00 46.91 ? 218  LEU B N   1 
ATOM   2666  C  CA  . LEU B  2  218 ? -18.400 57.118  9.021   1.00 46.91 ? 218  LEU B CA  1 
ATOM   2667  C  C   . LEU B  2  218 ? -17.736 58.405  9.507   1.00 46.91 ? 218  LEU B C   1 
ATOM   2668  O  O   . LEU B  2  218 ? -16.905 58.383  10.415  1.00 46.91 ? 218  LEU B O   1 
ATOM   2669  C  CB  . LEU B  2  218 ? -19.915 57.316  8.925   1.00 46.91 ? 218  LEU B CB  1 
ATOM   2670  N  N   . VAL B  2  219 ? -18.112 59.522  8.888   1.00 46.91 ? 219  VAL B N   1 
ATOM   2671  C  CA  . VAL B  2  219 ? -17.584 60.846  9.225   1.00 46.91 ? 219  VAL B CA  1 
ATOM   2672  C  C   . VAL B  2  219 ? -16.095 61.011  8.909   1.00 46.91 ? 219  VAL B C   1 
ATOM   2673  O  O   . VAL B  2  219 ? -15.738 61.775  8.009   1.00 46.91 ? 219  VAL B O   1 
ATOM   2674  C  CB  . VAL B  2  219 ? -17.841 61.208  10.705  1.00 46.91 ? 219  VAL B CB  1 
ATOM   2675  N  N   . ARG B  2  220 ? -15.242 60.311  9.656   1.00 46.91 ? 220  ARG B N   1 
ATOM   2676  C  CA  . ARG B  2  220 ? -13.795 60.372  9.468   1.00 46.91 ? 220  ARG B CA  1 
ATOM   2677  C  C   . ARG B  2  220 ? -13.300 61.822  9.492   1.00 46.91 ? 220  ARG B C   1 
ATOM   2678  O  O   . ARG B  2  220 ? -12.798 62.342  8.491   1.00 46.91 ? 220  ARG B O   1 
ATOM   2679  C  CB  . ARG B  2  220 ? -13.390 59.690  8.158   1.00 46.91 ? 220  ARG B CB  1 
ATOM   2680  N  N   . PRO B  2  221 ? -13.431 62.492  10.651  1.00 46.91 ? 221  PRO B N   1 
ATOM   2681  C  CA  . PRO B  2  221 ? -13.004 63.886  10.817  1.00 46.91 ? 221  PRO B CA  1 
ATOM   2682  C  C   . PRO B  2  221 ? -11.511 64.056  10.560  1.00 46.91 ? 221  PRO B C   1 
ATOM   2683  O  O   . PRO B  2  221 ? -10.682 63.401  11.194  1.00 46.91 ? 221  PRO B O   1 
ATOM   2684  C  CB  . PRO B  2  221 ? -13.345 64.177  12.282  1.00 46.91 ? 221  PRO B CB  1 
ATOM   2685  C  CG  . PRO B  2  221 ? -14.436 63.190  12.600  1.00 46.91 ? 221  PRO B CG  1 
ATOM   2686  C  CD  . PRO B  2  221 ? -13.937 61.952  11.923  1.00 46.91 ? 221  PRO B CD  1 
ATOM   2687  N  N   . PRO B  2  222 ? -11.154 64.940  9.616   1.00 46.91 ? 222  PRO B N   1 
ATOM   2688  C  CA  . PRO B  2  222 ? -9.773  65.237  9.226   1.00 46.91 ? 222  PRO B CA  1 
ATOM   2689  C  C   . PRO B  2  222 ? -9.177  66.397  10.028  1.00 46.91 ? 222  PRO B C   1 
ATOM   2690  O  O   . PRO B  2  222 ? -8.413  67.208  9.496   1.00 46.91 ? 222  PRO B O   1 
ATOM   2691  C  CB  . PRO B  2  222 ? -9.895  65.594  7.741   1.00 46.91 ? 222  PRO B CB  1 
ATOM   2692  N  N   . GLN B  2  223 ? -9.558  66.489  11.300  1.00 46.91 ? 223  GLN B N   1 
ATOM   2693  C  CA  . GLN B  2  223 ? -9.061  67.543  12.181  1.00 46.91 ? 223  GLN B CA  1 
ATOM   2694  C  C   . GLN B  2  223 ? -7.580  67.340  12.498  1.00 46.91 ? 223  GLN B C   1 
ATOM   2695  O  O   . GLN B  2  223 ? -7.041  66.247  12.318  1.00 46.91 ? 223  GLN B O   1 
ATOM   2696  C  CB  . GLN B  2  223 ? -9.876  67.576  13.477  1.00 46.91 ? 223  GLN B CB  1 
ATOM   2697  N  N   . ARG B  2  224 ? -6.928  68.406  12.955  1.00 46.91 ? 224  ARG B N   1 
ATOM   2698  C  CA  . ARG B  2  224 ? -5.508  68.357  13.290  1.00 46.91 ? 224  ARG B CA  1 
ATOM   2699  C  C   . ARG B  2  224 ? -5.243  67.611  14.597  1.00 46.91 ? 224  ARG B C   1 
ATOM   2700  O  O   . ARG B  2  224 ? -4.371  66.746  14.654  1.00 46.91 ? 224  ARG B O   1 
ATOM   2701  C  CB  . ARG B  2  224 ? -4.933  69.773  13.375  1.00 46.91 ? 224  ARG B CB  1 
ATOM   2702  N  N   . LEU B  2  225 ? -6.002  67.956  15.637  1.00 46.91 ? 225  LEU B N   1 
ATOM   2703  C  CA  . LEU B  2  225 ? -5.874  67.337  16.960  1.00 46.91 ? 225  LEU B CA  1 
ATOM   2704  C  C   . LEU B  2  225 ? -4.444  67.388  17.507  1.00 46.91 ? 225  LEU B C   1 
ATOM   2705  O  O   . LEU B  2  225 ? -3.678  66.435  17.364  1.00 46.91 ? 225  LEU B O   1 
ATOM   2706  C  CB  . LEU B  2  225 ? -6.377  65.888  16.925  1.00 46.91 ? 225  LEU B CB  1 
ATOM   2707  N  N   . TYR B  2  226 ? -4.124  68.489  18.185  1.00 46.91 ? 226  TYR B N   1 
ATOM   2708  C  CA  . TYR B  2  226 ? -2.800  68.714  18.768  1.00 46.91 ? 226  TYR B CA  1 
ATOM   2709  C  C   . TYR B  2  226 ? -1.741  68.976  17.692  1.00 46.91 ? 226  TYR B C   1 
ATOM   2710  O  O   . TYR B  2  226 ? -2.061  69.460  16.606  1.00 46.91 ? 226  TYR B O   1 
ATOM   2711  C  CB  . TYR B  2  226 ? -2.382  67.537  19.662  1.00 46.91 ? 226  TYR B CB  1 
ATOM   2712  N  N   . LYS B  2  227 ? -0.478  68.719  18.027  1.00 46.91 ? 227  LYS B N   1 
ATOM   2713  C  CA  . LYS B  2  227 ? 0.627   68.926  17.094  1.00 46.91 ? 227  LYS B CA  1 
ATOM   2714  C  C   . LYS B  2  227 ? 0.738   67.804  16.068  1.00 46.91 ? 227  LYS B C   1 
ATOM   2715  O  O   . LYS B  2  227 ? 1.127   68.038  14.922  1.00 46.91 ? 227  LYS B O   1 
ATOM   2716  C  CB  . LYS B  2  227 ? 1.950   69.062  17.854  1.00 46.91 ? 227  LYS B CB  1 
ATOM   2717  N  N   . ALA B  2  228 ? 0.414   66.586  16.490  1.00 46.91 ? 228  ALA B N   1 
ATOM   2718  C  CA  . ALA B  2  228 ? 0.480   65.421  15.613  1.00 46.91 ? 228  ALA B CA  1 
ATOM   2719  C  C   . ALA B  2  228 ? -0.478  64.330  16.083  1.00 46.91 ? 228  ALA B C   1 
ATOM   2720  O  O   . ALA B  2  228 ? -0.462  63.934  17.253  1.00 46.91 ? 228  ALA B O   1 
ATOM   2721  C  CB  . ALA B  2  228 ? 1.913   64.883  15.554  1.00 46.91 ? 228  ALA B CB  1 
ATOM   2722  N  N   . LEU B  2  229 ? -1.322  63.861  15.168  1.00 46.91 ? 229  LEU B N   1 
ATOM   2723  C  CA  . LEU B  2  229 ? -2.298  62.818  15.465  1.00 46.91 ? 229  LEU B CA  1 
ATOM   2724  C  C   . LEU B  2  229 ? -1.891  61.477  14.847  1.00 46.91 ? 229  LEU B C   1 
ATOM   2725  O  O   . LEU B  2  229 ? -0.723  61.087  14.904  1.00 46.91 ? 229  LEU B O   1 
ATOM   2726  C  CB  . LEU B  2  229 ? -3.687  63.237  14.964  1.00 46.91 ? 229  LEU B CB  1 
ATOM   2727  N  N   . ARG B  2  230 ? -2.861  60.763  14.281  1.00 46.91 ? 230  ARG B N   1 
ATOM   2728  C  CA  . ARG B  2  230 ? -2.600  59.471  13.650  1.00 46.91 ? 230  ARG B CA  1 
ATOM   2729  C  C   . ARG B  2  230 ? -2.985  59.512  12.172  1.00 46.91 ? 230  ARG B C   1 
ATOM   2730  O  O   . ARG B  2  230 ? -3.618  58.590  11.652  1.00 46.91 ? 230  ARG B O   1 
ATOM   2731  C  CB  . ARG B  2  230 ? -3.371  58.363  14.373  1.00 46.91 ? 230  ARG B CB  1 
ATOM   2732  N  N   . MET B  2  231 ? -2.616  60.604  11.511  1.00 46.91 ? 231  MET B N   1 
ATOM   2733  C  CA  . MET B  2  231 ? -2.912  60.791  10.098  1.00 46.91 ? 231  MET B CA  1 
ATOM   2734  C  C   . MET B  2  231 ? -1.652  60.699  9.239   1.00 46.91 ? 231  MET B C   1 
ATOM   2735  O  O   . MET B  2  231 ? -1.709  60.876  8.020   1.00 46.91 ? 231  MET B O   1 
ATOM   2736  C  CB  . MET B  2  231 ? -3.593  62.144  9.877   1.00 46.91 ? 231  MET B CB  1 
ATOM   2737  N  N   . GLY B  2  232 ? -0.517  60.431  9.879   1.00 46.91 ? 232  GLY B N   1 
ATOM   2738  C  CA  . GLY B  2  232 ? 0.739   60.323  9.158   1.00 46.91 ? 232  GLY B CA  1 
ATOM   2739  C  C   . GLY B  2  232 ? 1.481   59.032  9.447   1.00 46.91 ? 232  GLY B C   1 
ATOM   2740  O  O   . GLY B  2  232 ? 1.993   58.388  8.529   1.00 46.91 ? 232  GLY B O   1 
ATOM   2741  N  N   . ASN B  2  233 ? 1.560   58.666  10.722  1.00 46.91 ? 233  ASN B N   1 
ATOM   2742  C  CA  . ASN B  2  233 ? 2.249   57.447  11.134  1.00 46.91 ? 233  ASN B CA  1 
ATOM   2743  C  C   . ASN B  2  233 ? 1.297   56.441  11.775  1.00 46.91 ? 233  ASN B C   1 
ATOM   2744  O  O   . ASN B  2  233 ? 0.180   56.784  12.168  1.00 46.91 ? 233  ASN B O   1 
ATOM   2745  C  CB  . ASN B  2  233 ? 3.380   57.782  12.109  1.00 46.91 ? 233  ASN B CB  1 
ATOM   2746  N  N   . ILE B  2  234 ? 1.749   55.195  11.871  1.00 46.91 ? 234  ILE B N   1 
ATOM   2747  C  CA  . ILE B  2  234 ? 0.949   54.130  12.465  1.00 46.91 ? 234  ILE B CA  1 
ATOM   2748  C  C   . ILE B  2  234 ? 1.333   53.863  13.920  1.00 46.91 ? 234  ILE B C   1 
ATOM   2749  O  O   . ILE B  2  234 ? 0.716   53.030  14.586  1.00 46.91 ? 234  ILE B O   1 
ATOM   2750  C  CB  . ILE B  2  234 ? 1.086   52.819  11.665  1.00 46.91 ? 234  ILE B CB  1 
ATOM   2751  N  N   . GLU B  2  235 ? 2.364   54.553  14.401  1.00 46.91 ? 235  GLU B N   1 
ATOM   2752  C  CA  . GLU B  2  235 ? 2.828   54.391  15.776  1.00 46.91 ? 235  GLU B CA  1 
ATOM   2753  C  C   . GLU B  2  235 ? 1.870   55.022  16.783  1.00 46.91 ? 235  GLU B C   1 
ATOM   2754  O  O   . GLU B  2  235 ? 1.745   54.548  17.914  1.00 46.91 ? 235  GLU B O   1 
ATOM   2755  C  CB  . GLU B  2  235 ? 4.224   54.996  15.941  1.00 46.91 ? 235  GLU B CB  1 
ATOM   2756  N  N   . THR B  2  236 ? 1.220   56.108  16.375  1.00 46.91 ? 236  THR B N   1 
ATOM   2757  C  CA  . THR B  2  236 ? 0.272   56.814  17.230  1.00 46.91 ? 236  THR B CA  1 
ATOM   2758  C  C   . THR B  2  236 ? -0.957  55.954  17.517  1.00 46.91 ? 236  THR B C   1 
ATOM   2759  O  O   . THR B  2  236 ? -1.531  56.013  18.608  1.00 46.91 ? 236  THR B O   1 
ATOM   2760  C  CB  . THR B  2  236 ? -0.186  58.134  16.583  1.00 46.91 ? 236  THR B CB  1 
ATOM   2761  N  N   . VAL B  2  237 ? -1.372  55.184  16.515  1.00 46.91 ? 237  VAL B N   1 
ATOM   2762  C  CA  . VAL B  2  237 ? -2.526  54.301  16.640  1.00 46.91 ? 237  VAL B CA  1 
ATOM   2763  C  C   . VAL B  2  237 ? -2.176  53.078  17.484  1.00 46.91 ? 237  VAL B C   1 
ATOM   2764  O  O   . VAL B  2  237 ? -3.019  52.557  18.218  1.00 46.91 ? 237  VAL B O   1 
ATOM   2765  C  CB  . VAL B  2  237 ? -3.017  53.828  15.258  1.00 46.91 ? 237  VAL B CB  1 
ATOM   2766  N  N   . LEU B  2  238 ? -0.935  52.617  17.355  1.00 46.91 ? 238  LEU B N   1 
ATOM   2767  C  CA  . LEU B  2  238 ? -0.452  51.458  18.099  1.00 46.91 ? 238  LEU B CA  1 
ATOM   2768  C  C   . LEU B  2  238 ? -0.338  51.760  19.590  1.00 46.91 ? 238  LEU B C   1 
ATOM   2769  O  O   . LEU B  2  238 ? -0.552  50.880  20.427  1.00 46.91 ? 238  LEU B O   1 
ATOM   2770  C  CB  . LEU B  2  238 ? 0.906   51.010  17.554  1.00 46.91 ? 238  LEU B CB  1 
ATOM   2771  N  N   . SER B  2  239 ? 0.018   53.001  19.911  1.00 46.91 ? 239  SER B N   1 
ATOM   2772  C  CA  . SER B  2  239 ? 0.163   53.436  21.296  1.00 46.91 ? 239  SER B CA  1 
ATOM   2773  C  C   . SER B  2  239 ? -1.196  53.563  21.983  1.00 46.91 ? 239  SER B C   1 
ATOM   2774  O  O   . SER B  2  239 ? -1.275  53.723  23.202  1.00 46.91 ? 239  SER B O   1 
ATOM   2775  C  CB  . SER B  2  239 ? 0.904   54.773  21.355  1.00 46.91 ? 239  SER B CB  1 
ATOM   2776  N  N   . SER B  2  240 ? -2.261  53.539  21.187  1.00 46.91 ? 240  SER B N   1 
ATOM   2777  C  CA  . SER B  2  240 ? -3.619  53.634  21.710  1.00 46.91 ? 240  SER B CA  1 
ATOM   2778  C  C   . SER B  2  240 ? -4.082  52.270  22.212  1.00 46.91 ? 240  SER B C   1 
ATOM   2779  O  O   . SER B  2  240 ? -5.088  52.164  22.917  1.00 46.91 ? 240  SER B O   1 
ATOM   2780  C  CB  . SER B  2  240 ? -4.570  54.141  20.625  1.00 46.91 ? 240  SER B CB  1 
ATOM   2781  N  N   . SER B  2  241 ? -3.367  51.227  21.803  1.00 46.91 ? 241  SER B N   1 
ATOM   2782  C  CA  . SER B  2  241 ? -3.678  49.861  22.205  1.00 46.91 ? 241  SER B CA  1 
ATOM   2783  C  C   . SER B  2  241 ? -2.908  49.472  23.463  1.00 46.91 ? 241  SER B C   1 
ATOM   2784  O  O   . SER B  2  241 ? -3.278  48.524  24.158  1.00 46.91 ? 241  SER B O   1 
ATOM   2785  C  CB  . SER B  2  241 ? -3.342  48.889  21.074  1.00 46.91 ? 241  SER B CB  1 
ATOM   2786  N  N   . ILE B  2  242 ? -1.807  50.177  23.717  1.00 46.91 ? 242  ILE B N   1 
ATOM   2787  C  CA  . ILE B  2  242 ? -0.974  49.924  24.887  1.00 46.91 ? 242  ILE B CA  1 
ATOM   2788  C  C   . ILE B  2  242 ? -1.613  50.517  26.139  1.00 46.91 ? 242  ILE B C   1 
ATOM   2789  O  O   . ILE B  2  242 ? -1.502  49.958  27.229  1.00 46.91 ? 242  ILE B O   1 
ATOM   2790  C  CB  . ILE B  2  242 ? 0.433   50.527  24.713  1.00 46.91 ? 242  ILE B CB  1 
ATOM   2791  N  N   . ALA B  2  243 ? -2.259  51.669  25.974  1.00 46.91 ? 243  ALA B N   1 
ATOM   2792  C  CA  . ALA B  2  243 ? -2.927  52.348  27.079  1.00 46.91 ? 243  ALA B CA  1 
ATOM   2793  C  C   . ALA B  2  243 ? -4.208  51.613  27.466  1.00 46.91 ? 243  ALA B C   1 
ATOM   2794  O  O   . ALA B  2  243 ? -4.754  51.827  28.551  1.00 46.91 ? 243  ALA B O   1 
ATOM   2795  C  CB  . ALA B  2  243 ? -3.239  53.787  26.697  1.00 46.91 ? 243  ALA B CB  1 
ATOM   2796  N  N   . ALA B  2  244 ? -4.710  50.794  26.547  1.00 46.91 ? 244  ALA B N   1 
ATOM   2797  C  CA  . ALA B  2  244 ? -5.923  50.016  26.775  1.00 46.91 ? 244  ALA B CA  1 
ATOM   2798  C  C   . ALA B  2  244 ? -5.601  48.700  27.476  1.00 46.91 ? 244  ALA B C   1 
ATOM   2799  O  O   . ALA B  2  244 ? -6.498  48.014  27.972  1.00 46.91 ? 244  ALA B O   1 
ATOM   2800  C  CB  . ALA B  2  244 ? -6.632  49.752  25.455  1.00 46.91 ? 244  ALA B CB  1 
ATOM   2801  N  N   . VAL B  2  245 ? -4.323  48.328  27.468  1.00 46.91 ? 245  VAL B N   1 
ATOM   2802  C  CA  . VAL B  2  245 ? -3.868  47.098  28.106  1.00 46.91 ? 245  VAL B CA  1 
ATOM   2803  C  C   . VAL B  2  245 ? -3.605  47.318  29.593  1.00 46.91 ? 245  VAL B C   1 
ATOM   2804  O  O   . VAL B  2  245 ? -3.613  46.370  30.380  1.00 46.91 ? 245  VAL B O   1 
ATOM   2805  C  CB  . VAL B  2  245 ? -2.582  46.567  27.445  1.00 46.91 ? 245  VAL B CB  1 
ATOM   2806  N  N   . PHE B  2  246 ? -3.347  48.569  29.964  1.00 46.91 ? 246  PHE B N   1 
ATOM   2807  C  CA  . PHE B  2  246 ? -3.077  48.933  31.351  1.00 46.91 ? 246  PHE B CA  1 
ATOM   2808  C  C   . PHE B  2  246 ? -4.365  49.105  32.153  1.00 46.91 ? 246  PHE B C   1 
ATOM   2809  O  O   . PHE B  2  246 ? -4.339  49.153  33.385  1.00 46.91 ? 246  PHE B O   1 
ATOM   2810  C  CB  . PHE B  2  246 ? -2.261  50.227  31.407  1.00 46.91 ? 246  PHE B CB  1 
ATOM   2811  N  N   . PHE B  2  247 ? -5.482  49.250  31.446  1.00 46.91 ? 247  PHE B N   1 
ATOM   2812  C  CA  . PHE B  2  247 ? -6.783  49.421  32.082  1.00 46.91 ? 247  PHE B CA  1 
ATOM   2813  C  C   . PHE B  2  247 ? -7.600  48.132  32.040  1.00 46.91 ? 247  PHE B C   1 
ATOM   2814  O  O   . PHE B  2  247 ? -8.613  48.005  32.733  1.00 46.91 ? 247  PHE B O   1 
ATOM   2815  C  CB  . PHE B  2  247 ? -7.559  50.551  31.401  1.00 46.91 ? 247  PHE B CB  1 
ATOM   2816  N  N   . ALA B  2  248 ? -7.180  47.198  31.192  1.00 46.91 ? 248  ALA B N   1 
ATOM   2817  C  CA  . ALA B  2  248 ? -7.862  45.917  31.050  1.00 46.91 ? 248  ALA B CA  1 
ATOM   2818  C  C   . ALA B  2  248 ? -7.218  44.843  31.921  1.00 46.91 ? 248  ALA B C   1 
ATOM   2819  O  O   . ALA B  2  248 ? -7.873  43.871  32.304  1.00 46.91 ? 248  ALA B O   1 
ATOM   2820  C  CB  . ALA B  2  248 ? -7.862  45.483  29.591  1.00 46.91 ? 248  ALA B CB  1 
ATOM   2821  N  N   . ALA B  2  249 ? -5.927  45.002  32.192  1.00 46.91 ? 249  ALA B N   1 
ATOM   2822  C  CA  . ALA B  2  249 ? -5.184  44.053  33.014  1.00 46.91 ? 249  ALA B CA  1 
ATOM   2823  C  C   . ALA B  2  249 ? -5.328  44.372  34.499  1.00 46.91 ? 249  ALA B C   1 
ATOM   2824  O  O   . ALA B  2  249 ? -5.368  43.468  35.333  1.00 46.91 ? 249  ALA B O   1 
ATOM   2825  C  CB  . ALA B  2  249 ? -3.716  44.049  32.616  1.00 46.91 ? 249  ALA B CB  1 
ATOM   2826  N  N   . PHE B  2  250 ? -5.378  45.662  34.822  1.00 46.91 ? 250  PHE B N   1 
ATOM   2827  C  CA  . PHE B  2  250 ? -5.519  46.111  36.204  1.00 46.91 ? 250  PHE B CA  1 
ATOM   2828  C  C   . PHE B  2  250 ? -6.916  45.807  36.743  1.00 46.91 ? 250  PHE B C   1 
ATOM   2829  O  O   . PHE B  2  250 ? -7.113  45.704  37.956  1.00 46.91 ? 250  PHE B O   1 
ATOM   2830  C  CB  . PHE B  2  250 ? -5.237  47.611  36.307  1.00 46.91 ? 250  PHE B CB  1 
ATOM   2831  N  N   . VAL B  2  251 ? -7.886  45.719  35.836  1.00 46.91 ? 251  VAL B N   1 
ATOM   2832  C  CA  . VAL B  2  251 ? -9.266  45.425  36.203  1.00 46.91 ? 251  VAL B CA  1 
ATOM   2833  C  C   . VAL B  2  251 ? -9.492  43.918  36.297  1.00 46.91 ? 251  VAL B C   1 
ATOM   2834  O  O   . VAL B  2  251 ? -10.350 43.455  37.052  1.00 46.91 ? 251  VAL B O   1 
ATOM   2835  C  CB  . VAL B  2  251 ? -10.252 46.010  35.175  1.00 46.91 ? 251  VAL B CB  1 
ATOM   2836  N  N   . VAL B  2  252 ? -8.745  43.164  35.495  1.00 46.91 ? 252  VAL B N   1 
ATOM   2837  C  CA  . VAL B  2  252 ? -8.847  41.709  35.476  1.00 46.91 ? 252  VAL B CA  1 
ATOM   2838  C  C   . VAL B  2  252 ? -8.219  41.100  36.726  1.00 46.91 ? 252  VAL B C   1 
ATOM   2839  O  O   . VAL B  2  252 ? -8.772  40.170  37.317  1.00 46.91 ? 252  VAL B O   1 
ATOM   2840  C  CB  . VAL B  2  252 ? -8.160  41.115  34.232  1.00 46.91 ? 252  VAL B CB  1 
ATOM   2841  N  N   . ALA B  2  253 ? -7.049  41.610  37.100  1.00 46.91 ? 253  ALA B N   1 
ATOM   2842  C  CA  . ALA B  2  253 ? -6.331  41.133  38.277  1.00 46.91 ? 253  ALA B CA  1 
ATOM   2843  C  C   . ALA B  2  253 ? -7.022  41.598  39.556  1.00 46.91 ? 253  ALA B C   1 
ATOM   2844  O  O   . ALA B  2  253 ? -6.968  40.918  40.583  1.00 46.91 ? 253  ALA B O   1 
ATOM   2845  C  CB  . ALA B  2  253 ? -4.890  41.624  38.246  1.00 46.91 ? 253  ALA B CB  1 
ATOM   2846  N  N   . GLY B  2  254 ? -7.649  42.769  39.490  1.00 46.91 ? 254  GLY B N   1 
ATOM   2847  C  CA  . GLY B  2  254 ? -8.350  43.307  40.643  1.00 46.91 ? 254  GLY B CA  1 
ATOM   2848  C  C   . GLY B  2  254 ? -9.668  42.600  40.906  1.00 46.91 ? 254  GLY B C   1 
ATOM   2849  O  O   . GLY B  2  254 ? -10.343 42.878  41.900  1.00 46.91 ? 254  GLY B O   1 
ATOM   2850  N  N   . THR B  2  255 ? -10.053 41.715  39.991  1.00 46.91 ? 255  THR B N   1 
ATOM   2851  C  CA  . THR B  2  255 ? -11.294 40.959  40.117  1.00 46.91 ? 255  THR B CA  1 
ATOM   2852  C  C   . THR B  2  255 ? -11.152 39.851  41.157  1.00 46.91 ? 255  THR B C   1 
ATOM   2853  O  O   . THR B  2  255 ? -12.109 39.526  41.863  1.00 46.91 ? 255  THR B O   1 
ATOM   2854  C  CB  . THR B  2  255 ? -11.704 40.334  38.772  1.00 46.91 ? 255  THR B CB  1 
ATOM   2855  N  N   . MET B  2  256 ? -9.960  39.265  41.232  1.00 46.91 ? 256  MET B N   1 
ATOM   2856  C  CA  . MET B  2  256 ? -9.675  38.192  42.181  1.00 46.91 ? 256  MET B CA  1 
ATOM   2857  C  C   . MET B  2  256 ? -9.764  38.688  43.623  1.00 46.91 ? 256  MET B C   1 
ATOM   2858  O  O   . MET B  2  256 ? -10.097 37.923  44.532  1.00 46.91 ? 256  MET B O   1 
ATOM   2859  C  CB  . MET B  2  256 ? -8.285  37.604  41.920  1.00 46.91 ? 256  MET B CB  1 
ATOM   2860  N  N   . TRP B  2  257 ? -9.462  39.970  43.818  1.00 46.91 ? 257  TRP B N   1 
ATOM   2861  C  CA  . TRP B  2  257 ? -9.500  40.617  45.131  1.00 46.91 ? 257  TRP B CA  1 
ATOM   2862  C  C   . TRP B  2  257 ? -8.459  40.075  46.114  1.00 46.91 ? 257  TRP B C   1 
ATOM   2863  O  O   . TRP B  2  257 ? -8.571  40.274  47.330  1.00 46.91 ? 257  TRP B O   1 
ATOM   2864  C  CB  . TRP B  2  257 ? -10.907 40.526  45.736  1.00 46.91 ? 257  TRP B CB  1 
ATOM   2865  N  N   . TYR B  2  258 ? -7.434  39.420  45.572  1.00 46.91 ? 258  TYR B N   1 
ATOM   2866  C  CA  . TYR B  2  258 ? -6.349  38.845  46.364  1.00 46.91 ? 258  TYR B CA  1 
ATOM   2867  C  C   . TYR B  2  258 ? -5.221  38.396  45.438  1.00 46.91 ? 258  TYR B C   1 
ATOM   2868  O  O   . TYR B  2  258 ? -4.090  38.237  45.946  1.00 46.91 ? 258  TYR B O   1 
ATOM   2869  C  CB  . TYR B  2  258 ? -6.851  37.650  47.182  1.00 46.91 ? 258  TYR B CB  1 
ATOM   2870  C  CA  . UNK B  2  259 ? -10.853 32.272  46.629  1.00 46.91 ? 1001 UNK B CA  1 
ATOM   2871  C  CA  . UNK B  2  260 ? -10.010 35.041  49.076  1.00 46.91 ? 1002 UNK B CA  1 
ATOM   2872  C  CA  . UNK B  2  261 ? -6.661  35.371  50.792  1.00 46.91 ? 1003 UNK B CA  1 
ATOM   2873  C  CA  . UNK B  2  262 ? -7.711  38.270  52.973  1.00 46.91 ? 1004 UNK B CA  1 
ATOM   2874  C  CA  . UNK B  2  263 ? -11.439 37.617  52.988  1.00 46.91 ? 1005 UNK B CA  1 
ATOM   2875  C  CA  . UNK B  2  264 ? -10.808 33.975  53.910  1.00 46.91 ? 1006 UNK B CA  1 
ATOM   2876  C  CA  . UNK B  2  265 ? -8.311  34.920  56.610  1.00 46.91 ? 1007 UNK B CA  1 
ATOM   2877  C  CA  . UNK B  2  266 ? -10.841 37.278  58.148  1.00 46.91 ? 1008 UNK B CA  1 
ATOM   2878  C  CA  . UNK B  2  267 ? -14.022 35.366  59.021  1.00 46.91 ? 1009 UNK B CA  1 
ATOM   2879  C  CA  . UNK B  2  268 ? -15.855 34.032  55.971  1.00 46.91 ? 1010 UNK B CA  1 
ATOM   2880  C  CA  . UNK B  2  269 ? -15.282 30.413  57.036  1.00 46.91 ? 1011 UNK B CA  1 
ATOM   2881  C  CA  . UNK B  2  270 ? -15.303 30.811  60.802  1.00 46.91 ? 1012 UNK B CA  1 
ATOM   2882  C  CA  . UNK B  2  271 ? -18.509 32.883  60.978  1.00 46.91 ? 1013 UNK B CA  1 
ATOM   2883  C  CA  . UNK B  2  272 ? -20.363 30.477  58.735  1.00 46.91 ? 1014 UNK B CA  1 
ATOM   2884  C  CA  . UNK B  2  273 ? -19.097 27.305  60.326  1.00 46.91 ? 1015 UNK B CA  1 
ATOM   2885  C  CA  . UNK B  2  274 ? -19.591 28.349  63.893  1.00 46.91 ? 1016 UNK B CA  1 
ATOM   2886  C  CA  . UNK B  2  275 ? -22.961 30.058  63.181  1.00 46.91 ? 1017 UNK B CA  1 
ATOM   2887  C  CA  . UNK B  2  276 ? -24.130 26.891  61.467  1.00 46.91 ? 1018 UNK B CA  1 
ATOM   2888  C  CA  . UNK B  2  277 ? -23.324 24.755  64.525  1.00 46.91 ? 1019 UNK B CA  1 
ATOM   2889  C  CA  . UNK B  2  278 ? -25.020 27.411  66.659  1.00 46.91 ? 1020 UNK B CA  1 
ATOM   2890  C  CA  . UNK B  2  279 ? -28.380 27.275  64.825  1.00 46.91 ? 1021 UNK B CA  1 
ATOM   2891  C  CA  . UNK B  2  280 ? -28.163 23.474  64.772  1.00 46.91 ? 1022 UNK B CA  1 
ATOM   2892  C  CA  . UNK B  2  281 ? -28.375 22.964  68.536  1.00 46.91 ? 1023 UNK B CA  1 
ATOM   2893  C  CA  . UNK B  2  282 ? -29.794 19.482  68.113  1.00 46.91 ? 1024 UNK B CA  1 
ATOM   2894  C  CA  . UNK B  2  283 ? -27.440 16.507  69.456  1.00 46.91 ? 1025 UNK B CA  1 
ATOM   2895  C  CA  . UNK B  2  284 ? -24.050 18.162  69.810  1.00 46.91 ? 1026 UNK B CA  1 
ATOM   2896  C  CA  . UNK B  2  285 ? -21.222 16.206  68.256  1.00 46.91 ? 1027 UNK B CA  1 
ATOM   2897  C  CA  . UNK B  2  286 ? -22.825 15.259  64.964  1.00 46.91 ? 1028 UNK B CA  1 
ATOM   2898  C  CA  . UNK B  2  287 ? -24.503 18.461  63.829  1.00 46.91 ? 1029 UNK B CA  1 
ATOM   2899  C  CA  . UNK B  2  288 ? -20.882 19.479  63.198  1.00 46.91 ? 1030 UNK B CA  1 
ATOM   2900  C  CA  . UNK B  2  289 ? -20.546 16.457  60.900  1.00 46.91 ? 1031 UNK B CA  1 
ATOM   2901  C  CA  . UNK B  2  290 ? -23.415 17.425  58.608  1.00 46.91 ? 1032 UNK B CA  1 
ATOM   2902  C  CA  . UNK B  2  291 ? -22.278 21.072  58.479  1.00 59.97 ? 1033 UNK B CA  1 
ATOM   2903  C  CA  . UNK B  2  292 ? -18.750 20.159  57.363  1.00 46.91 ? 1034 UNK B CA  1 
ATOM   2904  C  CA  . UNK B  2  293 ? -20.554 18.973  54.218  1.00 46.91 ? 1035 UNK B CA  1 
ATOM   2905  C  CA  . UNK B  2  294 ? -20.017 22.509  52.987  1.00 46.91 ? 1036 UNK B CA  1 
ATOM   2906  C  CA  . UNK B  2  295 ? -17.933 24.281  55.647  1.00 46.91 ? 1037 UNK B CA  1 
ATOM   2907  C  CA  . UNK B  2  296 ? -15.403 21.525  55.188  1.00 46.91 ? 1038 UNK B CA  1 
ATOM   2908  C  CA  . UNK B  2  297 ? -15.198 21.811  51.450  1.00 46.91 ? 1039 UNK B CA  1 
ATOM   2909  C  CA  . UNK B  2  298 ? -13.667 25.216  51.326  1.00 46.91 ? 1040 UNK B CA  1 
ATOM   2910  C  CA  . UNK B  2  299 ? -10.898 24.077  53.723  1.00 46.91 ? 1041 UNK B CA  1 
ATOM   2911  C  CA  . UNK B  2  300 ? -9.126  26.986  55.346  1.00 46.91 ? 1042 UNK B CA  1 
ATOM   2912  C  CA  . UNK B  2  301 ? -5.859  25.052  55.055  1.00 46.91 ? 1043 UNK B CA  1 
ATOM   2913  C  CA  . UNK B  2  302 ? -5.768  26.312  51.484  1.00 46.91 ? 1044 UNK B CA  1 
ATOM   2914  C  CA  . UNK B  2  303 ? -6.386  30.065  51.223  1.00 46.91 ? 1045 UNK B CA  1 
ATOM   2915  C  CA  . UNK B  2  304 ? -4.600  32.526  48.974  1.00 46.91 ? 1046 UNK B CA  1 
ATOM   2916  C  CA  . UNK B  2  305 ? -0.868  33.059  49.320  1.00 46.91 ? 1047 UNK B CA  1 
ATOM   2917  C  CA  . UNK B  2  306 ? 1.181   31.622  52.155  1.00 46.91 ? 1048 UNK B CA  1 
ATOM   2918  N  N   . UNK B  2  307 ? -1.707  21.291  38.776  1.00 46.91 ? 1049 UNK B N   1 
ATOM   2919  C  CA  . UNK B  2  307 ? -2.442  21.478  40.062  1.00 46.91 ? 1049 UNK B CA  1 
ATOM   2920  C  C   . UNK B  2  307 ? -1.829  22.616  40.875  1.00 46.91 ? 1049 UNK B C   1 
ATOM   2921  O  O   . UNK B  2  307 ? -2.533  23.537  41.297  1.00 46.91 ? 1049 UNK B O   1 
ATOM   2922  C  CB  . UNK B  2  307 ? -2.420  20.185  40.866  1.00 46.91 ? 1049 UNK B CB  1 
ATOM   2923  N  N   . UNK B  2  308 ? -0.514  22.549  41.071  1.00 46.91 ? 1050 UNK B N   1 
ATOM   2924  C  CA  . UNK B  2  308 ? 0.245   23.550  41.821  1.00 46.91 ? 1050 UNK B CA  1 
ATOM   2925  C  C   . UNK B  2  308 ? -0.149  23.667  43.295  1.00 46.91 ? 1050 UNK B C   1 
ATOM   2926  O  O   . UNK B  2  308 ? 0.605   23.252  44.173  1.00 46.91 ? 1050 UNK B O   1 
ATOM   2927  C  CB  . UNK B  2  308 ? 0.166   24.913  41.132  1.00 46.91 ? 1050 UNK B CB  1 
ATOM   2928  N  N   . UNK B  2  309 ? -1.313  24.255  43.559  1.00 46.91 ? 1051 UNK B N   1 
ATOM   2929  C  CA  . UNK B  2  309 ? -1.803  24.437  44.925  1.00 46.91 ? 1051 UNK B CA  1 
ATOM   2930  C  C   . UNK B  2  309 ? -2.195  23.128  45.609  1.00 46.91 ? 1051 UNK B C   1 
ATOM   2931  O  O   . UNK B  2  309 ? -2.374  23.090  46.828  1.00 46.91 ? 1051 UNK B O   1 
ATOM   2932  C  CB  . UNK B  2  309 ? -2.978  25.405  44.934  1.00 46.91 ? 1051 UNK B CB  1 
ATOM   2933  N  N   . UNK B  2  310 ? -2.388  22.078  44.816  1.00 46.91 ? 1052 UNK B N   1 
ATOM   2934  C  CA  . UNK B  2  310 ? -2.757  20.770  45.347  1.00 46.91 ? 1052 UNK B CA  1 
ATOM   2935  C  C   . UNK B  2  310 ? -1.522  19.983  45.776  1.00 46.91 ? 1052 UNK B C   1 
ATOM   2936  O  O   . UNK B  2  310 ? -1.487  19.418  46.866  1.00 46.91 ? 1052 UNK B O   1 
ATOM   2937  C  CB  . UNK B  2  310 ? -3.554  19.987  44.319  1.00 46.91 ? 1052 UNK B CB  1 
ATOM   2938  N  N   . UNK B  2  311 ? -0.527  19.931  44.894  1.00 46.91 ? 1053 UNK B N   1 
ATOM   2939  C  CA  . UNK B  2  311 ? 0.717   19.216  45.166  1.00 46.91 ? 1053 UNK B CA  1 
ATOM   2940  C  C   . UNK B  2  311 ? 1.491   19.857  46.317  1.00 46.91 ? 1053 UNK B C   1 
ATOM   2941  O  O   . UNK B  2  311 ? 2.253   19.185  47.016  1.00 46.91 ? 1053 UNK B O   1 
ATOM   2942  C  CB  . UNK B  2  311 ? 1.578   19.168  43.911  1.00 46.91 ? 1053 UNK B CB  1 
ATOM   2943  N  N   . UNK B  2  312 ? 1.318   21.166  46.478  1.00 46.91 ? 1054 UNK B N   1 
ATOM   2944  C  CA  . UNK B  2  312 ? 1.982   21.916  47.541  1.00 46.91 ? 1054 UNK B CA  1 
ATOM   2945  C  C   . UNK B  2  312 ? 1.292   21.697  48.890  1.00 46.91 ? 1054 UNK B C   1 
ATOM   2946  O  O   . UNK B  2  312 ? 1.839   22.039  49.940  1.00 46.91 ? 1054 UNK B O   1 
ATOM   2947  C  CB  . UNK B  2  312 ? 2.002   23.400  47.195  1.00 46.91 ? 1054 UNK B CB  1 
ATOM   2948  N  N   . UNK B  2  313 ? 0.078   21.156  48.850  1.00 46.91 ? 1055 UNK B N   1 
ATOM   2949  C  CA  . UNK B  2  313 ? -0.689  20.881  50.060  1.00 46.91 ? 1055 UNK B CA  1 
ATOM   2950  C  C   . UNK B  2  313 ? -0.999  19.388  50.173  1.00 46.91 ? 1055 UNK B C   1 
ATOM   2951  O  O   . UNK B  2  313 ? -2.065  18.999  50.665  1.00 46.91 ? 1055 UNK B O   1 
ATOM   2952  C  CB  . UNK B  2  313 ? -1.971  21.700  50.078  1.00 46.91 ? 1055 UNK B CB  1 
ATOM   2953  N  N   . UNK B  2  314 ? -0.046  18.562  49.745  1.00 46.91 ? 1056 UNK B N   1 
ATOM   2954  C  CA  . UNK B  2  314 ? -0.181  17.106  49.779  1.00 46.91 ? 1056 UNK B CA  1 
ATOM   2955  C  C   . UNK B  2  314 ? -1.309  16.596  48.877  1.00 46.91 ? 1056 UNK B C   1 
ATOM   2956  O  O   . UNK B  2  314 ? -1.107  16.398  47.675  1.00 46.91 ? 1056 UNK B O   1 
ATOM   2957  C  CB  . UNK B  2  314 ? -0.363  16.616  51.214  1.00 46.91 ? 1056 UNK B CB  1 
ATOM   2958  N  N   . UNK B  2  315 ? -2.480  16.357  49.459  1.00 46.91 ? 1057 UNK B N   1 
ATOM   2959  C  CA  . UNK B  2  315 ? -3.632  15.871  48.702  1.00 46.91 ? 1057 UNK B CA  1 
ATOM   2960  C  C   . UNK B  2  315 ? -4.945  16.128  49.449  1.00 46.91 ? 1057 UNK B C   1 
ATOM   2961  O  O   . UNK B  2  315 ? -5.289  17.281  49.724  1.00 46.91 ? 1057 UNK B O   1 
ATOM   2962  C  CB  . UNK B  2  315 ? -3.470  14.383  48.383  1.00 46.91 ? 1057 UNK B CB  1 
ATOM   2963  N  N   . UNK B  2  316 ? -5.680  15.061  49.757  1.00 46.91 ? 1058 UNK B N   1 
ATOM   2964  C  CA  . UNK B  2  316 ? -6.950  15.175  50.468  1.00 46.91 ? 1058 UNK B CA  1 
ATOM   2965  C  C   . UNK B  2  316 ? -7.353  13.848  51.102  1.00 46.91 ? 1058 UNK B C   1 
ATOM   2966  O  O   . UNK B  2  316 ? -6.865  12.786  50.708  1.00 46.91 ? 1058 UNK B O   1 
ATOM   2967  C  CB  . UNK B  2  316 ? -8.047  15.658  49.527  1.00 46.91 ? 1058 UNK B CB  1 
ATOM   2968  N  N   . UNK B  2  317 ? -8.276  13.915  52.057  1.00 46.91 ? 1059 UNK B N   1 
ATOM   2969  C  CA  . UNK B  2  317 ? -8.757  12.729  52.758  1.00 46.91 ? 1059 UNK B CA  1 
ATOM   2970  C  C   . UNK B  2  317 ? -10.155 12.946  53.327  1.00 46.91 ? 1059 UNK B C   1 
ATOM   2971  O  O   . UNK B  2  317 ? -11.149 12.543  52.716  1.00 46.91 ? 1059 UNK B O   1 
ATOM   2972  C  CB  . UNK B  2  317 ? -7.785  12.350  53.869  1.00 46.91 ? 1059 UNK B CB  1 
ATOM   2973  N  N   . UNK B  2  318 ? -10.223 13.560  54.506  1.00 46.91 ? 1060 UNK B N   1 
ATOM   2974  C  CA  . UNK B  2  318 ? -11.495 13.835  55.169  1.00 46.91 ? 1060 UNK B CA  1 
ATOM   2975  C  C   . UNK B  2  318 ? -11.327 14.807  56.341  1.00 46.91 ? 1060 UNK B C   1 
ATOM   2976  O  O   . UNK B  2  318 ? -10.556 15.764  56.252  1.00 46.91 ? 1060 UNK B O   1 
ATOM   2977  C  CB  . UNK B  2  318 ? -12.131 12.526  55.645  1.00 46.91 ? 1060 UNK B CB  1 
ATOM   2978  N  N   . UNK B  2  319 ? -12.061 14.551  57.424  1.00 46.91 ? 1061 UNK B N   1 
ATOM   2979  C  CA  . UNK B  2  319 ? -12.031 15.372  58.638  1.00 46.91 ? 1061 UNK B CA  1 
ATOM   2980  C  C   . UNK B  2  319 ? -12.701 16.736  58.476  1.00 46.91 ? 1061 UNK B C   1 
ATOM   2981  O  O   . UNK B  2  319 ? -13.076 17.131  57.368  1.00 46.91 ? 1061 UNK B O   1 
ATOM   2982  C  CB  . UNK B  2  319 ? -10.600 15.533  59.148  1.00 46.91 ? 1061 UNK B CB  1 
ATOM   2983  N  N   . UNK B  2  320 ? -12.897 17.426  59.597  1.00 46.91 ? 1062 UNK B N   1 
ATOM   2984  C  CA  . UNK B  2  320 ? -13.527 18.744  59.604  1.00 46.91 ? 1062 UNK B CA  1 
ATOM   2985  C  C   . UNK B  2  320 ? -13.536 19.348  61.011  1.00 46.91 ? 1062 UNK B C   1 
ATOM   2986  O  O   . UNK B  2  320 ? -12.514 19.359  61.697  1.00 46.91 ? 1062 UNK B O   1 
ATOM   2987  C  CB  . UNK B  2  320 ? -14.955 18.648  59.056  1.00 46.91 ? 1062 UNK B CB  1 
ATOM   2988  N  N   . UNK B  2  321 ? -14.701 19.846  61.425  1.00 46.91 ? 1063 UNK B N   1 
ATOM   2989  C  CA  . UNK B  2  321 ? -14.894 20.461  62.738  1.00 46.91 ? 1063 UNK B CA  1 
ATOM   2990  C  C   . UNK B  2  321 ? -14.094 21.746  62.946  1.00 46.91 ? 1063 UNK B C   1 
ATOM   2991  O  O   . UNK B  2  321 ? -13.748 22.440  61.984  1.00 46.91 ? 1063 UNK B O   1 
ATOM   2992  C  CB  . UNK B  2  321 ? -14.589 19.450  63.850  1.00 46.91 ? 1063 UNK B CB  1 
ATOM   2993  N  N   . UNK B  2  322 ? -13.876 22.091  64.211  1.00 46.91 ? 1064 UNK B N   1 
ATOM   2994  C  CA  . UNK B  2  322 ? -13.129 23.285  64.578  1.00 46.91 ? 1064 UNK B CA  1 
ATOM   2995  C  C   . UNK B  2  322 ? -12.312 23.020  65.841  1.00 46.91 ? 1064 UNK B C   1 
ATOM   2996  O  O   . UNK B  2  322 ? -12.471 23.705  66.855  1.00 46.91 ? 1064 UNK B O   1 
ATOM   2997  C  CB  . UNK B  2  322 ? -14.087 24.457  64.797  1.00 46.91 ? 1064 UNK B CB  1 
ATOM   2998  N  N   . UNK B  2  323 ? -11.449 22.010  65.764  1.00 46.91 ? 1065 UNK B N   1 
ATOM   2999  C  CA  . UNK B  2  323 ? -10.582 21.611  66.870  1.00 46.91 ? 1065 UNK B CA  1 
ATOM   3000  C  C   . UNK B  2  323 ? -11.359 21.259  68.141  1.00 46.91 ? 1065 UNK B C   1 
ATOM   3001  O  O   . UNK B  2  323 ? -12.563 20.995  68.096  1.00 46.91 ? 1065 UNK B O   1 
ATOM   3002  C  CB  . UNK B  2  323 ? -9.550  22.702  67.156  1.00 46.91 ? 1065 UNK B CB  1 
ATOM   3003  N  N   . UNK B  2  324 ? -10.652 21.233  69.267  1.00 46.91 ? 1066 UNK B N   1 
ATOM   3004  C  CA  . UNK B  2  324 ? -11.252 20.915  70.558  1.00 46.91 ? 1066 UNK B CA  1 
ATOM   3005  C  C   . UNK B  2  324 ? -10.436 21.523  71.694  1.00 46.91 ? 1066 UNK B C   1 
ATOM   3006  O  O   . UNK B  2  324 ? -9.409  22.163  71.460  1.00 46.91 ? 1066 UNK B O   1 
ATOM   3007  C  CB  . UNK B  2  324 ? -11.354 19.406  70.732  1.00 46.91 ? 1066 UNK B CB  1 
ATOM   3008  N  N   . UNK B  2  325 ? -10.898 21.321  72.924  1.00 46.91 ? 1067 UNK B N   1 
ATOM   3009  C  CA  . UNK B  2  325 ? -10.213 21.850  74.097  1.00 46.91 ? 1067 UNK B CA  1 
ATOM   3010  C  C   . UNK B  2  325 ? -10.276 20.884  75.277  1.00 46.91 ? 1067 UNK B C   1 
ATOM   3011  O  O   . UNK B  2  325 ? -11.079 19.947  75.289  1.00 46.91 ? 1067 UNK B O   1 
ATOM   3012  C  CB  . UNK B  2  325 ? -10.804 23.199  74.486  1.00 46.91 ? 1067 UNK B CB  1 
ATOM   3013  N  N   . UNK B  2  326 ? -9.419  21.119  76.267  1.00 46.91 ? 1068 UNK B N   1 
ATOM   3014  C  CA  . UNK B  2  326 ? -9.355  20.281  77.458  1.00 46.91 ? 1068 UNK B CA  1 
ATOM   3015  C  C   . UNK B  2  326 ? -10.245 20.806  78.584  1.00 46.91 ? 1068 UNK B C   1 
ATOM   3016  O  O   . UNK B  2  326 ? -11.354 20.310  78.798  1.00 46.91 ? 1068 UNK B O   1 
ATOM   3017  C  CB  . UNK B  2  326 ? -7.914  20.165  77.936  1.00 46.91 ? 1068 UNK B CB  1 
ATOM   3018  N  N   . UNK B  2  327 ? -9.725  21.771  79.336  1.00 46.91 ? 1069 UNK B N   1 
ATOM   3019  C  CA  . UNK B  2  327 ? -10.459 22.369  80.443  1.00 46.91 ? 1069 UNK B CA  1 
ATOM   3020  C  C   . UNK B  2  327 ? -11.208 23.608  79.971  1.00 46.91 ? 1069 UNK B C   1 
ATOM   3021  O  O   . UNK B  2  327 ? -10.593 24.614  79.612  1.00 46.91 ? 1069 UNK B O   1 
ATOM   3022  C  CB  . UNK B  2  327 ? -9.502  22.726  81.573  1.00 46.91 ? 1069 UNK B CB  1 
ATOM   3023  N  N   . UNK B  2  328 ? -12.536 23.534  80.005  1.00 46.91 ? 1070 UNK B N   1 
ATOM   3024  C  CA  . UNK B  2  328 ? -13.401 24.632  79.580  1.00 46.91 ? 1070 UNK B CA  1 
ATOM   3025  C  C   . UNK B  2  328 ? -13.251 24.951  78.091  1.00 46.91 ? 1070 UNK B C   1 
ATOM   3026  O  O   . UNK B  2  328 ? -12.526 24.269  77.366  1.00 46.91 ? 1070 UNK B O   1 
ATOM   3027  C  CB  . UNK B  2  328 ? -13.139 25.879  80.424  1.00 46.91 ? 1070 UNK B CB  1 
ATOM   3028  N  N   . UNK B  2  329 ? -13.977 25.968  77.637  1.00 46.91 ? 1071 UNK B N   1 
ATOM   3029  C  CA  . UNK B  2  329 ? -13.941 26.387  76.239  1.00 46.91 ? 1071 UNK B CA  1 
ATOM   3030  C  C   . UNK B  2  329 ? -12.723 27.258  75.934  1.00 46.91 ? 1071 UNK B C   1 
ATOM   3031  O  O   . UNK B  2  329 ? -12.394 28.170  76.697  1.00 46.91 ? 1071 UNK B O   1 
ATOM   3032  C  CB  . UNK B  2  329 ? -15.222 27.132  75.887  1.00 46.91 ? 1071 UNK B CB  1 
ATOM   3033  N  N   . UNK B  2  330 ? -12.079 26.988  74.803  1.00 46.91 ? 1072 UNK B N   1 
ATOM   3034  C  CA  . UNK B  2  330 ? -10.901 27.741  74.383  1.00 46.91 ? 1072 UNK B CA  1 
ATOM   3035  C  C   . UNK B  2  330 ? -11.103 28.371  73.006  1.00 46.91 ? 1072 UNK B C   1 
ATOM   3036  O  O   . UNK B  2  330 ? -11.955 27.936  72.230  1.00 46.91 ? 1072 UNK B O   1 
ATOM   3037  C  CB  . UNK B  2  330 ? -9.673  26.839  74.375  1.00 46.91 ? 1072 UNK B CB  1 
ATOM   3038  N  N   . UNK B  2  331 ? -10.337 29.420  72.727  1.00 46.91 ? 1073 UNK B N   1 
ATOM   3039  C  CA  . UNK B  2  331 ? -10.417 30.119  71.447  1.00 46.91 ? 1073 UNK B CA  1 
ATOM   3040  C  C   . UNK B  2  331 ? -9.449  29.533  70.421  1.00 46.91 ? 1073 UNK B C   1 
ATOM   3041  O  O   . UNK B  2  331 ? -9.450  29.943  69.257  1.00 46.91 ? 1073 UNK B O   1 
ATOM   3042  C  CB  . UNK B  2  331 ? -10.145 31.605  71.643  1.00 46.91 ? 1073 UNK B CB  1 
ATOM   3043  N  N   . UNK B  2  332 ? -8.637  28.573  70.860  1.00 46.91 ? 1074 UNK B N   1 
ATOM   3044  C  CA  . UNK B  2  332 ? -7.648  27.910  70.009  1.00 46.91 ? 1074 UNK B CA  1 
ATOM   3045  C  C   . UNK B  2  332 ? -6.592  28.880  69.471  1.00 46.91 ? 1074 UNK B C   1 
ATOM   3046  O  O   . UNK B  2  332 ? -6.308  29.907  70.094  1.00 46.91 ? 1074 UNK B O   1 
ATOM   3047  C  CB  . UNK B  2  332 ? -8.339  27.170  68.860  1.00 46.91 ? 1074 UNK B CB  1 
ATOM   3048  N  N   . UNK B  2  333 ? -5.987  28.526  68.340  1.00 46.91 ? 1075 UNK B N   1 
ATOM   3049  C  CA  . UNK B  2  333 ? -4.962  29.356  67.715  1.00 46.91 ? 1075 UNK B CA  1 
ATOM   3050  C  C   . UNK B  2  333 ? -5.568  30.529  66.946  1.00 46.91 ? 1075 UNK B C   1 
ATOM   3051  O  O   . UNK B  2  333 ? -6.781  30.589  66.734  1.00 46.91 ? 1075 UNK B O   1 
ATOM   3052  C  CB  . UNK B  2  333 ? -4.095  28.510  66.789  1.00 46.91 ? 1075 UNK B CB  1 
ATOM   3053  N  N   . UNK B  2  334 ? -4.711  31.459  66.534  1.00 46.91 ? 1076 UNK B N   1 
ATOM   3054  C  CA  . UNK B  2  334 ? -5.142  32.638  65.787  1.00 46.91 ? 1076 UNK B CA  1 
ATOM   3055  C  C   . UNK B  2  334 ? -3.990  33.165  64.935  1.00 46.91 ? 1076 UNK B C   1 
ATOM   3056  O  O   . UNK B  2  334 ? -3.470  34.260  65.173  1.00 46.91 ? 1076 UNK B O   1 
ATOM   3057  C  CB  . UNK B  2  334 ? -5.638  33.717  66.746  1.00 46.91 ? 1076 UNK B CB  1 
ATOM   3058  N  N   . UNK B  2  335 ? -3.596  32.373  63.941  1.00 46.91 ? 1077 UNK B N   1 
ATOM   3059  C  CA  . UNK B  2  335 ? -2.501  32.727  63.043  1.00 46.91 ? 1077 UNK B CA  1 
ATOM   3060  C  C   . UNK B  2  335 ? -2.890  33.768  61.995  1.00 46.91 ? 1077 UNK B C   1 
ATOM   3061  O  O   . UNK B  2  335 ? -4.063  34.130  61.858  1.00 46.91 ? 1077 UNK B O   1 
ATOM   3062  C  CB  . UNK B  2  335 ? -1.958  31.475  62.365  1.00 46.91 ? 1077 UNK B CB  1 
ATOM   3063  N  N   . UNK B  2  336 ? -1.892  34.245  61.256  1.00 46.91 ? 1078 UNK B N   1 
ATOM   3064  C  CA  . UNK B  2  336 ? -2.102  35.241  60.211  1.00 46.91 ? 1078 UNK B CA  1 
ATOM   3065  C  C   . UNK B  2  336 ? -1.280  34.910  58.966  1.00 46.91 ? 1078 UNK B C   1 
ATOM   3066  O  O   . UNK B  2  336 ? -0.588  33.894  58.921  1.00 46.91 ? 1078 UNK B O   1 
ATOM   3067  C  CB  . UNK B  2  336 ? -1.740  36.628  60.730  1.00 46.91 ? 1078 UNK B CB  1 
ATOM   3068  N  N   . UNK B  2  337 ? -1.379  35.763  57.950  1.00 46.91 ? 1079 UNK B N   1 
ATOM   3069  C  CA  . UNK B  2  337 ? -0.641  35.566  56.706  1.00 46.91 ? 1079 UNK B CA  1 
ATOM   3070  C  C   . UNK B  2  337 ? 0.839   35.890  56.889  1.00 46.91 ? 1079 UNK B C   1 
ATOM   3071  O  O   . UNK B  2  337 ? 1.232   37.059  56.900  1.00 46.91 ? 1079 UNK B O   1 
ATOM   3072  C  CB  . UNK B  2  337 ? -1.239  36.425  55.597  1.00 46.91 ? 1079 UNK B CB  1 
ATOM   3073  N  N   . UNK B  2  338 ? 1.655   34.847  57.017  1.00 46.91 ? 1080 UNK B N   1 
ATOM   3074  C  CA  . UNK B  2  338 ? 3.094   35.005  57.203  1.00 46.91 ? 1080 UNK B CA  1 
ATOM   3075  C  C   . UNK B  2  338 ? 3.826   33.715  56.840  1.00 46.91 ? 1080 UNK B C   1 
ATOM   3076  O  O   . UNK B  2  338 ? 4.305   33.559  55.714  1.00 46.91 ? 1080 UNK B O   1 
ATOM   3077  C  CB  . UNK B  2  338 ? 3.399   35.404  58.645  1.00 46.91 ? 1080 UNK B CB  1 
ATOM   3078  N  N   . UNK B  2  339 ? 3.915   32.800  57.802  1.00 46.91 ? 1081 UNK B N   1 
ATOM   3079  C  CA  . UNK B  2  339 ? 4.580   31.515  57.608  1.00 46.91 ? 1081 UNK B CA  1 
ATOM   3080  C  C   . UNK B  2  339 ? 4.255   30.574  58.764  1.00 46.91 ? 1081 UNK B C   1 
ATOM   3081  O  O   . UNK B  2  339 ? 3.884   29.418  58.549  1.00 46.91 ? 1081 UNK B O   1 
ATOM   3082  C  CB  . UNK B  2  339 ? 6.091   31.709  57.496  1.00 46.91 ? 1081 UNK B CB  1 
ATOM   3083  N  N   . UNK B  2  340 ? 4.404   31.076  59.986  1.00 46.91 ? 1082 UNK B N   1 
ATOM   3084  C  CA  . UNK B  2  340 ? 4.127   30.299  61.190  1.00 46.91 ? 1082 UNK B CA  1 
ATOM   3085  C  C   . UNK B  2  340 ? 3.995   31.216  62.401  1.00 46.91 ? 1082 UNK B C   1 
ATOM   3086  O  O   . UNK B  2  340 ? 4.721   32.207  62.524  1.00 46.91 ? 1082 UNK B O   1 
ATOM   3087  C  CB  . UNK B  2  340 ? 5.234   29.276  61.427  1.00 46.91 ? 1082 UNK B CB  1 
ATOM   3088  N  N   . UNK B  2  341 ? 3.055   30.891  63.283  1.00 46.91 ? 1083 UNK B N   1 
ATOM   3089  C  CA  . UNK B  2  341 ? 2.827   31.679  64.488  1.00 46.91 ? 1083 UNK B CA  1 
ATOM   3090  C  C   . UNK B  2  341 ? 3.782   31.245  65.603  1.00 46.91 ? 1083 UNK B C   1 
ATOM   3091  O  O   . UNK B  2  341 ? 4.999   31.399  65.478  1.00 46.91 ? 1083 UNK B O   1 
ATOM   3092  C  CB  . UNK B  2  341 ? 1.371   31.548  64.938  1.00 46.91 ? 1083 UNK B CB  1 
ATOM   3093  N  N   . UNK B  2  342 ? 3.232   30.689  66.678  1.00 46.91 ? 1084 UNK B N   1 
ATOM   3094  C  CA  . UNK B  2  342 ? 4.039   30.240  67.807  1.00 46.91 ? 1084 UNK B CA  1 
ATOM   3095  C  C   . UNK B  2  342 ? 3.268   29.268  68.693  1.00 46.91 ? 1084 UNK B C   1 
ATOM   3096  O  O   . UNK B  2  342 ? 3.481   28.056  68.632  1.00 46.91 ? 1084 UNK B O   1 
ATOM   3097  C  CB  . UNK B  2  342 ? 4.513   31.440  68.626  1.00 46.91 ? 1084 UNK B CB  1 
ATOM   3098  N  N   . UNK B  2  343 ? 2.374   29.810  69.515  1.00 46.91 ? 1085 UNK B N   1 
ATOM   3099  C  CA  . UNK B  2  343 ? 1.570   29.003  70.424  1.00 46.91 ? 1085 UNK B CA  1 
ATOM   3100  C  C   . UNK B  2  343 ? 0.111   29.446  70.430  1.00 46.91 ? 1085 UNK B C   1 
ATOM   3101  O  O   . UNK B  2  343 ? -0.201  30.608  70.161  1.00 46.91 ? 1085 UNK B O   1 
ATOM   3102  C  CB  . UNK B  2  343 ? 2.147   29.072  71.831  1.00 46.91 ? 1085 UNK B CB  1 
ATOM   3103  N  N   . UNK B  2  344 ? -0.774  28.501  70.728  1.00 46.91 ? 1086 UNK B N   1 
ATOM   3104  C  CA  . UNK B  2  344 ? -2.207  28.763  70.783  1.00 46.91 ? 1086 UNK B CA  1 
ATOM   3105  C  C   . UNK B  2  344 ? -2.563  29.368  72.141  1.00 46.91 ? 1086 UNK B C   1 
ATOM   3106  O  O   . UNK B  2  344 ? -2.398  30.570  72.360  1.00 46.91 ? 1086 UNK B O   1 
ATOM   3107  C  CB  . UNK B  2  344 ? -2.982  27.468  70.554  1.00 46.91 ? 1086 UNK B CB  1 
ATOM   3108  N  N   . UNK B  2  345 ? -3.051  28.526  73.045  1.00 46.91 ? 1087 UNK B N   1 
ATOM   3109  C  CA  . UNK B  2  345 ? -3.422  28.958  74.387  1.00 46.91 ? 1087 UNK B CA  1 
ATOM   3110  C  C   . UNK B  2  345 ? -2.167  29.108  75.236  1.00 46.91 ? 1087 UNK B C   1 
ATOM   3111  O  O   . UNK B  2  345 ? -2.001  30.106  75.944  1.00 46.91 ? 1087 UNK B O   1 
ATOM   3112  C  CB  . UNK B  2  345 ? -4.368  27.949  75.021  1.00 46.91 ? 1087 UNK B CB  1 
ATOM   3113  N  N   . UNK B  2  346 ? -1.292  28.107  75.165  1.00 46.91 ? 1088 UNK B N   1 
ATOM   3114  C  CA  . UNK B  2  346 ? -0.040  28.102  75.917  1.00 46.91 ? 1088 UNK B CA  1 
ATOM   3115  C  C   . UNK B  2  346 ? 0.861   26.945  75.490  1.00 46.91 ? 1088 UNK B C   1 
ATOM   3116  O  O   . UNK B  2  346 ? 0.455   25.782  75.539  1.00 46.91 ? 1088 UNK B O   1 
ATOM   3117  C  CB  . UNK B  2  346 ? -0.326  28.016  77.416  1.00 46.91 ? 1088 UNK B CB  1 
ATOM   3118  N  N   . UNK B  2  347 ? 2.089   27.267  75.086  1.00 46.91 ? 1089 UNK B N   1 
ATOM   3119  C  CA  . UNK B  2  347 ? 3.055   26.256  74.655  1.00 46.91 ? 1089 UNK B CA  1 
ATOM   3120  C  C   . UNK B  2  347 ? 4.483   26.800  74.633  1.00 46.91 ? 1089 UNK B C   1 
ATOM   3121  O  O   . UNK B  2  347 ? 4.719   27.949  74.253  1.00 46.91 ? 1089 UNK B O   1 
ATOM   3122  C  CB  . UNK B  2  347 ? 2.677   25.714  73.280  1.00 46.91 ? 1089 UNK B CB  1 
ATOM   3123  N  N   . UNK B  2  348 ? 5.432   25.967  75.054  1.00 46.91 ? 1090 UNK B N   1 
ATOM   3124  C  CA  . UNK B  2  348 ? 6.843   26.343  75.088  1.00 46.91 ? 1090 UNK B CA  1 
ATOM   3125  C  C   . UNK B  2  348 ? 7.546   25.928  73.797  1.00 46.91 ? 1090 UNK B C   1 
ATOM   3126  O  O   . UNK B  2  348 ? 7.188   24.919  73.185  1.00 46.91 ? 1090 UNK B O   1 
ATOM   3127  C  CB  . UNK B  2  348 ? 7.524   25.700  76.290  1.00 46.91 ? 1090 UNK B CB  1 
ATOM   3128  N  N   . UNK B  2  349 ? 8.538   26.711  73.381  1.00 46.91 ? 1091 UNK B N   1 
ATOM   3129  C  CA  . UNK B  2  349 ? 9.287   26.422  72.160  1.00 46.91 ? 1091 UNK B CA  1 
ATOM   3130  C  C   . UNK B  2  349 ? 10.721  25.980  72.451  1.00 46.91 ? 1091 UNK B C   1 
ATOM   3131  O  O   . UNK B  2  349 ? 11.010  24.783  72.505  1.00 46.91 ? 1091 UNK B O   1 
ATOM   3132  C  CB  . UNK B  2  349 ? 9.281   27.638  71.236  1.00 46.91 ? 1091 UNK B CB  1 
ATOM   3133  N  N   . UNK B  2  350 ? 11.621  26.948  72.603  1.00 46.91 ? 1092 UNK B N   1 
ATOM   3134  C  CA  . UNK B  2  350 ? 13.024  26.657  72.886  1.00 46.91 ? 1092 UNK B CA  1 
ATOM   3135  C  C   . UNK B  2  350 ? 13.383  27.010  74.326  1.00 46.91 ? 1092 UNK B C   1 
ATOM   3136  O  O   . UNK B  2  350 ? 14.375  26.515  74.868  1.00 46.91 ? 1092 UNK B O   1 
ATOM   3137  C  CB  . UNK B  2  350 ? 13.922  27.411  71.918  1.00 46.91 ? 1092 UNK B CB  1 
ATOM   3138  N  N   . UNK B  2  351 ? 12.598  27.903  74.922  1.00 46.91 ? 1093 UNK B N   1 
ATOM   3139  C  CA  . UNK B  2  351 ? 12.816  28.325  76.299  1.00 46.91 ? 1093 UNK B CA  1 
ATOM   3140  C  C   . UNK B  2  351 ? 12.439  27.206  77.263  1.00 46.91 ? 1093 UNK B C   1 
ATOM   3141  O  O   . UNK B  2  351 ? 11.673  26.305  76.916  1.00 46.91 ? 1093 UNK B O   1 
ATOM   3142  C  CB  . UNK B  2  351 ? 12.004  29.578  76.598  1.00 46.91 ? 1093 UNK B CB  1 
ATOM   3143  N  N   . UNK B  2  352 ? 12.986  27.266  78.473  1.00 46.91 ? 1094 UNK B N   1 
ATOM   3144  C  CA  . UNK B  2  352 ? 12.711  26.261  79.493  1.00 46.91 ? 1094 UNK B CA  1 
ATOM   3145  C  C   . UNK B  2  352 ? 12.636  26.905  80.877  1.00 46.91 ? 1094 UNK B C   1 
ATOM   3146  O  O   . UNK B  2  352 ? 12.244  28.066  81.009  1.00 46.91 ? 1094 UNK B O   1 
ATOM   3147  C  CB  . UNK B  2  352 ? 13.789  25.180  79.463  1.00 46.91 ? 1094 UNK B CB  1 
ATOM   3148  N  N   . UNK B  2  353 ? 13.019  26.142  81.899  1.00 46.91 ? 1095 UNK B N   1 
ATOM   3149  C  CA  . UNK B  2  353 ? 13.018  26.599  83.288  1.00 46.91 ? 1095 UNK B CA  1 
ATOM   3150  C  C   . UNK B  2  353 ? 11.650  27.042  83.812  1.00 46.91 ? 1095 UNK B C   1 
ATOM   3151  O  O   . UNK B  2  353 ? 10.842  26.209  84.230  1.00 46.91 ? 1095 UNK B O   1 
ATOM   3152  C  CB  . UNK B  2  353 ? 14.056  27.708  83.486  1.00 46.91 ? 1095 UNK B CB  1 
ATOM   3153  N  N   . UNK B  2  354 ? 11.420  28.353  83.830  1.00 46.91 ? 1096 UNK B N   1 
ATOM   3154  C  CA  . UNK B  2  354 ? 10.165  28.924  84.314  1.00 46.91 ? 1096 UNK B CA  1 
ATOM   3155  C  C   . UNK B  2  354 ? 8.992   28.668  83.366  1.00 46.91 ? 1096 UNK B C   1 
ATOM   3156  O  O   . UNK B  2  354 ? 8.731   29.453  82.452  1.00 46.91 ? 1096 UNK B O   1 
ATOM   3157  C  CB  . UNK B  2  354 ? 10.336  30.418  84.566  1.00 46.91 ? 1096 UNK B CB  1 
ATOM   3158  N  N   . UNK B  2  355 ? 8.273   27.578  83.615  1.00 46.91 ? 1097 UNK B N   1 
ATOM   3159  C  CA  . UNK B  2  355 ? 7.133   27.193  82.790  1.00 46.91 ? 1097 UNK B CA  1 
ATOM   3160  C  C   . UNK B  2  355 ? 5.784   27.676  83.323  1.00 46.91 ? 1097 UNK B C   1 
ATOM   3161  O  O   . UNK B  2  355 ? 5.636   27.995  84.506  1.00 46.91 ? 1097 UNK B O   1 
ATOM   3162  C  CB  . UNK B  2  355 ? 7.112   25.678  82.602  1.00 46.91 ? 1097 UNK B CB  1 
ATOM   3163  N  N   . UNK B  2  356 ? 4.808   27.726  82.424  1.00 46.91 ? 1098 UNK B N   1 
ATOM   3164  C  CA  . UNK B  2  356 ? 3.446   28.147  82.739  1.00 46.91 ? 1098 UNK B CA  1 
ATOM   3165  C  C   . UNK B  2  356 ? 2.530   27.603  81.645  1.00 46.91 ? 1098 UNK B C   1 
ATOM   3166  O  O   . UNK B  2  356 ? 1.371   28.009  81.524  1.00 46.91 ? 1098 UNK B O   1 
ATOM   3167  C  CB  . UNK B  2  356 ? 3.364   29.671  82.793  1.00 46.91 ? 1098 UNK B CB  1 
ATOM   3168  N  N   . UNK B  2  357 ? 3.068   26.670  80.865  1.00 46.91 ? 1099 UNK B N   1 
ATOM   3169  C  CA  . UNK B  2  357 ? 2.350   26.046  79.763  1.00 46.91 ? 1099 UNK B CA  1 
ATOM   3170  C  C   . UNK B  2  357 ? 2.435   24.525  79.822  1.00 46.91 ? 1099 UNK B C   1 
ATOM   3171  O  O   . UNK B  2  357 ? 3.271   23.962  80.534  1.00 46.91 ? 1099 UNK B O   1 
ATOM   3172  C  CB  . UNK B  2  357 ? 2.908   26.543  78.439  1.00 46.91 ? 1099 UNK B CB  1 
ATOM   3173  N  N   . UNK B  2  358 ? 1.570   23.874  79.047  1.00 46.91 ? 1100 UNK B N   1 
ATOM   3174  C  CA  . UNK B  2  358 ? 1.506   22.416  78.959  1.00 46.91 ? 1100 UNK B CA  1 
ATOM   3175  C  C   . UNK B  2  358 ? 1.250   21.714  80.294  1.00 46.91 ? 1100 UNK B C   1 
ATOM   3176  O  O   . UNK B  2  358 ? 1.591   20.539  80.462  1.00 46.91 ? 1100 UNK B O   1 
ATOM   3177  C  CB  . UNK B  2  358 ? 2.770   21.870  78.298  1.00 46.91 ? 1100 UNK B CB  1 
ATOM   3178  N  N   . UNK B  2  359 ? 0.644   22.431  81.236  1.00 46.91 ? 1101 UNK B N   1 
ATOM   3179  C  CA  . UNK B  2  359 ? 0.335   21.871  82.548  1.00 46.91 ? 1101 UNK B CA  1 
ATOM   3180  C  C   . UNK B  2  359 ? -0.948  21.047  82.493  1.00 46.91 ? 1101 UNK B C   1 
ATOM   3181  O  O   . UNK B  2  359 ? -1.135  20.116  83.281  1.00 46.91 ? 1101 UNK B O   1 
ATOM   3182  C  CB  . UNK B  2  359 ? 0.203   22.985  83.578  1.00 46.91 ? 1101 UNK B CB  1 
ATOM   3183  N  N   . UNK B  2  360 ? -1.834  21.411  81.571  1.00 46.91 ? 1102 UNK B N   1 
ATOM   3184  C  CA  . UNK B  2  360 ? -3.109  20.725  81.388  1.00 46.91 ? 1102 UNK B CA  1 
ATOM   3185  C  C   . UNK B  2  360 ? -3.670  21.027  80.000  1.00 46.91 ? 1102 UNK B C   1 
ATOM   3186  O  O   . UNK B  2  360 ? -4.304  22.063  79.787  1.00 46.91 ? 1102 UNK B O   1 
ATOM   3187  C  CB  . UNK B  2  360 ? -4.102  21.154  82.465  1.00 46.91 ? 1102 UNK B CB  1 
ATOM   3188  N  N   . UNK B  2  361 ? -3.429  20.117  79.062  1.00 46.91 ? 1103 UNK B N   1 
ATOM   3189  C  CA  . UNK B  2  361 ? -3.905  20.279  77.691  1.00 46.91 ? 1103 UNK B CA  1 
ATOM   3190  C  C   . UNK B  2  361 ? -4.256  18.932  77.067  1.00 46.91 ? 1103 UNK B C   1 
ATOM   3191  O  O   . UNK B  2  361 ? -3.538  17.944  77.249  1.00 46.91 ? 1103 UNK B O   1 
ATOM   3192  C  CB  . UNK B  2  361 ? -2.851  20.994  76.852  1.00 46.91 ? 1103 UNK B CB  1 
ATOM   3193  N  N   . UNK B  2  362 ? -5.364  18.899  76.333  1.00 46.91 ? 1104 UNK B N   1 
ATOM   3194  C  CA  . UNK B  2  362 ? -5.831  17.684  75.672  1.00 46.91 ? 1104 UNK B CA  1 
ATOM   3195  C  C   . UNK B  2  362 ? -6.726  18.023  74.480  1.00 46.91 ? 1104 UNK B C   1 
ATOM   3196  O  O   . UNK B  2  362 ? -6.650  19.124  73.935  1.00 46.91 ? 1104 UNK B O   1 
ATOM   3197  C  CB  . UNK B  2  362 ? -6.585  16.804  76.668  1.00 46.91 ? 1104 UNK B CB  1 
ATOM   3198  N  N   . UNK B  2  363 ? -7.559  17.065  74.077  1.00 46.91 ? 1105 UNK B N   1 
ATOM   3199  C  CA  . UNK B  2  363 ? -8.476  17.247  72.952  1.00 46.91 ? 1105 UNK B CA  1 
ATOM   3200  C  C   . UNK B  2  363 ? -9.564  16.173  72.919  1.00 46.91 ? 1105 UNK B C   1 
ATOM   3201  O  O   . UNK B  2  363 ? -9.389  15.080  73.461  1.00 46.91 ? 1105 UNK B O   1 
ATOM   3202  C  CB  . UNK B  2  363 ? -7.702  17.247  71.637  1.00 46.91 ? 1105 UNK B CB  1 
ATOM   3203  N  N   . UNK B  2  364 ? -10.678 16.493  72.268  1.00 46.91 ? 1106 UNK B N   1 
ATOM   3204  C  CA  . UNK B  2  364 ? -11.810 15.578  72.142  1.00 46.91 ? 1106 UNK B CA  1 
ATOM   3205  C  C   . UNK B  2  364 ? -12.781 16.092  71.076  1.00 46.91 ? 1106 UNK B C   1 
ATOM   3206  O  O   . UNK B  2  364 ? -13.928 16.435  71.377  1.00 46.91 ? 1106 UNK B O   1 
ATOM   3207  C  CB  . UNK B  2  364 ? -12.522 15.432  73.486  1.00 46.91 ? 1106 UNK B CB  1 
ATOM   3208  N  N   . GLY B  2  365 ? -12.304 16.157  69.836  1.00 46.91 ? 403  GLY B N   1 
ATOM   3209  C  CA  . GLY B  2  365 ? -13.124 16.640  68.739  1.00 46.91 ? 403  GLY B CA  1 
ATOM   3210  C  C   . GLY B  2  365 ? -14.303 15.758  68.369  1.00 46.91 ? 403  GLY B C   1 
ATOM   3211  O  O   . GLY B  2  365 ? -14.763 14.929  69.159  1.00 46.91 ? 403  GLY B O   1 
ATOM   3212  N  N   . GLY B  2  366 ? -14.800 15.943  67.150  1.00 46.91 ? 404  GLY B N   1 
ATOM   3213  C  CA  . GLY B  2  366 ? -15.928 15.163  66.678  1.00 46.91 ? 404  GLY B CA  1 
ATOM   3214  C  C   . GLY B  2  366 ? -16.028 15.133  65.165  1.00 46.91 ? 404  GLY B C   1 
ATOM   3215  O  O   . GLY B  2  366 ? -16.993 15.650  64.588  1.00 46.91 ? 404  GLY B O   1 
ATOM   3216  N  N   . GLU B  2  367 ? -15.025 14.538  64.526  1.00 46.91 ? 405  GLU B N   1 
ATOM   3217  C  CA  . GLU B  2  367 ? -14.986 14.427  63.075  1.00 46.91 ? 405  GLU B CA  1 
ATOM   3218  C  C   . GLU B  2  367 ? -14.789 12.973  62.650  1.00 46.91 ? 405  GLU B C   1 
ATOM   3219  O  O   . GLU B  2  367 ? -15.730 12.173  62.705  1.00 46.91 ? 405  GLU B O   1 
ATOM   3220  C  CB  . GLU B  2  367 ? -13.876 15.313  62.501  1.00 46.91 ? 405  GLU B CB  1 
ATOM   3221  N  N   . LEU B  2  368 ? -13.573 12.636  62.228  1.00 46.91 ? 406  LEU B N   1 
ATOM   3222  C  CA  . LEU B  2  368 ? -13.254 11.280  61.788  1.00 46.91 ? 406  LEU B CA  1 
ATOM   3223  C  C   . LEU B  2  368 ? -12.924 10.327  62.937  1.00 46.91 ? 406  LEU B C   1 
ATOM   3224  O  O   . LEU B  2  368 ? -13.046 9.109   62.797  1.00 46.91 ? 406  LEU B O   1 
ATOM   3225  C  CB  . LEU B  2  368 ? -12.097 11.305  60.790  1.00 46.91 ? 406  LEU B CB  1 
ATOM   3226  N  N   . ASN B  2  369 ? -12.473 10.881  64.058  1.00 46.91 ? 407  ASN B N   1 
ATOM   3227  C  CA  . ASN B  2  369 ? -12.125 10.079  65.227  1.00 46.91 ? 407  ASN B CA  1 
ATOM   3228  C  C   . ASN B  2  369 ? -12.569 10.782  66.506  1.00 46.91 ? 407  ASN B C   1 
ATOM   3229  O  O   . ASN B  2  369 ? -11.750 11.333  67.246  1.00 46.91 ? 407  ASN B O   1 
ATOM   3230  C  CB  . ASN B  2  369 ? -10.617 9.806   65.261  1.00 46.91 ? 407  ASN B CB  1 
ATOM   3231  N  N   . GLY B  2  370 ? -13.878 10.769  66.742  1.00 46.91 ? 408  GLY B N   1 
ATOM   3232  C  CA  . GLY B  2  370 ? -14.434 11.404  67.923  1.00 46.91 ? 408  GLY B CA  1 
ATOM   3233  C  C   . GLY B  2  370 ? -14.121 10.636  69.191  1.00 46.91 ? 408  GLY B C   1 
ATOM   3234  O  O   . GLY B  2  370 ? -14.939 9.845   69.672  1.00 46.91 ? 408  GLY B O   1 
ATOM   3235  N  N   . GLN B  2  371 ? -12.925 10.860  69.723  1.00 46.91 ? 409  GLN B N   1 
ATOM   3236  C  CA  . GLN B  2  371 ? -12.475 10.203  70.942  1.00 46.91 ? 409  GLN B CA  1 
ATOM   3237  C  C   . GLN B  2  371 ? -11.713 11.205  71.805  1.00 46.91 ? 409  GLN B C   1 
ATOM   3238  O  O   . GLN B  2  371 ? -11.863 12.415  71.641  1.00 46.91 ? 409  GLN B O   1 
ATOM   3239  C  CB  . GLN B  2  371 ? -11.575 9.010   70.597  1.00 46.91 ? 409  GLN B CB  1 
ATOM   3240  N  N   . THR B  2  372 ? -10.915 10.698  72.738  1.00 46.91 ? 410  THR B N   1 
ATOM   3241  C  CA  . THR B  2  372 ? -10.135 11.556  73.619  1.00 46.91 ? 410  THR B CA  1 
ATOM   3242  C  C   . THR B  2  372 ? -8.692  11.074  73.698  1.00 46.91 ? 410  THR B C   1 
ATOM   3243  O  O   . THR B  2  372 ? -8.416  9.873   73.605  1.00 46.91 ? 410  THR B O   1 
ATOM   3244  C  CB  . THR B  2  372 ? -10.732 11.598  75.037  1.00 46.91 ? 410  THR B CB  1 
ATOM   3245  N  N   . PHE B  2  373 ? -7.771  12.020  73.851  1.00 46.91 ? 411  PHE B N   1 
ATOM   3246  C  CA  . PHE B  2  373 ? -6.349  11.714  73.935  1.00 46.91 ? 411  PHE B CA  1 
ATOM   3247  C  C   . PHE B  2  373 ? -5.852  11.744  75.381  1.00 46.91 ? 411  PHE B C   1 
ATOM   3248  O  O   . PHE B  2  373 ? -6.647  11.718  76.322  1.00 46.91 ? 411  PHE B O   1 
ATOM   3249  C  CB  . PHE B  2  373 ? -5.555  12.702  73.076  1.00 46.91 ? 411  PHE B CB  1 
ATOM   3250  C  CG  . PHE B  2  373 ? -5.994  12.743  71.638  1.00 46.91 ? 411  PHE B CG  1 
ATOM   3251  C  CD1 . PHE B  2  373 ? -6.832  13.755  71.183  1.00 46.91 ? 411  PHE B CD1 1 
ATOM   3252  C  CD2 . PHE B  2  373 ? -5.572  11.768  70.739  1.00 46.91 ? 411  PHE B CD2 1 
ATOM   3253  C  CE1 . PHE B  2  373 ? -7.245  13.798  69.854  1.00 46.91 ? 411  PHE B CE1 1 
ATOM   3254  C  CE2 . PHE B  2  373 ? -5.980  11.802  69.406  1.00 46.91 ? 411  PHE B CE2 1 
ATOM   3255  C  CZ  . PHE B  2  373 ? -6.819  12.819  68.962  1.00 46.91 ? 411  PHE B CZ  1 
ATOM   3256  N  N   . THR B  2  374 ? -4.532  11.776  75.550  1.00 46.91 ? 412  THR B N   1 
ATOM   3257  C  CA  . THR B  2  374 ? -3.927  11.804  76.880  1.00 46.91 ? 412  THR B CA  1 
ATOM   3258  C  C   . THR B  2  374 ? -2.462  12.225  76.832  1.00 46.91 ? 412  THR B C   1 
ATOM   3259  O  O   . THR B  2  374 ? -1.978  12.913  77.732  1.00 46.91 ? 412  THR B O   1 
ATOM   3260  C  CB  . THR B  2  374 ? -4.017  10.428  77.567  1.00 46.91 ? 412  THR B CB  1 
ATOM   3261  N  N   . ASP B  2  375 ? -1.751  11.776  75.802  1.00 46.91 ? 413  ASP B N   1 
ATOM   3262  C  CA  . ASP B  2  375 ? -0.339  12.110  75.637  1.00 46.91 ? 413  ASP B CA  1 
ATOM   3263  C  C   . ASP B  2  375 ? -0.177  13.570  75.223  1.00 46.91 ? 413  ASP B C   1 
ATOM   3264  O  O   . ASP B  2  375 ? -0.961  14.091  74.429  1.00 46.91 ? 413  ASP B O   1 
ATOM   3265  C  CB  . ASP B  2  375 ? 0.304   11.199  74.588  1.00 46.91 ? 413  ASP B CB  1 
ATOM   3266  N  N   . PRO B  2  376 ? 0.860   14.243  75.747  1.00 46.91 ? 414  PRO B N   1 
ATOM   3267  C  CA  . PRO B  2  376 ? 1.140   15.652  75.440  1.00 46.91 ? 414  PRO B CA  1 
ATOM   3268  C  C   . PRO B  2  376 ? 1.293   15.897  73.942  1.00 46.91 ? 414  PRO B C   1 
ATOM   3269  C  CB  . PRO B  2  376 ? 2.450   15.921  76.182  1.00 46.91 ? 414  PRO B CB  1 
ATOM   3270  N  N   . PRO B  2  377 ? 1.950   14.958  73.239  1.00 46.91 ? 415  PRO B N   1 
ATOM   3271  C  CA  . PRO B  2  377 ? 2.182   15.038  71.793  1.00 46.91 ? 415  PRO B CA  1 
ATOM   3272  C  C   . PRO B  2  377 ? 0.883   15.189  71.004  1.00 46.91 ? 415  PRO B C   1 
ATOM   3273  O  O   . PRO B  2  377 ? 0.892   15.634  69.859  1.00 46.91 ? 415  PRO B O   1 
ATOM   3274  C  CB  . PRO B  2  377 ? 2.875   13.714  71.473  1.00 46.91 ? 415  PRO B CB  1 
ATOM   3275  N  N   . THR B  2  378 ? -0.223  14.780  71.618  1.00 46.91 ? 416  THR B N   1 
ATOM   3276  C  CA  . THR B  2  378 ? -1.537  14.875  70.993  1.00 46.91 ? 416  THR B CA  1 
ATOM   3277  C  C   . THR B  2  378 ? -2.014  16.320  70.996  1.00 46.91 ? 416  THR B C   1 
ATOM   3278  O  O   . THR B  2  378 ? -2.582  16.796  70.015  1.00 46.91 ? 416  THR B O   1 
ATOM   3279  C  CB  . THR B  2  378 ? -2.572  14.014  71.732  1.00 46.91 ? 416  THR B CB  1 
ATOM   3280  N  N   . VAL B  2  379 ? -1.794  17.004  72.116  1.00 46.91 ? 417  VAL B N   1 
ATOM   3281  C  CA  . VAL B  2  379 ? -2.185  18.403  72.262  1.00 46.91 ? 417  VAL B CA  1 
ATOM   3282  C  C   . VAL B  2  379 ? -1.255  19.290  71.440  1.00 46.91 ? 417  VAL B C   1 
ATOM   3283  O  O   . VAL B  2  379 ? -1.616  20.404  71.058  1.00 46.91 ? 417  VAL B O   1 
ATOM   3284  C  CB  . VAL B  2  379 ? -2.128  18.850  73.734  1.00 46.91 ? 417  VAL B CB  1 
ATOM   3285  N  N   . LYS B  2  380 ? -0.037  18.804  71.213  1.00 46.91 ? 418  LYS B N   1 
ATOM   3286  C  CA  . LYS B  2  380 ? 0.954   19.534  70.430  1.00 46.91 ? 418  LYS B CA  1 
ATOM   3287  C  C   . LYS B  2  380 ? 0.810   19.189  68.947  1.00 46.91 ? 418  LYS B C   1 
ATOM   3288  O  O   . LYS B  2  380 ? 1.674   19.523  68.132  1.00 46.91 ? 418  LYS B O   1 
ATOM   3289  C  CB  . LYS B  2  380 ? 2.366   19.190  70.913  1.00 46.91 ? 418  LYS B CB  1 
ATOM   3290  N  N   . SER B  2  381 ? -0.269  18.488  68.615  1.00 46.91 ? 419  SER B N   1 
ATOM   3291  C  CA  . SER B  2  381 ? -0.550  18.086  67.241  1.00 46.91 ? 419  SER B CA  1 
ATOM   3292  C  C   . SER B  2  381 ? -1.950  18.525  66.826  1.00 46.91 ? 419  SER B C   1 
ATOM   3293  O  O   . SER B  2  381 ? -2.287  18.507  65.641  1.00 46.91 ? 419  SER B O   1 
ATOM   3294  C  CB  . SER B  2  381 ? -0.418  16.570  67.095  1.00 46.91 ? 419  SER B CB  1 
ATOM   3295  N  N   . TYR B  2  382 ? -2.775  18.856  67.814  1.00 46.91 ? 420  TYR B N   1 
ATOM   3296  C  CA  . TYR B  2  382 ? -4.139  19.308  67.568  1.00 46.91 ? 420  TYR B CA  1 
ATOM   3297  C  C   . TYR B  2  382 ? -4.156  20.829  67.476  1.00 46.91 ? 420  TYR B C   1 
ATOM   3298  O  O   . TYR B  2  382 ? -4.926  21.405  66.705  1.00 46.91 ? 420  TYR B O   1 
ATOM   3299  C  CB  . TYR B  2  382 ? -5.066  18.843  68.694  1.00 46.91 ? 420  TYR B CB  1 
ATOM   3300  N  N   . ALA B  2  383 ? -3.322  21.470  68.288  1.00 46.91 ? 421  ALA B N   1 
ATOM   3301  C  CA  . ALA B  2  383 ? -3.216  22.924  68.306  1.00 46.91 ? 421  ALA B CA  1 
ATOM   3302  C  C   . ALA B  2  383 ? -2.338  23.404  67.155  1.00 46.91 ? 421  ALA B C   1 
ATOM   3303  O  O   . ALA B  2  383 ? -2.493  24.525  66.670  1.00 46.91 ? 421  ALA B O   1 
ATOM   3304  C  CB  . ALA B  2  383 ? -2.645  23.391  69.637  1.00 46.91 ? 421  ALA B CB  1 
ATOM   3305  N  N   . ARG B  2  384 ? -1.393  22.559  66.751  1.00 46.91 ? 422  ARG B N   1 
ATOM   3306  C  CA  . ARG B  2  384 ? -0.483  22.879  65.656  1.00 46.91 ? 422  ARG B CA  1 
ATOM   3307  C  C   . ARG B  2  384 ? -1.184  22.752  64.306  1.00 46.91 ? 422  ARG B C   1 
ATOM   3308  O  O   . ARG B  2  384 ? -0.751  23.341  63.313  1.00 46.91 ? 422  ARG B O   1 
ATOM   3309  C  CB  . ARG B  2  384 ? 0.736   21.953  65.695  1.00 46.91 ? 422  ARG B CB  1 
ATOM   3310  N  N   . LYS B  2  385 ? -2.240  21.943  64.271  1.00 46.91 ? 423  LYS B N   1 
ATOM   3311  C  CA  . LYS B  2  385 ? -3.015  21.723  63.056  1.00 46.91 ? 423  LYS B CA  1 
ATOM   3312  C  C   . LYS B  2  385 ? -3.997  22.863  62.797  1.00 46.91 ? 423  LYS B C   1 
ATOM   3313  O  O   . LYS B  2  385 ? -4.205  23.262  61.650  1.00 46.91 ? 423  LYS B O   1 
ATOM   3314  C  CB  . LYS B  2  385 ? -3.773  20.397  63.147  1.00 46.91 ? 423  LYS B CB  1 
ATOM   3315  N  N   . ALA B  2  386 ? -4.609  23.365  63.865  1.00 46.91 ? 424  ALA B N   1 
ATOM   3316  C  CA  . ALA B  2  386 ? -5.574  24.457  63.767  1.00 46.91 ? 424  ALA B CA  1 
ATOM   3317  C  C   . ALA B  2  386 ? -4.920  25.783  63.379  1.00 46.91 ? 424  ALA B C   1 
ATOM   3318  O  O   . ALA B  2  386 ? -5.599  26.714  62.941  1.00 46.91 ? 424  ALA B O   1 
ATOM   3319  C  CB  . ALA B  2  386 ? -6.330  24.606  65.083  1.00 46.91 ? 424  ALA B CB  1 
ATOM   3320  N  N   . ILE B  2  387 ? -3.605  25.870  63.560  1.00 46.91 ? 425  ILE B N   1 
ATOM   3321  C  CA  . ILE B  2  387 ? -2.858  27.080  63.229  1.00 46.91 ? 425  ILE B CA  1 
ATOM   3322  C  C   . ILE B  2  387 ? -2.737  27.277  61.719  1.00 46.91 ? 425  ILE B C   1 
ATOM   3323  O  O   . ILE B  2  387 ? -2.864  28.396  61.219  1.00 46.91 ? 425  ILE B O   1 
ATOM   3324  C  CB  . ILE B  2  387 ? -1.444  27.052  63.846  1.00 46.91 ? 425  ILE B CB  1 
ATOM   3325  N  N   . PHE B  2  388 ? -2.459  26.192  61.002  1.00 46.91 ? 426  PHE B N   1 
ATOM   3326  C  CA  . PHE B  2  388 ? -2.330  26.238  59.550  1.00 46.91 ? 426  PHE B CA  1 
ATOM   3327  C  C   . PHE B  2  388 ? -3.682  26.509  58.894  1.00 46.91 ? 426  PHE B C   1 
ATOM   3328  O  O   . PHE B  2  388 ? -3.756  27.116  57.822  1.00 46.91 ? 426  PHE B O   1 
ATOM   3329  C  CB  . PHE B  2  388 ? -1.758  24.917  59.028  1.00 46.91 ? 426  PHE B CB  1 
ATOM   3330  N  N   . GLY B  2  389 ? -4.746  26.032  59.532  1.00 46.91 ? 427  GLY B N   1 
ATOM   3331  C  CA  . GLY B  2  389 ? -6.085  26.223  59.009  1.00 46.91 ? 427  GLY B CA  1 
ATOM   3332  C  C   . GLY B  2  389 ? -7.073  25.236  59.599  1.00 46.91 ? 427  GLY B C   1 
ATOM   3333  O  O   . GLY B  2  389 ? -7.366  25.284  60.790  1.00 46.91 ? 427  GLY B O   1 
ATOM   3334  N  N   . GLU B  2  390 ? -7.618  24.366  58.753  1.00 46.91 ? 428  GLU B N   1 
ATOM   3335  C  CA  . GLU B  2  390 ? -8.579  23.359  59.199  1.00 46.91 ? 428  GLU B CA  1 
ATOM   3336  C  C   . GLU B  2  390 ? -7.911  21.995  59.364  1.00 46.91 ? 428  GLU B C   1 
ATOM   3337  O  O   . GLU B  2  390 ? -7.143  21.566  58.500  1.00 46.91 ? 428  GLU B O   1 
ATOM   3338  C  CB  . GLU B  2  390 ? -9.735  23.249  58.204  1.00 46.91 ? 428  GLU B CB  1 
ATOM   3339  N  N   . ILE B  2  391 ? -8.224  21.317  60.466  1.00 46.91 ? 429  ILE B N   1 
ATOM   3340  C  CA  . ILE B  2  391 ? -7.666  19.999  60.758  1.00 46.91 ? 429  ILE B CA  1 
ATOM   3341  C  C   . ILE B  2  391 ? -8.126  18.962  59.737  1.00 46.91 ? 429  ILE B C   1 
ATOM   3342  O  O   . ILE B  2  391 ? -9.325  18.709  59.589  1.00 46.91 ? 429  ILE B O   1 
ATOM   3343  C  CB  . ILE B  2  391 ? -8.066  19.517  62.168  1.00 46.91 ? 429  ILE B CB  1 
ATOM   3344  N  N   . PHE B  2  392 ? -7.166  18.359  59.042  1.00 46.91 ? 430  PHE B N   1 
ATOM   3345  C  CA  . PHE B  2  392 ? -7.466  17.352  58.029  1.00 46.91 ? 430  PHE B CA  1 
ATOM   3346  C  C   . PHE B  2  392 ? -6.223  16.580  57.595  1.00 46.91 ? 430  PHE B C   1 
ATOM   3347  O  O   . PHE B  2  392 ? -5.112  17.116  57.596  1.00 46.91 ? 430  PHE B O   1 
ATOM   3348  C  CB  . PHE B  2  392 ? -8.114  18.009  56.806  1.00 46.91 ? 430  PHE B CB  1 
ATOM   3349  N  N   . GLU B  2  393 ? -6.418  15.306  57.264  1.00 46.91 ? 431  GLU B N   1 
ATOM   3350  C  CA  . GLU B  2  393 ? -5.337  14.433  56.821  1.00 46.91 ? 431  GLU B CA  1 
ATOM   3351  C  C   . GLU B  2  393 ? -5.144  14.530  55.309  1.00 46.91 ? 431  GLU B C   1 
ATOM   3352  O  O   . GLU B  2  393 ? -5.963  15.123  54.608  1.00 46.91 ? 431  GLU B O   1 
ATOM   3353  C  CB  . GLU B  2  393 ? -5.635  12.981  57.211  1.00 46.91 ? 431  GLU B CB  1 
ATOM   3354  N  N   . PHE B  2  394 ? -4.075  13.915  54.809  1.00 46.91 ? 432  PHE B N   1 
ATOM   3355  C  CA  . PHE B  2  394 ? -3.775  13.932  53.379  1.00 46.91 ? 432  PHE B CA  1 
ATOM   3356  C  C   . PHE B  2  394 ? -2.701  12.903  53.031  1.00 46.91 ? 432  PHE B C   1 
ATOM   3357  O  O   . PHE B  2  394 ? -1.881  12.538  53.879  1.00 46.91 ? 432  PHE B O   1 
ATOM   3358  C  CB  . PHE B  2  394 ? -3.316  15.330  52.949  1.00 46.91 ? 432  PHE B CB  1 
ATOM   3359  N  N   . ASP B  2  395 ? -2.740  12.401  51.799  1.00 46.91 ? 433  ASP B N   1 
ATOM   3360  C  CA  . ASP B  2  395 ? -1.766  11.415  51.339  1.00 46.91 ? 433  ASP B CA  1 
ATOM   3361  C  C   . ASP B  2  395 ? -0.623  12.091  50.583  1.00 46.91 ? 433  ASP B C   1 
ATOM   3362  O  O   . ASP B  2  395 ? -0.619  12.150  49.349  1.00 46.91 ? 433  ASP B O   1 
ATOM   3363  C  CB  . ASP B  2  395 ? -2.436  10.361  50.450  1.00 46.91 ? 433  ASP B CB  1 
ATOM   3364  N  N   . THR B  2  396 ? 0.348   12.598  51.335  1.00 46.91 ? 434  THR B N   1 
ATOM   3365  C  CA  . THR B  2  396 ? 1.506   13.270  50.754  1.00 46.91 ? 434  THR B CA  1 
ATOM   3366  C  C   . THR B  2  396 ? 2.494   12.269  50.166  1.00 46.91 ? 434  THR B C   1 
ATOM   3367  O  O   . THR B  2  396 ? 3.588   12.642  49.738  1.00 46.91 ? 434  THR B O   1 
ATOM   3368  C  CB  . THR B  2  396 ? 2.233   14.131  51.804  1.00 46.91 ? 434  THR B CB  1 
ATOM   3369  N  N   . GLU B  2  397 ? 2.122   10.993  50.194  1.00 46.91 ? 435  GLU B N   1 
ATOM   3370  C  CA  . GLU B  2  397 ? 2.961   9.929   49.657  1.00 46.91 ? 435  GLU B CA  1 
ATOM   3371  C  C   . GLU B  2  397 ? 2.593   9.636   48.201  1.00 46.91 ? 435  GLU B C   1 
ATOM   3372  O  O   . GLU B  2  397 ? 2.699   8.498   47.738  1.00 46.91 ? 435  GLU B O   1 
ATOM   3373  C  CB  . GLU B  2  397 ? 2.813   8.664   50.507  1.00 46.91 ? 435  GLU B CB  1 
ATOM   3374  N  N   . THR B  2  398 ? 2.131   10.665  47.497  1.00 46.91 ? 436  THR B N   1 
ATOM   3375  C  CA  . THR B  2  398 ? 1.745   10.536  46.097  1.00 46.91 ? 436  THR B CA  1 
ATOM   3376  C  C   . THR B  2  398 ? 2.917   10.911  45.189  1.00 46.91 ? 436  THR B C   1 
ATOM   3377  O  O   . THR B  2  398 ? 3.827   10.105  44.974  1.00 46.91 ? 436  THR B O   1 
ATOM   3378  C  CB  . THR B  2  398 ? 0.526   11.424  45.768  1.00 46.91 ? 436  THR B CB  1 
ATOM   3379  N  N   . LEU B  2  399 ? 2.882   12.123  44.643  1.00 46.91 ? 437  LEU B N   1 
ATOM   3380  C  CA  . LEU B  2  399 ? 3.941   12.609  43.766  1.00 46.91 ? 437  LEU B CA  1 
ATOM   3381  C  C   . LEU B  2  399 ? 4.903   13.513  44.535  1.00 46.91 ? 437  LEU B C   1 
ATOM   3382  O  O   . LEU B  2  399 ? 4.543   14.628  44.917  1.00 46.91 ? 437  LEU B O   1 
ATOM   3383  C  CB  . LEU B  2  399 ? 3.341   13.371  42.581  1.00 46.91 ? 437  LEU B CB  1 
ATOM   3384  N  N   . ASN B  2  400 ? 6.126   13.029  44.743  1.00 46.91 ? 438  ASN B N   1 
ATOM   3385  C  CA  . ASN B  2  400 ? 7.162   13.770  45.466  1.00 46.91 ? 438  ASN B CA  1 
ATOM   3386  C  C   . ASN B  2  400 ? 6.751   14.104  46.905  1.00 46.91 ? 438  ASN B C   1 
ATOM   3387  O  O   . ASN B  2  400 ? 6.606   13.201  47.731  1.00 46.91 ? 438  ASN B O   1 
ATOM   3388  C  CB  . ASN B  2  400 ? 7.547   15.044  44.704  1.00 46.91 ? 438  ASN B CB  1 
ATOM   3389  N  N   . SER B  2  401 ? 6.612   15.393  47.208  1.00 46.91 ? 439  SER B N   1 
ATOM   3390  C  CA  . SER B  2  401 ? 6.218   15.834  48.544  1.00 46.91 ? 439  SER B CA  1 
ATOM   3391  C  C   . SER B  2  401 ? 5.987   17.337  48.628  1.00 46.91 ? 439  SER B C   1 
ATOM   3392  O  O   . SER B  2  401 ? 6.616   18.122  47.912  1.00 46.91 ? 439  SER B O   1 
ATOM   3393  C  CB  . SER B  2  401 ? 7.269   15.430  49.581  1.00 46.91 ? 439  SER B CB  1 
ATOM   3394  N  N   . ASP B  2  402 ? 5.103   17.726  49.541  1.00 46.91 ? 440  ASP B N   1 
ATOM   3395  C  CA  . ASP B  2  402 ? 4.760   19.128  49.762  1.00 46.91 ? 440  ASP B CA  1 
ATOM   3396  C  C   . ASP B  2  402 ? 5.836   19.835  50.585  1.00 46.91 ? 440  ASP B C   1 
ATOM   3397  O  O   . ASP B  2  402 ? 6.651   19.188  51.251  1.00 46.91 ? 440  ASP B O   1 
ATOM   3398  C  CB  . ASP B  2  402 ? 3.412   19.224  50.481  1.00 46.91 ? 440  ASP B CB  1 
ATOM   3399  N  N   . GLY B  2  403 ? 5.835   21.163  50.535  1.00 46.91 ? 441  GLY B N   1 
ATOM   3400  C  CA  . GLY B  2  403 ? 6.810   21.930  51.286  1.00 46.91 ? 441  GLY B CA  1 
ATOM   3401  C  C   . GLY B  2  403 ? 6.966   23.367  50.828  1.00 46.91 ? 441  GLY B C   1 
ATOM   3402  O  O   . GLY B  2  403 ? 8.073   23.910  50.858  1.00 46.91 ? 441  GLY B O   1 
ATOM   3403  N  N   . ILE B  2  404 ? 5.864   23.993  50.421  1.00 46.91 ? 442  ILE B N   1 
ATOM   3404  C  CA  . ILE B  2  404 ? 5.895   25.377  49.955  1.00 46.91 ? 442  ILE B CA  1 
ATOM   3405  C  C   . ILE B  2  404 ? 4.559   26.094  50.152  1.00 46.91 ? 442  ILE B C   1 
ATOM   3406  O  O   . ILE B  2  404 ? 4.492   27.098  50.865  1.00 46.91 ? 442  ILE B O   1 
ATOM   3407  C  CB  . ILE B  2  404 ? 6.293   25.461  48.467  1.00 46.91 ? 442  ILE B CB  1 
ATOM   3408  N  N   . PHE B  2  405 ? 3.509   25.574  49.516  1.00 46.91 ? 443  PHE B N   1 
ATOM   3409  C  CA  . PHE B  2  405 ? 2.159   26.136  49.592  1.00 46.91 ? 443  PHE B CA  1 
ATOM   3410  C  C   . PHE B  2  405 ? 2.032   27.463  48.851  1.00 46.91 ? 443  PHE B C   1 
ATOM   3411  O  O   . PHE B  2  405 ? 2.668   28.457  49.211  1.00 46.91 ? 443  PHE B O   1 
ATOM   3412  C  CB  . PHE B  2  405 ? 1.713   26.303  51.048  1.00 46.91 ? 443  PHE B CB  1 
ATOM   3413  N  N   . ARG B  2  406 ? 1.197   27.478  47.818  1.00 46.91 ? 444  ARG B N   1 
ATOM   3414  C  CA  . ARG B  2  406 ? 0.983   28.680  47.019  1.00 46.91 ? 444  ARG B CA  1 
ATOM   3415  C  C   . ARG B  2  406 ? -0.415  28.721  46.406  1.00 46.91 ? 444  ARG B C   1 
ATOM   3416  O  O   . ARG B  2  406 ? -1.260  27.875  46.700  1.00 46.91 ? 444  ARG B O   1 
ATOM   3417  C  CB  . ARG B  2  406 ? 2.040   28.772  45.913  1.00 46.91 ? 444  ARG B CB  1 
ATOM   3418  N  N   . THR B  2  407 ? -0.666  29.753  45.609  1.00 46.91 ? 445  THR B N   1 
ATOM   3419  C  CA  . THR B  2  407 ? -1.948  29.918  44.939  1.00 46.91 ? 445  THR B CA  1 
ATOM   3420  C  C   . THR B  2  407 ? -1.795  29.540  43.470  1.00 46.91 ? 445  THR B C   1 
ATOM   3421  O  O   . THR B  2  407 ? -0.955  30.098  42.765  1.00 46.91 ? 445  THR B O   1 
ATOM   3422  C  CB  . THR B  2  407 ? -2.450  31.369  45.032  1.00 46.91 ? 445  THR B CB  1 
ATOM   3423  N  N   . SER B  2  408 ? -2.588  28.569  43.026  1.00 46.91 ? 446  SER B N   1 
ATOM   3424  C  CA  . SER B  2  408 ? -2.542  28.109  41.639  1.00 46.91 ? 446  SER B CA  1 
ATOM   3425  C  C   . SER B  2  408 ? -3.355  29.009  40.715  1.00 46.91 ? 446  SER B C   1 
ATOM   3426  O  O   . SER B  2  408 ? -3.072  29.109  39.521  1.00 46.91 ? 446  SER B O   1 
ATOM   3427  C  CB  . SER B  2  408 ? -3.058  26.672  41.541  1.00 46.91 ? 446  SER B CB  1 
ATOM   3428  N  N   . PRO B  2  409 ? -4.390  29.664  41.262  1.00 46.91 ? 447  PRO B N   1 
ATOM   3429  C  CA  . PRO B  2  409 ? -5.292  30.571  40.547  1.00 46.91 ? 447  PRO B CA  1 
ATOM   3430  C  C   . PRO B  2  409 ? -4.923  32.040  40.734  1.00 46.91 ? 447  PRO B C   1 
ATOM   3431  O  O   . PRO B  2  409 ? -4.503  32.705  39.790  1.00 46.91 ? 447  PRO B O   1 
ATOM   3432  C  CB  . PRO B  2  409 ? -6.657  30.266  41.160  1.00 46.91 ? 447  PRO B CB  1 
ATOM   3433  N  N   . ARG B  2  410 ? -5.098  32.540  41.955  1.00 46.91 ? 448  ARG B N   1 
ATOM   3434  C  CA  . ARG B  2  410 ? -4.793  33.933  42.272  1.00 46.91 ? 448  ARG B CA  1 
ATOM   3435  C  C   . ARG B  2  410 ? -3.293  34.220  42.332  1.00 46.91 ? 448  ARG B C   1 
ATOM   3436  O  O   . ARG B  2  410 ? -2.881  35.377  42.422  1.00 46.91 ? 448  ARG B O   1 
ATOM   3437  C  CB  . ARG B  2  410 ? -5.455  34.330  43.595  1.00 46.91 ? 448  ARG B CB  1 
ATOM   3438  N  N   . GLY B  2  411 ? -2.485  33.165  42.336  1.00 46.91 ? 449  GLY B N   1 
ATOM   3439  C  CA  . GLY B  2  411 ? -1.044  33.337  42.382  1.00 46.91 ? 449  GLY B CA  1 
ATOM   3440  C  C   . GLY B  2  411 ? -0.463  33.643  41.017  1.00 46.91 ? 449  GLY B C   1 
ATOM   3441  O  O   . GLY B  2  411 ? 0.384   34.527  40.874  1.00 46.91 ? 449  GLY B O   1 
ATOM   3442  N  N   . TRP B  2  412 ? -0.893  32.878  40.019  1.00 46.91 ? 450  TRP B N   1 
ATOM   3443  C  CA  . TRP B  2  412 ? -0.428  33.052  38.649  1.00 46.91 ? 450  TRP B CA  1 
ATOM   3444  C  C   . TRP B  2  412 ? -1.176  34.173  37.931  1.00 46.91 ? 450  TRP B C   1 
ATOM   3445  O  O   . TRP B  2  412 ? -0.719  34.676  36.901  1.00 46.91 ? 450  TRP B O   1 
ATOM   3446  C  CB  . TRP B  2  412 ? -0.570  31.741  37.878  1.00 46.91 ? 450  TRP B CB  1 
ATOM   3447  C  CG  . TRP B  2  412 ? 0.374   30.678  38.346  1.00 46.91 ? 450  TRP B CG  1 
ATOM   3448  C  CD1 . TRP B  2  412 ? 0.181   29.803  39.379  1.00 46.91 ? 450  TRP B CD1 1 
ATOM   3449  C  CD2 . TRP B  2  412 ? 1.660   30.377  37.800  1.00 46.91 ? 450  TRP B CD2 1 
ATOM   3450  N  NE1 . TRP B  2  412 ? 1.269   28.974  39.508  1.00 46.91 ? 450  TRP B NE1 1 
ATOM   3451  C  CE2 . TRP B  2  412 ? 2.195   29.306  38.550  1.00 46.91 ? 450  TRP B CE2 1 
ATOM   3452  C  CE3 . TRP B  2  412 ? 2.419   30.908  36.747  1.00 46.91 ? 450  TRP B CE3 1 
ATOM   3453  C  CZ2 . TRP B  2  412 ? 3.451   28.752  38.281  1.00 46.91 ? 450  TRP B CZ2 1 
ATOM   3454  C  CZ3 . TRP B  2  412 ? 3.667   30.359  36.480  1.00 46.91 ? 450  TRP B CZ3 1 
ATOM   3455  C  CH2 . TRP B  2  412 ? 4.170   29.293  37.244  1.00 46.91 ? 450  TRP B CH2 1 
ATOM   3456  N  N   . PHE B  2  413 ? -2.341  34.534  38.461  1.00 46.91 ? 451  PHE B N   1 
ATOM   3457  C  CA  . PHE B  2  413 ? -3.158  35.598  37.887  1.00 46.91 ? 451  PHE B CA  1 
ATOM   3458  C  C   . PHE B  2  413 ? -2.610  36.956  38.309  1.00 46.91 ? 451  PHE B C   1 
ATOM   3459  O  O   . PHE B  2  413 ? -2.615  37.909  37.528  1.00 46.91 ? 451  PHE B O   1 
ATOM   3460  C  CB  . PHE B  2  413 ? -4.611  35.461  38.344  1.00 46.91 ? 451  PHE B CB  1 
ATOM   3461  N  N   . THR B  2  414 ? -2.168  37.043  39.560  1.00 46.91 ? 452  THR B N   1 
ATOM   3462  C  CA  . THR B  2  414 ? -1.610  38.278  40.100  1.00 46.91 ? 452  THR B CA  1 
ATOM   3463  C  C   . THR B  2  414 ? -0.186  38.498  39.597  1.00 46.91 ? 452  THR B C   1 
ATOM   3464  O  O   . THR B  2  414 ? 0.370   39.590  39.743  1.00 46.91 ? 452  THR B O   1 
ATOM   3465  C  CB  . THR B  2  414 ? -1.598  38.259  41.638  1.00 46.91 ? 452  THR B CB  1 
ATOM   3466  N  N   . PHE B  2  415 ? 0.412   37.444  39.049  1.00 46.91 ? 453  PHE B N   1 
ATOM   3467  C  CA  . PHE B  2  415 ? 1.769   37.510  38.514  1.00 46.91 ? 453  PHE B CA  1 
ATOM   3468  C  C   . PHE B  2  415 ? 1.760   38.284  37.198  1.00 46.91 ? 453  PHE B C   1 
ATOM   3469  O  O   . PHE B  2  415 ? 2.756   38.910  36.827  1.00 46.91 ? 453  PHE B O   1 
ATOM   3470  C  CB  . PHE B  2  415 ? 2.320   36.097  38.289  1.00 46.91 ? 453  PHE B CB  1 
ATOM   3471  C  CG  . PHE B  2  415 ? 3.754   36.066  37.829  1.00 46.91 ? 453  PHE B CG  1 
ATOM   3472  C  CD1 . PHE B  2  415 ? 4.790   36.345  38.716  1.00 46.91 ? 453  PHE B CD1 1 
ATOM   3473  C  CD2 . PHE B  2  415 ? 4.068   35.757  36.509  1.00 46.91 ? 453  PHE B CD2 1 
ATOM   3474  C  CE1 . PHE B  2  415 ? 6.118   36.316  38.296  1.00 46.91 ? 453  PHE B CE1 1 
ATOM   3475  C  CE2 . PHE B  2  415 ? 5.392   35.725  36.078  1.00 46.91 ? 453  PHE B CE2 1 
ATOM   3476  C  CZ  . PHE B  2  415 ? 6.419   36.005  36.974  1.00 46.91 ? 453  PHE B CZ  1 
ATOM   3477  N  N   . ALA B  2  416 ? 0.642   38.203  36.482  1.00 46.91 ? 454  ALA B N   1 
ATOM   3478  C  CA  . ALA B  2  416 ? 0.482   38.900  35.212  1.00 46.91 ? 454  ALA B CA  1 
ATOM   3479  C  C   . ALA B  2  416 ? 0.291   40.395  35.449  1.00 46.91 ? 454  ALA B C   1 
ATOM   3480  O  O   . ALA B  2  416 ? 0.505   41.205  34.546  1.00 46.91 ? 454  ALA B O   1 
ATOM   3481  C  CB  . ALA B  2  416 ? -0.706  38.332  34.448  1.00 46.91 ? 454  ALA B CB  1 
ATOM   3482  N  N   . HIS B  2  417 ? -0.141  40.747  36.657  1.00 46.91 ? 455  HIS B N   1 
ATOM   3483  C  CA  . HIS B  2  417 ? -0.364  42.139  37.032  1.00 46.91 ? 455  HIS B CA  1 
ATOM   3484  C  C   . HIS B  2  417 ? 0.960   42.880  37.206  1.00 46.91 ? 455  HIS B C   1 
ATOM   3485  O  O   . HIS B  2  417 ? 1.023   44.102  37.054  1.00 46.91 ? 455  HIS B O   1 
ATOM   3486  C  CB  . HIS B  2  417 ? -1.172  42.213  38.329  1.00 46.91 ? 455  HIS B CB  1 
ATOM   3487  N  N   . ALA B  2  418 ? 1.999   42.141  37.584  1.00 59.16 ? 456  ALA B N   1 
ATOM   3488  C  CA  . ALA B  2  418 ? 3.327   42.714  37.777  1.00 59.97 ? 456  ALA B CA  1 
ATOM   3489  C  C   . ALA B  2  418 ? 4.085   42.763  36.453  1.00 60.48 ? 456  ALA B C   1 
ATOM   3490  O  O   . ALA B  2  418 ? 5.027   43.543  36.295  1.00 59.14 ? 456  ALA B O   1 
ATOM   3491  C  CB  . ALA B  2  418 ? 4.106   41.899  38.801  1.00 58.16 ? 456  ALA B CB  1 
ATOM   3492  N  N   . VAL B  2  419 ? 3.696   41.893  35.526  1.00 46.91 ? 457  VAL B N   1 
ATOM   3493  C  CA  . VAL B  2  419 ? 4.319   41.824  34.210  1.00 46.91 ? 457  VAL B CA  1 
ATOM   3494  C  C   . VAL B  2  419 ? 3.645   42.775  33.223  1.00 46.91 ? 457  VAL B C   1 
ATOM   3495  O  O   . VAL B  2  419 ? 4.191   43.064  32.156  1.00 46.91 ? 457  VAL B O   1 
ATOM   3496  C  CB  . VAL B  2  419 ? 4.261   40.391  33.642  1.00 46.91 ? 457  VAL B CB  1 
ATOM   3497  N  N   . PHE B  2  420 ? 2.442   43.224  33.571  1.00 46.91 ? 458  PHE B N   1 
ATOM   3498  C  CA  . PHE B  2  420 ? 1.679   44.141  32.731  1.00 46.91 ? 458  PHE B CA  1 
ATOM   3499  C  C   . PHE B  2  420 ? 2.160   45.577  32.915  1.00 46.91 ? 458  PHE B C   1 
ATOM   3500  O  O   . PHE B  2  420 ? 2.187   46.356  31.963  1.00 46.91 ? 458  PHE B O   1 
ATOM   3501  C  CB  . PHE B  2  420 ? 0.187   44.048  33.061  1.00 46.91 ? 458  PHE B CB  1 
ATOM   3502  N  N   . ALA B  2  421 ? 2.517   45.922  34.148  1.00 46.91 ? 459  ALA B N   1 
ATOM   3503  C  CA  . ALA B  2  421 ? 3.002   47.261  34.471  1.00 46.91 ? 459  ALA B CA  1 
ATOM   3504  C  C   . ALA B  2  421 ? 4.429   47.477  33.968  1.00 46.91 ? 459  ALA B C   1 
ATOM   3505  O  O   . ALA B  2  421 ? 4.971   48.580  34.066  1.00 46.91 ? 459  ALA B O   1 
ATOM   3506  C  CB  . ALA B  2  421 ? 2.930   47.495  35.973  1.00 46.91 ? 459  ALA B CB  1 
ATOM   3507  N  N   . LEU B  2  422 ? 5.047   46.406  33.481  1.00 46.91 ? 460  LEU B N   1 
ATOM   3508  C  CA  . LEU B  2  422 ? 6.407   46.464  32.958  1.00 46.91 ? 460  LEU B CA  1 
ATOM   3509  C  C   . LEU B  2  422 ? 6.410   46.657  31.443  1.00 46.91 ? 460  LEU B C   1 
ATOM   3510  O  O   . LEU B  2  422 ? 7.458   46.908  30.842  1.00 46.91 ? 460  LEU B O   1 
ATOM   3511  C  CB  . LEU B  2  422 ? 7.169   45.187  33.321  1.00 46.91 ? 460  LEU B CB  1 
ATOM   3512  N  N   . LEU B  2  423 ? 5.238   46.514  30.831  1.00 46.91 ? 461  LEU B N   1 
ATOM   3513  C  CA  . LEU B  2  423 ? 5.091   46.670  29.388  1.00 46.91 ? 461  LEU B CA  1 
ATOM   3514  C  C   . LEU B  2  423 ? 4.070   47.749  29.028  1.00 46.91 ? 461  LEU B C   1 
ATOM   3515  O  O   . LEU B  2  423 ? 3.797   47.986  27.848  1.00 46.91 ? 461  LEU B O   1 
ATOM   3516  C  CB  . LEU B  2  423 ? 4.688   45.336  28.751  1.00 46.91 ? 461  LEU B CB  1 
ATOM   3517  N  N   . PHE B  2  424 ? 3.502   48.387  30.047  1.00 46.91 ? 462  PHE B N   1 
ATOM   3518  C  CA  . PHE B  2  424 ? 2.516   49.445  29.850  1.00 46.91 ? 462  PHE B CA  1 
ATOM   3519  C  C   . PHE B  2  424 ? 3.083   50.790  30.298  1.00 46.91 ? 462  PHE B C   1 
ATOM   3520  O  O   . PHE B  2  424 ? 2.669   51.844  29.812  1.00 46.91 ? 462  PHE B O   1 
ATOM   3521  C  CB  . PHE B  2  424 ? 1.236   49.132  30.629  1.00 46.91 ? 462  PHE B CB  1 
ATOM   3522  N  N   . PHE B  2  425 ? 4.000   50.745  31.259  1.00 46.91 ? 463  PHE B N   1 
ATOM   3523  C  CA  . PHE B  2  425 ? 4.638   51.950  31.777  1.00 46.91 ? 463  PHE B CA  1 
ATOM   3524  C  C   . PHE B  2  425 ? 5.921   52.240  31.003  1.00 46.91 ? 463  PHE B C   1 
ATOM   3525  O  O   . PHE B  2  425 ? 6.325   53.397  30.858  1.00 46.91 ? 463  PHE B O   1 
ATOM   3526  C  CB  . PHE B  2  425 ? 4.953   51.787  33.266  1.00 46.91 ? 463  PHE B CB  1 
ATOM   3527  N  N   . PHE B  2  426 ? 6.577   51.176  30.550  1.00 46.91 ? 464  PHE B N   1 
ATOM   3528  C  CA  . PHE B  2  426 ? 7.812   51.286  29.782  1.00 46.91 ? 464  PHE B CA  1 
ATOM   3529  C  C   . PHE B  2  426 ? 7.553   51.018  28.302  1.00 46.91 ? 464  PHE B C   1 
ATOM   3530  O  O   . PHE B  2  426 ? 8.381   51.343  27.449  1.00 46.91 ? 464  PHE B O   1 
ATOM   3531  C  CB  . PHE B  2  426 ? 8.855   50.298  30.314  1.00 46.91 ? 464  PHE B CB  1 
ATOM   3532  N  N   . GLY B  2  427 ? 6.416   50.389  28.012  1.00 46.91 ? 465  GLY B N   1 
ATOM   3533  C  CA  . GLY B  2  427 ? 6.059   50.082  26.639  1.00 46.91 ? 465  GLY B CA  1 
ATOM   3534  C  C   . GLY B  2  427 ? 5.316   51.217  25.960  1.00 46.91 ? 465  GLY B C   1 
ATOM   3535  O  O   . GLY B  2  427 ? 5.443   51.413  24.749  1.00 46.91 ? 465  GLY B O   1 
ATOM   3536  N  N   . HIS B  2  428 ? 4.514   51.942  26.734  1.00 46.91 ? 466  HIS B N   1 
ATOM   3537  C  CA  . HIS B  2  428 ? 3.744   53.065  26.211  1.00 46.91 ? 466  HIS B CA  1 
ATOM   3538  C  C   . HIS B  2  428 ? 4.581   54.342  26.172  1.00 46.91 ? 466  HIS B C   1 
ATOM   3539  O  O   . HIS B  2  428 ? 4.263   55.278  25.437  1.00 46.91 ? 466  HIS B O   1 
ATOM   3540  C  CB  . HIS B  2  428 ? 2.489   53.292  27.055  1.00 46.91 ? 466  HIS B CB  1 
ATOM   3541  N  N   . ILE B  2  429 ? 5.623   54.388  26.998  1.00 46.91 ? 467  ILE B N   1 
ATOM   3542  C  CA  . ILE B  2  429 ? 6.513   55.543  27.059  1.00 46.91 ? 467  ILE B CA  1 
ATOM   3543  C  C   . ILE B  2  429 ? 7.509   55.519  25.902  1.00 46.91 ? 467  ILE B C   1 
ATOM   3544  O  O   . ILE B  2  429 ? 7.918   56.568  25.400  1.00 46.91 ? 467  ILE B O   1 
ATOM   3545  C  CB  . ILE B  2  429 ? 7.294   55.578  28.386  1.00 46.91 ? 467  ILE B CB  1 
ATOM   3546  N  N   . TRP B  2  430 ? 7.930   54.316  25.522  1.00 46.91 ? 468  TRP B N   1 
ATOM   3547  C  CA  . TRP B  2  430 ? 8.874   54.134  24.425  1.00 46.91 ? 468  TRP B CA  1 
ATOM   3548  C  C   . TRP B  2  430 ? 8.173   54.311  23.080  1.00 46.91 ? 468  TRP B C   1 
ATOM   3549  O  O   . TRP B  2  430 ? 8.798   54.700  22.091  1.00 46.91 ? 468  TRP B O   1 
ATOM   3550  C  CB  . TRP B  2  430 ? 9.512   52.745  24.500  1.00 46.91 ? 468  TRP B CB  1 
ATOM   3551  N  N   . HIS B  2  431 ? 6.886   53.980  23.046  1.00 46.91 ? 469  HIS B N   1 
ATOM   3552  C  CA  . HIS B  2  431 ? 6.082   54.100  21.834  1.00 46.91 ? 469  HIS B CA  1 
ATOM   3553  C  C   . HIS B  2  431 ? 5.456   55.488  21.726  1.00 46.91 ? 469  HIS B C   1 
ATOM   3554  O  O   . HIS B  2  431 ? 5.065   55.919  20.640  1.00 46.91 ? 469  HIS B O   1 
ATOM   3555  C  CB  . HIS B  2  431 ? 4.984   53.035  21.818  1.00 46.91 ? 469  HIS B CB  1 
ATOM   3556  N  N   . GLY B  2  432 ? 5.336   56.166  22.863  1.00 46.91 ? 470  GLY B N   1 
ATOM   3557  C  CA  . GLY B  2  432 ? 4.756   57.497  22.881  1.00 46.91 ? 470  GLY B CA  1 
ATOM   3558  C  C   . GLY B  2  432 ? 5.683   58.556  22.318  1.00 46.91 ? 470  GLY B C   1 
ATOM   3559  O  O   . GLY B  2  432 ? 5.228   59.610  21.867  1.00 46.91 ? 470  GLY B O   1 
ATOM   3560  N  N   . ALA B  2  433 ? 6.985   58.290  22.370  1.00 46.91 ? 471  ALA B N   1 
ATOM   3561  C  CA  . ALA B  2  433 ? 7.991   59.219  21.867  1.00 46.91 ? 471  ALA B CA  1 
ATOM   3562  C  C   . ALA B  2  433 ? 8.087   59.187  20.344  1.00 46.91 ? 471  ALA B C   1 
ATOM   3563  O  O   . ALA B  2  433 ? 8.172   60.233  19.700  1.00 46.91 ? 471  ALA B O   1 
ATOM   3564  C  CB  . ALA B  2  433 ? 9.348   58.906  22.487  1.00 46.91 ? 471  ALA B CB  1 
ATOM   3565  N  N   . ARG B  2  434 ? 8.112   57.982  19.783  1.00 46.91 ? 472  ARG B N   1 
ATOM   3566  C  CA  . ARG B  2  434 ? 8.201   57.798  18.336  1.00 46.91 ? 472  ARG B CA  1 
ATOM   3567  C  C   . ARG B  2  434 ? 6.829   57.881  17.669  1.00 46.91 ? 472  ARG B C   1 
ATOM   3568  O  O   . ARG B  2  434 ? 6.689   57.592  16.479  1.00 46.91 ? 472  ARG B O   1 
ATOM   3569  C  CB  . ARG B  2  434 ? 8.852   56.451  18.017  1.00 46.91 ? 472  ARG B CB  1 
ATOM   3570  N  N   . THR B  2  435 ? 5.818   58.249  18.449  1.00 46.91 ? 473  THR B N   1 
ATOM   3571  C  CA  . THR B  2  435 ? 4.456   58.369  17.943  1.00 46.91 ? 473  THR B CA  1 
ATOM   3572  C  C   . THR B  2  435 ? 4.195   59.734  17.315  1.00 46.91 ? 473  THR B C   1 
ATOM   3573  O  O   . THR B  2  435 ? 3.454   59.843  16.337  1.00 46.91 ? 473  THR B O   1 
ATOM   3574  C  CB  . THR B  2  435 ? 3.425   58.136  19.060  1.00 46.91 ? 473  THR B CB  1 
ATOM   3575  N  N   . LEU B  2  436 ? 4.797   60.774  17.887  1.00 46.91 ? 474  LEU B N   1 
ATOM   3576  C  CA  . LEU B  2  436 ? 4.622   62.135  17.388  1.00 46.91 ? 474  LEU B CA  1 
ATOM   3577  C  C   . LEU B  2  436 ? 5.944   62.900  17.327  1.00 46.91 ? 474  LEU B C   1 
ATOM   3578  O  O   . LEU B  2  436 ? 6.069   63.997  17.881  1.00 46.91 ? 474  LEU B O   1 
ATOM   3579  C  CB  . LEU B  2  436 ? 3.614   62.887  18.263  1.00 46.91 ? 474  LEU B CB  1 
ATOM   3580  N  N   . PHE B  2  437 ? 6.919   62.327  16.626  1.00 46.91 ? 475  PHE B N   1 
ATOM   3581  C  CA  . PHE B  2  437 ? 8.233   62.945  16.483  1.00 46.91 ? 475  PHE B CA  1 
ATOM   3582  C  C   . PHE B  2  437 ? 8.984   62.396  15.272  1.00 46.91 ? 475  PHE B C   1 
ATOM   3583  O  O   . PHE B  2  437 ? 8.879   61.213  14.944  1.00 46.91 ? 475  PHE B O   1 
ATOM   3584  C  CB  . PHE B  2  437 ? 9.066   62.730  17.749  1.00 46.91 ? 475  PHE B CB  1 
ATOM   3585  N  N   . ARG B  2  438 ? 9.730   63.270  14.602  1.00 46.91 ? 476  ARG B N   1 
ATOM   3586  C  CA  . ARG B  2  438 ? 10.505  62.884  13.427  1.00 46.91 ? 476  ARG B CA  1 
ATOM   3587  C  C   . ARG B  2  438 ? 11.927  63.437  13.511  1.00 46.91 ? 476  ARG B C   1 
