data_1J07
# 
_entry.id   1J07 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1J07         
RCSB  RCSB005465   
WWPDB D_1000005465 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1MAA .                   unspecified 
PDB 1MAH .                   unspecified 
PDB 1N5M 'gallamine complex' unspecified 
PDB 1J06 'apo form'          unspecified 
PDB 1N5R 'propidium complex' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1J07 
_pdbx_database_status.recvd_initial_deposition_date   2002-11-07 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bourne, Y.'  1 ? 
'Taylor, P.'  2 ? 
'Radic, Z.'   3 ? 
'Marchot, P.' 4 ? 
# 
_citation.id                        primary 
_citation.title                     
'Structural insights into ligand interactions at the acetylcholinesterase peripheral anionic site' 
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_volume            22 
_citation.page_first                1 
_citation.page_last                 12 
_citation.year                      2003 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12505979 
_citation.pdbx_database_id_DOI      10.1093/emboj/cdg005 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bourne, Y.'  1 ? 
primary 'Taylor, P.'  2 ? 
primary 'Radic, Z.'   3 ? 
primary 'Marchot, P.' 4 ? 
# 
_cell.entry_id           1J07 
_cell.length_a           79.531 
_cell.length_b           112.314 
_cell.length_c           226.964 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1J07 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man acetylcholinesterase                                                   59764.488 2   3.1.1.7 ? 
'CATALYTIC DOMAIN' ? 
2 branched    man 'alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose'  367.349   1   ?       ? ? ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                               221.208   2   ?       ? ? ? 
4 non-polymer syn 'CARBONATE ION'                                                        60.009    2   ?       ? ? ? 
5 non-polymer syn 'CHLORIDE ION'                                                         35.453    2   ?       ? ? ? 
6 non-polymer syn 
;3,8-DIAMINO-5,10'-(TRIMETHYLAMMONIUM)DECYL-6-PHENYL PHENANTHRIDINIUM
;
484.719   2   ?       ? ?                  ? 
7 non-polymer syn 'HEXAETHYLENE GLYCOL'                                                  282.331   1   ?       ? ? ? 
8 non-polymer syn 'TETRAETHYLENE GLYCOL'                                                 194.226   1   ?       ? ? ? 
9 water       nat water                                                                  18.015    385 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   GLY n 
1 3   ARG n 
1 4   GLU n 
1 5   ASP n 
1 6   PRO n 
1 7   GLN n 
1 8   LEU n 
1 9   LEU n 
1 10  VAL n 
1 11  ARG n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  GLY n 
1 16  GLN n 
1 17  LEU n 
1 18  ARG n 
1 19  GLY n 
1 20  ILE n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  ALA n 
1 25  PRO n 
1 26  GLY n 
1 27  GLY n 
1 28  PRO n 
1 29  VAL n 
1 30  SER n 
1 31  ALA n 
1 32  PHE n 
1 33  LEU n 
1 34  GLY n 
1 35  ILE n 
1 36  PRO n 
1 37  PHE n 
1 38  ALA n 
1 39  GLU n 
1 40  PRO n 
1 41  PRO n 
1 42  VAL n 
1 43  GLY n 
1 44  SER n 
1 45  ARG n 
1 46  ARG n 
1 47  PHE n 
1 48  MET n 
1 49  PRO n 
1 50  PRO n 
1 51  GLU n 
1 52  PRO n 
1 53  LYS n 
1 54  ARG n 
1 55  PRO n 
1 56  TRP n 
1 57  SER n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ALA n 
1 63  THR n 
1 64  THR n 
1 65  PHE n 
1 66  GLN n 
1 67  ASN n 
1 68  VAL n 
1 69  CYS n 
1 70  TYR n 
1 71  GLN n 
1 72  TYR n 
1 73  VAL n 
1 74  ASP n 
1 75  THR n 
1 76  LEU n 
1 77  TYR n 
1 78  PRO n 
1 79  GLY n 
1 80  PHE n 
1 81  GLU n 
1 82  GLY n 
1 83  THR n 
1 84  GLU n 
1 85  MET n 
1 86  TRP n 
1 87  ASN n 
1 88  PRO n 
1 89  ASN n 
1 90  ARG n 
1 91  GLU n 
1 92  LEU n 
1 93  SER n 
1 94  GLU n 
1 95  ASP n 
1 96  CYS n 
1 97  LEU n 
1 98  TYR n 
1 99  LEU n 
1 100 ASN n 
1 101 VAL n 
1 102 TRP n 
1 103 THR n 
1 104 PRO n 
1 105 TYR n 
1 106 PRO n 
1 107 ARG n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 PRO n 
1 112 THR n 
1 113 PRO n 
1 114 VAL n 
1 115 LEU n 
1 116 ILE n 
1 117 TRP n 
1 118 ILE n 
1 119 TYR n 
1 120 GLY n 
1 121 GLY n 
1 122 GLY n 
1 123 PHE n 
1 124 TYR n 
1 125 SER n 
1 126 GLY n 
1 127 ALA n 
1 128 ALA n 
1 129 SER n 
1 130 LEU n 
1 131 ASP n 
1 132 VAL n 
1 133 TYR n 
1 134 ASP n 
1 135 GLY n 
1 136 ARG n 
1 137 PHE n 
1 138 LEU n 
1 139 ALA n 
1 140 GLN n 
1 141 VAL n 
1 142 GLU n 
1 143 GLY n 
1 144 ALA n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 SER n 
1 149 MET n 
1 150 ASN n 
1 151 TYR n 
1 152 ARG n 
1 153 VAL n 
1 154 GLY n 
1 155 THR n 
1 156 PHE n 
1 157 GLY n 
1 158 PHE n 
1 159 LEU n 
1 160 ALA n 
1 161 LEU n 
1 162 PRO n 
1 163 GLY n 
1 164 SER n 
1 165 ARG n 
1 166 GLU n 
1 167 ALA n 
1 168 PRO n 
1 169 GLY n 
1 170 ASN n 
1 171 VAL n 
1 172 GLY n 
1 173 LEU n 
1 174 LEU n 
1 175 ASP n 
1 176 GLN n 
1 177 ARG n 
1 178 LEU n 
1 179 ALA n 
1 180 LEU n 
1 181 GLN n 
1 182 TRP n 
1 183 VAL n 
1 184 GLN n 
1 185 GLU n 
1 186 ASN n 
1 187 ILE n 
1 188 ALA n 
1 189 ALA n 
1 190 PHE n 
1 191 GLY n 
1 192 GLY n 
1 193 ASP n 
1 194 PRO n 
1 195 MET n 
1 196 SER n 
1 197 VAL n 
1 198 THR n 
1 199 LEU n 
1 200 PHE n 
1 201 GLY n 
1 202 GLU n 
1 203 SER n 
1 204 ALA n 
1 205 GLY n 
1 206 ALA n 
1 207 ALA n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 MET n 
1 212 HIS n 
1 213 ILE n 
1 214 LEU n 
1 215 SER n 
1 216 LEU n 
1 217 PRO n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 LEU n 
1 222 PHE n 
1 223 HIS n 
1 224 ARG n 
1 225 ALA n 
1 226 VAL n 
1 227 LEU n 
1 228 GLN n 
1 229 SER n 
1 230 GLY n 
1 231 THR n 
1 232 PRO n 
1 233 ASN n 
1 234 GLY n 
1 235 PRO n 
1 236 TRP n 
1 237 ALA n 
1 238 THR n 
1 239 VAL n 
1 240 SER n 
1 241 ALA n 
1 242 GLY n 
1 243 GLU n 
1 244 ALA n 
1 245 ARG n 
1 246 ARG n 
1 247 ARG n 
1 248 ALA n 
1 249 THR n 
1 250 LEU n 
1 251 LEU n 
1 252 ALA n 
1 253 ARG n 
1 254 LEU n 
1 255 VAL n 
1 256 GLY n 
1 257 CYS n 
1 258 PRO n 
1 259 PRO n 
1 260 GLY n 
1 261 GLY n 
1 262 ALA n 
1 263 GLY n 
1 264 GLY n 
1 265 ASN n 
1 266 ASP n 
1 267 THR n 
1 268 GLU n 
1 269 LEU n 
1 270 ILE n 
1 271 ALA n 
1 272 CYS n 
1 273 LEU n 
1 274 ARG n 
1 275 THR n 
1 276 ARG n 
1 277 PRO n 
1 278 ALA n 
1 279 GLN n 
1 280 ASP n 
1 281 LEU n 
1 282 VAL n 
1 283 ASP n 
1 284 HIS n 
1 285 GLU n 
1 286 TRP n 
1 287 HIS n 
1 288 VAL n 
1 289 LEU n 
1 290 PRO n 
1 291 GLN n 
1 292 GLU n 
1 293 SER n 
1 294 ILE n 
1 295 PHE n 
1 296 ARG n 
1 297 PHE n 
1 298 SER n 
1 299 PHE n 
1 300 VAL n 
1 301 PRO n 
1 302 VAL n 
1 303 VAL n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 PHE n 
1 308 LEU n 
1 309 SER n 
1 310 ASP n 
1 311 THR n 
1 312 PRO n 
1 313 GLU n 
1 314 ALA n 
1 315 LEU n 
1 316 ILE n 
1 317 ASN n 
1 318 THR n 
1 319 GLY n 
1 320 ASP n 
1 321 PHE n 
1 322 GLN n 
1 323 ASP n 
1 324 LEU n 
1 325 GLN n 
1 326 VAL n 
1 327 LEU n 
1 328 VAL n 
1 329 GLY n 
1 330 VAL n 
1 331 VAL n 
1 332 LYS n 
1 333 ASP n 
1 334 GLU n 
1 335 GLY n 
1 336 SER n 
1 337 TYR n 
1 338 PHE n 
1 339 LEU n 
1 340 VAL n 
1 341 TYR n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 GLY n 
1 346 PHE n 
1 347 SER n 
1 348 LYS n 
1 349 ASP n 
1 350 ASN n 
1 351 GLU n 
1 352 SER n 
1 353 LEU n 
1 354 ILE n 
1 355 SER n 
1 356 ARG n 
1 357 ALA n 
1 358 GLN n 
1 359 PHE n 
1 360 LEU n 
1 361 ALA n 
1 362 GLY n 
1 363 VAL n 
1 364 ARG n 
1 365 ILE n 
1 366 GLY n 
1 367 VAL n 
1 368 PRO n 
1 369 GLN n 
1 370 ALA n 
1 371 SER n 
1 372 ASP n 
1 373 LEU n 
1 374 ALA n 
1 375 ALA n 
1 376 GLU n 
1 377 ALA n 
1 378 VAL n 
1 379 VAL n 
1 380 LEU n 
1 381 HIS n 
1 382 TYR n 
1 383 THR n 
1 384 ASP n 
1 385 TRP n 
1 386 LEU n 
1 387 HIS n 
1 388 PRO n 
1 389 GLU n 
1 390 ASP n 
1 391 PRO n 
1 392 THR n 
1 393 HIS n 
1 394 LEU n 
1 395 ARG n 
1 396 ASP n 
1 397 ALA n 
1 398 MET n 
1 399 SER n 
1 400 ALA n 
1 401 VAL n 
1 402 VAL n 
1 403 GLY n 
1 404 ASP n 
1 405 HIS n 
1 406 ASN n 
1 407 VAL n 
1 408 VAL n 
1 409 CYS n 
1 410 PRO n 
1 411 VAL n 
1 412 ALA n 
1 413 GLN n 
1 414 LEU n 
1 415 ALA n 
1 416 GLY n 
1 417 ARG n 
1 418 LEU n 
1 419 ALA n 
1 420 ALA n 
1 421 GLN n 
1 422 GLY n 
1 423 ALA n 
1 424 ARG n 
1 425 VAL n 
1 426 TYR n 
1 427 ALA n 
1 428 TYR n 
1 429 ILE n 
1 430 PHE n 
1 431 GLU n 
1 432 HIS n 
1 433 ARG n 
1 434 ALA n 
1 435 SER n 
1 436 THR n 
1 437 LEU n 
1 438 THR n 
1 439 TRP n 
1 440 PRO n 
1 441 LEU n 
1 442 TRP n 
1 443 MET n 
1 444 GLY n 
1 445 VAL n 
1 446 PRO n 
1 447 HIS n 
1 448 GLY n 
1 449 TYR n 
1 450 GLU n 
1 451 ILE n 
1 452 GLU n 
1 453 PHE n 
1 454 ILE n 
1 455 PHE n 
1 456 GLY n 
1 457 LEU n 
1 458 PRO n 
1 459 LEU n 
1 460 ASP n 
1 461 PRO n 
1 462 SER n 
1 463 LEU n 
1 464 ASN n 
1 465 TYR n 
1 466 THR n 
1 467 THR n 
1 468 GLU n 
1 469 GLU n 
1 470 ARG n 
1 471 ILE n 
1 472 PHE n 
1 473 ALA n 
1 474 GLN n 
1 475 ARG n 
1 476 LEU n 
1 477 MET n 
1 478 LYS n 
1 479 TYR n 
1 480 TRP n 
1 481 THR n 
1 482 ASN n 
1 483 PHE n 
1 484 ALA n 
1 485 ARG n 
1 486 THR n 
1 487 GLY n 
1 488 ASP n 
1 489 PRO n 
1 490 ASN n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 ASP n 
1 495 SER n 
1 496 LYS n 
1 497 SER n 
1 498 PRO n 
1 499 GLN n 
1 500 TRP n 
1 501 PRO n 
1 502 PRO n 
1 503 TYR n 
1 504 THR n 
1 505 THR n 
1 506 ALA n 
1 507 ALA n 
1 508 GLN n 
1 509 GLN n 
1 510 TYR n 
1 511 VAL n 
1 512 SER n 
1 513 LEU n 
1 514 ASN n 
1 515 LEU n 
1 516 LYS n 
1 517 PRO n 
1 518 LEU n 
1 519 GLU n 
1 520 VAL n 
1 521 ARG n 
1 522 ARG n 
1 523 GLY n 
1 524 LEU n 
1 525 ARG n 
1 526 ALA n 
1 527 GLN n 
1 528 THR n 
1 529 CYS n 
1 530 ALA n 
1 531 PHE n 
1 532 TRP n 
1 533 ASN n 
1 534 ARG n 
1 535 PHE n 
1 536 LEU n 
1 537 PRO n 
1 538 LYS n 
1 539 LEU n 
1 540 LEU n 
1 541 SER n 
1 542 ALA n 
1 543 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     Homo 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              'LAMBDA-ZAP, LAMBDA-FIX CDNA, GENOMIC DNA' 
_entity_src_gen.pdbx_host_org_cell_line            'HEK 293' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 'HUMAN EMBRYONIC KIDNEY CELLS (HEK)' 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;EGREDPQLLVRVRGGQLRGIRLKAPGGPVSAFLGIPFAEPPVGSRRFMPPEPKRPWSGVLDATTFQNVCYQYVDTLYPGF
EGTEMWNPNRELSEDCLYLNVWTPYPRPASPTPVLIWIYGGGFYSGAASLDVYDGRFLAQVEGAVLVSMNYRVGTFGFLA
LPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASVGMHILSLPSRSLFHRAVLQSGTPNGPWATVS
AGEARRRATLLARLVGCPPGGAGGNDTELIACLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPEALINTGD
FQDLQVLVGVVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPEDPTHLRDAMSA
VVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGYEIEFIFGLPLDPSLNYTTEERIFAQRLMKYW
TNFARTGDPNDPRDSKSPQWPPYTTAAQQYVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSAT
;
_struct_ref.pdbx_align_begin           32 
_struct_ref.pdbx_db_accession          P21836 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1J07 A 1 ? 543 ? P21836 32 ? 574 ? 1 543 
2 1 1J07 B 1 ? 543 ? P21836 32 ? 574 ? 1 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                                                ? 'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking'           y ARGININE                                                               ? 'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                                             ? 'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                                        ? 'C4 H7 N O4'     
133.103 
CL  non-polymer                   . 'CHLORIDE ION'                                                         ? 'Cl -1'          
35.453  
CO3 non-polymer                   . 'CARBONATE ION'                                                        ? 'C O3 -2'        
60.009  
CYS 'L-peptide linking'           y CYSTEINE                                                               ? 'C3 H7 N O2 S'   
121.158 
DCU non-polymer                   . 
;3,8-DIAMINO-5,10'-(TRIMETHYLAMMONIUM)DECYL-6-PHENYL PHENANTHRIDINIUM
;
DECIDIUM                     'C32 H44 N4 2'   484.719 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                                                   ? 'C6 H12 O5'      
164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                                              ? 'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                                        ? 'C5 H9 N O4'     
147.129 
GLY 'peptide linking'             y GLYCINE                                                                ? 'C2 H5 N O2'     
75.067  
HIS 'L-peptide linking'           y HISTIDINE                                                              ? 'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer                   . WATER                                                                  ? 'H2 O'           
18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                                             ? 'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking'           y LEUCINE                                                                ? 'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking'           y LYSINE                                                                 ? 'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking'           y METHIONINE                                                             ? 'C5 H11 N O2 S'  
149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose                               ? 'C8 H15 N O6'    
221.208 
P6G non-polymer                   . 'HEXAETHYLENE GLYCOL'                                                  
'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7'     282.331 
PG4 non-polymer                   . 'TETRAETHYLENE GLYCOL'                                                 ? 'C8 H18 O5'      
194.226 
PHE 'L-peptide linking'           y PHENYLALANINE                                                          ? 'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking'           y PROLINE                                                                ? 'C5 H9 N O2'     
115.130 
SER 'L-peptide linking'           y SERINE                                                                 ? 'C3 H7 N O3'     
105.093 
THR 'L-peptide linking'           y THREONINE                                                              ? 'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                                             ? 'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking'           y TYROSINE                                                               ? 'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking'           y VALINE                                                                 ? 'C5 H11 N O2'    
117.146 
# 
_exptl.entry_id          1J07 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.07 
_exptl_crystal.density_percent_sol   69.51 
_exptl_crystal.description           ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    'PEG 600, HEPES OR SODIUM ACETATE, pH 6.5-8.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.933 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-2' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.933 
# 
_reflns.entry_id                     1J07 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             39.42 
_reflns.d_resolution_high            2.35 
_reflns.number_obs                   79355 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         93.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.045 
_reflns.pdbx_netI_over_sigmaI        9.6 
_reflns.B_iso_Wilson_estimate        32.2 
_reflns.pdbx_redundancy              3.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1J07 
_refine.ls_number_reflns_obs                     79331 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2337387.35 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             29.91 
_refine.ls_d_res_high                            2.35 
_refine.ls_percent_reflns_obs                    92.8 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.227 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  1588 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               52.1 
_refine.aniso_B[1][1]                            11.09 
_refine.aniso_B[2][2]                            14.21 
_refine.aniso_B[3][3]                            -25.31 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.3164 
_refine.solvent_model_param_bsol                 43.2724 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1J07 
_refine_analyze.Luzzati_coordinate_error_obs    0.29 
_refine_analyze.Luzzati_sigma_a_obs             0.33 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.33 
_refine_analyze.Luzzati_sigma_a_free            0.32 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8355 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         164 
_refine_hist.number_atoms_solvent             385 
_refine_hist.number_atoms_total               8904 
_refine_hist.d_res_high                       2.35 
_refine_hist.d_res_low                        29.91 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.011 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.8   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      24.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.09  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.33  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.20  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.12  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.17  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTR 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.35 
_refine_ls_shell.d_res_low                        2.50 
_refine_ls_shell.number_reflns_R_work             9316 
_refine_ls_shell.R_factor_R_work                  0.28 
_refine_ls_shell.percent_reflns_obs               67.7 
_refine_ls_shell.R_factor_R_free                  0.291 
_refine_ls_shell.R_factor_R_free_error            0.021 
_refine_ls_shell.percent_reflns_R_free            2.0 
_refine_ls_shell.number_reflns_R_free             194 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM  PROTEIN.TOP      'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM    WATER.TOP        'X-RAY DIFFRACTION' 
3 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 'X-RAY DIFFRACTION' 
4 ION.PARAM          ION.TOP          'X-RAY DIFFRACTION' 
5 LIG.PARAM          LIG.TOP          'X-RAY DIFFRACTION' 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id            1 
_struct_ncs_ens.details       ? 
_struct_ncs_ens.point_group   ? 
# 
_struct.entry_id                  1J07 
_struct.title                     'Crystal structure of the mouse acetylcholinesterase-decidium complex' 
_struct.pdbx_descriptor           'Acetylcholinesterase(E.C.3.1.1.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1J07 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'HYDROLASE, SERINE ESTERASE, ACETYLCHOLINESTERASE, HOMODIMER, HYDROLASE FOLD, GLYCOSYLATED PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
I N N 3 ? 
J N N 4 ? 
K N N 7 ? 
L N N 8 ? 
M N N 6 ? 
N N N 9 ? 
O N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 5   ? GLN A 7   ? ASP A 5   GLN A 7   5 ? 3  
HELX_P HELX_P2  2  VAL A 42  ? ARG A 46  ? VAL A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  3  PHE A 80  ? MET A 85  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  4  LEU A 130 ? ASP A 134 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  5  GLY A 135 ? GLY A 143 ? GLY A 135 GLY A 143 1 ? 9  
HELX_P HELX_P6  6  VAL A 153 ? LEU A 159 ? VAL A 153 LEU A 159 1 ? 7  
HELX_P HELX_P7  7  ASN A 170 ? ILE A 187 ? ASN A 170 ILE A 187 1 ? 18 
HELX_P HELX_P8  8  ALA A 188 ? PHE A 190 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  9  SER A 203 ? LEU A 214 ? SER A 203 LEU A 214 1 ? 12 
HELX_P HELX_P10 10 SER A 215 ? SER A 220 ? SER A 215 SER A 220 1 ? 6  
HELX_P HELX_P11 11 ALA A 241 ? VAL A 255 ? ALA A 241 VAL A 255 1 ? 15 
HELX_P HELX_P12 12 ASN A 265 ? ARG A 276 ? ASN A 265 ARG A 276 1 ? 12 
HELX_P HELX_P13 13 PRO A 277 ? GLU A 285 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 14 TRP A 286 ? LEU A 289 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 15 THR A 311 ? GLY A 319 ? THR A 311 GLY A 319 1 ? 9  
HELX_P HELX_P16 16 GLY A 335 ? VAL A 340 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 17 SER A 355 ? VAL A 367 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 18 SER A 371 ? THR A 383 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 19 ASP A 390 ? VAL A 407 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 20 VAL A 407 ? GLN A 421 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 21 PRO A 440 ? GLY A 444 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 22 GLU A 450 ? PHE A 455 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 23 GLY A 456 ? ASN A 464 ? GLY A 456 ASN A 464 5 ? 9  
HELX_P HELX_P24 24 THR A 466 ? GLY A 487 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 25 ARG A 525 ? ARG A 534 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 26 ARG A 534 ? SER A 541 ? ARG A 534 SER A 541 1 ? 8  
HELX_P HELX_P27 27 VAL B 42  ? ARG B 46  ? VAL B 42  ARG B 46  5 ? 5  
HELX_P HELX_P28 28 PHE B 80  ? MET B 85  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P29 29 LEU B 130 ? ASP B 134 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P30 30 GLY B 135 ? GLY B 143 ? GLY B 135 GLY B 143 1 ? 9  
HELX_P HELX_P31 31 VAL B 153 ? LEU B 159 ? VAL B 153 LEU B 159 1 ? 7  
HELX_P HELX_P32 32 ASN B 170 ? ILE B 187 ? ASN B 170 ILE B 187 1 ? 18 
HELX_P HELX_P33 33 ALA B 188 ? PHE B 190 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P34 34 SER B 203 ? LEU B 214 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P35 35 SER B 215 ? SER B 220 ? SER B 215 SER B 220 1 ? 6  
HELX_P HELX_P36 36 ALA B 241 ? VAL B 255 ? ALA B 241 VAL B 255 1 ? 15 
HELX_P HELX_P37 37 ASN B 265 ? THR B 275 ? ASN B 265 THR B 275 1 ? 11 
HELX_P HELX_P38 38 PRO B 277 ? TRP B 286 ? PRO B 277 TRP B 286 1 ? 10 
HELX_P HELX_P39 39 HIS B 287 ? LEU B 289 ? HIS B 287 LEU B 289 5 ? 3  
HELX_P HELX_P40 40 THR B 311 ? GLY B 319 ? THR B 311 GLY B 319 1 ? 9  
HELX_P HELX_P41 41 GLY B 335 ? VAL B 340 ? GLY B 335 VAL B 340 1 ? 6  
HELX_P HELX_P42 42 SER B 355 ? VAL B 367 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P43 43 SER B 371 ? THR B 383 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P44 44 ASP B 390 ? VAL B 407 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P45 45 VAL B 407 ? GLN B 421 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P46 46 PRO B 440 ? GLY B 444 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P47 47 GLU B 450 ? PHE B 455 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P48 48 GLY B 456 ? ASN B 464 ? GLY B 456 ASN B 464 5 ? 9  
HELX_P HELX_P49 49 THR B 466 ? GLY B 487 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P50 50 ARG B 525 ? ARG B 534 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P51 51 ARG B 534 ? SER B 541 ? ARG B 534 SER B 541 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 69  SG  ? ? ? 1_555 A CYS 96  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf2 disulf ?    ? A CYS 257 SG  ? ? ? 1_555 A CYS 272 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.070 ? ?               
disulf3 disulf ?    ? A CYS 409 SG  ? ? ? 1_555 A CYS 529 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.058 ? ?               
disulf4 disulf ?    ? B CYS 69  SG  ? ? ? 1_555 B CYS 96  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.065 ? ?               
disulf5 disulf ?    ? B CYS 257 SG  ? ? ? 1_555 B CYS 272 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.069 ? ?               
disulf6 disulf ?    ? B CYS 409 SG  ? ? ? 1_555 B CYS 529 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.049 ? ?               
covale1 covale one  ? A ASN 350 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 C NAG 1   1_555 ? ? ? ? ? ? ? 1.462 ? N-Glycosylation 
covale2 covale one  ? A ASN 464 ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 464 A NAG 701 1_555 ? ? ? ? ? ? ? 1.456 ? N-Glycosylation 
covale3 covale one  ? B ASN 350 ND2 ? ? ? 1_555 I NAG .   C1 ? ? B ASN 350 B NAG 601 1_555 ? ? ? ? ? ? ? 1.459 ? N-Glycosylation 
covale4 covale both ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 2   1_555 ? ? ? ? ? ? ? 1.407 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 105 A . ? TYR 105 A PRO 106 A ? PRO 106 A 1 0.05  
2 TYR 105 B . ? TYR 105 B PRO 106 B ? PRO 106 B 1 0.59  
3 CYS 257 B . ? CYS 257 B PRO 258 B ? PRO 258 B 1 -0.10 
4 SER 497 B . ? SER 497 B PRO 498 B ? PRO 498 B 1 1.87  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 2  ? 
D ? 2  ? 
E ? 3  ? 
F ? 11 ? 
G ? 2  ? 
H ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
C 1  2  ? parallel      
D 1  2  ? parallel      
E 1  2  ? anti-parallel 
E 2  3  ? parallel      
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
F 3  4  ? anti-parallel 
F 4  5  ? parallel      
F 5  6  ? parallel      
F 6  7  ? parallel      
F 7  8  ? parallel      
F 8  9  ? parallel      
F 9  10 ? parallel      
F 10 11 ? anti-parallel 
G 1  2  ? parallel      
H 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 9   ? VAL A 12  ? LEU A 9   VAL A 12  
A 2  GLY A 15  ? ARG A 18  ? GLY A 15  ARG A 18  
A 3  VAL A 59  ? ASP A 61  ? VAL A 59  ASP A 61  
B 1  ILE A 20  ? ALA A 24  ? ILE A 20  ALA A 24  
B 2  GLY A 27  ? PRO A 36  ? GLY A 27  PRO A 36  
B 3  TYR A 98  ? PRO A 104 ? TYR A 98  PRO A 104 
B 4  VAL A 145 ? MET A 149 ? VAL A 145 MET A 149 
B 5  THR A 112 ? ILE A 118 ? THR A 112 ILE A 118 
B 6  GLY A 192 ? GLU A 202 ? GLY A 192 GLU A 202 
B 7  ARG A 224 ? GLN A 228 ? ARG A 224 GLN A 228 
B 8  GLN A 325 ? VAL A 331 ? GLN A 325 VAL A 331 
B 9  ARG A 424 ? PHE A 430 ? ARG A 424 PHE A 430 
B 10 GLN A 509 ? LEU A 513 ? GLN A 509 LEU A 513 
B 11 GLU A 519 ? ARG A 522 ? GLU A 519 ARG A 522 
C 1  VAL A 68  ? CYS A 69  ? VAL A 68  CYS A 69  
C 2  LEU A 92  ? SER A 93  ? LEU A 92  SER A 93  
D 1  VAL A 239 ? SER A 240 ? VAL A 239 SER A 240 
D 2  VAL A 302 ? VAL A 303 ? VAL A 302 VAL A 303 
E 1  LEU B 9   ? VAL B 12  ? LEU B 9   VAL B 12  
E 2  GLY B 15  ? ARG B 18  ? GLY B 15  ARG B 18  
E 3  VAL B 59  ? ASP B 61  ? VAL B 59  ASP B 61  
F 1  ILE B 20  ? ALA B 24  ? ILE B 20  ALA B 24  
F 2  GLY B 27  ? PRO B 36  ? GLY B 27  PRO B 36  
F 3  TYR B 98  ? PRO B 104 ? TYR B 98  PRO B 104 
F 4  VAL B 145 ? MET B 149 ? VAL B 145 MET B 149 
F 5  THR B 112 ? ILE B 118 ? THR B 112 ILE B 118 
F 6  GLY B 192 ? GLU B 202 ? GLY B 192 GLU B 202 
F 7  ARG B 224 ? GLN B 228 ? ARG B 224 GLN B 228 
F 8  GLN B 325 ? VAL B 331 ? GLN B 325 VAL B 331 
F 9  ARG B 424 ? PHE B 430 ? ARG B 424 PHE B 430 
F 10 GLN B 509 ? LEU B 513 ? GLN B 509 LEU B 513 
F 11 GLU B 519 ? ARG B 522 ? GLU B 519 ARG B 522 
G 1  VAL B 68  ? CYS B 69  ? VAL B 68  CYS B 69  
G 2  LEU B 92  ? SER B 93  ? LEU B 92  SER B 93  
H 1  VAL B 239 ? SER B 240 ? VAL B 239 SER B 240 
H 2  VAL B 302 ? VAL B 303 ? VAL B 302 VAL B 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N VAL A 10  ? N VAL A 10  O LEU A 17  ? O LEU A 17  
A 2  3  N GLN A 16  ? N GLN A 16  O LEU A 60  ? O LEU A 60  
B 1  2  N LEU A 22  ? N LEU A 22  O VAL A 29  ? O VAL A 29  
B 2  3  N SER A 30  ? N SER A 30  O THR A 103 ? O THR A 103 
B 3  4  N ASN A 100 ? N ASN A 100 O SER A 148 ? O SER A 148 
B 4  5  O VAL A 147 ? O VAL A 147 N LEU A 115 ? N LEU A 115 
B 5  6  N VAL A 114 ? N VAL A 114 O SER A 196 ? O SER A 196 
B 6  7  N GLY A 201 ? N GLY A 201 O GLN A 228 ? O GLN A 228 
B 7  8  N LEU A 227 ? N LEU A 227 O LEU A 327 ? O LEU A 327 
B 8  9  N VAL A 328 ? N VAL A 328 O TYR A 426 ? O TYR A 426 
B 9  10 N ILE A 429 ? N ILE A 429 O LEU A 513 ? O LEU A 513 
B 10 11 N TYR A 510 ? N TYR A 510 O ARG A 521 ? O ARG A 521 
C 1  2  N VAL A 68  ? N VAL A 68  O SER A 93  ? O SER A 93  
D 1  2  N VAL A 239 ? N VAL A 239 O VAL A 303 ? O VAL A 303 
E 1  2  N VAL B 12  ? N VAL B 12  O GLY B 15  ? O GLY B 15  
E 2  3  N GLN B 16  ? N GLN B 16  O LEU B 60  ? O LEU B 60  
F 1  2  N LEU B 22  ? N LEU B 22  O VAL B 29  ? O VAL B 29  
F 2  3  N PHE B 32  ? N PHE B 32  O VAL B 101 ? O VAL B 101 
F 3  4  N ASN B 100 ? N ASN B 100 O SER B 148 ? O SER B 148 
F 4  5  O VAL B 147 ? O VAL B 147 N TRP B 117 ? N TRP B 117 
F 5  6  N ILE B 116 ? N ILE B 116 O THR B 198 ? O THR B 198 
F 6  7  N GLY B 201 ? N GLY B 201 O GLN B 228 ? O GLN B 228 
F 7  8  N LEU B 227 ? N LEU B 227 O LEU B 327 ? O LEU B 327 
F 8  9  N VAL B 326 ? N VAL B 326 O ARG B 424 ? O ARG B 424 
F 9  10 N ILE B 429 ? N ILE B 429 O LEU B 513 ? O LEU B 513 
F 10 11 N TYR B 510 ? N TYR B 510 O ARG B 521 ? O ARG B 521 
G 1  2  N VAL B 68  ? N VAL B 68  O SER B 93  ? O SER B 93  
H 1  2  N VAL B 239 ? N VAL B 239 O VAL B 303 ? O VAL B 303 
# 
_database_PDB_matrix.entry_id          1J07 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1J07 
_atom_sites.fract_transf_matrix[1][1]   0.012574 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008904 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004406 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A 1 1   ? 32.221  14.710  55.777  1.00 72.61 ? 1    GLU A N   1 
ATOM   2    C  CA  . GLU A 1 1   ? 30.759  14.932  55.590  1.00 71.76 ? 1    GLU A CA  1 
ATOM   3    C  C   . GLU A 1 1   ? 30.116  15.248  56.925  1.00 71.87 ? 1    GLU A C   1 
ATOM   4    O  O   . GLU A 1 1   ? 30.806  15.356  57.942  1.00 73.09 ? 1    GLU A O   1 
ATOM   5    C  CB  . GLU A 1 1   ? 30.106  13.688  54.958  1.00 71.47 ? 1    GLU A CB  1 
ATOM   6    C  CG  . GLU A 1 1   ? 30.547  12.351  55.555  1.00 68.95 ? 1    GLU A CG  1 
ATOM   7    C  CD  . GLU A 1 1   ? 30.243  11.159  54.649  1.00 68.13 ? 1    GLU A CD  1 
ATOM   8    O  OE1 . GLU A 1 1   ? 29.109  10.615  54.702  1.00 65.00 ? 1    GLU A OE1 1 
ATOM   9    O  OE2 . GLU A 1 1   ? 31.158  10.778  53.878  1.00 66.56 ? 1    GLU A OE2 1 
ATOM   10   N  N   . GLY A 1 2   ? 28.796  15.397  56.927  1.00 71.10 ? 2    GLY A N   1 
ATOM   11   C  CA  . GLY A 1 2   ? 28.100  15.706  58.160  1.00 68.97 ? 2    GLY A CA  1 
ATOM   12   C  C   . GLY A 1 2   ? 26.880  16.541  57.877  1.00 68.55 ? 2    GLY A C   1 
ATOM   13   O  O   . GLY A 1 2   ? 25.762  16.124  58.183  1.00 67.30 ? 2    GLY A O   1 
ATOM   14   N  N   . ARG A 1 3   ? 27.100  17.705  57.264  1.00 68.86 ? 3    ARG A N   1 
ATOM   15   C  CA  . ARG A 1 3   ? 26.025  18.639  56.930  1.00 69.43 ? 3    ARG A CA  1 
ATOM   16   C  C   . ARG A 1 3   ? 25.530  18.586  55.482  1.00 68.73 ? 3    ARG A C   1 
ATOM   17   O  O   . ARG A 1 3   ? 24.465  19.116  55.172  1.00 69.81 ? 3    ARG A O   1 
ATOM   18   C  CB  . ARG A 1 3   ? 26.456  20.075  57.256  1.00 71.10 ? 3    ARG A CB  1 
ATOM   19   C  CG  . ARG A 1 3   ? 26.102  20.558  58.673  1.00 75.21 ? 3    ARG A CG  1 
ATOM   20   C  CD  . ARG A 1 3   ? 26.929  19.868  59.773  1.00 77.77 ? 3    ARG A CD  1 
ATOM   21   N  NE  . ARG A 1 3   ? 26.472  20.212  61.132  1.00 79.52 ? 3    ARG A NE  1 
ATOM   22   C  CZ  . ARG A 1 3   ? 25.215  20.077  61.575  1.00 79.95 ? 3    ARG A CZ  1 
ATOM   23   N  NH1 . ARG A 1 3   ? 24.254  19.613  60.777  1.00 79.84 ? 3    ARG A NH1 1 
ATOM   24   N  NH2 . ARG A 1 3   ? 24.921  20.374  62.837  1.00 77.89 ? 3    ARG A NH2 1 
ATOM   25   N  N   . GLU A 1 4   ? 26.291  17.949  54.602  1.00 66.85 ? 4    GLU A N   1 
ATOM   26   C  CA  . GLU A 1 4   ? 25.922  17.849  53.190  1.00 65.45 ? 4    GLU A CA  1 
ATOM   27   C  C   . GLU A 1 4   ? 24.707  16.985  52.896  1.00 63.06 ? 4    GLU A C   1 
ATOM   28   O  O   . GLU A 1 4   ? 24.297  16.159  53.707  1.00 63.23 ? 4    GLU A O   1 
ATOM   29   C  CB  . GLU A 1 4   ? 27.088  17.287  52.389  1.00 67.86 ? 4    GLU A CB  1 
ATOM   30   C  CG  . GLU A 1 4   ? 28.315  18.134  52.447  1.00 71.59 ? 4    GLU A CG  1 
ATOM   31   C  CD  . GLU A 1 4   ? 29.540  17.363  52.038  1.00 74.24 ? 4    GLU A CD  1 
ATOM   32   O  OE1 . GLU A 1 4   ? 29.831  16.346  52.706  1.00 74.81 ? 4    GLU A OE1 1 
ATOM   33   O  OE2 . GLU A 1 4   ? 30.206  17.771  51.060  1.00 75.75 ? 4    GLU A OE2 1 
ATOM   34   N  N   . ASP A 1 5   ? 24.148  17.174  51.709  1.00 59.88 ? 5    ASP A N   1 
ATOM   35   C  CA  . ASP A 1 5   ? 22.997  16.401  51.270  1.00 57.66 ? 5    ASP A CA  1 
ATOM   36   C  C   . ASP A 1 5   ? 23.478  14.954  51.115  1.00 57.13 ? 5    ASP A C   1 
ATOM   37   O  O   . ASP A 1 5   ? 24.205  14.624  50.179  1.00 56.22 ? 5    ASP A O   1 
ATOM   38   C  CB  . ASP A 1 5   ? 22.493  16.940  49.919  1.00 53.52 ? 5    ASP A CB  1 
ATOM   39   C  CG  . ASP A 1 5   ? 21.272  16.215  49.419  1.00 50.69 ? 5    ASP A CG  1 
ATOM   40   O  OD1 . ASP A 1 5   ? 21.071  15.051  49.798  1.00 51.25 ? 5    ASP A OD1 1 
ATOM   41   O  OD2 . ASP A 1 5   ? 20.506  16.793  48.620  1.00 52.05 ? 5    ASP A OD2 1 
ATOM   42   N  N   . PRO A 1 6   ? 23.073  14.069  52.029  1.00 57.88 ? 6    PRO A N   1 
ATOM   43   C  CA  . PRO A 1 6   ? 23.479  12.660  51.974  1.00 57.18 ? 6    PRO A CA  1 
ATOM   44   C  C   . PRO A 1 6   ? 23.116  11.964  50.660  1.00 56.21 ? 6    PRO A C   1 
ATOM   45   O  O   . PRO A 1 6   ? 23.584  10.871  50.370  1.00 57.06 ? 6    PRO A O   1 
ATOM   46   C  CB  . PRO A 1 6   ? 22.742  12.057  53.161  1.00 57.53 ? 6    PRO A CB  1 
ATOM   47   C  CG  . PRO A 1 6   ? 21.453  12.852  53.166  1.00 57.87 ? 6    PRO A CG  1 
ATOM   48   C  CD  . PRO A 1 6   ? 21.992  14.259  53.013  1.00 58.20 ? 6    PRO A CD  1 
ATOM   49   N  N   . GLN A 1 7   ? 22.283  12.590  49.851  1.00 55.83 ? 7    GLN A N   1 
ATOM   50   C  CA  . GLN A 1 7   ? 21.899  11.961  48.595  1.00 55.37 ? 7    GLN A CA  1 
ATOM   51   C  C   . GLN A 1 7   ? 22.888  12.248  47.451  1.00 53.28 ? 7    GLN A C   1 
ATOM   52   O  O   . GLN A 1 7   ? 22.781  11.672  46.368  1.00 53.67 ? 7    GLN A O   1 
ATOM   53   C  CB  . GLN A 1 7   ? 20.488  12.424  48.227  1.00 58.93 ? 7    GLN A CB  1 
ATOM   54   C  CG  . GLN A 1 7   ? 19.875  11.795  46.961  1.00 63.08 ? 7    GLN A CG  1 
ATOM   55   C  CD  . GLN A 1 7   ? 19.601  10.280  47.064  1.00 65.11 ? 7    GLN A CD  1 
ATOM   56   O  OE1 . GLN A 1 7   ? 19.044  9.778   48.067  1.00 65.58 ? 7    GLN A OE1 1 
ATOM   57   N  NE2 . GLN A 1 7   ? 19.969  9.552   46.006  1.00 63.04 ? 7    GLN A NE2 1 
ATOM   58   N  N   . LEU A 1 8   ? 23.866  13.114  47.713  1.00 50.66 ? 8    LEU A N   1 
ATOM   59   C  CA  . LEU A 1 8   ? 24.876  13.508  46.721  1.00 48.59 ? 8    LEU A CA  1 
ATOM   60   C  C   . LEU A 1 8   ? 26.282  12.947  46.976  1.00 48.88 ? 8    LEU A C   1 
ATOM   61   O  O   . LEU A 1 8   ? 27.249  13.398  46.360  1.00 48.23 ? 8    LEU A O   1 
ATOM   62   C  CB  . LEU A 1 8   ? 24.966  15.042  46.661  1.00 45.46 ? 8    LEU A CB  1 
ATOM   63   C  CG  . LEU A 1 8   ? 23.633  15.740  46.343  1.00 44.39 ? 8    LEU A CG  1 
ATOM   64   C  CD1 . LEU A 1 8   ? 23.775  17.256  46.417  1.00 42.64 ? 8    LEU A CD1 1 
ATOM   65   C  CD2 . LEU A 1 8   ? 23.175  15.293  44.963  1.00 42.52 ? 8    LEU A CD2 1 
ATOM   66   N  N   . LEU A 1 9   ? 26.405  11.993  47.899  1.00 48.88 ? 9    LEU A N   1 
ATOM   67   C  CA  . LEU A 1 9   ? 27.709  11.410  48.202  1.00 47.80 ? 9    LEU A CA  1 
ATOM   68   C  C   . LEU A 1 9   ? 27.703  9.994   47.661  1.00 46.74 ? 9    LEU A C   1 
ATOM   69   O  O   . LEU A 1 9   ? 26.864  9.169   48.023  1.00 46.69 ? 9    LEU A O   1 
ATOM   70   C  CB  . LEU A 1 9   ? 27.980  11.424  49.711  1.00 47.86 ? 9    LEU A CB  1 
ATOM   71   C  CG  . LEU A 1 9   ? 27.933  12.825  50.362  1.00 50.39 ? 9    LEU A CG  1 
ATOM   72   C  CD1 . LEU A 1 9   ? 28.243  12.753  51.894  1.00 47.70 ? 9    LEU A CD1 1 
ATOM   73   C  CD2 . LEU A 1 9   ? 28.933  13.726  49.663  1.00 48.22 ? 9    LEU A CD2 1 
ATOM   74   N  N   . VAL A 1 10  ? 28.660  9.721   46.791  1.00 45.19 ? 10   VAL A N   1 
ATOM   75   C  CA  . VAL A 1 10  ? 28.751  8.435   46.135  1.00 45.18 ? 10   VAL A CA  1 
ATOM   76   C  C   . VAL A 1 10  ? 30.205  7.968   46.020  1.00 45.23 ? 10   VAL A C   1 
ATOM   77   O  O   . VAL A 1 10  ? 31.140  8.788   45.918  1.00 44.53 ? 10   VAL A O   1 
ATOM   78   C  CB  . VAL A 1 10  ? 28.113  8.585   44.714  1.00 45.61 ? 10   VAL A CB  1 
ATOM   79   C  CG1 . VAL A 1 10  ? 28.503  7.462   43.804  1.00 46.60 ? 10   VAL A CG1 1 
ATOM   80   C  CG2 . VAL A 1 10  ? 26.608  8.640   44.841  1.00 46.37 ? 10   VAL A CG2 1 
ATOM   81   N  N   . ARG A 1 11  ? 30.403  6.653   46.026  1.00 44.42 ? 11   ARG A N   1 
ATOM   82   C  CA  . ARG A 1 11  ? 31.756  6.136   45.868  1.00 43.89 ? 11   ARG A CA  1 
ATOM   83   C  C   . ARG A 1 11  ? 31.884  5.299   44.609  1.00 43.21 ? 11   ARG A C   1 
ATOM   84   O  O   . ARG A 1 11  ? 31.001  4.508   44.291  1.00 43.58 ? 11   ARG A O   1 
ATOM   85   C  CB  . ARG A 1 11  ? 32.186  5.292   47.062  1.00 43.65 ? 11   ARG A CB  1 
ATOM   86   C  CG  . ARG A 1 11  ? 33.516  4.556   46.821  1.00 44.28 ? 11   ARG A CG  1 
ATOM   87   C  CD  . ARG A 1 11  ? 33.952  3.676   48.014  1.00 41.45 ? 11   ARG A CD  1 
ATOM   88   N  NE  . ARG A 1 11  ? 34.337  4.488   49.164  1.00 39.50 ? 11   ARG A NE  1 
ATOM   89   C  CZ  . ARG A 1 11  ? 35.536  5.034   49.345  1.00 41.27 ? 11   ARG A CZ  1 
ATOM   90   N  NH1 . ARG A 1 11  ? 35.771  5.771   50.437  1.00 40.54 ? 11   ARG A NH1 1 
ATOM   91   N  NH2 . ARG A 1 11  ? 36.502  4.846   48.452  1.00 40.64 ? 11   ARG A NH2 1 
ATOM   92   N  N   . VAL A 1 12  ? 32.968  5.518   43.871  1.00 40.76 ? 12   VAL A N   1 