ATOM   3588  O  O   . ARG B  2  438 ? 12.406  64.104  12.590  1.00 46.91 ? 476  ARG B O   1 
ATOM   3589  C  CB  . ARG B  2  438 ? 9.815   63.380  12.152  1.00 46.91 ? 476  ARG B CB  1 
ATOM   3590  N  N   . ASP B  2  439 ? 12.597  63.143  14.622  1.00 46.91 ? 477  ASP B N   1 
ATOM   3591  C  CA  . ASP B  2  439 ? 13.966  63.597  14.853  1.00 46.91 ? 477  ASP B CA  1 
ATOM   3592  C  C   . ASP B  2  439 ? 14.769  62.542  15.612  1.00 46.91 ? 477  ASP B C   1 
ATOM   3593  O  O   . ASP B  2  439 ? 14.303  61.994  16.614  1.00 46.91 ? 477  ASP B O   1 
ATOM   3594  C  CB  . ASP B  2  439 ? 13.963  64.911  15.641  1.00 46.91 ? 477  ASP B CB  1 
ATOM   3595  N  N   . VAL B  2  440 ? 15.977  62.268  15.130  1.00 46.91 ? 478  VAL B N   1 
ATOM   3596  C  CA  . VAL B  2  440 ? 16.852  61.282  15.757  1.00 46.91 ? 478  VAL B CA  1 
ATOM   3597  C  C   . VAL B  2  440 ? 18.304  61.752  15.771  1.00 46.91 ? 478  VAL B C   1 
ATOM   3598  O  O   . VAL B  2  440 ? 18.856  61.976  14.671  1.00 46.91 ? 478  VAL B O   1 
ATOM   3599  C  CB  . VAL B  2  440 ? 16.771  59.919  15.036  1.00 46.91 ? 478  VAL B CB  1 
ATOM   3600  N  N   . LYS C  3  48  ? 53.206  83.847  52.931  1.00 46.91 ? 48   LYS C N   1 
ATOM   3601  C  CA  . LYS C  3  48  ? 52.244  83.565  54.037  1.00 46.91 ? 48   LYS C CA  1 
ATOM   3602  C  C   . LYS C  3  48  ? 52.195  82.069  54.346  1.00 46.91 ? 48   LYS C C   1 
ATOM   3603  O  O   . LYS C  3  48  ? 51.132  81.516  54.636  1.00 46.91 ? 48   LYS C O   1 
ATOM   3604  C  CB  . LYS C  3  48  ? 50.850  84.075  53.662  1.00 46.91 ? 48   LYS C CB  1 
ATOM   3605  N  N   . LEU C  3  49  ? 53.349  81.417  54.240  1.00 46.91 ? 49   LEU C N   1 
ATOM   3606  C  CA  . LEU C  3  49  ? 53.461  79.988  54.507  1.00 46.91 ? 49   LEU C CA  1 
ATOM   3607  C  C   . LEU C  3  49  ? 53.723  79.734  55.989  1.00 46.91 ? 49   LEU C C   1 
ATOM   3608  O  O   . LEU C  3  49  ? 53.282  78.726  56.544  1.00 46.91 ? 49   LEU C O   1 
ATOM   3609  C  CB  . LEU C  3  49  ? 54.587  79.380  53.670  1.00 46.91 ? 49   LEU C CB  1 
ATOM   3610  N  N   . LEU C  3  50  ? 54.488  80.629  56.607  1.00 46.91 ? 50   LEU C N   1 
ATOM   3611  C  CA  . LEU C  3  50  ? 54.821  80.520  58.023  1.00 46.91 ? 50   LEU C CA  1 
ATOM   3612  C  C   . LEU C  3  50  ? 53.699  81.067  58.898  1.00 46.91 ? 50   LEU C C   1 
ATOM   3613  O  O   . LEU C  3  50  ? 53.518  80.624  60.033  1.00 46.91 ? 50   LEU C O   1 
ATOM   3614  C  CB  . LEU C  3  50  ? 56.124  81.267  58.319  1.00 46.91 ? 50   LEU C CB  1 
ATOM   3615  N  N   . GLY C  3  51  ? 52.980  82.057  58.376  1.00 46.91 ? 51   GLY C N   1 
ATOM   3616  C  CA  . GLY C  3  51  ? 51.879  82.657  59.109  1.00 46.91 ? 51   GLY C CA  1 
ATOM   3617  C  C   . GLY C  3  51  ? 50.647  81.772  59.141  1.00 46.91 ? 51   GLY C C   1 
ATOM   3618  O  O   . GLY C  3  51  ? 49.796  81.912  60.019  1.00 46.91 ? 51   GLY C O   1 
ATOM   3619  N  N   . ALA C  3  52  ? 50.529  80.888  58.154  1.00 46.91 ? 52   ALA C N   1 
ATOM   3620  C  CA  . ALA C  3  52  ? 49.399  79.969  58.074  1.00 46.91 ? 52   ALA C CA  1 
ATOM   3621  C  C   . ALA C  3  52  ? 49.567  78.835  59.083  1.00 46.91 ? 52   ALA C C   1 
ATOM   3622  O  O   . ALA C  3  52  ? 48.615  78.109  59.382  1.00 46.91 ? 52   ALA C O   1 
ATOM   3623  C  CB  . ALA C  3  52  ? 49.278  79.406  56.665  1.00 46.91 ? 52   ALA C CB  1 
ATOM   3624  N  N   . HIS C  3  53  ? 50.795  78.657  59.558  1.00 46.91 ? 53   HIS C N   1 
ATOM   3625  C  CA  . HIS C  3  53  ? 51.112  77.623  60.534  1.00 46.91 ? 53   HIS C CA  1 
ATOM   3626  C  C   . HIS C  3  53  ? 51.025  78.172  61.956  1.00 46.91 ? 53   HIS C C   1 
ATOM   3627  O  O   . HIS C  3  53  ? 50.805  77.417  62.907  1.00 46.91 ? 53   HIS C O   1 
ATOM   3628  C  CB  . HIS C  3  53  ? 52.514  77.068  60.279  1.00 46.91 ? 53   HIS C CB  1 
ATOM   3629  N  N   . VAL C  3  54  ? 51.244  79.476  62.094  1.00 46.91 ? 54   VAL C N   1 
ATOM   3630  C  CA  . VAL C  3  54  ? 51.191  80.145  63.390  1.00 46.91 ? 54   VAL C CA  1 
ATOM   3631  C  C   . VAL C  3  54  ? 49.750  80.431  63.801  1.00 46.91 ? 54   VAL C C   1 
ATOM   3632  O  O   . VAL C  3  54  ? 49.359  80.173  64.939  1.00 46.91 ? 54   VAL C O   1 
ATOM   3633  C  CB  . VAL C  3  54  ? 51.972  81.472  63.367  1.00 46.91 ? 54   VAL C CB  1 
ATOM   3634  N  N   . ALA C  3  55  ? 48.970  80.972  62.868  1.00 46.91 ? 55   ALA C N   1 
ATOM   3635  C  CA  . ALA C  3  55  ? 47.569  81.295  63.117  1.00 46.91 ? 55   ALA C CA  1 
ATOM   3636  C  C   . ALA C  3  55  ? 46.726  80.027  63.248  1.00 46.91 ? 55   ALA C C   1 
ATOM   3637  O  O   . ALA C  3  55  ? 45.535  80.088  63.564  1.00 46.91 ? 55   ALA C O   1 
ATOM   3638  C  CB  . ALA C  3  55  ? 47.027  82.177  61.999  1.00 46.91 ? 55   ALA C CB  1 
ATOM   3639  N  N   . HIS C  3  56  ? 47.338  78.886  62.946  1.00 46.91 ? 56   HIS C N   1 
ATOM   3640  C  CA  . HIS C  3  56  ? 46.667  77.597  63.036  1.00 46.91 ? 56   HIS C CA  1 
ATOM   3641  C  C   . HIS C  3  56  ? 46.991  76.921  64.364  1.00 46.91 ? 56   HIS C C   1 
ATOM   3642  O  O   . HIS C  3  56  ? 46.174  76.173  64.904  1.00 46.91 ? 56   HIS C O   1 
ATOM   3643  C  CB  . HIS C  3  56  ? 47.094  76.694  61.877  1.00 46.91 ? 56   HIS C CB  1 
ATOM   3644  C  CG  . HIS C  3  56  ? 46.459  75.340  61.901  1.00 46.91 ? 56   HIS C CG  1 
ATOM   3645  N  ND1 . HIS C  3  56  ? 47.132  74.209  62.314  1.00 46.91 ? 56   HIS C ND1 1 
ATOM   3646  C  CD2 . HIS C  3  56  ? 45.210  74.934  61.572  1.00 46.91 ? 56   HIS C CD2 1 
ATOM   3647  C  CE1 . HIS C  3  56  ? 46.324  73.167  62.240  1.00 46.91 ? 56   HIS C CE1 1 
ATOM   3648  N  NE2 . HIS C  3  56  ? 45.152  73.580  61.792  1.00 46.91 ? 56   HIS C NE2 1 
ATOM   3649  N  N   . ALA C  3  57  ? 48.211  77.139  64.847  1.00 46.91 ? 57   ALA C N   1 
ATOM   3650  C  CA  . ALA C  3  57  ? 48.663  76.566  66.109  1.00 46.91 ? 57   ALA C CA  1 
ATOM   3651  C  C   . ALA C  3  57  ? 48.100  77.343  67.296  1.00 46.91 ? 57   ALA C C   1 
ATOM   3652  O  O   . ALA C  3  57  ? 47.985  76.806  68.399  1.00 46.91 ? 57   ALA C O   1 
ATOM   3653  C  CB  . ALA C  3  57  ? 50.185  76.550  66.163  1.00 46.91 ? 57   ALA C CB  1 
ATOM   3654  N  N   . GLY C  3  58  ? 47.798  78.618  67.069  1.00 46.91 ? 58   GLY C N   1 
ATOM   3655  C  CA  . GLY C  3  58  ? 47.247  79.457  68.118  1.00 46.91 ? 58   GLY C CA  1 
ATOM   3656  C  C   . GLY C  3  58  ? 45.734  79.362  68.184  1.00 46.91 ? 58   GLY C C   1 
ATOM   3657  O  O   . GLY C  3  58  ? 45.122  79.754  69.178  1.00 46.91 ? 58   GLY C O   1 
ATOM   3658  N  N   . LEU C  3  59  ? 45.127  78.873  67.107  1.00 46.91 ? 59   LEU C N   1 
ATOM   3659  C  CA  . LEU C  3  59  ? 43.679  78.720  67.034  1.00 46.91 ? 59   LEU C CA  1 
ATOM   3660  C  C   . LEU C  3  59  ? 43.249  77.290  67.356  1.00 46.91 ? 59   LEU C C   1 
ATOM   3661  O  O   . LEU C  3  59  ? 42.060  77.019  67.537  1.00 46.91 ? 59   LEU C O   1 
ATOM   3662  C  CB  . LEU C  3  59  ? 43.172  79.112  65.644  1.00 46.91 ? 59   LEU C CB  1 
ATOM   3663  N  N   . ILE C  3  60  ? 44.213  76.374  67.373  1.00 46.91 ? 60   ILE C N   1 
ATOM   3664  C  CA  . ILE C  3  60  ? 43.945  74.972  67.672  1.00 46.91 ? 60   ILE C CA  1 
ATOM   3665  C  C   . ILE C  3  60  ? 44.290  74.642  69.121  1.00 46.91 ? 60   ILE C C   1 
ATOM   3666  O  O   . ILE C  3  60  ? 43.791  73.661  69.677  1.00 46.91 ? 60   ILE C O   1 
ATOM   3667  C  CB  . ILE C  3  60  ? 44.745  74.035  66.746  1.00 46.91 ? 60   ILE C CB  1 
ATOM   3668  N  N   . VAL C  3  61  ? 45.186  75.431  69.706  1.00 46.91 ? 61   VAL C N   1 
ATOM   3669  C  CA  . VAL C  3  61  ? 45.602  75.240  71.090  1.00 46.91 ? 61   VAL C CA  1 
ATOM   3670  C  C   . VAL C  3  61  ? 44.677  76.003  72.033  1.00 46.91 ? 61   VAL C C   1 
ATOM   3671  O  O   . VAL C  3  61  ? 44.466  75.592  73.175  1.00 46.91 ? 61   VAL C O   1 
ATOM   3672  C  CB  . VAL C  3  61  ? 47.048  75.721  71.313  1.00 46.91 ? 61   VAL C CB  1 
ATOM   3673  N  N   . PHE C  3  62  ? 44.162  77.133  71.557  1.00 46.91 ? 62   PHE C N   1 
ATOM   3674  C  CA  . PHE C  3  62  ? 43.253  77.962  72.342  1.00 46.91 ? 62   PHE C CA  1 
ATOM   3675  C  C   . PHE C  3  62  ? 41.825  77.431  72.250  1.00 46.91 ? 62   PHE C C   1 
ATOM   3676  O  O   . PHE C  3  62  ? 40.941  77.865  72.993  1.00 46.91 ? 62   PHE C O   1 
ATOM   3677  C  CB  . PHE C  3  62  ? 43.301  79.411  71.855  1.00 46.91 ? 62   PHE C CB  1 
ATOM   3678  N  N   . TRP C  3  63  ? 41.594  76.530  71.299  1.00 46.91 ? 63   TRP C N   1 
ATOM   3679  C  CA  . TRP C  3  63  ? 40.281  75.930  71.101  1.00 46.91 ? 63   TRP C CA  1 
ATOM   3680  C  C   . TRP C  3  63  ? 40.195  74.589  71.824  1.00 46.91 ? 63   TRP C C   1 
ATOM   3681  O  O   . TRP C  3  63  ? 39.105  74.129  72.171  1.00 46.91 ? 63   TRP C O   1 
ATOM   3682  C  CB  . TRP C  3  63  ? 40.004  75.735  69.609  1.00 46.91 ? 63   TRP C CB  1 
ATOM   3683  N  N   . ALA C  3  64  ? 41.346  73.945  71.998  1.00 46.91 ? 64   ALA C N   1 
ATOM   3684  C  CA  . ALA C  3  64  ? 41.423  72.660  72.682  1.00 46.91 ? 64   ALA C CA  1 
ATOM   3685  C  C   . ALA C  3  64  ? 41.666  72.868  74.173  1.00 46.91 ? 64   ALA C C   1 
ATOM   3686  O  O   . ALA C  3  64  ? 41.322  72.012  74.993  1.00 46.91 ? 64   ALA C O   1 
ATOM   3687  C  CB  . ALA C  3  64  ? 42.532  71.810  72.080  1.00 46.91 ? 64   ALA C CB  1 
ATOM   3688  N  N   . GLY C  3  65  ? 42.298  73.990  74.509  1.00 46.91 ? 65   GLY C N   1 
ATOM   3689  C  CA  . GLY C  3  65  ? 42.582  74.308  75.897  1.00 46.91 ? 65   GLY C CA  1 
ATOM   3690  C  C   . GLY C  3  65  ? 41.377  74.906  76.594  1.00 46.91 ? 65   GLY C C   1 
ATOM   3691  O  O   . GLY C  3  65  ? 41.095  74.580  77.748  1.00 46.91 ? 65   GLY C O   1 
ATOM   3692  N  N   . ALA C  3  66  ? 40.679  75.799  75.898  1.00 46.91 ? 66   ALA C N   1 
ATOM   3693  C  CA  . ALA C  3  66  ? 39.491  76.449  76.440  1.00 46.91 ? 66   ALA C CA  1 
ATOM   3694  C  C   . ALA C  3  66  ? 38.334  75.462  76.556  1.00 46.91 ? 66   ALA C C   1 
ATOM   3695  O  O   . ALA C  3  66  ? 37.407  75.668  77.342  1.00 46.91 ? 66   ALA C O   1 
ATOM   3696  C  CB  . ALA C  3  66  ? 39.092  77.629  75.566  1.00 46.91 ? 66   ALA C CB  1 
ATOM   3697  N  N   . MET C  3  67  ? 38.368  74.421  75.728  1.00 46.91 ? 67   MET C N   1 
ATOM   3698  C  CA  . MET C  3  67  ? 37.338  73.389  75.739  1.00 46.91 ? 67   MET C CA  1 
ATOM   3699  C  C   . MET C  3  67  ? 37.584  72.424  76.895  1.00 46.91 ? 67   MET C C   1 
ATOM   3700  O  O   . MET C  3  67  ? 36.699  71.658  77.277  1.00 46.91 ? 67   MET C O   1 
ATOM   3701  C  CB  . MET C  3  67  ? 37.340  72.621  74.414  1.00 46.91 ? 67   MET C CB  1 
ATOM   3702  N  N   . THR C  3  68  ? 38.808  72.442  77.414  1.00 46.91 ? 68   THR C N   1 
ATOM   3703  C  CA  . THR C  3  68  ? 39.199  71.586  78.527  1.00 46.91 ? 68   THR C CA  1 
ATOM   3704  C  C   . THR C  3  68  ? 38.989  72.295  79.861  1.00 46.91 ? 68   THR C C   1 
ATOM   3705  O  O   . THR C  3  68  ? 38.721  71.653  80.878  1.00 46.91 ? 68   THR C O   1 
ATOM   3706  C  CB  . THR C  3  68  ? 40.677  71.174  78.418  1.00 46.91 ? 68   THR C CB  1 
ATOM   3707  N  N   . LEU C  3  69  ? 39.153  73.615  79.857  1.00 46.91 ? 69   LEU C N   1 
ATOM   3708  C  CA  . LEU C  3  69  ? 38.983  74.425  81.058  1.00 46.91 ? 69   LEU C CA  1 
ATOM   3709  C  C   . LEU C  3  69  ? 37.506  74.677  81.351  1.00 46.91 ? 69   LEU C C   1 
ATOM   3710  O  O   . LEU C  3  69  ? 37.125  74.928  82.498  1.00 46.91 ? 69   LEU C O   1 
ATOM   3711  C  CB  . LEU C  3  69  ? 39.718  75.758  80.907  1.00 46.91 ? 69   LEU C CB  1 
ATOM   3712  N  N   . PHE C  3  70  ? 36.689  74.655  80.303  1.00 46.91 ? 70   PHE C N   1 
ATOM   3713  C  CA  . PHE C  3  70  ? 35.253  74.870  80.437  1.00 46.91 ? 70   PHE C CA  1 
ATOM   3714  C  C   . PHE C  3  70  ? 34.535  73.563  80.761  1.00 46.91 ? 70   PHE C C   1 
ATOM   3715  O  O   . PHE C  3  70  ? 33.366  73.567  81.153  1.00 46.91 ? 70   PHE C O   1 
ATOM   3716  C  CB  . PHE C  3  70  ? 34.684  75.473  79.150  1.00 46.91 ? 70   PHE C CB  1 
ATOM   3717  N  N   . GLU C  3  71  ? 35.230  72.448  80.554  1.00 46.91 ? 71   GLU C N   1 
ATOM   3718  C  CA  . GLU C  3  71  ? 34.681  71.124  80.822  1.00 46.91 ? 71   GLU C CA  1 
ATOM   3719  C  C   . GLU C  3  71  ? 35.107  70.617  82.196  1.00 46.91 ? 71   GLU C C   1 
ATOM   3720  O  O   . GLU C  3  71  ? 34.400  69.823  82.818  1.00 46.91 ? 71   GLU C O   1 
ATOM   3721  C  CB  . GLU C  3  71  ? 35.133  70.135  79.745  1.00 46.91 ? 71   GLU C CB  1 
ATOM   3722  N  N   . LEU C  3  72  ? 36.280  71.055  82.646  1.00 46.91 ? 72   LEU C N   1 
ATOM   3723  C  CA  . LEU C  3  72  ? 36.812  70.657  83.945  1.00 46.91 ? 72   LEU C CA  1 
ATOM   3724  C  C   . LEU C  3  72  ? 36.018  71.299  85.080  1.00 46.91 ? 72   LEU C C   1 
ATOM   3725  O  O   . LEU C  3  72  ? 35.951  70.759  86.186  1.00 46.91 ? 72   LEU C O   1 
ATOM   3726  C  CB  . LEU C  3  72  ? 38.286  71.051  84.057  1.00 46.91 ? 72   LEU C CB  1 
ATOM   3727  N  N   . ALA C  3  73  ? 35.455  72.474  84.810  1.00 46.91 ? 73   ALA C N   1 
ATOM   3728  C  CA  . ALA C  3  73  ? 34.662  73.198  85.797  1.00 46.91 ? 73   ALA C CA  1 
ATOM   3729  C  C   . ALA C  3  73  ? 33.184  72.830  85.687  1.00 46.91 ? 73   ALA C C   1 
ATOM   3730  O  O   . ALA C  3  73  ? 32.391  73.133  86.582  1.00 46.91 ? 73   ALA C O   1 
ATOM   3731  C  CB  . ALA C  3  73  ? 34.850  74.697  85.622  1.00 46.91 ? 73   ALA C CB  1 
ATOM   3732  N  N   . HIS C  3  74  ? 32.813  72.221  84.565  1.00 46.91 ? 74   HIS C N   1 
ATOM   3733  C  CA  . HIS C  3  74  ? 31.434  71.807  84.327  1.00 46.91 ? 74   HIS C CA  1 
ATOM   3734  C  C   . HIS C  3  74  ? 31.157  70.458  84.982  1.00 46.91 ? 74   HIS C C   1 
ATOM   3735  O  O   . HIS C  3  74  ? 30.077  70.238  85.537  1.00 46.91 ? 74   HIS C O   1 
ATOM   3736  C  CB  . HIS C  3  74  ? 31.159  71.718  82.825  1.00 46.91 ? 74   HIS C CB  1 
ATOM   3737  N  N   . PHE C  3  75  ? 32.122  69.550  84.875  1.00 46.91 ? 75   PHE C N   1 
ATOM   3738  C  CA  . PHE C  3  75  ? 32.006  68.216  85.449  1.00 46.91 ? 75   PHE C CA  1 
ATOM   3739  C  C   . PHE C  3  75  ? 32.598  68.176  86.859  1.00 46.91 ? 75   PHE C C   1 
ATOM   3740  O  O   . PHE C  3  75  ? 32.128  68.882  87.754  1.00 46.91 ? 75   PHE C O   1 
ATOM   3741  C  CB  . PHE C  3  75  ? 32.697  67.189  84.544  1.00 46.91 ? 75   PHE C CB  1 
ATOM   3742  N  N   . ILE C  3  76  ? 33.617  67.337  87.052  1.00 46.91 ? 76   ILE C N   1 
ATOM   3743  C  CA  . ILE C  3  76  ? 34.294  67.183  88.340  1.00 46.91 ? 76   ILE C CA  1 
ATOM   3744  C  C   . ILE C  3  76  ? 33.306  66.959  89.486  1.00 46.91 ? 76   ILE C C   1 
ATOM   3745  O  O   . ILE C  3  76  ? 33.413  67.577  90.547  1.00 46.91 ? 76   ILE C O   1 
ATOM   3746  C  CB  . ILE C  3  76  ? 35.186  68.404  88.657  1.00 46.91 ? 76   ILE C CB  1 
ATOM   3747  N  N   . PRO C  3  77  ? 32.345  66.043  89.284  1.00 46.91 ? 77   PRO C N   1 
ATOM   3748  C  CA  . PRO C  3  77  ? 31.275  65.627  90.198  1.00 46.91 ? 77   PRO C CA  1 
ATOM   3749  C  C   . PRO C  3  77  ? 31.741  65.429  91.640  1.00 46.91 ? 77   PRO C C   1 
ATOM   3750  O  O   . PRO C  3  77  ? 31.469  66.263  92.505  1.00 46.91 ? 77   PRO C O   1 
ATOM   3751  C  CB  . PRO C  3  77  ? 30.775  64.316  89.584  1.00 46.91 ? 77   PRO C CB  1 
ATOM   3752  N  N   . GLU C  3  78  ? 32.416  64.311  91.894  1.00 46.91 ? 78   GLU C N   1 
ATOM   3753  C  CA  . GLU C  3  78  ? 32.924  63.991  93.227  1.00 46.91 ? 78   GLU C CA  1 
ATOM   3754  C  C   . GLU C  3  78  ? 33.743  62.707  93.203  1.00 46.91 ? 78   GLU C C   1 
ATOM   3755  O  O   . GLU C  3  78  ? 34.892  62.683  93.645  1.00 46.91 ? 78   GLU C O   1 
ATOM   3756  C  CB  . GLU C  3  78  ? 31.766  63.838  94.220  1.00 46.91 ? 78   GLU C CB  1 
ATOM   3757  N  N   . LYS C  3  79  ? 33.136  61.638  92.696  1.00 46.91 ? 79   LYS C N   1 
ATOM   3758  C  CA  . LYS C  3  79  ? 33.798  60.342  92.614  1.00 46.91 ? 79   LYS C CA  1 
ATOM   3759  C  C   . LYS C  3  79  ? 33.469  59.638  91.302  1.00 46.91 ? 79   LYS C C   1 
ATOM   3760  O  O   . LYS C  3  79  ? 34.192  58.739  90.869  1.00 46.91 ? 79   LYS C O   1 
ATOM   3761  C  CB  . LYS C  3  79  ? 33.389  59.461  93.795  1.00 46.91 ? 79   LYS C CB  1 
ATOM   3762  N  N   . PRO C  3  80  ? 32.345  60.015  90.673  1.00 46.91 ? 80   PRO C N   1 
ATOM   3763  C  CA  . PRO C  3  80  ? 31.876  59.449  89.404  1.00 46.91 ? 80   PRO C CA  1 
ATOM   3764  C  C   . PRO C  3  80  ? 32.616  60.053  88.211  1.00 46.91 ? 80   PRO C C   1 
ATOM   3765  O  O   . PRO C  3  80  ? 32.146  61.015  87.600  1.00 46.91 ? 80   PRO C O   1 
ATOM   3766  C  CB  . PRO C  3  80  ? 30.388  59.809  89.385  1.00 46.91 ? 80   PRO C CB  1 
ATOM   3767  N  N   . MET C  3  81  ? 33.791  59.507  87.917  1.00 46.91 ? 81   MET C N   1 
ATOM   3768  C  CA  . MET C  3  81  ? 34.607  59.982  86.806  1.00 46.91 ? 81   MET C CA  1 
ATOM   3769  C  C   . MET C  3  81  ? 34.211  59.282  85.505  1.00 46.91 ? 81   MET C C   1 
ATOM   3770  O  O   . MET C  3  81  ? 33.139  58.676  85.416  1.00 46.91 ? 81   MET C O   1 
ATOM   3771  C  CB  . MET C  3  81  ? 36.090  59.742  87.100  1.00 46.91 ? 81   MET C CB  1 
ATOM   3772  N  N   . TYR C  3  82  ? 35.086  59.367  84.504  1.00 46.91 ? 82   TYR C N   1 
ATOM   3773  C  CA  . TYR C  3  82  ? 34.865  58.754  83.193  1.00 46.91 ? 82   TYR C CA  1 
ATOM   3774  C  C   . TYR C  3  82  ? 33.636  59.302  82.466  1.00 46.91 ? 82   TYR C C   1 
ATOM   3775  O  O   . TYR C  3  82  ? 33.191  58.733  81.470  1.00 46.91 ? 82   TYR C O   1 
ATOM   3776  C  CB  . TYR C  3  82  ? 34.771  57.230  83.327  1.00 46.91 ? 82   TYR C CB  1 
ATOM   3777  N  N   . GLU C  3  83  ? 33.109  60.420  82.955  1.00 46.91 ? 83   GLU C N   1 
ATOM   3778  C  CA  . GLU C  3  83  ? 31.940  61.045  82.354  1.00 46.91 ? 83   GLU C CA  1 
ATOM   3779  C  C   . GLU C  3  83  ? 32.323  62.351  81.667  1.00 46.91 ? 83   GLU C C   1 
ATOM   3780  O  O   . GLU C  3  83  ? 32.331  63.410  82.296  1.00 46.91 ? 83   GLU C O   1 
ATOM   3781  C  CB  . GLU C  3  83  ? 30.872  61.307  83.420  1.00 46.91 ? 83   GLU C CB  1 
ATOM   3782  N  N   . GLN C  3  84  ? 32.630  62.266  80.375  1.00 46.91 ? 84   GLN C N   1 
ATOM   3783  C  CA  . GLN C  3  84  ? 33.021  63.422  79.566  1.00 46.91 ? 84   GLN C CA  1 
ATOM   3784  C  C   . GLN C  3  84  ? 34.358  64.035  79.987  1.00 46.91 ? 84   GLN C C   1 
ATOM   3785  O  O   . GLN C  3  84  ? 34.415  64.904  80.863  1.00 46.91 ? 84   GLN C O   1 
ATOM   3786  C  CB  . GLN C  3  84  ? 31.918  64.487  79.569  1.00 46.91 ? 84   GLN C CB  1 
ATOM   3787  N  N   . GLY C  3  85  ? 35.428  63.593  79.336  1.00 46.91 ? 85   GLY C N   1 
ATOM   3788  C  CA  . GLY C  3  85  ? 36.752  64.101  79.643  1.00 46.91 ? 85   GLY C CA  1 
ATOM   3789  C  C   . GLY C  3  85  ? 37.810  63.534  78.716  1.00 46.91 ? 85   GLY C C   1 
ATOM   3790  O  O   . GLY C  3  85  ? 38.716  62.825  79.153  1.00 46.91 ? 85   GLY C O   1 
ATOM   3791  N  N   . LEU C  3  86  ? 37.681  63.835  77.426  1.00 46.91 ? 86   LEU C N   1 
ATOM   3792  C  CA  . LEU C  3  86  ? 38.624  63.362  76.420  1.00 46.91 ? 86   LEU C CA  1 
ATOM   3793  C  C   . LEU C  3  86  ? 39.929  64.156  76.453  1.00 46.91 ? 86   LEU C C   1 
ATOM   3794  O  O   . LEU C  3  86  ? 40.978  63.653  76.046  1.00 46.91 ? 86   LEU C O   1 
ATOM   3795  C  CB  . LEU C  3  86  ? 38.000  63.453  75.026  1.00 46.91 ? 86   LEU C CB  1 
ATOM   3796  N  N   . ILE C  3  87  ? 39.851  65.404  76.907  1.00 46.91 ? 87   ILE C N   1 
ATOM   3797  C  CA  . ILE C  3  87  ? 41.022  66.269  76.993  1.00 46.91 ? 87   ILE C CA  1 
ATOM   3798  C  C   . ILE C  3  87  ? 41.635  66.257  78.391  1.00 46.91 ? 87   ILE C C   1 
ATOM   3799  O  O   . ILE C  3  87  ? 42.848  66.409  78.548  1.00 46.91 ? 87   ILE C O   1 
ATOM   3800  C  CB  . ILE C  3  87  ? 40.671  67.720  76.606  1.00 46.91 ? 87   ILE C CB  1 
ATOM   3801  N  N   . LEU C  3  88  ? 40.789  66.085  79.402  1.00 46.91 ? 88   LEU C N   1 
ATOM   3802  C  CA  . LEU C  3  88  ? 41.239  66.057  80.791  1.00 46.91 ? 88   LEU C CA  1 
ATOM   3803  C  C   . LEU C  3  88  ? 41.845  64.708  81.197  1.00 46.91 ? 88   LEU C C   1 
ATOM   3804  O  O   . LEU C  3  88  ? 42.488  64.603  82.242  1.00 46.91 ? 88   LEU C O   1 
ATOM   3805  C  CB  . LEU C  3  88  ? 40.080  66.411  81.728  1.00 46.91 ? 88   LEU C CB  1 
ATOM   3806  N  N   . ILE C  3  89  ? 41.632  63.692  80.367  1.00 46.91 ? 89   ILE C N   1 
ATOM   3807  C  CA  . ILE C  3  89  ? 42.148  62.351  80.625  1.00 46.91 ? 89   ILE C CA  1 
ATOM   3808  C  C   . ILE C  3  89  ? 43.656  62.217  80.374  1.00 46.91 ? 89   ILE C C   1 
ATOM   3809  O  O   . ILE C  3  89  ? 44.377  61.653  81.199  1.00 46.91 ? 89   ILE C O   1 
ATOM   3810  C  CB  . ILE C  3  89  ? 41.394  61.285  79.794  1.00 46.91 ? 89   ILE C CB  1 
ATOM   3811  N  N   . PRO C  3  90  ? 44.145  62.700  79.215  1.00 46.91 ? 90   PRO C N   1 
ATOM   3812  C  CA  . PRO C  3  90  ? 45.572  62.622  78.878  1.00 46.91 ? 90   PRO C CA  1 
ATOM   3813  C  C   . PRO C  3  90  ? 46.461  63.472  79.786  1.00 46.91 ? 90   PRO C C   1 
ATOM   3814  O  O   . PRO C  3  90  ? 47.690  63.388  79.719  1.00 46.91 ? 90   PRO C O   1 
ATOM   3815  C  CB  . PRO C  3  90  ? 45.608  63.144  77.439  1.00 46.91 ? 90   PRO C CB  1 
ATOM   3816  C  CG  . PRO C  3  90  ? 44.244  62.803  76.914  1.00 46.91 ? 90   PRO C CG  1 
ATOM   3817  C  CD  . PRO C  3  90  ? 43.383  63.216  78.067  1.00 46.91 ? 90   PRO C CD  1 
ATOM   3818  N  N   . HIS C  3  91  ? 45.838  64.323  80.592  1.00 46.91 ? 91   HIS C N   1 
ATOM   3819  C  CA  . HIS C  3  91  ? 46.569  65.193  81.504  1.00 46.91 ? 91   HIS C CA  1 
ATOM   3820  C  C   . HIS C  3  91  ? 47.161  64.420  82.678  1.00 46.91 ? 91   HIS C C   1 
ATOM   3821  O  O   . HIS C  3  91  ? 48.325  64.617  83.034  1.00 46.91 ? 91   HIS C O   1 
ATOM   3822  C  CB  . HIS C  3  91  ? 45.651  66.301  82.024  1.00 46.91 ? 91   HIS C CB  1 
ATOM   3823  N  N   . ILE C  3  92  ? 46.355  63.540  83.265  1.00 46.91 ? 92   ILE C N   1 
ATOM   3824  C  CA  . ILE C  3  92  ? 46.775  62.732  84.404  1.00 46.91 ? 92   ILE C CA  1 
ATOM   3825  C  C   . ILE C  3  92  ? 47.956  61.821  84.077  1.00 46.91 ? 92   ILE C C   1 
ATOM   3826  O  O   . ILE C  3  92  ? 48.716  61.435  84.965  1.00 46.91 ? 92   ILE C O   1 
ATOM   3827  C  CB  . ILE C  3  92  ? 45.610  61.873  84.929  1.00 46.91 ? 92   ILE C CB  1 
ATOM   3828  N  N   . ALA C  3  93  ? 48.106  61.477  82.803  1.00 46.91 ? 93   ALA C N   1 
ATOM   3829  C  CA  . ALA C  3  93  ? 49.197  60.613  82.369  1.00 46.91 ? 93   ALA C CA  1 
ATOM   3830  C  C   . ALA C  3  93  ? 50.512  61.383  82.263  1.00 46.91 ? 93   ALA C C   1 
ATOM   3831  O  O   . ALA C  3  93  ? 51.365  61.063  81.430  1.00 46.91 ? 93   ALA C O   1 
ATOM   3832  C  CB  . ALA C  3  93  ? 48.851  59.969  81.039  1.00 46.91 ? 93   ALA C CB  1 
ATOM   3833  N  N   . THR C  3  94  ? 50.676  62.389  83.117  1.00 46.91 ? 94   THR C N   1 
ATOM   3834  C  CA  . THR C  3  94  ? 51.876  63.216  83.124  1.00 46.91 ? 94   THR C CA  1 
ATOM   3835  C  C   . THR C  3  94  ? 51.909  64.107  84.359  1.00 46.91 ? 94   THR C C   1 
ATOM   3836  O  O   . THR C  3  94  ? 52.969  64.331  84.948  1.00 46.91 ? 94   THR C O   1 
ATOM   3837  C  CB  . THR C  3  94  ? 51.938  64.113  81.875  1.00 46.91 ? 94   THR C CB  1 
ATOM   3838  N  N   . LEU C  3  95  ? 50.747  64.642  84.727  1.00 46.91 ? 95   LEU C N   1 
ATOM   3839  C  CA  . LEU C  3  95  ? 50.624  65.518  85.886  1.00 46.91 ? 95   LEU C CA  1 
ATOM   3840  C  C   . LEU C  3  95  ? 49.155  65.757  86.217  1.00 46.91 ? 95   LEU C C   1 
ATOM   3841  O  O   . LEU C  3  95  ? 48.513  66.636  85.634  1.00 46.91 ? 95   LEU C O   1 
ATOM   3842  C  CB  . LEU C  3  95  ? 51.317  66.858  85.619  1.00 46.91 ? 95   LEU C CB  1 
ATOM   3843  N  N   . GLY C  3  96  ? 48.636  64.995  87.173  1.00 46.91 ? 96   GLY C N   1 
ATOM   3844  C  CA  . GLY C  3  96  ? 47.245  65.147  87.558  1.00 46.91 ? 96   GLY C CA  1 
ATOM   3845  C  C   . GLY C  3  96  ? 46.846  64.279  88.734  1.00 46.91 ? 96   GLY C C   1 
ATOM   3846  O  O   . GLY C  3  96  ? 45.919  63.472  88.627  1.00 46.91 ? 96   GLY C O   1 
ATOM   3847  N  N   . TRP C  3  97  ? 47.522  64.467  89.864  1.00 46.91 ? 97   TRP C N   1 
ATOM   3848  C  CA  . TRP C  3  97  ? 47.249  63.711  91.082  1.00 46.91 ? 97   TRP C CA  1 
ATOM   3849  C  C   . TRP C  3  97  ? 47.502  62.214  90.887  1.00 46.91 ? 97   TRP C C   1 
ATOM   3850  O  O   . TRP C  3  97  ? 48.358  61.821  90.094  1.00 46.91 ? 97   TRP C O   1 
ATOM   3851  C  CB  . TRP C  3  97  ? 45.811  63.956  91.554  1.00 46.91 ? 97   TRP C CB  1 
ATOM   3852  N  N   . GLY C  3  98  ? 46.777  61.390  91.638  1.00 46.91 ? 98   GLY C N   1 
ATOM   3853  C  CA  . GLY C  3  98  ? 46.938  59.951  91.535  1.00 46.91 ? 98   GLY C CA  1 
ATOM   3854  C  C   . GLY C  3  98  ? 45.694  59.196  91.966  1.00 46.91 ? 98   GLY C C   1 
ATOM   3855  O  O   . GLY C  3  98  ? 45.172  59.423  93.062  1.00 46.91 ? 98   GLY C O   1 
ATOM   3856  N  N   . VAL C  3  99  ? 45.249  58.274  91.114  1.00 46.91 ? 99   VAL C N   1 
ATOM   3857  C  CA  . VAL C  3  99  ? 44.060  57.455  91.356  1.00 46.91 ? 99   VAL C CA  1 
ATOM   3858  C  C   . VAL C  3  99  ? 42.781  58.287  91.334  1.00 46.91 ? 99   VAL C C   1 
ATOM   3859  O  O   . VAL C  3  99  ? 42.193  58.502  90.274  1.00 46.91 ? 99   VAL C O   1 
ATOM   3860  C  CB  . VAL C  3  99  ? 44.152  56.672  92.689  1.00 46.91 ? 99   VAL C CB  1 
ATOM   3861  N  N   . GLY C  3  100 ? 42.329  58.715  92.509  1.00 46.91 ? 100  GLY C N   1 
ATOM   3862  C  CA  . GLY C  3  100 ? 41.125  59.520  92.591  1.00 46.91 ? 100  GLY C CA  1 
ATOM   3863  C  C   . GLY C  3  100 ? 41.442  61.004  92.616  1.00 46.91 ? 100  GLY C C   1 
ATOM   3864  O  O   . GLY C  3  100 ? 42.606  61.390  92.518  1.00 46.91 ? 100  GLY C O   1 
ATOM   3865  N  N   . PRO C  3  101 ? 40.420  61.866  92.732  1.00 46.91 ? 101  PRO C N   1 
ATOM   3866  C  CA  . PRO C  3  101 ? 40.621  63.318  92.768  1.00 46.91 ? 101  PRO C CA  1 
ATOM   3867  C  C   . PRO C  3  101 ? 41.349  63.742  94.044  1.00 46.91 ? 101  PRO C C   1 
ATOM   3868  O  O   . PRO C  3  101 ? 41.027  63.265  95.135  1.00 46.91 ? 101  PRO C O   1 
ATOM   3869  C  CB  . PRO C  3  101 ? 39.190  63.857  92.723  1.00 46.91 ? 101  PRO C CB  1 
ATOM   3870  C  CG  . PRO C  3  101 ? 38.410  62.794  93.420  1.00 46.91 ? 101  PRO C CG  1 
ATOM   3871  C  CD  . PRO C  3  101 ? 38.991  61.528  92.848  1.00 46.91 ? 101  PRO C CD  1 
ATOM   3872  N  N   . GLY C  3  102 ? 42.330  64.627  93.898  1.00 46.91 ? 102  GLY C N   1 
ATOM   3873  C  CA  . GLY C  3  102 ? 43.099  65.092  95.041  1.00 46.91 ? 102  GLY C CA  1 
ATOM   3874  C  C   . GLY C  3  102 ? 42.320  65.961  96.016  1.00 46.91 ? 102  GLY C C   1 
ATOM   3875  O  O   . GLY C  3  102 ? 42.370  65.742  97.231  1.00 46.91 ? 102  GLY C O   1 
ATOM   3876  N  N   . GLY C  3  103 ? 41.615  66.956  95.484  1.00 46.91 ? 103  GLY C N   1 
ATOM   3877  C  CA  . GLY C  3  103 ? 40.832  67.849  96.322  1.00 46.91 ? 103  GLY C CA  1 
ATOM   3878  C  C   . GLY C  3  103 ? 40.093  68.912  95.529  1.00 46.91 ? 103  GLY C C   1 
ATOM   3879  O  O   . GLY C  3  103 ? 39.078  68.626  94.889  1.00 46.91 ? 103  GLY C O   1 
ATOM   3880  N  N   . GLU C  3  104 ? 40.578  70.148  95.605  1.00 46.91 ? 104  GLU C N   1 
ATOM   3881  C  CA  . GLU C  3  104 ? 39.965  71.260  94.885  1.00 46.91 ? 104  GLU C CA  1 
ATOM   3882  C  C   . GLU C  3  104 ? 40.863  72.491  94.840  1.00 46.91 ? 104  GLU C C   1 
ATOM   3883  O  O   . GLU C  3  104 ? 40.892  73.200  93.835  1.00 46.91 ? 104  GLU C O   1 
ATOM   3884  C  CB  . GLU C  3  104 ? 38.613  71.632  95.503  1.00 46.91 ? 104  GLU C CB  1 
ATOM   3885  N  N   . VAL C  3  105 ? 41.561  72.764  95.940  1.00 46.91 ? 105  VAL C N   1 
ATOM   3886  C  CA  . VAL C  3  105 ? 42.454  73.919  96.020  1.00 46.91 ? 105  VAL C CA  1 
ATOM   3887  C  C   . VAL C  3  105 ? 43.850  73.616  95.484  1.00 46.91 ? 105  VAL C C   1 
ATOM   3888  O  O   . VAL C  3  105 ? 44.334  74.288  94.570  1.00 46.91 ? 105  VAL C O   1 
ATOM   3889  C  CB  . VAL C  3  105 ? 42.585  74.431  97.470  1.00 46.91 ? 105  VAL C CB  1 
ATOM   3890  N  N   . VAL C  3  106 ? 44.506  72.630  96.087  1.00 46.91 ? 106  VAL C N   1 
ATOM   3891  C  CA  . VAL C  3  106 ? 45.850  72.231  95.685  1.00 46.91 ? 106  VAL C CA  1 
ATOM   3892  C  C   . VAL C  3  106 ? 45.837  71.263  94.505  1.00 46.91 ? 106  VAL C C   1 
ATOM   3893  O  O   . VAL C  3  106 ? 46.847  71.099  93.817  1.00 46.91 ? 106  VAL C O   1 
ATOM   3894  C  CB  . VAL C  3  106 ? 46.606  71.572  96.857  1.00 46.91 ? 106  VAL C CB  1 
ATOM   3895  N  N   . ASP C  3  107 ? 44.702  70.598  94.305  1.00 46.91 ? 107  ASP C N   1 
ATOM   3896  C  CA  . ASP C  3  107 ? 44.544  69.637  93.216  1.00 46.91 ? 107  ASP C CA  1 
ATOM   3897  C  C   . ASP C  3  107 ? 44.286  70.310  91.871  1.00 46.91 ? 107  ASP C C   1 
ATOM   3898  O  O   . ASP C  3  107 ? 44.745  69.837  90.832  1.00 46.91 ? 107  ASP C O   1 
ATOM   3899  C  CB  . ASP C  3  107 ? 43.408  68.661  93.530  1.00 46.91 ? 107  ASP C CB  1 
ATOM   3900  N  N   . THR C  3  108 ? 43.523  71.398  91.894  1.00 46.91 ? 108  THR C N   1 
ATOM   3901  C  CA  . THR C  3  108 ? 43.201  72.134  90.677  1.00 46.91 ? 108  THR C CA  1 
ATOM   3902  C  C   . THR C  3  108 ? 44.322  73.095  90.283  1.00 46.91 ? 108  THR C C   1 
ATOM   3903  O  O   . THR C  3  108 ? 44.107  74.019  89.499  1.00 46.91 ? 108  THR C O   1 
ATOM   3904  C  CB  . THR C  3  108 ? 41.885  72.921  90.830  1.00 46.91 ? 108  THR C CB  1 
ATOM   3905  N  N   . PHE C  3  109 ? 45.510  72.892  90.846  1.00 46.91 ? 109  PHE C N   1 
ATOM   3906  C  CA  . PHE C  3  109 ? 46.654  73.750  90.540  1.00 46.91 ? 109  PHE C CA  1 
ATOM   3907  C  C   . PHE C  3  109 ? 47.446  73.276  89.316  1.00 46.91 ? 109  PHE C C   1 
ATOM   3908  O  O   . PHE C  3  109 ? 47.798  74.082  88.458  1.00 46.91 ? 109  PHE C O   1 
ATOM   3909  C  CB  . PHE C  3  109 ? 47.566  73.900  91.762  1.00 46.91 ? 109  PHE C CB  1 
ATOM   3910  N  N   . PRO C  3  110 ? 47.807  71.980  89.257  1.00 46.91 ? 110  PRO C N   1 
ATOM   3911  C  CA  . PRO C  3  110 ? 48.559  71.480  88.101  1.00 46.91 ? 110  PRO C CA  1 
ATOM   3912  C  C   . PRO C  3  110 ? 47.673  71.095  86.916  1.00 46.91 ? 110  PRO C C   1 
ATOM   3913  O  O   . PRO C  3  110 ? 48.174  70.670  85.875  1.00 46.91 ? 110  PRO C O   1 
ATOM   3914  C  CB  . PRO C  3  110 ? 49.275  70.261  88.671  1.00 46.91 ? 110  PRO C CB  1 
ATOM   3915  C  CG  . PRO C  3  110 ? 48.289  69.741  89.654  1.00 46.91 ? 110  PRO C CG  1 
ATOM   3916  C  CD  . PRO C  3  110 ? 47.830  70.993  90.354  1.00 46.91 ? 110  PRO C CD  1 
ATOM   3917  N  N   . PHE C  3  111 ? 46.361  71.206  87.092  1.00 46.91 ? 111  PHE C N   1 
ATOM   3918  C  CA  . PHE C  3  111 ? 45.417  70.856  86.036  1.00 46.91 ? 111  PHE C CA  1 
ATOM   3919  C  C   . PHE C  3  111 ? 44.738  72.077  85.422  1.00 46.91 ? 111  PHE C C   1 
ATOM   3920  O  O   . PHE C  3  111 ? 44.716  72.233  84.201  1.00 46.91 ? 111  PHE C O   1 
ATOM   3921  C  CB  . PHE C  3  111 ? 44.357  69.892  86.580  1.00 46.91 ? 111  PHE C CB  1 
ATOM   3922  N  N   . PHE C  3  112 ? 44.169  72.927  86.272  1.00 46.91 ? 112  PHE C N   1 
ATOM   3923  C  CA  . PHE C  3  112 ? 43.473  74.126  85.814  1.00 46.91 ? 112  PHE C CA  1 
ATOM   3924  C  C   . PHE C  3  112 ? 44.391  75.302  85.493  1.00 46.91 ? 112  PHE C C   1 
ATOM   3925  O  O   . PHE C  3  112 ? 44.083  76.113  84.618  1.00 46.91 ? 112  PHE C O   1 
ATOM   3926  C  CB  . PHE C  3  112 ? 42.433  74.557  86.850  1.00 46.91 ? 112  PHE C CB  1 
ATOM   3927  N  N   . VAL C  3  113 ? 45.478  75.431  86.247  1.00 46.91 ? 113  VAL C N   1 
ATOM   3928  C  CA  . VAL C  3  113 ? 46.435  76.514  86.039  1.00 46.91 ? 113  VAL C CA  1 
ATOM   3929  C  C   . VAL C  3  113 ? 47.434  76.176  84.941  1.00 46.91 ? 113  VAL C C   1 
ATOM   3930  O  O   . VAL C  3  113 ? 48.068  77.068  84.374  1.00 46.91 ? 113  VAL C O   1 
ATOM   3931  C  CB  . VAL C  3  113 ? 47.206  76.845  87.329  1.00 46.91 ? 113  VAL C CB  1 
ATOM   3932  N  N   . VAL C  3  114 ? 47.621  74.882  84.697  1.00 46.91 ? 114  VAL C N   1 
ATOM   3933  C  CA  . VAL C  3  114 ? 48.541  74.417  83.665  1.00 46.91 ? 114  VAL C CA  1 
ATOM   3934  C  C   . VAL C  3  114 ? 47.901  74.584  82.292  1.00 46.91 ? 114  VAL C C   1 
ATOM   3935  O  O   . VAL C  3  114 ? 48.592  74.820  81.298  1.00 46.91 ? 114  VAL C O   1 
ATOM   3936  C  CB  . VAL C  3  114 ? 48.914  72.938  83.863  1.00 46.91 ? 114  VAL C CB  1 
ATOM   3937  N  N   . GLY C  3  115 ? 46.585  74.401  82.241  1.00 46.91 ? 115  GLY C N   1 
ATOM   3938  C  CA  . GLY C  3  115 ? 45.853  74.546  80.997  1.00 46.91 ? 115  GLY C CA  1 
ATOM   3939  C  C   . GLY C  3  115 ? 45.612  76.010  80.689  1.00 46.91 ? 115  GLY C C   1 
ATOM   3940  O  O   . GLY C  3  115 ? 45.622  76.418  79.526  1.00 46.91 ? 115  GLY C O   1 
ATOM   3941  N  N   . VAL C  3  116 ? 45.383  76.796  81.738  1.00 46.91 ? 116  VAL C N   1 
ATOM   3942  C  CA  . VAL C  3  116 ? 45.143  78.228  81.604  1.00 46.91 ? 116  VAL C CA  1 
ATOM   3943  C  C   . VAL C  3  116 ? 46.417  78.956  81.189  1.00 46.91 ? 116  VAL C C   1 
ATOM   3944  O  O   . VAL C  3  116 ? 46.360  80.015  80.563  1.00 46.91 ? 116  VAL C O   1 
ATOM   3945  C  CB  . VAL C  3  116 ? 44.639  78.835  82.927  1.00 46.91 ? 116  VAL C CB  1 
ATOM   3946  N  N   . VAL C  3  117 ? 47.563  78.411  81.590  1.00 46.91 ? 117  VAL C N   1 
ATOM   3947  C  CA  . VAL C  3  117 ? 48.855  78.998  81.253  1.00 46.91 ? 117  VAL C CA  1 
ATOM   3948  C  C   . VAL C  3  117 ? 49.300  78.551  79.862  1.00 46.91 ? 117  VAL C C   1 
ATOM   3949  O  O   . VAL C  3  117 ? 50.216  79.134  79.277  1.00 46.91 ? 117  VAL C O   1 
ATOM   3950  C  CB  . VAL C  3  117 ? 49.938  78.598  82.273  1.00 46.91 ? 117  VAL C CB  1 
ATOM   3951  N  N   . HIS C  3  118 ? 48.676  77.491  79.360  1.00 46.91 ? 118  HIS C N   1 
ATOM   3952  C  CA  . HIS C  3  118 ? 48.988  76.957  78.040  1.00 46.91 ? 118  HIS C CA  1 
ATOM   3953  C  C   . HIS C  3  118 ? 48.167  77.664  76.968  1.00 46.91 ? 118  HIS C C   1 
ATOM   3954  O  O   . HIS C  3  118 ? 48.624  77.829  75.835  1.00 46.91 ? 118  HIS C O   1 
ATOM   3955  C  CB  . HIS C  3  118 ? 48.714  75.453  77.997  1.00 46.91 ? 118  HIS C CB  1 
ATOM   3956  N  N   . LEU C  3  119 ? 46.947  78.054  77.328  1.00 46.91 ? 119  LEU C N   1 
ATOM   3957  C  CA  . LEU C  3  119 ? 46.045  78.744  76.414  1.00 46.91 ? 119  LEU C CA  1 
ATOM   3958  C  C   . LEU C  3  119 ? 46.306  80.247  76.406  1.00 46.91 ? 119  LEU C C   1 
ATOM   3959  O  O   . LEU C  3  119 ? 46.073  80.919  75.400  1.00 46.91 ? 119  LEU C O   1 
ATOM   3960  C  CB  . LEU C  3  119 ? 44.590  78.469  76.799  1.00 46.91 ? 119  LEU C CB  1 
ATOM   3961  N  N   . ILE C  3  120 ? 46.751  80.775  77.542  1.00 46.91 ? 120  ILE C N   1 
ATOM   3962  C  CA  . ILE C  3  120 ? 47.047  82.198  77.666  1.00 46.91 ? 120  ILE C CA  1 
ATOM   3963  C  C   . ILE C  3  120 ? 48.425  82.519  77.095  1.00 46.91 ? 120  ILE C C   1 
ATOM   3964  O  O   . ILE C  3  120 ? 48.792  83.687  76.953  1.00 46.91 ? 120  ILE C O   1 
ATOM   3965  C  CB  . ILE C  3  120 ? 46.996  82.661  79.134  1.00 46.91 ? 120  ILE C CB  1 
ATOM   3966  N  N   . SER C  3  121 ? 49.202  81.476  76.825  1.00 46.91 ? 121  SER C N   1 
ATOM   3967  C  CA  . SER C  3  121 ? 50.538  81.630  76.263  1.00 46.91 ? 121  SER C CA  1 
ATOM   3968  C  C   . SER C  3  121 ? 50.527  81.263  74.783  1.00 46.91 ? 121  SER C C   1 
ATOM   3969  O  O   . SER C  3  121 ? 51.471  81.565  74.051  1.00 46.91 ? 121  SER C O   1 
ATOM   3970  C  CB  . SER C  3  121 ? 51.532  80.745  77.012  1.00 46.91 ? 121  SER C CB  1 
ATOM   3971  N  N   . SER C  3  122 ? 49.476  80.563  74.368  1.00 46.91 ? 122  SER C N   1 
ATOM   3972  C  CA  . SER C  3  122 ? 49.313  80.148  72.980  1.00 46.91 ? 122  SER C CA  1 
ATOM   3973  C  C   . SER C  3  122 ? 48.567  81.228  72.210  1.00 46.91 ? 122  SER C C   1 
ATOM   3974  O  O   . SER C  3  122 ? 48.958  81.597  71.104  1.00 46.91 ? 122  SER C O   1 
ATOM   3975  C  CB  . SER C  3  122 ? 48.534  78.835  72.903  1.00 46.91 ? 122  SER C CB  1 
ATOM   3976  N  N   . ALA C  3  123 ? 47.480  81.717  72.803  1.00 61.08 ? 123  ALA C N   1 
ATOM   3977  C  CA  . ALA C  3  123 ? 46.663  82.762  72.196  1.00 60.72 ? 123  ALA C CA  1 
ATOM   3978  C  C   . ALA C  3  123 ? 47.374  84.113  72.255  1.00 61.17 ? 123  ALA C C   1 
ATOM   3979  O  O   . ALA C  3  123 ? 46.939  85.079  71.626  1.00 60.13 ? 123  ALA C O   1 
ATOM   3980  C  CB  . ALA C  3  123 ? 45.312  82.844  72.894  1.00 60.27 ? 123  ALA C CB  1 
ATOM   3981  N  N   . VAL C  3  124 ? 48.422  84.190  73.071  1.00 46.91 ? 124  VAL C N   1 
ATOM   3982  C  CA  . VAL C  3  124 ? 49.206  85.413  73.208  1.00 46.91 ? 124  VAL C CA  1 
ATOM   3983  C  C   . VAL C  3  124 ? 50.241  85.460  72.088  1.00 46.91 ? 124  VAL C C   1 
ATOM   3984  O  O   . VAL C  3  124 ? 50.657  86.536  71.654  1.00 46.91 ? 124  VAL C O   1 
ATOM   3985  C  CB  . VAL C  3  124 ? 49.934  85.468  74.563  1.00 46.91 ? 124  VAL C CB  1 
ATOM   3986  N  N   . LEU C  3  125 ? 50.689  84.280  71.669  1.00 46.91 ? 125  LEU C N   1 
ATOM   3987  C  CA  . LEU C  3  125 ? 51.666  84.150  70.596  1.00 46.91 ? 125  LEU C CA  1 
ATOM   3988  C  C   . LEU C  3  125 ? 50.956  84.093  69.246  1.00 46.91 ? 125  LEU C C   1 
ATOM   3989  O  O   . LEU C  3  125 ? 51.551  84.397  68.211  1.00 46.91 ? 125  LEU C O   1 
ATOM   3990  C  CB  . LEU C  3  125 ? 52.508  82.887  70.796  1.00 46.91 ? 125  LEU C CB  1 
ATOM   3991  N  N   . GLY C  3  126 ? 49.695  83.672  69.269  1.00 46.91 ? 126  GLY C N   1 
ATOM   3992  C  CA  . GLY C  3  126 ? 48.908  83.578  68.052  1.00 46.91 ? 126  GLY C CA  1 
ATOM   3993  C  C   . GLY C  3  126 ? 48.252  84.895  67.681  1.00 46.91 ? 126  GLY C C   1 
ATOM   3994  O  O   . GLY C  3  126 ? 47.960  85.141  66.510  1.00 46.91 ? 126  GLY C O   1 
ATOM   3995  N  N   . PHE C  3  127 ? 47.986  85.728  68.684  1.00 46.91 ? 127  PHE C N   1 
ATOM   3996  C  CA  . PHE C  3  127 ? 47.364  87.029  68.465  1.00 46.91 ? 127  PHE C CA  1 
ATOM   3997  C  C   . PHE C  3  127 ? 48.345  87.995  67.808  1.00 46.91 ? 127  PHE C C   1 
ATOM   3998  O  O   . PHE C  3  127 ? 47.952  88.837  66.995  1.00 46.91 ? 127  PHE C O   1 
ATOM   3999  C  CB  . PHE C  3  127 ? 46.869  87.615  69.790  1.00 46.91 ? 127  PHE C CB  1 
ATOM   4000  N  N   . GLY C  3  128 ? 49.610  87.906  68.207  1.00 46.91 ? 128  GLY C N   1 
ATOM   4001  C  CA  . GLY C  3  128 ? 50.636  88.765  67.649  1.00 46.91 ? 128  GLY C CA  1 
ATOM   4002  C  C   . GLY C  3  128 ? 51.385  88.100  66.510  1.00 46.91 ? 128  GLY C C   1 
ATOM   4003  O  O   . GLY C  3  128 ? 52.173  88.747  65.816  1.00 46.91 ? 128  GLY C O   1 
ATOM   4004  N  N   . GLY C  3  129 ? 51.168  86.798  66.344  1.00 46.91 ? 129  GLY C N   1 
ATOM   4005  C  CA  . GLY C  3  129 ? 51.828  86.057  65.284  1.00 46.91 ? 129  GLY C CA  1 
ATOM   4006  C  C   . GLY C  3  129 ? 51.075  86.100  63.966  1.00 46.91 ? 129  GLY C C   1 
ATOM   4007  O  O   . GLY C  3  129 ? 51.666  85.889  62.905  1.00 46.91 ? 129  GLY C O   1 
ATOM   4008  N  N   . VAL C  3  130 ? 49.774  86.375  64.037  1.00 46.91 ? 130  VAL C N   1 
ATOM   4009  C  CA  . VAL C  3  130 ? 48.913  86.447  62.857  1.00 46.91 ? 130  VAL C CA  1 
ATOM   4010  C  C   . VAL C  3  130 ? 49.099  87.747  62.074  1.00 46.91 ? 130  VAL C C   1 
ATOM   4011  O  O   . VAL C  3  130 ? 48.241  88.135  61.274  1.00 46.91 ? 130  VAL C O   1 
ATOM   4012  C  CB  . VAL C  3  130 ? 47.427  86.314  63.246  1.00 46.91 ? 130  VAL C CB  1 
ATOM   4013  N  N   . TYR C  3  131 ? 50.210  88.427  62.333  1.00 46.91 ? 131  TYR C N   1 
ATOM   4014  C  CA  . TYR C  3  131 ? 50.536  89.682  61.671  1.00 46.91 ? 131  TYR C CA  1 
ATOM   4015  C  C   . TYR C  3  131 ? 51.236  89.407  60.341  1.00 46.91 ? 131  TYR C C   1 
ATOM   4016  O  O   . TYR C  3  131 ? 51.377  90.300  59.501  1.00 46.91 ? 131  TYR C O   1 
ATOM   4017  C  CB  . TYR C  3  131 ? 51.443  90.511  62.580  1.00 46.91 ? 131  TYR C CB  1 
ATOM   4018  C  CG  . TYR C  3  131 ? 51.580  91.956  62.173  1.00 46.91 ? 131  TYR C CG  1 
ATOM   4019  C  CD1 . TYR C  3  131 ? 50.525  92.850  62.351  1.00 46.91 ? 131  TYR C CD1 1 
ATOM   4020  C  CD2 . TYR C  3  131 ? 52.766  92.436  61.622  1.00 46.91 ? 131  TYR C CD2 1 
ATOM   4021  C  CE1 . TYR C  3  131 ? 50.648  94.186  61.991  1.00 46.91 ? 131  TYR C CE1 1 
ATOM   4022  C  CE2 . TYR C  3  131 ? 52.901  93.773  61.258  1.00 46.91 ? 131  TYR C CE2 1 
ATOM   4023  C  CZ  . TYR C  3  131 ? 51.837  94.641  61.447  1.00 46.91 ? 131  TYR C CZ  1 
ATOM   4024  O  OH  . TYR C  3  131 ? 51.962  95.968  61.102  1.00 46.91 ? 131  TYR C OH  1 
ATOM   4025  N  N   . HIS C  3  132 ? 51.709  88.175  60.178  1.00 46.91 ? 132  HIS C N   1 
ATOM   4026  C  CA  . HIS C  3  132 ? 52.402  87.754  58.966  1.00 46.91 ? 132  HIS C CA  1 
ATOM   4027  C  C   . HIS C  3  132 ? 51.426  87.354  57.861  1.00 46.91 ? 132  HIS C C   1 
ATOM   4028  O  O   . HIS C  3  132 ? 51.838  87.048  56.740  1.00 46.91 ? 132  HIS C O   1 
ATOM   4029  C  CB  . HIS C  3  132 ? 53.338  86.585  59.280  1.00 46.91 ? 132  HIS C CB  1 
ATOM   4030  N  N   . ALA C  3  133 ? 50.139  87.323  58.193  1.00 46.91 ? 133  ALA C N   1 
ATOM   4031  C  CA  . ALA C  3  133 ? 49.102  86.961  57.232  1.00 46.91 ? 133  ALA C CA  1 
ATOM   4032  C  C   . ALA C  3  133 ? 48.196  88.148  56.912  1.00 46.91 ? 133  ALA C C   1 
ATOM   4033  O  O   . ALA C  3  133 ? 47.160  87.991  56.257  1.00 46.91 ? 133  ALA C O   1 
ATOM   4034  C  CB  . ALA C  3  133 ? 48.277  85.795  57.766  1.00 46.91 ? 133  ALA C CB  1 
ATOM   4035  N  N   . ILE C  3  134 ? 48.596  89.333  57.365  1.00 46.91 ? 134  ILE C N   1 
ATOM   4036  C  CA  . ILE C  3  134 ? 47.818  90.545  57.137  1.00 46.91 ? 134  ILE C CA  1 
ATOM   4037  C  C   . ILE C  3  134 ? 48.649  91.689  56.558  1.00 46.91 ? 134  ILE C C   1 
ATOM   4038  O  O   . ILE C  3  134 ? 48.140  92.500  55.778  1.00 46.91 ? 134  ILE C O   1 
ATOM   4039  C  CB  . ILE C  3  134 ? 47.154  91.032  58.440  1.00 46.91 ? 134  ILE C CB  1 
ATOM   4040  N  N   . ARG C  3  135 ? 49.919  91.757  56.947  1.00 46.91 ? 135  ARG C N   1 
ATOM   4041  C  CA  . ARG C  3  135 ? 50.814  92.808  56.471  1.00 46.91 ? 135  ARG C CA  1 
ATOM   4042  C  C   . ARG C  3  135 ? 52.244  92.306  56.265  1.00 46.91 ? 135  ARG C C   1 
ATOM   4043  O  O   . ARG C  3  135 ? 52.485  91.102  56.169  1.00 46.91 ? 135  ARG C O   1 
ATOM   4044  C  CB  . ARG C  3  135 ? 50.810  93.984  57.453  1.00 46.91 ? 135  ARG C CB  1 
ATOM   4045  N  N   . GLY C  3  136 ? 53.186  93.241  56.189  1.00 46.91 ? 136  GLY C N   1 
ATOM   4046  C  CA  . GLY C  3  136 ? 54.579  92.883  55.993  1.00 46.91 ? 136  GLY C CA  1 
ATOM   4047  C  C   . GLY C  3  136 ? 54.901  92.492  54.562  1.00 46.91 ? 136  GLY C C   1 
ATOM   4048  O  O   . GLY C  3  136 ? 54.129  92.779  53.643  1.00 46.91 ? 136  GLY C O   1 
ATOM   4049  N  N   . PRO C  3  137 ? 56.070  91.875  54.338  1.00 46.91 ? 137  PRO C N   1 
ATOM   4050  C  CA  . PRO C  3  137 ? 56.541  91.425  53.024  1.00 46.91 ? 137  PRO C CA  1 
ATOM   4051  C  C   . PRO C  3  137 ? 56.088  90.000  52.720  1.00 46.91 ? 137  PRO C C   1 
ATOM   4052  O  O   . PRO C  3  137 ? 56.286  89.093  53.530  1.00 46.91 ? 137  PRO C O   1 
ATOM   4053  C  CB  . PRO C  3  137 ? 58.063  91.512  53.146  1.00 46.91 ? 137  PRO C CB  1 
ATOM   4054  N  N   . GLU C  3  138 ? 55.475  89.814  51.553  1.00 46.91 ? 138  GLU C N   1 
ATOM   4055  C  CA  . GLU C  3  138 ? 54.990  88.501  51.136  1.00 46.91 ? 138  GLU C CA  1 
ATOM   4056  C  C   . GLU C  3  138 ? 56.141  87.538  50.864  1.00 46.91 ? 138  GLU C C   1 
ATOM   4057  O  O   . GLU C  3  138 ? 56.895  87.712  49.902  1.00 46.91 ? 138  GLU C O   1 
ATOM   4058  C  CB  . GLU C  3  138 ? 54.110  88.630  49.889  1.00 46.91 ? 138  GLU C CB  1 
ATOM   4059  N  N   . THR C  3  139 ? 56.247  86.512  51.706  1.00 46.91 ? 139  THR C N   1 
ATOM   4060  C  CA  . THR C  3  139 ? 57.288  85.491  51.602  1.00 46.91 ? 139  THR C CA  1 
ATOM   4061  C  C   . THR C  3  139 ? 58.685  86.011  51.934  1.00 46.91 ? 139  THR C C   1 
ATOM   4062  O  O   . THR C  3  139 ? 59.008  87.178  51.696  1.00 46.91 ? 139  THR C O   1 
ATOM   4063  C  CB  . THR C  3  139 ? 57.319  84.836  50.205  1.00 46.91 ? 139  THR C CB  1 
ATOM   4064  N  N   . LEU C  3  140 ? 59.508  85.126  52.487  1.00 46.91 ? 140  LEU C N   1 
ATOM   4065  C  CA  . LEU C  3  140 ? 60.875  85.467  52.863  1.00 46.91 ? 140  LEU C CA  1 
ATOM   4066  C  C   . LEU C  3  140 ? 61.790  84.258  52.689  1.00 46.91 ? 140  LEU C C   1 
ATOM   4067  O  O   . LEU C  3  140 ? 61.336  83.170  52.331  1.00 46.91 ? 140  LEU C O   1 
ATOM   4068  C  CB  . LEU C  3  140 ? 60.919  85.949  54.315  1.00 46.91 ? 140  LEU C CB  1 
ATOM   4069  N  N   . GLU C  3  141 ? 63.080  84.459  52.943  1.00 46.91 ? 141  GLU C N   1 
ATOM   4070  C  CA  . GLU C  3  141 ? 64.065  83.392  52.818  1.00 46.91 ? 141  GLU C CA  1 
ATOM   4071  C  C   . GLU C  3  141 ? 65.133  83.528  53.897  1.00 46.91 ? 141  GLU C C   1 
ATOM   4072  O  O   . GLU C  3  141 ? 65.368  82.598  54.671  1.00 46.91 ? 141  GLU C O   1 
ATOM   4073  C  CB  . GLU C  3  141 ? 64.715  83.428  51.431  1.00 46.91 ? 141  GLU C CB  1 
ATOM   4074  N  N   . GLU C  3  142 ? 65.760  84.702  53.955  1.00 46.91 ? 142  GLU C N   1 
ATOM   4075  C  CA  . GLU C  3  142 ? 66.805  84.997  54.934  1.00 46.91 ? 142  GLU C CA  1 
ATOM   4076  C  C   . GLU C  3  142 ? 67.989  84.031  54.851  1.00 46.91 ? 142  GLU C C   1 
ATOM   4077  O  O   . GLU C  3  142 ? 68.255  83.448  53.795  1.00 46.91 ? 142  GLU C O   1 
ATOM   4078  C  CB  . GLU C  3  142 ? 66.223  85.007  56.352  1.00 46.91 ? 142  GLU C CB  1 
ATOM   4079  N  N   . TYR C  3  143 ? 68.715  83.895  55.959  1.00 46.91 ? 143  TYR C N   1 
ATOM   4080  C  CA  . TYR C  3  143 ? 69.875  83.011  56.029  1.00 46.91 ? 143  TYR C CA  1 
ATOM   4081  C  C   . TYR C  3  143 ? 70.222  82.660  57.475  1.00 46.91 ? 143  TYR C C   1 
ATOM   4082  O  O   . TYR C  3  143 ? 70.355  83.602  58.289  1.00 46.91 ? 143  TYR C O   1 
ATOM   4083  C  CB  . TYR C  3  143 ? 71.083  83.663  55.349  1.00 46.91 ? 143  TYR C CB  1 
ATOM   4084  N  N   . TRP C  3  151 ? 63.291  80.099  51.316  1.00 46.91 ? 151  TRP C N   1 
ATOM   4085  C  CA  . TRP C  3  151 ? 62.074  79.345  50.900  1.00 46.91 ? 151  TRP C CA  1 
ATOM   4086  C  C   . TRP C  3  151 ? 61.722  79.630  49.441  1.00 46.91 ? 151  TRP C C   1 
ATOM   4087  O  O   . TRP C  3  151 ? 60.816  80.414  49.146  1.00 46.91 ? 151  TRP C O   1 
ATOM   4088  C  CB  . TRP C  3  151 ? 60.893  79.702  51.807  1.00 46.91 ? 151  TRP C CB  1 
ATOM   4089  N  N   . LYS C  3  152 ? 62.448  78.986  48.531  1.00 46.91 ? 152  LYS C N   1 
ATOM   4090  C  CA  . LYS C  3  152 ? 62.222  79.163  47.101  1.00 46.91 ? 152  LYS C CA  1 
ATOM   4091  C  C   . LYS C  3  152 ? 62.147  77.819  46.380  1.00 46.91 ? 152  LYS C C   1 
ATOM   4092  O  O   . LYS C  3  152 ? 62.589  77.692  45.235  1.00 46.91 ? 152  LYS C O   1 
ATOM   4093  C  CB  . LYS C  3  152 ? 63.332  80.027  46.496  1.00 46.91 ? 152  LYS C CB  1 
ATOM   4094  N  N   . ASP C  3  153 ? 61.568  76.828  47.055  1.00 46.91 ? 153  ASP C N   1 
ATOM   4095  C  CA  . ASP C  3  153 ? 61.414  75.478  46.513  1.00 46.91 ? 153  ASP C CA  1 
ATOM   4096  C  C   . ASP C  3  153 ? 62.739  74.852  46.069  1.00 46.91 ? 153  ASP C C   1 
ATOM   4097  O  O   . ASP C  3  153 ? 62.772  74.026  45.155  1.00 46.91 ? 153  ASP C O   1 
ATOM   4098  C  CB  . ASP C  3  153 ? 60.407  75.479  45.355  1.00 46.91 ? 153  ASP C CB  1 
ATOM   4099  N  N   . LYS C  3  154 ? 63.826  75.253  46.722  1.00 46.91 ? 154  LYS C N   1 
ATOM   4100  C  CA  . LYS C  3  154 ? 65.148  74.730  46.404  1.00 46.91 ? 154  LYS C CA  1 
ATOM   4101  C  C   . LYS C  3  154 ? 65.427  73.471  47.218  1.00 46.91 ? 154  LYS C C   1 
ATOM   4102  O  O   . LYS C  3  154 ? 65.061  73.389  48.389  1.00 46.91 ? 154  LYS C O   1 
ATOM   4103  C  CB  . LYS C  3  154 ? 66.220  75.784  46.690  1.00 46.91 ? 154  LYS C CB  1 
ATOM   4104  N  N   . ASN C  3  155 ? 66.068  72.490  46.589  1.00 46.91 ? 155  ASN C N   1 
ATOM   4105  C  CA  . ASN C  3  155 ? 66.397  71.233  47.257  1.00 46.91 ? 155  ASN C CA  1 
ATOM   4106  C  C   . ASN C  3  155 ? 67.565  71.412  48.225  1.00 46.91 ? 155  ASN C C   1 
ATOM   4107  O  O   . ASN C  3  155 ? 67.613  70.774  49.279  1.00 46.91 ? 155  ASN C O   1 
ATOM   4108  C  CB  . ASN C  3  155 ? 66.739  70.157  46.225  1.00 46.91 ? 155  ASN C CB  1 
ATOM   4109  N  N   . LYS C  3  156 ? 68.514  72.264  47.849  1.00 46.91 ? 156  LYS C N   1 
ATOM   4110  C  CA  . LYS C  3  156 ? 69.684  72.533  48.677  1.00 46.91 ? 156  LYS C CA  1 
ATOM   4111  C  C   . LYS C  3  156 ? 69.320  73.319  49.933  1.00 46.91 ? 156  LYS C C   1 
ATOM   4112  O  O   . LYS C  3  156 ? 69.922  73.126  50.989  1.00 46.91 ? 156  LYS C O   1 
ATOM   4113  C  CB  . LYS C  3  156 ? 70.735  73.299  47.870  1.00 46.91 ? 156  LYS C CB  1 
ATOM   4114  N  N   . MET C  3  157 ? 68.357  74.226  49.798  1.00 46.91 ? 157  MET C N   1 
ATOM   4115  C  CA  . MET C  3  157 ? 67.910  75.053  50.914  1.00 46.91 ? 157  MET C CA  1 
ATOM   4116  C  C   . MET C  3  157 ? 66.851  74.358  51.767  1.00 46.91 ? 157  MET C C   1 
ATOM   4117  O  O   . MET C  3  157 ? 66.657  74.707  52.931  1.00 46.91 ? 157  MET C O   1 
ATOM   4118  C  CB  . MET C  3  157 ? 67.363  76.387  50.398  1.00 46.91 ? 157  MET C CB  1 
ATOM   4119  N  N   . THR C  3  158 ? 66.149  73.397  51.172  1.00 46.91 ? 158  THR C N   1 
ATOM   4120  C  CA  . THR C  3  158 ? 65.103  72.650  51.866  1.00 46.91 ? 158  THR C CA  1 
ATOM   4121  C  C   . THR C  3  158 ? 65.671  71.646  52.863  1.00 46.91 ? 158  THR C C   1 
ATOM   4122  O  O   . THR C  3  158 ? 64.969  71.198  53.773  1.00 46.91 ? 158  THR C O   1 
ATOM   4123  C  CB  . THR C  3  158 ? 64.211  71.887  50.874  1.00 46.91 ? 158  THR C CB  1 
ATOM   4124  N  N   . THR C  3  159 ? 66.925  71.256  52.655  1.00 46.91 ? 159  THR C N   1 
ATOM   4125  C  CA  . THR C  3  159 ? 67.593  70.299  53.530  1.00 46.91 ? 159  THR C CA  1 
ATOM   4126  C  C   . THR C  3  159 ? 67.965  70.936  54.864  1.00 46.91 ? 159  THR C C   1 
ATOM   4127  O  O   . THR C  3  159 ? 67.779  70.334  55.920  1.00 46.91 ? 159  THR C O   1 
ATOM   4128  C  CB  . THR C  3  159 ? 68.866  69.738  52.874  1.00 46.91 ? 159  THR C CB  1 
ATOM   4129  N  N   . ILE C  3  160 ? 68.508  72.147  54.801  1.00 46.91 ? 160  ILE C N   1 
ATOM   4130  C  CA  . ILE C  3  160 ? 68.910  72.878  55.996  1.00 46.91 ? 160  ILE C CA  1 
ATOM   4131  C  C   . ILE C  3  160 ? 67.709  73.515  56.691  1.00 46.91 ? 160  ILE C C   1 
ATOM   4132  O  O   . ILE C  3  160 ? 67.777  73.869  57.872  1.00 46.91 ? 160  ILE C O   1 
ATOM   4133  C  CB  . ILE C  3  160 ? 69.930  73.983  55.659  1.00 46.91 ? 160  ILE C CB  1 
ATOM   4134  N  N   . LEU C  3  161 ? 66.627  73.702  55.939  1.00 46.91 ? 161  LEU C N   1 
ATOM   4135  C  CA  . LEU C  3  161 ? 65.406  74.297  56.471  1.00 46.91 ? 161  LEU C CA  1 
ATOM   4136  C  C   . LEU C  3  161 ? 64.525  73.254  57.149  1.00 46.91 ? 161  LEU C C   1 
ATOM   4137  O  O   . LEU C  3  161 ? 64.761  72.051  57.034  1.00 46.91 ? 161  LEU C O   1 
ATOM   4138  C  CB  . LEU C  3  161 ? 64.619  74.988  55.356  1.00 46.91 ? 161  LEU C CB  1 
ATOM   4139  N  N   . GLY C  3  162 ? 63.492  73.728  57.838  1.00 46.91 ? 162  GLY C N   1 
ATOM   4140  C  CA  . GLY C  3  162 ? 62.586  72.828  58.527  1.00 46.91 ? 162  GLY C CA  1 
ATOM   4141  C  C   . GLY C  3  162 ? 63.259  72.113  59.679  1.00 46.91 ? 162  GLY C C   1 
ATOM   4142  O  O   . GLY C  3  162 ? 62.932  70.963  59.980  1.00 46.91 ? 162  GLY C O   1 
ATOM   4143  N  N   . PHE C  3  163 ? 64.183  72.810  60.338  1.00 46.91 ? 163  PHE C N   1 
ATOM   4144  C  CA  . PHE C  3  163 ? 64.917  72.258  61.471  1.00 46.91 ? 163  PHE C CA  1 
ATOM   4145  C  C   . PHE C  3  163 ? 64.013  72.176  62.697  1.00 46.91 ? 163  PHE C C   1 
ATOM   4146  O  O   . PHE C  3  163 ? 64.183  72.920  63.667  1.00 46.91 ? 163  PHE C O   1 
ATOM   4147  C  CB  . PHE C  3  163 ? 66.149  73.116  61.771  1.00 46.91 ? 163  PHE C CB  1 
ATOM   4148  N  N   . HIS C  3  164 ? 63.011  71.308  62.615  1.00 46.91 ? 164  HIS C N   1 
ATOM   4149  C  CA  . HIS C  3  164 ? 62.064  71.109  63.701  1.00 46.91 ? 164  HIS C CA  1 
ATOM   4150  C  C   . HIS C  3  164 ? 62.230  69.722  64.310  1.00 46.91 ? 164  HIS C C   1 
ATOM   4151  O  O   . HIS C  3  164 ? 61.351  69.240  65.025  1.00 46.91 ? 164  HIS C O   1 
ATOM   4152  C  CB  . HIS C  3  164 ? 60.630  71.295  63.198  1.00 46.91 ? 164  HIS C CB  1 
ATOM   4153  C  CG  . HIS C  3  164 ? 60.315  72.697  62.778  1.00 46.91 ? 164  HIS C CG  1 
ATOM   4154  N  ND1 . HIS C  3  164 ? 59.435  73.502  63.471  1.00 46.91 ? 164  HIS C ND1 1 
ATOM   4155  C  CD2 . HIS C  3  164 ? 60.764  73.442  61.739  1.00 46.91 ? 164  HIS C CD2 1 
ATOM   4156  C  CE1 . HIS C  3  164 ? 59.357  74.677  62.879  1.00 46.91 ? 164  HIS C CE1 1 
ATOM   4157  N  NE2 . HIS C  3  164 ? 60.153  74.668  61.824  1.00 46.91 ? 164  HIS C NE2 1 
ATOM   4158  N  N   . LEU C  3  165 ? 63.330  69.063  63.963  1.00 46.91 ? 165  LEU C N   1 
ATOM   4159  C  CA  . LEU C  3  165 ? 63.635  67.738  64.485  1.00 46.91 ? 165  LEU C CA  1 
ATOM   4160  C  C   . LEU C  3  165 ? 64.307  67.900  65.843  1.00 46.91 ? 165  LEU C C   1 
ATOM   4161  O  O   . LEU C  3  165 ? 64.076  67.113  66.760  1.00 46.91 ? 165  LEU C O   1 
ATOM   4162  C  CB  . LEU C  3  165 ? 64.562  66.986  63.527  1.00 46.91 ? 165  LEU C CB  1 
ATOM   4163  N  N   . ILE C  3  166 ? 65.145  68.928  65.952  1.00 46.91 ? 166  ILE C N   1 
ATOM   4164  C  CA  . ILE C  3  166 ? 65.858  69.228  67.189  1.00 46.91 ? 166  ILE C CA  1 
ATOM   4165  C  C   . ILE C  3  166 ? 64.971  70.038  68.134  1.00 46.91 ? 166  ILE C C   1 
ATOM   4166  O  O   . ILE C  3  166 ? 65.363  70.346  69.261  1.00 46.91 ? 166  ILE C O   1 
ATOM   4167  C  CB  . ILE C  3  166 ? 67.149  70.021  66.911  1.00 46.91 ? 166  ILE C CB  1 
ATOM   4168  N  N   . VAL C  3  167 ? 63.804  70.436  67.640  1.00 46.91 ? 167  VAL C N   1 
ATOM   4169  C  CA  . VAL C  3  167 ? 62.847  71.205  68.426  1.00 46.91 ? 167  VAL C CA  1 
ATOM   4170  C  C   . VAL C  3  167 ? 61.738  70.290  68.936  1.00 46.91 ? 167  VAL C C   1 
ATOM   4171  O  O   . VAL C  3  167 ? 61.149  70.542  69.991  1.00 46.91 ? 167  VAL C O   1 
ATOM   4172  C  CB  . VAL C  3  167 ? 62.219  72.339  67.594  1.00 46.91 ? 167  VAL C CB  1 
ATOM   4173  N  N   . LEU C  3  168 ? 61.422  69.266  68.148  1.00 46.91 ? 168  LEU C N   1 
ATOM   4174  C  CA  . LEU C  3  168 ? 60.392  68.296  68.506  1.00 46.91 ? 168  LEU C CA  1 
ATOM   4175  C  C   . LEU C  3  168 ? 61.010  67.123  69.259  1.00 46.91 ? 168  LEU C C   1 
ATOM   4176  O  O   . LEU C  3  168 ? 60.310  66.395  69.969  1.00 46.91 ? 168  LEU C O   1 
ATOM   4177  C  CB  . LEU C  3  168 ? 59.677  67.788  67.252  1.00 46.91 ? 168  LEU C CB  1 
ATOM   4178  N  N   . GLY C  3  169 ? 62.307  66.914  69.053  1.00 46.91 ? 169  GLY C N   1 
ATOM   4179  C  CA  . GLY C  3  169 ? 63.012  65.839  69.729  1.00 46.91 ? 169  GLY C CA  1 
ATOM   4180  C  C   . GLY C  3  169 ? 63.328  66.246  71.154  1.00 46.91 ? 169  GLY C C   1 
ATOM   4181  O  O   . GLY C  3  169 ? 63.201  65.448  72.084  1.00 46.91 ? 169  GLY C O   1 
ATOM   4182  N  N   . ILE C  3  170 ? 63.766  67.490  71.319  1.00 46.91 ? 170  ILE C N   1 
ATOM   4183  C  CA  . ILE C  3  170 ? 64.091  68.028  72.634  1.00 46.91 ? 170  ILE C CA  1 
ATOM   4184  C  C   . ILE C  3  170 ? 62.826  68.551  73.316  1.00 46.91 ? 170  ILE C C   1 
ATOM   4185  O  O   . ILE C  3  170 ? 62.890  69.157  74.388  1.00 46.91 ? 170  ILE C O   1 
ATOM   4186  C  CB  . ILE C  3  170 ? 65.118  69.172  72.533  1.00 46.91 ? 170  ILE C CB  1 
ATOM   4187  N  N   . GLY C  3  171 ? 61.686  68.350  72.660  1.00 46.91 ? 171  GLY C N   1 
ATOM   4188  C  CA  . GLY C  3  171 ? 60.413  68.787  73.205  1.00 46.91 ? 171  GLY C CA  1 
ATOM   4189  C  C   . GLY C  3  171 ? 59.522  67.611  73.559  1.00 46.91 ? 171  GLY C C   1 
ATOM   4190  O  O   . GLY C  3  171 ? 58.496  67.778  74.224  1.00 46.91 ? 171  GLY C O   1 
ATOM   4191  N  N   . ALA C  3  172 ? 59.893  66.430  73.076  1.00 46.91 ? 172  ALA C N   1 
ATOM   4192  C  CA  . ALA C  3  172 ? 59.144  65.205  73.341  1.00 46.91 ? 172  ALA C CA  1 
ATOM   4193  C  C   . ALA C  3  172 ? 59.894  64.343  74.350  1.00 46.91 ? 172  ALA C C   1 
ATOM   4194  O  O   . ALA C  3  172 ? 59.292  63.521  75.044  1.00 46.91 ? 172  ALA C O   1 
ATOM   4195  C  CB  . ALA C  3  172 ? 58.922  64.434  72.049  1.00 46.91 ? 172  ALA C CB  1 
ATOM   4196  N  N   . LEU C  3  173 ? 61.214  64.507  74.390  1.00 46.91 ? 173  LEU C N   1 
ATOM   4197  C  CA  . LEU C  3  173 ? 62.062  63.761  75.311  1.00 46.91 ? 173  LEU C CA  1 
ATOM   4198  C  C   . LEU C  3  173 ? 62.211  64.528  76.621  1.00 46.91 ? 173  LEU C C   1 
ATOM   4199  O  O   . LEU C  3  173 ? 62.541  63.952  77.658  1.00 46.91 ? 173  LEU C O   1 
ATOM   4200  C  CB  . LEU C  3  173 ? 63.440  63.520  74.690  1.00 46.91 ? 173  LEU C CB  1 
ATOM   4201  N  N   . LEU C  3  174 ? 62.008  65.843  76.555  1.00 46.91 ? 174  LEU C N   1 
ATOM   4202  C  CA  . LEU C  3  174 ? 62.105  66.700  77.730  1.00 46.91 ? 174  LEU C CA  1 
ATOM   4203  C  C   . LEU C  3  174 ? 60.771  66.751  78.468  1.00 46.91 ? 174  LEU C C   1 
ATOM   4204  O  O   . LEU C  3  174 ? 60.718  67.102  79.649  1.00 46.91 ? 174  LEU C O   1 
ATOM   4205  C  CB  . LEU C  3  174 ? 62.528  68.113  77.324  1.00 46.91 ? 174  LEU C CB  1 
ATOM   4206  N  N   . LEU C  3  175 ? 59.694  66.448  77.749  1.00 46.91 ? 175  LEU C N   1 
ATOM   4207  C  CA  . LEU C  3  175 ? 58.353  66.448  78.319  1.00 46.91 ? 175  LEU C CA  1 
ATOM   4208  C  C   . LEU C  3  175 ? 58.005  65.087  78.917  1.00 46.91 ? 175  LEU C C   1 
ATOM   4209  O  O   . LEU C  3  175 ? 57.124  64.983  79.774  1.00 46.91 ? 175  LEU C O   1 
ATOM   4210  C  CB  . LEU C  3  175 ? 57.324  66.824  77.250  1.00 46.91 ? 175  LEU C CB  1 
ATOM   4211  N  N   . VAL C  3  176 ? 58.671  64.044  78.429  1.00 46.91 ? 176  VAL C N   1 
ATOM   4212  C  CA  . VAL C  3  176 ? 58.444  62.685  78.911  1.00 46.91 ? 176  VAL C CA  1 
ATOM   4213  C  C   . VAL C  3  176 ? 59.357  62.364  80.089  1.00 46.91 ? 176  VAL C C   1 
ATOM   4214  O  O   . VAL C  3  176 ? 58.946  61.695  81.038  1.00 46.91 ? 176  VAL C O   1 
ATOM   4215  C  CB  . VAL C  3  176 ? 58.682  61.649  77.800  1.00 46.91 ? 176  VAL C CB  1 
ATOM   4216  N  N   . ALA C  3  177 ? 60.605  62.818  80.007  1.00 46.91 ? 177  ALA C N   1 
ATOM   4217  C  CA  . ALA C  3  177 ? 61.579  62.589  81.068  1.00 46.91 ? 177  ALA C CA  1 
ATOM   4218  C  C   . ALA C  3  177 ? 61.356  63.542  82.241  1.00 46.91 ? 177  ALA C C   1 
ATOM   4219  O  O   . ALA C  3  177 ? 62.075  63.485  83.241  1.00 46.91 ? 177  ALA C O   1 
ATOM   4220  C  CB  . ALA C  3  177 ? 62.994  62.741  80.529  1.00 46.91 ? 177  ALA C CB  1 
ATOM   4221  N  N   . LYS C  3  178 ? 60.391  64.445  82.092  1.00 46.91 ? 178  LYS C N   1 
ATOM   4222  C  CA  . LYS C  3  178 ? 60.063  65.403  83.139  1.00 46.91 ? 178  LYS C CA  1 
ATOM   4223  C  C   . LYS C  3  178 ? 59.337  64.707  84.289  1.00 46.91 ? 178  LYS C C   1 
ATOM   4224  O  O   . LYS C  3  178 ? 59.184  65.278  85.370  1.00 46.91 ? 178  LYS C O   1 
ATOM   4225  C  CB  . LYS C  3  178 ? 59.189  66.527  82.578  1.00 46.91 ? 178  LYS C CB  1 
ATOM   4226  N  N   . ALA C  3  179 ? 58.869  63.488  84.032  1.00 63.00 ? 179  ALA C N   1 
ATOM   4227  C  CA  . ALA C  3  179 ? 58.160  62.696  85.031  1.00 62.79 ? 179  ALA C CA  1 
ATOM   4228  C  C   . ALA C  3  179 ? 59.107  62.216  86.131  1.00 63.84 ? 179  ALA C C   1 
ATOM   4229  O  O   . ALA C  3  179 ? 58.757  62.226  87.310  1.00 64.93 ? 179  ALA C O   1 
ATOM   4230  C  CB  . ALA C  3  179 ? 57.476  61.506  84.364  1.00 62.32 ? 179  ALA C CB  1 
ATOM   4231  N  N   . MET C  3  180 ? 60.303  61.788  85.735  1.00 46.91 ? 180  MET C N   1 
ATOM   4232  C  CA  . MET C  3  180 ? 61.300  61.307  86.688  1.00 46.91 ? 180  MET C CA  1 
ATOM   4233  C  C   . MET C  3  180 ? 61.912  62.454  87.496  1.00 46.91 ? 180  MET C C   1 
ATOM   4234  O  O   . MET C  3  180 ? 62.839  62.247  88.285  1.00 46.91 ? 180  MET C O   1 
ATOM   4235  C  CB  . MET C  3  180 ? 62.404  60.540  85.957  1.00 46.91 ? 180  MET C CB  1 
ATOM   4236  N  N   . PHE C  3  181 ? 61.414  63.665  87.268  1.00 46.91 ? 181  PHE C N   1 
ATOM   4237  C  CA  . PHE C  3  181 ? 61.893  64.852  87.966  1.00 46.91 ? 181  PHE C CA  1 
ATOM   4238  C  C   . PHE C  3  181 ? 60.745  65.585  88.658  1.00 46.91 ? 181  PHE C C   1 
ATOM   4239  O  O   . PHE C  3  181 ? 60.968  66.569  89.372  1.00 46.91 ? 181  PHE C O   1 
ATOM   4240  C  CB  . PHE C  3  181 ? 62.591  65.795  86.982  1.00 46.91 ? 181  PHE C CB  1 
ATOM   4241  N  N   . PHE C  3  182 ? 59.522  65.098  88.456  1.00 46.91 ? 182  PHE C N   1 
ATOM   4242  C  CA  . PHE C  3  182 ? 58.340  65.709  89.052  1.00 46.91 ? 182  PHE C CA  1 
ATOM   4243  C  C   . PHE C  3  182 ? 57.345  64.683  89.593  1.00 46.91 ? 182  PHE C C   1 
ATOM   4244  O  O   . PHE C  3  182 ? 57.233  64.499  90.807  1.00 46.91 ? 182  PHE C O   1 
ATOM   4245  C  CB  . PHE C  3  182 ? 57.645  66.618  88.033  1.00 46.91 ? 182  PHE C CB  1 
ATOM   4246  N  N   . GLY C  3  183 ? 56.601  64.048  88.692  1.00 46.91 ? 183  GLY C N   1 
ATOM   4247  C  CA  . GLY C  3  183 ? 55.614  63.066  89.102  1.00 46.91 ? 183  GLY C CA  1 
ATOM   4248  C  C   . GLY C  3  183 ? 55.990  61.629  88.804  1.00 46.91 ? 183  GLY C C   1 
ATOM   4249  O  O   . GLY C  3  183 ? 56.625  60.963  89.622  1.00 46.91 ? 183  GLY C O   1 
ATOM   4250  N  N   . GLY C  3  184 ? 55.564  61.143  87.641  1.00 46.91 ? 184  GLY C N   1 
ATOM   4251  C  CA  . GLY C  3  184 ? 55.855  59.777  87.247  1.00 46.91 ? 184  GLY C CA  1 
ATOM   4252  C  C   . GLY C  3  184 ? 54.634  59.055  86.709  1.00 46.91 ? 184  GLY C C   1 
ATOM   4253  O  O   . GLY C  3  184 ? 54.572  57.824  86.740  1.00 46.91 ? 184  GLY C O   1 
ATOM   4254  N  N   . LEU C  3  185 ? 53.677  59.822  86.191  1.00 46.91 ? 185  LEU C N   1 
ATOM   4255  C  CA  . LEU C  3  185 ? 52.438  59.279  85.637  1.00 46.91 ? 185  LEU C CA  1 
ATOM   4256  C  C   . LEU C  3  185 ? 51.629  58.526  86.692  1.00 46.91 ? 185  LEU C C   1 
ATOM   4257  O  O   . LEU C  3  185 ? 51.732  58.817  87.886  1.00 46.91 ? 185  LEU C O   1 
ATOM   4258  C  CB  . LEU C  3  185 ? 52.740  58.369  84.441  1.00 46.91 ? 185  LEU C CB  1 
ATOM   4259  N  N   . TYR C  3  186 ? 50.824  57.563  86.250  1.00 46.91 ? 186  TYR C N   1 
ATOM   4260  C  CA  . TYR C  3  186 ? 49.998  56.772  87.155  1.00 46.91 ? 186  TYR C CA  1 
ATOM   4261  C  C   . TYR C  3  186 ? 49.537  55.471  86.500  1.00 46.91 ? 186  TYR C C   1 
ATOM   4262  O  O   . TYR C  3  186 ? 48.534  55.446  85.783  1.00 46.91 ? 186  TYR C O   1 
ATOM   4263  C  CB  . TYR C  3  186 ? 48.782  57.585  87.611  1.00 46.91 ? 186  TYR C CB  1 
ATOM   4264  N  N   . ASP C  3  187 ? 50.280  54.396  86.746  1.00 46.91 ? 187  ASP C N   1 
ATOM   4265  C  CA  . ASP C  3  187 ? 49.963  53.079  86.193  1.00 46.91 ? 187  ASP C CA  1 
ATOM   4266  C  C   . ASP C  3  187 ? 50.780  51.996  86.894  1.00 46.91 ? 187  ASP C C   1 
ATOM   4267  O  O   . ASP C  3  187 ? 51.542  52.283  87.817  1.00 46.91 ? 187  ASP C O   1 
ATOM   4268  C  CB  . ASP C  3  187 ? 50.251  53.046  84.688  1.00 46.91 ? 187  ASP C CB  1 
ATOM   4269  N  N   . THR C  3  188 ? 50.615  50.754  86.445  1.00 46.91 ? 188  THR C N   1 
ATOM   4270  C  CA  . THR C  3  188 ? 51.332  49.609  87.004  1.00 46.91 ? 188  THR C CA  1 
ATOM   4271  C  C   . THR C  3  188 ? 50.960  49.293  88.453  1.00 46.91 ? 188  THR C C   1 
ATOM   4272  O  O   . THR C  3  188 ? 50.335  48.267  88.727  1.00 46.91 ? 188  THR C O   1 
ATOM   4273  C  CB  . THR C  3  188 ? 52.863  49.794  86.904  1.00 46.91 ? 188  THR C CB  1 
ATOM   4274  N  N   . TRP C  3  189 ? 51.389  50.146  89.378  1.00 46.91 ? 189  TRP C N   1 
ATOM   4275  C  CA  . TRP C  3  189 ? 51.103  49.961  90.797  1.00 46.91 ? 189  TRP C CA  1 
ATOM   4276  C  C   . TRP C  3  189 ? 49.639  50.267  91.122  1.00 46.91 ? 189  TRP C C   1 
ATOM   4277  O  O   . TRP C  3  189 ? 48.762  49.430  90.904  1.00 46.91 ? 189  TRP C O   1 
ATOM   4278  C  CB  . TRP C  3  189 ? 52.033  50.837  91.644  1.00 46.91 ? 189  TRP C CB  1 
ATOM   4279  N  N   . ALA C  3  190 ? 49.384  51.456  91.661  1.00 46.91 ? 190  ALA C N   1 
ATOM   4280  C  CA  . ALA C  3  190 ? 48.030  51.872  92.018  1.00 46.91 ? 190  ALA C CA  1 
ATOM   4281  C  C   . ALA C  3  190 ? 47.949  53.387  92.166  1.00 46.91 ? 190  ALA C C   1 
ATOM   4282  O  O   . ALA C  3  190 ? 46.890  53.985  91.967  1.00 46.91 ? 190  ALA C O   1 
ATOM   4283  C  CB  . ALA C  3  190 ? 47.592  51.192  93.313  1.00 46.91 ? 190  ALA C CB  1 
ATOM   4284  N  N   . PRO C  3  191 ? 49.062  54.016  92.570  1.00 46.91 ? 191  PRO C N   1 
ATOM   4285  C  CA  . PRO C  3  191 ? 49.182  55.463  92.769  1.00 46.91 ? 191  PRO C CA  1 
ATOM   4286  C  C   . PRO C  3  191 ? 50.104  56.086  91.722  1.00 46.91 ? 191  PRO C C   1 
ATOM   4287  O  O   . PRO C  3  191 ? 49.816  56.032  90.527  1.00 46.91 ? 191  PRO C O   1 
ATOM   4288  C  CB  . PRO C  3  191 ? 49.764  55.577  94.181  1.00 46.91 ? 191  PRO C CB  1 
ATOM   4289  N  N   . GLY C  3  192 ? 51.218  56.650  92.179  1.00 46.91 ? 192  GLY C N   1 
ATOM   4290  C  CA  . GLY C  3  192 ? 52.172  57.270  91.277  1.00 46.91 ? 192  GLY C CA  1 
ATOM   4291  C  C   . GLY C  3  192 ? 53.563  57.308  91.880  1.00 46.91 ? 192  GLY C C   1 
ATOM   4292  O  O   . GLY C  3  192 ? 53.715  57.440  93.099  1.00 46.91 ? 192  GLY C O   1 
ATOM   4293  N  N   . GLY C  3  193 ? 54.579  57.166  91.034  1.00 46.91 ? 193  GLY C N   1 
ATOM   4294  C  CA  . GLY C  3  193 ? 55.949  57.188  91.510  1.00 46.91 ? 193  GLY C CA  1 
ATOM   4295  C  C   . GLY C  3  193 ? 56.939  56.651  90.495  1.00 46.91 ? 193  GLY C C   1 
ATOM   4296  O  O   . GLY C  3  193 ? 57.331  55.482  90.562  1.00 46.91 ? 193  GLY C O   1 
ATOM   4297  N  N   . GLY C  3  194 ? 57.341  57.503  89.558  1.00 46.91 ? 194  GLY C N   1 
ATOM   4298  C  CA  . GLY C  3  194 ? 58.290  57.101  88.535  1.00 46.91 ? 194  GLY C CA  1 
ATOM   4299  C  C   . GLY C  3  194 ? 59.692  56.885  89.074  1.00 46.91 ? 194  GLY C C   1 
ATOM   4300  O  O   . GLY C  3  194 ? 60.130  57.584  89.993  1.00 46.91 ? 194  GLY C O   1 
ATOM   4301  N  N   . ASP C  3  195 ? 60.395  55.912  88.500  1.00 46.91 ? 195  ASP C N   1 
ATOM   4302  C  CA  . ASP C  3  195 ? 61.760  55.586  88.906  1.00 46.91 ? 195  ASP C CA  1 
ATOM   4303  C  C   . ASP C  3  195 ? 62.390  54.562  87.964  1.00 46.91 ? 195  ASP C C   1 
ATOM   4304  O  O   . ASP C  3  195 ? 61.700  53.942  87.149  1.00 46.91 ? 195  ASP C O   1 
ATOM   4305  C  CB  . ASP C  3  195 ? 61.778  55.042  90.339  1.00 46.91 ? 195  ASP C CB  1 
ATOM   4306  N  N   . VAL C  3  196 ? 63.700  54.369  88.109  1.00 46.91 ? 196  VAL C N   1 
ATOM   4307  C  CA  . VAL C  3  196 ? 64.466  53.427  87.293  1.00 46.91 ? 196  VAL C CA  1 
ATOM   4308  C  C   . VAL C  3  196 ? 64.543  53.836  85.820  1.00 46.91 ? 196  VAL C C   1 
ATOM   4309  O  O   . VAL C  3  196 ? 64.322  55.000  85.477  1.00 46.91 ? 196  VAL C O   1 
ATOM   4310  C  CB  . VAL C  3  196 ? 63.902  51.989  87.401  1.00 46.91 ? 196  VAL C CB  1 
ATOM   4311  N  N   . ARG C  3  197 ? 64.914  52.885  84.967  1.00 46.91 ? 197  ARG C N   1 
ATOM   4312  C  CA  . ARG C  3  197 ? 65.036  53.120  83.530  1.00 46.91 ? 197  ARG C CA  1 
ATOM   4313  C  C   . ARG C  3  197 ? 65.202  51.794  82.794  1.00 46.91 ? 197  ARG C C   1 
ATOM   4314  O  O   . ARG C  3  197 ? 66.226  51.122  82.929  1.00 46.91 ? 197  ARG C O   1 
ATOM   4315  C  CB  . ARG C  3  197 ? 66.231  54.033  83.234  1.00 46.91 ? 197  ARG C CB  1 
ATOM   4316  N  N   . VAL C  3  198 ? 64.176  51.413  82.039  1.00 46.91 ? 198  VAL C N   1 
ATOM   4317  C  CA  . VAL C  3  198 ? 64.185  50.168  81.277  1.00 46.91 ? 198  VAL C CA  1 
ATOM   4318  C  C   . VAL C  3  198 ? 64.642  50.383  79.833  1.00 46.91 ? 198  VAL C C   1 
ATOM   4319  O  O   . VAL C  3  198 ? 63.820  50.507  78.922  1.00 46.91 ? 198  VAL C O   1 
ATOM   4320  C  CB  . VAL C  3  198 ? 62.791  49.509  81.272  1.00 46.91 ? 198  VAL C CB  1 
ATOM   4321  N  N   . ILE C  3  199 ? 65.954  50.402  79.626  1.00 46.91 ? 199  ILE C N   1 
ATOM   4322  C  CA  . ILE C  3  199 ? 66.515  50.602  78.294  1.00 46.91 ? 199  ILE C CA  1 
ATOM   4323  C  C   . ILE C  3  199 ? 67.421  49.449  77.864  1.00 46.91 ? 199  ILE C C   1 
ATOM   4324  O  O   . ILE C  3  199 ? 68.323  49.079  78.648  1.00 46.91 ? 199  ILE C O   1 
ATOM   4325  C  CB  . ILE C  3  199 ? 67.273  51.921  78.237  1.00 46.91 ? 199  ILE C CB  1 
ATOM   4326  N  N   . LYS C  3  215 ? 67.309  49.203  68.998  1.00 46.91 ? 215  LYS C N   1 
ATOM   4327  C  CA  . LYS C  3  215 ? 66.014  49.369  69.719  1.00 46.91 ? 215  LYS C CA  1 
ATOM   4328  C  C   . LYS C  3  215 ? 65.779  48.244  70.723  1.00 46.91 ? 215  LYS C C   1 
ATOM   4329  O  O   . LYS C  3  215 ? 66.188  47.103  70.502  1.00 46.91 ? 215  LYS C O   1 
ATOM   4330  C  CB  . LYS C  3  215 ? 64.853  49.423  68.723  1.00 46.91 ? 215  LYS C CB  1 
ATOM   4331  N  N   . SER C  3  216 ? 65.128  48.577  71.833  1.00 46.91 ? 216  SER C N   1 
ATOM   4332  C  CA  . SER C  3  216 ? 64.835  47.598  72.876  1.00 46.91 ? 216  SER C CA  1 
ATOM   4333  C  C   . SER C  3  216 ? 63.614  46.727  72.561  1.00 46.91 ? 216  SER C C   1 
ATOM   4334  O  O   . SER C  3  216 ? 63.673  45.500  72.682  1.00 46.91 ? 216  SER C O   1 
ATOM   4335  C  CB  . SER C  3  216 ? 64.684  48.294  74.234  1.00 46.91 ? 216  SER C CB  1 
ATOM   4336  N  N   . PRO C  3  217 ? 62.486  47.346  72.158  1.00 46.91 ? 217  PRO C N   1 
ATOM   4337  C  CA  . PRO C  3  217 ? 61.284  46.571  71.839  1.00 46.91 ? 217  PRO C CA  1 
ATOM   4338  C  C   . PRO C  3  217 ? 61.354  45.986  70.430  1.00 46.91 ? 217  PRO C C   1 
ATOM   4339  O  O   . PRO C  3  217 ? 62.432  45.889  69.840  1.00 46.91 ? 217  PRO C O   1 
ATOM   4340  C  CB  . PRO C  3  217 ? 60.183  47.620  71.941  1.00 46.91 ? 217  PRO C CB  1 
ATOM   4341  C  CG  . PRO C  3  217 ? 60.854  48.818  71.367  1.00 46.91 ? 217  PRO C CG  1 
ATOM   4342  C  CD  . PRO C  3  217 ? 62.203  48.790  72.057  1.00 46.91 ? 217  PRO C CD  1 
ATOM   4343  N  N   . PHE C  3  218 ? 60.192  45.614  69.899  1.00 46.91 ? 218  PHE C N   1 
ATOM   4344  C  CA  . PHE C  3  218 ? 60.092  45.041  68.561  1.00 46.91 ? 218  PHE C CA  1 
ATOM   4345  C  C   . PHE C  3  218 ? 60.392  46.071  67.473  1.00 46.91 ? 218  PHE C C   1 
ATOM   4346  O  O   . PHE C  3  218 ? 60.186  47.271  67.662  1.00 46.91 ? 218  PHE C O   1 
ATOM   4347  C  CB  . PHE C  3  218 ? 58.698  44.447  68.344  1.00 46.91 ? 218  PHE C CB  1 
ATOM   4348  N  N   . GLY C  3  219 ? 60.899  45.587  66.344  1.00 46.91 ? 219  GLY C N   1 
ATOM   4349  C  CA  . GLY C  3  219 ? 61.220  46.468  65.237  1.00 46.91 ? 219  GLY C CA  1 
ATOM   4350  C  C   . GLY C  3  219 ? 60.024  46.817  64.371  1.00 46.91 ? 219  GLY C C   1 
ATOM   4351  O  O   . GLY C  3  219 ? 60.060  47.798  63.626  1.00 46.91 ? 219  GLY C O   1 
ATOM   4352  N  N   . GLY C  3  220 ? 58.986  45.986  64.426  1.00 46.91 ? 220  GLY C N   1 
ATOM   4353  C  CA  . GLY C  3  220 ? 57.792  46.233  63.637  1.00 46.91 ? 220  GLY C CA  1 
ATOM   4354  C  C   . GLY C  3  220 ? 56.829  47.198  64.305  1.00 46.91 ? 220  GLY C C   1 
ATOM   4355  O  O   . GLY C  3  220 ? 57.159  47.816  65.316  1.00 46.91 ? 220  GLY C O   1 
ATOM   4356  N  N   . GLU C  3  221 ? 55.635  47.327  63.731  1.00 46.91 ? 221  GLU C N   1 
ATOM   4357  C  CA  . GLU C  3  221 ? 54.610  48.216  64.270  1.00 46.91 ? 221  GLU C CA  1 
ATOM   4358  C  C   . GLU C  3  221 ? 54.022  47.650  65.560  1.00 46.91 ? 221  GLU C C   1 
ATOM   4359  O  O   . GLU C  3  221 ? 53.201  46.729  65.530  1.00 46.91 ? 221  GLU C O   1 
ATOM   4360  C  CB  . GLU C  3  221 ? 53.499  48.433  63.237  1.00 46.91 ? 221  GLU C CB  1 
ATOM   4361  N  N   . GLY C  3  222 ? 54.455  48.203  66.688  1.00 46.91 ? 222  GLY C N   1 
ATOM   4362  C  CA  . GLY C  3  222 ? 53.971  47.746  67.978  1.00 46.91 ? 222  GLY C CA  1 
ATOM   4363  C  C   . GLY C  3  222 ? 53.404  48.883  68.803  1.00 46.91 ? 222  GLY C C   1 
ATOM   4364  O  O   . GLY C  3  222 ? 54.119  49.508  69.589  1.00 46.91 ? 222  GLY C O   1 
ATOM   4365  N  N   . TRP C  3  223 ? 52.120  49.164  68.605  1.00 46.91 ? 223  TRP C N   1 
ATOM   4366  C  CA  . TRP C  3  223 ? 51.443  50.232  69.331  1.00 46.91 ? 223  TRP C CA  1 
ATOM   4367  C  C   . TRP C  3  223 ? 51.205  49.858  70.791  1.00 46.91 ? 223  TRP C C   1 
ATOM   4368  O  O   . TRP C  3  223 ? 51.279  50.710  71.677  1.00 46.91 ? 223  TRP C O   1 
ATOM   4369  C  CB  . TRP C  3  223 ? 50.114  50.572  68.654  1.00 46.91 ? 223  TRP C CB  1 
ATOM   4370  N  N   . ILE C  3  224 ? 50.905  48.584  71.032  1.00 46.91 ? 224  ILE C N   1 
ATOM   4371  C  CA  . ILE C  3  224 ? 50.653  48.092  72.383  1.00 46.91 ? 224  ILE C CA  1 
ATOM   4372  C  C   . ILE C  3  224 ? 51.952  47.743  73.108  1.00 46.91 ? 224  ILE C C   1 
ATOM   4373  O  O   . ILE C  3  224 ? 52.135  46.614  73.573  1.00 46.91 ? 224  ILE C O   1 
ATOM   4374  C  CB  . ILE C  3  224 ? 49.731  46.852  72.364  1.00 46.91 ? 224  ILE C CB  1 
ATOM   4375  N  N   . VAL C  3  225 ? 52.859  48.712  73.183  1.00 46.91 ? 225  VAL C N   1 
ATOM   4376  C  CA  . VAL C  3  225 ? 54.142  48.518  73.852  1.00 46.91 ? 225  VAL C CA  1 
ATOM   4377  C  C   . VAL C  3  225 ? 54.052  48.834  75.345  1.00 46.91 ? 225  VAL C C   1 
ATOM   4378  O  O   . VAL C  3  225 ? 55.010  48.621  76.089  1.00 46.91 ? 225  VAL C O   1 
ATOM   4379  C  CB  . VAL C  3  225 ? 55.242  49.390  73.218  1.00 46.91 ? 225  VAL C CB  1 
ATOM   4380  N  N   . SER C  3  226 ? 52.907  49.361  75.770  1.00 46.91 ? 226  SER C N   1 
ATOM   4381  C  CA  . SER C  3  226 ? 52.682  49.701  77.172  1.00 46.91 ? 226  SER C CA  1 
ATOM   4382  C  C   . SER C  3  226 ? 52.217  48.461  77.936  1.00 46.91 ? 226  SER C C   1 
ATOM   4383  O  O   . SER C  3  226 ? 51.142  48.452  78.541  1.00 46.91 ? 226  SER C O   1 
ATOM   4384  C  CB  . SER C  3  226 ? 51.639  50.815  77.285  1.00 46.91 ? 226  SER C CB  1 
ATOM   4385  N  N   . VAL C  3  227 ? 53.030  47.410  77.883  1.00 46.91 ? 227  VAL C N   1 
ATOM   4386  C  CA  . VAL C  3  227 ? 52.720  46.149  78.546  1.00 46.91 ? 227  VAL C CA  1 
ATOM   4387  C  C   . VAL C  3  227 ? 53.035  46.147  80.044  1.00 46.91 ? 227  VAL C C   1 
ATOM   4388  O  O   . VAL C  3  227 ? 52.810  47.141  80.734  1.00 46.91 ? 227  VAL C O   1 
ATOM   4389  C  CB  . VAL C  3  227 ? 53.453  44.978  77.860  1.00 46.91 ? 227  VAL C CB  1 
ATOM   4390  N  N   . ASN C  3  228 ? 53.534  45.014  80.537  1.00 46.91 ? 228  ASN C N   1 
ATOM   4391  C  CA  . ASN C  3  228 ? 53.879  44.838  81.947  1.00 46.91 ? 228  ASN C CA  1 
ATOM   4392  C  C   . ASN C  3  228 ? 54.657  46.013  82.530  1.00 46.91 ? 228  ASN C C   1 
ATOM   4393  O  O   . ASN C  3  228 ? 54.234  46.616  83.517  1.00 46.91 ? 228  ASN C O   1 
ATOM   4394  C  CB  . ASN C  3  228 ? 54.681  43.547  82.131  1.00 46.91 ? 228  ASN C CB  1 
ATOM   4395  N  N   . ASN C  3  229 ? 55.821  46.292  81.954  1.00 46.91 ? 229  ASN C N   1 
ATOM   4396  C  CA  . ASN C  3  229 ? 56.650  47.402  82.409  1.00 46.91 ? 229  ASN C CA  1 
ATOM   4397  C  C   . ASN C  3  229 ? 56.279  48.664  81.637  1.00 46.91 ? 229  ASN C C   1 
ATOM   4398  O  O   . ASN C  3  229 ? 56.632  48.811  80.467  1.00 46.91 ? 229  ASN C O   1 
ATOM   4399  C  CB  . ASN C  3  229 ? 58.134  47.078  82.215  1.00 46.91 ? 229  ASN C CB  1 
ATOM   4400  N  N   . LEU C  3  230 ? 55.547  49.558  82.295  1.00 46.91 ? 230  LEU C N   1 
ATOM   4401  C  CA  . LEU C  3  230 ? 55.116  50.809  81.680  1.00 46.91 ? 230  LEU C CA  1 
ATOM   4402  C  C   . LEU C  3  230 ? 56.228  51.856  81.627  1.00 46.91 ? 230  LEU C C   1 
ATOM   4403  O  O   . LEU C  3  230 ? 56.050  52.931  81.051  1.00 46.91 ? 230  LEU C O   1 
ATOM   4404  C  CB  . LEU C  3  230 ? 53.905  51.375  82.426  1.00 46.91 ? 230  LEU C CB  1 
ATOM   4405  N  N   . GLU C  3  231 ? 57.357  51.553  82.262  1.00 46.91 ? 231  GLU C N   1 
ATOM   4406  C  CA  . GLU C  3  231 ? 58.497  52.466  82.285  1.00 46.91 ? 231  GLU C CA  1 
ATOM   4407  C  C   . GLU C  3  231 ? 59.245  52.483  80.952  1.00 46.91 ? 231  GLU C C   1 
ATOM   4408  O  O   . GLU C  3  231 ? 60.015  53.406  80.680  1.00 46.91 ? 231  GLU C O   1 
ATOM   4409  C  CB  . GLU C  3  231 ? 59.458  52.089  83.415  1.00 46.91 ? 231  GLU C CB  1 
ATOM   4410  N  N   . ASP C  3  232 ? 59.024  51.454  80.137  1.00 46.91 ? 232  ASP C N   1 
ATOM   4411  C  CA  . ASP C  3  232 ? 59.675  51.341  78.835  1.00 46.91 ? 232  ASP C CA  1 
ATOM   4412  C  C   . ASP C  3  232 ? 59.167  52.374  77.828  1.00 46.91 ? 232  ASP C C   1 
ATOM   4413  O  O   . ASP C  3  232 ? 59.756  52.551  76.760  1.00 46.91 ? 232  ASP C O   1 
ATOM   4414  C  CB  . ASP C  3  232 ? 59.485  49.930  78.269  1.00 46.91 ? 232  ASP C CB  1 
ATOM   4415  N  N   . VAL C  3  233 ? 58.058  53.030  78.160  1.00 46.91 ? 233  VAL C N   1 
ATOM   4416  C  CA  . VAL C  3  233 ? 57.471  54.044  77.291  1.00 46.91 ? 233  VAL C CA  1 
ATOM   4417  C  C   . VAL C  3  233 ? 58.262  55.349  77.338  1.00 46.91 ? 233  VAL C C   1 
ATOM   4418  O  O   . VAL C  3  233 ? 58.457  56.004  76.312  1.00 46.91 ? 233  VAL C O   1 
ATOM   4419  C  CB  . VAL C  3  233 ? 56.010  54.335  77.685  1.00 46.91 ? 233  VAL C CB  1 
ATOM   4420  N  N   . VAL C  3  234 ? 58.671  55.739  78.542  1.00 46.91 ? 234  VAL C N   1 
ATOM   4421  C  CA  . VAL C  3  234 ? 59.440  56.963  78.752  1.00 46.91 ? 234  VAL C CA  1 
ATOM   4422  C  C   . VAL C  3  234 ? 60.882  56.817  78.268  1.00 46.91 ? 234  VAL C C   1 
ATOM   4423  O  O   . VAL C  3  234 ? 61.473  57.773  77.764  1.00 46.91 ? 234  VAL C O   1 
ATOM   4424  C  CB  . VAL C  3  234 ? 59.457  57.366  80.239  1.00 46.91 ? 234  VAL C CB  1 
ATOM   4425  N  N   . GLY C  3  235 ? 61.444  55.626  78.448  1.00 46.91 ? 235  GLY C N   1 
ATOM   4426  C  CA  . GLY C  3  235 ? 62.809  55.370  78.023  1.00 46.91 ? 235  GLY C CA  1 
ATOM   4427  C  C   . GLY C  3  235 ? 62.938  55.240  76.517  1.00 46.91 ? 235  GLY C C   1 
ATOM   4428  O  O   . GLY C  3  235 ? 64.041  55.323  75.972  1.00 46.91 ? 235  GLY C O   1 
ATOM   4429  N  N   . GLY C  3  236 ? 61.814  54.999  75.848  1.00 46.91 ? 236  GLY C N   1 
ATOM   4430  C  CA  . GLY C  3  236 ? 61.819  54.865  74.402  1.00 46.91 ? 236  GLY C CA  1 
ATOM   4431  C  C   . GLY C  3  236 ? 61.809  56.208  73.697  1.00 46.91 ? 236  GLY C C   1 
ATOM   4432  O  O   . GLY C  3  236 ? 61.872  56.272  72.466  1.00 46.91 ? 236  GLY C O   1 
ATOM   4433  N  N   . HIS C  3  237 ? 61.693  57.280  74.475  1.00 46.91 ? 237  HIS C N   1 
ATOM   4434  C  CA  . HIS C  3  237 ? 61.672  58.635  73.938  1.00 46.91 ? 237  HIS C CA  1 
ATOM   4435  C  C   . HIS C  3  237 ? 63.028  59.316  74.105  1.00 46.91 ? 237  HIS C C   1 
ATOM   4436  O  O   . HIS C  3  237 ? 63.383  60.206  73.333  1.00 46.91 ? 237  HIS C O   1 
ATOM   4437  C  CB  . HIS C  3  237 ? 60.594  59.469  74.636  1.00 46.91 ? 237  HIS C CB  1 
ATOM   4438  C  CG  . HIS C  3  237 ? 59.212  58.899  74.516  1.00 46.91 ? 237  HIS C CG  1 
ATOM   4439  N  ND1 . HIS C  3  237 ? 58.808  58.150  73.432  1.00 46.91 ? 237  HIS C ND1 1 
ATOM   4440  C  CD2 . HIS C  3  237 ? 58.146  58.971  75.345  1.00 46.91 ? 237  HIS C CD2 1 
ATOM   4441  C  CE1 . HIS C  3  237 ? 57.550  57.784  73.601  1.00 46.91 ? 237  HIS C CE1 1 
ATOM   4442  N  NE2 . HIS C  3  237 ? 57.124  58.269  74.752  1.00 46.91 ? 237  HIS C NE2 1 
ATOM   4443  N  N   . ILE C  3  238 ? 63.769  58.906  75.131  1.00 46.91 ? 238  ILE C N   1 
ATOM   4444  C  CA  . ILE C  3  238 ? 65.082  59.474  75.417  1.00 46.91 ? 238  ILE C CA  1 
ATOM   4445  C  C   . ILE C  3  238 ? 66.183  58.927  74.510  1.00 46.91 ? 238  ILE C C   1 
ATOM   4446  O  O   . ILE C  3  238 ? 67.232  59.556  74.351  1.00 46.91 ? 238  ILE C O   1 
ATOM   4447  C  CB  . ILE C  3  238 ? 65.485  59.231  76.885  1.00 46.91 ? 238  ILE C CB  1 
ATOM   4448  N  N   . TRP C  3  239 ? 65.965  57.736  73.959  1.00 46.91 ? 239  TRP C N   1 
ATOM   4449  C  CA  . TRP C  3  239 ? 66.943  57.114  73.076  1.00 46.91 ? 239  TRP C CA  1 
ATOM   4450  C  C   . TRP C  3  239 ? 66.637  57.445  71.618  1.00 46.91 ? 239  TRP C C   1 
ATOM   4451  O  O   . TRP C  3  239 ? 67.526  57.844  70.865  1.00 46.91 ? 239  TRP C O   1 
ATOM   4452  C  CB  . TRP C  3  239 ? 66.958  55.595  73.278  1.00 46.91 ? 239  TRP C CB  1 
ATOM   4453  C  CG  . TRP C  3  239 ? 68.239  54.934  72.842  1.00 46.91 ? 239  TRP C CG  1 
ATOM   4454  C  CD1 . TRP C  3  239 ? 69.289  54.582  73.644  1.00 46.91 ? 239  TRP C CD1 1 
ATOM   4455  C  CD2 . TRP C  3  239 ? 68.601  54.539  71.512  1.00 46.91 ? 239  TRP C CD2 1 
ATOM   4456  N  NE1 . TRP C  3  239 ? 70.280  53.993  72.897  1.00 46.91 ? 239  TRP C NE1 1 
ATOM   4457  C  CE2 . TRP C  3  239 ? 69.886  53.954  71.587  1.00 46.91 ? 239  TRP C CE2 1 
ATOM   4458  C  CE3 . TRP C  3  239 ? 67.968  54.622  70.265  1.00 46.91 ? 239  TRP C CE3 1 
ATOM   4459  C  CZ2 . TRP C  3  239 ? 70.548  53.453  70.459  1.00 46.91 ? 239  TRP C CZ2 1 
ATOM   4460  C  CZ3 . TRP C  3  239 ? 68.627  54.124  69.144  1.00 46.91 ? 239  TRP C CZ3 1 
ATOM   4461  C  CH2 . TRP C  3  239 ? 69.905  53.547  69.249  1.00 46.91 ? 239  TRP C CH2 1 
ATOM   4462  N  N   . ILE C  3  240 ? 65.384  57.233  71.216  1.00 46.91 ? 240  ILE C N   1 
ATOM   4463  C  CA  . ILE C  3  240 ? 64.956  57.508  69.848  1.00 46.91 ? 240  ILE C CA  1 
ATOM   4464  C  C   . ILE C  3  240 ? 64.740  58.998  69.594  1.00 46.91 ? 240  ILE C C   1 
ATOM   4465  O  O   . ILE C  3  240 ? 64.484  59.409  68.458  1.00 46.91 ? 240  ILE C O   1 
ATOM   4466  C  CB  . ILE C  3  240 ? 63.658  56.752  69.507  1.00 46.91 ? 240  ILE C CB  1 
ATOM   4467  N  N   . GLY C  3  241 ? 64.797  59.792  70.659  1.00 46.91 ? 241  GLY C N   1 
ATOM   4468  C  CA  . GLY C  3  241 ? 64.611  61.227  70.537  1.00 46.91 ? 241  GLY C CA  1 
ATOM   4469  C  C   . GLY C  3  241 ? 65.927  61.964  70.381  1.00 46.91 ? 241  GLY C C   1 
ATOM   4470  O  O   . GLY C  3  241 ? 66.073  62.804  69.493  1.00 46.91 ? 241  GLY C O   1 
ATOM   4471  N  N   . LEU C  3  242 ? 66.882  61.653  71.254  1.00 46.91 ? 242  LEU C N   1 
ATOM   4472  C  CA  . LEU C  3  242 ? 68.201  62.279  71.225  1.00 46.91 ? 242  LEU C CA  1 
ATOM   4473  C  C   . LEU C  3  242 ? 69.026  61.815  70.025  1.00 46.91 ? 242  LEU C C   1 
ATOM   4474  O  O   . LEU C  3  242 ? 70.056  62.412  69.703  1.00 46.91 ? 242  LEU C O   1 
ATOM   4475  C  CB  . LEU C  3  242 ? 68.957  61.978  72.521  1.00 46.91 ? 242  LEU C CB  1 
ATOM   4476  N  N   . ILE C  3  243 ? 68.604  60.713  69.411  1.00 46.91 ? 243  ILE C N   1 
ATOM   4477  C  CA  . ILE C  3  243 ? 69.286  60.167  68.245  1.00 46.91 ? 243  ILE C CA  1 
ATOM   4478  C  C   . ILE C  3  243 ? 68.656  60.709  66.964  1.00 46.91 ? 243  ILE C C   1 
ATOM   4479  O  O   . ILE C  3  243 ? 69.231  60.594  65.878  1.00 46.91 ? 243  ILE C O   1 
ATOM   4480  C  CB  . ILE C  3  243 ? 69.217  58.629  68.217  1.00 46.91 ? 243  ILE C CB  1 
ATOM   4481  N  N   . CYS C  3  244 ? 67.453  61.257  67.096  1.00 46.91 ? 244  CYS C N   1 
ATOM   4482  C  CA  . CYS C  3  244 ? 66.722  61.824  65.970  1.00 46.91 ? 244  CYS C CA  1 
ATOM   4483  C  C   . CYS C  3  244 ? 66.960  63.326  65.862  1.00 46.91 ? 244  CYS C C   1 
ATOM   4484  O  O   . CYS C  3  244 ? 66.898  63.895  64.771  1.00 46.91 ? 244  CYS C O   1 
ATOM   4485  C  CB  . CYS C  3  244 ? 65.225  61.551  66.121  1.00 46.91 ? 244  CYS C CB  1 
ATOM   4486  N  N   . ILE C  3  245 ? 67.196  63.963  67.006  1.00 46.91 ? 245  ILE C N   1 
ATOM   4487  C  CA  . ILE C  3  245 ? 67.443  65.399  67.065  1.00 46.91 ? 245  ILE C CA  1 
ATOM   4488  C  C   . ILE C  3  245 ? 68.887  65.716  66.686  1.00 46.91 ? 245  ILE C C   1 
ATOM   4489  O  O   . ILE C  3  245 ? 69.161  66.721  66.026  1.00 46.91 ? 245  ILE C O   1 
ATOM   4490  C  CB  . ILE C  3  245 ? 67.167  65.955  68.475  1.00 46.91 ? 245  ILE C CB  1 
ATOM   4491  N  N   . ALA C  3  246 ? 69.810  64.876  67.150  1.00 46.91 ? 246  ALA C N   1 
ATOM   4492  C  CA  . ALA C  3  246 ? 71.227  65.053  66.859  1.00 46.91 ? 246  ALA C CA  1 
ATOM   4493  C  C   . ALA C  3  246 ? 71.553  64.544  65.458  1.00 46.91 ? 246  ALA C C   1 
ATOM   4494  O  O   . ALA C  3  246 ? 72.513  65.001  64.832  1.00 46.91 ? 246  ALA C O   1 
ATOM   4495  C  CB  . ALA C  3  246 ? 72.069  64.322  67.894  1.00 46.91 ? 246  ALA C CB  1 
ATOM   4496  N  N   . GLY C  3  247 ? 70.780  63.567  64.996  1.00 46.91 ? 247  GLY C N   1 
ATOM   4497  C  CA  . GLY C  3  247 ? 70.987  63.009  63.672  1.00 46.91 ? 247  GLY C CA  1 
ATOM   4498  C  C   . GLY C  3  247 ? 70.265  63.795  62.594  1.00 46.91 ? 247  GLY C C   1 
ATOM   4499  O  O   . GLY C  3  247 ? 70.568  63.654  61.406  1.00 46.91 ? 247  GLY C O   1 
ATOM   4500  N  N   . GLY C  3  248 ? 69.280  64.588  63.006  1.00 46.91 ? 248  GLY C N   1 
ATOM   4501  C  CA  . GLY C  3  248 ? 68.520  65.394  62.069  1.00 46.91 ? 248  GLY C CA  1 
ATOM   4502  C  C   . GLY C  3  248 ? 69.222  66.694  61.726  1.00 46.91 ? 248  GLY C C   1 
ATOM   4503  O  O   . GLY C  3  248 ? 69.252  67.103  60.565  1.00 46.91 ? 248  GLY C O   1 
ATOM   4504  N  N   . ILE C  3  249 ? 69.767  67.352  62.745  1.00 46.91 ? 249  ILE C N   1 
ATOM   4505  C  CA  . ILE C  3  249 ? 70.478  68.613  62.567  1.00 46.91 ? 249  ILE C CA  1 
ATOM   4506  C  C   . ILE C  3  249 ? 71.830  68.405  61.886  1.00 46.91 ? 249  ILE C C   1 
ATOM   4507  O  O   . ILE C  3  249 ? 72.461  69.364  61.432  1.00 46.91 ? 249  ILE C O   1 
ATOM   4508  C  CB  . ILE C  3  249 ? 70.705  69.321  63.917  1.00 46.91 ? 249  ILE C CB  1 
ATOM   4509  N  N   . TRP C  3  250 ? 72.291  67.158  61.865  1.00 46.91 ? 250  TRP C N   1 
ATOM   4510  C  CA  . TRP C  3  250 ? 73.563  66.811  61.242  1.00 46.91 ? 250  TRP C CA  1 