ATOM   93   C  CA  . VAL A 1 12  ? 33.250  4.740   42.671  1.00 40.95 ? 12   VAL A CA  1 
ATOM   94   C  C   . VAL A 1 12  ? 34.666  4.126   42.853  1.00 41.68 ? 12   VAL A C   1 
ATOM   95   O  O   . VAL A 1 12  ? 35.390  4.505   43.774  1.00 40.28 ? 12   VAL A O   1 
ATOM   96   C  CB  . VAL A 1 12  ? 33.163  5.614   41.339  1.00 40.41 ? 12   VAL A CB  1 
ATOM   97   C  CG1 . VAL A 1 12  ? 31.780  6.218   41.205  1.00 38.85 ? 12   VAL A CG1 1 
ATOM   98   C  CG2 . VAL A 1 12  ? 34.232  6.734   41.316  1.00 38.51 ? 12   VAL A CG2 1 
ATOM   99   N  N   . ARG A 1 13  ? 35.049  3.193   41.979  1.00 43.56 ? 13   ARG A N   1 
ATOM   100  C  CA  . ARG A 1 13  ? 36.348  2.502   42.059  1.00 45.89 ? 13   ARG A CA  1 
ATOM   101  C  C   . ARG A 1 13  ? 37.540  3.389   42.407  1.00 47.04 ? 13   ARG A C   1 
ATOM   102  O  O   . ARG A 1 13  ? 38.467  2.954   43.075  1.00 47.46 ? 13   ARG A O   1 
ATOM   103  C  CB  . ARG A 1 13  ? 36.620  1.772   40.733  1.00 46.35 ? 13   ARG A CB  1 
ATOM   104  C  CG  . ARG A 1 13  ? 38.049  1.231   40.526  1.00 46.50 ? 13   ARG A CG  1 
ATOM   105  C  CD  . ARG A 1 13  ? 38.397  -0.051  41.329  1.00 46.88 ? 13   ARG A CD  1 
ATOM   106  N  NE  . ARG A 1 13  ? 39.376  0.324   42.339  1.00 50.30 ? 13   ARG A NE  1 
ATOM   107  C  CZ  . ARG A 1 13  ? 40.532  -0.290  42.565  1.00 49.67 ? 13   ARG A CZ  1 
ATOM   108  N  NH1 . ARG A 1 13  ? 40.888  -1.346  41.867  1.00 48.83 ? 13   ARG A NH1 1 
ATOM   109  N  NH2 . ARG A 1 13  ? 41.358  0.196   43.479  1.00 51.41 ? 13   ARG A NH2 1 
ATOM   110  N  N   . GLY A 1 14  ? 37.520  4.634   41.952  1.00 47.10 ? 14   GLY A N   1 
ATOM   111  C  CA  . GLY A 1 14  ? 38.630  5.512   42.242  1.00 46.31 ? 14   GLY A CA  1 
ATOM   112  C  C   . GLY A 1 14  ? 38.483  6.397   43.467  1.00 46.93 ? 14   GLY A C   1 
ATOM   113  O  O   . GLY A 1 14  ? 39.418  7.119   43.833  1.00 46.30 ? 14   GLY A O   1 
ATOM   114  N  N   . GLY A 1 15  ? 37.327  6.382   44.113  1.00 46.88 ? 15   GLY A N   1 
ATOM   115  C  CA  . GLY A 1 15  ? 37.194  7.226   45.287  1.00 48.19 ? 15   GLY A CA  1 
ATOM   116  C  C   . GLY A 1 15  ? 35.818  7.801   45.507  1.00 48.49 ? 15   GLY A C   1 
ATOM   117  O  O   . GLY A 1 15  ? 34.863  7.428   44.814  1.00 49.98 ? 15   GLY A O   1 
ATOM   118  N  N   . GLN A 1 16  ? 35.724  8.706   46.478  1.00 48.80 ? 16   GLN A N   1 
ATOM   119  C  CA  . GLN A 1 16  ? 34.471  9.359   46.830  1.00 49.36 ? 16   GLN A CA  1 
ATOM   120  C  C   . GLN A 1 16  ? 34.210  10.604  45.980  1.00 48.43 ? 16   GLN A C   1 
ATOM   121  O  O   . GLN A 1 16  ? 35.130  11.365  45.667  1.00 48.63 ? 16   GLN A O   1 
ATOM   122  C  CB  . GLN A 1 16  ? 34.483  9.732   48.320  1.00 50.01 ? 16   GLN A CB  1 
ATOM   123  C  CG  . GLN A 1 16  ? 34.196  8.545   49.227  1.00 52.43 ? 16   GLN A CG  1 
ATOM   124  C  CD  . GLN A 1 16  ? 34.110  8.922   50.710  1.00 53.62 ? 16   GLN A CD  1 
ATOM   125  O  OE1 . GLN A 1 16  ? 35.070  9.457   51.273  1.00 53.10 ? 16   GLN A OE1 1 
ATOM   126  N  NE2 . GLN A 1 16  ? 32.954  8.637   51.346  1.00 50.12 ? 16   GLN A NE2 1 
ATOM   127  N  N   . LEU A 1 17  ? 32.950  10.803  45.612  1.00 46.88 ? 17   LEU A N   1 
ATOM   128  C  CA  . LEU A 1 17  ? 32.561  11.948  44.794  1.00 46.37 ? 17   LEU A CA  1 
ATOM   129  C  C   . LEU A 1 17  ? 31.415  12.691  45.459  1.00 46.04 ? 17   LEU A C   1 
ATOM   130  O  O   . LEU A 1 17  ? 30.594  12.093  46.173  1.00 44.05 ? 17   LEU A O   1 
ATOM   131  C  CB  . LEU A 1 17  ? 32.043  11.484  43.435  1.00 44.45 ? 17   LEU A CB  1 
ATOM   132  C  CG  . LEU A 1 17  ? 32.839  10.510  42.584  1.00 45.54 ? 17   LEU A CG  1 
ATOM   133  C  CD1 . LEU A 1 17  ? 31.896  9.925   41.547  1.00 43.61 ? 17   LEU A CD1 1 
ATOM   134  C  CD2 . LEU A 1 17  ? 34.014  11.214  41.933  1.00 44.38 ? 17   LEU A CD2 1 
ATOM   135  N  N   . ARG A 1 18  ? 31.345  13.990  45.210  1.00 45.89 ? 18   ARG A N   1 
ATOM   136  C  CA  . ARG A 1 18  ? 30.238  14.775  45.721  1.00 45.90 ? 18   ARG A CA  1 
ATOM   137  C  C   . ARG A 1 18  ? 29.599  15.408  44.490  1.00 45.74 ? 18   ARG A C   1 
ATOM   138  O  O   . ARG A 1 18  ? 30.266  16.123  43.738  1.00 44.49 ? 18   ARG A O   1 
ATOM   139  C  CB  . ARG A 1 18  ? 30.705  15.859  46.693  1.00 47.15 ? 18   ARG A CB  1 
ATOM   140  C  CG  . ARG A 1 18  ? 29.544  16.733  47.203  1.00 51.79 ? 18   ARG A CG  1 
ATOM   141  C  CD  . ARG A 1 18  ? 29.934  17.656  48.361  1.00 56.02 ? 18   ARG A CD  1 
ATOM   142  N  NE  . ARG A 1 18  ? 31.243  18.265  48.153  1.00 58.96 ? 18   ARG A NE  1 
ATOM   143  C  CZ  . ARG A 1 18  ? 32.346  17.937  48.826  1.00 61.82 ? 18   ARG A CZ  1 
ATOM   144  N  NH1 . ARG A 1 18  ? 32.321  17.007  49.780  1.00 62.66 ? 18   ARG A NH1 1 
ATOM   145  N  NH2 . ARG A 1 18  ? 33.497  18.515  48.507  1.00 64.17 ? 18   ARG A NH2 1 
ATOM   146  N  N   . GLY A 1 19  ? 28.315  15.117  44.285  1.00 45.33 ? 19   GLY A N   1 
ATOM   147  C  CA  . GLY A 1 19  ? 27.593  15.654  43.153  1.00 46.03 ? 19   GLY A CA  1 
ATOM   148  C  C   . GLY A 1 19  ? 26.849  16.900  43.561  1.00 47.01 ? 19   GLY A C   1 
ATOM   149  O  O   . GLY A 1 19  ? 27.048  17.411  44.671  1.00 47.15 ? 19   GLY A O   1 
ATOM   150  N  N   . ILE A 1 20  ? 25.994  17.383  42.663  1.00 45.40 ? 20   ILE A N   1 
ATOM   151  C  CA  . ILE A 1 20  ? 25.194  18.570  42.909  1.00 45.84 ? 20   ILE A CA  1 
ATOM   152  C  C   . ILE A 1 20  ? 23.719  18.286  42.579  1.00 46.75 ? 20   ILE A C   1 
ATOM   153  O  O   . ILE A 1 20  ? 23.402  17.521  41.658  1.00 44.85 ? 20   ILE A O   1 
ATOM   154  C  CB  . ILE A 1 20  ? 25.711  19.740  42.053  1.00 45.69 ? 20   ILE A CB  1 
ATOM   155  C  CG1 . ILE A 1 20  ? 24.890  21.005  42.328  1.00 46.57 ? 20   ILE A CG1 1 
ATOM   156  C  CG2 . ILE A 1 20  ? 25.640  19.376  40.589  1.00 44.18 ? 20   ILE A CG2 1 
ATOM   157  C  CD1 . ILE A 1 20  ? 25.594  22.287  41.885  1.00 44.34 ? 20   ILE A CD1 1 
ATOM   158  N  N   . ARG A 1 21  ? 22.820  18.881  43.356  1.00 47.94 ? 21   ARG A N   1 
ATOM   159  C  CA  . ARG A 1 21  ? 21.385  18.698  43.140  1.00 50.26 ? 21   ARG A CA  1 
ATOM   160  C  C   . ARG A 1 21  ? 20.998  19.799  42.160  1.00 49.53 ? 21   ARG A C   1 
ATOM   161  O  O   . ARG A 1 21  ? 21.169  20.983  42.456  1.00 49.85 ? 21   ARG A O   1 
ATOM   162  C  CB  . ARG A 1 21  ? 20.634  18.873  44.467  1.00 52.61 ? 21   ARG A CB  1 
ATOM   163  C  CG  . ARG A 1 21  ? 19.143  18.588  44.387  1.00 57.09 ? 21   ARG A CG  1 
ATOM   164  C  CD  . ARG A 1 21  ? 18.449  18.837  45.730  1.00 60.37 ? 21   ARG A CD  1 
ATOM   165  N  NE  . ARG A 1 21  ? 17.456  19.889  45.572  1.00 66.60 ? 21   ARG A NE  1 
ATOM   166  C  CZ  . ARG A 1 21  ? 16.225  19.870  46.084  1.00 70.28 ? 21   ARG A CZ  1 
ATOM   167  N  NH1 . ARG A 1 21  ? 15.803  18.848  46.820  1.00 72.32 ? 21   ARG A NH1 1 
ATOM   168  N  NH2 . ARG A 1 21  ? 15.387  20.865  45.821  1.00 71.88 ? 21   ARG A NH2 1 
ATOM   169  N  N   . LEU A 1 22  ? 20.511  19.416  40.987  1.00 48.93 ? 22   LEU A N   1 
ATOM   170  C  CA  . LEU A 1 22  ? 20.147  20.402  39.969  1.00 50.08 ? 22   LEU A CA  1 
ATOM   171  C  C   . LEU A 1 22  ? 18.649  20.508  39.799  1.00 50.51 ? 22   LEU A C   1 
ATOM   172  O  O   . LEU A 1 22  ? 17.907  19.573  40.096  1.00 49.33 ? 22   LEU A O   1 
ATOM   173  C  CB  . LEU A 1 22  ? 20.776  20.060  38.608  1.00 48.51 ? 22   LEU A CB  1 
ATOM   174  C  CG  . LEU A 1 22  ? 22.303  20.106  38.438  1.00 47.84 ? 22   LEU A CG  1 
ATOM   175  C  CD1 . LEU A 1 22  ? 22.641  19.688  37.032  1.00 47.75 ? 22   LEU A CD1 1 
ATOM   176  C  CD2 . LEU A 1 22  ? 22.849  21.467  38.716  1.00 44.95 ? 22   LEU A CD2 1 
ATOM   177  N  N   . LYS A 1 23  ? 18.200  21.651  39.306  1.00 52.10 ? 23   LYS A N   1 
ATOM   178  C  CA  . LYS A 1 23  ? 16.777  21.816  39.115  1.00 54.36 ? 23   LYS A CA  1 
ATOM   179  C  C   . LYS A 1 23  ? 16.322  21.581  37.684  1.00 53.52 ? 23   LYS A C   1 
ATOM   180  O  O   . LYS A 1 23  ? 16.885  22.128  36.743  1.00 51.51 ? 23   LYS A O   1 
ATOM   181  C  CB  . LYS A 1 23  ? 16.328  23.199  39.546  1.00 58.50 ? 23   LYS A CB  1 
ATOM   182  C  CG  . LYS A 1 23  ? 14.834  23.212  39.694  1.00 65.98 ? 23   LYS A CG  1 
ATOM   183  C  CD  . LYS A 1 23  ? 14.176  24.496  39.241  1.00 71.27 ? 23   LYS A CD  1 
ATOM   184  C  CE  . LYS A 1 23  ? 12.660  24.297  39.304  1.00 74.47 ? 23   LYS A CE  1 
ATOM   185  N  NZ  . LYS A 1 23  ? 11.927  25.467  38.763  1.00 76.89 ? 23   LYS A NZ  1 
ATOM   186  N  N   . ALA A 1 24  ? 15.311  20.739  37.533  1.00 53.22 ? 24   ALA A N   1 
ATOM   187  C  CA  . ALA A 1 24  ? 14.738  20.454  36.227  1.00 54.99 ? 24   ALA A CA  1 
ATOM   188  C  C   . ALA A 1 24  ? 13.287  20.924  36.296  1.00 55.43 ? 24   ALA A C   1 
ATOM   189  O  O   . ALA A 1 24  ? 12.706  21.007  37.381  1.00 57.33 ? 24   ALA A O   1 
ATOM   190  C  CB  . ALA A 1 24  ? 14.803  18.972  35.927  1.00 54.60 ? 24   ALA A CB  1 
ATOM   191  N  N   . PRO A 1 25  ? 12.677  21.237  35.145  1.00 55.95 ? 25   PRO A N   1 
ATOM   192  C  CA  . PRO A 1 25  ? 11.282  21.704  35.168  1.00 54.57 ? 25   PRO A CA  1 
ATOM   193  C  C   . PRO A 1 25  ? 10.392  21.015  36.193  1.00 53.45 ? 25   PRO A C   1 
ATOM   194  O  O   . PRO A 1 25  ? 9.862   21.659  37.085  1.00 53.68 ? 25   PRO A O   1 
ATOM   195  C  CB  . PRO A 1 25  ? 10.818  21.462  33.741  1.00 56.24 ? 25   PRO A CB  1 
ATOM   196  C  CG  . PRO A 1 25  ? 12.086  21.759  32.950  1.00 56.16 ? 25   PRO A CG  1 
ATOM   197  C  CD  . PRO A 1 25  ? 13.158  21.055  33.762  1.00 55.00 ? 25   PRO A CD  1 
ATOM   198  N  N   . GLY A 1 26  ? 10.251  19.702  36.096  1.00 52.09 ? 26   GLY A N   1 
ATOM   199  C  CA  . GLY A 1 26  ? 9.382   19.018  37.029  1.00 51.51 ? 26   GLY A CA  1 
ATOM   200  C  C   . GLY A 1 26  ? 9.949   18.478  38.328  1.00 51.77 ? 26   GLY A C   1 
ATOM   201  O  O   . GLY A 1 26  ? 9.261   17.720  39.016  1.00 53.13 ? 26   GLY A O   1 
ATOM   202  N  N   . GLY A 1 27  ? 11.173  18.850  38.685  1.00 50.07 ? 27   GLY A N   1 
ATOM   203  C  CA  . GLY A 1 27  ? 11.743  18.334  39.916  1.00 48.13 ? 27   GLY A CA  1 
ATOM   204  C  C   . GLY A 1 27  ? 13.256  18.321  39.931  1.00 47.74 ? 27   GLY A C   1 
ATOM   205  O  O   . GLY A 1 27  ? 13.899  18.697  38.955  1.00 48.17 ? 27   GLY A O   1 
ATOM   206  N  N   . PRO A 1 28  ? 13.865  17.898  41.040  1.00 47.32 ? 28   PRO A N   1 
ATOM   207  C  CA  . PRO A 1 28  ? 15.331  17.881  41.085  1.00 45.69 ? 28   PRO A CA  1 
ATOM   208  C  C   . PRO A 1 28  ? 15.966  16.630  40.456  1.00 45.81 ? 28   PRO A C   1 
ATOM   209  O  O   . PRO A 1 28  ? 15.302  15.609  40.288  1.00 45.72 ? 28   PRO A O   1 
ATOM   210  C  CB  . PRO A 1 28  ? 15.617  17.995  42.570  1.00 44.01 ? 28   PRO A CB  1 
ATOM   211  C  CG  . PRO A 1 28  ? 14.480  17.191  43.179  1.00 46.02 ? 28   PRO A CG  1 
ATOM   212  C  CD  . PRO A 1 28  ? 13.273  17.607  42.363  1.00 46.17 ? 28   PRO A CD  1 
ATOM   213  N  N   . VAL A 1 29  ? 17.238  16.738  40.068  1.00 43.88 ? 29   VAL A N   1 
ATOM   214  C  CA  . VAL A 1 29  ? 17.970  15.599  39.531  1.00 43.75 ? 29   VAL A CA  1 
ATOM   215  C  C   . VAL A 1 29  ? 19.355  15.625  40.179  1.00 44.28 ? 29   VAL A C   1 
ATOM   216  O  O   . VAL A 1 29  ? 19.802  16.673  40.655  1.00 43.03 ? 29   VAL A O   1 
ATOM   217  C  CB  . VAL A 1 29  ? 18.143  15.661  37.982  1.00 44.09 ? 29   VAL A CB  1 
ATOM   218  C  CG1 . VAL A 1 29  ? 16.794  15.618  37.308  1.00 41.16 ? 29   VAL A CG1 1 
ATOM   219  C  CG2 . VAL A 1 29  ? 18.940  16.909  37.582  1.00 42.65 ? 29   VAL A CG2 1 
ATOM   220  N  N   . SER A 1 30  ? 20.029  14.477  40.226  1.00 44.05 ? 30   SER A N   1 
ATOM   221  C  CA  . SER A 1 30  ? 21.377  14.447  40.784  1.00 43.33 ? 30   SER A CA  1 
ATOM   222  C  C   . SER A 1 30  ? 22.355  14.537  39.610  1.00 42.09 ? 30   SER A C   1 
ATOM   223  O  O   . SER A 1 30  ? 22.177  13.855  38.593  1.00 41.32 ? 30   SER A O   1 
ATOM   224  C  CB  . SER A 1 30  ? 21.654  13.134  41.510  1.00 41.80 ? 30   SER A CB  1 
ATOM   225  O  OG  . SER A 1 30  ? 20.709  12.855  42.515  1.00 49.49 ? 30   SER A OG  1 
ATOM   226  N  N   . ALA A 1 31  ? 23.382  15.363  39.741  1.00 40.26 ? 31   ALA A N   1 
ATOM   227  C  CA  . ALA A 1 31  ? 24.388  15.442  38.691  1.00 41.25 ? 31   ALA A CA  1 
ATOM   228  C  C   . ALA A 1 31  ? 25.809  15.272  39.251  1.00 40.78 ? 31   ALA A C   1 
ATOM   229  O  O   . ALA A 1 31  ? 26.182  15.893  40.246  1.00 39.23 ? 31   ALA A O   1 
ATOM   230  C  CB  . ALA A 1 31  ? 24.287  16.767  37.934  1.00 39.51 ? 31   ALA A CB  1 
ATOM   231  N  N   . PHE A 1 32  ? 26.592  14.414  38.607  1.00 40.33 ? 32   PHE A N   1 
ATOM   232  C  CA  . PHE A 1 32  ? 27.981  14.203  39.004  1.00 40.05 ? 32   PHE A CA  1 
ATOM   233  C  C   . PHE A 1 32  ? 28.780  14.577  37.788  1.00 39.46 ? 32   PHE A C   1 
ATOM   234  O  O   . PHE A 1 32  ? 28.883  13.810  36.836  1.00 40.52 ? 32   PHE A O   1 
ATOM   235  C  CB  . PHE A 1 32  ? 28.200  12.755  39.410  1.00 37.56 ? 32   PHE A CB  1 
ATOM   236  C  CG  . PHE A 1 32  ? 27.405  12.372  40.607  1.00 39.62 ? 32   PHE A CG  1 
ATOM   237  C  CD1 . PHE A 1 32  ? 26.102  11.903  40.468  1.00 38.44 ? 32   PHE A CD1 1 
ATOM   238  C  CD2 . PHE A 1 32  ? 27.935  12.532  41.883  1.00 38.94 ? 32   PHE A CD2 1 
ATOM   239  C  CE1 . PHE A 1 32  ? 25.337  11.593  41.588  1.00 40.55 ? 32   PHE A CE1 1 
ATOM   240  C  CE2 . PHE A 1 32  ? 27.176  12.227  43.011  1.00 40.48 ? 32   PHE A CE2 1 
ATOM   241  C  CZ  . PHE A 1 32  ? 25.874  11.756  42.862  1.00 39.28 ? 32   PHE A CZ  1 
ATOM   242  N  N   . LEU A 1 33  ? 29.325  15.784  37.823  1.00 39.40 ? 33   LEU A N   1 
ATOM   243  C  CA  . LEU A 1 33  ? 30.044  16.320  36.684  1.00 39.83 ? 33   LEU A CA  1 
ATOM   244  C  C   . LEU A 1 33  ? 31.531  16.392  36.852  1.00 40.36 ? 33   LEU A C   1 
ATOM   245  O  O   . LEU A 1 33  ? 32.031  16.686  37.935  1.00 39.91 ? 33   LEU A O   1 
ATOM   246  C  CB  . LEU A 1 33  ? 29.515  17.720  36.371  1.00 39.59 ? 33   LEU A CB  1 
ATOM   247  C  CG  . LEU A 1 33  ? 27.983  17.825  36.239  1.00 40.21 ? 33   LEU A CG  1 
ATOM   248  C  CD1 . LEU A 1 33  ? 27.553  19.289  36.113  1.00 38.69 ? 33   LEU A CD1 1 
ATOM   249  C  CD2 . LEU A 1 33  ? 27.502  16.998  35.009  1.00 38.94 ? 33   LEU A CD2 1 
ATOM   250  N  N   . GLY A 1 34  ? 32.235  16.128  35.759  1.00 41.89 ? 34   GLY A N   1 
ATOM   251  C  CA  . GLY A 1 34  ? 33.679  16.205  35.764  1.00 40.81 ? 34   GLY A CA  1 
ATOM   252  C  C   . GLY A 1 34  ? 34.379  15.073  36.484  1.00 41.64 ? 34   GLY A C   1 
ATOM   253  O  O   . GLY A 1 34  ? 35.395  15.293  37.150  1.00 40.61 ? 34   GLY A O   1 
ATOM   254  N  N   . ILE A 1 35  ? 33.844  13.859  36.366  1.00 40.16 ? 35   ILE A N   1 
ATOM   255  C  CA  . ILE A 1 35  ? 34.491  12.722  37.003  1.00 39.21 ? 35   ILE A CA  1 
ATOM   256  C  C   . ILE A 1 35  ? 35.651  12.270  36.114  1.00 39.48 ? 35   ILE A C   1 
ATOM   257  O  O   . ILE A 1 35  ? 35.469  12.023  34.931  1.00 41.52 ? 35   ILE A O   1 
ATOM   258  C  CB  . ILE A 1 35  ? 33.538  11.511  37.159  1.00 38.72 ? 35   ILE A CB  1 
ATOM   259  C  CG1 . ILE A 1 35  ? 32.279  11.910  37.940  1.00 37.38 ? 35   ILE A CG1 1 
ATOM   260  C  CG2 . ILE A 1 35  ? 34.297  10.371  37.825  1.00 33.93 ? 35   ILE A CG2 1 
ATOM   261  C  CD1 . ILE A 1 35  ? 31.226  10.807  38.008  1.00 36.19 ? 35   ILE A CD1 1 
ATOM   262  N  N   . PRO A 1 36  ? 36.862  12.165  36.667  1.00 39.46 ? 36   PRO A N   1 
ATOM   263  C  CA  . PRO A 1 36  ? 37.999  11.726  35.840  1.00 39.57 ? 36   PRO A CA  1 
ATOM   264  C  C   . PRO A 1 36  ? 37.951  10.222  35.567  1.00 40.13 ? 36   PRO A C   1 
ATOM   265  O  O   . PRO A 1 36  ? 37.760  9.447   36.490  1.00 40.21 ? 36   PRO A O   1 
ATOM   266  C  CB  . PRO A 1 36  ? 39.216  12.097  36.704  1.00 39.56 ? 36   PRO A CB  1 
ATOM   267  C  CG  . PRO A 1 36  ? 38.680  11.881  38.137  1.00 37.73 ? 36   PRO A CG  1 
ATOM   268  C  CD  . PRO A 1 36  ? 37.295  12.519  38.038  1.00 38.44 ? 36   PRO A CD  1 
ATOM   269  N  N   . PHE A 1 37  ? 38.120  9.802   34.315  1.00 41.36 ? 37   PHE A N   1 
ATOM   270  C  CA  . PHE A 1 37  ? 38.110  8.374   34.006  1.00 39.41 ? 37   PHE A CA  1 
ATOM   271  C  C   . PHE A 1 37  ? 39.425  7.929   33.399  1.00 40.25 ? 37   PHE A C   1 
ATOM   272  O  O   . PHE A 1 37  ? 39.593  6.766   33.023  1.00 42.37 ? 37   PHE A O   1 
ATOM   273  C  CB  . PHE A 1 37  ? 36.948  8.005   33.076  1.00 38.30 ? 37   PHE A CB  1 
ATOM   274  C  CG  . PHE A 1 37  ? 37.055  8.550   31.674  1.00 37.12 ? 37   PHE A CG  1 
ATOM   275  C  CD1 . PHE A 1 37  ? 37.642  7.792   30.663  1.00 37.34 ? 37   PHE A CD1 1 
ATOM   276  C  CD2 . PHE A 1 37  ? 36.504  9.801   31.352  1.00 36.24 ? 37   PHE A CD2 1 
ATOM   277  C  CE1 . PHE A 1 37  ? 37.680  8.264   29.324  1.00 40.13 ? 37   PHE A CE1 1 
ATOM   278  C  CE2 . PHE A 1 37  ? 36.528  10.289  30.042  1.00 35.61 ? 37   PHE A CE2 1 
ATOM   279  C  CZ  . PHE A 1 37  ? 37.116  9.521   29.011  1.00 38.11 ? 37   PHE A CZ  1 
ATOM   280  N  N   . ALA A 1 38  ? 40.379  8.845   33.322  1.00 40.67 ? 38   ALA A N   1 
ATOM   281  C  CA  . ALA A 1 38  ? 41.678  8.511   32.743  1.00 41.69 ? 38   ALA A CA  1 
ATOM   282  C  C   . ALA A 1 38  ? 42.749  9.427   33.270  1.00 42.34 ? 38   ALA A C   1 
ATOM   283  O  O   . ALA A 1 38  ? 42.453  10.500  33.771  1.00 44.77 ? 38   ALA A O   1 
ATOM   284  C  CB  . ALA A 1 38  ? 41.628  8.640   31.222  1.00 41.04 ? 38   ALA A CB  1 
ATOM   285  N  N   . GLU A 1 39  ? 43.996  9.004   33.163  1.00 42.17 ? 39   GLU A N   1 
ATOM   286  C  CA  . GLU A 1 39  ? 45.080  9.866   33.582  1.00 43.28 ? 39   GLU A CA  1 
ATOM   287  C  C   . GLU A 1 39  ? 45.167  10.941  32.511  1.00 42.42 ? 39   GLU A C   1 
ATOM   288  O  O   . GLU A 1 39  ? 45.020  10.657  31.330  1.00 42.09 ? 39   GLU A O   1 
ATOM   289  C  CB  . GLU A 1 39  ? 46.404  9.085   33.653  1.00 45.80 ? 39   GLU A CB  1 
ATOM   290  C  CG  . GLU A 1 39  ? 46.514  8.200   34.917  1.00 48.95 ? 39   GLU A CG  1 
ATOM   291  C  CD  . GLU A 1 39  ? 46.537  9.021   36.205  1.00 52.14 ? 39   GLU A CD  1 
ATOM   292  O  OE1 . GLU A 1 39  ? 47.436  9.888   36.331  1.00 55.91 ? 39   GLU A OE1 1 
ATOM   293  O  OE2 . GLU A 1 39  ? 45.665  8.816   37.086  1.00 52.89 ? 39   GLU A OE2 1 
ATOM   294  N  N   . PRO A 1 40  ? 45.395  12.189  32.910  1.00 41.75 ? 40   PRO A N   1 
ATOM   295  C  CA  . PRO A 1 40  ? 45.494  13.269  31.933  1.00 42.83 ? 40   PRO A CA  1 
ATOM   296  C  C   . PRO A 1 40  ? 46.431  12.824  30.811  1.00 44.15 ? 40   PRO A C   1 
ATOM   297  O  O   . PRO A 1 40  ? 47.569  12.470  31.071  1.00 46.84 ? 40   PRO A O   1 
ATOM   298  C  CB  . PRO A 1 40  ? 46.070  14.416  32.757  1.00 42.16 ? 40   PRO A CB  1 
ATOM   299  C  CG  . PRO A 1 40  ? 45.489  14.159  34.131  1.00 42.14 ? 40   PRO A CG  1 
ATOM   300  C  CD  . PRO A 1 40  ? 45.679  12.665  34.276  1.00 41.50 ? 40   PRO A CD  1 
ATOM   301  N  N   . PRO A 1 41  ? 45.956  12.811  29.553  1.00 43.42 ? 41   PRO A N   1 
ATOM   302  C  CA  . PRO A 1 41  ? 46.808  12.387  28.437  1.00 42.56 ? 41   PRO A CA  1 
ATOM   303  C  C   . PRO A 1 41  ? 47.704  13.525  27.959  1.00 43.68 ? 41   PRO A C   1 
ATOM   304  O  O   . PRO A 1 41  ? 47.731  13.853  26.778  1.00 42.86 ? 41   PRO A O   1 
ATOM   305  C  CB  . PRO A 1 41  ? 45.793  11.966  27.385  1.00 42.55 ? 41   PRO A CB  1 
ATOM   306  C  CG  . PRO A 1 41  ? 44.718  12.979  27.586  1.00 43.54 ? 41   PRO A CG  1 
ATOM   307  C  CD  . PRO A 1 41  ? 44.580  13.068  29.096  1.00 41.34 ? 41   PRO A CD  1 
ATOM   308  N  N   . VAL A 1 42  ? 48.440  14.110  28.892  1.00 43.34 ? 42   VAL A N   1 
ATOM   309  C  CA  . VAL A 1 42  ? 49.323  15.230  28.605  1.00 43.87 ? 42   VAL A CA  1 
ATOM   310  C  C   . VAL A 1 42  ? 50.819  14.856  28.489  1.00 46.54 ? 42   VAL A C   1 
ATOM   311  O  O   . VAL A 1 42  ? 51.222  13.732  28.816  1.00 47.86 ? 42   VAL A O   1 
ATOM   312  C  CB  . VAL A 1 42  ? 49.154  16.296  29.705  1.00 42.42 ? 42   VAL A CB  1 
ATOM   313  C  CG1 . VAL A 1 42  ? 47.681  16.638  29.849  1.00 41.12 ? 42   VAL A CG1 1 
ATOM   314  C  CG2 . VAL A 1 42  ? 49.690  15.771  31.046  1.00 37.95 ? 42   VAL A CG2 1 
ATOM   315  N  N   . GLY A 1 43  ? 51.627  15.805  28.011  1.00 45.95 ? 43   GLY A N   1 
ATOM   316  C  CA  . GLY A 1 43  ? 53.058  15.582  27.879  1.00 46.85 ? 43   GLY A CA  1 
ATOM   317  C  C   . GLY A 1 43  ? 53.439  14.372  27.047  1.00 48.32 ? 43   GLY A C   1 
ATOM   318  O  O   . GLY A 1 43  ? 53.100  14.295  25.864  1.00 47.54 ? 43   GLY A O   1 
ATOM   319  N  N   . SER A 1 44  ? 54.141  13.416  27.652  1.00 49.19 ? 44   SER A N   1 
ATOM   320  C  CA  . SER A 1 44  ? 54.554  12.219  26.909  1.00 50.11 ? 44   SER A CA  1 
ATOM   321  C  C   . SER A 1 44  ? 53.398  11.275  26.604  1.00 48.89 ? 44   SER A C   1 
ATOM   322  O  O   . SER A 1 44  ? 53.583  10.271  25.924  1.00 48.55 ? 44   SER A O   1 
ATOM   323  C  CB  . SER A 1 44  ? 55.632  11.473  27.685  1.00 51.69 ? 44   SER A CB  1 
ATOM   324  O  OG  . SER A 1 44  ? 55.187  11.194  29.004  1.00 55.34 ? 44   SER A OG  1 
ATOM   325  N  N   . ARG A 1 45  ? 52.212  11.602  27.114  1.00 49.13 ? 45   ARG A N   1 
ATOM   326  C  CA  . ARG A 1 45  ? 51.023  10.780  26.893  1.00 48.53 ? 45   ARG A CA  1 
ATOM   327  C  C   . ARG A 1 45  ? 50.238  11.245  25.665  1.00 47.42 ? 45   ARG A C   1 
ATOM   328  O  O   . ARG A 1 45  ? 49.295  10.577  25.235  1.00 47.90 ? 45   ARG A O   1 
ATOM   329  C  CB  . ARG A 1 45  ? 50.134  10.838  28.132  1.00 52.46 ? 45   ARG A CB  1 
ATOM   330  C  CG  . ARG A 1 45  ? 50.797  10.346  29.417  1.00 55.67 ? 45   ARG A CG  1 
ATOM   331  C  CD  . ARG A 1 45  ? 50.327  8.947   29.748  1.00 62.90 ? 45   ARG A CD  1 
ATOM   332  N  NE  . ARG A 1 45  ? 49.753  8.822   31.101  1.00 68.96 ? 45   ARG A NE  1 
ATOM   333  C  CZ  . ARG A 1 45  ? 50.455  8.642   32.222  1.00 71.34 ? 45   ARG A CZ  1 
ATOM   334  N  NH1 . ARG A 1 45  ? 51.783  8.565   32.178  1.00 73.27 ? 45   ARG A NH1 1 
ATOM   335  N  NH2 . ARG A 1 45  ? 49.830  8.522   33.394  1.00 73.32 ? 45   ARG A NH2 1 
ATOM   336  N  N   . ARG A 1 46  ? 50.629  12.384  25.093  1.00 45.48 ? 46   ARG A N   1 
ATOM   337  C  CA  . ARG A 1 46  ? 49.940  12.904  23.915  1.00 43.98 ? 46   ARG A CA  1 
ATOM   338  C  C   . ARG A 1 46  ? 50.051  11.871  22.787  1.00 43.00 ? 46   ARG A C   1 
ATOM   339  O  O   . ARG A 1 46  ? 51.098  11.278  22.595  1.00 44.37 ? 46   ARG A O   1 
ATOM   340  C  CB  . ARG A 1 46  ? 50.534  14.259  23.495  1.00 41.48 ? 46   ARG A CB  1 
ATOM   341  C  CG  . ARG A 1 46  ? 49.867  14.871  22.258  1.00 40.85 ? 46   ARG A CG  1 
ATOM   342  C  CD  . ARG A 1 46  ? 50.643  16.073  21.725  1.00 37.04 ? 46   ARG A CD  1 
ATOM   343  N  NE  . ARG A 1 46  ? 50.404  17.254  22.537  1.00 38.18 ? 46   ARG A NE  1 
ATOM   344  C  CZ  . ARG A 1 46  ? 51.023  18.415  22.359  1.00 37.72 ? 46   ARG A CZ  1 
ATOM   345  N  NH1 . ARG A 1 46  ? 51.917  18.539  21.400  1.00 41.80 ? 46   ARG A NH1 1 
ATOM   346  N  NH2 . ARG A 1 46  ? 50.745  19.456  23.130  1.00 36.23 ? 46   ARG A NH2 1 
ATOM   347  N  N   . PHE A 1 47  ? 48.952  11.643  22.076  1.00 42.03 ? 47   PHE A N   1 
ATOM   348  C  CA  . PHE A 1 47  ? 48.884  10.676  20.984  1.00 43.04 ? 47   PHE A CA  1 
ATOM   349  C  C   . PHE A 1 47  ? 48.817  9.234   21.445  1.00 43.97 ? 47   PHE A C   1 
ATOM   350  O  O   . PHE A 1 47  ? 48.611  8.342   20.625  1.00 44.09 ? 47   PHE A O   1 
ATOM   351  C  CB  . PHE A 1 47  ? 50.072  10.801  20.021  1.00 44.02 ? 47   PHE A CB  1 
ATOM   352  C  CG  . PHE A 1 47  ? 50.284  12.187  19.492  1.00 44.63 ? 47   PHE A CG  1 
ATOM   353  C  CD1 . PHE A 1 47  ? 49.272  12.849  18.815  1.00 44.10 ? 47   PHE A CD1 1 
ATOM   354  C  CD2 . PHE A 1 47  ? 51.500  12.831  19.675  1.00 44.21 ? 47   PHE A CD2 1 
ATOM   355  C  CE1 . PHE A 1 47  ? 49.468  14.138  18.325  1.00 44.62 ? 47   PHE A CE1 1 
ATOM   356  C  CE2 . PHE A 1 47  ? 51.701  14.116  19.189  1.00 45.20 ? 47   PHE A CE2 1 
ATOM   357  C  CZ  . PHE A 1 47  ? 50.681  14.770  18.512  1.00 43.65 ? 47   PHE A CZ  1 
ATOM   358  N  N   . MET A 1 48  ? 48.977  9.000   22.747  1.00 44.91 ? 48   MET A N   1 
ATOM   359  C  CA  . MET A 1 48  ? 48.944  7.636   23.271  1.00 45.45 ? 48   MET A CA  1 
ATOM   360  C  C   . MET A 1 48  ? 47.588  7.181   23.815  1.00 43.90 ? 48   MET A C   1 
ATOM   361  O  O   . MET A 1 48  ? 46.748  7.996   24.208  1.00 42.64 ? 48   MET A O   1 
ATOM   362  C  CB  . MET A 1 48  ? 49.999  7.473   24.374  1.00 47.78 ? 48   MET A CB  1 
ATOM   363  C  CG  . MET A 1 48  ? 51.404  7.844   23.931  1.00 52.59 ? 48   MET A CG  1 
ATOM   364  S  SD  . MET A 1 48  ? 52.643  6.835   24.751  1.00 62.58 ? 48   MET A SD  1 
ATOM   365  C  CE  . MET A 1 48  ? 52.274  5.251   23.879  1.00 55.36 ? 48   MET A CE  1 
ATOM   366  N  N   . PRO A 1 49  ? 47.362  5.864   23.830  1.00 42.23 ? 49   PRO A N   1 
ATOM   367  C  CA  . PRO A 1 49  ? 46.104  5.307   24.344  1.00 42.25 ? 49   PRO A CA  1 
ATOM   368  C  C   . PRO A 1 49  ? 45.904  5.818   25.778  1.00 41.27 ? 49   PRO A C   1 
ATOM   369  O  O   . PRO A 1 49  ? 46.864  6.103   26.481  1.00 42.27 ? 49   PRO A O   1 
ATOM   370  C  CB  . PRO A 1 49  ? 46.350  3.798   24.292  1.00 41.89 ? 49   PRO A CB  1 
ATOM   371  C  CG  . PRO A 1 49  ? 47.266  3.651   23.077  1.00 40.35 ? 49   PRO A CG  1 
ATOM   372  C  CD  . PRO A 1 49  ? 48.221  4.817   23.239  1.00 41.17 ? 49   PRO A CD  1 
ATOM   373  N  N   . PRO A 1 50  ? 44.654  5.965   26.220  1.00 39.64 ? 50   PRO A N   1 
ATOM   374  C  CA  . PRO A 1 50  ? 44.433  6.453   27.582  1.00 40.40 ? 50   PRO A CA  1 
ATOM   375  C  C   . PRO A 1 50  ? 44.752  5.360   28.602  1.00 43.01 ? 50   PRO A C   1 
ATOM   376  O  O   . PRO A 1 50  ? 44.650  4.159   28.295  1.00 43.72 ? 50   PRO A O   1 
ATOM   377  C  CB  . PRO A 1 50  ? 42.948  6.767   27.584  1.00 37.25 ? 50   PRO A CB  1 
ATOM   378  C  CG  . PRO A 1 50  ? 42.418  5.634   26.771  1.00 34.86 ? 50   PRO A CG  1 
ATOM   379  C  CD  . PRO A 1 50  ? 43.382  5.582   25.594  1.00 36.19 ? 50   PRO A CD  1 
ATOM   380  N  N   . GLU A 1 51  ? 45.126  5.788   29.804  1.00 44.91 ? 51   GLU A N   1 
ATOM   381  C  CA  . GLU A 1 51  ? 45.405  4.882   30.915  1.00 49.47 ? 51   GLU A CA  1 
ATOM   382  C  C   . GLU A 1 51  ? 44.326  5.176   31.947  1.00 48.04 ? 51   GLU A C   1 
ATOM   383  O  O   . GLU A 1 51  ? 43.955  6.334   32.145  1.00 48.16 ? 51   GLU A O   1 
ATOM   384  C  CB  . GLU A 1 51  ? 46.753  5.197   31.565  1.00 53.68 ? 51   GLU A CB  1 
ATOM   385  C  CG  . GLU A 1 51  ? 47.972  5.007   30.681  1.00 62.56 ? 51   GLU A CG  1 
ATOM   386  C  CD  . GLU A 1 51  ? 49.245  5.535   31.359  1.00 69.13 ? 51   GLU A CD  1 
ATOM   387  O  OE1 . GLU A 1 51  ? 49.463  5.247   32.570  1.00 71.72 ? 51   GLU A OE1 1 
ATOM   388  O  OE2 . GLU A 1 51  ? 50.036  6.237   30.685  1.00 71.83 ? 51   GLU A OE2 1 
ATOM   389  N  N   . PRO A 1 52  ? 43.818  4.142   32.622  1.00 46.45 ? 52   PRO A N   1 
ATOM   390  C  CA  . PRO A 1 52  ? 42.781  4.374   33.634  1.00 43.91 ? 52   PRO A CA  1 
ATOM   391  C  C   . PRO A 1 52  ? 43.234  5.357   34.717  1.00 43.09 ? 52   PRO A C   1 
ATOM   392  O  O   . PRO A 1 52  ? 44.403  5.386   35.102  1.00 42.22 ? 52   PRO A O   1 
ATOM   393  C  CB  . PRO A 1 52  ? 42.520  2.972   34.187  1.00 44.58 ? 52   PRO A CB  1 
ATOM   394  C  CG  . PRO A 1 52  ? 42.783  2.080   32.968  1.00 45.74 ? 52   PRO A CG  1 
ATOM   395  C  CD  . PRO A 1 52  ? 44.031  2.703   32.370  1.00 45.58 ? 52   PRO A CD  1 
ATOM   396  N  N   . LYS A 1 53  ? 42.301  6.166   35.197  1.00 42.92 ? 53   LYS A N   1 
ATOM   397  C  CA  . LYS A 1 53  ? 42.580  7.137   36.246  1.00 45.29 ? 53   LYS A CA  1 
ATOM   398  C  C   . LYS A 1 53  ? 43.002  6.453   37.558  1.00 47.97 ? 53   LYS A C   1 
ATOM   399  O  O   . LYS A 1 53  ? 42.340  5.519   38.030  1.00 48.78 ? 53   LYS A O   1 
ATOM   400  C  CB  . LYS A 1 53  ? 41.335  7.987   36.480  1.00 43.13 ? 53   LYS A CB  1 
ATOM   401  C  CG  . LYS A 1 53  ? 41.391  8.875   37.692  1.00 41.71 ? 53   LYS A CG  1 
ATOM   402  C  CD  . LYS A 1 53  ? 42.448  9.927   37.546  1.00 41.75 ? 53   LYS A CD  1 
ATOM   403  C  CE  . LYS A 1 53  ? 42.312  10.968  38.635  1.00 40.60 ? 53   LYS A CE  1 
ATOM   404  N  NZ  . LYS A 1 53  ? 43.336  12.024  38.447  1.00 44.52 ? 53   LYS A NZ  1 
ATOM   405  N  N   . ARG A 1 54  ? 44.101  6.914   38.148  1.00 48.86 ? 54   ARG A N   1 
ATOM   406  C  CA  . ARG A 1 54  ? 44.550  6.327   39.398  1.00 51.78 ? 54   ARG A CA  1 
ATOM   407  C  C   . ARG A 1 54  ? 43.668  6.867   40.528  1.00 51.00 ? 54   ARG A C   1 
ATOM   408  O  O   . ARG A 1 54  ? 43.245  8.023   40.486  1.00 51.50 ? 54   ARG A O   1 
ATOM   409  C  CB  . ARG A 1 54  ? 46.035  6.639   39.625  1.00 54.11 ? 54   ARG A CB  1 
ATOM   410  C  CG  . ARG A 1 54  ? 46.938  6.075   38.507  1.00 60.03 ? 54   ARG A CG  1 
ATOM   411  C  CD  . ARG A 1 54  ? 48.383  5.898   38.961  1.00 64.60 ? 54   ARG A CD  1 
ATOM   412  N  NE  . ARG A 1 54  ? 48.877  7.086   39.657  1.00 70.12 ? 54   ARG A NE  1 
ATOM   413  C  CZ  . ARG A 1 54  ? 49.194  8.238   39.064  1.00 72.24 ? 54   ARG A CZ  1 
ATOM   414  N  NH1 . ARG A 1 54  ? 49.079  8.362   37.749  1.00 71.41 ? 54   ARG A NH1 1 
ATOM   415  N  NH2 . ARG A 1 54  ? 49.610  9.274   39.792  1.00 73.26 ? 54   ARG A NH2 1 
ATOM   416  N  N   . PRO A 1 55  ? 43.361  6.028   41.534  1.00 49.28 ? 55   PRO A N   1 
ATOM   417  C  CA  . PRO A 1 55  ? 42.519  6.424   42.667  1.00 48.62 ? 55   PRO A CA  1 
ATOM   418  C  C   . PRO A 1 55  ? 42.964  7.710   43.347  1.00 48.59 ? 55   PRO A C   1 
ATOM   419  O  O   . PRO A 1 55  ? 44.148  8.028   43.382  1.00 47.20 ? 55   PRO A O   1 
ATOM   420  C  CB  . PRO A 1 55  ? 42.586  5.205   43.590  1.00 49.24 ? 55   PRO A CB  1 
ATOM   421  C  CG  . PRO A 1 55  ? 42.680  4.063   42.606  1.00 49.80 ? 55   PRO A CG  1 
ATOM   422  C  CD  . PRO A 1 55  ? 43.702  4.596   41.604  1.00 49.21 ? 55   PRO A CD  1 
ATOM   423  N  N   . TRP A 1 56  ? 42.008  8.462   43.878  1.00 49.57 ? 56   TRP A N   1 
ATOM   424  C  CA  . TRP A 1 56  ? 42.335  9.711   44.563  1.00 50.25 ? 56   TRP A CA  1 
ATOM   425  C  C   . TRP A 1 56  ? 41.919  9.616   46.032  1.00 51.38 ? 56   TRP A C   1 
ATOM   426  O  O   . TRP A 1 56  ? 41.235  8.662   46.439  1.00 52.81 ? 56   TRP A O   1 
ATOM   427  C  CB  . TRP A 1 56  ? 41.641  10.890  43.859  1.00 48.02 ? 56   TRP A CB  1 
ATOM   428  C  CG  . TRP A 1 56  ? 40.144  10.748  43.806  1.00 47.60 ? 56   TRP A CG  1 
ATOM   429  C  CD1 . TRP A 1 56  ? 39.247  11.117  44.769  1.00 45.61 ? 56   TRP A CD1 1 
ATOM   430  C  CD2 . TRP A 1 56  ? 39.377  10.113  42.770  1.00 46.11 ? 56   TRP A CD2 1 
ATOM   431  N  NE1 . TRP A 1 56  ? 37.974  10.747  44.399  1.00 45.41 ? 56   TRP A NE1 1 
ATOM   432  C  CE2 . TRP A 1 56  ? 38.026  10.128  43.181  1.00 43.75 ? 56   TRP A CE2 1 
ATOM   433  C  CE3 . TRP A 1 56  ? 39.703  9.528   41.545  1.00 44.40 ? 56   TRP A CE3 1 
ATOM   434  C  CZ2 . TRP A 1 56  ? 37.010  9.584   42.418  1.00 42.16 ? 56   TRP A CZ2 1 
ATOM   435  C  CZ3 . TRP A 1 56  ? 38.677  8.978   40.782  1.00 45.63 ? 56   TRP A CZ3 1 
ATOM   436  C  CH2 . TRP A 1 56  ? 37.349  9.012   41.226  1.00 43.29 ? 56   TRP A CH2 1 
ATOM   437  N  N   . SER A 1 57  ? 42.340  10.584  46.837  1.00 52.17 ? 57   SER A N   1 
ATOM   438  C  CA  . SER A 1 57  ? 41.978  10.547  48.244  1.00 53.77 ? 57   SER A CA  1 
ATOM   439  C  C   . SER A 1 57  ? 40.979  11.656  48.518  1.00 53.13 ? 57   SER A C   1 
ATOM   440  O  O   . SER A 1 57  ? 40.934  12.651  47.794  1.00 53.86 ? 57   SER A O   1 
ATOM   441  C  CB  . SER A 1 57  ? 43.223  10.724  49.113  1.00 55.22 ? 57   SER A CB  1 
ATOM   442  O  OG  . SER A 1 57  ? 43.815  11.986  48.858  1.00 58.83 ? 57   SER A OG  1 
ATOM   443  N  N   . GLY A 1 58  ? 40.176  11.481  49.559  1.00 52.78 ? 58   GLY A N   1 
ATOM   444  C  CA  . GLY A 1 58  ? 39.196  12.484  49.900  1.00 50.89 ? 58   GLY A CA  1 
ATOM   445  C  C   . GLY A 1 58  ? 37.989  12.408  48.994  1.00 51.24 ? 58   GLY A C   1 
ATOM   446  O  O   . GLY A 1 58  ? 37.817  11.463  48.220  1.00 49.61 ? 58   GLY A O   1 
ATOM   447  N  N   . VAL A 1 59  ? 37.145  13.424  49.102  1.00 51.82 ? 59   VAL A N   1 
ATOM   448  C  CA  . VAL A 1 59  ? 35.937  13.495  48.309  1.00 51.92 ? 59   VAL A CA  1 
ATOM   449  C  C   . VAL A 1 59  ? 36.201  14.445  47.142  1.00 52.38 ? 59   VAL A C   1 
ATOM   450  O  O   . VAL A 1 59  ? 36.425  15.655  47.333  1.00 52.60 ? 59   VAL A O   1 
ATOM   451  C  CB  . VAL A 1 59  ? 34.767  14.013  49.160  1.00 52.21 ? 59   VAL A CB  1 
ATOM   452  C  CG1 . VAL A 1 59  ? 33.469  13.931  48.373  1.00 49.54 ? 59   VAL A CG1 1 
ATOM   453  C  CG2 . VAL A 1 59  ? 34.683  13.207  50.456  1.00 50.17 ? 59   VAL A CG2 1 
ATOM   454  N  N   . LEU A 1 60  ? 36.215  13.878  45.940  1.00 49.60 ? 60   LEU A N   1 
ATOM   455  C  CA  . LEU A 1 60  ? 36.445  14.654  44.740  1.00 49.18 ? 60   LEU A CA  1 
ATOM   456  C  C   . LEU A 1 60  ? 35.182  15.460  44.444  1.00 48.60 ? 60   LEU A C   1 
ATOM   457  O  O   . LEU A 1 60  ? 34.061  14.941  44.523  1.00 47.99 ? 60   LEU A O   1 
ATOM   458  C  CB  . LEU A 1 60  ? 36.796  13.733  43.560  1.00 49.35 ? 60   LEU A CB  1 
ATOM   459  C  CG  . LEU A 1 60  ? 37.136  14.409  42.217  1.00 50.95 ? 60   LEU A CG  1 
ATOM   460  C  CD1 . LEU A 1 60  ? 38.130  13.575  41.412  1.00 49.19 ? 60   LEU A CD1 1 
ATOM   461  C  CD2 . LEU A 1 60  ? 35.874  14.593  41.422  1.00 50.83 ? 60   LEU A CD2 1 
ATOM   462  N  N   . ASP A 1 61  ? 35.358  16.739  44.133  1.00 48.04 ? 61   ASP A N   1 
ATOM   463  C  CA  . ASP A 1 61  ? 34.205  17.571  43.839  1.00 48.51 ? 61   ASP A CA  1 
ATOM   464  C  C   . ASP A 1 61  ? 33.729  17.373  42.399  1.00 45.81 ? 61   ASP A C   1 
ATOM   465  O  O   . ASP A 1 61  ? 34.451  17.662  41.462  1.00 44.93 ? 61   ASP A O   1 
ATOM   466  C  CB  . ASP A 1 61  ? 34.511  19.041  44.065  1.00 52.11 ? 61   ASP A CB  1 
ATOM   467  C  CG  . ASP A 1 61  ? 33.329  19.917  43.726  1.00 57.54 ? 61   ASP A CG  1 
ATOM   468  O  OD1 . ASP A 1 61  ? 33.086  20.159  42.512  1.00 60.28 ? 61   ASP A OD1 1 
ATOM   469  O  OD2 . ASP A 1 61  ? 32.616  20.333  44.675  1.00 60.68 ? 61   ASP A OD2 1 
ATOM   470  N  N   . ALA A 1 62  ? 32.508  16.875  42.244  1.00 43.28 ? 62   ALA A N   1 
ATOM   471  C  CA  . ALA A 1 62  ? 31.954  16.617  40.929  1.00 44.19 ? 62   ALA A CA  1 
ATOM   472  C  C   . ALA A 1 62  ? 30.682  17.458  40.721  1.00 44.26 ? 62   ALA A C   1 
ATOM   473  O  O   . ALA A 1 62  ? 29.611  16.946  40.330  1.00 44.21 ? 62   ALA A O   1 
ATOM   474  C  CB  . ALA A 1 62  ? 31.646  15.120  40.784  1.00 39.78 ? 62   ALA A CB  1 
ATOM   475  N  N   . THR A 1 63  ? 30.814  18.755  40.976  1.00 43.74 ? 63   THR A N   1 
ATOM   476  C  CA  . THR A 1 63  ? 29.679  19.663  40.845  1.00 43.83 ? 63   THR A CA  1 
ATOM   477  C  C   . THR A 1 63  ? 29.733  20.590  39.632  1.00 43.46 ? 63   THR A C   1 
ATOM   478  O  O   . THR A 1 63  ? 28.817  21.370  39.439  1.00 44.07 ? 63   THR A O   1 
ATOM   479  C  CB  . THR A 1 63  ? 29.547  20.556  42.079  1.00 44.25 ? 63   THR A CB  1 
ATOM   480  O  OG1 . THR A 1 63  ? 30.713  21.372  42.162  1.00 42.52 ? 63   THR A OG1 1 
ATOM   481  C  CG2 . THR A 1 63  ? 29.402  19.712  43.377  1.00 42.09 ? 63   THR A CG2 1 
ATOM   482  N  N   . THR A 1 64  ? 30.798  20.531  38.833  1.00 42.92 ? 64   THR A N   1 
ATOM   483  C  CA  . THR A 1 64  ? 30.892  21.383  37.648  1.00 43.85 ? 64   THR A CA  1 
ATOM   484  C  C   . THR A 1 64  ? 31.589  20.666  36.488  1.00 43.97 ? 64   THR A C   1 
ATOM   485  O  O   . THR A 1 64  ? 32.396  19.757  36.687  1.00 43.77 ? 64   THR A O   1 
ATOM   486  C  CB  . THR A 1 64  ? 31.670  22.698  37.921  1.00 45.32 ? 64   THR A CB  1 
ATOM   487  O  OG1 . THR A 1 64  ? 33.067  22.408  38.061  1.00 46.95 ? 64   THR A OG1 1 
ATOM   488  C  CG2 . THR A 1 64  ? 31.195  23.342  39.208  1.00 47.24 ? 64   THR A CG2 1 
ATOM   489  N  N   . PHE A 1 65  ? 31.274  21.093  35.271  1.00 43.07 ? 65   PHE A N   1 
ATOM   490  C  CA  . PHE A 1 65  ? 31.867  20.490  34.092  1.00 42.32 ? 65   PHE A CA  1 
ATOM   491  C  C   . PHE A 1 65  ? 33.362  20.751  34.074  1.00 42.63 ? 65   PHE A C   1 
ATOM   492  O  O   . PHE A 1 65  ? 33.825  21.807  34.499  1.00 43.56 ? 65   PHE A O   1 
ATOM   493  C  CB  . PHE A 1 65  ? 31.251  21.067  32.819  1.00 38.83 ? 65   PHE A CB  1 
ATOM   494  C  CG  . PHE A 1 65  ? 29.856  20.578  32.533  1.00 38.17 ? 65   PHE A CG  1 
ATOM   495  C  CD1 . PHE A 1 65  ? 29.617  19.226  32.294  1.00 36.88 ? 65   PHE A CD1 1 
ATOM   496  C  CD2 . PHE A 1 65  ? 28.779  21.480  32.485  1.00 36.73 ? 65   PHE A CD2 1 
ATOM   497  C  CE1 . PHE A 1 65  ? 28.345  18.767  32.011  1.00 36.89 ? 65   PHE A CE1 1 
ATOM   498  C  CE2 . PHE A 1 65  ? 27.495  21.041  32.204  1.00 37.54 ? 65   PHE A CE2 1 
ATOM   499  C  CZ  . PHE A 1 65  ? 27.275  19.671  31.965  1.00 39.50 ? 65   PHE A CZ  1 
ATOM   500  N  N   . GLN A 1 66  ? 34.113  19.786  33.561  1.00 42.34 ? 66   GLN A N   1 
ATOM   501  C  CA  . GLN A 1 66  ? 35.549  19.911  33.459  1.00 40.91 ? 66   GLN A CA  1 
ATOM   502  C  C   . GLN A 1 66  ? 35.942  20.491  32.106  1.00 41.06 ? 66   GLN A C   1 
ATOM   503  O  O   . GLN A 1 66  ? 35.090  20.786  31.265  1.00 39.74 ? 66   GLN A O   1 
ATOM   504  C  CB  . GLN A 1 66  ? 36.185  18.544  33.655  1.00 43.21 ? 66   GLN A CB  1 
ATOM   505  C  CG  . GLN A 1 66  ? 36.613  18.312  35.062  1.00 43.77 ? 66   GLN A CG  1 
ATOM   506  C  CD  . GLN A 1 66  ? 37.843  19.137  35.380  1.00 49.71 ? 66   GLN A CD  1 
ATOM   507  O  OE1 . GLN A 1 66  ? 38.431  19.793  34.482  1.00 47.71 ? 66   GLN A OE1 1 
ATOM   508  N  NE2 . GLN A 1 66  ? 38.260  19.109  36.654  1.00 48.96 ? 66   GLN A NE2 1 
ATOM   509  N  N   . ASN A 1 67  ? 37.243  20.645  31.905  1.00 40.25 ? 67   ASN A N   1 
ATOM   510  C  CA  . ASN A 1 67  ? 37.779  21.183  30.675  1.00 38.67 ? 67   ASN A CA  1 
ATOM   511  C  C   . ASN A 1 67  ? 37.281  20.488  29.424  1.00 38.67 ? 67   ASN A C   1 
ATOM   512  O  O   . ASN A 1 67  ? 36.876  19.327  29.454  1.00 37.74 ? 67   ASN A O   1 
ATOM   513  C  CB  . ASN A 1 67  ? 39.294  21.095  30.686  1.00 38.21 ? 67   ASN A CB  1 
ATOM   514  C  CG  . ASN A 1 67  ? 39.899  21.875  31.807  1.00 41.97 ? 67   ASN A CG  1 
ATOM   515  O  OD1 . ASN A 1 67  ? 39.355  22.886  32.244  1.00 41.72 ? 67   ASN A OD1 1 
ATOM   516  N  ND2 . ASN A 1 67  ? 41.049  21.419  32.283  1.00 45.99 ? 67   ASN A ND2 1 
ATOM   517  N  N   . VAL A 1 68  ? 37.336  21.228  28.319  1.00 37.49 ? 68   VAL A N   1 
ATOM   518  C  CA  . VAL A 1 68  ? 36.953  20.728  27.016  1.00 36.47 ? 68   VAL A CA  1 
ATOM   519  C  C   . VAL A 1 68  ? 38.255  20.299  26.342  1.00 37.81 ? 68   VAL A C   1 
ATOM   520  O  O   . VAL A 1 68  ? 39.278  20.969  26.525  1.00 37.45 ? 68   VAL A O   1 
ATOM   521  C  CB  . VAL A 1 68  ? 36.293  21.844  26.207  1.00 36.99 ? 68   VAL A CB  1 
ATOM   522  C  CG1 . VAL A 1 68  ? 36.309  21.499  24.754  1.00 35.28 ? 68   VAL A CG1 1 
ATOM   523  C  CG2 . VAL A 1 68  ? 34.847  22.064  26.718  1.00 36.50 ? 68   VAL A CG2 1 
ATOM   524  N  N   . CYS A 1 69  ? 38.241  19.206  25.576  1.00 35.74 ? 69   CYS A N   1 
ATOM   525  C  CA  . CYS A 1 69  ? 39.460  18.769  24.928  1.00 38.60 ? 69   CYS A CA  1 
ATOM   526  C  C   . CYS A 1 69  ? 39.933  19.819  23.946  1.00 41.39 ? 69   CYS A C   1 
ATOM   527  O  O   . CYS A 1 69  ? 39.130  20.450  23.251  1.00 39.64 ? 69   CYS A O   1 
ATOM   528  C  CB  . CYS A 1 69  ? 39.270  17.426  24.220  1.00 38.16 ? 69   CYS A CB  1 
ATOM   529  S  SG  . CYS A 1 69  ? 38.988  16.054  25.422  1.00 43.00 ? 69   CYS A SG  1 
ATOM   530  N  N   . TYR A 1 70  ? 41.248  20.017  23.896  1.00 42.29 ? 70   TYR A N   1 
ATOM   531  C  CA  . TYR A 1 70  ? 41.818  21.024  23.021  1.00 43.11 ? 70   TYR A CA  1 
ATOM   532  C  C   . TYR A 1 70  ? 41.316  20.860  21.596  1.00 42.57 ? 70   TYR A C   1 
ATOM   533  O  O   . TYR A 1 70  ? 41.426  19.785  21.014  1.00 40.40 ? 70   TYR A O   1 
ATOM   534  C  CB  . TYR A 1 70  ? 43.346  20.981  23.058  1.00 46.26 ? 70   TYR A CB  1 
ATOM   535  C  CG  . TYR A 1 70  ? 43.923  22.376  23.030  1.00 49.04 ? 70   TYR A CG  1 
ATOM   536  C  CD1 . TYR A 1 70  ? 44.202  23.072  24.212  1.00 50.52 ? 70   TYR A CD1 1 
ATOM   537  C  CD2 . TYR A 1 70  ? 44.090  23.040  21.820  1.00 50.38 ? 70   TYR A CD2 1 
ATOM   538  C  CE1 . TYR A 1 70  ? 44.631  24.419  24.179  1.00 51.24 ? 70   TYR A CE1 1 
ATOM   539  C  CE2 . TYR A 1 70  ? 44.508  24.359  21.773  1.00 52.21 ? 70   TYR A CE2 1 
ATOM   540  C  CZ  . TYR A 1 70  ? 44.778  25.046  22.951  1.00 53.26 ? 70   TYR A CZ  1 
ATOM   541  O  OH  . TYR A 1 70  ? 45.201  26.362  22.858  1.00 57.19 ? 70   TYR A OH  1 
ATOM   542  N  N   . GLN A 1 71  ? 40.782  21.945  21.034  1.00 41.58 ? 71   GLN A N   1 
ATOM   543  C  CA  . GLN A 1 71  ? 40.215  21.883  19.698  1.00 40.82 ? 71   GLN A CA  1 
ATOM   544  C  C   . GLN A 1 71  ? 40.106  23.220  18.983  1.00 43.00 ? 71   GLN A C   1 
ATOM   545  O  O   . GLN A 1 71  ? 40.165  24.291  19.594  1.00 41.30 ? 71   GLN A O   1 
ATOM   546  C  CB  . GLN A 1 71  ? 38.806  21.299  19.775  1.00 39.05 ? 71   GLN A CB  1 
ATOM   547  C  CG  . GLN A 1 71  ? 37.867  22.113  20.645  1.00 35.67 ? 71   GLN A CG  1 
ATOM   548  C  CD  . GLN A 1 71  ? 36.553  21.385  20.977  1.00 37.01 ? 71   GLN A CD  1 
ATOM   549  O  OE1 . GLN A 1 71  ? 35.476  21.715  20.451  1.00 31.35 ? 71   GLN A OE1 1 
ATOM   550  N  NE2 . GLN A 1 71  ? 36.644  20.387  21.866  1.00 36.54 ? 71   GLN A NE2 1 
ATOM   551  N  N   . TYR A 1 72  ? 39.905  23.128  17.673  1.00 44.93 ? 72   TYR A N   1 
ATOM   552  C  CA  . TYR A 1 72  ? 39.717  24.294  16.828  1.00 47.82 ? 72   TYR A CA  1 
ATOM   553  C  C   . TYR A 1 72  ? 38.396  24.941  17.247  1.00 47.87 ? 72   TYR A C   1 
ATOM   554  O  O   . TYR A 1 72  ? 37.429  24.240  17.537  1.00 47.73 ? 72   TYR A O   1 
ATOM   555  C  CB  . TYR A 1 72  ? 39.663  23.859  15.353  1.00 50.58 ? 72   TYR A CB  1 
ATOM   556  C  CG  . TYR A 1 72  ? 39.194  24.939  14.402  1.00 55.03 ? 72   TYR A CG  1 
ATOM   557  C  CD1 . TYR A 1 72  ? 37.843  25.068  14.089  1.00 57.03 ? 72   TYR A CD1 1 
ATOM   558  C  CD2 . TYR A 1 72  ? 40.095  25.860  13.844  1.00 57.19 ? 72   TYR A CD2 1 
ATOM   559  C  CE1 . TYR A 1 72  ? 37.389  26.070  13.258  1.00 59.99 ? 72   TYR A CE1 1 
ATOM   560  C  CE2 . TYR A 1 72  ? 39.655  26.876  13.008  1.00 59.24 ? 72   TYR A CE2 1 
ATOM   561  C  CZ  . TYR A 1 72  ? 38.295  26.977  12.720  1.00 62.11 ? 72   TYR A CZ  1 
ATOM   562  O  OH  . TYR A 1 72  ? 37.815  27.993  11.909  1.00 64.53 ? 72   TYR A OH  1 
ATOM   563  N  N   . VAL A 1 73  ? 38.368  26.270  17.318  1.00 48.98 ? 73   VAL A N   1 
ATOM   564  C  CA  . VAL A 1 73  ? 37.154  27.007  17.687  1.00 50.26 ? 73   VAL A CA  1 
ATOM   565  C  C   . VAL A 1 73  ? 36.633  27.743  16.439  1.00 52.65 ? 73   VAL A C   1 
ATOM   566  O  O   . VAL A 1 73  ? 37.376  28.464  15.776  1.00 52.42 ? 73   VAL A O   1 
ATOM   567  C  CB  . VAL A 1 73  ? 37.428  28.036  18.820  1.00 49.81 ? 73   VAL A CB  1 
ATOM   568  C  CG1 . VAL A 1 73  ? 36.188  28.916  19.060  1.00 46.21 ? 73   VAL A CG1 1 
ATOM   569  C  CG2 . VAL A 1 73  ? 37.809  27.305  20.104  1.00 48.42 ? 73   VAL A CG2 1 
ATOM   570  N  N   . ASP A 1 74  ? 35.357  27.545  16.121  1.00 54.96 ? 74   ASP A N   1 
ATOM   571  C  CA  . ASP A 1 74  ? 34.756  28.157  14.938  1.00 56.56 ? 74   ASP A CA  1 
ATOM   572  C  C   . ASP A 1 74  ? 34.571  29.658  15.079  1.00 56.75 ? 74   ASP A C   1 
ATOM   573  O  O   . ASP A 1 74  ? 34.050  30.142  16.083  1.00 56.79 ? 74   ASP A O   1 
ATOM   574  C  CB  . ASP A 1 74  ? 33.398  27.506  14.618  1.00 57.07 ? 74   ASP A CB  1 
ATOM   575  C  CG  . ASP A 1 74  ? 32.826  27.956  13.271  1.00 60.49 ? 74   ASP A CG  1 
ATOM   576  O  OD1 . ASP A 1 74  ? 33.346  27.532  12.211  1.00 63.25 ? 74   ASP A OD1 1 
ATOM   577  O  OD2 . ASP A 1 74  ? 31.868  28.755  13.263  1.00 60.63 ? 74   ASP A OD2 1 
ATOM   578  N  N   . THR A 1 75  ? 34.998  30.391  14.056  1.00 58.03 ? 75   THR A N   1 
ATOM   579  C  CA  . THR A 1 75  ? 34.856  31.842  14.061  1.00 60.14 ? 75   THR A CA  1 
ATOM   580  C  C   . THR A 1 75  ? 34.261  32.398  12.766  1.00 61.30 ? 75   THR A C   1 
ATOM   581  O  O   . THR A 1 75  ? 34.287  33.605  12.550  1.00 61.64 ? 75   THR A O   1 
ATOM   582  C  CB  . THR A 1 75  ? 36.199  32.517  14.310  1.00 60.18 ? 75   THR A CB  1 
ATOM   583  O  OG1 . THR A 1 75  ? 37.225  31.756  13.656  1.00 58.21 ? 75   THR A OG1 1 
ATOM   584  C  CG2 . THR A 1 75  ? 36.467  32.628  15.809  1.00 57.87 ? 75   THR A CG2 1 
ATOM   585  N  N   . LEU A 1 76  ? 33.716  31.517  11.925  1.00 62.17 ? 76   LEU A N   1 
ATOM   586  C  CA  . LEU A 1 76  ? 33.113  31.917  10.659  1.00 62.74 ? 76   LEU A CA  1 
ATOM   587  C  C   . LEU A 1 76  ? 32.070  33.004  10.837  1.00 62.98 ? 76   LEU A C   1 
ATOM   588  O  O   . LEU A 1 76  ? 31.987  33.908  10.014  1.00 63.72 ? 76   LEU A O   1 
ATOM   589  C  CB  . LEU A 1 76  ? 32.468  30.717  9.962   1.00 63.55 ? 76   LEU A CB  1 
ATOM   590  C  CG  . LEU A 1 76  ? 31.757  31.008  8.630   1.00 66.19 ? 76   LEU A CG  1 
ATOM   591  C  CD1 . LEU A 1 76  ? 32.778  31.461  7.585   1.00 65.10 ? 76   LEU A CD1 1 
ATOM   592  C  CD2 . LEU A 1 76  ? 31.012  29.759  8.143   1.00 66.03 ? 76   LEU A CD2 1 
ATOM   593  N  N   . TYR A 1 77  ? 31.269  32.913  11.898  1.00 63.00 ? 77   TYR A N   1 
ATOM   594  C  CA  . TYR A 1 77  ? 30.224  33.907  12.178  1.00 61.92 ? 77   TYR A CA  1 
ATOM   595  C  C   . TYR A 1 77  ? 30.245  34.391  13.625  1.00 62.26 ? 77   TYR A C   1 
ATOM   596  O  O   . TYR A 1 77  ? 29.419  33.993  14.457  1.00 61.91 ? 77   TYR A O   1 
ATOM   597  C  CB  . TYR A 1 77  ? 28.849  33.336  11.851  1.00 59.92 ? 77   TYR A CB  1 
ATOM   598  C  CG  . TYR A 1 77  ? 28.651  33.022  10.391  1.00 60.33 ? 77   TYR A CG  1 
ATOM   599  C  CD1 . TYR A 1 77  ? 28.635  34.035  9.435   1.00 58.62 ? 77   TYR A CD1 1 
ATOM   600  C  CD2 . TYR A 1 77  ? 28.460  31.709  9.965   1.00 60.22 ? 77   TYR A CD2 1 
ATOM   601  C  CE1 . TYR A 1 77  ? 28.422  33.750  8.092   1.00 60.03 ? 77   TYR A CE1 1 
ATOM   602  C  CE2 . TYR A 1 77  ? 28.249  31.409  8.627   1.00 61.55 ? 77   TYR A CE2 1 
ATOM   603  C  CZ  . TYR A 1 77  ? 28.228  32.431  7.689   1.00 61.40 ? 77   TYR A CZ  1 
ATOM   604  O  OH  . TYR A 1 77  ? 27.972  32.121  6.362   1.00 61.77 ? 77   TYR A OH  1 
ATOM   605  N  N   . PRO A 1 78  ? 31.192  35.276  13.940  1.00 62.90 ? 78   PRO A N   1 
ATOM   606  C  CA  . PRO A 1 78  ? 31.357  35.841  15.285  1.00 63.52 ? 78   PRO A CA  1 
ATOM   607  C  C   . PRO A 1 78  ? 30.061  36.368  15.921  1.00 63.58 ? 78   PRO A C   1 
ATOM   608  O  O   . PRO A 1 78  ? 29.350  37.173  15.321  1.00 64.10 ? 78   PRO A O   1 
ATOM   609  C  CB  . PRO A 1 78  ? 32.392  36.938  15.058  1.00 63.88 ? 78   PRO A CB  1 
ATOM   610  C  CG  . PRO A 1 78  ? 33.284  36.302  13.996  1.00 63.91 ? 78   PRO A CG  1 
ATOM   611  C  CD  . PRO A 1 78  ? 32.242  35.762  13.026  1.00 62.72 ? 78   PRO A CD  1 
ATOM   612  N  N   . GLY A 1 79  ? 29.760  35.903  17.135  1.00 62.18 ? 79   GLY A N   1 
ATOM   613  C  CA  . GLY A 1 79  ? 28.559  36.340  17.829  1.00 59.24 ? 79   GLY A CA  1 
ATOM   614  C  C   . GLY A 1 79  ? 27.276  35.606  17.458  1.00 57.92 ? 79   GLY A C   1 
ATOM   615  O  O   . GLY A 1 79  ? 26.253  35.751  18.139  1.00 57.28 ? 79   GLY A O   1 
ATOM   616  N  N   . PHE A 1 80  ? 27.321  34.813  16.386  1.00 55.39 ? 80   PHE A N   1 
ATOM   617  C  CA  . PHE A 1 80  ? 26.152  34.068  15.920  1.00 53.07 ? 80   PHE A CA  1 
ATOM   618  C  C   . PHE A 1 80  ? 25.816  32.818  16.744  1.00 52.83 ? 80   PHE A C   1 
ATOM   619  O  O   . PHE A 1 80  ? 26.615  31.890  16.837  1.00 51.58 ? 80   PHE A O   1 
ATOM   620  C  CB  . PHE A 1 80  ? 26.362  33.676  14.461  1.00 52.47 ? 80   PHE A CB  1 
ATOM   621  C  CG  . PHE A 1 80  ? 25.196  32.959  13.848  1.00 51.37 ? 80   PHE A CG  1 
ATOM   622  C  CD1 . PHE A 1 80  ? 23.939  33.553  13.813  1.00 51.05 ? 80   PHE A CD1 1 
ATOM   623  C  CD2 . PHE A 1 80  ? 25.374  31.726  13.227  1.00 50.22 ? 80   PHE A CD2 1 
ATOM   624  C  CE1 . PHE A 1 80  ? 22.882  32.937  13.163  1.00 50.34 ? 80   PHE A CE1 1 
ATOM   625  C  CE2 . PHE A 1 80  ? 24.318  31.094  12.568  1.00 48.63 ? 80   PHE A CE2 1 
ATOM   626  C  CZ  . PHE A 1 80  ? 23.072  31.700  12.534  1.00 49.96 ? 80   PHE A CZ  1 
ATOM   627  N  N   . GLU A 1 81  ? 24.620  32.798  17.321  1.00 52.61 ? 81   GLU A N   1 
ATOM   628  C  CA  . GLU A 1 81  ? 24.162  31.683  18.138  1.00 54.18 ? 81   GLU A CA  1 
ATOM   629  C  C   . GLU A 1 81  ? 24.217  30.347  17.380  1.00 52.72 ? 81   GLU A C   1 
ATOM   630  O  O   . GLU A 1 81  ? 24.543  29.304  17.948  1.00 50.02 ? 81   GLU A O   1 
ATOM   631  C  CB  . GLU A 1 81  ? 22.735  31.960  18.612  1.00 57.63 ? 81   GLU A CB  1 
ATOM   632  C  CG  . GLU A 1 81  ? 22.050  30.811  19.335  1.00 66.04 ? 81   GLU A CG  1 
ATOM   633  C  CD  . GLU A 1 81  ? 22.211  30.862  20.858  1.00 71.37 ? 81   GLU A CD  1 
ATOM   634  O  OE1 . GLU A 1 81  ? 21.994  31.953  21.448  1.00 74.71 ? 81   GLU A OE1 1 
ATOM   635  O  OE2 . GLU A 1 81  ? 22.532  29.807  21.469  1.00 73.69 ? 81   GLU A OE2 1 
ATOM   636  N  N   . GLY A 1 82  ? 23.910  30.395  16.091  1.00 50.90 ? 82   GLY A N   1 
ATOM   637  C  CA  . GLY A 1 82  ? 23.915  29.190  15.290  1.00 49.54 ? 82   GLY A CA  1 
ATOM   638  C  C   . GLY A 1 82  ? 25.217  28.427  15.303  1.00 49.10 ? 82   GLY A C   1 
ATOM   639  O  O   . GLY A 1 82  ? 25.226  27.203  15.168  1.00 49.24 ? 82   GLY A O   1 
ATOM   640  N  N   . THR A 1 83  ? 26.325  29.144  15.427  1.00 48.87 ? 83   THR A N   1 
ATOM   641  C  CA  . THR A 1 83  ? 27.625  28.500  15.479  1.00 48.84 ? 83   THR A CA  1 
ATOM   642  C  C   . THR A 1 83  ? 28.172  28.432  16.923  1.00 49.38 ? 83   THR A C   1 
ATOM   643  O  O   . THR A 1 83  ? 28.743  27.422  17.323  1.00 49.92 ? 83   THR A O   1 
ATOM   644  C  CB  . THR A 1 83  ? 28.633  29.219  14.543  1.00 48.85 ? 83   THR A CB  1 
ATOM   645  O  OG1 . THR A 1 83  ? 28.567  30.628  14.763  1.00 50.55 ? 83   THR A OG1 1 
ATOM   646  C  CG2 . THR A 1 83  ? 28.310  28.940  13.085  1.00 46.99 ? 83   THR A CG2 1 
ATOM   647  N  N   . GLU A 1 84  ? 27.955  29.481  17.712  1.00 49.98 ? 84   GLU A N   1 
ATOM   648  C  CA  . GLU A 1 84  ? 28.442  29.538  19.084  1.00 50.44 ? 84   GLU A CA  1 
ATOM   649  C  C   . GLU A 1 84  ? 27.927  28.408  19.951  1.00 48.38 ? 84   GLU A C   1 
ATOM   650  O  O   . GLU A 1 84  ? 28.620  27.938  20.854  1.00 47.23 ? 84   GLU A O   1 
ATOM   651  C  CB  . GLU A 1 84  ? 28.031  30.851  19.744  1.00 55.34 ? 84   GLU A CB  1 
ATOM   652  C  CG  . GLU A 1 84  ? 28.421  32.096  18.976  1.00 63.56 ? 84   GLU A CG  1 
ATOM   653  C  CD  . GLU A 1 84  ? 29.884  32.460  19.120  1.00 68.33 ? 84   GLU A CD  1 
ATOM   654  O  OE1 . GLU A 1 84  ? 30.678  31.586  19.589  1.00 70.30 ? 84   GLU A OE1 1 
ATOM   655  O  OE2 . GLU A 1 84  ? 30.228  33.624  18.756  1.00 69.18 ? 84   GLU A OE2 1 
ATOM   656  N  N   . MET A 1 85  ? 26.704  27.968  19.699  1.00 47.63 ? 85   MET A N   1 
ATOM   657  C  CA  . MET A 1 85  ? 26.145  26.903  20.515  1.00 46.60 ? 85   MET A CA  1 
ATOM   658  C  C   . MET A 1 85  ? 26.944  25.588  20.448  1.00 44.77 ? 85   MET A C   1 
ATOM   659  O  O   . MET A 1 85  ? 26.746  24.722  21.286  1.00 45.55 ? 85   MET A O   1 
ATOM   660  C  CB  . MET A 1 85  ? 24.679  26.659  20.158  1.00 47.11 ? 85   MET A CB  1 
ATOM   661  C  CG  . MET A 1 85  ? 24.483  25.942  18.836  1.00 51.50 ? 85   MET A CG  1 
ATOM   662  S  SD  . MET A 1 85  ? 22.770  25.448  18.597  1.00 54.58 ? 85   MET A SD  1 
ATOM   663  C  CE  . MET A 1 85  ? 22.684  24.099  19.657  1.00 52.13 ? 85   MET A CE  1 
ATOM   664  N  N   . TRP A 1 86  ? 27.842  25.443  19.475  1.00 43.13 ? 86   TRP A N   1 
ATOM   665  C  CA  . TRP A 1 86  ? 28.650  24.235  19.369  1.00 43.27 ? 86   TRP A CA  1 
ATOM   666  C  C   . TRP A 1 86  ? 30.090  24.462  19.866  1.00 44.15 ? 86   TRP A C   1 
ATOM   667  O  O   . TRP A 1 86  ? 30.858  23.505  20.015  1.00 43.10 ? 86   TRP A O   1 
ATOM   668  C  CB  . TRP A 1 86  ? 28.692  23.713  17.928  1.00 40.55 ? 86   TRP A CB  1 
ATOM   669  C  CG  . TRP A 1 86  ? 27.344  23.574  17.288  1.00 42.91 ? 86   TRP A CG  1 
ATOM   670  C  CD1 . TRP A 1 86  ? 26.789  24.416  16.372  1.00 41.90 ? 86   TRP A CD1 1 
ATOM   671  C  CD2 . TRP A 1 86  ? 26.349  22.575  17.563  1.00 41.66 ? 86   TRP A CD2 1 
ATOM   672  N  NE1 . TRP A 1 86  ? 25.513  24.010  16.065  1.00 43.34 ? 86   TRP A NE1 1 
ATOM   673  C  CE2 . TRP A 1 86  ? 25.218  22.886  16.784  1.00 42.76 ? 86   TRP A CE2 1 
ATOM   674  C  CE3 . TRP A 1 86  ? 26.305  21.452  18.389  1.00 43.04 ? 86   TRP A CE3 1 
ATOM   675  C  CZ2 . TRP A 1 86  ? 24.062  22.119  16.809  1.00 43.37 ? 86   TRP A CZ2 1 
ATOM   676  C  CZ3 . TRP A 1 86  ? 25.150  20.683  18.415  1.00 42.51 ? 86   TRP A CZ3 1 
ATOM   677  C  CH2 . TRP A 1 86  ? 24.051  21.018  17.637  1.00 44.16 ? 86   TRP A CH2 1 
ATOM   678  N  N   . ASN A 1 87  ? 30.446  25.720  20.121  1.00 43.96 ? 87   ASN A N   1 
ATOM   679  C  CA  . ASN A 1 87  ? 31.786  26.073  20.595  1.00 44.95 ? 87   ASN A CA  1 
ATOM   680  C  C   . ASN A 1 87  ? 32.050  25.663  22.039  1.00 43.36 ? 87   ASN A C   1 
ATOM   681  O  O   . ASN A 1 87  ? 31.131  25.530  22.825  1.00 43.05 ? 87   ASN A O   1 
ATOM   682  C  CB  . ASN A 1 87  ? 32.023  27.582  20.455  1.00 45.85 ? 87   ASN A CB  1 
ATOM   683  C  CG  . ASN A 1 87  ? 32.398  27.982  19.028  1.00 50.79 ? 87   ASN A CG  1 
ATOM   684  O  OD1 . ASN A 1 87  ? 32.878  27.148  18.228  1.00 51.20 ? 87   ASN A OD1 1 
ATOM   685  N  ND2 . ASN A 1 87  ? 32.210  29.258  18.708  1.00 50.36 ? 87   ASN A ND2 1 
ATOM   686  N  N   . PRO A 1 88  ? 33.324  25.463  22.405  1.00 43.09 ? 88   PRO A N   1 
ATOM   687  C  CA  . PRO A 1 88  ? 33.651  25.064  23.790  1.00 42.59 ? 88   PRO A CA  1 
ATOM   688  C  C   . PRO A 1 88  ? 33.067  26.046  24.810  1.00 41.91 ? 88   PRO A C   1 
ATOM   689  O  O   . PRO A 1 88  ? 33.121  27.256  24.594  1.00 40.73 ? 88   PRO A O   1 
ATOM   690  C  CB  . PRO A 1 88  ? 35.186  25.048  23.809  1.00 40.39 ? 88   PRO A CB  1 
ATOM   691  C  CG  . PRO A 1 88  ? 35.539  24.695  22.385  1.00 43.70 ? 88   PRO A CG  1 
ATOM   692  C  CD  . PRO A 1 88  ? 34.529  25.502  21.550  1.00 41.47 ? 88   PRO A CD  1 
ATOM   693  N  N   . ASN A 1 89  ? 32.516  25.523  25.910  1.00 40.13 ? 89   ASN A N   1 
ATOM   694  C  CA  . ASN A 1 89  ? 31.920  26.363  26.932  1.00 38.95 ? 89   ASN A CA  1 
ATOM   695  C  C   . ASN A 1 89  ? 32.650  26.223  28.269  1.00 39.49 ? 89   ASN A C   1 
ATOM   696  O  O   . ASN A 1 89  ? 32.150  26.583  29.346  1.00 36.76 ? 89   ASN A O   1 
ATOM   697  C  CB  . ASN A 1 89  ? 30.432  26.038  27.090  1.00 40.46 ? 89   ASN A CB  1 
ATOM   698  C  CG  . ASN A 1 89  ? 30.188  24.638  27.647  1.00 41.83 ? 89   ASN A CG  1 
ATOM   699  O  OD1 . ASN A 1 89  ? 31.010  23.744  27.490  1.00 41.48 ? 89   ASN A OD1 1 
ATOM   700  N  ND2 . ASN A 1 89  ? 29.038  24.445  28.287  1.00 43.11 ? 89   ASN A ND2 1 
ATOM   701  N  N   . ARG A 1 90  ? 33.852  25.681  28.193  1.00 40.03 ? 90   ARG A N   1 
ATOM   702  C  CA  . ARG A 1 90  ? 34.727  25.523  29.360  1.00 40.76 ? 90   ARG A CA  1 
ATOM   703  C  C   . ARG A 1 90  ? 36.138  25.710  28.818  1.00 40.08 ? 90   ARG A C   1 
ATOM   704  O  O   . ARG A 1 90  ? 36.344  25.710  27.606  1.00 41.27 ? 90   ARG A O   1 
ATOM   705  C  CB  . ARG A 1 90  ? 34.590  24.123  29.992  1.00 40.30 ? 90   ARG A CB  1 
ATOM   706  C  CG  . ARG A 1 90  ? 33.350  23.957  30.879  1.00 41.87 ? 90   ARG A CG  1 
ATOM   707  C  CD  . ARG A 1 90  ? 33.441  24.830  32.143  1.00 44.89 ? 90   ARG A CD  1 
ATOM   708  N  NE  . ARG A 1 90  ? 32.218  24.763  32.926  1.00 50.15 ? 90   ARG A NE  1 
ATOM   709  C  CZ  . ARG A 1 90  ? 31.060  25.341  32.588  1.00 52.69 ? 90   ARG A CZ  1 
ATOM   710  N  NH1 . ARG A 1 90  ? 30.947  26.066  31.474  1.00 50.34 ? 90   ARG A NH1 1 
ATOM   711  N  NH2 . ARG A 1 90  ? 29.981  25.151  33.346  1.00 53.97 ? 90   ARG A NH2 1 
ATOM   712  N  N   . GLU A 1 91  ? 37.106  25.865  29.703  1.00 39.99 ? 91   GLU A N   1 
ATOM   713  C  CA  . GLU A 1 91  ? 38.477  26.040  29.272  1.00 40.77 ? 91   GLU A CA  1 
ATOM   714  C  C   . GLU A 1 91  ? 39.009  24.880  28.416  1.00 40.92 ? 91   GLU A C   1 
ATOM   715  O  O   . GLU A 1 91  ? 38.705  23.696  28.668  1.00 40.77 ? 91   GLU A O   1 
ATOM   716  C  CB  . GLU A 1 91  ? 39.383  26.188  30.478  1.00 40.96 ? 91   GLU A CB  1 
ATOM   717  C  CG  . GLU A 1 91  ? 40.813  26.396  30.058  1.00 46.00 ? 91   GLU A CG  1 
ATOM   718  C  CD  . GLU A 1 91  ? 41.757  26.481  31.241  1.00 51.12 ? 91   GLU A CD  1 
ATOM   719  O  OE1 . GLU A 1 91  ? 41.296  26.879  32.334  1.00 49.22 ? 91   GLU A OE1 1 
ATOM   720  O  OE2 . GLU A 1 91  ? 42.959  26.160  31.066  1.00 53.60 ? 91   GLU A OE2 1 
ATOM   721  N  N   . LEU A 1 92  ? 39.800  25.222  27.405  1.00 40.12 ? 92   LEU A N   1 
ATOM   722  C  CA  . LEU A 1 92  ? 40.403  24.227  26.529  1.00 42.01 ? 92   LEU A CA  1 
ATOM   723  C  C   . LEU A 1 92  ? 41.667  23.692  27.178  1.00 43.78 ? 92   LEU A C   1 
ATOM   724  O  O   . LEU A 1 92  ? 42.466  24.457  27.710  1.00 46.26 ? 92   LEU A O   1 
ATOM   725  C  CB  . LEU A 1 92  ? 40.794  24.827  25.191  1.00 41.39 ? 92   LEU A CB  1 
ATOM   726  C  CG  . LEU A 1 92  ? 39.698  25.292  24.247  1.00 42.02 ? 92   LEU A CG  1 
ATOM   727  C  CD1 . LEU A 1 92  ? 40.378  25.685  22.947  1.00 39.27 ? 92   LEU A CD1 1 
ATOM   728  C  CD2 . LEU A 1 92  ? 38.667  24.158  24.004  1.00 41.17 ? 92   LEU A CD2 1 
ATOM   729  N  N   . SER A 1 93  ? 41.863  22.381  27.125  1.00 43.34 ? 93   SER A N   1 
ATOM   730  C  CA  . SER A 1 93  ? 43.040  21.794  27.728  1.00 42.62 ? 93   SER A CA  1 
ATOM   731  C  C   . SER A 1 93  ? 43.229  20.353  27.282  1.00 43.07 ? 93   SER A C   1 
ATOM   732  O  O   . SER A 1 93  ? 42.267  19.660  26.939  1.00 44.33 ? 93   SER A O   1 
ATOM   733  C  CB  . SER A 1 93  ? 42.909  21.855  29.259  1.00 44.15 ? 93   SER A CB  1 
ATOM   734  O  OG  . SER A 1 93  ? 43.744  20.895  29.884  1.00 43.10 ? 93   SER A OG  1 
ATOM   735  N  N   . GLU A 1 94  ? 44.470  19.892  27.278  1.00 42.66 ? 94   GLU A N   1 
ATOM   736  C  CA  . GLU A 1 94  ? 44.718  18.508  26.927  1.00 41.21 ? 94   GLU A CA  1 
ATOM   737  C  C   . GLU A 1 94  ? 44.309  17.611  28.087  1.00 40.36 ? 94   GLU A C   1 
ATOM   738  O  O   . GLU A 1 94  ? 44.139  16.399  27.911  1.00 40.62 ? 94   GLU A O   1 
ATOM   739  C  CB  . GLU A 1 94  ? 46.177  18.275  26.590  1.00 42.70 ? 94   GLU A CB  1 
ATOM   740  C  CG  . GLU A 1 94  ? 46.548  18.787  25.216  1.00 43.29 ? 94   GLU A CG  1 
ATOM   741  C  CD  . GLU A 1 94  ? 47.986  18.452  24.830  1.00 44.23 ? 94   GLU A CD  1 
ATOM   742  O  OE1 . GLU A 1 94  ? 48.242  17.324  24.340  1.00 42.68 ? 94   GLU A OE1 1 
ATOM   743  O  OE2 . GLU A 1 94  ? 48.855  19.333  25.032  1.00 45.35 ? 94   GLU A OE2 1 
ATOM   744  N  N   . ASP A 1 95  ? 44.141  18.213  29.265  1.00 39.07 ? 95   ASP A N   1 
ATOM   745  C  CA  . ASP A 1 95  ? 43.706  17.486  30.464  1.00 39.84 ? 95   ASP A CA  1 
ATOM   746  C  C   . ASP A 1 95  ? 42.193  17.613  30.370  1.00 38.34 ? 95   ASP A C   1 
ATOM   747  O  O   . ASP A 1 95  ? 41.593  18.551  30.921  1.00 38.50 ? 95   ASP A O   1 
ATOM   748  C  CB  . ASP A 1 95  ? 44.222  18.181  31.742  1.00 39.84 ? 95   ASP A CB  1 
ATOM   749  C  CG  . ASP A 1 95  ? 43.780  17.473  33.013  1.00 42.87 ? 95   ASP A CG  1 
ATOM   750  O  OD1 . ASP A 1 95  ? 42.953  16.519  32.949  1.00 43.68 ? 95   ASP A OD1 1 
ATOM   751  O  OD2 . ASP A 1 95  ? 44.257  17.876  34.096  1.00 45.34 ? 95   ASP A OD2 1 
ATOM   752  N  N   . CYS A 1 96  ? 41.578  16.650  29.694  1.00 38.14 ? 96   CYS A N   1 
ATOM   753  C  CA  . CYS A 1 96  ? 40.150  16.723  29.433  1.00 38.04 ? 96   CYS A CA  1 
ATOM   754  C  C   . CYS A 1 96  ? 39.355  15.427  29.538  1.00 37.86 ? 96   CYS A C   1 
ATOM   755  O  O   . CYS A 1 96  ? 38.161  15.417  29.243  1.00 36.25 ? 96   CYS A O   1 
ATOM   756  C  CB  . CYS A 1 96  ? 39.974  17.312  28.017  1.00 37.21 ? 96   CYS A CB  1 
ATOM   757  S  SG  . CYS A 1 96  ? 40.589  16.210  26.688  1.00 39.92 ? 96   CYS A SG  1 
ATOM   758  N  N   . LEU A 1 97  ? 39.992  14.334  29.940  1.00 38.29 ? 97   LEU A N   1 
ATOM   759  C  CA  . LEU A 1 97  ? 39.257  13.077  29.999  1.00 38.63 ? 97   LEU A CA  1 
ATOM   760  C  C   . LEU A 1 97  ? 38.424  12.948  31.284  1.00 38.85 ? 97   LEU A C   1 
ATOM   761  O  O   . LEU A 1 97  ? 38.861  12.416  32.302  1.00 40.90 ? 97   LEU A O   1 
ATOM   762  C  CB  . LEU A 1 97  ? 40.232  11.899  29.789  1.00 37.61 ? 97   LEU A CB  1 
ATOM   763  C  CG  . LEU A 1 97  ? 40.975  11.958  28.435  1.00 37.10 ? 97   LEU A CG  1 
ATOM   764  C  CD1 . LEU A 1 97  ? 41.802  10.706  28.202  1.00 33.37 ? 97   LEU A CD1 1 
ATOM   765  C  CD2 . LEU A 1 97  ? 39.951  12.112  27.297  1.00 37.99 ? 97   LEU A CD2 1 
ATOM   766  N  N   . TYR A 1 98  ? 37.204  13.461  31.214  1.00 38.77 ? 98   TYR A N   1 
ATOM   767  C  CA  . TYR A 1 98  ? 36.266  13.447  32.333  1.00 38.71 ? 98   TYR A CA  1 
ATOM   768  C  C   . TYR A 1 98  ? 34.897  13.073  31.769  1.00 38.08 ? 98   TYR A C   1 
ATOM   769  O  O   . TYR A 1 98  ? 34.647  13.261  30.571  1.00 38.30 ? 98   TYR A O   1 
ATOM   770  C  CB  . TYR A 1 98  ? 36.216  14.845  32.980  1.00 39.82 ? 98   TYR A CB  1 
ATOM   771  C  CG  . TYR A 1 98  ? 37.550  15.323  33.526  1.00 41.72 ? 98   TYR A CG  1 
ATOM   772  C  CD1 . TYR A 1 98  ? 37.896  15.102  34.875  1.00 42.41 ? 98   TYR A CD1 1 
ATOM   773  C  CD2 . TYR A 1 98  ? 38.475  15.975  32.702  1.00 41.97 ? 98   TYR A CD2 1 
ATOM   774  C  CE1 . TYR A 1 98  ? 39.134  15.521  35.389  1.00 43.02 ? 98   TYR A CE1 1 
ATOM   775  C  CE2 . TYR A 1 98  ? 39.727  16.404  33.198  1.00 42.27 ? 98   TYR A CE2 1 
ATOM   776  C  CZ  . TYR A 1 98  ? 40.048  16.169  34.546  1.00 45.81 ? 98   TYR A CZ  1 
ATOM   777  O  OH  . TYR A 1 98  ? 41.283  16.556  35.038  1.00 45.35 ? 98   TYR A OH  1 
ATOM   778  N  N   . LEU A 1 99  ? 34.021  12.527  32.610  1.00 36.54 ? 99   LEU A N   1 
ATOM   779  C  CA  . LEU A 1 99  ? 32.688  12.168  32.151  1.00 35.32 ? 99   LEU A CA  1 
ATOM   780  C  C   . LEU A 1 99  ? 31.653  12.728  33.114  1.00 35.46 ? 99   LEU A C   1 
ATOM   781  O  O   . LEU A 1 99  ? 32.000  13.231  34.187  1.00 33.61 ? 99   LEU A O   1 
ATOM   782  C  CB  . LEU A 1 99  ? 32.554  10.649  31.982  1.00 33.94 ? 99   LEU A CB  1 
ATOM   783  C  CG  . LEU A 1 99  ? 32.929  9.719   33.147  1.00 33.45 ? 99   LEU A CG  1 
ATOM   784  C  CD1 . LEU A 1 99  ? 31.810  9.706   34.209  1.00 30.10 ? 99   LEU A CD1 1 
ATOM   785  C  CD2 . LEU A 1 99  ? 33.123  8.312   32.574  1.00 30.05 ? 99   LEU A CD2 1 
ATOM   786  N  N   . ASN A 1 100 ? 30.387  12.671  32.712  1.00 35.23 ? 100  ASN A N   1 
ATOM   787  C  CA  . ASN A 1 100 ? 29.305  13.233  33.508  1.00 35.59 ? 100  ASN A CA  1 
ATOM   788  C  C   . ASN A 1 100 ? 28.189  12.228  33.687  1.00 35.30 ? 100  ASN A C   1 
ATOM   789  O  O   . ASN A 1 100 ? 27.951  11.399  32.816  1.00 35.39 ? 100  ASN A O   1 
ATOM   790  C  CB  . ASN A 1 100 ? 28.743  14.469  32.801  1.00 35.80 ? 100  ASN A CB  1 
ATOM   791  C  CG  . ASN A 1 100 ? 29.831  15.353  32.238  1.00 38.08 ? 100  ASN A CG  1 
ATOM   792  O  OD1 . ASN A 1 100 ? 30.605  15.950  32.999  1.00 37.58 ? 100  ASN A OD1 1 
ATOM   793  N  ND2 . ASN A 1 100 ? 29.912  15.438  30.899  1.00 34.12 ? 100  ASN A ND2 1 
ATOM   794  N  N   . VAL A 1 101 ? 27.496  12.316  34.814  1.00 35.54 ? 101  VAL A N   1 
ATOM   795  C  CA  . VAL A 1 101 ? 26.403  11.408  35.092  1.00 36.42 ? 101  VAL A CA  1 
ATOM   796  C  C   . VAL A 1 101 ? 25.199  12.172  35.639  1.00 38.29 ? 101  VAL A C   1 
ATOM   797  O  O   . VAL A 1 101 ? 25.345  13.021  36.519  1.00 38.63 ? 101  VAL A O   1 
ATOM   798  C  CB  . VAL A 1 101 ? 26.825  10.351  36.137  1.00 36.37 ? 101  VAL A CB  1 
ATOM   799  C  CG1 . VAL A 1 101 ? 25.700  9.362   36.372  1.00 34.13 ? 101  VAL A CG1 1 
ATOM   800  C  CG2 . VAL A 1 101 ? 28.076  9.644   35.683  1.00 33.46 ? 101  VAL A CG2 1 
ATOM   801  N  N   . TRP A 1 102 ? 24.016  11.879  35.106  1.00 38.39 ? 102  TRP A N   1 
ATOM   802  C  CA  . TRP A 1 102 ? 22.783  12.499  35.578  1.00 38.74 ? 102  TRP A CA  1 
ATOM   803  C  C   . TRP A 1 102 ? 21.889  11.346  36.021  1.00 40.56 ? 102  TRP A C   1 
ATOM   804  O  O   . TRP A 1 102 ? 21.772  10.336  35.327  1.00 40.85 ? 102  TRP A O   1 
ATOM   805  C  CB  . TRP A 1 102 ? 22.070  13.258  34.453  1.00 37.20 ? 102  TRP A CB  1 
ATOM   806  C  CG  . TRP A 1 102 ? 22.635  14.620  34.129  1.00 36.86 ? 102  TRP A CG  1 
ATOM   807  C  CD1 . TRP A 1 102 ? 22.309  15.811  34.721  1.00 36.02 ? 102  TRP A CD1 1 
ATOM   808  C  CD2 . TRP A 1 102 ? 23.586  14.939  33.098  1.00 36.85 ? 102  TRP A CD2 1 
ATOM   809  N  NE1 . TRP A 1 102 ? 22.990  16.851  34.120  1.00 35.98 ? 102  TRP A NE1 1 
ATOM   810  C  CE2 . TRP A 1 102 ? 23.781  16.343  33.124  1.00 37.07 ? 102  TRP A CE2 1 
ATOM   811  C  CE3 . TRP A 1 102 ? 24.290  14.178  32.159  1.00 36.23 ? 102  TRP A CE3 1 
ATOM   812  C  CZ2 . TRP A 1 102 ? 24.649  16.993  32.244  1.00 36.56 ? 102  TRP A CZ2 1 
ATOM   813  C  CZ3 . TRP A 1 102 ? 25.153  14.823  31.280  1.00 36.23 ? 102  TRP A CZ3 1 
ATOM   814  C  CH2 . TRP A 1 102 ? 25.325  16.224  31.333  1.00 38.85 ? 102  TRP A CH2 1 
ATOM   815  N  N   . THR A 1 103 ? 21.266  11.476  37.182  1.00 42.35 ? 103  THR A N   1 
ATOM   816  C  CA  . THR A 1 103 ? 20.364  10.431  37.640  1.00 43.31 ? 103  THR A CA  1 
ATOM   817  C  C   . THR A 1 103 ? 19.223  11.097  38.361  1.00 43.56 ? 103  THR A C   1 
ATOM   818  O  O   . THR A 1 103 ? 19.338  12.242  38.805  1.00 43.43 ? 103  THR A O   1 
ATOM   819  C  CB  . THR A 1 103 ? 21.019  9.466   38.660  1.00 44.53 ? 103  THR A CB  1 
ATOM   820  O  OG1 . THR A 1 103 ? 21.326  10.191  39.858  1.00 46.24 ? 103  THR A OG1 1 
ATOM   821  C  CG2 . THR A 1 103 ? 22.288  8.851   38.108  1.00 43.98 ? 103  THR A CG2 1 
ATOM   822  N  N   . PRO A 1 104 ? 18.098  10.390  38.472  1.00 44.41 ? 104  PRO A N   1 
ATOM   823  C  CA  . PRO A 1 104 ? 16.917  10.903  39.163  1.00 46.72 ? 104  PRO A CA  1 
ATOM   824  C  C   . PRO A 1 104 ? 17.303  11.290  40.590  1.00 48.04 ? 104  PRO A C   1 
ATOM   825  O  O   . PRO A 1 104 ? 18.306  10.810  41.110  1.00 50.23 ? 104  PRO A O   1 
ATOM   826  C  CB  . PRO A 1 104 ? 15.975  9.700   39.149  1.00 45.87 ? 104  PRO A CB  1 
ATOM   827  C  CG  . PRO A 1 104 ? 16.265  9.086   37.797  1.00 45.38 ? 104  PRO A CG  1 
ATOM   828  C  CD  . PRO A 1 104 ? 17.788  9.138   37.750  1.00 44.22 ? 104  PRO A CD  1 
ATOM   829  N  N   . TYR A 1 105 ? 16.524  12.167  41.209  1.00 48.94 ? 105  TYR A N   1 
ATOM   830  C  CA  . TYR A 1 105 ? 16.770  12.566  42.585  1.00 50.21 ? 105  TYR A CA  1 
ATOM   831  C  C   . TYR A 1 105 ? 15.486  12.328  43.376  1.00 51.78 ? 105  TYR A C   1 
ATOM   832  O  O   . TYR A 1 105 ? 14.452  12.929  43.088  1.00 51.72 ? 105  TYR A O   1 
ATOM   833  C  CB  . TYR A 1 105 ? 17.151  14.037  42.663  1.00 48.25 ? 105  TYR A CB  1 
ATOM   834  C  CG  . TYR A 1 105 ? 17.455  14.510  44.068  1.00 47.19 ? 105  TYR A CG  1 
ATOM   835  C  CD1 . TYR A 1 105 ? 18.763  14.793  44.461  1.00 46.12 ? 105  TYR A CD1 1 
ATOM   836  C  CD2 . TYR A 1 105 ? 16.436  14.687  45.007  1.00 46.04 ? 105  TYR A CD2 1 
ATOM   837  C  CE1 . TYR A 1 105 ? 19.054  15.248  45.763  1.00 45.42 ? 105  TYR A CE1 1 
ATOM   838  C  CE2 . TYR A 1 105 ? 16.723  15.143  46.315  1.00 44.92 ? 105  TYR A CE2 1 
ATOM   839  C  CZ  . TYR A 1 105 ? 18.026  15.418  46.678  1.00 44.11 ? 105  TYR A CZ  1 
ATOM   840  O  OH  . TYR A 1 105 ? 18.305  15.895  47.932  1.00 40.47 ? 105  TYR A OH  1 
ATOM   841  N  N   . PRO A 1 106 ? 15.531  11.441  44.382  1.00 53.63 ? 106  PRO A N   1 
ATOM   842  C  CA  . PRO A 1 106 ? 16.686  10.653  44.829  1.00 54.01 ? 106  PRO A CA  1 
ATOM   843  C  C   . PRO A 1 106 ? 17.014  9.523   43.864  1.00 54.80 ? 106  PRO A C   1 
ATOM   844  O  O   . PRO A 1 106 ? 16.139  9.068   43.126  1.00 53.19 ? 106  PRO A O   1 
ATOM   845  C  CB  . PRO A 1 106 ? 16.235  10.132  46.185  1.00 53.24 ? 106  PRO A CB  1 
ATOM   846  C  CG  . PRO A 1 106 ? 14.775  9.883   45.946  1.00 53.81 ? 106  PRO A CG  1 
ATOM   847  C  CD  . PRO A 1 106 ? 14.345  11.134  45.202  1.00 53.08 ? 106  PRO A CD  1 
ATOM   848  N  N   . ARG A 1 107 ? 18.267  9.063   43.896  1.00 56.80 ? 107  ARG A N   1 
ATOM   849  C  CA  . ARG A 1 107 ? 18.721  7.996   43.006  1.00 58.97 ? 107  ARG A CA  1 
ATOM   850  C  C   . ARG A 1 107 ? 17.790  6.810   43.028  1.00 61.42 ? 107  ARG A C   1 
ATOM   851  O  O   . ARG A 1 107 ? 17.354  6.370   44.086  1.00 63.13 ? 107  ARG A O   1 
ATOM   852  C  CB  . ARG A 1 107 ? 20.144  7.557   43.352  1.00 58.34 ? 107  ARG A CB  1 
ATOM   853  C  CG  . ARG A 1 107 ? 21.197  8.652   43.129  1.00 58.29 ? 107  ARG A CG  1 
ATOM   854  C  CD  . ARG A 1 107 ? 22.579  8.056   43.075  1.00 59.44 ? 107  ARG A CD  1 
ATOM   855  N  NE  . ARG A 1 107 ? 22.910  7.277   44.270  1.00 57.63 ? 107  ARG A NE  1 
ATOM   856  C  CZ  . ARG A 1 107 ? 23.264  7.809   45.432  1.00 58.29 ? 107  ARG A CZ  1 
ATOM   857  N  NH1 . ARG A 1 107 ? 23.332  9.135   45.551  1.00 56.86 ? 107  ARG A NH1 1 
ATOM   858  N  NH2 . ARG A 1 107 ? 23.562  7.014   46.469  1.00 57.74 ? 107  ARG A NH2 1 
ATOM   859  N  N   . PRO A 1 108 ? 17.481  6.268   41.844  1.00 64.11 ? 108  PRO A N   1 
ATOM   860  C  CA  . PRO A 1 108 ? 16.586  5.116   41.644  1.00 65.89 ? 108  PRO A CA  1 
ATOM   861  C  C   . PRO A 1 108 ? 16.790  3.922   42.587  1.00 66.58 ? 108  PRO A C   1 
ATOM   862  O  O   . PRO A 1 108 ? 17.918  3.542   42.900  1.00 66.41 ? 108  PRO A O   1 
ATOM   863  C  CB  . PRO A 1 108 ? 16.807  4.750   40.171  1.00 66.13 ? 108  PRO A CB  1 
ATOM   864  C  CG  . PRO A 1 108 ? 18.214  5.245   39.899  1.00 66.56 ? 108  PRO A CG  1 
ATOM   865  C  CD  . PRO A 1 108 ? 18.228  6.576   40.609  1.00 64.65 ? 108  PRO A CD  1 
ATOM   866  N  N   . ALA A 1 109 ? 15.678  3.338   43.020  1.00 67.12 ? 109  ALA A N   1 
ATOM   867  C  CA  . ALA A 1 109 ? 15.696  2.189   43.920  1.00 68.31 ? 109  ALA A CA  1 
ATOM   868  C  C   . ALA A 1 109 ? 16.155  0.891   43.211  1.00 67.92 ? 109  ALA A C   1 
ATOM   869  O  O   . ALA A 1 109 ? 16.939  0.119   43.770  1.00 66.97 ? 109  ALA A O   1 
ATOM   870  C  CB  . ALA A 1 109 ? 14.302  1.999   44.549  1.00 69.58 ? 109  ALA A CB  1 
ATOM   871  N  N   . SER A 1 110 ? 15.663  0.649   41.996  1.00 66.55 ? 110  SER A N   1 
ATOM   872  C  CA  . SER A 1 110 ? 16.066  -0.533  41.221  1.00 65.33 ? 110  SER A CA  1 
ATOM   873  C  C   . SER A 1 110 ? 16.874  -0.100  39.997  1.00 63.60 ? 110  SER A C   1 
ATOM   874  O  O   . SER A 1 110 ? 16.674  0.992   39.483  1.00 63.13 ? 110  SER A O   1 
ATOM   875  C  CB  . SER A 1 110 ? 14.838  -1.310  40.773  1.00 64.86 ? 110  SER A CB  1 
ATOM   876  O  OG  . SER A 1 110 ? 13.734  -0.437  40.742  1.00 66.88 ? 110  SER A OG  1 
ATOM   877  N  N   . PRO A 1 111 ? 17.795  -0.957  39.519  1.00 62.17 ? 111  PRO A N   1 
ATOM   878  C  CA  . PRO A 1 111 ? 18.666  -0.717  38.361  1.00 60.34 ? 111  PRO A CA  1 
ATOM   879  C  C   . PRO A 1 111 ? 17.930  -0.087  37.185  1.00 59.56 ? 111  PRO A C   1 
ATOM   880  O  O   . PRO A 1 111 ? 16.964  -0.650  36.675  1.00 60.08 ? 111  PRO A O   1 
ATOM   881  C  CB  . PRO A 1 111 ? 19.188  -2.107  38.035  1.00 59.80 ? 111  PRO A CB  1 
ATOM   882  C  CG  . PRO A 1 111 ? 19.317  -2.712  39.385  1.00 61.43 ? 111  PRO A CG  1 
ATOM   883  C  CD  . PRO A 1 111 ? 18.007  -2.315  40.043  1.00 61.18 ? 111  PRO A CD  1 
ATOM   884  N  N   . THR A 1 112 ? 18.408  1.074   36.751  1.00 56.29 ? 112  THR A N   1 
ATOM   885  C  CA  . THR A 1 112 ? 17.780  1.800   35.663  1.00 53.91 ? 112  THR A CA  1 
ATOM   886  C  C   . THR A 1 112 ? 18.595  1.739   34.385  1.00 51.84 ? 112  THR A C   1 
ATOM   887  O  O   . THR A 1 112 ? 19.813  1.854   34.419  1.00 50.11 ? 112  THR A O   1 
ATOM   888  C  CB  . THR A 1 112 ? 17.613  3.245   36.073  1.00 54.51 ? 112  THR A CB  1 
ATOM   889  O  OG1 . THR A 1 112 ? 16.932  3.278   37.331  1.00 54.24 ? 112  THR A OG1 1 
ATOM   890  C  CG2 . THR A 1 112 ? 16.823  4.021   35.027  1.00 53.05 ? 112  THR A CG2 1 
ATOM   891  N  N   . PRO A 1 113 ? 17.930  1.546   33.237  1.00 50.90 ? 113  PRO A N   1 
ATOM   892  C  CA  . PRO A 1 113 ? 18.652  1.485   31.964  1.00 49.66 ? 113  PRO A CA  1 
ATOM   893  C  C   . PRO A 1 113 ? 19.532  2.742   31.809  1.00 47.98 ? 113  PRO A C   1 
ATOM   894  O  O   . PRO A 1 113 ? 19.127  3.855   32.159  1.00 47.10 ? 113  PRO A O   1 
ATOM   895  C  CB  . PRO A 1 113 ? 17.523  1.422   30.932  1.00 49.06 ? 113  PRO A CB  1 
ATOM   896  C  CG  . PRO A 1 113 ? 16.438  0.713   31.668  1.00 49.87 ? 113  PRO A CG  1 
ATOM   897  C  CD  . PRO A 1 113 ? 16.481  1.401   33.020  1.00 50.75 ? 113  PRO A CD  1 
ATOM   898  N  N   . VAL A 1 114 ? 20.735  2.542   31.285  1.00 44.72 ? 114  VAL A N   1 
ATOM   899  C  CA  . VAL A 1 114 ? 21.688  3.614   31.098  1.00 42.73 ? 114  VAL A CA  1 
ATOM   900  C  C   . VAL A 1 114 ? 21.802  4.072   29.633  1.00 41.68 ? 114  VAL A C   1 
ATOM   901  O  O   . VAL A 1 114 ? 21.864  3.254   28.710  1.00 38.87 ? 114  VAL A O   1 
ATOM   902  C  CB  . VAL A 1 114 ? 23.089  3.147   31.598  1.00 43.41 ? 114  VAL A CB  1 
ATOM   903  C  CG1 . VAL A 1 114 ? 24.120  4.226   31.369  1.00 41.25 ? 114  VAL A CG1 1 
ATOM   904  C  CG2 . VAL A 1 114 ? 23.010  2.748   33.095  1.00 42.21 ? 114  VAL A CG2 1 
ATOM   905  N  N   . LEU A 1 115 ? 21.829  5.386   29.432  1.00 40.59 ? 115  LEU A N   1 
ATOM   906  C  CA  . LEU A 1 115 ? 21.990  5.961   28.099  1.00 38.31 ? 115  LEU A CA  1 
ATOM   907  C  C   . LEU A 1 115 ? 23.340  6.662   28.096  1.00 37.93 ? 115  LEU A C   1 
ATOM   908  O  O   . LEU A 1 115 ? 23.618  7.497   28.976  1.00 38.49 ? 115  LEU A O   1 
ATOM   909  C  CB  . LEU A 1 115 ? 20.889  6.974   27.818  1.00 40.36 ? 115  LEU A CB  1 
ATOM   910  C  CG  . LEU A 1 115 ? 19.544  6.471   27.292  1.00 43.19 ? 115  LEU A CG  1 
ATOM   911  C  CD1 . LEU A 1 115 ? 18.545  7.580   27.270  1.00 45.82 ? 115  LEU A CD1 1 
ATOM   912  C  CD2 . LEU A 1 115 ? 19.716  5.975   25.891  1.00 47.70 ? 115  LEU A CD2 1 
ATOM   913  N  N   . ILE A 1 116 ? 24.201  6.314   27.146  1.00 36.42 ? 116  ILE A N   1 
ATOM   914  C  CA  . ILE A 1 116 ? 25.510  6.968   27.071  1.00 36.15 ? 116  ILE A CA  1 
ATOM   915  C  C   . ILE A 1 116 ? 25.597  7.778   25.770  1.00 36.28 ? 116  ILE A C   1 
ATOM   916  O  O   . ILE A 1 116 ? 25.473  7.229   24.659  1.00 35.40 ? 116  ILE A O   1 
ATOM   917  C  CB  . ILE A 1 116 ? 26.685  5.963   27.103  1.00 36.14 ? 116  ILE A CB  1 
ATOM   918  C  CG1 . ILE A 1 116 ? 26.598  5.114   28.360  1.00 35.32 ? 116  ILE A CG1 1 
ATOM   919  C  CG2 . ILE A 1 116 ? 28.035  6.722   27.039  1.00 33.77 ? 116  ILE A CG2 1 
ATOM   920  C  CD1 . ILE A 1 116 ? 27.691  4.075   28.449  1.00 35.94 ? 116  ILE A CD1 1 