ATOM   4511  C  C   . TRP C  3  250 ? 73.370  66.401  59.784  1.00 46.91 ? 250  TRP C C   1 
ATOM   4512  O  O   . TRP C  3  250 ? 74.316  66.427  58.992  1.00 46.91 ? 250  TRP C O   1 
ATOM   4513  C  CB  . TRP C  3  250 ? 74.238  65.674  62.013  1.00 46.91 ? 250  TRP C CB  1 
ATOM   4514  N  N   . HIS C  3  251 ? 72.150  65.993  59.447  1.00 46.91 ? 251  HIS C N   1 
ATOM   4515  C  CA  . HIS C  3  251 ? 71.813  65.571  58.092  1.00 46.91 ? 251  HIS C CA  1 
ATOM   4516  C  C   . HIS C  3  251 ? 71.644  66.752  57.137  1.00 46.91 ? 251  HIS C C   1 
ATOM   4517  O  O   . HIS C  3  251 ? 71.581  66.568  55.919  1.00 46.91 ? 251  HIS C O   1 
ATOM   4518  C  CB  . HIS C  3  251 ? 70.534  64.731  58.105  1.00 46.91 ? 251  HIS C CB  1 
ATOM   4519  N  N   . ILE C  3  252 ? 71.558  67.955  57.698  1.00 46.91 ? 252  ILE C N   1 
ATOM   4520  C  CA  . ILE C  3  252 ? 71.395  69.176  56.915  1.00 46.91 ? 252  ILE C CA  1 
ATOM   4521  C  C   . ILE C  3  252 ? 72.727  69.635  56.330  1.00 46.91 ? 252  ILE C C   1 
ATOM   4522  O  O   . ILE C  3  252 ? 72.779  69.834  55.096  1.00 46.91 ? 252  ILE C O   1 
ATOM   4523  C  CB  . ILE C  3  252 ? 70.816  70.314  57.777  1.00 46.91 ? 252  ILE C CB  1 
ATOM   4524  N  N   . ALA C  3  260 ? 73.202  59.521  45.864  1.00 46.91 ? 260  ALA C N   1 
ATOM   4525  C  CA  . ALA C  3  260 ? 72.521  60.155  44.697  1.00 46.91 ? 260  ALA C CA  1 
ATOM   4526  C  C   . ALA C  3  260 ? 71.422  61.117  45.141  1.00 46.91 ? 260  ALA C C   1 
ATOM   4527  O  O   . ALA C  3  260 ? 70.802  60.930  46.189  1.00 46.91 ? 260  ALA C O   1 
ATOM   4528  C  CB  . ALA C  3  260 ? 71.945  59.085  43.780  1.00 46.91 ? 260  ALA C CB  1 
ATOM   4529  N  N   . ARG C  3  261 ? 71.206  62.159  44.344  1.00 46.91 ? 261  ARG C N   1 
ATOM   4530  C  CA  . ARG C  3  261 ? 70.185  63.160  44.637  1.00 46.91 ? 261  ARG C CA  1 
ATOM   4531  C  C   . ARG C  3  261 ? 68.851  62.823  43.972  1.00 46.91 ? 261  ARG C C   1 
ATOM   4532  O  O   . ARG C  3  261 ? 67.962  63.671  43.887  1.00 46.91 ? 261  ARG C O   1 
ATOM   4533  C  CB  . ARG C  3  261 ? 70.659  64.544  44.185  1.00 46.91 ? 261  ARG C CB  1 
ATOM   4534  N  N   . ARG C  3  262 ? 68.733  61.597  43.470  1.00 46.91 ? 262  ARG C N   1 
ATOM   4535  C  CA  . ARG C  3  262 ? 67.511  61.151  42.809  1.00 46.91 ? 262  ARG C CA  1 
ATOM   4536  C  C   . ARG C  3  262 ? 66.641  60.309  43.743  1.00 46.91 ? 262  ARG C C   1 
ATOM   4537  O  O   . ARG C  3  262 ? 66.618  59.078  43.651  1.00 46.91 ? 262  ARG C O   1 
ATOM   4538  C  CB  . ARG C  3  262 ? 67.851  60.359  41.544  1.00 46.91 ? 262  ARG C CB  1 
ATOM   4539  N  N   . ALA C  3  263 ? 65.935  60.984  44.643  1.00 46.91 ? 263  ALA C N   1 
ATOM   4540  C  CA  . ALA C  3  263 ? 65.050  60.323  45.600  1.00 46.91 ? 263  ALA C CA  1 
ATOM   4541  C  C   . ALA C  3  263 ? 63.690  61.006  45.592  1.00 46.91 ? 263  ALA C C   1 
ATOM   4542  O  O   . ALA C  3  263 ? 63.339  61.728  46.528  1.00 46.91 ? 263  ALA C O   1 
ATOM   4543  C  CB  . ALA C  3  263 ? 65.668  60.364  46.996  1.00 46.91 ? 263  ALA C CB  1 
ATOM   4544  N  N   . PHE C  3  264 ? 62.915  60.738  44.542  1.00 46.91 ? 264  PHE C N   1 
ATOM   4545  C  CA  . PHE C  3  264 ? 61.584  61.317  44.361  1.00 46.91 ? 264  PHE C CA  1 
ATOM   4546  C  C   . PHE C  3  264 ? 61.655  62.811  44.047  1.00 46.91 ? 264  PHE C C   1 
ATOM   4547  O  O   . PHE C  3  264 ? 62.739  63.394  43.992  1.00 46.91 ? 264  PHE C O   1 
ATOM   4548  C  CB  . PHE C  3  264 ? 60.704  61.071  45.593  1.00 46.91 ? 264  PHE C CB  1 
ATOM   4549  N  N   . ILE C  3  265 ? 60.499  63.411  43.789  1.00 46.91 ? 265  ILE C N   1 
ATOM   4550  C  CA  . ILE C  3  265 ? 60.428  64.832  43.469  1.00 46.91 ? 265  ILE C CA  1 
ATOM   4551  C  C   . ILE C  3  265 ? 60.330  65.700  44.720  1.00 46.91 ? 265  ILE C C   1 
ATOM   4552  O  O   . ILE C  3  265 ? 59.249  65.861  45.292  1.00 46.91 ? 265  ILE C O   1 
ATOM   4553  C  CB  . ILE C  3  265 ? 59.230  65.143  42.548  1.00 46.91 ? 265  ILE C CB  1 
ATOM   4554  N  N   . TRP C  3  266 ? 61.465  66.245  45.147  1.00 46.91 ? 266  TRP C N   1 
ATOM   4555  C  CA  . TRP C  3  266 ? 61.510  67.110  46.323  1.00 46.91 ? 266  TRP C CA  1 
ATOM   4556  C  C   . TRP C  3  266 ? 60.720  68.384  46.040  1.00 46.91 ? 266  TRP C C   1 
ATOM   4557  O  O   . TRP C  3  266 ? 60.979  69.077  45.054  1.00 46.91 ? 266  TRP C O   1 
ATOM   4558  C  CB  . TRP C  3  266 ? 62.959  67.464  46.674  1.00 46.91 ? 266  TRP C CB  1 
ATOM   4559  C  CG  . TRP C  3  266 ? 63.771  66.308  47.183  1.00 46.91 ? 266  TRP C CG  1 
ATOM   4560  C  CD1 . TRP C  3  266 ? 64.747  65.628  46.507  1.00 46.91 ? 266  TRP C CD1 1 
ATOM   4561  C  CD2 . TRP C  3  266 ? 63.698  65.714  48.485  1.00 46.91 ? 266  TRP C CD2 1 
ATOM   4562  N  NE1 . TRP C  3  266 ? 65.288  64.652  47.310  1.00 46.91 ? 266  TRP C NE1 1 
ATOM   4563  C  CE2 . TRP C  3  266 ? 64.663  64.681  48.528  1.00 46.91 ? 266  TRP C CE2 1 
ATOM   4564  C  CE3 . TRP C  3  266 ? 62.914  65.954  49.621  1.00 46.91 ? 266  TRP C CE3 1 
ATOM   4565  C  CZ2 . TRP C  3  266 ? 64.863  63.889  49.665  1.00 46.91 ? 266  TRP C CZ2 1 
ATOM   4566  C  CZ3 . TRP C  3  266 ? 63.113  65.164  50.751  1.00 46.91 ? 266  TRP C CZ3 1 
ATOM   4567  C  CH2 . TRP C  3  266 ? 64.081  64.146  50.762  1.00 46.91 ? 266  TRP C CH2 1 
ATOM   4568  N  N   . SER C  3  267 ? 59.754  68.685  46.902  1.00 46.91 ? 267  SER C N   1 
ATOM   4569  C  CA  . SER C  3  267 ? 58.923  69.872  46.732  1.00 46.91 ? 267  SER C CA  1 
ATOM   4570  C  C   . SER C  3  267 ? 58.208  70.259  48.023  1.00 46.91 ? 267  SER C C   1 
ATOM   4571  O  O   . SER C  3  267 ? 58.447  69.671  49.079  1.00 46.91 ? 267  SER C O   1 
ATOM   4572  C  CB  . SER C  3  267 ? 57.895  69.638  45.622  1.00 46.91 ? 267  SER C CB  1 
ATOM   4573  N  N   . GLY C  3  268 ? 57.357  71.276  47.935  1.00 46.91 ? 268  GLY C N   1 
ATOM   4574  C  CA  . GLY C  3  268 ? 56.613  71.729  49.097  1.00 46.91 ? 268  GLY C CA  1 
ATOM   4575  C  C   . GLY C  3  268 ? 55.360  70.911  49.344  1.00 46.91 ? 268  GLY C C   1 
ATOM   4576  O  O   . GLY C  3  268 ? 54.858  70.859  50.467  1.00 46.91 ? 268  GLY C O   1 
ATOM   4577  N  N   . GLU C  3  269 ? 54.828  70.315  48.280  1.00 46.91 ? 269  GLU C N   1 
ATOM   4578  C  CA  . GLU C  3  269 ? 53.626  69.493  48.375  1.00 46.91 ? 269  GLU C CA  1 
ATOM   4579  C  C   . GLU C  3  269 ? 53.970  68.042  48.696  1.00 46.91 ? 269  GLU C C   1 
ATOM   4580  O  O   . GLU C  3  269 ? 53.211  67.353  49.377  1.00 46.91 ? 269  GLU C O   1 
ATOM   4581  C  CB  . GLU C  3  269 ? 52.832  69.562  47.068  1.00 46.91 ? 269  GLU C CB  1 
ATOM   4582  N  N   . ALA C  3  270 ? 55.106  67.579  48.179  1.00 46.91 ? 270  ALA C N   1 
ATOM   4583  C  CA  . ALA C  3  270 ? 55.562  66.212  48.410  1.00 46.91 ? 270  ALA C CA  1 
ATOM   4584  C  C   . ALA C  3  270 ? 55.975  66.010  49.865  1.00 46.91 ? 270  ALA C C   1 
ATOM   4585  O  O   . ALA C  3  270 ? 55.860  64.908  50.406  1.00 46.91 ? 270  ALA C O   1 
ATOM   4586  C  CB  . ALA C  3  270 ? 56.723  65.883  47.482  1.00 46.91 ? 270  ALA C CB  1 
ATOM   4587  N  N   . TYR C  3  271 ? 56.487  67.072  50.478  1.00 46.91 ? 271  TYR C N   1 
ATOM   4588  C  CA  . TYR C  3  271 ? 56.918  67.030  51.871  1.00 46.91 ? 271  TYR C CA  1 
ATOM   4589  C  C   . TYR C  3  271 ? 55.727  67.188  52.813  1.00 46.91 ? 271  TYR C C   1 
ATOM   4590  O  O   . TYR C  3  271 ? 55.800  66.818  53.987  1.00 46.91 ? 271  TYR C O   1 
ATOM   4591  C  CB  . TYR C  3  271 ? 57.945  68.133  52.140  1.00 46.91 ? 271  TYR C CB  1 
ATOM   4592  N  N   . LEU C  3  272 ? 54.650  67.778  52.303  1.00 46.91 ? 272  LEU C N   1 
ATOM   4593  C  CA  . LEU C  3  272 ? 53.438  67.990  53.085  1.00 46.91 ? 272  LEU C CA  1 
ATOM   4594  C  C   . LEU C  3  272 ? 52.568  66.736  53.111  1.00 46.91 ? 272  LEU C C   1 
ATOM   4595  O  O   . LEU C  3  272 ? 51.872  66.477  54.093  1.00 46.91 ? 272  LEU C O   1 
ATOM   4596  C  CB  . LEU C  3  272 ? 52.639  69.165  52.518  1.00 46.91 ? 272  LEU C CB  1 
ATOM   4597  N  N   . SER C  3  273 ? 52.591  65.982  52.015  1.00 46.91 ? 273  SER C N   1 
ATOM   4598  C  CA  . SER C  3  273 ? 51.811  64.755  51.902  1.00 46.91 ? 273  SER C CA  1 
ATOM   4599  C  C   . SER C  3  273 ? 52.450  63.616  52.692  1.00 46.91 ? 273  SER C C   1 
ATOM   4600  O  O   . SER C  3  273 ? 51.752  62.759  53.233  1.00 46.91 ? 273  SER C O   1 
ATOM   4601  C  CB  . SER C  3  273 ? 51.665  64.352  50.433  1.00 46.91 ? 273  SER C CB  1 
ATOM   4602  N  N   . TYR C  3  274 ? 53.780  63.591  52.723  1.00 46.91 ? 274  TYR C N   1 
ATOM   4603  C  CA  . TYR C  3  274 ? 54.512  62.562  53.454  1.00 46.91 ? 274  TYR C CA  1 
ATOM   4604  C  C   . TYR C  3  274 ? 54.450  62.854  54.952  1.00 46.91 ? 274  TYR C C   1 
ATOM   4605  O  O   . TYR C  3  274 ? 54.557  61.944  55.777  1.00 46.91 ? 274  TYR C O   1 
ATOM   4606  C  CB  . TYR C  3  274 ? 55.972  62.508  52.987  1.00 46.91 ? 274  TYR C CB  1 
ATOM   4607  C  CG  . TYR C  3  274 ? 56.790  61.396  53.616  1.00 46.91 ? 274  TYR C CG  1 
ATOM   4608  C  CD1 . TYR C  3  274 ? 56.574  60.061  53.271  1.00 46.91 ? 274  TYR C CD1 1 
ATOM   4609  C  CD2 . TYR C  3  274 ? 57.788  61.680  54.550  1.00 46.91 ? 274  TYR C CD2 1 
ATOM   4610  C  CE1 . TYR C  3  274 ? 57.332  59.036  53.840  1.00 46.91 ? 274  TYR C CE1 1 
ATOM   4611  C  CE2 . TYR C  3  274 ? 58.551  60.664  55.123  1.00 46.91 ? 274  TYR C CE2 1 
ATOM   4612  C  CZ  . TYR C  3  274 ? 58.319  59.346  54.764  1.00 46.91 ? 274  TYR C CZ  1 
ATOM   4613  O  OH  . TYR C  3  274 ? 59.078  58.341  55.321  1.00 46.91 ? 274  TYR C OH  1 
ATOM   4614  N  N   . SER C  3  275 ? 54.317  64.132  55.294  1.00 46.91 ? 275  SER C N   1 
ATOM   4615  C  CA  . SER C  3  275 ? 54.236  64.556  56.686  1.00 46.91 ? 275  SER C CA  1 
ATOM   4616  C  C   . SER C  3  275 ? 52.859  64.258  57.269  1.00 46.91 ? 275  SER C C   1 
ATOM   4617  O  O   . SER C  3  275 ? 52.717  64.065  58.478  1.00 46.91 ? 275  SER C O   1 
ATOM   4618  C  CB  . SER C  3  275 ? 54.531  66.052  56.799  1.00 46.91 ? 275  SER C CB  1 
ATOM   4619  N  N   . LEU C  3  276 ? 51.843  64.280  56.411  1.00 46.91 ? 276  LEU C N   1 
ATOM   4620  C  CA  . LEU C  3  276 ? 50.470  64.005  56.823  1.00 46.91 ? 276  LEU C CA  1 
ATOM   4621  C  C   . LEU C  3  276 ? 50.186  62.507  56.786  1.00 46.91 ? 276  LEU C C   1 
ATOM   4622  O  O   . LEU C  3  276 ? 49.378  62.003  57.567  1.00 46.91 ? 276  LEU C O   1 
ATOM   4623  C  CB  . LEU C  3  276 ? 49.485  64.742  55.916  1.00 46.91 ? 276  LEU C CB  1 
ATOM   4624  N  N   . GLY C  3  277 ? 50.834  61.811  55.857  1.00 46.91 ? 277  GLY C N   1 
ATOM   4625  C  CA  . GLY C  3  277 ? 50.651  60.376  55.730  1.00 46.91 ? 277  GLY C CA  1 
ATOM   4626  C  C   . GLY C  3  277 ? 51.298  59.618  56.872  1.00 46.91 ? 277  GLY C C   1 
ATOM   4627  O  O   . GLY C  3  277 ? 50.884  58.505  57.203  1.00 46.91 ? 277  GLY C O   1 
ATOM   4628  N  N   . ALA C  3  278 ? 52.348  60.203  57.442  1.00 46.91 ? 278  ALA C N   1 
ATOM   4629  C  CA  . ALA C  3  278 ? 53.065  59.601  58.559  1.00 46.91 ? 278  ALA C CA  1 
ATOM   4630  C  C   . ALA C  3  278 ? 52.389  59.964  59.878  1.00 46.91 ? 278  ALA C C   1 
ATOM   4631  O  O   . ALA C  3  278 ? 52.454  59.204  60.848  1.00 46.91 ? 278  ALA C O   1 
ATOM   4632  C  CB  . ALA C  3  278 ? 54.516  60.065  58.563  1.00 46.91 ? 278  ALA C CB  1 
ATOM   4633  N  N   . LEU C  3  279 ? 51.783  61.146  59.919  1.00 46.91 ? 279  LEU C N   1 
ATOM   4634  C  CA  . LEU C  3  279 ? 51.086  61.623  61.109  1.00 46.91 ? 279  LEU C CA  1 
ATOM   4635  C  C   . LEU C  3  279 ? 49.737  60.927  61.263  1.00 46.91 ? 279  LEU C C   1 
ATOM   4636  O  O   . LEU C  3  279 ? 49.258  60.729  62.380  1.00 46.91 ? 279  LEU C O   1 
ATOM   4637  C  CB  . LEU C  3  279 ? 50.885  63.139  61.037  1.00 46.91 ? 279  LEU C CB  1 
ATOM   4638  N  N   . SER C  3  280 ? 49.112  60.602  60.133  1.00 46.91 ? 280  SER C N   1 
ATOM   4639  C  CA  . SER C  3  280 ? 47.820  59.924  60.124  1.00 46.91 ? 280  SER C CA  1 
ATOM   4640  C  C   . SER C  3  280 ? 47.992  58.439  60.432  1.00 46.91 ? 280  SER C C   1 
ATOM   4641  O  O   . SER C  3  280 ? 47.060  57.779  60.894  1.00 46.91 ? 280  SER C O   1 
ATOM   4642  C  CB  . SER C  3  280 ? 47.135  60.099  58.767  1.00 46.91 ? 280  SER C CB  1 
ATOM   4643  N  N   . MET C  3  281 ? 49.178  57.912  60.138  1.00 46.91 ? 281  MET C N   1 
ATOM   4644  C  CA  . MET C  3  281 ? 49.485  56.512  60.398  1.00 46.91 ? 281  MET C CA  1 
ATOM   4645  C  C   . MET C  3  281 ? 49.621  56.296  61.903  1.00 46.91 ? 281  MET C C   1 
ATOM   4646  O  O   . MET C  3  281 ? 49.461  55.178  62.399  1.00 46.91 ? 281  MET C O   1 
ATOM   4647  C  CB  . MET C  3  281 ? 50.786  56.112  59.696  1.00 46.91 ? 281  MET C CB  1 
ATOM   4648  N  N   . MET C  3  282 ? 49.961  57.368  62.612  1.00 46.91 ? 282  MET C N   1 
ATOM   4649  C  CA  . MET C  3  282 ? 50.117  57.333  64.060  1.00 46.91 ? 282  MET C CA  1 
ATOM   4650  C  C   . MET C  3  282 ? 48.806  57.716  64.745  1.00 46.91 ? 282  MET C C   1 
ATOM   4651  O  O   . MET C  3  282 ? 48.669  57.567  65.959  1.00 46.91 ? 282  MET C O   1 
ATOM   4652  C  CB  . MET C  3  282 ? 51.229  58.288  64.498  1.00 46.91 ? 282  MET C CB  1 
ATOM   4653  N  N   . GLY C  3  283 ? 47.874  58.257  63.966  1.00 46.91 ? 283  GLY C N   1 
ATOM   4654  C  CA  . GLY C  3  283 ? 46.583  58.652  64.501  1.00 46.91 ? 283  GLY C CA  1 
ATOM   4655  C  C   . GLY C  3  283 ? 45.608  57.491  64.504  1.00 46.91 ? 283  GLY C C   1 
ATOM   4656  O  O   . GLY C  3  283 ? 44.839  57.317  65.452  1.00 46.91 ? 283  GLY C O   1 
ATOM   4657  N  N   . PHE C  3  284 ? 45.619  56.715  63.423  1.00 46.91 ? 284  PHE C N   1 
ATOM   4658  C  CA  . PHE C  3  284 ? 44.745  55.554  63.293  1.00 46.91 ? 284  PHE C CA  1 
ATOM   4659  C  C   . PHE C  3  284 ? 45.234  54.429  64.200  1.00 46.91 ? 284  PHE C C   1 
ATOM   4660  O  O   . PHE C  3  284 ? 44.472  53.527  64.553  1.00 46.91 ? 284  PHE C O   1 
ATOM   4661  C  CB  . PHE C  3  284 ? 44.711  55.075  61.839  1.00 46.91 ? 284  PHE C CB  1 
ATOM   4662  N  N   . ILE C  3  285 ? 46.520  54.468  64.535  1.00 46.91 ? 285  ILE C N   1 
ATOM   4663  C  CA  . ILE C  3  285 ? 47.129  53.470  65.406  1.00 46.91 ? 285  ILE C CA  1 
ATOM   4664  C  C   . ILE C  3  285 ? 46.859  53.816  66.868  1.00 46.91 ? 285  ILE C C   1 
ATOM   4665  O  O   . ILE C  3  285 ? 46.546  52.938  67.673  1.00 46.91 ? 285  ILE C O   1 
ATOM   4666  C  CB  . ILE C  3  285 ? 48.651  53.387  65.187  1.00 46.91 ? 285  ILE C CB  1 
ATOM   4667  N  N   . ALA C  3  286 ? 47.000  55.097  67.198  1.00 46.91 ? 286  ALA C N   1 
ATOM   4668  C  CA  . ALA C  3  286 ? 46.773  55.590  68.553  1.00 46.91 ? 286  ALA C CA  1 
ATOM   4669  C  C   . ALA C  3  286 ? 45.286  55.602  68.901  1.00 46.91 ? 286  ALA C C   1 
ATOM   4670  O  O   . ALA C  3  286 ? 44.915  55.787  70.063  1.00 46.91 ? 286  ALA C O   1 
ATOM   4671  C  CB  . ALA C  3  286 ? 47.359  56.984  68.713  1.00 46.91 ? 286  ALA C CB  1 
ATOM   4672  N  N   . THR C  3  287 ? 44.443  55.456  67.885  1.00 46.91 ? 287  THR C N   1 
ATOM   4673  C  CA  . THR C  3  287 ? 42.996  55.428  68.076  1.00 46.91 ? 287  THR C CA  1 
ATOM   4674  C  C   . THR C  3  287 ? 42.577  54.037  68.549  1.00 46.91 ? 287  THR C C   1 
ATOM   4675  O  O   . THR C  3  287 ? 41.387  53.740  68.674  1.00 46.91 ? 287  THR C O   1 
ATOM   4676  C  CB  . THR C  3  287 ? 42.256  55.755  66.768  1.00 46.91 ? 287  THR C CB  1 
ATOM   4677  N  N   . CYS C  3  288 ? 43.569  53.184  68.784  1.00 46.91 ? 288  CYS C N   1 
ATOM   4678  C  CA  . CYS C  3  288 ? 43.347  51.822  69.245  1.00 46.91 ? 288  CYS C CA  1 
ATOM   4679  C  C   . CYS C  3  288 ? 44.320  51.499  70.373  1.00 46.91 ? 288  CYS C C   1 
ATOM   4680  O  O   . CYS C  3  288 ? 44.025  50.676  71.238  1.00 46.91 ? 288  CYS C O   1 
ATOM   4681  C  CB  . CYS C  3  288 ? 43.541  50.836  68.092  1.00 46.91 ? 288  CYS C CB  1 
ATOM   4682  N  N   . PHE C  3  289 ? 45.492  52.128  70.335  1.00 46.91 ? 289  PHE C N   1 
ATOM   4683  C  CA  . PHE C  3  289 ? 46.512  51.924  71.357  1.00 46.91 ? 289  PHE C CA  1 
ATOM   4684  C  C   . PHE C  3  289 ? 46.122  52.653  72.640  1.00 46.91 ? 289  PHE C C   1 
ATOM   4685  O  O   . PHE C  3  289 ? 46.577  52.301  73.729  1.00 46.91 ? 289  PHE C O   1 
ATOM   4686  C  CB  . PHE C  3  289 ? 47.868  52.431  70.864  1.00 46.91 ? 289  PHE C CB  1 
ATOM   4687  N  N   . VAL C  3  290 ? 45.319  53.702  72.494  1.00 46.91 ? 290  VAL C N   1 
ATOM   4688  C  CA  . VAL C  3  290 ? 44.852  54.485  73.631  1.00 46.91 ? 290  VAL C CA  1 
ATOM   4689  C  C   . VAL C  3  290 ? 43.477  53.995  74.084  1.00 46.91 ? 290  VAL C C   1 
ATOM   4690  O  O   . VAL C  3  290 ? 42.701  54.747  74.679  1.00 46.91 ? 290  VAL C O   1 
ATOM   4691  C  CB  . VAL C  3  290 ? 44.766  55.984  73.283  1.00 46.91 ? 290  VAL C CB  1 
ATOM   4692  N  N   . TRP C  3  291 ? 43.187  52.729  73.798  1.00 46.91 ? 291  TRP C N   1 
ATOM   4693  C  CA  . TRP C  3  291 ? 41.916  52.116  74.163  1.00 46.91 ? 291  TRP C CA  1 
ATOM   4694  C  C   . TRP C  3  291 ? 42.058  50.600  74.300  1.00 46.91 ? 291  TRP C C   1 
ATOM   4695  O  O   . TRP C  3  291 ? 41.075  49.863  74.194  1.00 46.91 ? 291  TRP C O   1 
ATOM   4696  C  CB  . TRP C  3  291 ? 40.851  52.448  73.112  1.00 46.91 ? 291  TRP C CB  1 
ATOM   4697  N  N   . PHE C  3  292 ? 43.286  50.140  74.529  1.00 46.91 ? 292  PHE C N   1 
ATOM   4698  C  CA  . PHE C  3  292 ? 43.569  48.716  74.685  1.00 46.91 ? 292  PHE C CA  1 
ATOM   4699  C  C   . PHE C  3  292 ? 44.537  48.439  75.834  1.00 46.91 ? 292  PHE C C   1 
ATOM   4700  O  O   . PHE C  3  292 ? 44.124  48.014  76.915  1.00 46.91 ? 292  PHE C O   1 
ATOM   4701  C  CB  . PHE C  3  292 ? 44.135  48.126  73.386  1.00 46.91 ? 292  PHE C CB  1 
ATOM   4702  C  CG  . PHE C  3  292 ? 43.085  47.701  72.393  1.00 46.91 ? 292  PHE C CG  1 
ATOM   4703  C  CD1 . PHE C  3  292 ? 43.368  47.682  71.031  1.00 46.91 ? 292  PHE C CD1 1 
ATOM   4704  C  CD2 . PHE C  3  292 ? 41.820  47.301  72.817  1.00 46.91 ? 292  PHE C CD2 1 
ATOM   4705  C  CE1 . PHE C  3  292 ? 42.409  47.274  70.106  1.00 46.91 ? 292  PHE C CE1 1 
ATOM   4706  C  CE2 . PHE C  3  292 ? 40.854  46.894  71.901  1.00 46.91 ? 292  PHE C CE2 1 
ATOM   4707  C  CZ  . PHE C  3  292 ? 41.150  46.878  70.543  1.00 46.91 ? 292  PHE C CZ  1 
ATOM   4708  N  N   . ASN C  3  293 ? 45.828  48.628  75.576  1.00 46.91 ? 293  ASN C N   1 
ATOM   4709  C  CA  . ASN C  3  293 ? 46.857  48.396  76.584  1.00 46.91 ? 293  ASN C CA  1 
ATOM   4710  C  C   . ASN C  3  293 ? 47.186  49.664  77.365  1.00 46.91 ? 293  ASN C C   1 
ATOM   4711  O  O   . ASN C  3  293 ? 47.800  50.591  76.833  1.00 46.91 ? 293  ASN C O   1 
ATOM   4712  C  CB  . ASN C  3  293 ? 48.125  47.845  75.929  1.00 46.91 ? 293  ASN C CB  1 
ATOM   4713  N  N   . ASN C  3  294 ? 46.792  49.679  78.637  1.00 46.91 ? 294  ASN C N   1 
ATOM   4714  C  CA  . ASN C  3  294 ? 47.031  50.814  79.526  1.00 46.91 ? 294  ASN C CA  1 
ATOM   4715  C  C   . ASN C  3  294 ? 46.496  52.122  78.940  1.00 46.91 ? 294  ASN C C   1 
ATOM   4716  O  O   . ASN C  3  294 ? 45.295  52.248  78.704  1.00 46.91 ? 294  ASN C O   1 
ATOM   4717  C  CB  . ASN C  3  294 ? 48.526  50.932  79.850  1.00 46.91 ? 294  ASN C CB  1 
ATOM   4718  N  N   . THR C  3  295 ? 47.392  53.082  78.713  1.00 46.91 ? 295  THR C N   1 
ATOM   4719  C  CA  . THR C  3  295 ? 47.043  54.391  78.156  1.00 46.91 ? 295  THR C CA  1 
ATOM   4720  C  C   . THR C  3  295 ? 46.232  55.242  79.130  1.00 46.91 ? 295  THR C C   1 
ATOM   4721  O  O   . THR C  3  295 ? 46.677  56.314  79.545  1.00 46.91 ? 295  THR C O   1 
ATOM   4722  C  CB  . THR C  3  295 ? 46.265  54.261  76.829  1.00 46.91 ? 295  THR C CB  1 
ATOM   4723  N  N   . VAL C  3  296 ? 45.048  54.760  79.492  1.00 46.91 ? 296  VAL C N   1 
ATOM   4724  C  CA  . VAL C  3  296 ? 44.170  55.466  80.417  1.00 46.91 ? 296  VAL C CA  1 
ATOM   4725  C  C   . VAL C  3  296 ? 43.345  54.485  81.242  1.00 46.91 ? 296  VAL C C   1 
ATOM   4726  O  O   . VAL C  3  296 ? 42.486  53.779  80.715  1.00 46.91 ? 296  VAL C O   1 
ATOM   4727  C  CB  . VAL C  3  296 ? 43.215  56.416  79.669  1.00 46.91 ? 296  VAL C CB  1 
ATOM   4728  N  N   . TYR C  3  297 ? 43.588  54.478  82.549  1.00 46.91 ? 297  TYR C N   1 
ATOM   4729  C  CA  . TYR C  3  297 ? 42.883  53.588  83.465  1.00 46.91 ? 297  TYR C CA  1 
ATOM   4730  C  C   . TYR C  3  297 ? 41.395  53.906  83.657  1.00 46.91 ? 297  TYR C C   1 
ATOM   4731  O  O   . TYR C  3  297 ? 40.585  52.996  83.836  1.00 46.91 ? 297  TYR C O   1 
ATOM   4732  C  CB  . TYR C  3  297 ? 43.598  53.545  84.821  1.00 46.91 ? 297  TYR C CB  1 
ATOM   4733  C  CG  . TYR C  3  297 ? 43.059  52.494  85.768  1.00 46.91 ? 297  TYR C CG  1 
ATOM   4734  C  CD1 . TYR C  3  297 ? 43.138  51.136  85.454  1.00 46.91 ? 297  TYR C CD1 1 
ATOM   4735  C  CD2 . TYR C  3  297 ? 42.454  52.855  86.971  1.00 46.91 ? 297  TYR C CD2 1 
ATOM   4736  C  CE1 . TYR C  3  297 ? 42.630  50.165  86.312  1.00 46.91 ? 297  TYR C CE1 1 
ATOM   4737  C  CE2 . TYR C  3  297 ? 41.942  51.892  87.838  1.00 46.91 ? 297  TYR C CE2 1 
ATOM   4738  C  CZ  . TYR C  3  297 ? 42.033  50.549  87.501  1.00 46.91 ? 297  TYR C CZ  1 
ATOM   4739  O  OH  . TYR C  3  297 ? 41.540  49.588  88.354  1.00 46.91 ? 297  TYR C OH  1 
ATOM   4740  N  N   . PRO C  3  298 ? 41.021  55.199  83.692  1.00 46.91 ? 298  PRO C N   1 
ATOM   4741  C  CA  . PRO C  3  298 ? 39.595  55.495  83.873  1.00 46.91 ? 298  PRO C CA  1 
ATOM   4742  C  C   . PRO C  3  298 ? 38.716  55.071  82.692  1.00 46.91 ? 298  PRO C C   1 
ATOM   4743  O  O   . PRO C  3  298 ? 37.512  54.877  82.850  1.00 46.91 ? 298  PRO C O   1 
ATOM   4744  C  CB  . PRO C  3  298 ? 39.585  57.011  84.080  1.00 46.91 ? 298  PRO C CB  1 
ATOM   4745  C  CG  . PRO C  3  298 ? 40.783  57.469  83.326  1.00 46.91 ? 298  PRO C CG  1 
ATOM   4746  C  CD  . PRO C  3  298 ? 41.814  56.440  83.691  1.00 46.91 ? 298  PRO C CD  1 
ATOM   4747  N  N   . UNK C  3  299 ? 39.322  54.947  81.515  1.00 46.91 ? 1001 UNK C N   1 
ATOM   4748  C  CA  . UNK C  3  299 ? 38.606  54.546  80.306  1.00 46.91 ? 1001 UNK C CA  1 
ATOM   4749  C  C   . UNK C  3  299 ? 38.393  53.034  80.223  1.00 46.91 ? 1001 UNK C C   1 
ATOM   4750  O  O   . UNK C  3  299 ? 39.126  52.257  80.835  1.00 46.91 ? 1001 UNK C O   1 
ATOM   4751  C  CB  . UNK C  3  299 ? 39.351  55.036  79.072  1.00 46.91 ? 1001 UNK C CB  1 
ATOM   4752  N  N   . UNK C  3  300 ? 37.374  52.627  79.469  1.00 46.91 ? 1002 UNK C N   1 
ATOM   4753  C  CA  . UNK C  3  300 ? 37.060  51.211  79.288  1.00 46.91 ? 1002 UNK C CA  1 
ATOM   4754  C  C   . UNK C  3  300 ? 37.648  50.690  77.975  1.00 46.91 ? 1002 UNK C C   1 
ATOM   4755  O  O   . UNK C  3  300 ? 38.239  51.452  77.206  1.00 46.91 ? 1002 UNK C O   1 
ATOM   4756  C  CB  . UNK C  3  300 ? 35.551  50.997  79.318  1.00 46.91 ? 1002 UNK C CB  1 
ATOM   4757  N  N   . UNK C  3  301 ? 37.465  49.399  77.710  1.00 46.91 ? 1003 UNK C N   1 
ATOM   4758  C  CA  . UNK C  3  301 ? 37.985  48.782  76.492  1.00 46.91 ? 1003 UNK C CA  1 
ATOM   4759  C  C   . UNK C  3  301 ? 37.134  47.609  76.011  1.00 46.91 ? 1003 UNK C C   1 
ATOM   4760  O  O   . UNK C  3  301 ? 36.187  47.193  76.681  1.00 46.91 ? 1003 UNK C O   1 
ATOM   4761  C  CB  . UNK C  3  301 ? 39.425  48.326  76.708  1.00 46.91 ? 1003 UNK C CB  1 
ATOM   4762  N  N   . UNK C  3  302 ? 37.466  47.100  74.828  1.00 46.91 ? 1004 UNK C N   1 
ATOM   4763  C  CA  . UNK C  3  302 ? 36.757  45.968  74.239  1.00 46.91 ? 1004 UNK C CA  1 
ATOM   4764  C  C   . UNK C  3  302 ? 37.144  44.666  74.939  1.00 46.91 ? 1004 UNK C C   1 
ATOM   4765  O  O   . UNK C  3  302 ? 36.530  43.621  74.714  1.00 46.91 ? 1004 UNK C O   1 
ATOM   4766  C  CB  . UNK C  3  302 ? 37.056  45.881  72.750  1.00 46.91 ? 1004 UNK C CB  1 
ATOM   4767  N  N   . UNK C  3  303 ? 38.219  44.722  75.721  1.00 46.91 ? 1005 UNK C N   1 
ATOM   4768  C  CA  . UNK C  3  303 ? 38.689  43.567  76.477  1.00 46.91 ? 1005 UNK C CA  1 
ATOM   4769  C  C   . UNK C  3  303 ? 38.318  43.757  77.948  1.00 46.91 ? 1005 UNK C C   1 
ATOM   4770  O  O   . UNK C  3  303 ? 38.627  42.917  78.794  1.00 46.91 ? 1005 UNK C O   1 
ATOM   4771  C  CB  . UNK C  3  303 ? 40.195  43.407  76.321  1.00 46.91 ? 1005 UNK C CB  1 
ATOM   4772  N  N   . UNK C  3  304 ? 37.701  44.897  78.245  1.00 46.91 ? 1006 UNK C N   1 
ATOM   4773  C  CA  . UNK C  3  304 ? 37.265  45.227  79.597  1.00 46.91 ? 1006 UNK C CA  1 
ATOM   4774  C  C   . UNK C  3  304 ? 35.765  44.973  79.723  1.00 46.91 ? 1006 UNK C C   1 
ATOM   4775  O  O   . UNK C  3  304 ? 35.265  44.674  80.806  1.00 46.91 ? 1006 UNK C O   1 
ATOM   4776  C  CB  . UNK C  3  304 ? 37.583  46.683  79.914  1.00 46.91 ? 1006 UNK C CB  1 
ATOM   4777  N  N   . UNK C  3  305 ? 35.053  45.109  78.607  1.00 46.91 ? 1007 UNK C N   1 
ATOM   4778  C  CA  . UNK C  3  305 ? 33.611  44.891  78.571  1.00 46.91 ? 1007 UNK C CA  1 
ATOM   4779  C  C   . UNK C  3  305 ? 33.302  43.493  78.035  1.00 46.91 ? 1007 UNK C C   1 
ATOM   4780  O  O   . UNK C  3  305 ? 32.242  43.257  77.445  1.00 46.91 ? 1007 UNK C O   1 
ATOM   4781  C  CB  . UNK C  3  305 ? 32.942  45.955  77.706  1.00 46.91 ? 1007 UNK C CB  1 
ATOM   4782  N  N   . UNK C  3  306 ? 34.241  42.575  78.234  1.00 46.91 ? 1008 UNK C N   1 
ATOM   4783  C  CA  . UNK C  3  306 ? 34.095  41.198  77.780  1.00 46.91 ? 1008 UNK C CA  1 
ATOM   4784  C  C   . UNK C  3  306 ? 34.775  40.242  78.755  1.00 46.91 ? 1008 UNK C C   1 
ATOM   4785  O  O   . UNK C  3  306 ? 34.278  39.142  79.003  1.00 46.91 ? 1008 UNK C O   1 
ATOM   4786  C  CB  . UNK C  3  306 ? 34.688  41.039  76.386  1.00 46.91 ? 1008 UNK C CB  1 
ATOM   4787  N  N   . UNK C  3  307 ? 35.937  40.647  79.262  1.00 46.91 ? 1009 UNK C N   1 
ATOM   4788  C  CA  . UNK C  3  307 ? 36.685  39.838  80.218  1.00 46.91 ? 1009 UNK C CA  1 
ATOM   4789  C  C   . UNK C  3  307 ? 36.171  40.080  81.632  1.00 46.91 ? 1009 UNK C C   1 
ATOM   4790  O  O   . UNK C  3  307 ? 36.105  39.154  82.441  1.00 46.91 ? 1009 UNK C O   1 
ATOM   4791  C  CB  . UNK C  3  307 ? 38.168  40.159  80.132  1.00 46.91 ? 1009 UNK C CB  1 
ATOM   4792  N  N   . UNK C  3  308 ? 35.863  41.336  81.938  1.00 46.91 ? 1010 UNK C N   1 
ATOM   4793  C  CA  . UNK C  3  308 ? 35.347  41.702  83.252  1.00 46.91 ? 1010 UNK C CA  1 
ATOM   4794  C  C   . UNK C  3  308 ? 33.874  41.319  83.355  1.00 46.91 ? 1010 UNK C C   1 
ATOM   4795  O  O   . UNK C  3  308 ? 33.363  41.068  84.447  1.00 46.91 ? 1010 UNK C O   1 
ATOM   4796  C  CB  . UNK C  3  308 ? 35.530  43.191  83.503  1.00 46.91 ? 1010 UNK C CB  1 
ATOM   4797  N  N   . UNK C  3  309 ? 33.193  41.305  82.212  1.00 46.91 ? 1011 UNK C N   1 
ATOM   4798  C  CA  . UNK C  3  309 ? 31.781  40.941  82.155  1.00 46.91 ? 1011 UNK C CA  1 
ATOM   4799  C  C   . UNK C  3  309 ? 31.639  39.443  82.403  1.00 46.91 ? 1011 UNK C C   1 
ATOM   4800  O  O   . UNK C  3  309 ? 30.592  38.972  82.853  1.00 46.91 ? 1011 UNK C O   1 
ATOM   4801  C  CB  . UNK C  3  309 ? 31.196  41.314  80.802  1.00 46.91 ? 1011 UNK C CB  1 
ATOM   4802  N  N   . UNK C  3  310 ? 32.682  38.697  82.048  1.00 46.91 ? 1012 UNK C N   1 
ATOM   4803  C  CA  . UNK C  3  310 ? 32.710  37.253  82.239  1.00 46.91 ? 1012 UNK C CA  1 
ATOM   4804  C  C   . UNK C  3  310 ? 33.125  36.950  83.674  1.00 46.91 ? 1012 UNK C C   1 
ATOM   4805  O  O   . UNK C  3  310 ? 32.809  35.888  84.211  1.00 46.91 ? 1012 UNK C O   1 
ATOM   4806  C  CB  . UNK C  3  310 ? 33.684  36.612  81.262  1.00 46.91 ? 1012 UNK C CB  1 
ATOM   4807  N  N   . UNK C  3  311 ? 33.875  37.873  84.270  1.00 46.91 ? 1013 UNK C N   1 
ATOM   4808  C  CA  . UNK C  3  311 ? 34.337  37.729  85.645  1.00 46.91 ? 1013 UNK C CA  1 
ATOM   4809  C  C   . UNK C  3  311 ? 33.234  38.130  86.623  1.00 46.91 ? 1013 UNK C C   1 
ATOM   4810  O  O   . UNK C  3  311 ? 33.296  37.800  87.808  1.00 46.91 ? 1013 UNK C O   1 
ATOM   4811  C  CB  . UNK C  3  311 ? 35.580  38.579  85.874  1.00 46.91 ? 1013 UNK C CB  1 
ATOM   4812  N  N   . UNK C  3  312 ? 32.248  38.871  86.124  1.00 46.91 ? 1014 UNK C N   1 
ATOM   4813  C  CA  . UNK C  3  312 ? 31.124  39.319  86.938  1.00 46.91 ? 1014 UNK C CA  1 
ATOM   4814  C  C   . UNK C  3  312 ? 29.987  38.304  86.881  1.00 46.91 ? 1014 UNK C C   1 
ATOM   4815  O  O   . UNK C  3  312 ? 29.109  38.292  87.748  1.00 46.91 ? 1014 UNK C O   1 
ATOM   4816  C  CB  . UNK C  3  312 ? 30.640  40.680  86.457  1.00 46.91 ? 1014 UNK C CB  1 
ATOM   4817  N  N   . UNK C  3  313 ? 29.981  37.492  85.829  1.00 46.91 ? 1015 UNK C N   1 
ATOM   4818  C  CA  . UNK C  3  313 ? 28.961  36.468  85.644  1.00 46.91 ? 1015 UNK C CA  1 
ATOM   4819  C  C   . UNK C  3  313 ? 29.392  35.152  86.281  1.00 46.91 ? 1015 UNK C C   1 
ATOM   4820  O  O   . UNK C  3  313 ? 28.557  34.300  86.592  1.00 46.91 ? 1015 UNK C O   1 
ATOM   4821  C  CB  . UNK C  3  313 ? 28.682  36.270  84.161  1.00 46.91 ? 1015 UNK C CB  1 
ATOM   4822  N  N   . UNK C  3  314 ? 30.701  34.978  86.437  1.00 46.91 ? 1016 UNK C N   1 
ATOM   4823  C  CA  . UNK C  3  314 ? 31.260  33.771  87.034  1.00 46.91 ? 1016 UNK C CA  1 
ATOM   4824  C  C   . UNK C  3  314 ? 31.395  33.915  88.546  1.00 46.91 ? 1016 UNK C C   1 
ATOM   4825  O  O   . UNK C  3  314 ? 31.313  32.930  89.279  1.00 46.91 ? 1016 UNK C O   1 
ATOM   4826  C  CB  . UNK C  3  314 ? 32.613  33.454  86.413  1.00 46.91 ? 1016 UNK C CB  1 
ATOM   4827  N  N   . UNK C  3  315 ? 31.642  35.140  89.003  1.00 46.91 ? 1017 UNK C N   1 
ATOM   4828  C  CA  . UNK C  3  315 ? 31.787  35.418  90.428  1.00 46.91 ? 1017 UNK C CA  1 
ATOM   4829  C  C   . UNK C  3  315 ? 30.428  35.456  91.119  1.00 46.91 ? 1017 UNK C C   1 
ATOM   4830  O  O   . UNK C  3  315 ? 30.329  35.244  92.330  1.00 46.91 ? 1017 UNK C O   1 
ATOM   4831  C  CB  . UNK C  3  315 ? 32.521  36.736  90.636  1.00 46.91 ? 1017 UNK C CB  1 
ATOM   4832  N  N   . UNK C  3  316 ? 29.390  35.777  90.352  1.00 46.91 ? 1018 UNK C N   1 
ATOM   4833  C  CA  . UNK C  3  316 ? 28.030  35.841  90.874  1.00 46.91 ? 1018 UNK C CA  1 
ATOM   4834  C  C   . UNK C  3  316 ? 27.383  34.458  90.852  1.00 46.91 ? 1018 UNK C C   1 
ATOM   4835  O  O   . UNK C  3  316 ? 26.408  34.207  91.565  1.00 46.91 ? 1018 UNK C O   1 
ATOM   4836  C  CB  . UNK C  3  316 ? 27.202  36.824  90.058  1.00 46.91 ? 1018 UNK C CB  1 
ATOM   4837  N  N   . UNK C  3  317 ? 27.903  33.585  89.994  1.00 46.91 ? 1019 UNK C N   1 
ATOM   4838  C  CA  . UNK C  3  317 ? 27.398  32.225  89.861  1.00 46.91 ? 1019 UNK C CA  1 
ATOM   4839  C  C   . UNK C  3  317 ? 28.074  31.283  90.853  1.00 46.91 ? 1019 UNK C C   1 
ATOM   4840  O  O   . UNK C  3  317 ? 27.436  30.379  91.393  1.00 46.91 ? 1019 UNK C O   1 
ATOM   4841  C  CB  . UNK C  3  317 ? 27.602  31.727  88.437  1.00 46.91 ? 1019 UNK C CB  1 
ATOM   4842  N  N   . UNK C  3  318 ? 29.373  31.487  91.063  1.00 46.91 ? 1020 UNK C N   1 
ATOM   4843  C  CA  . UNK C  3  318 ? 30.152  30.665  91.983  1.00 46.91 ? 1020 UNK C CA  1 
ATOM   4844  C  C   . UNK C  3  318 ? 29.768  30.923  93.438  1.00 46.91 ? 1020 UNK C C   1 
ATOM   4845  O  O   . UNK C  3  318 ? 29.986  30.076  94.307  1.00 46.91 ? 1020 UNK C O   1 
ATOM   4846  C  CB  . UNK C  3  318 ? 31.640  30.914  91.781  1.00 46.91 ? 1020 UNK C CB  1 
ATOM   4847  N  N   . UNK C  3  319 ? 29.228  32.109  93.702  1.00 46.91 ? 1021 UNK C N   1 
ATOM   4848  C  CA  . UNK C  3  319 ? 28.805  32.479  95.049  1.00 46.91 ? 1021 UNK C CA  1 
ATOM   4849  C  C   . UNK C  3  319 ? 27.578  31.671  95.464  1.00 46.91 ? 1021 UNK C C   1 
ATOM   4850  O  O   . UNK C  3  319 ? 27.262  31.566  96.653  1.00 46.91 ? 1021 UNK C O   1 
ATOM   4851  C  CB  . UNK C  3  319 ? 28.504  33.970  95.112  1.00 46.91 ? 1021 UNK C CB  1 
ATOM   4852  N  N   . UNK C  3  320 ? 26.878  31.121  94.475  1.00 46.91 ? 1022 UNK C N   1 
ATOM   4853  C  CA  . UNK C  3  320 ? 25.684  30.327  94.718  1.00 46.91 ? 1022 UNK C CA  1 
ATOM   4854  C  C   . UNK C  3  320 ? 25.934  28.820  94.655  1.00 46.91 ? 1022 UNK C C   1 
ATOM   4855  O  O   . UNK C  3  320 ? 25.205  28.045  95.279  1.00 46.91 ? 1022 UNK C O   1 
ATOM   4856  C  CB  . UNK C  3  320 ? 24.587  30.721  93.735  1.00 46.91 ? 1022 UNK C CB  1 
ATOM   4857  N  N   . UNK C  3  321 ? 26.957  28.404  93.910  1.00 46.91 ? 1023 UNK C N   1 
ATOM   4858  C  CA  . UNK C  3  321 ? 27.265  26.982  93.770  1.00 46.91 ? 1023 UNK C CA  1 
ATOM   4859  C  C   . UNK C  3  321 ? 28.758  26.652  93.717  1.00 46.91 ? 1023 UNK C C   1 
ATOM   4860  O  O   . UNK C  3  321 ? 29.250  25.871  94.537  1.00 46.91 ? 1023 UNK C O   1 
ATOM   4861  C  CB  . UNK C  3  321 ? 26.568  26.421  92.536  1.00 46.91 ? 1023 UNK C CB  1 
ATOM   4862  N  N   . UNK C  3  322 ? 29.443  27.216  92.722  1.00 46.91 ? 1024 UNK C N   1 
ATOM   4863  C  CA  . UNK C  3  322 ? 30.881  27.024  92.482  1.00 46.91 ? 1024 UNK C CA  1 
ATOM   4864  C  C   . UNK C  3  322 ? 31.203  25.793  91.631  1.00 46.91 ? 1024 UNK C C   1 
ATOM   4865  O  O   . UNK C  3  322 ? 30.300  25.080  91.185  1.00 46.91 ? 1024 UNK C O   1 
ATOM   4866  C  CB  . UNK C  3  322 ? 31.671  26.998  93.796  1.00 46.91 ? 1024 UNK C CB  1 
ATOM   4867  N  N   . UNK C  3  323 ? 32.497  25.562  91.413  1.00 46.91 ? 1025 UNK C N   1 
ATOM   4868  C  CA  . UNK C  3  323 ? 33.009  24.446  90.611  1.00 46.91 ? 1025 UNK C CA  1 
ATOM   4869  C  C   . UNK C  3  323 ? 32.772  24.655  89.114  1.00 46.91 ? 1025 UNK C C   1 
ATOM   4870  O  O   . UNK C  3  323 ? 31.833  24.106  88.536  1.00 46.91 ? 1025 UNK C O   1 
ATOM   4871  C  CB  . UNK C  3  323 ? 32.409  23.115  91.074  1.00 46.91 ? 1025 UNK C CB  1 
ATOM   4872  N  N   . UNK C  3  324 ? 33.646  25.446  88.496  1.00 46.91 ? 1026 UNK C N   1 
ATOM   4873  C  CA  . UNK C  3  324 ? 33.556  25.748  87.070  1.00 46.91 ? 1026 UNK C CA  1 
ATOM   4874  C  C   . UNK C  3  324 ? 34.139  24.632  86.205  1.00 46.91 ? 1026 UNK C C   1 
ATOM   4875  O  O   . UNK C  3  324 ? 35.360  24.521  86.059  1.00 46.91 ? 1026 UNK C O   1 
ATOM   4876  C  CB  . UNK C  3  324 ? 34.253  27.071  86.771  1.00 46.91 ? 1026 UNK C CB  1 
ATOM   4877  N  N   . UNK C  3  325 ? 33.255  23.805  85.652  1.00 46.91 ? 1027 UNK C N   1 
ATOM   4878  C  CA  . UNK C  3  325 ? 33.635  22.687  84.788  1.00 46.91 ? 1027 UNK C CA  1 
ATOM   4879  C  C   . UNK C  3  325 ? 32.390  21.918  84.349  1.00 46.91 ? 1027 UNK C C   1 
ATOM   4880  O  O   . UNK C  3  325 ? 32.034  20.898  84.947  1.00 46.91 ? 1027 UNK C O   1 
ATOM   4881  C  CB  . UNK C  3  325 ? 34.604  21.751  85.513  1.00 46.91 ? 1027 UNK C CB  1 
ATOM   4882  N  N   . UNK C  3  326 ? 31.735  22.404  83.300  1.00 46.91 ? 1028 UNK C N   1 
ATOM   4883  C  CA  . UNK C  3  326 ? 30.527  21.765  82.787  1.00 46.91 ? 1028 UNK C CA  1 
ATOM   4884  C  C   . UNK C  3  326 ? 30.431  21.855  81.263  1.00 46.91 ? 1028 UNK C C   1 
ATOM   4885  O  O   . UNK C  3  326 ? 31.443  21.793  80.563  1.00 46.91 ? 1028 UNK C O   1 
ATOM   4886  C  CB  . UNK C  3  326 ? 29.292  22.385  83.439  1.00 46.91 ? 1028 UNK C CB  1 
ATOM   4887  N  N   . UNK C  3  327 ? 29.203  21.954  80.757  1.00 46.91 ? 1029 UNK C N   1 
ATOM   4888  C  CA  . UNK C  3  327 ? 28.944  22.053  79.323  1.00 46.91 ? 1029 UNK C CA  1 
ATOM   4889  C  C   . UNK C  3  327 ? 27.526  22.565  79.090  1.00 46.91 ? 1029 UNK C C   1 
ATOM   4890  O  O   . UNK C  3  327 ? 26.553  21.953  79.542  1.00 46.91 ? 1029 UNK C O   1 
ATOM   4891  C  CB  . UNK C  3  327 ? 29.130  20.693  78.656  1.00 46.91 ? 1029 UNK C CB  1 
ATOM   4892  N  N   . UNK C  3  328 ? 27.412  23.688  78.389  1.00 46.91 ? 1030 UNK C N   1 
ATOM   4893  C  CA  . UNK C  3  328 ? 26.113  24.288  78.104  1.00 46.91 ? 1030 UNK C CA  1 
ATOM   4894  C  C   . UNK C  3  328 ? 25.779  24.307  76.614  1.00 46.91 ? 1030 UNK C C   1 
ATOM   4895  O  O   . UNK C  3  328 ? 24.606  24.306  76.235  1.00 46.91 ? 1030 UNK C O   1 
ATOM   4896  C  CB  . UNK C  3  328 ? 26.054  25.700  78.673  1.00 46.91 ? 1030 UNK C CB  1 
ATOM   4897  N  N   . UNK C  3  329 ? 26.811  24.336  75.775  1.00 46.91 ? 1031 UNK C N   1 
ATOM   4898  C  CA  . UNK C  3  329 ? 26.627  24.357  74.327  1.00 46.91 ? 1031 UNK C CA  1 
ATOM   4899  C  C   . UNK C  3  329 ? 27.815  23.716  73.617  1.00 46.91 ? 1031 UNK C C   1 
ATOM   4900  O  O   . UNK C  3  329 ? 27.661  22.729  72.894  1.00 46.91 ? 1031 UNK C O   1 
ATOM   4901  C  CB  . UNK C  3  329 ? 26.431  25.790  73.840  1.00 46.91 ? 1031 UNK C CB  1 
ATOM   4902  N  N   . UNK C  3  330 ? 28.994  24.291  73.820  1.00 46.91 ? 1032 UNK C N   1 
ATOM   4903  C  CA  . UNK C  3  330 ? 30.222  23.791  73.212  1.00 46.91 ? 1032 UNK C CA  1 
ATOM   4904  C  C   . UNK C  3  330 ? 31.411  24.217  74.065  1.00 46.91 ? 1032 UNK C C   1 
ATOM   4905  O  O   . UNK C  3  330 ? 32.166  25.119  73.691  1.00 46.91 ? 1032 UNK C O   1 
ATOM   4906  C  CB  . UNK C  3  330 ? 30.363  24.327  71.788  1.00 46.91 ? 1032 UNK C CB  1 
ATOM   4907  N  N   . UNK C  3  331 ? 31.573  23.545  75.203  1.00 46.91 ? 1033 UNK C N   1 
ATOM   4908  C  CA  . UNK C  3  331 ? 32.648  23.828  76.152  1.00 46.91 ? 1033 UNK C CA  1 
ATOM   4909  C  C   . UNK C  3  331 ? 32.478  25.194  76.816  1.00 46.91 ? 1033 UNK C C   1 
ATOM   4910  O  O   . UNK C  3  331 ? 31.497  25.897  76.565  1.00 46.91 ? 1033 UNK C O   1 
ATOM   4911  C  CB  . UNK C  3  331 ? 34.016  23.727  75.468  1.00 46.91 ? 1033 UNK C CB  1 
ATOM   4912  N  N   . UNK C  3  332 ? 33.442  25.556  77.660  1.00 46.91 ? 1034 UNK C N   1 
ATOM   4913  C  CA  . UNK C  3  332 ? 33.436  26.824  78.388  1.00 46.91 ? 1034 UNK C CA  1 
ATOM   4914  C  C   . UNK C  3  332 ? 32.301  26.910  79.410  1.00 46.91 ? 1034 UNK C C   1 
ATOM   4915  O  O   . UNK C  3  332 ? 32.535  26.761  80.608  1.00 46.91 ? 1034 UNK C O   1 
ATOM   4916  C  CB  . UNK C  3  332 ? 33.376  28.007  77.417  1.00 46.91 ? 1034 UNK C CB  1 
ATOM   4917  N  N   . UNK C  3  333 ? 31.083  27.149  78.927  1.00 46.91 ? 1035 UNK C N   1 
ATOM   4918  C  CA  . UNK C  3  333 ? 29.896  27.261  79.776  1.00 46.91 ? 1035 UNK C CA  1 
ATOM   4919  C  C   . UNK C  3  333 ? 30.033  28.377  80.810  1.00 46.91 ? 1035 UNK C C   1 
ATOM   4920  O  O   . UNK C  3  333 ? 29.543  29.488  80.599  1.00 46.91 ? 1035 UNK C O   1 
ATOM   4921  C  CB  . UNK C  3  333 ? 29.595  25.924  80.456  1.00 46.91 ? 1035 UNK C CB  1 
ATOM   4922  N  N   . UNK C  3  334 ? 30.653  28.061  81.943  1.00 46.91 ? 1036 UNK C N   1 
ATOM   4923  C  CA  . UNK C  3  334 ? 30.866  29.038  83.004  1.00 46.91 ? 1036 UNK C CA  1 
ATOM   4924  C  C   . UNK C  3  334 ? 32.034  29.947  82.627  1.00 46.91 ? 1036 UNK C C   1 
ATOM   4925  O  O   . UNK C  3  334 ? 31.839  31.128  82.334  1.00 46.91 ? 1036 UNK C O   1 
ATOM   4926  C  CB  . UNK C  3  334 ? 31.143  28.332  84.327  1.00 46.91 ? 1036 UNK C CB  1 
ATOM   4927  N  N   . UNK C  3  335 ? 33.240  29.384  82.608  1.00 46.91 ? 1037 UNK C N   1 
ATOM   4928  C  CA  . UNK C  3  335 ? 34.442  30.139  82.263  1.00 46.91 ? 1037 UNK C CA  1 
ATOM   4929  C  C   . UNK C  3  335 ? 35.630  29.240  81.923  1.00 46.91 ? 1037 UNK C C   1 
ATOM   4930  O  O   . UNK C  3  335 ? 35.757  28.135  82.451  1.00 46.91 ? 1037 UNK C O   1 
ATOM   4931  C  CB  . UNK C  3  335 ? 34.810  31.088  83.398  1.00 46.91 ? 1037 UNK C CB  1 
ATOM   4932  N  N   . UNK C  3  336 ? 36.514  29.757  81.069  1.00 46.91 ? 1038 UNK C N   1 
ATOM   4933  C  CA  . UNK C  3  336 ? 37.722  29.061  80.617  1.00 46.91 ? 1038 UNK C CA  1 
ATOM   4934  C  C   . UNK C  3  336 ? 37.447  27.911  79.650  1.00 46.91 ? 1038 UNK C C   1 
ATOM   4935  O  O   . UNK C  3  336 ? 36.992  26.837  80.048  1.00 46.91 ? 1038 UNK C O   1 
ATOM   4936  C  CB  . UNK C  3  336 ? 38.548  28.574  81.810  1.00 46.91 ? 1038 UNK C CB  1 
ATOM   4937  N  N   . UNK C  3  337 ? 37.735  28.149  78.373  1.00 46.91 ? 1039 UNK C N   1 
ATOM   4938  C  CA  . UNK C  3  337 ? 37.531  27.151  77.327  1.00 46.91 ? 1039 UNK C CA  1 
ATOM   4939  C  C   . UNK C  3  337 ? 38.843  26.508  76.882  1.00 46.91 ? 1039 UNK C C   1 
ATOM   4940  O  O   . UNK C  3  337 ? 38.851  25.376  76.394  1.00 46.91 ? 1039 UNK C O   1 
ATOM   4941  C  CB  . UNK C  3  337 ? 36.829  27.785  76.133  1.00 46.91 ? 1039 UNK C CB  1 
ATOM   4942  N  N   . UNK C  3  338 ? 39.942  27.245  77.040  1.00 46.91 ? 1040 UNK C N   1 
ATOM   4943  C  CA  . UNK C  3  338 ? 41.279  26.783  76.662  1.00 46.91 ? 1040 UNK C CA  1 
ATOM   4944  C  C   . UNK C  3  338 ? 41.411  26.542  75.159  1.00 46.91 ? 1040 UNK C C   1 
ATOM   4945  O  O   . UNK C  3  338 ? 41.140  25.445  74.664  1.00 46.91 ? 1040 UNK C O   1 
ATOM   4946  C  CB  . UNK C  3  338 ? 41.653  25.522  77.441  1.00 46.91 ? 1040 UNK C CB  1 
ATOM   4947  N  N   . UNK C  3  339 ? 41.836  27.574  74.435  1.00 46.91 ? 1041 UNK C N   1 
ATOM   4948  C  CA  . UNK C  3  339 ? 42.003  27.481  72.989  1.00 46.91 ? 1041 UNK C CA  1 
ATOM   4949  C  C   . UNK C  3  339 ? 43.310  28.109  72.507  1.00 46.91 ? 1041 UNK C C   1 
ATOM   4950  O  O   . UNK C  3  339 ? 43.994  28.802  73.259  1.00 46.91 ? 1041 UNK C O   1 
ATOM   4951  C  CB  . UNK C  3  339 ? 40.817  28.133  72.286  1.00 46.91 ? 1041 UNK C CB  1 
ATOM   4952  N  N   . UNK C  3  340 ? 43.623  27.881  71.232  1.00 46.91 ? 1042 UNK C N   1 
ATOM   4953  C  CA  . UNK C  3  340 ? 44.830  28.400  70.591  1.00 46.91 ? 1042 UNK C CA  1 
ATOM   4954  C  C   . UNK C  3  340 ? 46.130  27.827  71.154  1.00 46.91 ? 1042 UNK C C   1 
ATOM   4955  O  O   . UNK C  3  340 ? 46.671  26.865  70.604  1.00 46.91 ? 1042 UNK C O   1 
ATOM   4956  C  CB  . UNK C  3  340 ? 44.850  29.930  70.636  1.00 46.91 ? 1042 UNK C CB  1 
ATOM   4957  N  N   . UNK C  3  341 ? 46.632  28.418  72.235  1.00 46.91 ? 1043 UNK C N   1 
ATOM   4958  C  CA  . UNK C  3  341 ? 47.874  27.958  72.850  1.00 46.91 ? 1043 UNK C CA  1 
ATOM   4959  C  C   . UNK C  3  341 ? 47.918  28.144  74.368  1.00 46.91 ? 1043 UNK C C   1 
ATOM   4960  O  O   . UNK C  3  341 ? 48.868  27.703  75.021  1.00 46.91 ? 1043 UNK C O   1 
ATOM   4961  C  CB  . UNK C  3  341 ? 49.066  28.661  72.205  1.00 46.91 ? 1043 UNK C CB  1 
ATOM   4962  N  N   . UNK C  3  342 ? 46.905  28.803  74.924  1.00 46.91 ? 1044 UNK C N   1 
ATOM   4963  C  CA  . UNK C  3  342 ? 46.849  29.046  76.363  1.00 46.91 ? 1044 UNK C CA  1 
ATOM   4964  C  C   . UNK C  3  342 ? 45.729  28.290  77.073  1.00 46.91 ? 1044 UNK C C   1 
ATOM   4965  O  O   . UNK C  3  342 ? 44.833  27.734  76.437  1.00 46.91 ? 1044 UNK C O   1 
ATOM   4966  C  CB  . UNK C  3  342 ? 46.730  30.540  76.635  1.00 46.91 ? 1044 UNK C CB  1 
ATOM   4967  N  N   . UNK C  3  343 ? 45.807  28.259  78.402  1.00 46.91 ? 1045 UNK C N   1 
ATOM   4968  C  CA  . UNK C  3  343 ? 44.808  27.585  79.226  1.00 46.91 ? 1045 UNK C CA  1 
ATOM   4969  C  C   . UNK C  3  343 ? 43.609  28.499  79.477  1.00 46.91 ? 1045 UNK C C   1 
ATOM   4970  O  O   . UNK C  3  343 ? 42.489  28.026  79.676  1.00 46.91 ? 1045 UNK C O   1 
ATOM   4971  C  CB  . UNK C  3  343 ? 45.426  27.155  80.551  1.00 46.91 ? 1045 UNK C CB  1 
ATOM   4972  N  N   . UNK C  3  344 ? 43.867  29.807  79.493  1.00 46.91 ? 1046 UNK C N   1 
ATOM   4973  C  CA  . UNK C  3  344 ? 42.844  30.829  79.718  1.00 46.91 ? 1046 UNK C CA  1 
ATOM   4974  C  C   . UNK C  3  344 ? 42.167  30.738  81.084  1.00 46.91 ? 1046 UNK C C   1 
ATOM   4975  O  O   . UNK C  3  344 ? 41.287  31.542  81.400  1.00 46.91 ? 1046 UNK C O   1 
ATOM   4976  C  CB  . UNK C  3  344 ? 41.801  30.791  78.599  1.00 46.91 ? 1046 UNK C CB  1 
ATOM   4977  N  N   . UNK C  3  345 ? 42.608  29.786  81.899  1.00 46.91 ? 1047 UNK C N   1 
ATOM   4978  C  CA  . UNK C  3  345 ? 42.051  29.582  83.232  1.00 46.91 ? 1047 UNK C CA  1 
ATOM   4979  C  C   . UNK C  3  345 ? 42.524  30.637  84.229  1.00 46.91 ? 1047 UNK C C   1 
ATOM   4980  O  O   . UNK C  3  345 ? 41.809  30.963  85.176  1.00 46.91 ? 1047 UNK C O   1 
ATOM   4981  C  CB  . UNK C  3  345 ? 42.405  28.194  83.737  1.00 46.91 ? 1047 UNK C CB  1 
ATOM   4982  N  N   . UNK C  3  346 ? 43.733  31.155  84.013  1.00 46.91 ? 1048 UNK C N   1 
ATOM   4983  C  CA  . UNK C  3  346 ? 44.330  32.169  84.879  1.00 46.91 ? 1048 UNK C CA  1 
ATOM   4984  C  C   . UNK C  3  346 ? 44.485  31.645  86.301  1.00 46.91 ? 1048 UNK C C   1 
ATOM   4985  O  O   . UNK C  3  346 ? 44.132  32.323  87.267  1.00 46.91 ? 1048 UNK C O   1 
ATOM   4986  C  CB  . UNK C  3  346 ? 43.485  33.454  84.867  1.00 46.91 ? 1048 UNK C CB  1 
ATOM   4987  N  N   . UNK C  3  347 ? 45.066  30.452  86.411  1.00 46.91 ? 1049 UNK C N   1 
ATOM   4988  C  CA  . UNK C  3  347 ? 45.296  29.787  87.692  1.00 46.91 ? 1049 UNK C CA  1 
ATOM   4989  C  C   . UNK C  3  347 ? 44.005  29.404  88.418  1.00 46.91 ? 1049 UNK C C   1 
ATOM   4990  O  O   . UNK C  3  347 ? 43.291  30.263  88.939  1.00 46.91 ? 1049 UNK C O   1 
ATOM   4991  C  CB  . UNK C  3  347 ? 46.190  30.647  88.605  1.00 46.91 ? 1049 UNK C CB  1 
ATOM   4992  N  N   . UNK C  3  348 ? 43.726  28.101  88.457  1.00 46.91 ? 1050 UNK C N   1 
ATOM   4993  C  CA  . UNK C  3  348 ? 42.533  27.566  89.118  1.00 46.91 ? 1050 UNK C CA  1 
ATOM   4994  C  C   . UNK C  3  348 ? 42.605  27.724  90.638  1.00 46.91 ? 1050 UNK C C   1 
ATOM   4995  O  O   . UNK C  3  348 ? 41.634  27.437  91.340  1.00 46.91 ? 1050 UNK C O   1 
ATOM   4996  C  CB  . UNK C  3  348 ? 42.350  26.101  88.757  1.00 46.91 ? 1050 UNK C CB  1 
ATOM   4997  N  N   . UNK C  3  349 ? 43.770  28.126  91.142  1.00 46.91 ? 1051 UNK C N   1 
ATOM   4998  C  CA  . UNK C  3  349 ? 43.955  28.320  92.575  1.00 46.91 ? 1051 UNK C CA  1 
ATOM   4999  C  C   . UNK C  3  349 ? 43.373  29.658  93.023  1.00 46.91 ? 1051 UNK C C   1 
ATOM   5000  O  O   . UNK C  3  349 ? 42.939  29.805  94.164  1.00 46.91 ? 1051 UNK C O   1 
ATOM   5001  C  CB  . UNK C  3  349 ? 45.435  28.246  92.929  1.00 46.91 ? 1051 UNK C CB  1 
ATOM   5002  N  N   . UNK C  3  350 ? 43.409  30.643  92.132  1.00 46.91 ? 1052 UNK C N   1 
ATOM   5003  C  CA  . UNK C  3  350 ? 42.885  31.975  92.438  1.00 46.91 ? 1052 UNK C CA  1 
ATOM   5004  C  C   . UNK C  3  350 ? 41.390  32.120  92.129  1.00 46.91 ? 1052 UNK C C   1 
ATOM   5005  O  O   . UNK C  3  350 ? 40.817  33.201  92.292  1.00 46.91 ? 1052 UNK C O   1 
ATOM   5006  C  CB  . UNK C  3  350 ? 43.683  33.038  91.689  1.00 46.91 ? 1052 UNK C CB  1 
ATOM   5007  N  N   . UNK C  3  351 ? 40.773  31.033  91.672  1.00 46.91 ? 1053 UNK C N   1 
ATOM   5008  C  CA  . UNK C  3  351 ? 39.354  31.031  91.350  1.00 46.91 ? 1053 UNK C CA  1 
ATOM   5009  C  C   . UNK C  3  351 ? 38.552  30.450  92.508  1.00 46.91 ? 1053 UNK C C   1 
ATOM   5010  O  O   . UNK C  3  351 ? 37.531  31.008  92.912  1.00 46.91 ? 1053 UNK C O   1 
ATOM   5011  C  CB  . UNK C  3  351 ? 39.099  30.228  90.076  1.00 46.91 ? 1053 UNK C CB  1 
ATOM   5012  N  N   . UNK C  3  352 ? 39.021  29.323  93.034  1.00 46.91 ? 1054 UNK C N   1 
ATOM   5013  C  CA  . UNK C  3  352 ? 38.354  28.636  94.136  1.00 46.91 ? 1054 UNK C CA  1 
ATOM   5014  C  C   . UNK C  3  352 ? 38.429  29.387  95.465  1.00 46.91 ? 1054 UNK C C   1 
ATOM   5015  O  O   . UNK C  3  352 ? 37.398  29.657  96.090  1.00 46.91 ? 1054 UNK C O   1 
ATOM   5016  C  CB  . UNK C  3  352 ? 38.928  27.232  94.293  1.00 46.91 ? 1054 UNK C CB  1 
ATOM   5017  N  N   . UNK C  3  353 ? 39.648  29.651  95.927  1.00 46.91 ? 1055 UNK C N   1 
ATOM   5018  C  CA  . UNK C  3  353 ? 39.857  30.367  97.183  1.00 46.91 ? 1055 UNK C CA  1 
ATOM   5019  C  C   . UNK C  3  353 ? 39.720  31.871  96.969  1.00 46.91 ? 1055 UNK C C   1 
ATOM   5020  O  O   . UNK C  3  353 ? 39.131  32.575  97.792  1.00 46.91 ? 1055 UNK C O   1 
ATOM   5021  C  CB  . UNK C  3  353 ? 41.232  30.039  97.748  1.00 46.91 ? 1055 UNK C CB  1 
ATOM   5022  N  N   . UNK C  3  354 ? 40.294  32.348  95.867  1.00 46.91 ? 1056 UNK C N   1 
ATOM   5023  C  CA  . UNK C  3  354 ? 40.266  33.758  95.490  1.00 46.91 ? 1056 UNK C CA  1 
ATOM   5024  C  C   . UNK C  3  354 ? 41.053  34.662  96.437  1.00 46.91 ? 1056 UNK C C   1 
ATOM   5025  O  O   . UNK C  3  354 ? 41.524  34.235  97.497  1.00 46.91 ? 1056 UNK C O   1 
ATOM   5026  C  CB  . UNK C  3  354 ? 38.819  34.248  95.362  1.00 46.91 ? 1056 UNK C CB  1 
ATOM   5027  N  N   . UNK C  3  355 ? 41.211  35.916  96.026  1.00 46.91 ? 1057 UNK C N   1 
ATOM   5028  C  CA  . UNK C  3  355 ? 41.931  36.910  96.811  1.00 46.91 ? 1057 UNK C CA  1 
ATOM   5029  C  C   . UNK C  3  355 ? 41.451  38.316  96.452  1.00 46.91 ? 1057 UNK C C   1 
ATOM   5030  O  O   . UNK C  3  355 ? 42.195  39.294  96.587  1.00 46.91 ? 1057 UNK C O   1 
ATOM   5031  C  CB  . UNK C  3  355 ? 43.436  36.779  96.582  1.00 46.91 ? 1057 UNK C CB  1 
ATOM   5032  N  N   . UNK C  3  356 ? 40.207  38.408  95.986  1.00 46.91 ? 1058 UNK C N   1 
ATOM   5033  C  CA  . UNK C  3  356 ? 39.604  39.684  95.613  1.00 46.91 ? 1058 UNK C CA  1 
ATOM   5034  C  C   . UNK C  3  356 ? 38.229  39.841  96.259  1.00 46.91 ? 1058 UNK C C   1 
ATOM   5035  O  O   . UNK C  3  356 ? 37.467  38.878  96.371  1.00 46.91 ? 1058 UNK C O   1 
ATOM   5036  C  CB  . UNK C  3  356 ? 39.496  39.797  94.096  1.00 46.91 ? 1058 UNK C CB  1 
ATOM   5037  N  N   . UNK C  3  357 ? 37.932  41.057  96.704  1.00 46.91 ? 1059 UNK C N   1 
ATOM   5038  C  CA  . UNK C  3  357 ? 36.655  41.361  97.342  1.00 46.91 ? 1059 UNK C CA  1 
ATOM   5039  C  C   . UNK C  3  357 ? 36.254  42.798  97.035  1.00 46.91 ? 1059 UNK C C   1 
ATOM   5040  O  O   . UNK C  3  357 ? 35.090  43.078  96.741  1.00 46.91 ? 1059 UNK C O   1 
ATOM   5041  C  CB  . UNK C  3  357 ? 36.751  41.152  98.848  1.00 46.91 ? 1059 UNK C CB  1 
ATOM   5042  N  N   . UNK C  3  358 ? 37.217  43.709  97.142  1.00 46.91 ? 1060 UNK C N   1 
ATOM   5043  C  CA  . UNK C  3  358 ? 36.977  45.120  96.868  1.00 46.91 ? 1060 UNK C CA  1 
ATOM   5044  C  C   . UNK C  3  358 ? 37.451  45.493  95.465  1.00 46.91 ? 1060 UNK C C   1 
ATOM   5045  O  O   . UNK C  3  358 ? 37.048  46.519  94.918  1.00 46.91 ? 1060 UNK C O   1 
ATOM   5046  C  CB  . UNK C  3  358 ? 37.671  45.983  97.911  1.00 46.91 ? 1060 UNK C CB  1 
ATOM   5047  N  N   . UNK C  3  359 ? 38.344  44.676  94.912  1.00 46.91 ? 1061 UNK C N   1 
ATOM   5048  C  CA  . UNK C  3  359 ? 38.883  44.906  93.575  1.00 46.91 ? 1061 UNK C CA  1 
ATOM   5049  C  C   . UNK C  3  359 ? 38.043  44.218  92.503  1.00 46.91 ? 1061 UNK C C   1 
ATOM   5050  O  O   . UNK C  3  359 ? 38.146  44.543  91.320  1.00 46.91 ? 1061 UNK C O   1 
ATOM   5051  C  CB  . UNK C  3  359 ? 40.325  44.423  93.503  1.00 46.91 ? 1061 UNK C CB  1 
ATOM   5052  N  N   . UNK C  3  360 ? 37.251  43.235  92.920  1.00 46.91 ? 1062 UNK C N   1 
ATOM   5053  C  CA  . UNK C  3  360 ? 36.391  42.493  92.007  1.00 46.91 ? 1062 UNK C CA  1 
ATOM   5054  C  C   . UNK C  3  360 ? 35.056  43.202  91.793  1.00 46.91 ? 1062 UNK C C   1 
ATOM   5055  O  O   . UNK C  3  360 ? 34.478  43.138  90.707  1.00 46.91 ? 1062 UNK C O   1 
ATOM   5056  C  CB  . UNK C  3  360 ? 36.159  41.084  92.533  1.00 46.91 ? 1062 UNK C CB  1 
ATOM   5057  N  N   . UNK C  3  361 ? 34.557  43.843  92.845  1.00 46.91 ? 1063 UNK C N   1 
ATOM   5058  C  CA  . UNK C  3  361 ? 33.288  44.564  92.780  1.00 46.91 ? 1063 UNK C CA  1 
ATOM   5059  C  C   . UNK C  3  361 ? 33.442  45.918  92.090  1.00 46.91 ? 1063 UNK C C   1 
ATOM   5060  O  O   . UNK C  3  361 ? 32.452  46.545  91.710  1.00 46.91 ? 1063 UNK C O   1 
ATOM   5061  C  CB  . UNK C  3  361 ? 32.714  44.748  94.177  1.00 46.91 ? 1063 UNK C CB  1 
ATOM   5062  N  N   . UNK C  3  362 ? 34.682  46.384  91.978  1.00 46.91 ? 1064 UNK C N   1 
ATOM   5063  C  CA  . UNK C  3  362 ? 34.972  47.659  91.333  1.00 46.91 ? 1064 UNK C CA  1 
ATOM   5064  C  C   . UNK C  3  362 ? 35.123  47.489  89.825  1.00 46.91 ? 1064 UNK C C   1 
ATOM   5065  O  O   . UNK C  3  362 ? 34.775  48.385  89.056  1.00 46.91 ? 1064 UNK C O   1 
ATOM   5066  C  CB  . UNK C  3  362 ? 36.230  48.273  91.925  1.00 46.91 ? 1064 UNK C CB  1 
ATOM   5067  N  N   . UNK C  3  363 ? 35.683  46.353  89.414  1.00 46.91 ? 1065 UNK C N   1 
ATOM   5068  C  CA  . UNK C  3  363 ? 35.887  46.056  88.001  1.00 46.91 ? 1065 UNK C CA  1 
ATOM   5069  C  C   . UNK C  3  363 ? 34.575  45.746  87.288  1.00 46.91 ? 1065 UNK C C   1 
ATOM   5070  O  O   . UNK C  3  363 ? 34.445  45.993  86.090  1.00 46.91 ? 1065 UNK C O   1 
ATOM   5071  C  CB  . UNK C  3  363 ? 36.866  44.898  87.842  1.00 46.91 ? 1065 UNK C CB  1 
ATOM   5072  N  N   . UNK C  3  364 ? 33.614  45.201  88.028  1.00 46.91 ? 1066 UNK C N   1 
ATOM   5073  C  CA  . UNK C  3  364 ? 32.308  44.854  87.470  1.00 46.91 ? 1066 UNK C CA  1 
ATOM   5074  C  C   . UNK C  3  364 ? 31.422  46.083  87.254  1.00 46.91 ? 1066 UNK C C   1 
ATOM   5075  O  O   . UNK C  3  364 ? 30.315  45.974  86.719  1.00 46.91 ? 1066 UNK C O   1 
ATOM   5076  C  CB  . UNK C  3  364 ? 31.604  43.848  88.371  1.00 46.91 ? 1066 UNK C CB  1 
ATOM   5077  N  N   . UNK C  3  365 ? 31.892  47.239  87.713  1.00 46.91 ? 1067 UNK C N   1 
ATOM   5078  C  CA  . UNK C  3  365 ? 31.146  48.486  87.573  1.00 46.91 ? 1067 UNK C CA  1 
ATOM   5079  C  C   . UNK C  3  365 ? 31.363  49.127  86.204  1.00 46.91 ? 1067 UNK C C   1 
ATOM   5080  O  O   . UNK C  3  365 ? 30.511  49.873  85.717  1.00 46.91 ? 1067 UNK C O   1 
ATOM   5081  C  CB  . UNK C  3  365 ? 31.535  49.458  88.676  1.00 46.91 ? 1067 UNK C CB  1 
ATOM   5082  N  N   . UNK C  3  366 ? 32.525  48.866  85.612  1.00 46.91 ? 1068 UNK C N   1 
ATOM   5083  C  CA  . UNK C  3  366 ? 32.873  49.414  84.304  1.00 46.91 ? 1068 UNK C CA  1 
ATOM   5084  C  C   . UNK C  3  366 ? 32.321  48.576  83.153  1.00 46.91 ? 1068 UNK C C   1 
ATOM   5085  O  O   . UNK C  3  366 ? 31.959  49.113  82.107  1.00 46.91 ? 1068 UNK C O   1 
ATOM   5086  C  CB  . UNK C  3  366 ? 34.383  49.548  84.181  1.00 46.91 ? 1068 UNK C CB  1 
ATOM   5087  N  N   . UNK C  3  367 ? 32.283  47.261  83.345  1.00 46.91 ? 1069 UNK C N   1 
ATOM   5088  C  CA  . UNK C  3  367 ? 31.786  46.343  82.325  1.00 46.91 ? 1069 UNK C CA  1 
ATOM   5089  C  C   . UNK C  3  367 ? 30.276  46.456  82.126  1.00 46.91 ? 1069 UNK C C   1 
ATOM   5090  O  O   . UNK C  3  367 ? 29.745  46.056  81.087  1.00 46.91 ? 1069 UNK C O   1 
ATOM   5091  C  CB  . UNK C  3  367 ? 32.164  44.914  82.680  1.00 46.91 ? 1069 UNK C CB  1 
ATOM   5092  N  N   . UNK C  3  368 ? 29.584  46.974  83.137  1.00 46.91 ? 1070 UNK C N   1 
ATOM   5093  C  CA  . UNK C  3  368 ? 28.134  47.137  83.079  1.00 46.91 ? 1070 UNK C CA  1 
ATOM   5094  C  C   . UNK C  3  368 ? 27.719  48.382  82.293  1.00 46.91 ? 1070 UNK C C   1 
ATOM   5095  O  O   . UNK C  3  368 ? 26.525  48.646  82.122  1.00 46.91 ? 1070 UNK C O   1 
ATOM   5096  C  CB  . UNK C  3  368 ? 27.558  47.188  84.489  1.00 46.91 ? 1070 UNK C CB  1 
ATOM   5097  N  N   . UNK C  3  369 ? 28.703  49.149  81.832  1.00 46.91 ? 1071 UNK C N   1 
ATOM   5098  C  CA  . UNK C  3  369 ? 28.446  50.367  81.075  1.00 46.91 ? 1071 UNK C CA  1 
ATOM   5099  C  C   . UNK C  3  369 ? 28.863  50.252  79.613  1.00 46.91 ? 1071 UNK C C   1 
ATOM   5100  O  O   . UNK C  3  369 ? 28.512  51.110  78.802  1.00 46.91 ? 1071 UNK C O   1 
ATOM   5101  C  CB  . UNK C  3  369 ? 29.148  51.546  81.731  1.00 46.91 ? 1071 UNK C CB  1 
ATOM   5102  N  N   . UNK C  3  370 ? 29.592  49.189  79.279  1.00 46.91 ? 1072 UNK C N   1 
ATOM   5103  C  CA  . UNK C  3  370 ? 30.072  48.948  77.917  1.00 46.91 ? 1072 UNK C CA  1 
ATOM   5104  C  C   . UNK C  3  370 ? 31.004  50.054  77.419  1.00 46.91 ? 1072 UNK C C   1 
ATOM   5105  O  O   . UNK C  3  370 ? 31.026  51.160  77.961  1.00 46.91 ? 1072 UNK C O   1 
ATOM   5106  C  CB  . UNK C  3  370 ? 28.896  48.762  76.953  1.00 46.91 ? 1072 UNK C CB  1 
ATOM   5107  N  N   . UNK C  3  371 ? 31.790  49.746  76.392  1.00 46.91 ? 1073 UNK C N   1 
ATOM   5108  C  CA  . UNK C  3  371 ? 32.716  50.724  75.836  1.00 46.91 ? 1073 UNK C CA  1 
ATOM   5109  C  C   . UNK C  3  371 ? 32.367  51.088  74.396  1.00 46.91 ? 1073 UNK C C   1 
ATOM   5110  O  O   . UNK C  3  371 ? 32.443  52.258  74.010  1.00 46.91 ? 1073 UNK C O   1 
ATOM   5111  C  CB  . UNK C  3  371 ? 34.144  50.207  75.913  1.00 46.91 ? 1073 UNK C CB  1 
ATOM   5112  N  N   . UNK C  3  372 ? 31.994  50.083  73.607  1.00 46.91 ? 1074 UNK C N   1 
ATOM   5113  C  CA  . UNK C  3  372 ? 31.636  50.280  72.205  1.00 46.91 ? 1074 UNK C CA  1 
ATOM   5114  C  C   . UNK C  3  372 ? 30.549  51.337  72.013  1.00 46.91 ? 1074 UNK C C   1 
ATOM   5115  O  O   . UNK C  3  372 ? 30.746  52.310  71.284  1.00 46.91 ? 1074 UNK C O   1 
ATOM   5116  C  CB  . UNK C  3  372 ? 31.205  48.957  71.588  1.00 46.91 ? 1074 UNK C CB  1 
ATOM   5117  N  N   . UNK C  3  373 ? 29.403  51.123  72.650  1.00 46.91 ? 1075 UNK C N   1 
ATOM   5118  C  CA  . UNK C  3  373 ? 28.278  52.048  72.560  1.00 46.91 ? 1075 UNK C CA  1 
ATOM   5119  C  C   . UNK C  3  373 ? 27.271  51.771  73.671  1.00 46.91 ? 1075 UNK C C   1 
ATOM   5120  O  O   . UNK C  3  373 ? 26.512  50.800  73.604  1.00 46.91 ? 1075 UNK C O   1 
ATOM   5121  C  CB  . UNK C  3  373 ? 27.600  51.926  71.196  1.00 46.91 ? 1075 UNK C CB  1 
ATOM   5122  N  N   . UNK C  3  374 ? 27.285  52.614  74.698  1.00 46.91 ? 1076 UNK C N   1 
ATOM   5123  C  CA  . UNK C  3  374 ? 26.372  52.465  75.825  1.00 46.91 ? 1076 UNK C CA  1 
ATOM   5124  C  C   . UNK C  3  374 ? 24.934  52.786  75.420  1.00 46.91 ? 1076 UNK C C   1 
ATOM   5125  O  O   . UNK C  3  374 ? 24.045  51.944  75.554  1.00 46.91 ? 1076 UNK C O   1 
ATOM   5126  C  CB  . UNK C  3  374 ? 26.816  53.357  76.983  1.00 46.91 ? 1076 UNK C CB  1 
ATOM   5127  N  N   . UNK C  3  375 ? 24.714  53.992  74.902  1.00 46.91 ? 1077 UNK C N   1 
ATOM   5128  C  CA  . UNK C  3  375 ? 23.380  54.409  74.484  1.00 46.91 ? 1077 UNK C CA  1 
ATOM   5129  C  C   . UNK C  3  375 ? 23.431  55.560  73.480  1.00 46.91 ? 1077 UNK C C   1 
ATOM   5130  O  O   . UNK C  3  375 ? 23.916  56.653  73.840  1.00 46.91 ? 1077 UNK C O   1 
ATOM   5131  C  CB  . UNK C  3  375 ? 22.543  54.798  75.706  1.00 46.91 ? 1077 UNK C CB  1 
ATOM   5132  N  N   . VAL C  3  407 ? 8.610   47.221  75.853  1.00 46.91 ? 407  VAL C N   1 
ATOM   5133  C  CA  . VAL C  3  407 ? 9.946   47.805  76.169  1.00 46.91 ? 407  VAL C CA  1 
ATOM   5134  C  C   . VAL C  3  407 ? 11.031  46.734  76.264  1.00 46.91 ? 407  VAL C C   1 
ATOM   5135  O  O   . VAL C  3  407 ? 10.741  45.558  76.497  1.00 46.91 ? 407  VAL C O   1 
ATOM   5136  C  CB  . VAL C  3  407 ? 9.912   48.592  77.494  1.00 46.91 ? 407  VAL C CB  1 
ATOM   5137  N  N   . GLY C  3  408 ? 12.278  47.150  76.064  1.00 46.91 ? 408  GLY C N   1 
ATOM   5138  C  CA  . GLY C  3  408 ? 13.395  46.224  76.133  1.00 46.91 ? 408  GLY C CA  1 
ATOM   5139  C  C   . GLY C  3  408 ? 14.313  46.516  77.304  1.00 46.91 ? 408  GLY C C   1 
ATOM   5140  O  O   . GLY C  3  408 ? 13.851  46.831  78.404  1.00 46.91 ? 408  GLY C O   1 
ATOM   5141  N  N   . GLY C  3  409 ? 15.616  46.385  77.073  1.00 46.91 ? 409  GLY C N   1 
ATOM   5142  C  CA  . GLY C  3  409 ? 16.591  46.643  78.117  1.00 46.91 ? 409  GLY C CA  1 
ATOM   5143  C  C   . GLY C  3  409 ? 17.259  47.997  77.971  1.00 46.91 ? 409  GLY C C   1 
ATOM   5144  O  O   . GLY C  3  409 ? 16.612  49.037  78.124  1.00 46.91 ? 409  GLY C O   1 
ATOM   5145  N  N   . VAL C  3  410 ? 18.563  47.977  77.706  1.00 46.91 ? 410  VAL C N   1 
ATOM   5146  C  CA  . VAL C  3  410 ? 19.351  49.195  77.532  1.00 46.91 ? 410  VAL C CA  1 
ATOM   5147  C  C   . VAL C  3  410 ? 20.779  48.856  77.112  1.00 46.91 ? 410  VAL C C   1 
ATOM   5148  O  O   . VAL C  3  410 ? 21.618  48.524  77.955  1.00 46.91 ? 410  VAL C O   1 
ATOM   5149  C  CB  . VAL C  3  410 ? 19.403  50.030  78.831  1.00 46.91 ? 410  VAL C CB  1 
ATOM   5150  N  N   . ALA C  3  411 ? 21.041  48.918  75.810  1.00 46.91 ? 411  ALA C N   1 
ATOM   5151  C  CA  . ALA C  3  411 ? 22.366  48.620  75.270  1.00 46.91 ? 411  ALA C CA  1 
ATOM   5152  C  C   . ALA C  3  411 ? 22.500  49.069  73.812  1.00 46.91 ? 411  ALA C C   1 
ATOM   5153  O  O   . ALA C  3  411 ? 22.075  50.166  73.449  1.00 46.91 ? 411  ALA C O   1 
ATOM   5154  C  CB  . ALA C  3  411 ? 22.664  47.123  75.402  1.00 46.91 ? 411  ALA C CB  1 
ATOM   5155  N  N   . THR C  3  412 ? 23.083  48.209  72.978  1.00 46.91 ? 412  THR C N   1 
ATOM   5156  C  CA  . THR C  3  412 ? 23.285  48.508  71.563  1.00 46.91 ? 412  THR C CA  1 
ATOM   5157  C  C   . THR C  3  412 ? 21.983  48.616  70.769  1.00 46.91 ? 412  THR C C   1 
ATOM   5158  O  O   . THR C  3  412 ? 21.997  48.976  69.588  1.00 46.91 ? 412  THR C O   1 
ATOM   5159  C  CB  . THR C  3  412 ? 24.181  47.449  70.898  1.00 46.91 ? 412  THR C CB  1 
ATOM   5160  N  N   . GLU C  3  413 ? 20.868  48.270  71.405  1.00 46.91 ? 413  GLU C N   1 
ATOM   5161  C  CA  . GLU C  3  413 ? 19.561  48.333  70.761  1.00 46.91 ? 413  GLU C CA  1 
ATOM   5162  C  C   . GLU C  3  413 ? 18.463  48.652  71.771  1.00 46.91 ? 413  GLU C C   1 
ATOM   5163  O  O   . GLU C  3  413 ? 18.090  47.803  72.582  1.00 46.91 ? 413  GLU C O   1 
ATOM   5164  C  CB  . GLU C  3  413 ? 19.253  47.012  70.050  1.00 46.91 ? 413  GLU C CB  1 
ATOM   5165  N  N   . ILE C  3  414 ? 17.932  49.870  71.680  1.00 46.91 ? 414  ILE C N   1 
ATOM   5166  C  CA  . ILE C  3  414 ? 16.869  50.357  72.562  1.00 46.91 ? 414  ILE C CA  1 
ATOM   5167  C  C   . ILE C  3  414 ? 17.332  50.571  74.005  1.00 46.91 ? 414  ILE C C   1 
ATOM   5168  O  O   . ILE C  3  414 ? 17.413  49.628  74.793  1.00 46.91 ? 414  ILE C O   1 
ATOM   5169  C  CB  . ILE C  3  414 ? 15.633  49.428  72.543  1.00 46.91 ? 414  ILE C CB  1 
ATOM   5170  N  N   . ASN C  3  415 ? 17.615  51.829  74.335  1.00 46.91 ? 415  ASN C N   1 
ATOM   5171  C  CA  . ASN C  3  415 ? 18.072  52.208  75.670  1.00 46.91 ? 415  ASN C CA  1 
ATOM   5172  C  C   . ASN C  3  415 ? 17.147  53.242  76.312  1.00 46.91 ? 415  ASN C C   1 
ATOM   5173  O  O   . ASN C  3  415 ? 16.064  53.534  75.792  1.00 46.91 ? 415  ASN C O   1 
ATOM   5174  C  CB  . ASN C  3  415 ? 19.494  52.770  75.597  1.00 46.91 ? 415  ASN C CB  1 
ATOM   5175  N  N   . SER C  3  416 ? 17.583  53.812  77.433  1.00 46.91 ? 416  SER C N   1 
ATOM   5176  C  CA  . SER C  3  416 ? 16.786  54.811  78.138  1.00 46.91 ? 416  SER C CA  1 
ATOM   5177  C  C   . SER C  3  416 ? 17.624  55.840  78.896  1.00 46.91 ? 416  SER C C   1 
ATOM   5178  O  O   . SER C  3  416 ? 17.730  56.993  78.471  1.00 46.91 ? 416  SER C O   1 
ATOM   5179  C  CB  . SER C  3  416 ? 15.809  54.127  79.096  1.00 46.91 ? 416  SER C CB  1 
ATOM   5180  N  N   . VAL C  3  417 ? 18.186  55.434  80.032  1.00 46.91 ? 417  VAL C N   1 
ATOM   5181  C  CA  . VAL C  3  417 ? 18.995  56.339  80.843  1.00 46.91 ? 417  VAL C CA  1 
ATOM   5182  C  C   . VAL C  3  417 ? 20.423  55.847  81.038  1.00 46.91 ? 417  VAL C C   1 
ATOM   5183  O  O   . VAL C  3  417 ? 20.652  54.781  81.612  1.00 46.91 ? 417  VAL C O   1 
ATOM   5184  C  CB  . VAL C  3  417 ? 18.362  56.567  82.232  1.00 46.91 ? 417  VAL C CB  1 
ATOM   5185  N  N   . ASN C  3  418 ? 21.379  56.642  80.568  1.00 46.91 ? 418  ASN C N   1 
ATOM   5186  C  CA  . ASN C  3  418 ? 22.794  56.313  80.690  1.00 46.91 ? 418  ASN C CA  1 
ATOM   5187  C  C   . ASN C  3  418 ? 23.635  57.581  80.837  1.00 46.91 ? 418  ASN C C   1 
ATOM   5188  O  O   . ASN C  3  418 ? 23.201  58.556  81.457  1.00 46.91 ? 418  ASN C O   1 
ATOM   5189  C  CB  . ASN C  3  418 ? 23.264  55.505  79.475  1.00 46.91 ? 418  ASN C CB  1 
ATOM   5190  N  N   . PHE C  3  419 ? 24.839  57.558  80.271  1.00 46.91 ? 419  PHE C N   1 
ATOM   5191  C  CA  . PHE C  3  419 ? 25.750  58.698  80.331  1.00 46.91 ? 419  PHE C CA  1 
ATOM   5192  C  C   . PHE C  3  419 ? 26.431  58.918  78.978  1.00 46.91 ? 419  PHE C C   1 
ATOM   5193  O  O   . PHE C  3  419 ? 25.891  59.616  78.116  1.00 46.91 ? 419  PHE C O   1 
ATOM   5194  C  CB  . PHE C  3  419 ? 26.798  58.483  81.430  1.00 46.91 ? 419  PHE C CB  1 
ATOM   5195  N  N   . VAL C  3  420 ? 27.618  58.335  78.809  1.00 46.91 ? 420  VAL C N   1 
ATOM   5196  C  CA  . VAL C  3  420 ? 28.390  58.442  77.569  1.00 46.91 ? 420  VAL C CA  1 
ATOM   5197  C  C   . VAL C  3  420 ? 29.596  57.501  77.566  1.00 46.91 ? 420  VAL C C   1 
ATOM   5198  O  O   . VAL C  3  420 ? 30.123  57.149  78.622  1.00 46.91 ? 420  VAL C O   1 
ATOM   5199  C  CB  . VAL C  3  420 ? 28.904  59.880  77.334  1.00 46.91 ? 420  VAL C CB  1 
ATOM   5200  N  N   . SER C  3  421 ? 30.018  57.090  76.373  1.00 46.91 ? 421  SER C N   1 
ATOM   5201  C  CA  . SER C  3  421 ? 31.164  56.194  76.221  1.00 46.91 ? 421  SER C CA  1 
ATOM   5202  C  C   . SER C  3  421 ? 32.475  56.930  76.490  1.00 46.91 ? 421  SER C C   1 
ATOM   5203  O  O   . SER C  3  421 ? 32.536  58.160  76.433  1.00 46.91 ? 421  SER C O   1 
ATOM   5204  C  CB  . SER C  3  421 ? 31.186  55.588  74.819  1.00 46.91 ? 421  SER C CB  1 
ATOM   5205  N  N   . PRO C  3  422 ? 33.552  56.176  76.772  1.00 46.91 ? 422  PRO C N   1 
ATOM   5206  C  CA  . PRO C  3  422 ? 34.897  56.686  77.061  1.00 46.91 ? 422  PRO C CA  1 
ATOM   5207  C  C   . PRO C  3  422 ? 35.716  57.045  75.818  1.00 46.91 ? 422  PRO C C   1 
ATOM   5208  O  O   . PRO C  3  422 ? 35.538  58.115  75.234  1.00 46.91 ? 422  PRO C O   1 
ATOM   5209  C  CB  . PRO C  3  422 ? 35.540  55.547  77.856  1.00 46.91 ? 422  PRO C CB  1 
ATOM   5210  N  N   . ARG C  3  423 ? 36.618  56.148  75.426  1.00 46.91 ? 423  ARG C N   1 
ATOM   5211  C  CA  . ARG C  3  423 ? 37.482  56.362  74.267  1.00 46.91 ? 423  ARG C CA  1 
ATOM   5212  C  C   . ARG C  3  423 ? 36.787  56.135  72.924  1.00 46.91 ? 423  ARG C C   1 
ATOM   5213  O  O   . ARG C  3  423 ? 37.414  56.250  71.870  1.00 46.91 ? 423  ARG C O   1 
ATOM   5214  C  CB  . ARG C  3  423 ? 38.720  55.468  74.366  1.00 46.91 ? 423  ARG C CB  1 
ATOM   5215  N  N   . SER C  3  424 ? 35.501  55.800  72.962  1.00 46.91 ? 424  SER C N   1 
ATOM   5216  C  CA  . SER C  3  424 ? 34.738  55.560  71.741  1.00 46.91 ? 424  SER C CA  1 
ATOM   5217  C  C   . SER C  3  424 ? 34.534  56.838  70.927  1.00 46.91 ? 424  SER C C   1 
ATOM   5218  O  O   . SER C  3  424 ? 34.317  56.782  69.713  1.00 46.91 ? 424  SER C O   1 
ATOM   5219  C  CB  . SER C  3  424 ? 33.385  54.926  72.071  1.00 46.91 ? 424  SER C CB  1 
ATOM   5220  N  N   . TRP C  3  425 ? 34.568  57.983  71.603  1.00 46.91 ? 425  TRP C N   1 
ATOM   5221  C  CA  . TRP C  3  425 ? 34.401  59.275  70.944  1.00 46.91 ? 425  TRP C CA  1 
ATOM   5222  C  C   . TRP C  3  425 ? 35.663  59.703  70.197  1.00 46.91 ? 425  TRP C C   1 
ATOM   5223  O  O   . TRP C  3  425 ? 35.588  60.438  69.211  1.00 46.91 ? 425  TRP C O   1 
ATOM   5224  C  CB  . TRP C  3  425 ? 34.000  60.350  71.958  1.00 46.91 ? 425  TRP C CB  1 
ATOM   5225  C  CG  . TRP C  3  425 ? 32.553  60.294  72.349  1.00 46.91 ? 425  TRP C CG  1 
ATOM   5226  C  CD1 . TRP C  3  425 ? 32.040  59.846  73.531  1.00 46.91 ? 425  TRP C CD1 1 
ATOM   5227  C  CD2 . TRP C  3  425 ? 31.436  60.697  71.550  1.00 46.91 ? 425  TRP C CD2 1 
ATOM   5228  N  NE1 . TRP C  3  425 ? 30.669  59.944  73.519  1.00 46.91 ? 425  TRP C NE1 1 
ATOM   5229  C  CE2 . TRP C  3  425 ? 30.271  60.463  72.315  1.00 46.91 ? 425  TRP C CE2 1 
ATOM   5230  C  CE3 . TRP C  3  425 ? 31.303  61.233  70.263  1.00 46.91 ? 425  TRP C CE3 1 
ATOM   5231  C  CZ2 . TRP C  3  425 ? 28.988  60.747  71.832  1.00 46.91 ? 425  TRP C CZ2 1 
ATOM   5232  C  CZ3 . TRP C  3  425 ? 30.027  61.515  69.783  1.00 46.91 ? 425  TRP C CZ3 1 
ATOM   5233  C  CH2 . TRP C  3  425 ? 28.887  61.271  70.569  1.00 46.91 ? 425  TRP C CH2 1 
ATOM   5234  N  N   . LEU C  3  426 ? 36.816  59.272  70.697  1.00 46.91 ? 426  LEU C N   1 
ATOM   5235  C  CA  . LEU C  3  426 ? 38.099  59.597  70.080  1.00 46.91 ? 426  LEU C CA  1 
ATOM   5236  C  C   . LEU C  3  426 ? 38.403  58.643  68.927  1.00 46.91 ? 426  LEU C C   1 
ATOM   5237  O  O   . LEU C  3  426 ? 39.095  59.006  67.975  1.00 46.91 ? 426  LEU C O   1 
ATOM   5238  C  CB  . LEU C  3  426 ? 39.221  59.528  71.119  1.00 46.91 ? 426  LEU C CB  1 
ATOM   5239  N  N   . ALA C  3  427 ? 37.898  57.419  69.035  1.00 46.91 ? 427  ALA C N   1 
ATOM   5240  C  CA  . ALA C  3  427 ? 38.101  56.399  68.013  1.00 46.91 ? 427  ALA C CA  1 
ATOM   5241  C  C   . ALA C  3  427 ? 36.956  56.411  67.000  1.00 46.91 ? 427  ALA C C   1 
ATOM   5242  O  O   . ALA C  3  427 ? 36.626  55.379  66.405  1.00 46.91 ? 427  ALA C O   1 
ATOM   5243  C  CB  . ALA C  3  427 ? 38.217  55.026  68.665  1.00 46.91 ? 427  ALA C CB  1 
ATOM   5244  N  N   . THR C  3  428 ? 36.357  57.581  66.801  1.00 46.91 ? 428  THR C N   1 
ATOM   5245  C  CA  . THR C  3  428 ? 35.247  57.734  65.867  1.00 46.91 ? 428  THR C CA  1 
ATOM   5246  C  C   . THR C  3  428 ? 35.073  59.189  65.436  1.00 46.91 ? 428  THR C C   1 
ATOM   5247  O  O   . THR C  3  428 ? 34.139  59.523  64.704  1.00 46.91 ? 428  THR C O   1 
ATOM   5248  C  CB  . THR C  3  428 ? 33.926  57.240  66.486  1.00 46.91 ? 428  THR C CB  1 
ATOM   5249  N  N   . SER C  3  429 ? 35.973  60.048  65.904  1.00 46.91 ? 429  SER C N   1 
ATOM   5250  C  CA  . SER C  3  429 ? 35.941  61.467  65.574  1.00 46.91 ? 429  SER C CA  1 
ATOM   5251  C  C   . SER C  3  429 ? 37.329  61.909  65.128  1.00 46.91 ? 429  SER C C   1 
ATOM   5252  O  O   . SER C  3  429 ? 37.470  62.752  64.239  1.00 46.91 ? 429  SER C O   1 
ATOM   5253  C  CB  . SER C  3  429 ? 35.506  62.286  66.791  1.00 46.91 ? 429  SER C CB  1 
ATOM   5254  N  N   . HIS C  3  430 ? 38.344  61.377  65.800  1.00 46.91 ? 430  HIS C N   1 
ATOM   5255  C  CA  . HIS C  3  430 ? 39.735  61.677  65.488  1.00 46.91 ? 430  HIS C CA  1 
ATOM   5256  C  C   . HIS C  3  430 ? 40.257  60.654  64.484  1.00 46.91 ? 430  HIS C C   1 
ATOM   5257  O  O   . HIS C  3  430 ? 41.141  60.953  63.682  1.00 46.91 ? 430  HIS C O   1 
ATOM   5258  C  CB  . HIS C  3  430 ? 40.586  61.636  66.759  1.00 46.91 ? 430  HIS C CB  1 
ATOM   5259  N  N   . PHE C  3  431 ? 39.718  59.441  64.565  1.00 46.91 ? 431  PHE C N   1 
ATOM   5260  C  CA  . PHE C  3  431 ? 40.096  58.349  63.674  1.00 46.91 ? 431  PHE C CA  1 
ATOM   5261  C  C   . PHE C  3  431 ? 39.417  58.513  62.320  1.00 46.91 ? 431  PHE C C   1 
ATOM   5262  O  O   . PHE C  3  431 ? 39.881  57.982  61.310  1.00 46.91 ? 431  PHE C O   1 
ATOM   5263  C  CB  . PHE C  3  431 ? 39.700  57.005  64.290  1.00 46.91 ? 431  PHE C CB  1 
ATOM   5264  N  N   . VAL C  3  432 ? 38.272  59.191  62.324  1.00 46.91 ? 432  VAL C N   1 
ATOM   5265  C  CA  . VAL C  3  432 ? 37.519  59.445  61.103  1.00 46.91 ? 432  VAL C CA  1 
ATOM   5266  C  C   . VAL C  3  432 ? 38.104  60.664  60.396  1.00 46.91 ? 432  VAL C C   1 
ATOM   5267  O  O   . VAL C  3  432 ? 37.937  60.832  59.186  1.00 46.91 ? 432  VAL C O   1 
ATOM   5268  C  CB  . VAL C  3  432 ? 36.032  59.703  61.406  1.00 46.91 ? 432  VAL C CB  1 
ATOM   5269  N  N   . LEU C  3  433 ? 38.747  61.530  61.173  1.00 46.91 ? 433  LEU C N   1 
ATOM   5270  C  CA  . LEU C  3  433 ? 39.372  62.735  60.642  1.00 46.91 ? 433  LEU C CA  1 
ATOM   5271  C  C   . LEU C  3  433 ? 40.793  62.437  60.169  1.00 46.91 ? 433  LEU C C   1 
ATOM   5272  O  O   . LEU C  3  433 ? 41.374  63.210  59.405  1.00 46.91 ? 433  LEU C O   1 
ATOM   5273  C  CB  . LEU C  3  433 ? 39.398  63.833  61.708  1.00 46.91 ? 433  LEU C CB  1 
ATOM   5274  N  N   . ALA C  3  434 ? 41.357  61.339  60.663  1.00 46.91 ? 434  ALA C N   1 
ATOM   5275  C  CA  . ALA C  3  434 ? 42.708  60.928  60.297  1.00 46.91 ? 434  ALA C CA  1 
ATOM   5276  C  C   . ALA C  3  434 ? 42.701  60.088  59.021  1.00 46.91 ? 434  ALA C C   1 
ATOM   5277  O  O   . ALA C  3  434 ? 43.677  60.081  58.269  1.00 46.91 ? 434  ALA C O   1 
ATOM   5278  C  CB  . ALA C  3  434 ? 43.348  60.148  61.439  1.00 46.91 ? 434  ALA C CB  1 
ATOM   5279  N  N   . PHE C  3  435 ? 41.612  59.356  58.806  1.00 46.91 ? 435  PHE C N   1 
ATOM   5280  C  CA  . PHE C  3  435 ? 41.468  58.512  57.626  1.00 46.91 ? 435  PHE C CA  1 
ATOM   5281  C  C   . PHE C  3  435 ? 40.939  59.308  56.435  1.00 46.91 ? 435  PHE C C   1 
ATOM   5282  O  O   . PHE C  3  435 ? 40.994  58.844  55.293  1.00 46.91 ? 435  PHE C O   1 
ATOM   5283  C  CB  . PHE C  3  435 ? 40.537  57.336  57.926  1.00 46.91 ? 435  PHE C CB  1 
ATOM   5284  N  N   . PHE C  3  436 ? 40.380  60.484  56.712  1.00 46.91 ? 436  PHE C N   1 
ATOM   5285  C  CA  . PHE C  3  436 ? 39.846  61.352  55.669  1.00 46.91 ? 436  PHE C CA  1 
ATOM   5286  C  C   . PHE C  3  436 ? 40.934  62.304  55.176  1.00 46.91 ? 436  PHE C C   1 
ATOM   5287  O  O   . PHE C  3  436 ? 40.954  62.683  54.003  1.00 46.91 ? 436  PHE C O   1 
ATOM   5288  C  CB  . PHE C  3  436 ? 38.648  62.147  56.200  1.00 46.91 ? 436  PHE C CB  1 
ATOM   5289  C  CG  . PHE C  3  436 ? 37.958  62.985  55.155  1.00 46.91 ? 436  PHE C CG  1 
ATOM   5290  C  CD1 . PHE C  3  436 ? 37.223  62.387  54.137  1.00 46.91 ? 436  PHE C CD1 1 
ATOM   5291  C  CD2 . PHE C  3  436 ? 38.041  64.371  55.195  1.00 46.91 ? 436  PHE C CD2 1 
ATOM   5292  C  CE1 . PHE C  3  436 ? 36.578  63.160  53.171  1.00 46.91 ? 436  PHE C CE1 1 
ATOM   5293  C  CE2 . PHE C  3  436 ? 37.401  65.155  54.234  1.00 46.91 ? 436  PHE C CE2 1 
ATOM   5294  C  CZ  . PHE C  3  436 ? 36.669  64.547  53.221  1.00 46.91 ? 436  PHE C CZ  1 
ATOM   5295  N  N   . PHE C  3  437 ? 41.806  62.721  56.090  1.00 46.91 ? 437  PHE C N   1 
ATOM   5296  C  CA  . PHE C  3  437 ? 42.903  63.623  55.754  1.00 46.91 ? 437  PHE C CA  1 
ATOM   5297  C  C   . PHE C  3  437 ? 44.024  62.867  55.048  1.00 46.91 ? 437  PHE C C   1 
ATOM   5298  O  O   . PHE C  3  437 ? 44.777  63.452  54.268  1.00 46.91 ? 437  PHE C O   1 
ATOM   5299  C  CB  . PHE C  3  437 ? 43.444  64.301  57.015  1.00 46.91 ? 437  PHE C CB  1 
ATOM   5300  N  N   . LEU C  3  438 ? 44.152  61.579  55.355  1.00 46.91 ? 438  LEU C N   1 
ATOM   5301  C  CA  . LEU C  3  438 ? 45.175  60.735  54.746  1.00 46.91 ? 438  LEU C CA  1 
ATOM   5302  C  C   . LEU C  3  438 ? 44.784  60.370  53.317  1.00 46.91 ? 438  LEU C C   1 
ATOM   5303  O  O   . LEU C  3  438 ? 45.646  60.122  52.472  1.00 46.91 ? 438  LEU C O   1 
ATOM   5304  C  CB  . LEU C  3  438 ? 45.376  59.462  55.570  1.00 46.91 ? 438  LEU C CB  1 
ATOM   5305  N  N   . VAL C  3  439 ? 43.480  60.291  53.071  1.00 46.91 ? 439  VAL C N   1 
ATOM   5306  C  CA  . VAL C  3  439 ? 42.958  59.963  51.749  1.00 46.91 ? 439  VAL C CA  1 
ATOM   5307  C  C   . VAL C  3  439 ? 43.064  61.178  50.830  1.00 46.91 ? 439  VAL C C   1 
ATOM   5308  O  O   . VAL C  3  439 ? 43.075  61.043  49.604  1.00 46.91 ? 439  VAL C O   1 
ATOM   5309  C  CB  . VAL C  3  439 ? 41.485  59.519  51.821  1.00 46.91 ? 439  VAL C CB  1 
ATOM   5310  N  N   . GLY C  3  440 ? 43.084  62.362  51.435  1.00 46.91 ? 440  GLY C N   1 
ATOM   5311  C  CA  . GLY C  3  440 ? 43.195  63.593  50.677  1.00 46.91 ? 440  GLY C CA  1 
ATOM   5312  C  C   . GLY C  3  440 ? 44.635  64.051  50.539  1.00 46.91 ? 440  GLY C C   1 
ATOM   5313  O  O   . GLY C  3  440 ? 44.932  64.948  49.747  1.00 46.91 ? 440  GLY C O   1 
ATOM   5314  N  N   . HIS C  3  441 ? 45.521  63.464  51.339  1.00 46.91 ? 441  HIS C N   1 
ATOM   5315  C  CA  . HIS C  3  441 ? 46.941  63.802  51.310  1.00 46.91 ? 441  HIS C CA  1 
ATOM   5316  C  C   . HIS C  3  441 ? 47.690  62.928  50.309  1.00 46.91 ? 441  HIS C C   1 
ATOM   5317  O  O   . HIS C  3  441 ? 48.553  63.414  49.575  1.00 46.91 ? 441  HIS C O   1 
ATOM   5318  C  CB  . HIS C  3  441 ? 47.556  63.641  52.702  1.00 46.91 ? 441  HIS C CB  1 
ATOM   5319  N  N   . LEU C  3  442 ? 47.376  61.635  50.309  1.00 46.91 ? 442  LEU C N   1 
ATOM   5320  C  CA  . LEU C  3  442 ? 48.005  60.683  49.400  1.00 46.91 ? 442  LEU C CA  1 
ATOM   5321  C  C   . LEU C  3  442 ? 47.557  60.940  47.964  1.00 46.91 ? 442  LEU C C   1 
ATOM   5322  O  O   . LEU C  3  442 ? 48.274  60.618  47.013  1.00 46.91 ? 442  LEU C O   1 
ATOM   5323  C  CB  . LEU C  3  442 ? 47.653  59.250  49.805  1.00 46.91 ? 442  LEU C CB  1 
ATOM   5324  N  N   . TRP C  3  443 ? 46.344  61.465  47.818  1.00 46.91 ? 443  TRP C N   1 
ATOM   5325  C  CA  . TRP C  3  443 ? 45.788  61.783  46.508  1.00 46.91 ? 443  TRP C CA  1 
ATOM   5326  C  C   . TRP C  3  443 ? 46.356  63.113  46.020  1.00 46.91 ? 443  TRP C C   1 
ATOM   5327  O  O   . TRP C  3  443 ? 46.383  63.386  44.818  1.00 46.91 ? 443  TRP C O   1 
ATOM   5328  C  CB  . TRP C  3  443 ? 44.261  61.864  46.584  1.00 46.91 ? 443  TRP C CB  1 
ATOM   5329  N  N   . HIS C  3  444 ? 46.767  63.951  46.969  1.00 46.91 ? 444  HIS C N   1 
ATOM   5330  C  CA  . HIS C  3  444 ? 47.345  65.254  46.663  1.00 46.91 ? 444  HIS C CA  1 
ATOM   5331  C  C   . HIS C  3  444 ? 48.808  65.107  46.251  1.00 46.91 ? 444  HIS C C   1 
ATOM   5332  O  O   . HIS C  3  444 ? 49.380  66.006  45.634  1.00 46.91 ? 444  HIS C O   1 
ATOM   5333  C  CB  . HIS C  3  444 ? 47.242  66.180  47.877  1.00 46.91 ? 444  HIS C CB  1 
ATOM   5334  N  N   . ALA C  3  445 ? 49.412  63.984  46.631  1.00 46.91 ? 445  ALA C N   1 
ATOM   5335  C  CA  . ALA C  3  445 ? 50.804  63.701  46.302  1.00 46.91 ? 445  ALA C CA  1 
ATOM   5336  C  C   . ALA C  3  445 ? 50.954  63.437  44.806  1.00 46.91 ? 445  ALA C C   1 
ATOM   5337  O  O   . ALA C  3  445 ? 52.038  63.602  44.243  1.00 46.91 ? 445  ALA C O   1 
ATOM   5338  C  CB  . ALA C  3  445 ? 51.300  62.506  47.101  1.00 46.91 ? 445  ALA C CB  1 
ATOM   5339  N  N   . GLY C  3  446 ? 49.871  62.982  44.181  1.00 46.91 ? 446  GLY C N   1 
ATOM   5340  C  CA  . GLY C  3  446 ? 49.892  62.706  42.756  1.00 46.91 ? 446  GLY C CA  1 
ATOM   5341  C  C   . GLY C  3  446 ? 49.767  63.968  41.923  1.00 46.91 ? 446  GLY C C   1 
ATOM   5342  O  O   . GLY C  3  446 ? 49.954  63.935  40.705  1.00 46.91 ? 446  GLY C O   1 
ATOM   5343  N  N   . ARG C  3  447 ? 49.402  65.068  42.573  1.00 46.91 ? 447  ARG C N   1 
ATOM   5344  C  CA  . ARG C  3  447 ? 49.250  66.357  41.903  1.00 46.91 ? 447  ARG C CA  1 
ATOM   5345  C  C   . ARG C  3  447 ? 50.585  67.095  41.830  1.00 46.91 ? 447  ARG C C   1 
ATOM   5346  O  O   . ARG C  3  447 ? 50.714  68.096  41.123  1.00 46.91 ? 447  ARG C O   1 
ATOM   5347  C  CB  . ARG C  3  447 ? 48.221  67.220  42.640  1.00 46.91 ? 447  ARG C CB  1 
ATOM   5348  N  N   . ALA C  3  448 ? 51.558  66.623  42.605  1.00 46.91 ? 448  ALA C N   1 
ATOM   5349  C  CA  . ALA C  3  448 ? 52.888  67.220  42.633  1.00 46.91 ? 448  ALA C CA  1 
ATOM   5350  C  C   . ALA C  3  448 ? 53.834  66.477  41.694  1.00 46.91 ? 448  ALA C C   1 
ATOM   5351  O  O   . ALA C  3  448 ? 54.763  67.065  41.138  1.00 46.91 ? 448  ALA C O   1 
ATOM   5352  C  CB  . ALA C  3  448 ? 53.437  67.209  44.053  1.00 46.91 ? 448  ALA C CB  1 
ATOM   5353  N  N   . ARG C  3  449 ? 53.609  65.173  41.554  1.00 46.91 ? 449  ARG C N   1 
ATOM   5354  C  CA  . ARG C  3  449 ? 54.428  64.332  40.689  1.00 46.91 ? 449  ARG C CA  1 
ATOM   5355  C  C   . ARG C  3  449 ? 54.000  64.438  39.228  1.00 46.91 ? 449  ARG C C   1 
ATOM   5356  O  O   . ARG C  3  449 ? 54.730  64.015  38.326  1.00 46.91 ? 449  ARG C O   1 
ATOM   5357  C  CB  . ARG C  3  449 ? 54.351  62.873  41.147  1.00 46.91 ? 449  ARG C CB  1 
ATOM   5358  N  N   . ALA C  3  450 ? 52.806  64.978  39.003  1.00 46.91 ? 450  ALA C N   1 
ATOM   5359  C  CA  . ALA C  3  450 ? 52.269  65.143  37.656  1.00 46.91 ? 450  ALA C CA  1 
ATOM   5360  C  C   . ALA C  3  450 ? 52.007  66.616  37.341  1.00 46.91 ? 450  ALA C C   1 
ATOM   5361  O  O   . ALA C  3  450 ? 51.111  66.945  36.561  1.00 46.91 ? 450  ALA C O   1 
ATOM   5362  C  CB  . ALA C  3  450 ? 50.991  64.326  37.497  1.00 46.91 ? 450  ALA C CB  1 
ATOM   5363  N  N   . ALA C  3  451 ? 52.786  67.495  37.963  1.00 46.91 ? 451  ALA C N   1 
ATOM   5364  C  CA  . ALA C  3  451 ? 52.654  68.933  37.753  1.00 46.91 ? 451  ALA C CA  1 
ATOM   5365  C  C   . ALA C  3  451 ? 53.812  69.451  36.909  1.00 46.91 ? 451  ALA C C   1 
ATOM   5366  O  O   . ALA C  3  451 ? 53.626  70.286  36.018  1.00 46.91 ? 451  ALA C O   1 
ATOM   5367  C  CB  . ALA C  3  451 ? 52.616  69.655  39.090  1.00 46.91 ? 451  ALA C CB  1 
ATOM   5368  N  N   . ALA C  3  452 ? 55.016  68.985  37.228  1.00 46.91 ? 452  ALA C N   1 
ATOM   5369  C  CA  . ALA C  3  452 ? 56.221  69.380  36.513  1.00 46.91 ? 452  ALA C CA  1 
ATOM   5370  C  C   . ALA C  3  452 ? 56.456  68.490  35.293  1.00 46.91 ? 452  ALA C C   1 
ATOM   5371  O  O   . ALA C  3  452 ? 57.257  68.824  34.415  1.00 46.91 ? 452  ALA C O   1 
ATOM   5372  C  CB  . ALA C  3  452 ? 57.423  69.320  37.447  1.00 46.91 ? 452  ALA C CB  1 
ATOM   5373  N  N   . ALA C  3  453 ? 55.771  67.351  35.257  1.00 46.91 ? 453  ALA C N   1 
ATOM   5374  C  CA  . ALA C  3  453 ? 55.899  66.399  34.159  1.00 46.91 ? 453  ALA C CA  1 
ATOM   5375  C  C   . ALA C  3  453 ? 54.549  66.110  33.500  1.00 46.91 ? 453  ALA C C   1 
ATOM   5376  O  O   . ALA C  3  453 ? 54.389  65.101  32.804  1.00 46.91 ? 453  ALA C O   1 
ATOM   5377  C  CB  . ALA C  3  453 ? 56.533  65.107  34.664  1.00 46.91 ? 453  ALA C CB  1 
ATOM   5378  N  N   . GLY C  3  454 ? 53.592  67.012  33.699  1.00 46.91 ? 454  GLY C N   1 
ATOM   5379  C  CA  . GLY C  3  454 ? 52.271  66.836  33.123  1.00 46.91 ? 454  GLY C CA  1 
ATOM   5380  C  C   . GLY C  3  454 ? 51.473  68.123  33.042  1.00 46.91 ? 454  GLY C C   1 
ATOM   5381  O  O   . GLY C  3  454 ? 51.258  68.652  31.948  1.00 46.91 ? 454  GLY C O   1 
ATOM   5382  N  N   . PHE C  3  455 ? 51.043  68.620  34.200  1.00 46.91 ? 455  PHE C N   1 
ATOM   5383  C  CA  . PHE C  3  455 ? 50.256  69.850  34.314  1.00 46.91 ? 455  PHE C CA  1 
ATOM   5384  C  C   . PHE C  3  455 ? 48.824  69.699  33.802  1.00 46.91 ? 455  PHE C C   1 
ATOM   5385  O  O   . PHE C  3  455 ? 48.583  69.104  32.748  1.00 46.91 ? 455  PHE C O   1 
ATOM   5386  C  CB  . PHE C  3  455 ? 50.950  71.016  33.601  1.00 46.91 ? 455  PHE C CB  1 
ATOM   5387  N  N   . GLU C  3  456 ? 47.873  70.238  34.561  1.00 46.91 ? 456  GLU C N   1 
ATOM   5388  C  CA  . GLU C  3  456 ? 46.463  70.172  34.193  1.00 46.91 ? 456  GLU C CA  1 
ATOM   5389  C  C   . GLU C  3  456 ? 46.055  71.370  33.334  1.00 46.91 ? 456  GLU C C   1 
ATOM   5390  O  O   . GLU C  3  456 ? 45.925  72.481  33.894  1.00 46.91 ? 456  GLU C O   1 
ATOM   5391  C  CB  . GLU C  3  456 ? 45.587  70.093  35.447  1.00 46.91 ? 456  GLU C CB  1 
ATOM   5392  N  N   . GLY D  4  34  ? 0.989   72.203  31.650  1.00 46.91 ? 34   GLY D N   1 
ATOM   5393  C  CA  . GLY D  4  34  ? 1.831   71.825  32.824  1.00 46.91 ? 34   GLY D CA  1 
ATOM   5394  C  C   . GLY D  4  34  ? 1.334   72.420  34.129  1.00 46.91 ? 34   GLY D C   1 
ATOM   5395  O  O   . GLY D  4  34  ? 2.114   72.635  35.058  1.00 46.91 ? 34   GLY D O   1 
ATOM   5396  N  N   . ILE D  4  35  ? 0.040   72.720  34.183  1.00 46.91 ? 35   ILE D N   1 
ATOM   5397  C  CA  . ILE D  4  35  ? -0.574  73.290  35.378  1.00 46.91 ? 35   ILE D CA  1 
ATOM   5398  C  C   . ILE D  4  35  ? -0.830  72.206  36.423  1.00 46.91 ? 35   ILE D C   1 
ATOM   5399  O  O   . ILE D  4  35  ? -1.052  72.504  37.596  1.00 46.91 ? 35   ILE D O   1 
ATOM   5400  C  CB  . ILE D  4  35  ? -1.909  73.985  35.046  1.00 46.91 ? 35   ILE D CB  1 
ATOM   5401  N  N   . LEU D  4  36  ? -0.837  70.953  35.975  1.00 46.91 ? 36   LEU D N   1 
ATOM   5402  C  CA  . LEU D  4  36  ? -1.063  69.813  36.858  1.00 46.91 ? 36   LEU D CA  1 
ATOM   5403  C  C   . LEU D  4  36  ? 0.150   69.551  37.746  1.00 46.91 ? 36   LEU D C   1 
ATOM   5404  O  O   . LEU D  4  36  ? 0.004   69.167  38.907  1.00 46.91 ? 36   LEU D O   1 
ATOM   5405  C  CB  . LEU D  4  36  ? -1.386  68.563  36.036  1.00 46.91 ? 36   LEU D CB  1 
ATOM   5406  N  N   . LEU D  4  37  ? 1.341   69.753  37.188  1.00 46.91 ? 37   LEU D N   1 
ATOM   5407  C  CA  . LEU D  4  37  ? 2.587   69.544  37.919  1.00 46.91 ? 37   LEU D CA  1 
ATOM   5408  C  C   . LEU D  4  37  ? 2.765   70.563  39.042  1.00 46.91 ? 37   LEU D C   1 
ATOM   5409  O  O   . LEU D  4  37  ? 3.462   70.303  40.023  1.00 46.91 ? 37   LEU D O   1 
ATOM   5410  C  CB  . LEU D  4  37  ? 3.781   69.611  36.963  1.00 46.91 ? 37   LEU D CB  1 
ATOM   5411  N  N   . PHE D  4  38  ? 2.167   71.739  38.869  1.00 46.91 ? 38   PHE D N   1 
ATOM   5412  C  CA  . PHE D  4  38  ? 2.250   72.798  39.869  1.00 46.91 ? 38   PHE D CA  1 
ATOM   5413  C  C   . PHE D  4  38  ? 1.251   72.583  41.002  1.00 46.91 ? 38   PHE D C   1 
ATOM   5414  O  O   . PHE D  4  38  ? 1.442   73.082  42.113  1.00 46.91 ? 38   PHE D O   1 
ATOM   5415  C  CB  . PHE D  4  38  ? 2.019   74.166  39.221  1.00 46.91 ? 38   PHE D CB  1 
ATOM   5416  C  CG  . PHE D  4  38  ? 3.153   74.620  38.346  1.00 46.91 ? 38   PHE D CG  1 
ATOM   5417  C  CD1 . PHE D  4  38  ? 2.911   75.088  37.059  1.00 46.91 ? 38   PHE D CD1 1 
ATOM   5418  C  CD2 . PHE D  4  38  ? 4.463   74.587  38.811  1.00 46.91 ? 38   PHE D CD2 1 
ATOM   5419  C  CE1 . PHE D  4  38  ? 3.958   75.518  36.247  1.00 46.91 ? 38   PHE D CE1 1 
ATOM   5420  C  CE2 . PHE D  4  38  ? 5.518   75.012  38.009  1.00 46.91 ? 38   PHE D CE2 1 
ATOM   5421  C  CZ  . PHE D  4  38  ? 5.266   75.479  36.724  1.00 46.91 ? 38   PHE D CZ  1 
ATOM   5422  N  N   . PRO D  4  39  ? 0.147   71.878  40.715  1.00 46.91 ? 39   PRO D N   1 
ATOM   5423  C  CA  . PRO D  4  39  ? -0.913  71.574  41.682  1.00 46.91 ? 39   PRO D CA  1 
ATOM   5424  C  C   . PRO D  4  39  ? -0.621  70.288  42.450  1.00 46.91 ? 39   PRO D C   1 
ATOM   5425  O  O   . PRO D  4  39  ? -1.261  70.001  43.463  1.00 46.91 ? 39   PRO D O   1 
ATOM   5426  C  CB  . PRO D  4  39  ? -2.157  71.427  40.807  1.00 46.91 ? 39   PRO D CB  1 
ATOM   5427  N  N   . CYS D  4  40  ? 0.316   69.500  41.931  1.00 46.91 ? 40   CYS D N   1 
ATOM   5428  C  CA  . CYS D  4  40  ? 0.708   68.242  42.555  1.00 46.91 ? 40   CYS D CA  1 
ATOM   5429  C  C   . CYS D  4  40  ? 1.914   68.450  43.463  1.00 46.91 ? 40   CYS D C   1 
ATOM   5430  O  O   . CYS D  4  40  ? 2.002   67.854  44.536  1.00 46.91 ? 40   CYS D O   1 
ATOM   5431  C  CB  . CYS D  4  40  ? 1.038   67.199  41.485  1.00 46.91 ? 40   CYS D CB  1 
ATOM   5432  N  N   . ALA D  4  41  ? 2.851   69.283  43.014  1.00 46.91 ? 41   ALA D N   1 
ATOM   5433  C  CA  . ALA D  4  41  ? 4.054   69.581  43.783  1.00 46.91 ? 41   ALA D CA  1 