ATOM   921  N  N   . TRP A 1 117 ? 25.813  9.079   25.926  1.00 34.17 ? 117  TRP A N   1 
ATOM   922  C  CA  . TRP A 1 117 ? 25.890  9.981   24.794  1.00 35.01 ? 117  TRP A CA  1 
ATOM   923  C  C   . TRP A 1 117 ? 27.314  10.229  24.328  1.00 35.67 ? 117  TRP A C   1 
ATOM   924  O  O   . TRP A 1 117 ? 28.209  10.494  25.141  1.00 33.03 ? 117  TRP A O   1 
ATOM   925  C  CB  . TRP A 1 117 ? 25.255  11.332  25.153  1.00 34.37 ? 117  TRP A CB  1 
ATOM   926  C  CG  . TRP A 1 117 ? 25.449  12.401  24.090  1.00 35.46 ? 117  TRP A CG  1 
ATOM   927  C  CD1 . TRP A 1 117 ? 26.284  13.498  24.150  1.00 35.05 ? 117  TRP A CD1 1 
ATOM   928  C  CD2 . TRP A 1 117 ? 24.755  12.496  22.839  1.00 34.53 ? 117  TRP A CD2 1 
ATOM   929  N  NE1 . TRP A 1 117 ? 26.138  14.267  23.007  1.00 36.20 ? 117  TRP A NE1 1 
ATOM   930  C  CE2 . TRP A 1 117 ? 25.209  13.675  22.191  1.00 34.74 ? 117  TRP A CE2 1 
ATOM   931  C  CE3 . TRP A 1 117 ? 23.792  11.699  22.203  1.00 35.35 ? 117  TRP A CE3 1 
ATOM   932  C  CZ2 . TRP A 1 117 ? 24.727  14.078  20.937  1.00 36.16 ? 117  TRP A CZ2 1 
ATOM   933  C  CZ3 . TRP A 1 117 ? 23.309  12.092  20.952  1.00 35.73 ? 117  TRP A CZ3 1 
ATOM   934  C  CH2 . TRP A 1 117 ? 23.780  13.277  20.332  1.00 37.01 ? 117  TRP A CH2 1 
ATOM   935  N  N   . ILE A 1 118 ? 27.515  10.150  23.016  1.00 33.63 ? 118  ILE A N   1 
ATOM   936  C  CA  . ILE A 1 118 ? 28.814  10.420  22.463  1.00 33.23 ? 118  ILE A CA  1 
ATOM   937  C  C   . ILE A 1 118 ? 28.620  11.574  21.494  1.00 32.22 ? 118  ILE A C   1 
ATOM   938  O  O   . ILE A 1 118 ? 27.984  11.404  20.473  1.00 30.67 ? 118  ILE A O   1 
ATOM   939  C  CB  . ILE A 1 118 ? 29.346  9.240   21.699  1.00 32.15 ? 118  ILE A CB  1 
ATOM   940  C  CG1 . ILE A 1 118 ? 29.413  8.007   22.605  1.00 33.72 ? 118  ILE A CG1 1 
ATOM   941  C  CG2 . ILE A 1 118 ? 30.726  9.589   21.170  1.00 33.38 ? 118  ILE A CG2 1 
ATOM   942  C  CD1 . ILE A 1 118 ? 30.005  6.786   21.878  1.00 30.14 ? 118  ILE A CD1 1 
ATOM   943  N  N   . TYR A 1 119 ? 29.183  12.733  21.801  1.00 31.02 ? 119  TYR A N   1 
ATOM   944  C  CA  . TYR A 1 119 ? 29.010  13.888  20.932  1.00 32.38 ? 119  TYR A CA  1 
ATOM   945  C  C   . TYR A 1 119 ? 29.690  13.855  19.557  1.00 33.85 ? 119  TYR A C   1 
ATOM   946  O  O   . TYR A 1 119 ? 30.655  13.116  19.331  1.00 33.02 ? 119  TYR A O   1 
ATOM   947  C  CB  . TYR A 1 119 ? 29.453  15.159  21.661  1.00 30.95 ? 119  TYR A CB  1 
ATOM   948  C  CG  . TYR A 1 119 ? 30.917  15.178  22.069  1.00 33.78 ? 119  TYR A CG  1 
ATOM   949  C  CD1 . TYR A 1 119 ? 31.952  15.341  21.125  1.00 32.74 ? 119  TYR A CD1 1 
ATOM   950  C  CD2 . TYR A 1 119 ? 31.268  15.087  23.425  1.00 32.76 ? 119  TYR A CD2 1 
ATOM   951  C  CE1 . TYR A 1 119 ? 33.312  15.415  21.533  1.00 32.40 ? 119  TYR A CE1 1 
ATOM   952  C  CE2 . TYR A 1 119 ? 32.591  15.150  23.835  1.00 34.83 ? 119  TYR A CE2 1 
ATOM   953  C  CZ  . TYR A 1 119 ? 33.612  15.315  22.891  1.00 34.22 ? 119  TYR A CZ  1 
ATOM   954  O  OH  . TYR A 1 119 ? 34.909  15.334  23.359  1.00 32.87 ? 119  TYR A OH  1 
ATOM   955  N  N   . GLY A 1 120 ? 29.155  14.675  18.648  1.00 33.99 ? 120  GLY A N   1 
ATOM   956  C  CA  . GLY A 1 120 ? 29.705  14.817  17.310  1.00 35.81 ? 120  GLY A CA  1 
ATOM   957  C  C   . GLY A 1 120 ? 30.563  16.078  17.238  1.00 37.16 ? 120  GLY A C   1 
ATOM   958  O  O   . GLY A 1 120 ? 30.826  16.727  18.265  1.00 39.32 ? 120  GLY A O   1 
ATOM   959  N  N   . GLY A 1 121 ? 30.974  16.448  16.028  1.00 38.42 ? 121  GLY A N   1 
ATOM   960  C  CA  . GLY A 1 121 ? 31.841  17.600  15.819  1.00 36.59 ? 121  GLY A CA  1 
ATOM   961  C  C   . GLY A 1 121 ? 32.963  17.230  14.843  1.00 36.34 ? 121  GLY A C   1 
ATOM   962  O  O   . GLY A 1 121 ? 34.111  17.686  14.989  1.00 35.79 ? 121  GLY A O   1 
ATOM   963  N  N   . GLY A 1 122 ? 32.624  16.381  13.866  1.00 35.06 ? 122  GLY A N   1 
ATOM   964  C  CA  . GLY A 1 122 ? 33.565  15.938  12.839  1.00 36.17 ? 122  GLY A CA  1 
ATOM   965  C  C   . GLY A 1 122 ? 34.885  15.364  13.334  1.00 38.00 ? 122  GLY A C   1 
ATOM   966  O  O   . GLY A 1 122 ? 35.867  15.357  12.600  1.00 37.58 ? 122  GLY A O   1 
ATOM   967  N  N   . PHE A 1 123 ? 34.899  14.881  14.581  1.00 38.25 ? 123  PHE A N   1 
ATOM   968  C  CA  . PHE A 1 123 ? 36.093  14.319  15.199  1.00 35.84 ? 123  PHE A CA  1 
ATOM   969  C  C   . PHE A 1 123 ? 37.147  15.371  15.483  1.00 37.21 ? 123  PHE A C   1 
ATOM   970  O  O   . PHE A 1 123 ? 38.255  15.018  15.887  1.00 37.93 ? 123  PHE A O   1 
ATOM   971  C  CB  . PHE A 1 123 ? 36.707  13.234  14.319  1.00 34.63 ? 123  PHE A CB  1 
ATOM   972  C  CG  . PHE A 1 123 ? 35.910  11.967  14.285  1.00 34.07 ? 123  PHE A CG  1 
ATOM   973  C  CD1 . PHE A 1 123 ? 35.741  11.207  15.454  1.00 30.89 ? 123  PHE A CD1 1 
ATOM   974  C  CD2 . PHE A 1 123 ? 35.310  11.544  13.093  1.00 31.32 ? 123  PHE A CD2 1 
ATOM   975  C  CE1 . PHE A 1 123 ? 34.977  10.031  15.444  1.00 33.60 ? 123  PHE A CE1 1 
ATOM   976  C  CE2 . PHE A 1 123 ? 34.538  10.370  13.052  1.00 32.63 ? 123  PHE A CE2 1 
ATOM   977  C  CZ  . PHE A 1 123 ? 34.367  9.605   14.232  1.00 33.34 ? 123  PHE A CZ  1 
ATOM   978  N  N   . TYR A 1 124 ? 36.823  16.652  15.276  1.00 36.52 ? 124  TYR A N   1 
ATOM   979  C  CA  . TYR A 1 124 ? 37.796  17.723  15.518  1.00 36.03 ? 124  TYR A CA  1 
ATOM   980  C  C   . TYR A 1 124 ? 37.295  18.666  16.580  1.00 37.25 ? 124  TYR A C   1 
ATOM   981  O  O   . TYR A 1 124 ? 38.007  19.581  16.988  1.00 38.65 ? 124  TYR A O   1 
ATOM   982  C  CB  . TYR A 1 124 ? 38.106  18.535  14.236  1.00 36.65 ? 124  TYR A CB  1 
ATOM   983  C  CG  . TYR A 1 124 ? 36.981  19.447  13.749  1.00 36.12 ? 124  TYR A CG  1 
ATOM   984  C  CD1 . TYR A 1 124 ? 36.777  20.719  14.304  1.00 37.32 ? 124  TYR A CD1 1 
ATOM   985  C  CD2 . TYR A 1 124 ? 36.066  18.999  12.801  1.00 37.39 ? 124  TYR A CD2 1 
ATOM   986  C  CE1 . TYR A 1 124 ? 35.670  21.516  13.930  1.00 36.77 ? 124  TYR A CE1 1 
ATOM   987  C  CE2 . TYR A 1 124 ? 34.965  19.774  12.423  1.00 37.88 ? 124  TYR A CE2 1 
ATOM   988  C  CZ  . TYR A 1 124 ? 34.769  21.026  12.996  1.00 38.95 ? 124  TYR A CZ  1 
ATOM   989  O  OH  . TYR A 1 124 ? 33.621  21.726  12.675  1.00 40.94 ? 124  TYR A OH  1 
ATOM   990  N  N   . SER A 1 125 ? 36.072  18.453  17.047  1.00 35.76 ? 125  SER A N   1 
ATOM   991  C  CA  . SER A 1 125 ? 35.519  19.351  18.062  1.00 34.44 ? 125  SER A CA  1 
ATOM   992  C  C   . SER A 1 125 ? 34.394  18.688  18.825  1.00 34.32 ? 125  SER A C   1 
ATOM   993  O  O   . SER A 1 125 ? 33.968  17.573  18.508  1.00 33.80 ? 125  SER A O   1 
ATOM   994  C  CB  . SER A 1 125 ? 34.956  20.622  17.415  1.00 33.26 ? 125  SER A CB  1 
ATOM   995  O  OG  . SER A 1 125 ? 33.948  20.293  16.472  1.00 32.54 ? 125  SER A OG  1 
ATOM   996  N  N   . GLY A 1 126 ? 33.879  19.412  19.801  1.00 32.18 ? 126  GLY A N   1 
ATOM   997  C  CA  . GLY A 1 126 ? 32.806  18.876  20.592  1.00 34.16 ? 126  GLY A CA  1 
ATOM   998  C  C   . GLY A 1 126 ? 33.147  18.845  22.061  1.00 33.54 ? 126  GLY A C   1 
ATOM   999  O  O   . GLY A 1 126 ? 34.302  19.044  22.468  1.00 32.10 ? 126  GLY A O   1 
ATOM   1000 N  N   . ALA A 1 127 ? 32.131  18.575  22.859  1.00 32.92 ? 127  ALA A N   1 
ATOM   1001 C  CA  . ALA A 1 127 ? 32.290  18.535  24.304  1.00 35.65 ? 127  ALA A CA  1 
ATOM   1002 C  C   . ALA A 1 127 ? 30.995  18.043  24.933  1.00 36.35 ? 127  ALA A C   1 
ATOM   1003 O  O   . ALA A 1 127 ? 29.902  18.353  24.449  1.00 37.32 ? 127  ALA A O   1 
ATOM   1004 C  CB  . ALA A 1 127 ? 32.623  19.941  24.831  1.00 34.35 ? 127  ALA A CB  1 
ATOM   1005 N  N   . ALA A 1 128 ? 31.108  17.304  26.027  1.00 36.91 ? 128  ALA A N   1 
ATOM   1006 C  CA  . ALA A 1 128 ? 29.927  16.779  26.685  1.00 36.41 ? 128  ALA A CA  1 
ATOM   1007 C  C   . ALA A 1 128 ? 29.234  17.815  27.575  1.00 37.68 ? 128  ALA A C   1 
ATOM   1008 O  O   . ALA A 1 128 ? 28.180  17.548  28.146  1.00 37.31 ? 128  ALA A O   1 
ATOM   1009 C  CB  . ALA A 1 128 ? 30.299  15.545  27.495  1.00 37.99 ? 128  ALA A CB  1 
ATOM   1010 N  N   . SER A 1 129 ? 29.813  19.001  27.679  1.00 37.29 ? 129  SER A N   1 
ATOM   1011 C  CA  . SER A 1 129 ? 29.238  20.053  28.518  1.00 38.84 ? 129  SER A CA  1 
ATOM   1012 C  C   . SER A 1 129 ? 28.365  21.086  27.777  1.00 39.24 ? 129  SER A C   1 
ATOM   1013 O  O   . SER A 1 129 ? 27.932  22.068  28.378  1.00 40.17 ? 129  SER A O   1 
ATOM   1014 C  CB  . SER A 1 129 ? 30.368  20.784  29.234  1.00 37.18 ? 129  SER A CB  1 
ATOM   1015 O  OG  . SER A 1 129 ? 31.318  21.206  28.276  1.00 37.43 ? 129  SER A OG  1 
ATOM   1016 N  N   . LEU A 1 130 ? 28.120  20.887  26.485  1.00 38.70 ? 130  LEU A N   1 
ATOM   1017 C  CA  . LEU A 1 130 ? 27.291  21.837  25.743  1.00 39.52 ? 130  LEU A CA  1 
ATOM   1018 C  C   . LEU A 1 130 ? 25.871  21.795  26.260  1.00 39.88 ? 130  LEU A C   1 
ATOM   1019 O  O   . LEU A 1 130 ? 25.404  20.759  26.737  1.00 39.53 ? 130  LEU A O   1 
ATOM   1020 C  CB  . LEU A 1 130 ? 27.302  21.529  24.240  1.00 36.78 ? 130  LEU A CB  1 
ATOM   1021 C  CG  . LEU A 1 130 ? 28.696  21.516  23.606  1.00 36.42 ? 130  LEU A CG  1 
ATOM   1022 C  CD1 . LEU A 1 130 ? 28.584  21.389  22.099  1.00 37.09 ? 130  LEU A CD1 1 
ATOM   1023 C  CD2 . LEU A 1 130 ? 29.429  22.777  23.994  1.00 33.84 ? 130  LEU A CD2 1 
ATOM   1024 N  N   . ASP A 1 131 ? 25.185  22.927  26.180  1.00 41.38 ? 131  ASP A N   1 
ATOM   1025 C  CA  . ASP A 1 131 ? 23.801  23.014  26.649  1.00 42.68 ? 131  ASP A CA  1 
ATOM   1026 C  C   . ASP A 1 131 ? 22.834  22.020  25.988  1.00 42.42 ? 131  ASP A C   1 
ATOM   1027 O  O   . ASP A 1 131 ? 21.932  21.531  26.667  1.00 40.46 ? 131  ASP A O   1 
ATOM   1028 C  CB  . ASP A 1 131 ? 23.261  24.433  26.453  1.00 44.43 ? 131  ASP A CB  1 
ATOM   1029 C  CG  . ASP A 1 131 ? 23.774  25.392  27.497  1.00 47.26 ? 131  ASP A CG  1 
ATOM   1030 O  OD1 . ASP A 1 131 ? 24.524  24.959  28.377  1.00 48.04 ? 131  ASP A OD1 1 
ATOM   1031 O  OD2 . ASP A 1 131 ? 23.427  26.584  27.449  1.00 52.60 ? 131  ASP A OD2 1 
ATOM   1032 N  N   . VAL A 1 132 ? 23.016  21.722  24.692  1.00 40.12 ? 132  VAL A N   1 
ATOM   1033 C  CA  . VAL A 1 132 ? 22.118  20.785  24.025  1.00 40.58 ? 132  VAL A CA  1 
ATOM   1034 C  C   . VAL A 1 132 ? 22.273  19.354  24.461  1.00 39.47 ? 132  VAL A C   1 
ATOM   1035 O  O   . VAL A 1 132 ? 21.443  18.527  24.104  1.00 39.79 ? 132  VAL A O   1 
ATOM   1036 C  CB  . VAL A 1 132 ? 22.246  20.805  22.493  1.00 41.75 ? 132  VAL A CB  1 
ATOM   1037 C  CG1 . VAL A 1 132 ? 21.673  22.089  21.956  1.00 44.48 ? 132  VAL A CG1 1 
ATOM   1038 C  CG2 . VAL A 1 132 ? 23.683  20.655  22.094  1.00 43.68 ? 132  VAL A CG2 1 
ATOM   1039 N  N   . TYR A 1 133 ? 23.316  19.039  25.224  1.00 38.24 ? 133  TYR A N   1 
ATOM   1040 C  CA  . TYR A 1 133 ? 23.489  17.661  25.684  1.00 37.64 ? 133  TYR A CA  1 
ATOM   1041 C  C   . TYR A 1 133 ? 23.164  17.568  27.183  1.00 38.62 ? 133  TYR A C   1 
ATOM   1042 O  O   . TYR A 1 133 ? 23.556  16.605  27.845  1.00 38.90 ? 133  TYR A O   1 
ATOM   1043 C  CB  . TYR A 1 133 ? 24.929  17.167  25.459  1.00 36.24 ? 133  TYR A CB  1 
ATOM   1044 C  CG  . TYR A 1 133 ? 25.507  17.359  24.075  1.00 38.58 ? 133  TYR A CG  1 
ATOM   1045 C  CD1 . TYR A 1 133 ? 24.713  17.173  22.927  1.00 38.55 ? 133  TYR A CD1 1 
ATOM   1046 C  CD2 . TYR A 1 133 ? 26.857  17.733  23.899  1.00 37.04 ? 133  TYR A CD2 1 
ATOM   1047 C  CE1 . TYR A 1 133 ? 25.237  17.359  21.654  1.00 38.00 ? 133  TYR A CE1 1 
ATOM   1048 C  CE2 . TYR A 1 133 ? 27.400  17.927  22.606  1.00 37.55 ? 133  TYR A CE2 1 
ATOM   1049 C  CZ  . TYR A 1 133 ? 26.583  17.741  21.494  1.00 38.45 ? 133  TYR A CZ  1 
ATOM   1050 O  OH  . TYR A 1 133 ? 27.070  17.950  20.213  1.00 37.08 ? 133  TYR A OH  1 
ATOM   1051 N  N   . ASP A 1 134 ? 22.474  18.577  27.721  1.00 39.38 ? 134  ASP A N   1 
ATOM   1052 C  CA  . ASP A 1 134 ? 22.102  18.615  29.137  1.00 39.01 ? 134  ASP A CA  1 
ATOM   1053 C  C   . ASP A 1 134 ? 21.237  17.400  29.469  1.00 39.76 ? 134  ASP A C   1 
ATOM   1054 O  O   . ASP A 1 134 ? 20.122  17.292  28.967  1.00 38.48 ? 134  ASP A O   1 
ATOM   1055 C  CB  . ASP A 1 134 ? 21.313  19.878  29.443  1.00 38.34 ? 134  ASP A CB  1 
ATOM   1056 C  CG  . ASP A 1 134 ? 21.074  20.070  30.932  1.00 40.14 ? 134  ASP A CG  1 
ATOM   1057 O  OD1 . ASP A 1 134 ? 21.157  19.089  31.706  1.00 38.40 ? 134  ASP A OD1 1 
ATOM   1058 O  OD2 . ASP A 1 134 ? 20.791  21.216  31.329  1.00 41.58 ? 134  ASP A OD2 1 
ATOM   1059 N  N   . GLY A 1 135 ? 21.743  16.495  30.314  1.00 39.01 ? 135  GLY A N   1 
ATOM   1060 C  CA  . GLY A 1 135 ? 20.976  15.297  30.632  1.00 38.64 ? 135  GLY A CA  1 
ATOM   1061 C  C   . GLY A 1 135 ? 19.890  15.399  31.696  1.00 38.91 ? 135  GLY A C   1 
ATOM   1062 O  O   . GLY A 1 135 ? 19.186  14.424  31.942  1.00 38.14 ? 135  GLY A O   1 
ATOM   1063 N  N   . ARG A 1 136 ? 19.702  16.567  32.299  1.00 38.72 ? 136  ARG A N   1 
ATOM   1064 C  CA  . ARG A 1 136 ? 18.720  16.674  33.380  1.00 41.23 ? 136  ARG A CA  1 
ATOM   1065 C  C   . ARG A 1 136 ? 17.284  16.323  33.011  1.00 41.59 ? 136  ARG A C   1 
ATOM   1066 O  O   . ARG A 1 136 ? 16.593  15.693  33.815  1.00 40.59 ? 136  ARG A O   1 
ATOM   1067 C  CB  . ARG A 1 136 ? 18.776  18.067  34.053  1.00 41.87 ? 136  ARG A CB  1 
ATOM   1068 C  CG  . ARG A 1 136 ? 18.068  19.192  33.312  1.00 45.04 ? 136  ARG A CG  1 
ATOM   1069 C  CD  . ARG A 1 136 ? 18.194  20.530  34.048  1.00 46.55 ? 136  ARG A CD  1 
ATOM   1070 N  NE  . ARG A 1 136 ? 19.585  20.994  34.073  1.00 51.53 ? 136  ARG A NE  1 
ATOM   1071 C  CZ  . ARG A 1 136 ? 20.084  21.951  34.869  1.00 52.40 ? 136  ARG A CZ  1 
ATOM   1072 N  NH1 . ARG A 1 136 ? 21.372  22.267  34.777  1.00 50.66 ? 136  ARG A NH1 1 
ATOM   1073 N  NH2 . ARG A 1 136 ? 19.315  22.597  35.756  1.00 51.49 ? 136  ARG A NH2 1 
ATOM   1074 N  N   . PHE A 1 137 ? 16.842  16.687  31.801  1.00 39.98 ? 137  PHE A N   1 
ATOM   1075 C  CA  . PHE A 1 137 ? 15.472  16.402  31.390  1.00 39.61 ? 137  PHE A CA  1 
ATOM   1076 C  C   . PHE A 1 137 ? 15.195  14.900  31.223  1.00 39.64 ? 137  PHE A C   1 
ATOM   1077 O  O   . PHE A 1 137 ? 14.165  14.401  31.657  1.00 39.20 ? 137  PHE A O   1 
ATOM   1078 C  CB  . PHE A 1 137 ? 15.131  17.144  30.088  1.00 38.09 ? 137  PHE A CB  1 
ATOM   1079 C  CG  . PHE A 1 137 ? 15.494  18.585  30.110  1.00 38.55 ? 137  PHE A CG  1 
ATOM   1080 C  CD1 . PHE A 1 137 ? 14.733  19.490  30.832  1.00 40.46 ? 137  PHE A CD1 1 
ATOM   1081 C  CD2 . PHE A 1 137 ? 16.659  19.031  29.489  1.00 38.24 ? 137  PHE A CD2 1 
ATOM   1082 C  CE1 . PHE A 1 137 ? 15.123  20.832  30.952  1.00 40.28 ? 137  PHE A CE1 1 
ATOM   1083 C  CE2 . PHE A 1 137 ? 17.057  20.357  29.602  1.00 38.17 ? 137  PHE A CE2 1 
ATOM   1084 C  CZ  . PHE A 1 137 ? 16.284  21.268  30.342  1.00 39.30 ? 137  PHE A CZ  1 
ATOM   1085 N  N   . LEU A 1 138 ? 16.098  14.181  30.574  1.00 40.17 ? 138  LEU A N   1 
ATOM   1086 C  CA  . LEU A 1 138 ? 15.898  12.755  30.394  1.00 41.33 ? 138  LEU A CA  1 
ATOM   1087 C  C   . LEU A 1 138 ? 15.910  12.057  31.762  1.00 41.02 ? 138  LEU A C   1 
ATOM   1088 O  O   . LEU A 1 138 ? 15.108  11.166  32.011  1.00 41.27 ? 138  LEU A O   1 
ATOM   1089 C  CB  . LEU A 1 138 ? 16.974  12.186  29.464  1.00 41.67 ? 138  LEU A CB  1 
ATOM   1090 C  CG  . LEU A 1 138 ? 16.677  12.371  27.973  1.00 42.49 ? 138  LEU A CG  1 
ATOM   1091 C  CD1 . LEU A 1 138 ? 17.906  11.996  27.144  1.00 41.30 ? 138  LEU A CD1 1 
ATOM   1092 C  CD2 . LEU A 1 138 ? 15.456  11.510  27.567  1.00 40.04 ? 138  LEU A CD2 1 
ATOM   1093 N  N   . ALA A 1 139 ? 16.802  12.486  32.647  1.00 41.17 ? 139  ALA A N   1 
ATOM   1094 C  CA  . ALA A 1 139 ? 16.882  11.936  34.006  1.00 42.71 ? 139  ALA A CA  1 
ATOM   1095 C  C   . ALA A 1 139 ? 15.604  12.211  34.820  1.00 45.30 ? 139  ALA A C   1 
ATOM   1096 O  O   . ALA A 1 139 ? 15.034  11.302  35.424  1.00 45.99 ? 139  ALA A O   1 
ATOM   1097 C  CB  . ALA A 1 139 ? 18.068  12.531  34.748  1.00 38.50 ? 139  ALA A CB  1 
ATOM   1098 N  N   . GLN A 1 140 ? 15.164  13.468  34.850  1.00 46.20 ? 140  GLN A N   1 
ATOM   1099 C  CA  . GLN A 1 140 ? 13.977  13.840  35.617  1.00 46.66 ? 140  GLN A CA  1 
ATOM   1100 C  C   . GLN A 1 140 ? 12.675  13.255  35.057  1.00 47.05 ? 140  GLN A C   1 
ATOM   1101 O  O   . GLN A 1 140 ? 11.936  12.584  35.775  1.00 47.36 ? 140  GLN A O   1 
ATOM   1102 C  CB  . GLN A 1 140 ? 13.861  15.366  35.690  1.00 46.13 ? 140  GLN A CB  1 
ATOM   1103 C  CG  . GLN A 1 140 ? 13.029  15.922  36.853  1.00 47.90 ? 140  GLN A CG  1 
ATOM   1104 C  CD  . GLN A 1 140 ? 11.527  15.618  36.755  1.00 51.60 ? 140  GLN A CD  1 
ATOM   1105 O  OE1 . GLN A 1 140 ? 10.889  15.854  35.717  1.00 52.79 ? 140  GLN A OE1 1 
ATOM   1106 N  NE2 . GLN A 1 140 ? 10.951  15.111  37.851  1.00 50.94 ? 140  GLN A NE2 1 
ATOM   1107 N  N   . VAL A 1 141 ? 12.414  13.483  33.775  1.00 45.58 ? 141  VAL A N   1 
ATOM   1108 C  CA  . VAL A 1 141 ? 11.185  13.013  33.162  1.00 44.75 ? 141  VAL A CA  1 
ATOM   1109 C  C   . VAL A 1 141 ? 11.056  11.526  32.884  1.00 46.64 ? 141  VAL A C   1 
ATOM   1110 O  O   . VAL A 1 141 ? 9.978   10.970  33.076  1.00 47.04 ? 141  VAL A O   1 
ATOM   1111 C  CB  . VAL A 1 141 ? 10.901  13.799  31.878  1.00 44.95 ? 141  VAL A CB  1 
ATOM   1112 C  CG1 . VAL A 1 141 ? 9.636   13.284  31.217  1.00 42.43 ? 141  VAL A CG1 1 
ATOM   1113 C  CG2 . VAL A 1 141 ? 10.760  15.290  32.216  1.00 41.36 ? 141  VAL A CG2 1 
ATOM   1114 N  N   . GLU A 1 142 ? 12.127  10.877  32.437  1.00 46.33 ? 142  GLU A N   1 
ATOM   1115 C  CA  . GLU A 1 142 ? 12.078  9.449   32.151  1.00 45.71 ? 142  GLU A CA  1 
ATOM   1116 C  C   . GLU A 1 142 ? 12.784  8.582   33.203  1.00 46.42 ? 142  GLU A C   1 
ATOM   1117 O  O   . GLU A 1 142 ? 12.843  7.353   33.070  1.00 45.43 ? 142  GLU A O   1 
ATOM   1118 C  CB  . GLU A 1 142 ? 12.701  9.175   30.793  1.00 46.57 ? 142  GLU A CB  1 
ATOM   1119 C  CG  . GLU A 1 142 ? 11.950  9.783   29.639  1.00 49.69 ? 142  GLU A CG  1 
ATOM   1120 C  CD  . GLU A 1 142 ? 10.529  9.243   29.492  1.00 53.86 ? 142  GLU A CD  1 
ATOM   1121 O  OE1 . GLU A 1 142 ? 10.262  8.074   29.890  1.00 55.12 ? 142  GLU A OE1 1 
ATOM   1122 O  OE2 . GLU A 1 142 ? 9.679   9.986   28.950  1.00 55.04 ? 142  GLU A OE2 1 
ATOM   1123 N  N   . GLY A 1 143 ? 13.331  9.219   34.238  1.00 46.79 ? 143  GLY A N   1 
ATOM   1124 C  CA  . GLY A 1 143 ? 14.022  8.472   35.282  1.00 46.06 ? 143  GLY A CA  1 
ATOM   1125 C  C   . GLY A 1 143 ? 15.229  7.743   34.721  1.00 46.42 ? 143  GLY A C   1 
ATOM   1126 O  O   . GLY A 1 143 ? 15.602  6.681   35.208  1.00 47.42 ? 143  GLY A O   1 
ATOM   1127 N  N   . ALA A 1 144 ? 15.856  8.315   33.697  1.00 44.57 ? 144  ALA A N   1 
ATOM   1128 C  CA  . ALA A 1 144 ? 17.016  7.682   33.090  1.00 42.56 ? 144  ALA A CA  1 
ATOM   1129 C  C   . ALA A 1 144 ? 18.346  8.036   33.758  1.00 40.42 ? 144  ALA A C   1 
ATOM   1130 O  O   . ALA A 1 144 ? 18.480  9.087   34.389  1.00 38.14 ? 144  ALA A O   1 
ATOM   1131 C  CB  . ALA A 1 144 ? 17.080  8.063   31.622  1.00 45.05 ? 144  ALA A CB  1 
ATOM   1132 N  N   . VAL A 1 145 ? 19.314  7.131   33.646  1.00 38.20 ? 145  VAL A N   1 
ATOM   1133 C  CA  . VAL A 1 145 ? 20.665  7.417   34.127  1.00 38.59 ? 145  VAL A CA  1 
ATOM   1134 C  C   . VAL A 1 145 ? 21.425  7.756   32.817  1.00 38.99 ? 145  VAL A C   1 
ATOM   1135 O  O   . VAL A 1 145 ? 21.605  6.900   31.928  1.00 38.11 ? 145  VAL A O   1 
ATOM   1136 C  CB  . VAL A 1 145 ? 21.331  6.203   34.818  1.00 38.47 ? 145  VAL A CB  1 
ATOM   1137 C  CG1 . VAL A 1 145 ? 22.815  6.491   35.049  1.00 38.75 ? 145  VAL A CG1 1 
ATOM   1138 C  CG2 . VAL A 1 145 ? 20.660  5.942   36.177  1.00 39.66 ? 145  VAL A CG2 1 
ATOM   1139 N  N   . LEU A 1 146 ? 21.830  9.012   32.676  1.00 37.52 ? 146  LEU A N   1 
ATOM   1140 C  CA  . LEU A 1 146 ? 22.510  9.420   31.460  1.00 38.06 ? 146  LEU A CA  1 
ATOM   1141 C  C   . LEU A 1 146 ? 23.972  9.742   31.720  1.00 37.59 ? 146  LEU A C   1 
ATOM   1142 O  O   . LEU A 1 146 ? 24.323  10.407  32.710  1.00 38.66 ? 146  LEU A O   1 
ATOM   1143 C  CB  . LEU A 1 146 ? 21.787  10.619  30.838  1.00 39.42 ? 146  LEU A CB  1 
ATOM   1144 C  CG  . LEU A 1 146 ? 22.148  10.857  29.373  1.00 42.43 ? 146  LEU A CG  1 
ATOM   1145 C  CD1 . LEU A 1 146 ? 20.923  11.207  28.610  1.00 43.37 ? 146  LEU A CD1 1 
ATOM   1146 C  CD2 . LEU A 1 146 ? 23.204  11.968  29.271  1.00 43.42 ? 146  LEU A CD2 1 
ATOM   1147 N  N   . VAL A 1 147 ? 24.824  9.241   30.833  1.00 36.27 ? 147  VAL A N   1 
ATOM   1148 C  CA  . VAL A 1 147 ? 26.257  9.448   30.952  1.00 35.62 ? 147  VAL A CA  1 
ATOM   1149 C  C   . VAL A 1 147 ? 26.799  10.037  29.658  1.00 36.18 ? 147  VAL A C   1 
ATOM   1150 O  O   . VAL A 1 147 ? 26.405  9.605   28.581  1.00 35.67 ? 147  VAL A O   1 
ATOM   1151 C  CB  . VAL A 1 147 ? 27.030  8.092   31.198  1.00 35.97 ? 147  VAL A CB  1 
ATOM   1152 C  CG1 . VAL A 1 147 ? 28.544  8.351   31.286  1.00 32.62 ? 147  VAL A CG1 1 
ATOM   1153 C  CG2 . VAL A 1 147 ? 26.576  7.436   32.497  1.00 34.89 ? 147  VAL A CG2 1 
ATOM   1154 N  N   . SER A 1 148 ? 27.696  11.017  29.765  1.00 34.95 ? 148  SER A N   1 
ATOM   1155 C  CA  . SER A 1 148 ? 28.333  11.598  28.578  1.00 36.24 ? 148  SER A CA  1 
ATOM   1156 C  C   . SER A 1 148 ? 29.820  11.777  28.911  1.00 35.67 ? 148  SER A C   1 
ATOM   1157 O  O   . SER A 1 148 ? 30.169  12.115  30.046  1.00 36.09 ? 148  SER A O   1 
ATOM   1158 C  CB  . SER A 1 148 ? 27.704  12.942  28.226  1.00 32.74 ? 148  SER A CB  1 
ATOM   1159 O  OG  . SER A 1 148 ? 27.893  13.811  29.307  1.00 34.00 ? 148  SER A OG  1 
ATOM   1160 N  N   . MET A 1 149 ? 30.696  11.508  27.943  1.00 35.28 ? 149  MET A N   1 
ATOM   1161 C  CA  . MET A 1 149 ? 32.132  11.651  28.174  1.00 33.63 ? 149  MET A CA  1 
ATOM   1162 C  C   . MET A 1 149 ? 32.838  12.545  27.170  1.00 35.48 ? 149  MET A C   1 
ATOM   1163 O  O   . MET A 1 149 ? 32.395  12.684  26.016  1.00 34.88 ? 149  MET A O   1 
ATOM   1164 C  CB  . MET A 1 149 ? 32.813  10.288  28.130  1.00 33.70 ? 149  MET A CB  1 
ATOM   1165 C  CG  . MET A 1 149 ? 33.295  9.841   26.740  1.00 31.65 ? 149  MET A CG  1 
ATOM   1166 S  SD  . MET A 1 149 ? 31.905  9.511   25.642  1.00 38.50 ? 149  MET A SD  1 
ATOM   1167 C  CE  . MET A 1 149 ? 31.458  7.815   26.082  1.00 32.46 ? 149  MET A CE  1 
ATOM   1168 N  N   . ASN A 1 150 ? 33.924  13.170  27.614  1.00 34.73 ? 150  ASN A N   1 
ATOM   1169 C  CA  . ASN A 1 150 ? 34.725  13.972  26.700  1.00 35.57 ? 150  ASN A CA  1 
ATOM   1170 C  C   . ASN A 1 150 ? 35.694  12.937  26.112  1.00 35.04 ? 150  ASN A C   1 
ATOM   1171 O  O   . ASN A 1 150 ? 36.058  11.982  26.799  1.00 35.59 ? 150  ASN A O   1 
ATOM   1172 C  CB  . ASN A 1 150 ? 35.562  15.033  27.443  1.00 34.64 ? 150  ASN A CB  1 
ATOM   1173 C  CG  . ASN A 1 150 ? 34.785  16.290  27.790  1.00 38.05 ? 150  ASN A CG  1 
ATOM   1174 O  OD1 . ASN A 1 150 ? 33.588  16.429  27.514  1.00 38.06 ? 150  ASN A OD1 1 
ATOM   1175 N  ND2 . ASN A 1 150 ? 35.486  17.233  28.406  1.00 40.49 ? 150  ASN A ND2 1 
ATOM   1176 N  N   . TYR A 1 151 ? 36.066  13.087  24.846  1.00 33.95 ? 151  TYR A N   1 
ATOM   1177 C  CA  . TYR A 1 151 ? 37.066  12.216  24.246  1.00 32.91 ? 151  TYR A CA  1 
ATOM   1178 C  C   . TYR A 1 151 ? 37.927  13.122  23.380  1.00 35.53 ? 151  TYR A C   1 
ATOM   1179 O  O   . TYR A 1 151 ? 37.431  14.109  22.805  1.00 35.66 ? 151  TYR A O   1 
ATOM   1180 C  CB  . TYR A 1 151 ? 36.454  11.100  23.409  1.00 32.56 ? 151  TYR A CB  1 
ATOM   1181 C  CG  . TYR A 1 151 ? 35.596  11.551  22.252  1.00 32.05 ? 151  TYR A CG  1 
ATOM   1182 C  CD1 . TYR A 1 151 ? 34.229  11.784  22.420  1.00 31.66 ? 151  TYR A CD1 1 
ATOM   1183 C  CD2 . TYR A 1 151 ? 36.142  11.735  20.987  1.00 31.74 ? 151  TYR A CD2 1 
ATOM   1184 C  CE1 . TYR A 1 151 ? 33.432  12.183  21.356  1.00 30.42 ? 151  TYR A CE1 1 
ATOM   1185 C  CE2 . TYR A 1 151 ? 35.354  12.139  19.912  1.00 31.77 ? 151  TYR A CE2 1 
ATOM   1186 C  CZ  . TYR A 1 151 ? 34.003  12.362  20.099  1.00 31.87 ? 151  TYR A CZ  1 
ATOM   1187 O  OH  . TYR A 1 151 ? 33.222  12.766  19.031  1.00 31.80 ? 151  TYR A OH  1 
ATOM   1188 N  N   . ARG A 1 152 ? 39.216  12.811  23.284  1.00 36.18 ? 152  ARG A N   1 
ATOM   1189 C  CA  . ARG A 1 152 ? 40.133  13.653  22.506  1.00 36.38 ? 152  ARG A CA  1 
ATOM   1190 C  C   . ARG A 1 152 ? 39.733  13.752  21.045  1.00 36.43 ? 152  ARG A C   1 
ATOM   1191 O  O   . ARG A 1 152 ? 39.336  12.761  20.436  1.00 36.16 ? 152  ARG A O   1 
ATOM   1192 C  CB  . ARG A 1 152 ? 41.572  13.134  22.624  1.00 36.10 ? 152  ARG A CB  1 
ATOM   1193 C  CG  . ARG A 1 152 ? 42.240  13.439  23.973  1.00 38.83 ? 152  ARG A CG  1 
ATOM   1194 C  CD  . ARG A 1 152 ? 43.578  12.713  24.112  1.00 38.88 ? 152  ARG A CD  1 
ATOM   1195 N  NE  . ARG A 1 152 ? 43.363  11.284  24.303  1.00 39.49 ? 152  ARG A NE  1 
ATOM   1196 C  CZ  . ARG A 1 152 ? 44.324  10.357  24.300  1.00 41.89 ? 152  ARG A CZ  1 
ATOM   1197 N  NH1 . ARG A 1 152 ? 45.603  10.697  24.100  1.00 38.88 ? 152  ARG A NH1 1 
ATOM   1198 N  NH2 . ARG A 1 152 ? 44.005  9.077   24.538  1.00 38.32 ? 152  ARG A NH2 1 
ATOM   1199 N  N   . VAL A 1 153 ? 39.861  14.962  20.492  1.00 35.87 ? 153  VAL A N   1 
ATOM   1200 C  CA  . VAL A 1 153 ? 39.516  15.230  19.099  1.00 35.39 ? 153  VAL A CA  1 
ATOM   1201 C  C   . VAL A 1 153 ? 40.722  15.805  18.373  1.00 38.83 ? 153  VAL A C   1 
ATOM   1202 O  O   . VAL A 1 153 ? 41.782  16.076  18.979  1.00 38.72 ? 153  VAL A O   1 
ATOM   1203 C  CB  . VAL A 1 153 ? 38.361  16.267  18.988  1.00 35.25 ? 153  VAL A CB  1 
ATOM   1204 C  CG1 . VAL A 1 153 ? 37.070  15.679  19.504  1.00 31.76 ? 153  VAL A CG1 1 
ATOM   1205 C  CG2 . VAL A 1 153 ? 38.702  17.506  19.796  1.00 31.23 ? 153  VAL A CG2 1 
ATOM   1206 N  N   . GLY A 1 154 ? 40.548  16.017  17.072  1.00 39.28 ? 154  GLY A N   1 
ATOM   1207 C  CA  . GLY A 1 154 ? 41.628  16.566  16.269  1.00 40.56 ? 154  GLY A CA  1 
ATOM   1208 C  C   . GLY A 1 154 ? 42.866  15.683  16.307  1.00 41.30 ? 154  GLY A C   1 
ATOM   1209 O  O   . GLY A 1 154 ? 42.770  14.440  16.421  1.00 42.37 ? 154  GLY A O   1 
ATOM   1210 N  N   . THR A 1 155 ? 44.029  16.319  16.202  1.00 38.63 ? 155  THR A N   1 
ATOM   1211 C  CA  . THR A 1 155 ? 45.287  15.590  16.209  1.00 38.62 ? 155  THR A CA  1 
ATOM   1212 C  C   . THR A 1 155 ? 45.451  14.817  17.538  1.00 39.24 ? 155  THR A C   1 
ATOM   1213 O  O   . THR A 1 155 ? 45.837  13.654  17.547  1.00 39.22 ? 155  THR A O   1 
ATOM   1214 C  CB  . THR A 1 155 ? 46.480  16.545  16.053  1.00 38.21 ? 155  THR A CB  1 
ATOM   1215 O  OG1 . THR A 1 155 ? 46.437  17.521  17.104  1.00 34.60 ? 155  THR A OG1 1 
ATOM   1216 C  CG2 . THR A 1 155 ? 46.453  17.246  14.669  1.00 35.00 ? 155  THR A CG2 1 
ATOM   1217 N  N   . PHE A 1 156 ? 45.127  15.465  18.643  1.00 37.29 ? 156  PHE A N   1 
ATOM   1218 C  CA  . PHE A 1 156 ? 45.266  14.842  19.946  1.00 40.19 ? 156  PHE A CA  1 
ATOM   1219 C  C   . PHE A 1 156 ? 44.589  13.487  20.039  1.00 40.06 ? 156  PHE A C   1 
ATOM   1220 O  O   . PHE A 1 156 ? 45.115  12.579  20.681  1.00 40.99 ? 156  PHE A O   1 
ATOM   1221 C  CB  . PHE A 1 156 ? 44.722  15.784  21.017  1.00 39.55 ? 156  PHE A CB  1 
ATOM   1222 C  CG  . PHE A 1 156 ? 45.284  17.162  20.916  1.00 41.25 ? 156  PHE A CG  1 
ATOM   1223 C  CD1 . PHE A 1 156 ? 46.520  17.467  21.480  1.00 42.81 ? 156  PHE A CD1 1 
ATOM   1224 C  CD2 . PHE A 1 156 ? 44.623  18.134  20.173  1.00 41.30 ? 156  PHE A CD2 1 
ATOM   1225 C  CE1 . PHE A 1 156 ? 47.108  18.732  21.299  1.00 44.23 ? 156  PHE A CE1 1 
ATOM   1226 C  CE2 . PHE A 1 156 ? 45.193  19.396  19.978  1.00 44.39 ? 156  PHE A CE2 1 
ATOM   1227 C  CZ  . PHE A 1 156 ? 46.443  19.698  20.541  1.00 43.87 ? 156  PHE A CZ  1 
ATOM   1228 N  N   . GLY A 1 157 ? 43.442  13.335  19.389  1.00 39.16 ? 157  GLY A N   1 
ATOM   1229 C  CA  . GLY A 1 157 ? 42.757  12.063  19.453  1.00 37.62 ? 157  GLY A CA  1 
ATOM   1230 C  C   . GLY A 1 157 ? 42.840  11.178  18.228  1.00 36.99 ? 157  GLY A C   1 
ATOM   1231 O  O   . GLY A 1 157 ? 42.478  10.006  18.310  1.00 35.95 ? 157  GLY A O   1 
ATOM   1232 N  N   . PHE A 1 158 ? 43.320  11.704  17.101  1.00 36.71 ? 158  PHE A N   1 
ATOM   1233 C  CA  . PHE A 1 158 ? 43.359  10.899  15.889  1.00 37.90 ? 158  PHE A CA  1 
ATOM   1234 C  C   . PHE A 1 158 ? 44.576  10.952  15.004  1.00 39.40 ? 158  PHE A C   1 
ATOM   1235 O  O   . PHE A 1 158 ? 44.610  10.239  14.005  1.00 40.78 ? 158  PHE A O   1 
ATOM   1236 C  CB  . PHE A 1 158 ? 42.109  11.179  15.053  1.00 36.88 ? 158  PHE A CB  1 
ATOM   1237 C  CG  . PHE A 1 158 ? 40.846  10.815  15.766  1.00 36.75 ? 158  PHE A CG  1 
ATOM   1238 C  CD1 . PHE A 1 158 ? 40.459  9.482   15.869  1.00 36.40 ? 158  PHE A CD1 1 
ATOM   1239 C  CD2 . PHE A 1 158 ? 40.146  11.776  16.488  1.00 35.76 ? 158  PHE A CD2 1 
ATOM   1240 C  CE1 . PHE A 1 158 ? 39.398  9.110   16.702  1.00 38.09 ? 158  PHE A CE1 1 
ATOM   1241 C  CE2 . PHE A 1 158 ? 39.084  11.414  17.326  1.00 37.79 ? 158  PHE A CE2 1 
ATOM   1242 C  CZ  . PHE A 1 158 ? 38.712  10.083  17.437  1.00 36.18 ? 158  PHE A CZ  1 
ATOM   1243 N  N   . LEU A 1 159 ? 45.570  11.770  15.342  1.00 40.74 ? 159  LEU A N   1 
ATOM   1244 C  CA  . LEU A 1 159 ? 46.758  11.809  14.511  1.00 42.78 ? 159  LEU A CA  1 
ATOM   1245 C  C   . LEU A 1 159 ? 47.416  10.445  14.653  1.00 44.79 ? 159  LEU A C   1 
ATOM   1246 O  O   . LEU A 1 159 ? 47.621  9.942   15.762  1.00 45.74 ? 159  LEU A O   1 
ATOM   1247 C  CB  . LEU A 1 159 ? 47.715  12.910  14.960  1.00 44.58 ? 159  LEU A CB  1 
ATOM   1248 C  CG  . LEU A 1 159 ? 49.024  12.956  14.147  1.00 45.52 ? 159  LEU A CG  1 
ATOM   1249 C  CD1 . LEU A 1 159 ? 49.542  14.389  14.115  1.00 44.81 ? 159  LEU A CD1 1 
ATOM   1250 C  CD2 . LEU A 1 159 ? 50.060  12.006  14.766  1.00 43.95 ? 159  LEU A CD2 1 
ATOM   1251 N  N   . ALA A 1 160 ? 47.763  9.835   13.537  1.00 45.04 ? 160  ALA A N   1 
ATOM   1252 C  CA  . ALA A 1 160 ? 48.341  8.519   13.619  1.00 45.74 ? 160  ALA A CA  1 
ATOM   1253 C  C   . ALA A 1 160 ? 49.496  8.231   12.677  1.00 48.26 ? 160  ALA A C   1 
ATOM   1254 O  O   . ALA A 1 160 ? 49.521  8.680   11.526  1.00 47.52 ? 160  ALA A O   1 
ATOM   1255 C  CB  . ALA A 1 160 ? 47.256  7.504   13.378  1.00 46.15 ? 160  ALA A CB  1 
ATOM   1256 N  N   . LEU A 1 161 ? 50.463  7.483   13.192  1.00 49.40 ? 161  LEU A N   1 
ATOM   1257 C  CA  . LEU A 1 161 ? 51.581  7.001   12.386  1.00 50.34 ? 161  LEU A CA  1 
ATOM   1258 C  C   . LEU A 1 161 ? 51.373  5.503   12.541  1.00 49.34 ? 161  LEU A C   1 
ATOM   1259 O  O   . LEU A 1 161 ? 52.002  4.859   13.369  1.00 50.38 ? 161  LEU A O   1 
ATOM   1260 C  CB  . LEU A 1 161 ? 52.892  7.495   12.973  1.00 51.08 ? 161  LEU A CB  1 
ATOM   1261 C  CG  . LEU A 1 161 ? 52.931  8.966   12.517  1.00 54.27 ? 161  LEU A CG  1 
ATOM   1262 C  CD1 . LEU A 1 161 ? 53.652  9.846   13.477  1.00 55.96 ? 161  LEU A CD1 1 
ATOM   1263 C  CD2 . LEU A 1 161 ? 53.566  9.027   11.134  1.00 55.15 ? 161  LEU A CD2 1 
ATOM   1264 N  N   . PRO A 1 162 ? 50.427  4.940   11.761  1.00 49.54 ? 162  PRO A N   1 
ATOM   1265 C  CA  . PRO A 1 162 ? 50.064  3.516   11.774  1.00 50.91 ? 162  PRO A CA  1 
ATOM   1266 C  C   . PRO A 1 162 ? 51.257  2.556   11.857  1.00 53.83 ? 162  PRO A C   1 
ATOM   1267 O  O   . PRO A 1 162 ? 52.190  2.633   11.045  1.00 52.92 ? 162  PRO A O   1 
ATOM   1268 C  CB  . PRO A 1 162 ? 49.264  3.349   10.483  1.00 48.38 ? 162  PRO A CB  1 
ATOM   1269 C  CG  . PRO A 1 162 ? 48.677  4.676   10.274  1.00 47.01 ? 162  PRO A CG  1 
ATOM   1270 C  CD  . PRO A 1 162 ? 49.806  5.609   10.607  1.00 45.94 ? 162  PRO A CD  1 
ATOM   1271 N  N   . GLY A 1 163 ? 51.210  1.658   12.845  1.00 55.73 ? 163  GLY A N   1 
ATOM   1272 C  CA  . GLY A 1 163 ? 52.283  0.695   13.039  1.00 55.96 ? 163  GLY A CA  1 
ATOM   1273 C  C   . GLY A 1 163 ? 53.239  1.147   14.123  1.00 57.36 ? 163  GLY A C   1 
ATOM   1274 O  O   . GLY A 1 163 ? 53.952  0.333   14.714  1.00 58.41 ? 163  GLY A O   1 
ATOM   1275 N  N   . SER A 1 164 ? 53.273  2.448   14.389  1.00 57.34 ? 164  SER A N   1 
ATOM   1276 C  CA  . SER A 1 164 ? 54.147  2.965   15.426  1.00 57.52 ? 164  SER A CA  1 
ATOM   1277 C  C   . SER A 1 164 ? 53.575  2.597   16.789  1.00 58.72 ? 164  SER A C   1 
ATOM   1278 O  O   . SER A 1 164 ? 52.441  2.129   16.894  1.00 59.38 ? 164  SER A O   1 
ATOM   1279 C  CB  . SER A 1 164 ? 54.270  4.488   15.330  1.00 57.78 ? 164  SER A CB  1 
ATOM   1280 O  OG  . SER A 1 164 ? 53.152  5.149   15.897  1.00 55.33 ? 164  SER A OG  1 
ATOM   1281 N  N   . ARG A 1 165 ? 54.359  2.819   17.833  1.00 59.63 ? 165  ARG A N   1 
ATOM   1282 C  CA  . ARG A 1 165 ? 53.917  2.514   19.179  1.00 61.82 ? 165  ARG A CA  1 
ATOM   1283 C  C   . ARG A 1 165 ? 53.490  3.797   19.895  1.00 59.83 ? 165  ARG A C   1 
ATOM   1284 O  O   . ARG A 1 165 ? 52.627  3.762   20.772  1.00 59.43 ? 165  ARG A O   1 
ATOM   1285 C  CB  . ARG A 1 165 ? 55.058  1.816   19.943  1.00 67.25 ? 165  ARG A CB  1 
ATOM   1286 C  CG  . ARG A 1 165 ? 55.029  1.979   21.464  1.00 74.12 ? 165  ARG A CG  1 
ATOM   1287 C  CD  . ARG A 1 165 ? 56.222  1.283   22.123  1.00 80.80 ? 165  ARG A CD  1 
ATOM   1288 N  NE  . ARG A 1 165 ? 56.007  -0.162  22.235  1.00 86.95 ? 165  ARG A NE  1 
ATOM   1289 C  CZ  . ARG A 1 165 ? 55.105  -0.718  23.044  1.00 89.71 ? 165  ARG A CZ  1 
ATOM   1290 N  NH1 . ARG A 1 165 ? 54.340  0.052   23.812  1.00 91.35 ? 165  ARG A NH1 1 
ATOM   1291 N  NH2 . ARG A 1 165 ? 54.959  -2.038  23.083  1.00 90.72 ? 165  ARG A NH2 1 
ATOM   1292 N  N   . GLU A 1 166 ? 54.079  4.923   19.491  1.00 56.72 ? 166  GLU A N   1 
ATOM   1293 C  CA  . GLU A 1 166 ? 53.805  6.220   20.101  1.00 55.99 ? 166  GLU A CA  1 
ATOM   1294 C  C   . GLU A 1 166 ? 52.590  6.992   19.549  1.00 53.78 ? 166  GLU A C   1 
ATOM   1295 O  O   . GLU A 1 166 ? 52.131  7.939   20.171  1.00 52.55 ? 166  GLU A O   1 
ATOM   1296 C  CB  . GLU A 1 166 ? 55.056  7.112   20.013  1.00 59.09 ? 166  GLU A CB  1 
ATOM   1297 C  CG  . GLU A 1 166 ? 56.368  6.414   20.397  1.00 63.69 ? 166  GLU A CG  1 
ATOM   1298 C  CD  . GLU A 1 166 ? 57.057  5.680   19.209  1.00 68.18 ? 166  GLU A CD  1 
ATOM   1299 O  OE1 . GLU A 1 166 ? 56.368  5.058   18.355  1.00 69.27 ? 166  GLU A OE1 1 
ATOM   1300 O  OE2 . GLU A 1 166 ? 58.310  5.707   19.141  1.00 68.81 ? 166  GLU A OE2 1 
ATOM   1301 N  N   . ALA A 1 167 ? 52.078  6.595   18.390  1.00 50.70 ? 167  ALA A N   1 
ATOM   1302 C  CA  . ALA A 1 167 ? 50.915  7.250   17.798  1.00 49.14 ? 167  ALA A CA  1 
ATOM   1303 C  C   . ALA A 1 167 ? 50.174  6.213   16.956  1.00 47.65 ? 167  ALA A C   1 
ATOM   1304 O  O   . ALA A 1 167 ? 50.103  6.320   15.734  1.00 48.83 ? 167  ALA A O   1 
ATOM   1305 C  CB  . ALA A 1 167 ? 51.353  8.426   16.934  1.00 46.39 ? 167  ALA A CB  1 
ATOM   1306 N  N   . PRO A 1 168 ? 49.593  5.200   17.611  1.00 46.79 ? 168  PRO A N   1 
ATOM   1307 C  CA  . PRO A 1 168 ? 48.866  4.126   16.922  1.00 45.55 ? 168  PRO A CA  1 
ATOM   1308 C  C   . PRO A 1 168 ? 47.551  4.520   16.249  1.00 46.31 ? 168  PRO A C   1 
ATOM   1309 O  O   . PRO A 1 168 ? 47.011  3.764   15.436  1.00 45.98 ? 168  PRO A O   1 
ATOM   1310 C  CB  . PRO A 1 168 ? 48.680  3.080   18.031  1.00 44.91 ? 168  PRO A CB  1 
ATOM   1311 C  CG  . PRO A 1 168 ? 48.520  3.928   19.270  1.00 43.67 ? 168  PRO A CG  1 
ATOM   1312 C  CD  . PRO A 1 168 ? 49.545  5.035   19.080  1.00 44.54 ? 168  PRO A CD  1 
ATOM   1313 N  N   . GLY A 1 169 ? 47.031  5.697   16.584  1.00 45.60 ? 169  GLY A N   1 
ATOM   1314 C  CA  . GLY A 1 169 ? 45.776  6.127   15.993  1.00 45.40 ? 169  GLY A CA  1 
ATOM   1315 C  C   . GLY A 1 169 ? 44.565  5.653   16.796  1.00 45.98 ? 169  GLY A C   1 
ATOM   1316 O  O   . GLY A 1 169 ? 44.679  4.776   17.662  1.00 44.49 ? 169  GLY A O   1 
ATOM   1317 N  N   . ASN A 1 170 ? 43.409  6.259   16.516  1.00 45.18 ? 170  ASN A N   1 
ATOM   1318 C  CA  . ASN A 1 170 ? 42.149  5.934   17.170  1.00 42.87 ? 170  ASN A CA  1 
ATOM   1319 C  C   . ASN A 1 170 ? 42.119  6.071   18.693  1.00 41.51 ? 170  ASN A C   1 
ATOM   1320 O  O   . ASN A 1 170 ? 41.238  5.509   19.328  1.00 42.39 ? 170  ASN A O   1 
ATOM   1321 C  CB  . ASN A 1 170 ? 41.705  4.512   16.795  1.00 41.92 ? 170  ASN A CB  1 
ATOM   1322 C  CG  . ASN A 1 170 ? 41.556  4.323   15.308  1.00 44.22 ? 170  ASN A CG  1 
ATOM   1323 O  OD1 . ASN A 1 170 ? 41.141  5.236   14.590  1.00 44.89 ? 170  ASN A OD1 1 
ATOM   1324 N  ND2 . ASN A 1 170 ? 41.882  3.124   14.828  1.00 43.34 ? 170  ASN A ND2 1 
ATOM   1325 N  N   . VAL A 1 171 ? 43.042  6.819   19.290  1.00 40.58 ? 171  VAL A N   1 
ATOM   1326 C  CA  . VAL A 1 171 ? 43.032  6.953   20.736  1.00 39.12 ? 171  VAL A CA  1 
ATOM   1327 C  C   . VAL A 1 171 ? 41.767  7.647   21.244  1.00 40.24 ? 171  VAL A C   1 
ATOM   1328 O  O   . VAL A 1 171 ? 41.312  7.386   22.367  1.00 41.05 ? 171  VAL A O   1 
ATOM   1329 C  CB  . VAL A 1 171 ? 44.305  7.667   21.267  1.00 39.46 ? 171  VAL A CB  1 
ATOM   1330 C  CG1 . VAL A 1 171 ? 45.537  6.980   20.698  1.00 40.32 ? 171  VAL A CG1 1 
ATOM   1331 C  CG2 . VAL A 1 171 ? 44.303  9.128   20.942  1.00 38.95 ? 171  VAL A CG2 1 
ATOM   1332 N  N   . GLY A 1 172 ? 41.178  8.510   20.415  1.00 39.67 ? 172  GLY A N   1 
ATOM   1333 C  CA  . GLY A 1 172 ? 39.956  9.183   20.825  1.00 36.82 ? 172  GLY A CA  1 
ATOM   1334 C  C   . GLY A 1 172 ? 38.844  8.156   20.983  1.00 36.55 ? 172  GLY A C   1 
ATOM   1335 O  O   . GLY A 1 172 ? 37.960  8.280   21.833  1.00 34.23 ? 172  GLY A O   1 
ATOM   1336 N  N   . LEU A 1 173 ? 38.876  7.135   20.137  1.00 35.54 ? 173  LEU A N   1 
ATOM   1337 C  CA  . LEU A 1 173 ? 37.888  6.079   20.230  1.00 35.90 ? 173  LEU A CA  1 
ATOM   1338 C  C   . LEU A 1 173 ? 38.182  5.256   21.491  1.00 37.70 ? 173  LEU A C   1 
ATOM   1339 O  O   . LEU A 1 173 ? 37.252  4.745   22.147  1.00 38.23 ? 173  LEU A O   1 
ATOM   1340 C  CB  . LEU A 1 173 ? 37.946  5.174   18.992  1.00 35.79 ? 173  LEU A CB  1 
ATOM   1341 C  CG  . LEU A 1 173 ? 37.412  5.803   17.705  1.00 36.00 ? 173  LEU A CG  1 
ATOM   1342 C  CD1 . LEU A 1 173 ? 37.746  4.905   16.519  1.00 34.57 ? 173  LEU A CD1 1 
ATOM   1343 C  CD2 . LEU A 1 173 ? 35.894  6.012   17.825  1.00 32.75 ? 173  LEU A CD2 1 
ATOM   1344 N  N   . LEU A 1 174 ? 39.466  5.128   21.837  1.00 37.39 ? 174  LEU A N   1 
ATOM   1345 C  CA  . LEU A 1 174 ? 39.834  4.363   23.019  1.00 38.47 ? 174  LEU A CA  1 
ATOM   1346 C  C   . LEU A 1 174 ? 39.396  5.118   24.248  1.00 38.30 ? 174  LEU A C   1 
ATOM   1347 O  O   . LEU A 1 174 ? 39.033  4.498   25.230  1.00 39.36 ? 174  LEU A O   1 
ATOM   1348 C  CB  . LEU A 1 174 ? 41.336  4.095   23.063  1.00 37.85 ? 174  LEU A CB  1 
ATOM   1349 C  CG  . LEU A 1 174 ? 41.792  3.104   21.985  1.00 42.87 ? 174  LEU A CG  1 
ATOM   1350 C  CD1 . LEU A 1 174 ? 43.318  3.038   21.962  1.00 40.20 ? 174  LEU A CD1 1 
ATOM   1351 C  CD2 . LEU A 1 174 ? 41.185  1.722   22.245  1.00 41.45 ? 174  LEU A CD2 1 
ATOM   1352 N  N   . ASP A 1 175 ? 39.410  6.454   24.191  1.00 38.65 ? 175  ASP A N   1 
ATOM   1353 C  CA  . ASP A 1 175 ? 38.970  7.250   25.337  1.00 38.20 ? 175  ASP A CA  1 
ATOM   1354 C  C   . ASP A 1 175 ? 37.513  6.905   25.592  1.00 38.59 ? 175  ASP A C   1 
ATOM   1355 O  O   . ASP A 1 175 ? 37.099  6.698   26.740  1.00 38.87 ? 175  ASP A O   1 
ATOM   1356 C  CB  . ASP A 1 175 ? 39.086  8.753   25.078  1.00 37.52 ? 175  ASP A CB  1 
ATOM   1357 C  CG  . ASP A 1 175 ? 40.523  9.224   24.917  1.00 40.49 ? 175  ASP A CG  1 
ATOM   1358 O  OD1 . ASP A 1 175 ? 41.451  8.566   25.453  1.00 41.11 ? 175  ASP A OD1 1 
ATOM   1359 O  OD2 . ASP A 1 175 ? 40.735  10.277  24.266  1.00 39.62 ? 175  ASP A OD2 1 
ATOM   1360 N  N   . GLN A 1 176 ? 36.736  6.837   24.519  1.00 39.14 ? 176  GLN A N   1 
ATOM   1361 C  CA  . GLN A 1 176 ? 35.308  6.498   24.617  1.00 40.20 ? 176  GLN A CA  1 
ATOM   1362 C  C   . GLN A 1 176 ? 35.149  5.101   25.213  1.00 39.85 ? 176  GLN A C   1 
ATOM   1363 O  O   . GLN A 1 176 ? 34.324  4.882   26.104  1.00 40.32 ? 176  GLN A O   1 
ATOM   1364 C  CB  . GLN A 1 176 ? 34.643  6.536   23.235  1.00 37.68 ? 176  GLN A CB  1 
ATOM   1365 C  CG  . GLN A 1 176 ? 34.589  7.927   22.599  1.00 37.81 ? 176  GLN A CG  1 
ATOM   1366 C  CD  . GLN A 1 176 ? 34.165  7.892   21.140  1.00 40.53 ? 176  GLN A CD  1 
ATOM   1367 O  OE1 . GLN A 1 176 ? 33.614  6.877   20.651  1.00 38.31 ? 176  GLN A OE1 1 
ATOM   1368 N  NE2 . GLN A 1 176 ? 34.414  9.004   20.421  1.00 40.79 ? 176  GLN A NE2 1 
ATOM   1369 N  N   . ARG A 1 177 ? 35.955  4.166   24.720  1.00 39.76 ? 177  ARG A N   1 
ATOM   1370 C  CA  . ARG A 1 177 ? 35.890  2.796   25.206  1.00 39.64 ? 177  ARG A CA  1 
ATOM   1371 C  C   . ARG A 1 177 ? 36.207  2.738   26.716  1.00 38.68 ? 177  ARG A C   1 
ATOM   1372 O  O   . ARG A 1 177 ? 35.533  2.036   27.466  1.00 37.64 ? 177  ARG A O   1 
ATOM   1373 C  CB  . ARG A 1 177 ? 36.854  1.893   24.418  1.00 38.38 ? 177  ARG A CB  1 
ATOM   1374 C  CG  . ARG A 1 177 ? 36.778  0.418   24.864  1.00 41.15 ? 177  ARG A CG  1 
ATOM   1375 C  CD  . ARG A 1 177 ? 37.716  -0.457  24.083  1.00 40.89 ? 177  ARG A CD  1 
ATOM   1376 N  NE  . ARG A 1 177 ? 37.142  -0.819  22.794  1.00 44.05 ? 177  ARG A NE  1 
ATOM   1377 C  CZ  . ARG A 1 177 ? 37.847  -1.259  21.755  1.00 42.73 ? 177  ARG A CZ  1 
ATOM   1378 N  NH1 . ARG A 1 177 ? 39.172  -1.384  21.855  1.00 43.74 ? 177  ARG A NH1 1 
ATOM   1379 N  NH2 . ARG A 1 177 ? 37.227  -1.577  20.630  1.00 40.42 ? 177  ARG A NH2 1 
ATOM   1380 N  N   . LEU A 1 178 ? 37.209  3.500   27.155  1.00 36.81 ? 178  LEU A N   1 
ATOM   1381 C  CA  . LEU A 1 178 ? 37.567  3.522   28.560  1.00 37.87 ? 178  LEU A CA  1 
ATOM   1382 C  C   . LEU A 1 178 ? 36.390  4.052   29.386  1.00 39.13 ? 178  LEU A C   1 
ATOM   1383 O  O   . LEU A 1 178 ? 36.116  3.546   30.481  1.00 40.68 ? 178  LEU A O   1 
ATOM   1384 C  CB  . LEU A 1 178 ? 38.811  4.385   28.785  1.00 37.37 ? 178  LEU A CB  1 
ATOM   1385 C  CG  . LEU A 1 178 ? 39.356  4.479   30.217  1.00 38.35 ? 178  LEU A CG  1 
ATOM   1386 C  CD1 . LEU A 1 178 ? 39.662  3.075   30.765  1.00 36.27 ? 178  LEU A CD1 1 
ATOM   1387 C  CD2 . LEU A 1 178 ? 40.622  5.321   30.218  1.00 38.16 ? 178  LEU A CD2 1 
ATOM   1388 N  N   . ALA A 1 179 ? 35.682  5.054   28.860  1.00 38.50 ? 179  ALA A N   1 
ATOM   1389 C  CA  . ALA A 1 179 ? 34.522  5.608   29.563  1.00 36.36 ? 179  ALA A CA  1 
ATOM   1390 C  C   . ALA A 1 179 ? 33.424  4.540   29.599  1.00 35.35 ? 179  ALA A C   1 
ATOM   1391 O  O   . ALA A 1 179 ? 32.682  4.447   30.573  1.00 35.18 ? 179  ALA A O   1 
ATOM   1392 C  CB  . ALA A 1 179 ? 34.019  6.897   28.878  1.00 35.47 ? 179  ALA A CB  1 
ATOM   1393 N  N   . LEU A 1 180 ? 33.314  3.724   28.553  1.00 36.64 ? 180  LEU A N   1 
ATOM   1394 C  CA  . LEU A 1 180 ? 32.305  2.668   28.585  1.00 38.75 ? 180  LEU A CA  1 
ATOM   1395 C  C   . LEU A 1 180 ? 32.675  1.612   29.658  1.00 39.98 ? 180  LEU A C   1 
ATOM   1396 O  O   . LEU A 1 180 ? 31.798  1.063   30.328  1.00 36.86 ? 180  LEU A O   1 
ATOM   1397 C  CB  . LEU A 1 180 ? 32.159  1.969   27.228  1.00 37.86 ? 180  LEU A CB  1 
ATOM   1398 C  CG  . LEU A 1 180 ? 31.850  2.815   25.984  1.00 40.99 ? 180  LEU A CG  1 
ATOM   1399 C  CD1 . LEU A 1 180 ? 31.347  1.888   24.885  1.00 38.28 ? 180  LEU A CD1 1 
ATOM   1400 C  CD2 . LEU A 1 180 ? 30.835  3.885   26.253  1.00 36.30 ? 180  LEU A CD2 1 
ATOM   1401 N  N   . GLN A 1 181 ? 33.970  1.348   29.835  1.00 41.03 ? 181  GLN A N   1 
ATOM   1402 C  CA  . GLN A 1 181 ? 34.370  0.352   30.829  1.00 42.81 ? 181  GLN A CA  1 
ATOM   1403 C  C   . GLN A 1 181 ? 34.111  0.918   32.218  1.00 42.42 ? 181  GLN A C   1 
ATOM   1404 O  O   . GLN A 1 181 ? 33.670  0.196   33.132  1.00 42.67 ? 181  GLN A O   1 
ATOM   1405 C  CB  . GLN A 1 181 ? 35.849  -0.031  30.659  1.00 43.97 ? 181  GLN A CB  1 
ATOM   1406 C  CG  . GLN A 1 181 ? 36.157  -0.537  29.244  1.00 48.01 ? 181  GLN A CG  1 
ATOM   1407 C  CD  . GLN A 1 181 ? 37.632  -0.793  28.978  1.00 49.30 ? 181  GLN A CD  1 
ATOM   1408 O  OE1 . GLN A 1 181 ? 38.503  -0.022  29.385  1.00 53.39 ? 181  GLN A OE1 1 
ATOM   1409 N  NE2 . GLN A 1 181 ? 37.915  -1.866  28.263  1.00 51.38 ? 181  GLN A NE2 1 
ATOM   1410 N  N   . TRP A 1 182 ? 34.370  2.212   32.366  1.00 39.69 ? 182  TRP A N   1 
ATOM   1411 C  CA  . TRP A 1 182 ? 34.144  2.883   33.629  1.00 38.56 ? 182  TRP A CA  1 
ATOM   1412 C  C   . TRP A 1 182 ? 32.672  2.728   33.994  1.00 39.22 ? 182  TRP A C   1 
ATOM   1413 O  O   . TRP A 1 182 ? 32.337  2.523   35.164  1.00 38.79 ? 182  TRP A O   1 
ATOM   1414 C  CB  . TRP A 1 182 ? 34.489  4.367   33.528  1.00 37.06 ? 182  TRP A CB  1 
ATOM   1415 C  CG  . TRP A 1 182 ? 34.291  5.108   34.830  1.00 34.99 ? 182  TRP A CG  1 
ATOM   1416 C  CD1 . TRP A 1 182 ? 35.245  5.393   35.770  1.00 34.38 ? 182  TRP A CD1 1 
ATOM   1417 C  CD2 . TRP A 1 182 ? 33.074  5.669   35.307  1.00 33.29 ? 182  TRP A CD2 1 
ATOM   1418 N  NE1 . TRP A 1 182 ? 34.686  6.110   36.807  1.00 36.18 ? 182  TRP A NE1 1 
ATOM   1419 C  CE2 . TRP A 1 182 ? 33.356  6.288   36.549  1.00 34.95 ? 182  TRP A CE2 1 
ATOM   1420 C  CE3 . TRP A 1 182 ? 31.763  5.716   34.806  1.00 35.14 ? 182  TRP A CE3 1 
ATOM   1421 C  CZ2 . TRP A 1 182 ? 32.375  6.948   37.301  1.00 35.82 ? 182  TRP A CZ2 1 
ATOM   1422 C  CZ3 . TRP A 1 182 ? 30.782  6.381   35.557  1.00 35.07 ? 182  TRP A CZ3 1 
ATOM   1423 C  CH2 . TRP A 1 182 ? 31.099  6.984   36.788  1.00 34.55 ? 182  TRP A CH2 1 
ATOM   1424 N  N   . VAL A 1 183 ? 31.794  2.808   32.994  1.00 38.23 ? 183  VAL A N   1 
ATOM   1425 C  CA  . VAL A 1 183 ? 30.370  2.669   33.273  1.00 38.79 ? 183  VAL A CA  1 
ATOM   1426 C  C   . VAL A 1 183 ? 30.057  1.242   33.747  1.00 40.01 ? 183  VAL A C   1 
ATOM   1427 O  O   . VAL A 1 183 ? 29.330  1.049   34.731  1.00 39.62 ? 183  VAL A O   1 
ATOM   1428 C  CB  . VAL A 1 183 ? 29.509  3.061   32.028  1.00 37.36 ? 183  VAL A CB  1 
ATOM   1429 C  CG1 . VAL A 1 183 ? 28.077  2.537   32.170  1.00 34.55 ? 183  VAL A CG1 1 
ATOM   1430 C  CG2 . VAL A 1 183 ? 29.472  4.615   31.895  1.00 35.22 ? 183  VAL A CG2 1 
ATOM   1431 N  N   . GLN A 1 184 ? 30.618  0.250   33.068  1.00 40.82 ? 184  GLN A N   1 
ATOM   1432 C  CA  . GLN A 1 184 ? 30.379  -1.139  33.460  1.00 43.79 ? 184  GLN A CA  1 
ATOM   1433 C  C   . GLN A 1 184 ? 30.750  -1.365  34.901  1.00 42.01 ? 184  GLN A C   1 
ATOM   1434 O  O   . GLN A 1 184 ? 30.026  -2.016  35.647  1.00 42.05 ? 184  GLN A O   1 
ATOM   1435 C  CB  . GLN A 1 184 ? 31.187  -2.110  32.598  1.00 43.49 ? 184  GLN A CB  1 
ATOM   1436 C  CG  . GLN A 1 184 ? 30.566  -2.311  31.245  1.00 45.96 ? 184  GLN A CG  1 
ATOM   1437 C  CD  . GLN A 1 184 ? 29.204  -2.937  31.351  1.00 48.34 ? 184  GLN A CD  1 
ATOM   1438 O  OE1 . GLN A 1 184 ? 29.072  -4.073  31.805  1.00 51.62 ? 184  GLN A OE1 1 
ATOM   1439 N  NE2 . GLN A 1 184 ? 28.178  -2.204  30.946  1.00 47.84 ? 184  GLN A NE2 1 
ATOM   1440 N  N   . GLU A 1 185 ? 31.875  -0.807  35.310  1.00 41.54 ? 185  GLU A N   1 
ATOM   1441 C  CA  . GLU A 1 185 ? 32.284  -1.031  36.661  1.00 42.19 ? 185  GLU A CA  1 
ATOM   1442 C  C   . GLU A 1 185 ? 31.622  -0.177  37.723  1.00 41.88 ? 185  GLU A C   1 
ATOM   1443 O  O   . GLU A 1 185 ? 31.374  -0.660  38.829  1.00 41.98 ? 185  GLU A O   1 
ATOM   1444 C  CB  . GLU A 1 185 ? 33.811  -0.904  36.828  1.00 42.27 ? 185  GLU A CB  1 
ATOM   1445 C  CG  . GLU A 1 185 ? 34.211  -0.953  38.323  1.00 46.94 ? 185  GLU A CG  1 
ATOM   1446 C  CD  . GLU A 1 185 ? 35.677  -1.195  38.569  1.00 49.87 ? 185  GLU A CD  1 
ATOM   1447 O  OE1 . GLU A 1 185 ? 36.035  -1.605  39.707  1.00 49.03 ? 185  GLU A OE1 1 
ATOM   1448 O  OE2 . GLU A 1 185 ? 36.473  -0.966  37.628  1.00 52.48 ? 185  GLU A OE2 1 
ATOM   1449 N  N   . ASN A 1 186 ? 31.331  1.077   37.410  1.00 41.06 ? 186  ASN A N   1 
ATOM   1450 C  CA  . ASN A 1 186 ? 30.794  1.965   38.445  1.00 40.63 ? 186  ASN A CA  1 
ATOM   1451 C  C   . ASN A 1 186 ? 29.360  2.462   38.337  1.00 39.74 ? 186  ASN A C   1 
ATOM   1452 O  O   . ASN A 1 186 ? 28.839  3.011   39.302  1.00 40.42 ? 186  ASN A O   1 
ATOM   1453 C  CB  . ASN A 1 186 ? 31.689  3.201   38.551  1.00 40.04 ? 186  ASN A CB  1 
ATOM   1454 C  CG  . ASN A 1 186 ? 33.156  2.863   38.759  1.00 41.81 ? 186  ASN A CG  1 
ATOM   1455 O  OD1 . ASN A 1 186 ? 33.599  2.594   39.885  1.00 42.79 ? 186  ASN A OD1 1 
ATOM   1456 N  ND2 . ASN A 1 186 ? 33.929  2.901   37.676  1.00 41.19 ? 186  ASN A ND2 1 
ATOM   1457 N  N   . ILE A 1 187 ? 28.701  2.300   37.196  1.00 40.87 ? 187  ILE A N   1 
ATOM   1458 C  CA  . ILE A 1 187 ? 27.355  2.870   37.101  1.00 40.94 ? 187  ILE A CA  1 
ATOM   1459 C  C   . ILE A 1 187 ? 26.341  2.370   38.149  1.00 42.82 ? 187  ILE A C   1 
ATOM   1460 O  O   . ILE A 1 187 ? 25.457  3.133   38.580  1.00 42.71 ? 187  ILE A O   1 
ATOM   1461 C  CB  . ILE A 1 187 ? 26.790  2.761   35.657  1.00 37.63 ? 187  ILE A CB  1 
ATOM   1462 C  CG1 . ILE A 1 187 ? 25.826  3.926   35.418  1.00 39.08 ? 187  ILE A CG1 1 
ATOM   1463 C  CG2 . ILE A 1 187 ? 26.072  1.467   35.429  1.00 36.20 ? 187  ILE A CG2 1 
ATOM   1464 C  CD1 . ILE A 1 187 ? 26.491  5.305   35.471  1.00 35.50 ? 187  ILE A CD1 1 
ATOM   1465 N  N   . ALA A 1 188 ? 26.486  1.117   38.590  1.00 42.26 ? 188  ALA A N   1 
ATOM   1466 C  CA  . ALA A 1 188 ? 25.568  0.576   39.592  1.00 42.32 ? 188  ALA A CA  1 
ATOM   1467 C  C   . ALA A 1 188 ? 25.547  1.466   40.838  1.00 42.49 ? 188  ALA A C   1 
ATOM   1468 O  O   . ALA A 1 188 ? 24.491  1.638   41.452  1.00 42.48 ? 188  ALA A O   1 
ATOM   1469 C  CB  . ALA A 1 188 ? 25.955  -0.857  39.965  1.00 42.40 ? 188  ALA A CB  1 
ATOM   1470 N  N   . ALA A 1 189 ? 26.695  2.049   41.202  1.00 40.79 ? 189  ALA A N   1 
ATOM   1471 C  CA  . ALA A 1 189 ? 26.753  2.929   42.370  1.00 40.21 ? 189  ALA A CA  1 
ATOM   1472 C  C   . ALA A 1 189 ? 25.777  4.086   42.266  1.00 41.42 ? 189  ALA A C   1 
ATOM   1473 O  O   . ALA A 1 189 ? 25.448  4.706   43.269  1.00 42.10 ? 189  ALA A O   1 
ATOM   1474 C  CB  . ALA A 1 189 ? 28.152  3.490   42.558  1.00 37.53 ? 189  ALA A CB  1 
ATOM   1475 N  N   . PHE A 1 190 ? 25.330  4.399   41.053  1.00 43.44 ? 190  PHE A N   1 
ATOM   1476 C  CA  . PHE A 1 190 ? 24.411  5.524   40.843  1.00 43.56 ? 190  PHE A CA  1 
ATOM   1477 C  C   . PHE A 1 190 ? 22.998  5.029   40.573  1.00 43.86 ? 190  PHE A C   1 
ATOM   1478 O  O   . PHE A 1 190 ? 22.087  5.828   40.314  1.00 44.28 ? 190  PHE A O   1 
ATOM   1479 C  CB  . PHE A 1 190 ? 24.865  6.386   39.646  1.00 41.95 ? 190  PHE A CB  1 
ATOM   1480 C  CG  . PHE A 1 190 ? 26.249  6.966   39.785  1.00 40.62 ? 190  PHE A CG  1 
ATOM   1481 C  CD1 . PHE A 1 190 ? 27.376  6.222   39.441  1.00 41.17 ? 190  PHE A CD1 1 
ATOM   1482 C  CD2 . PHE A 1 190 ? 26.427  8.262   40.244  1.00 41.01 ? 190  PHE A CD2 1 
ATOM   1483 C  CE1 . PHE A 1 190 ? 28.670  6.770   39.552  1.00 39.26 ? 190  PHE A CE1 1 
ATOM   1484 C  CE2 . PHE A 1 190 ? 27.715  8.825   40.366  1.00 39.90 ? 190  PHE A CE2 1 
ATOM   1485 C  CZ  . PHE A 1 190 ? 28.837  8.075   40.018  1.00 39.88 ? 190  PHE A CZ  1 
ATOM   1486 N  N   . GLY A 1 191 ? 22.822  3.711   40.611  1.00 43.24 ? 191  GLY A N   1 
ATOM   1487 C  CA  . GLY A 1 191 ? 21.516  3.137   40.347  1.00 43.50 ? 191  GLY A CA  1 
ATOM   1488 C  C   . GLY A 1 191 ? 21.301  2.753   38.896  1.00 44.26 ? 191  GLY A C   1 
ATOM   1489 O  O   . GLY A 1 191 ? 20.178  2.438   38.485  1.00 44.87 ? 191  GLY A O   1 
ATOM   1490 N  N   . GLY A 1 192 ? 22.374  2.779   38.109  1.00 44.26 ? 192  GLY A N   1 
ATOM   1491 C  CA  . GLY A 1 192 ? 22.266  2.421   36.707  1.00 42.69 ? 192  GLY A CA  1 
ATOM   1492 C  C   . GLY A 1 192 ? 22.456  0.925   36.530  1.00 42.20 ? 192  GLY A C   1 
ATOM   1493 O  O   . GLY A 1 192 ? 23.168  0.289   37.295  1.00 40.83 ? 192  GLY A O   1 
ATOM   1494 N  N   . ASP A 1 193 ? 21.806  0.356   35.531  1.00 42.39 ? 193  ASP A N   1 
ATOM   1495 C  CA  . ASP A 1 193 ? 21.928  -1.064  35.281  1.00 42.88 ? 193  ASP A CA  1 
ATOM   1496 C  C   . ASP A 1 193 ? 23.007  -1.295  34.247  1.00 42.89 ? 193  ASP A C   1 
ATOM   1497 O  O   . ASP A 1 193 ? 22.815  -1.027  33.072  1.00 43.59 ? 193  ASP A O   1 
ATOM   1498 C  CB  . ASP A 1 193 ? 20.596  -1.612  34.769  1.00 43.82 ? 193  ASP A CB  1 
ATOM   1499 C  CG  . ASP A 1 193 ? 20.627  -3.115  34.522  1.00 46.22 ? 193  ASP A CG  1 
ATOM   1500 O  OD1 . ASP A 1 193 ? 21.691  -3.753  34.724  1.00 45.72 ? 193  ASP A OD1 1 
ATOM   1501 O  OD2 . ASP A 1 193 ? 19.568  -3.661  34.113  1.00 48.99 ? 193  ASP A OD2 1 
ATOM   1502 N  N   . PRO A 1 194 ? 24.164  -1.801  34.670  1.00 44.16 ? 194  PRO A N   1 
ATOM   1503 C  CA  . PRO A 1 194 ? 25.240  -2.046  33.707  1.00 44.61 ? 194  PRO A CA  1 
ATOM   1504 C  C   . PRO A 1 194 ? 24.860  -3.080  32.652  1.00 45.88 ? 194  PRO A C   1 
ATOM   1505 O  O   . PRO A 1 194 ? 25.517  -3.203  31.626  1.00 47.13 ? 194  PRO A O   1 
ATOM   1506 C  CB  . PRO A 1 194 ? 26.414  -2.490  34.591  1.00 43.80 ? 194  PRO A CB  1 
ATOM   1507 C  CG  . PRO A 1 194 ? 25.720  -3.155  35.748  1.00 43.23 ? 194  PRO A CG  1 
ATOM   1508 C  CD  . PRO A 1 194 ? 24.538  -2.244  36.025  1.00 43.14 ? 194  PRO A CD  1 
ATOM   1509 N  N   . MET A 1 195 ? 23.786  -3.811  32.882  1.00 47.37 ? 195  MET A N   1 
ATOM   1510 C  CA  . MET A 1 195 ? 23.385  -4.813  31.904  1.00 48.38 ? 195  MET A CA  1 
ATOM   1511 C  C   . MET A 1 195 ? 22.388  -4.269  30.885  1.00 46.85 ? 195  MET A C   1 
ATOM   1512 O  O   . MET A 1 195 ? 21.852  -5.006  30.065  1.00 46.72 ? 195  MET A O   1 
ATOM   1513 C  CB  . MET A 1 195 ? 22.824  -6.045  32.619  1.00 51.96 ? 195  MET A CB  1 
ATOM   1514 C  CG  . MET A 1 195 ? 23.844  -6.703  33.562  1.00 56.06 ? 195  MET A CG  1 
ATOM   1515 S  SD  . MET A 1 195 ? 23.343  -8.352  34.141  1.00 60.55 ? 195  MET A SD  1 
ATOM   1516 C  CE  . MET A 1 195 ? 24.051  -9.337  32.859  1.00 59.88 ? 195  MET A CE  1 
ATOM   1517 N  N   . SER A 1 196 ? 22.122  -2.976  30.951  1.00 45.86 ? 196  SER A N   1 
ATOM   1518 C  CA  . SER A 1 196 ? 21.234  -2.346  29.981  1.00 45.40 ? 196  SER A CA  1 
ATOM   1519 C  C   . SER A 1 196 ? 21.816  -0.963  29.656  1.00 45.04 ? 196  SER A C   1 
ATOM   1520 O  O   . SER A 1 196 ? 21.434  0.059   30.252  1.00 42.31 ? 196  SER A O   1 
ATOM   1521 C  CB  . SER A 1 196 ? 19.842  -2.210  30.561  1.00 46.20 ? 196  SER A CB  1 
ATOM   1522 O  OG  . SER A 1 196 ? 18.958  -1.659  29.603  1.00 47.89 ? 196  SER A OG  1 
ATOM   1523 N  N   . VAL A 1 197 ? 22.762  -0.957  28.722  1.00 43.56 ? 197  VAL A N   1 
ATOM   1524 C  CA  . VAL A 1 197 ? 23.451  0.257   28.315  1.00 41.89 ? 197  VAL A CA  1 
ATOM   1525 C  C   . VAL A 1 197 ? 23.195  0.511   26.849  1.00 41.63 ? 197  VAL A C   1 
ATOM   1526 O  O   . VAL A 1 197 ? 23.480  -0.339  26.001  1.00 41.75 ? 197  VAL A O   1 
ATOM   1527 C  CB  . VAL A 1 197 ? 24.993  0.124   28.530  1.00 41.72 ? 197  VAL A CB  1 
ATOM   1528 C  CG1 . VAL A 1 197 ? 25.731  1.296   27.894  1.00 39.01 ? 197  VAL A CG1 1 
ATOM   1529 C  CG2 . VAL A 1 197 ? 25.306  0.041   30.014  1.00 41.90 ? 197  VAL A CG2 1 
ATOM   1530 N  N   . THR A 1 198 ? 22.635  1.674   26.548  1.00 41.51 ? 198  THR A N   1 
ATOM   1531 C  CA  . THR A 1 198 ? 22.378  2.069   25.163  1.00 40.03 ? 198  THR A CA  1 
ATOM   1532 C  C   . THR A 1 198 ? 23.301  3.251   24.797  1.00 39.52 ? 198  THR A C   1 
ATOM   1533 O  O   . THR A 1 198 ? 23.328  4.285   25.497  1.00 40.79 ? 198  THR A O   1 
ATOM   1534 C  CB  . THR A 1 198 ? 20.917  2.511   24.974  1.00 40.86 ? 198  THR A CB  1 
ATOM   1535 O  OG1 . THR A 1 198 ? 20.052  1.409   25.252  1.00 44.21 ? 198  THR A OG1 1 
ATOM   1536 C  CG2 . THR A 1 198 ? 20.665  2.969   23.537  1.00 40.97 ? 198  THR A CG2 1 
ATOM   1537 N  N   . LEU A 1 199 ? 24.087  3.095   23.738  1.00 37.75 ? 199  LEU A N   1 
ATOM   1538 C  CA  . LEU A 1 199 ? 24.951  4.186   23.282  1.00 38.16 ? 199  LEU A CA  1 
ATOM   1539 C  C   . LEU A 1 199 ? 24.169  4.982   22.241  1.00 37.03 ? 199  LEU A C   1 
ATOM   1540 O  O   . LEU A 1 199 ? 23.486  4.401   21.400  1.00 37.77 ? 199  LEU A O   1 
ATOM   1541 C  CB  . LEU A 1 199 ? 26.210  3.661   22.575  1.00 37.42 ? 199  LEU A CB  1 
ATOM   1542 C  CG  . LEU A 1 199 ? 27.065  2.550   23.207  1.00 36.86 ? 199  LEU A CG  1 
ATOM   1543 C  CD1 . LEU A 1 199 ? 28.203  2.217   22.272  1.00 32.84 ? 199  LEU A CD1 1 
ATOM   1544 C  CD2 . LEU A 1 199 ? 27.598  2.978   24.554  1.00 34.92 ? 199  LEU A CD2 1 
ATOM   1545 N  N   . PHE A 1 200 ? 24.225  6.303   22.320  1.00 36.37 ? 200  PHE A N   1 
ATOM   1546 C  CA  . PHE A 1 200 ? 23.609  7.106   21.282  1.00 35.27 ? 200  PHE A CA  1 
ATOM   1547 C  C   . PHE A 1 200 ? 24.530  8.294   21.014  1.00 36.14 ? 200  PHE A C   1 
ATOM   1548 O  O   . PHE A 1 200 ? 25.276  8.726   21.881  1.00 36.49 ? 200  PHE A O   1 
ATOM   1549 C  CB  . PHE A 1 200 ? 22.150  7.495   21.606  1.00 33.86 ? 200  PHE A CB  1 
ATOM   1550 C  CG  . PHE A 1 200 ? 21.972  8.559   22.666  1.00 34.55 ? 200  PHE A CG  1 
ATOM   1551 C  CD1 . PHE A 1 200 ? 22.560  8.440   23.919  1.00 34.25 ? 200  PHE A CD1 1 
ATOM   1552 C  CD2 . PHE A 1 200 ? 21.104  9.630   22.436  1.00 35.86 ? 200  PHE A CD2 1 
ATOM   1553 C  CE1 . PHE A 1 200 ? 22.282  9.369   24.937  1.00 36.26 ? 200  PHE A CE1 1 
ATOM   1554 C  CE2 . PHE A 1 200 ? 20.810  10.575  23.446  1.00 36.18 ? 200  PHE A CE2 1 
ATOM   1555 C  CZ  . PHE A 1 200 ? 21.402  10.443  24.703  1.00 36.50 ? 200  PHE A CZ  1 
ATOM   1556 N  N   . GLY A 1 201 ? 24.530  8.763   19.776  1.00 37.52 ? 201  GLY A N   1 
ATOM   1557 C  CA  . GLY A 1 201 ? 25.391  9.867   19.425  1.00 37.21 ? 201  GLY A CA  1 
ATOM   1558 C  C   . GLY A 1 201 ? 24.935  10.432  18.100  1.00 37.18 ? 201  GLY A C   1 
ATOM   1559 O  O   . GLY A 1 201 ? 24.114  9.829   17.391  1.00 35.70 ? 201  GLY A O   1 
ATOM   1560 N  N   . GLU A 1 202 ? 25.461  11.600  17.767  1.00 35.23 ? 202  GLU A N   1 
ATOM   1561 C  CA  . GLU A 1 202 ? 25.078  12.223  16.533  1.00 35.48 ? 202  GLU A CA  1 
ATOM   1562 C  C   . GLU A 1 202 ? 26.303  12.607  15.714  1.00 35.58 ? 202  GLU A C   1 
ATOM   1563 O  O   . GLU A 1 202 ? 27.337  13.005  16.244  1.00 35.29 ? 202  GLU A O   1 
ATOM   1564 C  CB  . GLU A 1 202 ? 24.187  13.424  16.837  1.00 33.15 ? 202  GLU A CB  1 
ATOM   1565 C  CG  . GLU A 1 202 ? 23.599  14.118  15.621  1.00 36.75 ? 202  GLU A CG  1 
ATOM   1566 C  CD  . GLU A 1 202 ? 24.457  15.275  15.137  1.00 38.38 ? 202  GLU A CD  1 
ATOM   1567 O  OE1 . GLU A 1 202 ? 25.402  15.649  15.882  1.00 38.68 ? 202  GLU A OE1 1 
ATOM   1568 O  OE2 . GLU A 1 202 ? 24.168  15.810  14.032  1.00 35.38 ? 202  GLU A OE2 1 
ATOM   1569 N  N   . SER A 1 203 ? 26.172  12.456  14.404  1.00 36.80 ? 203  SER A N   1 
ATOM   1570 C  CA  . SER A 1 203 ? 27.245  12.790  13.474  1.00 38.17 ? 203  SER A CA  1 
ATOM   1571 C  C   . SER A 1 203 ? 28.527  11.978  13.738  1.00 36.89 ? 203  SER A C   1 
ATOM   1572 O  O   . SER A 1 203 ? 28.501  10.755  13.600  1.00 37.67 ? 203  SER A O   1 
ATOM   1573 C  CB  . SER A 1 203 ? 27.504  14.284  13.562  1.00 38.82 ? 203  SER A CB  1 
ATOM   1574 O  OG  . SER A 1 203 ? 27.956  14.700  12.320  1.00 41.19 ? 203  SER A OG  1 
ATOM   1575 N  N   . ALA A 1 204 ? 29.634  12.624  14.118  1.00 35.49 ? 204  ALA A N   1 
ATOM   1576 C  CA  . ALA A 1 204 ? 30.873  11.872  14.398  1.00 35.55 ? 204  ALA A CA  1 
ATOM   1577 C  C   . ALA A 1 204 ? 30.609  10.957  15.616  1.00 36.72 ? 204  ALA A C   1 
ATOM   1578 O  O   . ALA A 1 204 ? 31.242  9.891   15.770  1.00 34.79 ? 204  ALA A O   1 
ATOM   1579 C  CB  . ALA A 1 204 ? 32.036  12.817  14.705  1.00 35.18 ? 204  ALA A CB  1 
ATOM   1580 N  N   . GLY A 1 205 ? 29.692  11.405  16.482  1.00 34.89 ? 205  GLY A N   1 
ATOM   1581 C  CA  . GLY A 1 205 ? 29.300  10.628  17.643  1.00 34.41 ? 205  GLY A CA  1 
ATOM   1582 C  C   . GLY A 1 205 ? 28.580  9.368   17.155  1.00 35.74 ? 205  GLY A C   1 
ATOM   1583 O  O   . GLY A 1 205 ? 28.796  8.272   17.667  1.00 34.06 ? 205  GLY A O   1 
ATOM   1584 N  N   . ALA A 1 206 ? 27.732  9.522   16.143  1.00 35.35 ? 206  ALA A N   1 
ATOM   1585 C  CA  . ALA A 1 206 ? 27.021  8.380   15.592  1.00 36.23 ? 206  ALA A CA  1 
ATOM   1586 C  C   . ALA A 1 206 ? 28.040  7.476   14.909  1.00 37.75 ? 206  ALA A C   1 
ATOM   1587 O  O   . ALA A 1 206 ? 27.988  6.255   15.035  1.00 39.89 ? 206  ALA A O   1 
ATOM   1588 C  CB  . ALA A 1 206 ? 25.941  8.843   14.582  1.00 36.20 ? 206  ALA A CB  1 
ATOM   1589 N  N   . ALA A 1 207 ? 28.978  8.066   14.189  1.00 37.65 ? 207  ALA A N   1 
ATOM   1590 C  CA  . ALA A 1 207 ? 29.977  7.258   13.532  1.00 39.66 ? 207  ALA A CA  1 
ATOM   1591 C  C   . ALA A 1 207 ? 30.716  6.471   14.615  1.00 39.78 ? 207  ALA A C   1 
ATOM   1592 O  O   . ALA A 1 207 ? 31.036  5.291   14.443  1.00 40.82 ? 207  ALA A O   1 
ATOM   1593 C  CB  . ALA A 1 207 ? 30.945  8.152   12.774  1.00 39.43 ? 207  ALA A CB  1 
ATOM   1594 N  N   . SER A 1 208 ? 30.991  7.144   15.728  1.00 39.56 ? 208  SER A N   1 
ATOM   1595 C  CA  . SER A 1 208 ? 31.698  6.521   16.851  1.00 40.22 ? 208  SER A CA  1 
ATOM   1596 C  C   . SER A 1 208 ? 30.919  5.314   17.344  1.00 39.39 ? 208  SER A C   1 
ATOM   1597 O  O   . SER A 1 208 ? 31.479  4.234   17.474  1.00 38.60 ? 208  SER A O   1 
ATOM   1598 C  CB  . SER A 1 208 ? 31.884  7.520   18.003  1.00 39.90 ? 208  SER A CB  1 
ATOM   1599 O  OG  . SER A 1 208 ? 32.807  8.538   17.641  1.00 42.46 ? 208  SER A OG  1 
ATOM   1600 N  N   . VAL A 1 209 ? 29.632  5.511   17.616  1.00 36.75 ? 209  VAL A N   1 
ATOM   1601 C  CA  . VAL A 1 209 ? 28.781  4.436   18.079  1.00 35.90 ? 209  VAL A CA  1 
ATOM   1602 C  C   . VAL A 1 209 ? 28.919  3.263   17.101  1.00 38.92 ? 209  VAL A C   1 
ATOM   1603 O  O   . VAL A 1 209 ? 29.115  2.111   17.517  1.00 39.15 ? 209  VAL A O   1 
ATOM   1604 C  CB  . VAL A 1 209 ? 27.300  4.892   18.129  1.00 35.39 ? 209  VAL A CB  1 
ATOM   1605 C  CG1 . VAL A 1 209 ? 26.375  3.694   18.238  1.00 29.48 ? 209  VAL A CG1 1 
ATOM   1606 C  CG2 . VAL A 1 209 ? 27.088  5.833   19.296  1.00 30.67 ? 209  VAL A CG2 1 
ATOM   1607 N  N   . GLY A 1 210 ? 28.835  3.562   15.801  1.00 38.47 ? 210  GLY A N   1 
ATOM   1608 C  CA  . GLY A 1 210 ? 28.953  2.524   14.789  1.00 36.64 ? 210  GLY A CA  1 
ATOM   1609 C  C   . GLY A 1 210 ? 30.294  1.814   14.873  1.00 38.46 ? 210  GLY A C   1 
ATOM   1610 O  O   . GLY A 1 210 ? 30.394  0.617   14.623  1.00 39.74 ? 210  GLY A O   1 
ATOM   1611 N  N   . MET A 1 211 ? 31.350  2.532   15.213  1.00 37.60 ? 211  MET A N   1 
ATOM   1612 C  CA  . MET A 1 211 ? 32.624  1.858   15.311  1.00 40.06 ? 211  MET A CA  1 
ATOM   1613 C  C   . MET A 1 211 ? 32.731  0.956   16.549  1.00 40.36 ? 211  MET A C   1 
ATOM   1614 O  O   . MET A 1 211 ? 33.460  -0.032  16.522  1.00 40.45 ? 211  MET A O   1 
ATOM   1615 C  CB  . MET A 1 211 ? 33.741  2.870   15.227  1.00 41.31 ? 211  MET A CB  1 
ATOM   1616 C  CG  . MET A 1 211 ? 33.919  3.251   13.755  1.00 45.94 ? 211  MET A CG  1 
ATOM   1617 S  SD  . MET A 1 211 ? 34.906  4.659   13.574  1.00 51.66 ? 211  MET A SD  1 
ATOM   1618 C  CE  . MET A 1 211 ? 34.190  5.447   12.100  1.00 48.82 ? 211  MET A CE  1 
ATOM   1619 N  N   . HIS A 1 212 ? 31.987  1.270   17.610  1.00 37.35 ? 212  HIS A N   1 
ATOM   1620 C  CA  . HIS A 1 212 ? 32.003  0.420   18.779  1.00 38.71 ? 212  HIS A CA  1 
ATOM   1621 C  C   . HIS A 1 212 ? 31.244  -0.848  18.423  1.00 40.61 ? 212  HIS A C   1 
ATOM   1622 O  O   . HIS A 1 212 ? 31.557  -1.917  18.914  1.00 42.26 ? 212  HIS A O   1 
ATOM   1623 C  CB  . HIS A 1 212 ? 31.372  1.120   19.958  1.00 35.89 ? 212  HIS A CB  1 
ATOM   1624 C  CG  . HIS A 1 212 ? 32.239  2.196   20.513  1.00 36.43 ? 212  HIS A CG  1 
ATOM   1625 N  ND1 . HIS A 1 212 ? 33.495  1.942   21.012  1.00 36.26 ? 212  HIS A ND1 1 
ATOM   1626 C  CD2 . HIS A 1 212 ? 32.051  3.533   20.622  1.00 35.44 ? 212  HIS A CD2 1 
ATOM   1627 C  CE1 . HIS A 1 212 ? 34.046  3.077   21.413  1.00 38.58 ? 212  HIS A CE1 1 
ATOM   1628 N  NE2 . HIS A 1 212 ? 33.190  4.058   21.186  1.00 37.88 ? 212  HIS A NE2 1 
ATOM   1629 N  N   . ILE A 1 213 ? 30.260  -0.729  17.541  1.00 42.01 ? 213  ILE A N   1 
ATOM   1630 C  CA  . ILE A 1 213 ? 29.511  -1.889  17.103  1.00 42.23 ? 213  ILE A CA  1 
ATOM   1631 C  C   . ILE A 1 213 ? 30.427  -2.804  16.286  1.00 45.10 ? 213  ILE A C   1 
ATOM   1632 O  O   . ILE A 1 213 ? 30.277  -4.024  16.310  1.00 46.81 ? 213  ILE A O   1 
ATOM   1633 C  CB  . ILE A 1 213 ? 28.334  -1.470  16.212  1.00 40.75 ? 213  ILE A CB  1 
ATOM   1634 C  CG1 . ILE A 1 213 ? 27.217  -0.872  17.075  1.00 39.84 ? 213  ILE A CG1 1 
ATOM   1635 C  CG2 . ILE A 1 213 ? 27.835  -2.664  15.392  1.00 39.89 ? 213  ILE A CG2 1 
ATOM   1636 C  CD1 . ILE A 1 213 ? 26.074  -0.312  16.256  1.00 37.89 ? 213  ILE A CD1 1 
ATOM   1637 N  N   . LEU A 1 214 ? 31.392  -2.215  15.583  1.00 45.61 ? 214  LEU A N   1 
ATOM   1638 C  CA  . LEU A 1 214 ? 32.283  -2.982  14.725  1.00 44.75 ? 214  LEU A CA  1 
ATOM   1639 C  C   . LEU A 1 214 ? 33.593  -3.385  15.343  1.00 44.58 ? 214  LEU A C   1 
ATOM   1640 O  O   . LEU A 1 214 ? 34.404  -4.013  14.669  1.00 44.51 ? 214  LEU A O   1 
ATOM   1641 C  CB  . LEU A 1 214 ? 32.582  -2.198  13.438  1.00 44.40 ? 214  LEU A CB  1 
ATOM   1642 C  CG  . LEU A 1 214 ? 31.348  -1.840  12.622  1.00 44.72 ? 214  LEU A CG  1 
ATOM   1643 C  CD1 . LEU A 1 214 ? 31.715  -0.879  11.505  1.00 43.91 ? 214  LEU A CD1 1 
ATOM   1644 C  CD2 . LEU A 1 214 ? 30.733  -3.113  12.087  1.00 43.31 ? 214  LEU A CD2 1 
ATOM   1645 N  N   . SER A 1 215 ? 33.829  -3.019  16.598  1.00 44.33 ? 215  SER A N   1 
ATOM   1646 C  CA  . SER A 1 215 ? 35.088  -3.373  17.249  1.00 45.63 ? 215  SER A CA  1 
ATOM   1647 C  C   . SER A 1 215 ? 34.758  -4.303  18.408  1.00 48.25 ? 215  SER A C   1 
ATOM   1648 O  O   . SER A 1 215 ? 34.201  -3.876  19.420  1.00 47.37 ? 215  SER A O   1 
ATOM   1649 C  CB  . SER A 1 215 ? 35.781  -2.117  17.768  1.00 46.80 ? 215  SER A CB  1 
ATOM   1650 O  OG  . SER A 1 215 ? 37.142  -2.354  18.084  1.00 44.76 ? 215  SER A OG  1 
ATOM   1651 N  N   . LEU A 1 216 ? 35.109  -5.579  18.252  1.00 50.98 ? 216  LEU A N   1 
ATOM   1652 C  CA  . LEU A 1 216 ? 34.809  -6.607  19.257  1.00 50.91 ? 216  LEU A CA  1 
ATOM   1653 C  C   . LEU A 1 216 ? 34.978  -6.226  20.729  1.00 48.13 ? 216  LEU A C   1 
ATOM   1654 O  O   . LEU A 1 216 ? 34.043  -6.371  21.513  1.00 47.90 ? 216  LEU A O   1 
ATOM   1655 C  CB  . LEU A 1 216 ? 35.613  -7.870  18.973  1.00 53.85 ? 216  LEU A CB  1 
ATOM   1656 C  CG  . LEU A 1 216 ? 34.892  -9.031  19.662  1.00 58.71 ? 216  LEU A CG  1 
ATOM   1657 C  CD1 . LEU A 1 216 ? 33.570  -9.302  18.920  1.00 59.14 ? 216  LEU A CD1 1 
ATOM   1658 C  CD2 . LEU A 1 216 ? 35.785  -10.276 19.669  1.00 60.55 ? 216  LEU A CD2 1 
ATOM   1659 N  N   . PRO A 1 217 ? 36.159  -5.723  21.114  1.00 46.49 ? 217  PRO A N   1 
ATOM   1660 C  CA  . PRO A 1 217 ? 36.389  -5.341  22.507  1.00 46.52 ? 217  PRO A CA  1 
ATOM   1661 C  C   . PRO A 1 217 ? 35.351  -4.353  23.075  1.00 48.40 ? 217  PRO A C   1 
ATOM   1662 O  O   . PRO A 1 217 ? 35.241  -4.204  24.298  1.00 49.12 ? 217  PRO A O   1 
ATOM   1663 C  CB  . PRO A 1 217 ? 37.806  -4.748  22.481  1.00 46.11 ? 217  PRO A CB  1 
ATOM   1664 C  CG  . PRO A 1 217 ? 38.448  -5.388  21.297  1.00 43.86 ? 217  PRO A CG  1 
ATOM   1665 C  CD  . PRO A 1 217 ? 37.339  -5.429  20.281  1.00 44.77 ? 217  PRO A CD  1 
ATOM   1666 N  N   . SER A 1 218 ? 34.607  -3.655  22.216  1.00 47.97 ? 218  SER A N   1 
ATOM   1667 C  CA  . SER A 1 218 ? 33.586  -2.721  22.724  1.00 48.32 ? 218  SER A CA  1 
ATOM   1668 C  C   . SER A 1 218 ? 32.215  -3.374  22.867  1.00 48.63 ? 218  SER A C   1 
ATOM   1669 O  O   . SER A 1 218 ? 31.373  -2.913  23.640  1.00 48.29 ? 218  SER A O   1 
ATOM   1670 C  CB  . SER A 1 218 ? 33.434  -1.490  21.813  1.00 46.83 ? 218  SER A CB  1 
ATOM   1671 O  OG  . SER A 1 218 ? 34.524  -0.597  21.949  1.00 47.29 ? 218  SER A OG  1 
ATOM   1672 N  N   . ARG A 1 219 ? 31.995  -4.450  22.122  1.00 48.98 ? 219  ARG A N   1 
ATOM   1673 C  CA  . ARG A 1 219 ? 30.705  -5.126  22.130  1.00 49.45 ? 219  ARG A CA  1 
ATOM   1674 C  C   . ARG A 1 219 ? 30.180  -5.641  23.464  1.00 49.16 ? 219  ARG A C   1 
ATOM   1675 O  O   . ARG A 1 219 ? 28.967  -5.771  23.633  1.00 49.21 ? 219  ARG A O   1 
ATOM   1676 C  CB  . ARG A 1 219 ? 30.714  -6.242  21.092  1.00 49.34 ? 219  ARG A CB  1 
ATOM   1677 C  CG  . ARG A 1 219 ? 30.666  -5.706  19.679  1.00 51.72 ? 219  ARG A CG  1 
ATOM   1678 C  CD  . ARG A 1 219 ? 29.428  -4.819  19.485  1.00 55.03 ? 219  ARG A CD  1 
ATOM   1679 N  NE  . ARG A 1 219 ? 28.167  -5.568  19.458  1.00 57.71 ? 219  ARG A NE  1 
ATOM   1680 C  CZ  . ARG A 1 219 ? 27.782  -6.374  18.464  1.00 61.15 ? 219  ARG A CZ  1 
ATOM   1681 N  NH1 . ARG A 1 219 ? 28.550  -6.560  17.385  1.00 60.41 ? 219  ARG A NH1 1 
ATOM   1682 N  NH2 . ARG A 1 219 ? 26.611  -6.995  18.544  1.00 63.16 ? 219  ARG A NH2 1 
ATOM   1683 N  N   . SER A 1 220 ? 31.078  -5.931  24.401  1.00 47.76 ? 220  SER A N   1 
ATOM   1684 C  CA  . SER A 1 220 ? 30.667  -6.396  25.716  1.00 48.32 ? 220  SER A CA  1 
ATOM   1685 C  C   . SER A 1 220 ? 30.377  -5.231  26.657  1.00 46.70 ? 220  SER A C   1 
ATOM   1686 O  O   . SER A 1 220 ? 30.026  -5.455  27.816  1.00 45.76 ? 220  SER A O   1 
ATOM   1687 C  CB  . SER A 1 220 ? 31.759  -7.265  26.349  1.00 49.90 ? 220  SER A CB  1 
ATOM   1688 O  OG  . SER A 1 220 ? 32.994  -6.565  26.409  1.00 53.86 ? 220  SER A OG  1 
ATOM   1689 N  N   . LEU A 1 221 ? 30.520  -3.996  26.173  1.00 43.89 ? 221  LEU A N   1 
ATOM   1690 C  CA  . LEU A 1 221 ? 30.285  -2.842  27.035  1.00 41.81 ? 221  LEU A CA  1 
ATOM   1691 C  C   . LEU A 1 221 ? 28.955  -2.183  26.813  1.00 41.36 ? 221  LEU A C   1 
ATOM   1692 O  O   . LEU A 1 221 ? 28.607  -1.262  27.538  1.00 42.49 ? 221  LEU A O   1 
ATOM   1693 C  CB  . LEU A 1 221 ? 31.414  -1.824  26.885  1.00 40.13 ? 221  LEU A CB  1 
ATOM   1694 C  CG  . LEU A 1 221 ? 32.788  -2.507  26.953  1.00 41.04 ? 221  LEU A CG  1 
ATOM   1695 C  CD1 . LEU A 1 221 ? 33.893  -1.516  26.623  1.00 40.15 ? 221  LEU A CD1 1 
ATOM   1696 C  CD2 . LEU A 1 221 ? 32.987  -3.105  28.357  1.00 37.18 ? 221  LEU A CD2 1 
ATOM   1697 N  N   . PHE A 1 222 ? 28.193  -2.653  25.830  1.00 40.40 ? 222  PHE A N   1 
ATOM   1698 C  CA  . PHE A 1 222 ? 26.872  -2.066  25.594  1.00 41.18 ? 222  PHE A CA  1 
ATOM   1699 C  C   . PHE A 1 222 ? 25.936  -3.055  24.949  1.00 42.17 ? 222  PHE A C   1 
ATOM   1700 O  O   . PHE A 1 222 ? 26.367  -4.057  24.431  1.00 43.52 ? 222  PHE A O   1 
ATOM   1701 C  CB  . PHE A 1 222 ? 26.954  -0.811  24.718  1.00 40.47 ? 222  PHE A CB  1 
ATOM   1702 C  CG  . PHE A 1 222 ? 27.408  -1.074  23.320  1.00 35.72 ? 222  PHE A CG  1 
ATOM   1703 C  CD1 . PHE A 1 222 ? 28.764  -1.182  23.029  1.00 37.25 ? 222  PHE A CD1 1 
ATOM   1704 C  CD2 . PHE A 1 222 ? 26.487  -1.167  22.291  1.00 38.00 ? 222  PHE A CD2 1 
ATOM   1705 C  CE1 . PHE A 1 222 ? 29.205  -1.376  21.723  1.00 37.17 ? 222  PHE A CE1 1 
ATOM   1706 C  CE2 . PHE A 1 222 ? 26.903  -1.360  20.974  1.00 38.46 ? 222  PHE A CE2 1 
ATOM   1707 C  CZ  . PHE A 1 222 ? 28.271  -1.466  20.688  1.00 38.28 ? 222  PHE A CZ  1 
ATOM   1708 N  N   . HIS A 1 223 ? 24.652  -2.739  24.931  1.00 44.62 ? 223  HIS A N   1 
ATOM   1709 C  CA  . HIS A 1 223 ? 23.680  -3.664  24.391  1.00 46.28 ? 223  HIS A CA  1 
ATOM   1710 C  C   . HIS A 1 223 ? 22.829  -3.149  23.230  1.00 47.98 ? 223  HIS A C   1 
ATOM   1711 O  O   . HIS A 1 223 ? 22.354  -3.932  22.409  1.00 50.81 ? 223  HIS A O   1 
ATOM   1712 C  CB  . HIS A 1 223 ? 22.773  -4.107  25.543  1.00 47.23 ? 223  HIS A CB  1 
ATOM   1713 C  CG  . HIS A 1 223 ? 23.524  -4.463  26.789  1.00 49.10 ? 223  HIS A CG  1 
ATOM   1714 N  ND1 . HIS A 1 223 ? 23.937  -3.516  27.707  1.00 49.05 ? 223  HIS A ND1 1 
ATOM   1715 C  CD2 . HIS A 1 223 ? 23.990  -5.655  27.239  1.00 49.21 ? 223  HIS A CD2 1 
ATOM   1716 C  CE1 . HIS A 1 223 ? 24.626  -4.110  28.665  1.00 49.01 ? 223  HIS A CE1 1 
ATOM   1717 N  NE2 . HIS A 1 223 ? 24.671  -5.407  28.407  1.00 49.26 ? 223  HIS A NE2 1 
ATOM   1718 N  N   . ARG A 1 224 ? 22.627  -1.839  23.165  1.00 47.90 ? 224  ARG A N   1 
ATOM   1719 C  CA  . ARG A 1 224 ? 21.814  -1.242  22.115  1.00 47.96 ? 224  ARG A CA  1 
ATOM   1720 C  C   . ARG A 1 224 ? 22.483  0.035   21.593  1.00 46.64 ? 224  ARG A C   1 
ATOM   1721 O  O   . ARG A 1 224 ? 23.340  0.621   22.261  1.00 45.54 ? 224  ARG A O   1 
ATOM   1722 C  CB  . ARG A 1 224 ? 20.419  -0.951  22.669  1.00 51.01 ? 224  ARG A CB  1 
ATOM   1723 C  CG  . ARG A 1 224 ? 19.569  -2.191  22.744  1.00 56.27 ? 224  ARG A CG  1 
ATOM   1724 C  CD  . ARG A 1 224 ? 18.173  -1.928  23.320  1.00 60.39 ? 224  ARG A CD  1 
ATOM   1725 N  NE  . ARG A 1 224 ? 18.195  -1.918  24.772  1.00 63.50 ? 224  ARG A NE  1 
ATOM   1726 C  CZ  . ARG A 1 224 ? 18.637  -2.929  25.516  1.00 65.06 ? 224  ARG A CZ  1 
ATOM   1727 N  NH1 . ARG A 1 224 ? 19.088  -4.041  24.942  1.00 66.31 ? 224  ARG A NH1 1 
ATOM   1728 N  NH2 . ARG A 1 224 ? 18.655  -2.816  26.836  1.00 65.62 ? 224  ARG A NH2 1 
ATOM   1729 N  N   . ALA A 1 225 ? 22.101  0.468   20.399  1.00 43.82 ? 225  ALA A N   1 
ATOM   1730 C  CA  . ALA A 1 225 ? 22.735  1.634   19.842  1.00 42.53 ? 225  ALA A CA  1 
ATOM   1731 C  C   . ALA A 1 225 ? 21.824  2.477   18.974  1.00 42.55 ? 225  ALA A C   1 
ATOM   1732 O  O   . ALA A 1 225 ? 20.934  1.958   18.285  1.00 40.30 ? 225  ALA A O   1 
ATOM   1733 C  CB  . ALA A 1 225 ? 23.958  1.213   19.053  1.00 42.63 ? 225  ALA A CB  1 
ATOM   1734 N  N   . VAL A 1 226 ? 22.074  3.789   19.037  1.00 41.07 ? 226  VAL A N   1 
ATOM   1735 C  CA  . VAL A 1 226 ? 21.359  4.791   18.270  1.00 39.62 ? 226  VAL A CA  1 
ATOM   1736 C  C   . VAL A 1 226 ? 22.388  5.628   17.502  1.00 40.33 ? 226  VAL A C   1 
ATOM   1737 O  O   . VAL A 1 226 ? 23.332  6.159   18.085  1.00 40.50 ? 226  VAL A O   1 
ATOM   1738 C  CB  . VAL A 1 226 ? 20.591  5.709   19.177  1.00 38.89 ? 226  VAL A CB  1 
ATOM   1739 C  CG1 . VAL A 1 226 ? 19.799  6.689   18.352  1.00 36.38 ? 226  VAL A CG1 1 
ATOM   1740 C  CG2 . VAL A 1 226 ? 19.691  4.878   20.089  1.00 38.66 ? 226  VAL A CG2 1 
ATOM   1741 N  N   . LEU A 1 227 ? 22.205  5.726   16.193  1.00 39.19 ? 227  LEU A N   1 
ATOM   1742 C  CA  . LEU A 1 227 ? 23.087  6.498   15.340  1.00 38.33 ? 227  LEU A CA  1 
ATOM   1743 C  C   . LEU A 1 227 ? 22.266  7.592   14.685  1.00 38.14 ? 227  LEU A C   1 
ATOM   1744 O  O   . LEU A 1 227 ? 21.444  7.316   13.810  1.00 38.48 ? 227  LEU A O   1 
ATOM   1745 C  CB  . LEU A 1 227 ? 23.687  5.611   14.256  1.00 38.24 ? 227  LEU A CB  1 
ATOM   1746 C  CG  . LEU A 1 227 ? 24.643  4.504   14.726  1.00 40.37 ? 227  LEU A CG  1 
ATOM   1747 C  CD1 . LEU A 1 227 ? 23.867  3.339   15.325  1.00 39.00 ? 227  LEU A CD1 1 
ATOM   1748 C  CD2 . LEU A 1 227 ? 25.476  4.027   13.536  1.00 39.56 ? 227  LEU A CD2 1 