ATOM   5434  C  C   . ALA D  4  41  ? 3.745   70.529  44.940  1.00 46.91 ? 41   ALA D C   1 
ATOM   5435  O  O   . ALA D  4  41  ? 4.606   70.801  45.780  1.00 46.91 ? 41   ALA D O   1 
ATOM   5436  C  CB  . ALA D  4  41  ? 5.120   70.181  42.878  1.00 46.91 ? 41   ALA D CB  1 
ATOM   5437  N  N   . TYR D  4  42  ? 2.530   71.070  44.941  1.00 46.91 ? 42   TYR D N   1 
ATOM   5438  C  CA  . TYR D  4  42  ? 2.082   71.985  45.985  1.00 46.91 ? 42   TYR D CA  1 
ATOM   5439  C  C   . TYR D  4  42  ? 1.307   71.210  47.047  1.00 46.91 ? 42   TYR D C   1 
ATOM   5440  O  O   . TYR D  4  42  ? 1.291   71.590  48.219  1.00 46.91 ? 42   TYR D O   1 
ATOM   5441  C  CB  . TYR D  4  42  ? 1.197   73.080  45.380  1.00 46.91 ? 42   TYR D CB  1 
ATOM   5442  C  CG  . TYR D  4  42  ? 0.803   74.173  46.351  1.00 46.91 ? 42   TYR D CG  1 
ATOM   5443  C  CD1 . TYR D  4  42  ? 1.742   75.095  46.812  1.00 46.91 ? 42   TYR D CD1 1 
ATOM   5444  C  CD2 . TYR D  4  42  ? -0.512  74.291  46.803  1.00 46.91 ? 42   TYR D CD2 1 
ATOM   5445  C  CE1 . TYR D  4  42  ? 1.384   76.107  47.701  1.00 46.91 ? 42   TYR D CE1 1 
ATOM   5446  C  CE2 . TYR D  4  42  ? -0.882  75.298  47.692  1.00 46.91 ? 42   TYR D CE2 1 
ATOM   5447  C  CZ  . TYR D  4  42  ? 0.070   76.203  48.134  1.00 46.91 ? 42   TYR D CZ  1 
ATOM   5448  O  OH  . TYR D  4  42  ? -0.291  77.206  49.006  1.00 46.91 ? 42   TYR D OH  1 
ATOM   5449  N  N   . LEU D  4  43  ? 0.632   70.147  46.616  1.00 46.91 ? 43   LEU D N   1 
ATOM   5450  C  CA  . LEU D  4  43  ? -0.150  69.306  47.516  1.00 46.91 ? 43   LEU D CA  1 
ATOM   5451  C  C   . LEU D  4  43  ? 0.735   68.285  48.226  1.00 46.91 ? 43   LEU D C   1 
ATOM   5452  O  O   . LEU D  4  43  ? 0.469   67.912  49.370  1.00 46.91 ? 43   LEU D O   1 
ATOM   5453  C  CB  . LEU D  4  43  ? -1.254  68.583  46.740  1.00 46.91 ? 43   LEU D CB  1 
ATOM   5454  N  N   . ALA D  4  44  ? 1.767   67.817  47.529  1.00 46.91 ? 44   ALA D N   1 
ATOM   5455  C  CA  . ALA D  4  44  ? 2.699   66.841  48.082  1.00 46.91 ? 44   ALA D CA  1 
ATOM   5456  C  C   . ALA D  4  44  ? 3.669   67.506  49.055  1.00 46.91 ? 44   ALA D C   1 
ATOM   5457  O  O   . ALA D  4  44  ? 4.125   66.879  50.012  1.00 46.91 ? 44   ALA D O   1 
ATOM   5458  C  CB  . ALA D  4  44  ? 3.465   66.149  46.960  1.00 46.91 ? 44   ALA D CB  1 
ATOM   5459  N  N   . LEU D  4  45  ? 4.019   68.758  48.776  1.00 46.91 ? 45   LEU D N   1 
ATOM   5460  C  CA  . LEU D  4  45  ? 4.929   69.514  49.630  1.00 46.91 ? 45   LEU D CA  1 
ATOM   5461  C  C   . LEU D  4  45  ? 4.163   70.254  50.724  1.00 46.91 ? 45   LEU D C   1 
ATOM   5462  O  O   . LEU D  4  45  ? 4.757   70.739  51.692  1.00 46.91 ? 45   LEU D O   1 
ATOM   5463  C  CB  . LEU D  4  45  ? 5.738   70.509  48.795  1.00 46.91 ? 45   LEU D CB  1 
ATOM   5464  N  N   . GLY D  4  46  ? 2.851   70.371  50.544  1.00 46.91 ? 46   GLY D N   1 
ATOM   5465  C  CA  . GLY D  4  46  ? 2.016   71.047  51.521  1.00 46.91 ? 46   GLY D CA  1 
ATOM   5466  C  C   . GLY D  4  46  ? 1.458   70.092  52.558  1.00 46.91 ? 46   GLY D C   1 
ATOM   5467  O  O   . GLY D  4  46  ? 0.942   70.522  53.594  1.00 46.91 ? 46   GLY D O   1 
ATOM   5468  N  N   . GLY D  4  47  ? 1.532   68.797  52.265  1.00 46.91 ? 47   GLY D N   1 
ATOM   5469  C  CA  . GLY D  4  47  ? 1.036   67.789  53.183  1.00 46.91 ? 47   GLY D CA  1 
ATOM   5470  C  C   . GLY D  4  47  ? 2.156   67.109  53.950  1.00 46.91 ? 47   GLY D C   1 
ATOM   5471  O  O   . GLY D  4  47  ? 1.977   66.724  55.105  1.00 46.91 ? 47   GLY D O   1 
ATOM   5472  N  N   . TRP D  4  48  ? 3.305   66.958  53.298  1.00 46.91 ? 48   TRP D N   1 
ATOM   5473  C  CA  . TRP D  4  48  ? 4.476   66.323  53.899  1.00 46.91 ? 48   TRP D CA  1 
ATOM   5474  C  C   . TRP D  4  48  ? 5.045   67.209  55.008  1.00 46.91 ? 48   TRP D C   1 
ATOM   5475  O  O   . TRP D  4  48  ? 5.407   66.725  56.082  1.00 46.91 ? 48   TRP D O   1 
ATOM   5476  C  CB  . TRP D  4  48  ? 5.539   66.073  52.821  1.00 46.91 ? 48   TRP D CB  1 
ATOM   5477  C  CG  . TRP D  4  48  ? 6.669   65.177  53.248  1.00 46.91 ? 48   TRP D CG  1 
ATOM   5478  C  CD1 . TRP D  4  48  ? 6.735   63.821  53.113  1.00 46.91 ? 48   TRP D CD1 1 
ATOM   5479  C  CD2 . TRP D  4  48  ? 7.903   65.581  53.859  1.00 46.91 ? 48   TRP D CD2 1 
ATOM   5480  N  NE1 . TRP D  4  48  ? 7.932   63.353  53.600  1.00 46.91 ? 48   TRP D NE1 1 
ATOM   5481  C  CE2 . TRP D  4  48  ? 8.667   64.411  54.065  1.00 46.91 ? 48   TRP D CE2 1 
ATOM   5482  C  CE3 . TRP D  4  48  ? 8.438   66.816  54.253  1.00 46.91 ? 48   TRP D CE3 1 
ATOM   5483  C  CZ2 . TRP D  4  48  ? 9.938   64.439  54.648  1.00 46.91 ? 48   TRP D CZ2 1 
ATOM   5484  C  CZ3 . TRP D  4  48  ? 9.700   66.846  54.833  1.00 46.91 ? 48   TRP D CZ3 1 
ATOM   5485  C  CH2 . TRP D  4  48  ? 10.436  65.663  55.024  1.00 46.91 ? 48   TRP D CH2 1 
ATOM   5486  N  N   . LEU D  4  49  ? 5.149   68.506  54.728  1.00 46.91 ? 49   LEU D N   1 
ATOM   5487  C  CA  . LEU D  4  49  ? 5.667   69.467  55.694  1.00 46.91 ? 49   LEU D CA  1 
ATOM   5488  C  C   . LEU D  4  49  ? 4.624   69.793  56.761  1.00 46.91 ? 49   LEU D C   1 
ATOM   5489  O  O   . LEU D  4  49  ? 4.951   70.352  57.812  1.00 46.91 ? 49   LEU D O   1 
ATOM   5490  C  CB  . LEU D  4  49  ? 6.102   70.751  54.982  1.00 46.91 ? 49   LEU D CB  1 
ATOM   5491  N  N   . THR D  4  50  ? 3.366   69.478  56.465  1.00 46.91 ? 50   THR D N   1 
ATOM   5492  C  CA  . THR D  4  50  ? 2.267   69.725  57.390  1.00 46.91 ? 50   THR D CA  1 
ATOM   5493  C  C   . THR D  4  50  ? 2.093   68.573  58.371  1.00 46.91 ? 50   THR D C   1 
ATOM   5494  O  O   . THR D  4  50  ? 1.848   68.793  59.557  1.00 46.91 ? 50   THR D O   1 
ATOM   5495  C  CB  . THR D  4  50  ? 0.941   69.938  56.639  1.00 46.91 ? 50   THR D CB  1 
ATOM   5496  N  N   . GLY D  4  51  ? 2.200   67.348  57.860  1.00 46.91 ? 51   GLY D N   1 
ATOM   5497  C  CA  . GLY D  4  51  ? 2.053   66.164  58.689  1.00 46.91 ? 51   GLY D CA  1 
ATOM   5498  C  C   . GLY D  4  51  ? 3.190   65.989  59.680  1.00 46.91 ? 51   GLY D C   1 
ATOM   5499  O  O   . GLY D  4  51  ? 3.007   65.415  60.756  1.00 46.91 ? 51   GLY D O   1 
ATOM   5500  N  N   . THR D  4  52  ? 4.374   66.462  59.305  1.00 46.91 ? 52   THR D N   1 
ATOM   5501  C  CA  . THR D  4  52  ? 5.548   66.376  60.164  1.00 46.91 ? 52   THR D CA  1 
ATOM   5502  C  C   . THR D  4  52  ? 5.719   67.700  60.907  1.00 46.91 ? 52   THR D C   1 
ATOM   5503  O  O   . THR D  4  52  ? 6.812   68.270  60.951  1.00 46.91 ? 52   THR D O   1 
ATOM   5504  C  CB  . THR D  4  52  ? 6.815   66.073  59.342  1.00 46.91 ? 52   THR D CB  1 
ATOM   5505  N  N   . THR D  4  53  ? 4.623   68.188  61.480  1.00 46.91 ? 53   THR D N   1 
ATOM   5506  C  CA  . THR D  4  53  ? 4.623   69.447  62.213  1.00 46.91 ? 53   THR D CA  1 
ATOM   5507  C  C   . THR D  4  53  ? 3.325   69.650  62.996  1.00 46.91 ? 53   THR D C   1 
ATOM   5508  O  O   . THR D  4  53  ? 3.330   70.271  64.063  1.00 46.91 ? 53   THR D O   1 
ATOM   5509  C  CB  . THR D  4  53  ? 4.812   70.645  61.262  1.00 46.91 ? 53   THR D CB  1 
ATOM   5510  N  N   . PHE D  4  54  ? 2.215   69.155  62.449  1.00 46.91 ? 54   PHE D N   1 
ATOM   5511  C  CA  . PHE D  4  54  ? 0.909   69.278  63.088  1.00 46.91 ? 54   PHE D CA  1 
ATOM   5512  C  C   . PHE D  4  54  ? -0.009  68.100  62.761  1.00 46.91 ? 54   PHE D C   1 
ATOM   5513  O  O   . PHE D  4  54  ? -1.037  68.264  62.100  1.00 46.91 ? 54   PHE D O   1 
ATOM   5514  C  CB  . PHE D  4  54  ? 0.233   70.595  62.681  1.00 46.91 ? 54   PHE D CB  1 
ATOM   5515  C  CG  . PHE D  4  54  ? 0.836   71.816  63.320  1.00 46.91 ? 54   PHE D CG  1 
ATOM   5516  C  CD1 . PHE D  4  54  ? 1.520   72.756  62.553  1.00 46.91 ? 54   PHE D CD1 1 
ATOM   5517  C  CD2 . PHE D  4  54  ? 0.725   72.025  64.689  1.00 46.91 ? 54   PHE D CD2 1 
ATOM   5518  C  CE1 . PHE D  4  54  ? 2.084   73.886  63.144  1.00 46.91 ? 54   PHE D CE1 1 
ATOM   5519  C  CE2 . PHE D  4  54  ? 1.284   73.149  65.292  1.00 46.91 ? 54   PHE D CE2 1 
ATOM   5520  C  CZ  . PHE D  4  54  ? 1.965   74.082  64.517  1.00 46.91 ? 54   PHE D CZ  1 
ATOM   5521  N  N   . VAL D  4  55  ? 0.347   66.922  63.263  1.00 46.91 ? 55   VAL D N   1 
ATOM   5522  C  CA  . VAL D  4  55  ? -0.444  65.718  63.030  1.00 46.91 ? 55   VAL D CA  1 
ATOM   5523  C  C   . VAL D  4  55  ? -0.387  64.787  64.240  1.00 46.91 ? 55   VAL D C   1 
ATOM   5524  O  O   . VAL D  4  55  ? -0.277  65.249  65.378  1.00 46.91 ? 55   VAL D O   1 
ATOM   5525  C  CB  . VAL D  4  55  ? 0.047   64.968  61.770  1.00 46.91 ? 55   VAL D CB  1 
ATOM   5526  N  N   . THR D  4  56  ? -0.521  63.486  63.995  1.00 46.91 ? 56   THR D N   1 
ATOM   5527  C  CA  . THR D  4  56  ? -0.475  62.475  65.050  1.00 46.91 ? 56   THR D CA  1 
ATOM   5528  C  C   . THR D  4  56  ? -0.631  61.072  64.461  1.00 46.91 ? 56   THR D C   1 
ATOM   5529  O  O   . THR D  4  56  ? 0.138   60.674  63.586  1.00 46.91 ? 56   THR D O   1 
ATOM   5530  C  CB  . THR D  4  56  ? -1.575  62.715  66.113  1.00 46.91 ? 56   THR D CB  1 
ATOM   5531  N  N   . SER D  4  57  ? -1.608  60.320  64.966  1.00 46.91 ? 57   SER D N   1 
ATOM   5532  C  CA  . SER D  4  57  ? -1.888  58.963  64.500  1.00 46.91 ? 57   SER D CA  1 
ATOM   5533  C  C   . SER D  4  57  ? -3.060  58.379  65.288  1.00 46.91 ? 57   SER D C   1 
ATOM   5534  O  O   . SER D  4  57  ? -4.204  58.422  64.834  1.00 46.91 ? 57   SER D O   1 
ATOM   5535  C  CB  . SER D  4  57  ? -0.655  58.063  64.654  1.00 46.91 ? 57   SER D CB  1 
ATOM   5536  N  N   . TRP D  4  58  ? -2.767  57.869  66.483  1.00 46.91 ? 58   TRP D N   1 
ATOM   5537  C  CA  . TRP D  4  58  ? -3.766  57.272  67.373  1.00 46.91 ? 58   TRP D CA  1 
ATOM   5538  C  C   . TRP D  4  58  ? -4.460  56.031  66.806  1.00 46.91 ? 58   TRP D C   1 
ATOM   5539  O  O   . TRP D  4  58  ? -5.345  55.460  67.448  1.00 46.91 ? 58   TRP D O   1 
ATOM   5540  C  CB  . TRP D  4  58  ? -4.812  58.315  67.786  1.00 46.91 ? 58   TRP D CB  1 
ATOM   5541  N  N   . TYR D  4  59  ? -4.037  55.608  65.620  1.00 46.91 ? 59   TYR D N   1 
ATOM   5542  C  CA  . TYR D  4  59  ? -4.608  54.436  64.966  1.00 46.91 ? 59   TYR D CA  1 
ATOM   5543  C  C   . TYR D  4  59  ? -3.535  53.368  64.807  1.00 46.91 ? 59   TYR D C   1 
ATOM   5544  O  O   . TYR D  4  59  ? -3.828  52.170  64.761  1.00 46.91 ? 59   TYR D O   1 
ATOM   5545  C  CB  . TYR D  4  59  ? -5.167  54.817  63.593  1.00 46.91 ? 59   TYR D CB  1 
ATOM   5546  N  N   . THR D  4  60  ? -2.287  53.815  64.738  1.00 46.91 ? 60   THR D N   1 
ATOM   5547  C  CA  . THR D  4  60  ? -1.147  52.924  64.583  1.00 46.91 ? 60   THR D CA  1 
ATOM   5548  C  C   . THR D  4  60  ? 0.050   53.531  65.301  1.00 46.91 ? 60   THR D C   1 
ATOM   5549  O  O   . THR D  4  60  ? 0.760   54.370  64.746  1.00 46.91 ? 60   THR D O   1 
ATOM   5550  C  CB  . THR D  4  60  ? -0.803  52.722  63.096  1.00 46.91 ? 60   THR D CB  1 
ATOM   5551  N  N   . HIS D  4  61  ? 0.254   53.106  66.546  1.00 46.91 ? 61   HIS D N   1 
ATOM   5552  C  CA  . HIS D  4  61  ? 1.354   53.588  67.379  1.00 46.91 ? 61   HIS D CA  1 
ATOM   5553  C  C   . HIS D  4  61  ? 1.207   55.074  67.712  1.00 46.91 ? 61   HIS D C   1 
ATOM   5554  O  O   . HIS D  4  61  ? 0.234   55.476  68.355  1.00 46.91 ? 61   HIS D O   1 
ATOM   5555  C  CB  . HIS D  4  61  ? 2.702   53.316  66.700  1.00 46.91 ? 61   HIS D CB  1 
ATOM   5556  N  N   . GLY D  4  62  ? 2.182   55.878  67.302  1.00 46.91 ? 62   GLY D N   1 
ATOM   5557  C  CA  . GLY D  4  62  ? 2.136   57.302  67.574  1.00 46.91 ? 62   GLY D CA  1 
ATOM   5558  C  C   . GLY D  4  62  ? 3.458   57.985  67.289  1.00 46.91 ? 62   GLY D C   1 
ATOM   5559  O  O   . GLY D  4  62  ? 4.515   57.521  67.726  1.00 46.91 ? 62   GLY D O   1 
ATOM   5560  N  N   . LEU D  4  63  ? 3.394   59.095  66.563  1.00 46.91 ? 63   LEU D N   1 
ATOM   5561  C  CA  . LEU D  4  63  ? 4.582   59.865  66.205  1.00 46.91 ? 63   LEU D CA  1 
ATOM   5562  C  C   . LEU D  4  63  ? 4.228   61.341  66.031  1.00 46.91 ? 63   LEU D C   1 
ATOM   5563  O  O   . LEU D  4  63  ? 3.115   61.758  66.358  1.00 46.91 ? 63   LEU D O   1 
ATOM   5564  C  CB  . LEU D  4  63  ? 5.192   59.321  64.910  1.00 46.91 ? 63   LEU D CB  1 
ATOM   5565  N  N   . ALA D  4  64  ? 5.191   62.123  65.545  1.00 46.91 ? 64   ALA D N   1 
ATOM   5566  C  CA  . ALA D  4  64  ? 5.013   63.558  65.314  1.00 46.91 ? 64   ALA D CA  1 
ATOM   5567  C  C   . ALA D  4  64  ? 4.340   64.239  66.504  1.00 46.91 ? 64   ALA D C   1 
ATOM   5568  O  O   . ALA D  4  64  ? 3.392   65.010  66.350  1.00 46.91 ? 64   ALA D O   1 
ATOM   5569  C  CB  . ALA D  4  64  ? 4.216   63.790  64.031  1.00 46.91 ? 64   ALA D CB  1 
ATOM   5570  N  N   . SER D  4  65  ? 4.838   63.936  67.697  1.00 46.91 ? 65   SER D N   1 
ATOM   5571  C  CA  . SER D  4  65  ? 4.303   64.495  68.932  1.00 46.91 ? 65   SER D CA  1 
ATOM   5572  C  C   . SER D  4  65  ? 4.738   65.939  69.149  1.00 46.91 ? 65   SER D C   1 
ATOM   5573  O  O   . SER D  4  65  ? 5.821   66.198  69.676  1.00 46.91 ? 65   SER D O   1 
ATOM   5574  C  CB  . SER D  4  65  ? 4.728   63.636  70.126  1.00 46.91 ? 65   SER D CB  1 
ATOM   5575  N  N   . SER D  4  66  ? 3.862   66.869  68.777  1.00 46.91 ? 66   SER D N   1 
ATOM   5576  C  CA  . SER D  4  66  ? 4.122   68.298  68.922  1.00 46.91 ? 66   SER D CA  1 
ATOM   5577  C  C   . SER D  4  66  ? 5.444   68.734  68.287  1.00 46.91 ? 66   SER D C   1 
ATOM   5578  O  O   . SER D  4  66  ? 6.242   69.436  68.915  1.00 46.91 ? 66   SER D O   1 
ATOM   5579  C  CB  . SER D  4  66  ? 4.098   68.696  70.403  1.00 46.91 ? 66   SER D CB  1 
ATOM   5580  N  N   . TYR D  4  67  ? 5.659   68.324  67.039  1.00 46.91 ? 67   TYR D N   1 
ATOM   5581  C  CA  . TYR D  4  67  ? 6.874   68.658  66.294  1.00 46.91 ? 67   TYR D CA  1 
ATOM   5582  C  C   . TYR D  4  67  ? 8.153   68.236  67.021  1.00 46.91 ? 67   TYR D C   1 
ATOM   5583  O  O   . TYR D  4  67  ? 9.126   68.994  67.088  1.00 46.91 ? 67   TYR D O   1 
ATOM   5584  C  CB  . TYR D  4  67  ? 6.908   70.159  65.980  1.00 46.91 ? 67   TYR D CB  1 
ATOM   5585  N  N   . LEU D  4  68  ? 8.147   67.016  67.550  1.00 46.91 ? 68   LEU D N   1 
ATOM   5586  C  CA  . LEU D  4  68  ? 9.292   66.471  68.269  1.00 46.91 ? 68   LEU D CA  1 
ATOM   5587  C  C   . LEU D  4  68  ? 9.381   64.952  68.090  1.00 46.91 ? 68   LEU D C   1 
ATOM   5588  O  O   . LEU D  4  68  ? 8.933   64.188  68.947  1.00 46.91 ? 68   LEU D O   1 
ATOM   5589  C  CB  . LEU D  4  68  ? 9.197   66.821  69.762  1.00 46.91 ? 68   LEU D CB  1 
ATOM   5590  N  N   . GLU D  4  69  ? 9.976   64.536  66.979  1.00 46.91 ? 69   GLU D N   1 
ATOM   5591  C  CA  . GLU D  4  69  ? 10.137  63.119  66.665  1.00 46.91 ? 69   GLU D CA  1 
ATOM   5592  C  C   . GLU D  4  69  ? 11.498  62.855  66.030  1.00 46.91 ? 69   GLU D C   1 
ATOM   5593  O  O   . GLU D  4  69  ? 12.054  63.719  65.349  1.00 46.91 ? 69   GLU D O   1 
ATOM   5594  C  CB  . GLU D  4  69  ? 9.026   62.656  65.720  1.00 46.91 ? 69   GLU D CB  1 
ATOM   5595  N  N   . GLY D  4  70  ? 12.033  61.660  66.264  1.00 46.91 ? 70   GLY D N   1 
ATOM   5596  C  CA  . GLY D  4  70  ? 13.328  61.303  65.709  1.00 46.91 ? 70   GLY D CA  1 
ATOM   5597  C  C   . GLY D  4  70  ? 13.286  61.000  64.220  1.00 46.91 ? 70   GLY D C   1 
ATOM   5598  O  O   . GLY D  4  70  ? 14.329  60.867  63.577  1.00 46.91 ? 70   GLY D O   1 
ATOM   5599  N  N   . CYS D  4  71  ? 12.082  60.865  63.675  1.00 46.91 ? 71   CYS D N   1 
ATOM   5600  C  CA  . CYS D  4  71  ? 11.906  60.568  62.257  1.00 46.91 ? 71   CYS D CA  1 
ATOM   5601  C  C   . CYS D  4  71  ? 10.951  61.542  61.577  1.00 46.91 ? 71   CYS D C   1 
ATOM   5602  O  O   . CYS D  4  71  ? 11.125  61.862  60.401  1.00 46.91 ? 71   CYS D O   1 
ATOM   5603  C  CB  . CYS D  4  71  ? 11.388  59.139  62.077  1.00 46.91 ? 71   CYS D CB  1 
ATOM   5604  N  N   . ASN D  4  72  ? 9.965   62.027  62.332  1.00 46.91 ? 72   ASN D N   1 
ATOM   5605  C  CA  . ASN D  4  72  ? 8.955   62.958  61.818  1.00 46.91 ? 72   ASN D CA  1 
ATOM   5606  C  C   . ASN D  4  72  ? 8.123   62.274  60.733  1.00 46.91 ? 72   ASN D C   1 
ATOM   5607  O  O   . ASN D  4  72  ? 7.843   62.854  59.683  1.00 46.91 ? 72   ASN D O   1 
ATOM   5608  C  CB  . ASN D  4  72  ? 9.618   64.226  61.267  1.00 46.91 ? 72   ASN D CB  1 
ATOM   5609  N  N   . PHE D  4  73  ? 7.738   61.031  61.010  1.00 46.91 ? 73   PHE D N   1 
ATOM   5610  C  CA  . PHE D  4  73  ? 6.944   60.227  60.086  1.00 46.91 ? 73   PHE D CA  1 
ATOM   5611  C  C   . PHE D  4  73  ? 5.475   60.652  60.051  1.00 46.91 ? 73   PHE D C   1 
ATOM   5612  O  O   . PHE D  4  73  ? 4.992   61.332  60.957  1.00 46.91 ? 73   PHE D O   1 
ATOM   5613  C  CB  . PHE D  4  73  ? 7.037   58.749  60.471  1.00 46.91 ? 73   PHE D CB  1 
ATOM   5614  N  N   . LEU D  4  74  ? 4.774   60.218  59.007  1.00 46.91 ? 74   LEU D N   1 
ATOM   5615  C  CA  . LEU D  4  74  ? 3.359   60.523  58.820  1.00 46.91 ? 74   LEU D CA  1 
ATOM   5616  C  C   . LEU D  4  74  ? 2.763   59.602  57.757  1.00 46.91 ? 74   LEU D C   1 
ATOM   5617  O  O   . LEU D  4  74  ? 3.011   59.774  56.563  1.00 46.91 ? 74   LEU D O   1 
ATOM   5618  C  CB  . LEU D  4  74  ? 3.169   61.987  58.402  1.00 46.91 ? 74   LEU D CB  1 
ATOM   5619  N  N   . THR D  4  75  ? 2.007   58.601  58.196  1.00 46.91 ? 75   THR D N   1 
ATOM   5620  C  CA  . THR D  4  75  ? 1.374   57.658  57.279  1.00 46.91 ? 75   THR D CA  1 
ATOM   5621  C  C   . THR D  4  75  ? 0.237   56.912  57.965  1.00 46.91 ? 75   THR D C   1 
ATOM   5622  O  O   . THR D  4  75  ? -0.897  56.935  57.491  1.00 46.91 ? 75   THR D O   1 
ATOM   5623  C  CB  . THR D  4  75  ? 2.390   56.635  56.724  1.00 46.91 ? 75   THR D CB  1 
ATOM   5624  N  N   . VAL D  4  76  ? 0.554   56.261  59.084  1.00 46.91 ? 76   VAL D N   1 
ATOM   5625  C  CA  . VAL D  4  76  ? -0.418  55.503  59.876  1.00 46.91 ? 76   VAL D CA  1 
ATOM   5626  C  C   . VAL D  4  76  ? -1.221  54.467  59.090  1.00 46.91 ? 76   VAL D C   1 
ATOM   5627  O  O   . VAL D  4  76  ? -0.861  53.289  59.067  1.00 46.91 ? 76   VAL D O   1 
ATOM   5628  C  CB  . VAL D  4  76  ? -1.396  56.446  60.619  1.00 46.91 ? 76   VAL D CB  1 
ATOM   5629  N  N   . ALA D  4  77  ? -2.303  54.923  58.457  1.00 46.91 ? 77   ALA D N   1 
ATOM   5630  C  CA  . ALA D  4  77  ? -3.201  54.082  57.665  1.00 46.91 ? 77   ALA D CA  1 
ATOM   5631  C  C   . ALA D  4  77  ? -4.034  53.165  58.557  1.00 46.91 ? 77   ALA D C   1 
ATOM   5632  O  O   . ALA D  4  77  ? -3.624  52.049  58.892  1.00 46.91 ? 77   ALA D O   1 
ATOM   5633  C  CB  . ALA D  4  77  ? -2.420  53.273  56.628  1.00 46.91 ? 77   ALA D CB  1 
ATOM   5634  N  N   . VAL D  4  78  ? -5.209  53.654  58.941  1.00 46.91 ? 78   VAL D N   1 
ATOM   5635  C  CA  . VAL D  4  78  ? -6.125  52.915  59.801  1.00 46.91 ? 78   VAL D CA  1 
ATOM   5636  C  C   . VAL D  4  78  ? -6.661  51.642  59.154  1.00 46.91 ? 78   VAL D C   1 
ATOM   5637  O  O   . VAL D  4  78  ? -6.941  51.603  57.951  1.00 46.91 ? 78   VAL D O   1 
ATOM   5638  C  CB  . VAL D  4  78  ? -7.320  53.786  60.227  1.00 46.91 ? 78   VAL D CB  1 
ATOM   5639  N  N   . SER D  4  79  ? -6.824  50.607  59.973  1.00 46.91 ? 79   SER D N   1 
ATOM   5640  C  CA  . SER D  4  79  ? -7.329  49.321  59.510  1.00 46.91 ? 79   SER D CA  1 
ATOM   5641  C  C   . SER D  4  79  ? -8.771  49.433  59.024  1.00 46.91 ? 79   SER D C   1 
ATOM   5642  O  O   . SER D  4  79  ? -9.651  49.883  59.761  1.00 46.91 ? 79   SER D O   1 
ATOM   5643  C  CB  . SER D  4  79  ? -7.231  48.286  60.634  1.00 46.91 ? 79   SER D CB  1 
ATOM   5644  N  N   . THR D  4  80  ? -9.004  49.008  57.787  1.00 46.91 ? 80   THR D N   1 
ATOM   5645  C  CA  . THR D  4  80  ? -10.331 49.056  57.190  1.00 46.91 ? 80   THR D CA  1 
ATOM   5646  C  C   . THR D  4  80  ? -10.472 48.021  56.080  1.00 46.91 ? 80   THR D C   1 
ATOM   5647  O  O   . THR D  4  80  ? -11.341 47.140  56.237  1.00 46.91 ? 80   THR D O   1 
ATOM   5648  C  CB  . THR D  4  80  ? -10.624 50.453  56.600  1.00 46.91 ? 80   THR D CB  1 
ATOM   5649  N  N   . GLU D  4  96  ? -16.213 57.410  51.145  1.00 46.91 ? 96   GLU D N   1 
ATOM   5650  C  CA  . GLU D  4  96  ? -16.584 58.404  52.196  1.00 46.91 ? 96   GLU D CA  1 
ATOM   5651  C  C   . GLU D  4  96  ? -16.489 57.815  53.604  1.00 46.91 ? 96   GLU D C   1 
ATOM   5652  O  O   . GLU D  4  96  ? -17.109 56.791  53.906  1.00 46.91 ? 96   GLU D O   1 
ATOM   5653  C  CB  . GLU D  4  96  ? -17.999 58.934  51.947  1.00 46.91 ? 96   GLU D CB  1 
ATOM   5654  N  N   . ALA D  4  97  ? -15.700 58.464  54.453  1.00 46.91 ? 97   ALA D N   1 
ATOM   5655  C  CA  . ALA D  4  97  ? -15.516 58.024  55.831  1.00 46.91 ? 97   ALA D CA  1 
ATOM   5656  C  C   . ALA D  4  97  ? -16.170 59.004  56.801  1.00 46.91 ? 97   ALA D C   1 
ATOM   5657  O  O   . ALA D  4  97  ? -17.091 58.640  57.537  1.00 46.91 ? 97   ALA D O   1 
ATOM   5658  C  CB  . ALA D  4  97  ? -14.029 57.882  56.141  1.00 46.91 ? 97   ALA D CB  1 
ATOM   5659  N  N   . GLN D  4  98  ? -15.697 60.246  56.794  1.00 46.91 ? 98   GLN D N   1 
ATOM   5660  C  CA  . GLN D  4  98  ? -16.229 61.275  57.678  1.00 46.91 ? 98   GLN D CA  1 
ATOM   5661  C  C   . GLN D  4  98  ? -16.482 62.575  56.915  1.00 46.91 ? 98   GLN D C   1 
ATOM   5662  O  O   . GLN D  4  98  ? -17.098 62.564  55.845  1.00 46.91 ? 98   GLN D O   1 
ATOM   5663  C  CB  . GLN D  4  98  ? -15.268 61.511  58.850  1.00 46.91 ? 98   GLN D CB  1 
ATOM   5664  N  N   . GLY D  4  99  ? -16.025 63.692  57.475  1.00 46.91 ? 99   GLY D N   1 
ATOM   5665  C  CA  . GLY D  4  99  ? -16.210 64.979  56.829  1.00 46.91 ? 99   GLY D CA  1 
ATOM   5666  C  C   . GLY D  4  99  ? -15.634 66.132  57.626  1.00 46.91 ? 99   GLY D C   1 
ATOM   5667  O  O   . GLY D  4  99  ? -16.350 67.080  57.955  1.00 46.91 ? 99   GLY D O   1 
ATOM   5668  N  N   . ASP D  4  100 ? -14.342 66.052  57.933  1.00 46.91 ? 100  ASP D N   1 
ATOM   5669  C  CA  . ASP D  4  100 ? -13.656 67.092  58.693  1.00 46.91 ? 100  ASP D CA  1 
ATOM   5670  C  C   . ASP D  4  100 ? -12.217 67.290  58.213  1.00 46.91 ? 100  ASP D C   1 
ATOM   5671  O  O   . ASP D  4  100 ? -11.883 66.978  57.068  1.00 46.91 ? 100  ASP D O   1 
ATOM   5672  C  CB  . ASP D  4  100 ? -13.666 66.749  60.185  1.00 46.91 ? 100  ASP D CB  1 
ATOM   5673  N  N   . PHE D  4  101 ? -11.380 67.848  59.086  1.00 46.91 ? 101  PHE D N   1 
ATOM   5674  C  CA  . PHE D  4  101 ? -9.976  68.097  58.775  1.00 46.91 ? 101  PHE D CA  1 
ATOM   5675  C  C   . PHE D  4  101 ? -9.093  67.668  59.948  1.00 46.91 ? 101  PHE D C   1 
ATOM   5676  O  O   . PHE D  4  101 ? -7.872  67.572  59.813  1.00 46.91 ? 101  PHE D O   1 
ATOM   5677  C  CB  . PHE D  4  101 ? -9.755  69.583  58.469  1.00 46.91 ? 101  PHE D CB  1 
ATOM   5678  C  CG  . PHE D  4  101 ? -8.366  69.908  57.991  1.00 46.91 ? 101  PHE D CG  1 
ATOM   5679  C  CD1 . PHE D  4  101 ? -7.902  69.418  56.774  1.00 46.91 ? 101  PHE D CD1 1 
ATOM   5680  C  CD2 . PHE D  4  101 ? -7.524  70.714  58.753  1.00 46.91 ? 101  PHE D CD2 1 
ATOM   5681  C  CE1 . PHE D  4  101 ? -6.623  69.727  56.321  1.00 46.91 ? 101  PHE D CE1 1 
ATOM   5682  C  CE2 . PHE D  4  101 ? -6.241  71.029  58.308  1.00 46.91 ? 101  PHE D CE2 1 
ATOM   5683  C  CZ  . PHE D  4  101 ? -5.789  70.534  57.088  1.00 46.91 ? 101  PHE D CZ  1 
ATOM   5684  N  N   . THR D  4  102 ? -9.713  67.454  61.105  1.00 46.91 ? 102  THR D N   1 
ATOM   5685  C  CA  . THR D  4  102 ? -8.988  67.040  62.302  1.00 46.91 ? 102  THR D CA  1 
ATOM   5686  C  C   . THR D  4  102 ? -9.316  65.598  62.686  1.00 46.91 ? 102  THR D C   1 
ATOM   5687  O  O   . THR D  4  102 ? -8.494  64.907  63.294  1.00 46.91 ? 102  THR D O   1 
ATOM   5688  C  CB  . THR D  4  102 ? -9.311  67.954  63.497  1.00 46.91 ? 102  THR D CB  1 
ATOM   5689  N  N   . ARG D  4  103 ? -10.539 65.168  62.383  1.00 46.91 ? 103  ARG D N   1 
ATOM   5690  C  CA  . ARG D  4  103 ? -10.986 63.814  62.676  1.00 46.91 ? 103  ARG D CA  1 
ATOM   5691  C  C   . ARG D  4  103 ? -10.698 62.903  61.489  1.00 46.91 ? 103  ARG D C   1 
ATOM   5692  O  O   . ARG D  4  103 ? -10.429 61.714  61.658  1.00 46.91 ? 103  ARG D O   1 
ATOM   5693  C  CB  . ARG D  4  103 ? -12.486 63.798  62.984  1.00 46.91 ? 103  ARG D CB  1 
ATOM   5694  N  N   . TRP D  4  104 ? -10.789 63.471  60.290  1.00 46.91 ? 104  TRP D N   1 
ATOM   5695  C  CA  . TRP D  4  104 ? -10.544 62.740  59.054  1.00 46.91 ? 104  TRP D CA  1 
ATOM   5696  C  C   . TRP D  4  104 ? -9.041  62.577  58.812  1.00 46.91 ? 104  TRP D C   1 
ATOM   5697  O  O   . TRP D  4  104 ? -8.599  61.568  58.259  1.00 46.91 ? 104  TRP D O   1 
ATOM   5698  C  CB  . TRP D  4  104 ? -11.198 63.477  57.880  1.00 46.91 ? 104  TRP D CB  1 
ATOM   5699  C  CG  . TRP D  4  104 ? -11.153 62.730  56.582  1.00 46.91 ? 104  TRP D CG  1 
ATOM   5700  C  CD1 . TRP D  4  104 ? -11.925 61.660  56.224  1.00 46.91 ? 104  TRP D CD1 1 
ATOM   5701  C  CD2 . TRP D  4  104 ? -10.285 62.990  55.472  1.00 46.91 ? 104  TRP D CD2 1 
ATOM   5702  N  NE1 . TRP D  4  104 ? -11.587 61.235  54.959  1.00 46.91 ? 104  TRP D NE1 1 
ATOM   5703  C  CE2 . TRP D  4  104 ? -10.584 62.033  54.475  1.00 46.91 ? 104  TRP D CE2 1 
ATOM   5704  C  CE3 . TRP D  4  104 ? -9.281  63.937  55.223  1.00 46.91 ? 104  TRP D CE3 1 
ATOM   5705  C  CZ2 . TRP D  4  104 ? -9.914  61.995  53.248  1.00 46.91 ? 104  TRP D CZ2 1 
ATOM   5706  C  CZ3 . TRP D  4  104 ? -8.615  63.900  54.004  1.00 46.91 ? 104  TRP D CZ3 1 
ATOM   5707  C  CH2 . TRP D  4  104 ? -8.936  62.934  53.032  1.00 46.91 ? 104  TRP D CH2 1 
ATOM   5708  N  N   . CYS D  4  105 ? -8.265  63.580  59.220  1.00 46.91 ? 105  CYS D N   1 
ATOM   5709  C  CA  . CYS D  4  105 ? -6.813  63.563  59.058  1.00 46.91 ? 105  CYS D CA  1 
ATOM   5710  C  C   . CYS D  4  105 ? -6.089  62.895  60.227  1.00 46.91 ? 105  CYS D C   1 
ATOM   5711  O  O   . CYS D  4  105 ? -4.862  62.974  60.332  1.00 46.91 ? 105  CYS D O   1 
ATOM   5712  C  CB  . CYS D  4  105 ? -6.293  64.989  58.872  1.00 46.91 ? 105  CYS D CB  1 
ATOM   5713  N  N   . GLN D  4  106 ? -6.853  62.279  61.123  1.00 46.91 ? 106  GLN D N   1 
ATOM   5714  C  CA  . GLN D  4  106 ? -6.285  61.601  62.284  1.00 46.91 ? 106  GLN D CA  1 
ATOM   5715  C  C   . GLN D  4  106 ? -6.058  60.120  61.994  1.00 46.91 ? 106  GLN D C   1 
ATOM   5716  O  O   . GLN D  4  106 ? -4.921  59.643  62.001  1.00 46.91 ? 106  GLN D O   1 
ATOM   5717  C  CB  . GLN D  4  106 ? -7.206  61.760  63.496  1.00 46.91 ? 106  GLN D CB  1 
ATOM   5718  N  N   . LEU D  4  107 ? -7.155  59.400  61.763  1.00 46.91 ? 107  LEU D N   1 
ATOM   5719  C  CA  . LEU D  4  107 ? -7.106  57.972  61.463  1.00 46.91 ? 107  LEU D CA  1 
ATOM   5720  C  C   . LEU D  4  107 ? -6.416  57.702  60.129  1.00 46.91 ? 107  LEU D C   1 
ATOM   5721  O  O   . LEU D  4  107 ? -5.872  56.618  59.913  1.00 46.91 ? 107  LEU D O   1 
ATOM   5722  C  CB  . LEU D  4  107 ? -8.522  57.390  61.442  1.00 46.91 ? 107  LEU D CB  1 
ATOM   5723  N  N   . GLY D  4  108 ? -6.474  58.681  59.233  1.00 46.91 ? 108  GLY D N   1 
ATOM   5724  C  CA  . GLY D  4  108 ? -5.853  58.545  57.929  1.00 46.91 ? 108  GLY D CA  1 
ATOM   5725  C  C   . GLY D  4  108 ? -5.867  59.863  57.182  1.00 46.91 ? 108  GLY D C   1 
ATOM   5726  O  O   . GLY D  4  108 ? -5.644  60.921  57.772  1.00 46.91 ? 108  GLY D O   1 
ATOM   5727  N  N   . GLY D  4  109 ? -6.126  59.803  55.878  1.00 46.91 ? 109  GLY D N   1 
ATOM   5728  C  CA  . GLY D  4  109 ? -6.170  61.012  55.074  1.00 46.91 ? 109  GLY D CA  1 
ATOM   5729  C  C   . GLY D  4  109 ? -4.815  61.625  54.769  1.00 46.91 ? 109  GLY D C   1 
ATOM   5730  O  O   . GLY D  4  109 ? -4.683  62.375  53.803  1.00 46.91 ? 109  GLY D O   1 
ATOM   5731  N  N   . LEU D  4  110 ? -3.818  61.321  55.595  1.00 46.91 ? 110  LEU D N   1 
ATOM   5732  C  CA  . LEU D  4  110 ? -2.469  61.845  55.408  1.00 46.91 ? 110  LEU D CA  1 
ATOM   5733  C  C   . LEU D  4  110 ? -1.758  61.113  54.273  1.00 46.91 ? 110  LEU D C   1 
ATOM   5734  O  O   . LEU D  4  110 ? -1.401  61.718  53.261  1.00 46.91 ? 110  LEU D O   1 
ATOM   5735  C  CB  . LEU D  4  110 ? -1.663  61.719  56.704  1.00 46.91 ? 110  LEU D CB  1 
ATOM   5736  N  N   . TRP D  4  111 ? -1.546  59.813  54.453  1.00 46.91 ? 111  TRP D N   1 
ATOM   5737  C  CA  . TRP D  4  111 ? -0.890  58.991  53.441  1.00 46.91 ? 111  TRP D CA  1 
ATOM   5738  C  C   . TRP D  4  111 ? -1.881  58.702  52.314  1.00 46.91 ? 111  TRP D C   1 
ATOM   5739  O  O   . TRP D  4  111 ? -1.491  58.403  51.186  1.00 46.91 ? 111  TRP D O   1 
ATOM   5740  C  CB  . TRP D  4  111 ? -0.394  57.682  54.063  1.00 46.91 ? 111  TRP D CB  1 
ATOM   5741  C  CG  . TRP D  4  111 ? 0.382   56.812  53.119  1.00 46.91 ? 111  TRP D CG  1 
ATOM   5742  C  CD1 . TRP D  4  111 ? 1.722   56.874  52.859  1.00 46.91 ? 111  TRP D CD1 1 
ATOM   5743  C  CD2 . TRP D  4  111 ? -0.138  55.758  52.299  1.00 46.91 ? 111  TRP D CD2 1 
ATOM   5744  N  NE1 . TRP D  4  111 ? 2.068   55.925  51.928  1.00 46.91 ? 111  TRP D NE1 1 
ATOM   5745  C  CE2 . TRP D  4  111 ? 0.945   55.227  51.566  1.00 46.91 ? 111  TRP D CE2 1 
ATOM   5746  C  CE3 . TRP D  4  111 ? -1.417  55.212  52.110  1.00 46.91 ? 111  TRP D CE3 1 
ATOM   5747  C  CZ2 . TRP D  4  111 ? 0.790   54.175  50.658  1.00 46.91 ? 111  TRP D CZ2 1 
ATOM   5748  C  CZ3 . TRP D  4  111 ? -1.572  54.169  51.210  1.00 46.91 ? 111  TRP D CZ3 1 
ATOM   5749  C  CH2 . TRP D  4  111 ? -0.473  53.661  50.493  1.00 46.91 ? 111  TRP D CH2 1 
ATOM   5750  N  N   . THR D  4  112 ? -3.168  58.766  52.643  1.00 46.91 ? 112  THR D N   1 
ATOM   5751  C  CA  . THR D  4  112 ? -4.228  58.524  51.674  1.00 46.91 ? 112  THR D CA  1 
ATOM   5752  C  C   . THR D  4  112 ? -4.311  59.650  50.646  1.00 46.91 ? 112  THR D C   1 
ATOM   5753  O  O   . THR D  4  112 ? -4.936  59.492  49.595  1.00 46.91 ? 112  THR D O   1 
ATOM   5754  C  CB  . THR D  4  112 ? -5.593  58.384  52.372  1.00 46.91 ? 112  THR D CB  1 
ATOM   5755  N  N   . PHE D  4  113 ? -3.716  60.795  50.972  1.00 46.91 ? 113  PHE D N   1 
ATOM   5756  C  CA  . PHE D  4  113 ? -3.713  61.945  50.075  1.00 46.91 ? 113  PHE D CA  1 
ATOM   5757  C  C   . PHE D  4  113 ? -2.354  62.104  49.399  1.00 46.91 ? 113  PHE D C   1 
ATOM   5758  O  O   . PHE D  4  113 ? -2.263  62.631  48.288  1.00 46.91 ? 113  PHE D O   1 
ATOM   5759  C  CB  . PHE D  4  113 ? -4.071  63.223  50.839  1.00 46.91 ? 113  PHE D CB  1 
ATOM   5760  C  CG  . PHE D  4  113 ? -4.360  64.399  49.949  1.00 46.91 ? 113  PHE D CG  1 
ATOM   5761  C  CD1 . PHE D  4  113 ? -5.484  64.401  49.130  1.00 46.91 ? 113  PHE D CD1 1 
ATOM   5762  C  CD2 . PHE D  4  113 ? -3.505  65.495  49.917  1.00 46.91 ? 113  PHE D CD2 1 
ATOM   5763  C  CE1 . PHE D  4  113 ? -5.754  65.476  48.291  1.00 46.91 ? 113  PHE D CE1 1 
ATOM   5764  C  CE2 . PHE D  4  113 ? -3.766  66.579  49.080  1.00 46.91 ? 113  PHE D CE2 1 
ATOM   5765  C  CZ  . PHE D  4  113 ? -4.893  66.568  48.265  1.00 46.91 ? 113  PHE D CZ  1 
ATOM   5766  N  N   . ILE D  4  114 ? -1.303  61.670  50.089  1.00 46.91 ? 114  ILE D N   1 
ATOM   5767  C  CA  . ILE D  4  114 ? 0.056   61.746  49.568  1.00 46.91 ? 114  ILE D CA  1 
ATOM   5768  C  C   . ILE D  4  114 ? 0.283   60.675  48.503  1.00 46.91 ? 114  ILE D C   1 
ATOM   5769  O  O   . ILE D  4  114 ? 1.200   60.781  47.686  1.00 46.91 ? 114  ILE D O   1 
ATOM   5770  C  CB  . ILE D  4  114 ? 1.096   61.565  50.692  1.00 46.91 ? 114  ILE D CB  1 
ATOM   5771  N  N   . ALA D  4  115 ? -0.543  59.633  48.541  1.00 57.92 ? 115  ALA D N   1 
ATOM   5772  C  CA  . ALA D  4  115 ? -0.456  58.536  47.585  1.00 57.82 ? 115  ALA D CA  1 
ATOM   5773  C  C   . ALA D  4  115 ? -1.508  58.690  46.487  1.00 58.73 ? 115  ALA D C   1 
ATOM   5774  O  O   . ALA D  4  115 ? -1.507  57.944  45.504  1.00 57.86 ? 115  ALA D O   1 
ATOM   5775  C  CB  . ALA D  4  115 ? -0.628  57.202  48.301  1.00 57.10 ? 115  ALA D CB  1 
ATOM   5776  N  N   . LEU D  4  116 ? -2.429  59.631  46.682  1.00 46.91 ? 116  LEU D N   1 
ATOM   5777  C  CA  . LEU D  4  116 ? -3.487  59.890  45.711  1.00 46.91 ? 116  LEU D CA  1 
ATOM   5778  C  C   . LEU D  4  116 ? -3.149  61.090  44.828  1.00 46.91 ? 116  LEU D C   1 
ATOM   5779  O  O   . LEU D  4  116 ? -3.493  61.116  43.646  1.00 46.91 ? 116  LEU D O   1 
ATOM   5780  C  CB  . LEU D  4  116 ? -4.819  60.132  46.429  1.00 46.91 ? 116  LEU D CB  1 
ATOM   5781  N  N   . HIS D  4  117 ? -2.514  62.097  45.422  1.00 46.91 ? 117  HIS D N   1 
ATOM   5782  C  CA  . HIS D  4  117 ? -2.129  63.308  44.705  1.00 46.91 ? 117  HIS D CA  1 
ATOM   5783  C  C   . HIS D  4  117 ? -0.672  63.263  44.249  1.00 46.91 ? 117  HIS D C   1 
ATOM   5784  O  O   . HIS D  4  117 ? -0.293  63.940  43.290  1.00 46.91 ? 117  HIS D O   1 
ATOM   5785  C  CB  . HIS D  4  117 ? -2.361  64.536  45.588  1.00 46.91 ? 117  HIS D CB  1 
ATOM   5786  N  N   . GLY D  4  118 ? 0.139   62.481  44.958  1.00 46.91 ? 118  GLY D N   1 
ATOM   5787  C  CA  . GLY D  4  118 ? 1.549   62.349  44.626  1.00 46.91 ? 118  GLY D CA  1 
ATOM   5788  C  C   . GLY D  4  118 ? 1.837   61.276  43.587  1.00 46.91 ? 118  GLY D C   1 
ATOM   5789  O  O   . GLY D  4  118 ? 2.835   61.352  42.871  1.00 46.91 ? 118  GLY D O   1 
ATOM   5790  N  N   . ALA D  4  119 ? 0.989   60.251  43.535  1.00 46.91 ? 119  ALA D N   1 
ATOM   5791  C  CA  . ALA D  4  119 ? 1.148   59.157  42.581  1.00 46.91 ? 119  ALA D CA  1 
ATOM   5792  C  C   . ALA D  4  119 ? 0.428   59.446  41.262  1.00 46.91 ? 119  ALA D C   1 
ATOM   5793  O  O   . ALA D  4  119 ? 0.927   59.113  40.187  1.00 46.91 ? 119  ALA D O   1 
ATOM   5794  C  CB  . ALA D  4  119 ? 0.646   57.854  43.181  1.00 46.91 ? 119  ALA D CB  1 
ATOM   5795  N  N   . PHE D  4  120 ? -0.768  60.025  41.348  1.00 46.91 ? 120  PHE D N   1 
ATOM   5796  C  CA  . PHE D  4  120 ? -1.548  60.347  40.155  1.00 46.91 ? 120  PHE D CA  1 
ATOM   5797  C  C   . PHE D  4  120 ? -1.010  61.597  39.464  1.00 46.91 ? 120  PHE D C   1 
ATOM   5798  O  O   . PHE D  4  120 ? -0.956  61.660  38.231  1.00 46.91 ? 120  PHE D O   1 
ATOM   5799  C  CB  . PHE D  4  120 ? -3.027  60.537  40.513  1.00 46.91 ? 120  PHE D CB  1 
ATOM   5800  C  CG  . PHE D  4  120 ? -3.916  60.796  39.320  1.00 46.91 ? 120  PHE D CG  1 
ATOM   5801  C  CD1 . PHE D  4  120 ? -4.213  59.776  38.419  1.00 46.91 ? 120  PHE D CD1 1 
ATOM   5802  C  CD2 . PHE D  4  120 ? -4.447  62.063  39.094  1.00 46.91 ? 120  PHE D CD2 1 
ATOM   5803  C  CE1 . PHE D  4  120 ? -5.024  60.016  37.308  1.00 46.91 ? 120  PHE D CE1 1 
ATOM   5804  C  CE2 . PHE D  4  120 ? -5.257  62.314  37.988  1.00 46.91 ? 120  PHE D CE2 1 
ATOM   5805  C  CZ  . PHE D  4  120 ? -5.546  61.288  37.093  1.00 46.91 ? 120  PHE D CZ  1 
ATOM   5806  N  N   . GLY D  4  121 ? -0.653  62.601  40.263  1.00 46.91 ? 121  GLY D N   1 
ATOM   5807  C  CA  . GLY D  4  121 ? -0.115  63.837  39.723  1.00 46.91 ? 121  GLY D CA  1 
ATOM   5808  C  C   . GLY D  4  121 ? 1.169   63.594  38.955  1.00 46.91 ? 121  GLY D C   1 
ATOM   5809  O  O   . GLY D  4  121 ? 1.389   64.199  37.905  1.00 46.91 ? 121  GLY D O   1 
ATOM   5810  N  N   . LEU D  4  122 ? 2.005   62.709  39.499  1.00 46.91 ? 122  LEU D N   1 
ATOM   5811  C  CA  . LEU D  4  122 ? 3.298   62.307  38.930  1.00 46.91 ? 122  LEU D CA  1 
ATOM   5812  C  C   . LEU D  4  122 ? 3.931   63.248  37.900  1.00 46.91 ? 122  LEU D C   1 
ATOM   5813  O  O   . LEU D  4  122 ? 4.800   64.057  38.241  1.00 46.91 ? 122  LEU D O   1 
ATOM   5814  C  CB  . LEU D  4  122 ? 3.198   60.892  38.352  1.00 46.91 ? 122  LEU D CB  1 
ATOM   5815  N  N   . ILE D  4  123 ? 3.507   63.115  36.644  1.00 46.91 ? 123  ILE D N   1 
ATOM   5816  C  CA  . ILE D  4  123 ? 4.009   63.934  35.542  1.00 46.91 ? 123  ILE D CA  1 
ATOM   5817  C  C   . ILE D  4  123 ? 5.514   63.746  35.348  1.00 46.91 ? 123  ILE D C   1 
ATOM   5818  O  O   . ILE D  4  123 ? 5.968   62.643  35.041  1.00 46.91 ? 123  ILE D O   1 
ATOM   5819  C  CB  . ILE D  4  123 ? 3.681   65.429  35.749  1.00 46.91 ? 123  ILE D CB  1 
ATOM   5820  N  N   . GLY D  4  124 ? 6.278   64.819  35.543  1.00 46.91 ? 124  GLY D N   1 
ATOM   5821  C  CA  . GLY D  4  124 ? 7.720   64.752  35.388  1.00 46.91 ? 124  GLY D CA  1 
ATOM   5822  C  C   . GLY D  4  124 ? 8.153   64.456  33.965  1.00 46.91 ? 124  GLY D C   1 
ATOM   5823  O  O   . GLY D  4  124 ? 8.458   65.369  33.198  1.00 46.91 ? 124  GLY D O   1 
ATOM   5824  N  N   . PHE D  4  125 ? 8.234   63.172  33.634  1.00 46.91 ? 125  PHE D N   1 
ATOM   5825  C  CA  . PHE D  4  125 ? 8.629   62.739  32.300  1.00 46.91 ? 125  PHE D CA  1 
ATOM   5826  C  C   . PHE D  4  125 ? 7.476   62.870  31.307  1.00 46.91 ? 125  PHE D C   1 
ATOM   5827  O  O   . PHE D  4  125 ? 7.696   63.047  30.110  1.00 46.91 ? 125  PHE D O   1 
ATOM   5828  C  CB  . PHE D  4  125 ? 9.115   61.289  32.338  1.00 46.91 ? 125  PHE D CB  1 
ATOM   5829  N  N   . MET D  4  126 ? 6.251   62.751  31.809  1.00 46.91 ? 126  MET D N   1 
ATOM   5830  C  CA  . MET D  4  126 ? 5.058   62.852  30.973  1.00 46.91 ? 126  MET D CA  1 
ATOM   5831  C  C   . MET D  4  126 ? 4.756   64.294  30.572  1.00 46.91 ? 126  MET D C   1 
ATOM   5832  O  O   . MET D  4  126 ? 4.024   64.542  29.610  1.00 46.91 ? 126  MET D O   1 
ATOM   5833  C  CB  . MET D  4  126 ? 3.851   62.255  31.703  1.00 46.91 ? 126  MET D CB  1 
ATOM   5834  N  N   . LEU D  4  127 ? 5.279   65.239  31.348  1.00 46.91 ? 127  LEU D N   1 
ATOM   5835  C  CA  . LEU D  4  127 ? 5.078   66.658  31.084  1.00 46.91 ? 127  LEU D CA  1 
ATOM   5836  C  C   . LEU D  4  127 ? 6.254   67.250  30.311  1.00 46.91 ? 127  LEU D C   1 
ATOM   5837  O  O   . LEU D  4  127 ? 6.121   68.294  29.667  1.00 46.91 ? 127  LEU D O   1 
ATOM   5838  C  CB  . LEU D  4  127 ? 4.887   67.416  32.400  1.00 46.91 ? 127  LEU D CB  1 
ATOM   5839  N  N   . ARG D  4  128 ? 7.408   66.598  30.408  1.00 46.91 ? 128  ARG D N   1 
ATOM   5840  C  CA  . ARG D  4  128 ? 8.616   67.051  29.724  1.00 46.91 ? 128  ARG D CA  1 
ATOM   5841  C  C   . ARG D  4  128 ? 8.743   66.485  28.312  1.00 46.91 ? 128  ARG D C   1 
ATOM   5842  O  O   . ARG D  4  128 ? 9.401   67.079  27.461  1.00 46.91 ? 128  ARG D O   1 
ATOM   5843  C  CB  . ARG D  4  128 ? 9.856   66.686  30.543  1.00 46.91 ? 128  ARG D CB  1 
ATOM   5844  N  N   . GLN D  4  129 ? 8.131   65.329  28.076  1.00 46.91 ? 129  GLN D N   1 
ATOM   5845  C  CA  . GLN D  4  129 ? 8.176   64.683  26.767  1.00 46.91 ? 129  GLN D CA  1 
ATOM   5846  C  C   . GLN D  4  129 ? 7.186   65.299  25.778  1.00 46.91 ? 129  GLN D C   1 
ATOM   5847  O  O   . GLN D  4  129 ? 7.081   64.855  24.631  1.00 46.91 ? 129  GLN D O   1 
ATOM   5848  C  CB  . GLN D  4  129 ? 7.903   63.184  26.910  1.00 46.91 ? 129  GLN D CB  1 
ATOM   5849  N  N   . PHE D  4  130 ? 6.430   66.292  26.239  1.00 46.91 ? 130  PHE D N   1 
ATOM   5850  C  CA  . PHE D  4  130 ? 5.450   66.969  25.402  1.00 46.91 ? 130  PHE D CA  1 
ATOM   5851  C  C   . PHE D  4  130 ? 5.710   68.474  25.352  1.00 46.91 ? 130  PHE D C   1 
ATOM   5852  O  O   . PHE D  4  130 ? 4.831   69.253  24.970  1.00 46.91 ? 130  PHE D O   1 
ATOM   5853  C  CB  . PHE D  4  130 ? 4.034   66.696  25.915  1.00 46.91 ? 130  PHE D CB  1 
ATOM   5854  N  N   . GLU D  4  131 ? 6.914   68.875  25.745  1.00 46.91 ? 131  GLU D N   1 
ATOM   5855  C  CA  . GLU D  4  131 ? 7.309   70.279  25.747  1.00 46.91 ? 131  GLU D CA  1 
ATOM   5856  C  C   . GLU D  4  131 ? 8.745   70.422  25.257  1.00 46.91 ? 131  GLU D C   1 
ATOM   5857  O  O   . GLU D  4  131 ? 9.115   71.448  24.683  1.00 46.91 ? 131  GLU D O   1 
ATOM   5858  C  CB  . GLU D  4  131 ? 7.174   70.870  27.153  1.00 46.91 ? 131  GLU D CB  1 
ATOM   5859  N  N   . ILE D  4  132 ? 9.556   69.402  25.527  1.00 46.91 ? 132  ILE D N   1 
ATOM   5860  C  CA  . ILE D  4  132 ? 10.953  69.387  25.115  1.00 46.91 ? 132  ILE D CA  1 
ATOM   5861  C  C   . ILE D  4  132 ? 11.087  68.759  23.732  1.00 46.91 ? 132  ILE D C   1 
ATOM   5862  O  O   . ILE D  4  132 ? 11.803  69.274  22.876  1.00 46.91 ? 132  ILE D O   1 
ATOM   5863  C  CB  . ILE D  4  132 ? 11.823  68.589  26.102  1.00 46.91 ? 132  ILE D CB  1 
ATOM   5864  N  N   . ALA D  4  133 ? 10.414  67.629  23.532  1.00 46.91 ? 133  ALA D N   1 
ATOM   5865  C  CA  . ALA D  4  133 ? 10.450  66.924  22.255  1.00 46.91 ? 133  ALA D CA  1 
ATOM   5866  C  C   . ALA D  4  133 ? 9.669   67.681  21.180  1.00 46.91 ? 133  ALA D C   1 
ATOM   5867  O  O   . ALA D  4  133 ? 9.644   67.274  20.013  1.00 46.91 ? 133  ALA D O   1 
ATOM   5868  C  CB  . ALA D  4  133 ? 9.898   65.517  22.422  1.00 46.91 ? 133  ALA D CB  1 
ATOM   5869  N  N   . ARG D  4  134 ? 9.005   68.758  21.589  1.00 46.91 ? 134  ARG D N   1 
ATOM   5870  C  CA  . ARG D  4  134 ? 8.221   69.584  20.679  1.00 46.91 ? 134  ARG D CA  1 
ATOM   5871  C  C   . ARG D  4  134 ? 8.966   70.874  20.340  1.00 46.91 ? 134  ARG D C   1 
ATOM   5872  O  O   . ARG D  4  134 ? 8.680   71.517  19.325  1.00 46.91 ? 134  ARG D O   1 
ATOM   5873  C  CB  . ARG D  4  134 ? 6.864   69.918  21.305  1.00 46.91 ? 134  ARG D CB  1 
ATOM   5874  N  N   . LEU D  4  135 ? 9.895   71.265  21.209  1.00 46.91 ? 135  LEU D N   1 
ATOM   5875  C  CA  . LEU D  4  135 ? 10.685  72.479  21.018  1.00 46.91 ? 135  LEU D CA  1 
ATOM   5876  C  C   . LEU D  4  135 ? 12.145  72.159  20.701  1.00 46.91 ? 135  LEU D C   1 
ATOM   5877  O  O   . LEU D  4  135 ? 12.664  72.564  19.658  1.00 46.91 ? 135  LEU D O   1 
ATOM   5878  C  CB  . LEU D  4  135 ? 10.606  73.364  22.264  1.00 46.91 ? 135  LEU D CB  1 
ATOM   5879  N  N   . VAL D  4  136 ? 12.810  71.471  21.623  1.00 46.91 ? 136  VAL D N   1 
ATOM   5880  C  CA  . VAL D  4  136 ? 14.209  71.088  21.453  1.00 46.91 ? 136  VAL D CA  1 
ATOM   5881  C  C   . VAL D  4  136 ? 14.328  69.701  20.824  1.00 46.91 ? 136  VAL D C   1 
ATOM   5882  O  O   . VAL D  4  136 ? 14.545  69.575  19.617  1.00 46.91 ? 136  VAL D O   1 
ATOM   5883  C  CB  . VAL D  4  136 ? 14.958  71.097  22.802  1.00 46.91 ? 136  VAL D CB  1 
ATOM   5884  N  N   . GLY D  4  137 ? 14.230  68.662  21.650  1.00 46.91 ? 137  GLY D N   1 
ATOM   5885  C  CA  . GLY D  4  137 ? 14.316  67.306  21.141  1.00 46.91 ? 137  GLY D CA  1 
ATOM   5886  C  C   . GLY D  4  137 ? 14.945  66.318  22.104  1.00 46.91 ? 137  GLY D C   1 
ATOM   5887  O  O   . GLY D  4  137 ? 15.383  66.689  23.197  1.00 46.91 ? 137  GLY D O   1 
ATOM   5888  N  N   . VAL D  4  138 ? 15.012  65.056  21.671  1.00 46.91 ? 138  VAL D N   1 
ATOM   5889  C  CA  . VAL D  4  138 ? 15.587  63.967  22.452  1.00 46.91 ? 138  VAL D CA  1 
ATOM   5890  C  C   . VAL D  4  138 ? 14.763  63.568  23.677  1.00 46.91 ? 138  VAL D C   1 
ATOM   5891  O  O   . VAL D  4  138 ? 15.096  63.919  24.810  1.00 46.91 ? 138  VAL D O   1 
ATOM   5892  C  CB  . VAL D  4  138 ? 17.042  64.272  22.883  1.00 46.91 ? 138  VAL D CB  1 
ATOM   5893  N  N   . ARG D  4  139 ? 13.706  62.797  23.440  1.00 46.91 ? 139  ARG D N   1 
ATOM   5894  C  CA  . ARG D  4  139 ? 12.834  62.328  24.513  1.00 46.91 ? 139  ARG D CA  1 
ATOM   5895  C  C   . ARG D  4  139 ? 13.309  60.972  25.037  1.00 46.91 ? 139  ARG D C   1 
ATOM   5896  O  O   . ARG D  4  139 ? 12.560  59.993  25.041  1.00 46.91 ? 139  ARG D O   1 
ATOM   5897  C  CB  . ARG D  4  139 ? 11.388  62.226  24.015  1.00 46.91 ? 139  ARG D CB  1 
ATOM   5898  N  N   . PRO D  4  140 ? 14.583  60.894  25.453  1.00 46.91 ? 140  PRO D N   1 
ATOM   5899  C  CA  . PRO D  4  140 ? 15.208  59.679  25.985  1.00 46.91 ? 140  PRO D CA  1 
ATOM   5900  C  C   . PRO D  4  140 ? 15.208  59.632  27.511  1.00 46.91 ? 140  PRO D C   1 
ATOM   5901  O  O   . PRO D  4  140 ? 15.179  58.552  28.102  1.00 46.91 ? 140  PRO D O   1 
ATOM   5902  C  CB  . PRO D  4  140 ? 16.632  59.743  25.432  1.00 46.91 ? 140  PRO D CB  1 
ATOM   5903  N  N   . TYR D  4  141 ? 15.278  60.803  28.138  1.00 46.91 ? 141  TYR D N   1 
ATOM   5904  C  CA  . TYR D  4  141 ? 15.289  60.905  29.595  1.00 46.91 ? 141  TYR D CA  1 
ATOM   5905  C  C   . TYR D  4  141 ? 13.928  60.582  30.207  1.00 46.91 ? 141  TYR D C   1 
ATOM   5906  O  O   . TYR D  4  141 ? 13.819  60.362  31.416  1.00 46.91 ? 141  TYR D O   1 
ATOM   5907  C  CB  . TYR D  4  141 ? 15.729  62.306  30.024  1.00 46.91 ? 141  TYR D CB  1 
ATOM   5908  N  N   . ASN D  4  142 ? 12.894  60.586  29.371  1.00 46.91 ? 142  ASN D N   1 
ATOM   5909  C  CA  . ASN D  4  142 ? 11.534  60.291  29.811  1.00 46.91 ? 142  ASN D CA  1 
ATOM   5910  C  C   . ASN D  4  142 ? 11.348  58.802  30.101  1.00 46.91 ? 142  ASN D C   1 
ATOM   5911  O  O   . ASN D  4  142 ? 10.454  58.417  30.854  1.00 46.91 ? 142  ASN D O   1 
ATOM   5912  C  CB  . ASN D  4  142 ? 10.526  60.746  28.753  1.00 46.91 ? 142  ASN D CB  1 
ATOM   5913  N  N   . ALA D  4  143 ? 12.171  57.970  29.468  1.00 46.91 ? 143  ALA D N   1 
ATOM   5914  C  CA  . ALA D  4  143 ? 12.100  56.526  29.659  1.00 46.91 ? 143  ALA D CA  1 
ATOM   5915  C  C   . ALA D  4  143 ? 12.719  56.103  30.990  1.00 46.91 ? 143  ALA D C   1 
ATOM   5916  O  O   . ALA D  4  143 ? 12.332  55.087  31.569  1.00 46.91 ? 143  ALA D O   1 
ATOM   5917  C  CB  . ALA D  4  143 ? 12.791  55.811  28.506  1.00 46.91 ? 143  ALA D CB  1 
ATOM   5918  N  N   . ILE D  4  144 ? 13.703  56.872  31.449  1.00 46.91 ? 144  ILE D N   1 
ATOM   5919  C  CA  . ILE D  4  144 ? 14.390  56.591  32.705  1.00 46.91 ? 144  ILE D CA  1 
ATOM   5920  C  C   . ILE D  4  144 ? 13.551  56.986  33.919  1.00 46.91 ? 144  ILE D C   1 
ATOM   5921  O  O   . ILE D  4  144 ? 13.695  56.405  34.996  1.00 46.91 ? 144  ILE D O   1 
ATOM   5922  C  CB  . ILE D  4  144 ? 15.741  57.327  32.780  1.00 46.91 ? 144  ILE D CB  1 
ATOM   5923  N  N   . ALA D  4  145 ? 12.707  58.000  33.753  1.00 46.91 ? 145  ALA D N   1 
ATOM   5924  C  CA  . ALA D  4  145 ? 11.855  58.461  34.843  1.00 46.91 ? 145  ALA D CA  1 
ATOM   5925  C  C   . ALA D  4  145 ? 10.627  57.569  35.000  1.00 46.91 ? 145  ALA D C   1 
ATOM   5926  O  O   . ALA D  4  145 ? 10.052  57.481  36.086  1.00 46.91 ? 145  ALA D O   1 
ATOM   5927  C  CB  . ALA D  4  145 ? 11.440  59.909  34.619  1.00 46.91 ? 145  ALA D CB  1 
ATOM   5928  N  N   . PHE D  4  146 ? 10.228  56.913  33.912  1.00 46.91 ? 146  PHE D N   1 
ATOM   5929  C  CA  . PHE D  4  146 ? 9.067   56.027  33.919  1.00 46.91 ? 146  PHE D CA  1 
ATOM   5930  C  C   . PHE D  4  146 ? 9.434   54.602  34.325  1.00 46.91 ? 146  PHE D C   1 
ATOM   5931  O  O   . PHE D  4  146 ? 8.898   53.628  33.782  1.00 46.91 ? 146  PHE D O   1 
ATOM   5932  C  CB  . PHE D  4  146 ? 8.392   56.019  32.544  1.00 46.91 ? 146  PHE D CB  1 
ATOM   5933  N  N   . SER D  4  147 ? 10.323  54.489  35.305  1.00 46.91 ? 147  SER D N   1 
ATOM   5934  C  CA  . SER D  4  147 ? 10.772  53.197  35.804  1.00 46.91 ? 147  SER D CA  1 
ATOM   5935  C  C   . SER D  4  147 ? 11.553  53.387  37.099  1.00 46.91 ? 147  SER D C   1 
ATOM   5936  O  O   . SER D  4  147 ? 11.367  52.640  38.062  1.00 46.91 ? 147  SER D O   1 
ATOM   5937  C  CB  . SER D  4  147 ? 11.657  52.508  34.761  1.00 46.91 ? 147  SER D CB  1 
ATOM   5938  N  N   . ALA D  4  148 ? 12.414  54.401  37.123  1.00 46.91 ? 148  ALA D N   1 
ATOM   5939  C  CA  . ALA D  4  148 ? 13.229  54.689  38.296  1.00 46.91 ? 148  ALA D CA  1 
ATOM   5940  C  C   . ALA D  4  148 ? 12.518  55.575  39.318  1.00 46.91 ? 148  ALA D C   1 
ATOM   5941  O  O   . ALA D  4  148 ? 13.001  55.750  40.443  1.00 46.91 ? 148  ALA D O   1 
ATOM   5942  C  CB  . ALA D  4  148 ? 14.547  55.321  37.873  1.00 46.91 ? 148  ALA D CB  1 
ATOM   5943  N  N   . PRO D  4  149 ? 11.367  56.154  38.940  1.00 46.91 ? 149  PRO D N   1 
ATOM   5944  C  CA  . PRO D  4  149 ? 10.576  57.031  39.810  1.00 46.91 ? 149  PRO D CA  1 
ATOM   5945  C  C   . PRO D  4  149 ? 9.075   56.769  39.724  1.00 46.91 ? 149  PRO D C   1 
ATOM   5946  O  O   . PRO D  4  149 ? 8.335   57.047  40.672  1.00 46.91 ? 149  PRO D O   1 
ATOM   5947  C  CB  . PRO D  4  149 ? 10.915  58.433  39.304  1.00 46.91 ? 149  PRO D CB  1 
ATOM   5948  N  N   . ILE D  4  150 ? 8.632   56.264  38.577  1.00 46.91 ? 150  ILE D N   1 
ATOM   5949  C  CA  . ILE D  4  150 ? 7.221   55.969  38.357  1.00 46.91 ? 150  ILE D CA  1 
ATOM   5950  C  C   . ILE D  4  150 ? 6.845   54.578  38.859  1.00 46.91 ? 150  ILE D C   1 
ATOM   5951  O  O   . ILE D  4  150 ? 5.744   54.371  39.368  1.00 46.91 ? 150  ILE D O   1 
ATOM   5952  C  CB  . ILE D  4  150 ? 6.866   56.063  36.861  1.00 46.91 ? 150  ILE D CB  1 
ATOM   5953  N  N   . ALA D  4  151 ? 7.747   53.618  38.667  1.00 46.91 ? 151  ALA D N   1 
ATOM   5954  C  CA  . ALA D  4  151 ? 7.514   52.244  39.099  1.00 46.91 ? 151  ALA D CA  1 
ATOM   5955  C  C   . ALA D  4  151 ? 7.876   52.058  40.568  1.00 46.91 ? 151  ALA D C   1 
ATOM   5956  O  O   . ALA D  4  151 ? 7.336   51.178  41.239  1.00 46.91 ? 151  ALA D O   1 
ATOM   5957  C  CB  . ALA D  4  151 ? 8.314   51.274  38.234  1.00 46.91 ? 151  ALA D CB  1 
ATOM   5958  N  N   . VAL D  4  152 ? 8.790   52.890  41.058  1.00 46.91 ? 152  VAL D N   1 
ATOM   5959  C  CA  . VAL D  4  152 ? 9.244   52.822  42.443  1.00 46.91 ? 152  VAL D CA  1 
ATOM   5960  C  C   . VAL D  4  152 ? 8.170   53.237  43.449  1.00 46.91 ? 152  VAL D C   1 
ATOM   5961  O  O   . VAL D  4  152 ? 8.203   52.820  44.609  1.00 46.91 ? 152  VAL D O   1 
ATOM   5962  C  CB  . VAL D  4  152 ? 10.496  53.694  42.657  1.00 46.91 ? 152  VAL D CB  1 
ATOM   5963  N  N   . PHE D  4  153 ? 7.236   54.073  43.008  1.00 46.91 ? 153  PHE D N   1 
ATOM   5964  C  CA  . PHE D  4  153 ? 6.159   54.542  43.870  1.00 46.91 ? 153  PHE D CA  1 
ATOM   5965  C  C   . PHE D  4  153 ? 4.846   53.818  43.578  1.00 46.91 ? 153  PHE D C   1 
ATOM   5966  O  O   . PHE D  4  153 ? 4.057   53.560  44.490  1.00 46.91 ? 153  PHE D O   1 
ATOM   5967  C  CB  . PHE D  4  153 ? 5.973   56.053  43.706  1.00 46.91 ? 153  PHE D CB  1 
ATOM   5968  C  CG  . PHE D  4  153 ? 5.320   56.717  44.886  1.00 46.91 ? 153  PHE D CG  1 
ATOM   5969  C  CD1 . PHE D  4  153 ? 6.090   57.395  45.826  1.00 46.91 ? 153  PHE D CD1 1 
ATOM   5970  C  CD2 . PHE D  4  153 ? 3.939   56.665  45.062  1.00 46.91 ? 153  PHE D CD2 1 
ATOM   5971  C  CE1 . PHE D  4  153 ? 5.497   58.011  46.923  1.00 46.91 ? 153  PHE D CE1 1 
ATOM   5972  C  CE2 . PHE D  4  153 ? 3.336   57.278  46.155  1.00 46.91 ? 153  PHE D CE2 1 
ATOM   5973  C  CZ  . PHE D  4  153 ? 4.116   57.953  47.089  1.00 46.91 ? 153  PHE D CZ  1 
ATOM   5974  N  N   . VAL D  4  154 ? 4.614   53.496  42.308  1.00 46.91 ? 154  VAL D N   1 
ATOM   5975  C  CA  . VAL D  4  154 ? 3.390   52.809  41.899  1.00 46.91 ? 154  VAL D CA  1 
ATOM   5976  C  C   . VAL D  4  154 ? 3.326   51.355  42.360  1.00 46.91 ? 154  VAL D C   1 
ATOM   5977  O  O   . VAL D  4  154 ? 2.296   50.695  42.202  1.00 46.91 ? 154  VAL D O   1 
ATOM   5978  C  CB  . VAL D  4  154 ? 3.208   52.847  40.370  1.00 46.91 ? 154  VAL D CB  1 
ATOM   5979  N  N   . SER D  4  155 ? 4.439   50.850  42.883  1.00 46.91 ? 155  SER D N   1 
ATOM   5980  C  CA  . SER D  4  155 ? 4.517   49.478  43.368  1.00 46.91 ? 155  SER D CA  1 
ATOM   5981  C  C   . SER D  4  155 ? 4.183   49.405  44.854  1.00 46.91 ? 155  SER D C   1 
ATOM   5982  O  O   . SER D  4  155 ? 3.593   48.427  45.321  1.00 46.91 ? 155  SER D O   1 
ATOM   5983  C  CB  . SER D  4  155 ? 5.915   48.908  43.123  1.00 46.91 ? 155  SER D CB  1 
ATOM   5984  N  N   . VAL D  4  156 ? 4.596   50.426  45.599  1.00 46.91 ? 156  VAL D N   1 
ATOM   5985  C  CA  . VAL D  4  156 ? 4.345   50.485  47.035  1.00 46.91 ? 156  VAL D CA  1 
ATOM   5986  C  C   . VAL D  4  156 ? 2.969   51.063  47.365  1.00 46.91 ? 156  VAL D C   1 
ATOM   5987  O  O   . VAL D  4  156 ? 2.647   51.281  48.537  1.00 46.91 ? 156  VAL D O   1 
ATOM   5988  C  CB  . VAL D  4  156 ? 5.422   51.326  47.755  1.00 46.91 ? 156  VAL D CB  1 
ATOM   5989  N  N   . PHE D  4  157 ? 2.157   51.298  46.339  1.00 46.91 ? 157  PHE D N   1 
ATOM   5990  C  CA  . PHE D  4  157 ? 0.821   51.852  46.533  1.00 46.91 ? 157  PHE D CA  1 
ATOM   5991  C  C   . PHE D  4  157 ? -0.234  51.168  45.662  1.00 46.91 ? 157  PHE D C   1 
ATOM   5992  O  O   . PHE D  4  157 ? -1.341  51.690  45.485  1.00 46.91 ? 157  PHE D O   1 
ATOM   5993  C  CB  . PHE D  4  157 ? 0.833   53.360  46.259  1.00 46.91 ? 157  PHE D CB  1 
ATOM   5994  N  N   . LEU D  4  158 ? 0.102   49.988  45.144  1.00 46.91 ? 158  LEU D N   1 
ATOM   5995  C  CA  . LEU D  4  158 ? -0.806  49.225  44.291  1.00 46.91 ? 158  LEU D CA  1 
ATOM   5996  C  C   . LEU D  4  158 ? -0.564  47.721  44.395  1.00 46.91 ? 158  LEU D C   1 
ATOM   5997  O  O   . LEU D  4  158 ? -1.239  46.928  43.731  1.00 46.91 ? 158  LEU D O   1 
ATOM   5998  C  CB  . LEU D  4  158 ? -0.661  49.665  42.831  1.00 46.91 ? 158  LEU D CB  1 
ATOM   5999  N  N   . ILE D  4  159 ? 0.415   47.333  45.204  1.00 46.91 ? 159  ILE D N   1 
ATOM   6000  C  CA  . ILE D  4  159 ? 0.741   45.924  45.388  1.00 46.91 ? 159  ILE D CA  1 
ATOM   6001  C  C   . ILE D  4  159 ? 0.541   45.515  46.840  1.00 46.91 ? 159  ILE D C   1 
ATOM   6002  O  O   . ILE D  4  159 ? -0.269  44.638  47.142  1.00 46.91 ? 159  ILE D O   1 
ATOM   6003  C  CB  . ILE D  4  159 ? 2.200   45.633  44.986  1.00 46.91 ? 159  ILE D CB  1 
ATOM   6004  N  N   . TYR D  4  160 ? 1.289   46.157  47.733  1.00 46.91 ? 160  TYR D N   1 
ATOM   6005  C  CA  . TYR D  4  160 ? 1.207   45.882  49.161  1.00 46.91 ? 160  TYR D CA  1 
ATOM   6006  C  C   . TYR D  4  160 ? -0.144  46.355  49.693  1.00 46.91 ? 160  TYR D C   1 
ATOM   6007  O  O   . TYR D  4  160 ? -0.678  45.804  50.659  1.00 46.91 ? 160  TYR D O   1 
ATOM   6008  C  CB  . TYR D  4  160 ? 2.340   46.603  49.898  1.00 46.91 ? 160  TYR D CB  1 
ATOM   6009  C  CG  . TYR D  4  160 ? 2.415   46.288  51.377  1.00 46.91 ? 160  TYR D CG  1 
ATOM   6010  C  CD1 . TYR D  4  160 ? 3.262   45.291  51.849  1.00 46.91 ? 160  TYR D CD1 1 
ATOM   6011  C  CD2 . TYR D  4  160 ? 1.634   46.980  52.301  1.00 46.91 ? 160  TYR D CD2 1 
ATOM   6012  C  CE1 . TYR D  4  160 ? 3.327   44.980  53.207  1.00 46.91 ? 160  TYR D CE1 1 
ATOM   6013  C  CE2 . TYR D  4  160 ? 1.686   46.681  53.660  1.00 46.91 ? 160  TYR D CE2 1 
ATOM   6014  C  CZ  . TYR D  4  160 ? 2.538   45.681  54.107  1.00 46.91 ? 160  TYR D CZ  1 
ATOM   6015  O  OH  . TYR D  4  160 ? 2.594   45.364  55.446  1.00 46.91 ? 160  TYR D OH  1 
ATOM   6016  N  N   . PRO D  4  161 ? -0.690  47.417  49.086  1.00 46.91 ? 161  PRO D N   1 
ATOM   6017  C  CA  . PRO D  4  161 ? -1.969  48.055  49.405  1.00 46.91 ? 161  PRO D CA  1 
ATOM   6018  C  C   . PRO D  4  161 ? -3.135  47.285  48.790  1.00 46.91 ? 161  PRO D C   1 
ATOM   6019  O  O   . PRO D  4  161 ? -3.248  47.191  47.567  1.00 46.91 ? 161  PRO D O   1 
ATOM   6020  C  CB  . PRO D  4  161 ? -1.833  49.444  48.779  1.00 46.91 ? 161  PRO D CB  1 
ATOM   6021  N  N   . LEU D  4  162 ? -4.002  46.750  49.645  1.00 46.91 ? 162  LEU D N   1 
ATOM   6022  C  CA  . LEU D  4  162 ? -5.172  45.985  49.210  1.00 46.91 ? 162  LEU D CA  1 
ATOM   6023  C  C   . LEU D  4  162 ? -4.817  44.709  48.439  1.00 46.91 ? 162  LEU D C   1 
ATOM   6024  O  O   . LEU D  4  162 ? -5.358  44.451  47.360  1.00 46.91 ? 162  LEU D O   1 
ATOM   6025  C  CB  . LEU D  4  162 ? -6.105  46.869  48.371  1.00 46.91 ? 162  LEU D CB  1 
ATOM   6026  N  N   . GLY D  4  163 ? -3.953  43.890  49.033  1.00 46.91 ? 163  GLY D N   1 
ATOM   6027  C  CA  . GLY D  4  163 ? -3.540  42.649  48.405  1.00 46.91 ? 163  GLY D CA  1 
ATOM   6028  C  C   . GLY D  4  163 ? -3.160  41.588  49.417  1.00 46.91 ? 163  GLY D C   1 
ATOM   6029  O  O   . GLY D  4  163 ? -4.069  41.021  50.056  1.00 46.91 ? 163  GLY D O   1 
ATOM   6030  N  N   . PHE D  4  169 ? -2.988  44.938  54.973  1.00 46.91 ? 169  PHE D N   1 
ATOM   6031  C  CA  . PHE D  4  169 ? -3.927  45.437  53.926  1.00 46.91 ? 169  PHE D CA  1 
ATOM   6032  C  C   . PHE D  4  169 ? -4.297  46.895  54.187  1.00 46.91 ? 169  PHE D C   1 
ATOM   6033  O  O   . PHE D  4  169 ? -4.825  47.582  53.311  1.00 46.91 ? 169  PHE D O   1 
ATOM   6034  C  CB  . PHE D  4  169 ? -5.190  44.575  53.899  1.00 46.91 ? 169  PHE D CB  1 
ATOM   6035  N  N   . ALA D  4  170 ? -4.052  47.343  55.415  1.00 46.91 ? 170  ALA D N   1 
ATOM   6036  C  CA  . ALA D  4  170 ? -4.338  48.716  55.811  1.00 46.91 ? 170  ALA D CA  1 
ATOM   6037  C  C   . ALA D  4  170 ? -3.067  49.549  55.688  1.00 46.91 ? 170  ALA D C   1 
ATOM   6038  O  O   . ALA D  4  170 ? -2.924  50.357  54.765  1.00 46.91 ? 170  ALA D O   1 
ATOM   6039  C  CB  . ALA D  4  170 ? -4.859  48.752  57.238  1.00 46.91 ? 170  ALA D CB  1 
ATOM   6040  N  N   . PRO D  4  171 ? -2.122  49.355  56.623  1.00 46.91 ? 171  PRO D N   1 
ATOM   6041  C  CA  . PRO D  4  171 ? -0.847  50.080  56.634  1.00 46.91 ? 171  PRO D CA  1 
ATOM   6042  C  C   . PRO D  4  171 ? 0.071   49.590  55.517  1.00 46.91 ? 171  PRO D C   1 
ATOM   6043  O  O   . PRO D  4  171 ? 0.499   48.436  55.513  1.00 46.91 ? 171  PRO D O   1 
ATOM   6044  C  CB  . PRO D  4  171 ? -0.271  49.762  58.013  1.00 46.91 ? 171  PRO D CB  1 
ATOM   6045  N  N   . SER D  4  172 ? 0.357   50.475  54.569  1.00 46.91 ? 172  SER D N   1 
ATOM   6046  C  CA  . SER D  4  172 ? 1.200   50.135  53.429  1.00 46.91 ? 172  SER D CA  1 
ATOM   6047  C  C   . SER D  4  172 ? 2.698   50.337  53.646  1.00 46.91 ? 172  SER D C   1 
ATOM   6048  O  O   . SER D  4  172 ? 3.438   49.368  53.811  1.00 46.91 ? 172  SER D O   1 
ATOM   6049  C  CB  . SER D  4  172 ? 0.741   50.906  52.190  1.00 46.91 ? 172  SER D CB  1 
ATOM   6050  N  N   . PHE D  4  173 ? 3.144   51.592  53.654  1.00 46.91 ? 173  PHE D N   1 
ATOM   6051  C  CA  . PHE D  4  173 ? 4.565   51.888  53.821  1.00 46.91 ? 173  PHE D CA  1 
ATOM   6052  C  C   . PHE D  4  173 ? 4.796   53.211  54.557  1.00 46.91 ? 173  PHE D C   1 
ATOM   6053  O  O   . PHE D  4  173 ? 3.848   53.925  54.890  1.00 46.91 ? 173  PHE D O   1 
ATOM   6054  C  CB  . PHE D  4  173 ? 5.230   51.936  52.439  1.00 46.91 ? 173  PHE D CB  1 
ATOM   6055  C  CG  . PHE D  4  173 ? 6.707   51.642  52.453  1.00 46.91 ? 173  PHE D CG  1 
ATOM   6056  C  CD1 . PHE D  4  173 ? 7.175   50.368  52.757  1.00 46.91 ? 173  PHE D CD1 1 
ATOM   6057  C  CD2 . PHE D  4  173 ? 7.630   52.635  52.131  1.00 46.91 ? 173  PHE D CD2 1 
ATOM   6058  C  CE1 . PHE D  4  173 ? 8.539   50.084  52.738  1.00 46.91 ? 173  PHE D CE1 1 
ATOM   6059  C  CE2 . PHE D  4  173 ? 8.995   52.362  52.110  1.00 46.91 ? 173  PHE D CE2 1 
ATOM   6060  C  CZ  . PHE D  4  173 ? 9.451   51.082  52.413  1.00 46.91 ? 173  PHE D CZ  1 
ATOM   6061  N  N   . GLY D  4  174 ? 6.062   53.508  54.837  1.00 46.91 ? 174  GLY D N   1 
ATOM   6062  C  CA  . GLY D  4  174 ? 6.411   54.738  55.522  1.00 46.91 ? 174  GLY D CA  1 
ATOM   6063  C  C   . GLY D  4  174 ? 6.755   55.856  54.555  1.00 46.91 ? 174  GLY D C   1 
ATOM   6064  O  O   . GLY D  4  174 ? 7.056   55.608  53.386  1.00 46.91 ? 174  GLY D O   1 
ATOM   6065  N  N   . VAL D  4  175 ? 6.715   57.090  55.045  1.00 46.91 ? 175  VAL D N   1 
ATOM   6066  C  CA  . VAL D  4  175 ? 7.023   58.252  54.217  1.00 46.91 ? 175  VAL D CA  1 
ATOM   6067  C  C   . VAL D  4  175 ? 7.870   59.262  54.985  1.00 46.91 ? 175  VAL D C   1 
ATOM   6068  O  O   . VAL D  4  175 ? 7.433   60.382  55.254  1.00 46.91 ? 175  VAL D O   1 
ATOM   6069  C  CB  . VAL D  4  175 ? 5.737   58.939  53.712  1.00 46.91 ? 175  VAL D CB  1 
ATOM   6070  N  N   . ALA D  4  176 ? 9.085   58.854  55.339  1.00 57.92 ? 176  ALA D N   1 
ATOM   6071  C  CA  . ALA D  4  176 ? 10.003  59.714  56.079  1.00 57.82 ? 176  ALA D CA  1 
ATOM   6072  C  C   . ALA D  4  176 ? 11.437  59.204  55.969  1.00 58.73 ? 176  ALA D C   1 
ATOM   6073  O  O   . ALA D  4  176 ? 11.872  58.779  54.894  1.00 57.86 ? 176  ALA D O   1 
ATOM   6074  C  CB  . ALA D  4  176 ? 9.578   59.804  57.542  1.00 57.10 ? 176  ALA D CB  1 
ATOM   6075  N  N   . ALA D  4  177 ? 12.175  59.275  57.073  1.00 46.91 ? 177  ALA D N   1 
ATOM   6076  C  CA  . ALA D  4  177 ? 13.560  58.820  57.114  1.00 46.91 ? 177  ALA D CA  1 
ATOM   6077  C  C   . ALA D  4  177 ? 13.676  57.468  57.811  1.00 46.91 ? 177  ALA D C   1 
ATOM   6078  O  O   . ALA D  4  177 ? 14.154  56.499  57.224  1.00 46.91 ? 177  ALA D O   1 
ATOM   6079  C  CB  . ALA D  4  177 ? 14.426  59.855  57.826  1.00 46.91 ? 177  ALA D CB  1 
ATOM   6080  N  N   . ILE D  4  178 ? 13.282  57.426  59.082  1.00 46.91 ? 178  ILE D N   1 
ATOM   6081  C  CA  . ILE D  4  178 ? 13.332  56.196  59.862  1.00 46.91 ? 178  ILE D CA  1 
ATOM   6082  C  C   . ILE D  4  178 ? 12.058  55.376  59.677  1.00 46.91 ? 178  ILE D C   1 
ATOM   6083  O  O   . ILE D  4  178 ? 11.981  54.230  60.123  1.00 46.91 ? 178  ILE D O   1 
ATOM   6084  C  CB  . ILE D  4  178 ? 13.543  56.479  61.359  1.00 46.91 ? 178  ILE D CB  1 
ATOM   6085  N  N   . PHE D  4  179 ? 11.044  55.993  59.075  1.00 46.91 ? 179  PHE D N   1 
ATOM   6086  C  CA  . PHE D  4  179 ? 9.774   55.322  58.821  1.00 46.91 ? 179  PHE D CA  1 
ATOM   6087  C  C   . PHE D  4  179 ? 9.933   54.384  57.630  1.00 46.91 ? 179  PHE D C   1 
ATOM   6088  O  O   . PHE D  4  179 ? 9.432   53.258  57.644  1.00 46.91 ? 179  PHE D O   1 
ATOM   6089  C  CB  . PHE D  4  179 ? 8.680   56.350  58.531  1.00 46.91 ? 179  PHE D CB  1 
ATOM   6090  N  N   . ARG D  4  180 ? 10.615  54.867  56.594  1.00 46.91 ? 180  ARG D N   1 
ATOM   6091  C  CA  . ARG D  4  180 ? 10.861  54.079  55.391  1.00 46.91 ? 180  ARG D CA  1 
ATOM   6092  C  C   . ARG D  4  180 ? 12.051  53.145  55.605  1.00 46.91 ? 180  ARG D C   1 
ATOM   6093  O  O   . ARG D  4  180 ? 12.336  52.285  54.769  1.00 46.91 ? 180  ARG D O   1 
ATOM   6094  C  CB  . ARG D  4  180 ? 11.133  55.000  54.200  1.00 46.91 ? 180  ARG D CB  1 
ATOM   6095  N  N   . PHE D  4  181 ? 12.769  53.355  56.705  1.00 46.91 ? 181  PHE D N   1 
ATOM   6096  C  CA  . PHE D  4  181 ? 13.925  52.537  57.042  1.00 46.91 ? 181  PHE D CA  1 
ATOM   6097  C  C   . PHE D  4  181 ? 13.535  51.360  57.932  1.00 46.91 ? 181  PHE D C   1 
ATOM   6098  O  O   . PHE D  4  181 ? 14.276  50.379  58.034  1.00 46.91 ? 181  PHE D O   1 
ATOM   6099  C  CB  . PHE D  4  181 ? 14.993  53.386  57.735  1.00 46.91 ? 181  PHE D CB  1 
ATOM   6100  N  N   . LEU D  4  182 ? 12.397  51.484  58.608  1.00 46.91 ? 182  LEU D N   1 
ATOM   6101  C  CA  . LEU D  4  182 ? 11.902  50.432  59.490  1.00 46.91 ? 182  LEU D CA  1 
ATOM   6102  C  C   . LEU D  4  182 ? 10.943  49.504  58.751  1.00 46.91 ? 182  LEU D C   1 
ATOM   6103  O  O   . LEU D  4  182 ? 10.747  48.354  59.150  1.00 46.91 ? 182  LEU D O   1 
ATOM   6104  C  CB  . LEU D  4  182 ? 11.203  51.040  60.707  1.00 46.91 ? 182  LEU D CB  1 
ATOM   6105  N  N   . LEU D  4  183 ? 10.310  50.032  57.706  1.00 46.91 ? 183  LEU D N   1 
ATOM   6106  C  CA  . LEU D  4  183 ? 9.372   49.266  56.894  1.00 46.91 ? 183  LEU D CA  1 
ATOM   6107  C  C   . LEU D  4  183 ? 10.120  48.456  55.836  1.00 46.91 ? 183  LEU D C   1 
ATOM   6108  O  O   . LEU D  4  183 ? 9.596   47.476  55.303  1.00 46.91 ? 183  LEU D O   1 
ATOM   6109  C  CB  . LEU D  4  183 ? 8.359   50.199  56.227  1.00 46.91 ? 183  LEU D CB  1 
ATOM   6110  N  N   . PHE D  4  184 ? 11.329  48.901  55.506  1.00 46.91 ? 184  PHE D N   1 
ATOM   6111  C  CA  . PHE D  4  184 ? 12.165  48.212  54.530  1.00 46.91 ? 184  PHE D CA  1 
ATOM   6112  C  C   . PHE D  4  184 ? 13.077  47.222  55.252  1.00 46.91 ? 184  PHE D C   1 
ATOM   6113  O  O   . PHE D  4  184 ? 13.833  46.477  54.622  1.00 46.91 ? 184  PHE D O   1 
ATOM   6114  C  CB  . PHE D  4  184 ? 13.005  49.217  53.738  1.00 46.91 ? 184  PHE D CB  1 
ATOM   6115  N  N   . PHE D  4  185 ? 13.028  47.255  56.581  1.00 46.91 ? 185  PHE D N   1 
ATOM   6116  C  CA  . PHE D  4  185 ? 13.827  46.369  57.419  1.00 46.91 ? 185  PHE D CA  1 
ATOM   6117  C  C   . PHE D  4  185 ? 12.970  45.207  57.916  1.00 46.91 ? 185  PHE D C   1 
ATOM   6118  O  O   . PHE D  4  185 ? 13.427  44.064  57.962  1.00 46.91 ? 185  PHE D O   1 
ATOM   6119  C  CB  . PHE D  4  185 ? 14.402  47.138  58.610  1.00 46.91 ? 185  PHE D CB  1 
ATOM   6120  N  N   . GLN D  4  186 ? 11.742  45.518  58.320  1.00 46.91 ? 186  GLN D N   1 
ATOM   6121  C  CA  . GLN D  4  186 ? 10.802  44.515  58.808  1.00 46.91 ? 186  GLN D CA  1 
ATOM   6122  C  C   . GLN D  4  186 ? 10.086  43.847  57.639  1.00 46.91 ? 186  GLN D C   1 
ATOM   6123  O  O   . GLN D  4  186 ? 9.689   42.683  57.726  1.00 46.91 ? 186  GLN D O   1 
ATOM   6124  C  CB  . GLN D  4  186 ? 9.780   45.156  59.751  1.00 46.91 ? 186  GLN D CB  1 
ATOM   6125  N  N   . GLY D  4  187 ? 9.897   44.602  56.559  1.00 46.91 ? 187  GLY D N   1 
ATOM   6126  C  CA  . GLY D  4  187 ? 9.240   44.070  55.380  1.00 46.91 ? 187  GLY D CA  1 
ATOM   6127  C  C   . GLY D  4  187 ? 10.156  43.115  54.636  1.00 46.91 ? 187  GLY D C   1 
ATOM   6128  O  O   . GLY D  4  187 ? 9.694   42.171  53.990  1.00 46.91 ? 187  GLY D O   1 
ATOM   6129  N  N   . PHE D  4  188 ? 11.456  43.388  54.700  1.00 46.91 ? 188  PHE D N   1 
ATOM   6130  C  CA  . PHE D  4  188 ? 12.457  42.553  54.048  1.00 46.91 ? 188  PHE D CA  1 
ATOM   6131  C  C   . PHE D  4  188 ? 12.834  41.370  54.938  1.00 46.91 ? 188  PHE D C   1 
ATOM   6132  O  O   . PHE D  4  188 ? 13.559  40.472  54.512  1.00 46.91 ? 188  PHE D O   1 
ATOM   6133  C  CB  . PHE D  4  188 ? 13.705  43.377  53.722  1.00 46.91 ? 188  PHE D CB  1 
ATOM   6134  N  N   . HIS D  4  189 ? 12.377  41.404  56.186  1.00 46.91 ? 189  HIS D N   1 
ATOM   6135  C  CA  . HIS D  4  189 ? 12.651  40.339  57.144  1.00 46.91 ? 189  HIS D CA  1 
ATOM   6136  C  C   . HIS D  4  189 ? 11.730  39.149  56.897  1.00 46.91 ? 189  HIS D C   1 
ATOM   6137  O  O   . HIS D  4  189 ? 12.126  37.995  57.070  1.00 46.91 ? 189  HIS D O   1 
ATOM   6138  C  CB  . HIS D  4  189 ? 12.463  40.847  58.574  1.00 46.91 ? 189  HIS D CB  1 
ATOM   6139  N  N   . ASN D  4  190 ? 10.494  39.441  56.500  1.00 46.91 ? 190  ASN D N   1 
ATOM   6140  C  CA  . ASN D  4  190 ? 9.502   38.408  56.227  1.00 46.91 ? 190  ASN D CA  1 
ATOM   6141  C  C   . ASN D  4  190 ? 9.760   37.681  54.908  1.00 46.91 ? 190  ASN D C   1 
ATOM   6142  O  O   . ASN D  4  190 ? 9.150   36.643  54.638  1.00 46.91 ? 190  ASN D O   1 
ATOM   6143  C  CB  . ASN D  4  190 ? 8.098   39.018  56.219  1.00 46.91 ? 190  ASN D CB  1 
ATOM   6144  N  N   . TRP D  4  191 ? 10.654  38.229  54.089  1.00 46.91 ? 191  TRP D N   1 
ATOM   6145  C  CA  . TRP D  4  191 ? 10.988  37.632  52.799  1.00 46.91 ? 191  TRP D CA  1 
ATOM   6146  C  C   . TRP D  4  191 ? 12.500  37.599  52.570  1.00 46.91 ? 191  TRP D C   1 
ATOM   6147  O  O   . TRP D  4  191 ? 13.189  36.713  53.080  1.00 46.91 ? 191  TRP D O   1 
ATOM   6148  C  CB  . TRP D  4  191 ? 10.290  38.392  51.664  1.00 46.91 ? 191  TRP D CB  1 
ATOM   6149  N  N   . THR D  4  192 ? 13.008  38.567  51.807  1.00 46.91 ? 192  THR D N   1 
ATOM   6150  C  CA  . THR D  4  192 ? 14.435  38.671  51.496  1.00 46.91 ? 192  THR D CA  1 
ATOM   6151  C  C   . THR D  4  192 ? 14.943  37.540  50.600  1.00 46.91 ? 192  THR D C   1 
ATOM   6152  O  O   . THR D  4  192 ? 14.190  36.637  50.233  1.00 46.91 ? 192  THR D O   1 
ATOM   6153  C  CB  . THR D  4  192 ? 15.295  38.713  52.781  1.00 46.91 ? 192  THR D CB  1 
ATOM   6154  N  N   . LEU D  4  193 ? 16.218  37.622  50.225  1.00 46.91 ? 193  LEU D N   1 
ATOM   6155  C  CA  . LEU D  4  193 ? 16.860  36.621  49.371  1.00 46.91 ? 193  LEU D CA  1 
ATOM   6156  C  C   . LEU D  4  193 ? 16.154  36.401  48.028  1.00 46.91 ? 193  LEU D C   1 
ATOM   6157  O  O   . LEU D  4  193 ? 16.187  35.302  47.471  1.00 46.91 ? 193  LEU D O   1 
ATOM   6158  C  CB  . LEU D  4  193 ? 16.996  35.291  50.123  1.00 46.91 ? 193  LEU D CB  1 
ATOM   6159  N  N   . ASN D  4  194 ? 15.542  37.458  47.504  1.00 46.91 ? 194  ASN D N   1 
ATOM   6160  C  CA  . ASN D  4  194 ? 14.829  37.388  46.229  1.00 46.91 ? 194  ASN D CA  1 
ATOM   6161  C  C   . ASN D  4  194 ? 15.777  37.413  45.031  1.00 46.91 ? 194  ASN D C   1 
ATOM   6162  O  O   . ASN D  4  194 ? 16.887  37.946  45.111  1.00 46.91 ? 194  ASN D O   1 
ATOM   6163  C  CB  . ASN D  4  194 ? 13.822  38.537  46.114  1.00 46.91 ? 194  ASN D CB  1 
ATOM   6164  N  N   . PRO D  4  195 ? 15.351  36.816  43.905  1.00 46.91 ? 195  PRO D N   1 
ATOM   6165  C  CA  . PRO D  4  195 ? 16.130  36.750  42.663  1.00 46.91 ? 195  PRO D CA  1 
ATOM   6166  C  C   . PRO D  4  195 ? 15.985  38.037  41.854  1.00 46.91 ? 195  PRO D C   1 
ATOM   6167  O  O   . PRO D  4  195 ? 16.932  38.487  41.210  1.00 46.91 ? 195  PRO D O   1 
ATOM   6168  C  CB  . PRO D  4  195 ? 15.524  35.554  41.927  1.00 46.91 ? 195  PRO D CB  1 
ATOM   6169  N  N   . PHE D  4  196 ? 14.777  38.596  41.862  1.00 46.91 ? 196  PHE D N   1 
ATOM   6170  C  CA  . PHE D  4  196 ? 14.489  39.832  41.142  1.00 46.91 ? 196  PHE D CA  1 
ATOM   6171  C  C   . PHE D  4  196 ? 15.051  41.035  41.896  1.00 46.91 ? 196  PHE D C   1 
ATOM   6172  O  O   . PHE D  4  196 ? 15.578  41.965  41.289  1.00 46.91 ? 196  PHE D O   1 
ATOM   6173  C  CB  . PHE D  4  196 ? 12.978  39.997  40.954  1.00 46.91 ? 196  PHE D CB  1 
ATOM   6174  N  N   . HIS D  4  197 ? 14.935  41.004  43.222  1.00 46.91 ? 197  HIS D N   1 
ATOM   6175  C  CA  . HIS D  4  197 ? 15.431  42.085  44.067  1.00 46.91 ? 197  HIS D CA  1 
ATOM   6176  C  C   . HIS D  4  197 ? 16.958  42.142  44.086  1.00 46.91 ? 197  HIS D C   1 
ATOM   6177  O  O   . HIS D  4  197 ? 17.544  43.083  44.626  1.00 46.91 ? 197  HIS D O   1 
ATOM   6178  C  CB  . HIS D  4  197 ? 14.899  41.935  45.494  1.00 46.91 ? 197  HIS D CB  1 
ATOM   6179  N  N   . MET D  4  198 ? 17.595  41.105  43.547  1.00 46.91 ? 198  MET D N   1 
ATOM   6180  C  CA  . MET D  4  198 ? 19.051  41.044  43.485  1.00 46.91 ? 198  MET D CA  1 
ATOM   6181  C  C   . MET D  4  198 ? 19.565  41.922  42.345  1.00 46.91 ? 198  MET D C   1 
ATOM   6182  O  O   . MET D  4  198 ? 20.729  42.329  42.337  1.00 46.91 ? 198  MET D O   1 
ATOM   6183  C  CB  . MET D  4  198 ? 19.515  39.599  43.281  1.00 46.91 ? 198  MET D CB  1 
ATOM   6184  N  N   . MET D  4  199 ? 18.699  42.167  41.366  1.00 46.91 ? 199  MET D N   1 
ATOM   6185  C  CA  . MET D  4  199 ? 19.033  42.994  40.213  1.00 46.91 ? 199  MET D CA  1 
ATOM   6186  C  C   . MET D  4  199 ? 18.871  44.476  40.545  1.00 46.91 ? 199  MET D C   1 
ATOM   6187  O  O   . MET D  4  199 ? 19.581  45.321  39.998  1.00 46.91 ? 199  MET D O   1 
ATOM   6188  C  CB  . MET D  4  199 ? 18.143  42.628  39.023  1.00 46.91 ? 199  MET D CB  1 
ATOM   6189  N  N   . GLY D  4  200 ? 17.919  44.781  41.424  1.00 46.91 ? 200  GLY D N   1 
ATOM   6190  C  CA  . GLY D  4  200 ? 17.678  46.156  41.826  1.00 46.91 ? 200  GLY D CA  1 
ATOM   6191  C  C   . GLY D  4  200 ? 18.789  46.685  42.714  1.00 46.91 ? 200  GLY D C   1 
ATOM   6192  O  O   . GLY D  4  200 ? 18.944  47.899  42.879  1.00 46.91 ? 200  GLY D O   1 
ATOM   6193  N  N   . VAL D  4  201 ? 19.525  45.768  43.336  1.00 46.91 ? 201  VAL D N   1 
ATOM   6194  C  CA  . VAL D  4  201 ? 20.635  46.123  44.210  1.00 46.91 ? 201  VAL D CA  1 
ATOM   6195  C  C   . VAL D  4  201 ? 21.937  46.149  43.411  1.00 46.91 ? 201  VAL D C   1 
ATOM   6196  O  O   . VAL D  4  201 ? 22.927  46.750  43.841  1.00 46.91 ? 201  VAL D O   1 
ATOM   6197  C  CB  . VAL D  4  201 ? 20.779  45.117  45.368  1.00 46.91 ? 201  VAL D CB  1 
ATOM   6198  N  N   . ALA D  4  202 ? 21.940  45.456  42.277  1.00 46.91 ? 202  ALA D N   1 
ATOM   6199  C  CA  . ALA D  4  202 ? 23.105  45.393  41.402  1.00 46.91 ? 202  ALA D CA  1 
ATOM   6200  C  C   . ALA D  4  202 ? 23.143  46.590  40.455  1.00 46.91 ? 202  ALA D C   1 
ATOM   6201  O  O   . ALA D  4  202 ? 24.197  46.922  39.906  1.00 46.91 ? 202  ALA D O   1 
ATOM   6202  C  CB  . ALA D  4  202 ? 23.097  44.093  40.610  1.00 46.91 ? 202  ALA D CB  1 
ATOM   6203  N  N   . GLY D  4  203 ? 21.981  47.197  40.234  1.00 46.91 ? 203  GLY D N   1 
ATOM   6204  C  CA  . GLY D  4  203 ? 21.890  48.351  39.357  1.00 46.91 ? 203  GLY D CA  1 
ATOM   6205  C  C   . GLY D  4  203 ? 22.299  49.627  40.068  1.00 46.91 ? 203  GLY D C   1 
ATOM   6206  O  O   . GLY D  4  203 ? 22.830  50.551  39.447  1.00 46.91 ? 203  GLY D O   1 
ATOM   6207  N  N   . VAL D  4  204 ? 22.023  49.688  41.367  1.00 46.91 ? 204  VAL D N   1 
ATOM   6208  C  CA  . VAL D  4  204 ? 22.371  50.847  42.181  1.00 46.91 ? 204  VAL D CA  1 
ATOM   6209  C  C   . VAL D  4  204 ? 23.873  50.876  42.457  1.00 46.91 ? 204  VAL D C   1 
ATOM   6210  O  O   . VAL D  4  204 ? 24.413  51.886  42.915  1.00 46.91 ? 204  VAL D O   1 
ATOM   6211  C  CB  . VAL D  4  204 ? 21.615  50.837  43.523  1.00 46.91 ? 204  VAL D CB  1 
ATOM   6212  N  N   . LEU D  4  205 ? 24.528  49.741  42.225  1.00 46.91 ? 205  LEU D N   1 
ATOM   6213  C  CA  . LEU D  4  205 ? 25.966  49.613  42.427  1.00 46.91 ? 205  LEU D CA  1 
ATOM   6214  C  C   . LEU D  4  205 ? 26.680  49.520  41.080  1.00 46.91 ? 205  LEU D C   1 
ATOM   6215  O  O   . LEU D  4  205 ? 27.912  49.495  41.019  1.00 46.91 ? 205  LEU D O   1 
ATOM   6216  C  CB  . LEU D  4  205 ? 26.276  48.372  43.268  1.00 46.91 ? 205  LEU D CB  1 
ATOM   6217  N  N   . GLY D  4  206 ? 25.896  49.433  40.010  1.00 46.91 ? 206  GLY D N   1 
ATOM   6218  C  CA  . GLY D  4  206 ? 26.450  49.348  38.672  1.00 46.91 ? 206  GLY D CA  1 
ATOM   6219  C  C   . GLY D  4  206 ? 26.422  50.686  37.962  1.00 46.91 ? 206  GLY D C   1 
ATOM   6220  O  O   . GLY D  4  206 ? 27.320  51.000  37.179  1.00 46.91 ? 206  GLY D O   1 
ATOM   6221  N  N   . GLY D  4  207 ? 25.366  51.456  38.206  1.00 46.91 ? 207  GLY D N   1 
ATOM   6222  C  CA  . GLY D  4  207 ? 25.232  52.766  37.594  1.00 46.91 ? 207  GLY D CA  1 
ATOM   6223  C  C   . GLY D  4  207 ? 26.014  53.823  38.352  1.00 46.91 ? 207  GLY D C   1 
ATOM   6224  O  O   . GLY D  4  207 ? 26.401  54.848  37.786  1.00 46.91 ? 207  GLY D O   1 
ATOM   6225  N  N   . ALA D  4  208 ? 26.209  53.592  39.647  1.00 46.91 ? 208  ALA D N   1 
ATOM   6226  C  CA  . ALA D  4  208 ? 26.952  54.513  40.498  1.00 46.91 ? 208  ALA D CA  1 
ATOM   6227  C  C   . ALA D  4  208 ? 28.450  54.345  40.272  1.00 46.91 ? 208  ALA D C   1 
ATOM   6228  O  O   . ALA D  4  208 ? 29.220  55.300  40.410  1.00 46.91 ? 208  ALA D O   1 
ATOM   6229  C  CB  . ALA D  4  208 ? 26.607  54.274  41.960  1.00 46.91 ? 208  ALA D CB  1 
ATOM   6230  N  N   . LEU D  4  209 ? 28.859  53.115  39.972  1.00 46.91 ? 209  LEU D N   1 
ATOM   6231  C  CA  . LEU D  4  209 ? 30.259  52.798  39.719  1.00 46.91 ? 209  LEU D CA  1 
ATOM   6232  C  C   . LEU D  4  209 ? 30.654  53.212  38.304  1.00 46.91 ? 209  LEU D C   1 
ATOM   6233  O  O   . LEU D  4  209 ? 31.827  53.472  38.031  1.00 46.91 ? 209  LEU D O   1 
ATOM   6234  C  CB  . LEU D  4  209 ? 30.509  51.302  39.912  1.00 46.91 ? 209  LEU D CB  1 
ATOM   6235  N  N   . LEU D  4  210 ? 29.676  53.228  37.403  1.00 46.91 ? 210  LEU D N   1 
ATOM   6236  C  CA  . LEU D  4  210 ? 29.908  53.617  36.016  1.00 46.91 ? 210  LEU D CA  1 
ATOM   6237  C  C   . LEU D  4  210 ? 30.089  55.128  35.920  1.00 46.91 ? 210  LEU D C   1 
ATOM   6238  O  O   . LEU D  4  210 ? 30.688  55.633  34.968  1.00 46.91 ? 210  LEU D O   1 
ATOM   6239  C  CB  . LEU D  4  210 ? 28.737  53.174  35.135  1.00 46.91 ? 210  LEU D CB  1 
ATOM   6240  N  N   . CYS D  4  211 ? 29.533  55.843  36.893  1.00 46.91 ? 211  CYS D N   1 
ATOM   6241  C  CA  . CYS D  4  211 ? 29.626  57.296  36.943  1.00 46.91 ? 211  CYS D CA  1 
ATOM   6242  C  C   . CYS D  4  211 ? 30.853  57.733  37.740  1.00 46.91 ? 211  CYS D C   1 
ATOM   6243  O  O   . CYS D  4  211 ? 31.314  58.870  37.614  1.00 46.91 ? 211  CYS D O   1 
ATOM   6244  C  CB  . CYS D  4  211 ? 28.363  57.881  37.577  1.00 46.91 ? 211  CYS D CB  1 
ATOM   6245  N  N   . ALA D  4  212 ? 31.347  56.838  38.591  1.00 46.91 ? 212  ALA D N   1 
ATOM   6246  C  CA  . ALA D  4  212 ? 32.517  57.110  39.415  1.00 46.91 ? 212  ALA D CA  1 
ATOM   6247  C  C   . ALA D  4  212 ? 33.805  56.783  38.664  1.00 46.91 ? 212  ALA D C   1 
ATOM   6248  O  O   . ALA D  4  212 ? 34.830  57.439  38.858  1.00 46.91 ? 212  ALA D O   1 
ATOM   6249  C  CB  . ALA D  4  212 ? 32.445  56.313  40.712  1.00 46.91 ? 212  ALA D CB  1 
ATOM   6250  N  N   . ILE D  4  213 ? 33.757  55.737  37.842  1.00 46.91 ? 213  ILE D N   1 
ATOM   6251  C  CA  . ILE D  4  213 ? 34.912  55.320  37.057  1.00 46.91 ? 213  ILE D CA  1 
ATOM   6252  C  C   . ILE D  4  213 ? 35.031  56.162  35.789  1.00 46.91 ? 213  ILE D C   1 
ATOM   6253  O  O   . ILE D  4  213 ? 36.085  56.191  35.150  1.00 46.91 ? 213  ILE D O   1 
ATOM   6254  C  CB  . ILE D  4  213 ? 34.815  53.833  36.657  1.00 46.91 ? 213  ILE D CB  1 
ATOM   6255  N  N   . HIS D  4  214 ? 33.934  56.810  35.411  1.00 46.91 ? 214  HIS D N   1 
ATOM   6256  C  CA  . HIS D  4  214 ? 33.904  57.657  34.228  1.00 46.91 ? 214  HIS D CA  1 
ATOM   6257  C  C   . HIS D  4  214 ? 34.193  59.109  34.599  1.00 46.91 ? 214  HIS D C   1 
ATOM   6258  O  O   . HIS D  4  214 ? 34.747  59.863  33.798  1.00 46.91 ? 214  HIS D O   1 
ATOM   6259  C  CB  . HIS D  4  214 ? 32.544  57.557  33.535  1.00 46.91 ? 214  HIS D CB  1 
ATOM   6260  C  CG  . HIS D  4  214 ? 32.444  58.369  32.280  1.00 46.91 ? 214  HIS D CG  1 
ATOM   6261  N  ND1 . HIS D  4  214 ? 31.784  59.577  32.226  1.00 46.91 ? 214  HIS D ND1 1 
ATOM   6262  C  CD2 . HIS D  4  214 ? 32.929  58.148  31.035  1.00 46.91 ? 214  HIS D CD2 1 
ATOM   6263  C  CE1 . HIS D  4  214 ? 31.867  60.067  31.001  1.00 46.91 ? 214  HIS D CE1 1 
ATOM   6264  N  NE2 . HIS D  4  214 ? 32.556  59.219  30.259  1.00 46.91 ? 214  HIS D NE2 1 
ATOM   6265  N  N   . GLY D  4  215 ? 33.768  59.501  35.796  1.00 46.91 ? 215  GLY D N   1 
ATOM   6266  C  CA  . GLY D  4  215 ? 33.990  60.856  36.262  1.00 46.91 ? 215  GLY D CA  1 
ATOM   6267  C  C   . GLY D  4  215 ? 35.408  61.076  36.754  1.00 46.91 ? 215  GLY D C   1 
ATOM   6268  O  O   . GLY D  4  215 ? 35.875  62.215  36.836  1.00 46.91 ? 215  GLY D O   1 
ATOM   6269  N  N   . ALA D  4  216 ? 36.082  59.988  37.115  1.00 46.91 ? 216  ALA D N   1 
ATOM   6270  C  CA  . ALA D  4  216 ? 37.454  60.053  37.603  1.00 46.91 ? 216  ALA D CA  1 
ATOM   6271  C  C   . ALA D  4  216 ? 38.460  59.692  36.513  1.00 46.91 ? 216  ALA D C   1 
ATOM   6272  O  O   . ALA D  4  216 ? 39.672  59.774  36.725  1.00 46.91 ? 216  ALA D O   1 
ATOM   6273  C  CB  . ALA D  4  216 ? 37.626  59.137  38.808  1.00 46.91 ? 216  ALA D CB  1 
ATOM   6274  N  N   . THR D  4  217 ? 37.957  59.260  35.361  1.00 46.91 ? 217  THR D N   1 
ATOM   6275  C  CA  . THR D  4  217 ? 38.812  58.890  34.238  1.00 46.91 ? 217  THR D CA  1 
ATOM   6276  C  C   . THR D  4  217 ? 38.791  59.955  33.148  1.00 46.91 ? 217  THR D C   1 
ATOM   6277  O  O   . THR D  4  217 ? 39.698  60.021  32.316  1.00 46.91 ? 217  THR D O   1 
ATOM   6278  C  CB  . THR D  4  217 ? 38.388  57.545  33.625  1.00 46.91 ? 217  THR D CB  1 
ATOM   6279  N  N   . VAL D  4  218 ? 37.730  60.757  33.130  1.00 46.91 ? 218  VAL D N   1 
ATOM   6280  C  CA  . VAL D  4  218 ? 37.581  61.823  32.145  1.00 46.91 ? 218  VAL D CA  1 
ATOM   6281  C  C   . VAL D  4  218 ? 38.184  63.132  32.651  1.00 46.91 ? 218  VAL D C   1 
ATOM   6282  O  O   . VAL D  4  218 ? 38.593  63.983  31.860  1.00 46.91 ? 218  VAL D O   1 
ATOM   6283  C  CB  . VAL D  4  218 ? 36.100  62.063  31.796  1.00 46.91 ? 218  VAL D CB  1 
ATOM   6284  N  N   . GLU D  4  219 ? 38.200  63.299  33.970  1.00 46.91 ? 219  GLU D N   1 
ATOM   6285  C  CA  . GLU D  4  219 ? 38.749  64.498  34.594  1.00 46.91 ? 219  GLU D CA  1 
ATOM   6286  C  C   . GLU D  4  219 ? 40.274  64.445  34.662  1.00 46.91 ? 219  GLU D C   1 
ATOM   6287  O  O   . GLU D  4  219 ? 40.939  65.485  34.683  1.00 46.91 ? 219  GLU D O   1 
ATOM   6288  C  CB  . GLU D  4  219 ? 38.177  64.667  36.004  1.00 46.91 ? 219  GLU D CB  1 
ATOM   6289  N  N   . ASN D  4  220 ? 40.815  63.234  34.735  1.00 46.91 ? 220  ASN D N   1 
ATOM   6290  C  CA  . ASN D  4  220 ? 42.257  63.031  34.811  1.00 46.91 ? 220  ASN D CA  1 
ATOM   6291  C  C   . ASN D  4  220 ? 42.875  62.678  33.458  1.00 46.91 ? 220  ASN D C   1 
ATOM   6292  O  O   . ASN D  4  220 ? 44.096  62.553  33.345  1.00 46.91 ? 220  ASN D O   1 
ATOM   6293  C  CB  . ASN D  4  220 ? 42.580  61.934  35.828  1.00 46.91 ? 220  ASN D CB  1 
ATOM   6294  N  N   . THR D  4  221 ? 42.028  62.513  32.444  1.00 46.91 ? 221  THR D N   1 
ATOM   6295  C  CA  . THR D  4  221 ? 42.478  62.169  31.098  1.00 46.91 ? 221  THR D CA  1 
ATOM   6296  C  C   . THR D  4  221 ? 43.319  63.283  30.478  1.00 46.91 ? 221  THR D C   1 
ATOM   6297  O  O   . THR D  4  221 ? 44.458  62.973  30.063  1.00 46.91 ? 221  THR D O   1 
ATOM   6298  C  CB  . THR D  4  221 ? 41.286  61.882  30.165  1.00 46.91 ? 221  THR D CB  1 
ATOM   6299  N  N   . TYR D  4  244 ? 43.789  75.749  29.201  1.00 46.91 ? 244  TYR D N   1 
ATOM   6300  C  CA  . TYR D  4  244 ? 43.774  74.302  28.837  1.00 46.91 ? 244  TYR D CA  1 
ATOM   6301  C  C   . TYR D  4  244 ? 45.129  73.647  29.090  1.00 46.91 ? 244  TYR D C   1 
ATOM   6302  O  O   . TYR D  4  244 ? 46.048  74.274  29.622  1.00 46.91 ? 244  TYR D O   1 
ATOM   6303  C  CB  . TYR D  4  244 ? 43.382  74.133  27.366  1.00 46.91 ? 244  TYR D CB  1 
ATOM   6304  N  N   . SER D  4  245 ? 45.244  72.379  28.709  1.00 46.91 ? 245  SER D N   1 
ATOM   6305  C  CA  . SER D  4  245 ? 46.478  71.626  28.889  1.00 46.91 ? 245  SER D CA  1 
ATOM   6306  C  C   . SER D  4  245 ? 46.540  70.483  27.881  1.00 46.91 ? 245  SER D C   1 
ATOM   6307  O  O   . SER D  4  245 ? 45.905  70.542  26.826  1.00 46.91 ? 245  SER D O   1 
ATOM   6308  C  CB  . SER D  4  245 ? 46.557  71.075  30.316  1.00 46.91 ? 245  SER D CB  1 
ATOM   6309  N  N   . MET D  4  246 ? 47.337  69.464  28.192  1.00 46.91 ? 246  MET D N   1 
ATOM   6310  C  CA  . MET D  4  246 ? 47.477  68.303  27.319  1.00 46.91 ? 246  MET D CA  1 
ATOM   6311  C  C   . MET D  4  246 ? 46.236  67.415  27.396  1.00 46.91 ? 246  MET D C   1 
ATOM   6312  O  O   . MET D  4  246 ? 45.994  66.599  26.508  1.00 46.91 ? 246  MET D O   1 
ATOM   6313  C  CB  . MET D  4  246 ? 48.718  67.495  27.706  1.00 46.91 ? 246  MET D CB  1 
ATOM   6314  N  N   . VAL D  4  247 ? 45.466  67.579  28.467  1.00 46.91 ? 247  VAL D N   1 
ATOM   6315  C  CA  . VAL D  4  247 ? 44.251  66.800  28.681  1.00 46.91 ? 247  VAL D CA  1 
ATOM   6316  C  C   . VAL D  4  247 ? 43.072  67.316  27.860  1.00 46.91 ? 247  VAL D C   1 
ATOM   6317  O  O   . VAL D  4  247 ? 42.666  66.686  26.884  1.00 46.91 ? 247  VAL D O   1 
ATOM   6318  C  CB  . VAL D  4  247 ? 43.854  66.786  30.172  1.00 46.91 ? 247  VAL D CB  1 
ATOM   6319  N  N   . THR D  4  248 ? 42.545  68.477  28.247  1.00 46.91 ? 248  THR D N   1 
ATOM   6320  C  CA  . THR D  4  248 ? 41.404  69.087  27.567  1.00 46.91 ? 248  THR D CA  1 
ATOM   6321  C  C   . THR D  4  248 ? 40.148  68.226  27.735  1.00 46.91 ? 248  THR D C   1 
ATOM   6322  O  O   . THR D  4  248 ? 39.604  68.135  28.836  1.00 46.91 ? 248  THR D O   1 
ATOM   6323  C  CB  . THR D  4  248 ? 41.688  69.317  26.064  1.00 46.91 ? 248  THR D CB  1 
ATOM   6324  N  N   . ALA D  4  249 ? 39.684  67.626  26.640  1.00 57.92 ? 249  ALA D N   1 
ATOM   6325  C  CA  . ALA D  4  249 ? 38.500  66.766  26.642  1.00 57.82 ? 249  ALA D CA  1 
ATOM   6326  C  C   . ALA D  4  249 ? 38.200  66.277  25.227  1.00 58.73 ? 249  ALA D C   1 
ATOM   6327  O  O   . ALA D  4  249 ? 37.405  66.886  24.506  1.00 57.86 ? 249  ALA D O   1 
ATOM   6328  C  CB  . ALA D  4  249 ? 37.288  67.513  27.209  1.00 57.10 ? 249  ALA D CB  1 
ATOM   6329  N  N   . ASN D  4  250 ? 38.845  65.185  24.831  1.00 46.91 ? 250  ASN D N   1 
ATOM   6330  C  CA  . ASN D  4  250 ? 38.655  64.604  23.503  1.00 46.91 ? 250  ASN D CA  1 
ATOM   6331  C  C   . ASN D  4  250 ? 38.852  63.092  23.537  1.00 46.91 ? 250  ASN D C   1 
ATOM   6332  O  O   . ASN D  4  250 ? 39.174  62.476  22.518  1.00 46.91 ? 250  ASN D O   1 
ATOM   6333  C  CB  . ASN D  4  250 ? 39.633  65.240  22.507  1.00 46.91 ? 250  ASN D CB  1 
ATOM   6334  N  N   . ARG D  4  251 ? 38.610  62.504  24.707  1.00 46.91 ? 251  ARG D N   1 
ATOM   6335  C  CA  . ARG D  4  251 ? 38.757  61.067  24.931  1.00 46.91 ? 251  ARG D CA  1 
ATOM   6336  C  C   . ARG D  4  251 ? 40.220  60.617  24.853  1.00 46.91 ? 251  ARG D C   1 
ATOM   6337  O  O   . ARG D  4  251 ? 41.072  61.157  25.559  1.00 46.91 ? 251  ARG D O   1 
ATOM   6338  C  CB  . ARG D  4  251 ? 37.884  60.265  23.955  1.00 46.91 ? 251  ARG D CB  1 
ATOM   6339  N  N   . PHE D  4  252 ? 40.500  59.630  24.004  1.00 46.91 ? 252  PHE D N   1 
ATOM   6340  C  CA  . PHE D  4  252 ? 41.851  59.090  23.826  1.00 46.91 ? 252  PHE D CA  1 
ATOM   6341  C  C   . PHE D  4  252 ? 42.371  58.343  25.054  1.00 46.91 ? 252  PHE D C   1 
ATOM   6342  O  O   . PHE D  4  252 ? 43.530  57.924  25.089  1.00 46.91 ? 252  PHE D O   1 
ATOM   6343  C  CB  . PHE D  4  252 ? 42.835  60.198  23.431  1.00 46.91 ? 252  PHE D CB  1 
ATOM   6344  N  N   . TRP D  4  253 ? 41.505  58.159  26.046  1.00 46.91 ? 253  TRP D N   1 
ATOM   6345  C  CA  . TRP D  4  253 ? 41.876  57.457  27.271  1.00 46.91 ? 253  TRP D CA  1 
ATOM   6346  C  C   . TRP D  4  253 ? 41.436  55.993  27.206  1.00 46.91 ? 253  TRP D C   1 
ATOM   6347  O  O   . TRP D  4  253 ? 41.229  55.351  28.235  1.00 46.91 ? 253  TRP D O   1 
ATOM   6348  C  CB  . TRP D  4  253 ? 41.242  58.144  28.484  1.00 46.91 ? 253  TRP D CB  1 
ATOM   6349  N  N   . SER D  4  254 ? 41.267  55.485  25.989  1.00 46.91 ? 254  SER D N   1 
ATOM   6350  C  CA  . SER D  4  254 ? 40.850  54.102  25.780  1.00 46.91 ? 254  SER D CA  1 
ATOM   6351  C  C   . SER D  4  254 ? 42.026  53.129  25.802  1.00 46.91 ? 254  SER D C   1 
ATOM   6352  O  O   . SER D  4  254 ? 41.850  51.927  25.596  1.00 46.91 ? 254  SER D O   1 
ATOM   6353  C  CB  . SER D  4  254 ? 40.097  53.975  24.457  1.00 46.91 ? 254  SER D CB  1 
ATOM   6354  N  N   . GLN D  4  255 ? 43.230  53.660  25.990  1.00 46.91 ? 255  GLN D N   1 
ATOM   6355  C  CA  . GLN D  4  255 ? 44.434  52.838  26.041  1.00 46.91 ? 255  GLN D CA  1 