ATOM   1749 N  N   . GLN A 1 228 ? 22.485  8.833   15.104  1.00 37.39 ? 228  GLN A N   1 
ATOM   1750 C  CA  . GLN A 1 228 ? 21.752  9.967   14.537  1.00 36.57 ? 228  GLN A CA  1 
ATOM   1751 C  C   . GLN A 1 228 ? 22.619  10.725  13.506  1.00 36.60 ? 228  GLN A C   1 
ATOM   1752 O  O   . GLN A 1 228 ? 23.652  11.292  13.856  1.00 37.84 ? 228  GLN A O   1 
ATOM   1753 C  CB  . GLN A 1 228 ? 21.340  10.929  15.662  1.00 34.40 ? 228  GLN A CB  1 
ATOM   1754 C  CG  . GLN A 1 228 ? 20.747  10.255  16.870  1.00 37.07 ? 228  GLN A CG  1 
ATOM   1755 C  CD  . GLN A 1 228 ? 20.329  11.220  17.964  1.00 39.91 ? 228  GLN A CD  1 
ATOM   1756 O  OE1 . GLN A 1 228 ? 19.996  10.803  19.078  1.00 39.37 ? 228  GLN A OE1 1 
ATOM   1757 N  NE2 . GLN A 1 228 ? 20.340  12.515  17.659  1.00 40.71 ? 228  GLN A NE2 1 
ATOM   1758 N  N   . SER A 1 229 ? 22.203  10.722  12.243  1.00 36.61 ? 229  SER A N   1 
ATOM   1759 C  CA  . SER A 1 229 ? 22.915  11.453  11.197  1.00 34.29 ? 229  SER A CA  1 
ATOM   1760 C  C   . SER A 1 229 ? 24.415  11.146  11.136  1.00 34.24 ? 229  SER A C   1 
ATOM   1761 O  O   . SER A 1 229 ? 25.248  12.061  11.110  1.00 33.79 ? 229  SER A O   1 
ATOM   1762 C  CB  . SER A 1 229 ? 22.727  12.962  11.403  1.00 33.12 ? 229  SER A CB  1 
ATOM   1763 O  OG  . SER A 1 229 ? 21.368  13.298  11.543  1.00 32.37 ? 229  SER A OG  1 
ATOM   1764 N  N   . GLY A 1 230 ? 24.763  9.868   11.101  1.00 32.93 ? 230  GLY A N   1 
ATOM   1765 C  CA  . GLY A 1 230 ? 26.164  9.503   11.059  1.00 33.97 ? 230  GLY A CA  1 
ATOM   1766 C  C   . GLY A 1 230 ? 26.325  8.000   11.011  1.00 36.11 ? 230  GLY A C   1 
ATOM   1767 O  O   . GLY A 1 230 ? 25.464  7.244   11.495  1.00 36.36 ? 230  GLY A O   1 
ATOM   1768 N  N   . THR A 1 231 ? 27.444  7.558   10.450  1.00 35.32 ? 231  THR A N   1 
ATOM   1769 C  CA  . THR A 1 231 ? 27.701  6.141   10.298  1.00 35.36 ? 231  THR A CA  1 
ATOM   1770 C  C   . THR A 1 231 ? 29.189  5.888   10.237  1.00 36.47 ? 231  THR A C   1 
ATOM   1771 O  O   . THR A 1 231 ? 29.948  6.773   9.854   1.00 38.41 ? 231  THR A O   1 
ATOM   1772 C  CB  . THR A 1 231 ? 27.068  5.613   8.981   1.00 34.38 ? 231  THR A CB  1 
ATOM   1773 O  OG1 . THR A 1 231 ? 27.676  6.262   7.863   1.00 34.81 ? 231  THR A OG1 1 
ATOM   1774 C  CG2 . THR A 1 231 ? 25.582  5.908   8.933   1.00 32.48 ? 231  THR A CG2 1 
ATOM   1775 N  N   . PRO A 1 232 ? 29.633  4.673   10.614  1.00 36.79 ? 232  PRO A N   1 
ATOM   1776 C  CA  . PRO A 1 232 ? 31.073  4.366   10.569  1.00 35.69 ? 232  PRO A CA  1 
ATOM   1777 C  C   . PRO A 1 232 ? 31.520  4.201   9.108   1.00 37.67 ? 232  PRO A C   1 
ATOM   1778 O  O   . PRO A 1 232 ? 32.654  4.486   8.761   1.00 38.23 ? 232  PRO A O   1 
ATOM   1779 C  CB  . PRO A 1 232 ? 31.185  3.093   11.421  1.00 35.37 ? 232  PRO A CB  1 
ATOM   1780 C  CG  . PRO A 1 232 ? 29.865  2.412   11.217  1.00 34.04 ? 232  PRO A CG  1 
ATOM   1781 C  CD  . PRO A 1 232 ? 28.846  3.551   11.163  1.00 34.89 ? 232  PRO A CD  1 
ATOM   1782 N  N   . ASN A 1 233 ? 30.611  3.742   8.246   1.00 39.89 ? 233  ASN A N   1 
ATOM   1783 C  CA  . ASN A 1 233 ? 30.902  3.626   6.821   1.00 40.67 ? 233  ASN A CA  1 
ATOM   1784 C  C   . ASN A 1 233 ? 30.652  5.033   6.253   1.00 42.38 ? 233  ASN A C   1 
ATOM   1785 O  O   . ASN A 1 233 ? 30.150  5.924   6.970   1.00 39.75 ? 233  ASN A O   1 
ATOM   1786 C  CB  . ASN A 1 233 ? 29.951  2.638   6.148   1.00 40.60 ? 233  ASN A CB  1 
ATOM   1787 C  CG  . ASN A 1 233 ? 28.513  2.926   6.459   1.00 41.71 ? 233  ASN A CG  1 
ATOM   1788 O  OD1 . ASN A 1 233 ? 28.124  2.932   7.627   1.00 41.55 ? 233  ASN A OD1 1 
ATOM   1789 N  ND2 . ASN A 1 233 ? 27.704  3.166   5.424   1.00 42.26 ? 233  ASN A ND2 1 
ATOM   1790 N  N   . GLY A 1 234 ? 30.970  5.236   4.973   1.00 41.16 ? 234  GLY A N   1 
ATOM   1791 C  CA  . GLY A 1 234 ? 30.781  6.556   4.398   1.00 42.13 ? 234  GLY A CA  1 
ATOM   1792 C  C   . GLY A 1 234 ? 32.114  7.198   4.044   1.00 43.19 ? 234  GLY A C   1 
ATOM   1793 O  O   . GLY A 1 234 ? 33.155  6.743   4.506   1.00 45.66 ? 234  GLY A O   1 
ATOM   1794 N  N   . PRO A 1 235 ? 32.112  8.310   3.296   1.00 43.81 ? 235  PRO A N   1 
ATOM   1795 C  CA  . PRO A 1 235 ? 33.328  9.011   2.859   1.00 42.78 ? 235  PRO A CA  1 
ATOM   1796 C  C   . PRO A 1 235 ? 34.147  9.865   3.807   1.00 41.22 ? 235  PRO A C   1 
ATOM   1797 O  O   . PRO A 1 235 ? 35.258  10.253  3.469   1.00 43.66 ? 235  PRO A O   1 
ATOM   1798 C  CB  . PRO A 1 235 ? 32.823  9.828   1.676   1.00 43.00 ? 235  PRO A CB  1 
ATOM   1799 C  CG  . PRO A 1 235 ? 31.473  10.289  2.182   1.00 44.52 ? 235  PRO A CG  1 
ATOM   1800 C  CD  . PRO A 1 235 ? 30.900  9.065   2.915   1.00 42.92 ? 235  PRO A CD  1 
ATOM   1801 N  N   . TRP A 1 236 ? 33.641  10.148  4.991   1.00 40.21 ? 236  TRP A N   1 
ATOM   1802 C  CA  . TRP A 1 236 ? 34.362  11.020  5.917   1.00 38.06 ? 236  TRP A CA  1 
ATOM   1803 C  C   . TRP A 1 236 ? 34.761  10.467  7.291   1.00 39.35 ? 236  TRP A C   1 
ATOM   1804 O  O   . TRP A 1 236 ? 35.670  10.998  7.916   1.00 38.98 ? 236  TRP A O   1 
ATOM   1805 C  CB  . TRP A 1 236 ? 33.528  12.283  6.167   1.00 36.10 ? 236  TRP A CB  1 
ATOM   1806 C  CG  . TRP A 1 236 ? 32.144  11.971  6.732   1.00 35.52 ? 236  TRP A CG  1 
ATOM   1807 C  CD1 . TRP A 1 236 ? 30.983  11.753  6.019   1.00 33.68 ? 236  TRP A CD1 1 
ATOM   1808 C  CD2 . TRP A 1 236 ? 31.799  11.789  8.112   1.00 33.85 ? 236  TRP A CD2 1 
ATOM   1809 N  NE1 . TRP A 1 236 ? 29.954  11.454  6.873   1.00 32.37 ? 236  TRP A NE1 1 
ATOM   1810 C  CE2 . TRP A 1 236 ? 30.423  11.466  8.160   1.00 33.79 ? 236  TRP A CE2 1 
ATOM   1811 C  CE3 . TRP A 1 236 ? 32.521  11.869  9.313   1.00 34.98 ? 236  TRP A CE3 1 
ATOM   1812 C  CZ2 . TRP A 1 236 ? 29.752  11.221  9.368   1.00 35.39 ? 236  TRP A CZ2 1 
ATOM   1813 C  CZ3 . TRP A 1 236 ? 31.862  11.632  10.511  1.00 32.73 ? 236  TRP A CZ3 1 
ATOM   1814 C  CH2 . TRP A 1 236 ? 30.484  11.307  10.529  1.00 34.77 ? 236  TRP A CH2 1 
ATOM   1815 N  N   . ALA A 1 237 ? 34.068  9.440   7.781   1.00 39.96 ? 237  ALA A N   1 
ATOM   1816 C  CA  . ALA A 1 237 ? 34.354  8.906   9.124   1.00 40.29 ? 237  ALA A CA  1 
ATOM   1817 C  C   . ALA A 1 237 ? 35.692  8.160   9.337   1.00 41.45 ? 237  ALA A C   1 
ATOM   1818 O  O   . ALA A 1 237 ? 36.139  8.005   10.485  1.00 40.02 ? 237  ALA A O   1 
ATOM   1819 C  CB  . ALA A 1 237 ? 33.185  8.026   9.590   1.00 39.84 ? 237  ALA A CB  1 
ATOM   1820 N  N   . THR A 1 238 ? 36.321  7.674   8.267   1.00 39.98 ? 238  THR A N   1 
ATOM   1821 C  CA  . THR A 1 238 ? 37.614  7.005   8.417   1.00 41.51 ? 238  THR A CA  1 
ATOM   1822 C  C   . THR A 1 238 ? 38.556  7.375   7.270   1.00 43.29 ? 238  THR A C   1 
ATOM   1823 O  O   . THR A 1 238 ? 38.152  7.993   6.283   1.00 42.35 ? 238  THR A O   1 
ATOM   1824 C  CB  . THR A 1 238 ? 37.493  5.436   8.414   1.00 40.88 ? 238  THR A CB  1 
ATOM   1825 O  OG1 . THR A 1 238 ? 36.864  5.005   7.203   1.00 43.31 ? 238  THR A OG1 1 
ATOM   1826 C  CG2 . THR A 1 238 ? 36.667  4.939   9.593   1.00 39.99 ? 238  THR A CG2 1 
ATOM   1827 N  N   . VAL A 1 239 ? 39.821  7.002   7.430   1.00 44.55 ? 239  VAL A N   1 
ATOM   1828 C  CA  . VAL A 1 239 ? 40.839  7.184   6.404   1.00 43.98 ? 239  VAL A CA  1 
ATOM   1829 C  C   . VAL A 1 239 ? 41.653  5.890   6.467   1.00 46.26 ? 239  VAL A C   1 
ATOM   1830 O  O   . VAL A 1 239 ? 41.617  5.163   7.479   1.00 45.46 ? 239  VAL A O   1 
ATOM   1831 C  CB  . VAL A 1 239 ? 41.787  8.380   6.683   1.00 44.06 ? 239  VAL A CB  1 
ATOM   1832 C  CG1 . VAL A 1 239 ? 41.081  9.714   6.348   1.00 43.04 ? 239  VAL A CG1 1 
ATOM   1833 C  CG2 . VAL A 1 239 ? 42.269  8.343   8.135   1.00 39.29 ? 239  VAL A CG2 1 
ATOM   1834 N  N   . SER A 1 240 ? 42.371  5.609   5.382   1.00 45.65 ? 240  SER A N   1 
ATOM   1835 C  CA  . SER A 1 240 ? 43.218  4.431   5.274   1.00 44.92 ? 240  SER A CA  1 
ATOM   1836 C  C   . SER A 1 240 ? 44.467  4.733   6.077   1.00 44.75 ? 240  SER A C   1 
ATOM   1837 O  O   . SER A 1 240 ? 44.760  5.901   6.348   1.00 45.39 ? 240  SER A O   1 
ATOM   1838 C  CB  . SER A 1 240 ? 43.612  4.215   3.806   1.00 44.03 ? 240  SER A CB  1 
ATOM   1839 O  OG  . SER A 1 240 ? 44.464  5.274   3.384   1.00 43.53 ? 240  SER A OG  1 
ATOM   1840 N  N   . ALA A 1 241 ? 45.216  3.695   6.439   1.00 46.19 ? 241  ALA A N   1 
ATOM   1841 C  CA  . ALA A 1 241 ? 46.446  3.890   7.199   1.00 46.40 ? 241  ALA A CA  1 
ATOM   1842 C  C   . ALA A 1 241 ? 47.385  4.779   6.382   1.00 45.48 ? 241  ALA A C   1 
ATOM   1843 O  O   . ALA A 1 241 ? 48.021  5.680   6.906   1.00 44.50 ? 241  ALA A O   1 
ATOM   1844 C  CB  . ALA A 1 241 ? 47.096  2.548   7.481   1.00 47.26 ? 241  ALA A CB  1 
ATOM   1845 N  N   . GLY A 1 242 ? 47.458  4.522   5.084   1.00 47.16 ? 242  GLY A N   1 
ATOM   1846 C  CA  . GLY A 1 242 ? 48.322  5.327   4.240   1.00 48.11 ? 242  GLY A CA  1 
ATOM   1847 C  C   . GLY A 1 242 ? 47.980  6.805   4.288   1.00 48.84 ? 242  GLY A C   1 
ATOM   1848 O  O   . GLY A 1 242 ? 48.866  7.662   4.435   1.00 49.34 ? 242  GLY A O   1 
ATOM   1849 N  N   . GLU A 1 243 ? 46.690  7.115   4.188   1.00 48.48 ? 243  GLU A N   1 
ATOM   1850 C  CA  . GLU A 1 243 ? 46.264  8.510   4.194   1.00 47.18 ? 243  GLU A CA  1 
ATOM   1851 C  C   . GLU A 1 243 ? 46.531  9.182   5.540   1.00 45.86 ? 243  GLU A C   1 
ATOM   1852 O  O   . GLU A 1 243 ? 46.949  10.357  5.603   1.00 43.70 ? 243  GLU A O   1 
ATOM   1853 C  CB  . GLU A 1 243 ? 44.774  8.602   3.781   1.00 47.48 ? 243  GLU A CB  1 
ATOM   1854 C  CG  . GLU A 1 243 ? 44.169  10.014  3.806   1.00 46.99 ? 243  GLU A CG  1 
ATOM   1855 C  CD  . GLU A 1 243 ? 44.812  11.017  2.827   1.00 47.78 ? 243  GLU A CD  1 
ATOM   1856 O  OE1 . GLU A 1 243 ? 44.502  12.218  2.947   1.00 46.78 ? 243  GLU A OE1 1 
ATOM   1857 O  OE2 . GLU A 1 243 ? 45.609  10.629  1.945   1.00 47.74 ? 243  GLU A OE2 1 
ATOM   1858 N  N   . ALA A 1 244 ? 46.320  8.444   6.625   1.00 45.27 ? 244  ALA A N   1 
ATOM   1859 C  CA  . ALA A 1 244 ? 46.563  9.020   7.947   1.00 44.94 ? 244  ALA A CA  1 
ATOM   1860 C  C   . ALA A 1 244 ? 48.066  9.317   8.098   1.00 46.50 ? 244  ALA A C   1 
ATOM   1861 O  O   . ALA A 1 244 ? 48.462  10.366  8.619   1.00 46.99 ? 244  ALA A O   1 
ATOM   1862 C  CB  . ALA A 1 244 ? 46.082  8.071   9.026   1.00 42.33 ? 244  ALA A CB  1 
ATOM   1863 N  N   . ARG A 1 245 ? 48.904  8.399   7.622   1.00 47.79 ? 245  ARG A N   1 
ATOM   1864 C  CA  . ARG A 1 245 ? 50.354  8.581   7.685   1.00 49.93 ? 245  ARG A CA  1 
ATOM   1865 C  C   . ARG A 1 245 ? 50.721  9.854   6.927   1.00 49.13 ? 245  ARG A C   1 
ATOM   1866 O  O   . ARG A 1 245 ? 51.438  10.730  7.419   1.00 49.48 ? 245  ARG A O   1 
ATOM   1867 C  CB  . ARG A 1 245 ? 51.074  7.381   7.045   1.00 51.77 ? 245  ARG A CB  1 
ATOM   1868 C  CG  . ARG A 1 245 ? 52.611  7.527   6.964   1.00 52.68 ? 245  ARG A CG  1 
ATOM   1869 C  CD  . ARG A 1 245 ? 53.281  6.154   6.777   1.00 53.44 ? 245  ARG A CD  1 
ATOM   1870 N  NE  . ARG A 1 245 ? 53.267  5.344   8.004   1.00 52.70 ? 245  ARG A NE  1 
ATOM   1871 C  CZ  . ARG A 1 245 ? 54.045  5.580   9.056   1.00 53.21 ? 245  ARG A CZ  1 
ATOM   1872 N  NH1 . ARG A 1 245 ? 54.905  6.586   9.047   1.00 54.77 ? 245  ARG A NH1 1 
ATOM   1873 N  NH2 . ARG A 1 245 ? 53.951  4.826   10.134  1.00 55.00 ? 245  ARG A NH2 1 
ATOM   1874 N  N   . ARG A 1 246 ? 50.205  9.953   5.719   1.00 47.78 ? 246  ARG A N   1 
ATOM   1875 C  CA  . ARG A 1 246 ? 50.480  11.122  4.920   1.00 48.79 ? 246  ARG A CA  1 
ATOM   1876 C  C   . ARG A 1 246 ? 50.121  12.428  5.663   1.00 48.93 ? 246  ARG A C   1 
ATOM   1877 O  O   . ARG A 1 246 ? 50.954  13.352  5.780   1.00 48.40 ? 246  ARG A O   1 
ATOM   1878 C  CB  . ARG A 1 246 ? 49.697  11.026  3.618   1.00 50.04 ? 246  ARG A CB  1 
ATOM   1879 C  CG  . ARG A 1 246 ? 50.112  12.038  2.590   1.00 53.36 ? 246  ARG A CG  1 
ATOM   1880 C  CD  . ARG A 1 246 ? 48.929  12.370  1.695   1.00 55.32 ? 246  ARG A CD  1 
ATOM   1881 N  NE  . ARG A 1 246 ? 48.641  13.793  1.813   1.00 58.52 ? 246  ARG A NE  1 
ATOM   1882 C  CZ  . ARG A 1 246 ? 47.454  14.291  2.120   1.00 58.65 ? 246  ARG A CZ  1 
ATOM   1883 N  NH1 . ARG A 1 246 ? 46.424  13.491  2.338   1.00 60.96 ? 246  ARG A NH1 1 
ATOM   1884 N  NH2 . ARG A 1 246 ? 47.308  15.590  2.236   1.00 60.31 ? 246  ARG A NH2 1 
ATOM   1885 N  N   . ARG A 1 247 ? 48.890  12.504  6.172   1.00 46.62 ? 247  ARG A N   1 
ATOM   1886 C  CA  . ARG A 1 247 ? 48.451  13.711  6.868   1.00 45.91 ? 247  ARG A CA  1 
ATOM   1887 C  C   . ARG A 1 247 ? 49.280  14.021  8.091   1.00 45.89 ? 247  ARG A C   1 
ATOM   1888 O  O   . ARG A 1 247 ? 49.613  15.193  8.356   1.00 44.43 ? 247  ARG A O   1 
ATOM   1889 C  CB  . ARG A 1 247 ? 46.967  13.606  7.265   1.00 45.15 ? 247  ARG A CB  1 
ATOM   1890 C  CG  . ARG A 1 247 ? 46.022  13.486  6.057   1.00 43.23 ? 247  ARG A CG  1 
ATOM   1891 C  CD  . ARG A 1 247 ? 44.580  13.349  6.493   1.00 40.85 ? 247  ARG A CD  1 
ATOM   1892 N  NE  . ARG A 1 247 ? 43.681  13.075  5.377   1.00 40.60 ? 247  ARG A NE  1 
ATOM   1893 C  CZ  . ARG A 1 247 ? 42.346  13.122  5.441   1.00 41.03 ? 247  ARG A CZ  1 
ATOM   1894 N  NH1 . ARG A 1 247 ? 41.730  13.436  6.584   1.00 39.87 ? 247  ARG A NH1 1 
ATOM   1895 N  NH2 . ARG A 1 247 ? 41.618  12.850  4.363   1.00 35.83 ? 247  ARG A NH2 1 
ATOM   1896 N  N   . ALA A 1 248 ? 49.620  12.982  8.849   1.00 46.53 ? 248  ALA A N   1 
ATOM   1897 C  CA  . ALA A 1 248 ? 50.395  13.198  10.056  1.00 45.01 ? 248  ALA A CA  1 
ATOM   1898 C  C   . ALA A 1 248 ? 51.787  13.705  9.726   1.00 46.26 ? 248  ALA A C   1 
ATOM   1899 O  O   . ALA A 1 248 ? 52.270  14.658  10.353  1.00 44.04 ? 248  ALA A O   1 
ATOM   1900 C  CB  . ALA A 1 248 ? 50.480  11.935  10.860  1.00 45.81 ? 248  ALA A CB  1 
ATOM   1901 N  N   . THR A 1 249 ? 52.448  13.099  8.736   1.00 46.77 ? 249  THR A N   1 
ATOM   1902 C  CA  . THR A 1 249 ? 53.790  13.589  8.460   1.00 48.35 ? 249  THR A CA  1 
ATOM   1903 C  C   . THR A 1 249 ? 53.735  14.990  7.848   1.00 47.46 ? 249  THR A C   1 
ATOM   1904 O  O   . THR A 1 249 ? 54.599  15.821  8.138   1.00 47.04 ? 249  THR A O   1 
ATOM   1905 C  CB  . THR A 1 249 ? 54.641  12.590  7.612   1.00 48.33 ? 249  THR A CB  1 
ATOM   1906 O  OG1 . THR A 1 249 ? 54.754  13.046  6.266   1.00 52.15 ? 249  THR A OG1 1 
ATOM   1907 C  CG2 . THR A 1 249 ? 54.033  11.227  7.636   1.00 47.05 ? 249  THR A CG2 1 
ATOM   1908 N  N   . LEU A 1 250 ? 52.702  15.272  7.046   1.00 47.66 ? 250  LEU A N   1 
ATOM   1909 C  CA  . LEU A 1 250 ? 52.570  16.607  6.468   1.00 46.33 ? 250  LEU A CA  1 
ATOM   1910 C  C   . LEU A 1 250 ? 52.382  17.614  7.588   1.00 46.65 ? 250  LEU A C   1 
ATOM   1911 O  O   . LEU A 1 250 ? 52.993  18.695  7.575   1.00 47.86 ? 250  LEU A O   1 
ATOM   1912 C  CB  . LEU A 1 250 ? 51.376  16.707  5.507   1.00 46.53 ? 250  LEU A CB  1 
ATOM   1913 C  CG  . LEU A 1 250 ? 51.129  18.144  4.966   1.00 48.68 ? 250  LEU A CG  1 
ATOM   1914 C  CD1 . LEU A 1 250 ? 52.443  18.753  4.376   1.00 44.42 ? 250  LEU A CD1 1 
ATOM   1915 C  CD2 . LEU A 1 250 ? 50.048  18.122  3.888   1.00 44.55 ? 250  LEU A CD2 1 
ATOM   1916 N  N   . LEU A 1 251 ? 51.541  17.275  8.565   1.00 45.26 ? 251  LEU A N   1 
ATOM   1917 C  CA  . LEU A 1 251 ? 51.317  18.201  9.674   1.00 45.55 ? 251  LEU A CA  1 
ATOM   1918 C  C   . LEU A 1 251 ? 52.618  18.400  10.441  1.00 45.47 ? 251  LEU A C   1 
ATOM   1919 O  O   . LEU A 1 251 ? 52.906  19.491  10.925  1.00 43.86 ? 251  LEU A O   1 
ATOM   1920 C  CB  . LEU A 1 251 ? 50.229  17.682  10.641  1.00 45.90 ? 251  LEU A CB  1 
ATOM   1921 C  CG  . LEU A 1 251 ? 50.122  18.668  11.817  1.00 45.58 ? 251  LEU A CG  1 
ATOM   1922 C  CD1 . LEU A 1 251 ? 48.928  19.562  11.636  1.00 46.54 ? 251  LEU A CD1 1 
ATOM   1923 C  CD2 . LEU A 1 251 ? 50.062  17.947  13.112  1.00 45.70 ? 251  LEU A CD2 1 
ATOM   1924 N  N   . ALA A 1 252 ? 53.386  17.325  10.576  1.00 47.12 ? 252  ALA A N   1 
ATOM   1925 C  CA  . ALA A 1 252 ? 54.668  17.383  11.270  1.00 49.29 ? 252  ALA A CA  1 
ATOM   1926 C  C   . ALA A 1 252 ? 55.553  18.404  10.542  1.00 49.12 ? 252  ALA A C   1 
ATOM   1927 O  O   . ALA A 1 252 ? 56.129  19.300  11.164  1.00 47.56 ? 252  ALA A O   1 
ATOM   1928 C  CB  . ALA A 1 252 ? 55.330  15.996  11.270  1.00 49.61 ? 252  ALA A CB  1 
ATOM   1929 N  N   . ARG A 1 253 ? 55.656  18.280  9.221   1.00 50.71 ? 253  ARG A N   1 
ATOM   1930 C  CA  . ARG A 1 253 ? 56.470  19.245  8.477   1.00 53.24 ? 253  ARG A CA  1 
ATOM   1931 C  C   . ARG A 1 253 ? 55.967  20.672  8.731   1.00 53.77 ? 253  ARG A C   1 
ATOM   1932 O  O   . ARG A 1 253 ? 56.756  21.563  9.058   1.00 54.43 ? 253  ARG A O   1 
ATOM   1933 C  CB  . ARG A 1 253 ? 56.472  18.963  6.969   1.00 53.04 ? 253  ARG A CB  1 
ATOM   1934 C  CG  . ARG A 1 253 ? 57.176  17.686  6.579   1.00 58.18 ? 253  ARG A CG  1 
ATOM   1935 C  CD  . ARG A 1 253 ? 57.755  17.728  5.156   1.00 63.90 ? 253  ARG A CD  1 
ATOM   1936 N  NE  . ARG A 1 253 ? 56.750  18.079  4.144   1.00 71.21 ? 253  ARG A NE  1 
ATOM   1937 C  CZ  . ARG A 1 253 ? 56.601  19.289  3.589   1.00 74.03 ? 253  ARG A CZ  1 
ATOM   1938 N  NH1 . ARG A 1 253 ? 55.642  19.498  2.682   1.00 73.53 ? 253  ARG A NH1 1 
ATOM   1939 N  NH2 . ARG A 1 253 ? 57.419  20.288  3.924   1.00 75.35 ? 253  ARG A NH2 1 
ATOM   1940 N  N   . LEU A 1 254 ? 54.657  20.886  8.620   1.00 53.54 ? 254  LEU A N   1 
ATOM   1941 C  CA  . LEU A 1 254 ? 54.099  22.219  8.825   1.00 52.82 ? 254  LEU A CA  1 
ATOM   1942 C  C   . LEU A 1 254 ? 54.465  22.886  10.131  1.00 54.80 ? 254  LEU A C   1 
ATOM   1943 O  O   . LEU A 1 254 ? 54.480  24.112  10.207  1.00 54.86 ? 254  LEU A O   1 
ATOM   1944 C  CB  . LEU A 1 254 ? 52.584  22.190  8.687   1.00 50.33 ? 254  LEU A CB  1 
ATOM   1945 C  CG  . LEU A 1 254 ? 52.153  21.832  7.273   1.00 50.38 ? 254  LEU A CG  1 
ATOM   1946 C  CD1 . LEU A 1 254 ? 50.647  21.747  7.204   1.00 48.16 ? 254  LEU A CD1 1 
ATOM   1947 C  CD2 . LEU A 1 254 ? 52.696  22.893  6.307   1.00 47.50 ? 254  LEU A CD2 1 
ATOM   1948 N  N   . VAL A 1 255 ? 54.756  22.110  11.169  1.00 56.41 ? 255  VAL A N   1 
ATOM   1949 C  CA  . VAL A 1 255 ? 55.124  22.740  12.436  1.00 59.02 ? 255  VAL A CA  1 
ATOM   1950 C  C   . VAL A 1 255 ? 56.617  22.635  12.785  1.00 61.53 ? 255  VAL A C   1 
ATOM   1951 O  O   . VAL A 1 255 ? 57.025  22.924  13.914  1.00 62.14 ? 255  VAL A O   1 
ATOM   1952 C  CB  . VAL A 1 255 ? 54.277  22.187  13.623  1.00 58.20 ? 255  VAL A CB  1 
ATOM   1953 C  CG1 . VAL A 1 255 ? 52.827  22.573  13.430  1.00 55.79 ? 255  VAL A CG1 1 
ATOM   1954 C  CG2 . VAL A 1 255 ? 54.426  20.667  13.741  1.00 55.83 ? 255  VAL A CG2 1 
ATOM   1955 N  N   . GLY A 1 256 ? 57.421  22.231  11.812  1.00 63.90 ? 256  GLY A N   1 
ATOM   1956 C  CA  . GLY A 1 256 ? 58.849  22.129  12.028  1.00 68.32 ? 256  GLY A CA  1 
ATOM   1957 C  C   . GLY A 1 256 ? 59.364  20.791  12.523  1.00 70.39 ? 256  GLY A C   1 
ATOM   1958 O  O   . GLY A 1 256 ? 60.415  20.717  13.127  1.00 72.37 ? 256  GLY A O   1 
ATOM   1959 N  N   . CYS A 1 257 ? 58.627  19.726  12.252  1.00 71.49 ? 257  CYS A N   1 
ATOM   1960 C  CA  . CYS A 1 257 ? 59.053  18.426  12.706  1.00 73.25 ? 257  CYS A CA  1 
ATOM   1961 C  C   . CYS A 1 257 ? 59.280  17.511  11.544  1.00 76.38 ? 257  CYS A C   1 
ATOM   1962 O  O   . CYS A 1 257 ? 58.380  17.295  10.720  1.00 77.41 ? 257  CYS A O   1 
ATOM   1963 C  CB  . CYS A 1 257 ? 58.025  17.812  13.643  1.00 70.43 ? 257  CYS A CB  1 
ATOM   1964 S  SG  . CYS A 1 257 ? 57.909  18.580  15.282  1.00 67.15 ? 257  CYS A SG  1 
ATOM   1965 N  N   . PRO A 1 258 ? 60.477  16.897  11.505  1.00 79.81 ? 258  PRO A N   1 
ATOM   1966 C  CA  . PRO A 1 258 ? 61.766  16.227  11.451  1.00 80.34 ? 258  PRO A CA  1 
ATOM   1967 C  C   . PRO A 1 258 ? 62.885  17.237  11.737  1.00 81.39 ? 258  PRO A C   1 
ATOM   1968 O  O   . PRO A 1 258 ? 62.649  18.341  12.277  1.00 81.65 ? 258  PRO A O   1 
ATOM   1969 C  CB  . PRO A 1 258 ? 61.795  15.731  9.998   1.00 80.31 ? 258  PRO A CB  1 
ATOM   1970 C  CG  . PRO A 1 258 ? 61.233  16.982  9.254   1.00 80.44 ? 258  PRO A CG  1 
ATOM   1971 C  CD  . PRO A 1 258 ? 60.529  17.838  10.358  1.00 80.11 ? 258  PRO A CD  1 
ATOM   1972 N  N   . ASN A 1 265 ? 61.921  7.776   10.459  1.00 72.34 ? 265  ASN A N   1 
ATOM   1973 C  CA  . ASN A 1 265 ? 61.764  7.165   11.783  1.00 72.88 ? 265  ASN A CA  1 
ATOM   1974 C  C   . ASN A 1 265 ? 60.635  7.833   12.594  1.00 70.50 ? 265  ASN A C   1 
ATOM   1975 O  O   . ASN A 1 265 ? 60.704  9.031   12.932  1.00 70.56 ? 265  ASN A O   1 
ATOM   1976 C  CB  . ASN A 1 265 ? 63.107  7.234   12.531  1.00 75.96 ? 265  ASN A CB  1 
ATOM   1977 C  CG  . ASN A 1 265 ? 62.976  6.928   14.013  1.00 78.31 ? 265  ASN A CG  1 
ATOM   1978 O  OD1 . ASN A 1 265 ? 62.906  7.851   14.844  1.00 78.48 ? 265  ASN A OD1 1 
ATOM   1979 N  ND2 . ASN A 1 265 ? 62.938  5.629   14.358  1.00 78.52 ? 265  ASN A ND2 1 
ATOM   1980 N  N   . ASP A 1 266 ? 59.604  7.051   12.917  1.00 67.18 ? 266  ASP A N   1 
ATOM   1981 C  CA  . ASP A 1 266 ? 58.452  7.584   13.645  1.00 63.23 ? 266  ASP A CA  1 
ATOM   1982 C  C   . ASP A 1 266 ? 58.694  8.109   15.038  1.00 62.30 ? 266  ASP A C   1 
ATOM   1983 O  O   . ASP A 1 266 ? 58.127  9.134   15.404  1.00 62.17 ? 266  ASP A O   1 
ATOM   1984 C  CB  . ASP A 1 266 ? 57.323  6.562   13.694  1.00 61.19 ? 266  ASP A CB  1 
ATOM   1985 C  CG  . ASP A 1 266 ? 56.744  6.278   12.326  1.00 59.36 ? 266  ASP A CG  1 
ATOM   1986 O  OD1 . ASP A 1 266 ? 56.944  7.105   11.413  1.00 59.67 ? 266  ASP A OD1 1 
ATOM   1987 O  OD2 . ASP A 1 266 ? 56.082  5.237   12.157  1.00 56.96 ? 266  ASP A OD2 1 
ATOM   1988 N  N   . THR A 1 267 ? 59.526  7.427   15.820  1.00 62.01 ? 267  THR A N   1 
ATOM   1989 C  CA  . THR A 1 267 ? 59.788  7.868   17.191  1.00 60.21 ? 267  THR A CA  1 
ATOM   1990 C  C   . THR A 1 267 ? 60.246  9.319   17.259  1.00 61.67 ? 267  THR A C   1 
ATOM   1991 O  O   . THR A 1 267 ? 59.754  10.102  18.086  1.00 62.02 ? 267  THR A O   1 
ATOM   1992 C  CB  . THR A 1 267 ? 60.848  6.982   17.885  1.00 58.57 ? 267  THR A CB  1 
ATOM   1993 O  OG1 . THR A 1 267 ? 60.442  5.609   17.822  1.00 56.94 ? 267  THR A OG1 1 
ATOM   1994 C  CG2 . THR A 1 267 ? 61.007  7.385   19.351  1.00 55.23 ? 267  THR A CG2 1 
ATOM   1995 N  N   . GLU A 1 268 ? 61.189  9.679   16.392  1.00 62.90 ? 268  GLU A N   1 
ATOM   1996 C  CA  . GLU A 1 268 ? 61.724  11.048  16.356  1.00 64.10 ? 268  GLU A CA  1 
ATOM   1997 C  C   . GLU A 1 268 ? 60.641  12.082  16.055  1.00 60.86 ? 268  GLU A C   1 
ATOM   1998 O  O   . GLU A 1 268 ? 60.544  13.108  16.721  1.00 60.10 ? 268  GLU A O   1 
ATOM   1999 C  CB  . GLU A 1 268 ? 62.796  11.188  15.266  1.00 68.93 ? 268  GLU A CB  1 
ATOM   2000 C  CG  . GLU A 1 268 ? 64.151  10.599  15.556  1.00 76.13 ? 268  GLU A CG  1 
ATOM   2001 C  CD  . GLU A 1 268 ? 65.135  10.859  14.402  1.00 81.18 ? 268  GLU A CD  1 
ATOM   2002 O  OE1 . GLU A 1 268 ? 65.533  12.040  14.177  1.00 81.38 ? 268  GLU A OE1 1 
ATOM   2003 O  OE2 . GLU A 1 268 ? 65.495  9.872   13.712  1.00 84.03 ? 268  GLU A OE2 1 
ATOM   2004 N  N   . LEU A 1 269 ? 59.863  11.795  15.015  1.00 58.52 ? 269  LEU A N   1 
ATOM   2005 C  CA  . LEU A 1 269 ? 58.785  12.657  14.538  1.00 56.11 ? 269  LEU A CA  1 
ATOM   2006 C  C   . LEU A 1 269 ? 57.753  12.915  15.639  1.00 54.68 ? 269  LEU A C   1 
ATOM   2007 O  O   . LEU A 1 269 ? 57.462  14.059  16.001  1.00 53.92 ? 269  LEU A O   1 
ATOM   2008 C  CB  . LEU A 1 269 ? 58.144  11.981  13.316  1.00 55.00 ? 269  LEU A CB  1 
ATOM   2009 C  CG  . LEU A 1 269 ? 57.197  12.762  12.408  1.00 54.24 ? 269  LEU A CG  1 
ATOM   2010 C  CD1 . LEU A 1 269 ? 57.377  12.302  10.999  1.00 53.66 ? 269  LEU A CD1 1 
ATOM   2011 C  CD2 . LEU A 1 269 ? 55.759  12.550  12.839  1.00 53.72 ? 269  LEU A CD2 1 
ATOM   2012 N  N   . ILE A 1 270 ? 57.219  11.838  16.191  1.00 54.65 ? 270  ILE A N   1 
ATOM   2013 C  CA  . ILE A 1 270 ? 56.237  11.937  17.248  1.00 53.66 ? 270  ILE A CA  1 
ATOM   2014 C  C   . ILE A 1 270 ? 56.808  12.652  18.465  1.00 54.18 ? 270  ILE A C   1 
ATOM   2015 O  O   . ILE A 1 270 ? 56.142  13.505  19.070  1.00 56.23 ? 270  ILE A O   1 
ATOM   2016 C  CB  . ILE A 1 270 ? 55.752  10.552  17.627  1.00 51.90 ? 270  ILE A CB  1 
ATOM   2017 C  CG1 . ILE A 1 270 ? 55.113  9.915   16.402  1.00 51.31 ? 270  ILE A CG1 1 
ATOM   2018 C  CG2 . ILE A 1 270 ? 54.779  10.629  18.787  1.00 51.38 ? 270  ILE A CG2 1 
ATOM   2019 C  CD1 . ILE A 1 270 ? 54.945  8.420   16.499  1.00 52.95 ? 270  ILE A CD1 1 
ATOM   2020 N  N   . ALA A 1 271 ? 58.045  12.338  18.822  1.00 52.79 ? 271  ALA A N   1 
ATOM   2021 C  CA  . ALA A 1 271 ? 58.642  12.992  19.973  1.00 52.42 ? 271  ALA A CA  1 
ATOM   2022 C  C   . ALA A 1 271 ? 58.669  14.514  19.778  1.00 52.90 ? 271  ALA A C   1 
ATOM   2023 O  O   . ALA A 1 271 ? 58.409  15.276  20.714  1.00 53.17 ? 271  ALA A O   1 
ATOM   2024 C  CB  . ALA A 1 271 ? 60.041  12.459  20.199  1.00 50.94 ? 271  ALA A CB  1 
ATOM   2025 N  N   . CYS A 1 272 ? 58.997  14.946  18.561  1.00 53.12 ? 272  CYS A N   1 
ATOM   2026 C  CA  . CYS A 1 272 ? 59.060  16.372  18.213  1.00 53.80 ? 272  CYS A CA  1 
ATOM   2027 C  C   . CYS A 1 272 ? 57.656  16.959  18.256  1.00 51.32 ? 272  CYS A C   1 
ATOM   2028 O  O   . CYS A 1 272 ? 57.462  18.050  18.780  1.00 51.44 ? 272  CYS A O   1 
ATOM   2029 C  CB  . CYS A 1 272 ? 59.662  16.540  16.814  1.00 57.42 ? 272  CYS A CB  1 
ATOM   2030 S  SG  . CYS A 1 272 ? 59.757  18.243  16.151  1.00 64.47 ? 272  CYS A SG  1 
ATOM   2031 N  N   . LEU A 1 273 ? 56.682  16.240  17.702  1.00 49.64 ? 273  LEU A N   1 
ATOM   2032 C  CA  . LEU A 1 273 ? 55.296  16.700  17.754  1.00 48.93 ? 273  LEU A CA  1 
ATOM   2033 C  C   . LEU A 1 273 ? 54.863  16.896  19.210  1.00 49.61 ? 273  LEU A C   1 
ATOM   2034 O  O   . LEU A 1 273 ? 54.120  17.837  19.522  1.00 49.05 ? 273  LEU A O   1 
ATOM   2035 C  CB  . LEU A 1 273 ? 54.361  15.689  17.102  1.00 48.22 ? 273  LEU A CB  1 
ATOM   2036 C  CG  . LEU A 1 273 ? 54.263  15.732  15.585  1.00 47.49 ? 273  LEU A CG  1 
ATOM   2037 C  CD1 . LEU A 1 273 ? 53.423  14.572  15.059  1.00 46.46 ? 273  LEU A CD1 1 
ATOM   2038 C  CD2 . LEU A 1 273 ? 53.662  17.055  15.195  1.00 46.57 ? 273  LEU A CD2 1 
ATOM   2039 N  N   . ARG A 1 274 ? 55.338  16.029  20.108  1.00 48.05 ? 274  ARG A N   1 
ATOM   2040 C  CA  . ARG A 1 274 ? 54.934  16.160  21.501  1.00 47.12 ? 274  ARG A CA  1 
ATOM   2041 C  C   . ARG A 1 274 ? 55.484  17.415  22.141  1.00 47.57 ? 274  ARG A C   1 
ATOM   2042 O  O   . ARG A 1 274 ? 54.934  17.897  23.128  1.00 48.04 ? 274  ARG A O   1 
ATOM   2043 C  CB  . ARG A 1 274 ? 55.345  14.925  22.321  1.00 47.52 ? 274  ARG A CB  1 
ATOM   2044 C  CG  . ARG A 1 274 ? 54.562  13.651  21.990  1.00 48.27 ? 274  ARG A CG  1 
ATOM   2045 C  CD  . ARG A 1 274 ? 54.684  12.600  23.098  1.00 51.28 ? 274  ARG A CD  1 
ATOM   2046 N  NE  . ARG A 1 274 ? 56.083  12.242  23.293  1.00 55.10 ? 274  ARG A NE  1 
ATOM   2047 C  CZ  . ARG A 1 274 ? 56.695  11.218  22.698  1.00 55.21 ? 274  ARG A CZ  1 
ATOM   2048 N  NH1 . ARG A 1 274 ? 56.010  10.419  21.875  1.00 54.92 ? 274  ARG A NH1 1 
ATOM   2049 N  NH2 . ARG A 1 274 ? 58.008  11.034  22.882  1.00 51.20 ? 274  ARG A NH2 1 
ATOM   2050 N  N   . THR A 1 275 ? 56.555  17.971  21.587  1.00 46.94 ? 275  THR A N   1 
ATOM   2051 C  CA  . THR A 1 275 ? 57.131  19.179  22.177  1.00 47.70 ? 275  THR A CA  1 
ATOM   2052 C  C   . THR A 1 275 ? 56.407  20.431  21.716  1.00 48.20 ? 275  THR A C   1 
ATOM   2053 O  O   . THR A 1 275 ? 56.639  21.519  22.239  1.00 51.07 ? 275  THR A O   1 
ATOM   2054 C  CB  . THR A 1 275 ? 58.612  19.369  21.786  1.00 48.69 ? 275  THR A CB  1 
ATOM   2055 O  OG1 . THR A 1 275 ? 58.697  19.604  20.370  1.00 48.41 ? 275  THR A OG1 1 
ATOM   2056 C  CG2 . THR A 1 275 ? 59.427  18.143  22.133  1.00 47.10 ? 275  THR A CG2 1 
ATOM   2057 N  N   . ARG A 1 276 ? 55.536  20.291  20.734  1.00 47.95 ? 276  ARG A N   1 
ATOM   2058 C  CA  . ARG A 1 276 ? 54.811  21.437  20.198  1.00 49.49 ? 276  ARG A CA  1 
ATOM   2059 C  C   . ARG A 1 276 ? 53.608  21.866  21.027  1.00 48.80 ? 276  ARG A C   1 
ATOM   2060 O  O   . ARG A 1 276 ? 52.896  21.035  21.580  1.00 48.88 ? 276  ARG A O   1 
ATOM   2061 C  CB  . ARG A 1 276 ? 54.361  21.126  18.771  1.00 52.94 ? 276  ARG A CB  1 
ATOM   2062 C  CG  . ARG A 1 276 ? 55.512  20.885  17.807  1.00 56.50 ? 276  ARG A CG  1 
ATOM   2063 C  CD  . ARG A 1 276 ? 56.263  22.194  17.611  1.00 62.04 ? 276  ARG A CD  1 
ATOM   2064 N  NE  . ARG A 1 276 ? 57.403  22.076  16.697  1.00 68.37 ? 276  ARG A NE  1 
ATOM   2065 C  CZ  . ARG A 1 276 ? 58.642  21.746  17.068  1.00 70.14 ? 276  ARG A CZ  1 
ATOM   2066 N  NH1 . ARG A 1 276 ? 58.909  21.488  18.345  1.00 69.14 ? 276  ARG A NH1 1 
ATOM   2067 N  NH2 . ARG A 1 276 ? 59.624  21.711  16.160  1.00 71.69 ? 276  ARG A NH2 1 
ATOM   2068 N  N   . PRO A 1 277 ? 53.379  23.179  21.131  1.00 48.13 ? 277  PRO A N   1 
ATOM   2069 C  CA  . PRO A 1 277 ? 52.255  23.734  21.891  1.00 47.37 ? 277  PRO A CA  1 
ATOM   2070 C  C   . PRO A 1 277 ? 50.968  23.207  21.258  1.00 46.87 ? 277  PRO A C   1 
ATOM   2071 O  O   . PRO A 1 277 ? 50.912  23.037  20.050  1.00 46.54 ? 277  PRO A O   1 
ATOM   2072 C  CB  . PRO A 1 277 ? 52.405  25.244  21.683  1.00 48.59 ? 277  PRO A CB  1 
ATOM   2073 C  CG  . PRO A 1 277 ? 53.890  25.420  21.422  1.00 49.64 ? 277  PRO A CG  1 
ATOM   2074 C  CD  . PRO A 1 277 ? 54.181  24.246  20.506  1.00 47.45 ? 277  PRO A CD  1 
ATOM   2075 N  N   . ALA A 1 278 ? 49.943  22.947  22.062  1.00 46.06 ? 278  ALA A N   1 
ATOM   2076 C  CA  . ALA A 1 278 ? 48.687  22.437  21.545  1.00 45.14 ? 278  ALA A CA  1 
ATOM   2077 C  C   . ALA A 1 278 ? 48.099  23.338  20.444  1.00 45.12 ? 278  ALA A C   1 
ATOM   2078 O  O   . ALA A 1 278 ? 47.667  22.855  19.395  1.00 44.22 ? 278  ALA A O   1 
ATOM   2079 C  CB  . ALA A 1 278 ? 47.685  22.269  22.708  1.00 44.22 ? 278  ALA A CB  1 
ATOM   2080 N  N   . GLN A 1 279 ? 48.100  24.645  20.679  1.00 46.00 ? 279  GLN A N   1 
ATOM   2081 C  CA  . GLN A 1 279 ? 47.548  25.588  19.716  1.00 47.15 ? 279  GLN A CA  1 
ATOM   2082 C  C   . GLN A 1 279 ? 48.254  25.569  18.374  1.00 48.22 ? 279  GLN A C   1 
ATOM   2083 O  O   . GLN A 1 279 ? 47.641  25.889  17.361  1.00 49.96 ? 279  GLN A O   1 
ATOM   2084 C  CB  . GLN A 1 279 ? 47.567  26.997  20.298  1.00 46.79 ? 279  GLN A CB  1 
ATOM   2085 C  CG  . GLN A 1 279 ? 46.700  27.958  19.550  1.00 47.49 ? 279  GLN A CG  1 
ATOM   2086 C  CD  . GLN A 1 279 ? 45.260  27.489  19.494  1.00 47.71 ? 279  GLN A CD  1 
ATOM   2087 O  OE1 . GLN A 1 279 ? 44.619  27.282  20.527  1.00 48.78 ? 279  GLN A OE1 1 
ATOM   2088 N  NE2 . GLN A 1 279 ? 44.742  27.332  18.290  1.00 46.65 ? 279  GLN A NE2 1 
ATOM   2089 N  N   . ASP A 1 280 ? 49.535  25.204  18.350  1.00 49.25 ? 280  ASP A N   1 
ATOM   2090 C  CA  . ASP A 1 280 ? 50.250  25.133  17.073  1.00 49.47 ? 280  ASP A CA  1 
ATOM   2091 C  C   . ASP A 1 280 ? 49.707  23.992  16.247  1.00 48.55 ? 280  ASP A C   1 
ATOM   2092 O  O   . ASP A 1 280 ? 49.618  24.105  15.027  1.00 48.00 ? 280  ASP A O   1 
ATOM   2093 C  CB  . ASP A 1 280 ? 51.750  24.909  17.260  1.00 52.95 ? 280  ASP A CB  1 
ATOM   2094 C  CG  . ASP A 1 280 ? 52.497  26.189  17.563  1.00 58.43 ? 280  ASP A CG  1 
ATOM   2095 O  OD1 . ASP A 1 280 ? 51.875  27.148  18.104  1.00 60.65 ? 280  ASP A OD1 1 
ATOM   2096 O  OD2 . ASP A 1 280 ? 53.717  26.225  17.279  1.00 61.41 ? 280  ASP A OD2 1 
ATOM   2097 N  N   . LEU A 1 281 ? 49.350  22.887  16.902  1.00 47.23 ? 281  LEU A N   1 
ATOM   2098 C  CA  . LEU A 1 281 ? 48.835  21.744  16.168  1.00 46.53 ? 281  LEU A CA  1 
ATOM   2099 C  C   . LEU A 1 281 ? 47.469  22.082  15.581  1.00 45.85 ? 281  LEU A C   1 
ATOM   2100 O  O   . LEU A 1 281 ? 47.187  21.766  14.415  1.00 45.19 ? 281  LEU A O   1 
ATOM   2101 C  CB  . LEU A 1 281 ? 48.767  20.507  17.065  1.00 46.50 ? 281  LEU A CB  1 
ATOM   2102 C  CG  . LEU A 1 281 ? 50.151  20.047  17.568  1.00 47.45 ? 281  LEU A CG  1 
ATOM   2103 C  CD1 . LEU A 1 281 ? 50.050  18.725  18.272  1.00 47.85 ? 281  LEU A CD1 1 
ATOM   2104 C  CD2 . LEU A 1 281 ? 51.099  19.901  16.416  1.00 45.78 ? 281  LEU A CD2 1 
ATOM   2105 N  N   . VAL A 1 282 ? 46.637  22.750  16.377  1.00 44.68 ? 282  VAL A N   1 
ATOM   2106 C  CA  . VAL A 1 282 ? 45.308  23.150  15.929  1.00 44.23 ? 282  VAL A CA  1 
ATOM   2107 C  C   . VAL A 1 282 ? 45.423  24.147  14.769  1.00 44.92 ? 282  VAL A C   1 
ATOM   2108 O  O   . VAL A 1 282 ? 44.683  24.027  13.798  1.00 45.50 ? 282  VAL A O   1 
ATOM   2109 C  CB  . VAL A 1 282 ? 44.461  23.799  17.098  1.00 44.78 ? 282  VAL A CB  1 
ATOM   2110 C  CG1 . VAL A 1 282 ? 43.128  24.347  16.561  1.00 41.13 ? 282  VAL A CG1 1 
ATOM   2111 C  CG2 . VAL A 1 282 ? 44.178  22.749  18.201  1.00 43.25 ? 282  VAL A CG2 1 
ATOM   2112 N  N   . ASP A 1 283 ? 46.341  25.112  14.867  1.00 44.24 ? 283  ASP A N   1 
ATOM   2113 C  CA  . ASP A 1 283 ? 46.533  26.104  13.811  1.00 45.54 ? 283  ASP A CA  1 
ATOM   2114 C  C   . ASP A 1 283 ? 46.852  25.524  12.428  1.00 45.67 ? 283  ASP A C   1 
ATOM   2115 O  O   . ASP A 1 283 ? 46.568  26.172  11.436  1.00 47.29 ? 283  ASP A O   1 
ATOM   2116 C  CB  . ASP A 1 283 ? 47.625  27.111  14.185  1.00 45.80 ? 283  ASP A CB  1 
ATOM   2117 C  CG  . ASP A 1 283 ? 47.176  28.100  15.273  1.00 49.82 ? 283  ASP A CG  1 
ATOM   2118 O  OD1 . ASP A 1 283 ? 45.969  28.144  15.607  1.00 49.72 ? 283  ASP A OD1 1 
ATOM   2119 O  OD2 . ASP A 1 283 ? 48.043  28.845  15.795  1.00 51.40 ? 283  ASP A OD2 1 
ATOM   2120 N  N   . HIS A 1 284 ? 47.414  24.319  12.346  1.00 45.57 ? 284  HIS A N   1 
ATOM   2121 C  CA  . HIS A 1 284 ? 47.719  23.745  11.035  1.00 46.80 ? 284  HIS A CA  1 
ATOM   2122 C  C   . HIS A 1 284 ? 46.878  22.536  10.656  1.00 45.63 ? 284  HIS A C   1 
ATOM   2123 O  O   . HIS A 1 284 ? 47.021  21.984  9.563   1.00 44.36 ? 284  HIS A O   1 
ATOM   2124 C  CB  . HIS A 1 284 ? 49.193  23.365  10.963  1.00 49.84 ? 284  HIS A CB  1 
ATOM   2125 C  CG  . HIS A 1 284 ? 50.105  24.540  11.059  1.00 51.70 ? 284  HIS A CG  1 
ATOM   2126 N  ND1 . HIS A 1 284 ? 50.473  25.094  12.265  1.00 53.34 ? 284  HIS A ND1 1 
ATOM   2127 C  CD2 . HIS A 1 284 ? 50.632  25.334  10.099  1.00 51.50 ? 284  HIS A CD2 1 
ATOM   2128 C  CE1 . HIS A 1 284 ? 51.184  26.185  12.046  1.00 54.35 ? 284  HIS A CE1 1 
ATOM   2129 N  NE2 . HIS A 1 284 ? 51.292  26.352  10.739  1.00 54.17 ? 284  HIS A NE2 1 
ATOM   2130 N  N   . GLU A 1 285 ? 45.998  22.146  11.564  1.00 43.94 ? 285  GLU A N   1 
ATOM   2131 C  CA  . GLU A 1 285 ? 45.134  20.983  11.383  1.00 45.55 ? 285  GLU A CA  1 
ATOM   2132 C  C   . GLU A 1 285 ? 44.441  20.904  10.017  1.00 45.37 ? 285  GLU A C   1 
ATOM   2133 O  O   . GLU A 1 285 ? 44.469  19.864  9.333   1.00 43.07 ? 285  GLU A O   1 
ATOM   2134 C  CB  . GLU A 1 285 ? 44.091  20.999  12.500  1.00 46.70 ? 285  GLU A CB  1 
ATOM   2135 C  CG  . GLU A 1 285 ? 43.310  19.754  12.638  1.00 50.53 ? 285  GLU A CG  1 
ATOM   2136 C  CD  . GLU A 1 285 ? 42.283  19.866  13.745  1.00 51.56 ? 285  GLU A CD  1 
ATOM   2137 O  OE1 . GLU A 1 285 ? 42.608  20.422  14.798  1.00 51.89 ? 285  GLU A OE1 1 
ATOM   2138 O  OE2 . GLU A 1 285 ? 41.151  19.391  13.568  1.00 55.06 ? 285  GLU A OE2 1 
ATOM   2139 N  N   . TRP A 1 286 ? 43.828  22.008  9.605   1.00 46.02 ? 286  TRP A N   1 
ATOM   2140 C  CA  . TRP A 1 286 ? 43.124  22.032  8.332   1.00 49.58 ? 286  TRP A CA  1 
ATOM   2141 C  C   . TRP A 1 286 ? 43.972  22.055  7.066   1.00 50.10 ? 286  TRP A C   1 
ATOM   2142 O  O   . TRP A 1 286 ? 43.453  21.821  5.977   1.00 51.99 ? 286  TRP A O   1 
ATOM   2143 C  CB  . TRP A 1 286 ? 42.133  23.201  8.310   1.00 50.59 ? 286  TRP A CB  1 
ATOM   2144 C  CG  . TRP A 1 286 ? 41.030  23.012  9.307   1.00 55.18 ? 286  TRP A CG  1 
ATOM   2145 C  CD1 . TRP A 1 286 ? 40.965  23.507  10.600  1.00 55.30 ? 286  TRP A CD1 1 
ATOM   2146 C  CD2 . TRP A 1 286 ? 39.877  22.193  9.135   1.00 55.41 ? 286  TRP A CD2 1 
ATOM   2147 N  NE1 . TRP A 1 286 ? 39.841  23.034  11.228  1.00 55.75 ? 286  TRP A NE1 1 
ATOM   2148 C  CE2 . TRP A 1 286 ? 39.153  22.228  10.357  1.00 57.16 ? 286  TRP A CE2 1 
ATOM   2149 C  CE3 . TRP A 1 286 ? 39.381  21.428  8.069   1.00 56.46 ? 286  TRP A CE3 1 
ATOM   2150 C  CZ2 . TRP A 1 286 ? 37.957  21.523  10.538  1.00 58.93 ? 286  TRP A CZ2 1 
ATOM   2151 C  CZ3 . TRP A 1 286 ? 38.195  20.727  8.244   1.00 57.86 ? 286  TRP A CZ3 1 
ATOM   2152 C  CH2 . TRP A 1 286 ? 37.493  20.779  9.475   1.00 60.06 ? 286  TRP A CH2 1 
ATOM   2153 N  N   . HIS A 1 287 ? 45.271  22.300  7.194   1.00 50.72 ? 287  HIS A N   1 
ATOM   2154 C  CA  . HIS A 1 287 ? 46.121  22.376  6.008   1.00 50.62 ? 287  HIS A CA  1 
ATOM   2155 C  C   . HIS A 1 287 ? 46.576  21.041  5.448   1.00 50.06 ? 287  HIS A C   1 
ATOM   2156 O  O   . HIS A 1 287 ? 47.367  21.021  4.503   1.00 51.32 ? 287  HIS A O   1 
ATOM   2157 C  CB  . HIS A 1 287 ? 47.343  23.240  6.299   1.00 51.65 ? 287  HIS A CB  1 
ATOM   2158 C  CG  . HIS A 1 287 ? 47.005  24.641  6.697   1.00 54.69 ? 287  HIS A CG  1 
ATOM   2159 N  ND1 . HIS A 1 287 ? 47.743  25.353  7.618   1.00 56.19 ? 287  HIS A ND1 1 
ATOM   2160 C  CD2 . HIS A 1 287 ? 46.012  25.468  6.292   1.00 58.44 ? 287  HIS A CD2 1 
ATOM   2161 C  CE1 . HIS A 1 287 ? 47.218  26.557  7.764   1.00 58.27 ? 287  HIS A CE1 1 
ATOM   2162 N  NE2 . HIS A 1 287 ? 46.167  26.653  6.970   1.00 59.46 ? 287  HIS A NE2 1 