ATOM   6356  C  C   . GLN D  4  255 ? 44.992  52.789  27.460  1.00 46.91 ? 255  GLN D C   1 
ATOM   6357  O  O   . GLN D  4  255 ? 45.757  51.885  27.805  1.00 46.91 ? 255  GLN D O   1 
ATOM   6358  C  CB  . GLN D  4  255 ? 45.494  53.384  25.080  1.00 46.91 ? 255  GLN D CB  1 
ATOM   6359  N  N   . ILE D  4  256 ? 44.644  53.795  28.258  1.00 46.91 ? 256  ILE D N   1 
ATOM   6360  C  CA  . ILE D  4  256 ? 45.096  53.876  29.641  1.00 46.91 ? 256  ILE D CA  1 
ATOM   6361  C  C   . ILE D  4  256 ? 44.189  53.057  30.556  1.00 46.91 ? 256  ILE D C   1 
ATOM   6362  O  O   . ILE D  4  256 ? 44.632  52.547  31.588  1.00 46.91 ? 256  ILE D O   1 
ATOM   6363  C  CB  . ILE D  4  256 ? 45.123  55.334  30.138  1.00 46.91 ? 256  ILE D CB  1 
ATOM   6364  N  N   . PHE D  4  257 ? 42.915  52.968  30.187  1.00 46.91 ? 257  PHE D N   1 
ATOM   6365  C  CA  . PHE D  4  257 ? 41.938  52.213  30.961  1.00 46.91 ? 257  PHE D CA  1 
ATOM   6366  C  C   . PHE D  4  257 ? 41.730  50.819  30.371  1.00 46.91 ? 257  PHE D C   1 
ATOM   6367  O  O   . PHE D  4  257 ? 41.369  49.885  31.085  1.00 46.91 ? 257  PHE D O   1 
ATOM   6368  C  CB  . PHE D  4  257 ? 40.606  52.966  31.008  1.00 46.91 ? 257  PHE D CB  1 
ATOM   6369  N  N   . GLY D  4  258 ? 41.957  50.697  29.066  1.00 46.91 ? 258  GLY D N   1 
ATOM   6370  C  CA  . GLY D  4  258 ? 41.797  49.421  28.387  1.00 46.91 ? 258  GLY D CA  1 
ATOM   6371  C  C   . GLY D  4  258 ? 42.782  48.358  28.840  1.00 46.91 ? 258  GLY D C   1 
ATOM   6372  O  O   . GLY D  4  258 ? 42.466  47.165  28.840  1.00 46.91 ? 258  GLY D O   1 
ATOM   6373  N  N   . ILE D  4  259 ? 43.993  48.789  29.182  1.00 46.91 ? 259  ILE D N   1 
ATOM   6374  C  CA  . ILE D  4  259 ? 45.037  47.882  29.647  1.00 46.91 ? 259  ILE D CA  1 
ATOM   6375  C  C   . ILE D  4  259 ? 44.813  47.501  31.110  1.00 46.91 ? 259  ILE D C   1 
ATOM   6376  O  O   . ILE D  4  259 ? 45.590  46.735  31.688  1.00 46.91 ? 259  ILE D O   1 
ATOM   6377  C  CB  . ILE D  4  259 ? 46.432  48.526  29.521  1.00 46.91 ? 259  ILE D CB  1 
ATOM   6378  N  N   . ALA D  4  260 ? 43.760  48.054  31.704  1.00 46.91 ? 260  ALA D N   1 
ATOM   6379  C  CA  . ALA D  4  260 ? 43.430  47.793  33.096  1.00 46.91 ? 260  ALA D CA  1 
ATOM   6380  C  C   . ALA D  4  260 ? 42.172  46.946  33.270  1.00 46.91 ? 260  ALA D C   1 
ATOM   6381  O  O   . ALA D  4  260 ? 42.162  46.002  34.065  1.00 46.91 ? 260  ALA D O   1 
ATOM   6382  C  CB  . ALA D  4  260 ? 43.288  49.108  33.851  1.00 46.91 ? 260  ALA D CB  1 
ATOM   6383  N  N   . PHE D  4  261 ? 41.110  47.292  32.547  1.00 46.91 ? 261  PHE D N   1 
ATOM   6384  C  CA  . PHE D  4  261 ? 39.851  46.562  32.646  1.00 46.91 ? 261  PHE D CA  1 
ATOM   6385  C  C   . PHE D  4  261 ? 38.914  46.830  31.470  1.00 46.91 ? 261  PHE D C   1 
ATOM   6386  O  O   . PHE D  4  261 ? 38.260  47.875  31.407  1.00 46.91 ? 261  PHE D O   1 
ATOM   6387  C  CB  . PHE D  4  261 ? 39.146  46.921  33.958  1.00 46.91 ? 261  PHE D CB  1 
ATOM   6388  C  CG  . PHE D  4  261 ? 37.855  46.182  34.183  1.00 46.91 ? 261  PHE D CG  1 
ATOM   6389  C  CD1 . PHE D  4  261 ? 37.840  44.794  34.287  1.00 46.91 ? 261  PHE D CD1 1 
ATOM   6390  C  CD2 . PHE D  4  261 ? 36.653  46.876  34.301  1.00 46.91 ? 261  PHE D CD2 1 
ATOM   6391  C  CE1 . PHE D  4  261 ? 36.648  44.108  34.505  1.00 46.91 ? 261  PHE D CE1 1 
ATOM   6392  C  CE2 . PHE D  4  261 ? 35.455  46.198  34.520  1.00 46.91 ? 261  PHE D CE2 1 
ATOM   6393  C  CZ  . PHE D  4  261 ? 35.455  44.811  34.621  1.00 46.91 ? 261  PHE D CZ  1 
ATOM   6394  N  N   . SER D  4  262 ? 38.800  45.844  30.584  1.00 46.91 ? 262  SER D N   1 
ATOM   6395  C  CA  . SER D  4  262 ? 37.932  45.942  29.412  1.00 46.91 ? 262  SER D CA  1 
ATOM   6396  C  C   . SER D  4  262 ? 38.254  47.155  28.539  1.00 46.91 ? 262  SER D C   1 
ATOM   6397  O  O   . SER D  4  262 ? 39.413  47.536  28.407  1.00 46.91 ? 262  SER D O   1 
ATOM   6398  C  CB  . SER D  4  262 ? 36.463  45.977  29.848  1.00 46.91 ? 262  SER D CB  1 
ATOM   6399  N  N   . ASN D  4  263 ? 37.227  47.726  27.915  1.00 46.91 ? 263  ASN D N   1 
ATOM   6400  C  CA  . ASN D  4  263 ? 37.395  48.896  27.054  1.00 46.91 ? 263  ASN D CA  1 
ATOM   6401  C  C   . ASN D  4  263 ? 36.048  49.383  26.535  1.00 46.91 ? 263  ASN D C   1 
ATOM   6402  O  O   . ASN D  4  263 ? 35.177  48.579  26.192  1.00 46.91 ? 263  ASN D O   1 
ATOM   6403  C  CB  . ASN D  4  263 ? 38.308  48.566  25.872  1.00 46.91 ? 263  ASN D CB  1 
ATOM   6404  N  N   . LYS D  4  264 ? 35.878  50.700  26.503  1.00 46.91 ? 264  LYS D N   1 
ATOM   6405  C  CA  . LYS D  4  264 ? 34.643  51.304  26.026  1.00 46.91 ? 264  LYS D CA  1 
ATOM   6406  C  C   . LYS D  4  264 ? 34.642  51.403  24.504  1.00 46.91 ? 264  LYS D C   1 
ATOM   6407  O  O   . LYS D  4  264 ? 35.621  51.847  23.899  1.00 46.91 ? 264  LYS D O   1 
ATOM   6408  C  CB  . LYS D  4  264 ? 34.453  52.692  26.642  1.00 46.91 ? 264  LYS D CB  1 
ATOM   6409  N  N   . ARG D  4  265 ? 33.552  50.953  23.890  1.00 46.91 ? 265  ARG D N   1 
ATOM   6410  C  CA  . ARG D  4  265 ? 33.406  50.996  22.439  1.00 46.91 ? 265  ARG D CA  1 
ATOM   6411  C  C   . ARG D  4  265 ? 33.110  52.422  21.981  1.00 46.91 ? 265  ARG D C   1 
ATOM   6412  O  O   . ARG D  4  265 ? 33.058  52.700  20.781  1.00 46.91 ? 265  ARG D O   1 
ATOM   6413  C  CB  . ARG D  4  265 ? 32.277  50.059  21.999  1.00 46.91 ? 265  ARG D CB  1 
ATOM   6414  N  N   . TRP D  4  266 ? 32.948  53.318  22.951  1.00 46.91 ? 266  TRP D N   1 
ATOM   6415  C  CA  . TRP D  4  266 ? 32.635  54.723  22.706  1.00 46.91 ? 266  TRP D CA  1 
ATOM   6416  C  C   . TRP D  4  266 ? 31.212  54.863  22.166  1.00 46.91 ? 266  TRP D C   1 
ATOM   6417  O  O   . TRP D  4  266 ? 30.305  54.171  22.632  1.00 46.91 ? 266  TRP D O   1 
ATOM   6418  C  CB  . TRP D  4  266 ? 33.660  55.355  21.753  1.00 46.91 ? 266  TRP D CB  1 
ATOM   6419  N  N   . LEU D  4  267 ? 31.026  55.750  21.189  1.00 46.91 ? 267  LEU D N   1 
ATOM   6420  C  CA  . LEU D  4  267 ? 29.724  56.003  20.569  1.00 46.91 ? 267  LEU D CA  1 
ATOM   6421  C  C   . LEU D  4  267 ? 28.709  56.585  21.550  1.00 46.91 ? 267  LEU D C   1 
ATOM   6422  O  O   . LEU D  4  267 ? 27.495  56.448  21.365  1.00 46.91 ? 267  LEU D O   1 
ATOM   6423  C  CB  . LEU D  4  267 ? 29.167  54.731  19.915  1.00 46.91 ? 267  LEU D CB  1 
ATOM   6424  N  N   . HIS D  4  268 ? 29.215  57.279  22.567  1.00 46.91 ? 268  HIS D N   1 
ATOM   6425  C  CA  . HIS D  4  268 ? 28.374  57.894  23.590  1.00 46.91 ? 268  HIS D CA  1 
ATOM   6426  C  C   . HIS D  4  268 ? 27.531  56.874  24.350  1.00 46.91 ? 268  HIS D C   1 
ATOM   6427  O  O   . HIS D  4  268 ? 26.492  57.219  24.914  1.00 46.91 ? 268  HIS D O   1 
ATOM   6428  C  CB  . HIS D  4  268 ? 27.467  58.957  22.963  1.00 46.91 ? 268  HIS D CB  1 
ATOM   6429  N  N   . PHE D  4  269 ? 27.984  55.626  24.365  1.00 46.91 ? 269  PHE D N   1 
ATOM   6430  C  CA  . PHE D  4  269 ? 27.265  54.563  25.057  1.00 46.91 ? 269  PHE D CA  1 
ATOM   6431  C  C   . PHE D  4  269 ? 27.456  54.652  26.574  1.00 46.91 ? 269  PHE D C   1 
ATOM   6432  O  O   . PHE D  4  269 ? 26.945  53.815  27.322  1.00 46.91 ? 269  PHE D O   1 
ATOM   6433  C  CB  . PHE D  4  269 ? 27.720  53.191  24.554  1.00 46.91 ? 269  PHE D CB  1 
ATOM   6434  N  N   . PHE D  4  270 ? 28.204  55.657  27.022  1.00 46.91 ? 270  PHE D N   1 
ATOM   6435  C  CA  . PHE D  4  270 ? 28.453  55.864  28.446  1.00 46.91 ? 270  PHE D CA  1 
ATOM   6436  C  C   . PHE D  4  270 ? 27.202  56.375  29.154  1.00 46.91 ? 270  PHE D C   1 
ATOM   6437  O  O   . PHE D  4  270 ? 27.044  56.200  30.362  1.00 46.91 ? 270  PHE D O   1 
ATOM   6438  C  CB  . PHE D  4  270 ? 29.600  56.861  28.639  1.00 46.91 ? 270  PHE D CB  1 
ATOM   6439  N  N   . MET D  4  271 ? 26.349  57.060  28.400  1.00 46.91 ? 271  MET D N   1 
ATOM   6440  C  CA  . MET D  4  271 ? 25.110  57.603  28.944  1.00 46.91 ? 271  MET D CA  1 
ATOM   6441  C  C   . MET D  4  271 ? 23.933  56.661  28.696  1.00 46.91 ? 271  MET D C   1 
ATOM   6442  O  O   . MET D  4  271 ? 22.923  56.722  29.397  1.00 46.91 ? 271  MET D O   1 
ATOM   6443  C  CB  . MET D  4  271 ? 24.819  58.974  28.331  1.00 46.91 ? 271  MET D CB  1 
ATOM   6444  N  N   . LEU D  4  272 ? 24.060  55.809  27.681  1.00 46.91 ? 272  LEU D N   1 
ATOM   6445  C  CA  . LEU D  4  272 ? 23.013  54.855  27.335  1.00 46.91 ? 272  LEU D CA  1 
ATOM   6446  C  C   . LEU D  4  272 ? 23.056  53.610  28.215  1.00 46.91 ? 272  LEU D C   1 
ATOM   6447  O  O   . LEU D  4  272 ? 22.025  52.985  28.471  1.00 46.91 ? 272  LEU D O   1 
ATOM   6448  C  CB  . LEU D  4  272 ? 23.129  54.453  25.863  1.00 46.91 ? 272  LEU D CB  1 
ATOM   6449  N  N   . PHE D  4  273 ? 24.257  53.231  28.641  1.00 46.91 ? 273  PHE D N   1 
ATOM   6450  C  CA  . PHE D  4  273 ? 24.437  52.058  29.489  1.00 46.91 ? 273  PHE D CA  1 
ATOM   6451  C  C   . PHE D  4  273 ? 24.011  52.352  30.924  1.00 46.91 ? 273  PHE D C   1 
ATOM   6452  O  O   . PHE D  4  273 ? 23.508  51.469  31.623  1.00 46.91 ? 273  PHE D O   1 
ATOM   6453  C  CB  . PHE D  4  273 ? 25.899  51.599  29.461  1.00 46.91 ? 273  PHE D CB  1 
ATOM   6454  C  CG  . PHE D  4  273 ? 26.134  50.287  30.148  1.00 46.91 ? 273  PHE D CG  1 
ATOM   6455  C  CD1 . PHE D  4  273 ? 25.551  49.122  29.663  1.00 46.91 ? 273  PHE D CD1 1 
ATOM   6456  C  CD2 . PHE D  4  273 ? 26.930  50.216  31.287  1.00 46.91 ? 273  PHE D CD2 1 
ATOM   6457  C  CE1 . PHE D  4  273 ? 25.754  47.902  30.302  1.00 46.91 ? 273  PHE D CE1 1 
ATOM   6458  C  CE2 . PHE D  4  273 ? 27.139  49.001  31.934  1.00 46.91 ? 273  PHE D CE2 1 
ATOM   6459  C  CZ  . PHE D  4  273 ? 26.550  47.842  31.440  1.00 46.91 ? 273  PHE D CZ  1 
ATOM   6460  N  N   . VAL D  4  274 ? 24.241  53.586  31.365  1.00 46.91 ? 274  VAL D N   1 
ATOM   6461  C  CA  . VAL D  4  274 ? 23.876  54.006  32.713  1.00 46.91 ? 274  VAL D CA  1 
ATOM   6462  C  C   . VAL D  4  274 ? 22.365  54.164  32.844  1.00 46.91 ? 274  VAL D C   1 
ATOM   6463  O  O   . VAL D  4  274 ? 21.809  54.031  33.936  1.00 46.91 ? 274  VAL D O   1 
ATOM   6464  C  CB  . VAL D  4  274 ? 24.553  55.341  33.084  1.00 46.91 ? 274  VAL D CB  1 
ATOM   6465  N  N   . PRO D  4  275 ? 21.688  54.493  31.733  1.00 46.91 ? 275  PRO D N   1 
ATOM   6466  C  CA  . PRO D  4  275 ? 20.235  54.682  31.676  1.00 46.91 ? 275  PRO D CA  1 
ATOM   6467  C  C   . PRO D  4  275 ? 19.507  53.343  31.587  1.00 46.91 ? 275  PRO D C   1 
ATOM   6468  O  O   . PRO D  4  275 ? 18.355  53.222  32.004  1.00 46.91 ? 275  PRO D O   1 
ATOM   6469  C  CB  . PRO D  4  275 ? 20.035  55.509  30.406  1.00 46.91 ? 275  PRO D CB  1 
ATOM   6470  N  N   . VAL D  4  276 ? 20.177  52.350  31.009  1.00 46.91 ? 276  VAL D N   1 
ATOM   6471  C  CA  . VAL D  4  276 ? 19.615  51.012  30.869  1.00 46.91 ? 276  VAL D CA  1 
ATOM   6472  C  C   . VAL D  4  276 ? 20.001  50.146  32.066  1.00 46.91 ? 276  VAL D C   1 
ATOM   6473  O  O   . VAL D  4  276 ? 19.809  48.927  32.053  1.00 46.91 ? 276  VAL D O   1 
ATOM   6474  C  CB  . VAL D  4  276 ? 20.113  50.329  29.579  1.00 46.91 ? 276  VAL D CB  1 
ATOM   6475  N  N   . THR D  4  277 ? 20.566  50.782  33.087  1.00 46.91 ? 277  THR D N   1 
ATOM   6476  C  CA  . THR D  4  277 ? 20.991  50.089  34.297  1.00 46.91 ? 277  THR D CA  1 
ATOM   6477  C  C   . THR D  4  277 ? 20.168  50.527  35.503  1.00 46.91 ? 277  THR D C   1 
ATOM   6478  O  O   . THR D  4  277 ? 19.759  49.698  36.314  1.00 46.91 ? 277  THR D O   1 
ATOM   6479  C  CB  . THR D  4  277 ? 22.478  50.343  34.595  1.00 46.91 ? 277  THR D CB  1 
ATOM   6480  N  N   . GLY D  4  278 ? 19.949  51.832  35.624  1.00 46.91 ? 278  GLY D N   1 
ATOM   6481  C  CA  . GLY D  4  278 ? 19.176  52.361  36.734  1.00 46.91 ? 278  GLY D CA  1 
ATOM   6482  C  C   . GLY D  4  278 ? 17.676  52.289  36.518  1.00 46.91 ? 278  GLY D C   1 
ATOM   6483  O  O   . GLY D  4  278 ? 16.903  52.345  37.478  1.00 46.91 ? 278  GLY D O   1 
ATOM   6484  N  N   . LEU D  4  279 ? 17.263  52.212  35.257  1.00 46.91 ? 279  LEU D N   1 
ATOM   6485  C  CA  . LEU D  4  279 ? 15.847  52.131  34.913  1.00 46.91 ? 279  LEU D CA  1 
ATOM   6486  C  C   . LEU D  4  279 ? 15.381  50.678  34.838  1.00 46.91 ? 279  LEU D C   1 
ATOM   6487  O  O   . LEU D  4  279 ? 14.215  50.378  35.100  1.00 46.91 ? 279  LEU D O   1 
ATOM   6488  C  CB  . LEU D  4  279 ? 15.581  52.834  33.580  1.00 46.91 ? 279  LEU D CB  1 
ATOM   6489  N  N   . TRP D  4  280 ? 16.288  49.793  34.436  1.00 46.91 ? 280  TRP D N   1 
ATOM   6490  C  CA  . TRP D  4  280 ? 15.987  48.369  34.327  1.00 46.91 ? 280  TRP D CA  1 
ATOM   6491  C  C   . TRP D  4  280 ? 16.087  47.679  35.685  1.00 46.91 ? 280  TRP D C   1 
ATOM   6492  O  O   . TRP D  4  280 ? 15.564  46.578  35.868  1.00 46.91 ? 280  TRP D O   1 
ATOM   6493  C  CB  . TRP D  4  280 ? 16.932  47.695  33.332  1.00 46.91 ? 280  TRP D CB  1 
ATOM   6494  N  N   . MET D  4  281 ? 16.802  48.309  36.612  1.00 46.91 ? 281  MET D N   1 
ATOM   6495  C  CA  . MET D  4  281 ? 16.974  47.769  37.958  1.00 46.91 ? 281  MET D CA  1 
ATOM   6496  C  C   . MET D  4  281 ? 15.796  48.167  38.837  1.00 46.91 ? 281  MET D C   1 
ATOM   6497  O  O   . MET D  4  281 ? 15.350  47.393  39.682  1.00 46.91 ? 281  MET D O   1 
ATOM   6498  C  CB  . MET D  4  281 ? 18.279  48.279  38.575  1.00 46.91 ? 281  MET D CB  1 
ATOM   6499  N  N   . SER D  4  282 ? 15.322  49.396  38.660  1.00 46.91 ? 282  SER D N   1 
ATOM   6500  C  CA  . SER D  4  282 ? 14.190  49.899  39.427  1.00 46.91 ? 282  SER D CA  1 
ATOM   6501  C  C   . SER D  4  282 ? 12.903  49.214  38.976  1.00 46.91 ? 282  SER D C   1 
ATOM   6502  O  O   . SER D  4  282 ? 11.948  49.101  39.745  1.00 46.91 ? 282  SER D O   1 
ATOM   6503  C  CB  . SER D  4  282 ? 14.061  51.409  39.250  1.00 46.91 ? 282  SER D CB  1 
ATOM   6504  N  N   . ALA D  4  283 ? 12.875  48.792  37.714  1.00 46.91 ? 283  ALA D N   1 
ATOM   6505  C  CA  . ALA D  4  283 ? 11.718  48.107  37.151  1.00 46.91 ? 283  ALA D CA  1 
ATOM   6506  C  C   . ALA D  4  283 ? 11.722  46.632  37.550  1.00 46.91 ? 283  ALA D C   1 
ATOM   6507  O  O   . ALA D  4  283 ? 10.685  45.965  37.498  1.00 46.91 ? 283  ALA D O   1 
ATOM   6508  C  CB  . ALA D  4  283 ? 11.711  48.247  35.635  1.00 46.91 ? 283  ALA D CB  1 
ATOM   6509  N  N   . ILE D  4  284 ? 12.902  46.121  37.890  1.00 46.91 ? 284  ILE D N   1 
ATOM   6510  C  CA  . ILE D  4  284 ? 13.064  44.731  38.304  1.00 46.91 ? 284  ILE D CA  1 
ATOM   6511  C  C   . ILE D  4  284 ? 12.811  44.588  39.802  1.00 46.91 ? 284  ILE D C   1 
ATOM   6512  O  O   . ILE D  4  284 ? 12.224  43.600  40.249  1.00 46.91 ? 284  ILE D O   1 
ATOM   6513  C  CB  . ILE D  4  284 ? 14.483  44.214  37.993  1.00 46.91 ? 284  ILE D CB  1 
ATOM   6514  N  N   . GLY D  4  285 ? 13.282  45.568  40.569  1.00 46.91 ? 285  GLY D N   1 
ATOM   6515  C  CA  . GLY D  4  285 ? 13.099  45.554  42.008  1.00 46.91 ? 285  GLY D CA  1 
ATOM   6516  C  C   . GLY D  4  285 ? 11.667  45.871  42.391  1.00 46.91 ? 285  GLY D C   1 
ATOM   6517  O  O   . GLY D  4  285 ? 11.202  45.485  43.464  1.00 46.91 ? 285  GLY D O   1 
ATOM   6518  N  N   . VAL D  4  286 ? 10.987  46.626  41.531  1.00 46.91 ? 286  VAL D N   1 
ATOM   6519  C  CA  . VAL D  4  286 ? 9.596   46.995  41.754  1.00 46.91 ? 286  VAL D CA  1 
ATOM   6520  C  C   . VAL D  4  286 ? 8.697   45.820  41.386  1.00 46.91 ? 286  VAL D C   1 
ATOM   6521  O  O   . VAL D  4  286 ? 7.620   45.649  41.958  1.00 46.91 ? 286  VAL D O   1 
ATOM   6522  C  CB  . VAL D  4  286 ? 9.191   48.215  40.905  1.00 46.91 ? 286  VAL D CB  1 
ATOM   6523  N  N   . VAL D  4  287 ? 9.130   45.041  40.397  1.00 46.91 ? 287  VAL D N   1 
ATOM   6524  C  CA  . VAL D  4  287 ? 8.385   43.871  39.946  1.00 46.91 ? 287  VAL D CA  1 
ATOM   6525  C  C   . VAL D  4  287 ? 8.589   42.712  40.919  1.00 46.91 ? 287  VAL D C   1 
ATOM   6526  O  O   . VAL D  4  287 ? 7.794   41.769  40.950  1.00 46.91 ? 287  VAL D O   1 
ATOM   6527  C  CB  . VAL D  4  287 ? 8.831   43.429  38.540  1.00 46.91 ? 287  VAL D CB  1 
ATOM   6528  N  N   . GLY D  4  288 ? 9.687   42.766  41.667  1.00 46.91 ? 288  GLY D N   1 
ATOM   6529  C  CA  . GLY D  4  288 ? 9.986   41.734  42.642  1.00 46.91 ? 288  GLY D CA  1 
ATOM   6530  C  C   . GLY D  4  288 ? 9.260   41.997  43.947  1.00 46.91 ? 288  GLY D C   1 
ATOM   6531  O  O   . GLY D  4  288 ? 8.965   41.068  44.702  1.00 46.91 ? 288  GLY D O   1 
ATOM   6532  N  N   . LEU D  4  289 ? 9.016   43.274  44.229  1.00 46.91 ? 289  LEU D N   1 
ATOM   6533  C  CA  . LEU D  4  289 ? 8.314   43.695  45.436  1.00 46.91 ? 289  LEU D CA  1 
ATOM   6534  C  C   . LEU D  4  289 ? 6.804   43.658  45.211  1.00 46.91 ? 289  LEU D C   1 
ATOM   6535  O  O   . LEU D  4  289 ? 6.027   43.588  46.166  1.00 46.91 ? 289  LEU D O   1 
ATOM   6536  C  CB  . LEU D  4  289 ? 8.743   45.108  45.834  1.00 46.91 ? 289  LEU D CB  1 
ATOM   6537  N  N   . ALA D  4  290 ? 6.403   43.752  43.947  1.00 46.91 ? 290  ALA D N   1 
ATOM   6538  C  CA  . ALA D  4  290 ? 4.995   43.719  43.573  1.00 46.91 ? 290  ALA D CA  1 
ATOM   6539  C  C   . ALA D  4  290 ? 4.506   42.278  43.468  1.00 46.91 ? 290  ALA D C   1 
ATOM   6540  O  O   . ALA D  4  290 ? 3.303   42.024  43.378  1.00 46.91 ? 290  ALA D O   1 
ATOM   6541  C  CB  . ALA D  4  290 ? 4.784   44.446  42.250  1.00 46.91 ? 290  ALA D CB  1 
ATOM   6542  N  N   . LEU D  4  291 ? 5.451   41.343  43.436  1.00 65.48 ? 291  LEU D N   1 
ATOM   6543  C  CA  . LEU D  4  291 ? 5.135   39.925  43.341  1.00 66.29 ? 291  LEU D CA  1 
ATOM   6544  C  C   . LEU D  4  291 ? 5.072   39.283  44.723  1.00 66.53 ? 291  LEU D C   1 
ATOM   6545  O  O   . LEU D  4  291 ? 4.217   38.434  44.978  1.00 66.79 ? 291  LEU D O   1 
ATOM   6546  C  CB  . LEU D  4  291 ? 6.174   39.203  42.481  1.00 66.20 ? 291  LEU D CB  1 
ATOM   6547  N  N   . ASN D  4  292 ? 6.000   39.671  45.596  1.00 46.91 ? 292  ASN D N   1 
ATOM   6548  C  CA  . ASN D  4  292 ? 6.058   39.141  46.953  1.00 46.91 ? 292  ASN D CA  1 
ATOM   6549  C  C   . ASN D  4  292 ? 4.775   39.446  47.718  1.00 46.91 ? 292  ASN D C   1 
ATOM   6550  O  O   . ASN D  4  292 ? 4.300   38.622  48.505  1.00 46.91 ? 292  ASN D O   1 
ATOM   6551  C  CB  . ASN D  4  292 ? 7.265   39.719  47.697  1.00 46.91 ? 292  ASN D CB  1 
ATOM   6552  N  N   . LEU D  4  293 ? 4.235   40.642  47.503  1.00 46.91 ? 293  LEU D N   1 
ATOM   6553  C  CA  . LEU D  4  293 ? 3.003   41.066  48.158  1.00 46.91 ? 293  LEU D CA  1 
ATOM   6554  C  C   . LEU D  4  293 ? 1.797   40.360  47.538  1.00 46.91 ? 293  LEU D C   1 
ATOM   6555  O  O   . LEU D  4  293 ? 0.878   39.940  48.247  1.00 46.91 ? 293  LEU D O   1 
ATOM   6556  C  CB  . LEU D  4  293 ? 2.838   42.582  48.046  1.00 46.91 ? 293  LEU D CB  1 
ATOM   6557  N  N   . ARG D  4  294 ? 1.811   40.236  46.213  1.00 46.91 ? 294  ARG D N   1 
ATOM   6558  C  CA  . ARG D  4  294 ? 0.733   39.579  45.479  1.00 46.91 ? 294  ARG D CA  1 
ATOM   6559  C  C   . ARG D  4  294 ? 0.893   38.056  45.465  1.00 46.91 ? 294  ARG D C   1 
ATOM   6560  O  O   . ARG D  4  294 ? 0.366   37.377  44.578  1.00 46.91 ? 294  ARG D O   1 
ATOM   6561  C  CB  . ARG D  4  294 ? 0.672   40.112  44.044  1.00 46.91 ? 294  ARG D CB  1 
ATOM   6562  N  N   . SER D  4  295 ? 1.613   37.529  46.454  1.00 46.91 ? 295  SER D N   1 
ATOM   6563  C  CA  . SER D  4  295 ? 1.852   36.096  46.596  1.00 46.91 ? 295  SER D CA  1 
ATOM   6564  C  C   . SER D  4  295 ? 2.772   35.488  45.546  1.00 46.91 ? 295  SER D C   1 
ATOM   6565  O  O   . SER D  4  295 ? 2.335   35.112  44.455  1.00 46.91 ? 295  SER D O   1 
ATOM   6566  C  CB  . SER D  4  295 ? 0.529   35.327  46.629  1.00 46.91 ? 295  SER D CB  1 
ATOM   6567  N  N   . TYR D  4  296 ? 4.038   35.335  45.915  1.00 46.91 ? 296  TYR D N   1 
ATOM   6568  C  CA  . TYR D  4  296 ? 5.036   34.758  45.025  1.00 46.91 ? 296  TYR D CA  1 
ATOM   6569  C  C   . TYR D  4  296 ? 5.693   33.558  45.704  1.00 46.91 ? 296  TYR D C   1 
ATOM   6570  O  O   . TYR D  4  296 ? 5.045   32.531  45.923  1.00 46.91 ? 296  TYR D O   1 
ATOM   6571  C  CB  . TYR D  4  296 ? 6.083   35.813  44.648  1.00 46.91 ? 296  TYR D CB  1 
ATOM   6572  N  N   . ASP D  4  297 ? 6.971   33.694  46.043  1.00 46.91 ? 297  ASP D N   1 
ATOM   6573  C  CA  . ASP D  4  297 ? 7.717   32.629  46.700  1.00 46.91 ? 297  ASP D CA  1 
ATOM   6574  C  C   . ASP D  4  297 ? 8.791   33.248  47.589  1.00 46.91 ? 297  ASP D C   1 
ATOM   6575  O  O   . ASP D  4  297 ? 8.624   33.329  48.807  1.00 46.91 ? 297  ASP D O   1 
ATOM   6576  C  CB  . ASP D  4  297 ? 8.350   31.703  45.655  1.00 46.91 ? 297  ASP D CB  1 
ATOM   6577  N  N   . PHE D  4  298 ? 9.868   33.718  46.961  1.00 46.91 ? 298  PHE D N   1 
ATOM   6578  C  CA  . PHE D  4  298 ? 10.990  34.349  47.652  1.00 46.91 ? 298  PHE D CA  1 
ATOM   6579  C  C   . PHE D  4  298 ? 11.690  33.438  48.661  1.00 46.91 ? 298  PHE D C   1 
ATOM   6580  O  O   . PHE D  4  298 ? 12.595  32.679  48.300  1.00 46.91 ? 298  PHE D O   1 
ATOM   6581  C  CB  . PHE D  4  298 ? 10.538  35.648  48.332  1.00 46.91 ? 298  PHE D CB  1 
ATOM   6582  N  N   . ILE D  4  299 ? 11.259  33.526  49.916  1.00 46.91 ? 299  ILE D N   1 
ATOM   6583  C  CA  . ILE D  4  299 ? 11.817  32.742  51.014  1.00 46.91 ? 299  ILE D CA  1 
ATOM   6584  C  C   . ILE D  4  299 ? 11.716  31.240  50.783  1.00 46.91 ? 299  ILE D C   1 
ATOM   6585  O  O   . ILE D  4  299 ? 10.841  30.773  50.054  1.00 46.91 ? 299  ILE D O   1 
ATOM   6586  C  CB  . ILE D  4  299 ? 11.102  33.066  52.338  1.00 46.91 ? 299  ILE D CB  1 
ATOM   6587  N  N   . SER D  4  300 ? 12.571  30.493  51.481  1.00 46.91 ? 300  SER D N   1 
ATOM   6588  C  CA  . SER D  4  300 ? 12.634  29.034  51.394  1.00 46.91 ? 300  SER D CA  1 
ATOM   6589  C  C   . SER D  4  300 ? 13.295  28.563  50.106  1.00 46.91 ? 300  SER D C   1 
ATOM   6590  O  O   . SER D  4  300 ? 12.673  28.532  49.042  1.00 46.91 ? 300  SER D O   1 
ATOM   6591  C  CB  . SER D  4  300 ? 11.245  28.401  51.536  1.00 46.91 ? 300  SER D CB  1 
ATOM   6592  N  N   . GLN D  4  301 ? 14.564  28.182  50.222  1.00 46.91 ? 301  GLN D N   1 
ATOM   6593  C  CA  . GLN D  4  301 ? 15.342  27.702  49.084  1.00 46.91 ? 301  GLN D CA  1 
ATOM   6594  C  C   . GLN D  4  301 ? 14.725  26.457  48.447  1.00 46.91 ? 301  GLN D C   1 
ATOM   6595  O  O   . GLN D  4  301 ? 15.082  26.090  47.326  1.00 46.91 ? 301  GLN D O   1 
ATOM   6596  C  CB  . GLN D  4  301 ? 16.781  27.408  49.515  1.00 46.91 ? 301  GLN D CB  1 
ATOM   6597  N  N   . GLU D  4  302 ? 13.803  25.820  49.169  1.00 46.91 ? 302  GLU D N   1 
ATOM   6598  C  CA  . GLU D  4  302 ? 13.110  24.615  48.708  1.00 46.91 ? 302  GLU D CA  1 
ATOM   6599  C  C   . GLU D  4  302 ? 14.010  23.382  48.645  1.00 46.91 ? 302  GLU D C   1 
ATOM   6600  O  O   . GLU D  4  302 ? 13.560  22.266  48.908  1.00 46.91 ? 302  GLU D O   1 
ATOM   6601  C  CB  . GLU D  4  302 ? 12.448  24.852  47.344  1.00 46.91 ? 302  GLU D CB  1 
ATOM   6602  N  N   . ILE D  4  303 ? 15.269  23.584  48.268  1.00 46.91 ? 303  ILE D N   1 
ATOM   6603  C  CA  . ILE D  4  303 ? 16.234  22.495  48.173  1.00 46.91 ? 303  ILE D CA  1 
ATOM   6604  C  C   . ILE D  4  303 ? 16.922  22.276  49.516  1.00 46.91 ? 303  ILE D C   1 
ATOM   6605  O  O   . ILE D  4  303 ? 17.261  21.146  49.871  1.00 46.91 ? 303  ILE D O   1 
ATOM   6606  C  CB  . ILE D  4  303 ? 17.308  22.793  47.108  1.00 46.91 ? 303  ILE D CB  1 
ATOM   6607  N  N   . ARG D  4  304 ? 17.164  23.368  50.235  1.00 46.91 ? 304  ARG D N   1 
ATOM   6608  C  CA  . ARG D  4  304 ? 17.812  23.309  51.541  1.00 46.91 ? 304  ARG D CA  1 
ATOM   6609  C  C   . ARG D  4  304 ? 16.791  23.218  52.671  1.00 46.91 ? 304  ARG D C   1 
ATOM   6610  O  O   . ARG D  4  304 ? 17.125  22.821  53.787  1.00 46.91 ? 304  ARG D O   1 
ATOM   6611  C  CB  . ARG D  4  304 ? 18.708  24.533  51.746  1.00 46.91 ? 304  ARG D CB  1 
ATOM   6612  N  N   . ALA D  4  305 ? 15.556  23.620  52.386  1.00 46.91 ? 305  ALA D N   1 
ATOM   6613  C  CA  . ALA D  4  305 ? 14.483  23.588  53.376  1.00 46.91 ? 305  ALA D CA  1 
ATOM   6614  C  C   . ALA D  4  305 ? 13.935  22.180  53.600  1.00 46.91 ? 305  ALA D C   1 
ATOM   6615  O  O   . ALA D  4  305 ? 13.300  21.908  54.623  1.00 46.91 ? 305  ALA D O   1 
ATOM   6616  C  CB  . ALA D  4  305 ? 13.360  24.528  52.960  1.00 46.91 ? 305  ALA D CB  1 
ATOM   6617  N  N   . ALA D  4  306 ? 14.150  21.302  52.624  1.00 46.91 ? 306  ALA D N   1 
ATOM   6618  C  CA  . ALA D  4  306 ? 13.679  19.925  52.703  1.00 46.91 ? 306  ALA D CA  1 
ATOM   6619  C  C   . ALA D  4  306 ? 14.809  18.947  53.022  1.00 46.91 ? 306  ALA D C   1 
ATOM   6620  O  O   . ALA D  4  306 ? 14.559  17.781  53.348  1.00 46.91 ? 306  ALA D O   1 
ATOM   6621  C  CB  . ALA D  4  306 ? 12.993  19.535  51.401  1.00 46.91 ? 306  ALA D CB  1 
ATOM   6622  N  N   . GLU D  4  307 ? 16.047  19.417  52.908  1.00 46.91 ? 307  GLU D N   1 
ATOM   6623  C  CA  . GLU D  4  307 ? 17.213  18.584  53.177  1.00 46.91 ? 307  GLU D CA  1 
ATOM   6624  C  C   . GLU D  4  307 ? 17.910  18.932  54.496  1.00 46.91 ? 307  GLU D C   1 
ATOM   6625  O  O   . GLU D  4  307 ? 19.108  19.229  54.520  1.00 46.91 ? 307  GLU D O   1 
ATOM   6626  C  CB  . GLU D  4  307 ? 18.201  18.667  52.008  1.00 46.91 ? 307  GLU D CB  1 
ATOM   6627  N  N   . ASP D  4  308 ? 17.166  18.843  55.597  1.00 46.91 ? 308  ASP D N   1 
ATOM   6628  C  CA  . ASP D  4  308 ? 17.708  19.139  56.925  1.00 46.91 ? 308  ASP D CA  1 
ATOM   6629  C  C   . ASP D  4  308 ? 17.258  18.102  57.957  1.00 46.91 ? 308  ASP D C   1 
ATOM   6630  O  O   . ASP D  4  308 ? 16.478  18.408  58.863  1.00 46.91 ? 308  ASP D O   1 
ATOM   6631  C  CB  . ASP D  4  308 ? 17.290  20.544  57.366  1.00 46.91 ? 308  ASP D CB  1 
ATOM   6632  N  N   . PRO D  4  309 ? 17.724  16.849  57.811  1.00 46.91 ? 309  PRO D N   1 
ATOM   6633  C  CA  . PRO D  4  309 ? 17.374  15.757  58.726  1.00 46.91 ? 309  PRO D CA  1 
ATOM   6634  C  C   . PRO D  4  309 ? 18.007  15.928  60.107  1.00 46.91 ? 309  PRO D C   1 
ATOM   6635  O  O   . PRO D  4  309 ? 17.379  15.635  61.125  1.00 46.91 ? 309  PRO D O   1 
ATOM   6636  C  CB  . PRO D  4  309 ? 17.937  14.521  58.013  1.00 46.91 ? 309  PRO D CB  1 
ATOM   6637  C  CG  . PRO D  4  309 ? 17.982  14.936  56.565  1.00 46.91 ? 309  PRO D CG  1 
ATOM   6638  C  CD  . PRO D  4  309 ? 18.514  16.332  56.681  1.00 46.91 ? 309  PRO D CD  1 
ATOM   6639  N  N   . GLU D  4  310 ? 19.254  16.389  60.135  1.00 46.91 ? 310  GLU D N   1 
ATOM   6640  C  CA  . GLU D  4  310 ? 19.965  16.580  61.393  1.00 46.91 ? 310  GLU D CA  1 
ATOM   6641  C  C   . GLU D  4  310 ? 20.977  17.721  61.321  1.00 46.91 ? 310  GLU D C   1 
ATOM   6642  O  O   . GLU D  4  310 ? 20.616  18.890  61.449  1.00 46.91 ? 310  GLU D O   1 
ATOM   6643  C  CB  . GLU D  4  310 ? 20.665  15.279  61.796  1.00 46.91 ? 310  GLU D CB  1 
ATOM   6644  N  N   . PHE D  4  311 ? 22.248  17.373  61.135  1.00 46.91 ? 311  PHE D N   1 
ATOM   6645  C  CA  . PHE D  4  311 ? 23.318  18.363  61.057  1.00 46.91 ? 311  PHE D CA  1 
ATOM   6646  C  C   . PHE D  4  311 ? 23.490  18.958  59.660  1.00 46.91 ? 311  PHE D C   1 
ATOM   6647  O  O   . PHE D  4  311 ? 23.693  18.232  58.684  1.00 46.91 ? 311  PHE D O   1 
ATOM   6648  C  CB  . PHE D  4  311 ? 24.639  17.745  61.525  1.00 46.91 ? 311  PHE D CB  1 
ATOM   6649  N  N   . GLU D  4  312 ? 23.444  20.285  59.585  1.00 46.91 ? 312  GLU D N   1 
ATOM   6650  C  CA  . GLU D  4  312 ? 23.603  20.997  58.322  1.00 46.91 ? 312  GLU D CA  1 
ATOM   6651  C  C   . GLU D  4  312 ? 24.276  22.348  58.564  1.00 46.91 ? 312  GLU D C   1 
ATOM   6652  O  O   . GLU D  4  312 ? 25.504  22.430  58.637  1.00 46.91 ? 312  GLU D O   1 
ATOM   6653  C  CB  . GLU D  4  312 ? 22.247  21.192  57.640  1.00 46.91 ? 312  GLU D CB  1 
ATOM   6654  N  N   . THR D  4  313 ? 23.464  23.390  58.729  1.00 46.91 ? 313  THR D N   1 
ATOM   6655  C  CA  . THR D  4  313 ? 23.943  24.750  58.973  1.00 46.91 ? 313  THR D CA  1 
ATOM   6656  C  C   . THR D  4  313 ? 24.679  25.371  57.786  1.00 46.91 ? 313  THR D C   1 
ATOM   6657  O  O   . THR D  4  313 ? 25.711  24.867  57.335  1.00 46.91 ? 313  THR D O   1 
ATOM   6658  C  CB  . THR D  4  313 ? 24.838  24.829  60.224  1.00 46.91 ? 313  THR D CB  1 
ATOM   6659  N  N   . PHE D  4  314 ? 24.150  26.489  57.303  1.00 46.91 ? 314  PHE D N   1 
ATOM   6660  C  CA  . PHE D  4  314 ? 24.738  27.198  56.173  1.00 46.91 ? 314  PHE D CA  1 
ATOM   6661  C  C   . PHE D  4  314 ? 24.392  28.685  56.233  1.00 46.91 ? 314  PHE D C   1 
ATOM   6662  O  O   . PHE D  4  314 ? 24.143  29.229  57.308  1.00 46.91 ? 314  PHE D O   1 
ATOM   6663  C  CB  . PHE D  4  314 ? 24.242  26.590  54.859  1.00 46.91 ? 314  PHE D CB  1 
ATOM   6664  N  N   . TYR D  4  315 ? 24.415  29.345  55.079  1.00 46.91 ? 315  TYR D N   1 
ATOM   6665  C  CA  . TYR D  4  315 ? 24.100  30.768  55.008  1.00 46.91 ? 315  TYR D CA  1 
ATOM   6666  C  C   . TYR D  4  315 ? 22.593  31.003  54.908  1.00 46.91 ? 315  TYR D C   1 
ATOM   6667  O  O   . TYR D  4  315 ? 22.131  32.144  54.947  1.00 46.91 ? 315  TYR D O   1 
ATOM   6668  C  CB  . TYR D  4  315 ? 24.811  31.409  53.815  1.00 46.91 ? 315  TYR D CB  1 
ATOM   6669  N  N   . THR D  4  316 ? 21.841  29.922  54.730  1.00 46.91 ? 316  THR D N   1 
ATOM   6670  C  CA  . THR D  4  316 ? 20.389  29.996  54.626  1.00 46.91 ? 316  THR D CA  1 
ATOM   6671  C  C   . THR D  4  316 ? 19.734  29.576  55.939  1.00 46.91 ? 316  THR D C   1 
ATOM   6672  O  O   . THR D  4  316 ? 18.585  29.928  56.210  1.00 46.91 ? 316  THR D O   1 
ATOM   6673  C  CB  . THR D  4  316 ? 19.861  29.094  53.498  1.00 46.91 ? 316  THR D CB  1 
ATOM   6674  N  N   . LYS D  4  317 ? 20.457  28.783  56.723  1.00 46.91 ? 317  LYS D N   1 
ATOM   6675  C  CA  . LYS D  4  317 ? 19.964  28.304  58.011  1.00 46.91 ? 317  LYS D CA  1 
ATOM   6676  C  C   . LYS D  4  317 ? 20.177  29.348  59.105  1.00 46.91 ? 317  LYS D C   1 
ATOM   6677  O  O   . LYS D  4  317 ? 19.537  29.296  60.156  1.00 46.91 ? 317  LYS D O   1 
ATOM   6678  C  CB  . LYS D  4  317 ? 20.669  27.001  58.397  1.00 46.91 ? 317  LYS D CB  1 
ATOM   6679  N  N   . ASN D  4  318 ? 21.116  30.260  58.872  1.00 46.91 ? 318  ASN D N   1 
ATOM   6680  C  CA  . ASN D  4  318 ? 21.412  31.320  59.828  1.00 46.91 ? 318  ASN D CA  1 
ATOM   6681  C  C   . ASN D  4  318 ? 20.665  32.603  59.465  1.00 46.91 ? 318  ASN D C   1 
ATOM   6682  O  O   . ASN D  4  318 ? 20.637  33.556  60.247  1.00 46.91 ? 318  ASN D O   1 
ATOM   6683  C  CB  . ASN D  4  318 ? 22.917  31.584  59.884  1.00 46.91 ? 318  ASN D CB  1 
ATOM   6684  N  N   . LEU D  4  319 ? 20.097  32.632  58.263  1.00 46.91 ? 319  LEU D N   1 
ATOM   6685  C  CA  . LEU D  4  319 ? 19.346  33.787  57.784  1.00 46.91 ? 319  LEU D CA  1 
ATOM   6686  C  C   . LEU D  4  319 ? 17.862  33.637  58.102  1.00 46.91 ? 319  LEU D C   1 
ATOM   6687  O  O   . LEU D  4  319 ? 17.171  34.625  58.360  1.00 46.91 ? 319  LEU D O   1 
ATOM   6688  C  CB  . LEU D  4  319 ? 19.537  33.956  56.274  1.00 46.91 ? 319  LEU D CB  1 
ATOM   6689  N  N   . LEU D  4  320 ? 17.374  32.402  58.039  1.00 46.91 ? 320  LEU D N   1 
ATOM   6690  C  CA  . LEU D  4  320 ? 15.974  32.102  58.322  1.00 46.91 ? 320  LEU D CA  1 
ATOM   6691  C  C   . LEU D  4  320 ? 15.716  32.021  59.828  1.00 46.91 ? 320  LEU D C   1 
ATOM   6692  O  O   . LEU D  4  320 ? 14.575  31.854  60.262  1.00 46.91 ? 320  LEU D O   1 
ATOM   6693  C  CB  . LEU D  4  320 ? 15.570  30.785  57.654  1.00 46.91 ? 320  LEU D CB  1 
ATOM   6694  N  N   . LEU D  4  321 ? 16.788  32.094  60.612  1.00 46.91 ? 321  LEU D N   1 
ATOM   6695  C  CA  . LEU D  4  321 ? 16.689  32.043  62.065  1.00 46.91 ? 321  LEU D CA  1 
ATOM   6696  C  C   . LEU D  4  321 ? 16.847  33.437  62.667  1.00 46.91 ? 321  LEU D C   1 
ATOM   6697  O  O   . LEU D  4  321 ? 16.447  33.680  63.807  1.00 46.91 ? 321  LEU D O   1 
ATOM   6698  C  CB  . LEU D  4  321 ? 17.751  31.101  62.638  1.00 46.91 ? 321  LEU D CB  1 
ATOM   6699  N  N   . ASN D  4  322 ? 17.474  34.332  61.910  1.00 46.91 ? 322  ASN D N   1 
ATOM   6700  C  CA  . ASN D  4  322 ? 17.690  35.706  62.349  1.00 46.91 ? 322  ASN D CA  1 
ATOM   6701  C  C   . ASN D  4  322 ? 16.578  36.622  61.844  1.00 46.91 ? 322  ASN D C   1 
ATOM   6702  O  O   . ASN D  4  322 ? 16.576  37.826  62.123  1.00 46.91 ? 322  ASN D O   1 
ATOM   6703  C  CB  . ASN D  4  322 ? 19.046  36.211  61.852  1.00 46.91 ? 322  ASN D CB  1 
ATOM   6704  N  N   . GLU D  4  323 ? 15.647  36.049  61.088  1.00 46.91 ? 323  GLU D N   1 
ATOM   6705  C  CA  . GLU D  4  323 ? 14.521  36.793  60.535  1.00 46.91 ? 323  GLU D CA  1 
ATOM   6706  C  C   . GLU D  4  323 ? 13.201  36.123  60.904  1.00 46.91 ? 323  GLU D C   1 
ATOM   6707  O  O   . GLU D  4  323 ? 12.146  36.760  60.886  1.00 46.91 ? 323  GLU D O   1 
ATOM   6708  C  CB  . GLU D  4  323 ? 14.650  36.891  59.013  1.00 46.91 ? 323  GLU D CB  1 
ATOM   6709  N  N   . GLY D  4  324 ? 13.265  34.831  61.213  1.00 46.91 ? 324  GLY D N   1 
ATOM   6710  C  CA  . GLY D  4  324 ? 12.074  34.090  61.587  1.00 46.91 ? 324  GLY D CA  1 
ATOM   6711  C  C   . GLY D  4  324 ? 11.766  34.219  63.066  1.00 46.91 ? 324  GLY D C   1 
ATOM   6712  O  O   . GLY D  4  324 ? 10.620  34.040  63.489  1.00 46.91 ? 324  GLY D O   1 
ATOM   6713  N  N   . ILE D  4  325 ? 12.802  34.481  63.857  1.00 46.91 ? 325  ILE D N   1 
ATOM   6714  C  CA  . ILE D  4  325 ? 12.663  34.641  65.300  1.00 46.91 ? 325  ILE D CA  1 
ATOM   6715  C  C   . ILE D  4  325 ? 12.593  36.118  65.680  1.00 46.91 ? 325  ILE D C   1 
ATOM   6716  O  O   . ILE D  4  325 ? 12.114  36.467  66.760  1.00 46.91 ? 325  ILE D O   1 
ATOM   6717  C  CB  . ILE D  4  325 ? 13.841  33.990  66.051  1.00 46.91 ? 325  ILE D CB  1 
ATOM   6718  N  N   . ARG D  4  326 ? 13.109  36.976  64.803  1.00 46.91 ? 326  ARG D N   1 
ATOM   6719  C  CA  . ARG D  4  326 ? 13.108  38.416  65.032  1.00 46.91 ? 326  ARG D CA  1 
ATOM   6720  C  C   . ARG D  4  326 ? 11.761  39.036  64.674  1.00 46.91 ? 326  ARG D C   1 
ATOM   6721  O  O   . ARG D  4  326 ? 11.382  40.076  65.217  1.00 46.91 ? 326  ARG D O   1 
ATOM   6722  C  CB  . ARG D  4  326 ? 14.214  39.087  64.215  1.00 46.91 ? 326  ARG D CB  1 
ATOM   6723  N  N   . ALA D  4  327 ? 11.065  38.414  63.726  1.00 46.91 ? 327  ALA D N   1 
ATOM   6724  C  CA  . ALA D  4  327 ? 9.762   38.894  63.281  1.00 46.91 ? 327  ALA D CA  1 
ATOM   6725  C  C   . ALA D  4  327 ? 8.633   38.316  64.130  1.00 46.91 ? 327  ALA D C   1 
ATOM   6726  O  O   . ALA D  4  327 ? 7.505   38.813  64.099  1.00 46.91 ? 327  ALA D O   1 
ATOM   6727  C  CB  . ALA D  4  327 ? 9.550   38.546  61.814  1.00 46.91 ? 327  ALA D CB  1 
ATOM   6728  N  N   . TRP D  4  328 ? 8.933   37.242  64.854  1.00 46.91 ? 328  TRP D N   1 
ATOM   6729  C  CA  . TRP D  4  328 ? 7.952   36.591  65.715  1.00 46.91 ? 328  TRP D CA  1 
ATOM   6730  C  C   . TRP D  4  328 ? 7.684   37.425  66.963  1.00 46.91 ? 328  TRP D C   1 
ATOM   6731  O  O   . TRP D  4  328 ? 6.529   37.654  67.332  1.00 46.91 ? 328  TRP D O   1 
ATOM   6732  C  CB  . TRP D  4  328 ? 8.440   35.197  66.115  1.00 46.91 ? 328  TRP D CB  1 
ATOM   6733  N  N   . MET D  4  329 ? 8.756   37.849  67.623  1.00 46.91 ? 329  MET D N   1 
ATOM   6734  C  CA  . MET D  4  329 ? 8.653   38.655  68.833  1.00 46.91 ? 329  MET D CA  1 
ATOM   6735  C  C   . MET D  4  329 ? 8.584   40.148  68.514  1.00 46.91 ? 329  MET D C   1 
ATOM   6736  O  O   . MET D  4  329 ? 8.684   40.553  67.355  1.00 46.91 ? 329  MET D O   1 
ATOM   6737  C  CB  . MET D  4  329 ? 9.842   38.371  69.756  1.00 46.91 ? 329  MET D CB  1 
ATOM   6738  N  N   . ALA D  4  330 ? 8.400   40.958  69.557  1.00 46.91 ? 330  ALA D N   1 
ATOM   6739  C  CA  . ALA D  4  330 ? 8.321   42.414  69.429  1.00 46.91 ? 330  ALA D CA  1 
ATOM   6740  C  C   . ALA D  4  330 ? 7.178   42.900  68.530  1.00 46.91 ? 330  ALA D C   1 
ATOM   6741  O  O   . ALA D  4  330 ? 7.092   44.091  68.222  1.00 46.91 ? 330  ALA D O   1 
ATOM   6742  C  CB  . ALA D  4  330 ? 9.658   42.977  68.936  1.00 46.91 ? 330  ALA D CB  1 
ATOM   6743  N  N   . PRO D  4  331 ? 6.277   41.988  68.132  1.00 46.91 ? 331  PRO D N   1 
ATOM   6744  C  CA  . PRO D  4  331 ? 5.123   42.277  67.274  1.00 46.91 ? 331  PRO D CA  1 
ATOM   6745  C  C   . PRO D  4  331 ? 4.245   43.387  67.847  1.00 46.91 ? 331  PRO D C   1 
ATOM   6746  O  O   . PRO D  4  331 ? 3.744   43.279  68.971  1.00 46.91 ? 331  PRO D O   1 
ATOM   6747  C  CB  . PRO D  4  331 ? 4.377   40.942  67.224  1.00 46.91 ? 331  PRO D CB  1 
ATOM   6748  N  N   . GLN D  4  332 ? 4.078   44.456  67.077  1.00 46.91 ? 332  GLN D N   1 
ATOM   6749  C  CA  . GLN D  4  332 ? 3.269   45.596  67.496  1.00 46.91 ? 332  GLN D CA  1 
ATOM   6750  C  C   . GLN D  4  332 ? 2.738   46.387  66.302  1.00 46.91 ? 332  GLN D C   1 
ATOM   6751  O  O   . GLN D  4  332 ? 2.208   47.488  66.465  1.00 46.91 ? 332  GLN D O   1 
ATOM   6752  C  CB  . GLN D  4  332 ? 4.086   46.518  68.406  1.00 46.91 ? 332  GLN D CB  1 
ATOM   6753  N  N   . ASP D  4  333 ? 2.903   45.832  65.105  1.00 46.91 ? 333  ASP D N   1 
ATOM   6754  C  CA  . ASP D  4  333 ? 2.436   46.482  63.885  1.00 46.91 ? 333  ASP D CA  1 
ATOM   6755  C  C   . ASP D  4  333 ? 0.915   46.418  63.794  1.00 46.91 ? 333  ASP D C   1 
ATOM   6756  O  O   . ASP D  4  333 ? 0.248   47.438  63.610  1.00 46.91 ? 333  ASP D O   1 
ATOM   6757  C  CB  . ASP D  4  333 ? 3.061   45.820  62.654  1.00 46.91 ? 333  ASP D CB  1 
ATOM   6758  N  N   . GLN D  4  334 ? 0.376   45.207  63.904  1.00 46.91 ? 334  GLN D N   1 
ATOM   6759  C  CA  . GLN D  4  334 ? -1.065  44.997  63.842  1.00 46.91 ? 334  GLN D CA  1 
ATOM   6760  C  C   . GLN D  4  334 ? -1.712  45.213  65.207  1.00 46.91 ? 334  GLN D C   1 
ATOM   6761  O  O   . GLN D  4  334 ? -1.310  44.609  66.201  1.00 46.91 ? 334  GLN D O   1 
ATOM   6762  C  CB  . GLN D  4  334 ? -1.374  43.587  63.335  1.00 46.91 ? 334  GLN D CB  1 
ATOM   6763  N  N   . PRO D  4  335 ? -2.723  46.092  65.267  1.00 46.91 ? 335  PRO D N   1 
ATOM   6764  C  CA  . PRO D  4  335 ? -3.435  46.399  66.512  1.00 46.91 ? 335  PRO D CA  1 
ATOM   6765  C  C   . PRO D  4  335 ? -4.715  45.578  66.661  1.00 46.91 ? 335  PRO D C   1 
ATOM   6766  O  O   . PRO D  4  335 ? -5.647  45.985  67.359  1.00 46.91 ? 335  PRO D O   1 
ATOM   6767  C  CB  . PRO D  4  335 ? -3.747  47.889  66.382  1.00 46.91 ? 335  PRO D CB  1 
ATOM   6768  N  N   . HIS D  4  336 ? -4.764  44.427  65.997  1.00 46.91 ? 336  HIS D N   1 
ATOM   6769  C  CA  . HIS D  4  336 ? -5.938  43.564  66.055  1.00 46.91 ? 336  HIS D CA  1 
ATOM   6770  C  C   . HIS D  4  336 ? -5.584  42.092  65.879  1.00 46.91 ? 336  HIS D C   1 
ATOM   6771  O  O   . HIS D  4  336 ? -6.297  41.213  66.369  1.00 46.91 ? 336  HIS D O   1 
ATOM   6772  C  CB  . HIS D  4  336 ? -6.947  43.980  64.980  1.00 46.91 ? 336  HIS D CB  1 
ATOM   6773  N  N   . GLU D  4  337 ? -4.513  41.832  65.135  1.00 46.91 ? 337  GLU D N   1 
ATOM   6774  C  CA  . GLU D  4  337 ? -4.062  40.469  64.887  1.00 46.91 ? 337  GLU D CA  1 
ATOM   6775  C  C   . GLU D  4  337 ? -3.167  39.969  66.019  1.00 46.91 ? 337  GLU D C   1 
ATOM   6776  O  O   . GLU D  4  337 ? -3.289  38.824  66.455  1.00 46.91 ? 337  GLU D O   1 
ATOM   6777  C  CB  . GLU D  4  337 ? -3.315  40.391  63.555  1.00 46.91 ? 337  GLU D CB  1 
ATOM   6778  N  N   . ASN D  4  338 ? -2.257  40.826  66.469  1.00 46.91 ? 338  ASN D N   1 
ATOM   6779  C  CA  . ASN D  4  338 ? -1.338  40.487  67.551  1.00 46.91 ? 338  ASN D CA  1 
ATOM   6780  C  C   . ASN D  4  338 ? -2.039  40.510  68.908  1.00 46.91 ? 338  ASN D C   1 
ATOM   6781  O  O   . ASN D  4  338 ? -2.989  41.270  69.117  1.00 46.91 ? 338  ASN D O   1 
ATOM   6782  C  CB  . ASN D  4  338 ? -0.152  41.456  67.565  1.00 46.91 ? 338  ASN D CB  1 
ATOM   6783  N  N   . PHE D  4  339 ? -1.566  39.673  69.826  1.00 46.91 ? 339  PHE D N   1 
ATOM   6784  C  CA  . PHE D  4  339 ? -2.136  39.594  71.167  1.00 46.91 ? 339  PHE D CA  1 
ATOM   6785  C  C   . PHE D  4  339 ? -1.101  39.092  72.173  1.00 46.91 ? 339  PHE D C   1 
ATOM   6786  O  O   . PHE D  4  339 ? -0.249  39.858  72.629  1.00 46.91 ? 339  PHE D O   1 
ATOM   6787  C  CB  . PHE D  4  339 ? -3.372  38.688  71.171  1.00 46.91 ? 339  PHE D CB  1 
ATOM   6788  N  N   . VAL D  4  340 ? -1.192  37.816  72.537  1.00 46.91 ? 340  VAL D N   1 
ATOM   6789  C  CA  . VAL D  4  340 ? -0.255  37.228  73.486  1.00 46.91 ? 340  VAL D CA  1 
ATOM   6790  C  C   . VAL D  4  340 ? 0.942   36.624  72.761  1.00 46.91 ? 340  VAL D C   1 
ATOM   6791  O  O   . VAL D  4  340 ? 0.789   35.716  71.940  1.00 46.91 ? 340  VAL D O   1 
ATOM   6792  C  CB  . VAL D  4  340 ? -0.931  36.137  74.342  1.00 46.91 ? 340  VAL D CB  1 
ATOM   6793  N  N   . PHE D  4  341 ? 2.131   37.128  73.072  1.00 46.91 ? 341  PHE D N   1 
ATOM   6794  C  CA  . PHE D  4  341 ? 3.357   36.643  72.450  1.00 46.91 ? 341  PHE D CA  1 
ATOM   6795  C  C   . PHE D  4  341 ? 4.501   36.560  73.455  1.00 46.91 ? 341  PHE D C   1 
ATOM   6796  O  O   . PHE D  4  341 ? 5.517   35.913  73.201  1.00 46.91 ? 341  PHE D O   1 
ATOM   6797  C  CB  . PHE D  4  341 ? 3.755   37.554  71.283  1.00 46.91 ? 341  PHE D CB  1 
ATOM   6798  N  N   . PRO D  4  342 ? 4.356   37.237  74.604  1.00 46.91 ? 342  PRO D N   1 
ATOM   6799  C  CA  . PRO D  4  342 ? 5.374   37.247  75.659  1.00 46.91 ? 342  PRO D CA  1 
ATOM   6800  C  C   . PRO D  4  342 ? 5.200   36.077  76.631  1.00 46.91 ? 342  PRO D C   1 
ATOM   6801  O  O   . PRO D  4  342 ? 5.188   34.917  76.218  1.00 46.91 ? 342  PRO D O   1 
ATOM   6802  C  CB  . PRO D  4  342 ? 5.156   38.596  76.348  1.00 46.91 ? 342  PRO D CB  1 
ATOM   6803  N  N   . GLU D  4  343 ? 5.046   36.397  77.915  1.00 46.91 ? 343  GLU D N   1 
ATOM   6804  C  CA  . GLU D  4  343 ? 4.869   35.399  78.971  1.00 46.91 ? 343  GLU D CA  1 
ATOM   6805  C  C   . GLU D  4  343 ? 6.115   34.542  79.202  1.00 46.91 ? 343  GLU D C   1 
ATOM   6806  O  O   . GLU D  4  343 ? 6.052   33.520  79.886  1.00 46.91 ? 343  GLU D O   1 
ATOM   6807  C  CB  . GLU D  4  343 ? 3.659   34.506  78.678  1.00 46.91 ? 343  GLU D CB  1 
ATOM   6808  N  N   . GLU D  4  344 ? 7.247   34.996  78.667  1.00 46.91 ? 344  GLU D N   1 
ATOM   6809  C  CA  . GLU D  4  344 ? 8.524   34.295  78.801  1.00 46.91 ? 344  GLU D CA  1 
ATOM   6810  C  C   . GLU D  4  344 ? 8.477   32.862  78.269  1.00 46.91 ? 344  GLU D C   1 
ATOM   6811  O  O   . GLU D  4  344 ? 8.864   31.916  78.960  1.00 46.91 ? 344  GLU D O   1 
ATOM   6812  C  CB  . GLU D  4  344 ? 8.990   34.307  80.260  1.00 46.91 ? 344  GLU D CB  1 
ATOM   6813  N  N   . VAL D  4  345 ? 8.025   32.715  77.029  1.00 46.91 ? 345  VAL D N   1 
ATOM   6814  C  CA  . VAL D  4  345 ? 7.927   31.407  76.386  1.00 46.91 ? 345  VAL D CA  1 
ATOM   6815  C  C   . VAL D  4  345 ? 7.924   31.553  74.867  1.00 46.91 ? 345  VAL D C   1 
ATOM   6816  O  O   . VAL D  4  345 ? 7.497   30.649  74.143  1.00 46.91 ? 345  VAL D O   1 
ATOM   6817  C  CB  . VAL D  4  345 ? 6.647   30.666  76.820  1.00 46.91 ? 345  VAL D CB  1 
ATOM   6818  N  N   . LEU D  4  346 ? 8.401   32.701  74.393  1.00 46.91 ? 346  LEU D N   1 
ATOM   6819  C  CA  . LEU D  4  346 ? 8.464   32.984  72.965  1.00 46.91 ? 346  LEU D CA  1 
ATOM   6820  C  C   . LEU D  4  346 ? 9.692   32.342  72.317  1.00 46.91 ? 346  LEU D C   1 
ATOM   6821  O  O   . LEU D  4  346 ? 10.320  31.448  72.890  1.00 46.91 ? 346  LEU D O   1 
ATOM   6822  C  CB  . LEU D  4  346 ? 8.472   34.497  72.728  1.00 46.91 ? 346  LEU D CB  1 
ATOM   6823  N  N   . PRO D  4  347 ? 10.031  32.778  71.095  1.00 46.91 ? 347  PRO D N   1 
ATOM   6824  C  CA  . PRO D  4  347 ? 11.172  32.284  70.317  1.00 46.91 ? 347  PRO D CA  1 
ATOM   6825  C  C   . PRO D  4  347 ? 12.486  32.986  70.659  1.00 46.91 ? 347  PRO D C   1 
ATOM   6826  O  O   . PRO D  4  347 ? 12.508  33.936  71.443  1.00 46.91 ? 347  PRO D O   1 
ATOM   6827  C  CB  . PRO D  4  347 ? 10.756  32.559  68.870  1.00 46.91 ? 347  PRO D CB  1 
ATOM   6828  N  N   . ARG D  4  348 ? 13.568  32.509  70.045  1.00 46.91 ? 348  ARG D N   1 
ATOM   6829  C  CA  . ARG D  4  348 ? 14.915  33.049  70.240  1.00 46.91 ? 348  ARG D CA  1 
ATOM   6830  C  C   . ARG D  4  348 ? 15.501  32.784  71.624  1.00 46.91 ? 348  ARG D C   1 
ATOM   6831  O  O   . ARG D  4  348 ? 15.021  33.305  72.633  1.00 46.91 ? 348  ARG D O   1 
ATOM   6832  C  CB  . ARG D  4  348 ? 14.957  34.549  69.922  1.00 46.91 ? 348  ARG D CB  1 
ATOM   6833  N  N   . GLY D  4  349 ? 16.557  31.977  71.658  1.00 46.91 ? 349  GLY D N   1 
ATOM   6834  C  CA  . GLY D  4  349 ? 17.206  31.649  72.914  1.00 46.91 ? 349  GLY D CA  1 
ATOM   6835  C  C   . GLY D  4  349 ? 18.670  31.307  72.714  1.00 46.91 ? 349  GLY D C   1 
ATOM   6836  O  O   . GLY D  4  349 ? 18.999  30.289  72.101  1.00 46.91 ? 349  GLY D O   1 
ATOM   6837  N  N   . ASN D  4  350 ? 19.550  32.156  73.233  1.00 46.91 ? 350  ASN D N   1 
ATOM   6838  C  CA  . ASN D  4  350 ? 20.989  31.952  73.111  1.00 46.91 ? 350  ASN D CA  1 
ATOM   6839  C  C   . ASN D  4  350 ? 21.732  32.492  74.331  1.00 46.91 ? 350  ASN D C   1 
ATOM   6840  O  O   . ASN D  4  350 ? 22.567  31.799  74.916  1.00 46.91 ? 350  ASN D O   1 
ATOM   6841  C  CB  . ASN D  4  350 ? 21.516  32.633  71.845  1.00 46.91 ? 350  ASN D CB  1 
ATOM   6842  N  N   . ALA D  4  351 ? 21.431  33.734  74.696  1.00 46.91 ? 351  ALA D N   1 
ATOM   6843  C  CA  . ALA D  4  351 ? 22.059  34.386  75.841  1.00 46.91 ? 351  ALA D CA  1 
ATOM   6844  C  C   . ALA D  4  351 ? 21.116  35.414  76.457  1.00 46.91 ? 351  ALA D C   1 
ATOM   6845  O  O   . ALA D  4  351 ? 21.099  35.599  77.676  1.00 46.91 ? 351  ALA D O   1 
ATOM   6846  C  CB  . ALA D  4  351 ? 23.365  35.050  75.419  1.00 46.91 ? 351  ALA D CB  1 
ATOM   6847  N  N   . LEU D  4  352 ? 20.341  36.080  75.603  1.00 46.91 ? 352  LEU D N   1 
ATOM   6848  C  CA  . LEU D  4  352 ? 19.377  37.097  76.023  1.00 46.91 ? 352  LEU D CA  1 
ATOM   6849  C  C   . LEU D  4  352 ? 20.038  38.270  76.746  1.00 46.91 ? 352  LEU D C   1 
ATOM   6850  O  O   . LEU D  4  352 ? 19.832  39.410  76.278  1.00 46.91 ? 352  LEU D O   1 
ATOM   6851  C  CB  . LEU D  4  352 ? 18.296  36.475  76.912  1.00 46.91 ? 352  LEU D CB  1 
ATOM   6852  N  N   . ARG E  5  7   ? 3.957   92.082  40.164  1.00 46.91 ? 7    ARG E N   1 
ATOM   6853  C  CA  . ARG E  5  7   ? 5.444   92.018  40.264  1.00 46.91 ? 7    ARG E CA  1 
ATOM   6854  C  C   . ARG E  5  7   ? 6.115   92.272  38.910  1.00 46.91 ? 7    ARG E C   1 
ATOM   6855  O  O   . ARG E  5  7   ? 6.687   91.364  38.307  1.00 46.91 ? 7    ARG E O   1 
ATOM   6856  C  CB  . ARG E  5  7   ? 5.880   90.663  40.831  1.00 46.91 ? 7    ARG E CB  1 
ATOM   6857  N  N   . PRO E  5  8   ? 6.013   93.514  38.401  1.00 46.91 ? 8    PRO E N   1 
ATOM   6858  C  CA  . PRO E  5  8   ? 6.608   93.900  37.116  1.00 46.91 ? 8    PRO E CA  1 
ATOM   6859  C  C   . PRO E  5  8   ? 8.121   94.110  37.215  1.00 46.91 ? 8    PRO E C   1 
ATOM   6860  O  O   . PRO E  5  8   ? 8.838   93.273  37.761  1.00 46.91 ? 8    PRO E O   1 
ATOM   6861  C  CB  . PRO E  5  8   ? 5.876   95.202  36.790  1.00 46.91 ? 8    PRO E CB  1 
ATOM   6862  C  CG  . PRO E  5  8   ? 5.675   95.804  38.144  1.00 46.91 ? 8    PRO E CG  1 
ATOM   6863  C  CD  . PRO E  5  8   ? 5.207   94.616  38.955  1.00 46.91 ? 8    PRO E CD  1 
ATOM   6864  N  N   . PHE E  5  9   ? 8.589   95.250  36.709  1.00 46.91 ? 9    PHE E N   1 
ATOM   6865  C  CA  . PHE E  5  9   ? 10.006  95.601  36.723  1.00 46.91 ? 9    PHE E CA  1 
ATOM   6866  C  C   . PHE E  5  9   ? 10.848  94.676  35.843  1.00 46.91 ? 9    PHE E C   1 
ATOM   6867  O  O   . PHE E  5  9   ? 10.372  94.175  34.821  1.00 46.91 ? 9    PHE E O   1 
ATOM   6868  C  CB  . PHE E  5  9   ? 10.544  95.613  38.160  1.00 46.91 ? 9    PHE E CB  1 
ATOM   6869  N  N   . SER E  5  10  ? 12.115  94.510  36.214  1.00 46.91 ? 10   SER E N   1 
ATOM   6870  C  CA  . SER E  5  10  ? 13.036  93.660  35.470  1.00 46.91 ? 10   SER E CA  1 
ATOM   6871  C  C   . SER E  5  10  ? 13.326  92.352  36.196  1.00 46.91 ? 10   SER E C   1 
ATOM   6872  O  O   . SER E  5  10  ? 13.141  92.251  37.413  1.00 46.91 ? 10   SER E O   1 
ATOM   6873  C  CB  . SER E  5  10  ? 14.349  94.402  35.213  1.00 46.91 ? 10   SER E CB  1 
ATOM   6874  N  N   . ASP E  5  11  ? 13.811  91.370  35.439  1.00 46.91 ? 11   ASP E N   1 
ATOM   6875  C  CA  . ASP E  5  11  ? 14.146  90.054  35.969  1.00 46.91 ? 11   ASP E CA  1 
ATOM   6876  C  C   . ASP E  5  11  ? 15.251  90.117  37.022  1.00 46.91 ? 11   ASP E C   1 
ATOM   6877  O  O   . ASP E  5  11  ? 16.161  90.949  36.937  1.00 46.91 ? 11   ASP E O   1 
ATOM   6878  C  CB  . ASP E  5  11  ? 14.568  89.121  34.835  1.00 46.91 ? 11   ASP E CB  1 
ATOM   6879  N  N   . ILE E  5  12  ? 15.167  89.221  38.000  1.00 46.91 ? 12   ILE E N   1 
ATOM   6880  C  CA  . ILE E  5  12  ? 16.141  89.153  39.084  1.00 46.91 ? 12   ILE E CA  1 
ATOM   6881  C  C   . ILE E  5  12  ? 17.232  88.113  38.825  1.00 46.91 ? 12   ILE E C   1 
ATOM   6882  O  O   . ILE E  5  12  ? 17.075  87.217  37.994  1.00 46.91 ? 12   ILE E O   1 
ATOM   6883  C  CB  . ILE E  5  12  ? 15.454  88.825  40.422  1.00 46.91 ? 12   ILE E CB  1 
ATOM   6884  N  N   . ILE E  5  13  ? 18.335  88.236  39.558  1.00 46.91 ? 13   ILE E N   1 
ATOM   6885  C  CA  . ILE E  5  13  ? 19.463  87.320  39.430  1.00 46.91 ? 13   ILE E CA  1 
ATOM   6886  C  C   . ILE E  5  13  ? 20.273  87.291  40.723  1.00 46.91 ? 13   ILE E C   1 
ATOM   6887  O  O   . ILE E  5  13  ? 20.452  86.233  41.333  1.00 46.91 ? 13   ILE E O   1 
ATOM   6888  C  CB  . ILE E  5  13  ? 20.392  87.729  38.269  1.00 46.91 ? 13   ILE E CB  1 
ATOM   6889  N  N   . THR E  5  14  ? 20.770  88.456  41.127  1.00 46.91 ? 14   THR E N   1 
ATOM   6890  C  CA  . THR E  5  14  ? 21.561  88.585  42.348  1.00 46.91 ? 14   THR E CA  1 
ATOM   6891  C  C   . THR E  5  14  ? 21.733  90.058  42.718  1.00 46.91 ? 14   THR E C   1 
ATOM   6892  O  O   . THR E  5  14  ? 22.767  90.462  43.257  1.00 46.91 ? 14   THR E O   1 
ATOM   6893  C  CB  . THR E  5  14  ? 22.953  87.945  42.187  1.00 46.91 ? 14   THR E CB  1 
ATOM   6894  N  N   . SER E  5  15  ? 20.720  90.860  42.411  1.00 46.91 ? 15   SER E N   1 
ATOM   6895  C  CA  . SER E  5  15  ? 20.750  92.289  42.704  1.00 46.91 ? 15   SER E CA  1 
ATOM   6896  C  C   . SER E  5  15  ? 19.807  92.658  43.849  1.00 46.91 ? 15   SER E C   1 
ATOM   6897  O  O   . SER E  5  15  ? 20.118  93.532  44.660  1.00 46.91 ? 15   SER E O   1 
ATOM   6898  C  CB  . SER E  5  15  ? 20.390  93.093  41.451  1.00 46.91 ? 15   SER E CB  1 
ATOM   6899  N  N   . VAL E  5  16  ? 18.646  92.009  43.893  1.00 46.91 ? 16   VAL E N   1 
ATOM   6900  C  CA  . VAL E  5  16  ? 17.651  92.267  44.932  1.00 46.91 ? 16   VAL E CA  1 
ATOM   6901  C  C   . VAL E  5  16  ? 17.928  91.450  46.194  1.00 46.91 ? 16   VAL E C   1 
ATOM   6902  O  O   . VAL E  5  16  ? 17.965  90.220  46.151  1.00 46.91 ? 16   VAL E O   1 
ATOM   6903  C  CB  . VAL E  5  16  ? 16.225  91.939  44.436  1.00 46.91 ? 16   VAL E CB  1 
ATOM   6904  N  N   . ARG E  5  17  ? 18.122  92.138  47.314  1.00 46.91 ? 17   ARG E N   1 
ATOM   6905  C  CA  . ARG E  5  17  ? 18.393  91.471  48.584  1.00 46.91 ? 17   ARG E CA  1 
ATOM   6906  C  C   . ARG E  5  17  ? 17.165  91.454  49.495  1.00 46.91 ? 17   ARG E C   1 
ATOM   6907  O  O   . ARG E  5  17  ? 16.330  90.553  49.405  1.00 46.91 ? 17   ARG E O   1 
ATOM   6908  C  CB  . ARG E  5  17  ? 19.577  92.137  49.295  1.00 46.91 ? 17   ARG E CB  1 
ATOM   6909  N  N   . TYR E  5  18  ? 17.081  92.433  50.392  1.00 46.91 ? 18   TYR E N   1 
ATOM   6910  C  CA  . TYR E  5  18  ? 15.969  92.537  51.331  1.00 46.91 ? 18   TYR E CA  1 
ATOM   6911  C  C   . TYR E  5  18  ? 14.855  93.440  50.809  1.00 46.91 ? 18   TYR E C   1 
ATOM   6912  O  O   . TYR E  5  18  ? 13.718  93.361  51.275  1.00 46.91 ? 18   TYR E O   1 
ATOM   6913  C  CB  . TYR E  5  18  ? 16.471  93.066  52.678  1.00 46.91 ? 18   TYR E CB  1 
ATOM   6914  N  N   . TRP E  5  19  ? 15.195  94.290  49.841  1.00 46.91 ? 19   TRP E N   1 
ATOM   6915  C  CA  . TRP E  5  19  ? 14.253  95.232  49.238  1.00 46.91 ? 19   TRP E CA  1 
ATOM   6916  C  C   . TRP E  5  19  ? 13.770  96.292  50.235  1.00 46.91 ? 19   TRP E C   1 
ATOM   6917  O  O   . TRP E  5  19  ? 12.711  96.894  50.049  1.00 46.91 ? 19   TRP E O   1 
ATOM   6918  C  CB  . TRP E  5  19  ? 13.062  94.492  48.618  1.00 46.91 ? 19   TRP E CB  1 
ATOM   6919  N  N   . VAL E  5  20  ? 14.597  96.555  51.246  1.00 46.91 ? 20   VAL E N   1 
ATOM   6920  C  CA  . VAL E  5  20  ? 14.303  97.530  52.294  1.00 46.91 ? 20   VAL E CA  1 
ATOM   6921  C  C   . VAL E  5  20  ? 13.089  97.137  53.136  1.00 46.91 ? 20   VAL E C   1 
ATOM   6922  O  O   . VAL E  5  20  ? 13.200  96.307  54.040  1.00 46.91 ? 20   VAL E O   1 
ATOM   6923  C  CB  . VAL E  5  20  ? 14.106  98.955  51.720  1.00 46.91 ? 20   VAL E CB  1 
ATOM   6924  N  N   . ILE E  5  21  ? 11.946  97.763  52.865  1.00 46.91 ? 21   ILE E N   1 
ATOM   6925  C  CA  . ILE E  5  21  ? 10.717  97.476  53.598  1.00 46.91 ? 21   ILE E CA  1 
ATOM   6926  C  C   . ILE E  5  21  ? 10.163  96.096  53.243  1.00 46.91 ? 21   ILE E C   1 
ATOM   6927  O  O   . ILE E  5  21  ? 10.557  95.495  52.241  1.00 46.91 ? 21   ILE E O   1 
ATOM   6928  C  CB  . ILE E  5  21  ? 9.638   98.539  53.314  1.00 46.91 ? 21   ILE E CB  1 
ATOM   6929  N  N   . HIS E  5  22  ? 9.232   95.613  54.064  1.00 46.91 ? 22   HIS E N   1 
ATOM   6930  C  CA  . HIS E  5  22  ? 8.611   94.303  53.865  1.00 46.91 ? 22   HIS E CA  1 
ATOM   6931  C  C   . HIS E  5  22  ? 9.615   93.158  53.985  1.00 46.91 ? 22   HIS E C   1 
ATOM   6932  O  O   . HIS E  5  22  ? 9.354   92.043  53.535  1.00 46.91 ? 22   HIS E O   1 
ATOM   6933  C  CB  . HIS E  5  22  ? 7.897   94.241  52.509  1.00 46.91 ? 22   HIS E CB  1 
ATOM   6934  N  N   . SER E  5  23  ? 10.759  93.444  54.598  1.00 46.91 ? 23   SER E N   1 
ATOM   6935  C  CA  . SER E  5  23  ? 11.804  92.448  54.787  1.00 46.91 ? 23   SER E CA  1 
ATOM   6936  C  C   . SER E  5  23  ? 11.851  92.024  56.250  1.00 46.91 ? 23   SER E C   1 
ATOM   6937  O  O   . SER E  5  23  ? 11.851  90.834  56.564  1.00 46.91 ? 23   SER E O   1 
ATOM   6938  C  CB  . SER E  5  23  ? 13.159  93.010  54.355  1.00 46.91 ? 23   SER E CB  1 
ATOM   6939  N  N   . ILE E  5  24  ? 11.917  93.010  57.141  1.00 46.91 ? 24   ILE E N   1 
ATOM   6940  C  CA  . ILE E  5  24  ? 11.947  92.746  58.574  1.00 46.91 ? 24   ILE E CA  1 
ATOM   6941  C  C   . ILE E  5  24  ? 10.518  92.540  59.074  1.00 46.91 ? 24   ILE E C   1 
ATOM   6942  O  O   . ILE E  5  24  ? 10.295  91.879  60.087  1.00 46.91 ? 24   ILE E O   1 
ATOM   6943  C  CB  . ILE E  5  24  ? 12.596  93.909  59.350  1.00 46.91 ? 24   ILE E CB  1 
ATOM   6944  N  N   . THR E  5  25  ? 9.560   93.141  58.374  1.00 46.91 ? 25   THR E N   1 
ATOM   6945  C  CA  . THR E  5  25  ? 8.149   93.014  58.727  1.00 46.91 ? 25   THR E CA  1 
ATOM   6946  C  C   . THR E  5  25  ? 7.621   91.657  58.276  1.00 46.91 ? 25   THR E C   1 
ATOM   6947  O  O   . THR E  5  25  ? 6.616   91.172  58.795  1.00 46.91 ? 25   THR E O   1 
ATOM   6948  C  CB  . THR E  5  25  ? 7.303   94.117  58.071  1.00 46.91 ? 25   THR E CB  1 
ATOM   6949  N  N   . ILE E  5  26  ? 8.273   91.084  57.266  1.00 46.91 ? 26   ILE E N   1 
ATOM   6950  C  CA  . ILE E  5  26  ? 7.894   89.778  56.734  1.00 46.91 ? 26   ILE E CA  1 
ATOM   6951  C  C   . ILE E  5  26  ? 8.292   88.689  57.726  1.00 46.91 ? 26   ILE E C   1 
ATOM   6952  O  O   . ILE E  5  26  ? 7.654   87.639  57.806  1.00 46.91 ? 26   ILE E O   1 
ATOM   6953  C  CB  . ILE E  5  26  ? 8.590   89.497  55.389  1.00 46.91 ? 26   ILE E CB  1 
ATOM   6954  N  N   . PRO E  5  27  ? 9.388   88.919  58.464  1.00 46.91 ? 27   PRO E N   1 
ATOM   6955  C  CA  . PRO E  5  27  ? 9.942   88.013  59.475  1.00 46.91 ? 27   PRO E CA  1 
ATOM   6956  C  C   . PRO E  5  27  ? 9.286   88.241  60.836  1.00 46.91 ? 27   PRO E C   1 
ATOM   6957  O  O   . PRO E  5  27  ? 9.599   87.553  61.812  1.00 46.91 ? 27   PRO E O   1 
ATOM   6958  C  CB  . PRO E  5  27  ? 11.425  88.381  59.506  1.00 46.91 ? 27   PRO E CB  1 
ATOM   6959  N  N   . ALA E  5  28  ? 8.409   89.239  60.897  1.00 46.91 ? 28   ALA E N   1 
ATOM   6960  C  CA  . ALA E  5  28  ? 7.689   89.575  62.119  1.00 46.91 ? 28   ALA E CA  1 
ATOM   6961  C  C   . ALA E  5  28  ? 6.208   89.247  61.965  1.00 46.91 ? 28   ALA E C   1 
ATOM   6962  O  O   . ALA E  5  28  ? 5.461   89.233  62.944  1.00 46.91 ? 28   ALA E O   1 
ATOM   6963  C  CB  . ALA E  5  28  ? 7.875   91.050  62.447  1.00 46.91 ? 28   ALA E CB  1 
ATOM   6964  N  N   . LEU E  5  29  ? 5.786   89.036  60.722  1.00 46.91 ? 29   LEU E N   1 
ATOM   6965  C  CA  . LEU E  5  29  ? 4.401   88.703  60.408  1.00 46.91 ? 29   LEU E CA  1 
ATOM   6966  C  C   . LEU E  5  29  ? 4.225   87.188  60.350  1.00 46.91 ? 29   LEU E C   1 
ATOM   6967  O  O   . LEU E  5  29  ? 3.149   86.667  60.645  1.00 46.91 ? 29   LEU E O   1 
ATOM   6968  C  CB  . LEU E  5  29  ? 3.994   89.322  59.070  1.00 46.91 ? 29   LEU E CB  1 
ATOM   6969  N  N   . PHE E  5  30  ? 5.274   86.497  59.917  1.00 46.91 ? 30   PHE E N   1 
ATOM   6970  C  CA  . PHE E  5  30  ? 5.258   85.043  59.821  1.00 46.91 ? 30   PHE E CA  1 
ATOM   6971  C  C   . PHE E  5  30  ? 5.356   84.422  61.210  1.00 46.91 ? 30   PHE E C   1 
ATOM   6972  O  O   . PHE E  5  30  ? 4.662   83.453  61.513  1.00 46.91 ? 30   PHE E O   1 
ATOM   6973  C  CB  . PHE E  5  30  ? 6.414   84.552  58.945  1.00 46.91 ? 30   PHE E CB  1 
ATOM   6974  N  N   . ILE E  5  31  ? 6.233   84.982  62.040  1.00 46.91 ? 31   ILE E N   1 
ATOM   6975  C  CA  . ILE E  5  31  ? 6.430   84.499  63.403  1.00 46.91 ? 31   ILE E CA  1 
ATOM   6976  C  C   . ILE E  5  31  ? 5.258   84.889  64.305  1.00 46.91 ? 31   ILE E C   1 
ATOM   6977  O  O   . ILE E  5  31  ? 5.147   84.409  65.437  1.00 46.91 ? 31   ILE E O   1 
ATOM   6978  C  CB  . ILE E  5  31  ? 7.732   85.054  64.015  1.00 46.91 ? 31   ILE E CB  1 
ATOM   6979  N  N   . ALA E  5  32  ? 4.420   85.799  63.817  1.00 46.91 ? 32   ALA E N   1 
ATOM   6980  C  CA  . ALA E  5  32  ? 3.250   86.256  64.556  1.00 46.91 ? 32   ALA E CA  1 
ATOM   6981  C  C   . ALA E  5  32  ? 2.053   85.337  64.307  1.00 46.91 ? 32   ALA E C   1 
ATOM   6982  O  O   . ALA E  5  32  ? 0.972   85.545  64.868  1.00 46.91 ? 32   ALA E O   1 
ATOM   6983  C  CB  . ALA E  5  32  ? 2.906   87.686  64.163  1.00 46.91 ? 32   ALA E CB  1 
ATOM   6984  N  N   . GLY E  5  33  ? 2.251   84.338  63.449  1.00 46.91 ? 33   GLY E N   1 
ATOM   6985  C  CA  . GLY E  5  33  ? 1.190   83.398  63.136  1.00 46.91 ? 33   GLY E CA  1 
ATOM   6986  C  C   . GLY E  5  33  ? 1.641   81.951  63.206  1.00 46.91 ? 33   GLY E C   1 
ATOM   6987  O  O   . GLY E  5  33  ? 0.870   81.043  62.882  1.00 46.91 ? 33   GLY E O   1 
ATOM   6988  N  N   . TRP E  5  34  ? 2.889   81.736  63.613  1.00 46.91 ? 34   TRP E N   1 
ATOM   6989  C  CA  . TRP E  5  34  ? 3.451   80.394  63.729  1.00 46.91 ? 34   TRP E CA  1 
ATOM   6990  C  C   . TRP E  5  34  ? 3.678   80.033  65.194  1.00 46.91 ? 34   TRP E C   1 
ATOM   6991  O  O   . TRP E  5  34  ? 3.205   78.999  65.669  1.00 46.91 ? 34   TRP E O   1 
ATOM   6992  C  CB  . TRP E  5  34  ? 4.769   80.304  62.957  1.00 46.91 ? 34   TRP E CB  1 
ATOM   6993  N  N   . LEU E  5  35  ? 4.415   80.886  65.900  1.00 46.91 ? 35   LEU E N   1 
ATOM   6994  C  CA  . LEU E  5  35  ? 4.707   80.682  67.316  1.00 46.91 ? 35   LEU E CA  1 
ATOM   6995  C  C   . LEU E  5  35  ? 3.468   80.969  68.164  1.00 46.91 ? 35   LEU E C   1 
ATOM   6996  O  O   . LEU E  5  35  ? 3.425   80.640  69.353  1.00 46.91 ? 35   LEU E O   1 
ATOM   6997  C  CB  . LEU E  5  35  ? 5.856   81.592  67.755  1.00 46.91 ? 35   LEU E CB  1 
ATOM   6998  N  N   . PHE E  5  36  ? 2.489   81.630  67.554  1.00 46.91 ? 36   PHE E N   1 
ATOM   6999  C  CA  . PHE E  5  36  ? 1.238   81.969  68.224  1.00 46.91 ? 36   PHE E CA  1 
ATOM   7000  C  C   . PHE E  5  36  ? 0.201   80.874  67.998  1.00 46.91 ? 36   PHE E C   1 
ATOM   7001  O  O   . PHE E  5  36  ? -0.546  80.515  68.910  1.00 46.91 ? 36   PHE E O   1 
ATOM   7002  C  CB  . PHE E  5  36  ? 0.703   83.305  67.703  1.00 46.91 ? 36   PHE E CB  1 
ATOM   7003  N  N   . VAL E  5  37  ? 0.151   80.360  66.773  1.00 46.91 ? 37   VAL E N   1 
ATOM   7004  C  CA  . VAL E  5  37  ? -0.788  79.304  66.411  1.00 46.91 ? 37   VAL E CA  1 
ATOM   7005  C  C   . VAL E  5  37  ? -0.250  77.918  66.778  1.00 46.91 ? 37   VAL E C   1 
ATOM   7006  O  O   . VAL E  5  37  ? -0.730  76.901  66.272  1.00 46.91 ? 37   VAL E O   1 
ATOM   7007  C  CB  . VAL E  5  37  ? -1.107  79.335  64.900  1.00 46.91 ? 37   VAL E CB  1 
ATOM   7008  N  N   . SER E  5  38  ? 0.736   77.884  67.667  1.00 46.91 ? 38   SER E N   1 
ATOM   7009  C  CA  . SER E  5  38  ? 1.336   76.628  68.100  1.00 46.91 ? 38   SER E CA  1 
ATOM   7010  C  C   . SER E  5  38  ? 1.431   76.552  69.618  1.00 46.91 ? 38   SER E C   1 
ATOM   7011  O  O   . SER E  5  38  ? 1.178   75.503  70.214  1.00 46.91 ? 38   SER E O   1 
ATOM   7012  C  CB  . SER E  5  38  ? 2.730   76.470  67.488  1.00 46.91 ? 38   SER E CB  1 
ATOM   7013  N  N   . THR E  5  39  ? 1.812   77.666  70.236  1.00 46.91 ? 39   THR E N   1 
ATOM   7014  C  CA  . THR E  5  39  ? 1.955   77.740  71.685  1.00 46.91 ? 39   THR E CA  1 
ATOM   7015  C  C   . THR E  5  39  ? 0.694   78.247  72.383  1.00 46.91 ? 39   THR E C   1 
ATOM   7016  O  O   . THR E  5  39  ? 0.666   78.374  73.611  1.00 46.91 ? 39   THR E O   1 
ATOM   7017  C  CB  . THR E  5  39  ? 3.136   78.648  72.079  1.00 46.91 ? 39   THR E CB  1 
ATOM   7018  N  N   . GLY E  5  40  ? -0.346  78.535  71.606  1.00 46.91 ? 40   GLY E N   1 
ATOM   7019  C  CA  . GLY E  5  40  ? -1.584  79.022  72.185  1.00 46.91 ? 40   GLY E CA  1 
ATOM   7020  C  C   . GLY E  5  40  ? -2.677  79.322  71.179  1.00 46.91 ? 40   GLY E C   1 
ATOM   7021  O  O   . GLY E  5  40  ? -3.209  80.433  71.148  1.00 46.91 ? 40   GLY E O   1 
ATOM   7022  N  N   . LEU E  5  41  ? -3.030  78.324  70.373  1.00 46.91 ? 41   LEU E N   1 
ATOM   7023  C  CA  . LEU E  5  41  ? -4.073  78.479  69.362  1.00 46.91 ? 41   LEU E CA  1 
ATOM   7024  C  C   . LEU E  5  41  ? -5.444  78.160  69.955  1.00 46.91 ? 41   LEU E C   1 
ATOM   7025  O  O   . LEU E  5  41  ? -6.455  78.458  69.283  1.00 46.91 ? 41   LEU E O   1 
ATOM   7026  C  CB  . LEU E  5  41  ? -3.796  77.563  68.165  1.00 46.91 ? 41   LEU E CB  1 
ATOM   7027  N  N   . PRO F  6  13  ? 6.101   86.090  29.905  1.00 46.91 ? 13   PRO F N   1 
ATOM   7028  C  CA  . PRO F  6  13  ? 5.711   84.908  30.702  1.00 46.91 ? 13   PRO F CA  1 
ATOM   7029  C  C   . PRO F  6  13  ? 4.298   85.068  31.256  1.00 46.91 ? 13   PRO F C   1 
ATOM   7030  O  O   . PRO F  6  13  ? 3.445   84.206  31.051  1.00 46.91 ? 13   PRO F O   1 
ATOM   7031  C  CB  . PRO F  6  13  ? 6.727   84.788  31.828  1.00 46.91 ? 13   PRO F CB  1 
ATOM   7032  C  CG  . PRO F  6  13  ? 7.219   86.231  31.955  1.00 46.91 ? 13   PRO F CG  1 
ATOM   7033  C  CD  . PRO F  6  13  ? 7.278   86.734  30.512  1.00 46.91 ? 13   PRO F CD  1 
ATOM   7034  N  N   . ILE F  6  14  ? 4.057   86.191  31.925  1.00 46.91 ? 14   ILE F N   1 
ATOM   7035  C  CA  . ILE F  6  14  ? 2.753   86.489  32.508  1.00 46.91 ? 14   ILE F CA  1 
ATOM   7036  C  C   . ILE F  6  14  ? 2.590   87.986  32.747  1.00 46.91 ? 14   ILE F C   1 
ATOM   7037  O  O   . ILE F  6  14  ? 1.506   88.538  32.542  1.00 46.91 ? 14   ILE F O   1 
ATOM   7038  C  CB  . ILE F  6  14  ? 2.547   85.750  33.844  1.00 46.91 ? 14   ILE F CB  1 
ATOM   7039  N  N   . PHE F  6  15  ? 3.674   88.631  33.178  1.00 46.91 ? 15   PHE F N   1 
ATOM   7040  C  CA  . PHE F  6  15  ? 3.690   90.067  33.458  1.00 46.91 ? 15   PHE F CA  1 
ATOM   7041  C  C   . PHE F  6  15  ? 2.719   90.480  34.565  1.00 46.91 ? 15   PHE F C   1 
ATOM   7042  O  O   . PHE F  6  15  ? 2.507   91.670  34.807  1.00 46.91 ? 15   PHE F O   1 
ATOM   7043  C  CB  . PHE F  6  15  ? 3.403   90.868  32.183  1.00 46.91 ? 15   PHE F CB  1 
ATOM   7044  N  N   . THR F  6  16  ? 2.131   89.492  35.232  1.00 46.91 ? 16   THR F N   1 
ATOM   7045  C  CA  . THR F  6  16  ? 1.192   89.742  36.318  1.00 46.91 ? 16   THR F CA  1 
ATOM   7046  C  C   . THR F  6  16  ? 1.736   89.158  37.616  1.00 46.91 ? 16   THR F C   1 
ATOM   7047  O  O   . THR F  6  16  ? 1.383   89.607  38.707  1.00 46.91 ? 16   THR F O   1 
ATOM   7048  C  CB  . THR F  6  16  ? -0.180  89.111  36.022  1.00 46.91 ? 16   THR F CB  1 
ATOM   7049  N  N   . VAL F  6  17  ? 2.585   88.143  37.483  1.00 46.91 ? 17   VAL F N   1 
ATOM   7050  C  CA  . VAL F  6  17  ? 3.200   87.478  38.624  1.00 46.91 ? 17   VAL F CA  1 
ATOM   7051  C  C   . VAL F  6  17  ? 4.449   86.734  38.164  1.00 46.91 ? 17   VAL F C   1 
ATOM   7052  O  O   . VAL F  6  17  ? 5.568   87.125  38.497  1.00 46.91 ? 17   VAL F O   1 
ATOM   7053  C  CB  . VAL F  6  17  ? 2.227   86.484  39.286  1.00 46.91 ? 17   VAL F CB  1 
ATOM   7054  N  N   . ARG F  6  18  ? 4.244   85.684  37.371  1.00 46.91 ? 18   ARG F N   1 
ATOM   7055  C  CA  . ARG F  6  18  ? 5.329   84.861  36.836  1.00 46.91 ? 18   ARG F CA  1 
ATOM   7056  C  C   . ARG F  6  18  ? 6.222   84.243  37.914  1.00 46.91 ? 18   ARG F C   1 
ATOM   7057  O  O   . ARG F  6  18  ? 6.001   83.104  38.327  1.00 46.91 ? 18   ARG F O   1 
ATOM   7058  C  CB  . ARG F  6  18  ? 6.170   85.663  35.834  1.00 46.91 ? 18   ARG F CB  1 
ATOM   7059  N  N   . TRP F  6  19  ? 7.244   84.982  38.339  1.00 46.91 ? 19   TRP F N   1 
ATOM   7060  C  CA  . TRP F  6  19  ? 8.170   84.513  39.365  1.00 46.91 ? 19   TRP F CA  1 
ATOM   7061  C  C   . TRP F  6  19  ? 7.465   84.383  40.715  1.00 46.91 ? 19   TRP F C   1 
ATOM   7062  O  O   . TRP F  6  19  ? 7.701   83.432  41.461  1.00 46.91 ? 19   TRP F O   1 
ATOM   7063  C  CB  . TRP F  6  19  ? 9.356   85.480  39.479  1.00 46.91 ? 19   TRP F CB  1 
ATOM   7064  C  CG  . TRP F  6  19  ? 10.534  84.936  40.242  1.00 46.91 ? 19   TRP F CG  1 
ATOM   7065  C  CD1 . TRP F  6  19  ? 10.659  84.832  41.598  1.00 46.91 ? 19   TRP F CD1 1 
ATOM   7066  C  CD2 . TRP F  6  19  ? 11.758  84.434  39.685  1.00 46.91 ? 19   TRP F CD2 1 
ATOM   7067  N  NE1 . TRP F  6  19  ? 11.884  84.296  41.921  1.00 46.91 ? 19   TRP F NE1 1 
ATOM   7068  C  CE2 . TRP F  6  19  ? 12.575  84.042  40.772  1.00 46.91 ? 19   TRP F CE2 1 
ATOM   7069  C  CE3 . TRP F  6  19  ? 12.240  84.277  38.379  1.00 46.91 ? 19   TRP F CE3 1 
ATOM   7070  C  CZ2 . TRP F  6  19  ? 13.856  83.503  40.585  1.00 46.91 ? 19   TRP F CZ2 1 
ATOM   7071  C  CZ3 . TRP F  6  19  ? 13.512  83.740  38.196  1.00 46.91 ? 19   TRP F CZ3 1 
ATOM   7072  C  CH2 . TRP F  6  19  ? 14.304  83.359  39.296  1.00 46.91 ? 19   TRP F CH2 1 
ATOM   7073  N  N   . VAL F  6  20  ? 6.617   85.359  41.029  1.00 46.91 ? 20   VAL F N   1 
ATOM   7074  C  CA  . VAL F  6  20  ? 5.872   85.371  42.284  1.00 46.91 ? 20   VAL F CA  1 
ATOM   7075  C  C   . VAL F  6  20  ? 4.745   84.338  42.277  1.00 46.91 ? 20   VAL F C   1 
ATOM   7076  O  O   . VAL F  6  20  ? 3.591   84.656  41.972  1.00 46.91 ? 20   VAL F O   1 
ATOM   7077  C  CB  . VAL F  6  20  ? 5.285   86.769  42.572  1.00 46.91 ? 20   VAL F CB  1 
ATOM   7078  N  N   . ALA F  6  21  ? 5.089   83.104  42.634  1.00 46.91 ? 21   ALA F N   1 
ATOM   7079  C  CA  . ALA F  6  21  ? 4.128   82.006  42.677  1.00 46.91 ? 21   ALA F CA  1 
ATOM   7080  C  C   . ALA F  6  21  ? 4.642   80.897  43.587  1.00 46.91 ? 21   ALA F C   1 
ATOM   7081  O  O   . ALA F  6  21  ? 3.890   80.348  44.394  1.00 46.91 ? 21   ALA F O   1 
ATOM   7082  C  CB  . ALA F  6  21  ? 3.886   81.463  41.272  1.00 46.91 ? 21   ALA F CB  1 
ATOM   7083  N  N   . VAL F  6  22  ? 5.919   80.561  43.433  1.00 46.91 ? 22   VAL F N   1 
ATOM   7084  C  CA  . VAL F  6  22  ? 6.554   79.521  44.235  1.00 46.91 ? 22   VAL F CA  1 
ATOM   7085  C  C   . VAL F  6  22  ? 6.783   79.990  45.669  1.00 46.91 ? 22   VAL F C   1 
ATOM   7086  O  O   . VAL F  6  22  ? 6.894   79.175  46.587  1.00 46.91 ? 22   VAL F O   1 
ATOM   7087  C  CB  . VAL F  6  22  ? 7.907   79.098  43.632  1.00 46.91 ? 22   VAL F CB  1 
ATOM   7088  N  N   . HIS F  6  23  ? 6.883   81.305  45.846  1.00 46.91 ? 23   HIS F N   1 
ATOM   7089  C  CA  . HIS F  6  23  ? 7.100   81.898  47.161  1.00 46.91 ? 23   HIS F CA  1 
ATOM   7090  C  C   . HIS F  6  23  ? 5.866   81.768  48.052  1.00 46.91 ? 23   HIS F C   1 
ATOM   7091  O  O   . HIS F  6  23  ? 5.955   81.910  49.273  1.00 46.91 ? 23   HIS F O   1 
ATOM   7092  C  CB  . HIS F  6  23  ? 7.483   83.373  47.017  1.00 46.91 ? 23   HIS F CB  1 
ATOM   7093  N  N   . THR F  6  24  ? 4.714   81.539  47.431  1.00 46.91 ? 24   THR F N   1 
ATOM   7094  C  CA  . THR F  6  24  ? 3.459   81.388  48.158  1.00 46.91 ? 24   THR F CA  1 
ATOM   7095  C  C   . THR F  6  24  ? 3.430   80.079  48.945  1.00 46.91 ? 24   THR F C   1 
ATOM   7096  O  O   . THR F  6  24  ? 2.867   80.016  50.039  1.00 46.91 ? 24   THR F O   1 
ATOM   7097  C  CB  . THR F  6  24  ? 2.254   81.418  47.203  1.00 46.91 ? 24   THR F CB  1 
ATOM   7098  N  N   . LEU F  6  25  ? 4.002   79.031  48.359  1.00 46.91 ? 25   LEU F N   1 
ATOM   7099  C  CA  . LEU F  6  25  ? 4.058   77.719  48.996  1.00 46.91 ? 25   LEU F CA  1 
ATOM   7100  C  C   . LEU F  6  25  ? 5.268   77.616  49.922  1.00 46.91 ? 25   LEU F C   1 
ATOM   7101  O  O   . LEU F  6  25  ? 5.273   76.822  50.867  1.00 46.91 ? 25   LEU F O   1 
ATOM   7102  C  CB  . LEU F  6  25  ? 4.124   76.618  47.934  1.00 46.91 ? 25   LEU F CB  1 
ATOM   7103  N  N   . ALA F  6  26  ? 6.302   78.399  49.621  1.00 46.91 ? 26   ALA F N   1 
ATOM   7104  C  CA  . ALA F  6  26  ? 7.526   78.412  50.417  1.00 46.91 ? 26   ALA F CA  1 
ATOM   7105  C  C   . ALA F  6  26  ? 7.320   79.155  51.735  1.00 46.91 ? 26   ALA F C   1 
ATOM   7106  O  O   . ALA F  6  26  ? 8.203   79.169  52.594  1.00 46.91 ? 26   ALA F O   1 
ATOM   7107  C  CB  . ALA F  6  26  ? 8.659   79.045  49.625  1.00 46.91 ? 26   ALA F CB  1 
ATOM   7108  N  N   . VAL F  6  27  ? 6.159   79.790  51.873  1.00 46.91 ? 27   VAL F N   1 
ATOM   7109  C  CA  . VAL F  6  27  ? 5.812   80.532  53.081  1.00 46.91 ? 27   VAL F CA  1 
ATOM   7110  C  C   . VAL F  6  27  ? 5.684   79.573  54.263  1.00 46.91 ? 27   VAL F C   1 
ATOM   7111  O  O   . VAL F  6  27  ? 5.832   79.971  55.419  1.00 46.91 ? 27   VAL F O   1 
ATOM   7112  C  CB  . VAL F  6  27  ? 4.484   81.288  52.911  1.00 46.91 ? 27   VAL F CB  1 
ATOM   7113  N  N   . PRO F  6  28  ? 5.389   78.294  53.979  1.00 46.91 ? 28   PRO F N   1 
ATOM   7114  C  CA  . PRO F  6  28  ? 5.227   77.223  54.969  1.00 46.91 ? 28   PRO F CA  1 
ATOM   7115  C  C   . PRO F  6  28  ? 6.556   76.803  55.594  1.00 46.91 ? 28   PRO F C   1 
ATOM   7116  O  O   . PRO F  6  28  ? 6.593   75.936  56.468  1.00 46.91 ? 28   PRO F O   1 
ATOM   7117  C  CB  . PRO F  6  28  ? 4.608   76.085  54.159  1.00 46.91 ? 28   PRO F CB  1 
ATOM   7118  N  N   . THR F  6  29  ? 7.647   77.382  55.101  1.00 46.91 ? 29   THR F N   1 
ATOM   7119  C  CA  . THR F  6  29  ? 8.979   77.083  55.612  1.00 46.91 ? 29   THR F CA  1 
ATOM   7120  C  C   . THR F  6  29  ? 9.212   77.788  56.945  1.00 46.91 ? 29   THR F C   1 
ATOM   7121  O  O   . THR F  6  29  ? 9.977   77.310  57.784  1.00 46.91 ? 29   THR F O   1 
ATOM   7122  C  CB  . THR F  6  29  ? 10.070  77.531  54.625  1.00 46.91 ? 29   THR F CB  1 
ATOM   7123  N  N   . ILE F  6  30  ? 8.593   78.953  57.105  1.00 46.91 ? 30   ILE F N   1 
ATOM   7124  C  CA  . ILE F  6  30  ? 8.715   79.736  58.329  1.00 46.91 ? 30   ILE F CA  1 
ATOM   7125  C  C   . ILE F  6  30  ? 7.694   79.283  59.368  1.00 46.91 ? 30   ILE F C   1 
ATOM   7126  O  O   . ILE F  6  30  ? 7.895   79.470  60.568  1.00 46.91 ? 30   ILE F O   1 
ATOM   7127  C  CB  . ILE F  6  30  ? 8.523   81.225  58.029  1.00 46.91 ? 30   ILE F CB  1 
ATOM   7128  N  N   . PHE F  6  31  ? 6.593   78.708  58.892  1.00 46.91 ? 31   PHE F N   1 
ATOM   7129  C  CA  . PHE F  6  31  ? 5.526   78.217  59.760  1.00 46.91 ? 31   PHE F CA  1 
ATOM   7130  C  C   . PHE F  6  31  ? 6.008   76.995  60.538  1.00 46.91 ? 31   PHE F C   1 
ATOM   7131  O  O   . PHE F  6  31  ? 5.565   76.742  61.659  1.00 46.91 ? 31   PHE F O   1 
ATOM   7132  C  CB  . PHE F  6  31  ? 4.300   77.852  58.916  1.00 46.91 ? 31   PHE F CB  1 
ATOM   7133  C  CG  . PHE F  6  31  ? 3.080   77.518  59.728  1.00 46.91 ? 31   PHE F CG  1 
ATOM   7134  C  CD1 . PHE F  6  31  ? 2.308   78.529  60.292  1.00 46.91 ? 31   PHE F CD1 1 
ATOM   7135  C  CD2 . PHE F  6  31  ? 2.694   76.194  59.917  1.00 46.91 ? 31   PHE F CD2 1 
ATOM   7136  C  CE1 . PHE F  6  31  ? 1.175   78.227  61.043  1.00 46.91 ? 31   PHE F CE1 1 
ATOM   7137  C  CE2 . PHE F  6  31  ? 1.561   75.881  60.667  1.00 46.91 ? 31   PHE F CE2 1 
ATOM   7138  C  CZ  . PHE F  6  31  ? 0.798   76.902  61.227  1.00 46.91 ? 31   PHE F CZ  1 
ATOM   7139  N  N   . PHE F  6  32  ? 6.879   76.214  59.905  1.00 46.91 ? 32   PHE F N   1 
ATOM   7140  C  CA  . PHE F  6  32  ? 7.434   75.014  60.516  1.00 46.91 ? 32   PHE F CA  1 
ATOM   7141  C  C   . PHE F  6  32  ? 8.679   75.331  61.341  1.00 46.91 ? 32   PHE F C   1 
ATOM   7142  O  O   . PHE F  6  32  ? 9.183   74.473  62.069  1.00 46.91 ? 32   PHE F O   1 
ATOM   7143  C  CB  . PHE F  6  32  ? 7.772   73.984  59.436  1.00 46.91 ? 32   PHE F CB  1 
ATOM   7144  N  N   . LEU F  6  33  ? 9.199   76.545  61.181  1.00 46.91 ? 33   LEU F N   1 
ATOM   7145  C  CA  . LEU F  6  33  ? 10.382  76.987  61.910  1.00 46.91 ? 33   LEU F CA  1 
ATOM   7146  C  C   . LEU F  6  33  ? 10.021  77.473  63.312  1.00 46.91 ? 33   LEU F C   1 
ATOM   7147  O  O   . LEU F  6  33  ? 10.817  77.342  64.246  1.00 46.91 ? 33   LEU F O   1 
ATOM   7148  C  CB  . LEU F  6  33  ? 11.094  78.103  61.138  1.00 46.91 ? 33   LEU F CB  1 
ATOM   7149  N  N   . GLY F  6  34  ? 8.837   78.068  63.440  1.00 46.91 ? 34   GLY F N   1 
ATOM   7150  C  CA  . GLY F  6  34  ? 8.383   78.568  64.726  1.00 46.91 ? 34   GLY F CA  1 
ATOM   7151  C  C   . GLY F  6  34  ? 7.671   77.516  65.555  1.00 46.91 ? 34   GLY F C   1 
ATOM   7152  O  O   . GLY F  6  34  ? 7.718   77.552  66.786  1.00 46.91 ? 34   GLY F O   1 
ATOM   7153  N  N   . ALA F  6  35  ? 6.992   76.593  64.882  1.00 46.91 ? 35   ALA F N   1 
ATOM   7154  C  CA  . ALA F  6  35  ? 6.262   75.521  65.552  1.00 46.91 ? 35   ALA F CA  1 
ATOM   7155  C  C   . ALA F  6  35  ? 7.212   74.489  66.155  1.00 46.91 ? 35   ALA F C   1 
ATOM   7156  O  O   . ALA F  6  35  ? 6.837   73.740  67.061  1.00 46.91 ? 35   ALA F O   1 
ATOM   7157  C  CB  . ALA F  6  35  ? 5.304   74.851  64.576  1.00 46.91 ? 35   ALA F CB  1 
ATOM   7158  N  N   . ILE F  6  36  ? 8.425   74.425  65.613  1.00 46.91 ? 36   ILE F N   1 
ATOM   7159  C  CA  . ILE F  6  36  ? 9.439   73.493  66.090  1.00 46.91 ? 36   ILE F CA  1 
ATOM   7160  C  C   . ILE F  6  36  ? 10.237  74.088  67.248  1.00 46.91 ? 36   ILE F C   1 
ATOM   7161  O  O   . ILE F  6  36  ? 10.903  73.363  67.990  1.00 46.91 ? 36   ILE F O   1 
ATOM   7162  C  CB  . ILE F  6  36  ? 10.414  73.108  64.962  1.00 46.91 ? 36   ILE F CB  1 
ATOM   7163  N  N   . ALA F  6  37  ? 10.197  75.412  67.370  1.00 46.91 ? 37   ALA F N   1 
ATOM   7164  C  CA  . ALA F  6  37  ? 10.910  76.116  68.431  1.00 46.91 ? 37   ALA F CA  1 
ATOM   7165  C  C   . ALA F  6  37  ? 10.017  76.369  69.645  1.00 46.91 ? 37   ALA F C   1 
ATOM   7166  O  O   . ALA F  6  37  ? 10.503  76.748  70.714  1.00 46.91 ? 37   ALA F O   1 
ATOM   7167  C  CB  . ALA F  6  37  ? 11.465  77.434  67.901  1.00 46.91 ? 37   ALA F CB  1 
ATOM   7168  N  N   . ALA F  6  38  ? 8.713   76.191  69.462  1.00 46.91 ? 38   ALA F N   1 
ATOM   7169  C  CA  . ALA F  6  38  ? 7.744   76.398  70.533  1.00 46.91 ? 38   ALA F CA  1 
ATOM   7170  C  C   . ALA F  6  38  ? 7.499   75.119  71.331  1.00 46.91 ? 38   ALA F C   1 
ATOM   7171  O  O   . ALA F  6  38  ? 7.076   75.172  72.487  1.00 46.91 ? 38   ALA F O   1 
ATOM   7172  C  CB  . ALA F  6  38  ? 6.434   76.921  69.959  1.00 46.91 ? 38   ALA F CB  1 
ATOM   7173  N  N   . MET F  6  39  ? 7.730   73.975  70.693  1.00 46.91 ? 39   MET F N   1 
ATOM   7174  C  CA  . MET F  6  39  ? 7.536   72.678  71.334  1.00 46.91 ? 39   MET F CA  1 
ATOM   7175  C  C   . MET F  6  39  ? 8.828   72.124  71.930  1.00 46.91 ? 39   MET F C   1 
ATOM   7176  O  O   . MET F  6  39  ? 8.814   71.097  72.615  1.00 46.91 ? 39   MET F O   1 
ATOM   7177  C  CB  . MET F  6  39  ? 6.958   71.677  70.330  1.00 46.91 ? 39   MET F CB  1 
ATOM   7178  N  N   . GLN F  6  40  ? 9.944   72.785  71.641  1.00 46.91 ? 40   GLN F N   1 
ATOM   7179  C  CA  . GLN F  6  40  ? 11.246  72.361  72.144  1.00 46.91 ? 40   GLN F CA  1 
ATOM   7180  C  C   . GLN F  6  40  ? 11.688  73.173  73.361  1.00 46.91 ? 40   GLN F C   1 
ATOM   7181  O  O   . GLN F  6  40  ? 12.554  72.736  74.125  1.00 46.91 ? 40   GLN F O   1 
ATOM   7182  C  CB  . GLN F  6  40  ? 12.301  72.469  71.039  1.00 46.91 ? 40   GLN F CB  1 
ATOM   7183  N  N   . PHE F  6  41  ? 11.111  74.359  73.523  1.00 46.91 ? 41   PHE F N   1 
ATOM   7184  C  CA  . PHE F  6  41  ? 11.445  75.237  74.640  1.00 46.91 ? 41   PHE F CA  1 
ATOM   7185  C  C   . PHE F  6  41  ? 10.531  75.028  75.847  1.00 46.91 ? 41   PHE F C   1 
ATOM   7186  O  O   . PHE F  6  41  ? 10.954  75.211  76.991  1.00 46.91 ? 41   PHE F O   1 
ATOM   7187  C  CB  . PHE F  6  41  ? 11.393  76.702  74.194  1.00 46.91 ? 41   PHE F CB  1 
ATOM   7188  N  N   . ILE F  6  42  ? 9.274   74.679  75.584  1.00 46.91 ? 42   ILE F N   1 
ATOM   7189  C  CA  . ILE F  6  42  ? 8.294   74.449  76.641  1.00 46.91 ? 42   ILE F CA  1 
ATOM   7190  C  C   . ILE F  6  42  ? 8.128   72.957  76.921  1.00 46.91 ? 42   ILE F C   1 
ATOM   7191  O  O   . ILE F  6  42  ? 7.676   72.628  78.041  1.00 46.91 ? 42   ILE F O   1 
ATOM   7192  C  CB  . ILE F  6  42  ? 6.919   75.041  76.264  1.00 46.91 ? 42   ILE F CB  1 
ATOM   7193  C  CA  . UNK G  7  1   ? 28.766  39.745  10.363  1.00 66.91 ? 1    UNK G CA  1 
ATOM   7194  C  CA  . UNK G  7  2   ? 25.108  38.807  10.705  1.00 66.91 ? 2    UNK G CA  1 
ATOM   7195  C  CA  . UNK G  7  3   ? 26.637  35.411  11.378  1.00 66.91 ? 3    UNK G CA  1 
ATOM   7196  C  CA  . UNK G  7  4   ? 28.184  36.101  14.764  1.00 66.91 ? 4    UNK G CA  1 
ATOM   7197  C  CA  . UNK G  7  5   ? 25.227  38.273  15.735  1.00 66.91 ? 5    UNK G CA  1 
ATOM   7198  C  CA  . UNK G  7  6   ? 22.829  35.487  14.704  1.00 66.91 ? 6    UNK G CA  1 
ATOM   7199  C  CA  . UNK G  7  7   ? 24.856  32.838  16.543  1.00 66.91 ? 7    UNK G CA  1 
ATOM   7200  C  CA  . UNK G  7  8   ? 25.153  34.792  19.781  1.00 66.91 ? 8    UNK G CA  1 
ATOM   7201  C  CA  . UNK G  7  9   ? 21.472  35.808  19.680  1.00 66.91 ? 9    UNK G CA  1 
ATOM   7202  C  CA  . UNK G  7  10  ? 20.135  32.264  19.266  1.00 66.91 ? 10   UNK G CA  1 
ATOM   7203  C  CA  . UNK G  7  11  ? 23.085  30.680  21.098  1.00 66.91 ? 11   UNK G CA  1 
ATOM   7204  C  CA  . UNK G  7  12  ? 22.390  32.969  24.034  1.00 66.91 ? 12   UNK G CA  1 
ATOM   7205  C  CA  . UNK G  7  13  ? 18.588  32.611  23.981  1.00 66.91 ? 13   UNK G CA  1 
ATOM   7206  C  CA  . UNK G  7  14  ? 18.464  28.948  23.078  1.00 66.91 ? 14   UNK G CA  1 
ATOM   7207  C  CA  . UNK G  7  15  ? 21.541  27.908  24.975  1.00 66.91 ? 15   UNK G CA  1 
ATOM   7208  C  CA  . UNK G  7  16  ? 20.785  29.769  28.139  1.00 66.91 ? 16   UNK G CA  1 
ATOM   7209  C  CA  . UNK G  7  17  ? 17.031  28.954  28.060  1.00 66.91 ? 17   UNK G CA  1 
ATOM   7210  C  CA  . UNK G  7  18  ? 17.714  25.438  26.842  1.00 66.91 ? 18   UNK G CA  1 
ATOM   7211  C  CA  . UNK G  7  19  ? 20.101  24.737  29.728  1.00 66.91 ? 19   UNK G CA  1 
ATOM   7212  C  CA  . UNK G  7  20  ? 17.532  26.291  32.058  1.00 66.91 ? 20   UNK G CA  1 
ATOM   7213  C  CA  . UNK G  7  21  ? 14.668  23.946  31.074  1.00 66.91 ? 21   UNK G CA  1 
ATOM   7214  C  CA  . UNK G  7  22  ? 17.082  21.006  31.169  1.00 66.91 ? 22   UNK G CA  1 
ATOM   7215  C  CA  . UNK G  7  23  ? 18.497  21.899  34.590  1.00 66.91 ? 23   UNK G CA  1 
ATOM   7216  C  CA  . UNK G  7  24  ? 15.230  22.595  36.392  1.00 66.91 ? 24   UNK G CA  1 
ATOM   7217  C  CA  . UNK G  7  25  ? 13.284  19.693  34.918  1.00 66.91 ? 25   UNK G CA  1 
ATOM   7218  C  CA  . UNK G  7  26  ? 15.445  18.219  37.656  1.00 66.91 ? 26   UNK G CA  1 
ATOM   7219  C  CA  . UNK G  7  27  ? 15.853  20.665  40.534  1.00 66.91 ? 27   UNK G CA  1 
ATOM   7220  C  CA  . UNK G  7  28  ? 15.124  19.014  43.872  1.00 66.91 ? 28   UNK G CA  1 
ATOM   7221  C  CA  . UNK G  7  29  ? 32.508  42.642  18.616  1.00 66.91 ? 29   UNK G CA  1 
ATOM   7222  C  CA  . UNK G  7  30  ? 30.110  44.602  20.824  1.00 66.91 ? 30   UNK G CA  1 
ATOM   7223  C  CA  . UNK G  7  31  ? 27.182  42.446  19.768  1.00 66.91 ? 31   UNK G CA  1 
ATOM   7224  C  CA  . UNK G  7  32  ? 29.145  39.523  21.168  1.00 66.91 ? 32   UNK G CA  1 
ATOM   7225  C  CA  . UNK G  7  33  ? 30.217  41.312  24.339  1.00 66.91 ? 33   UNK G CA  1 
ATOM   7226  C  CA  . UNK G  7  34  ? 26.608  42.380  24.972  1.00 66.91 ? 34   UNK G CA  1 
ATOM   7227  C  CA  . UNK G  7  35  ? 25.273  38.882  24.255  1.00 66.91 ? 35   UNK G CA  1 
ATOM   7228  C  CA  . UNK G  7  36  ? 27.762  37.081  26.484  1.00 66.91 ? 36   UNK G CA  1 
ATOM   7229  C  CA  . UNK G  7  37  ? 27.319  39.631  29.295  1.00 66.91 ? 37   UNK G CA  1 
ATOM   7230  C  CA  . UNK G  7  38  ? 23.534  39.196  29.385  1.00 66.91 ? 38   UNK G CA  1 
ATOM   7231  C  CA  . UNK G  7  39  ? 23.829  35.411  28.982  1.00 66.91 ? 39   UNK G CA  1 
ATOM   7232  C  CA  . UNK G  7  40  ? 26.122  35.349  31.996  1.00 66.91 ? 40   UNK G CA  1 
ATOM   7233  C  CA  . UNK G  7  41  ? 24.088  37.797  34.109  1.00 66.91 ? 41   UNK G CA  1 
ATOM   7234  C  CA  . UNK G  7  42  ? 20.867  35.952  33.414  1.00 66.91 ? 42   UNK G CA  1 
ATOM   7235  C  CA  . UNK G  7  43  ? 22.235  32.469  33.865  1.00 66.91 ? 43   UNK G CA  1 
ATOM   7236  C  CA  . UNK G  7  44  ? 24.155  33.133  37.016  1.00 66.91 ? 44   UNK G CA  1 
ATOM   7237  C  CA  . UNK G  7  45  ? 21.482  35.413  38.569  1.00 66.91 ? 45   UNK G CA  1 
ATOM   7238  C  CA  . UNK G  7  46  ? 18.691  33.141  37.408  1.00 66.91 ? 46   UNK G CA  1 
ATOM   7239  C  CA  . UNK G  7  47  ? 20.557  29.937  38.293  1.00 66.91 ? 47   UNK G CA  1 
ATOM   7240  C  CA  . UNK G  7  48  ? 20.055  31.231  41.837  1.00 66.91 ? 48   UNK G CA  1 
ATOM   7241  C  CA  . UNK G  7  49  ? 16.231  31.307  41.662  1.00 66.91 ? 49   UNK G CA  1 
ATOM   7242  C  CA  . UNK G  7  50  ? 15.976  28.718  38.890  1.00 66.91 ? 50   UNK G CA  1 
ATOM   7243  C  CA  . UNK G  7  51  ? 17.452  25.735  40.730  1.00 66.91 ? 51   UNK G CA  1 
ATOM   7244  C  CA  . UNK G  7  52  ? 14.867  26.029  43.497  1.00 66.91 ? 52   UNK G CA  1 
ATOM   7245  C  CA  . UNK G  7  53  ? 44.419  43.259  24.811  1.00 66.91 ? 53   UNK G CA  1 
ATOM   7246  C  CA  . UNK G  7  54  ? 40.651  43.688  25.085  1.00 66.91 ? 54   UNK G CA  1 
ATOM   7247  C  CA  . UNK G  7  55  ? 40.023  40.657  22.905  1.00 66.91 ? 55   UNK G CA  1 
ATOM   7248  C  CA  . UNK G  7  56  ? 41.939  38.687  25.515  1.00 66.91 ? 56   UNK G CA  1 
ATOM   7249  C  CA  . UNK G  7  57  ? 40.234  40.310  28.492  1.00 66.91 ? 57   UNK G CA  1 
ATOM   7250  C  CA  . UNK G  7  58  ? 36.822  39.640  26.920  1.00 66.91 ? 58   UNK G CA  1 
ATOM   7251  C  CA  . UNK G  7  59  ? 37.739  36.043  26.061  1.00 66.91 ? 59   UNK G CA  1 
ATOM   7252  C  CA  . UNK G  7  60  ? 39.107  35.189  29.497  1.00 66.91 ? 60   UNK G CA  1 
ATOM   7253  C  CA  . UNK G  7  61  ? 36.174  36.894  31.255  1.00 66.91 ? 61   UNK G CA  1 
ATOM   7254  C  CA  . UNK G  7  62  ? 33.571  34.881  29.333  1.00 66.91 ? 62   UNK G CA  1 
ATOM   7255  C  CA  . UNK G  7  63  ? 35.621  31.677  29.657  1.00 66.91 ? 63   UNK G CA  1 
ATOM   7256  C  CA  . UNK G  7  64  ? 35.678  32.187  33.410  1.00 66.91 ? 64   UNK G CA  1 
ATOM   7257  C  CA  . UNK G  7  65  ? 32.012  33.203  33.702  1.00 66.91 ? 65   UNK G CA  1 
ATOM   7258  C  CA  . UNK G  7  66  ? 30.944  30.692  31.099  1.00 66.91 ? 66   UNK G CA  1 
ATOM   7259  C  CA  . UNK G  7  67  ? 33.437  27.989  31.900  1.00 66.91 ? 67   UNK G CA  1 
ATOM   7260  C  CA  . UNK G  7  68  ? 33.153  28.194  35.629  1.00 66.91 ? 68   UNK G CA  1 
ATOM   7261  C  CA  . UNK G  7  69  ? 29.341  28.650  35.557  1.00 66.91 ? 69   UNK G CA  1 
ATOM   7262  C  CA  . UNK G  7  70  ? 29.084  25.595  33.339  1.00 66.91 ? 70   UNK G CA  1 
ATOM   7263  C  CA  . UNK G  7  71  ? 31.015  23.440  35.820  1.00 66.91 ? 71   UNK G CA  1 
ATOM   7264  C  CA  . UNK G  7  72  ? 28.853  24.915  38.582  1.00 66.91 ? 72   UNK G CA  1 
ATOM   7265  C  CA  . UNK G  7  73  ? 25.509  23.862  37.040  1.00 66.91 ? 73   UNK G CA  1 
ATOM   7266  C  CA  . UNK G  7  74  ? 27.002  20.462  36.195  1.00 66.91 ? 74   UNK G CA  1 
ATOM   7267  C  CA  . UNK G  7  75  ? 28.421  19.889  39.684  1.00 66.91 ? 75   UNK G CA  1 
ATOM   7268  C  CA  . UNK G  7  76  ? 25.376  20.933  41.705  1.00 66.91 ? 76   UNK G CA  1 
ATOM   7269  C  CA  . UNK G  7  77  ? 22.785  19.250  39.504  1.00 66.91 ? 77   UNK G CA  1 
ATOM   7270  C  CA  . UNK G  7  78  ? 24.921  16.134  39.786  1.00 66.91 ? 78   UNK G CA  1 
ATOM   7271  C  CA  . UNK G  7  79  ? 64.339  53.965  40.839  1.00 66.91 ? 79   UNK G CA  1 
ATOM   7272  C  CA  . UNK G  7  80  ? 61.658  53.560  43.505  1.00 66.91 ? 80   UNK G CA  1 
ATOM   7273  C  CA  . UNK G  7  81  ? 59.526  51.435  41.209  1.00 66.91 ? 81   UNK G CA  1 
ATOM   7274  C  CA  . UNK G  7  82  ? 62.478  49.063  41.065  1.00 66.91 ? 82   UNK G CA  1 
ATOM   7275  C  CA  . UNK G  7  83  ? 63.200  49.182  44.788  1.00 66.91 ? 83   UNK G CA  1 
ATOM   7276  C  CA  . UNK G  7  84  ? 59.522  48.490  45.536  1.00 66.91 ? 84   UNK G CA  1 
ATOM   7277  C  CA  . UNK G  7  85  ? 59.363  45.665  42.984  1.00 66.91 ? 85   UNK G CA  1 
ATOM   7278  C  CA  . UNK G  7  86  ? 62.517  43.922  44.175  1.00 66.91 ? 86   UNK G CA  1 
ATOM   7279  C  CA  . UNK G  7  87  ? 61.531  44.319  47.846  1.00 66.91 ? 87   UNK G CA  1 
ATOM   7280  C  CA  . UNK G  7  88  ? 58.134  42.668  47.336  1.00 66.91 ? 88   UNK G CA  1 
ATOM   7281  C  CA  . UNK G  7  89  ? 59.630  39.998  45.055  1.00 66.91 ? 89   UNK G CA  1 
ATOM   7282  C  CA  . UNK G  7  90  ? 62.099  39.150  47.798  1.00 66.91 ? 90   UNK G CA  1 
ATOM   7283  C  CA  . UNK G  7  91  ? 59.586  39.299  50.672  1.00 66.91 ? 91   UNK G CA  1 
ATOM   7284  C  CA  . UNK G  7  92  ? 57.110  37.133  48.817  1.00 66.91 ? 92   UNK G CA  1 
ATOM   7285  C  CA  . UNK G  7  93  ? 59.595  34.616  47.519  1.00 66.91 ? 93   UNK G CA  1 
ATOM   7286  C  CA  . UNK G  7  94  ? 61.486  34.142  50.720  1.00 66.91 ? 94   UNK G CA  1 
ATOM   7287  C  CA  . UNK G  7  95  ? 58.311  34.188  52.888  1.00 66.91 ? 95   UNK G CA  1 
ATOM   7288  C  CA  . UNK G  7  96  ? 56.808  31.552  50.625  1.00 66.91 ? 96   UNK G CA  1 
ATOM   7289  C  CA  . UNK G  7  97  ? 59.788  29.220  51.104  1.00 66.91 ? 97   UNK G CA  1 
ATOM   7290  C  CA  . UNK G  7  98  ? 59.596  29.955  54.831  1.00 66.91 ? 98   UNK G CA  1 
ATOM   7291  C  CA  . UNK G  7  99  ? 55.958  28.830  55.247  1.00 66.91 ? 99   UNK G CA  1 
ATOM   7292  C  CA  . UNK G  7  100 ? 56.673  25.808  53.043  1.00 66.91 ? 100  UNK G CA  1 
ATOM   7293  C  CA  . UNK G  7  101 ? 59.819  24.797  54.937  1.00 66.91 ? 101  UNK G CA  1 
ATOM   7294  C  CA  . UNK G  7  102 ? 58.475  25.141  58.477  1.00 66.91 ? 102  UNK G CA  1 
ATOM   7295  C  CA  . UNK G  7  103 ? 55.076  23.595  57.814  1.00 66.91 ? 103  UNK G CA  1 
ATOM   7296  C  CA  . UNK G  7  104 ? 56.962  20.726  56.212  1.00 66.91 ? 104  UNK G CA  1 
ATOM   7297  C  CA  . UNK G  7  105 ? 49.963  103.273 69.142  1.00 66.91 ? 105  UNK G CA  1 
ATOM   7298  C  CA  . UNK G  7  106 ? 47.185  100.720 69.585  1.00 66.91 ? 106  UNK G CA  1 
ATOM   7299  C  CA  . UNK G  7  107 ? 49.521  97.849  68.771  1.00 66.91 ? 107  UNK G CA  1 
ATOM   7300  C  CA  . UNK G  7  108 ? 51.563  99.008  71.741  1.00 66.91 ? 108  UNK G CA  1 
ATOM   7301  C  CA  . UNK G  7  109 ? 48.593  99.545  74.031  1.00 66.91 ? 109  UNK G CA  1 
ATOM   7302  C  CA  . UNK G  7  110 ? 47.283  96.070  73.157  1.00 66.91 ? 110  UNK G CA  1 
ATOM   7303  C  CA  . UNK G  7  111 ? 50.702  94.474  73.635  1.00 66.91 ? 111  UNK G CA  1 
ATOM   7304  C  CA  . UNK G  7  112 ? 51.649  96.056  76.949  1.00 66.91 ? 112  UNK G CA  1 
ATOM   7305  C  CA  . UNK G  7  113 ? 48.068  95.612  78.195  1.00 66.91 ? 113  UNK G CA  1 
ATOM   7306  C  CA  . UNK G  7  114 ? 48.051  91.875  77.466  1.00 66.91 ? 114  UNK G CA  1 
ATOM   7307  C  CA  . UNK G  7  115 ? 51.601  91.469  78.798  1.00 66.91 ? 115  UNK G CA  1 
ATOM   7308  C  CA  . UNK G  7  116 ? 50.491  93.085  82.033  1.00 66.91 ? 116  UNK G CA  1 
ATOM   7309  C  CA  . UNK G  7  117 ? 47.051  91.430  82.178  1.00 66.91 ? 117  UNK G CA  1 
ATOM   7310  C  CA  . UNK G  7  118 ? 48.680  88.023  82.192  1.00 66.91 ? 118  UNK G CA  1 
ATOM   7311  C  CA  . UNK G  7  119 ? 51.390  88.829  84.684  1.00 66.91 ? 119  UNK G CA  1 
ATOM   7312  C  CA  . UNK G  7  120 ? 49.222  90.620  87.163  1.00 66.91 ? 120  UNK G CA  1 
ATOM   7313  C  CA  . UNK G  7  121 ? 46.315  88.133  86.787  1.00 66.91 ? 121  UNK G CA  1 
ATOM   7314  C  CA  . UNK G  7  122 ? 48.750  85.298  87.397  1.00 66.91 ? 122  UNK G CA  1 
ATOM   7315  C  CA  . UNK G  7  123 ? 49.949  86.831  90.680  1.00 66.91 ? 123  UNK G CA  1 
ATOM   7316  C  CA  . UNK G  7  124 ? 46.302  87.449  91.569  1.00 66.91 ? 124  UNK G CA  1 
ATOM   7317  C  CA  . UNK G  7  125 ? 45.210  83.793  91.232  1.00 66.91 ? 125  UNK G CA  1 
ATOM   7318  C  CA  . UNK G  7  126 ? 48.371  82.713  93.057  1.00 66.91 ? 126  UNK G CA  1 
ATOM   7319  C  CA  . UNK G  7  127 ? 47.925  85.187  95.918  1.00 66.91 ? 127  UNK G CA  1 
ATOM   7320  C  CA  . UNK G  7  128 ? 44.231  84.595  96.597  1.00 66.91 ? 128  UNK G CA  1 
ATOM   7321  C  CA  . UNK G  7  129 ? 44.315  80.818  96.245  1.00 66.91 ? 129  UNK G CA  1 
ATOM   7322  C  CA  . UNK G  7  130 ? 47.235  80.900  98.657  1.00 66.91 ? 130  UNK G CA  1 
ATOM   7323  C  CA  . UNK G  7  131 ? 45.878  94.037  60.274  1.00 66.91 ? 131  UNK G CA  1 
ATOM   7324  C  CA  . UNK G  7  132 ? 43.602  96.659  61.822  1.00 66.91 ? 132  UNK G CA  1 
ATOM   7325  C  CA  . UNK G  7  133 ? 40.672  94.259  61.879  1.00 66.91 ? 133  UNK G CA  1 
ATOM   7326  C  CA  . UNK G  7  134 ? 42.841  92.051  64.066  1.00 66.91 ? 134  UNK G CA  1 
ATOM   7327  C  CA  . UNK G  7  135 ? 44.102  94.874  66.265  1.00 66.91 ? 135  UNK G CA  1 
ATOM   7328  C  CA  . UNK G  7  136 ? 40.521  96.090  66.783  1.00 66.91 ? 136  UNK G CA  1 
ATOM   7329  C  CA  . UNK G  7  137 ? 39.252  92.569  67.500  1.00 66.91 ? 137  UNK G CA  1 
ATOM   7330  C  CA  . UNK G  7  138 ? 41.974  91.707  70.002  1.00 66.91 ? 138  UNK G CA  1 
ATOM   7331  C  CA  . UNK G  7  139 ? 41.672  95.104  71.727  1.00 66.91 ? 139  UNK G CA  1 
ATOM   7332  C  CA  . UNK G  7  140 ? 37.923  94.722  72.297  1.00 66.91 ? 140  UNK G CA  1 
ATOM   7333  C  CA  . UNK G  7  141 ? 38.104  91.004  73.147  1.00 66.91 ? 141  UNK G CA  1 
ATOM   7334  C  CA  . UNK G  7  142 ? 41.362  91.547  74.996  1.00 66.91 ? 142  UNK G CA  1 
ATOM   7335  C  CA  . UNK G  7  143 ? 40.308  94.776  76.740  1.00 66.91 ? 143  UNK G CA  1 
ATOM   7336  C  CA  . UNK G  7  144 ? 37.041  93.275  77.878  1.00 66.91 ? 144  UNK G CA  1 
ATOM   7337  C  CA  . UNK G  7  145 ? 38.424  89.941  78.960  1.00 66.91 ? 145  UNK G CA  1 
ATOM   7338  C  CA  . UNK G  7  146 ? 41.396  91.262  80.820  1.00 66.91 ? 146  UNK G CA  1 
ATOM   7339  C  CA  . UNK G  7  147 ? 39.442  94.186  82.358  1.00 66.91 ? 147  UNK G CA  1 
ATOM   7340  C  CA  . UNK G  7  148 ? 36.822  91.734  83.543  1.00 66.91 ? 148  UNK G CA  1 
ATOM   7341  C  CA  . UNK G  7  149 ? 39.412  89.604  85.354  1.00 66.91 ? 149  UNK G CA  1 
ATOM   7342  C  CA  . UNK G  7  150 ? 40.876  92.813  86.764  1.00 66.91 ? 150  UNK G CA  1 
ATOM   7343  C  CA  . UNK G  7  151 ? 37.636  94.019  88.398  1.00 66.91 ? 151  UNK G CA  1 
ATOM   7344  C  CA  . UNK G  7  152 ? 36.988  90.488  89.647  1.00 66.91 ? 152  UNK G CA  1 
ATOM   7345  C  CA  . UNK G  7  153 ? 40.478  90.029  91.093  1.00 66.91 ? 153  UNK G CA  1 
ATOM   7346  C  CA  . UNK G  7  154 ? 40.781  93.372  92.877  1.00 66.91 ? 154  UNK G CA  1 
ATOM   7347  C  CA  . UNK G  7  155 ? 37.251  93.460  94.257  1.00 66.91 ? 155  UNK G CA  1 
ATOM   7348  C  CA  . UNK G  7  156 ? 37.927  89.968  95.544  1.00 66.91 ? 156  UNK G CA  1 
ATOM   7349  C  CA  . UNK G  7  157 ? 42.597  92.399  50.147  1.00 66.91 ? 157  UNK G CA  1 
ATOM   7350  C  CA  . UNK G  7  158 ? 41.127  95.017  52.479  1.00 66.91 ? 158  UNK G CA  1 
ATOM   7351  C  CA  . UNK G  7  159 ? 39.236  98.217  51.702  1.00 66.91 ? 159  UNK G CA  1 
ATOM   7352  C  CA  . UNK G  7  160 ? 36.512  100.448 53.102  1.00 66.91 ? 160  UNK G CA  1 
ATOM   7353  C  CA  . UNK G  7  161 ? 33.482  98.907  54.793  1.00 66.91 ? 161  UNK G CA  1 
ATOM   7354  C  CA  . UNK G  7  162 ? 36.019  96.110  54.631  1.00 66.91 ? 162  UNK G CA  1 
ATOM   7355  C  CA  . UNK G  7  163 ? 36.655  96.807  58.297  1.00 66.91 ? 163  UNK G CA  1 
ATOM   7356  C  CA  . UNK G  7  164 ? 33.001  97.116  59.232  1.00 66.91 ? 164  UNK G CA  1 
ATOM   7357  C  CA  . UNK G  7  165 ? 32.249  93.838  57.453  1.00 66.91 ? 165  UNK G CA  1 
ATOM   7358  C  CA  . UNK G  7  166 ? 35.221  92.092  59.061  1.00 66.91 ? 166  UNK G CA  1 
ATOM   7359  C  CA  . UNK G  7  167 ? 34.568  93.230  62.614  1.00 66.91 ? 167  UNK G CA  1 
ATOM   7360  C  CA  . UNK G  7  168 ? 30.783  93.392  62.206  1.00 66.91 ? 168  UNK G CA  1 
ATOM   7361  C  CA  . UNK G  7  169 ? 30.548  89.810  60.937  1.00 66.91 ? 169  UNK G CA  1 
ATOM   7362  C  CA  . UNK G  7  170 ? 33.150  88.508  63.399  1.00 66.91 ? 170  UNK G CA  1 
ATOM   7363  C  CA  . UNK G  7  171 ? 31.597  90.573  66.162  1.00 66.91 ? 171  UNK G CA  1 
ATOM   7364  C  CA  . UNK G  7  172 ? 28.040  89.204  65.908  1.00 66.91 ? 172  UNK G CA  1 
ATOM   7365  C  CA  . UNK G  7  173 ? 29.746  86.078  67.164  1.00 66.91 ? 173  UNK G CA  1 
ATOM   7366  C  CA  . UNK G  7  174 ? 31.211  87.586  70.292  1.00 66.91 ? 174  UNK G CA  1 
ATOM   7367  C  CA  . UNK G  7  175 ? 28.137  89.424  71.400  1.00 66.91 ? 175  UNK G CA  1 
ATOM   7368  C  CA  . UNK G  7  176 ? 25.773  86.551  70.433  1.00 66.91 ? 176  UNK G CA  1 
ATOM   7369  C  CA  . UNK G  7  177 ? 27.949  84.178  72.425  1.00 66.91 ? 177  UNK G CA  1 
ATOM   7370  C  CA  . UNK G  7  178 ? 27.670  86.319  75.570  1.00 66.91 ? 178  UNK G CA  1 
ATOM   7371  C  CA  . UNK G  7  179 ? 23.934  86.581  74.900  1.00 66.91 ? 179  UNK G CA  1 
ATOM   7372  C  CA  . UNK G  7  180 ? 23.295  82.803  74.863  1.00 66.91 ? 180  UNK G CA  1 
ATOM   7373  C  CA  . UNK G  7  181 ? 25.553  82.423  77.905  1.00 66.91 ? 181  UNK G CA  1 
ATOM   7374  C  CA  . UNK G  7  182 ? 23.867  85.210  79.880  1.00 66.91 ? 182  UNK G CA  1 
ATOM   7375  C  CA  . UNK G  7  183 ? 20.248  84.248  79.224  1.00 66.91 ? 183  UNK G CA  1 
ATOM   7376  C  CA  . UNK G  7  184 ? -10.365 65.714  12.906  1.00 66.91 ? 184  UNK G CA  1 
ATOM   7377  C  CA  . UNK G  7  185 ? -12.748 67.814  14.991  1.00 66.91 ? 185  UNK G CA  1 
ATOM   7378  C  CA  . UNK G  7  186 ? -15.641 66.840  17.232  1.00 66.91 ? 186  UNK G CA  1 
ATOM   7379  C  CA  . UNK G  7  187 ? -13.666 67.654  20.375  1.00 66.91 ? 187  UNK G CA  1 
ATOM   7380  C  CA  . UNK G  7  188 ? -16.950 68.407  22.071  1.00 66.91 ? 188  UNK G CA  1 
ATOM   7381  C  CA  . UNK G  7  189 ? -18.117 64.818  22.278  1.00 66.91 ? 189  UNK G CA  1 
ATOM   7382  C  CA  . UNK G  7  190 ? -14.832 64.158  24.042  1.00 66.91 ? 190  UNK G CA  1 
ATOM   7383  C  CA  . UNK G  7  191 ? -15.635 66.881  26.584  1.00 66.91 ? 191  UNK G CA  1 
ATOM   7384  C  CA  . UNK G  7  192 ? -19.025 65.262  26.951  1.00 66.91 ? 192  UNK G CA  1 
ATOM   7385  C  CA  . UNK G  7  193 ? -17.457 61.874  26.281  1.00 66.91 ? 193  UNK G CA  1 
ATOM   7386  C  CA  . UNK G  7  194 ? -14.281 62.635  28.254  1.00 66.91 ? 194  UNK G CA  1 
ATOM   7387  C  CA  . UNK G  7  195 ? -16.203 63.621  31.389  1.00 66.91 ? 195  UNK G CA  1 
ATOM   7388  C  CA  . UNK G  7  196 ? -18.658 60.738  30.946  1.00 66.91 ? 196  UNK G CA  1 
ATOM   7389  C  CA  . UNK G  7  197 ? -15.721 58.357  30.826  1.00 66.91 ? 197  UNK G CA  1 
ATOM   7390  C  CA  . UNK G  7  198 ? -14.100 60.040  33.840  1.00 66.91 ? 198  UNK G CA  1 
ATOM   7391  C  CA  . UNK G  7  199 ? -17.459 60.164  35.562  1.00 66.91 ? 199  UNK G CA  1 
ATOM   7392  C  CA  . UNK G  7  200 ? -18.556 56.672  34.667  1.00 66.91 ? 200  UNK G CA  1 
ATOM   7393  C  CA  . UNK G  7  201 ? -15.335 54.947  35.504  1.00 66.91 ? 201  UNK G CA  1 
ATOM   7394  C  CA  . UNK G  7  202 ? -14.747 57.051  38.668  1.00 66.91 ? 202  UNK G CA  1 
ATOM   7395  C  CA  . UNK G  7  203 ? -18.252 56.186  39.813  1.00 66.91 ? 203  UNK G CA  1 
ATOM   7396  C  CA  . UNK G  7  204 ? -17.601 52.441  39.483  1.00 66.91 ? 204  UNK G CA  1 
ATOM   7397  C  CA  . UNK G  7  205 ? -14.280 52.998  41.256  1.00 66.91 ? 205  UNK G CA  1 
ATOM   7398  C  CA  . UNK G  7  206 ? -15.793 54.602  44.388  1.00 66.91 ? 206  UNK G CA  1 
ATOM   7399  C  CA  . UNK G  7  207 ? -18.532 51.957  44.384  1.00 66.91 ? 207  UNK G CA  1 
ATOM   7400  C  CA  . UNK G  7  208 ? -16.122 49.032  44.005  1.00 66.91 ? 208  UNK G CA  1 
ATOM   7401  C  CA  . UNK G  7  209 ? -13.559 50.078  46.611  1.00 66.91 ? 209  UNK G CA  1 
ATOM   7402  C  CA  . UNK G  7  210 ? -16.043 51.243  49.231  1.00 66.91 ? 210  UNK G CA  1 
ATOM   7403  C  CA  . UNK G  7  211 ? -19.138 52.604  47.422  1.00 66.91 ? 211  UNK G CA  1 
ATOM   7404  C  CA  . UNK G  7  212 ? -22.337 53.050  49.410  1.00 66.91 ? 212  UNK G CA  1 
ATOM   7405  C  CA  . UNK G  7  213 ? -25.857 53.428  48.047  1.00 66.91 ? 213  UNK G CA  1 
ATOM   7406  C  CA  . UNK G  7  214 ? -28.306 50.528  48.080  1.00 66.91 ? 214  UNK G CA  1 
ATOM   7407  C  CA  . UNK G  7  215 ? -26.837 47.115  47.315  1.00 66.91 ? 215  UNK G CA  1 
ATOM   7408  C  CA  . UNK G  7  216 ? -23.419 45.571  47.912  1.00 66.91 ? 216  UNK G CA  1 
ATOM   7409  C  CA  . UNK G  7  217 ? -21.634 42.404  48.999  1.00 66.91 ? 217  UNK G CA  1 
ATOM   7410  C  CA  . UNK G  7  218 ? -23.733 39.314  48.303  1.00 66.91 ? 218  UNK G CA  1 
ATOM   7411  C  CA  . UNK G  7  219 ? -21.013 36.676  48.556  1.00 66.91 ? 219  UNK G CA  1 
ATOM   7412  C  CA  . UNK G  7  220 ? -17.252 36.770  48.033  1.00 66.91 ? 220  UNK G CA  1 
ATOM   7413  N  N   . UNK H  8  1   ? -30.087 57.215  51.954  1.00 46.91 ? 1    UNK H N   1 
ATOM   7414  C  CA  . UNK H  8  1   ? -28.855 56.731  51.264  1.00 46.91 ? 1    UNK H CA  1 
ATOM   7415  C  C   . UNK H  8  1   ? -27.632 57.546  51.672  1.00 46.91 ? 1    UNK H C   1 
ATOM   7416  O  O   . UNK H  8  1   ? -27.544 58.740  51.381  1.00 46.91 ? 1    UNK H O   1 
ATOM   7417  C  CB  . UNK H  8  1   ? -29.045 56.786  49.753  1.00 46.91 ? 1    UNK H CB  1 
ATOM   7418  N  N   . UNK H  8  2   ? -26.701 56.902  52.370  1.00 46.91 ? 2    UNK H N   1 
ATOM   7419  C  CA  . UNK H  8  2   ? -25.483 57.571  52.815  1.00 46.91 ? 2    UNK H CA  1 
ATOM   7420  C  C   . UNK H  8  2   ? -24.389 57.550  51.748  1.00 46.91 ? 2    UNK H C   1 
ATOM   7421  O  O   . UNK H  8  2   ? -23.458 58.354  51.792  1.00 46.91 ? 2    UNK H O   1 
ATOM   7422  C  CB  . UNK H  8  2   ? -24.977 56.941  54.103  1.00 46.91 ? 2    UNK H CB  1 
ATOM   7423  N  N   . UNK H  8  3   ? -24.484 56.607  50.813  1.00 46.91 ? 3    UNK H N   1 
ATOM   7424  C  CA  . UNK H  8  3   ? -23.497 56.496  49.742  1.00 46.91 ? 3    UNK H CA  1 
ATOM   7425  C  C   . UNK H  8  3   ? -23.803 57.427  48.571  1.00 46.91 ? 3    UNK H C   1 
ATOM   7426  O  O   . UNK H  8  3   ? -22.935 57.687  47.736  1.00 46.91 ? 3    UNK H O   1 
ATOM   7427  C  CB  . UNK H  8  3   ? -23.404 55.053  49.260  1.00 46.91 ? 3    UNK H CB  1 
ATOM   7428  N  N   . UNK H  8  4   ? -25.048 57.889  48.487  1.00 46.91 ? 4    UNK H N   1 
ATOM   7429  C  CA  . UNK H  8  4   ? -25.465 58.787  47.415  1.00 46.91 ? 4    UNK H CA  1 
ATOM   7430  C  C   . UNK H  8  4   ? -25.219 60.255  47.755  1.00 46.91 ? 4    UNK H C   1 
ATOM   7431  O  O   . UNK H  8  4   ? -25.229 61.113  46.870  1.00 46.91 ? 4    UNK H O   1 
ATOM   7432  C  CB  . UNK H  8  4   ? -26.932 58.561  47.080  1.00 46.91 ? 4    UNK H CB  1 
ATOM   7433  N  N   . UNK H  8  5   ? -25.056 60.545  49.042  1.00 46.91 ? 5    UNK H N   1 
ATOM   7434  C  CA  . UNK H  8  5   ? -24.809 61.909  49.496  1.00 46.91 ? 5    UNK H CA  1 
ATOM   7435  C  C   . UNK H  8  5   ? -23.312 62.203  49.563  1.00 46.91 ? 5    UNK H C   1 
ATOM   7436  O  O   . UNK H  8  5   ? -22.893 63.357  49.460  1.00 46.91 ? 5    UNK H O   1 
ATOM   7437  C  CB  . UNK H  8  5   ? -25.456 62.136  50.856  1.00 46.91 ? 5    UNK H CB  1 
ATOM   7438  N  N   . UNK H  8  6   ? -22.517 61.158  49.773  1.00 46.91 ? 6    UNK H N   1 
ATOM   7439  C  CA  . UNK H  8  6   ? -21.068 61.287  49.861  1.00 46.91 ? 6    UNK H CA  1 
ATOM   7440  C  C   . UNK H  8  6   ? -20.410 61.303  48.481  1.00 46.91 ? 6    UNK H C   1 
ATOM   7441  O  O   . UNK H  8  6   ? -19.286 61.784  48.328  1.00 46.91 ? 6    UNK H O   1 
ATOM   7442  C  CB  . UNK H  8  6   ? -20.493 60.154  50.703  1.00 46.91 ? 6    UNK H CB  1 
ATOM   7443  N  N   . UNK H  8  7   ? -21.097 60.732  47.496  1.00 46.91 ? 7    UNK H N   1 
ATOM   7444  C  CA  . UNK H  8  7   ? -20.592 60.675  46.128  1.00 46.91 ? 7    UNK H CA  1 
ATOM   7445  C  C   . UNK H  8  7   ? -20.923 61.939  45.341  1.00 46.91 ? 7    UNK H C   1 
ATOM   7446  O  O   . UNK H  8  7   ? -20.289 62.229  44.325  1.00 46.91 ? 7    UNK H O   1 
ATOM   7447  C  CB  . UNK H  8  7   ? -21.150 59.451  45.415  1.00 46.91 ? 7    UNK H CB  1 
ATOM   7448  N  N   . UNK H  8  8   ? -21.950 62.659  45.785  1.00 46.91 ? 8    UNK H N   1 
ATOM   7449  C  CA  . UNK H  8  8   ? -22.372 63.889  45.125  1.00 46.91 ? 8    UNK H CA  1 
ATOM   7450  C  C   . UNK H  8  8   ? -21.607 65.105  45.642  1.00 46.91 ? 8    UNK H C   1 
ATOM   7451  O  O   . UNK H  8  8   ? -21.574 66.151  44.987  1.00 46.91 ? 8    UNK H O   1 
ATOM   7452  C  CB  . UNK H  8  8   ? -23.870 64.091  45.306  1.00 46.91 ? 8    UNK H CB  1 
ATOM   7453  N  N   . UNK H  8  9   ? -21.030 64.976  46.833  1.00 46.91 ? 9    UNK H N   1 
ATOM   7454  C  CA  . UNK H  8  9   ? -20.266 66.057  47.446  1.00 46.91 ? 9    UNK H CA  1 
ATOM   7455  C  C   . UNK H  8  9   ? -18.807 66.045  46.993  1.00 46.91 ? 9    UNK H C   1 
ATOM   7456  O  O   . UNK H  8  9   ? -18.124 67.071  47.047  1.00 46.91 ? 9    UNK H O   1 
ATOM   7457  C  CB  . UNK H  8  9   ? -20.347 65.962  48.962  1.00 46.91 ? 9    UNK H CB  1 
ATOM   7458  N  N   . UNK H  8  10  ? -18.324 64.871  46.600  1.00 57.92 ? 10   UNK H N   1 
ATOM   7459  C  CA  . UNK H  8  10  ? -16.950 64.715  46.138  1.00 57.82 ? 10   UNK H CA  1 
ATOM   7460  C  C   . UNK H  8  10  ? -16.818 65.063  44.657  1.00 58.73 ? 10   UNK H C   1 
ATOM   7461  O  O   . UNK H  8  10  ? -15.736 65.429  44.192  1.00 57.86 ? 10   UNK H O   1 
ATOM   7462  C  CB  . UNK H  8  10  ? -16.470 63.292  46.392  1.00 57.10 ? 10   UNK H CB  1 
ATOM   7463  N  N   . UNK H  8  11  ? -17.912 64.902  43.918  1.00 46.91 ? 11   UNK H N   1 
ATOM   7464  C  CA  . UNK H  8  11  ? -17.930 65.200  42.490  1.00 46.91 ? 11   UNK H CA  1 
ATOM   7465  C  C   . UNK H  8  11  ? -18.077 66.697  42.228  1.00 46.91 ? 11   UNK H C   1 
ATOM   7466  O  O   . UNK H  8  11  ? -17.672 67.193  41.173  1.00 46.91 ? 11   UNK H O   1 
ATOM   7467  C  CB  . UNK H  8  11  ? -19.060 64.433  41.812  1.00 46.91 ? 11   UNK H CB  1 
ATOM   7468  N  N   . UNK H  8  12  ? -18.698 67.401  43.171  1.00 46.91 ? 12   UNK H N   1 
ATOM   7469  C  CA  . UNK H  8  12  ? -18.908 68.841  43.056  1.00 46.91 ? 12   UNK H CA  1 
ATOM   7470  C  C   . UNK H  8  12  ? -17.702 69.627  43.562  1.00 46.91 ? 12   UNK H C   1 
ATOM   7471  O  O   . UNK H  8  12  ? -17.511 70.791  43.198  1.00 46.91 ? 12   UNK H O   1 
ATOM   7472  C  CB  . UNK H  8  12  ? -20.158 69.250  43.819  1.00 46.91 ? 12   UNK H CB  1 
ATOM   7473  N  N   . UNK H  8  13  ? -16.924 69.002  44.441  1.00 46.91 ? 13   UNK H N   1 
ATOM   7474  C  CA  . UNK H  8  13  ? -15.731 69.629  45.000  1.00 46.91 ? 13   UNK H CA  1 
ATOM   7475  C  C   . UNK H  8  13  ? -14.593 69.621  43.985  1.00 46.91 ? 13   UNK H C   1 
ATOM   7476  O  O   . UNK H  8  13  ? -13.711 70.484  44.015  1.00 46.91 ? 13   UNK H O   1 
ATOM   7477  C  CB  . UNK H  8  13  ? -15.308 68.914  46.274  1.00 46.91 ? 13   UNK H CB  1 
ATOM   7478  N  N   . UNK H  8  14  ? -14.596 68.612  43.117  1.00 59.16 ? 14   UNK H N   1 
ATOM   7479  C  CA  . UNK H  8  14  ? -13.580 68.478  42.082  1.00 59.97 ? 14   UNK H CA  1 
ATOM   7480  C  C   . UNK H  8  14  ? -13.868 69.417  40.913  1.00 60.48 ? 14   UNK H C   1 
ATOM   7481  O  O   . UNK H  8  14  ? -12.961 69.788  40.165  1.00 59.14 ? 14   UNK H O   1 
ATOM   7482  C  CB  . UNK H  8  14  ? -13.515 67.034  41.597  1.00 58.16 ? 14   UNK H CB  1 
ATOM   7483  N  N   . UNK H  8  15  ? -15.142 69.761  40.739  1.00 46.91 ? 15   UNK H N   1 
ATOM   7484  C  CA  . UNK H  8  15  ? -15.569 70.655  39.668  1.00 46.91 ? 15   UNK H CA  1 
ATOM   7485  C  C   . UNK H  8  15  ? -15.483 72.121  40.092  1.00 46.91 ? 15   UNK H C   1 
ATOM   7486  O  O   . UNK H  8  15  ? -15.931 73.014  39.367  1.00 46.91 ? 15   UNK H O   1 
ATOM   7487  C  CB  . UNK H  8  15  ? -16.989 70.309  39.235  1.00 46.91 ? 15   UNK H CB  1 
ATOM   7488  N  N   . UNK H  8  16  ? -14.926 72.355  41.276  1.00 46.91 ? 16   UNK H N   1 
ATOM   7489  C  CA  . UNK H  8  16  ? -14.769 73.700  41.816  1.00 46.91 ? 16   UNK H CA  1 
ATOM   7490  C  C   . UNK H  8  16  ? -13.299 73.991  42.118  1.00 46.91 ? 16   UNK H C   1 
ATOM   7491  O  O   . UNK H  8  16  ? -12.974 74.973  42.791  1.00 46.91 ? 16   UNK H O   1 
ATOM   7492  C  CB  . UNK H  8  16  ? -15.607 73.856  43.080  1.00 46.91 ? 16   UNK H CB  1 
ATOM   7493  N  N   . UNK H  8  17  ? -12.417 73.133  41.612  1.00 46.91 ? 17   UNK H N   1 
ATOM   7494  C  CA  . UNK H  8  17  ? -10.980 73.277  41.820  1.00 46.91 ? 17   UNK H CA  1 
ATOM   7495  C  C   . UNK H  8  17  ? -10.198 72.998  40.540  1.00 46.91 ? 17   UNK H C   1 
ATOM   7496  O  O   . UNK H  8  17  ? -9.025  73.361  40.428  1.00 46.91 ? 17   UNK H O   1 
ATOM   7497  C  CB  . UNK H  8  17  ? -10.519 72.340  42.928  1.00 46.91 ? 17   UNK H CB  1 
ATOM   7498  N  N   . UNK H  8  18  ? -10.846 72.325  39.593  1.00 46.91 ? 18   UNK H N   1 
ATOM   7499  C  CA  . UNK H  8  18  ? -10.227 71.988  38.317  1.00 46.91 ? 18   UNK H CA  1 
ATOM   7500  C  C   . UNK H  8  18  ? -10.858 72.766  37.166  1.00 46.91 ? 18   UNK H C   1 
ATOM   7501  O  O   . UNK H  8  18  ? -10.188 73.085  36.179  1.00 46.91 ? 18   UNK H O   1 
ATOM   7502  C  CB  . UNK H  8  18  ? -10.333 70.492  38.060  1.00 46.91 ? 18   UNK H CB  1 
ATOM   7503  N  N   . UNK H  8  19  ? -12.160 73.017  37.269  1.00 46.91 ? 19   UNK H N   1 
ATOM   7504  C  CA  . UNK H  8  19  ? -12.884 73.756  36.239  1.00 46.91 ? 19   UNK H CA  1 
ATOM   7505  C  C   . UNK H  8  19  ? -12.907 75.251  36.544  1.00 46.91 ? 19   UNK H C   1 
ATOM   7506  O  O   . UNK H  8  19  ? -13.024 76.076  35.634  1.00 46.91 ? 19   UNK H O   1 
ATOM   7507  C  CB  . UNK H  8  19  ? -14.304 73.223  36.106  1.00 46.91 ? 19   UNK H CB  1 
ATOM   7508  N  N   . UNK H  8  20  ? -12.837 75.589  37.828  1.00 46.91 ? 20   UNK H N   1 
ATOM   7509  C  CA  . UNK H  8  20  ? -12.842 76.981  38.261  1.00 46.91 ? 20   UNK H CA  1 
ATOM   7510  C  C   . UNK H  8  20  ? -11.448 77.594  38.168  1.00 46.91 ? 20   UNK H C   1 
ATOM   7511  O  O   . UNK H  8  20  ? -11.303 78.797  37.935  1.00 46.91 ? 20   UNK H O   1 
ATOM   7512  C  CB  . UNK H  8  20  ? -13.371 77.087  39.685  1.00 46.91 ? 20   UNK H CB  1 
ATOM   7513  N  N   . UNK H  8  21  ? -10.430 76.768  38.396  1.00 46.91 ? 21   UNK H N   1 
ATOM   7514  C  CA  . UNK H  8  21  ? -9.041  77.212  38.336  1.00 46.91 ? 21   UNK H CA  1 
ATOM   7515  C  C   . UNK H  8  21  ? -8.576  77.374  36.892  1.00 46.91 ? 21   UNK H C   1 
ATOM   7516  O  O   . UNK H  8  21  ? -7.682  78.175  36.602  1.00 46.91 ? 21   UNK H O   1 
ATOM   7517  C  CB  . UNK H  8  21  ? -8.143  76.228  39.071  1.00 46.91 ? 21   UNK H CB  1 
ATOM   7518  N  N   . UNK H  8  22  ? -9.155  76.574  36.002  1.00 61.08 ? 22   UNK H N   1 
ATOM   7519  C  CA  . UNK H  8  22  ? -8.819  76.622  34.583  1.00 60.72 ? 22   UNK H CA  1 
ATOM   7520  C  C   . UNK H  8  22  ? -9.431  77.851  33.919  1.00 61.17 ? 22   UNK H C   1 
ATOM   7521  O  O   . UNK H  8  22  ? -9.005  78.259  32.836  1.00 60.13 ? 22   UNK H O   1 
ATOM   7522  C  CB  . UNK H  8  22  ? -9.294  75.354  33.885  1.00 60.27 ? 22   UNK H CB  1 
ATOM   7523  N  N   . UNK H  8  23  ? -10.457 78.411  34.553  1.00 46.91 ? 23   UNK H N   1 
ATOM   7524  C  CA  . UNK H  8  23  ? -11.136 79.592  34.037  1.00 46.91 ? 23   UNK H CA  1 
ATOM   7525  C  C   . UNK H  8  23  ? -10.460 80.881  34.500  1.00 46.91 ? 23   UNK H C   1 
ATOM   7526  O  O   . UNK H  8  23  ? -10.759 81.963  33.992  1.00 46.91 ? 23   UNK H O   1 
ATOM   7527  C  CB  . UNK H  8  23  ? -12.602 79.583  34.459  1.00 46.91 ? 23   UNK H CB  1 
ATOM   7528  N  N   . UNK H  8  24  ? -9.583  80.763  35.493  1.00 46.91 ? 24   UNK H N   1 
ATOM   7529  C  CA  . UNK H  8  24  ? -8.860  81.912  36.027  1.00 46.91 ? 24   UNK H CA  1 
ATOM   7530  C  C   . UNK H  8  24  ? -7.544  82.123  35.284  1.00 46.91 ? 24   UNK H C   1 
ATOM   7531  O  O   . UNK H  8  24  ? -6.933  83.191  35.372  1.00 46.91 ? 24   UNK H O   1 
ATOM   7532  C  CB  . UNK H  8  24  ? -8.601  81.724  37.515  1.00 46.91 ? 24   UNK H CB  1 
ATOM   7533  N  N   . UNK H  8  25  ? -7.095  81.083  34.587  1.00 46.91 ? 25   UNK H N   1 
ATOM   7534  C  CA  . UNK H  8  25  ? -5.854  81.132  33.825  1.00 46.91 ? 25   UNK H CA  1 
ATOM   7535  C  C   . UNK H  8  25  ? -6.114  81.263  32.325  1.00 46.91 ? 25   UNK H C   1 
ATOM   7536  O  O   . UNK H  8  25  ? -5.173  81.329  31.531  1.00 46.91 ? 25   UNK H O   1 
ATOM   7537  C  CB  . UNK H  8  25  ? -5.019  79.889  34.108  1.00 46.91 ? 25   UNK H CB  1 
ATOM   7538  N  N   . UNK H  8  26  ? -7.386  81.269  31.938  1.00 46.91 ? 26   UNK H N   1 
ATOM   7539  C  CA  . UNK H  8  26  ? -7.761  81.389  30.533  1.00 46.91 ? 26   UNK H CA  1 
ATOM   7540  C  C   . UNK H  8  26  ? -8.179  82.812  30.179  1.00 46.91 ? 26   UNK H C   1 
ATOM   7541  O  O   . UNK H  8  26  ? -8.034  83.243  29.033  1.00 46.91 ? 26   UNK H O   1 
ATOM   7542  C  CB  . UNK H  8  26  ? -8.881  80.415  30.201  1.00 46.91 ? 26   UNK H CB  1 
ATOM   7543  N  N   . UNK H  8  27  ? -8.742  83.518  31.154  1.00 46.91 ? 27   UNK H N   1 
ATOM   7544  C  CA  . UNK H  8  27  ? -9.185  84.892  30.952  1.00 46.91 ? 27   UNK H CA  1 
ATOM   7545  C  C   . UNK H  8  27  ? -8.070  85.888  31.266  1.00 46.91 ? 27   UNK H C   1 
ATOM   7546  O  O   . UNK H  8  27  ? -8.143  87.053  30.872  1.00 46.91 ? 27   UNK H O   1 
ATOM   7547  C  CB  . UNK H  8  27  ? -10.409 85.179  31.809  1.00 46.91 ? 27   UNK H CB  1 
ATOM   7548  N  N   . UNK H  8  28  ? -7.066  85.433  32.009  1.00 46.91 ? 28   UNK H N   1 
ATOM   7549  C  CA  . UNK H  8  28  ? -5.934  86.275  32.378  1.00 46.91 ? 28   UNK H CA  1 
ATOM   7550  C  C   . UNK H  8  28  ? -4.879  86.278  31.276  1.00 46.91 ? 28   UNK H C   1 
ATOM   7551  O  O   . UNK H  8  28  ? -4.195  87.281  31.061  1.00 46.91 ? 28   UNK H O   1 
ATOM   7552  C  CB  . UNK H  8  28  ? -5.326  85.792  33.688  1.00 46.91 ? 28   UNK H CB  1 
ATOM   7553  N  N   . UNK H  8  29  ? -4.733  85.138  30.605  1.00 46.91 ? 29   UNK H N   1 
ATOM   7554  C  CA  . UNK H  8  29  ? -3.765  84.985  29.525  1.00 46.91 ? 29   UNK H CA  1 
ATOM   7555  C  C   . UNK H  8  29  ? -4.196  85.725  28.263  1.00 46.91 ? 29   UNK H C   1 
ATOM   7556  O  O   . UNK H  8  29  ? -3.358  86.172  27.481  1.00 46.91 ? 29   UNK H O   1 
ATOM   7557  C  CB  . UNK H  8  29  ? -3.554  83.508  29.219  1.00 46.91 ? 29   UNK H CB  1 
ATOM   7558  N  N   . UNK H  8  30  ? -5.505  85.812  28.047  1.00 46.91 ? 30   UNK H N   1 
ATOM   7559  C  CA  . UNK H  8  30  ? -6.042  86.494  26.875  1.00 46.91 ? 30   UNK H CA  1 
ATOM   7560  C  C   . UNK H  8  30  ? -6.029  88.014  27.032  1.00 46.91 ? 30   UNK H C   1 
ATOM   7561  O  O   . UNK H  8  30  ? -6.111  88.747  26.042  1.00 46.91 ? 30   UNK H O   1 
ATOM   7562  C  CB  . UNK H  8  30  ? -7.454  86.004  26.586  1.00 46.91 ? 30   UNK H CB  1 
ATOM   7563  N  N   . UNK H  8  31  ? -5.955  88.482  28.274  1.00 46.91 ? 31   UNK H N   1 
ATOM   7564  C  CA  . UNK H  8  31  ? -5.937  89.911  28.569  1.00 46.91 ? 31   UNK H CA  1 
ATOM   7565  C  C   . UNK H  8  31  ? -4.568  90.539  28.322  1.00 46.91 ? 31   UNK H C   1 
ATOM   7566  O  O   . UNK H  8  31  ? -4.473  91.690  27.885  1.00 46.91 ? 31   UNK H O   1 
ATOM   7567  C  CB  . UNK H  8  31  ? -6.371  90.152  30.008  1.00 46.91 ? 31   UNK H CB  1 
ATOM   7568  N  N   . UNK H  8  32  ? -3.513  89.789  28.627  1.00 46.91 ? 32   UNK H N   1 
ATOM   7569  C  CA  . UNK H  8  32  ? -2.147  90.267  28.449  1.00 46.91 ? 32   UNK H CA  1 
ATOM   7570  C  C   . UNK H  8  32  ? -1.175  89.129  28.141  1.00 46.91 ? 32   UNK H C   1 
ATOM   7571  O  O   . UNK H  8  32  ? -0.418  88.689  29.011  1.00 46.91 ? 32   UNK H O   1 
ATOM   7572  C  CB  . UNK H  8  32  ? -1.694  91.031  29.694  1.00 46.91 ? 32   UNK H CB  1 
ATOM   7573  N  N   . UNK H  8  33  ? -1.180  88.674  26.891  1.00 46.91 ? 33   UNK H N   1 
ATOM   7574  C  CA  . UNK H  8  33  ? -0.294  87.598  26.460  1.00 46.91 ? 33   UNK H CA  1 
ATOM   7575  C  C   . UNK H  8  33  ? 1.019   88.168  25.921  1.00 46.91 ? 33   UNK H C   1 
ATOM   7576  O  O   . UNK H  8  33  ? 1.905   87.357  25.566  1.00 46.91 ? 33   UNK H O   1 
ATOM   7577  C  CB  . UNK H  8  33  ? -0.983  86.746  25.398  1.00 46.91 ? 33   UNK H CB  1 
ATOM   7578  N  N   . UNK I  9  1   ? 36.426  89.294  44.002  1.00 46.91 ? 1    UNK I N   1 
ATOM   7579  C  CA  . UNK I  9  1   ? 35.208  88.646  44.573  1.00 46.91 ? 1    UNK I CA  1 
ATOM   7580  C  C   . UNK I  9  1   ? 34.499  89.569  45.563  1.00 46.91 ? 1    UNK I C   1 
ATOM   7581  O  O   . UNK I  9  1   ? 33.476  90.171  45.234  1.00 46.91 ? 1    UNK I O   1 
ATOM   7582  C  CB  . UNK I  9  1   ? 35.609  87.353  45.292  1.00 46.91 ? 1    UNK I CB  1 
ATOM   7583  N  N   . UNK I  9  2   ? 35.063  89.684  46.765  1.00 46.91 ? 2    UNK I N   1 
ATOM   7584  C  CA  . UNK I  9  2   ? 34.520  90.525  47.834  1.00 46.91 ? 2    UNK I CA  1 
ATOM   7585  C  C   . UNK I  9  2   ? 33.196  90.040  48.425  1.00 46.91 ? 2    UNK I C   1 
ATOM   7586  O  O   . UNK I  9  2   ? 32.802  90.482  49.505  1.00 46.91 ? 2    UNK I O   1 
ATOM   7587  C  CB  . UNK I  9  2   ? 34.310  91.965  47.298  1.00 46.91 ? 2    UNK I CB  1 
ATOM   7588  N  N   . UNK I  9  3   ? 32.514  89.146  47.710  1.00 46.91 ? 3    UNK I N   1 
ATOM   7589  C  CA  . UNK I  9  3   ? 31.236  88.588  48.150  1.00 46.91 ? 3    UNK I CA  1 
ATOM   7590  C  C   . UNK I  9  3   ? 30.216  89.668  48.525  1.00 46.91 ? 3    UNK I C   1 
ATOM   7591  O  O   . UNK I  9  3   ? 30.043  90.647  47.793  1.00 46.91 ? 3    UNK I O   1 
ATOM   7592  C  CB  . UNK I  9  3   ? 31.457  87.681  49.377  1.00 46.91 ? 3    UNK I CB  1 
ATOM   7593  N  N   . UNK I  9  4   ? 29.532  89.477  49.651  1.00 46.91 ? 4    UNK I N   1 
ATOM   7594  C  CA  . UNK I  9  4   ? 28.529  90.428  50.127  1.00 46.91 ? 4    UNK I CA  1 
ATOM   7595  C  C   . UNK I  9  4   ? 28.083  90.096  51.550  1.00 46.91 ? 4    UNK I C   1 
ATOM   7596  O  O   . UNK I  9  4   ? 27.288  89.179  51.763  1.00 46.91 ? 4    UNK I O   1 
ATOM   7597  C  CB  . UNK I  9  4   ? 27.299  90.398  49.206  1.00 46.91 ? 4    UNK I CB  1 
ATOM   7598  N  N   . UNK I  9  5   ? 28.594  90.851  52.518  1.00 46.91 ? 5    UNK I N   1 
ATOM   7599  C  CA  . UNK I  9  5   ? 28.250  90.647  53.922  1.00 46.91 ? 5    UNK I CA  1 
ATOM   7600  C  C   . UNK I  9  5   ? 26.958  91.379  54.281  1.00 46.91 ? 5    UNK I C   1 
ATOM   7601  O  O   . UNK I  9  5   ? 26.989  92.517  54.759  1.00 46.91 ? 5    UNK I O   1 
ATOM   7602  C  CB  . UNK I  9  5   ? 29.377  91.169  54.821  1.00 46.91 ? 5    UNK I CB  1 
ATOM   7603  N  N   . UNK I  9  6   ? 25.825  90.729  54.034  1.00 46.91 ? 6    UNK I N   1 
ATOM   7604  C  CA  . UNK I  9  6   ? 24.517  91.309  54.328  1.00 46.91 ? 6    UNK I CA  1 
ATOM   7605  C  C   . UNK I  9  6   ? 23.382  90.328  54.056  1.00 46.91 ? 6    UNK I C   1 
ATOM   7606  O  O   . UNK I  9  6   ? 22.438  90.228  54.841  1.00 46.91 ? 6    UNK I O   1 
ATOM   7607  C  CB  . UNK I  9  6   ? 24.297  92.565  53.467  1.00 46.91 ? 6    UNK I CB  1 
ATOM   7608  N  N   . UNK I  9  7   ? 23.456  89.643  52.919  1.00 46.91 ? 7    UNK I N   1 
ATOM   7609  C  CA  . UNK I  9  7   ? 22.436  88.673  52.536  1.00 46.91 ? 7    UNK I CA  1 
ATOM   7610  C  C   . UNK I  9  7   ? 22.673  87.304  53.167  1.00 46.91 ? 7    UNK I C   1 
ATOM   7611  O  O   . UNK I  9  7   ? 21.725  86.564  53.434  1.00 46.91 ? 7    UNK I O   1 
ATOM   7612  C  CB  . UNK I  9  7   ? 22.419  88.510  51.003  1.00 46.91 ? 7    UNK I CB  1 
ATOM   7613  N  N   . UNK I  9  8   ? 23.941  86.958  53.371  1.00 46.91 ? 8    UNK I N   1 
ATOM   7614  C  CA  . UNK I  9  8   ? 24.301  85.673  53.962  1.00 46.91 ? 8    UNK I CA  1 
ATOM   7615  C  C   . UNK I  9  8   ? 24.561  85.798  55.463  1.00 46.91 ? 8    UNK I C   1 
ATOM   7616  O  O   . UNK I  9  8   ? 24.577  84.798  56.183  1.00 46.91 ? 8    UNK I O   1 
ATOM   7617  C  CB  . UNK I  9  8   ? 25.567  85.121  53.289  1.00 46.91 ? 8    UNK I CB  1 
ATOM   7618  N  N   . UNK I  9  9   ? 24.796  87.024  55.924  1.00 46.91 ? 9    UNK I N   1 
ATOM   7619  C  CA  . UNK I  9  9   ? 25.054  87.280  57.338  1.00 46.91 ? 9    UNK I CA  1 
ATOM   7620  C  C   . UNK I  9  9   ? 23.771  87.177  58.159  1.00 46.91 ? 9    UNK I C   1 
ATOM   7621  O  O   . UNK I  9  9   ? 23.811  86.871  59.354  1.00 46.91 ? 9    UNK I O   1 
ATOM   7622  C  CB  . UNK I  9  9   ? 25.643  88.685  57.518  1.00 46.91 ? 9    UNK I CB  1 
ATOM   7623  N  N   . UNK I  9  10  ? 22.643  87.478  57.523  1.00 46.91 ? 10   UNK I N   1 
ATOM   7624  C  CA  . UNK I  9  10  ? 21.342  87.416  58.179  1.00 46.91 ? 10   UNK I CA  1 
ATOM   7625  C  C   . UNK I  9  10  ? 20.730  86.024  58.050  1.00 46.91 ? 10   UNK I C   1 
ATOM   7626  O  O   . UNK I  9  10  ? 19.892  85.627  58.863  1.00 46.91 ? 10   UNK I O   1 
ATOM   7627  C  CB  . UNK I  9  10  ? 20.384  88.435  57.544  1.00 46.91 ? 10   UNK I CB  1 
ATOM   7628  N  N   . UNK I  9  11  ? 21.124  85.303  57.003  1.00 46.91 ? 11   UNK I N   1 
ATOM   7629  C  CA  . UNK I  9  11  ? 20.625  83.954  56.757  1.00 46.91 ? 11   UNK I CA  1 
ATOM   7630  C  C   . UNK I  9  11  ? 21.368  82.920  57.598  1.00 46.91 ? 11   UNK I C   1 
ATOM   7631  O  O   . UNK I  9  11  ? 20.846  81.836  57.864  1.00 46.91 ? 11   UNK I O   1 
ATOM   7632  C  CB  . UNK I  9  11  ? 20.797  83.595  55.271  1.00 46.91 ? 11   UNK I CB  1 
ATOM   7633  N  N   . UNK I  9  12  ? 22.599  83.246  57.978  1.00 46.91 ? 12   UNK I N   1 
ATOM   7634  C  CA  . UNK I  9  12  ? 23.421  82.356  58.791  1.00 46.91 ? 12   UNK I CA  1 
ATOM   7635  C  C   . UNK I  9  12  ? 23.102  82.513  60.274  1.00 46.91 ? 12   UNK I C   1 
ATOM   7636  O  O   . UNK I  9  12  ? 23.391  81.624  61.077  1.00 46.91 ? 12   UNK I O   1 
ATOM   7637  C  CB  . UNK I  9  12  ? 24.908  82.669  58.570  1.00 46.91 ? 12   UNK I CB  1 
ATOM   7638  N  N   . UNK I  9  13  ? 22.548  83.666  60.637  1.00 46.91 ? 13   UNK I N   1 
ATOM   7639  C  CA  . UNK I  9  13  ? 22.186  83.949  62.020  1.00 46.91 ? 13   UNK I CA  1 
ATOM   7640  C  C   . UNK I  9  13  ? 20.786  83.440  62.353  1.00 46.91 ? 13   UNK I C   1 
ATOM   7641  O  O   . UNK I  9  13  ? 20.395  83.398  63.522  1.00 46.91 ? 13   UNK I O   1 
ATOM   7642  C  CB  . UNK I  9  13  ? 22.230  85.464  62.275  1.00 46.91 ? 13   UNK I CB  1 
ATOM   7643  N  N   . UNK I  9  14  ? 20.025  83.090  61.319  1.00 46.91 ? 14   UNK I N   1 
ATOM   7644  C  CA  . UNK I  9  14  ? 18.668  82.588  61.495  1.00 46.91 ? 14   UNK I CA  1 
ATOM   7645  C  C   . UNK I  9  14  ? 18.595  81.069  61.355  1.00 46.91 ? 14   UNK I C   1 
ATOM   7646  O  O   . UNK I  9  14  ? 17.654  80.439  61.842  1.00 46.91 ? 14   UNK I O   1 
ATOM   7647  C  CB  . UNK I  9  14  ? 17.734  83.222  60.448  1.00 46.91 ? 14   UNK I CB  1 
ATOM   7648  N  N   . UNK I  9  15  ? 19.569  80.492  60.657  1.00 46.91 ? 15   UNK I N   1 
ATOM   7649  C  CA  . UNK I  9  15  ? 19.617  79.050  60.447  1.00 46.91 ? 15   UNK I CA  1 
ATOM   7650  C  C   . UNK I  9  15  ? 20.337  78.324  61.580  1.00 46.91 ? 15   UNK I C   1 
ATOM   7651  O  O   . UNK I  9  15  ? 20.029  77.170  61.884  1.00 46.91 ? 15   UNK I O   1 
ATOM   7652  C  CB  . UNK I  9  15  ? 20.345  78.738  59.125  1.00 46.91 ? 15   UNK I CB  1 
ATOM   7653  N  N   . UNK I  9  16  ? 21.325  78.991  62.171  1.00 46.91 ? 16   UNK I N   1 
ATOM   7654  C  CA  . UNK I  9  16  ? 22.098  78.417  63.266  1.00 46.91 ? 16   UNK I CA  1 
ATOM   7655  C  C   . UNK I  9  16  ? 21.381  78.548  64.608  1.00 46.91 ? 16   UNK I C   1 
ATOM   7656  O  O   . UNK I  9  16  ? 21.653  77.791  65.540  1.00 46.91 ? 16   UNK I O   1 
ATOM   7657  C  CB  . UNK I  9  16  ? 23.462  79.122  63.369  1.00 46.91 ? 16   UNK I CB  1 
ATOM   7658  N  N   . UNK I  9  17  ? 20.503  79.541  64.710  1.00 46.91 ? 17   UNK I N   1 
ATOM   7659  C  CA  . UNK I  9  17  ? 19.745  79.781  65.933  1.00 46.91 ? 17   UNK I CA  1 
ATOM   7660  C  C   . UNK I  9  17  ? 18.523  78.871  66.033  1.00 46.91 ? 17   UNK I C   1 
ATOM   7661  O  O   . UNK I  9  17  ? 18.041  78.586  67.132  1.00 46.91 ? 17   UNK I O   1 
ATOM   7662  C  CB  . UNK I  9  17  ? 19.272  81.244  65.977  1.00 46.91 ? 17   UNK I CB  1 
ATOM   7663  N  N   . UNK I  9  18  ? 18.002  78.457  64.882  1.00 46.91 ? 18   UNK I N   1 
ATOM   7664  C  CA  . UNK I  9  18  ? 16.836  77.581  64.829  1.00 46.91 ? 18   UNK I CA  1 
ATOM   7665  C  C   . UNK I  9  18  ? 17.219  76.121  65.056  1.00 46.91 ? 18   UNK I C   1 
ATOM   7666  O  O   . UNK I  9  18  ? 16.383  75.308  65.457  1.00 46.91 ? 18   UNK I O   1 
ATOM   7667  C  CB  . UNK I  9  18  ? 16.151  77.702  63.457  1.00 46.91 ? 18   UNK I CB  1 
ATOM   7668  N  N   . UNK I  9  19  ? 18.472  75.788  64.759  1.00 46.91 ? 19   UNK I N   1 
ATOM   7669  C  CA  . UNK I  9  19  ? 18.973  74.429  64.929  1.00 46.91 ? 19   UNK I CA  1 
ATOM   7670  C  C   . UNK I  9  19  ? 19.456  74.177  66.357  1.00 46.91 ? 19   UNK I C   1 
ATOM   7671  O  O   . UNK I  9  19  ? 19.577  73.028  66.785  1.00 46.91 ? 19   UNK I O   1 
ATOM   7672  C  CB  . UNK I  9  19  ? 20.145  74.178  63.964  1.00 46.91 ? 19   UNK I CB  1 
ATOM   7673  N  N   . UNK I  9  20  ? 19.766  75.255  67.072  1.00 46.91 ? 20   UNK I N   1 
ATOM   7674  C  CA  . UNK I  9  20  ? 20.236  75.161  68.449  1.00 46.91 ? 20   UNK I CA  1 
ATOM   7675  C  C   . UNK I  9  20  ? 19.068  75.003  69.420  1.00 46.91 ? 20   UNK I C   1 
ATOM   7676  O  O   . UNK I  9  20  ? 19.214  74.409  70.491  1.00 46.91 ? 20   UNK I O   1 
ATOM   7677  C  CB  . UNK I  9  20  ? 21.018  76.428  68.824  1.00 46.91 ? 20   UNK I CB  1 
ATOM   7678  N  N   . UNK I  9  21  ? 17.924  75.575  69.052  1.00 46.91 ? 21   UNK I N   1 
ATOM   7679  C  CA  . UNK I  9  21  ? 16.743  75.487  69.895  1.00 46.91 ? 21   UNK I CA  1 
ATOM   7680  C  C   . UNK I  9  21  ? 16.004  74.171  69.734  1.00 46.91 ? 21   UNK I C   1 
ATOM   7681  O  O   . UNK I  9  21  ? 15.373  73.688  70.676  1.00 46.91 ? 21   UNK I O   1 
ATOM   7682  C  CB  . UNK I  9  21  ? 15.773  76.639  69.555  1.00 46.91 ? 21   UNK I CB  1 
ATOM   7683  N  N   . UNK I  9  22  ? 16.052  73.613  68.528  1.00 46.91 ? 22   UNK I N   1 
ATOM   7684  C  CA  . UNK I  9  22  ? 15.389  72.348  68.231  1.00 46.91 ? 22   UNK I CA  1 
ATOM   7685  C  C   . UNK I  9  22  ? 16.157  71.165  68.817  1.00 46.91 ? 22   UNK I C   1 
ATOM   7686  O  O   . UNK I  9  22  ? 15.558  70.173  69.237  1.00 46.91 ? 22   UNK I O   1 
ATOM   7687  C  CB  . UNK I  9  22  ? 15.278  72.157  66.709  1.00 46.91 ? 22   UNK I CB  1 
ATOM   7688  N  N   . UNK I  9  23  ? 17.483  71.265  68.808  1.00 46.91 ? 23   UNK I N   1 
ATOM   7689  C  CA  . UNK I  9  23  ? 18.347  70.214  69.337  1.00 46.91 ? 23   UNK I CA  1 
ATOM   7690  C  C   . UNK I  9  23  ? 18.490  70.304  70.855  1.00 46.91 ? 23   UNK I C   1 
ATOM   7691  O  O   . UNK I  9  23  ? 19.137  69.455  71.475  1.00 46.91 ? 23   UNK I O   1 
ATOM   7692  C  CB  . UNK I  9  23  ? 19.746  70.320  68.704  1.00 46.91 ? 23   UNK I CB  1 
ATOM   7693  N  N   . UNK I  9  24  ? 17.891  71.336  71.443  1.00 46.91 ? 24   UNK I N   1 
ATOM   7694  C  CA  . UNK I  9  24  ? 17.941  71.559  72.883  1.00 46.91 ? 24   UNK I CA  1 
ATOM   7695  C  C   . UNK I  9  24  ? 17.402  70.373  73.677  1.00 46.91 ? 24   UNK I C   1 
ATOM   7696  O  O   . UNK I  9  24  ? 17.945  70.022  74.728  1.00 46.91 ? 24   UNK I O   1 
ATOM   7697  C  CB  . UNK I  9  24  ? 17.114  72.807  73.247  1.00 46.91 ? 24   UNK I CB  1 
ATOM   7698  N  N   . UNK I  9  25  ? 16.338  69.758  73.167  1.00 46.91 ? 25   UNK I N   1 
ATOM   7699  C  CA  . UNK I  9  25  ? 15.742  68.617  73.837  1.00 46.91 ? 25   UNK I CA  1 
ATOM   7700  C  C   . UNK I  9  25  ? 14.520  68.987  74.655  1.00 46.91 ? 25   UNK I C   1 
ATOM   7701  O  O   . UNK I  9  25  ? 14.641  69.499  75.771  1.00 46.91 ? 25   UNK I O   1 
ATOM   7702  C  CB  . UNK I  9  25  ? 16.779  67.961  74.773  1.00 46.91 ? 25   UNK I CB  1 
ATOM   7703  N  N   . UNK I  9  26  ? 13.341  68.730  74.095  1.00 46.91 ? 26   UNK I N   1 
ATOM   7704  C  CA  . UNK I  9  26  ? 12.078  69.028  74.763  1.00 46.91 ? 26   UNK I CA  1 
ATOM   7705  C  C   . UNK I  9  26  ? 11.614  67.841  75.605  1.00 46.91 ? 26   UNK I C   1 
ATOM   7706  O  O   . UNK I  9  26  ? 11.661  66.686  75.150  1.00 46.91 ? 26   UNK I O   1 
ATOM   7707  C  CB  . UNK I  9  26  ? 10.995  69.346  73.723  1.00 46.91 ? 26   UNK I CB  1 
ATOM   7708  N  N   . ALA J  10 5   ? 30.587  86.029  87.649  1.00 46.91 ? 5    ALA K N   1 
ATOM   7709  C  CA  . ALA J  10 5   ? 30.576  84.539  87.704  1.00 46.91 ? 5    ALA K CA  1 
ATOM   7710  C  C   . ALA J  10 5   ? 31.584  83.930  86.732  1.00 46.91 ? 5    ALA K C   1 
ATOM   7711  O  O   . ALA J  10 5   ? 32.309  83.000  87.087  1.00 46.91 ? 5    ALA K O   1 
ATOM   7712  C  CB  . ALA J  10 5   ? 29.175  84.014  87.412  1.00 46.91 ? 5    ALA K CB  1 
ATOM   7713  N  N   . TYR J  10 6   ? 31.622  84.467  85.514  1.00 46.91 ? 6    TYR K N   1 
ATOM   7714  C  CA  . TYR J  10 6   ? 32.526  83.999  84.466  1.00 46.91 ? 6    TYR K CA  1 
ATOM   7715  C  C   . TYR J  10 6   ? 32.341  82.515  84.147  1.00 46.91 ? 6    TYR K C   1 
ATOM   7716  O  O   . TYR J  10 6   ? 33.313  81.768  84.013  1.00 46.91 ? 6    TYR K O   1 
ATOM   7717  C  CB  . TYR J  10 6   ? 33.985  84.288  84.851  1.00 46.91 ? 6    TYR K CB  1 
ATOM   7718  N  N   . ALA J  10 7   ? 31.084  82.099  84.028  1.00 57.92 ? 7    ALA K N   1 
ATOM   7719  C  CA  . ALA J  10 7   ? 30.751  80.711  83.724  1.00 57.82 ? 7    ALA K CA  1 
ATOM   7720  C  C   . ALA J  10 7   ? 30.624  80.462  82.222  1.00 58.73 ? 7    ALA K C   1 
ATOM   7721  O  O   . ALA J  10 7   ? 30.245  79.369  81.798  1.00 57.86 ? 7    ALA K O   1 
ATOM   7722  C  CB  . ALA J  10 7   ? 29.462  80.317  84.437  1.00 57.10 ? 7    ALA K CB  1 
ATOM   7723  N  N   . ILE J  10 8   ? 30.907  81.488  81.425  1.00 46.91 ? 8    ILE K N   1 
ATOM   7724  C  CA  . ILE J  10 8   ? 30.825  81.378  79.972  1.00 46.91 ? 8    ILE K CA  1 
ATOM   7725  C  C   . ILE J  10 8   ? 32.173  81.000  79.355  1.00 46.91 ? 8    ILE K C   1 
ATOM   7726  O  O   . ILE J  10 8   ? 32.493  81.418  78.241  1.00 46.91 ? 8    ILE K O   1 
ATOM   7727  C  CB  . ILE J  10 8   ? 30.329  82.696  79.341  1.00 46.91 ? 8    ILE K CB  1 
ATOM   7728  N  N   . PHE J  10 9   ? 32.961  80.224  80.093  1.00 46.91 ? 9    PHE K N   1 
ATOM   7729  C  CA  . PHE J  10 9   ? 34.273  79.789  79.626  1.00 46.91 ? 9    PHE K CA  1 
ATOM   7730  C  C   . PHE J  10 9   ? 34.170  78.636  78.627  1.00 46.91 ? 9    PHE K C   1 
ATOM   7731  O  O   . PHE J  10 9   ? 35.050  78.457  77.785  1.00 46.91 ? 9    PHE K O   1 
ATOM   7732  C  CB  . PHE J  10 9   ? 35.145  79.373  80.812  1.00 46.91 ? 9    PHE K CB  1 
ATOM   7733  N  N   . ASP J  10 10  ? 33.110  77.842  78.750  1.00 46.91 ? 10   ASP K N   1 
ATOM   7734  C  CA  . ASP J  10 10  ? 32.888  76.706  77.863  1.00 46.91 ? 10   ASP K CA  1 
ATOM   7735  C  C   . ASP J  10 10  ? 32.326  77.139  76.509  1.00 46.91 ? 10   ASP K C   1 
ATOM   7736  O  O   . ASP J  10 10  ? 32.383  76.387  75.533  1.00 46.91 ? 10   ASP K O   1 
ATOM   7737  C  CB  . ASP J  10 10  ? 31.941  75.697  78.521  1.00 46.91 ? 10   ASP K CB  1 
ATOM   7738  N  N   . PRO J  10 11  ? 31.739  78.344  76.446  1.00 46.91 ? 11   PRO K N   1 
ATOM   7739  C  CA  . PRO J  10 11  ? 31.159  78.888  75.215  1.00 46.91 ? 11   PRO K CA  1 
ATOM   7740  C  C   . PRO J  10 11  ? 32.163  79.665  74.365  1.00 46.91 ? 11   PRO K C   1 
ATOM   7741  O  O   . PRO J  10 11  ? 31.844  80.093  73.253  1.00 46.91 ? 11   PRO K O   1 
ATOM   7742  C  CB  . PRO J  10 11  ? 30.041  79.798  75.723  1.00 46.91 ? 11   PRO K CB  1 
ATOM   7743  N  N   . LEU J  10 12  ? 33.360  79.876  74.904  1.00 46.91 ? 12   LEU K N   1 
ATOM   7744  C  CA  . LEU J  10 12  ? 34.408  80.604  74.197  1.00 46.91 ? 12   LEU K CA  1 
ATOM   7745  C  C   . LEU J  10 12  ? 35.538  79.686  73.735  1.00 46.91 ? 12   LEU K C   1 
ATOM   7746  O  O   . LEU J  10 12  ? 36.434  80.114  73.003  1.00 46.91 ? 12   LEU K O   1 
ATOM   7747  C  CB  . LEU J  10 12  ? 34.972  81.714  75.086  1.00 46.91 ? 12   LEU K CB  1 
ATOM   7748  N  N   . VAL J  10 13  ? 35.508  78.437  74.192  1.00 46.91 ? 13   VAL K N   1 
ATOM   7749  C  CA  . VAL J  10 13  ? 36.523  77.455  73.831  1.00 46.91 ? 13   VAL K CA  1 
ATOM   7750  C  C   . VAL J  10 13  ? 36.140  76.675  72.577  1.00 46.91 ? 13   VAL K C   1 
ATOM   7751  O  O   . VAL J  10 13  ? 36.987  76.406  71.722  1.00 46.91 ? 13   VAL K O   1 
ATOM   7752  C  CB  . VAL J  10 13  ? 36.766  76.457  74.981  1.00 46.91 ? 13   VAL K CB  1 
ATOM   7753  N  N   . ASP J  10 14  ? 34.872  76.282  72.497  1.00 46.91 ? 14   ASP K N   1 
ATOM   7754  C  CA  . ASP J  10 14  ? 34.366  75.527  71.356  1.00 46.91 ? 14   ASP K CA  1 
ATOM   7755  C  C   . ASP J  10 14  ? 34.167  76.418  70.132  1.00 46.91 ? 14   ASP K C   1 
ATOM   7756  O  O   . ASP J  10 14  ? 34.459  76.014  69.006  1.00 46.91 ? 14   ASP K O   1 
ATOM   7757  C  CB  . ASP J  10 14  ? 33.047  74.836  71.719  1.00 46.91 ? 14   ASP K CB  1 
ATOM   7758  N  N   . VAL J  10 15  ? 33.653  77.624  70.360  1.00 46.91 ? 15   VAL K N   1 
ATOM   7759  C  CA  . VAL J  10 15  ? 33.404  78.582  69.283  1.00 46.91 ? 15   VAL K CA  1 
ATOM   7760  C  C   . VAL J  10 15  ? 34.697  79.174  68.718  1.00 46.91 ? 15   VAL K C   1 
ATOM   7761  O  O   . VAL J  10 15  ? 34.678  79.869  67.699  1.00 46.91 ? 15   VAL K O   1 
ATOM   7762  C  CB  . VAL J  10 15  ? 32.499  79.737  69.764  1.00 46.91 ? 15   VAL K CB  1 
ATOM   7763  N  N   . LEU J  10 16  ? 35.812  78.910  69.395  1.00 46.91 ? 16   LEU K N   1 
ATOM   7764  C  CA  . LEU J  10 16  ? 37.120  79.408  68.975  1.00 46.91 ? 16   LEU K CA  1 
ATOM   7765  C  C   . LEU J  10 16  ? 37.624  78.720  67.709  1.00 46.91 ? 16   LEU K C   1 
ATOM   7766  O  O   . LEU J  10 16  ? 38.579  79.181  67.076  1.00 46.91 ? 16   LEU K O   1 
ATOM   7767  C  CB  . LEU J  10 16  ? 38.139  79.221  70.103  1.00 46.91 ? 16   LEU K CB  1 
ATOM   7768  N  N   . PRO J  10 17  ? 36.996  77.596  67.331  1.00 46.91 ? 17   PRO K N   1 
ATOM   7769  C  CA  . PRO J  10 17  ? 37.346  76.808  66.145  1.00 46.91 ? 17   PRO K CA  1 
ATOM   7770  C  C   . PRO J  10 17  ? 36.106  76.332  65.392  1.00 46.91 ? 17   PRO K C   1 
ATOM   7771  O  O   . PRO J  10 17  ? 36.209  75.593  64.411  1.00 46.91 ? 17   PRO K O   1 
ATOM   7772  C  CB  . PRO J  10 17  ? 38.135  75.632  66.721  1.00 46.91 ? 17   PRO K CB  1 
ATOM   7773  N  N   . VAL J  10 18  ? 34.936  76.739  65.876  1.00 46.91 ? 18   VAL K N   1 
ATOM   7774  C  CA  . VAL J  10 18  ? 33.672  76.367  65.254  1.00 46.91 ? 18   VAL K CA  1 
ATOM   7775  C  C   . VAL J  10 18  ? 33.215  77.456  64.291  1.00 46.91 ? 18   VAL K C   1 
ATOM   7776  O  O   . VAL J  10 18  ? 32.702  77.167  63.209  1.00 46.91 ? 18   VAL K O   1 
ATOM   7777  C  CB  . VAL J  10 18  ? 32.567  76.150  66.308  1.00 46.91 ? 18   VAL K CB  1 
ATOM   7778  N  N   . ILE J  10 19  ? 33.371  78.709  64.711  1.00 46.91 ? 19   ILE K N   1 
ATOM   7779  C  CA  . ILE J  10 19  ? 32.981  79.858  63.902  1.00 46.91 ? 19   ILE K CA  1 
ATOM   7780  C  C   . ILE J  10 19  ? 34.042  80.303  62.888  1.00 46.91 ? 19   ILE K C   1 
ATOM   7781  O  O   . ILE J  10 19  ? 33.714  80.591  61.737  1.00 46.91 ? 19   ILE K O   1 
ATOM   7782  C  CB  . ILE J  10 19  ? 32.583  81.063  64.785  1.00 46.91 ? 19   ILE K CB  1 
ATOM   7783  N  N   . PRO J  10 20  ? 35.318  80.416  63.316  1.00 46.91 ? 20   PRO K N   1 
ATOM   7784  C  CA  . PRO J  10 20  ? 36.400  80.835  62.416  1.00 46.91 ? 20   PRO K CA  1 
ATOM   7785  C  C   . PRO J  10 20  ? 36.618  79.859  61.264  1.00 46.91 ? 20   PRO K C   1 
ATOM   7786  O  O   . PRO J  10 20  ? 36.641  78.644  61.470  1.00 46.91 ? 20   PRO K O   1 
ATOM   7787  C  CB  . PRO J  10 20  ? 37.617  80.864  63.343  1.00 46.91 ? 20   PRO K CB  1 
ATOM   7788  C  CG  . PRO J  10 20  ? 37.025  81.173  64.676  1.00 46.91 ? 20   PRO K CG  1 
ATOM   7789  C  CD  . PRO J  10 20  ? 35.826  80.270  64.690  1.00 46.91 ? 20   PRO K CD  1 
ATOM   7790  N  N   . VAL J  10 21  ? 36.835  80.401  60.067  1.00 46.91 ? 21   VAL K N   1 
ATOM   7791  C  CA  . VAL J  10 21  ? 37.049  79.600  58.862  1.00 46.91 ? 21   VAL K CA  1 
ATOM   7792  C  C   . VAL J  10 21  ? 35.815  78.770  58.501  1.00 46.91 ? 21   VAL K C   1 
ATOM   7793  O  O   . VAL J  10 21  ? 35.905  77.788  57.760  1.00 46.91 ? 21   VAL K O   1 
ATOM   7794  C  CB  . VAL J  10 21  ? 38.274  78.664  59.003  1.00 46.91 ? 21   VAL K CB  1 
ATOM   7795  N  N   . LEU J  10 22  ? 34.664  79.184  59.022  1.00 46.91 ? 22   LEU K N   1 
ATOM   7796  C  CA  . LEU J  10 22  ? 33.396  78.508  58.773  1.00 46.91 ? 22   LEU K CA  1 
ATOM   7797  C  C   . LEU J  10 22  ? 32.289  79.537  58.558  1.00 46.91 ? 22   LEU K C   1 
ATOM   7798  O  O   . LEU J  10 22  ? 31.180  79.198  58.138  1.00 46.91 ? 22   LEU K O   1 
ATOM   7799  C  CB  . LEU J  10 22  ? 33.039  77.598  59.950  1.00 46.91 ? 22   LEU K CB  1 
ATOM   7800  N  N   . PHE J  10 23  ? 32.607  80.795  58.856  1.00 46.91 ? 23   PHE K N   1 
ATOM   7801  C  CA  . PHE J  10 23  ? 31.677  81.909  58.704  1.00 46.91 ? 23   PHE K CA  1 
ATOM   7802  C  C   . PHE J  10 23  ? 32.463  83.215  58.599  1.00 46.91 ? 23   PHE K C   1 
ATOM   7803  O  O   . PHE J  10 23  ? 31.883  84.293  58.452  1.00 46.91 ? 23   PHE K O   1 
ATOM   7804  C  CB  . PHE J  10 23  ? 30.718  81.971  59.896  1.00 46.91 ? 23   PHE K CB  1 
ATOM   7805  N  N   . LEU J  10 24  ? 33.784  83.109  58.702  1.00 46.91 ? 24   LEU K N   1 
ATOM   7806  C  CA  . LEU J  10 24  ? 34.673  84.262  58.614  1.00 46.91 ? 24   LEU K CA  1 
ATOM   7807  C  C   . LEU J  10 24  ? 35.602  84.137  57.407  1.00 46.91 ? 24   LEU K C   1 
ATOM   7808  O  O   . LEU J  10 24  ? 36.480  84.978  57.199  1.00 46.91 ? 24   LEU K O   1 
ATOM   7809  C  CB  . LEU J  10 24  ? 35.498  84.394  59.896  1.00 46.91 ? 24   LEU K CB  1 
ATOM   7810  N  N   . ALA J  10 25  ? 35.406  83.080  56.622  1.00 46.91 ? 25   ALA K N   1 
ATOM   7811  C  CA  . ALA J  10 25  ? 36.217  82.828  55.434  1.00 46.91 ? 25   ALA K CA  1 
ATOM   7812  C  C   . ALA J  10 25  ? 35.421  82.125  54.334  1.00 46.91 ? 25   ALA K C   1 
ATOM   7813  O  O   . ALA J  10 25  ? 35.851  82.085  53.179  1.00 46.91 ? 25   ALA K O   1 
ATOM   7814  C  CB  . ALA J  10 25  ? 37.447  82.006  55.804  1.00 46.91 ? 25   ALA K CB  1 
ATOM   7815  N  N   . LEU J  10 26  ? 34.287  81.536  54.703  1.00 46.91 ? 26   LEU K N   1 
ATOM   7816  C  CA  . LEU J  10 26  ? 33.435  80.840  53.743  1.00 46.91 ? 26   LEU K CA  1 
ATOM   7817  C  C   . LEU J  10 26  ? 32.523  81.828  53.020  1.00 46.91 ? 26   LEU K C   1 
ATOM   7818  O  O   . LEU J  10 26  ? 32.263  81.690  51.822  1.00 46.91 ? 26   LEU K O   1 
ATOM   7819  C  CB  . LEU J  10 26  ? 32.592  79.777  54.452  1.00 46.91 ? 26   LEU K CB  1 
ATOM   7820  N  N   . ALA J  10 27  ? 32.018  82.802  53.772  1.00 65.35 ? 27   ALA K N   1 
ATOM   7821  C  CA  . ALA J  10 27  ? 31.135  83.828  53.234  1.00 66.06 ? 27   ALA K CA  1 
ATOM   7822  C  C   . ALA J  10 27  ? 31.934  85.001  52.670  1.00 67.31 ? 27   ALA K C   1 
ATOM   7823  O  O   . ALA J  10 27  ? 31.557  85.584  51.654  1.00 69.31 ? 27   ALA K O   1 
ATOM   7824  C  CB  . ALA J  10 27  ? 30.178  84.313  54.315  1.00 65.97 ? 27   ALA K CB  1 
ATOM   7825  N  N   . PHE J  10 28  ? 33.022  85.354  53.350  1.00 46.91 ? 28   PHE K N   1 
ATOM   7826  C  CA  . PHE J  10 28  ? 33.878  86.459  52.926  1.00 46.91 ? 28   PHE K CA  1 
ATOM   7827  C  C   . PHE J  10 28  ? 34.715  86.095  51.702  1.00 46.91 ? 28   PHE K C   1 
ATOM   7828  O  O   . PHE J  10 28  ? 34.943  86.931  50.827  1.00 46.91 ? 28   PHE K O   1 
ATOM   7829  C  CB  . PHE J  10 28  ? 34.798  86.884  54.074  1.00 46.91 ? 28   PHE K CB  1 
ATOM   7830  N  N   . VAL J  10 29  ? 35.186  84.850  51.665  1.00 46.91 ? 29   VAL K N   1 
ATOM   7831  C  CA  . VAL J  10 29  ? 35.998  84.335  50.562  1.00 46.91 ? 29   VAL K CA  1 
ATOM   7832  C  C   . VAL J  10 29  ? 37.244  85.178  50.276  1.00 46.91 ? 29   VAL K C   1 
ATOM   7833  O  O   . VAL J  10 29  ? 37.567  85.457  49.117  1.00 46.91 ? 29   VAL K O   1 
ATOM   7834  C  CB  . VAL J  10 29  ? 35.161  84.198  49.272  1.00 46.91 ? 29   VAL K CB  1 
ATOM   7835  N  N   . TRP J  10 30  ? 37.955  85.558  51.335  1.00 46.91 ? 30   TRP K N   1 
ATOM   7836  C  CA  . TRP J  10 30  ? 39.164  86.367  51.210  1.00 46.91 ? 30   TRP K CA  1 
ATOM   7837  C  C   . TRP J  10 30  ? 40.395  85.534  50.847  1.00 46.91 ? 30   TRP K C   1 
ATOM   7838  O  O   . TRP J  10 30  ? 40.916  85.637  49.735  1.00 46.91 ? 30   TRP K O   1 
ATOM   7839  C  CB  . TRP J  10 30  ? 39.417  87.144  52.504  1.00 46.91 ? 30   TRP K CB  1 
ATOM   7840  N  N   . GLN J  10 31  ? 40.866  84.735  51.805  1.00 46.91 ? 31   GLN K N   1 
ATOM   7841  C  CA  . GLN J  10 31  ? 42.032  83.862  51.633  1.00 46.91 ? 31   GLN K CA  1 
ATOM   7842  C  C   . GLN J  10 31  ? 43.348  84.609  51.423  1.00 46.91 ? 31   GLN K C   1 
ATOM   7843  O  O   . GLN J  10 31  ? 44.400  83.950  51.565  1.00 46.91 ? 31   GLN K O   1 
ATOM   7844  C  CB  . GLN J  10 31  ? 41.803  82.872  50.483  1.00 46.91 ? 31   GLN K CB  1 
ATOM   7845  N  N   . UNK K  11 1   ? 32.447  32.012  75.395  1.00 46.91 ? 1    UNK O N   1 
ATOM   7846  C  CA  . UNK K  11 1   ? 32.936  33.404  75.170  1.00 46.91 ? 1    UNK O CA  1 
ATOM   7847  C  C   . UNK K  11 1   ? 34.460  33.453  75.109  1.00 46.91 ? 1    UNK O C   1 
ATOM   7848  O  O   . UNK K  11 1   ? 35.143  33.158  76.092  1.00 46.91 ? 1    UNK O O   1 
ATOM   7849  C  CB  . UNK K  11 1   ? 32.422  34.323  76.272  1.00 46.91 ? 1    UNK O CB  1 
ATOM   7850  N  N   . UNK K  11 2   ? 34.987  33.811  73.940  1.00 46.91 ? 2    UNK O N   1 
ATOM   7851  C  CA  . UNK K  11 2   ? 36.429  33.905  73.739  1.00 46.91 ? 2    UNK O CA  1 
ATOM   7852  C  C   . UNK K  11 2   ? 36.849  35.356  73.523  1.00 46.91 ? 2    UNK O C   1 
ATOM   7853  O  O   . UNK K  11 2   ? 36.130  36.132  72.890  1.00 46.91 ? 2    UNK O O   1 
ATOM   7854  C  CB  . UNK K  11 2   ? 36.847  33.052  72.548  1.00 46.91 ? 2    UNK O CB  1 
ATOM   7855  N  N   . UNK K  11 3   ? 38.018  35.716  74.050  1.00 46.91 ? 3    UNK O N   1 
ATOM   7856  C  CA  . UNK K  11 3   ? 38.538  37.074  73.918  1.00 46.91 ? 3    UNK O CA  1 
ATOM   7857  C  C   . UNK K  11 3   ? 40.060  37.113  74.048  1.00 46.91 ? 3    UNK O C   1 
ATOM   7858  O  O   . UNK K  11 3   ? 40.690  36.112  74.394  1.00 46.91 ? 3    UNK O O   1 
ATOM   7859  C  CB  . UNK K  11 3   ? 37.898  37.985  74.962  1.00 46.91 ? 3    UNK O CB  1 
ATOM   7860  N  N   . UNK K  11 4   ? 40.643  38.268  73.735  1.00 46.91 ? 4    UNK O N   1 
ATOM   7861  C  CA  . UNK K  11 4   ? 42.088  38.449  73.822  1.00 46.91 ? 4    UNK O CA  1 
ATOM   7862  C  C   . UNK K  11 4   ? 42.494  38.855  75.236  1.00 46.91 ? 4    UNK O C   1 
ATOM   7863  O  O   . UNK K  11 4   ? 41.820  39.668  75.875  1.00 46.91 ? 4    UNK O O   1 
ATOM   7864  C  CB  . UNK K  11 4   ? 42.548  39.497  72.818  1.00 46.91 ? 4    UNK O CB  1 
ATOM   7865  N  N   . UNK K  11 5   ? 43.596  38.284  75.714  1.00 46.91 ? 5    UNK O N   1 
ATOM   7866  C  CA  . UNK K  11 5   ? 44.100  38.578  77.052  1.00 46.91 ? 5    UNK O CA  1 
ATOM   7867  C  C   . UNK K  11 5   ? 44.528  40.037  77.186  1.00 46.91 ? 5    UNK O C   1 
ATOM   7868  O  O   . UNK K  11 5   ? 45.272  40.559  76.350  1.00 46.91 ? 5    UNK O O   1 
ATOM   7869  C  CB  . UNK K  11 5   ? 45.260  37.656  77.391  1.00 46.91 ? 5    UNK O CB  1 
ATOM   7870  N  N   . UNK K  11 6   ? 44.045  40.687  78.240  1.00 46.91 ? 6    UNK O N   1 
ATOM   7871  C  CA  . UNK K  11 6   ? 44.363  42.086  78.501  1.00 46.91 ? 6    UNK O CA  1 
ATOM   7872  C  C   . UNK K  11 6   ? 45.188  42.235  79.778  1.00 46.91 ? 6    UNK O C   1 
ATOM   7873  O  O   . UNK K  11 6   ? 44.760  42.884  80.736  1.00 46.91 ? 6    UNK O O   1 
ATOM   7874  C  CB  . UNK K  11 6   ? 43.079  42.906  78.594  1.00 46.91 ? 6    UNK O CB  1 
ATOM   7875  N  N   . UNK K  11 7   ? 46.378  41.638  79.776  1.00 46.91 ? 7    UNK O N   1 
ATOM   7876  C  CA  . UNK K  11 7   ? 47.290  41.684  80.919  1.00 46.91 ? 7    UNK O CA  1 
ATOM   7877  C  C   . UNK K  11 7   ? 46.666  41.112  82.195  1.00 46.91 ? 7    UNK O C   1 
ATOM   7878  O  O   . UNK K  11 7   ? 45.797  40.242  82.134  1.00 46.91 ? 7    UNK O O   1 
ATOM   7879  C  CB  . UNK K  11 7   ? 47.780  43.118  81.153  1.00 46.91 ? 7    UNK O CB  1 
ATOM   7880  N  N   . UNK K  11 8   ? 47.136  41.584  83.347  1.00 46.91 ? 8    UNK O N   1 
ATOM   7881  C  CA  . UNK K  11 8   ? 46.630  41.124  84.634  1.00 46.91 ? 8    UNK O CA  1 
ATOM   7882  C  C   . UNK K  11 8   ? 46.550  42.274  85.638  1.00 46.91 ? 8    UNK O C   1 
ATOM   7883  O  O   . UNK K  11 8   ? 47.236  42.268  86.663  1.00 46.91 ? 8    UNK O O   1 
ATOM   7884  C  CB  . UNK K  11 8   ? 47.518  40.005  85.174  1.00 46.91 ? 8    UNK O CB  1 
ATOM   7885  N  N   . UNK K  11 9   ? 45.704  43.256  85.328  1.00 46.91 ? 9    UNK O N   1 
ATOM   7886  C  CA  . UNK K  11 9   ? 45.498  44.431  86.176  1.00 46.91 ? 9    UNK O CA  1 
ATOM   7887  C  C   . UNK K  11 9   ? 46.794  45.182  86.470  1.00 46.91 ? 9    UNK O C   1 
ATOM   7888  O  O   . UNK K  11 9   ? 46.765  46.428  86.365  1.00 46.91 ? 9    UNK O O   1 
ATOM   7889  C  CB  . UNK K  11 9   ? 44.806  44.030  87.477  1.00 46.91 ? 9    UNK O CB  1 
ATOM   7890  N  N   . UNK K  11 10  ? 45.786  42.630  91.821  1.00 46.91 ? 10   UNK O N   1 
ATOM   7891  C  CA  . UNK K  11 10  ? 46.098  41.911  90.550  1.00 46.91 ? 10   UNK O CA  1 
ATOM   7892  C  C   . UNK K  11 10  ? 45.147  40.738  90.326  1.00 46.91 ? 10   UNK O C   1 
ATOM   7893  O  O   . UNK K  11 10  ? 44.251  40.484  91.137  1.00 46.91 ? 10   UNK O O   1 
ATOM   7894  C  CB  . UNK K  11 10  ? 47.543  41.425  90.563  1.00 46.91 ? 10   UNK O CB  1 
ATOM   7895  N  N   . UNK K  11 11  ? 45.337  40.037  89.211  1.00 46.91 ? 11   UNK O N   1 
ATOM   7896  C  CA  . UNK K  11 11  ? 44.503  38.892  88.865  1.00 46.91 ? 11   UNK O CA  1 
ATOM   7897  C  C   . UNK K  11 11  ? 44.948  37.612  89.573  1.00 46.91 ? 11   UNK O C   1 
ATOM   7898  O  O   . UNK K  11 11  ? 45.909  37.617  90.347  1.00 46.91 ? 11   UNK O O   1 
ATOM   7899  C  CB  . UNK K  11 11  ? 44.499  38.687  87.356  1.00 46.91 ? 11   UNK O CB  1 
ATOM   7900  N  N   . UNK K  11 12  ? 44.231  36.525  89.305  1.00 46.91 ? 12   UNK O N   1 
ATOM   7901  C  CA  . UNK K  11 12  ? 44.523  35.224  89.900  1.00 46.91 ? 12   UNK O CA  1 
ATOM   7902  C  C   . UNK K  11 12  ? 45.829  34.629  89.380  1.00 46.91 ? 12   UNK O C   1 
ATOM   7903  O  O   . UNK K  11 12  ? 46.545  33.955  90.122  1.00 46.91 ? 12   UNK O O   1 
ATOM   7904  C  CB  . UNK K  11 12  ? 43.371  34.263  89.640  1.00 46.91 ? 12   UNK O CB  1 
ATOM   7905  N  N   . UNK K  11 13  ? 46.120  34.879  88.104  1.00 46.91 ? 13   UNK O N   1 
ATOM   7906  C  CA  . UNK K  11 13  ? 47.327  34.379  87.440  1.00 46.91 ? 13   UNK O CA  1 
ATOM   7907  C  C   . UNK K  11 13  ? 47.326  32.855  87.327  1.00 46.91 ? 13   UNK O C   1 
ATOM   7908  O  O   . UNK K  11 13  ? 47.743  32.146  88.247  1.00 46.91 ? 13   UNK O O   1 
ATOM   7909  C  CB  . UNK K  11 13  ? 48.585  34.867  88.163  1.00 46.91 ? 13   UNK O CB  1 
ATOM   7910  N  N   . UNK K  11 14  ? 46.831  32.356  86.198  1.00 46.91 ? 14   UNK O N   1 
ATOM   7911  C  CA  . UNK K  11 14  ? 46.759  30.919  85.954  1.00 46.91 ? 14   UNK O CA  1 
ATOM   7912  C  C   . UNK K  11 14  ? 48.069  30.339  85.422  1.00 46.91 ? 14   UNK O C   1 
ATOM   7913  O  O   . UNK K  11 14  ? 48.368  30.452  84.231  1.00 46.91 ? 14   UNK O O   1 
ATOM   7914  C  CB  . UNK K  11 14  ? 45.615  30.607  84.996  1.00 46.91 ? 14   UNK O CB  1 
ATOM   7915  N  N   . UNK K  11 15  ? 48.819  29.684  86.306  1.00 46.91 ? 15   UNK O N   1 
ATOM   7916  C  CA  . UNK K  11 15  ? 50.099  29.059  85.969  1.00 46.91 ? 15   UNK O CA  1 
ATOM   7917  C  C   . UNK K  11 15  ? 51.137  30.036  85.411  1.00 46.91 ? 15   UNK O C   1 
ATOM   7918  O  O   . UNK K  11 15  ? 51.946  30.585  86.162  1.00 46.91 ? 15   UNK O O   1 
ATOM   7919  C  CB  . UNK K  11 15  ? 49.886  27.888  85.006  1.00 46.91 ? 15   UNK O CB  1 
ATOM   7920  N  N   . UNK K  11 16  ? 51.145  30.204  84.092  1.00 46.91 ? 16   UNK O N   1 
ATOM   7921  C  CA  . UNK K  11 16  ? 52.081  31.108  83.430  1.00 46.91 ? 16   UNK O CA  1 
ATOM   7922  C  C   . UNK K  11 16  ? 51.623  32.563  83.525  1.00 46.91 ? 16   UNK O C   1 
ATOM   7923  O  O   . UNK K  11 16  ? 50.636  32.874  84.195  1.00 46.91 ? 16   UNK O O   1 
ATOM   7924  C  CB  . UNK K  11 16  ? 52.258  30.701  81.971  1.00 46.91 ? 16   UNK O CB  1 
ATOM   7925  N  N   . UNK K  11 17  ? 52.351  33.452  82.855  1.00 46.91 ? 17   UNK O N   1 
ATOM   7926  C  CA  . UNK K  11 17  ? 52.027  34.876  82.849  1.00 46.91 ? 17   UNK O CA  1 
ATOM   7927  C  C   . UNK K  11 17  ? 52.660  35.578  81.650  1.00 46.91 ? 17   UNK O C   1 
ATOM   7928  O  O   . UNK K  11 17  ? 52.004  36.366  80.965  1.00 46.91 ? 17   UNK O O   1 
ATOM   7929  C  CB  . UNK K  11 17  ? 52.489  35.529  84.148  1.00 46.91 ? 17   UNK O CB  1 
ATOM   7930  N  N   . UNK K  11 18  ? 53.939  35.297  81.410  1.00 46.91 ? 18   UNK O N   1 
ATOM   7931  C  CA  . UNK K  11 18  ? 54.675  35.892  80.295  1.00 46.91 ? 18   UNK O CA  1 
ATOM   7932  C  C   . UNK K  11 18  ? 56.005  35.182  80.060  1.00 46.91 ? 18   UNK O C   1 
ATOM   7933  O  O   . UNK K  11 18  ? 56.834  35.641  79.270  1.00 46.91 ? 18   UNK O O   1 
ATOM   7934  C  CB  . UNK K  11 18  ? 54.909  37.380  80.549  1.00 46.91 ? 18   UNK O CB  1 
ATOM   7935  N  N   . UNK K  11 19  ? 56.216  34.076  80.769  1.00 46.91 ? 19   UNK O N   1 
ATOM   7936  C  CA  . UNK K  11 19  ? 57.440  33.294  80.640  1.00 46.91 ? 19   UNK O CA  1 
ATOM   7937  C  C   . UNK K  11 19  ? 57.372  32.355  79.439  1.00 46.91 ? 19   UNK O C   1 
ATOM   7938  O  O   . UNK K  11 19  ? 58.376  32.126  78.759  1.00 46.91 ? 19   UNK O O   1 
ATOM   7939  C  CB  . UNK K  11 19  ? 57.696  32.504  81.917  1.00 46.91 ? 19   UNK O CB  1 
ATOM   7940  N  N   . UNK K  11 20  ? 56.186  31.805  79.192  1.00 46.91 ? 20   UNK O N   1 
ATOM   7941  C  CA  . UNK K  11 20  ? 55.968  30.888  78.079  1.00 46.91 ? 20   UNK O CA  1 
ATOM   7942  C  C   . UNK K  11 20  ? 54.485  30.799  77.740  1.00 46.91 ? 20   UNK O C   1 
ATOM   7943  O  O   . UNK K  11 20  ? 53.658  30.499  78.603  1.00 46.91 ? 20   UNK O O   1 
ATOM   7944  C  CB  . UNK K  11 20  ? 56.515  29.503  78.416  1.00 46.91 ? 20   UNK O CB  1 
ATOM   7945  N  N   . UNK K  11 21  ? 54.154  31.064  76.480  1.00 46.91 ? 21   UNK O N   1 
ATOM   7946  C  CA  . UNK K  11 21  ? 52.770  31.015  76.021  1.00 46.91 ? 21   UNK O CA  1 
ATOM   7947  C  C   . UNK K  11 21  ? 52.692  30.404  74.624  1.00 46.91 ? 21   UNK O C   1 
ATOM   7948  O  O   . UNK K  11 21  ? 52.439  31.100  73.638  1.00 46.91 ? 21   UNK O O   1 
ATOM   7949  C  CB  . UNK K  11 21  ? 52.162  32.417  76.030  1.00 46.91 ? 21   UNK O CB  1 
ATOM   7950  N  N   . UNK K  11 22  ? 52.923  29.097  74.551  1.00 46.91 ? 22   UNK O N   1 
ATOM   7951  C  CA  . UNK K  11 22  ? 52.886  28.370  73.288  1.00 46.91 ? 22   UNK O CA  1 
ATOM   7952  C  C   . UNK K  11 22  ? 52.525  26.906  73.518  1.00 46.91 ? 22   UNK O C   1 
ATOM   7953  O  O   . UNK K  11 22  ? 51.766  26.316  72.745  1.00 46.91 ? 22   UNK O O   1 
ATOM   7954  C  CB  . UNK K  11 22  ? 54.231  28.475  72.579  1.00 46.91 ? 22   UNK O CB  1 
ATOM   7955  N  N   . UNK K  11 23  ? 53.097  26.319  74.566  1.00 46.91 ? 23   UNK O N   1 
ATOM   7956  C  CA  . UNK K  11 23  ? 52.836  24.926  74.907  1.00 46.91 ? 23   UNK O CA  1 
ATOM   7957  C  C   . UNK K  11 23  ? 52.023  24.826  76.197  1.00 46.91 ? 23   UNK O C   1 
ATOM   7958  O  O   . UNK K  11 23  ? 50.805  25.013  76.183  1.00 46.91 ? 23   UNK O O   1 
ATOM   7959  C  CB  . UNK K  11 23  ? 54.151  24.160  75.035  1.00 46.91 ? 23   UNK O CB  1 
ATOM   7960  N  N   . UNK K  11 24  ? 52.707  24.550  77.307  1.00 46.91 ? 24   UNK O N   1 
ATOM   7961  C  CA  . UNK K  11 24  ? 52.075  24.419  78.620  1.00 46.91 ? 24   UNK O CA  1 
ATOM   7962  C  C   . UNK K  11 24  ? 50.982  23.349  78.644  1.00 46.91 ? 24   UNK O C   1 
ATOM   7963  O  O   . UNK K  11 24  ? 50.084  23.384  79.488  1.00 46.91 ? 24   UNK O O   1 
ATOM   7964  C  CB  . UNK K  11 24  ? 51.516  25.768  79.080  1.00 46.91 ? 24   UNK O CB  1 
ATOM   7965  N  N   . UNK K  11 25  ? 51.080  22.390  77.728  1.00 46.91 ? 25   UNK O N   1 
ATOM   7966  C  CA  . UNK K  11 25  ? 50.104  21.311  77.636  1.00 46.91 ? 25   UNK O CA  1 
ATOM   7967  C  C   . UNK K  11 25  ? 50.669  19.996  78.170  1.00 46.91 ? 25   UNK O C   1 
ATOM   7968  O  O   . UNK K  11 25  ? 50.404  19.620  79.313  1.00 46.91 ? 25   UNK O O   1 
ATOM   7969  C  CB  . UNK K  11 25  ? 49.639  21.144  76.193  1.00 46.91 ? 25   UNK O CB  1 
ATOM   7970  N  N   . UNK K  11 26  ? 51.470  19.325  77.342  1.00 46.91 ? 26   UNK O N   1 
ATOM   7971  C  CA  . UNK K  11 26  ? 52.093  18.044  77.684  1.00 46.91 ? 26   UNK O CA  1 
ATOM   7972  C  C   . UNK K  11 26  ? 51.099  16.882  77.736  1.00 46.91 ? 26   UNK O C   1 
ATOM   7973  O  O   . UNK K  11 26  ? 51.498  15.717  77.675  1.00 46.91 ? 26   UNK O O   1 
ATOM   7974  C  CB  . UNK K  11 26  ? 52.867  18.149  79.000  1.00 46.91 ? 26   UNK O CB  1 
ATOM   7975  N  N   . UNK K  11 27  ? 49.814  17.202  77.851  1.00 46.91 ? 27   UNK O N   1 
ATOM   7976  C  CA  . UNK K  11 27  ? 48.761  16.192  77.905  1.00 46.91 ? 27   UNK O CA  1 
ATOM   7977  C  C   . UNK K  11 27  ? 48.324  15.790  76.495  1.00 46.91 ? 27   UNK O C   1 
ATOM   7978  O  O   . UNK K  11 27  ? 48.675  16.453  75.517  1.00 46.91 ? 27   UNK O O   1 
ATOM   7979  C  CB  . UNK K  11 27  ? 47.571  16.717  78.698  1.00 46.91 ? 27   UNK O CB  1 
ATOM   7980  N  N   . UNK K  11 28  ? 47.548  14.711  76.409  1.00 46.91 ? 28   UNK O N   1 
ATOM   7981  C  CA  . UNK K  11 28  ? 47.041  14.187  75.139  1.00 46.91 ? 28   UNK O CA  1 
ATOM   7982  C  C   . UNK K  11 28  ? 48.159  13.805  74.166  1.00 46.91 ? 28   UNK O C   1 
ATOM   7983  O  O   . UNK K  11 28  ? 48.632  12.667  74.179  1.00 46.91 ? 28   UNK O O   1 
ATOM   7984  C  CB  . UNK K  11 28  ? 46.078  15.186  74.491  1.00 46.91 ? 28   UNK O CB  1 
ATOM   7985  N  N   . UNK K  11 29  ? 48.571  14.762  73.335  1.00 46.91 ? 29   UNK O N   1 
ATOM   7986  C  CA  . UNK K  11 29  ? 49.632  14.575  72.344  1.00 46.91 ? 29   UNK O CA  1 
ATOM   7987  C  C   . UNK K  11 29  ? 49.218  13.783  71.105  1.00 46.91 ? 29   UNK O C   1 
ATOM   7988  O  O   . UNK K  11 29  ? 49.551  14.167  69.981  1.00 46.91 ? 29   UNK O O   1 
ATOM   7989  C  CB  . UNK K  11 29  ? 50.875  13.951  72.988  1.00 46.91 ? 29   UNK O CB  1 
ATOM   7990  N  N   . UNK K  11 30  ? 48.506  12.678  71.308  1.00 46.91 ? 30   UNK O N   1 
ATOM   7991  C  CA  . UNK K  11 30  ? 48.059  11.836  70.202  1.00 46.91 ? 30   UNK O CA  1 
ATOM   7992  C  C   . UNK K  11 30  ? 46.536  11.746  70.124  1.00 46.91 ? 30   UNK O C   1 
ATOM   7993  O  O   . UNK K  11 30  ? 45.824  12.329  70.945  1.00 46.91 ? 30   UNK O O   1 
ATOM   7994  C  CB  . UNK K  11 30  ? 48.666  10.444  70.328  1.00 46.91 ? 30   UNK O CB  1 
ATOM   7995  N  N   . UNK K  11 31  ? 46.043  11.014  69.127  1.00 46.91 ? 31   UNK O N   1 
ATOM   7996  C  CA  . UNK K  11 31  ? 44.606  10.840  68.929  1.00 46.91 ? 31   UNK O CA  1 
ATOM   7997  C  C   . UNK K  11 31  ? 44.292  9.614   68.077  1.00 46.91 ? 31   UNK O C   1 
ATOM   7998  O  O   . UNK K  11 31  ? 45.197  8.941   67.579  1.00 46.91 ? 31   UNK O O   1 
ATOM   7999  C  CB  . UNK K  11 31  ? 44.009  12.089  68.289  1.00 46.91 ? 31   UNK O CB  1 
ATOM   8000  N  N   . UNK K  11 32  ? 43.001  9.332   67.918  1.00 46.91 ? 32   UNK O N   1 
ATOM   8001  C  CA  . UNK K  11 32  ? 42.534  8.193   67.132  1.00 46.91 ? 32   UNK O CA  1 
ATOM   8002  C  C   . UNK K  11 32  ? 41.022  8.252   66.935  1.00 46.91 ? 32   UNK O C   1 
ATOM   8003  O  O   . UNK K  11 32  ? 40.328  9.031   67.594  1.00 46.91 ? 32   UNK O O   1 
ATOM   8004  C  CB  . UNK K  11 32  ? 42.924  6.883   67.814  1.00 46.91 ? 32   UNK O CB  1 
ATOM   8005  N  N   . UNK K  11 33  ? 40.517  7.428   66.021  1.00 46.91 ? 33   UNK O N   1 
ATOM   8006  C  CA  . UNK K  11 33  ? 39.088  7.373   65.731  1.00 46.91 ? 33   UNK O CA  1 
ATOM   8007  C  C   . UNK K  11 33  ? 38.687  5.965   65.299  1.00 46.91 ? 33   UNK O C   1 
ATOM   8008  O  O   . UNK K  11 33  ? 39.189  5.444   64.301  1.00 46.91 ? 33   UNK O O   1 
ATOM   8009  C  CB  . UNK K  11 33  ? 38.730  8.383   64.648  1.00 46.91 ? 33   UNK O CB  1 
ATOM   8010  N  N   . UNK K  11 34  ? 37.787  5.354   66.062  1.00 46.91 ? 34   UNK O N   1 
ATOM   8011  C  CA  . UNK K  11 34  ? 37.315  4.003   65.777  1.00 46.91 ? 34   UNK O CA  1 
ATOM   8012  C  C   . UNK K  11 34  ? 36.480  3.916   64.503  1.00 46.91 ? 34   UNK O C   1 
ATOM   8013  O  O   . UNK K  11 34  ? 35.765  4.855   64.143  1.00 46.91 ? 34   UNK O O   1 
ATOM   8014  C  CB  . UNK K  11 34  ? 36.525  3.463   66.962  1.00 46.91 ? 34   UNK O CB  1 
ATOM   8015  N  N   . UNK K  11 35  ? 36.578  2.776   63.826  1.00 46.91 ? 35   UNK O N   1 
ATOM   8016  C  CA  . UNK K  11 35  ? 35.837  2.541   62.594  1.00 46.91 ? 35   UNK O CA  1 
ATOM   8017  C  C   . UNK K  11 35  ? 34.482  1.895   62.872  1.00 46.91 ? 35   UNK O C   1 
ATOM   8018  O  O   . UNK K  11 35  ? 34.353  1.056   63.767  1.00 46.91 ? 35   UNK O O   1 
ATOM   8019  C  CB  . UNK K  11 35  ? 36.654  1.668   61.650  1.00 46.91 ? 35   UNK O CB  1 
ATOM   8020  N  N   . UNK K  11 36  ? 33.474  2.296   62.102  1.00 46.91 ? 36   UNK O N   1 
ATOM   8021  C  CA  . UNK K  11 36  ? 32.123  1.761   62.247  1.00 46.91 ? 36   UNK O CA  1 
ATOM   8022  C  C   . UNK K  11 36  ? 31.681  1.076   60.955  1.00 46.91 ? 36   UNK O C   1 
ATOM   8023  O  O   . UNK K  11 36  ? 31.356  1.741   59.968  1.00 46.91 ? 36   UNK O O   1 
ATOM   8024  C  CB  . UNK K  11 36  ? 31.149  2.876   62.616  1.00 46.91 ? 36   UNK O CB  1 
ATOM   8025  N  N   . UNK K  11 37  ? 31.681  -0.253  60.962  1.00 46.91 ? 37   UNK O N   1 
ATOM   8026  C  CA  . UNK K  11 37  ? 31.286  -1.029  59.792  1.00 46.91 ? 37   UNK O CA  1 
ATOM   8027  C  C   . UNK K  11 37  ? 30.338  -2.168  60.167  1.00 46.91 ? 37   UNK O C   1 
ATOM   8028  O  O   . UNK K  11 37  ? 29.489  -2.019  61.050  1.00 46.91 ? 37   UNK O O   1 
ATOM   8029  C  CB  . UNK K  11 37  ? 32.526  -1.572  59.083  1.00 46.91 ? 37   UNK O CB  1 
ATOM   8030  N  N   . UNK K  11 38  ? 30.474  -3.299  59.477  1.00 46.91 ? 38   UNK O N   1 
ATOM   8031  C  CA  . UNK K  11 38  ? 29.635  -4.466  59.723  1.00 46.91 ? 38   UNK O CA  1 
ATOM   8032  C  C   . UNK K  11 38  ? 30.359  -5.744  59.302  1.00 46.91 ? 38   UNK O C   1 
ATOM   8033  O  O   . UNK K  11 38  ? 29.825  -6.554  58.537  1.00 46.91 ? 38   UNK O O   1 
ATOM   8034  C  CB  . UNK K  11 38  ? 28.311  -4.331  58.973  1.00 46.91 ? 38   UNK O CB  1 
ATOM   8035  N  N   . UNK K  11 39  ? 31.578  -5.911  59.801  1.00 46.91 ? 39   UNK O N   1 
ATOM   8036  C  CA  . UNK K  11 39  ? 32.392  -7.081  59.488  1.00 46.91 ? 39   UNK O CA  1 
ATOM   8037  C  C   . UNK K  11 39  ? 33.422  -7.334  60.587  1.00 46.91 ? 39   UNK O C   1 
ATOM   8038  O  O   . UNK K  11 39  ? 33.065  -7.442  61.762  1.00 46.91 ? 39   UNK O O   1 
ATOM   8039  C  CB  . UNK K  11 39  ? 33.080  -6.898  58.134  1.00 46.91 ? 39   UNK O CB  1 
ATOM   8040  N  N   . UNK K  11 40  ? 34.688  -7.465  60.203  1.00 46.91 ? 40   UNK O N   1 
ATOM   8041  C  CA  . UNK K  11 40  ? 35.758  -7.698  61.164  1.00 46.91 ? 40   UNK O CA  1 
ATOM   8042  C  C   . UNK K  11 40  ? 36.185  -6.385  61.814  1.00 46.91 ? 40   UNK O C   1 
ATOM   8043  O  O   . UNK K  11 40  ? 36.446  -5.394  61.126  1.00 46.91 ? 40   UNK O O   1 
ATOM   8044  C  CB  . UNK K  11 40  ? 36.948  -8.366  60.482  1.00 46.91 ? 40   UNK O CB  1 
ATOM   8045  N  N   . UNK K  11 41  ? 36.241  -6.381  63.142  1.00 46.91 ? 41   UNK O N   1 
ATOM   8046  C  CA  . UNK K  11 41  ? 36.634  -5.192  63.889  1.00 46.91 ? 41   UNK O CA  1 
ATOM   8047  C  C   . UNK K  11 41  ? 38.126  -4.911  63.737  1.00 46.91 ? 41   UNK O C   1 
ATOM   8048  O  O   . UNK K  11 41  ? 38.950  -5.831  63.775  1.00 46.91 ? 41   UNK O O   1 
ATOM   8049  C  CB  . UNK K  11 41  ? 36.273  -5.349  65.358  1.00 46.91 ? 41   UNK O CB  1 
ATOM   8050  N  N   . UNK K  11 42  ? 38.462  -3.633  63.580  1.00 46.91 ? 42   UNK O N   1 
ATOM   8051  C  CA  . UNK K  11 42  ? 39.847  -3.192  63.423  1.00 46.91 ? 42   UNK O CA  1 
ATOM   8052  C  C   . UNK K  11 42  ? 39.935  -1.668  63.334  1.00 46.91 ? 42   UNK O C   1 
ATOM   8053  O  O   . UNK K  11 42  ? 39.747  -1.090  62.262  1.00 46.91 ? 42   UNK O O   1 
ATOM   8054  C  CB  . UNK K  11 42  ? 40.473  -3.830  62.181  1.00 46.91 ? 42   UNK O CB  1 
ATOM   8055  N  N   . UNK K  11 43  ? 40.218  -1.025  64.464  1.00 46.91 ? 43   UNK O N   1 
ATOM   8056  C  CA  . UNK K  11 43  ? 40.333  0.430   64.518  1.00 46.91 ? 43   UNK O CA  1 
ATOM   8057  C  C   . UNK K  11 43  ? 41.791  0.887   64.506  1.00 46.91 ? 43   UNK O C   1 
ATOM   8058  O  O   . UNK K  11 43  ? 42.626  0.355   65.246  1.00 46.91 ? 43   UNK O O   1 
ATOM   8059  C  CB  . UNK K  11 43  ? 39.624  0.963   65.757  1.00 46.91 ? 43   UNK O CB  1 
ATOM   8060  N  N   . UNK K  11 44  ? 42.088  1.875   63.667  1.00 46.91 ? 44   UNK O N   1 
ATOM   8061  C  CA  . UNK K  11 44  ? 43.435  2.425   63.545  1.00 46.91 ? 44   UNK O CA  1 
ATOM   8062  C  C   . UNK K  11 44  ? 43.422  3.716   62.730  1.00 46.91 ? 44   UNK O C   1 
ATOM   8063  O  O   . UNK K  11 44  ? 43.437  3.683   61.497  1.00 46.91 ? 44   UNK O O   1 
ATOM   8064  C  CB  . UNK K  11 44  ? 44.370  1.403   62.898  1.00 46.91 ? 44   UNK O CB  1 
ATOM   8065  N  N   . UNK K  11 45  ? 43.418  4.850   63.423  1.00 46.91 ? 45   UNK O N   1 
ATOM   8066  C  CA  . UNK K  11 45  ? 43.401  6.157   62.769  1.00 46.91 ? 45   UNK O CA  1 
ATOM   8067  C  C   . UNK K  11 45  ? 44.278  7.169   63.509  1.00 46.91 ? 45   UNK O C   1 
ATOM   8068  O  O   . UNK K  11 45  ? 45.048  6.798   64.398  1.00 46.91 ? 45   UNK O O   1 
ATOM   8069  C  CB  . UNK K  11 45  ? 41.967  6.669   62.666  1.00 46.91 ? 45   UNK O CB  1 
ATOM   8070  N  N   . UNK K  11 46  ? 44.185  8.437   63.114  1.00 46.91 ? 46   UNK O N   1 
ATOM   8071  C  CA  . UNK K  11 46  ? 44.966  9.505   63.735  1.00 46.91 ? 46   UNK O CA  1 
ATOM   8072  C  C   . UNK K  11 46  ? 44.453  10.888  63.330  1.00 46.91 ? 46   UNK O C   1 
ATOM   8073  O  O   . UNK K  11 46  ? 44.753  11.376  62.237  1.00 46.91 ? 46   UNK O O   1 
ATOM   8074  C  CB  . UNK K  11 46  ? 46.442  9.362   63.365  1.00 46.91 ? 46   UNK O CB  1 
ATOM   8075  N  N   . UNK K  11 47  ? 43.680  11.512  64.216  1.00 46.91 ? 47   UNK O N   1 
ATOM   8076  C  CA  . UNK K  11 47  ? 43.117  12.839  63.965  1.00 46.91 ? 47   UNK O CA  1 
ATOM   8077  C  C   . UNK K  11 47  ? 43.985  13.954  64.554  1.00 46.91 ? 47   UNK O C   1 
ATOM   8078  O  O   . UNK K  11 47  ? 44.870  13.698  65.374  1.00 46.91 ? 47   UNK O O   1 
ATOM   8079  C  CB  . UNK K  11 47  ? 41.702  12.918  64.525  1.00 46.91 ? 47   UNK O CB  1 
ATOM   8080  N  N   . UNK K  11 48  ? 43.724  15.192  64.137  1.00 46.91 ? 48   UNK O N   1 
ATOM   8081  C  CA  . UNK K  11 48  ? 44.472  16.354  64.619  1.00 46.91 ? 48   UNK O CA  1 
ATOM   8082  C  C   . UNK K  11 48  ? 43.731  17.652  64.304  1.00 46.91 ? 48   UNK O C   1 
ATOM   8083  O  O   . UNK K  11 48  ? 43.810  18.170  63.187  1.00 46.91 ? 48   UNK O O   1 
ATOM   8084  C  CB  . UNK K  11 48  ? 45.867  16.380  63.999  1.00 46.91 ? 48   UNK O CB  1 
ATOM   8085  N  N   . UNK K  11 49  ? 43.016  18.175  65.296  1.00 46.91 ? 49   UNK O N   1 
ATOM   8086  C  CA  . UNK K  11 49  ? 42.253  19.407  65.128  1.00 46.91 ? 49   UNK O CA  1 
ATOM   8087  C  C   . UNK K  11 49  ? 42.905  20.606  65.822  1.00 46.91 ? 49   UNK O C   1 
ATOM   8088  O  O   . UNK K  11 49  ? 44.026  20.996  65.482  1.00 46.91 ? 49   UNK O O   1 
ATOM   8089  C  CB  . UNK K  11 49  ? 40.825  19.209  65.624  1.00 46.91 ? 49   UNK O CB  1 
ATOM   8090  N  N   . UNK K  11 50  ? 42.187  21.209  66.765  1.00 46.91 ? 50   UNK O N   1 
ATOM   8091  C  CA  . UNK K  11 50  ? 42.684  22.368  67.498  1.00 46.91 ? 50   UNK O CA  1 
ATOM   8092  C  C   . UNK K  11 50  ? 43.274  21.992  68.855  1.00 46.91 ? 50   UNK O C   1 
ATOM   8093  O  O   . UNK K  11 50  ? 43.231  20.831  69.265  1.00 46.91 ? 50   UNK O O   1 
ATOM   8094  C  CB  . UNK K  11 50  ? 41.569  23.391  67.674  1.00 46.91 ? 50   UNK O CB  1 
ATOM   8095  N  N   . UNK K  11 51  ? 43.837  22.984  69.538  1.00 46.91 ? 51   UNK O N   1 
ATOM   8096  C  CA  . UNK K  11 51  ? 44.436  22.778  70.852  1.00 46.91 ? 51   UNK O CA  1 
ATOM   8097  C  C   . UNK K  11 51  ? 43.393  22.954  71.952  1.00 46.91 ? 51   UNK O C   1 
ATOM   8098  O  O   . UNK K  11 51  ? 42.896  24.061  72.178  1.00 46.91 ? 51   UNK O O   1 
ATOM   8099  C  CB  . UNK K  11 51  ? 45.593  23.748  71.060  1.00 46.91 ? 51   UNK O CB  1 
ATOM   8100  N  N   . UNK K  11 52  ? 43.068  21.857  72.630  1.00 46.91 ? 52   UNK O N   1 
ATOM   8101  C  CA  . UNK K  11 52  ? 42.087  21.869  73.711  1.00 46.91 ? 52   UNK O CA  1 
ATOM   8102  C  C   . UNK K  11 52  ? 42.251  20.626  74.581  1.00 46.91 ? 52   UNK O C   1 
ATOM   8103  O  O   . UNK K  11 52  ? 41.506  19.653  74.442  1.00 46.91 ? 52   UNK O O   1 
ATOM   8104  C  CB  . UNK K  11 52  ? 40.670  21.937  73.138  1.00 46.91 ? 52   UNK O CB  1 
ATOM   8105  N  N   . UNK K  11 53  ? 43.232  20.663  75.478  1.00 46.91 ? 53   UNK O N   1 
ATOM   8106  C  CA  . UNK K  11 53  ? 43.499  19.538  76.367  1.00 46.91 ? 53   UNK O CA  1 
ATOM   8107  C  C   . UNK K  11 53  ? 43.737  19.986  77.806  1.00 46.91 ? 53   UNK O C   1 
ATOM   8108  O  O   . UNK K  11 53  ? 44.070  21.146  78.061  1.00 46.91 ? 53   UNK O O   1 
ATOM   8109  C  CB  . UNK K  11 53  ? 44.696  18.741  75.858  1.00 46.91 ? 53   UNK O CB  1 
ATOM   8110  N  N   . UNK K  11 54  ? 43.569  19.052  78.739  1.00 46.91 ? 54   UNK O N   1 
ATOM   8111  C  CA  . UNK K  11 54  ? 43.757  19.321  80.162  1.00 46.91 ? 54   UNK O CA  1 
ATOM   8112  C  C   . UNK K  11 54  ? 43.825  18.011  80.943  1.00 46.91 ? 54   UNK O C   1 
ATOM   8113  O  O   . UNK K  11 54  ? 42.944  17.159  80.815  1.00 46.91 ? 54   UNK O O   1 
ATOM   8114  C  CB  . UNK K  11 54  ? 42.620  20.189  80.690  1.00 46.91 ? 54   UNK O CB  1 
ATOM   8115  N  N   . UNK K  11 55  ? 44.878  17.853  81.741  1.00 46.91 ? 55   UNK O N   1 
ATOM   8116  C  CA  . UNK K  11 55  ? 45.061  16.647  82.543  1.00 46.91 ? 55   UNK O CA  1 
ATOM   8117  C  C   . UNK K  11 55  ? 46.072  16.858  83.667  1.00 46.91 ? 55   UNK O C   1 
ATOM   8118  O  O   . UNK K  11 55  ? 47.284  16.772  83.454  1.00 46.91 ? 55   UNK O O   1 
ATOM   8119  C  CB  . UNK K  11 55  ? 45.492  15.480  81.655  1.00 46.91 ? 55   UNK O CB  1 
ATOM   8120  N  N   . UNK K  11 56  ? 45.567  17.141  84.864  1.00 46.91 ? 56   UNK O N   1 
ATOM   8121  C  CA  . UNK K  11 56  ? 46.418  17.357  86.029  1.00 46.91 ? 56   UNK O CA  1 
ATOM   8122  C  C   . UNK K  11 56  ? 46.128  16.320  87.113  1.00 46.91 ? 56   UNK O C   1 
ATOM   8123  O  O   . UNK K  11 56  ? 45.479  15.305  86.851  1.00 46.91 ? 56   UNK O O   1 
ATOM   8124  C  CB  . UNK K  11 56  ? 46.218  18.767  86.574  1.00 46.91 ? 56   UNK O CB  1 
ATOM   8125  N  N   . UNK K  11 57  ? 46.610  16.579  88.325  1.00 46.91 ? 57   UNK O N   1 
ATOM   8126  C  CA  . UNK K  11 57  ? 46.404  15.671  89.449  1.00 46.91 ? 57   UNK O CA  1 
ATOM   8127  C  C   . UNK K  11 57  ? 46.570  16.397  90.782  1.00 46.91 ? 57   UNK O C   1 
ATOM   8128  O  O   . UNK K  11 57  ? 47.686  16.569  91.277  1.00 46.91 ? 57   UNK O O   1 
ATOM   8129  C  CB  . UNK K  11 57  ? 47.372  14.494  89.361  1.00 46.91 ? 57   UNK O CB  1 
ATOM   8130  N  N   . UNK K  11 58  ? 45.451  16.844  91.344  1.00 46.91 ? 58   UNK O N   1 
ATOM   8131  C  CA  . UNK K  11 58  ? 45.459  17.550  92.620  1.00 46.91 ? 58   UNK O CA  1 
ATOM   8132  C  C   . UNK K  11 58  ? 44.776  16.706  93.695  1.00 46.91 ? 58   UNK O C   1 
ATOM   8133  O  O   . UNK K  11 58  ? 43.772  17.117  94.284  1.00 46.91 ? 58   UNK O O   1 
ATOM   8134  C  CB  . UNK K  11 58  ? 44.771  18.905  92.479  1.00 46.91 ? 58   UNK O CB  1 
ATOM   8135  N  N   . UNK K  11 59  ? 45.321  15.516  93.925  1.00 46.91 ? 59   UNK O N   1 
ATOM   8136  C  CA  . UNK K  11 59  ? 44.786  14.588  94.916  1.00 46.91 ? 59   UNK O CA  1 
ATOM   8137  C  C   . UNK K  11 59  ? 44.950  15.101  96.344  1.00 46.91 ? 59   UNK O C   1 
ATOM   8138  O  O   . UNK K  11 59  ? 45.795  15.957  96.618  1.00 46.91 ? 59   UNK O O   1 
ATOM   8139  C  CB  . UNK K  11 59  ? 45.450  13.224  94.769  1.00 46.91 ? 59   UNK O CB  1 
ATOM   8140  N  N   . UNK K  11 60  ? 44.128  14.568  97.241  1.00 46.91 ? 60   UNK O N   1 
ATOM   8141  C  CA  . UNK K  11 60  ? 44.144  14.935  98.654  1.00 46.91 ? 60   UNK O CA  1 
ATOM   8142  C  C   . UNK K  11 60  ? 43.227  13.992  99.428  1.00 46.91 ? 60   UNK O C   1 
ATOM   8143  O  O   . UNK K  11 60  ? 43.508  13.634  100.573 1.00 46.91 ? 60   UNK O O   1 
ATOM   8144  C  CB  . UNK K  11 60  ? 43.685  16.378  98.834  1.00 46.91 ? 60   UNK O CB  1 
ATOM   8145  N  N   . UNK K  11 61  ? 42.113  13.619  98.804  1.00 46.91 ? 61   UNK O N   1 
ATOM   8146  C  CA  . UNK K  11 61  ? 41.145  12.716  99.415  1.00 46.91 ? 61   UNK O CA  1 
ATOM   8147  C  C   . UNK K  11 61  ? 41.551  11.256  99.216  1.00 46.91 ? 61   UNK O C   1 
ATOM   8148  O  O   . UNK K  11 61  ? 42.455  10.952  98.435  1.00 46.91 ? 61   UNK O O   1 
ATOM   8149  C  CB  . UNK K  11 61  ? 39.758  12.962  98.832  1.00 46.91 ? 61   UNK O CB  1 
ATOM   8150  N  N   . UNK K  11 62  ? 40.873  10.358  99.925  1.00 46.91 ? 62   UNK O N   1 
ATOM   8151  C  CA  . UNK K  11 62  ? 41.156  8.930   99.831  1.00 46.91 ? 62   UNK O CA  1 
ATOM   8152  C  C   . UNK K  11 62  ? 39.985  8.088   100.334 1.00 46.91 ? 62   UNK O C   1 
ATOM   8153  O  O   . UNK K  11 62  ? 38.888  8.600   100.581 1.00 46.91 ? 62   UNK O O   1 
ATOM   8154  C  CB  . UNK K  11 62  ? 42.421  8.596   100.620 1.00 46.91 ? 62   UNK O CB  1 
ATOM   8155  N  N   . UNK K  11 63  ? 40.233  6.791   100.490 1.00 46.91 ? 63   UNK O N   1 
ATOM   8156  C  CA  . UNK K  11 63  ? 39.229  5.852   100.970 1.00 46.91 ? 63   UNK O CA  1 
ATOM   8157  C  C   . UNK K  11 63  ? 39.886  4.810   101.872 1.00 46.91 ? 63   UNK O C   1 
ATOM   8158  O  O   . UNK K  11 63  ? 41.075  4.911   102.183 1.00 46.91 ? 63   UNK O O   1 
ATOM   8159  C  CB  . UNK K  11 63  ? 38.532  5.176   99.793  1.00 46.91 ? 63   UNK O CB  1 
ATOM   8160  N  N   . UNK K  11 64  ? 39.102  3.832   102.317 1.00 46.91 ? 64   UNK O N   1 
ATOM   8161  C  CA  . UNK K  11 64  ? 39.601  2.771   103.187 1.00 46.91 ? 64   UNK O CA  1 
ATOM   8162  C  C   . UNK K  11 64  ? 40.698  1.964   102.496 1.00 46.91 ? 64   UNK O C   1 
ATOM   8163  O  O   . UNK K  11 64  ? 41.831  1.898   102.979 1.00 46.91 ? 64   UNK O O   1 
ATOM   8164  C  CB  . UNK K  11 64  ? 38.454  1.855   103.601 1.00 46.91 ? 64   UNK O CB  1 
ATOM   8165  N  N   . UNK K  11 65  ? 40.329  1.321   101.390 1.00 46.91 ? 65   UNK O N   1 
ATOM   8166  C  CA  . UNK K  11 65  ? 41.239  0.503   100.593 1.00 46.91 ? 65   UNK O CA  1 
ATOM   8167  C  C   . UNK K  11 65  ? 40.489  -0.024  99.370  1.00 46.91 ? 65   UNK O C   1 
ATOM   8168  O  O   . UNK K  11 65  ? 40.259  -1.231  99.238  1.00 46.91 ? 65   UNK O O   1 
ATOM   8169  C  CB  . UNK K  11 65  ? 41.785  -0.660  101.425 1.00 46.91 ? 65   UNK O CB  1 
ATOM   8170  N  N   . UNK K  11 66  ? 40.060  0.894   98.509  1.00 46.91 ? 66   UNK O N   1 
ATOM   8171  C  CA  . UNK K  11 66  ? 39.325  0.539   97.301  1.00 46.91 ? 66   UNK O CA  1 
ATOM   8172  C  C   . UNK K  11 66  ? 39.357  1.663   96.271  1.00 46.91 ? 66   UNK O C   1 
ATOM   8173  O  O   . UNK K  11 66  ? 39.946  1.517   95.202  1.00 46.91 ? 66   UNK O O   1 
ATOM   8174  C  CB  . UNK K  11 66  ? 37.881  0.189   97.648  1.00 46.91 ? 66   UNK O CB  1 
ATOM   8175  N  N   . UNK K  11 67  ? 38.677  2.763   96.580  1.00 46.91 ? 67   UNK O N   1 
ATOM   8176  C  CA  . UNK K  11 67  ? 38.626  3.911   95.682  1.00 46.91 ? 67   UNK O CA  1 
ATOM   8177  C  C   . UNK K  11 67  ? 39.828  4.831   95.886  1.00 46.91 ? 67   UNK O C   1 
ATOM   8178  O  O   . UNK K  11 67  ? 40.443  4.837   96.955  1.00 46.91 ? 67   UNK O O   1 
ATOM   8179  C  CB  . UNK K  11 67  ? 37.327  4.676   95.892  1.00 46.91 ? 67   UNK O CB  1 
ATOM   8180  N  N   . UNK K  11 68  ? 40.158  5.614   94.862  1.00 46.91 ? 68   UNK O N   1 
ATOM   8181  C  CA  . UNK K  11 68  ? 41.288  6.533   94.939  1.00 46.91 ? 68   UNK O CA  1 
ATOM   8182  C  C   . UNK K  11 68  ? 40.895  7.964   94.581  1.00 46.91 ? 68   UNK O C   1 
ATOM   8183  O  O   . UNK K  11 68  ? 40.550  8.257   93.433  1.00 46.91 ? 68   UNK O O   1 
ATOM   8184  C  CB  . UNK K  11 68  ? 42.422  6.055   94.039  1.00 46.91 ? 68   UNK O CB  1 
ATOM   8185  N  N   . UNK K  11 69  ? 40.963  8.846   95.575  1.00 46.91 ? 69   UNK O N   1 
ATOM   8186  C  CA  . UNK K  11 69  ? 40.631  10.263  95.415  1.00 46.91 ? 69   UNK O CA  1 
ATOM   8187  C  C   . UNK K  11 69  ? 39.263  10.496  94.772  1.00 46.91 ? 69   UNK O C   1 
ATOM   8188  O  O   . UNK K  11 69  ? 39.140  11.222  93.780  1.00 46.91 ? 69   UNK O O   1 
ATOM   8189  C  CB  . UNK K  11 69  ? 41.729  10.976  94.622  1.00 46.91 ? 69   UNK O CB  1 
ATOM   8190  N  N   . UNK K  11 70  ? 38.238  9.877   95.347  1.00 46.91 ? 70   UNK O N   1 
ATOM   8191  C  CA  . UNK K  11 70  ? 36.877  10.007  94.843  1.00 46.91 ? 70   UNK O CA  1 
ATOM   8192  C  C   . UNK K  11 70  ? 36.327  11.409  95.079  1.00 46.91 ? 70   UNK O C   1 
ATOM   8193  O  O   . UNK K  11 70  ? 36.498  11.981  96.159  1.00 46.91 ? 70   UNK O O   1 
ATOM   8194  C  CB  . UNK K  11 70  ? 35.974  8.970   95.496  1.00 46.91 ? 70   UNK O CB  1 
ATOM   8195  N  N   . UNK K  11 71  ? 35.637  11.937  94.069  1.00 46.91 ? 71   UNK O N   1 
ATOM   8196  C  CA  . UNK K  11 71  ? 35.032  13.266  94.123  1.00 46.91 ? 71   UNK O CA  1 
ATOM   8197  C  C   . UNK K  11 71  ? 36.043  14.382  94.394  1.00 46.91 ? 71   UNK O C   1 
ATOM   8198  O  O   . UNK K  11 71  ? 35.848  15.205  95.291  1.00 46.91 ? 71   UNK O O   1 
ATOM   8199  C  CB  . UNK K  11 71  ? 33.905  13.291  95.157  1.00 46.91 ? 71   UNK O CB  1 
ATOM   8200  N  N   . UNK K  11 72  ? 37.106  14.413  93.596  1.00 46.91 ? 72   UNK O N   1 
ATOM   8201  C  CA  . UNK K  11 72  ? 38.155  15.420  93.731  1.00 46.91 ? 72   UNK O CA  1 