ATOM   2163 N  N   . VAL A 1 288 ? 46.087  19.926  5.993   1.00 47.24 ? 288  VAL A N   1 
ATOM   2164 C  CA  . VAL A 1 288 ? 46.521  18.643  5.475   1.00 44.03 ? 288  VAL A CA  1 
ATOM   2165 C  C   . VAL A 1 288 ? 45.506  17.920  4.614   1.00 44.44 ? 288  VAL A C   1 
ATOM   2166 O  O   . VAL A 1 288 ? 45.807  16.837  4.109   1.00 43.44 ? 288  VAL A O   1 
ATOM   2167 C  CB  . VAL A 1 288 ? 47.010  17.694  6.616   1.00 45.69 ? 288  VAL A CB  1 
ATOM   2168 C  CG1 . VAL A 1 288 ? 48.081  18.394  7.451   1.00 42.55 ? 288  VAL A CG1 1 
ATOM   2169 C  CG2 . VAL A 1 288 ? 45.831  17.243  7.493   1.00 43.74 ? 288  VAL A CG2 1 
ATOM   2170 N  N   . LEU A 1 289 ? 44.312  18.489  4.433   1.00 43.98 ? 289  LEU A N   1 
ATOM   2171 C  CA  . LEU A 1 289 ? 43.300  17.825  3.581   1.00 46.38 ? 289  LEU A CA  1 
ATOM   2172 C  C   . LEU A 1 289 ? 43.784  17.762  2.135   1.00 47.98 ? 289  LEU A C   1 
ATOM   2173 O  O   . LEU A 1 289 ? 44.334  18.722  1.610   1.00 48.97 ? 289  LEU A O   1 
ATOM   2174 C  CB  . LEU A 1 289 ? 41.934  18.539  3.647   1.00 44.26 ? 289  LEU A CB  1 
ATOM   2175 C  CG  . LEU A 1 289 ? 41.152  18.359  4.962   1.00 44.12 ? 289  LEU A CG  1 
ATOM   2176 C  CD1 . LEU A 1 289 ? 39.957  19.307  4.984   1.00 41.55 ? 289  LEU A CD1 1 
ATOM   2177 C  CD2 . LEU A 1 289 ? 40.724  16.885  5.135   1.00 38.06 ? 289  LEU A CD2 1 
ATOM   2178 N  N   . PRO A 1 290 ? 43.593  16.618  1.478   1.00 49.67 ? 290  PRO A N   1 
ATOM   2179 C  CA  . PRO A 1 290 ? 44.018  16.411  0.094   1.00 51.36 ? 290  PRO A CA  1 
ATOM   2180 C  C   . PRO A 1 290 ? 43.479  17.355  -0.981  1.00 53.93 ? 290  PRO A C   1 
ATOM   2181 O  O   . PRO A 1 290 ? 44.221  17.717  -1.892  1.00 54.96 ? 290  PRO A O   1 
ATOM   2182 C  CB  . PRO A 1 290 ? 43.665  14.945  -0.163  1.00 50.61 ? 290  PRO A CB  1 
ATOM   2183 C  CG  . PRO A 1 290 ? 42.543  14.676  0.782   1.00 49.71 ? 290  PRO A CG  1 
ATOM   2184 C  CD  . PRO A 1 290 ? 42.979  15.402  2.028   1.00 50.30 ? 290  PRO A CD  1 
ATOM   2185 N  N   . GLN A 1 291 ? 42.206  17.746  -0.902  1.00 55.51 ? 291  GLN A N   1 
ATOM   2186 C  CA  . GLN A 1 291 ? 41.635  18.671  -1.887  1.00 56.10 ? 291  GLN A CA  1 
ATOM   2187 C  C   . GLN A 1 291 ? 40.734  19.679  -1.204  1.00 55.25 ? 291  GLN A C   1 
ATOM   2188 O  O   . GLN A 1 291 ? 40.436  19.557  -0.021  1.00 57.08 ? 291  GLN A O   1 
ATOM   2189 C  CB  . GLN A 1 291 ? 40.791  17.937  -2.938  1.00 58.39 ? 291  GLN A CB  1 
ATOM   2190 C  CG  . GLN A 1 291 ? 41.345  16.620  -3.427  1.00 61.76 ? 291  GLN A CG  1 
ATOM   2191 C  CD  . GLN A 1 291 ? 40.991  15.490  -2.489  1.00 64.73 ? 291  GLN A CD  1 
ATOM   2192 O  OE1 . GLN A 1 291 ? 41.416  14.339  -2.679  1.00 65.37 ? 291  GLN A OE1 1 
ATOM   2193 N  NE2 . GLN A 1 291 ? 40.198  15.809  -1.459  1.00 64.25 ? 291  GLN A NE2 1 
ATOM   2194 N  N   . GLU A 1 292 ? 40.298  20.680  -1.954  1.00 54.24 ? 292  GLU A N   1 
ATOM   2195 C  CA  . GLU A 1 292 ? 39.384  21.680  -1.420  1.00 54.32 ? 292  GLU A CA  1 
ATOM   2196 C  C   . GLU A 1 292 ? 38.113  20.869  -1.179  1.00 51.91 ? 292  GLU A C   1 
ATOM   2197 O  O   . GLU A 1 292 ? 37.722  20.057  -2.024  1.00 51.14 ? 292  GLU A O   1 
ATOM   2198 C  CB  . GLU A 1 292 ? 39.114  22.775  -2.460  1.00 57.01 ? 292  GLU A CB  1 
ATOM   2199 C  CG  . GLU A 1 292 ? 38.497  24.040  -1.889  1.00 64.40 ? 292  GLU A CG  1 
ATOM   2200 C  CD  . GLU A 1 292 ? 38.111  25.055  -2.965  1.00 70.37 ? 292  GLU A CD  1 
ATOM   2201 O  OE1 . GLU A 1 292 ? 38.752  25.057  -4.053  1.00 72.15 ? 292  GLU A OE1 1 
ATOM   2202 O  OE2 . GLU A 1 292 ? 37.172  25.860  -2.712  1.00 73.54 ? 292  GLU A OE2 1 
ATOM   2203 N  N   . SER A 1 293 ? 37.443  21.081  -0.056  1.00 49.35 ? 293  SER A N   1 
ATOM   2204 C  CA  . SER A 1 293 ? 36.259  20.267  0.195   1.00 48.48 ? 293  SER A CA  1 
ATOM   2205 C  C   . SER A 1 293 ? 35.441  20.702  1.385   1.00 47.18 ? 293  SER A C   1 
ATOM   2206 O  O   . SER A 1 293 ? 35.832  21.587  2.137   1.00 47.42 ? 293  SER A O   1 
ATOM   2207 C  CB  . SER A 1 293 ? 36.708  18.829  0.456   1.00 49.43 ? 293  SER A CB  1 
ATOM   2208 O  OG  . SER A 1 293 ? 37.607  18.805  1.566   1.00 49.12 ? 293  SER A OG  1 
ATOM   2209 N  N   . ILE A 1 294 ? 34.281  20.077  1.532   1.00 45.86 ? 294  ILE A N   1 
ATOM   2210 C  CA  . ILE A 1 294 ? 33.446  20.302  2.700   1.00 43.74 ? 294  ILE A CA  1 
ATOM   2211 C  C   . ILE A 1 294 ? 33.091  18.901  3.194   1.00 42.03 ? 294  ILE A C   1 
ATOM   2212 O  O   . ILE A 1 294 ? 33.198  17.920  2.446   1.00 38.95 ? 294  ILE A O   1 
ATOM   2213 C  CB  . ILE A 1 294 ? 32.154  21.104  2.409   1.00 45.26 ? 294  ILE A CB  1 
ATOM   2214 C  CG1 . ILE A 1 294 ? 31.416  20.522  1.212   1.00 44.31 ? 294  ILE A CG1 1 
ATOM   2215 C  CG2 . ILE A 1 294 ? 32.491  22.593  2.211   1.00 45.96 ? 294  ILE A CG2 1 
ATOM   2216 C  CD1 . ILE A 1 294 ? 30.041  21.119  1.069   1.00 44.16 ? 294  ILE A CD1 1 
ATOM   2217 N  N   . PHE A 1 295 ? 32.678  18.808  4.453   1.00 41.52 ? 295  PHE A N   1 
ATOM   2218 C  CA  . PHE A 1 295 ? 32.344  17.523  5.071   1.00 41.59 ? 295  PHE A CA  1 
ATOM   2219 C  C   . PHE A 1 295 ? 33.508  16.518  5.002   1.00 41.07 ? 295  PHE A C   1 
ATOM   2220 O  O   . PHE A 1 295 ? 33.313  15.327  4.718   1.00 38.94 ? 295  PHE A O   1 
ATOM   2221 C  CB  . PHE A 1 295 ? 31.102  16.895  4.436   1.00 41.19 ? 295  PHE A CB  1 
ATOM   2222 C  CG  . PHE A 1 295 ? 30.169  16.281  5.446   1.00 43.86 ? 295  PHE A CG  1 
ATOM   2223 C  CD1 . PHE A 1 295 ? 30.664  15.446  6.451   1.00 41.99 ? 295  PHE A CD1 1 
ATOM   2224 C  CD2 . PHE A 1 295 ? 28.792  16.534  5.403   1.00 43.71 ? 295  PHE A CD2 1 
ATOM   2225 C  CE1 . PHE A 1 295 ? 29.807  14.875  7.395   1.00 40.45 ? 295  PHE A CE1 1 
ATOM   2226 C  CE2 . PHE A 1 295 ? 27.936  15.962  6.344   1.00 42.39 ? 295  PHE A CE2 1 
ATOM   2227 C  CZ  . PHE A 1 295 ? 28.445  15.135  7.340   1.00 41.41 ? 295  PHE A CZ  1 
ATOM   2228 N  N   . ARG A 1 296 ? 34.719  17.042  5.202   1.00 40.02 ? 296  ARG A N   1 
ATOM   2229 C  CA  . ARG A 1 296 ? 35.939  16.237  5.257   1.00 39.77 ? 296  ARG A CA  1 
ATOM   2230 C  C   . ARG A 1 296 ? 36.712  16.803  6.444   1.00 39.41 ? 296  ARG A C   1 
ATOM   2231 O  O   . ARG A 1 296 ? 36.802  18.020  6.627   1.00 38.50 ? 296  ARG A O   1 
ATOM   2232 C  CB  . ARG A 1 296 ? 36.772  16.333  3.984   1.00 36.85 ? 296  ARG A CB  1 
ATOM   2233 C  CG  . ARG A 1 296 ? 36.136  15.637  2.814   1.00 36.04 ? 296  ARG A CG  1 
ATOM   2234 C  CD  . ARG A 1 296 ? 35.965  14.157  3.034   1.00 37.32 ? 296  ARG A CD  1 
ATOM   2235 N  NE  . ARG A 1 296 ? 35.397  13.519  1.842   1.00 36.66 ? 296  ARG A NE  1 
ATOM   2236 C  CZ  . ARG A 1 296 ? 34.094  13.433  1.589   1.00 39.91 ? 296  ARG A CZ  1 
ATOM   2237 N  NH1 . ARG A 1 296 ? 33.224  13.933  2.464   1.00 40.98 ? 296  ARG A NH1 1 
ATOM   2238 N  NH2 . ARG A 1 296 ? 33.659  12.893  0.444   1.00 40.76 ? 296  ARG A NH2 1 
ATOM   2239 N  N   . PHE A 1 297 ? 37.257  15.906  7.252   1.00 38.43 ? 297  PHE A N   1 
ATOM   2240 C  CA  . PHE A 1 297 ? 37.963  16.315  8.447   1.00 38.55 ? 297  PHE A CA  1 
ATOM   2241 C  C   . PHE A 1 297 ? 39.334  15.692  8.468   1.00 39.18 ? 297  PHE A C   1 
ATOM   2242 O  O   . PHE A 1 297 ? 39.501  14.522  8.134   1.00 38.98 ? 297  PHE A O   1 
ATOM   2243 C  CB  . PHE A 1 297 ? 37.111  15.904  9.649   1.00 37.01 ? 297  PHE A CB  1 
ATOM   2244 C  CG  . PHE A 1 297 ? 35.648  16.176  9.444   1.00 36.44 ? 297  PHE A CG  1 
ATOM   2245 C  CD1 . PHE A 1 297 ? 35.169  17.488  9.408   1.00 35.41 ? 297  PHE A CD1 1 
ATOM   2246 C  CD2 . PHE A 1 297 ? 34.756  15.131  9.205   1.00 37.40 ? 297  PHE A CD2 1 
ATOM   2247 C  CE1 . PHE A 1 297 ? 33.825  17.761  9.133   1.00 34.87 ? 297  PHE A CE1 1 
ATOM   2248 C  CE2 . PHE A 1 297 ? 33.385  15.392  8.925   1.00 35.56 ? 297  PHE A CE2 1 
ATOM   2249 C  CZ  . PHE A 1 297 ? 32.929  16.708  8.891   1.00 35.25 ? 297  PHE A CZ  1 
ATOM   2250 N  N   . SER A 1 298 ? 40.316  16.484  8.868   1.00 39.98 ? 298  SER A N   1 
ATOM   2251 C  CA  . SER A 1 298 ? 41.699  16.050  8.877   1.00 41.39 ? 298  SER A CA  1 
ATOM   2252 C  C   . SER A 1 298 ? 42.099  14.795  9.643   1.00 41.74 ? 298  SER A C   1 
ATOM   2253 O  O   . SER A 1 298 ? 42.732  13.892  9.075   1.00 40.98 ? 298  SER A O   1 
ATOM   2254 C  CB  . SER A 1 298 ? 42.565  17.204  9.327   1.00 41.40 ? 298  SER A CB  1 
ATOM   2255 O  OG  . SER A 1 298 ? 42.717  18.091  8.235   1.00 47.73 ? 298  SER A OG  1 
ATOM   2256 N  N   . PHE A 1 299 ? 41.745  14.729  10.923  1.00 41.05 ? 299  PHE A N   1 
ATOM   2257 C  CA  . PHE A 1 299 ? 42.124  13.576  11.729  1.00 40.27 ? 299  PHE A CA  1 
ATOM   2258 C  C   . PHE A 1 299 ? 40.921  12.840  12.256  1.00 39.91 ? 299  PHE A C   1 
ATOM   2259 O  O   . PHE A 1 299 ? 40.233  13.290  13.174  1.00 39.57 ? 299  PHE A O   1 
ATOM   2260 C  CB  . PHE A 1 299 ? 43.056  14.022  12.853  1.00 40.61 ? 299  PHE A CB  1 
ATOM   2261 C  CG  . PHE A 1 299 ? 44.321  14.654  12.342  1.00 42.02 ? 299  PHE A CG  1 
ATOM   2262 C  CD1 . PHE A 1 299 ? 44.380  16.015  12.087  1.00 41.70 ? 299  PHE A CD1 1 
ATOM   2263 C  CD2 . PHE A 1 299 ? 45.406  13.863  11.968  1.00 42.72 ? 299  PHE A CD2 1 
ATOM   2264 C  CE1 . PHE A 1 299 ? 45.502  16.576  11.451  1.00 40.87 ? 299  PHE A CE1 1 
ATOM   2265 C  CE2 . PHE A 1 299 ? 46.528  14.421  11.333  1.00 39.11 ? 299  PHE A CE2 1 
ATOM   2266 C  CZ  . PHE A 1 299 ? 46.568  15.771  11.076  1.00 41.42 ? 299  PHE A CZ  1 
ATOM   2267 N  N   . VAL A 1 300 ? 40.672  11.698  11.641  1.00 38.31 ? 300  VAL A N   1 
ATOM   2268 C  CA  . VAL A 1 300 ? 39.539  10.871  11.984  1.00 38.36 ? 300  VAL A CA  1 
ATOM   2269 C  C   . VAL A 1 300 ? 39.975  9.417   12.246  1.00 40.01 ? 300  VAL A C   1 
ATOM   2270 O  O   . VAL A 1 300 ? 41.156  9.094   12.188  1.00 39.60 ? 300  VAL A O   1 
ATOM   2271 C  CB  . VAL A 1 300 ? 38.497  10.909  10.819  1.00 36.58 ? 300  VAL A CB  1 
ATOM   2272 C  CG1 . VAL A 1 300 ? 38.029  12.357  10.582  1.00 35.52 ? 300  VAL A CG1 1 
ATOM   2273 C  CG2 . VAL A 1 300 ? 39.120  10.346  9.541   1.00 34.06 ? 300  VAL A CG2 1 
ATOM   2274 N  N   . PRO A 1 301 ? 39.022  8.533   12.568  1.00 40.08 ? 301  PRO A N   1 
ATOM   2275 C  CA  . PRO A 1 301 ? 39.417  7.145   12.810  1.00 40.18 ? 301  PRO A CA  1 
ATOM   2276 C  C   . PRO A 1 301 ? 40.163  6.544   11.613  1.00 43.01 ? 301  PRO A C   1 
ATOM   2277 O  O   . PRO A 1 301 ? 39.797  6.758   10.448  1.00 42.23 ? 301  PRO A O   1 
ATOM   2278 C  CB  . PRO A 1 301 ? 38.082  6.458   13.090  1.00 38.66 ? 301  PRO A CB  1 
ATOM   2279 C  CG  . PRO A 1 301 ? 37.372  7.518   13.925  1.00 39.88 ? 301  PRO A CG  1 
ATOM   2280 C  CD  . PRO A 1 301 ? 37.683  8.812   13.138  1.00 39.99 ? 301  PRO A CD  1 
ATOM   2281 N  N   . VAL A 1 302 ? 41.220  5.790   11.913  1.00 42.85 ? 302  VAL A N   1 
ATOM   2282 C  CA  . VAL A 1 302 ? 42.014  5.155   10.884  1.00 42.39 ? 302  VAL A CA  1 
ATOM   2283 C  C   . VAL A 1 302 ? 41.766  3.642   10.854  1.00 44.47 ? 302  VAL A C   1 
ATOM   2284 O  O   . VAL A 1 302 ? 41.596  3.018   11.904  1.00 43.60 ? 302  VAL A O   1 
ATOM   2285 C  CB  . VAL A 1 302 ? 43.510  5.397   11.123  1.00 40.37 ? 302  VAL A CB  1 
ATOM   2286 C  CG1 . VAL A 1 302 ? 43.893  4.895   12.512  1.00 39.21 ? 302  VAL A CG1 1 
ATOM   2287 C  CG2 . VAL A 1 302 ? 44.328  4.652   10.056  1.00 40.24 ? 302  VAL A CG2 1 
ATOM   2288 N  N   . VAL A 1 303 ? 41.721  3.059   9.654   1.00 45.26 ? 303  VAL A N   1 
ATOM   2289 C  CA  . VAL A 1 303 ? 41.544  1.610   9.538   1.00 47.44 ? 303  VAL A CA  1 
ATOM   2290 C  C   . VAL A 1 303 ? 42.949  1.056   9.821   1.00 49.69 ? 303  VAL A C   1 
ATOM   2291 O  O   . VAL A 1 303 ? 43.776  0.907   8.918   1.00 49.34 ? 303  VAL A O   1 
ATOM   2292 C  CB  . VAL A 1 303 ? 41.077  1.213   8.133   1.00 47.30 ? 303  VAL A CB  1 
ATOM   2293 C  CG1 . VAL A 1 303 ? 40.931  -0.291  8.045   1.00 46.12 ? 303  VAL A CG1 1 
ATOM   2294 C  CG2 . VAL A 1 303 ? 39.752  1.887   7.822   1.00 43.38 ? 303  VAL A CG2 1 
ATOM   2295 N  N   . ASP A 1 304 ? 43.206  0.804   11.106  1.00 50.56 ? 304  ASP A N   1 
ATOM   2296 C  CA  . ASP A 1 304 ? 44.495  0.345   11.598  1.00 50.76 ? 304  ASP A CA  1 
ATOM   2297 C  C   . ASP A 1 304 ? 44.670  -1.152  11.622  1.00 51.61 ? 304  ASP A C   1 
ATOM   2298 O  O   . ASP A 1 304 ? 45.765  -1.639  11.881  1.00 51.35 ? 304  ASP A O   1 
ATOM   2299 C  CB  . ASP A 1 304 ? 44.742  0.899   13.012  1.00 49.72 ? 304  ASP A CB  1 
ATOM   2300 C  CG  . ASP A 1 304 ? 43.657  0.474   14.024  1.00 51.31 ? 304  ASP A CG  1 
ATOM   2301 O  OD1 . ASP A 1 304 ? 42.592  -0.067  13.607  1.00 50.55 ? 304  ASP A OD1 1 
ATOM   2302 O  OD2 . ASP A 1 304 ? 43.874  0.701   15.250  1.00 50.97 ? 304  ASP A OD2 1 
ATOM   2303 N  N   . GLY A 1 305 ? 43.599  -1.888  11.354  1.00 52.25 ? 305  GLY A N   1 
ATOM   2304 C  CA  . GLY A 1 305 ? 43.714  -3.335  11.393  1.00 52.90 ? 305  GLY A CA  1 
ATOM   2305 C  C   . GLY A 1 305 ? 43.795  -3.823  12.836  1.00 54.37 ? 305  GLY A C   1 
ATOM   2306 O  O   . GLY A 1 305 ? 44.191  -4.960  13.072  1.00 55.93 ? 305  GLY A O   1 
ATOM   2307 N  N   . ASP A 1 306 ? 43.432  -2.956  13.791  1.00 53.10 ? 306  ASP A N   1 
ATOM   2308 C  CA  . ASP A 1 306 ? 43.421  -3.257  15.241  1.00 51.18 ? 306  ASP A CA  1 
ATOM   2309 C  C   . ASP A 1 306 ? 42.028  -2.889  15.763  1.00 49.43 ? 306  ASP A C   1 
ATOM   2310 O  O   . ASP A 1 306 ? 41.156  -3.753  15.808  1.00 48.47 ? 306  ASP A O   1 
ATOM   2311 C  CB  . ASP A 1 306 ? 44.484  -2.442  15.994  1.00 52.90 ? 306  ASP A CB  1 
ATOM   2312 C  CG  . ASP A 1 306 ? 44.552  -2.783  17.486  1.00 54.84 ? 306  ASP A CG  1 
ATOM   2313 O  OD1 . ASP A 1 306 ? 43.795  -3.668  17.958  1.00 54.90 ? 306  ASP A OD1 1 
ATOM   2314 O  OD2 . ASP A 1 306 ? 45.379  -2.157  18.193  1.00 54.76 ? 306  ASP A OD2 1 
ATOM   2315 N  N   . PHE A 1 307 ? 41.817  -1.625  16.150  1.00 46.64 ? 307  PHE A N   1 
ATOM   2316 C  CA  . PHE A 1 307 ? 40.489  -1.184  16.597  1.00 45.72 ? 307  PHE A CA  1 
ATOM   2317 C  C   . PHE A 1 307 ? 39.496  -1.507  15.466  1.00 46.25 ? 307  PHE A C   1 
ATOM   2318 O  O   . PHE A 1 307 ? 38.387  -1.984  15.693  1.00 46.94 ? 307  PHE A O   1 
ATOM   2319 C  CB  . PHE A 1 307 ? 40.483  0.322   16.879  1.00 43.11 ? 307  PHE A CB  1 
ATOM   2320 C  CG  . PHE A 1 307 ? 39.269  0.786   17.637  1.00 42.52 ? 307  PHE A CG  1 
ATOM   2321 C  CD1 . PHE A 1 307 ? 38.018  0.798   17.030  1.00 40.39 ? 307  PHE A CD1 1 
ATOM   2322 C  CD2 . PHE A 1 307 ? 39.368  1.148   18.990  1.00 40.14 ? 307  PHE A CD2 1 
ATOM   2323 C  CE1 . PHE A 1 307 ? 36.875  1.159   17.753  1.00 38.74 ? 307  PHE A CE1 1 
ATOM   2324 C  CE2 . PHE A 1 307 ? 38.235  1.511   19.720  1.00 40.60 ? 307  PHE A CE2 1 
ATOM   2325 C  CZ  . PHE A 1 307 ? 36.985  1.516   19.100  1.00 40.87 ? 307  PHE A CZ  1 
ATOM   2326 N  N   . LEU A 1 308 ? 39.908  -1.231  14.236  1.00 47.42 ? 308  LEU A N   1 
ATOM   2327 C  CA  . LEU A 1 308 ? 39.094  -1.538  13.066  1.00 48.78 ? 308  LEU A CA  1 
ATOM   2328 C  C   . LEU A 1 308 ? 39.875  -2.611  12.291  1.00 50.22 ? 308  LEU A C   1 
ATOM   2329 O  O   . LEU A 1 308 ? 40.853  -2.310  11.608  1.00 51.49 ? 308  LEU A O   1 
ATOM   2330 C  CB  . LEU A 1 308 ? 38.896  -0.282  12.212  1.00 45.98 ? 308  LEU A CB  1 
ATOM   2331 C  CG  . LEU A 1 308 ? 37.866  0.717   12.762  1.00 46.84 ? 308  LEU A CG  1 
ATOM   2332 C  CD1 . LEU A 1 308 ? 37.812  1.961   11.875  1.00 42.42 ? 308  LEU A CD1 1 
ATOM   2333 C  CD2 . LEU A 1 308 ? 36.477  0.038   12.818  1.00 42.43 ? 308  LEU A CD2 1 
ATOM   2334 N  N   . SER A 1 309 ? 39.452  -3.862  12.415  1.00 51.37 ? 309  SER A N   1 
ATOM   2335 C  CA  . SER A 1 309 ? 40.152  -4.957  11.756  1.00 53.16 ? 309  SER A CA  1 
ATOM   2336 C  C   . SER A 1 309 ? 40.132  -4.829  10.238  1.00 53.79 ? 309  SER A C   1 
ATOM   2337 O  O   . SER A 1 309 ? 41.010  -5.347  9.551   1.00 54.52 ? 309  SER A O   1 
ATOM   2338 C  CB  . SER A 1 309 ? 39.572  -6.316  12.206  1.00 52.75 ? 309  SER A CB  1 
ATOM   2339 O  OG  . SER A 1 309 ? 38.241  -6.518  11.758  1.00 53.31 ? 309  SER A OG  1 
ATOM   2340 N  N   . ASP A 1 310 ? 39.143  -4.121  9.714   1.00 54.49 ? 310  ASP A N   1 
ATOM   2341 C  CA  . ASP A 1 310 ? 39.038  -3.918  8.271   1.00 55.21 ? 310  ASP A CA  1 
ATOM   2342 C  C   . ASP A 1 310 ? 38.236  -2.616  8.037   1.00 55.03 ? 310  ASP A C   1 
ATOM   2343 O  O   . ASP A 1 310 ? 37.901  -1.921  8.997   1.00 54.45 ? 310  ASP A O   1 
ATOM   2344 C  CB  . ASP A 1 310 ? 38.326  -5.117  7.648   1.00 56.68 ? 310  ASP A CB  1 
ATOM   2345 C  CG  . ASP A 1 310 ? 38.640  -5.286  6.165   1.00 60.70 ? 310  ASP A CG  1 
ATOM   2346 O  OD1 . ASP A 1 310 ? 39.220  -4.352  5.552   1.00 60.87 ? 310  ASP A OD1 1 
ATOM   2347 O  OD2 . ASP A 1 310 ? 38.291  -6.362  5.610   1.00 62.12 ? 310  ASP A OD2 1 
ATOM   2348 N  N   . THR A 1 311 ? 37.916  -2.274  6.788   1.00 53.98 ? 311  THR A N   1 
ATOM   2349 C  CA  . THR A 1 311 ? 37.167  -1.037  6.551   1.00 53.49 ? 311  THR A CA  1 
ATOM   2350 C  C   . THR A 1 311 ? 35.745  -1.207  7.067   1.00 54.19 ? 311  THR A C   1 
ATOM   2351 O  O   . THR A 1 311 ? 35.218  -2.320  7.079   1.00 55.55 ? 311  THR A O   1 
ATOM   2352 C  CB  . THR A 1 311 ? 37.075  -0.682  5.059   1.00 53.56 ? 311  THR A CB  1 
ATOM   2353 O  OG1 . THR A 1 311 ? 36.211  -1.621  4.404   1.00 54.72 ? 311  THR A OG1 1 
ATOM   2354 C  CG2 . THR A 1 311 ? 38.456  -0.703  4.409   1.00 50.88 ? 311  THR A CG2 1 
ATOM   2355 N  N   . PRO A 1 312 ? 35.095  -0.113  7.498   1.00 53.43 ? 312  PRO A N   1 
ATOM   2356 C  CA  . PRO A 1 312 ? 33.728  -0.296  7.986   1.00 53.66 ? 312  PRO A CA  1 
ATOM   2357 C  C   . PRO A 1 312 ? 32.843  -0.927  6.917   1.00 54.09 ? 312  PRO A C   1 
ATOM   2358 O  O   . PRO A 1 312 ? 31.881  -1.625  7.220   1.00 53.64 ? 312  PRO A O   1 
ATOM   2359 C  CB  . PRO A 1 312 ? 33.298  1.126   8.342   1.00 52.03 ? 312  PRO A CB  1 
ATOM   2360 C  CG  . PRO A 1 312 ? 34.579  1.741   8.781   1.00 53.89 ? 312  PRO A CG  1 
ATOM   2361 C  CD  . PRO A 1 312 ? 35.536  1.275   7.711   1.00 52.62 ? 312  PRO A CD  1 
ATOM   2362 N  N   . GLU A 1 313 ? 33.164  -0.672  5.658   1.00 56.40 ? 313  GLU A N   1 
ATOM   2363 C  CA  . GLU A 1 313 ? 32.381  -1.233  4.567   1.00 58.82 ? 313  GLU A CA  1 
ATOM   2364 C  C   . GLU A 1 313 ? 32.490  -2.760  4.570   1.00 57.86 ? 313  GLU A C   1 
ATOM   2365 O  O   . GLU A 1 313 ? 31.489  -3.472  4.507   1.00 56.60 ? 313  GLU A O   1 
ATOM   2366 C  CB  . GLU A 1 313 ? 32.861  -0.670  3.235   1.00 61.88 ? 313  GLU A CB  1 
ATOM   2367 C  CG  . GLU A 1 313 ? 31.746  -0.062  2.421   1.00 69.84 ? 313  GLU A CG  1 
ATOM   2368 C  CD  . GLU A 1 313 ? 31.562  -0.768  1.086   1.00 74.93 ? 313  GLU A CD  1 
ATOM   2369 O  OE1 . GLU A 1 313 ? 32.545  -0.795  0.297   1.00 75.91 ? 313  GLU A OE1 1 
ATOM   2370 O  OE2 . GLU A 1 313 ? 30.440  -1.294  0.830   1.00 78.07 ? 313  GLU A OE2 1 
ATOM   2371 N  N   . ALA A 1 314 ? 33.711  -3.266  4.658   1.00 56.85 ? 314  ALA A N   1 
ATOM   2372 C  CA  . ALA A 1 314 ? 33.891  -4.704  4.689   1.00 57.26 ? 314  ALA A CA  1 
ATOM   2373 C  C   . ALA A 1 314 ? 33.166  -5.279  5.904   1.00 57.32 ? 314  ALA A C   1 
ATOM   2374 O  O   . ALA A 1 314 ? 32.402  -6.237  5.783   1.00 57.86 ? 314  ALA A O   1 
ATOM   2375 C  CB  . ALA A 1 314 ? 35.392  -5.057  4.741   1.00 55.26 ? 314  ALA A CB  1 
ATOM   2376 N  N   . LEU A 1 315 ? 33.401  -4.685  7.074   1.00 57.98 ? 315  LEU A N   1 
ATOM   2377 C  CA  . LEU A 1 315 ? 32.797  -5.160  8.314   1.00 56.69 ? 315  LEU A CA  1 
ATOM   2378 C  C   . LEU A 1 315 ? 31.272  -5.157  8.332   1.00 57.69 ? 315  LEU A C   1 
ATOM   2379 O  O   . LEU A 1 315 ? 30.668  -6.066  8.877   1.00 58.86 ? 315  LEU A O   1 
ATOM   2380 C  CB  . LEU A 1 315 ? 33.340  -4.366  9.500   1.00 56.13 ? 315  LEU A CB  1 
ATOM   2381 C  CG  . LEU A 1 315 ? 34.866  -4.465  9.622   1.00 56.08 ? 315  LEU A CG  1 
ATOM   2382 C  CD1 . LEU A 1 315 ? 35.327  -3.756  10.861  1.00 55.29 ? 315  LEU A CD1 1 
ATOM   2383 C  CD2 . LEU A 1 315 ? 35.292  -5.921  9.682   1.00 54.89 ? 315  LEU A CD2 1 
ATOM   2384 N  N   . ILE A 1 316 ? 30.619  -4.163  7.745   1.00 58.63 ? 316  ILE A N   1 
ATOM   2385 C  CA  . ILE A 1 316 ? 29.163  -4.206  7.778   1.00 60.74 ? 316  ILE A CA  1 
ATOM   2386 C  C   . ILE A 1 316 ? 28.605  -5.137  6.688   1.00 63.04 ? 316  ILE A C   1 
ATOM   2387 O  O   . ILE A 1 316 ? 27.441  -5.523  6.737   1.00 62.84 ? 316  ILE A O   1 
ATOM   2388 C  CB  . ILE A 1 316 ? 28.504  -2.782  7.657   1.00 59.00 ? 316  ILE A CB  1 
ATOM   2389 C  CG1 . ILE A 1 316 ? 28.548  -2.279  6.215   1.00 59.73 ? 316  ILE A CG1 1 
ATOM   2390 C  CG2 . ILE A 1 316 ? 29.194  -1.809  8.593   1.00 57.08 ? 316  ILE A CG2 1 
ATOM   2391 C  CD1 . ILE A 1 316 ? 27.791  -0.961  5.993   1.00 58.33 ? 316  ILE A CD1 1 
ATOM   2392 N  N   . ASN A 1 317 ? 29.426  -5.495  5.703   1.00 65.44 ? 317  ASN A N   1 
ATOM   2393 C  CA  . ASN A 1 317 ? 28.968  -6.396  4.646   1.00 67.96 ? 317  ASN A CA  1 
ATOM   2394 C  C   . ASN A 1 317 ? 29.110  -7.854  5.076   1.00 68.90 ? 317  ASN A C   1 
ATOM   2395 O  O   . ASN A 1 317 ? 28.384  -8.712  4.591   1.00 70.31 ? 317  ASN A O   1 
ATOM   2396 C  CB  . ASN A 1 317 ? 29.764  -6.207  3.341   1.00 69.12 ? 317  ASN A CB  1 
ATOM   2397 C  CG  . ASN A 1 317 ? 29.444  -4.893  2.625   1.00 71.54 ? 317  ASN A CG  1 
ATOM   2398 O  OD1 . ASN A 1 317 ? 28.375  -4.291  2.827   1.00 73.03 ? 317  ASN A OD1 1 
ATOM   2399 N  ND2 . ASN A 1 317 ? 30.366  -4.452  1.760   1.00 71.05 ? 317  ASN A ND2 1 
ATOM   2400 N  N   . THR A 1 318 ? 30.024  -8.132  5.999   1.00 67.79 ? 318  THR A N   1 
ATOM   2401 C  CA  . THR A 1 318 ? 30.255  -9.501  6.427   1.00 67.54 ? 318  THR A CA  1 
ATOM   2402 C  C   . THR A 1 318 ? 30.032  -9.743  7.914   1.00 68.60 ? 318  THR A C   1 
ATOM   2403 O  O   . THR A 1 318 ? 30.398  -10.796 8.442   1.00 69.80 ? 318  THR A O   1 
ATOM   2404 C  CB  . THR A 1 318 ? 31.687  -9.894  6.133   1.00 68.19 ? 318  THR A CB  1 
ATOM   2405 O  OG1 . THR A 1 318 ? 32.536  -9.293  7.122   1.00 67.11 ? 318  THR A OG1 1 
ATOM   2406 C  CG2 . THR A 1 318 ? 32.101  -9.407  4.735   1.00 66.64 ? 318  THR A CG2 1 
ATOM   2407 N  N   . GLY A 1 319 ? 29.444  -8.782  8.605   1.00 68.25 ? 319  GLY A N   1 
ATOM   2408 C  CA  . GLY A 1 319 ? 29.236  -8.975  10.023  1.00 68.40 ? 319  GLY A CA  1 
ATOM   2409 C  C   . GLY A 1 319 ? 27.948  -9.686  10.373  1.00 68.56 ? 319  GLY A C   1 
ATOM   2410 O  O   . GLY A 1 319 ? 26.975  -9.671  9.609   1.00 68.21 ? 319  GLY A O   1 
ATOM   2411 N  N   . ASP A 1 320 ? 27.957  -10.325 11.537  1.00 68.72 ? 320  ASP A N   1 
ATOM   2412 C  CA  . ASP A 1 320 ? 26.791  -11.022 12.050  1.00 69.01 ? 320  ASP A CA  1 
ATOM   2413 C  C   . ASP A 1 320 ? 26.247  -10.111 13.148  1.00 68.66 ? 320  ASP A C   1 
ATOM   2414 O  O   . ASP A 1 320 ? 26.895  -9.910  14.173  1.00 67.72 ? 320  ASP A O   1 
ATOM   2415 C  CB  . ASP A 1 320 ? 27.209  -12.381 12.625  1.00 71.21 ? 320  ASP A CB  1 
ATOM   2416 C  CG  . ASP A 1 320 ? 26.064  -13.110 13.311  1.00 71.20 ? 320  ASP A CG  1 
ATOM   2417 O  OD1 . ASP A 1 320 ? 24.978  -13.231 12.696  1.00 72.07 ? 320  ASP A OD1 1 
ATOM   2418 O  OD2 . ASP A 1 320 ? 26.258  -13.563 14.459  1.00 71.10 ? 320  ASP A OD2 1 
ATOM   2419 N  N   . PHE A 1 321 ? 25.066  -9.548  12.925  1.00 69.02 ? 321  PHE A N   1 
ATOM   2420 C  CA  . PHE A 1 321 ? 24.473  -8.629  13.900  1.00 69.82 ? 321  PHE A CA  1 
ATOM   2421 C  C   . PHE A 1 321 ? 23.192  -9.195  14.491  1.00 71.60 ? 321  PHE A C   1 
ATOM   2422 O  O   . PHE A 1 321 ? 22.214  -8.473  14.703  1.00 71.55 ? 321  PHE A O   1 
ATOM   2423 C  CB  . PHE A 1 321 ? 24.208  -7.275  13.216  1.00 67.71 ? 321  PHE A CB  1 
ATOM   2424 C  CG  . PHE A 1 321 ? 25.434  -6.683  12.584  1.00 63.76 ? 321  PHE A CG  1 
ATOM   2425 C  CD1 . PHE A 1 321 ? 26.514  -6.295  13.369  1.00 62.21 ? 321  PHE A CD1 1 
ATOM   2426 C  CD2 . PHE A 1 321 ? 25.549  -6.599  11.207  1.00 63.27 ? 321  PHE A CD2 1 
ATOM   2427 C  CE1 . PHE A 1 321 ? 27.691  -5.841  12.796  1.00 60.92 ? 321  PHE A CE1 1 
ATOM   2428 C  CE2 . PHE A 1 321 ? 26.729  -6.144  10.623  1.00 62.47 ? 321  PHE A CE2 1 
ATOM   2429 C  CZ  . PHE A 1 321 ? 27.802  -5.767  11.427  1.00 61.77 ? 321  PHE A CZ  1 
ATOM   2430 N  N   . GLN A 1 322 ? 23.233  -10.497 14.767  1.00 73.80 ? 322  GLN A N   1 
ATOM   2431 C  CA  . GLN A 1 322 ? 22.115  -11.262 15.320  1.00 74.88 ? 322  GLN A CA  1 
ATOM   2432 C  C   . GLN A 1 322 ? 21.400  -10.635 16.519  1.00 74.08 ? 322  GLN A C   1 
ATOM   2433 O  O   . GLN A 1 322 ? 20.201  -10.343 16.465  1.00 73.79 ? 322  GLN A O   1 
ATOM   2434 C  CB  . GLN A 1 322 ? 22.615  -12.654 15.725  1.00 77.83 ? 322  GLN A CB  1 
ATOM   2435 C  CG  . GLN A 1 322 ? 21.641  -13.806 15.478  1.00 80.80 ? 322  GLN A CG  1 
ATOM   2436 C  CD  . GLN A 1 322 ? 21.525  -14.174 14.002  1.00 83.38 ? 322  GLN A CD  1 
ATOM   2437 O  OE1 . GLN A 1 322 ? 20.647  -13.682 13.283  1.00 84.30 ? 322  GLN A OE1 1 
ATOM   2438 N  NE2 . GLN A 1 322 ? 22.427  -15.037 13.541  1.00 83.40 ? 322  GLN A NE2 1 
ATOM   2439 N  N   . ASP A 1 323 ? 22.129  -10.433 17.608  1.00 73.39 ? 323  ASP A N   1 
ATOM   2440 C  CA  . ASP A 1 323 ? 21.499  -9.889  18.804  1.00 74.01 ? 323  ASP A CA  1 
ATOM   2441 C  C   . ASP A 1 323 ? 21.761  -8.414  19.030  1.00 71.46 ? 323  ASP A C   1 
ATOM   2442 O  O   . ASP A 1 323 ? 22.219  -8.010  20.097  1.00 71.59 ? 323  ASP A O   1 
ATOM   2443 C  CB  . ASP A 1 323 ? 21.927  -10.705 20.035  1.00 78.00 ? 323  ASP A CB  1 
ATOM   2444 C  CG  . ASP A 1 323 ? 21.258  -12.089 20.081  1.00 81.77 ? 323  ASP A CG  1 
ATOM   2445 O  OD1 . ASP A 1 323 ? 19.999  -12.147 20.135  1.00 82.64 ? 323  ASP A OD1 1 
ATOM   2446 O  OD2 . ASP A 1 323 ? 21.993  -13.113 20.058  1.00 82.88 ? 323  ASP A OD2 1 
ATOM   2447 N  N   . LEU A 1 324 ? 21.432  -7.613  18.022  1.00 67.85 ? 324  LEU A N   1 
ATOM   2448 C  CA  . LEU A 1 324 ? 21.655  -6.174  18.076  1.00 63.71 ? 324  LEU A CA  1 
ATOM   2449 C  C   . LEU A 1 324 ? 20.423  -5.367  17.703  1.00 59.46 ? 324  LEU A C   1 
ATOM   2450 O  O   . LEU A 1 324 ? 19.789  -5.632  16.684  1.00 57.69 ? 324  LEU A O   1 
ATOM   2451 C  CB  . LEU A 1 324 ? 22.786  -5.795  17.117  1.00 64.27 ? 324  LEU A CB  1 
ATOM   2452 C  CG  . LEU A 1 324 ? 23.207  -4.325  17.161  1.00 65.22 ? 324  LEU A CG  1 
ATOM   2453 C  CD1 . LEU A 1 324 ? 23.903  -4.059  18.478  1.00 64.66 ? 324  LEU A CD1 1 
ATOM   2454 C  CD2 . LEU A 1 324 ? 24.118  -3.993  15.999  1.00 65.09 ? 324  LEU A CD2 1 
ATOM   2455 N  N   . GLN A 1 325 ? 20.068  -4.400  18.538  1.00 55.54 ? 325  GLN A N   1 
ATOM   2456 C  CA  . GLN A 1 325 ? 18.943  -3.541  18.215  1.00 53.80 ? 325  GLN A CA  1 
ATOM   2457 C  C   . GLN A 1 325 ? 19.533  -2.164  17.958  1.00 51.34 ? 325  GLN A C   1 
ATOM   2458 O  O   . GLN A 1 325 ? 20.319  -1.644  18.756  1.00 49.29 ? 325  GLN A O   1 
ATOM   2459 C  CB  . GLN A 1 325 ? 17.918  -3.467  19.340  1.00 54.17 ? 325  GLN A CB  1 
ATOM   2460 C  CG  . GLN A 1 325 ? 17.215  -4.754  19.630  1.00 56.81 ? 325  GLN A CG  1 
ATOM   2461 C  CD  . GLN A 1 325 ? 17.836  -5.459  20.799  1.00 60.20 ? 325  GLN A CD  1 
ATOM   2462 O  OE1 . GLN A 1 325 ? 17.914  -4.903  21.905  1.00 59.86 ? 325  GLN A OE1 1 
ATOM   2463 N  NE2 . GLN A 1 325 ? 18.304  -6.690  20.570  1.00 62.96 ? 325  GLN A NE2 1 
ATOM   2464 N  N   . VAL A 1 326 ? 19.171  -1.587  16.825  1.00 48.97 ? 326  VAL A N   1 
ATOM   2465 C  CA  . VAL A 1 326 ? 19.697  -0.289  16.461  1.00 48.77 ? 326  VAL A CA  1 
ATOM   2466 C  C   . VAL A 1 326 ? 18.621  0.647   15.975  1.00 47.43 ? 326  VAL A C   1 
ATOM   2467 O  O   . VAL A 1 326 ? 17.694  0.239   15.279  1.00 47.36 ? 326  VAL A O   1 
ATOM   2468 C  CB  . VAL A 1 326 ? 20.769  -0.428  15.351  1.00 49.52 ? 326  VAL A CB  1 
ATOM   2469 C  CG1 . VAL A 1 326 ? 21.213  0.916   14.875  1.00 49.74 ? 326  VAL A CG1 1 
ATOM   2470 C  CG2 . VAL A 1 326 ? 21.963  -1.172  15.884  1.00 51.15 ? 326  VAL A CG2 1 
ATOM   2471 N  N   . LEU A 1 327 ? 18.743  1.905   16.372  1.00 46.12 ? 327  LEU A N   1 
ATOM   2472 C  CA  . LEU A 1 327 ? 17.828  2.944   15.941  1.00 45.39 ? 327  LEU A CA  1 
ATOM   2473 C  C   . LEU A 1 327 ? 18.695  3.922   15.123  1.00 44.65 ? 327  LEU A C   1 
ATOM   2474 O  O   . LEU A 1 327 ? 19.715  4.413   15.613  1.00 43.80 ? 327  LEU A O   1 
ATOM   2475 C  CB  . LEU A 1 327 ? 17.198  3.637   17.157  1.00 46.33 ? 327  LEU A CB  1 
ATOM   2476 C  CG  . LEU A 1 327 ? 16.401  4.921   16.848  1.00 47.59 ? 327  LEU A CG  1 
ATOM   2477 C  CD1 . LEU A 1 327 ? 15.280  4.614   15.905  1.00 50.17 ? 327  LEU A CD1 1 
ATOM   2478 C  CD2 . LEU A 1 327 ? 15.844  5.496   18.092  1.00 48.96 ? 327  LEU A CD2 1 
ATOM   2479 N  N   . VAL A 1 328 ? 18.306  4.183   13.877  1.00 43.86 ? 328  VAL A N   1 
ATOM   2480 C  CA  . VAL A 1 328 ? 19.071  5.082   13.010  1.00 42.69 ? 328  VAL A CA  1 
ATOM   2481 C  C   . VAL A 1 328 ? 18.191  6.103   12.309  1.00 42.64 ? 328  VAL A C   1 
ATOM   2482 O  O   . VAL A 1 328 ? 17.003  5.865   12.089  1.00 43.64 ? 328  VAL A O   1 
ATOM   2483 C  CB  . VAL A 1 328 ? 19.825  4.301   11.915  1.00 43.06 ? 328  VAL A CB  1 
ATOM   2484 C  CG1 . VAL A 1 328 ? 20.734  3.319   12.545  1.00 43.15 ? 328  VAL A CG1 1 
ATOM   2485 C  CG2 . VAL A 1 328 ? 18.847  3.599   10.979  1.00 41.34 ? 328  VAL A CG2 1 
ATOM   2486 N  N   . GLY A 1 329 ? 18.764  7.241   11.937  1.00 41.27 ? 329  GLY A N   1 
ATOM   2487 C  CA  . GLY A 1 329 ? 17.947  8.224   11.248  1.00 39.33 ? 329  GLY A CA  1 
ATOM   2488 C  C   . GLY A 1 329 ? 18.713  9.425   10.778  1.00 39.17 ? 329  GLY A C   1 
ATOM   2489 O  O   . GLY A 1 329 ? 19.912  9.576   11.068  1.00 40.27 ? 329  GLY A O   1 
ATOM   2490 N  N   . VAL A 1 330 ? 18.001  10.307  10.087  1.00 37.58 ? 330  VAL A N   1 
ATOM   2491 C  CA  . VAL A 1 330 ? 18.588  11.502  9.519   1.00 36.36 ? 330  VAL A CA  1 
ATOM   2492 C  C   . VAL A 1 330 ? 17.628  12.665  9.680   1.00 37.78 ? 330  VAL A C   1 
ATOM   2493 O  O   . VAL A 1 330 ? 16.463  12.453  10.010  1.00 38.44 ? 330  VAL A O   1 
ATOM   2494 C  CB  . VAL A 1 330 ? 18.835  11.291  8.026   1.00 36.38 ? 330  VAL A CB  1 
ATOM   2495 C  CG1 . VAL A 1 330 ? 19.741  10.080  7.802   1.00 33.98 ? 330  VAL A CG1 1 
ATOM   2496 C  CG2 . VAL A 1 330 ? 17.507  11.084  7.318   1.00 33.50 ? 330  VAL A CG2 1 
ATOM   2497 N  N   . VAL A 1 331 ? 18.117  13.890  9.481   1.00 37.26 ? 331  VAL A N   1 
ATOM   2498 C  CA  . VAL A 1 331 ? 17.249  15.069  9.546   1.00 37.22 ? 331  VAL A CA  1 
ATOM   2499 C  C   . VAL A 1 331 ? 16.912  15.422  8.106   1.00 38.70 ? 331  VAL A C   1 
ATOM   2500 O  O   . VAL A 1 331 ? 17.565  14.947  7.171   1.00 39.02 ? 331  VAL A O   1 
ATOM   2501 C  CB  . VAL A 1 331 ? 17.926  16.285  10.203  1.00 36.02 ? 331  VAL A CB  1 
ATOM   2502 C  CG1 . VAL A 1 331 ? 18.284  15.946  11.641  1.00 35.49 ? 331  VAL A CG1 1 
ATOM   2503 C  CG2 . VAL A 1 331 ? 19.173  16.701  9.409   1.00 34.20 ? 331  VAL A CG2 1 
ATOM   2504 N  N   . LYS A 1 332 ? 15.907  16.266  7.928   1.00 41.55 ? 332  LYS A N   1 
ATOM   2505 C  CA  . LYS A 1 332 ? 15.445  16.653  6.595   1.00 42.97 ? 332  LYS A CA  1 
ATOM   2506 C  C   . LYS A 1 332 ? 16.487  17.279  5.685   1.00 43.34 ? 332  LYS A C   1 
ATOM   2507 O  O   . LYS A 1 332 ? 16.495  17.013  4.475   1.00 42.12 ? 332  LYS A O   1 
ATOM   2508 C  CB  . LYS A 1 332 ? 14.231  17.587  6.716   1.00 46.27 ? 332  LYS A CB  1 
ATOM   2509 C  CG  . LYS A 1 332 ? 13.431  17.801  5.409   1.00 49.82 ? 332  LYS A CG  1 
ATOM   2510 C  CD  . LYS A 1 332 ? 12.127  18.587  5.686   1.00 53.77 ? 332  LYS A CD  1 
ATOM   2511 C  CE  . LYS A 1 332 ? 11.881  19.735  4.671   1.00 60.68 ? 332  LYS A CE  1 
ATOM   2512 N  NZ  . LYS A 1 332 ? 12.771  20.995  4.826   1.00 58.52 ? 332  LYS A NZ  1 
ATOM   2513 N  N   . ASP A 1 333 ? 17.381  18.094  6.238   1.00 42.36 ? 333  ASP A N   1 
ATOM   2514 C  CA  . ASP A 1 333 ? 18.397  18.731  5.385   1.00 43.27 ? 333  ASP A CA  1 
ATOM   2515 C  C   . ASP A 1 333 ? 19.828  18.550  5.884   1.00 42.38 ? 333  ASP A C   1 
ATOM   2516 O  O   . ASP A 1 333 ? 20.460  19.499  6.355   1.00 42.72 ? 333  ASP A O   1 
ATOM   2517 C  CB  . ASP A 1 333 ? 18.069  20.222  5.229   1.00 44.07 ? 333  ASP A CB  1 
ATOM   2518 C  CG  . ASP A 1 333 ? 16.699  20.447  4.616   1.00 45.07 ? 333  ASP A CG  1 
ATOM   2519 O  OD1 . ASP A 1 333 ? 15.690  20.446  5.347   1.00 44.17 ? 333  ASP A OD1 1 
ATOM   2520 O  OD2 . ASP A 1 333 ? 16.632  20.599  3.382   1.00 46.10 ? 333  ASP A OD2 1 
ATOM   2521 N  N   . GLU A 1 334 ? 20.345  17.331  5.750   1.00 41.59 ? 334  GLU A N   1 
ATOM   2522 C  CA  . GLU A 1 334 ? 21.680  17.025  6.235   1.00 40.41 ? 334  GLU A CA  1 
ATOM   2523 C  C   . GLU A 1 334 ? 22.791  17.915  5.674   1.00 40.62 ? 334  GLU A C   1 
ATOM   2524 O  O   . GLU A 1 334 ? 23.723  18.269  6.397   1.00 40.77 ? 334  GLU A O   1 
ATOM   2525 C  CB  . GLU A 1 334 ? 22.019  15.561  5.941   1.00 40.56 ? 334  GLU A CB  1 
ATOM   2526 C  CG  . GLU A 1 334 ? 21.227  14.510  6.705   1.00 40.38 ? 334  GLU A CG  1 
ATOM   2527 C  CD  . GLU A 1 334 ? 21.494  14.513  8.224   1.00 41.42 ? 334  GLU A CD  1 
ATOM   2528 O  OE1 . GLU A 1 334 ? 22.512  15.077  8.678   1.00 40.41 ? 334  GLU A OE1 1 
ATOM   2529 O  OE2 . GLU A 1 334 ? 20.680  13.932  8.972   1.00 42.14 ? 334  GLU A OE2 1 
ATOM   2530 N  N   . GLY A 1 335 ? 22.690  18.296  4.405   1.00 39.74 ? 335  GLY A N   1 
ATOM   2531 C  CA  . GLY A 1 335 ? 23.744  19.081  3.808   1.00 37.60 ? 335  GLY A CA  1 
ATOM   2532 C  C   . GLY A 1 335 ? 23.751  20.594  3.867   1.00 39.49 ? 335  GLY A C   1 
ATOM   2533 O  O   . GLY A 1 335 ? 24.815  21.195  3.717   1.00 39.48 ? 335  GLY A O   1 
ATOM   2534 N  N   . SER A 1 336 ? 22.612  21.228  4.113   1.00 40.25 ? 336  SER A N   1 
ATOM   2535 C  CA  . SER A 1 336 ? 22.563  22.689  4.087   1.00 40.98 ? 336  SER A CA  1 
ATOM   2536 C  C   . SER A 1 336 ? 23.694  23.374  4.825   1.00 41.96 ? 336  SER A C   1 
ATOM   2537 O  O   . SER A 1 336 ? 24.440  24.153  4.245   1.00 42.50 ? 336  SER A O   1 
ATOM   2538 C  CB  . SER A 1 336 ? 21.220  23.165  4.621   1.00 41.09 ? 336  SER A CB  1 
ATOM   2539 O  OG  . SER A 1 336 ? 21.040  22.708  5.935   1.00 40.59 ? 336  SER A OG  1 
ATOM   2540 N  N   . TYR A 1 337 ? 23.802  23.062  6.106   1.00 44.26 ? 337  TYR A N   1 
ATOM   2541 C  CA  . TYR A 1 337 ? 24.815  23.583  7.031   1.00 46.78 ? 337  TYR A CA  1 
ATOM   2542 C  C   . TYR A 1 337 ? 26.239  23.713  6.422   1.00 45.35 ? 337  TYR A C   1 
ATOM   2543 O  O   . TYR A 1 337 ? 26.875  24.774  6.481   1.00 44.12 ? 337  TYR A O   1 
ATOM   2544 C  CB  . TYR A 1 337 ? 24.846  22.629  8.247   1.00 51.21 ? 337  TYR A CB  1 
ATOM   2545 C  CG  . TYR A 1 337 ? 25.630  23.076  9.446   1.00 55.85 ? 337  TYR A CG  1 
ATOM   2546 C  CD1 . TYR A 1 337 ? 24.990  23.676  10.529  1.00 59.83 ? 337  TYR A CD1 1 
ATOM   2547 C  CD2 . TYR A 1 337 ? 27.012  22.918  9.495   1.00 59.13 ? 337  TYR A CD2 1 
ATOM   2548 C  CE1 . TYR A 1 337 ? 25.704  24.125  11.651  1.00 63.54 ? 337  TYR A CE1 1 
ATOM   2549 C  CE2 . TYR A 1 337 ? 27.753  23.363  10.602  1.00 65.24 ? 337  TYR A CE2 1 
ATOM   2550 C  CZ  . TYR A 1 337 ? 27.090  23.975  11.687  1.00 66.68 ? 337  TYR A CZ  1 
ATOM   2551 O  OH  . TYR A 1 337 ? 27.823  24.456  12.775  1.00 69.05 ? 337  TYR A OH  1 
ATOM   2552 N  N   . PHE A 1 338 ? 26.712  22.621  5.830   1.00 43.76 ? 338  PHE A N   1 
ATOM   2553 C  CA  . PHE A 1 338 ? 28.050  22.543  5.266   1.00 43.35 ? 338  PHE A CA  1 
ATOM   2554 C  C   . PHE A 1 338 ? 28.373  23.425  4.072   1.00 43.76 ? 338  PHE A C   1 
ATOM   2555 O  O   . PHE A 1 338 ? 29.537  23.755  3.839   1.00 43.06 ? 338  PHE A O   1 
ATOM   2556 C  CB  . PHE A 1 338 ? 28.373  21.086  4.918   1.00 42.62 ? 338  PHE A CB  1 
ATOM   2557 C  CG  . PHE A 1 338 ? 28.311  20.155  6.107   1.00 42.61 ? 338  PHE A CG  1 
ATOM   2558 C  CD1 . PHE A 1 338 ? 27.114  19.538  6.468   1.00 41.58 ? 338  PHE A CD1 1 
ATOM   2559 C  CD2 . PHE A 1 338 ? 29.436  19.945  6.900   1.00 39.92 ? 338  PHE A CD2 1 
ATOM   2560 C  CE1 . PHE A 1 338 ? 27.049  18.726  7.614   1.00 42.50 ? 338  PHE A CE1 1 
ATOM   2561 C  CE2 . PHE A 1 338 ? 29.372  19.142  8.029   1.00 39.36 ? 338  PHE A CE2 1 
ATOM   2562 C  CZ  . PHE A 1 338 ? 28.178  18.531  8.391   1.00 38.35 ? 338  PHE A CZ  1 
ATOM   2563 N  N   . LEU A 1 339 ? 27.347  23.818  3.332   1.00 42.56 ? 339  LEU A N   1 
ATOM   2564 C  CA  . LEU A 1 339 ? 27.542  24.633  2.153   1.00 42.15 ? 339  LEU A CA  1 
ATOM   2565 C  C   . LEU A 1 339 ? 28.174  25.988  2.447   1.00 42.72 ? 339  LEU A C   1 
ATOM   2566 O  O   . LEU A 1 339 ? 28.984  26.483  1.665   1.00 43.93 ? 339  LEU A O   1 
ATOM   2567 C  CB  . LEU A 1 339 ? 26.204  24.821  1.422   1.00 39.35 ? 339  LEU A CB  1 
ATOM   2568 C  CG  . LEU A 1 339 ? 25.479  23.539  1.004   1.00 36.92 ? 339  LEU A CG  1 
ATOM   2569 C  CD1 . LEU A 1 339 ? 24.287  23.888  0.126   1.00 37.27 ? 339  LEU A CD1 1 
ATOM   2570 C  CD2 . LEU A 1 339 ? 26.434  22.620  0.243   1.00 35.62 ? 339  LEU A CD2 1 
ATOM   2571 N  N   . VAL A 1 340 ? 27.828  26.591  3.574   1.00 44.09 ? 340  VAL A N   1 
ATOM   2572 C  CA  . VAL A 1 340 ? 28.375  27.910  3.896   1.00 44.74 ? 340  VAL A CA  1 
ATOM   2573 C  C   . VAL A 1 340 ? 29.823  27.872  4.360   1.00 45.99 ? 340  VAL A C   1 
ATOM   2574 O  O   . VAL A 1 340 ? 30.430  28.922  4.583   1.00 45.72 ? 340  VAL A O   1 
ATOM   2575 C  CB  . VAL A 1 340 ? 27.549  28.623  4.986   1.00 43.42 ? 340  VAL A CB  1 
ATOM   2576 C  CG1 . VAL A 1 340 ? 26.113  28.730  4.546   1.00 42.32 ? 340  VAL A CG1 1 
ATOM   2577 C  CG2 . VAL A 1 340 ? 27.653  27.858  6.300   1.00 43.16 ? 340  VAL A CG2 1 