ATOM   8202  C  C   . UNK K  11 72  ? 37.659  16.799  93.295  1.00 46.91 ? 72   UNK O C   1 
ATOM   8203  O  O   . UNK K  11 72  ? 37.790  17.773  94.037  1.00 46.91 ? 72   UNK O O   1 
ATOM   8204  C  CB  . UNK K  11 72  ? 39.382  15.012  92.921  1.00 46.91 ? 72   UNK O CB  1 
ATOM   8205  N  N   . UNK K  11 73  ? 37.093  16.869  92.091  1.00 46.91 ? 73   UNK O N   1 
ATOM   8206  C  CA  . UNK K  11 73  ? 36.560  18.113  91.535  1.00 46.91 ? 73   UNK O CA  1 
ATOM   8207  C  C   . UNK K  11 73  ? 37.557  19.276  91.531  1.00 46.91 ? 73   UNK O C   1 
ATOM   8208  O  O   . UNK K  11 73  ? 37.196  20.417  91.833  1.00 46.91 ? 73   UNK O O   1 
ATOM   8209  C  CB  . UNK K  11 73  ? 35.281  18.512  92.269  1.00 46.91 ? 73   UNK O CB  1 
ATOM   8210  N  N   . UNK K  11 74  ? 38.801  18.988  91.167  1.00 46.91 ? 74   UNK O N   1 
ATOM   8211  C  CA  . UNK K  11 74  ? 39.841  20.010  91.120  1.00 46.91 ? 74   UNK O CA  1 
ATOM   8212  C  C   . UNK K  11 74  ? 40.733  19.813  89.893  1.00 46.91 ? 74   UNK O C   1 
ATOM   8213  O  O   . UNK K  11 74  ? 40.239  19.520  88.804  1.00 46.91 ? 74   UNK O O   1 
ATOM   8214  C  CB  . UNK K  11 74  ? 40.669  19.974  92.405  1.00 46.91 ? 74   UNK O CB  1 
ATOM   8215  N  N   . UNK K  11 75  ? 42.041  19.987  90.076  1.00 46.91 ? 75   UNK O N   1 
ATOM   8216  C  CA  . UNK K  11 75  ? 43.021  19.828  89.001  1.00 46.91 ? 75   UNK O CA  1 
ATOM   8217  C  C   . UNK K  11 75  ? 42.813  20.807  87.840  1.00 46.91 ? 75   UNK O C   1 
ATOM   8218  O  O   . UNK K  11 75  ? 42.487  21.977  88.058  1.00 46.91 ? 75   UNK O O   1 
ATOM   8219  C  CB  . UNK K  11 75  ? 43.033  18.380  88.498  1.00 46.91 ? 75   UNK O CB  1 
ATOM   8220  N  N   . UNK K  11 76  ? 43.057  20.342  86.618  1.00 46.91 ? 76   UNK O N   1 
ATOM   8221  C  CA  . UNK K  11 76  ? 42.904  21.173  85.428  1.00 46.91 ? 76   UNK O CA  1 
ATOM   8222  C  C   . UNK K  11 76  ? 41.558  20.967  84.740  1.00 46.91 ? 76   UNK O C   1 
ATOM   8223  O  O   . UNK K  11 76  ? 41.253  19.870  84.266  1.00 46.91 ? 76   UNK O O   1 
ATOM   8224  C  CB  . UNK K  11 76  ? 44.041  20.906  84.449  1.00 46.91 ? 76   UNK O CB  1 
ATOM   8225  N  N   . UNK K  11 77  ? 40.777  22.042  84.664  1.00 46.91 ? 77   UNK O N   1 
ATOM   8226  C  CA  . UNK K  11 77  ? 39.459  22.024  84.031  1.00 46.91 ? 77   UNK O CA  1 
ATOM   8227  C  C   . UNK K  11 77  ? 38.534  20.942  84.591  1.00 46.91 ? 77   UNK O C   1 
ATOM   8228  O  O   . UNK K  11 77  ? 38.546  20.667  85.792  1.00 46.91 ? 77   UNK O O   1 
ATOM   8229  C  CB  . UNK K  11 77  ? 39.605  21.876  82.514  1.00 46.91 ? 77   UNK O CB  1 
ATOM   8230  N  N   . UNK K  11 78  ? 37.701  20.374  83.724  1.00 46.91 ? 78   UNK O N   1 
ATOM   8231  C  CA  . UNK K  11 78  ? 36.763  19.323  84.105  1.00 46.91 ? 78   UNK O CA  1 
ATOM   8232  C  C   . UNK K  11 78  ? 36.093  18.728  82.870  1.00 46.91 ? 78   UNK O C   1 
ATOM   8233  O  O   . UNK K  11 78  ? 35.602  17.600  82.905  1.00 46.91 ? 78   UNK O O   1 
ATOM   8234  C  CB  . UNK K  11 78  ? 35.707  19.876  85.059  1.00 46.91 ? 78   UNK O CB  1 
ATOM   8235  N  N   . UNK K  11 79  ? 36.056  19.502  81.788  1.00 46.91 ? 79   UNK O N   1 
ATOM   8236  C  CA  . UNK K  11 79  ? 35.445  19.062  80.539  1.00 46.91 ? 79   UNK O CA  1 
ATOM   8237  C  C   . UNK K  11 79  ? 35.917  19.924  79.371  1.00 46.91 ? 79   UNK O C   1 
ATOM   8238  O  O   . UNK K  11 79  ? 35.680  21.137  79.341  1.00 46.91 ? 79   UNK O O   1 
ATOM   8239  C  CB  . UNK K  11 79  ? 33.924  19.111  80.650  1.00 46.91 ? 79   UNK O CB  1 
ATOM   8240  N  N   . UNK K  11 80  ? 36.603  19.293  78.423  1.00 46.91 ? 80   UNK O N   1 
ATOM   8241  C  CA  . UNK K  11 80  ? 37.116  19.982  77.243  1.00 46.91 ? 80   UNK O CA  1 
ATOM   8242  C  C   . UNK K  11 80  ? 36.088  19.981  76.109  1.00 46.91 ? 80   UNK O C   1 
ATOM   8243  O  O   . UNK K  11 80  ? 34.897  19.759  76.338  1.00 46.91 ? 80   UNK O O   1 
ATOM   8244  C  CB  . UNK K  11 80  ? 38.417  19.332  76.782  1.00 46.91 ? 80   UNK O CB  1 
ATOM   8245  N  N   . UNK K  11 81  ? 36.557  20.244  74.891  1.00 46.91 ? 81   UNK O N   1 
ATOM   8246  C  CA  . UNK K  11 81  ? 35.694  20.274  73.713  1.00 46.91 ? 81   UNK O CA  1 
ATOM   8247  C  C   . UNK K  11 81  ? 36.512  20.080  72.437  1.00 46.91 ? 81   UNK O C   1 
ATOM   8248  O  O   . UNK K  11 81  ? 36.815  21.041  71.724  1.00 46.91 ? 81   UNK O O   1 
ATOM   8249  C  CB  . UNK K  11 81  ? 34.922  21.589  73.657  1.00 46.91 ? 81   UNK O CB  1 
ATOM   8250  N  N   . UNK K  11 82  ? 36.874  18.829  72.165  1.00 46.91 ? 82   UNK O N   1 
ATOM   8251  C  CA  . UNK K  11 82  ? 37.657  18.483  70.983  1.00 46.91 ? 82   UNK O CA  1 
ATOM   8252  C  C   . UNK K  11 82  ? 36.794  18.398  69.723  1.00 46.91 ? 82   UNK O C   1 
ATOM   8253  O  O   . UNK K  11 82  ? 35.632  18.816  69.720  1.00 46.91 ? 82   UNK O O   1 
ATOM   8254  C  CB  . UNK K  11 82  ? 38.387  17.164  71.209  1.00 46.91 ? 82   UNK O CB  1 
ATOM   8255  N  N   . UNK K  11 83  ? 37.379  17.870  68.649  1.00 46.91 ? 83   UNK O N   1 
ATOM   8256  C  CA  . UNK K  11 83  ? 36.683  17.720  67.377  1.00 46.91 ? 83   UNK O CA  1 
ATOM   8257  C  C   . UNK K  11 83  ? 37.476  16.821  66.433  1.00 46.91 ? 83   UNK O C   1 
ATOM   8258  O  O   . UNK K  11 83  ? 38.433  17.263  65.799  1.00 46.91 ? 83   UNK O O   1 
ATOM   8259  C  CB  . UNK K  11 83  ? 36.460  19.085  66.736  1.00 46.91 ? 83   UNK O CB  1 
ATOM   8260  N  N   . UNK K  11 84  ? 37.077  15.556  66.351  1.00 46.91 ? 84   UNK O N   1 
ATOM   8261  C  CA  . UNK K  11 84  ? 37.752  14.600  65.481  1.00 46.91 ? 84   UNK O CA  1 
ATOM   8262  C  C   . UNK K  11 84  ? 37.461  14.888  64.008  1.00 46.91 ? 84   UNK O C   1 
ATOM   8263  O  O   . UNK K  11 84  ? 36.399  15.414  63.665  1.00 46.91 ? 84   UNK O O   1 
ATOM   8264  C  CB  . UNK K  11 84  ? 37.331  13.183  65.834  1.00 46.91 ? 84   UNK O CB  1 
ATOM   8265  N  N   . UNK K  11 85  ? 38.411  14.537  63.147  1.00 46.91 ? 85   UNK O N   1 
ATOM   8266  C  CA  . UNK K  11 85  ? 38.273  14.743  61.708  1.00 46.91 ? 85   UNK O CA  1 
ATOM   8267  C  C   . UNK K  11 85  ? 39.325  13.937  60.953  1.00 46.91 ? 85   UNK O C   1 
ATOM   8268  O  O   . UNK K  11 85  ? 40.514  14.264  60.983  1.00 46.91 ? 85   UNK O O   1 
ATOM   8269  C  CB  . UNK K  11 85  ? 38.394  16.228  61.365  1.00 46.91 ? 85   UNK O CB  1 
ATOM   8270  N  N   . UNK K  11 86  ? 38.881  12.868  60.298  1.00 46.91 ? 86   UNK O N   1 
ATOM   8271  C  CA  . UNK K  11 86  ? 39.777  12.002  59.539  1.00 46.91 ? 86   UNK O CA  1 
ATOM   8272  C  C   . UNK K  11 86  ? 39.621  12.195  58.028  1.00 46.91 ? 86   UNK O C   1 
ATOM   8273  O  O   . UNK K  11 86  ? 39.560  13.327  57.541  1.00 46.91 ? 86   UNK O O   1 
ATOM   8274  C  CB  . UNK K  11 86  ? 39.542  10.541  59.922  1.00 46.91 ? 86   UNK O CB  1 
ATOM   8275  N  N   . UNK K  11 87  ? 39.574  11.086  57.294  1.00 46.91 ? 87   UNK O N   1 
ATOM   8276  C  CA  . UNK K  11 87  ? 39.427  11.118  55.841  1.00 46.91 ? 87   UNK O CA  1 
ATOM   8277  C  C   . UNK K  11 87  ? 38.009  11.490  55.408  1.00 46.91 ? 87   UNK O C   1 
ATOM   8278  O  O   . UNK K  11 87  ? 37.792  11.903  54.267  1.00 46.91 ? 87   UNK O O   1 
ATOM   8279  C  CB  . UNK K  11 87  ? 39.821  9.773   55.247  1.00 46.91 ? 87   UNK O CB  1 
ATOM   8280  N  N   . UNK K  11 88  ? 37.048  11.303  56.305  1.00 46.91 ? 88   UNK O N   1 
ATOM   8281  C  CA  . UNK K  11 88  ? 35.654  11.621  56.017  1.00 46.91 ? 88   UNK O CA  1 
ATOM   8282  C  C   . UNK K  11 88  ? 35.163  12.773  56.895  1.00 46.91 ? 88   UNK O C   1 
ATOM   8283  O  O   . UNK K  11 88  ? 35.280  13.941  56.520  1.00 46.91 ? 88   UNK O O   1 
ATOM   8284  C  CB  . UNK K  11 88  ? 34.781  10.383  56.216  1.00 46.91 ? 88   UNK O CB  1 
ATOM   8285  N  N   . UNK K  11 89  ? 34.596  12.430  58.049  1.00 46.91 ? 89   UNK O N   1 
ATOM   8286  C  CA  . UNK K  11 89  ? 34.077  13.406  59.004  1.00 46.91 ? 89   UNK O CA  1 
ATOM   8287  C  C   . UNK K  11 89  ? 33.742  12.686  60.306  1.00 46.91 ? 89   UNK O C   1 
ATOM   8288  O  O   . UNK K  11 89  ? 33.235  11.560  60.289  1.00 46.91 ? 89   UNK O O   1 
ATOM   8289  C  CB  . UNK K  11 89  ? 32.833  14.090  58.445  1.00 46.91 ? 89   UNK O CB  1 
ATOM   8290  N  N   . UNK K  11 90  ? 34.008  13.341  61.431  1.00 46.91 ? 90   UNK O N   1 
ATOM   8291  C  CA  . UNK K  11 90  ? 33.738  12.751  62.738  1.00 46.91 ? 90   UNK O CA  1 
ATOM   8292  C  C   . UNK K  11 90  ? 33.404  13.798  63.797  1.00 46.91 ? 90   UNK O C   1 
ATOM   8293  O  O   . UNK K  11 90  ? 33.082  14.947  63.478  1.00 46.91 ? 90   UNK O O   1 
ATOM   8294  C  CB  . UNK K  11 90  ? 34.929  11.907  63.185  1.00 46.91 ? 90   UNK O CB  1 
ATOM   8295  N  N   . UNK K  11 91  ? 33.446  13.374  65.057  1.00 46.91 ? 91   UNK O N   1 
ATOM   8296  C  CA  . UNK K  11 91  ? 33.157  14.239  66.195  1.00 46.91 ? 91   UNK O CA  1 
ATOM   8297  C  C   . UNK K  11 91  ? 33.588  13.541  67.480  1.00 46.91 ? 91   UNK O C   1 
ATOM   8298  O  O   . UNK K  11 91  ? 33.518  12.316  67.580  1.00 46.91 ? 91   UNK O O   1 
ATOM   8299  C  CB  . UNK K  11 91  ? 31.669  14.566  66.248  1.00 46.91 ? 91   UNK O CB  1 
ATOM   8300  N  N   . UNK K  11 92  ? 34.025  14.327  68.459  1.00 46.91 ? 92   UNK O N   1 
ATOM   8301  C  CA  . UNK K  11 92  ? 34.469  13.786  69.739  1.00 46.91 ? 92   UNK O CA  1 
ATOM   8302  C  C   . UNK K  11 92  ? 34.405  14.843  70.838  1.00 46.91 ? 92   UNK O C   1 
ATOM   8303  O  O   . UNK K  11 92  ? 34.960  15.933  70.698  1.00 46.91 ? 92   UNK O O   1 
ATOM   8304  C  CB  . UNK K  11 92  ? 35.888  13.244  69.616  1.00 46.91 ? 92   UNK O CB  1 
ATOM   8305  N  N   . UNK K  11 93  ? 33.735  14.503  71.935  1.00 46.91 ? 93   UNK O N   1 
ATOM   8306  C  CA  . UNK K  11 93  ? 33.593  15.412  73.069  1.00 46.91 ? 93   UNK O CA  1 
ATOM   8307  C  C   . UNK K  11 93  ? 33.280  14.644  74.350  1.00 46.91 ? 93   UNK O C   1 
ATOM   8308  O  O   . UNK K  11 93  ? 32.116  14.402  74.673  1.00 46.91 ? 93   UNK O O   1 
ATOM   8309  C  CB  . UNK K  11 93  ? 32.502  16.444  72.787  1.00 46.91 ? 93   UNK O CB  1 
ATOM   8310  N  N   . UNK K  11 94  ? 34.328  14.259  75.072  1.00 46.91 ? 94   UNK O N   1 
ATOM   8311  C  CA  . UNK K  11 94  ? 34.178  13.519  76.323  1.00 46.91 ? 94   UNK O CA  1 
ATOM   8312  C  C   . UNK K  11 94  ? 35.197  14.004  77.350  1.00 46.91 ? 94   UNK O C   1 
ATOM   8313  O  O   . UNK K  11 94  ? 34.827  14.539  78.397  1.00 46.91 ? 94   UNK O O   1 
ATOM   8314  C  CB  . UNK K  11 94  ? 34.345  12.023  76.074  1.00 46.91 ? 94   UNK O CB  1 
ATOM   8315  N  N   . UNK K  11 95  ? 36.478  13.834  77.025  1.00 46.91 ? 95   UNK O N   1 
ATOM   8316  C  CA  . UNK K  11 95  ? 37.589  14.248  77.881  1.00 46.91 ? 95   UNK O CA  1 
ATOM   8317  C  C   . UNK K  11 95  ? 37.708  13.466  79.195  1.00 46.91 ? 95   UNK O C   1 
ATOM   8318  O  O   . UNK K  11 95  ? 38.044  12.281  79.186  1.00 46.91 ? 95   UNK O O   1 
ATOM   8319  C  CB  . UNK K  11 95  ? 37.528  15.757  78.150  1.00 46.91 ? 95   UNK O CB  1 
ATOM   8320  N  N   . UNK K  11 96  ? 37.479  14.144  80.316  1.00 46.91 ? 96   UNK O N   1 
ATOM   8321  C  CA  . UNK K  11 96  ? 37.572  13.521  81.634  1.00 46.91 ? 96   UNK O CA  1 
ATOM   8322  C  C   . UNK K  11 96  ? 36.248  12.925  82.118  1.00 46.91 ? 96   UNK O C   1 
ATOM   8323  O  O   . UNK K  11 96  ? 35.314  12.740  81.335  1.00 46.91 ? 96   UNK O O   1 
ATOM   8324  C  CB  . UNK K  11 96  ? 38.103  14.529  82.649  1.00 46.91 ? 96   UNK O CB  1 
ATOM   8325  N  N   . UNK K  11 97  ? 36.187  12.617  83.411  1.00 46.91 ? 97   UNK O N   1 
ATOM   8326  C  CA  . UNK K  11 97  ? 34.995  12.039  84.030  1.00 46.91 ? 97   UNK O CA  1 
ATOM   8327  C  C   . UNK K  11 97  ? 34.865  12.526  85.473  1.00 46.91 ? 97   UNK O C   1 
ATOM   8328  O  O   . UNK K  11 97  ? 35.848  12.562  86.212  1.00 46.91 ? 97   UNK O O   1 
ATOM   8329  C  CB  . UNK K  11 97  ? 35.072  10.518  83.993  1.00 46.91 ? 97   UNK O CB  1 
ATOM   8330  N  N   . UNK K  11 98  ? 33.649  12.895  85.870  1.00 46.91 ? 98   UNK O N   1 
ATOM   8331  C  CA  . UNK K  11 98  ? 33.399  13.390  87.222  1.00 46.91 ? 98   UNK O CA  1 
ATOM   8332  C  C   . UNK K  11 98  ? 33.197  12.283  88.256  1.00 46.91 ? 98   UNK O C   1 
ATOM   8333  O  O   . UNK K  11 98  ? 32.136  11.659  88.311  1.00 46.91 ? 98   UNK O O   1 
ATOM   8334  C  CB  . UNK K  11 98  ? 32.201  14.336  87.218  1.00 46.91 ? 98   UNK O CB  1 
ATOM   8335  N  N   . UNK K  11 99  ? 34.204  12.096  89.108  1.00 46.91 ? 99   UNK O N   1 
ATOM   8336  C  CA  . UNK K  11 99  ? 34.187  11.089  90.171  1.00 46.91 ? 99   UNK O CA  1 
ATOM   8337  C  C   . UNK K  11 99  ? 34.051  9.651   89.667  1.00 46.91 ? 99   UNK O C   1 
ATOM   8338  O  O   . UNK K  11 99  ? 32.945  9.171   89.414  1.00 46.91 ? 99   UNK O O   1 
ATOM   8339  C  CB  . UNK K  11 99  ? 33.088  11.404  91.190  1.00 46.91 ? 99   UNK O CB  1 
ATOM   8340  N  N   . UNK K  11 100 ? 35.183  8.963   89.559  1.00 46.91 ? 100  UNK O N   1 
ATOM   8341  C  CA  . UNK K  11 100 ? 35.215  7.578   89.096  1.00 46.91 ? 100  UNK O CA  1 
ATOM   8342  C  C   . UNK K  11 100 ? 36.194  6.764   89.936  1.00 46.91 ? 100  UNK O C   1 
ATOM   8343  O  O   . UNK K  11 100 ? 36.000  5.563   90.144  1.00 46.91 ? 100  UNK O O   1 
ATOM   8344  C  CB  . UNK K  11 100 ? 35.611  7.525   87.625  1.00 46.91 ? 100  UNK O CB  1 
ATOM   8345  N  N   . UNK K  11 101 ? 37.226  7.440   90.435  1.00 46.91 ? 101  UNK O N   1 
ATOM   8346  C  CA  . UNK K  11 101 ? 38.267  6.826   91.260  1.00 46.91 ? 101  UNK O CA  1 
ATOM   8347  C  C   . UNK K  11 101 ? 39.060  5.761   90.502  1.00 46.91 ? 101  UNK O C   1 
ATOM   8348  O  O   . UNK K  11 101 ? 39.113  5.772   89.270  1.00 46.91 ? 101  UNK O O   1 
ATOM   8349  C  CB  . UNK K  11 101 ? 37.663  6.244   92.540  1.00 46.91 ? 101  UNK O CB  1 
ATOM   8350  N  N   . UNK K  11 102 ? 39.703  4.867   91.251  1.00 46.91 ? 102  UNK O N   1 
ATOM   8351  C  CA  . UNK K  11 102 ? 40.500  3.791   90.674  1.00 46.91 ? 102  UNK O CA  1 
ATOM   8352  C  C   . UNK K  11 102 ? 40.779  2.712   91.721  1.00 46.91 ? 102  UNK O C   1 
ATOM   8353  O  O   . UNK K  11 102 ? 39.927  1.858   91.984  1.00 46.91 ? 102  UNK O O   1 
ATOM   8354  C  CB  . UNK K  11 102 ? 41.810  4.346   90.108  1.00 46.91 ? 102  UNK O CB  1 
ATOM   8355  N  N   . UNK K  11 103 ? 41.974  2.751   92.306  1.00 46.91 ? 103  UNK O N   1 
ATOM   8356  C  CA  . UNK K  11 103 ? 42.383  1.787   93.324  1.00 46.91 ? 103  UNK O CA  1 
ATOM   8357  C  C   . UNK K  11 103 ? 43.447  2.401   94.227  1.00 46.91 ? 103  UNK O C   1 
ATOM   8358  O  O   . UNK K  11 103 ? 44.296  3.169   93.766  1.00 46.91 ? 103  UNK O O   1 
ATOM   8359  C  CB  . UNK K  11 103 ? 42.918  0.516   92.668  1.00 46.91 ? 103  UNK O CB  1 
ATOM   8360  N  N   . UNK K  11 104 ? 43.397  2.064   95.513  1.00 46.91 ? 104  UNK O N   1 
ATOM   8361  C  CA  . UNK K  11 104 ? 44.357  2.587   96.479  1.00 46.91 ? 104  UNK O CA  1 
ATOM   8362  C  C   . UNK K  11 104 ? 44.529  1.671   97.691  1.00 46.91 ? 104  UNK O C   1 
ATOM   8363  O  O   . UNK K  11 104 ? 43.569  1.063   98.168  1.00 46.91 ? 104  UNK O O   1 
ATOM   8364  C  CB  . UNK K  11 104 ? 43.942  3.982   96.927  1.00 46.91 ? 104  UNK O CB  1 
ATOM   8365  N  N   . UNK K  11 105 ? 45.763  1.605   98.188  1.00 46.91 ? 105  UNK O N   1 
ATOM   8366  C  CA  . UNK K  11 105 ? 46.126  0.788   99.345  1.00 46.91 ? 105  UNK O CA  1 
ATOM   8367  C  C   . UNK K  11 105 ? 45.913  -0.715  99.153  1.00 46.91 ? 105  UNK O C   1 
ATOM   8368  O  O   . UNK K  11 105 ? 45.402  -1.165  98.124  1.00 46.91 ? 105  UNK O O   1 
ATOM   8369  C  CB  . UNK K  11 105 ? 45.396  1.278   100.598 1.00 46.91 ? 105  UNK O CB  1 
ATOM   8370  N  N   . UNK K  11 106 ? 46.342  -1.482  100.154 1.00 46.91 ? 106  UNK O N   1 
ATOM   8371  C  CA  . UNK K  11 106 ? 46.227  -2.939  100.142 1.00 46.91 ? 106  UNK O CA  1 
ATOM   8372  C  C   . UNK K  11 106 ? 46.961  -3.577  98.959  1.00 46.91 ? 106  UNK O C   1 
ATOM   8373  O  O   . UNK K  11 106 ? 46.725  -4.741  98.623  1.00 46.91 ? 106  UNK O O   1 
ATOM   8374  C  CB  . UNK K  11 106 ? 44.754  -3.357  100.147 1.00 46.91 ? 106  UNK O CB  1 
ATOM   8375  N  N   . UNK K  11 107 ? 47.865  -2.817  98.349  1.00 46.91 ? 107  UNK O N   1 
ATOM   8376  C  CA  . UNK K  11 107 ? 48.631  -3.291  97.203  1.00 46.91 ? 107  UNK O CA  1 
ATOM   8377  C  C   . UNK K  11 107 ? 49.828  -4.142  97.618  1.00 46.91 ? 107  UNK O C   1 
ATOM   8378  O  O   . UNK K  11 107 ? 50.175  -4.221  98.800  1.00 46.91 ? 107  UNK O O   1 
ATOM   8379  C  CB  . UNK K  11 107 ? 49.092  -2.107  96.358  1.00 46.91 ? 107  UNK O CB  1 
ATOM   8380  N  N   . UNK K  11 108 ? 50.439  -4.798  96.636  1.00 46.91 ? 108  UNK O N   1 
ATOM   8381  C  CA  . UNK K  11 108 ? 51.605  -5.642  96.879  1.00 46.91 ? 108  UNK O CA  1 
ATOM   8382  C  C   . UNK K  11 108 ? 52.869  -4.801  97.056  1.00 46.91 ? 108  UNK O C   1 
ATOM   8383  O  O   . UNK K  11 108 ? 53.951  -5.335  97.318  1.00 46.91 ? 108  UNK O O   1 
ATOM   8384  C  CB  . UNK K  11 108 ? 51.785  -6.631  95.731  1.00 46.91 ? 108  UNK O CB  1 
ATOM   8385  N  N   . UNK K  11 109 ? 52.727  -3.488  96.890  1.00 46.91 ? 109  UNK O N   1 
ATOM   8386  C  CA  . UNK K  11 109 ? 53.847  -2.565  97.026  1.00 46.91 ? 109  UNK O CA  1 
ATOM   8387  C  C   . UNK K  11 109 ? 53.578  -1.502  98.087  1.00 46.91 ? 109  UNK O C   1 
ATOM   8388  O  O   . UNK K  11 109 ? 54.248  -1.467  99.123  1.00 46.91 ? 109  UNK O O   1 
ATOM   8389  C  CB  . UNK K  11 109 ? 54.150  -1.909  95.684  1.00 46.91 ? 109  UNK O CB  1 
ATOM   8390  N  N   . UNK K  11 110 ? 52.592  -0.648  97.823  1.00 46.91 ? 110  UNK O N   1 
ATOM   8391  C  CA  . UNK K  11 110 ? 52.211  0.433   98.730  1.00 46.91 ? 110  UNK O CA  1 
ATOM   8392  C  C   . UNK K  11 110 ? 53.353  1.419   98.983  1.00 46.91 ? 110  UNK O C   1 
ATOM   8393  O  O   . UNK K  11 110 ? 54.347  1.430   98.255  1.00 46.91 ? 110  UNK O O   1 
ATOM   8394  C  CB  . UNK K  11 110 ? 51.690  -0.136  100.053 1.00 46.91 ? 110  UNK O CB  1 
ATOM   8395  N  N   . UNK K  11 111 ? 53.195  2.244   100.018 1.00 46.91 ? 111  UNK O N   1 
ATOM   8396  C  CA  . UNK K  11 111 ? 54.188  3.251   100.394 1.00 46.91 ? 111  UNK O CA  1 
ATOM   8397  C  C   . UNK K  11 111 ? 54.528  4.178   99.225  1.00 46.91 ? 111  UNK O C   1 
ATOM   8398  O  O   . UNK K  11 111 ? 53.645  4.848   98.689  1.00 46.91 ? 111  UNK O O   1 
ATOM   8399  C  CB  . UNK K  11 111 ? 55.452  2.578   100.943 1.00 46.91 ? 111  UNK O CB  1 
ATOM   8400  N  N   . UNK K  11 112 ? 55.802  4.228   98.847  1.00 46.91 ? 112  UNK O N   1 
ATOM   8401  C  CA  . UNK K  11 112 ? 56.245  5.071   97.741  1.00 46.91 ? 112  UNK O CA  1 
ATOM   8402  C  C   . UNK K  11 112 ? 55.780  4.503   96.401  1.00 46.91 ? 112  UNK O C   1 
ATOM   8403  O  O   . UNK K  11 112 ? 55.177  5.211   95.595  1.00 46.91 ? 112  UNK O O   1 
ATOM   8404  C  CB  . UNK K  11 112 ? 57.761  5.210   97.757  1.00 46.91 ? 112  UNK O CB  1 
ATOM   8405  N  N   . UNK K  11 113 ? 56.063  3.219   96.184  1.00 46.91 ? 113  UNK O N   1 
ATOM   8406  C  CA  . UNK K  11 113 ? 55.693  2.506   94.959  1.00 46.91 ? 113  UNK O CA  1 
ATOM   8407  C  C   . UNK K  11 113 ? 56.415  3.015   93.713  1.00 46.91 ? 113  UNK O C   1 
ATOM   8408  O  O   . UNK K  11 113 ? 56.197  4.139   93.267  1.00 46.91 ? 113  UNK O O   1 
ATOM   8409  C  CB  . UNK K  11 113 ? 54.177  2.538   94.753  1.00 46.91 ? 113  UNK O CB  1 
ATOM   8410  N  N   . UNK K  11 114 ? 57.288  2.177   93.163  1.00 46.91 ? 114  UNK O N   1 
ATOM   8411  C  CA  . UNK K  11 114 ? 58.044  2.532   91.967  1.00 46.91 ? 114  UNK O CA  1 
ATOM   8412  C  C   . UNK K  11 114 ? 57.204  2.354   90.705  1.00 46.91 ? 114  UNK O C   1 
ATOM   8413  O  O   . UNK K  11 114 ? 57.427  3.033   89.702  1.00 46.91 ? 114  UNK O O   1 
ATOM   8414  C  CB  . UNK K  11 114 ? 59.313  1.694   91.880  1.00 46.91 ? 114  UNK O CB  1 
ATOM   8415  N  N   . UNK K  11 115 ? 56.260  1.416   90.749  1.00 46.91 ? 115  UNK O N   1 
ATOM   8416  C  CA  . UNK K  11 115 ? 55.393  1.147   89.607  1.00 46.91 ? 115  UNK O CA  1 
ATOM   8417  C  C   . UNK K  11 115 ? 53.935  0.985   90.026  1.00 46.91 ? 115  UNK O C   1 
ATOM   8418  O  O   . UNK K  11 115 ? 53.554  -0.030  90.616  1.00 46.91 ? 115  UNK O O   1 
ATOM   8419  C  CB  . UNK K  11 115 ? 55.873  -0.094  88.864  1.00 46.91 ? 115  UNK O CB  1 
ATOM   8420  N  N   . UNK K  11 116 ? 53.130  1.997   89.718  1.00 46.91 ? 116  UNK O N   1 
ATOM   8421  C  CA  . UNK K  11 116 ? 51.709  1.998   90.049  1.00 46.91 ? 116  UNK O CA  1 
ATOM   8422  C  C   . UNK K  11 116 ? 50.897  1.132   89.087  1.00 46.91 ? 116  UNK O C   1 
ATOM   8423  O  O   . UNK K  11 116 ? 51.399  0.701   88.044  1.00 46.91 ? 116  UNK O O   1 
ATOM   8424  C  CB  . UNK K  11 116 ? 51.176  3.427   90.050  1.00 46.91 ? 116  UNK O CB  1 
ATOM   8425  N  N   . UNK K  11 117 ? 49.641  0.879   89.448  1.00 46.91 ? 117  UNK O N   1 
ATOM   8426  C  CA  . UNK K  11 117 ? 48.739  0.070   88.633  1.00 46.91 ? 117  UNK O CA  1 
ATOM   8427  C  C   . UNK K  11 117 ? 47.287  0.262   89.062  1.00 46.91 ? 117  UNK O C   1 
ATOM   8428  O  O   . UNK K  11 117 ? 46.809  -0.396  89.990  1.00 46.91 ? 117  UNK O O   1 
ATOM   8429  C  CB  . UNK K  11 117 ? 49.128  -1.406  88.720  1.00 46.91 ? 117  UNK O CB  1 
ATOM   8430  N  N   . UNK K  11 118 ? 46.589  1.163   88.377  1.00 46.91 ? 118  UNK O N   1 
ATOM   8431  C  CA  . UNK K  11 118 ? 45.189  1.457   88.674  1.00 46.91 ? 118  UNK O CA  1 
ATOM   8432  C  C   . UNK K  11 118 ? 44.332  1.392   87.411  1.00 46.91 ? 118  UNK O C   1 
ATOM   8433  O  O   . UNK K  11 118 ? 44.765  1.806   86.335  1.00 46.91 ? 118  UNK O O   1 
ATOM   8434  C  CB  . UNK K  11 118 ? 45.073  2.832   89.320  1.00 46.91 ? 118  UNK O CB  1 
ATOM   8435  N  N   . UNK K  11 119 ? 43.118  0.857   87.550  1.00 46.91 ? 119  UNK O N   1 
ATOM   8436  C  CA  . UNK K  11 119 ? 42.183  0.730   86.432  1.00 46.91 ? 119  UNK O CA  1 
ATOM   8437  C  C   . UNK K  11 119 ? 40.808  0.270   86.913  1.00 46.91 ? 119  UNK O C   1 
ATOM   8438  O  O   . UNK K  11 119 ? 40.642  -0.877  87.341  1.00 46.91 ? 119  UNK O O   1 
ATOM   8439  C  CB  . UNK K  11 119 ? 42.730  -0.250  85.395  1.00 46.91 ? 119  UNK O CB  1 
ATOM   8440  N  N   . UNK K  11 120 ? 39.823  1.163   86.830  1.00 46.91 ? 120  UNK O N   1 
ATOM   8441  C  CA  . UNK K  11 120 ? 38.461  0.857   87.262  1.00 46.91 ? 120  UNK O CA  1 
ATOM   8442  C  C   . UNK K  11 120 ? 37.434  0.992   86.133  1.00 46.91 ? 120  UNK O C   1 
ATOM   8443  O  O   . UNK K  11 120 ? 37.443  0.208   85.181  1.00 46.91 ? 120  UNK O O   1 
ATOM   8444  C  CB  . UNK K  11 120 ? 38.079  1.738   88.450  1.00 46.91 ? 120  UNK O CB  1 
ATOM   8445  N  N   . UNK K  11 121 ? 36.530  1.963   86.264  1.00 46.91 ? 121  UNK O N   1 
ATOM   8446  C  CA  . UNK K  11 121 ? 35.487  2.215   85.269  1.00 46.91 ? 121  UNK O CA  1 
ATOM   8447  C  C   . UNK K  11 121 ? 34.866  3.598   85.479  1.00 46.91 ? 121  UNK O C   1 
ATOM   8448  O  O   . UNK K  11 121 ? 34.511  3.964   86.602  1.00 46.91 ? 121  UNK O O   1 
ATOM   8449  C  CB  . UNK K  11 121 ? 34.410  1.135   85.350  1.00 46.91 ? 121  UNK O CB  1 
ATOM   8450  N  N   . UNK K  11 122 ? 34.724  4.349   84.389  1.00 46.91 ? 122  UNK O N   1 
ATOM   8451  C  CA  . UNK K  11 122 ? 34.159  5.695   84.439  1.00 46.91 ? 122  UNK O CA  1 
ATOM   8452  C  C   . UNK K  11 122 ? 32.639  5.741   84.249  1.00 46.91 ? 122  UNK O C   1 
ATOM   8453  O  O   . UNK K  11 122 ? 31.885  5.652   85.219  1.00 46.91 ? 122  UNK O O   1 
ATOM   8454  C  CB  . UNK K  11 122 ? 34.848  6.588   83.412  1.00 46.91 ? 122  UNK O CB  1 
ATOM   8455  N  N   . UNK K  11 123 ? 32.203  5.896   82.998  1.00 46.91 ? 123  UNK O N   1 
ATOM   8456  C  CA  . UNK K  11 123 ? 30.786  5.968   82.641  1.00 46.91 ? 123  UNK O CA  1 
ATOM   8457  C  C   . UNK K  11 123 ? 30.104  7.231   83.169  1.00 46.91 ? 123  UNK O C   1 
ATOM   8458  O  O   . UNK K  11 123 ? 29.175  7.161   83.979  1.00 46.91 ? 123  UNK O O   1 
ATOM   8459  C  CB  . UNK K  11 123 ? 30.045  4.712   83.111  1.00 46.91 ? 123  UNK O CB  1 
ATOM   8460  N  N   . UNK K  11 124 ? 30.555  8.384   82.686  1.00 46.91 ? 124  UNK O N   1 
ATOM   8461  C  CA  . UNK K  11 124 ? 30.000  9.670   83.101  1.00 46.91 ? 124  UNK O CA  1 
ATOM   8462  C  C   . UNK K  11 124 ? 29.630  10.535  81.892  1.00 46.91 ? 124  UNK O C   1 
ATOM   8463  O  O   . UNK K  11 124 ? 29.112  10.028  80.897  1.00 46.91 ? 124  UNK O O   1 
ATOM   8464  C  CB  . UNK K  11 124 ? 30.996  10.403  84.000  1.00 46.91 ? 124  UNK O CB  1 
ATOM   8465  N  N   . UNK K  11 125 ? 29.888  11.839  81.993  1.00 46.91 ? 125  UNK O N   1 
ATOM   8466  C  CA  . UNK K  11 125 ? 29.600  12.800  80.923  1.00 46.91 ? 125  UNK O CA  1 
ATOM   8467  C  C   . UNK K  11 125 ? 28.113  12.905  80.572  1.00 46.91 ? 125  UNK O C   1 
ATOM   8468  O  O   . UNK K  11 125 ? 27.251  12.661  81.420  1.00 46.91 ? 125  UNK O O   1 
ATOM   8469  C  CB  . UNK K  11 125 ? 30.427  12.476  79.672  1.00 46.91 ? 125  UNK O CB  1 
ATOM   8470  N  N   . UNK K  11 126 ? 27.829  13.339  79.343  1.00 46.91 ? 126  UNK O N   1 
ATOM   8471  C  CA  . UNK K  11 126 ? 26.462  13.497  78.846  1.00 46.91 ? 126  UNK O CA  1 
ATOM   8472  C  C   . UNK K  11 126 ? 26.452  13.930  77.375  1.00 46.91 ? 126  UNK O C   1 
ATOM   8473  O  O   . UNK K  11 126 ? 26.836  13.160  76.494  1.00 46.91 ? 126  UNK O O   1 
ATOM   8474  C  CB  . UNK K  11 126 ? 25.692  14.506  79.705  1.00 46.91 ? 126  UNK O CB  1 
ATOM   8475  N  N   . UNK K  11 127 ? 26.019  15.164  77.118  1.00 46.91 ? 127  UNK O N   1 
ATOM   8476  C  CA  . UNK K  11 127 ? 25.953  15.701  75.761  1.00 46.91 ? 127  UNK O CA  1 
ATOM   8477  C  C   . UNK K  11 127 ? 25.971  17.231  75.763  1.00 46.91 ? 127  UNK O C   1 
ATOM   8478  O  O   . UNK K  11 127 ? 26.048  17.862  76.823  1.00 46.91 ? 127  UNK O O   1 
ATOM   8479  C  CB  . UNK K  11 127 ? 24.701  15.190  75.054  1.00 46.91 ? 127  UNK O CB  1 
ATOM   8480  N  N   . UNK K  11 128 ? 25.909  17.820  74.570  1.00 46.91 ? 128  UNK O N   1 
ATOM   8481  C  CA  . UNK K  11 128 ? 25.918  19.276  74.423  1.00 46.91 ? 128  UNK O CA  1 
ATOM   8482  C  C   . UNK K  11 128 ? 24.688  19.917  75.060  1.00 46.91 ? 128  UNK O C   1 
ATOM   8483  O  O   . UNK K  11 128 ? 23.584  19.836  74.521  1.00 46.91 ? 128  UNK O O   1 
ATOM   8484  C  CB  . UNK K  11 128 ? 26.012  19.660  72.953  1.00 46.91 ? 128  UNK O CB  1 
ATOM   8485  N  N   . UNK K  11 129 ? 24.890  20.552  76.209  1.00 46.91 ? 129  UNK O N   1 
ATOM   8486  C  CA  . UNK K  11 129 ? 23.811  21.204  76.942  1.00 46.91 ? 129  UNK O CA  1 
ATOM   8487  C  C   . UNK K  11 129 ? 23.266  22.422  76.208  1.00 46.91 ? 129  UNK O C   1 
ATOM   8488  O  O   . UNK K  11 129 ? 24.028  23.267  75.728  1.00 46.91 ? 129  UNK O O   1 
ATOM   8489  C  CB  . UNK K  11 129 ? 24.295  21.596  78.337  1.00 46.91 ? 129  UNK O CB  1 
ATOM   8490  N  N   . UNK K  11 130 ? 21.941  22.512  76.145  1.00 46.91 ? 130  UNK O N   1 
ATOM   8491  C  CA  . UNK K  11 130 ? 21.262  23.618  75.483  1.00 46.91 ? 130  UNK O CA  1 
ATOM   8492  C  C   . UNK K  11 130 ? 19.799  23.657  75.901  1.00 46.91 ? 130  UNK O C   1 
ATOM   8493  O  O   . UNK K  11 130 ? 19.361  24.597  76.570  1.00 46.91 ? 130  UNK O O   1 
ATOM   8494  C  CB  . UNK K  11 130 ? 21.377  23.480  73.965  1.00 46.91 ? 130  UNK O CB  1 
ATOM   8495  N  N   . UNK K  11 131 ? 19.063  22.607  75.537  1.00 46.91 ? 131  UNK O N   1 
ATOM   8496  C  CA  . UNK K  11 131 ? 17.641  22.487  75.850  1.00 46.91 ? 131  UNK O CA  1 
ATOM   8497  C  C   . UNK K  11 131 ? 16.834  23.631  75.233  1.00 46.91 ? 131  UNK O C   1 
ATOM   8498  O  O   . UNK K  11 131 ? 17.243  24.210  74.223  1.00 46.91 ? 131  UNK O O   1 
ATOM   8499  C  CB  . UNK K  11 131 ? 17.429  22.428  77.365  1.00 46.91 ? 131  UNK O CB  1 
ATOM   8500  N  N   . UNK K  11 132 ? 15.688  23.941  75.841  1.00 46.91 ? 132  UNK O N   1 
ATOM   8501  C  CA  . UNK K  11 132 ? 14.806  25.010  75.371  1.00 46.91 ? 132  UNK O CA  1 
ATOM   8502  C  C   . UNK K  11 132 ? 14.503  24.891  73.875  1.00 46.91 ? 132  UNK O C   1 
ATOM   8503  O  O   . UNK K  11 132 ? 14.620  25.863  73.120  1.00 46.91 ? 132  UNK O O   1 
ATOM   8504  C  CB  . UNK K  11 132 ? 15.417  26.376  75.690  1.00 46.91 ? 132  UNK O CB  1 
ATOM   8505  N  N   . UNK K  11 133 ? 14.090  23.694  73.465  1.00 46.91 ? 133  UNK O N   1 
ATOM   8506  C  CA  . UNK K  11 133 ? 13.772  23.409  72.070  1.00 46.91 ? 133  UNK O CA  1 
ATOM   8507  C  C   . UNK K  11 133 ? 12.580  24.196  71.531  1.00 46.91 ? 133  UNK O C   1 
ATOM   8508  O  O   . UNK K  11 133 ? 11.762  24.723  72.293  1.00 46.91 ? 133  UNK O O   1 
ATOM   8509  C  CB  . UNK K  11 133 ? 13.536  21.916  71.886  1.00 46.91 ? 133  UNK O CB  1 
ATOM   8510  N  N   . UNK K  11 134 ? 12.503  24.276  70.206  1.00 46.91 ? 134  UNK O N   1 
ATOM   8511  C  CA  . UNK K  11 134 ? 11.424  24.982  69.527  1.00 46.91 ? 134  UNK O CA  1 
ATOM   8512  C  C   . UNK K  11 134 ? 10.179  24.096  69.439  1.00 46.91 ? 134  UNK O C   1 
ATOM   8513  O  O   . UNK K  11 134 ? 9.662   23.631  70.458  1.00 46.91 ? 134  UNK O O   1 
ATOM   8514  C  CB  . UNK K  11 134 ? 11.879  25.418  68.129  1.00 46.91 ? 134  UNK O CB  1 
ATOM   8515  N  N   . UNK K  11 135 ? 9.690   23.883  68.222  1.00 46.91 ? 135  UNK O N   1 
ATOM   8516  C  CA  . UNK K  11 135 ? 8.515   23.051  68.002  1.00 46.91 ? 135  UNK O CA  1 
ATOM   8517  C  C   . UNK K  11 135 ? 8.912   21.713  67.387  1.00 46.91 ? 135  UNK O C   1 
ATOM   8518  O  O   . UNK K  11 135 ? 8.965   20.697  68.081  1.00 46.91 ? 135  UNK O O   1 
ATOM   8519  C  CB  . UNK K  11 135 ? 7.514   23.775  67.114  1.00 46.91 ? 135  UNK O CB  1 
ATOM   8520  N  N   . UNK K  11 136 ? 9.194   21.725  66.086  1.00 46.91 ? 136  UNK O N   1 
ATOM   8521  C  CA  . UNK K  11 136 ? 9.588   20.520  65.358  1.00 46.91 ? 136  UNK O CA  1 
ATOM   8522  C  C   . UNK K  11 136 ? 10.042  20.863  63.938  1.00 46.91 ? 136  UNK O C   1 
ATOM   8523  O  O   . UNK K  11 136 ? 11.050  21.548  63.747  1.00 46.91 ? 136  UNK O O   1 
ATOM   8524  C  CB  . UNK K  11 136 ? 8.429   19.514  65.328  1.00 46.91 ? 136  UNK O CB  1 
ATOM   8525  N  N   . UNK K  11 137 ? 9.294   20.380  62.947  1.00 46.91 ? 137  UNK O N   1 
ATOM   8526  C  CA  . UNK K  11 137 ? 9.603   20.622  61.541  1.00 46.91 ? 137  UNK O CA  1 
ATOM   8527  C  C   . UNK K  11 137 ? 9.410   22.088  61.159  1.00 46.91 ? 137  UNK O C   1 
ATOM   8528  O  O   . UNK K  11 137 ? 8.540   22.774  61.701  1.00 46.91 ? 137  UNK O O   1 
ATOM   8529  C  CB  . UNK K  11 137 ? 8.740   19.729  60.657  1.00 46.91 ? 137  UNK O CB  1 
ATOM   8530  N  N   . UNK K  11 138 ? 10.234  22.563  60.229  1.00 46.91 ? 138  UNK O N   1 
ATOM   8531  C  CA  . UNK K  11 138 ? 10.159  23.945  59.762  1.00 46.91 ? 138  UNK O CA  1 
ATOM   8532  C  C   . UNK K  11 138 ? 8.842   24.208  59.029  1.00 46.91 ? 138  UNK O C   1 
ATOM   8533  O  O   . UNK K  11 138 ? 8.461   25.361  58.815  1.00 46.91 ? 138  UNK O O   1 
ATOM   8534  C  CB  . UNK K  11 138 ? 11.342  24.257  58.852  1.00 46.91 ? 138  UNK O CB  1 
ATOM   8535  N  N   . UNK K  11 139 ? 8.172   23.134  58.622  1.00 46.91 ? 139  UNK O N   1 
ATOM   8536  C  CA  . UNK K  11 139 ? 6.900   23.230  57.915  1.00 46.91 ? 139  UNK O CA  1 
ATOM   8537  C  C   . UNK K  11 139 ? 5.867   22.274  58.512  1.00 46.91 ? 139  UNK O C   1 
ATOM   8538  O  O   . UNK K  11 139 ? 6.025   21.797  59.639  1.00 46.91 ? 139  UNK O O   1 
ATOM   8539  C  CB  . UNK K  11 139 ? 7.103   22.937  56.433  1.00 46.91 ? 139  UNK O CB  1 
ATOM   8540  N  N   . UNK K  11 140 ? 4.809   22.001  57.753  1.00 46.91 ? 140  UNK O N   1 
ATOM   8541  C  CA  . UNK K  11 140 ? 3.750   21.105  58.204  1.00 46.91 ? 140  UNK O CA  1 
ATOM   8542  C  C   . UNK K  11 140 ? 3.198   20.270  57.053  1.00 46.91 ? 140  UNK O C   1 
ATOM   8543  O  O   . UNK K  11 140 ? 2.672   20.808  56.077  1.00 46.91 ? 140  UNK O O   1 
ATOM   8544  C  CB  . UNK K  11 140 ? 2.631   21.903  58.865  1.00 46.91 ? 140  UNK O CB  1 
ATOM   8545  N  N   . UNK K  11 141 ? 3.334   18.953  57.176  1.00 46.91 ? 141  UNK O N   1 
ATOM   8546  C  CA  . UNK K  11 141 ? 2.857   18.013  56.166  1.00 46.91 ? 141  UNK O CA  1 
ATOM   8547  C  C   . UNK K  11 141 ? 2.784   16.611  56.765  1.00 46.91 ? 141  UNK O C   1 
ATOM   8548  O  O   . UNK K  11 141 ? 1.699   16.110  57.064  1.00 46.91 ? 141  UNK O O   1 
ATOM   8549  C  CB  . UNK K  11 141 ? 3.780   18.025  54.949  1.00 46.91 ? 141  UNK O CB  1 
ATOM   8550  N  N   . UNK K  11 142 ? 3.943   15.976  56.920  1.00 46.91 ? 142  UNK O N   1 
ATOM   8551  C  CA  . UNK K  11 142 ? 4.020   14.635  57.490  1.00 46.91 ? 142  UNK O CA  1 
ATOM   8552  C  C   . UNK K  11 142 ? 4.213   14.722  59.004  1.00 46.91 ? 142  UNK O C   1 
ATOM   8553  O  O   . UNK K  11 142 ? 3.359   14.276  59.772  1.00 46.91 ? 142  UNK O O   1 
ATOM   8554  C  CB  . UNK K  11 142 ? 5.162   13.855  56.849  1.00 46.91 ? 142  UNK O CB  1 
ATOM   8555  N  N   . UNK K  11 143 ? 5.342   15.295  59.415  1.00 46.91 ? 143  UNK O N   1 
ATOM   8556  C  CA  . UNK K  11 143 ? 5.684   15.471  60.828  1.00 46.91 ? 143  UNK O CA  1 
ATOM   8557  C  C   . UNK K  11 143 ? 5.676   14.178  61.652  1.00 46.91 ? 143  UNK O C   1 
ATOM   8558  O  O   . UNK K  11 143 ? 5.449   14.208  62.865  1.00 46.91 ? 143  UNK O O   1 
ATOM   8559  C  CB  . UNK K  11 143 ? 4.767   16.516  61.463  1.00 46.91 ? 143  UNK O CB  1 
ATOM   8560  N  N   . UNK K  11 144 ? 5.941   13.055  60.992  1.00 46.91 ? 144  UNK O N   1 
ATOM   8561  C  CA  . UNK K  11 144 ? 5.976   11.754  61.655  1.00 46.91 ? 144  UNK O CA  1 
ATOM   8562  C  C   . UNK K  11 144 ? 6.972   10.827  60.961  1.00 46.91 ? 144  UNK O C   1 
ATOM   8563  O  O   . UNK K  11 144 ? 7.770   11.271  60.134  1.00 46.91 ? 144  UNK O O   1 
ATOM   8564  C  CB  . UNK K  11 144 ? 4.581   11.127  61.664  1.00 46.91 ? 144  UNK O CB  1 
ATOM   8565  N  N   . UNK K  11 145 ? 6.907   9.538   61.289  1.00 46.91 ? 145  UNK O N   1 
ATOM   8566  C  CA  . UNK K  11 145 ? 7.793   8.525   60.715  1.00 46.91 ? 145  UNK O CA  1 
ATOM   8567  C  C   . UNK K  11 145 ? 9.262   8.740   61.093  1.00 46.91 ? 145  UNK O C   1 
ATOM   8568  O  O   . UNK K  11 145 ? 9.678   8.376   62.193  1.00 46.91 ? 145  UNK O O   1 
ATOM   8569  C  CB  . UNK K  11 145 ? 7.626   8.463   59.191  1.00 46.91 ? 145  UNK O CB  1 
ATOM   8570  N  N   . UNK K  11 146 ? 10.046  9.287   60.169  1.00 46.91 ? 146  UNK O N   1 
ATOM   8571  C  CA  . UNK K  11 146 ? 11.465  9.539   60.415  1.00 46.91 ? 146  UNK O CA  1 
ATOM   8572  C  C   . UNK K  11 146 ? 11.741  11.002  60.762  1.00 46.91 ? 146  UNK O C   1 
ATOM   8573  O  O   . UNK K  11 146 ? 12.893  11.390  60.973  1.00 46.91 ? 146  UNK O O   1 
ATOM   8574  C  CB  . UNK K  11 146 ? 12.289  9.121   59.204  1.00 46.91 ? 146  UNK O CB  1 
ATOM   8575  N  N   . UNK K  11 147 ? 10.688  11.812  60.779  1.00 46.91 ? 147  UNK O N   1 
ATOM   8576  C  CA  . UNK K  11 147 ? 10.803  13.231  61.096  1.00 46.91 ? 147  UNK O CA  1 
ATOM   8577  C  C   . UNK K  11 147 ? 10.849  13.459  62.604  1.00 46.91 ? 147  UNK O C   1 
ATOM   8578  O  O   . UNK K  11 147 ? 11.582  14.324  63.087  1.00 46.91 ? 147  UNK O O   1 
ATOM   8579  C  CB  . UNK K  11 147 ? 9.643   14.001  60.482  1.00 46.91 ? 147  UNK O CB  1 
ATOM   8580  N  N   . UNK K  11 148 ? 10.042  12.698  63.336  1.00 46.91 ? 148  UNK O N   1 
ATOM   8581  C  CA  . UNK K  11 148 ? 9.986   12.807  64.790  1.00 46.91 ? 148  UNK O CA  1 
ATOM   8582  C  C   . UNK K  11 148 ? 11.103  12.004  65.457  1.00 46.91 ? 148  UNK O C   1 
ATOM   8583  O  O   . UNK K  11 148 ? 11.152  11.892  66.684  1.00 46.91 ? 148  UNK O O   1 
ATOM   8584  C  CB  . UNK K  11 148 ? 8.626   12.343  65.298  1.00 46.91 ? 148  UNK O CB  1 
ATOM   8585  N  N   . UNK K  11 149 ? 11.972  11.412  64.642  1.00 46.91 ? 149  UNK O N   1 
ATOM   8586  C  CA  . UNK K  11 149 ? 13.089  10.624  65.147  1.00 46.91 ? 149  UNK O CA  1 
ATOM   8587  C  C   . UNK K  11 149 ? 14.319  11.502  65.360  1.00 46.91 ? 149  UNK O C   1 
ATOM   8588  O  O   . UNK K  11 149 ? 15.116  11.260  66.269  1.00 46.91 ? 149  UNK O O   1 
ATOM   8589  C  CB  . UNK K  11 149 ? 13.410  9.490   64.182  1.00 46.91 ? 149  UNK O CB  1 
ATOM   8590  N  N   . UNK K  11 150 ? 14.480  12.503  64.499  1.00 46.91 ? 150  UNK O N   1 
ATOM   8591  C  CA  . UNK K  11 150 ? 15.608  13.426  64.575  1.00 46.91 ? 150  UNK O CA  1 
ATOM   8592  C  C   . UNK K  11 150 ? 15.311  14.624  65.476  1.00 46.91 ? 150  UNK O C   1 
ATOM   8593  O  O   . UNK K  11 150 ? 16.206  15.413  65.789  1.00 46.91 ? 150  UNK O O   1 
ATOM   8594  C  CB  . UNK K  11 150 ? 15.987  13.902  63.179  1.00 46.91 ? 150  UNK O CB  1 
ATOM   8595  N  N   . UNK K  11 151 ? 14.046  14.775  65.859  1.00 46.91 ? 151  UNK O N   1 
ATOM   8596  C  CA  . UNK K  11 151 ? 13.623  15.873  66.719  1.00 46.91 ? 151  UNK O CA  1 
ATOM   8597  C  C   . UNK K  11 151 ? 13.477  15.401  68.164  1.00 46.91 ? 151  UNK O C   1 
ATOM   8598  O  O   . UNK K  11 151 ? 12.367  15.324  68.697  1.00 46.91 ? 151  UNK O O   1 
ATOM   8599  C  CB  . UNK K  11 151 ? 12.307  16.455  66.212  1.00 46.91 ? 151  UNK O CB  1 
ATOM   8600  N  N   . UNK K  11 152 ? 14.605  15.107  68.803  1.00 46.91 ? 152  UNK O N   1 
ATOM   8601  C  CA  . UNK K  11 152 ? 14.598  14.636  70.184  1.00 46.91 ? 152  UNK O CA  1 
ATOM   8602  C  C   . UNK K  11 152 ? 15.869  15.024  70.937  1.00 46.91 ? 152  UNK O C   1 
ATOM   8603  O  O   . UNK K  11 152 ? 16.713  15.756  70.417  1.00 46.91 ? 152  UNK O O   1 
ATOM   8604  C  CB  . UNK K  11 152 ? 14.403  13.123  70.218  1.00 46.91 ? 152  UNK O CB  1 
ATOM   8605  N  N   . UNK K  11 153 ? 15.988  14.541  72.170  1.00 46.91 ? 153  UNK O N   1 
ATOM   8606  C  CA  . UNK K  11 153 ? 17.150  14.824  73.008  1.00 46.91 ? 153  UNK O CA  1 
ATOM   8607  C  C   . UNK K  11 153 ? 17.356  13.713  74.033  1.00 46.91 ? 153  UNK O C   1 
ATOM   8608  O  O   . UNK K  11 153 ? 16.567  13.560  74.969  1.00 46.91 ? 153  UNK O O   1 
ATOM   8609  C  CB  . UNK K  11 153 ? 16.979  16.167  73.711  1.00 46.91 ? 153  UNK O CB  1 
ATOM   8610  N  N   . UNK K  11 154 ? 18.413  12.928  73.839  1.00 46.91 ? 154  UNK O N   1 
ATOM   8611  C  CA  . UNK K  11 154 ? 18.730  11.821  74.737  1.00 46.91 ? 154  UNK O CA  1 
ATOM   8612  C  C   . UNK K  11 154 ? 19.970  12.102  75.585  1.00 46.91 ? 154  UNK O C   1 
ATOM   8613  O  O   . UNK K  11 154 ? 20.538  13.193  75.531  1.00 46.91 ? 154  UNK O O   1 
ATOM   8614  C  CB  . UNK K  11 154 ? 18.914  10.537  73.937  1.00 46.91 ? 154  UNK O CB  1 
ATOM   8615  N  N   . UNK K  11 155 ? 20.375  11.112  76.377  1.00 46.91 ? 155  UNK O N   1 
ATOM   8616  C  CA  . UNK K  11 155 ? 21.547  11.234  77.241  1.00 46.91 ? 155  UNK O CA  1 
ATOM   8617  C  C   . UNK K  11 155 ? 22.063  9.859   77.663  1.00 46.91 ? 155  UNK O C   1 
ATOM   8618  O  O   . UNK K  11 155 ? 21.420  9.156   78.447  1.00 46.91 ? 155  UNK O O   1 
ATOM   8619  C  CB  . UNK K  11 155 ? 21.212  12.074  78.470  1.00 46.91 ? 155  UNK O CB  1 
ATOM   8620  N  N   . UNK K  11 156 ? 23.211  9.474   77.115  1.00 46.91 ? 156  UNK O N   1 
ATOM   8621  C  CA  . UNK K  11 156 ? 23.830  8.187   77.421  1.00 46.91 ? 156  UNK O CA  1 
ATOM   8622  C  C   . UNK K  11 156 ? 25.038  8.345   78.344  1.00 46.91 ? 156  UNK O C   1 
ATOM   8623  O  O   . UNK K  11 156 ? 25.394  9.459   78.727  1.00 46.91 ? 156  UNK O O   1 
ATOM   8624  C  CB  . UNK K  11 156 ? 24.239  7.487   76.130  1.00 46.91 ? 156  UNK O CB  1 
ATOM   8625  N  N   . UNK K  11 157 ? 25.651  7.218   78.704  1.00 46.91 ? 157  UNK O N   1 
ATOM   8626  C  CA  . UNK K  11 157 ? 26.824  7.205   79.579  1.00 46.91 ? 157  UNK O CA  1 
ATOM   8627  C  C   . UNK K  11 157 ? 27.434  5.805   79.633  1.00 46.91 ? 157  UNK O C   1 
ATOM   8628  O  O   . UNK K  11 157 ? 26.821  4.873   80.161  1.00 46.91 ? 157  UNK O O   1 
ATOM   8629  C  CB  . UNK K  11 157 ? 26.445  7.666   80.986  1.00 46.91 ? 157  UNK O CB  1 
ATOM   8630  N  N   . UNK K  11 158 ? 28.634  5.660   79.075  1.00 46.91 ? 158  UNK O N   1 
ATOM   8631  C  CA  . UNK K  11 158 ? 29.330  4.375   79.058  1.00 46.91 ? 158  UNK O CA  1 
ATOM   8632  C  C   . UNK K  11 158 ? 30.807  4.537   78.708  1.00 46.91 ? 158  UNK O C   1 
ATOM   8633  O  O   . UNK K  11 158 ? 31.164  4.681   77.538  1.00 46.91 ? 158  UNK O O   1 
ATOM   8634  C  CB  . UNK K  11 158 ? 28.656  3.420   78.074  1.00 46.91 ? 158  UNK O CB  1 
ATOM   8635  N  N   . UNK K  11 159 ? 31.661  4.484   79.726  1.00 46.91 ? 159  UNK O N   1 
ATOM   8636  C  CA  . UNK K  11 159 ? 33.103  4.625   79.537  1.00 46.91 ? 159  UNK O CA  1 
ATOM   8637  C  C   . UNK K  11 159 ? 33.882  3.739   80.511  1.00 46.91 ? 159  UNK O C   1 
ATOM   8638  O  O   . UNK K  11 159 ? 33.293  3.096   81.384  1.00 46.91 ? 159  UNK O O   1 
ATOM   8639  C  CB  . UNK K  11 159 ? 33.512  6.083   79.709  1.00 46.91 ? 159  UNK O CB  1 
ATOM   8640  N  N   . UNK K  11 160 ? 35.201  3.693   80.336  1.00 46.91 ? 160  UNK O N   1 
ATOM   8641  C  CA  . UNK K  11 160 ? 36.080  2.895   81.191  1.00 46.91 ? 160  UNK O CA  1 
ATOM   8642  C  C   . UNK K  11 160 ? 37.553  3.149   80.870  1.00 46.91 ? 160  UNK O C   1 
ATOM   8643  O  O   . UNK K  11 160 ? 38.149  2.454   80.044  1.00 46.91 ? 160  UNK O O   1 
ATOM   8644  C  CB  . UNK K  11 160 ? 35.757  1.407   81.044  1.00 46.91 ? 160  UNK O CB  1 
ATOM   8645  N  N   . UNK K  11 161 ? 38.128  4.161   81.515  1.00 46.91 ? 161  UNK O N   1 
ATOM   8646  C  CA  . UNK K  11 161 ? 39.532  4.513   81.315  1.00 46.91 ? 161  UNK O CA  1 
ATOM   8647  C  C   . UNK K  11 161 ? 40.445  3.541   82.065  1.00 46.91 ? 161  UNK O C   1 
ATOM   8648  O  O   . UNK K  11 161 ? 39.978  2.758   82.895  1.00 46.91 ? 161  UNK O O   1 
ATOM   8649  C  CB  . UNK K  11 161 ? 39.782  5.943   81.779  1.00 46.91 ? 161  UNK O CB  1 
ATOM   8650  N  N   . UNK K  11 162 ? 41.743  3.598   81.777  1.00 46.91 ? 162  UNK O N   1 
ATOM   8651  C  CA  . UNK K  11 162 ? 42.716  2.719   82.423  1.00 46.91 ? 162  UNK O CA  1 
ATOM   8652  C  C   . UNK K  11 162 ? 44.158  3.170   82.184  1.00 46.91 ? 162  UNK O C   1 
ATOM   8653  O  O   . UNK K  11 162 ? 44.905  2.524   81.442  1.00 46.91 ? 162  UNK O O   1 
ATOM   8654  C  CB  . UNK K  11 162 ? 42.525  1.281   81.944  1.00 46.91 ? 162  UNK O CB  1 
ATOM   8655  N  N   . UNK K  11 163 ? 44.547  4.269   82.820  1.00 46.91 ? 163  UNK O N   1 
ATOM   8656  C  CA  . UNK K  11 163 ? 45.898  4.806   82.677  1.00 46.91 ? 163  UNK O CA  1 
ATOM   8657  C  C   . UNK K  11 163 ? 46.706  4.634   83.962  1.00 46.91 ? 163  UNK O C   1 
ATOM   8658  O  O   . UNK K  11 163 ? 46.340  5.174   85.011  1.00 46.91 ? 163  UNK O O   1 
ATOM   8659  C  CB  . UNK K  11 163 ? 45.839  6.274   82.283  1.00 46.91 ? 163  UNK O CB  1 
ATOM   8660  N  N   . UNK K  11 164 ? 47.814  3.903   83.873  1.00 46.91 ? 164  UNK O N   1 
ATOM   8661  C  CA  . UNK K  11 164 ? 48.664  3.662   85.037  1.00 46.91 ? 164  UNK O CA  1 
ATOM   8662  C  C   . UNK K  11 164 ? 50.151  3.579   84.698  1.00 46.91 ? 164  UNK O C   1 
ATOM   8663  O  O   . UNK K  11 164 ? 50.568  2.765   83.869  1.00 46.91 ? 164  UNK O O   1 
ATOM   8664  C  CB  . UNK K  11 164 ? 48.218  2.394   85.750  1.00 46.91 ? 164  UNK O CB  1 
ATOM   8665  N  N   . UNK K  11 165 ? 50.948  4.408   85.369  1.00 46.91 ? 165  UNK O N   1 
ATOM   8666  C  CA  . UNK K  11 165 ? 52.395  4.447   85.168  1.00 46.91 ? 165  UNK O CA  1 
ATOM   8667  C  C   . UNK K  11 165 ? 53.091  5.202   86.301  1.00 46.91 ? 165  UNK O C   1 
ATOM   8668  O  O   . UNK K  11 165 ? 52.435  5.778   87.173  1.00 46.91 ? 165  UNK O O   1 
ATOM   8669  C  CB  . UNK K  11 165 ? 52.726  5.096   83.828  1.00 46.91 ? 165  UNK O CB  1 
ATOM   8670  N  N   . UNK K  11 166 ? 54.421  5.181   86.288  1.00 46.91 ? 166  UNK O N   1 
ATOM   8671  C  CA  . UNK K  11 166 ? 55.214  5.868   87.303  1.00 46.91 ? 166  UNK O CA  1 
ATOM   8672  C  C   . UNK K  11 166 ? 55.169  7.376   87.066  1.00 46.91 ? 166  UNK O C   1 
ATOM   8673  O  O   . UNK K  11 166 ? 55.747  7.879   86.098  1.00 46.91 ? 166  UNK O O   1 
ATOM   8674  C  CB  . UNK K  11 166 ? 56.652  5.366   87.273  1.00 46.91 ? 166  UNK O CB  1 
ATOM   8675  N  N   . UNK K  11 167 ? 54.481  8.089   87.953  1.00 46.91 ? 167  UNK O N   1 
ATOM   8676  C  CA  . UNK K  11 167 ? 54.341  9.538   87.848  1.00 46.91 ? 167  UNK O CA  1 
ATOM   8677  C  C   . UNK K  11 167 ? 55.519  10.305  88.443  1.00 46.91 ? 167  UNK O C   1 
ATOM   8678  O  O   . UNK K  11 167 ? 56.033  11.242  87.828  1.00 46.91 ? 167  UNK O O   1 
ATOM   8679  C  CB  . UNK K  11 167 ? 53.037  9.987   88.501  1.00 46.91 ? 167  UNK O CB  1 
ATOM   8680  N  N   . UNK K  11 168 ? 55.930  9.920   89.649  1.00 46.91 ? 168  UNK O N   1 
ATOM   8681  C  CA  . UNK K  11 168 ? 57.041  10.579  90.328  1.00 46.91 ? 168  UNK O CA  1 
ATOM   8682  C  C   . UNK K  11 168 ? 58.123  9.589   90.748  1.00 46.91 ? 168  UNK O C   1 
ATOM   8683  O  O   . UNK K  11 168 ? 59.232  9.602   90.204  1.00 46.91 ? 168  UNK O O   1 
ATOM   8684  C  CB  . UNK K  11 168 ? 56.532  11.352  91.541  1.00 46.91 ? 168  UNK O CB  1 
ATOM   8685  N  N   . UNK K  11 169 ? 57.795  8.744   91.725  1.00 46.91 ? 169  UNK O N   1 
ATOM   8686  C  CA  . UNK K  11 169 ? 58.708  7.729   92.249  1.00 46.91 ? 169  UNK O CA  1 
ATOM   8687  C  C   . UNK K  11 169 ? 60.000  8.310   92.828  1.00 46.91 ? 169  UNK O C   1 
ATOM   8688  O  O   . UNK K  11 169 ? 61.071  7.703   92.722  1.00 46.91 ? 169  UNK O O   1 
ATOM   8689  C  CB  . UNK K  11 169 ? 59.020  6.689   91.172  1.00 46.91 ? 169  UNK O CB  1 
ATOM   8690  N  N   . UNK K  11 170 ? 59.889  9.476   93.464  1.00 46.91 ? 170  UNK O N   1 
ATOM   8691  C  CA  . UNK K  11 170 ? 61.037  10.145  94.070  1.00 46.91 ? 170  UNK O CA  1 
ATOM   8692  C  C   . UNK K  11 170 ? 60.617  11.319  94.955  1.00 46.91 ? 170  UNK O C   1 
ATOM   8693  O  O   . UNK K  11 170 ? 61.330  11.677  95.898  1.00 46.91 ? 170  UNK O O   1 
ATOM   8694  C  CB  . UNK K  11 170 ? 62.004  10.625  92.990  1.00 46.91 ? 170  UNK O CB  1 
ATOM   8695  N  N   . UNK K  11 171 ? 59.474  11.922  94.640  1.00 46.91 ? 171  UNK O N   1 
ATOM   8696  C  CA  . UNK K  11 171 ? 58.970  13.063  95.399  1.00 46.91 ? 171  UNK O CA  1 
ATOM   8697  C  C   . UNK K  11 171 ? 57.469  12.975  95.684  1.00 46.91 ? 171  UNK O C   1 
ATOM   8698  O  O   . UNK K  11 171 ? 56.881  11.894  95.636  1.00 46.91 ? 171  UNK O O   1 
ATOM   8699  C  CB  . UNK K  11 171 ? 59.295  14.360  94.662  1.00 46.91 ? 171  UNK O CB  1 
ATOM   8700  N  N   . UNK K  11 172 ? 56.866  14.127  95.977  1.00 46.91 ? 172  UNK O N   1 
ATOM   8701  C  CA  . UNK K  11 172 ? 55.437  14.231  96.283  1.00 46.91 ? 172  UNK O CA  1 
ATOM   8702  C  C   . UNK K  11 172 ? 55.059  13.475  97.559  1.00 46.91 ? 172  UNK O C   1 
ATOM   8703  O  O   . UNK K  11 172 ? 54.064  12.748  97.597  1.00 46.91 ? 172  UNK O O   1 
ATOM   8704  C  CB  . UNK K  11 172 ? 54.593  13.755  95.095  1.00 46.91 ? 172  UNK O CB  1 
ATOM   8705  N  N   . UNK K  11 173 ? 55.843  13.694  98.615  1.00 46.91 ? 173  UNK O N   1 
ATOM   8706  C  CA  . UNK K  11 173 ? 55.627  13.057  99.913  1.00 46.91 ? 173  UNK O CA  1 
ATOM   8707  C  C   . UNK K  11 173 ? 55.742  11.532  99.854  1.00 46.91 ? 173  UNK O C   1 
ATOM   8708  O  O   . UNK K  11 173 ? 56.355  10.983  98.937  1.00 46.91 ? 173  UNK O O   1 
ATOM   8709  C  CB  . UNK K  11 173 ? 54.272  13.474  100.496 1.00 46.91 ? 173  UNK O CB  1 
ATOM   8710  N  N   . UNK K  11 174 ? 55.197  10.862  100.869 1.00 46.91 ? 174  UNK O N   1 
ATOM   8711  C  CA  . UNK K  11 174 ? 55.223  9.401   100.959 1.00 46.91 ? 174  UNK O CA  1 
ATOM   8712  C  C   . UNK K  11 174 ? 54.351  8.910   102.112 1.00 46.91 ? 174  UNK O C   1 
ATOM   8713  O  O   . UNK K  11 174 ? 54.148  9.624   103.095 1.00 46.91 ? 174  UNK O O   1 
ATOM   8714  C  CB  . UNK K  11 174 ? 56.657  8.902   101.138 1.00 46.91 ? 174  UNK O CB  1 
ATOM   8715  N  N   . UNK K  11 175 ? 53.839  7.687   101.987 1.00 46.91 ? 175  UNK O N   1 
ATOM   8716  C  CA  . UNK K  11 175 ? 52.988  7.097   103.016 1.00 46.91 ? 175  UNK O CA  1 
ATOM   8717  C  C   . UNK K  11 175 ? 53.728  6.016   103.800 1.00 46.91 ? 175  UNK O C   1 
ATOM   8718  O  O   . UNK K  11 175 ? 54.183  6.333   104.920 1.00 46.91 ? 175  UNK O O   1 
ATOM   8719  C  CB  . UNK K  11 175 ? 51.726  6.524   102.386 1.00 46.91 ? 175  UNK O CB  1 
ATOM   8720  N  N   . UNK K  11 176 ? 44.788  9.458   105.540 1.00 46.91 ? 176  UNK O N   1 
ATOM   8721  C  CA  . UNK K  11 176 ? 44.791  10.542  104.513 1.00 46.91 ? 176  UNK O CA  1 
ATOM   8722  C  C   . UNK K  11 176 ? 45.212  11.873  105.130 1.00 46.91 ? 176  UNK O C   1 
ATOM   8723  O  O   . UNK K  11 176 ? 44.780  12.224  106.231 1.00 46.91 ? 176  UNK O O   1 
ATOM   8724  C  CB  . UNK K  11 176 ? 43.411  10.666  103.879 1.00 46.91 ? 176  UNK O CB  1 
ATOM   8725  N  N   . UNK K  11 177 ? 46.068  12.604  104.422 1.00 46.91 ? 177  UNK O N   1 
ATOM   8726  C  CA  . UNK K  11 177 ? 46.553  13.894  104.898 1.00 46.91 ? 177  UNK O CA  1 
ATOM   8727  C  C   . UNK K  11 177 ? 46.605  14.931  103.778 1.00 46.91 ? 177  UNK O C   1 
ATOM   8728  O  O   . UNK K  11 177 ? 45.711  15.775  103.660 1.00 46.91 ? 177  UNK O O   1 
ATOM   8729  C  CB  . UNK K  11 177 ? 47.931  13.735  105.539 1.00 46.91 ? 177  UNK O CB  1 
ATOM   8730  N  N   . UNK K  11 178 ? 47.664  14.873  102.975 1.00 46.91 ? 178  UNK O N   1 
ATOM   8731  C  CA  . UNK K  11 178 ? 47.863  15.794  101.860 1.00 46.91 ? 178  UNK O CA  1 
ATOM   8732  C  C   . UNK K  11 178 ? 49.073  15.356  101.043 1.00 46.91 ? 178  UNK O C   1 
ATOM   8733  O  O   . UNK K  11 178 ? 50.218  15.587  101.441 1.00 46.91 ? 178  UNK O O   1 
ATOM   8734  C  CB  . UNK K  11 178 ? 48.066  17.219  102.373 1.00 46.91 ? 178  UNK O CB  1 
ATOM   8735  N  N   . UNK K  11 179 ? 48.812  14.708  99.913  1.00 46.91 ? 179  UNK O N   1 
ATOM   8736  C  CA  . UNK K  11 179 ? 49.875  14.230  99.035  1.00 46.91 ? 179  UNK O CA  1 
ATOM   8737  C  C   . UNK K  11 179 ? 49.612  14.611  97.584  1.00 46.91 ? 179  UNK O C   1 
ATOM   8738  O  O   . UNK K  11 179 ? 48.638  14.158  96.980  1.00 46.91 ? 179  UNK O O   1 
ATOM   8739  C  CB  . UNK K  11 179 ? 50.028  12.721  99.166  1.00 46.91 ? 179  UNK O CB  1 
ATOM   8740  N  N   . UNK K  11 180 ? 50.478  15.462  97.039  1.00 46.91 ? 180  UNK O N   1 
ATOM   8741  C  CA  . UNK K  11 180 ? 50.359  15.919  95.658  1.00 46.91 ? 180  UNK O CA  1 
ATOM   8742  C  C   . UNK K  11 180 ? 50.745  14.825  94.660  1.00 46.91 ? 180  UNK O C   1 
ATOM   8743  O  O   . UNK K  11 180 ? 51.157  13.732  95.052  1.00 46.91 ? 180  UNK O O   1 
ATOM   8744  C  CB  . UNK K  11 180 ? 51.221  17.158  95.444  1.00 46.91 ? 180  UNK O CB  1 
ATOM   8745  N  N   . UNK K  11 181 ? 50.646  15.140  93.371  1.00 46.91 ? 181  UNK O N   1 
ATOM   8746  C  CA  . UNK K  11 181 ? 50.977  14.185  92.317  1.00 46.91 ? 181  UNK O CA  1 
ATOM   8747  C  C   . UNK K  11 181 ? 51.445  14.873  91.036  1.00 46.91 ? 181  UNK O C   1 
ATOM   8748  O  O   . UNK K  11 181 ? 51.636  16.093  91.002  1.00 46.91 ? 181  UNK O O   1 
ATOM   8749  C  CB  . UNK K  11 181 ? 49.775  13.292  92.029  1.00 46.91 ? 181  UNK O CB  1 
ATOM   8750  N  N   . UNK K  11 182 ? 51.643  14.078  89.988  1.00 46.91 ? 182  UNK O N   1 
ATOM   8751  C  CA  . UNK K  11 182 ? 52.090  14.588  88.696  1.00 46.91 ? 182  UNK O CA  1 
ATOM   8752  C  C   . UNK K  11 182 ? 51.245  14.031  87.553  1.00 46.91 ? 182  UNK O C   1 
ATOM   8753  O  O   . UNK K  11 182 ? 50.349  13.212  87.769  1.00 46.91 ? 182  UNK O O   1 
ATOM   8754  C  CB  . UNK K  11 182 ? 53.561  14.249  88.479  1.00 46.91 ? 182  UNK O CB  1 
ATOM   8755  N  N   . UNK K  11 183 ? 51.533  14.485  86.337  1.00 46.91 ? 183  UNK O N   1 
ATOM   8756  C  CA  . UNK K  11 183 ? 50.799  14.037  85.158  1.00 46.91 ? 183  UNK O CA  1 
ATOM   8757  C  C   . UNK K  11 183 ? 51.699  13.317  84.161  1.00 46.91 ? 183  UNK O C   1 
ATOM   8758  O  O   . UNK K  11 183 ? 52.499  13.944  83.462  1.00 46.91 ? 183  UNK O O   1 
ATOM   8759  C  CB  . UNK K  11 183 ? 50.108  15.217  84.491  1.00 46.91 ? 183  UNK O CB  1 
ATOM   8760  N  N   . UNK K  11 184 ? 51.555  11.997  84.102  1.00 46.91 ? 184  UNK O N   1 
ATOM   8761  C  CA  . UNK K  11 184 ? 52.333  11.150  83.200  1.00 46.91 ? 184  UNK O CA  1 
ATOM   8762  C  C   . UNK K  11 184 ? 51.909  9.695   83.382  1.00 46.91 ? 184  UNK O C   1 
ATOM   8763  O  O   . UNK K  11 184 ? 52.734  8.783   83.304  1.00 46.91 ? 184  UNK O O   1 
ATOM   8764  C  CB  . UNK K  11 184 ? 53.827  11.303  83.481  1.00 46.91 ? 184  UNK O CB  1 
ATOM   8765  N  N   . UNK K  11 185 ? 50.613  9.489   83.600  1.00 46.91 ? 185  UNK O N   1 
ATOM   8766  C  CA  . UNK K  11 185 ? 50.054  8.154   83.810  1.00 46.91 ? 185  UNK O CA  1 
ATOM   8767  C  C   . UNK K  11 185 ? 49.977  7.295   82.545  1.00 46.91 ? 185  UNK O C   1 
ATOM   8768  O  O   . UNK K  11 185 ? 49.087  6.453   82.417  1.00 46.91 ? 185  UNK O O   1 
ATOM   8769  C  CB  . UNK K  11 185 ? 48.677  8.265   84.459  1.00 46.91 ? 185  UNK O CB  1 
ATOM   8770  N  N   . UNK K  11 186 ? 50.918  7.505   81.625  1.00 46.91 ? 186  UNK O N   1 
ATOM   8771  C  CA  . UNK K  11 186 ? 50.990  6.763   80.365  1.00 46.91 ? 186  UNK O CA  1 
ATOM   8772  C  C   . UNK K  11 186 ? 49.855  7.064   79.385  1.00 46.91 ? 186  UNK O C   1 
ATOM   8773  O  O   . UNK K  11 186 ? 50.011  6.863   78.179  1.00 46.91 ? 186  UNK O O   1 
ATOM   8774  C  CB  . UNK K  11 186 ? 51.084  5.257   80.627  1.00 46.91 ? 186  UNK O CB  1 
ATOM   8775  N  N   . UNK K  11 187 ? 48.737  7.570   79.906  1.00 46.91 ? 187  UNK O N   1 
ATOM   8776  C  CA  . UNK K  11 187 ? 47.560  7.919   79.108  1.00 46.91 ? 187  UNK O CA  1 
ATOM   8777  C  C   . UNK K  11 187 ? 46.876  6.734   78.424  1.00 46.91 ? 187  UNK O C   1 
ATOM   8778  O  O   . UNK K  11 187 ? 47.531  5.816   77.929  1.00 46.91 ? 187  UNK O O   1 
ATOM   8779  C  CB  . UNK K  11 187 ? 47.908  8.998   78.083  1.00 46.91 ? 187  UNK O CB  1 
ATOM   8780  N  N   . UNK K  11 188 ? 45.544  6.774   78.409  1.00 46.91 ? 188  UNK O N   1 
ATOM   8781  C  CA  . UNK K  11 188 ? 44.719  5.733   77.797  1.00 46.91 ? 188  UNK O CA  1 
ATOM   8782  C  C   . UNK K  11 188 ? 43.245  6.112   77.906  1.00 46.91 ? 188  UNK O C   1 
ATOM   8783  O  O   . UNK K  11 188 ? 42.835  6.778   78.861  1.00 46.91 ? 188  UNK O O   1 
ATOM   8784  C  CB  . UNK K  11 188 ? 44.965  4.390   78.478  1.00 46.91 ? 188  UNK O CB  1 
ATOM   8785  N  N   . UNK K  11 189 ? 42.445  5.665   76.941  1.00 46.91 ? 189  UNK O N   1 
ATOM   8786  C  CA  . UNK K  11 189 ? 41.015  5.961   76.933  1.00 46.91 ? 189  UNK O CA  1 
ATOM   8787  C  C   . UNK K  11 189 ? 40.217  4.964   76.098  1.00 46.91 ? 189  UNK O C   1 
ATOM   8788  O  O   . UNK K  11 189 ? 40.780  4.073   75.455  1.00 46.91 ? 189  UNK O O   1 
ATOM   8789  C  CB  . UNK K  11 189 ? 40.771  7.381   76.430  1.00 46.91 ? 189  UNK O CB  1 
ATOM   8790  N  N   . UNK K  11 190 ? 38.895  5.119   76.128  1.00 46.91 ? 190  UNK O N   1 
ATOM   8791  C  CA  . UNK K  11 190 ? 37.979  4.253   75.389  1.00 46.91 ? 190  UNK O CA  1 
ATOM   8792  C  C   . UNK K  11 190 ? 36.564  4.830   75.424  1.00 46.91 ? 190  UNK O C   1 
ATOM   8793  O  O   . UNK K  11 190 ? 35.581  4.105   75.241  1.00 46.91 ? 190  UNK O O   1 
ATOM   8794  C  CB  . UNK K  11 190 ? 37.989  2.846   75.984  1.00 46.91 ? 190  UNK O CB  1 
ATOM   8795  N  N   . UNK K  11 191 ? 36.469  6.134   75.667  1.00 46.91 ? 191  UNK O N   1 
ATOM   8796  C  CA  . UNK K  11 191 ? 35.184  6.820   75.743  1.00 46.91 ? 191  UNK O CA  1 
ATOM   8797  C  C   . UNK K  11 191 ? 34.535  7.063   74.383  1.00 46.91 ? 191  UNK O C   1 
ATOM   8798  O  O   . UNK K  11 191 ? 35.130  7.688   73.502  1.00 46.91 ? 191  UNK O O   1 
ATOM   8799  C  CB  . UNK K  11 191 ? 35.340  8.136   76.492  1.00 46.91 ? 191  UNK O CB  1 
ATOM   8800  N  N   . UNK K  11 192 ? 33.310  6.571   74.227  1.00 46.91 ? 192  UNK O N   1 
ATOM   8801  C  CA  . UNK K  11 192 ? 32.555  6.737   72.989  1.00 46.91 ? 192  UNK O CA  1 
ATOM   8802  C  C   . UNK K  11 192 ? 31.772  8.048   73.029  1.00 46.91 ? 192  UNK O C   1 
ATOM   8803  O  O   . UNK K  11 192 ? 31.119  8.361   74.027  1.00 46.91 ? 192  UNK O O   1 
ATOM   8804  C  CB  . UNK K  11 192 ? 31.605  5.561   72.794  1.00 46.91 ? 192  UNK O CB  1 
ATOM   8805  N  N   . UNK K  11 193 ? 31.852  8.818   71.944  1.00 46.91 ? 193  UNK O N   1 
ATOM   8806  C  CA  . UNK K  11 193 ? 31.156  10.100  71.850  1.00 46.91 ? 193  UNK O CA  1 
ATOM   8807  C  C   . UNK K  11 193 ? 29.667  9.935   71.542  1.00 46.91 ? 193  UNK O C   1 
ATOM   8808  O  O   . UNK K  11 193 ? 29.214  8.848   71.176  1.00 46.91 ? 193  UNK O O   1 
ATOM   8809  C  CB  . UNK K  11 193 ? 31.820  10.977  70.794  1.00 46.91 ? 193  UNK O CB  1 
ATOM   8810  N  N   . UNK K  11 194 ? 28.915  11.024  71.676  1.00 46.91 ? 194  UNK O N   1 
ATOM   8811  C  CA  . UNK K  11 194 ? 27.476  11.013  71.418  1.00 46.91 ? 194  UNK O CA  1 
ATOM   8812  C  C   . UNK K  11 194 ? 26.964  12.411  71.083  1.00 46.91 ? 194  UNK O C   1 
ATOM   8813  O  O   . UNK K  11 194 ? 27.547  13.415  71.502  1.00 46.91 ? 194  UNK O O   1 
ATOM   8814  C  CB  . UNK K  11 194 ? 26.730  10.456  72.626  1.00 46.91 ? 194  UNK O CB  1 
ATOM   8815  N  N   . UNK K  11 195 ? 25.868  12.474  70.327  1.00 46.91 ? 195  UNK O N   1 
ATOM   8816  C  CA  . UNK K  11 195 ? 25.278  13.750  69.931  1.00 46.91 ? 195  UNK O CA  1 
ATOM   8817  C  C   . UNK K  11 195 ? 23.845  13.601  69.421  1.00 46.91 ? 195  UNK O C   1 
ATOM   8818  O  O   . UNK K  11 195 ? 22.889  13.870  70.149  1.00 46.91 ? 195  UNK O O   1 
ATOM   8819  C  CB  . UNK K  11 195 ? 26.148  14.432  68.874  1.00 46.91 ? 195  UNK O CB  1 
ATOM   8820  N  N   . UNK K  11 196 ? 23.703  13.190  68.163  1.00 46.91 ? 196  UNK O N   1 
ATOM   8821  C  CA  . UNK K  11 196 ? 22.388  13.006  67.553  1.00 46.91 ? 196  UNK O CA  1 
ATOM   8822  C  C   . UNK K  11 196 ? 22.433  11.919  66.487  1.00 46.91 ? 196  UNK O C   1 
ATOM   8823  O  O   . UNK K  11 196 ? 23.163  12.034  65.498  1.00 46.91 ? 196  UNK O O   1 
ATOM   8824  C  CB  . UNK K  11 196 ? 21.894  14.319  66.953  1.00 46.91 ? 196  UNK O CB  1 
ATOM   8825  N  N   . UNK K  11 197 ? 21.621  10.880  66.682  1.00 46.91 ? 197  UNK O N   1 
ATOM   8826  C  CA  . UNK K  11 197 ? 21.555  9.744   65.764  1.00 46.91 ? 197  UNK O CA  1 
ATOM   8827  C  C   . UNK K  11 197 ? 22.891  9.003   65.740  1.00 46.91 ? 197  UNK O C   1 
ATOM   8828  O  O   . UNK K  11 197 ? 23.804  9.336   66.496  1.00 46.91 ? 197  UNK O O   1 
ATOM   8829  C  CB  . UNK K  11 197 ? 21.163  10.204  64.355  1.00 46.91 ? 197  UNK O CB  1 
ATOM   8830  N  N   . UNK K  11 198 ? 22.995  7.984   64.888  1.00 46.91 ? 198  UNK O N   1 
ATOM   8831  C  CA  . UNK K  11 198 ? 24.222  7.195   64.772  1.00 46.91 ? 198  UNK O CA  1 
ATOM   8832  C  C   . UNK K  11 198 ? 24.643  6.595   66.118  1.00 46.91 ? 198  UNK O C   1 
ATOM   8833  O  O   . UNK K  11 198 ? 23.795  6.310   66.969  1.00 46.91 ? 198  UNK O O   1 
ATOM   8834  C  CB  . UNK K  11 198 ? 25.346  8.052   64.186  1.00 46.91 ? 198  UNK O CB  1 
ATOM   8835  N  N   . UNK K  11 199 ? 25.948  6.379   66.287  1.00 46.91 ? 199  UNK O N   1 
ATOM   8836  C  CA  . UNK K  11 199 ? 26.507  5.817   67.516  1.00 46.91 ? 199  UNK O CA  1 
ATOM   8837  C  C   . UNK K  11 199 ? 28.034  5.938   67.530  1.00 46.91 ? 199  UNK O C   1 
ATOM   8838  O  O   . UNK K  11 199 ? 28.582  6.865   68.126  1.00 46.91 ? 199  UNK O O   1 
ATOM   8839  C  CB  . UNK K  11 199 ? 26.085  4.356   67.671  1.00 46.91 ? 199  UNK O CB  1 
ATOM   8840  N  N   . UNK K  11 200 ? 28.708  5.000   66.859  1.00 46.91 ? 200  UNK O N   1 
ATOM   8841  C  CA  . UNK K  11 200 ? 30.171  4.969   66.775  1.00 46.91 ? 200  UNK O CA  1 
ATOM   8842  C  C   . UNK K  11 200 ? 30.865  4.773   68.129  1.00 46.91 ? 200  UNK O C   1 
ATOM   8843  O  O   . UNK K  11 200 ? 30.260  4.260   69.077  1.00 46.91 ? 200  UNK O O   1 
ATOM   8844  C  CB  . UNK K  11 200 ? 30.694  6.228   66.079  1.00 46.91 ? 200  UNK O CB  1 
ATOM   8845  N  N   . UNK K  11 201 ? 32.148  5.123   68.185  1.00 46.91 ? 201  UNK O N   1 
ATOM   8846  C  CA  . UNK K  11 201 ? 32.954  4.996   69.400  1.00 46.91 ? 201  UNK O CA  1 
ATOM   8847  C  C   . UNK K  11 201 ? 34.319  5.657   69.221  1.00 46.91 ? 201  UNK O C   1 
ATOM   8848  O  O   . UNK K  11 201 ? 34.641  6.158   68.146  1.00 46.91 ? 201  UNK O O   1 
ATOM   8849  C  CB  . UNK K  11 201 ? 33.131  3.522   69.768  1.00 46.91 ? 201  UNK O CB  1 
ATOM   8850  N  N   . UNK K  11 202 ? 35.131  5.630   70.280  1.00 46.91 ? 202  UNK O N   1 
ATOM   8851  C  CA  . UNK K  11 202 ? 36.463  6.223   70.246  1.00 46.91 ? 202  UNK O CA  1 
ATOM   8852  C  C   . UNK K  11 202 ? 37.395  5.579   71.274  1.00 46.91 ? 202  UNK O C   1 
ATOM   8853  O  O   . UNK K  11 202 ? 36.960  4.787   72.114  1.00 46.91 ? 202  UNK O O   1 
ATOM   8854  C  CB  . UNK K  11 202 ? 36.376  7.727   70.481  1.00 46.91 ? 202  UNK O CB  1 
ATOM   8855  N  N   . UNK K  11 203 ? 38.682  5.907   71.182  1.00 46.91 ? 203  UNK O N   1 
ATOM   8856  C  CA  . UNK K  11 203 ? 39.695  5.374   72.089  1.00 46.91 ? 203  UNK O CA  1 
ATOM   8857  C  C   . UNK K  11 203 ? 40.973  6.206   71.998  1.00 46.91 ? 203  UNK O C   1 
ATOM   8858  O  O   . UNK K  11 203 ? 41.879  5.888   71.224  1.00 46.91 ? 203  UNK O O   1 
ATOM   8859  C  CB  . UNK K  11 203 ? 39.989  3.913   71.756  1.00 46.91 ? 203  UNK O CB  1 
ATOM   8860  N  N   . UNK K  11 204 ? 41.034  7.277   72.785  1.00 46.91 ? 204  UNK O N   1 
ATOM   8861  C  CA  . UNK K  11 204 ? 42.188  8.172   72.797  1.00 46.91 ? 204  UNK O CA  1 
ATOM   8862  C  C   . UNK K  11 204 ? 43.412  7.569   73.483  1.00 46.91 ? 204  UNK O C   1 
ATOM   8863  O  O   . UNK K  11 204 ? 43.340  7.147   74.639  1.00 46.91 ? 204  UNK O O   1 
ATOM   8864  C  CB  . UNK K  11 204 ? 41.815  9.492   73.459  1.00 46.91 ? 204  UNK O CB  1 
ATOM   8865  N  N   . UNK K  11 205 ? 44.541  7.569   72.781  1.00 46.91 ? 205  UNK O N   1 
ATOM   8866  C  CA  . UNK K  11 205 ? 45.787  7.028   73.315  1.00 46.91 ? 205  UNK O CA  1 
ATOM   8867  C  C   . UNK K  11 205 ? 46.980  7.449   72.459  1.00 46.91 ? 205  UNK O C   1 
ATOM   8868  O  O   . UNK K  11 205 ? 48.077  6.886   72.669  1.00 46.91 ? 205  UNK O O   1 
ATOM   8869  C  CB  . UNK K  11 205 ? 45.705  5.504   73.402  1.00 46.91 ? 205  UNK O CB  1 
ATOM   8870  N  N   . UNK L  12 1   ? -0.665  8.439   71.791  1.00 46.91 ? 1    UNK U N   1 
ATOM   8871  C  CA  . UNK L  12 1   ? -0.057  7.234   71.156  1.00 46.91 ? 1    UNK U CA  1 
ATOM   8872  C  C   . UNK L  12 1   ? 1.335   6.936   71.708  1.00 46.91 ? 1    UNK U C   1 
ATOM   8873  O  O   . UNK L  12 1   ? 1.615   5.809   72.122  1.00 46.91 ? 1    UNK U O   1 
ATOM   8874  C  CB  . UNK L  12 1   ? 0.000   7.412   69.643  1.00 46.91 ? 1    UNK U CB  1 
ATOM   8875  N  N   . UNK L  12 2   ? 2.192   7.956   71.721  1.00 46.91 ? 2    UNK U N   1 
ATOM   8876  C  CA  . UNK L  12 2   ? 3.565   7.837   72.216  1.00 46.91 ? 2    UNK U CA  1 
ATOM   8877  C  C   . UNK L  12 2   ? 4.409   6.846   71.413  1.00 46.91 ? 2    UNK U C   1 
ATOM   8878  O  O   . UNK L  12 2   ? 3.985   6.357   70.362  1.00 46.91 ? 2    UNK U O   1 
ATOM   8879  C  CB  . UNK L  12 2   ? 3.569   7.466   73.701  1.00 46.91 ? 2    UNK U CB  1 
ATOM   8880  N  N   . UNK L  12 3   ? 5.614   6.578   71.908  1.00 46.91 ? 3    UNK U N   1 
ATOM   8881  C  CA  . UNK L  12 3   ? 6.545   5.655   71.264  1.00 46.91 ? 3    UNK U CA  1 
ATOM   8882  C  C   . UNK L  12 3   ? 7.703   5.341   72.209  1.00 46.91 ? 3    UNK U C   1 
ATOM   8883  O  O   . UNK L  12 3   ? 7.582   5.496   73.426  1.00 46.91 ? 3    UNK U O   1 
ATOM   8884  C  CB  . UNK L  12 3   ? 7.073   6.260   69.963  1.00 46.91 ? 3    UNK U CB  1 
ATOM   8885  N  N   . UNK L  12 4   ? 8.811   4.866   71.647  1.00 46.91 ? 4    UNK U N   1 
ATOM   8886  C  CA  . UNK L  12 4   ? 9.993   4.539   72.437  1.00 46.91 ? 4    UNK U CA  1 
ATOM   8887  C  C   . UNK L  12 4   ? 11.173  5.423   72.036  1.00 46.91 ? 4    UNK U C   1 
ATOM   8888  O  O   . UNK L  12 4   ? 12.279  5.274   72.561  1.00 46.91 ? 4    UNK U O   1 
ATOM   8889  C  CB  . UNK L  12 4   ? 10.349  3.067   72.268  1.00 46.91 ? 4    UNK U CB  1 
ATOM   8890  N  N   . UNK L  12 5   ? 10.934  6.325   71.089  1.00 46.91 ? 5    UNK U N   1 
ATOM   8891  C  CA  . UNK L  12 5   ? 11.966  7.238   70.610  1.00 46.91 ? 5    UNK U CA  1 
ATOM   8892  C  C   . UNK L  12 5   ? 11.414  8.653   70.451  1.00 46.91 ? 5    UNK U C   1 
ATOM   8893  O  O   . UNK L  12 5   ? 12.155  9.631   70.551  1.00 46.91 ? 5    UNK U O   1 
ATOM   8894  C  CB  . UNK L  12 5   ? 12.535  6.742   69.285  1.00 46.91 ? 5    UNK U CB  1 
ATOM   8895  N  N   . UNK L  12 6   ? 10.119  8.751   70.162  1.00 46.91 ? 6    UNK U N   1 
ATOM   8896  C  CA  . UNK L  12 6   ? 9.465   10.043  69.992  1.00 46.91 ? 6    UNK U CA  1 
ATOM   8897  C  C   . UNK L  12 6   ? 9.004   10.604  71.336  1.00 46.91 ? 6    UNK U C   1 
ATOM   8898  O  O   . UNK L  12 6   ? 8.837   11.816  71.486  1.00 46.91 ? 6    UNK U O   1 
ATOM   8899  C  CB  . UNK L  12 6   ? 8.283   9.914   69.036  1.00 46.91 ? 6    UNK U CB  1 
ATOM   8900  N  N   . UNK L  12 7   ? 8.760   9.713   72.292  1.00 46.91 ? 7    UNK U N   1 
ATOM   8901  C  CA  . UNK L  12 7   ? 8.317   10.106  73.625  1.00 46.91 ? 7    UNK U CA  1 
ATOM   8902  C  C   . UNK L  12 7   ? 9.492   10.282  74.586  1.00 46.91 ? 7    UNK U C   1 
ATOM   8903  O  O   . UNK L  12 7   ? 9.331   10.825  75.681  1.00 46.91 ? 7    UNK U O   1 
ATOM   8904  C  CB  . UNK L  12 7   ? 7.337   9.079   74.174  1.00 46.91 ? 7    UNK U CB  1 
ATOM   8905  N  N   . UNK L  12 8   ? 10.660  9.788   74.186  1.00 46.91 ? 8    UNK U N   1 
ATOM   8906  C  CA  . UNK L  12 8   ? 11.863  9.885   75.007  1.00 46.91 ? 8    UNK U CA  1 
ATOM   8907  C  C   . UNK L  12 8   ? 12.625  11.186  74.771  1.00 46.91 ? 8    UNK U C   1 
ATOM   8908  O  O   . UNK L  12 8   ? 13.375  11.639  75.638  1.00 46.91 ? 8    UNK U O   1 
ATOM   8909  C  CB  . UNK L  12 8   ? 12.770  8.689   74.748  1.00 46.91 ? 8    UNK U CB  1 
ATOM   8910  N  N   . UNK L  12 9   ? 12.459  11.764  73.585  1.00 46.91 ? 9    UNK U N   1 
ATOM   8911  C  CA  . UNK L  12 9   ? 13.134  13.008  73.233  1.00 46.91 ? 9    UNK U CA  1 
ATOM   8912  C  C   . UNK L  12 9   ? 12.275  14.241  73.505  1.00 46.91 ? 9    UNK U C   1 
ATOM   8913  O  O   . UNK L  12 9   ? 12.777  15.368  73.500  1.00 46.91 ? 9    UNK U O   1 
ATOM   8914  C  CB  . UNK L  12 9   ? 13.557  12.975  71.769  1.00 46.91 ? 9    UNK U CB  1 
ATOM   8915  N  N   . UNK L  12 10  ? 10.980  14.026  73.714  1.00 46.91 ? 10   UNK U N   1 
ATOM   8916  C  CA  . UNK L  12 10  ? 10.049  15.118  73.977  1.00 46.91 ? 10   UNK U CA  1 
ATOM   8917  C  C   . UNK L  12 10  ? 10.015  15.533  75.446  1.00 46.91 ? 10   UNK U C   1 
ATOM   8918  O  O   . UNK L  12 10  ? 9.887   16.718  75.759  1.00 46.91 ? 10   UNK U O   1 
ATOM   8919  C  CB  . UNK L  12 10  ? 8.652   14.739  73.505  1.00 46.91 ? 10   UNK U CB  1 
ATOM   8920  N  N   . UNK L  12 11  ? 10.087  14.550  76.339  1.00 46.91 ? 11   UNK U N   1 
ATOM   8921  C  CA  . UNK L  12 11  ? 10.060  14.809  77.776  1.00 46.91 ? 11   UNK U CA  1 
ATOM   8922  C  C   . UNK L  12 11  ? 11.438  15.154  78.339  1.00 46.91 ? 11   UNK U C   1 
ATOM   8923  O  O   . UNK L  12 11  ? 11.572  15.466  79.526  1.00 46.91 ? 11   UNK U O   1 
ATOM   8924  C  CB  . UNK L  12 11  ? 9.476   13.610  78.512  1.00 46.91 ? 11   UNK U CB  1 
ATOM   8925  N  N   . UNK L  12 12  ? 12.460  15.073  77.492  1.00 46.91 ? 12   UNK U N   1 
ATOM   8926  C  CA  . UNK L  12 12  ? 13.828  15.375  77.899  1.00 46.91 ? 12   UNK U CA  1 
ATOM   8927  C  C   . UNK L  12 12  ? 14.149  16.866  77.792  1.00 46.91 ? 12   UNK U C   1 
ATOM   8928  O  O   . UNK L  12 12  ? 15.292  17.280  78.006  1.00 46.91 ? 12   UNK U O   1 
ATOM   8929  C  CB  . UNK L  12 12  ? 14.813  14.560  77.068  1.00 46.91 ? 12   UNK U CB  1 
ATOM   8930  N  N   . UNK L  12 13  ? 13.142  17.668  77.459  1.00 46.91 ? 13   UNK U N   1 
ATOM   8931  C  CA  . UNK L  12 13  ? 13.317  19.109  77.320  1.00 46.91 ? 13   UNK U CA  1 
ATOM   8932  C  C   . UNK L  12 13  ? 12.062  19.887  77.712  1.00 46.91 ? 13   UNK U C   1 
ATOM   8933  O  O   . UNK L  12 13  ? 12.063  21.122  77.707  1.00 46.91 ? 13   UNK U O   1 
ATOM   8934  C  CB  . UNK L  12 13  ? 13.722  19.451  75.890  1.00 46.91 ? 13   UNK U CB  1 
ATOM   8935  N  N   . UNK L  12 14  ? 10.995  19.165  78.042  1.00 46.91 ? 14   UNK U N   1 
ATOM   8936  C  CA  . UNK L  12 14  ? 9.735   19.787  78.435  1.00 46.91 ? 14   UNK U CA  1 
ATOM   8937  C  C   . UNK L  12 14  ? 9.339   19.375  79.851  1.00 46.91 ? 14   UNK U C   1 
ATOM   8938  O  O   . UNK L  12 14  ? 9.617   20.096  80.812  1.00 46.91 ? 14   UNK U O   1 
ATOM   8939  C  CB  . UNK L  12 14  ? 8.636   19.421  77.443  1.00 46.91 ? 14   UNK U CB  1 
ATOM   8940  N  N   . UNK L  12 15  ? 8.689   18.218  79.967  1.00 46.91 ? 15   UNK U N   1 
ATOM   8941  C  CA  . UNK L  12 15  ? 8.241   17.676  81.249  1.00 46.91 ? 15   UNK U CA  1 
ATOM   8942  C  C   . UNK L  12 15  ? 7.207   18.550  81.961  1.00 46.91 ? 15   UNK U C   1 
ATOM   8943  O  O   . UNK L  12 15  ? 6.832   19.620  81.474  1.00 46.91 ? 15   UNK U O   1 
ATOM   8944  C  CB  . UNK L  12 15  ? 9.439   17.413  82.163  1.00 46.91 ? 15   UNK U CB  1 
ATOM   8945  N  N   . UNK L  12 16  ? 6.721   18.057  83.097  1.00 46.91 ? 16   UNK U N   1 
ATOM   8946  C  CA  . UNK L  12 16  ? 5.727   18.763  83.902  1.00 46.91 ? 16   UNK U CA  1 
ATOM   8947  C  C   . UNK L  12 16  ? 5.551   18.051  85.244  1.00 46.91 ? 16   UNK U C   1 
ATOM   8948  O  O   . UNK L  12 16  ? 6.517   17.538  85.811  1.00 46.91 ? 16   UNK U O   1 
ATOM   8949  C  CB  . UNK L  12 16  ? 4.393   18.835  83.154  1.00 46.91 ? 16   UNK U CB  1 
ATOM   8950  N  N   . UNK L  12 17  ? 4.311   18.010  85.732  1.00 46.91 ? 17   UNK U N   1 
ATOM   8951  C  CA  . UNK L  12 17  ? 3.964   17.365  87.001  1.00 46.91 ? 17   UNK U CA  1 
ATOM   8952  C  C   . UNK L  12 17  ? 4.449   18.110  88.244  1.00 46.91 ? 17   UNK U C   1 
ATOM   8953  O  O   . UNK L  12 17  ? 3.806   18.048  89.292  1.00 46.91 ? 17   UNK U O   1 
ATOM   8954  C  CB  . UNK L  12 17  ? 4.450   15.913  87.023  1.00 46.91 ? 17   UNK U CB  1 
ATOM   8955  N  N   . UNK L  12 18  ? 5.572   18.814  88.123  1.00 46.91 ? 18   UNK U N   1 
ATOM   8956  C  CA  . UNK L  12 18  ? 6.137   19.569  89.239  1.00 46.91 ? 18   UNK U CA  1 
ATOM   8957  C  C   . UNK L  12 18  ? 5.230   20.728  89.650  1.00 46.91 ? 18   UNK U C   1 
ATOM   8958  O  O   . UNK L  12 18  ? 5.108   21.036  90.836  1.00 46.91 ? 18   UNK U O   1 
ATOM   8959  C  CB  . UNK L  12 18  ? 7.523   20.087  88.875  1.00 46.91 ? 18   UNK U CB  1 
ATOM   8960  N  N   . UNK L  12 19  ? 4.582   21.340  88.660  1.00 46.91 ? 19   UNK U N   1 
ATOM   8961  C  CA  . UNK L  12 19  ? 3.674   22.471  88.866  1.00 46.91 ? 19   UNK U CA  1 
ATOM   8962  C  C   . UNK L  12 19  ? 4.401   23.756  89.253  1.00 46.91 ? 19   UNK U C   1 
ATOM   8963  O  O   . UNK L  12 19  ? 4.394   24.733  88.499  1.00 46.91 ? 19   UNK U O   1 
ATOM   8964  C  CB  . UNK L  12 19  ? 2.604   22.127  89.907  1.00 46.91 ? 19   UNK U CB  1 
ATOM   8965  N  N   . UNK L  12 20  ? 4.991   23.761  90.443  1.00 46.91 ? 20   UNK U N   1 
ATOM   8966  C  CA  . UNK L  12 20  ? 5.725   24.915  90.939  1.00 46.91 ? 20   UNK U CA  1 
ATOM   8967  C  C   . UNK L  12 20  ? 7.232   24.652  90.908  1.00 46.91 ? 20   UNK U C   1 
ATOM   8968  O  O   . UNK L  12 20  ? 7.827   24.541  89.834  1.00 46.91 ? 20   UNK U O   1 
ATOM   8969  C  CB  . UNK L  12 20  ? 5.263   25.262  92.353  1.00 46.91 ? 20   UNK U CB  1 
ATOM   8970  N  N   . UNK L  12 21  ? 7.840   24.573  92.089  1.00 46.91 ? 21   UNK U N   1 
ATOM   8971  C  CA  . UNK L  12 21  ? 9.273   24.330  92.218  1.00 46.91 ? 21   UNK U CA  1 
ATOM   8972  C  C   . UNK L  12 21  ? 9.626   22.846  92.147  1.00 46.91 ? 21   UNK U C   1 
ATOM   8973  O  O   . UNK L  12 21  ? 8.755   21.982  92.270  1.00 46.91 ? 21   UNK U O   1 
ATOM   8974  C  CB  . UNK L  12 21  ? 9.785   24.930  93.520  1.00 46.91 ? 21   UNK U CB  1 
ATOM   8975  N  N   . UNK L  12 22  ? 10.913  22.563  91.965  1.00 46.91 ? 22   UNK U N   1 
ATOM   8976  C  CA  . UNK L  12 22  ? 11.407  21.192  91.876  1.00 46.91 ? 22   UNK U CA  1 
ATOM   8977  C  C   . UNK L  12 22  ? 12.843  21.093  92.392  1.00 46.91 ? 22   UNK U C   1 
ATOM   8978  O  O   . UNK L  12 22  ? 13.407  22.075  92.880  1.00 46.91 ? 22   UNK U O   1 
ATOM   8979  C  CB  . UNK L  12 22  ? 11.329  20.699  90.434  1.00 46.91 ? 22   UNK U CB  1 
ATOM   8980  N  N   . UNK L  12 23  ? 13.425  19.902  92.288  1.00 46.91 ? 23   UNK U N   1 
ATOM   8981  C  CA  . UNK L  12 23  ? 14.795  19.669  92.739  1.00 46.91 ? 23   UNK U CA  1 
ATOM   8982  C  C   . UNK L  12 23  ? 15.815  20.295  91.790  1.00 46.91 ? 23   UNK U C   1 
ATOM   8983  O  O   . UNK L  12 23  ? 16.948  20.578  92.185  1.00 46.91 ? 23   UNK U O   1 
ATOM   8984  C  CB  . UNK L  12 23  ? 15.055  18.175  92.881  1.00 46.91 ? 23   UNK U CB  1 
ATOM   8985  N  N   . UNK L  12 24  ? 15.417  20.489  90.536  1.00 46.91 ? 24   UNK U N   1 
ATOM   8986  C  CA  . UNK L  12 24  ? 16.297  21.079  89.533  1.00 46.91 ? 24   UNK U CA  1 
ATOM   8987  C  C   . UNK L  12 24  ? 15.574  22.148  88.718  1.00 46.91 ? 24   UNK U C   1 
ATOM   8988  O  O   . UNK L  12 24  ? 14.983  21.857  87.676  1.00 46.91 ? 24   UNK U O   1 
ATOM   8989  C  CB  . UNK L  12 24  ? 16.850  19.992  88.615  1.00 46.91 ? 24   UNK U CB  1 
ATOM   8990  N  N   . UNK L  12 25  ? 15.632  23.386  89.198  1.00 46.91 ? 25   UNK U N   1 
ATOM   8991  C  CA  . UNK L  12 25  ? 14.984  24.507  88.523  1.00 46.91 ? 25   UNK U CA  1 
ATOM   8992  C  C   . UNK L  12 25  ? 15.826  25.780  88.609  1.00 46.91 ? 25   UNK U C   1 
ATOM   8993  O  O   . UNK L  12 25  ? 15.329  26.878  88.349  1.00 46.91 ? 25   UNK U O   1 
ATOM   8994  C  CB  . UNK L  12 25  ? 13.600  24.748  89.117  1.00 46.91 ? 25   UNK U CB  1 
ATOM   8995  N  N   . UNK L  12 26  ? 17.109  25.614  88.929  1.00 46.91 ? 26   UNK U N   1 
ATOM   8996  C  CA  . UNK L  12 26  ? 18.055  26.724  89.061  1.00 46.91 ? 26   UNK U CA  1 
ATOM   8997  C  C   . UNK L  12 26  ? 17.743  27.621  90.260  1.00 46.91 ? 26   UNK U C   1 
ATOM   8998  O  O   . UNK L  12 26  ? 16.780  27.387  90.992  1.00 46.91 ? 26   UNK U O   1 
ATOM   8999  C  CB  . UNK L  12 26  ? 18.105  27.548  87.770  1.00 46.91 ? 26   UNK U CB  1 
ATOM   9000  N  N   . UNK L  12 27  ? 18.590  28.624  90.476  1.00 46.91 ? 27   UNK U N   1 
ATOM   9001  C  CA  . UNK L  12 27  ? 18.414  29.558  91.586  1.00 46.91 ? 27   UNK U CA  1 
ATOM   9002  C  C   . UNK L  12 27  ? 17.445  30.690  91.243  1.00 46.91 ? 27   UNK U C   1 
ATOM   9003  O  O   . UNK L  12 27  ? 17.376  31.695  91.952  1.00 46.91 ? 27   UNK U O   1 
ATOM   9004  C  CB  . UNK L  12 27  ? 19.763  30.126  92.011  1.00 46.91 ? 27   UNK U CB  1 
ATOM   9005  N  N   . UNK L  12 28  ? 16.734  30.539  90.130  1.00 46.91 ? 28   UNK U N   1 
ATOM   9006  C  CA  . UNK L  12 28  ? 15.768  31.539  89.688  1.00 46.91 ? 28   UNK U CA  1 
ATOM   9007  C  C   . UNK L  12 28  ? 14.374  31.243  90.237  1.00 46.91 ? 28   UNK U C   1 
ATOM   9008  O  O   . UNK L  12 28  ? 13.476  32.084  90.161  1.00 46.91 ? 28   UNK U O   1 
ATOM   9009  C  CB  . UNK L  12 28  ? 15.735  31.598  88.167  1.00 46.91 ? 28   UNK U CB  1 
ATOM   9010  N  N   . UNK L  12 29  ? 14.194  30.034  90.759  1.00 46.91 ? 29   UNK U N   1 
ATOM   9011  C  CA  . UNK L  12 29  ? 12.916  29.607  91.317  1.00 46.91 ? 29   UNK U CA  1 
ATOM   9012  C  C   . UNK L  12 29  ? 12.686  30.152  92.725  1.00 46.91 ? 29   UNK U C   1 
ATOM   9013  O  O   . UNK L  12 29  ? 11.544  30.386  93.127  1.00 46.91 ? 29   UNK U O   1 
ATOM   9014  C  CB  . UNK L  12 29  ? 12.832  28.086  91.324  1.00 46.91 ? 29   UNK U CB  1 
ATOM   9015  N  N   . UNK L  12 30  ? 13.771  30.325  93.474  1.00 46.91 ? 30   UNK U N   1 
ATOM   9016  C  CA  . UNK L  12 30  ? 13.699  30.834  94.840  1.00 46.91 ? 30   UNK U CA  1 
ATOM   9017  C  C   . UNK L  12 30  ? 13.377  32.325  94.895  1.00 46.91 ? 30   UNK U C   1 
ATOM   9018  O  O   . UNK L  12 30  ? 12.659  32.779  95.786  1.00 46.91 ? 30   UNK U O   1 
ATOM   9019  C  CB  . UNK L  12 30  ? 15.003  30.552  95.574  1.00 46.91 ? 30   UNK U CB  1 
ATOM   9020  N  N   . UNK L  12 31  ? 13.925  33.085  93.950  1.00 46.91 ? 31   UNK U N   1 
ATOM   9021  C  CA  . UNK L  12 31  ? 13.700  34.526  93.898  1.00 46.91 ? 31   UNK U CA  1 
ATOM   9022  C  C   . UNK L  12 31  ? 12.318  34.896  93.355  1.00 46.91 ? 31   UNK U C   1 
ATOM   9023  O  O   . UNK L  12 31  ? 12.012  36.079  93.172  1.00 46.91 ? 31   UNK U O   1 
ATOM   9024  C  CB  . UNK L  12 31  ? 14.791  35.194  93.070  1.00 46.91 ? 31   UNK U CB  1 
ATOM   9025  N  N   . UNK L  12 32  ? 11.497  33.889  93.079  1.00 46.91 ? 32   UNK U N   1 
ATOM   9026  C  CA  . UNK L  12 32  ? 10.154  34.108  92.554  1.00 46.91 ? 32   UNK U CA  1 
ATOM   9027  C  C   . UNK L  12 32  ? 9.071   33.842  93.599  1.00 46.91 ? 32   UNK U C   1 
ATOM   9028  O  O   . UNK L  12 32  ? 8.024   34.499  93.602  1.00 46.91 ? 32   UNK U O   1 
ATOM   9029  C  CB  . UNK L  12 32  ? 9.925   33.238  91.325  1.00 46.91 ? 32   UNK U CB  1 
ATOM   9030  N  N   . UNK L  12 33  ? 9.311   32.858  94.460  1.00 46.91 ? 33   UNK U N   1 
ATOM   9031  C  CA  . UNK L  12 33  ? 8.365   32.490  95.509  1.00 46.91 ? 33   UNK U CA  1 
ATOM   9032  C  C   . UNK L  12 33  ? 8.900   32.834  96.899  1.00 46.91 ? 33   UNK U C   1 
ATOM   9033  O  O   . UNK L  12 33  ? 9.968   33.427  97.032  1.00 46.91 ? 33   UNK U O   1 
ATOM   9034  C  CB  . UNK L  12 33  ? 8.043   31.002  95.421  1.00 46.91 ? 33   UNK U CB  1 
ATOM   9035  N  N   . UNK L  12 34  ? 8.131   32.473  97.926  1.00 46.91 ? 34   UNK U N   1 
ATOM   9036  C  CA  . UNK L  12 34  ? 8.500   32.713  99.323  1.00 46.91 ? 34   UNK U CA  1 
ATOM   9037  C  C   . UNK L  12 34  ? 9.024   34.124  99.608  1.00 46.91 ? 34   UNK U C   1 
ATOM   9038  O  O   . UNK L  12 34  ? 8.356   35.115  99.295  1.00 46.91 ? 34   UNK U O   1 
ATOM   9039  C  CB  . UNK L  12 34  ? 9.509   31.658  99.786  1.00 46.91 ? 34   UNK U CB  1 
ATOM   9040  N  N   . UNK L  12 35  ? 10.190  34.203  100.249 1.00 46.91 ? 35   UNK U N   1 
ATOM   9041  C  CA  . UNK L  12 35  ? 10.822  35.475  100.591 1.00 46.91 ? 35   UNK U CA  1 
ATOM   9042  C  C   . UNK L  12 35  ? 12.236  35.276  101.136 1.00 46.91 ? 35   UNK U C   1 
ATOM   9043  O  O   . UNK L  12 35  ? 13.074  36.178  101.054 1.00 46.91 ? 35   UNK U O   1 
ATOM   9044  C  CB  . UNK L  12 35  ? 9.970   36.231  101.611 1.00 46.91 ? 35   UNK U CB  1 
ATOM   9045  N  N   . UNK L  12 36  ? 12.483  34.111  101.732 1.00 46.91 ? 36   UNK U N   1 
ATOM   9046  C  CA  . UNK L  12 36  ? 13.792  33.794  102.299 1.00 46.91 ? 36   UNK U CA  1 
ATOM   9047  C  C   . UNK L  12 36  ? 14.621  32.885  101.390 1.00 46.91 ? 36   UNK U C   1 
ATOM   9048  O  O   . UNK L  12 36  ? 14.167  32.485  100.319 1.00 46.91 ? 36   UNK U O   1 
ATOM   9049  C  CB  . UNK L  12 36  ? 13.623  33.152  103.673 1.00 46.91 ? 36   UNK U CB  1 
ATOM   9050  N  N   . UNK L  12 37  ? 15.833  32.562  101.841 1.00 46.91 ? 37   UNK U N   1 
ATOM   9051  C  CA  . UNK L  12 37  ? 16.759  31.699  101.105 1.00 46.91 ? 37   UNK U CA  1 
ATOM   9052  C  C   . UNK L  12 37  ? 17.085  32.217  99.705  1.00 46.91 ? 37   UNK U C   1 
ATOM   9053  O  O   . UNK L  12 37  ? 16.727  31.601  98.701  1.00 46.91 ? 37   UNK U O   1 
ATOM   9054  C  CB  . UNK L  12 37  ? 16.216  30.270  101.037 1.00 46.91 ? 37   UNK U CB  1 
ATOM   9055  N  N   . UNK L  12 38  ? 17.790  33.344  99.649  1.00 46.91 ? 38   UNK U N   1 
ATOM   9056  C  CA  . UNK L  12 38  ? 18.165  33.939  98.371  1.00 46.91 ? 38   UNK U CA  1 
ATOM   9057  C  C   . UNK L  12 38  ? 19.680  34.028  98.177  1.00 46.91 ? 38   UNK U C   1 
ATOM   9058  O  O   . UNK L  12 38  ? 20.150  34.475  97.128  1.00 46.91 ? 38   UNK U O   1 
ATOM   9059  C  CB  . UNK L  12 38  ? 17.531  35.327  98.210  1.00 46.91 ? 38   UNK U CB  1 
ATOM   9060  N  N   . UNK L  12 39  ? 20.440  33.611  99.188  1.00 46.91 ? 39   UNK U N   1 
ATOM   9061  C  CA  . UNK L  12 39  ? 21.898  33.650  99.111  1.00 46.91 ? 39   UNK U CA  1 
ATOM   9062  C  C   . UNK L  12 39  ? 22.581  32.806  100.184 1.00 46.91 ? 39   UNK U C   1 
ATOM   9063  O  O   . UNK L  12 39  ? 23.567  32.118  99.906  1.00 46.91 ? 39   UNK U O   1 
ATOM   9064  C  CB  . UNK L  12 39  ? 22.392  35.093  99.189  1.00 46.91 ? 39   UNK U CB  1 
ATOM   9065  N  N   . UNK L  12 40  ? 22.081  32.890  101.414 1.00 46.91 ? 40   UNK U N   1 
ATOM   9066  C  CA  . UNK L  12 40  ? 22.649  32.147  102.535 1.00 46.91 ? 40   UNK U CA  1 
ATOM   9067  C  C   . UNK L  12 40  ? 22.218  30.683  102.581 1.00 46.91 ? 40   UNK U C   1 
ATOM   9068  O  O   . UNK L  12 40  ? 23.058  29.781  102.569 1.00 46.91 ? 40   UNK U O   1 
ATOM   9069  C  CB  . UNK L  12 40  ? 22.305  32.840  103.847 1.00 46.91 ? 40   UNK U CB  1 
ATOM   9070  N  N   . UNK L  12 41  ? 20.912  30.458  102.695 1.00 46.91 ? 41   UNK U N   1 
ATOM   9071  C  CA  . UNK L  12 41  ? 20.363  29.106  102.756 1.00 46.91 ? 41   UNK U CA  1 
ATOM   9072  C  C   . UNK L  12 41  ? 20.070  28.530  101.373 1.00 46.91 ? 41   UNK U C   1 
ATOM   9073  O  O   . UNK L  12 41  ? 19.706  27.361  101.247 1.00 46.91 ? 41   UNK U O   1 
ATOM   9074  C  CB  . UNK L  12 41  ? 19.102  29.094  103.612 1.00 46.91 ? 41   UNK U CB  1 
ATOM   9075  N  N   . UNK L  12 42  ? 20.201  29.364  100.345 1.00 46.91 ? 42   UNK U N   1 
ATOM   9076  C  CA  . UNK L  12 42  ? 19.950  28.938  98.972  1.00 46.91 ? 42   UNK U CA  1 
ATOM   9077  C  C   . UNK L  12 42  ? 21.076  28.056  98.439  1.00 46.91 ? 42   UNK U C   1 
ATOM   9078  O  O   . UNK L  12 42  ? 20.833  27.113  97.686  1.00 46.91 ? 42   UNK U O   1 
ATOM   9079  C  CB  . UNK L  12 42  ? 19.763  30.152  98.074  1.00 46.91 ? 42   UNK U CB  1 
ATOM   9080  N  N   . UNK L  12 43  ? 22.310  28.389  98.811  1.00 46.91 ? 43   UNK U N   1 
ATOM   9081  C  CA  . UNK L  12 43  ? 23.479  27.631  98.374  1.00 46.91 ? 43   UNK U CA  1 
ATOM   9082  C  C   . UNK L  12 43  ? 23.740  26.410  99.254  1.00 46.91 ? 43   UNK U C   1 
ATOM   9083  O  O   . UNK L  12 43  ? 24.677  25.647  99.007  1.00 46.91 ? 43   UNK U O   1 
ATOM   9084  C  CB  . UNK L  12 43  ? 24.705  28.535  98.350  1.00 46.91 ? 43   UNK U CB  1 
ATOM   9085  N  N   . UNK L  12 44  ? 22.934  26.253  100.300 1.00 46.91 ? 44   UNK U N   1 
ATOM   9086  C  CA  . UNK L  12 44  ? 23.070  25.132  101.221 1.00 46.91 ? 44   UNK U CA  1 
ATOM   9087  C  C   . UNK L  12 44  ? 22.213  23.945  100.794 1.00 46.91 ? 44   UNK U C   1 
ATOM   9088  O  O   . UNK L  12 44  ? 22.705  22.820  100.689 1.00 46.91 ? 44   UNK U O   1 
ATOM   9089  C  CB  . UNK L  12 44  ? 22.699  25.567  102.634 1.00 46.91 ? 44   UNK U CB  1 
ATOM   9090  N  N   . UNK L  12 45  ? 20.928  24.202  100.569 1.00 46.91 ? 45   UNK U N   1 
ATOM   9091  C  CA  . UNK L  12 45  ? 19.982  23.167  100.161 1.00 46.91 ? 45   UNK U CA  1 
ATOM   9092  C  C   . UNK L  12 45  ? 20.187  22.704  98.719  1.00 46.91 ? 45   UNK U C   1 
ATOM   9093  O  O   . UNK L  12 45  ? 19.636  21.682  98.306  1.00 46.91 ? 45   UNK U O   1 
ATOM   9094  C  CB  . UNK L  12 45  ? 18.554  23.661  100.358 1.00 46.91 ? 45   UNK U CB  1 
ATOM   9095  N  N   . UNK L  12 46  ? 20.947  23.478  97.950  1.00 46.91 ? 46   UNK U N   1 
ATOM   9096  C  CA  . UNK L  12 46  ? 21.219  23.147  96.555  1.00 46.91 ? 46   UNK U CA  1 
ATOM   9097  C  C   . UNK L  12 46  ? 22.390  22.173  96.423  1.00 46.91 ? 46   UNK U C   1 
ATOM   9098  O  O   . UNK L  12 46  ? 22.513  21.469  95.419  1.00 46.91 ? 46   UNK U O   1 
ATOM   9099  C  CB  . UNK L  12 46  ? 21.496  24.415  95.760  1.00 46.91 ? 46   UNK U CB  1 
ATOM   9100  N  N   . UNK L  12 47  ? 23.264  22.166  97.424  1.00 46.91 ? 47   UNK U N   1 
ATOM   9101  C  CA  . UNK L  12 47  ? 24.431  21.290  97.426  1.00 46.91 ? 47   UNK U CA  1 
ATOM   9102  C  C   . UNK L  12 47  ? 24.194  19.991  98.194  1.00 46.91 ? 47   UNK U C   1 
ATOM   9103  O  O   . UNK L  12 47  ? 24.991  19.054  98.098  1.00 46.91 ? 47   UNK U O   1 
ATOM   9104  C  CB  . UNK L  12 47  ? 25.634  22.028  98.000  1.00 46.91 ? 47   UNK U CB  1 
ATOM   9105  N  N   . UNK L  12 48  ? 23.115  19.945  98.968  1.00 46.91 ? 48   UNK U N   1 
ATOM   9106  C  CA  . UNK L  12 48  ? 22.783  18.768  99.761  1.00 46.91 ? 48   UNK U CA  1 
ATOM   9107  C  C   . UNK L  12 48  ? 21.813  17.820  99.056  1.00 46.91 ? 48   UNK U C   1 
ATOM   9108  O  O   . UNK L  12 48  ? 21.922  16.600  99.194  1.00 46.91 ? 48   UNK U O   1 
ATOM   9109  C  CB  . UNK L  12 48  ? 22.218  19.190  101.112 1.00 46.91 ? 48   UNK U CB  1 
ATOM   9110  N  N   . UNK L  12 49  ? 20.862  18.386  98.318  1.00 46.91 ? 49   UNK U N   1 
ATOM   9111  C  CA  . UNK L  12 49  ? 19.858  17.605  97.599  1.00 46.91 ? 49   UNK U CA  1 
ATOM   9112  C  C   . UNK L  12 49  ? 20.466  16.664  96.561  1.00 46.91 ? 49   UNK U C   1 
ATOM   9113  O  O   . UNK L  12 49  ? 21.130  17.104  95.619  1.00 46.91 ? 49   UNK U O   1 
ATOM   9114  C  CB  . UNK L  12 49  ? 18.848  18.534  96.939  1.00 46.91 ? 49   UNK U CB  1 
ATOM   9115  N  N   . UNK L  12 50  ? 20.210  15.369  96.727  1.00 46.91 ? 50   UNK U N   1 
ATOM   9116  C  CA  . UNK L  12 50  ? 20.722  14.351  95.814  1.00 46.91 ? 50   UNK U CA  1 
ATOM   9117  C  C   . UNK L  12 50  ? 20.096  12.988  96.088  1.00 46.91 ? 50   UNK U C   1 
ATOM   9118  O  O   . UNK L  12 50  ? 19.859  12.207  95.164  1.00 46.91 ? 50   UNK U O   1 
ATOM   9119  C  CB  . UNK L  12 50  ? 22.243  14.259  95.919  1.00 46.91 ? 50   UNK U CB  1 
ATOM   9120  N  N   . UNK L  12 51  ? 19.858  12.701  97.364  1.00 46.91 ? 51   UNK U N   1 
ATOM   9121  C  CA  . UNK L  12 51  ? 19.265  11.434  97.775  1.00 46.91 ? 51   UNK U CA  1 
ATOM   9122  C  C   . UNK L  12 51  ? 17.751  11.401  97.570  1.00 46.91 ? 51   UNK U C   1 
ATOM   9123  O  O   . UNK L  12 51  ? 17.195  10.365  97.202  1.00 46.91 ? 51   UNK U O   1 
ATOM   9124  C  CB  . UNK L  12 51  ? 19.604  11.145  99.229  1.00 46.91 ? 51   UNK U CB  1 
ATOM   9125  N  N   . UNK L  12 52  ? 17.103  12.539  97.814  1.00 46.91 ? 52   UNK U N   1 
ATOM   9126  C  CA  . UNK L  12 52  ? 15.653  12.687  97.678  1.00 46.91 ? 52   UNK U CA  1 
ATOM   9127  C  C   . UNK L  12 52  ? 14.876  11.924  98.750  1.00 46.91 ? 52   UNK U C   1 
ATOM   9128  O  O   . UNK L  12 52  ? 15.110  10.736  98.984  1.00 46.91 ? 52   UNK U O   1 
ATOM   9129  C  CB  . UNK L  12 52  ? 15.193  12.265  96.281  1.00 46.91 ? 52   UNK U CB  1 
ATOM   9130  N  N   . UNK L  12 53  ? 13.953  12.620  99.404  1.00 46.91 ? 53   UNK U N   1 
ATOM   9131  C  CA  . UNK L  12 53  ? 13.136  12.018  100.452 1.00 46.91 ? 53   UNK U CA  1 
ATOM   9132  C  C   . UNK L  12 53  ? 11.772  12.702  100.548 1.00 46.91 ? 53   UNK U C   1 
ATOM   9133  O  O   . UNK L  12 53  ? 11.190  13.084  99.531  1.00 46.91 ? 53   UNK U O   1 
ATOM   9134  C  CB  . UNK L  12 53  ? 13.867  12.080  101.792 1.00 46.91 ? 53   UNK U CB  1 
ATOM   9135  N  N   . UNK L  12 54  ? 11.255  12.826  101.767 1.00 46.91 ? 54   UNK U N   1 
ATOM   9136  C  CA  . UNK L  12 54  ? 9.961   13.459  101.996 1.00 46.91 ? 54   UNK U CA  1 
ATOM   9137  C  C   . UNK L  12 54  ? 10.059  14.983  102.060 1.00 46.91 ? 54   UNK U C   1 
ATOM   9138  O  O   . UNK L  12 54  ? 9.170   15.643  102.604 1.00 46.91 ? 54   UNK U O   1 
ATOM   9139  C  CB  . UNK L  12 54  ? 9.333   12.914  103.272 1.00 46.91 ? 54   UNK U CB  1 
ATOM   9140  N  N   . UNK L  12 55  ? 11.137  15.527  101.495 1.00 46.91 ? 55   UNK U N   1 
ATOM   9141  C  CA  . UNK L  12 55  ? 11.395  16.969  101.455 1.00 46.91 ? 55   UNK U CA  1 
ATOM   9142  C  C   . UNK L  12 55  ? 11.789  17.571  102.804 1.00 46.91 ? 55   UNK U C   1 
ATOM   9143  O  O   . UNK L  12 55  ? 12.620  18.477  102.861 1.00 46.91 ? 55   UNK U O   1 
ATOM   9144  C  CB  . UNK L  12 55  ? 10.196  17.719  100.865 1.00 46.91 ? 55   UNK U CB  1 
ATOM   9145  N  N   . UNK L  12 56  ? 11.189  17.072  103.880 1.00 46.91 ? 56   UNK U N   1 
ATOM   9146  C  CA  . UNK L  12 56  ? 11.477  17.567  105.223 1.00 46.91 ? 56   UNK U CA  1 
ATOM   9147  C  C   . UNK L  12 56  ? 12.756  16.966  105.808 1.00 46.91 ? 56   UNK U C   1 
ATOM   9148  O  O   . UNK L  12 56  ? 13.147  17.295  106.930 1.00 46.91 ? 56   UNK U O   1 
ATOM   9149  C  CB  . UNK L  12 56  ? 10.295  17.293  106.144 1.00 46.91 ? 56   UNK U CB  1 
ATOM   9150  N  N   . UNK L  12 57  ? 13.378  16.057  105.062 1.00 46.91 ? 57   UNK U N   1 
ATOM   9151  C  CA  . UNK L  12 57  ? 14.610  15.409  105.503 1.00 46.91 ? 57   UNK U CA  1 
ATOM   9152  C  C   . UNK L  12 57  ? 15.852  16.116  104.960 1.00 46.91 ? 57   UNK U C   1 
ATOM   9153  O  O   . UNK L  12 57  ? 16.969  15.843  105.401 1.00 46.91 ? 57   UNK U O   1 
ATOM   9154  C  CB  . UNK L  12 57  ? 14.609  13.947  105.082 1.00 46.91 ? 57   UNK U CB  1 
ATOM   9155  N  N   . UNK L  12 58  ? 15.649  16.991  103.979 1.00 46.91 ? 58   UNK U N   1 
ATOM   9156  C  CA  . UNK L  12 58  ? 16.741  17.741  103.366 1.00 46.91 ? 58   UNK U CA  1 
ATOM   9157  C  C   . UNK L  12 58  ? 17.228  18.864  104.279 1.00 46.91 ? 58   UNK U C   1 
ATOM   9158  O  O   . UNK L  12 58  ? 18.421  19.166  104.321 1.00 46.91 ? 58   UNK U O   1 
ATOM   9159  C  CB  . UNK L  12 58  ? 16.295  18.308  102.023 1.00 46.91 ? 58   UNK U CB  1 
ATOM   9160  N  N   . UNK L  12 59  ? 16.291  19.499  104.979 1.00 46.91 ? 59   UNK U N   1 
ATOM   9161  C  CA  . UNK L  12 59  ? 16.615  20.589  105.892 1.00 46.91 ? 59   UNK U CA  1 
ATOM   9162  C  C   . UNK L  12 59  ? 17.236  20.067  107.186 1.00 46.91 ? 59   UNK U C   1 
ATOM   9163  O  O   . UNK L  12 59  ? 17.853  20.825  107.936 1.00 46.91 ? 59   UNK U O   1 
ATOM   9164  C  CB  . UNK L  12 59  ? 15.365  21.404  106.198 1.00 46.91 ? 59   UNK U CB  1 
ATOM   9165  N  N   . UNK L  12 60  ? 17.041  18.781  107.461 1.00 46.91 ? 60   UNK U N   1 
ATOM   9166  C  CA  . UNK L  12 60  ? 17.587  18.162  108.664 1.00 46.91 ? 60   UNK U CA  1 
ATOM   9167  C  C   . UNK L  12 60  ? 19.068  17.820  108.505 1.00 46.91 ? 60   UNK U C   1 
ATOM   9168  O  O   . UNK L  12 60  ? 19.719  17.394  109.462 1.00 46.91 ? 60   UNK U O   1 
ATOM   9169  C  CB  . UNK L  12 60  ? 16.788  16.914  109.020 1.00 46.91 ? 60   UNK U CB  1 
ATOM   9170  N  N   . UNK L  12 61  ? 19.588  17.985  107.291 1.00 46.91 ? 61   UNK U N   1 
ATOM   9171  C  CA  . UNK L  12 61  ? 20.990  17.699  107.002 1.00 46.91 ? 61   UNK U CA  1 
ATOM   9172  C  C   . UNK L  12 61  ? 21.836  18.971  106.926 1.00 46.91 ? 61   UNK U C   1 
ATOM   9173  O  O   . UNK L  12 61  ? 23.069  18.904  106.904 1.00 46.91 ? 61   UNK U O   1 
ATOM   9174  C  CB  . UNK L  12 61  ? 21.108  16.907  105.707 1.00 46.91 ? 61   UNK U CB  1 
ATOM   9175  N  N   . UNK L  12 62  ? 21.172  20.120  106.869 1.00 46.91 ? 62   UNK U N   1 
ATOM   9176  C  CA  . UNK L  12 62  ? 21.855  21.409  106.797 1.00 46.91 ? 62   UNK U CA  1 
ATOM   9177  C  C   . UNK L  12 62  ? 22.393  21.828  108.167 1.00 46.91 ? 62   UNK U C   1 
ATOM   9178  O  O   . UNK L  12 62  ? 22.422  21.030  109.107 1.00 46.91 ? 62   UNK U O   1 
ATOM   9179  C  CB  . UNK L  12 62  ? 20.909  22.473  106.247 1.00 46.91 ? 62   UNK U CB  1 
ATOM   9180  N  N   . UNK L  12 63  ? 22.841  23.076  108.269 1.00 46.91 ? 63   UNK U N   1 
ATOM   9181  C  CA  . UNK L  12 63  ? 23.372  23.601  109.524 1.00 46.91 ? 63   UNK U CA  1 
ATOM   9182  C  C   . UNK L  12 63  ? 22.860  25.017  109.784 1.00 46.91 ? 63   UNK U C   1 
ATOM   9183  O  O   . UNK L  12 63  ? 23.615  25.901  110.203 1.00 46.91 ? 63   UNK U O   1 
ATOM   9184  C  CB  . UNK L  12 63  ? 24.898  23.573  109.504 1.00 46.91 ? 63   UNK U CB  1 
ATOM   9185  N  N   . UNK L  12 64  ? 21.574  25.221  109.515 1.00 46.91 ? 64   UNK U N   1 
ATOM   9186  C  CA  . UNK L  12 64  ? 20.921  26.513  109.707 1.00 46.91 ? 64   UNK U CA  1 
ATOM   9187  C  C   . UNK L  12 64  ? 20.531  26.742  111.168 1.00 46.91 ? 64   UNK U C   1 
ATOM   9188  O  O   . UNK L  12 64  ? 20.865  25.944  112.048 1.00 46.91 ? 64   UNK U O   1 
ATOM   9189  C  CB  . UNK L  12 64  ? 19.688  26.613  108.811 1.00 46.91 ? 64   UNK U CB  1 
ATOM   9190  N  N   . UNK L  12 65  ? 19.825  27.842  111.414 1.00 46.91 ? 65   UNK U N   1 
ATOM   9191  C  CA  . UNK L  12 65  ? 19.369  28.203  112.754 1.00 46.91 ? 65   UNK U CA  1 
ATOM   9192  C  C   . UNK L  12 65  ? 18.150  29.116  112.641 1.00 46.91 ? 65   UNK U C   1 
ATOM   9193  O  O   . UNK L  12 65  ? 18.286  30.333  112.498 1.00 46.91 ? 65   UNK U O   1 
ATOM   9194  C  CB  . UNK L  12 65  ? 20.489  28.902  113.524 1.00 46.91 ? 65   UNK U CB  1 
ATOM   9195  N  N   . UNK L  12 66  ? 16.963  28.515  112.713 1.00 46.91 ? 66   UNK U N   1 
ATOM   9196  C  CA  . UNK L  12 66  ? 15.695  29.238  112.607 1.00 46.91 ? 66   UNK U CA  1 
ATOM   9197  C  C   . UNK L  12 66  ? 15.551  29.936  111.252 1.00 46.91 ? 66   UNK U C   1 
ATOM   9198  O  O   . UNK L  12 66  ? 14.769  30.878  111.106 1.00 46.91 ? 66   UNK U O   1 
ATOM   9199  C  CB  . UNK L  12 66  ? 15.548  30.245  113.753 1.00 46.91 ? 66   UNK U CB  1 
ATOM   9200  N  N   . UNK L  12 67  ? 16.316  29.467  110.271 1.00 46.91 ? 67   UNK U N   1 
ATOM   9201  C  CA  . UNK L  12 67  ? 16.289  30.023  108.924 1.00 46.91 ? 67   UNK U CA  1 
ATOM   9202  C  C   . UNK L  12 67  ? 15.585  29.061  107.973 1.00 46.91 ? 67   UNK U C   1 
ATOM   9203  O  O   . UNK L  12 67  ? 14.688  29.456  107.225 1.00 46.91 ? 67   UNK U O   1 
ATOM   9204  C  CB  . UNK L  12 67  ? 17.706  30.299  108.443 1.00 46.91 ? 67   UNK U CB  1 
ATOM   9205  N  N   . UNK L  12 68  ? 16.028  27.808  107.980 1.00 46.91 ? 68   UNK U N   1 
ATOM   9206  C  CA  . UNK L  12 68  ? 15.438  26.777  107.134 1.00 46.91 ? 68   UNK U CA  1 
ATOM   9207  C  C   . UNK L  12 68  ? 14.313  26.071  107.888 1.00 46.91 ? 68   UNK U C   1 
ATOM   9208  O  O   . UNK L  12 68  ? 13.554  25.293  107.308 1.00 46.91 ? 68   UNK U O   1 
ATOM   9209  C  CB  . UNK L  12 68  ? 16.501  25.772  106.706 1.00 46.91 ? 68   UNK U CB  1 
ATOM   9210  N  N   . UNK L  12 69  ? 14.231  26.334  109.190 1.00 46.91 ? 69   UNK U N   1 
ATOM   9211  C  CA  . UNK L  12 69  ? 13.207  25.740  110.043 1.00 46.91 ? 69   UNK U CA  1 
ATOM   9212  C  C   . UNK L  12 69  ? 11.848  26.397  109.822 1.00 46.91 ? 69   UNK U C   1 
ATOM   9213  O  O   . UNK L  12 69  ? 10.818  25.883  110.268 1.00 46.91 ? 69   UNK U O   1 
ATOM   9214  C  CB  . UNK L  12 69  ? 13.616  25.853  111.506 1.00 46.91 ? 69   UNK U CB  1 
ATOM   9215  N  N   . UNK L  12 70  ? 11.857  27.562  109.181 1.00 46.91 ? 70   UNK U N   1 
ATOM   9216  C  CA  . UNK L  12 70  ? 10.633  28.299  108.893 1.00 46.91 ? 70   UNK U CA  1 
ATOM   9217  C  C   . UNK L  12 70  ? 10.045  27.869  107.552 1.00 46.91 ? 70   UNK U C   1 
ATOM   9218  O  O   . UNK L  12 70  ? 8.825   27.876  107.365 1.00 46.91 ? 70   UNK U O   1 
ATOM   9219  C  CB  . UNK L  12 70  ? 10.910  29.796  108.893 1.00 46.91 ? 70   UNK U CB  1 
ATOM   9220  N  N   . UNK L  12 71  ? 10.924  27.528  106.613 1.00 46.91 ? 71   UNK U N   1 
ATOM   9221  C  CA  . UNK L  12 71  ? 10.514  27.094  105.282 1.00 46.91 ? 71   UNK U CA  1 
ATOM   9222  C  C   . UNK L  12 71  ? 10.379  25.573  105.192 1.00 46.91 ? 71   UNK U C   1 
ATOM   9223  O  O   . UNK L  12 71  ? 10.258  25.017  104.098 1.00 46.91 ? 71   UNK U O   1 
ATOM   9224  C  CB  . UNK L  12 71  ? 11.506  27.600  104.239 1.00 46.91 ? 71   UNK U CB  1 
ATOM   9225  N  N   . UNK L  12 72  ? 10.414  24.908  106.343 1.00 46.91 ? 72   UNK U N   1 
ATOM   9226  C  CA  . UNK L  12 72  ? 10.297  23.454  106.402 1.00 46.91 ? 72   UNK U CA  1 
ATOM   9227  C  C   . UNK L  12 72  ? 8.838   22.999  106.453 1.00 46.91 ? 72   UNK U C   1 
ATOM   9228  O  O   . UNK L  12 72  ? 8.544   21.865  106.844 1.00 46.91 ? 72   UNK U O   1 
ATOM   9229  C  CB  . UNK L  12 72  ? 11.064  22.916  107.605 1.00 46.91 ? 72   UNK U CB  1 
ATOM   9230  N  N   . UNK L  12 73  ? 7.926   23.893  106.080 1.00 46.91 ? 73   UNK U N   1 
ATOM   9231  C  CA  . UNK L  12 73  ? 6.498   23.587  106.079 1.00 46.91 ? 73   UNK U CA  1 
ATOM   9232  C  C   . UNK L  12 73  ? 6.058   22.906  104.783 1.00 46.91 ? 73   UNK U C   1 
ATOM   9233  O  O   . UNK L  12 73  ? 4.901   22.497  104.650 1.00 46.91 ? 73   UNK U O   1 
ATOM   9234  C  CB  . UNK L  12 73  ? 5.691   24.856  106.311 1.00 46.91 ? 73   UNK U CB  1 
ATOM   9235  N  N   . UNK L  12 74  ? 6.989   22.791  103.838 1.00 46.91 ? 74   UNK U N   1 
ATOM   9236  C  CA  . UNK L  12 74  ? 6.745   22.167  102.538 1.00 46.91 ? 74   UNK U CA  1 
ATOM   9237  C  C   . UNK L  12 74  ? 5.726   22.926  101.684 1.00 46.91 ? 74   UNK U C   1 
ATOM   9238  O  O   . UNK L  12 74  ? 5.933   24.097  101.357 1.00 46.91 ? 74   UNK U O   1 
ATOM   9239  C  CB  . UNK L  12 74  ? 6.326   20.702  102.715 1.00 46.91 ? 74   UNK U CB  1 
ATOM   9240  N  N   . UNK L  12 75  ? 4.635   22.247  101.325 1.00 46.91 ? 75   UNK U N   1 
ATOM   9241  C  CA  . UNK L  12 75  ? 3.561   22.810  100.504 1.00 46.91 ? 75   UNK U CA  1 
ATOM   9242  C  C   . UNK L  12 75  ? 3.947   22.980  99.034  1.00 46.91 ? 75   UNK U C   1 
ATOM   9243  O  O   . UNK L  12 75  ? 3.077   23.192  98.183  1.00 46.91 ? 75   UNK U O   1 
ATOM   9244  C  CB  . UNK L  12 75  ? 3.073   24.141  101.089 1.00 46.91 ? 75   UNK U CB  1 
ATOM   9245  N  N   . UNK L  12 76  ? 5.237   22.841  98.740  1.00 46.91 ? 76   UNK U N   1 
ATOM   9246  C  CA  . UNK L  12 76  ? 5.766   22.977  97.383  1.00 46.91 ? 76   UNK U CA  1 
ATOM   9247  C  C   . UNK L  12 76  ? 7.257   22.642  97.353  1.00 46.91 ? 76   UNK U C   1 
ATOM   9248  O  O   . UNK L  12 76  ? 8.106   23.538  97.411  1.00 46.91 ? 76   UNK U O   1 
ATOM   9249  C  CB  . UNK L  12 76  ? 5.535   24.398  96.867  1.00 46.91 ? 76   UNK U CB  1 
ATOM   9250  N  N   . UNK L  12 77  ? 7.569   21.352  97.256  1.00 46.91 ? 77   UNK U N   1 
ATOM   9251  C  CA  . UNK L  12 77  ? 8.957   20.892  97.226  1.00 46.91 ? 77   UNK U CA  1 
ATOM   9252  C  C   . UNK L  12 77  ? 9.113   19.442  96.766  1.00 46.91 ? 77   UNK U C   1 
ATOM   9253  O  O   . UNK L  12 77  ? 8.185   18.636  96.876  1.00 46.91 ? 77   UNK U O   1 
ATOM   9254  C  CB  . UNK L  12 77  ? 9.596   21.073  98.595  1.00 46.91 ? 77   UNK U CB  1 
ATOM   9255  N  N   . UNK L  12 78  ? 10.320  19.115  96.303  1.00 46.91 ? 78   UNK U N   1 
ATOM   9256  C  CA  . UNK L  12 78  ? 10.664  17.780  95.818  1.00 46.91 ? 78   UNK U CA  1 
ATOM   9257  C  C   . UNK L  12 78  ? 9.862   17.389  94.573  1.00 46.91 ? 78   UNK U C   1 
ATOM   9258  O  O   . UNK L  12 78  ? 9.933   18.075  93.553  1.00 46.91 ? 78   UNK U O   1 
ATOM   9259  C  CB  . UNK L  12 78  ? 10.496  16.745  96.936  1.00 46.91 ? 78   UNK U CB  1 
ATOM   9260  N  N   . UNK L  12 79  ? 9.129   16.280  94.652  1.00 46.91 ? 79   UNK U N   1 
ATOM   9261  C  CA  . UNK L  12 79  ? 8.311   15.780  93.544  1.00 46.91 ? 79   UNK U CA  1 
ATOM   9262  C  C   . UNK L  12 79  ? 9.104   15.459  92.275  1.00 46.91 ? 79   UNK U C   1 
ATOM   9263  O  O   . UNK L  12 79  ? 8.523   15.091  91.252  1.00 46.91 ? 79   UNK U O   1 
ATOM   9264  C  CB  . UNK L  12 79  ? 7.174   16.761  93.231  1.00 46.91 ? 79   UNK U CB  1 
ATOM   9265  N  N   . UNK L  12 80  ? 10.426  15.562  92.358  1.00 46.91 ? 80   UNK U N   1 
ATOM   9266  C  CA  . UNK L  12 80  ? 11.292  15.290  91.216  1.00 46.91 ? 80   UNK U CA  1 
ATOM   9267  C  C   . UNK L  12 80  ? 11.817  13.859  91.210  1.00 46.91 ? 80   UNK U C   1 
ATOM   9268  O  O   . UNK L  12 80  ? 12.294  13.352  92.228  1.00 46.91 ? 80   UNK U O   1 
ATOM   9269  C  CB  . UNK L  12 80  ? 12.450  16.282  91.185  1.00 46.91 ? 80   UNK U CB  1 
ATOM   9270  N  N   . UNK L  12 81  ? 11.711  13.208  90.055  1.00 46.91 ? 81   UNK U N   1 
ATOM   9271  C  CA  . UNK L  12 81  ? 12.176  11.836  89.894  1.00 46.91 ? 81   UNK U CA  1 
ATOM   9272  C  C   . UNK L  12 81  ? 13.555  11.808  89.244  1.00 46.91 ? 81   UNK U C   1 
ATOM   9273  O  O   . UNK L  12 81  ? 13.686  12.011  88.036  1.00 46.91 ? 81   UNK U O   1 
ATOM   9274  C  CB  . UNK L  12 81  ? 11.178  11.037  89.064  1.00 46.91 ? 81   UNK U CB  1 
ATOM   9275  N  N   . UNK L  12 82  ? 14.580  11.567  90.056  1.00 46.91 ? 82   UNK U N   1 
ATOM   9276  C  CA  . UNK L  12 82  ? 15.956  11.511  89.575  1.00 46.91 ? 82   UNK U CA  1 
ATOM   9277  C  C   . UNK L  12 82  ? 16.198  10.258  88.739  1.00 46.91 ? 82   UNK U C   1 
ATOM   9278  O  O   . UNK L  12 82  ? 16.267  9.146   89.272  1.00 46.91 ? 82   UNK U O   1 
ATOM   9279  C  CB  . UNK L  12 82  ? 16.925  11.558  90.750  1.00 46.91 ? 82   UNK U CB  1 
ATOM   9280  N  N   . UNK L  12 83  ? 16.334  10.443  87.430  1.00 46.91 ? 83   UNK U N   1 
ATOM   9281  C  CA  . UNK L  12 83  ? 16.569  9.336   86.510  1.00 46.91 ? 83   UNK U CA  1 
ATOM   9282  C  C   . UNK L  12 83  ? 16.934  9.859   85.126  1.00 46.91 ? 83   UNK U C   1 
ATOM   9283  O  O   . UNK L  12 83  ? 18.078  9.729   84.685  1.00 46.91 ? 83   UNK U O   1 
ATOM   9284  C  CB  . UNK L  12 83  ? 15.332  8.441   86.427  1.00 46.91 ? 83   UNK U CB  1 
ATOM   9285  N  N   . UNK L  12 84  ? 15.951  10.434  84.441  1.00 46.91 ? 84   UNK U N   1 
ATOM   9286  C  CA  . UNK L  12 84  ? 16.160  10.982  83.106  1.00 46.91 ? 84   UNK U CA  1 
ATOM   9287  C  C   . UNK L  12 84  ? 16.819  12.359  83.150  1.00 46.91 ? 84   UNK U C   1 
ATOM   9288  O  O   . UNK L  12 84  ? 17.333  12.839  82.139  1.00 46.91 ? 84   UNK U O   1 
ATOM   9289  C  CB  . UNK L  12 84  ? 14.838  11.052  82.357  1.00 46.91 ? 84   UNK U CB  1 
ATOM   9290  N  N   . UNK L  12 85  ? 16.784  12.996  84.318  1.00 46.91 ? 85   UNK U N   1 
ATOM   9291  C  CA  . UNK L  12 85  ? 17.375  14.319  84.495  1.00 46.91 ? 85   UNK U CA  1 
ATOM   9292  C  C   . UNK L  12 85  ? 18.885  14.237  84.728  1.00 46.91 ? 85   UNK U C   1 
ATOM   9293  O  O   . UNK L  12 85  ? 19.384  14.607  85.793  1.00 46.91 ? 85   UNK U O   1 
ATOM   9294  C  CB  . UNK L  12 85  ? 16.694  15.049  85.650  1.00 46.91 ? 85   UNK U CB  1 
ATOM   9295  N  N   . UNK L  12 86  ? 19.604  13.730  83.731  1.00 46.91 ? 86   UNK U N   1 
ATOM   9296  C  CA  . UNK L  12 86  ? 21.054  13.597  83.812  1.00 46.91 ? 86   UNK U CA  1 
ATOM   9297  C  C   . UNK L  12 86  ? 21.748  14.671  82.979  1.00 46.91 ? 86   UNK U C   1 
ATOM   9298  O  O   . UNK L  12 86  ? 22.883  15.057  83.267  1.00 46.91 ? 86   UNK U O   1 
ATOM   9299  C  CB  . UNK L  12 86  ? 21.480  12.210  83.351  1.00 46.91 ? 86   UNK U CB  1 
ATOM   9300  N  N   . UNK L  12 87  ? 21.075  15.116  81.922  1.00 63.00 ? 87   UNK U N   1 
ATOM   9301  C  CA  . UNK L  12 87  ? 21.610  16.142  81.034  1.00 62.79 ? 87   UNK U CA  1 
ATOM   9302  C  C   . UNK L  12 87  ? 21.326  17.547  81.560  1.00 63.84 ? 87   UNK U C   1 
ATOM   9303  O  O   . UNK L  12 87  ? 22.017  18.504  81.201  1.00 64.93 ? 87   UNK U O   1 
ATOM   9304  C  CB  . UNK L  12 87  ? 21.033  15.977  79.635  1.00 62.32 ? 87   UNK U CB  1 
ATOM   9305  N  N   . UNK L  12 88  ? 20.282  17.670  82.374  1.00 46.91 ? 88   UNK U N   1 
ATOM   9306  C  CA  . UNK L  12 88  ? 19.895  18.952  82.952  1.00 46.91 ? 88   UNK U CA  1 
ATOM   9307  C  C   . UNK L  12 88  ? 20.762  19.309  84.158  1.00 46.91 ? 88   UNK U C   1 
ATOM   9308  O  O   . UNK L  12 88  ? 20.974  20.486  84.451  1.00 46.91 ? 88   UNK U O   1 
ATOM   9309  C  CB  . UNK L  12 88  ? 18.425  18.927  83.348  1.00 46.91 ? 88   UNK U CB  1 
ATOM   9310  N  N   . UNK L  12 89  ? 21.244  18.286  84.859  1.00 46.91 ? 89   UNK U N   1 
ATOM   9311  C  CA  . UNK L  12 89  ? 22.084  18.480  86.037  1.00 46.91 ? 89   UNK U CA  1 
ATOM   9312  C  C   . UNK L  12 89  ? 23.495  18.953  85.684  1.00 46.91 ? 89   UNK U C   1 
ATOM   9313  O  O   . UNK L  12 89  ? 24.316  19.198  86.574  1.00 46.91 ? 89   UNK U O   1 
ATOM   9314  C  CB  . UNK L  12 89  ? 22.147  17.194  86.850  1.00 46.91 ? 89   UNK U CB  1 
ATOM   9315  N  N   . UNK L  12 90  ? 23.782  19.058  84.390  1.00 46.91 ? 90   UNK U N   1 
ATOM   9316  C  CA  . UNK L  12 90  ? 25.090  19.499  83.919  1.00 46.91 ? 90   UNK U CA  1 
ATOM   9317  C  C   . UNK L  12 90  ? 25.284  21.003  84.101  1.00 46.91 ? 90   UNK U C   1 
ATOM   9318  O  O   . UNK L  12 90  ? 26.330  21.448  84.583  1.00 46.91 ? 90   UNK U O   1 
ATOM   9319  C  CB  . UNK L  12 90  ? 25.276  19.117  82.456  1.00 46.91 ? 90   UNK U CB  1 
ATOM   9320  N  N   . UNK L  12 91  ? 24.289  21.779  83.683  1.00 46.91 ? 91   UNK U N   1 
ATOM   9321  C  CA  . UNK L  12 91  ? 24.342  23.232  83.793  1.00 46.91 ? 91   UNK U CA  1 
ATOM   9322  C  C   . UNK L  12 91  ? 23.517  23.743  84.971  1.00 46.91 ? 91   UNK U C   1 
ATOM   9323  O  O   . UNK L  12 91  ? 22.295  23.870  84.879  1.00 46.91 ? 91   UNK U O   1 
ATOM   9324  C  CB  . UNK L  12 91  ? 23.867  23.874  82.495  1.00 46.91 ? 91   UNK U CB  1 
ATOM   9325  N  N   . UNK L  12 92  ? 24.196  24.043  86.074  1.00 46.91 ? 92   UNK U N   1 
ATOM   9326  C  CA  . UNK L  12 92  ? 23.533  24.546  87.273  1.00 46.91 ? 92   UNK U CA  1 
ATOM   9327  C  C   . UNK L  12 92  ? 23.229  26.041  87.165  1.00 46.91 ? 92   UNK U C   1 
ATOM   9328  O  O   . UNK L  12 92  ? 22.538  26.605  88.017  1.00 46.91 ? 92   UNK U O   1 
ATOM   9329  C  CB  . UNK L  12 92  ? 24.390  24.269  88.501  1.00 46.91 ? 92   UNK U CB  1 
ATOM   9330  N  N   . UNK L  12 93  ? 23.771  26.682  86.133  1.00 46.91 ? 93   UNK U N   1 
ATOM   9331  C  CA  . UNK L  12 93  ? 23.562  28.108  85.908  1.00 46.91 ? 93   UNK U CA  1 
ATOM   9332  C  C   . UNK L  12 93  ? 23.764  28.459  84.437  1.00 46.91 ? 93   UNK U C   1 
ATOM   9333  O  O   . UNK L  12 93  ? 24.867  28.821  84.017  1.00 46.91 ? 93   UNK U O   1 
ATOM   9334  C  CB  . UNK L  12 93  ? 24.507  28.925  86.786  1.00 46.91 ? 93   UNK U CB  1 
ATOM   9335  N  N   . UNK L  12 94  ? 22.691  28.349  83.661  1.00 46.91 ? 94   UNK U N   1 
ATOM   9336  C  CA  . UNK L  12 94  ? 22.724  28.650  82.232  1.00 46.91 ? 94   UNK U CA  1 
ATOM   9337  C  C   . UNK L  12 94  ? 21.313  28.796  81.667  1.00 46.91 ? 94   UNK U C   1 
ATOM   9338  O  O   . UNK L  12 94  ? 21.137  29.107  80.487  1.00 46.91 ? 94   UNK U O   1 
ATOM   9339  C  CB  . UNK L  12 94  ? 23.481  27.558  81.479  1.00 46.91 ? 94   UNK U CB  1 
ATOM   9340  N  N   . UNK L  12 95  ? 20.313  28.548  82.508  1.00 46.91 ? 95   UNK U N   1 
ATOM   9341  C  CA  . UNK L  12 95  ? 18.916  28.651  82.104  1.00 46.91 ? 95   UNK U CA  1 
ATOM   9342  C  C   . UNK L  12 95  ? 18.387  30.074  82.262  1.00 46.91 ? 95   UNK U C   1 
ATOM   9343  O  O   . UNK L  12 95  ? 17.603  30.548  81.437  1.00 46.91 ? 95   UNK U O   1 
ATOM   9344  C  CB  . UNK L  12 95  ? 18.064  27.678  82.910  1.00 46.91 ? 95   UNK U CB  1 
ATOM   9345  N  N   . UNK L  12 96  ? 18.801  30.740  83.337  1.00 46.91 ? 96   UNK U N   1 
ATOM   9346  C  CA  . UNK L  12 96  ? 18.374  32.105  83.618  1.00 46.91 ? 96   UNK U CA  1 
ATOM   9347  C  C   . UNK L  12 96  ? 19.005  33.110  82.655  1.00 46.91 ? 96   UNK U C   1 
ATOM   9348  O  O   . UNK L  12 96  ? 20.228  33.156  82.502  1.00 46.91 ? 96   UNK U O   1 
ATOM   9349  C  CB  . UNK L  12 96  ? 18.709  32.474  85.058  1.00 46.91 ? 96   UNK U CB  1 
ATOM   9350  N  N   . UNK L  12 97  ? 18.161  33.914  82.014  1.00 46.91 ? 97   UNK U N   1 
ATOM   9351  C  CA  . UNK L  12 97  ? 18.623  34.923  81.065  1.00 46.91 ? 97   UNK U CA  1 
ATOM   9352  C  C   . UNK L  12 97  ? 19.063  36.204  81.773  1.00 46.91 ? 97   UNK U C   1 
ATOM   9353  O  O   . UNK L  12 97  ? 18.199  36.840  82.417  1.00 46.91 ? 97   UNK U O   1 
ATOM   9354  C  CB  . UNK L  12 97  ? 17.529  35.225  80.045  1.00 46.91 ? 97   UNK U CB  1 
ATOM   9355  N  N   . GLU M  13 2   ? 0.726   62.201  82.911  1.00 46.91 ? 2    GLU V N   1 
ATOM   9356  C  CA  . GLU M  13 2   ? -0.220  62.792  83.903  1.00 46.91 ? 2    GLU V CA  1 
ATOM   9357  C  C   . GLU M  13 2   ? 0.080   62.309  85.319  1.00 46.91 ? 2    GLU V C   1 
ATOM   9358  O  O   . GLU M  13 2   ? -0.374  61.238  85.732  1.00 46.91 ? 2    GLU V O   1 
ATOM   9359  C  CB  . GLU M  13 2   ? -1.663  62.448  83.525  1.00 46.91 ? 2    GLU V CB  1 
ATOM   9360  N  N   . LEU M  13 3   ? 0.843   63.109  86.058  1.00 46.91 ? 3    LEU V N   1 
ATOM   9361  C  CA  . LEU M  13 3   ? 1.212   62.778  87.429  1.00 46.91 ? 3    LEU V CA  1 
ATOM   9362  C  C   . LEU M  13 3   ? 0.210   63.337  88.435  1.00 46.91 ? 3    LEU V C   1 
ATOM   9363  O  O   . LEU M  13 3   ? 0.133   64.550  88.646  1.00 46.91 ? 3    LEU V O   1 
ATOM   9364  C  CB  . LEU M  13 3   ? 2.614   63.306  87.743  1.00 46.91 ? 3    LEU V CB  1 
ATOM   9365  N  N   . THR M  13 4   ? -0.578  62.448  89.029  1.00 46.91 ? 4    THR V N   1 
ATOM   9366  C  CA  . THR M  13 4   ? -1.575  62.840  90.018  1.00 46.91 ? 4    THR V CA  1 
ATOM   9367  C  C   . THR M  13 4   ? -1.025  62.667  91.432  1.00 46.91 ? 4    THR V C   1 
ATOM   9368  O  O   . THR M  13 4   ? 0.040   62.083  91.627  1.00 46.91 ? 4    THR V O   1 
ATOM   9369  C  CB  . THR M  13 4   ? -2.856  62.000  89.879  1.00 46.91 ? 4    THR V CB  1 
ATOM   9370  N  N   . PRO M  13 5   ? -1.751  63.182  92.436  1.00 46.91 ? 5    PRO V N   1 
ATOM   9371  C  CA  . PRO M  13 5   ? -1.356  63.098  93.847  1.00 46.91 ? 5    PRO V CA  1 
ATOM   9372  C  C   . PRO M  13 5   ? -1.553  61.698  94.431  1.00 46.91 ? 5    PRO V C   1 
ATOM   9373  O  O   . PRO M  13 5   ? -1.154  61.428  95.564  1.00 46.91 ? 5    PRO V O   1 
ATOM   9374  C  CB  . PRO M  13 5   ? -2.271  64.114  94.531  1.00 46.91 ? 5    PRO V CB  1 
ATOM   9375  N  N   . GLU M  13 6   ? -2.214  60.831  93.670  1.00 46.91 ? 6    GLU V N   1 
ATOM   9376  C  CA  . GLU M  13 6   ? -2.468  59.462  94.108  1.00 46.91 ? 6    GLU V CA  1 
ATOM   9377  C  C   . GLU M  13 6   ? -1.334  58.518  93.713  1.00 46.91 ? 6    GLU V C   1 
ATOM   9378  O  O   . GLU M  13 6   ? -1.061  57.542  94.413  1.00 46.91 ? 6    GLU V O   1 
ATOM   9379  C  CB  . GLU M  13 6   ? -3.792  58.956  93.529  1.00 46.91 ? 6    GLU V CB  1 
ATOM   9380  N  N   . VAL M  13 7   ? -0.700  58.799  92.577  1.00 46.91 ? 7    VAL V N   1 
ATOM   9381  C  CA  . VAL M  13 7   ? 0.398   57.979  92.075  1.00 46.91 ? 7    VAL V CA  1 
ATOM   9382  C  C   . VAL M  13 7   ? 1.663   58.115  92.919  1.00 46.91 ? 7    VAL V C   1 
ATOM   9383  O  O   . VAL M  13 7   ? 2.280   57.116  93.292  1.00 46.91 ? 7    VAL V O   1 
ATOM   9384  C  CB  . VAL M  13 7   ? 0.737   58.335  90.613  1.00 46.91 ? 7    VAL V CB  1 
ATOM   9385  N  N   . LEU M  13 8   ? 2.040   59.354  93.219  1.00 46.91 ? 8    LEU V N   1 
ATOM   9386  C  CA  . LEU M  13 8   ? 3.236   59.622  94.012  1.00 46.91 ? 8    LEU V CA  1 
ATOM   9387  C  C   . LEU M  13 8   ? 2.997   59.504  95.520  1.00 46.91 ? 8    LEU V C   1 
ATOM   9388  O  O   . LEU M  13 8   ? 3.745   60.065  96.323  1.00 46.91 ? 8    LEU V O   1 
ATOM   9389  C  CB  . LEU M  13 8   ? 3.792   61.009  93.672  1.00 46.91 ? 8    LEU V CB  1 
ATOM   9390  N  N   . THR M  13 9   ? 1.948   58.782  95.901  1.00 46.91 ? 9    THR V N   1 
ATOM   9391  C  CA  . THR M  13 9   ? 1.622   58.588  97.309  1.00 46.91 ? 9    THR V CA  1 
ATOM   9392  C  C   . THR M  13 9   ? 2.258   57.304  97.841  1.00 46.91 ? 9    THR V C   1 
ATOM   9393  O  O   . THR M  13 9   ? 1.557   56.386  98.285  1.00 46.91 ? 9    THR V O   1 
ATOM   9394  C  CB  . THR M  13 9   ? 0.100   58.535  97.528  1.00 46.91 ? 9    THR V CB  1 
ATOM   9395  N  N   . VAL M  13 10  ? 3.586   57.238  97.781  1.00 46.91 ? 10   VAL V N   1 
ATOM   9396  C  CA  . VAL M  13 10  ? 4.331   56.072  98.255  1.00 46.91 ? 10   VAL V CA  1 
ATOM   9397  C  C   . VAL M  13 10  ? 4.129   55.856  99.757  1.00 46.91 ? 10   VAL V C   1 
ATOM   9398  O  O   . VAL M  13 10  ? 4.062   56.820  100.525 1.00 46.91 ? 10   VAL V O   1 
ATOM   9399  C  CB  . VAL M  13 10  ? 5.841   56.225  97.965  1.00 46.91 ? 10   VAL V CB  1 
ATOM   9400  N  N   . PRO M  13 11  ? 3.989   54.588  100.187 1.00 46.91 ? 11   PRO V N   1 
ATOM   9401  C  CA  . PRO M  13 11  ? 3.789   54.236  101.598 1.00 46.91 ? 11   PRO V CA  1 
ATOM   9402  C  C   . PRO M  13 11  ? 5.020   54.555  102.444 1.00 46.91 ? 11   PRO V C   1 
ATOM   9403  O  O   . PRO M  13 11  ? 6.150   54.425  101.978 1.00 46.91 ? 11   PRO V O   1 
ATOM   9404  C  CB  . PRO M  13 11  ? 3.524   52.736  101.530 1.00 46.91 ? 11   PRO V CB  1 
ATOM   9405  C  CG  . PRO M  13 11  ? 4.351   52.306  100.360 1.00 46.91 ? 11   PRO V CG  1 
ATOM   9406  C  CD  . PRO M  13 11  ? 4.018   53.377  99.349  1.00 46.91 ? 11   PRO V CD  1 
ATOM   9407  N  N   . LEU M  13 12  ? 4.793   54.971  103.686 1.00 46.91 ? 12   LEU V N   1 
ATOM   9408  C  CA  . LEU M  13 12  ? 5.888   55.318  104.585 1.00 46.91 ? 12   LEU V CA  1 
ATOM   9409  C  C   . LEU M  13 12  ? 6.139   54.284  105.679 1.00 46.91 ? 12   LEU V C   1 
ATOM   9410  O  O   . LEU M  13 12  ? 6.868   54.558  106.635 1.00 46.91 ? 12   LEU V O   1 
ATOM   9411  C  CB  . LEU M  13 12  ? 5.635   56.687  105.218 1.00 46.91 ? 12   LEU V CB  1 
ATOM   9412  N  N   . ASN M  13 13  ? 5.517   53.115  105.551 1.00 46.91 ? 13   ASN V N   1 
ATOM   9413  C  CA  . ASN M  13 13  ? 5.676   52.035  106.525 1.00 46.91 ? 13   ASN V CA  1 
ATOM   9414  C  C   . ASN M  13 13  ? 4.881   50.792  106.142 1.00 46.91 ? 13   ASN V C   1 
ATOM   9415  O  O   . ASN M  13 13  ? 3.973   50.847  105.310 1.00 46.91 ? 13   ASN V O   1 
ATOM   9416  C  CB  . ASN M  13 13  ? 5.245   52.497  107.922 1.00 46.91 ? 13   ASN V CB  1 
ATOM   9417  N  N   . SER M  13 14  ? 5.240   49.664  106.750 1.00 46.91 ? 14   SER V N   1 
ATOM   9418  C  CA  . SER M  13 14  ? 4.558   48.400  106.495 1.00 46.91 ? 14   SER V CA  1 
ATOM   9419  C  C   . SER M  13 14  ? 3.277   48.308  107.322 1.00 46.91 ? 14   SER V C   1 
ATOM   9420  O  O   . SER M  13 14  ? 2.547   47.318  107.242 1.00 46.91 ? 14   SER V O   1 
ATOM   9421  C  CB  . SER M  13 14  ? 5.477   47.224  106.830 1.00 46.91 ? 14   SER V CB  1 
ATOM   9422  N  N   . GLU M  13 15  ? 3.042   49.323  108.148 1.00 46.91 ? 15   GLU V N   1 
ATOM   9423  C  CA  . GLU M  13 15  ? 1.857   49.382  108.996 1.00 46.91 ? 15   GLU V CA  1 
ATOM   9424  C  C   . GLU M  13 15  ? 0.641   49.822  108.186 1.00 46.91 ? 15   GLU V C   1 
ATOM   9425  O  O   . GLU M  13 15  ? -0.386  49.141  108.169 1.00 46.91 ? 15   GLU V O   1 
ATOM   9426  C  CB  . GLU M  13 15  ? 2.085   50.354  110.157 1.00 46.91 ? 15   GLU V CB  1 
ATOM   9427  N  N   . GLY M  13 16  ? 0.766   50.974  107.532 1.00 46.91 ? 16   GLY V N   1 
ATOM   9428  C  CA  . GLY M  13 16  ? -0.318  51.504  106.725 1.00 46.91 ? 16   GLY V CA  1 
ATOM   9429  C  C   . GLY M  13 16  ? -0.169  52.990  106.451 1.00 46.91 ? 16   GLY V C   1 
ATOM   9430  O  O   . GLY M  13 16  ? -1.107  53.638  105.980 1.00 46.91 ? 16   GLY V O   1 
ATOM   9431  N  N   . LYS M  13 17  ? 1.000   53.536  106.770 1.00 46.91 ? 17   LYS V N   1 
ATOM   9432  C  CA  . LYS M  13 17  ? 1.276   54.953  106.559 1.00 46.91 ? 17   LYS V CA  1 
ATOM   9433  C  C   . LYS M  13 17  ? 1.560   55.278  105.093 1.00 46.91 ? 17   LYS V C   1 
ATOM   9434  O  O   . LYS M  13 17  ? 1.487   54.406  104.224 1.00 46.91 ? 17   LYS V O   1 
ATOM   9435  C  CB  . LYS M  13 17  ? 2.458   55.391  107.426 1.00 46.91 ? 17   LYS V CB  1 
ATOM   9436  N  N   . THR M  13 18  ? 1.871   56.545  104.827 1.00 46.91 ? 18   THR V N   1 
ATOM   9437  C  CA  . THR M  13 18  ? 2.177   57.006  103.476 1.00 46.91 ? 18   THR V CA  1 
ATOM   9438  C  C   . THR M  13 18  ? 2.559   58.479  103.448 1.00 46.91 ? 18   THR V C   1 
ATOM   9439  O  O   . THR M  13 18  ? 1.872   59.323  104.032 1.00 46.91 ? 18   THR V O   1 
ATOM   9440  C  CB  . THR M  13 18  ? 0.987   56.797  102.516 1.00 46.91 ? 18   THR V CB  1 
ATOM   9441  N  N   . ILE M  13 19  ? 3.678   58.777  102.795 1.00 46.91 ? 19   ILE V N   1 
ATOM   9442  C  CA  . ILE M  13 19  ? 4.160   60.144  102.666 1.00 46.91 ? 19   ILE V CA  1 
ATOM   9443  C  C   . ILE M  13 19  ? 3.503   60.793  101.447 1.00 46.91 ? 19   ILE V C   1 
ATOM   9444  O  O   . ILE M  13 19  ? 2.424   60.377  101.019 1.00 46.91 ? 19   ILE V O   1 
ATOM   9445  C  CB  . ILE M  13 19  ? 5.697   60.182  102.501 1.00 46.91 ? 19   ILE V CB  1 
ATOM   9446  N  N   . THR M  13 20  ? 4.136   61.832  100.912 1.00 46.91 ? 20   THR V N   1 
ATOM   9447  C  CA  . THR M  13 20  ? 3.608   62.524  99.740  1.00 46.91 ? 20   THR V CA  1 
ATOM   9448  C  C   . THR M  13 20  ? 4.679   63.399  99.102  1.00 46.91 ? 20   THR V C   1 
ATOM   9449  O  O   . THR M  13 20  ? 4.840   64.571  99.457  1.00 46.91 ? 20   THR V O   1 
ATOM   9450  C  CB  . THR M  13 20  ? 2.388   63.395  100.099 1.00 46.91 ? 20   THR V CB  1 
ATOM   9451  N  N   . LEU M  13 21  ? 5.423   62.811  98.171  1.00 46.91 ? 21   LEU V N   1 
ATOM   9452  C  CA  . LEU M  13 21  ? 6.487   63.509  97.463  1.00 46.91 ? 21   LEU V CA  1 
ATOM   9453  C  C   . LEU M  13 21  ? 5.930   64.589  96.538  1.00 46.91 ? 21   LEU V C   1 
ATOM   9454  O  O   . LEU M  13 21  ? 4.714   64.774  96.437  1.00 46.91 ? 21   LEU V O   1 
ATOM   9455  C  CB  . LEU M  13 21  ? 7.324   62.514  96.655  1.00 46.91 ? 21   LEU V CB  1 
ATOM   9456  N  N   . THR M  13 22  ? 6.826   65.312  95.876  1.00 46.91 ? 22   THR V N   1 
ATOM   9457  C  CA  . THR M  13 22  ? 6.422   66.374  94.959  1.00 46.91 ? 22   THR V CA  1 
ATOM   9458  C  C   . THR M  13 22  ? 6.958   66.119  93.556  1.00 46.91 ? 22   THR V C   1 
ATOM   9459  O  O   . THR M  13 22  ? 7.704   65.167  93.329  1.00 46.91 ? 22   THR V O   1 
ATOM   9460  C  CB  . THR M  13 22  ? 6.924   67.746  95.439  1.00 46.91 ? 22   THR V CB  1 
ATOM   9461  N  N   . GLU M  13 23  ? 6.560   66.968  92.613  1.00 46.91 ? 23   GLU V N   1 
ATOM   9462  C  CA  . GLU M  13 23  ? 7.010   66.845  91.230  1.00 46.91 ? 23   GLU V CA  1 
ATOM   9463  C  C   . GLU M  13 23  ? 8.481   67.237  91.109  1.00 46.91 ? 23   GLU V C   1 
ATOM   9464  O  O   . GLU M  13 23  ? 9.120   66.984  90.088  1.00 46.91 ? 23   GLU V O   1 
ATOM   9465  C  CB  . GLU M  13 23  ? 6.159   67.726  90.311  1.00 46.91 ? 23   GLU V CB  1 
ATOM   9466  N  N   . LYS M  13 24  ? 8.993   67.903  92.140  1.00 46.91 ? 24   LYS V N   1 
ATOM   9467  C  CA  . LYS M  13 24  ? 10.385  68.333  92.175  1.00 46.91 ? 24   LYS V CA  1 
ATOM   9468  C  C   . LYS M  13 24  ? 11.267  67.247  92.785  1.00 46.91 ? 24   LYS V C   1 
ATOM   9469  O  O   . LYS M  13 24  ? 12.472  67.200  92.532  1.00 46.91 ? 24   LYS V O   1 
ATOM   9470  C  CB  . LYS M  13 24  ? 10.519  69.626  92.983  1.00 46.91 ? 24   LYS V CB  1 
ATOM   9471  N  N   . GLN M  13 25  ? 10.667  66.414  93.631  1.00 46.91 ? 25   GLN V N   1 
ATOM   9472  C  CA  . GLN M  13 25  ? 11.381  65.323  94.286  1.00 46.91 ? 25   GLN V CA  1 
ATOM   9473  C  C   . GLN M  13 25  ? 11.594  64.149  93.333  1.00 46.91 ? 25   GLN V C   1 
ATOM   9474  O  O   . GLN M  13 25  ? 12.658  63.531  93.330  1.00 46.91 ? 25   GLN V O   1 
ATOM   9475  C  CB  . GLN M  13 25  ? 10.614  64.855  95.526  1.00 46.91 ? 25   GLN V CB  1 
ATOM   9476  N  N   . TYR M  13 26  ? 10.568  63.840  92.547  1.00 46.91 ? 26   TYR V N   1 
ATOM   9477  C  CA  . TYR M  13 26  ? 10.627  62.746  91.579  1.00 46.91 ? 26   TYR V CA  1 
ATOM   9478  C  C   . TYR M  13 26  ? 11.638  63.045  90.473  1.00 46.91 ? 26   TYR V C   1 
ATOM   9479  O  O   . TYR M  13 26  ? 12.252  62.133  89.920  1.00 46.91 ? 26   TYR V O   1 
ATOM   9480  C  CB  . TYR M  13 26  ? 9.233   62.501  90.980  1.00 46.91 ? 26   TYR V CB  1 
ATOM   9481  C  CG  . TYR M  13 26  ? 9.204   61.560  89.790  1.00 46.91 ? 26   TYR V CG  1 
ATOM   9482  C  CD1 . TYR M  13 26  ? 9.433   60.191  89.945  1.00 46.91 ? 26   TYR V CD1 1 
ATOM   9483  C  CD2 . TYR M  13 26  ? 8.947   62.043  88.507  1.00 46.91 ? 26   TYR V CD2 1 
ATOM   9484  C  CE1 . TYR M  13 26  ? 9.406   59.328  88.847  1.00 46.91 ? 26   TYR V CE1 1 
ATOM   9485  C  CE2 . TYR M  13 26  ? 8.919   61.191  87.407  1.00 46.91 ? 26   TYR V CE2 1 
ATOM   9486  C  CZ  . TYR M  13 26  ? 9.150   59.837  87.581  1.00 46.91 ? 26   TYR V CZ  1 
ATOM   9487  O  OH  . TYR M  13 26  ? 9.123   59.002  86.485  1.00 46.91 ? 26   TYR V OH  1 
ATOM   9488  N  N   . LEU M  13 27  ? 11.773  64.322  90.128  1.00 46.91 ? 27   LEU V N   1 
ATOM   9489  C  CA  . LEU M  13 27  ? 12.706  64.744  89.091  1.00 46.91 ? 27   LEU V CA  1 
ATOM   9490  C  C   . LEU M  13 27  ? 14.149  64.746  89.594  1.00 46.91 ? 27   LEU V C   1 
ATOM   9491  O  O   . LEU M  13 27  ? 15.091  64.718  88.799  1.00 46.91 ? 27   LEU V O   1 
ATOM   9492  C  CB  . LEU M  13 27  ? 12.334  66.143  88.586  1.00 46.91 ? 27   LEU V CB  1 
ATOM   9493  N  N   . GLU M  13 28  ? 14.312  64.824  90.912  1.00 46.91 ? 28   GLU V N   1 
ATOM   9494  C  CA  . GLU M  13 28  ? 15.633  64.831  91.532  1.00 46.91 ? 28   GLU V CA  1 
ATOM   9495  C  C   . GLU M  13 28  ? 16.215  63.425  91.631  1.00 46.91 ? 28   GLU V C   1 
ATOM   9496  O  O   . GLU M  13 28  ? 17.417  63.230  91.433  1.00 46.91 ? 28   GLU V O   1 
ATOM   9497  C  CB  . GLU M  13 28  ? 15.561  65.466  92.924  1.00 46.91 ? 28   GLU V CB  1 
ATOM   9498  N  N   . GLY M  13 29  ? 15.364  62.460  91.966  1.00 46.91 ? 29   GLY V N   1 
ATOM   9499  C  CA  . GLY M  13 29  ? 15.802  61.081  92.087  1.00 46.91 ? 29   GLY V CA  1 
ATOM   9500  C  C   . GLY M  13 29  ? 15.918  60.377  90.748  1.00 46.91 ? 29   GLY V C   1 
ATOM   9501  O  O   . GLY M  13 29  ? 16.544  59.320  90.648  1.00 46.91 ? 29   GLY V O   1 
ATOM   9502  N  N   . LYS M  13 30  ? 15.285  60.944  89.725  1.00 46.91 ? 30   LYS V N   1 
ATOM   9503  C  CA  . LYS M  13 30  ? 15.322  60.372  88.385  1.00 46.91 ? 30   LYS V CA  1 
ATOM   9504  C  C   . LYS M  13 30  ? 16.657  60.656  87.703  1.00 46.91 ? 30   LYS V C   1 
ATOM   9505  O  O   . LYS M  13 30  ? 17.015  59.999  86.723  1.00 46.91 ? 30   LYS V O   1 
ATOM   9506  C  CB  . LYS M  13 30  ? 14.177  60.929  87.536  1.00 46.91 ? 30   LYS V CB  1 
ATOM   9507  N  N   . ARG M  13 31  ? 17.369  61.659  88.205  1.00 46.91 ? 31   ARG V N   1 
ATOM   9508  C  CA  . ARG M  13 31  ? 18.663  62.037  87.656  1.00 46.91 ? 31   ARG V CA  1 
ATOM   9509  C  C   . ARG M  13 31  ? 19.825  61.515  88.496  1.00 46.91 ? 31   ARG V C   1 
ATOM   9510  O  O   . ARG M  13 31  ? 20.975  61.557  88.060  1.00 46.91 ? 31   ARG V O   1 
ATOM   9511  C  CB  . ARG M  13 31  ? 18.756  63.559  87.518  1.00 46.91 ? 31   ARG V CB  1 
ATOM   9512  N  N   . LEU M  13 32  ? 19.532  61.068  89.713  1.00 46.91 ? 32   LEU V N   1 
ATOM   9513  C  CA  . LEU M  13 32  ? 20.566  60.540  90.597  1.00 46.91 ? 32   LEU V CA  1 
ATOM   9514  C  C   . LEU M  13 32  ? 20.656  59.014  90.509  1.00 46.91 ? 32   LEU V C   1 
ATOM   9515  O  O   . LEU M  13 32  ? 21.727  58.436  90.709  1.00 46.91 ? 32   LEU V O   1 
ATOM   9516  C  CB  . LEU M  13 32  ? 20.310  60.972  92.042  1.00 46.91 ? 32   LEU V CB  1 
ATOM   9517  N  N   . PHE M  13 33  ? 19.528  58.369  90.222  1.00 46.91 ? 33   PHE V N   1 
ATOM   9518  C  CA  . PHE M  13 33  ? 19.473  56.914  90.101  1.00 46.91 ? 33   PHE V CA  1 
ATOM   9519  C  C   . PHE M  13 33  ? 19.855  56.469  88.688  1.00 46.91 ? 33   PHE V C   1 
ATOM   9520  O  O   . PHE M  13 33  ? 20.094  55.283  88.445  1.00 46.91 ? 33   PHE V O   1 
ATOM   9521  C  CB  . PHE M  13 33  ? 18.067  56.406  90.453  1.00 46.91 ? 33   PHE V CB  1 
ATOM   9522  C  CG  . PHE M  13 33  ? 17.982  54.911  90.643  1.00 46.91 ? 33   PHE V CG  1 
ATOM   9523  C  CD1 . PHE M  13 33  ? 18.610  54.299  91.724  1.00 46.91 ? 33   PHE V CD1 1 
ATOM   9524  C  CD2 . PHE M  13 33  ? 17.269  54.118  89.746  1.00 46.91 ? 33   PHE V CD2 1 
ATOM   9525  C  CE1 . PHE M  13 33  ? 18.529  52.920  91.914  1.00 46.91 ? 33   PHE V CE1 1 
ATOM   9526  C  CE2 . PHE M  13 33  ? 17.182  52.736  89.927  1.00 46.91 ? 33   PHE V CE2 1 
ATOM   9527  C  CZ  . PHE M  13 33  ? 17.813  52.138  91.013  1.00 46.91 ? 33   PHE V CZ  1 
ATOM   9528  N  N   . GLN M  13 34  ? 19.910  57.425  87.765  1.00 46.91 ? 34   GLN V N   1 
ATOM   9529  C  CA  . GLN M  13 34  ? 20.256  57.140  86.374  1.00 46.91 ? 34   GLN V CA  1 
ATOM   9530  C  C   . GLN M  13 34  ? 21.626  57.692  85.973  1.00 46.91 ? 34   GLN V C   1 
ATOM   9531  O  O   . GLN M  13 34  ? 22.055  57.535  84.826  1.00 46.91 ? 34   GLN V O   1 
ATOM   9532  C  CB  . GLN M  13 34  ? 19.180  57.697  85.437  1.00 46.91 ? 34   GLN V CB  1 
ATOM   9533  N  N   . TYR M  13 35  ? 22.310  58.335  86.914  1.00 46.91 ? 35   TYR V N   1 
ATOM   9534  C  CA  . TYR M  13 35  ? 23.624  58.905  86.646  1.00 46.91 ? 35   TYR V CA  1 
ATOM   9535  C  C   . TYR M  13 35  ? 24.726  58.263  87.488  1.00 46.91 ? 35   TYR V C   1 
ATOM   9536  O  O   . TYR M  13 35  ? 25.910  58.550  87.293  1.00 46.91 ? 35   TYR V O   1 
ATOM   9537  C  CB  . TYR M  13 35  ? 23.602  60.416  86.881  1.00 46.91 ? 35   TYR V CB  1 
ATOM   9538  N  N   . ALA M  13 36  ? 24.337  57.380  88.403  1.00 61.08 ? 36   ALA V N   1 
ATOM   9539  C  CA  . ALA M  13 36  ? 25.289  56.702  89.277  1.00 60.72 ? 36   ALA V CA  1 
ATOM   9540  C  C   . ALA M  13 36  ? 24.741  55.374  89.802  1.00 61.17 ? 36   ALA V C   1 
ATOM   9541  O  O   . ALA M  13 36  ? 25.212  54.854  90.817  1.00 60.13 ? 36   ALA V O   1 
ATOM   9542  C  CB  . ALA M  13 36  ? 25.668  57.614  90.441  1.00 60.27 ? 36   ALA V CB  1 
ATOM   9543  N  N   . CYS M  13 37  ? 23.780  54.804  89.084  1.00 46.91 ? 37   CYS V N   1 
ATOM   9544  C  CA  . CYS M  13 37  ? 23.170  53.537  89.480  1.00 46.91 ? 37   CYS V CA  1 
ATOM   9545  C  C   . CYS M  13 37  ? 22.660  52.756  88.273  1.00 46.91 ? 37   CYS V C   1 
ATOM   9546  O  O   . CYS M  13 37  ? 22.560  51.526  88.319  1.00 46.91 ? 37   CYS V O   1 
ATOM   9547  C  CB  . CYS M  13 37  ? 22.019  53.791  90.453  1.00 46.91 ? 37   CYS V CB  1 
ATOM   9548  N  N   . ALA M  13 38  ? 22.342  53.477  87.201  1.00 46.91 ? 38   ALA V N   1 
ATOM   9549  C  CA  . ALA M  13 38  ? 21.854  52.870  85.969  1.00 46.91 ? 38   ALA V CA  1 
ATOM   9550  C  C   . ALA M  13 38  ? 22.987  52.155  85.239  1.00 46.91 ? 38   ALA V C   1 
ATOM   9551  O  O   . ALA M  13 38  ? 22.772  51.526  84.203  1.00 46.91 ? 38   ALA V O   1 
ATOM   9552  C  CB  . ALA M  13 38  ? 21.236  53.926  85.070  1.00 46.91 ? 38   ALA V CB  1 
ATOM   9553  N  N   . SER M  13 39  ? 24.203  52.287  85.762  1.00 46.91 ? 39   SER V N   1 
ATOM   9554  C  CA  . SER M  13 39  ? 25.367  51.638  85.171  1.00 46.91 ? 39   SER V CA  1 
ATOM   9555  C  C   . SER M  13 39  ? 25.253  50.124  85.341  1.00 46.91 ? 39   SER V C   1 
ATOM   9556  O  O   . SER M  13 39  ? 26.011  49.361  84.740  1.00 46.91 ? 39   SER V O   1 
ATOM   9557  C  CB  . SER M  13 39  ? 26.647  52.137  85.840  1.00 46.91 ? 39   SER V CB  1 
ATOM   9558  N  N   . CYS M  13 40  ? 24.322  49.703  86.193  1.00 46.91 ? 40   CYS V N   1 
ATOM   9559  C  CA  . CYS M  13 40  ? 24.071  48.292  86.466  1.00 46.91 ? 40   CYS V CA  1 
ATOM   9560  C  C   . CYS M  13 40  ? 22.584  48.069  86.738  1.00 46.91 ? 40   CYS V C   1 
ATOM   9561  O  O   . CYS M  13 40  ? 22.175  46.995  87.184  1.00 46.91 ? 40   CYS V O   1 
ATOM   9562  C  CB  . CYS M  13 40  ? 24.888  47.833  87.674  1.00 46.91 ? 40   CYS V CB  1 
ATOM   9563  N  N   . HIS M  13 41  ? 21.794  49.110  86.499  1.00 46.91 ? 41   HIS V N   1 
ATOM   9564  C  CA  . HIS M  13 41  ? 20.349  49.070  86.699  1.00 46.91 ? 41   HIS V CA  1 
ATOM   9565  C  C   . HIS M  13 41  ? 19.663  49.835  85.569  1.00 46.91 ? 41   HIS V C   1 
ATOM   9566  O  O   . HIS M  13 41  ? 18.847  50.726  85.813  1.00 46.91 ? 41   HIS V O   1 
ATOM   9567  C  CB  . HIS M  13 41  ? 19.975  49.699  88.048  1.00 46.91 ? 41   HIS V CB  1 
ATOM   9568  C  CG  . HIS M  13 41  ? 20.368  48.876  89.236  1.00 46.91 ? 41   HIS V CG  1 
ATOM   9569  N  ND1 . HIS M  13 41  ? 19.714  47.711  89.582  1.00 46.91 ? 41   HIS V ND1 1 
ATOM   9570  C  CD2 . HIS M  13 41  ? 21.328  49.058  90.171  1.00 46.91 ? 41   HIS V CD2 1 
ATOM   9571  C  CE1 . HIS M  13 41  ? 20.254  47.215  90.679  1.00 46.91 ? 41   HIS V CE1 1 
ATOM   9572  N  NE2 . HIS M  13 41  ? 21.237  48.013  91.058  1.00 46.91 ? 41   HIS V NE2 1 
ATOM   9573  N  N   . VAL M  13 42  ? 20.026  49.505  84.332  1.00 46.91 ? 42   VAL V N   1 
ATOM   9574  C  CA  . VAL M  13 42  ? 19.451  50.159  83.161  1.00 46.91 ? 42   VAL V CA  1 
ATOM   9575  C  C   . VAL M  13 42  ? 17.990  49.766  82.962  1.00 46.91 ? 42   VAL V C   1 
ATOM   9576  O  O   . VAL M  13 42  ? 17.687  48.672  82.477  1.00 46.91 ? 42   VAL V O   1 
ATOM   9577  C  CB  . VAL M  13 42  ? 20.244  49.823  81.885  1.00 46.91 ? 42   VAL V CB  1 
ATOM   9578  N  N   . GLY M  13 43  ? 17.093  50.686  83.304  1.00 46.91 ? 43   GLY V N   1 
ATOM   9579  C  CA  . GLY M  13 43  ? 15.670  50.434  83.170  1.00 46.91 ? 43   GLY V CA  1 
ATOM   9580  C  C   . GLY M  13 43  ? 15.097  49.650  84.335  1.00 46.91 ? 43   GLY V C   1 
ATOM   9581  O  O   . GLY M  13 43  ? 14.048  49.016  84.204  1.00 46.91 ? 43   GLY V O   1 
ATOM   9582  N  N   . GLY M  13 44  ? 15.763  49.727  85.483  1.00 46.91 ? 44   GLY V N   1 
ATOM   9583  C  CA  . GLY M  13 44  ? 15.306  49.016  86.665  1.00 46.91 ? 44   GLY V CA  1 
ATOM   9584  C  C   . GLY M  13 44  ? 15.770  47.573  86.739  1.00 46.91 ? 44   GLY V C   1 
ATOM   9585  O  O   . GLY M  13 44  ? 15.707  46.954  87.803  1.00 46.91 ? 44   GLY V O   1 
ATOM   9586  N  N   . ILE M  13 45  ? 16.242  47.036  85.617  1.00 46.91 ? 45   ILE V N   1 
ATOM   9587  C  CA  . ILE M  13 45  ? 16.714  45.656  85.565  1.00 46.91 ? 45   ILE V CA  1 
ATOM   9588  C  C   . ILE M  13 45  ? 18.074  45.488  86.245  1.00 46.91 ? 45   ILE V C   1 
ATOM   9589  O  O   . ILE M  13 45  ? 18.569  46.403  86.907  1.00 46.91 ? 45   ILE V O   1 
ATOM   9590  C  CB  . ILE M  13 45  ? 16.805  45.150  84.109  1.00 46.91 ? 45   ILE V CB  1 
ATOM   9591  N  N   . THR M  13 46  ? 18.677  44.316  86.077  1.00 46.91 ? 46   THR V N   1 
ATOM   9592  C  CA  . THR M  13 46  ? 19.972  44.035  86.685  1.00 46.91 ? 46   THR V CA  1 
ATOM   9593  C  C   . THR M  13 46  ? 20.945  43.365  85.723  1.00 46.91 ? 46   THR V C   1 
ATOM   9594  O  O   . THR M  13 46  ? 20.578  42.454  84.978  1.00 46.91 ? 46   THR V O   1 
ATOM   9595  C  CB  . THR M  13 46  ? 19.818  43.147  87.931  1.00 46.91 ? 46   THR V CB  1 
ATOM   9596  N  N   . LYS M  13 47  ? 22.194  43.821  85.754  1.00 46.91 ? 47   LYS V N   1 
ATOM   9597  C  CA  . LYS M  13 47  ? 23.240  43.282  84.892  1.00 46.91 ? 47   LYS V CA  1 
ATOM   9598  C  C   . LYS M  13 47  ? 24.081  42.221  85.597  1.00 46.91 ? 47   LYS V C   1 
ATOM   9599  O  O   . LYS M  13 47  ? 24.697  41.376  84.945  1.00 46.91 ? 47   LYS V O   1 
ATOM   9600  C  CB  . LYS M  13 47  ? 24.149  44.410  84.400  1.00 46.91 ? 47   LYS V CB  1 
ATOM   9601  N  N   . THR M  13 48  ? 24.135  42.288  86.924  1.00 46.91 ? 48   THR V N   1 
ATOM   9602  C  CA  . THR M  13 48  ? 24.916  41.334  87.706  1.00 46.91 ? 48   THR V CA  1 
ATOM   9603  C  C   . THR M  13 48  ? 24.078  40.652  88.785  1.00 46.91 ? 48   THR V C   1 
ATOM   9604  O  O   . THR M  13 48  ? 24.435  40.664  89.966  1.00 46.91 ? 48   THR V O   1 
ATOM   9605  C  CB  . THR M  13 48  ? 26.129  42.016  88.364  1.00 46.91 ? 48   THR V CB  1 
ATOM   9606  N  N   . ASN M  13 49  ? 22.974  40.041  88.365  1.00 46.91 ? 49   ASN V N   1 
ATOM   9607  C  CA  . ASN M  13 49  ? 22.071  39.344  89.277  1.00 46.91 ? 49   ASN V CA  1 
ATOM   9608  C  C   . ASN M  13 49  ? 21.104  38.458  88.500  1.00 46.91 ? 49   ASN V C   1 
ATOM   9609  O  O   . ASN M  13 49  ? 20.784  38.734  87.343  1.00 46.91 ? 49   ASN V O   1 
ATOM   9610  C  CB  . ASN M  13 49  ? 21.284  40.350  90.119  1.00 46.91 ? 49   ASN V CB  1 
ATOM   9611  N  N   . PRO M  13 50  ? 20.647  37.362  89.124  1.00 46.91 ? 50   PRO V N   1 
ATOM   9612  C  CA  . PRO M  13 50  ? 19.711  36.428  88.490  1.00 46.91 ? 50   PRO V CA  1 
ATOM   9613  C  C   . PRO M  13 50  ? 18.262  36.890  88.647  1.00 46.91 ? 50   PRO V C   1 
ATOM   9614  O  O   . PRO M  13 50  ? 17.529  36.386  89.500  1.00 46.91 ? 50   PRO V O   1 
ATOM   9615  C  CB  . PRO M  13 50  ? 19.968  35.112  89.229  1.00 46.91 ? 50   PRO V CB  1 
ATOM   9616  N  N   . SER M  13 51  ? 17.859  37.843  87.809  1.00 46.91 ? 51   SER V N   1 
ATOM   9617  C  CA  . SER M  13 51  ? 16.509  38.402  87.829  1.00 46.91 ? 51   SER V CA  1 
ATOM   9618  C  C   . SER M  13 51  ? 16.163  39.012  89.187  1.00 46.91 ? 51   SER V C   1 
ATOM   9619  O  O   . SER M  13 51  ? 15.344  38.472  89.937  1.00 46.91 ? 51   SER V O   1 
ATOM   9620  C  CB  . SER M  13 51  ? 15.476  37.336  87.448  1.00 46.91 ? 51   SER V CB  1 
ATOM   9621  N  N   . LEU M  13 52  ? 16.796  40.141  89.493  1.00 46.91 ? 52   LEU V N   1 
ATOM   9622  C  CA  . LEU M  13 52  ? 16.568  40.840  90.753  1.00 46.91 ? 52   LEU V CA  1 
ATOM   9623  C  C   . LEU M  13 52  ? 16.192  42.302  90.518  1.00 46.91 ? 52   LEU V C   1 
ATOM   9624  O  O   . LEU M  13 52  ? 16.926  43.217  90.901  1.00 46.91 ? 52   LEU V O   1 
ATOM   9625  C  CB  . LEU M  13 52  ? 17.816  40.750  91.639  1.00 46.91 ? 52   LEU V CB  1 
ATOM   9626  N  N   . ASP M  13 53  ? 15.053  42.508  89.861  1.00 46.91 ? 53   ASP V N   1 
ATOM   9627  C  CA  . ASP M  13 53  ? 14.558  43.851  89.572  1.00 46.91 ? 53   ASP V CA  1 
ATOM   9628  C  C   . ASP M  13 53  ? 14.057  44.525  90.849  1.00 46.91 ? 53   ASP V C   1 
ATOM   9629  O  O   . ASP M  13 53  ? 13.980  43.890  91.905  1.00 46.91 ? 53   ASP V O   1 
ATOM   9630  C  CB  . ASP M  13 53  ? 13.433  43.788  88.535  1.00 46.91 ? 53   ASP V CB  1 
ATOM   9631  N  N   . LEU M  13 54  ? 13.718  45.806  90.748  1.00 46.91 ? 54   LEU V N   1 
ATOM   9632  C  CA  . LEU M  13 54  ? 13.228  46.569  91.891  1.00 46.91 ? 54   LEU V CA  1 
ATOM   9633  C  C   . LEU M  13 54  ? 11.720  46.811  91.838  1.00 46.91 ? 54   LEU V C   1 
ATOM   9634  O  O   . LEU M  13 54  ? 11.230  47.830  92.330  1.00 46.91 ? 54   LEU V O   1 
ATOM   9635  C  CB  . LEU M  13 54  ? 13.973  47.904  91.988  1.00 46.91 ? 54   LEU V CB  1 
ATOM   9636  N  N   . ARG M  13 55  ? 10.989  45.876  91.239  1.00 46.91 ? 55   ARG V N   1 
ATOM   9637  C  CA  . ARG M  13 55  ? 9.538   45.989  91.131  1.00 46.91 ? 55   ARG V CA  1 
ATOM   9638  C  C   . ARG M  13 55  ? 8.892   45.883  92.511  1.00 46.91 ? 55   ARG V C   1 
ATOM   9639  O  O   . ARG M  13 55  ? 9.504   45.384  93.455  1.00 46.91 ? 55   ARG V O   1 
ATOM   9640  C  CB  . ARG M  13 55  ? 8.987   44.892  90.217  1.00 46.91 ? 55   ARG V CB  1 
ATOM   9641  N  N   . THR M  13 56  ? 7.645   46.332  92.618  1.00 46.91 ? 56   THR V N   1 
ATOM   9642  C  CA  . THR M  13 56  ? 6.919   46.286  93.885  1.00 46.91 ? 56   THR V CA  1 
ATOM   9643  C  C   . THR M  13 56  ? 6.534   44.858  94.278  1.00 46.91 ? 56   THR V C   1 
ATOM   9644  O  O   . THR M  13 56  ? 5.753   44.648  95.211  1.00 46.91 ? 56   THR V O   1 
ATOM   9645  C  CB  . THR M  13 56  ? 5.650   47.150  93.834  1.00 46.91 ? 56   THR V CB  1 
ATOM   9646  N  N   . GLU M  13 57  ? 7.038   43.887  93.521  1.00 46.91 ? 57   GLU V N   1 
ATOM   9647  C  CA  . GLU M  13 57  ? 6.776   42.476  93.776  1.00 46.91 ? 57   GLU V CA  1 
ATOM   9648  C  C   . GLU M  13 57  ? 8.062   41.792  94.240  1.00 46.91 ? 57   GLU V C   1 
ATOM   9649  O  O   . GLU M  13 57  ? 8.047   40.628  94.649  1.00 46.91 ? 57   GLU V O   1 
ATOM   9650  C  CB  . GLU M  13 57  ? 6.256   41.799  92.505  1.00 46.91 ? 57   GLU V CB  1 
ATOM   9651  N  N   . THR M  13 58  ? 9.171   42.517  94.142  1.00 46.91 ? 58   THR V N   1 
ATOM   9652  C  CA  . THR M  13 58  ? 10.480  42.013  94.542  1.00 46.91 ? 58   THR V CA  1 
ATOM   9653  C  C   . THR M  13 58  ? 10.931  42.619  95.869  1.00 46.91 ? 58   THR V C   1 
ATOM   9654  O  O   . THR M  13 58  ? 11.619  41.966  96.660  1.00 46.91 ? 58   THR V O   1 
ATOM   9655  C  CB  . THR M  13 58  ? 11.550  42.325  93.475  1.00 46.91 ? 58   THR V CB  1 
ATOM   9656  N  N   . LEU M  13 59  ? 10.552  43.874  96.094  1.00 46.91 ? 59   LEU V N   1 
ATOM   9657  C  CA  . LEU M  13 59  ? 10.904  44.593  97.317  1.00 46.91 ? 59   LEU V CA  1 
ATOM   9658  C  C   . LEU M  13 59  ? 10.042  44.157  98.498  1.00 46.91 ? 59   LEU V C   1 
ATOM   9659  O  O   . LEU M  13 59  ? 10.497  44.162  99.640  1.00 46.91 ? 59   LEU V O   1 
ATOM   9660  C  CB  . LEU M  13 59  ? 10.759  46.101  97.104  1.00 46.91 ? 59   LEU V CB  1 
ATOM   9661  N  N   . ALA M  13 60  ? 8.798   43.784  98.215  1.00 46.91 ? 60   ALA V N   1 
ATOM   9662  C  CA  . ALA M  13 60  ? 7.868   43.342  99.249  1.00 46.91 ? 60   ALA V CA  1 
ATOM   9663  C  C   . ALA M  13 60  ? 8.255   41.981  99.825  1.00 46.91 ? 60   ALA V C   1 
ATOM   9664  O  O   . ALA M  13 60  ? 7.775   41.594  100.894 1.00 46.91 ? 60   ALA V O   1 
ATOM   9665  C  CB  . ALA M  13 60  ? 6.450   43.288  98.689  1.00 46.91 ? 60   ALA V CB  1 
ATOM   9666  N  N   . LEU M  13 61  ? 9.087   41.247  99.091  1.00 46.91 ? 61   LEU V N   1 
ATOM   9667  C  CA  . LEU M  13 61  ? 9.542   39.928  99.516  1.00 46.91 ? 61   LEU V CA  1 
ATOM   9668  C  C   . LEU M  13 61  ? 10.848  39.982  100.316 1.00 46.91 ? 61   LEU V C   1 
ATOM   9669  O  O   . LEU M  13 61  ? 11.403  38.941  100.683 1.00 46.91 ? 61   LEU V O   1 
ATOM   9670  C  CB  . LEU M  13 61  ? 9.719   39.017  98.297  1.00 46.91 ? 61   LEU V CB  1 
ATOM   9671  N  N   . ALA M  13 62  ? 11.335  41.192  100.582 1.00 46.91 ? 62   ALA V N   1 
ATOM   9672  C  CA  . ALA M  13 62  ? 12.571  41.381  101.334 1.00 46.91 ? 62   ALA V CA  1 
ATOM   9673  C  C   . ALA M  13 62  ? 12.410  41.045  102.813 1.00 46.91 ? 62   ALA V C   1 
ATOM   9674  O  O   . ALA M  13 62  ? 11.311  40.728  103.278 1.00 46.91 ? 62   ALA V O   1 
ATOM   9675  C  CB  . ALA M  13 62  ? 13.078  42.813  101.169 1.00 46.91 ? 62   ALA V CB  1 
ATOM   9676  N  N   . THR M  13 63  ? 13.511  41.125  103.554 1.00 46.91 ? 63   THR V N   1 
ATOM   9677  C  CA  . THR M  13 63  ? 13.496  40.827  104.984 1.00 46.91 ? 63   THR V CA  1 
ATOM   9678  C  C   . THR M  13 63  ? 14.266  41.870  105.792 1.00 46.91 ? 63   THR V C   1 
ATOM   9679  O  O   . THR M  13 63  ? 15.477  41.751  105.985 1.00 46.91 ? 63   THR V O   1 
ATOM   9680  C  CB  . THR M  13 63  ? 14.094  39.436  105.266 1.00 46.91 ? 63   THR V CB  1 
ATOM   9681  N  N   . PRO M  13 64  ? 13.569  42.903  106.290 1.00 46.91 ? 64   PRO V N   1 
ATOM   9682  C  CA  . PRO M  13 64  ? 12.136  43.199  106.174 1.00 46.91 ? 64   PRO V CA  1 
ATOM   9683  C  C   . PRO M  13 64  ? 11.775  43.839  104.835 1.00 46.91 ? 64   PRO V C   1 
ATOM   9684  O  O   . PRO M  13 64  ? 12.648  44.311  104.106 1.00 46.91 ? 64   PRO V O   1 
ATOM   9685  C  CB  . PRO M  13 64  ? 11.880  44.160  107.335 1.00 46.91 ? 64   PRO V CB  1 
ATOM   9686  N  N   . PRO M  13 65  ? 10.476  43.847  104.497 1.00 46.91 ? 65   PRO V N   1 
ATOM   9687  C  CA  . PRO M  13 65  ? 9.929   44.412  103.259 1.00 46.91 ? 65   PRO V CA  1 
ATOM   9688  C  C   . PRO M  13 65  ? 10.367  45.860  103.060 1.00 46.91 ? 65   PRO V C   1 
ATOM   9689  O  O   . PRO M  13 65  ? 10.099  46.720  103.905 1.00 46.91 ? 65   PRO V O   1 
ATOM   9690  C  CB  . PRO M  13 65  ? 8.417   44.315  103.465 1.00 46.91 ? 65   PRO V CB  1 
ATOM   9691  N  N   . ARG M  13 66  ? 11.065  46.112  101.957 1.00 46.91 ? 66   ARG V N   1 
ATOM   9692  C  CA  . ARG M  13 66  ? 11.555  47.448  101.630 1.00 46.91 ? 66   ARG V CA  1 
ATOM   9693  C  C   . ARG M  13 66  ? 10.674  48.125  100.578 1.00 46.91 ? 66   ARG V C   1 
ATOM   9694  O  O   . ARG M  13 66  ? 11.173  48.832  99.699  1.00 46.91 ? 66   ARG V O   1 
ATOM   9695  C  CB  . ARG M  13 66  ? 13.003  47.370  101.133 1.00 46.91 ? 66   ARG V CB  1 
ATOM   9696  N  N   . ASP M  13 67  ? 9.367   47.885  100.658 1.00 46.91 ? 67   ASP V N   1 
ATOM   9697  C  CA  . ASP M  13 67  ? 8.415   48.476  99.720  1.00 46.91 ? 67   ASP V CA  1 
ATOM   9698  C  C   . ASP M  13 67  ? 7.941   49.857  100.176 1.00 46.91 ? 67   ASP V C   1 
ATOM   9699  O  O   . ASP M  13 67  ? 7.108   50.483  99.518  1.00 46.91 ? 67   ASP V O   1 
ATOM   9700  C  CB  . ASP M  13 67  ? 7.209   47.550  99.530  1.00 46.91 ? 67   ASP V CB  1 
ATOM   9701  N  N   . ASN M  13 68  ? 8.436   50.299  101.328 1.00 46.91 ? 68   ASN V N   1 
ATOM   9702  C  CA  . ASN M  13 68  ? 8.070   51.600  101.876 1.00 46.91 ? 68   ASN V CA  1 
ATOM   9703  C  C   . ASN M  13 68  ? 9.103   52.664  101.510 1.00 46.91 ? 68   ASN V C   1 
ATOM   9704  O  O   . ASN M  13 68  ? 9.991   52.426  100.689 1.00 46.91 ? 68   ASN V O   1 
ATOM   9705  C  CB  . ASN M  13 68  ? 7.933   51.510  103.399 1.00 46.91 ? 68   ASN V CB  1 
ATOM   9706  N  N   . ILE M  13 69  ? 8.964   53.847  102.103 1.00 46.91 ? 69   ILE V N   1 
ATOM   9707  C  CA  . ILE M  13 69  ? 9.887   54.949  101.861 1.00 46.91 ? 69   ILE V CA  1 
ATOM   9708  C  C   . ILE M  13 69  ? 10.864  55.059  103.029 1.00 46.91 ? 69   ILE V C   1 
ATOM   9709  O  O   . ILE M  13 69  ? 11.930  55.663  102.909 1.00 46.91 ? 69   ILE V O   1 
ATOM   9710  C  CB  . ILE M  13 69  ? 9.137   56.287  101.704 1.00 46.91 ? 69   ILE V CB  1 
ATOM   9711  N  N   . GLU M  13 70  ? 10.463  54.506  104.170 1.00 46.91 ? 70   GLU V N   1 
ATOM   9712  C  CA  . GLU M  13 70  ? 11.288  54.519  105.372 1.00 46.91 ? 70   GLU V CA  1 
ATOM   9713  C  C   . GLU M  13 70  ? 12.054  53.207  105.525 1.00 46.91 ? 70   GLU V C   1 
ATOM   9714  O  O   . GLU M  13 70  ? 12.910  53.078  106.405 1.00 46.91 ? 70   GLU V O   1 
ATOM   9715  C  CB  . GLU M  13 70  ? 10.416  54.753  106.608 1.00 46.91 ? 70   GLU V CB  1 
ATOM   9716  N  N   . GLY M  13 71  ? 11.701  52.222  104.703 1.00 46.91 ? 71   GLY V N   1 
ATOM   9717  C  CA  . GLY M  13 71  ? 12.362  50.930  104.752 1.00 46.91 ? 71   GLY V CA  1 
ATOM   9718  C  C   . GLY M  13 71  ? 13.432  50.775  103.686 1.00 46.91 ? 71   GLY V C   1 
ATOM   9719  O  O   . GLY M  13 71  ? 14.452  50.122  103.913 1.00 46.91 ? 71   GLY V O   1 
ATOM   9720  N  N   . LEU M  13 72  ? 13.181  51.353  102.515 1.00 46.91 ? 72   LEU V N   1 
ATOM   9721  C  CA  . LEU M  13 72  ? 14.119  51.291  101.397 1.00 46.91 ? 72   LEU V CA  1 
ATOM   9722  C  C   . LEU M  13 72  ? 15.273  52.277  101.574 1.00 46.91 ? 72   LEU V C   1 
ATOM   9723  O  O   . LEU M  13 72  ? 16.390  52.020  101.122 1.00 46.91 ? 72   LEU V O   1 
ATOM   9724  C  CB  . LEU M  13 72  ? 13.390  51.578  100.082 1.00 46.91 ? 72   LEU V CB  1 
ATOM   9725  N  N   . VAL M  13 73  ? 14.988  53.403  102.222 1.00 46.91 ? 73   VAL V N   1 
ATOM   9726  C  CA  . VAL M  13 73  ? 15.986  54.442  102.467 1.00 46.91 ? 73   VAL V CA  1 
ATOM   9727  C  C   . VAL M  13 73  ? 17.097  53.968  103.400 1.00 46.91 ? 73   VAL V C   1 
ATOM   9728  O  O   . VAL M  13 73  ? 18.261  54.343  103.234 1.00 46.91 ? 73   VAL V O   1 
ATOM   9729  C  CB  . VAL M  13 73  ? 15.339  55.702  103.069 1.00 46.91 ? 73   VAL V CB  1 
ATOM   9730  N  N   . ASP M  13 74  ? 16.723  53.192  104.413 1.00 46.91 ? 74   ASP V N   1 
ATOM   9731  C  CA  . ASP M  13 74  ? 17.680  52.660  105.376 1.00 46.91 ? 74   ASP V CA  1 
ATOM   9732  C  C   . ASP M  13 74  ? 18.535  51.561  104.747 1.00 46.91 ? 74   ASP V C   1 
ATOM   9733  O  O   . ASP M  13 74  ? 19.674  51.337  105.162 1.00 46.91 ? 74   ASP V O   1 
ATOM   9734  C  CB  . ASP M  13 74  ? 16.946  52.110  106.604 1.00 46.91 ? 74   ASP V CB  1 
ATOM   9735  N  N   . TYR M  13 75  ? 17.963  50.865  103.768 1.00 46.91 ? 75   TYR V N   1 
ATOM   9736  C  CA  . TYR M  13 75  ? 18.652  49.784  103.069 1.00 46.91 ? 75   TYR V CA  1 
ATOM   9737  C  C   . TYR M  13 75  ? 19.739  50.294  102.121 1.00 46.91 ? 75   TYR V C   1 
ATOM   9738  O  O   . TYR M  13 75  ? 20.654  49.547  101.762 1.00 46.91 ? 75   TYR V O   1 
ATOM   9739  C  CB  . TYR M  13 75  ? 17.645  48.937  102.290 1.00 46.91 ? 75   TYR V CB  1 
ATOM   9740  N  N   . MET M  13 76  ? 19.616  51.547  101.694 1.00 46.91 ? 76   MET V N   1 
ATOM   9741  C  CA  . MET M  13 76  ? 20.587  52.156  100.787 1.00 46.91 ? 76   MET V CA  1 
ATOM   9742  C  C   . MET M  13 76  ? 21.967  52.235  101.432 1.00 46.91 ? 76   MET V C   1 
ATOM   9743  O  O   . MET M  13 76  ? 22.959  51.787  100.851 1.00 46.91 ? 76   MET V O   1 
ATOM   9744  C  CB  . MET M  13 76  ? 20.125  53.556  100.373 1.00 46.91 ? 76   MET V CB  1 
ATOM   9745  N  N   . LYS M  13 77  ? 22.028  52.840  102.614 1.00 46.91 ? 77   LYS V N   1 
ATOM   9746  C  CA  . LYS M  13 77  ? 23.279  52.972  103.350 1.00 46.91 ? 77   LYS V CA  1 
ATOM   9747  C  C   . LYS M  13 77  ? 23.688  51.607  103.899 1.00 46.91 ? 77   LYS V C   1 
ATOM   9748  O  O   . LYS M  13 77  ? 24.848  51.204  103.792 1.00 46.91 ? 77   LYS V O   1 
ATOM   9749  C  CB  . LYS M  13 77  ? 23.114  53.970  104.500 1.00 46.91 ? 77   LYS V CB  1 
ATOM   9750  N  N   . ASN M  13 78  ? 22.723  50.906  104.490 1.00 46.91 ? 78   ASN V N   1 
ATOM   9751  C  CA  . ASN M  13 78  ? 22.951  49.585  105.066 1.00 46.91 ? 78   ASN V CA  1 
ATOM   9752  C  C   . ASN M  13 78  ? 22.557  48.459  104.108 1.00 46.91 ? 78   ASN V C   1 
ATOM   9753  O  O   . ASN M  13 78  ? 21.570  47.749  104.331 1.00 46.91 ? 78   ASN V O   1 
ATOM   9754  C  CB  . ASN M  13 78  ? 22.185  49.448  106.384 1.00 46.91 ? 78   ASN V CB  1 
ATOM   9755  N  N   . PRO M  13 79  ? 23.352  48.261  103.045 1.00 46.91 ? 79   PRO V N   1 
ATOM   9756  C  CA  . PRO M  13 79  ? 23.200  47.258  101.984 1.00 46.91 ? 79   PRO V CA  1 
ATOM   9757  C  C   . PRO M  13 79  ? 23.102  45.826  102.510 1.00 46.91 ? 79   PRO V C   1 
ATOM   9758  O  O   . PRO M  13 79  ? 23.750  45.470  103.497 1.00 46.91 ? 79   PRO V O   1 
ATOM   9759  C  CB  . PRO M  13 79  ? 24.461  47.446  101.139 1.00 46.91 ? 79   PRO V CB  1 
ATOM   9760  N  N   . THR M  13 80  ? 22.306  45.007  101.828 1.00 46.91 ? 80   THR V N   1 
ATOM   9761  C  CA  . THR M  13 80  ? 22.118  43.617  102.221 1.00 46.91 ? 80   THR V CA  1 
ATOM   9762  C  C   . THR M  13 80  ? 22.421  42.653  101.073 1.00 46.91 ? 80   THR V C   1 
ATOM   9763  O  O   . THR M  13 80  ? 22.964  43.049  100.037 1.00 46.91 ? 80   THR V O   1 
ATOM   9764  C  CB  . THR M  13 80  ? 20.680  43.368  102.714 1.00 46.91 ? 80   THR V CB  1 
ATOM   9765  N  N   . THR M  13 81  ? 22.046  41.389  101.256 1.00 46.91 ? 81   THR V N   1 
ATOM   9766  C  CA  . THR M  13 81  ? 22.271  40.359  100.249 1.00 46.91 ? 81   THR V CA  1 
ATOM   9767  C  C   . THR M  13 81  ? 21.098  39.384  100.151 1.00 46.91 ? 81   THR V C   1 
ATOM   9768  O  O   . THR M  13 81  ? 21.234  38.201  100.468 1.00 46.91 ? 81   THR V O   1 
ATOM   9769  C  CB  . THR M  13 81  ? 23.563  39.573  100.538 1.00 46.91 ? 81   THR V CB  1 
ATOM   9770  N  N   . TYR M  13 82  ? 19.952  39.891  99.698  1.00 46.91 ? 82   TYR V N   1 
ATOM   9771  C  CA  . TYR M  13 82  ? 18.731  39.095  99.530  1.00 46.91 ? 82   TYR V CA  1 
ATOM   9772  C  C   . TYR M  13 82  ? 18.158  38.497  100.820 1.00 46.91 ? 82   TYR V C   1 
ATOM   9773  O  O   . TYR M  13 82  ? 17.194  39.029  101.371 1.00 46.91 ? 82   TYR V O   1 
ATOM   9774  C  CB  . TYR M  13 82  ? 18.950  37.994  98.485  1.00 46.91 ? 82   TYR V CB  1 
ATOM   9775  N  N   . ASP M  13 83  ? 18.718  37.374  101.266 1.00 46.91 ? 83   ASP V N   1 
ATOM   9776  C  CA  . ASP M  13 83  ? 18.264  36.702  102.485 1.00 46.91 ? 83   ASP V CA  1 
ATOM   9777  C  C   . ASP M  13 83  ? 18.458  37.565  103.731 1.00 46.91 ? 83   ASP V C   1 
ATOM   9778  O  O   . ASP M  13 83  ? 17.846  37.316  104.775 1.00 46.91 ? 83   ASP V O   1 
ATOM   9779  C  CB  . ASP M  13 83  ? 18.993  35.368  102.664 1.00 46.91 ? 83   ASP V CB  1 
ATOM   9780  N  N   . GLY M  13 84  ? 19.330  38.564  103.620 1.00 46.91 ? 84   GLY V N   1 
ATOM   9781  C  CA  . GLY M  13 84  ? 19.593  39.457  104.734 1.00 46.91 ? 84   GLY V CA  1 
ATOM   9782  C  C   . GLY M  13 84  ? 20.406  38.820  105.845 1.00 46.91 ? 84   GLY V C   1 
ATOM   9783  O  O   . GLY M  13 84  ? 20.252  39.172  107.017 1.00 46.91 ? 84   GLY V O   1 
ATOM   9784  N  N   . GLU M  13 85  ? 21.271  37.881  105.475 1.00 46.91 ? 85   GLU V N   1 
ATOM   9785  C  CA  . GLU M  13 85  ? 22.120  37.185  106.435 1.00 46.91 ? 85   GLU V CA  1 
ATOM   9786  C  C   . GLU M  13 85  ? 23.582  37.594  106.280 1.00 46.91 ? 85   GLU V C   1 
ATOM   9787  O  O   . GLU M  13 85  ? 24.268  37.865  107.270 1.00 46.91 ? 85   GLU V O   1 
ATOM   9788  C  CB  . GLU M  13 85  ? 21.977  35.671  106.266 1.00 46.91 ? 85   GLU V CB  1 
ATOM   9789  N  N   . GLN M  13 86  ? 24.068  37.591  105.041 1.00 46.91 ? 86   GLN V N   1 
ATOM   9790  C  CA  . GLN M  13 86  ? 25.445  37.972  104.753 1.00 46.91 ? 86   GLN V CA  1 
ATOM   9791  C  C   . GLN M  13 86  ? 25.530  39.464  104.454 1.00 46.91 ? 86   GLN V C   1 
ATOM   9792  O  O   . GLN M  13 86  ? 25.014  39.931  103.438 1.00 46.91 ? 86   GLN V O   1 
ATOM   9793  C  CB  . GLN M  13 86  ? 25.983  37.173  103.562 1.00 46.91 ? 86   GLN V CB  1 
ATOM   9794  N  N   . GLU M  13 87  ? 26.192  40.202  105.338 1.00 46.91 ? 87   GLU V N   1 
ATOM   9795  C  CA  . GLU M  13 87  ? 26.347  41.644  105.176 1.00 46.91 ? 87   GLU V CA  1 
ATOM   9796  C  C   . GLU M  13 87  ? 27.212  41.993  103.966 1.00 46.91 ? 87   GLU V C   1 
ATOM   9797  O  O   . GLU M  13 87  ? 28.420  41.733  103.956 1.00 46.91 ? 87   GLU V O   1 
ATOM   9798  C  CB  . GLU M  13 87  ? 26.946  42.261  106.442 1.00 46.91 ? 87   GLU V CB  1 
ATOM   9799  N  N   . ILE M  13 88  ? 26.584  42.567  102.945 1.00 46.91 ? 88   ILE V N   1 
ATOM   9800  C  CA  . ILE M  13 88  ? 27.284  42.961  101.725 1.00 46.91 ? 88   ILE V CA  1 
ATOM   9801  C  C   . ILE M  13 88  ? 27.588  44.461  101.749 1.00 46.91 ? 88   ILE V C   1 
ATOM   9802  O  O   . ILE M  13 88  ? 27.284  45.189  100.802 1.00 46.91 ? 88   ILE V O   1 
ATOM   9803  C  CB  . ILE M  13 88  ? 26.454  42.621  100.469 1.00 46.91 ? 88   ILE V CB  1 
ATOM   9804  N  N   . ALA M  13 89  ? 28.192  44.907  102.846 1.00 46.91 ? 89   ALA V N   1 
ATOM   9805  C  CA  . ALA M  13 89  ? 28.540  46.311  103.027 1.00 46.91 ? 89   ALA V CA  1 
ATOM   9806  C  C   . ALA M  13 89  ? 29.827  46.705  102.306 1.00 46.91 ? 89   ALA V C   1 
ATOM   9807  O  O   . ALA M  13 89  ? 30.228  47.871  102.332 1.00 46.91 ? 89   ALA V O   1 
ATOM   9808  C  CB  . ALA M  13 89  ? 28.651  46.629  104.510 1.00 46.91 ? 89   ALA V CB  1 
ATOM   9809  N  N   . GLU M  13 90  ? 30.491  45.727  101.696 1.00 46.91 ? 90   GLU V N   1 
ATOM   9810  C  CA  . GLU M  13 90  ? 31.735  45.982  100.978 1.00 46.91 ? 90   GLU V CA  1 
ATOM   9811  C  C   . GLU M  13 90  ? 31.652  45.564  99.513  1.00 46.91 ? 90   GLU V C   1 
ATOM   9812  O  O   . GLU M  13 90  ? 32.458  46.000  98.690  1.00 46.91 ? 90   GLU V O   1 
ATOM   9813  C  CB  . GLU M  13 90  ? 32.895  45.253  101.659 1.00 46.91 ? 90   GLU V CB  1 
ATOM   9814  N  N   . VAL M  13 91  ? 30.703  44.686  99.200  1.00 46.91 ? 91   VAL V N   1 
ATOM   9815  C  CA  . VAL M  13 91  ? 30.517  44.207  97.835  1.00 46.91 ? 91   VAL V CA  1 
ATOM   9816  C  C   . VAL M  13 91  ? 29.778  45.231  96.978  1.00 46.91 ? 91   VAL V C   1 
ATOM   9817  O  O   . VAL M  13 91  ? 30.210  45.556  95.870  1.00 46.91 ? 91   VAL V O   1 
ATOM   9818  C  CB  . VAL M  13 91  ? 29.736  42.879  97.807  1.00 46.91 ? 91   VAL V CB  1 
ATOM   9819  N  N   . HIS M  13 92  ? 28.644  45.708  97.479  1.00 46.91 ? 92   HIS V N   1 
ATOM   9820  C  CA  . HIS M  13 92  ? 27.836  46.689  96.765  1.00 46.91 ? 92   HIS V CA  1 
ATOM   9821  C  C   . HIS M  13 92  ? 28.073  48.102  97.294  1.00 46.91 ? 92   HIS V C   1 
ATOM   9822  O  O   . HIS M  13 92  ? 28.308  48.299  98.484  1.00 46.91 ? 92   HIS V O   1 
ATOM   9823  C  CB  . HIS M  13 92  ? 26.352  46.327  96.879  1.00 46.91 ? 92   HIS V CB  1 
ATOM   9824  C  CG  . HIS M  13 92  ? 25.448  47.214  96.080  1.00 46.91 ? 92   HIS V CG  1 
ATOM   9825  N  ND1 . HIS M  13 92  ? 24.635  48.162  96.659  1.00 46.91 ? 92   HIS V ND1 1 
ATOM   9826  C  CD2 . HIS M  13 92  ? 25.225  47.292  94.746  1.00 46.91 ? 92   HIS V CD2 1 
ATOM   9827  C  CE1 . HIS M  13 92  ? 23.948  48.786  95.719  1.00 46.91 ? 92   HIS V CE1 1 
ATOM   9828  N  NE2 . HIS M  13 92  ? 24.287  48.277  94.549  1.00 46.91 ? 92   HIS V NE2 1 
ATOM   9829  N  N   . PRO M  13 93  ? 28.021  49.104  96.403  1.00 46.91 ? 93   PRO V N   1 
ATOM   9830  C  CA  . PRO M  13 93  ? 28.227  50.509  96.770  1.00 46.91 ? 93   PRO V CA  1 
ATOM   9831  C  C   . PRO M  13 93  ? 27.063  51.043  97.604  1.00 46.91 ? 93   PRO V C   1 
ATOM   9832  O  O   . PRO M  13 93  ? 25.902  50.930  97.205  1.00 46.91 ? 93   PRO V O   1 
ATOM   9833  C  CB  . PRO M  13 93  ? 28.312  51.218  95.420  1.00 46.91 ? 93   PRO V CB  1 
ATOM   9834  N  N   . SER M  13 94  ? 27.381  51.633  98.750  1.00 46.91 ? 94   SER V N   1 
ATOM   9835  C  CA  . SER M  13 94  ? 26.366  52.181  99.645  1.00 46.91 ? 94   SER V CA  1 
ATOM   9836  C  C   . SER M  13 94  ? 26.792  53.539  100.194 1.00 46.91 ? 94   SER V C   1 
ATOM   9837  O  O   . SER M  13 94  ? 27.944  53.944  100.041 1.00 46.91 ? 94   SER V O   1 
ATOM   9838  C  CB  . SER M  13 94  ? 26.098  51.212  100.799 1.00 46.91 ? 94   SER V CB  1 
ATOM   9839  N  N   . LEU M  13 95  ? 25.852  54.245  100.817 1.00 46.91 ? 95   LEU V N   1 
ATOM   9840  C  CA  . LEU M  13 95  ? 26.118  55.563  101.386 1.00 46.91 ? 95   LEU V CA  1 
ATOM   9841  C  C   . LEU M  13 95  ? 27.038  55.515  102.606 1.00 46.91 ? 95   LEU V C   1 
ATOM   9842  O  O   . LEU M  13 95  ? 27.578  56.539  103.023 1.00 46.91 ? 95   LEU V O   1 
ATOM   9843  C  CB  . LEU M  13 95  ? 24.802  56.252  101.756 1.00 46.91 ? 95   LEU V CB  1 
ATOM   9844  N  N   . ARG M  13 96  ? 27.165  54.336  103.207 1.00 46.91 ? 96   ARG V N   1 
ATOM   9845  C  CA  . ARG M  13 96  ? 28.020  54.159  104.376 1.00 46.91 ? 96   ARG V CA  1 
ATOM   9846  C  C   . ARG M  13 96  ? 29.466  53.902  103.967 1.00 46.91 ? 96   ARG V C   1 
ATOM   9847  O  O   . ARG M  13 96  ? 30.394  54.127  104.747 1.00 46.91 ? 96   ARG V O   1 
ATOM   9848  C  CB  . ARG M  13 96  ? 27.510  53.000  105.236 1.00 46.91 ? 96   ARG V CB  1 
ATOM   9849  N  N   . SER M  13 97  ? 29.646  53.410  102.745 1.00 46.91 ? 97   SER V N   1 
ATOM   9850  C  CA  . SER M  13 97  ? 30.971  53.111  102.221 1.00 46.91 ? 97   SER V CA  1 
ATOM   9851  C  C   . SER M  13 97  ? 31.441  54.183  101.240 1.00 46.91 ? 97   SER V C   1 
ATOM   9852  O  O   . SER M  13 97  ? 31.436  53.971  100.029 1.00 46.91 ? 97   SER V O   1 
ATOM   9853  C  CB  . SER M  13 97  ? 30.965  51.738  101.541 1.00 46.91 ? 97   SER V CB  1 
ATOM   9854  N  N   . ALA M  13 98  ? 31.854  55.329  101.772 1.00 46.91 ? 98   ALA V N   1 
ATOM   9855  C  CA  . ALA M  13 98  ? 32.327  56.436  100.944 1.00 46.91 ? 98   ALA V CA  1 
ATOM   9856  C  C   . ALA M  13 98  ? 33.676  56.119  100.299 1.00 46.91 ? 98   ALA V C   1 
ATOM   9857  O  O   . ALA M  13 98  ? 34.135  56.842  99.411  1.00 46.91 ? 98   ALA V O   1 
ATOM   9858  C  CB  . ALA M  13 98  ? 32.424  57.708  101.771 1.00 46.91 ? 98   ALA V CB  1 
ATOM   9859  N  N   . ASP M  13 99  ? 34.327  55.065  100.789 1.00 46.91 ? 99   ASP V N   1 
ATOM   9860  C  CA  . ASP M  13 99  ? 35.620  54.636  100.267 1.00 46.91 ? 99   ASP V CA  1 
ATOM   9861  C  C   . ASP M  13 99  ? 35.464  54.054  98.866  1.00 46.91 ? 99   ASP V C   1 
ATOM   9862  O  O   . ASP M  13 99  ? 36.258  54.351  97.970  1.00 46.91 ? 99   ASP V O   1 
ATOM   9863  C  CB  . ASP M  13 99  ? 36.252  53.597  101.199 1.00 46.91 ? 99   ASP V CB  1 
ATOM   9864  N  N   . ILE M  13 100 ? 34.465  53.193  98.696  1.00 46.91 ? 100  ILE V N   1 
ATOM   9865  C  CA  . ILE M  13 100 ? 34.195  52.571  97.405  1.00 46.91 ? 100  ILE V CA  1 
ATOM   9866  C  C   . ILE M  13 100 ? 33.290  53.460  96.554  1.00 46.91 ? 100  ILE V C   1 
ATOM   9867  O  O   . ILE M  13 100 ? 33.595  53.740  95.392  1.00 46.91 ? 100  ILE V O   1 
ATOM   9868  C  CB  . ILE M  13 100 ? 33.524  51.191  97.574  1.00 46.91 ? 100  ILE V CB  1 
ATOM   9869  N  N   . PHE M  13 101 ? 32.167  53.877  97.133  1.00 46.91 ? 101  PHE V N   1 
ATOM   9870  C  CA  . PHE M  13 101 ? 31.211  54.735  96.443  1.00 46.91 ? 101  PHE V CA  1 
ATOM   9871  C  C   . PHE M  13 101 ? 31.545  56.213  96.628  1.00 46.91 ? 101  PHE V C   1 
ATOM   9872  O  O   . PHE M  13 101 ? 31.012  56.880  97.516  1.00 46.91 ? 101  PHE V O   1 
ATOM   9873  C  CB  . PHE M  13 101 ? 29.788  54.453  96.938  1.00 46.91 ? 101  PHE V CB  1 
ATOM   9874  N  N   . PRO M  13 102 ? 32.444  56.743  95.784  1.00 46.91 ? 102  PRO V N   1 
ATOM   9875  C  CA  . PRO M  13 102 ? 32.858  58.149  95.843  1.00 46.91 ? 102  PRO V CA  1 
ATOM   9876  C  C   . PRO M  13 102 ? 31.876  59.073  95.120  1.00 46.91 ? 102  PRO V C   1 
ATOM   9877  O  O   . PRO M  13 102 ? 32.151  60.261  94.930  1.00 46.91 ? 102  PRO V O   1 
ATOM   9878  C  CB  . PRO M  13 102 ? 34.225  58.143  95.158  1.00 46.91 ? 102  PRO V CB  1 
ATOM   9879  N  N   . LYS M  13 103 ? 30.752  58.509  94.685  1.00 46.91 ? 103  LYS V N   1 
ATOM   9880  C  CA  . LYS M  13 103 ? 29.723  59.268  93.982  1.00 46.91 ? 103  LYS V CA  1 
ATOM   9881  C  C   . LYS M  13 103 ? 28.719  59.882  94.954  1.00 46.91 ? 103  LYS V C   1 
ATOM   9882  O  O   . LYS M  13 103 ? 28.367  61.059  94.836  1.00 46.91 ? 103  LYS V O   1 
ATOM   9883  C  CB  . LYS M  13 103 ? 28.991  58.366  92.986  1.00 46.91 ? 103  LYS V CB  1 
ATOM   9884  N  N   . MET M  13 104 ? 28.237  59.067  95.887  1.00 46.91 ? 104  MET V N   1 
ATOM   9885  C  CA  . MET M  13 104 ? 27.268  59.513  96.884  1.00 46.91 ? 104  MET V CA  1 
ATOM   9886  C  C   . MET M  13 104 ? 27.937  60.103  98.125  1.00 46.91 ? 104  MET V C   1 
ATOM   9887  O  O   . MET M  13 104 ? 27.327  60.168  99.193  1.00 46.91 ? 104  MET V O   1 
ATOM   9888  C  CB  . MET M  13 104 ? 26.357  58.350  97.289  1.00 46.91 ? 104  MET V CB  1 
ATOM   9889  N  N   . ARG M  13 105 ? 29.187  60.534  97.981  1.00 46.91 ? 105  ARG V N   1 
ATOM   9890  C  CA  . ARG M  13 105 ? 29.935  61.117  99.091  1.00 46.91 ? 105  ARG V CA  1 
ATOM   9891  C  C   . ARG M  13 105 ? 29.347  62.457  99.531  1.00 46.91 ? 105  ARG V C   1 
ATOM   9892  O  O   . ARG M  13 105 ? 29.367  62.798  100.716 1.00 46.91 ? 105  ARG V O   1 
ATOM   9893  C  CB  . ARG M  13 105 ? 31.405  61.298  98.700  1.00 46.91 ? 105  ARG V CB  1 
ATOM   9894  N  N   . ASN M  13 106 ? 28.868  63.233  98.562  1.00 46.91 ? 106  ASN V N   1 
ATOM   9895  C  CA  . ASN M  13 106 ? 28.273  64.536  98.836  1.00 46.91 ? 106  ASN V CA  1 
ATOM   9896  C  C   . ASN M  13 106 ? 26.805  64.406  99.238  1.00 46.91 ? 106  ASN V C   1 
ATOM   9897  O  O   . ASN M  13 106 ? 26.284  65.232  99.994  1.00 46.91 ? 106  ASN V O   1 
ATOM   9898  C  CB  . ASN M  13 106 ? 28.396  65.443  97.609  1.00 46.91 ? 106  ASN V CB  1 
ATOM   9899  N  N   . LEU M  13 107 ? 26.139  63.391  98.694  1.00 46.91 ? 107  LEU V N   1 
ATOM   9900  C  CA  . LEU M  13 107 ? 24.731  63.136  98.984  1.00 46.91 ? 107  LEU V CA  1 
ATOM   9901  C  C   . LEU M  13 107 ? 24.515  62.758  100.446 1.00 46.91 ? 107  LEU V C   1 
ATOM   9902  O  O   . LEU M  13 107 ? 25.329  62.056  101.046 1.00 46.91 ? 107  LEU V O   1 
ATOM   9903  C  CB  . LEU M  13 107 ? 24.198  62.024  98.077  1.00 46.91 ? 107  LEU V CB  1 
ATOM   9904  N  N   . THR M  13 108 ? 23.422  63.245  101.021 1.00 46.91 ? 108  THR V N   1 
ATOM   9905  C  CA  . THR M  13 108 ? 23.100  62.955  102.412 1.00 46.91 ? 108  THR V CA  1 
ATOM   9906  C  C   . THR M  13 108 ? 21.886  62.037  102.510 1.00 46.91 ? 108  THR V C   1 
ATOM   9907  O  O   . THR M  13 108 ? 21.489  61.412  101.527 1.00 46.91 ? 108  THR V O   1 
ATOM   9908  C  CB  . THR M  13 108 ? 22.821  64.251  103.195 1.00 46.91 ? 108  THR V CB  1 
ATOM   9909  N  N   . GLU M  13 109 ? 21.300  61.955  103.703 1.00 46.91 ? 109  GLU V N   1 
ATOM   9910  C  CA  . GLU M  13 109 ? 20.125  61.117  103.928 1.00 46.91 ? 109  GLU V CA  1 
ATOM   9911  C  C   . GLU M  13 109 ? 18.887  61.688  103.231 1.00 46.91 ? 109  GLU V C   1 
ATOM   9912  O  O   . GLU M  13 109 ? 17.786  61.154  103.365 1.00 46.91 ? 109  GLU V O   1 
ATOM   9913  C  CB  . GLU M  13 109 ? 19.858  60.974  105.429 1.00 46.91 ? 109  GLU V CB  1 
ATOM   9914  N  N   . LYS M  13 110 ? 19.069  62.811  102.541 1.00 46.91 ? 110  LYS V N   1 
ATOM   9915  C  CA  . LYS M  13 110 ? 17.982  63.465  101.821 1.00 46.91 ? 110  LYS V CA  1 
ATOM   9916  C  C   . LYS M  13 110 ? 17.770  62.840  100.443 1.00 46.91 ? 110  LYS V C   1 
ATOM   9917  O  O   . LYS M  13 110 ? 16.636  62.716  99.979  1.00 46.91 ? 110  LYS V O   1 
ATOM   9918  C  CB  . LYS M  13 110 ? 18.274  64.960  101.670 1.00 46.91 ? 110  LYS V CB  1 
ATOM   9919  N  N   . ASP M  13 111 ? 18.871  62.500  99.780  1.00 46.91 ? 111  ASP V N   1 
ATOM   9920  C  CA  . ASP M  13 111 ? 18.824  61.892  98.452  1.00 46.91 ? 111  ASP V CA  1 
ATOM   9921  C  C   . ASP M  13 111 ? 18.579  60.384  98.507  1.00 46.91 ? 111  ASP V C   1 
ATOM   9922  O  O   . ASP M  13 111 ? 18.440  59.733  97.471  1.00 46.91 ? 111  ASP V O   1 
ATOM   9923  C  CB  . ASP M  13 111 ? 20.124  62.180  97.694  1.00 46.91 ? 111  ASP V CB  1 
ATOM   9924  N  N   . LEU M  13 112 ? 18.554  59.832  99.718  1.00 46.91 ? 112  LEU V N   1 
ATOM   9925  C  CA  . LEU M  13 112 ? 18.328  58.403  99.912  1.00 46.91 ? 112  LEU V CA  1 
ATOM   9926  C  C   . LEU M  13 112 ? 16.866  58.028  99.679  1.00 46.91 ? 112  LEU V C   1 
ATOM   9927  O  O   . LEU M  13 112 ? 16.571  57.021  99.034  1.00 46.91 ? 112  LEU V O   1 
ATOM   9928  C  CB  . LEU M  13 112 ? 18.750  57.988  101.323 1.00 46.91 ? 112  LEU V CB  1 
ATOM   9929  N  N   . VAL M  13 113 ? 15.960  58.829  100.234 1.00 46.91 ? 113  VAL V N   1 
ATOM   9930  C  CA  . VAL M  13 113 ? 14.525  58.594  100.093 1.00 46.91 ? 113  VAL V CA  1 
ATOM   9931  C  C   . VAL M  13 113 ? 14.015  59.016  98.716  1.00 46.91 ? 113  VAL V C   1 
ATOM   9932  O  O   . VAL M  13 113 ? 12.841  58.828  98.396  1.00 46.91 ? 113  VAL V O   1 
ATOM   9933  C  CB  . VAL M  13 113 ? 13.728  59.351  101.172 1.00 46.91 ? 113  VAL V CB  1 
ATOM   9934  N  N   . ALA M  13 114 ? 14.893  59.633  97.929  1.00 46.91 ? 114  ALA V N   1 
ATOM   9935  C  CA  . ALA M  13 114 ? 14.549  60.085  96.586  1.00 46.91 ? 114  ALA V CA  1 
ATOM   9936  C  C   . ALA M  13 114 ? 14.712  58.948  95.582  1.00 46.91 ? 114  ALA V C   1 
ATOM   9937  O  O   . ALA M  13 114 ? 13.823  58.695  94.769  1.00 46.91 ? 114  ALA V O   1 
ATOM   9938  C  CB  . ALA M  13 114 ? 15.417  61.272  96.190  1.00 46.91 ? 114  ALA V CB  1 
ATOM   9939  N  N   . ILE M  13 115 ? 15.863  58.281  95.634  1.00 46.91 ? 115  ILE V N   1 
ATOM   9940  C  CA  . ILE M  13 115 ? 16.154  57.165  94.738  1.00 46.91 ? 115  ILE V CA  1 
ATOM   9941  C  C   . ILE M  13 115 ? 15.292  55.950  95.079  1.00 46.91 ? 115  ILE V C   1 
ATOM   9942  O  O   . ILE M  13 115 ? 15.155  55.027  94.271  1.00 46.91 ? 115  ILE V O   1 
ATOM   9943  C  CB  . ILE M  13 115 ? 17.640  56.760  94.816  1.00 46.91 ? 115  ILE V CB  1 
ATOM   9944  N  N   . ALA M  13 116 ? 14.753  55.941  96.296  1.00 46.91 ? 116  ALA V N   1 
ATOM   9945  C  CA  . ALA M  13 116 ? 13.896  54.860  96.765  1.00 46.91 ? 116  ALA V CA  1 
ATOM   9946  C  C   . ALA M  13 116 ? 12.474  55.068  96.255  1.00 46.91 ? 116  ALA V C   1 
ATOM   9947  O  O   . ALA M  13 116 ? 11.846  54.139  95.745  1.00 46.91 ? 116  ALA V O   1 
ATOM   9948  C  CB  . ALA M  13 116 ? 13.907  54.805  98.287  1.00 46.91 ? 116  ALA V CB  1 
ATOM   9949  N  N   . GLY M  13 117 ? 11.970  56.289  96.416  1.00 46.91 ? 117  GLY V N   1 
ATOM   9950  C  CA  . GLY M  13 117 ? 10.632  56.612  95.958  1.00 46.91 ? 117  GLY V CA  1 
ATOM   9951  C  C   . GLY M  13 117 ? 10.548  56.670  94.445  1.00 46.91 ? 117  GLY V C   1 
ATOM   9952  O  O   . GLY M  13 117 ? 9.456   56.668  93.875  1.00 46.91 ? 117  GLY V O   1 
ATOM   9953  N  N   . HIS M  13 118 ? 11.706  56.755  93.797  1.00 46.91 ? 118  HIS V N   1 
ATOM   9954  C  CA  . HIS M  13 118 ? 11.780  56.808  92.343  1.00 46.91 ? 118  HIS V CA  1 
ATOM   9955  C  C   . HIS M  13 118 ? 11.544  55.422  91.749  1.00 46.91 ? 118  HIS V C   1 
ATOM   9956  O  O   . HIS M  13 118 ? 10.996  55.290  90.654  1.00 46.91 ? 118  HIS V O   1 
ATOM   9957  C  CB  . HIS M  13 118 ? 13.146  57.341  91.898  1.00 46.91 ? 118  HIS V CB  1 
ATOM   9958  C  CG  . HIS M  13 118 ? 13.338  57.345  90.414  1.00 46.91 ? 118  HIS V CG  1 
ATOM   9959  N  ND1 . HIS M  13 118 ? 14.266  56.544  89.782  1.00 46.91 ? 118  HIS V ND1 1 
ATOM   9960  C  CD2 . HIS M  13 118 ? 12.709  58.037  89.435  1.00 46.91 ? 118  HIS V CD2 1 
ATOM   9961  C  CE1 . HIS M  13 118 ? 14.197  56.741  88.477  1.00 46.91 ? 118  HIS V CE1 1 
ATOM   9962  N  NE2 . HIS M  13 118 ? 13.260  57.641  88.241  1.00 46.91 ? 118  HIS V NE2 1 
ATOM   9963  N  N   . ILE M  13 119 ? 12.004  54.398  92.462  1.00 46.91 ? 119  ILE V N   1 
ATOM   9964  C  CA  . ILE M  13 119 ? 11.851  53.015  92.025  1.00 46.91 ? 119  ILE V CA  1 
ATOM   9965  C  C   . ILE M  13 119 ? 10.404  52.548  92.166  1.00 46.91 ? 119  ILE V C   1 
ATOM   9966  O  O   . ILE M  13 119 ? 9.875   51.868  91.285  1.00 46.91 ? 119  ILE V O   1 
ATOM   9967  C  CB  . ILE M  13 119 ? 12.757  52.072  92.839  1.00 46.91 ? 119  ILE V CB  1 
ATOM   9968  N  N   . LEU M  13 120 ? 9.782   52.903  93.287  1.00 46.91 ? 120  LEU V N   1 
ATOM   9969  C  CA  . LEU M  13 120 ? 8.399   52.529  93.563  1.00 46.91 ? 120  LEU V CA  1 
ATOM   9970  C  C   . LEU M  13 120 ? 7.422   53.211  92.609  1.00 46.91 ? 120  LEU V C   1 
ATOM   9971  O  O   . LEU M  13 120 ? 6.465   52.590  92.138  1.00 46.91 ? 120  LEU V O   1 
ATOM   9972  C  CB  . LEU M  13 120 ? 8.037   52.877  95.010  1.00 46.91 ? 120  LEU V CB  1 
ATOM   9973  N  N   . VAL M  13 121 ? 7.653   54.496  92.352  1.00 46.91 ? 121  VAL V N   1 
ATOM   9974  C  CA  . VAL M  13 121 ? 6.807   55.278  91.457  1.00 46.91 ? 121  VAL V CA  1 
ATOM   9975  C  C   . VAL M  13 121 ? 6.965   54.840  90.002  1.00 46.91 ? 121  VAL V C   1 
ATOM   9976  O  O   . VAL M  13 121 ? 6.056   55.022  89.191  1.00 46.91 ? 121  VAL V O   1 
ATOM   9977  C  CB  . VAL M  13 121 ? 7.125   56.782  91.557  1.00 46.91 ? 121  VAL V CB  1 
ATOM   9978  N  N   . GLU M  13 122 ? 8.127   54.280  89.677  1.00 46.91 ? 122  GLU V N   1 
ATOM   9979  C  CA  . GLU M  13 122 ? 8.409   53.812  88.324  1.00 46.91 ? 122  GLU V CA  1 
ATOM   9980  C  C   . GLU M  13 122 ? 7.484   52.663  87.932  1.00 46.91 ? 122  GLU V C   1 
ATOM   9981  O  O   . GLU M  13 122 ? 7.191   52.463  86.752  1.00 46.91 ? 122  GLU V O   1 
ATOM   9982  C  CB  . GLU M  13 122 ? 9.869   53.368  88.210  1.00 46.91 ? 122  GLU V CB  1 
ATOM   9983  N  N   . PRO M  13 123 ? 7.023   51.887  88.925  1.00 46.91 ? 123  PRO V N   1 
ATOM   9984  C  CA  . PRO M  13 123 ? 6.127   50.739  88.749  1.00 46.91 ? 123  PRO V CA  1 
ATOM   9985  C  C   . PRO M  13 123 ? 4.648   51.128  88.716  1.00 46.91 ? 123  PRO V C   1 
ATOM   9986  O  O   . PRO M  13 123 ? 3.777   50.259  88.624  1.00 46.91 ? 123  PRO V O   1 
ATOM   9987  C  CB  . PRO M  13 123 ? 6.441   49.859  89.959  1.00 46.91 ? 123  PRO V CB  1 
ATOM   9988  N  N   . LYS M  13 124 ? 4.368   52.424  88.818  1.00 46.91 ? 124  LYS V N   1 
ATOM   9989  C  CA  . LYS M  13 124 ? 2.996   52.924  88.801  1.00 46.91 ? 124  LYS V CA  1 
ATOM   9990  C  C   . LYS M  13 124 ? 2.644   53.611  87.480  1.00 46.91 ? 124  LYS V C   1 
ATOM   9991  O  O   . LYS M  13 124 ? 1.531   54.118  87.311  1.00 46.91 ? 124  LYS V O   1 
ATOM   9992  C  CB  . LYS M  13 124 ? 2.774   53.893  89.966  1.00 46.91 ? 124  LYS V CB  1 
ATOM   9993  N  N   . ILE M  13 125 ? 3.599   53.636  86.554  1.00 46.91 ? 125  ILE V N   1 
ATOM   9994  C  CA  . ILE M  13 125 ? 3.402   54.261  85.249  1.00 46.91 ? 125  ILE V CA  1 
ATOM   9995  C  C   . ILE M  13 125 ? 2.582   53.383  84.305  1.00 46.91 ? 125  ILE V C   1 
ATOM   9996  O  O   . ILE M  13 125 ? 1.847   53.892  83.450  1.00 46.91 ? 125  ILE V O   1 
ATOM   9997  C  CB  . ILE M  13 125 ? 4.753   54.580  84.580  1.00 46.91 ? 125  ILE V CB  1 
ATOM   9998  N  N   . LEU M  13 126 ? 2.728   52.070  84.446  1.00 46.91 ? 126  LEU V N   1 
ATOM   9999  C  CA  . LEU M  13 126 ? 2.007   51.119  83.610  1.00 46.91 ? 126  LEU V CA  1 
ATOM   10000 C  C   . LEU M  13 126 ? 1.093   50.202  84.421  1.00 46.91 ? 126  LEU V C   1 
ATOM   10001 O  O   . LEU M  13 126 ? 1.025   50.298  85.649  1.00 46.91 ? 126  LEU V O   1 
ATOM   10002 C  CB  . LEU M  13 126 ? 2.992   50.280  82.793  1.00 46.91 ? 126  LEU V CB  1 
ATOM   10003 N  N   . GLY M  13 127 ? 0.378   49.327  83.720  1.00 46.91 ? 127  GLY V N   1 
ATOM   10004 C  CA  . GLY M  13 127 ? -0.530  48.405  84.378  1.00 46.91 ? 127  GLY V CA  1 
ATOM   10005 C  C   . GLY M  13 127 ? 0.115   47.129  84.888  1.00 46.91 ? 127  GLY V C   1 
ATOM   10006 O  O   . GLY M  13 127 ? -0.209  46.662  85.982  1.00 46.91 ? 127  GLY V O   1 
ATOM   10007 N  N   . ASP M  13 128 ? 0.997   46.543  84.084  1.00 46.91 ? 128  ASP V N   1 
ATOM   10008 C  CA  . ASP M  13 128 ? 1.679   45.308  84.465  1.00 46.91 ? 128  ASP V CA  1 
ATOM   10009 C  C   . ASP M  13 128 ? 3.016   45.134  83.746  1.00 46.91 ? 128  ASP V C   1 
ATOM   10010 O  O   . ASP M  13 128 ? 3.766   44.200  84.037  1.00 46.91 ? 128  ASP V O   1 
ATOM   10011 C  CB  . ASP M  13 128 ? 0.783   44.098  84.173  1.00 46.91 ? 128  ASP V CB  1 
ATOM   10012 N  N   . LYS M  13 129 ? 3.297   46.021  82.795  1.00 46.91 ? 129  LYS V N   1 
ATOM   10013 C  CA  . LYS M  13 129 ? 4.536   45.964  82.026  1.00 46.91 ? 129  LYS V CA  1 
ATOM   10014 C  C   . LYS M  13 129 ? 5.735   46.547  82.771  1.00 46.91 ? 129  LYS V C   1 
ATOM   10015 O  O   . LYS M  13 129 ? 5.660   47.643  83.329  1.00 46.91 ? 129  LYS V O   1 
ATOM   10016 C  CB  . LYS M  13 129 ? 4.362   46.683  80.688  1.00 46.91 ? 129  LYS V CB  1 
ATOM   10017 N  N   . TRP M  13 130 ? 6.847   45.818  82.739  1.00 46.91 ? 130  TRP V N   1 
ATOM   10018 C  CA  . TRP M  13 130 ? 8.081   46.241  83.398  1.00 46.91 ? 130  TRP V CA  1 
ATOM   10019 C  C   . TRP M  13 130 ? 9.312   45.909  82.549  1.00 46.91 ? 130  TRP V C   1 
ATOM   10020 O  O   . TRP M  13 130 ? 9.133   45.379  81.428  1.00 46.91 ? 130  TRP V O   1 
ATOM   10021 C  CB  . TRP M  13 130 ? 8.201   45.579  84.777  1.00 46.91 ? 130  TRP V CB  1 
ATOM   10022 C  CG  . TRP M  13 130 ? 9.478   45.899  85.512  1.00 46.91 ? 130  TRP V CG  1 
ATOM   10023 C  CD1 . TRP M  13 130 ? 10.620  45.147  85.537  1.00 46.91 ? 130  TRP V CD1 1 
ATOM   10024 C  CD2 . TRP M  13 130 ? 9.739   47.046  86.330  1.00 46.91 ? 130  TRP V CD2 1 
ATOM   10025 N  NE1 . TRP M  13 130 ? 11.573  45.753  86.315  1.00 46.91 ? 130  TRP V NE1 1 
ATOM   10026 C  CE2 . TRP M  13 130 ? 11.060  46.922  86.815  1.00 46.91 ? 130  TRP V CE2 1 
ATOM   10027 C  CE3 . TRP M  13 130 ? 8.987   48.170  86.700  1.00 46.91 ? 130  TRP V CE3 1 
ATOM   10028 C  CZ2 . TRP M  13 130 ? 11.645  47.878  87.655  1.00 46.91 ? 130  TRP V CZ2 1 
ATOM   10029 C  CZ3 . TRP M  13 130 ? 9.569   49.121  87.535  1.00 46.91 ? 130  TRP V CZ3 1 
ATOM   10030 C  CH2 . TRP M  13 130 ? 10.886  48.967  88.001  1.00 46.91 ? 130  TRP V CH2 1 
ATOM   10031 N  N   . UNK N  14 1   ? -7.458  84.587  70.905  1.00 46.91 ? 1    UNK X N   1 
ATOM   10032 C  CA  . UNK N  14 1   ? -8.939  84.419  70.829  1.00 46.91 ? 1    UNK X CA  1 
ATOM   10033 C  C   . UNK N  14 1   ? -9.328  83.366  69.794  1.00 46.91 ? 1    UNK X C   1 
ATOM   10034 O  O   . UNK N  14 1   ? -9.816  82.287  70.147  1.00 46.91 ? 1    UNK X O   1 
ATOM   10035 C  CB  . UNK N  14 1   ? -9.601  85.753  70.499  1.00 46.91 ? 1    UNK X CB  1 
ATOM   10036 N  N   . UNK N  14 2   ? -9.109  83.684  68.521  1.00 46.91 ? 2    UNK X N   1 
ATOM   10037 C  CA  . UNK N  14 2   ? -9.435  82.777  67.425  1.00 46.91 ? 2    UNK X CA  1 
ATOM   10038 C  C   . UNK N  14 2   ? -8.519  83.017  66.231  1.00 46.91 ? 2    UNK X C   1 
ATOM   10039 O  O   . UNK N  14 2   ? -8.096  82.072  65.566  1.00 46.91 ? 2    UNK X O   1 
ATOM   10040 C  CB  . UNK N  14 2   ? -10.897 82.949  67.013  1.00 46.91 ? 2    UNK X CB  1 
ATOM   10041 N  N   . UNK N  14 3   ? -8.222  84.285  65.965  1.00 46.91 ? 3    UNK X N   1 
ATOM   10042 C  CA  . UNK N  14 3   ? -7.351  84.661  64.858  1.00 46.91 ? 3    UNK X CA  1 
ATOM   10043 C  C   . UNK N  14 3   ? -6.213  85.553  65.354  1.00 46.91 ? 3    UNK X C   1 
ATOM   10044 O  O   . UNK N  14 3   ? -6.229  86.772  65.169  1.00 46.91 ? 3    UNK X O   1 
ATOM   10045 C  CB  . UNK N  14 3   ? -8.155  85.366  63.769  1.00 46.91 ? 3    UNK X CB  1 
ATOM   10046 N  N   . UNK N  14 4   ? -5.247  84.932  66.023  1.00 46.91 ? 4    UNK X N   1 
ATOM   1