ATOM   2578 N  N   . TYR A 1 341 ? 30.365  26.671  4.529   1.00 47.12 ? 341  TYR A N   1 
ATOM   2579 C  CA  . TYR A 1 341 ? 31.761  26.525  4.945   1.00 49.44 ? 341  TYR A CA  1 
ATOM   2580 C  C   . TYR A 1 341 ? 32.721  26.234  3.785   1.00 49.67 ? 341  TYR A C   1 
ATOM   2581 O  O   . TYR A 1 341 ? 33.743  25.589  3.985   1.00 51.38 ? 341  TYR A O   1 
ATOM   2582 C  CB  . TYR A 1 341 ? 31.913  25.412  5.998   1.00 49.57 ? 341  TYR A CB  1 
ATOM   2583 C  CG  . TYR A 1 341 ? 31.465  25.822  7.374   1.00 50.20 ? 341  TYR A CG  1 
ATOM   2584 C  CD1 . TYR A 1 341 ? 30.114  25.803  7.727   1.00 49.23 ? 341  TYR A CD1 1 
ATOM   2585 C  CD2 . TYR A 1 341 ? 32.391  26.297  8.310   1.00 50.60 ? 341  TYR A CD2 1 
ATOM   2586 C  CE1 . TYR A 1 341 ? 29.693  26.260  8.982   1.00 50.98 ? 341  TYR A CE1 1 
ATOM   2587 C  CE2 . TYR A 1 341 ? 31.980  26.752  9.563   1.00 50.63 ? 341  TYR A CE2 1 
ATOM   2588 C  CZ  . TYR A 1 341 ? 30.628  26.730  9.891   1.00 51.13 ? 341  TYR A CZ  1 
ATOM   2589 O  OH  . TYR A 1 341 ? 30.218  27.177  11.126  1.00 53.89 ? 341  TYR A OH  1 
ATOM   2590 N  N   . GLY A 1 342 ? 32.408  26.690  2.579   1.00 50.41 ? 342  GLY A N   1 
ATOM   2591 C  CA  . GLY A 1 342 ? 33.333  26.432  1.494   1.00 50.67 ? 342  GLY A CA  1 
ATOM   2592 C  C   . GLY A 1 342 ? 32.809  26.347  0.074   1.00 50.94 ? 342  GLY A C   1 
ATOM   2593 O  O   . GLY A 1 342 ? 33.611  26.241  -0.856  1.00 53.16 ? 342  GLY A O   1 
ATOM   2594 N  N   . VAL A 1 343 ? 31.496  26.340  -0.128  1.00 49.41 ? 343  VAL A N   1 
ATOM   2595 C  CA  . VAL A 1 343 ? 31.003  26.315  -1.498  1.00 47.80 ? 343  VAL A CA  1 
ATOM   2596 C  C   . VAL A 1 343 ? 30.701  27.765  -1.891  1.00 47.44 ? 343  VAL A C   1 
ATOM   2597 O  O   . VAL A 1 343 ? 29.887  28.445  -1.260  1.00 46.24 ? 343  VAL A O   1 
ATOM   2598 C  CB  . VAL A 1 343 ? 29.739  25.457  -1.654  1.00 47.91 ? 343  VAL A CB  1 
ATOM   2599 C  CG1 . VAL A 1 343 ? 29.258  25.507  -3.127  1.00 46.38 ? 343  VAL A CG1 1 
ATOM   2600 C  CG2 . VAL A 1 343 ? 30.046  24.012  -1.254  1.00 47.92 ? 343  VAL A CG2 1 
ATOM   2601 N  N   . PRO A 1 344 ? 31.384  28.270  -2.918  1.00 46.43 ? 344  PRO A N   1 
ATOM   2602 C  CA  . PRO A 1 344 ? 31.163  29.655  -3.361  1.00 47.49 ? 344  PRO A CA  1 
ATOM   2603 C  C   . PRO A 1 344 ? 29.709  29.891  -3.738  1.00 47.27 ? 344  PRO A C   1 
ATOM   2604 O  O   . PRO A 1 344 ? 29.109  29.087  -4.457  1.00 44.40 ? 344  PRO A O   1 
ATOM   2605 C  CB  . PRO A 1 344 ? 32.094  29.800  -4.563  1.00 46.35 ? 344  PRO A CB  1 
ATOM   2606 C  CG  . PRO A 1 344 ? 33.211  28.870  -4.217  1.00 48.29 ? 344  PRO A CG  1 
ATOM   2607 C  CD  . PRO A 1 344 ? 32.484  27.644  -3.654  1.00 47.12 ? 344  PRO A CD  1 
ATOM   2608 N  N   . GLY A 1 345 ? 29.154  30.989  -3.225  1.00 46.87 ? 345  GLY A N   1 
ATOM   2609 C  CA  . GLY A 1 345 ? 27.779  31.328  -3.526  1.00 45.99 ? 345  GLY A CA  1 
ATOM   2610 C  C   . GLY A 1 345 ? 26.834  31.100  -2.376  1.00 45.19 ? 345  GLY A C   1 
ATOM   2611 O  O   . GLY A 1 345 ? 25.721  31.605  -2.404  1.00 45.19 ? 345  GLY A O   1 
ATOM   2612 N  N   . PHE A 1 346 ? 27.265  30.349  -1.365  1.00 44.69 ? 346  PHE A N   1 
ATOM   2613 C  CA  . PHE A 1 346 ? 26.417  30.068  -0.219  1.00 44.71 ? 346  PHE A CA  1 
ATOM   2614 C  C   . PHE A 1 346 ? 26.780  30.890  0.992   1.00 46.69 ? 346  PHE A C   1 
ATOM   2615 O  O   . PHE A 1 346 ? 27.952  31.034  1.349   1.00 48.61 ? 346  PHE A O   1 
ATOM   2616 C  CB  . PHE A 1 346 ? 26.452  28.581  0.128   1.00 41.69 ? 346  PHE A CB  1 
ATOM   2617 C  CG  . PHE A 1 346 ? 25.795  27.709  -0.911  1.00 40.57 ? 346  PHE A CG  1 
ATOM   2618 C  CD1 . PHE A 1 346 ? 26.486  27.334  -2.061  1.00 40.25 ? 346  PHE A CD1 1 
ATOM   2619 C  CD2 . PHE A 1 346 ? 24.471  27.294  -0.749  1.00 38.86 ? 346  PHE A CD2 1 
ATOM   2620 C  CE1 . PHE A 1 346 ? 25.868  26.553  -3.045  1.00 42.33 ? 346  PHE A CE1 1 
ATOM   2621 C  CE2 . PHE A 1 346 ? 23.843  26.531  -1.703  1.00 40.19 ? 346  PHE A CE2 1 
ATOM   2622 C  CZ  . PHE A 1 346 ? 24.539  26.152  -2.869  1.00 42.53 ? 346  PHE A CZ  1 
ATOM   2623 N  N   . SER A 1 347 ? 25.751  31.428  1.627   1.00 48.39 ? 347  SER A N   1 
ATOM   2624 C  CA  . SER A 1 347 ? 25.914  32.263  2.813   1.00 51.22 ? 347  SER A CA  1 
ATOM   2625 C  C   . SER A 1 347 ? 24.697  32.133  3.703   1.00 50.65 ? 347  SER A C   1 
ATOM   2626 O  O   . SER A 1 347 ? 23.616  31.847  3.221   1.00 53.08 ? 347  SER A O   1 
ATOM   2627 C  CB  . SER A 1 347 ? 26.072  33.733  2.413   1.00 50.97 ? 347  SER A CB  1 
ATOM   2628 O  OG  . SER A 1 347 ? 25.978  34.557  3.562   1.00 54.80 ? 347  SER A OG  1 
ATOM   2629 N  N   . LYS A 1 348 ? 24.857  32.340  4.999   1.00 51.22 ? 348  LYS A N   1 
ATOM   2630 C  CA  . LYS A 1 348 ? 23.710  32.230  5.878   1.00 51.38 ? 348  LYS A CA  1 
ATOM   2631 C  C   . LYS A 1 348 ? 22.935  33.529  5.827   1.00 51.05 ? 348  LYS A C   1 
ATOM   2632 O  O   . LYS A 1 348 ? 21.796  33.592  6.283   1.00 48.66 ? 348  LYS A O   1 
ATOM   2633 C  CB  . LYS A 1 348 ? 24.152  31.971  7.319   1.00 51.03 ? 348  LYS A CB  1 
ATOM   2634 C  CG  . LYS A 1 348 ? 24.547  33.225  8.101   1.00 51.37 ? 348  LYS A CG  1 
ATOM   2635 C  CD  . LYS A 1 348 ? 24.954  32.865  9.523   1.00 52.12 ? 348  LYS A CD  1 
ATOM   2636 C  CE  . LYS A 1 348 ? 25.383  34.079  10.297  1.00 53.10 ? 348  LYS A CE  1 
ATOM   2637 N  NZ  . LYS A 1 348 ? 24.261  35.052  10.451  1.00 56.00 ? 348  LYS A NZ  1 
ATOM   2638 N  N   . ASP A 1 349 ? 23.558  34.562  5.262   1.00 51.70 ? 349  ASP A N   1 
ATOM   2639 C  CA  . ASP A 1 349 ? 22.924  35.880  5.214   1.00 53.80 ? 349  ASP A CA  1 
ATOM   2640 C  C   . ASP A 1 349 ? 22.089  36.270  3.993   1.00 55.22 ? 349  ASP A C   1 
ATOM   2641 O  O   . ASP A 1 349 ? 21.511  37.347  3.985   1.00 54.88 ? 349  ASP A O   1 
ATOM   2642 C  CB  . ASP A 1 349 ? 23.968  36.954  5.529   1.00 52.03 ? 349  ASP A CB  1 
ATOM   2643 C  CG  . ASP A 1 349 ? 24.543  36.796  6.930   1.00 51.82 ? 349  ASP A CG  1 
ATOM   2644 O  OD1 . ASP A 1 349 ? 23.735  36.676  7.882   1.00 50.40 ? 349  ASP A OD1 1 
ATOM   2645 O  OD2 . ASP A 1 349 ? 25.790  36.775  7.077   1.00 51.73 ? 349  ASP A OD2 1 
ATOM   2646 N  N   . ASN A 1 350 ? 22.023  35.409  2.976   1.00 57.04 ? 350  ASN A N   1 
ATOM   2647 C  CA  . ASN A 1 350 ? 21.179  35.663  1.815   1.00 59.34 ? 350  ASN A CA  1 
ATOM   2648 C  C   . ASN A 1 350 ? 20.542  34.343  1.392   1.00 59.08 ? 350  ASN A C   1 
ATOM   2649 O  O   . ASN A 1 350 ? 20.834  33.305  1.986   1.00 59.11 ? 350  ASN A O   1 
ATOM   2650 C  CB  . ASN A 1 350 ? 21.949  36.340  0.665   1.00 63.65 ? 350  ASN A CB  1 
ATOM   2651 C  CG  . ASN A 1 350 ? 23.080  35.507  0.118   1.00 69.73 ? 350  ASN A CG  1 
ATOM   2652 O  OD1 . ASN A 1 350 ? 22.981  34.291  0.019   1.00 71.35 ? 350  ASN A OD1 1 
ATOM   2653 N  ND2 . ASN A 1 350 ? 24.153  36.185  -0.283  1.00 77.38 ? 350  ASN A ND2 1 
ATOM   2654 N  N   . GLU A 1 351 ? 19.667  34.381  0.390   1.00 58.26 ? 351  GLU A N   1 
ATOM   2655 C  CA  . GLU A 1 351 ? 18.944  33.191  -0.088  1.00 57.24 ? 351  GLU A CA  1 
ATOM   2656 C  C   . GLU A 1 351 ? 19.785  32.107  -0.729  1.00 54.12 ? 351  GLU A C   1 
ATOM   2657 O  O   . GLU A 1 351 ? 19.317  30.988  -0.952  1.00 51.13 ? 351  GLU A O   1 
ATOM   2658 C  CB  . GLU A 1 351 ? 17.844  33.608  -1.069  1.00 61.08 ? 351  GLU A CB  1 
ATOM   2659 C  CG  . GLU A 1 351 ? 16.772  34.440  -0.417  1.00 66.28 ? 351  GLU A CG  1 
ATOM   2660 C  CD  . GLU A 1 351 ? 16.339  33.827  0.893   1.00 70.71 ? 351  GLU A CD  1 
ATOM   2661 O  OE1 . GLU A 1 351 ? 15.664  32.766  0.871   1.00 74.74 ? 351  GLU A OE1 1 
ATOM   2662 O  OE2 . GLU A 1 351 ? 16.696  34.395  1.949   1.00 73.60 ? 351  GLU A OE2 1 
ATOM   2663 N  N   . SER A 1 352 ? 21.019  32.463  -1.054  1.00 52.61 ? 352  SER A N   1 
ATOM   2664 C  CA  . SER A 1 352 ? 21.960  31.531  -1.650  1.00 51.29 ? 352  SER A CA  1 
ATOM   2665 C  C   . SER A 1 352 ? 21.500  30.921  -2.964  1.00 51.37 ? 352  SER A C   1 
ATOM   2666 O  O   . SER A 1 352 ? 21.824  29.769  -3.254  1.00 50.59 ? 352  SER A O   1 
ATOM   2667 C  CB  . SER A 1 352 ? 22.302  30.405  -0.652  1.00 51.06 ? 352  SER A CB  1 
ATOM   2668 O  OG  . SER A 1 352 ? 23.069  30.888  0.443   1.00 48.81 ? 352  SER A OG  1 
ATOM   2669 N  N   . LEU A 1 353 ? 20.737  31.680  -3.747  1.00 50.93 ? 353  LEU A N   1 
ATOM   2670 C  CA  . LEU A 1 353 ? 20.300  31.206  -5.057  1.00 50.64 ? 353  LEU A CA  1 
ATOM   2671 C  C   . LEU A 1 353 ? 21.570  31.134  -5.894  1.00 48.95 ? 353  LEU A C   1 
ATOM   2672 O  O   . LEU A 1 353 ? 22.297  32.108  -6.009  1.00 51.45 ? 353  LEU A O   1 
ATOM   2673 C  CB  . LEU A 1 353 ? 19.318  32.193  -5.686  1.00 50.70 ? 353  LEU A CB  1 
ATOM   2674 C  CG  . LEU A 1 353 ? 18.021  32.352  -4.889  1.00 52.28 ? 353  LEU A CG  1 
ATOM   2675 C  CD1 . LEU A 1 353 ? 17.071  33.223  -5.686  1.00 51.05 ? 353  LEU A CD1 1 
ATOM   2676 C  CD2 . LEU A 1 353 ? 17.395  30.991  -4.631  1.00 50.50 ? 353  LEU A CD2 1 
ATOM   2677 N  N   . ILE A 1 354 ? 21.858  29.987  -6.476  1.00 46.82 ? 354  ILE A N   1 
ATOM   2678 C  CA  . ILE A 1 354 ? 23.083  29.869  -7.240  1.00 43.99 ? 354  ILE A CA  1 
ATOM   2679 C  C   . ILE A 1 354 ? 22.876  29.565  -8.712  1.00 44.86 ? 354  ILE A C   1 
ATOM   2680 O  O   . ILE A 1 354 ? 21.808  29.138  -9.136  1.00 46.59 ? 354  ILE A O   1 
ATOM   2681 C  CB  . ILE A 1 354 ? 24.012  28.771  -6.631  1.00 43.36 ? 354  ILE A CB  1 
ATOM   2682 C  CG1 . ILE A 1 354 ? 23.256  27.445  -6.506  1.00 38.09 ? 354  ILE A CG1 1 
ATOM   2683 C  CG2 . ILE A 1 354 ? 24.536  29.212  -5.283  1.00 40.77 ? 354  ILE A CG2 1 
ATOM   2684 C  CD1 . ILE A 1 354 ? 24.127  26.244  -6.653  1.00 36.36 ? 354  ILE A CD1 1 
ATOM   2685 N  N   . SER A 1 355 ? 23.929  29.776  -9.485  1.00 45.63 ? 355  SER A N   1 
ATOM   2686 C  CA  . SER A 1 355 ? 23.912  29.545  -10.923 1.00 47.52 ? 355  SER A CA  1 
ATOM   2687 C  C   . SER A 1 355 ? 24.255  28.095  -11.200 1.00 47.95 ? 355  SER A C   1 
ATOM   2688 O  O   . SER A 1 355 ? 24.758  27.384  -10.325 1.00 46.86 ? 355  SER A O   1 
ATOM   2689 C  CB  . SER A 1 355 ? 24.972  30.406  -11.604 1.00 48.11 ? 355  SER A CB  1 
ATOM   2690 O  OG  . SER A 1 355 ? 26.281  29.905  -11.316 1.00 49.94 ? 355  SER A OG  1 
ATOM   2691 N  N   . ARG A 1 356 ? 24.024  27.666  -12.429 1.00 47.40 ? 356  ARG A N   1 
ATOM   2692 C  CA  . ARG A 1 356 ? 24.346  26.302  -12.771 1.00 49.33 ? 356  ARG A CA  1 
ATOM   2693 C  C   . ARG A 1 356 ? 25.858  26.084  -12.689 1.00 49.65 ? 356  ARG A C   1 
ATOM   2694 O  O   . ARG A 1 356 ? 26.328  25.015  -12.301 1.00 50.13 ? 356  ARG A O   1 
ATOM   2695 C  CB  . ARG A 1 356 ? 23.850  25.970  -14.175 1.00 50.94 ? 356  ARG A CB  1 
ATOM   2696 C  CG  . ARG A 1 356 ? 24.172  24.553  -14.558 1.00 52.37 ? 356  ARG A CG  1 
ATOM   2697 C  CD  . ARG A 1 356 ? 23.345  24.044  -15.702 1.00 53.55 ? 356  ARG A CD  1 
ATOM   2698 N  NE  . ARG A 1 356 ? 23.614  22.620  -15.852 1.00 56.14 ? 356  ARG A NE  1 
ATOM   2699 C  CZ  . ARG A 1 356 ? 23.070  21.663  -15.101 1.00 53.99 ? 356  ARG A CZ  1 
ATOM   2700 N  NH1 . ARG A 1 356 ? 22.211  21.962  -14.137 1.00 54.32 ? 356  ARG A NH1 1 
ATOM   2701 N  NH2 . ARG A 1 356 ? 23.390  20.402  -15.325 1.00 53.32 ? 356  ARG A NH2 1 
ATOM   2702 N  N   . ALA A 1 357 ? 26.628  27.099  -13.059 1.00 49.84 ? 357  ALA A N   1 
ATOM   2703 C  CA  . ALA A 1 357 ? 28.080  26.977  -12.999 1.00 49.01 ? 357  ALA A CA  1 
ATOM   2704 C  C   . ALA A 1 357 ? 28.540  26.802  -11.540 1.00 47.96 ? 357  ALA A C   1 
ATOM   2705 O  O   . ALA A 1 357 ? 29.420  25.995  -11.251 1.00 47.30 ? 357  ALA A O   1 
ATOM   2706 C  CB  . ALA A 1 357 ? 28.757  28.214  -13.630 1.00 46.73 ? 357  ALA A CB  1 
ATOM   2707 N  N   . GLN A 1 358 ? 27.960  27.576  -10.630 1.00 46.57 ? 358  GLN A N   1 
ATOM   2708 C  CA  . GLN A 1 358 ? 28.319  27.469  -9.225  1.00 44.82 ? 358  GLN A CA  1 
ATOM   2709 C  C   . GLN A 1 358 ? 27.991  26.064  -8.730  1.00 45.45 ? 358  GLN A C   1 
ATOM   2710 O  O   . GLN A 1 358 ? 28.718  25.501  -7.909  1.00 45.25 ? 358  GLN A O   1 
ATOM   2711 C  CB  . GLN A 1 358 ? 27.577  28.525  -8.400  1.00 44.16 ? 358  GLN A CB  1 
ATOM   2712 C  CG  . GLN A 1 358 ? 28.086  29.937  -8.645  1.00 46.12 ? 358  GLN A CG  1 
ATOM   2713 C  CD  . GLN A 1 358 ? 27.306  31.003  -7.899  1.00 48.12 ? 358  GLN A CD  1 
ATOM   2714 O  OE1 . GLN A 1 358 ? 26.088  31.083  -8.018  1.00 52.35 ? 358  GLN A OE1 1 
ATOM   2715 N  NE2 . GLN A 1 358 ? 28.006  31.837  -7.135  1.00 46.49 ? 358  GLN A NE2 1 
ATOM   2716 N  N   . PHE A 1 359 ? 26.903  25.495  -9.249  1.00 45.02 ? 359  PHE A N   1 
ATOM   2717 C  CA  . PHE A 1 359 ? 26.484  24.153  -8.904  1.00 43.82 ? 359  PHE A CA  1 
ATOM   2718 C  C   . PHE A 1 359 ? 27.546  23.132  -9.316  1.00 44.98 ? 359  PHE A C   1 
ATOM   2719 O  O   . PHE A 1 359 ? 27.964  22.310  -8.506  1.00 44.13 ? 359  PHE A O   1 
ATOM   2720 C  CB  . PHE A 1 359 ? 25.166  23.814  -9.603  1.00 43.60 ? 359  PHE A CB  1 
ATOM   2721 C  CG  . PHE A 1 359 ? 24.663  22.423  -9.316  1.00 42.27 ? 359  PHE A CG  1 
ATOM   2722 C  CD1 . PHE A 1 359 ? 24.339  21.564  -10.349 1.00 42.20 ? 359  PHE A CD1 1 
ATOM   2723 C  CD2 . PHE A 1 359 ? 24.515  21.977  -8.007  1.00 43.62 ? 359  PHE A CD2 1 
ATOM   2724 C  CE1 . PHE A 1 359 ? 23.878  20.275  -10.095 1.00 43.83 ? 359  PHE A CE1 1 
ATOM   2725 C  CE2 . PHE A 1 359 ? 24.048  20.680  -7.729  1.00 42.96 ? 359  PHE A CE2 1 
ATOM   2726 C  CZ  . PHE A 1 359 ? 23.732  19.832  -8.771  1.00 43.70 ? 359  PHE A CZ  1 
ATOM   2727 N  N   . LEU A 1 360 ? 27.984  23.170  -10.572 1.00 45.25 ? 360  LEU A N   1 
ATOM   2728 C  CA  . LEU A 1 360 ? 28.981  22.203  -11.010 1.00 47.18 ? 360  LEU A CA  1 
ATOM   2729 C  C   . LEU A 1 360 ? 30.250  22.343  -10.189 1.00 47.88 ? 360  LEU A C   1 
ATOM   2730 O  O   . LEU A 1 360 ? 30.925  21.338  -9.907  1.00 48.73 ? 360  LEU A O   1 
ATOM   2731 C  CB  . LEU A 1 360 ? 29.333  22.369  -12.489 1.00 49.02 ? 360  LEU A CB  1 
ATOM   2732 C  CG  . LEU A 1 360 ? 28.207  22.532  -13.521 1.00 52.84 ? 360  LEU A CG  1 
ATOM   2733 C  CD1 . LEU A 1 360 ? 28.813  22.351  -14.932 1.00 53.21 ? 360  LEU A CD1 1 
ATOM   2734 C  CD2 . LEU A 1 360 ? 27.082  21.538  -13.292 1.00 52.04 ? 360  LEU A CD2 1 
ATOM   2735 N  N   . ALA A 1 361 ? 30.590  23.579  -9.820  1.00 44.49 ? 361  ALA A N   1 
ATOM   2736 C  CA  . ALA A 1 361 ? 31.774  23.806  -9.015  1.00 44.65 ? 361  ALA A CA  1 
ATOM   2737 C  C   . ALA A 1 361 ? 31.558  23.303  -7.574  1.00 46.30 ? 361  ALA A C   1 
ATOM   2738 O  O   . ALA A 1 361 ? 32.477  22.754  -6.964  1.00 46.51 ? 361  ALA A O   1 
ATOM   2739 C  CB  . ALA A 1 361 ? 32.131  25.264  -9.006  1.00 43.08 ? 361  ALA A CB  1 
ATOM   2740 N  N   . GLY A 1 362 ? 30.349  23.491  -7.038  1.00 45.33 ? 362  GLY A N   1 
ATOM   2741 C  CA  . GLY A 1 362 ? 30.048  23.027  -5.691  1.00 43.02 ? 362  GLY A CA  1 
ATOM   2742 C  C   . GLY A 1 362 ? 30.149  21.507  -5.598  1.00 43.20 ? 362  GLY A C   1 
ATOM   2743 O  O   . GLY A 1 362 ? 30.598  20.968  -4.600  1.00 41.46 ? 362  GLY A O   1 
ATOM   2744 N  N   . VAL A 1 363 ? 29.736  20.819  -6.653  1.00 42.65 ? 363  VAL A N   1 
ATOM   2745 C  CA  . VAL A 1 363 ? 29.790  19.377  -6.698  1.00 42.99 ? 363  VAL A CA  1 
ATOM   2746 C  C   . VAL A 1 363 ? 31.230  18.882  -6.603  1.00 45.77 ? 363  VAL A C   1 
ATOM   2747 O  O   . VAL A 1 363 ? 31.491  17.852  -5.966  1.00 46.36 ? 363  VAL A O   1 
ATOM   2748 C  CB  . VAL A 1 363 ? 29.141  18.855  -7.999  1.00 42.12 ? 363  VAL A CB  1 
ATOM   2749 C  CG1 . VAL A 1 363 ? 29.378  17.358  -8.168  1.00 39.31 ? 363  VAL A CG1 1 
ATOM   2750 C  CG2 . VAL A 1 363 ? 27.633  19.161  -7.976  1.00 39.42 ? 363  VAL A CG2 1 
ATOM   2751 N  N   . ARG A 1 364 ? 32.175  19.596  -7.214  1.00 46.20 ? 364  ARG A N   1 
ATOM   2752 C  CA  . ARG A 1 364 ? 33.566  19.148  -7.133  1.00 47.14 ? 364  ARG A CA  1 
ATOM   2753 C  C   . ARG A 1 364 ? 34.085  19.294  -5.707  1.00 47.72 ? 364  ARG A C   1 
ATOM   2754 O  O   . ARG A 1 364 ? 34.928  18.518  -5.262  1.00 48.04 ? 364  ARG A O   1 
ATOM   2755 C  CB  . ARG A 1 364 ? 34.487  19.924  -8.085  1.00 48.83 ? 364  ARG A CB  1 
ATOM   2756 C  CG  . ARG A 1 364 ? 34.195  19.733  -9.571  1.00 49.19 ? 364  ARG A CG  1 
ATOM   2757 C  CD  . ARG A 1 364 ? 33.755  18.314  -9.869  1.00 53.30 ? 364  ARG A CD  1 
ATOM   2758 N  NE  . ARG A 1 364 ? 34.834  17.320  -9.874  1.00 57.11 ? 364  ARG A NE  1 
ATOM   2759 C  CZ  . ARG A 1 364 ? 35.688  17.145  -10.883 1.00 59.03 ? 364  ARG A CZ  1 
ATOM   2760 N  NH1 . ARG A 1 364 ? 35.606  17.910  -11.970 1.00 57.91 ? 364  ARG A NH1 1 
ATOM   2761 N  NH2 . ARG A 1 364 ? 36.587  16.166  -10.827 1.00 58.39 ? 364  ARG A NH2 1 
ATOM   2762 N  N   . ILE A 1 365 ? 33.585  20.292  -4.993  1.00 45.47 ? 365  ILE A N   1 
ATOM   2763 C  CA  . ILE A 1 365 ? 33.991  20.498  -3.621  1.00 45.06 ? 365  ILE A CA  1 
ATOM   2764 C  C   . ILE A 1 365 ? 33.212  19.559  -2.676  1.00 44.97 ? 365  ILE A C   1 
ATOM   2765 O  O   . ILE A 1 365 ? 33.746  19.083  -1.679  1.00 44.78 ? 365  ILE A O   1 
ATOM   2766 C  CB  . ILE A 1 365 ? 33.744  21.950  -3.227  1.00 45.66 ? 365  ILE A CB  1 
ATOM   2767 C  CG1 . ILE A 1 365 ? 34.604  22.863  -4.109  1.00 46.60 ? 365  ILE A CG1 1 
ATOM   2768 C  CG2 . ILE A 1 365 ? 34.062  22.169  -1.756  1.00 42.50 ? 365  ILE A CG2 1 
ATOM   2769 C  CD1 . ILE A 1 365 ? 34.244  24.319  -3.965  1.00 44.69 ? 365  ILE A CD1 1 
ATOM   2770 N  N   . GLY A 1 366 ? 31.955  19.290  -3.016  1.00 45.32 ? 366  GLY A N   1 
ATOM   2771 C  CA  . GLY A 1 366 ? 31.110  18.436  -2.207  1.00 45.16 ? 366  GLY A CA  1 
ATOM   2772 C  C   . GLY A 1 366 ? 31.395  16.958  -2.368  1.00 45.76 ? 366  GLY A C   1 
ATOM   2773 O  O   . GLY A 1 366 ? 31.104  16.175  -1.469  1.00 46.52 ? 366  GLY A O   1 
ATOM   2774 N  N   . VAL A 1 367 ? 31.949  16.563  -3.507  1.00 45.56 ? 367  VAL A N   1 
ATOM   2775 C  CA  . VAL A 1 367 ? 32.275  15.166  -3.741  1.00 44.99 ? 367  VAL A CA  1 
ATOM   2776 C  C   . VAL A 1 367 ? 33.725  15.218  -4.199  1.00 46.70 ? 367  VAL A C   1 
ATOM   2777 O  O   . VAL A 1 367 ? 34.064  14.778  -5.299  1.00 47.06 ? 367  VAL A O   1 
ATOM   2778 C  CB  . VAL A 1 367 ? 31.388  14.592  -4.857  1.00 45.94 ? 367  VAL A CB  1 
ATOM   2779 C  CG1 . VAL A 1 367 ? 31.439  13.055  -4.832  1.00 41.01 ? 367  VAL A CG1 1 
ATOM   2780 C  CG2 . VAL A 1 367 ? 29.962  15.116  -4.695  1.00 42.19 ? 367  VAL A CG2 1 
ATOM   2781 N  N   . PRO A 1 368 ? 34.608  15.737  -3.330  1.00 48.47 ? 368  PRO A N   1 
ATOM   2782 C  CA  . PRO A 1 368 ? 36.043  15.901  -3.584  1.00 48.22 ? 368  PRO A CA  1 
ATOM   2783 C  C   . PRO A 1 368 ? 36.793  14.721  -4.147  1.00 50.80 ? 368  PRO A C   1 
ATOM   2784 O  O   . PRO A 1 368 ? 37.753  14.900  -4.898  1.00 52.27 ? 368  PRO A O   1 
ATOM   2785 C  CB  . PRO A 1 368 ? 36.579  16.377  -2.237  1.00 46.82 ? 368  PRO A CB  1 
ATOM   2786 C  CG  . PRO A 1 368 ? 35.680  15.718  -1.259  1.00 47.43 ? 368  PRO A CG  1 
ATOM   2787 C  CD  . PRO A 1 368 ? 34.313  15.872  -1.884  1.00 47.69 ? 368  PRO A CD  1 
ATOM   2788 N  N   . GLN A 1 369 ? 36.364  13.511  -3.817  1.00 53.29 ? 369  GLN A N   1 
ATOM   2789 C  CA  . GLN A 1 369 ? 37.053  12.324  -4.328  1.00 55.49 ? 369  GLN A CA  1 
ATOM   2790 C  C   . GLN A 1 369 ? 36.528  11.819  -5.674  1.00 56.83 ? 369  GLN A C   1 
ATOM   2791 O  O   . GLN A 1 369 ? 37.008  10.801  -6.178  1.00 57.98 ? 369  GLN A O   1 
ATOM   2792 C  CB  . GLN A 1 369 ? 37.001  11.185  -3.291  1.00 56.08 ? 369  GLN A CB  1 
ATOM   2793 C  CG  . GLN A 1 369 ? 38.081  11.268  -2.182  1.00 57.04 ? 369  GLN A CG  1 
ATOM   2794 C  CD  . GLN A 1 369 ? 37.799  12.338  -1.100  1.00 58.79 ? 369  GLN A CD  1 
ATOM   2795 O  OE1 . GLN A 1 369 ? 36.864  12.206  -0.287  1.00 55.49 ? 369  GLN A OE1 1 
ATOM   2796 N  NE2 . GLN A 1 369 ? 38.614  13.401  -1.093  1.00 58.29 ? 369  GLN A NE2 1 
ATOM   2797 N  N   . ALA A 1 370 ? 35.562  12.530  -6.260  1.00 57.65 ? 370  ALA A N   1 
ATOM   2798 C  CA  . ALA A 1 370 ? 34.975  12.126  -7.540  1.00 58.03 ? 370  ALA A CA  1 
ATOM   2799 C  C   . ALA A 1 370 ? 35.757  12.558  -8.763  1.00 59.04 ? 370  ALA A C   1 
ATOM   2800 O  O   . ALA A 1 370 ? 36.298  13.663  -8.823  1.00 57.68 ? 370  ALA A O   1 
ATOM   2801 C  CB  . ALA A 1 370 ? 33.524  12.646  -7.663  1.00 57.25 ? 370  ALA A CB  1 
ATOM   2802 N  N   . SER A 1 371 ? 35.785  11.669  -9.752  1.00 61.29 ? 371  SER A N   1 
ATOM   2803 C  CA  . SER A 1 371 ? 36.464  11.930  -11.008 1.00 62.43 ? 371  SER A CA  1 
ATOM   2804 C  C   . SER A 1 371 ? 35.579  12.889  -11.795 1.00 63.12 ? 371  SER A C   1 
ATOM   2805 O  O   . SER A 1 371 ? 34.528  13.304  -11.313 1.00 64.12 ? 371  SER A O   1 
ATOM   2806 C  CB  . SER A 1 371 ? 36.649  10.622  -11.782 1.00 63.31 ? 371  SER A CB  1 
ATOM   2807 O  OG  . SER A 1 371 ? 35.409  10.070  -12.211 1.00 64.92 ? 371  SER A OG  1 
ATOM   2808 N  N   . ASP A 1 372 ? 35.999  13.244  -13.000 1.00 62.97 ? 372  ASP A N   1 
ATOM   2809 C  CA  . ASP A 1 372 ? 35.215  14.142  -13.828 1.00 63.05 ? 372  ASP A CA  1 
ATOM   2810 C  C   . ASP A 1 372 ? 33.931  13.444  -14.299 1.00 62.61 ? 372  ASP A C   1 
ATOM   2811 O  O   . ASP A 1 372 ? 32.848  14.040  -14.344 1.00 62.05 ? 372  ASP A O   1 
ATOM   2812 C  CB  . ASP A 1 372 ? 36.061  14.591  -15.020 1.00 64.18 ? 372  ASP A CB  1 
ATOM   2813 C  CG  . ASP A 1 372 ? 37.048  15.673  -14.648 1.00 66.36 ? 372  ASP A CG  1 
ATOM   2814 O  OD1 . ASP A 1 372 ? 37.723  15.536  -13.606 1.00 66.42 ? 372  ASP A OD1 1 
ATOM   2815 O  OD2 . ASP A 1 372 ? 37.150  16.666  -15.401 1.00 69.18 ? 372  ASP A OD2 1 
ATOM   2816 N  N   . LEU A 1 373 ? 34.068  12.170  -14.648 1.00 61.90 ? 373  LEU A N   1 
ATOM   2817 C  CA  . LEU A 1 373 ? 32.942  11.376  -15.109 1.00 60.12 ? 373  LEU A CA  1 
ATOM   2818 C  C   . LEU A 1 373 ? 31.929  11.214  -13.965 1.00 59.83 ? 373  LEU A C   1 
ATOM   2819 O  O   . LEU A 1 373 ? 30.714  11.380  -14.156 1.00 59.45 ? 373  LEU A O   1 
ATOM   2820 C  CB  . LEU A 1 373 ? 33.452  10.010  -15.570 1.00 58.33 ? 373  LEU A CB  1 
ATOM   2821 C  CG  . LEU A 1 373 ? 32.416  9.001   -16.047 1.00 57.47 ? 373  LEU A CG  1 
ATOM   2822 C  CD1 . LEU A 1 373 ? 31.591  9.587   -17.199 1.00 56.82 ? 373  LEU A CD1 1 
ATOM   2823 C  CD2 . LEU A 1 373 ? 33.136  7.747   -16.494 1.00 56.81 ? 373  LEU A CD2 1 
ATOM   2824 N  N   . ALA A 1 374 ? 32.441  10.895  -12.774 1.00 58.46 ? 374  ALA A N   1 
ATOM   2825 C  CA  . ALA A 1 374 ? 31.594  10.715  -11.588 1.00 56.59 ? 374  ALA A CA  1 
ATOM   2826 C  C   . ALA A 1 374 ? 30.882  12.014  -11.222 1.00 54.80 ? 374  ALA A C   1 
ATOM   2827 O  O   . ALA A 1 374 ? 29.689  12.006  -10.916 1.00 54.72 ? 374  ALA A O   1 
ATOM   2828 C  CB  . ALA A 1 374 ? 32.429  10.208  -10.403 1.00 55.41 ? 374  ALA A CB  1 
ATOM   2829 N  N   . ALA A 1 375 ? 31.603  13.132  -11.278 1.00 53.50 ? 375  ALA A N   1 
ATOM   2830 C  CA  . ALA A 1 375 ? 31.005  14.427  -10.959 1.00 53.65 ? 375  ALA A CA  1 
ATOM   2831 C  C   . ALA A 1 375 ? 29.890  14.733  -11.957 1.00 53.98 ? 375  ALA A C   1 
ATOM   2832 O  O   . ALA A 1 375 ? 28.837  15.253  -11.589 1.00 55.70 ? 375  ALA A O   1 
ATOM   2833 C  CB  . ALA A 1 375 ? 32.066  15.535  -11.000 1.00 52.02 ? 375  ALA A CB  1 
ATOM   2834 N  N   . GLU A 1 376 ? 30.114  14.396  -13.220 1.00 53.98 ? 376  GLU A N   1 
ATOM   2835 C  CA  . GLU A 1 376 ? 29.115  14.663  -14.244 1.00 53.89 ? 376  GLU A CA  1 
ATOM   2836 C  C   . GLU A 1 376 ? 27.894  13.811  -13.945 1.00 50.86 ? 376  GLU A C   1 
ATOM   2837 O  O   . GLU A 1 376 ? 26.766  14.272  -14.090 1.00 50.42 ? 376  GLU A O   1 
ATOM   2838 C  CB  . GLU A 1 376 ? 29.689  14.357  -15.639 1.00 57.28 ? 376  GLU A CB  1 
ATOM   2839 C  CG  . GLU A 1 376 ? 28.985  15.083  -16.803 1.00 63.85 ? 376  GLU A CG  1 
ATOM   2840 C  CD  . GLU A 1 376 ? 28.336  16.425  -16.395 1.00 68.73 ? 376  GLU A CD  1 
ATOM   2841 O  OE1 . GLU A 1 376 ? 29.042  17.337  -15.856 1.00 69.03 ? 376  GLU A OE1 1 
ATOM   2842 O  OE2 . GLU A 1 376 ? 27.102  16.559  -16.622 1.00 69.83 ? 376  GLU A OE2 1 
ATOM   2843 N  N   . ALA A 1 377 ? 28.125  12.581  -13.491 1.00 47.87 ? 377  ALA A N   1 
ATOM   2844 C  CA  . ALA A 1 377 ? 27.024  11.678  -13.159 1.00 47.23 ? 377  ALA A CA  1 
ATOM   2845 C  C   . ALA A 1 377 ? 26.156  12.288  -12.053 1.00 46.12 ? 377  ALA A C   1 
ATOM   2846 O  O   . ALA A 1 377 ? 24.916  12.245  -12.109 1.00 44.93 ? 377  ALA A O   1 
ATOM   2847 C  CB  . ALA A 1 377 ? 27.561  10.321  -12.715 1.00 44.79 ? 377  ALA A CB  1 
ATOM   2848 N  N   . VAL A 1 378 ? 26.819  12.877  -11.064 1.00 44.77 ? 378  VAL A N   1 
ATOM   2849 C  CA  . VAL A 1 378 ? 26.119  13.499  -9.949  1.00 42.74 ? 378  VAL A CA  1 
ATOM   2850 C  C   . VAL A 1 378 ? 25.279  14.647  -10.461 1.00 43.67 ? 378  VAL A C   1 
ATOM   2851 O  O   . VAL A 1 378 ? 24.101  14.776  -10.113 1.00 42.51 ? 378  VAL A O   1 
ATOM   2852 C  CB  . VAL A 1 378 ? 27.112  14.054  -8.889  1.00 41.65 ? 378  VAL A CB  1 
ATOM   2853 C  CG1 . VAL A 1 378 ? 26.372  14.919  -7.900  1.00 39.17 ? 378  VAL A CG1 1 
ATOM   2854 C  CG2 . VAL A 1 378 ? 27.819  12.918  -8.173  1.00 38.01 ? 378  VAL A CG2 1 
ATOM   2855 N  N   . VAL A 1 379 ? 25.902  15.486  -11.283 1.00 45.05 ? 379  VAL A N   1 
ATOM   2856 C  CA  . VAL A 1 379 ? 25.235  16.655  -11.847 1.00 46.40 ? 379  VAL A CA  1 
ATOM   2857 C  C   . VAL A 1 379 ? 24.010  16.272  -12.677 1.00 47.18 ? 379  VAL A C   1 
ATOM   2858 O  O   . VAL A 1 379 ? 22.936  16.872  -12.559 1.00 46.08 ? 379  VAL A O   1 
ATOM   2859 C  CB  . VAL A 1 379 ? 26.224  17.462  -12.715 1.00 45.76 ? 379  VAL A CB  1 
ATOM   2860 C  CG1 . VAL A 1 379 ? 25.495  18.580  -13.470 1.00 45.26 ? 379  VAL A CG1 1 
ATOM   2861 C  CG2 . VAL A 1 379 ? 27.284  18.063  -11.823 1.00 47.17 ? 379  VAL A CG2 1 
ATOM   2862 N  N   . LEU A 1 380 ? 24.175  15.253  -13.504 1.00 48.18 ? 380  LEU A N   1 
ATOM   2863 C  CA  . LEU A 1 380 ? 23.090  14.810  -14.355 1.00 50.76 ? 380  LEU A CA  1 
ATOM   2864 C  C   . LEU A 1 380 ? 21.948  14.194  -13.559 1.00 50.76 ? 380  LEU A C   1 
ATOM   2865 O  O   . LEU A 1 380 ? 20.787  14.316  -13.934 1.00 52.14 ? 380  LEU A O   1 
ATOM   2866 C  CB  . LEU A 1 380 ? 23.630  13.828  -15.395 1.00 51.94 ? 380  LEU A CB  1 
ATOM   2867 C  CG  . LEU A 1 380 ? 24.695  14.455  -16.309 1.00 54.19 ? 380  LEU A CG  1 
ATOM   2868 C  CD1 . LEU A 1 380 ? 25.017  13.499  -17.452 1.00 56.04 ? 380  LEU A CD1 1 
ATOM   2869 C  CD2 . LEU A 1 380 ? 24.191  15.792  -16.865 1.00 55.82 ? 380  LEU A CD2 1 
ATOM   2870 N  N   . HIS A 1 381 ? 22.284  13.550  -12.449 1.00 50.72 ? 381  HIS A N   1 
ATOM   2871 C  CA  . HIS A 1 381 ? 21.286  12.922  -11.587 1.00 49.62 ? 381  HIS A CA  1 
ATOM   2872 C  C   . HIS A 1 381 ? 20.499  13.942  -10.752 1.00 48.11 ? 381  HIS A C   1 
ATOM   2873 O  O   . HIS A 1 381 ? 19.291  13.813  -10.564 1.00 47.91 ? 381  HIS A O   1 
ATOM   2874 C  CB  . HIS A 1 381 ? 21.972  11.939  -10.645 1.00 50.29 ? 381  HIS A CB  1 
ATOM   2875 C  CG  . HIS A 1 381 ? 21.024  11.202  -9.763  1.00 52.00 ? 381  HIS A CG  1 
ATOM   2876 N  ND1 . HIS A 1 381 ? 20.424  10.021  -10.138 1.00 53.14 ? 381  HIS A ND1 1 
ATOM   2877 C  CD2 . HIS A 1 381 ? 20.530  11.503  -8.539  1.00 52.56 ? 381  HIS A CD2 1 
ATOM   2878 C  CE1 . HIS A 1 381 ? 19.600  9.625   -9.185  1.00 53.94 ? 381  HIS A CE1 1 
ATOM   2879 N  NE2 . HIS A 1 381 ? 19.645  10.508  -8.203  1.00 55.15 ? 381  HIS A NE2 1 
ATOM   2880 N  N   . TYR A 1 382 ? 21.187  14.963  -10.253 1.00 46.71 ? 382  TYR A N   1 
ATOM   2881 C  CA  . TYR A 1 382 ? 20.532  15.958  -9.418  1.00 45.49 ? 382  TYR A CA  1 
ATOM   2882 C  C   . TYR A 1 382 ? 19.905  17.106  -10.172 1.00 44.61 ? 382  TYR A C   1 
ATOM   2883 O  O   . TYR A 1 382 ? 19.063  17.808  -9.631  1.00 44.41 ? 382  TYR A O   1 
ATOM   2884 C  CB  . TYR A 1 382 ? 21.498  16.478  -8.352  1.00 42.23 ? 382  TYR A CB  1 
ATOM   2885 C  CG  . TYR A 1 382 ? 21.629  15.524  -7.199  1.00 42.33 ? 382  TYR A CG  1 
ATOM   2886 C  CD1 . TYR A 1 382 ? 22.487  14.425  -7.266  1.00 42.87 ? 382  TYR A CD1 1 
ATOM   2887 C  CD2 . TYR A 1 382 ? 20.863  15.695  -6.038  1.00 42.52 ? 382  TYR A CD2 1 
ATOM   2888 C  CE1 . TYR A 1 382 ? 22.585  13.523  -6.218  1.00 42.44 ? 382  TYR A CE1 1 
ATOM   2889 C  CE2 . TYR A 1 382 ? 20.947  14.807  -4.989  1.00 41.50 ? 382  TYR A CE2 1 
ATOM   2890 C  CZ  . TYR A 1 382 ? 21.808  13.724  -5.078  1.00 43.65 ? 382  TYR A CZ  1 
ATOM   2891 O  OH  . TYR A 1 382 ? 21.915  12.852  -4.016  1.00 45.43 ? 382  TYR A OH  1 
ATOM   2892 N  N   . THR A 1 383 ? 20.304  17.298  -11.422 1.00 45.88 ? 383  THR A N   1 
ATOM   2893 C  CA  . THR A 1 383 ? 19.715  18.354  -12.243 1.00 46.19 ? 383  THR A CA  1 
ATOM   2894 C  C   . THR A 1 383 ? 18.241  18.055  -12.468 1.00 47.16 ? 383  THR A C   1 
ATOM   2895 O  O   . THR A 1 383 ? 17.877  16.920  -12.709 1.00 48.59 ? 383  THR A O   1 
ATOM   2896 C  CB  . THR A 1 383 ? 20.404  18.435  -13.634 1.00 45.15 ? 383  THR A CB  1 
ATOM   2897 O  OG1 . THR A 1 383 ? 21.747  18.895  -13.473 1.00 46.49 ? 383  THR A OG1 1 
ATOM   2898 C  CG2 . THR A 1 383 ? 19.683  19.397  -14.552 1.00 42.22 ? 383  THR A CG2 1 
ATOM   2899 N  N   . ASP A 1 384 ? 17.391  19.063  -12.355 1.00 49.85 ? 384  ASP A N   1 
ATOM   2900 C  CA  . ASP A 1 384 ? 15.965  18.896  -12.642 1.00 53.66 ? 384  ASP A CA  1 
ATOM   2901 C  C   . ASP A 1 384 ? 15.864  19.312  -14.115 1.00 54.64 ? 384  ASP A C   1 
ATOM   2902 O  O   . ASP A 1 384 ? 15.866  20.513  -14.425 1.00 53.87 ? 384  ASP A O   1 
ATOM   2903 C  CB  . ASP A 1 384 ? 15.128  19.853  -11.799 1.00 56.29 ? 384  ASP A CB  1 
ATOM   2904 C  CG  . ASP A 1 384 ? 13.750  20.076  -12.383 1.00 60.60 ? 384  ASP A CG  1 
ATOM   2905 O  OD1 . ASP A 1 384 ? 13.358  19.324  -13.306 1.00 59.64 ? 384  ASP A OD1 1 
ATOM   2906 O  OD2 . ASP A 1 384 ? 13.056  21.008  -11.916 1.00 65.12 ? 384  ASP A OD2 1 
ATOM   2907 N  N   . TRP A 1 385 ? 15.759  18.354  -15.033 1.00 54.95 ? 385  TRP A N   1 
ATOM   2908 C  CA  . TRP A 1 385 ? 15.743  18.750  -16.433 1.00 56.24 ? 385  TRP A CA  1 
ATOM   2909 C  C   . TRP A 1 385 ? 14.583  19.585  -16.973 1.00 58.37 ? 385  TRP A C   1 
ATOM   2910 O  O   . TRP A 1 385 ? 14.629  20.042  -18.112 1.00 57.65 ? 385  TRP A O   1 
ATOM   2911 C  CB  . TRP A 1 385 ? 16.051  17.555  -17.325 1.00 54.41 ? 385  TRP A CB  1 
ATOM   2912 C  CG  . TRP A 1 385 ? 17.421  17.017  -17.028 1.00 52.86 ? 385  TRP A CG  1 
ATOM   2913 C  CD1 . TRP A 1 385 ? 17.728  15.969  -16.206 1.00 52.32 ? 385  TRP A CD1 1 
ATOM   2914 C  CD2 . TRP A 1 385 ? 18.671  17.555  -17.470 1.00 51.31 ? 385  TRP A CD2 1 
ATOM   2915 N  NE1 . TRP A 1 385 ? 19.090  15.820  -16.108 1.00 50.56 ? 385  TRP A NE1 1 
ATOM   2916 C  CE2 . TRP A 1 385 ? 19.697  16.780  -16.868 1.00 50.36 ? 385  TRP A CE2 1 
ATOM   2917 C  CE3 . TRP A 1 385 ? 19.028  18.622  -18.305 1.00 52.31 ? 385  TRP A CE3 1 
ATOM   2918 C  CZ2 . TRP A 1 385 ? 21.062  17.032  -17.074 1.00 52.08 ? 385  TRP A CZ2 1 
ATOM   2919 C  CZ3 . TRP A 1 385 ? 20.395  18.885  -18.515 1.00 54.65 ? 385  TRP A CZ3 1 
ATOM   2920 C  CH2 . TRP A 1 385 ? 21.397  18.086  -17.895 1.00 54.87 ? 385  TRP A CH2 1 
ATOM   2921 N  N   . LEU A 1 386 ? 13.578  19.830  -16.143 1.00 60.97 ? 386  LEU A N   1 
ATOM   2922 C  CA  . LEU A 1 386 ? 12.482  20.687  -16.540 1.00 62.99 ? 386  LEU A CA  1 
ATOM   2923 C  C   . LEU A 1 386 ? 12.874  22.145  -16.280 1.00 64.51 ? 386  LEU A C   1 
ATOM   2924 O  O   . LEU A 1 386 ? 12.385  23.046  -16.959 1.00 65.15 ? 386  LEU A O   1 
ATOM   2925 C  CB  . LEU A 1 386 ? 11.214  20.356  -15.761 1.00 64.16 ? 386  LEU A CB  1 
ATOM   2926 C  CG  . LEU A 1 386 ? 10.248  19.507  -16.574 1.00 66.58 ? 386  LEU A CG  1 
ATOM   2927 C  CD1 . LEU A 1 386 ? 8.918   19.463  -15.862 1.00 67.00 ? 386  LEU A CD1 1 
ATOM   2928 C  CD2 . LEU A 1 386 ? 10.089  20.115  -17.988 1.00 66.38 ? 386  LEU A CD2 1 
ATOM   2929 N  N   . HIS A 1 387 ? 13.734  22.375  -15.283 1.00 64.73 ? 387  HIS A N   1 
ATOM   2930 C  CA  . HIS A 1 387 ? 14.197  23.724  -14.949 1.00 64.70 ? 387  HIS A CA  1 
ATOM   2931 C  C   . HIS A 1 387 ? 15.674  23.623  -14.550 1.00 63.93 ? 387  HIS A C   1 
ATOM   2932 O  O   . HIS A 1 387 ? 16.061  23.928  -13.423 1.00 64.12 ? 387  HIS A O   1 
ATOM   2933 C  CB  . HIS A 1 387 ? 13.372  24.311  -13.803 1.00 67.87 ? 387  HIS A CB  1 
ATOM   2934 C  CG  . HIS A 1 387 ? 11.892  24.117  -13.957 1.00 71.92 ? 387  HIS A CG  1 
ATOM   2935 N  ND1 . HIS A 1 387 ? 11.258  22.933  -13.635 1.00 72.29 ? 387  HIS A ND1 1 
ATOM   2936 C  CD2 . HIS A 1 387 ? 10.918  24.959  -14.389 1.00 73.51 ? 387  HIS A CD2 1 
ATOM   2937 C  CE1 . HIS A 1 387 ? 9.960   23.056  -13.858 1.00 73.47 ? 387  HIS A CE1 1 
ATOM   2938 N  NE2 . HIS A 1 387 ? 9.729   24.275  -14.317 1.00 73.37 ? 387  HIS A NE2 1 
ATOM   2939 N  N   . PRO A 1 388 ? 16.527  23.212  -15.499 1.00 62.63 ? 388  PRO A N   1 
ATOM   2940 C  CA  . PRO A 1 388 ? 17.964  23.048  -15.277 1.00 59.93 ? 388  PRO A CA  1 
ATOM   2941 C  C   . PRO A 1 388 ? 18.752  24.266  -14.867 1.00 58.22 ? 388  PRO A C   1 
ATOM   2942 O  O   . PRO A 1 388 ? 19.897  24.140  -14.431 1.00 58.04 ? 388  PRO A O   1 
ATOM   2943 C  CB  . PRO A 1 388 ? 18.452  22.478  -16.601 1.00 60.30 ? 388  PRO A CB  1 
ATOM   2944 C  CG  . PRO A 1 388 ? 17.564  23.145  -17.582 1.00 60.27 ? 388  PRO A CG  1 
ATOM   2945 C  CD  . PRO A 1 388 ? 16.207  23.043  -16.930 1.00 62.11 ? 388  PRO A CD  1 
ATOM   2946 N  N   . GLU A 1 389 ? 18.151  25.441  -14.989 1.00 57.47 ? 389  GLU A N   1 
ATOM   2947 C  CA  . GLU A 1 389 ? 18.848  26.681  -14.650 1.00 56.35 ? 389  GLU A CA  1 
ATOM   2948 C  C   . GLU A 1 389 ? 18.236  27.423  -13.476 1.00 53.50 ? 389  GLU A C   1 
ATOM   2949 O  O   . GLU A 1 389 ? 18.732  28.477  -13.082 1.00 51.45 ? 389  GLU A O   1 
ATOM   2950 C  CB  . GLU A 1 389 ? 18.877  27.614  -15.870 1.00 59.44 ? 389  GLU A CB  1 
ATOM   2951 C  CG  . GLU A 1 389 ? 19.696  27.087  -17.039 1.00 64.62 ? 389  GLU A CG  1 
ATOM   2952 C  CD  . GLU A 1 389 ? 21.167  27.491  -16.956 1.00 69.84 ? 389  GLU A CD  1 
ATOM   2953 O  OE1 . GLU A 1 389 ? 21.686  27.733  -15.838 1.00 72.67 ? 389  GLU A OE1 1 
ATOM   2954 O  OE2 . GLU A 1 389 ? 21.820  27.562  -18.018 1.00 73.04 ? 389  GLU A OE2 1 
ATOM   2955 N  N   . ASP A 1 390 ? 17.151  26.881  -12.932 1.00 51.97 ? 390  ASP A N   1 
ATOM   2956 C  CA  . ASP A 1 390 ? 16.466  27.506  -11.807 1.00 50.28 ? 390  ASP A CA  1 
ATOM   2957 C  C   . ASP A 1 390 ? 17.390  27.570  -10.585 1.00 48.30 ? 390  ASP A C   1 
ATOM   2958 O  O   . ASP A 1 390 ? 17.818  26.554  -10.066 1.00 46.10 ? 390  ASP A O   1 
ATOM   2959 C  CB  . ASP A 1 390 ? 15.212  26.724  -11.457 1.00 51.25 ? 390  ASP A CB  1 
ATOM   2960 C  CG  . ASP A 1 390 ? 14.418  27.404  -10.401 1.00 53.65 ? 390  ASP A CG  1 
ATOM   2961 O  OD1 . ASP A 1 390 ? 13.625  28.286  -10.737 1.00 58.85 ? 390  ASP A OD1 1 
ATOM   2962 O  OD2 . ASP A 1 390 ? 14.604  27.102  -9.220  1.00 56.17 ? 390  ASP A OD2 1 
ATOM   2963 N  N   . PRO A 1 391 ? 17.689  28.780  -10.109 1.00 47.91 ? 391  PRO A N   1 
ATOM   2964 C  CA  . PRO A 1 391 ? 18.563  29.031  -8.959  1.00 47.98 ? 391  PRO A CA  1 
ATOM   2965 C  C   . PRO A 1 391 ? 18.135  28.339  -7.671  1.00 47.46 ? 391  PRO A C   1 
ATOM   2966 O  O   . PRO A 1 391 ? 18.962  27.814  -6.950  1.00 45.70 ? 391  PRO A O   1 
ATOM   2967 C  CB  . PRO A 1 391 ? 18.533  30.555  -8.829  1.00 48.17 ? 391  PRO A CB  1 
ATOM   2968 C  CG  . PRO A 1 391 ? 18.269  31.014  -10.220 1.00 49.43 ? 391  PRO A CG  1 
ATOM   2969 C  CD  . PRO A 1 391 ? 17.212  30.048  -10.681 1.00 48.93 ? 391  PRO A CD  1 
ATOM   2970 N  N   . THR A 1 392 ? 16.839  28.363  -7.385  1.00 47.82 ? 392  THR A N   1 
ATOM   2971 C  CA  . THR A 1 392 ? 16.324  27.745  -6.187  1.00 47.90 ? 392  THR A CA  1 
ATOM   2972 C  C   . THR A 1 392 ? 16.525  26.232  -6.217  1.00 48.59 ? 392  THR A C   1 
ATOM   2973 O  O   . THR A 1 392 ? 16.948  25.647  -5.221  1.00 49.22 ? 392  THR A O   1 
ATOM   2974 C  CB  . THR A 1 392 ? 14.827  28.065  -5.989  1.00 47.56 ? 392  THR A CB  1 
ATOM   2975 O  OG1 . THR A 1 392 ? 14.666  29.461  -5.703  1.00 47.14 ? 392  THR A OG1 1 
ATOM   2976 C  CG2 . THR A 1 392 ? 14.275  27.268  -4.807  1.00 47.67 ? 392  THR A CG2 1 
ATOM   2977 N  N   . HIS A 1 393 ? 16.232  25.592  -7.343  1.00 47.68 ? 393  HIS A N   1 
ATOM   2978 C  CA  . HIS A 1 393 ? 16.413  24.157  -7.397  1.00 49.19 ? 393  HIS A CA  1 
ATOM   2979 C  C   . HIS A 1 393 ? 17.888  23.780  -7.317  1.00 48.43 ? 393  HIS A C   1 
ATOM   2980 O  O   . HIS A 1 393 ? 18.239  22.769  -6.717  1.00 50.36 ? 393  HIS A O   1 
ATOM   2981 C  CB  . HIS A 1 393 ? 15.839  23.548  -8.680  1.00 52.87 ? 393  HIS A CB  1 
ATOM   2982 C  CG  . HIS A 1 393 ? 16.217  22.106  -8.856  1.00 57.61 ? 393  HIS A CG  1 
ATOM   2983 N  ND1 . HIS A 1 393 ? 15.662  21.091  -8.098  1.00 61.77 ? 393  HIS A ND1 1 
ATOM   2984 C  CD2 . HIS A 1 393 ? 17.174  21.523  -9.619  1.00 59.51 ? 393  HIS A CD2 1 
ATOM   2985 C  CE1 . HIS A 1 393 ? 16.265  19.949  -8.385  1.00 60.47 ? 393  HIS A CE1 1 
ATOM   2986 N  NE2 . HIS A 1 393 ? 17.188  20.182  -9.302  1.00 59.94 ? 393  HIS A NE2 1 
ATOM   2987 N  N   . LEU A 1 394 ? 18.750  24.577  -7.944  1.00 45.66 ? 394  LEU A N   1 
ATOM   2988 C  CA  . LEU A 1 394 ? 20.171  24.292  -7.934  1.00 43.65 ? 394  LEU A CA  1 
ATOM   2989 C  C   . LEU A 1 394 ? 20.725  24.392  -6.522  1.00 41.98 ? 394  LEU A C   1 
ATOM   2990 O  O   . LEU A 1 394 ? 21.538  23.571  -6.110  1.00 39.08 ? 394  LEU A O   1 
ATOM   2991 C  CB  . LEU A 1 394 ? 20.930  25.240  -8.878  1.00 42.94 ? 394  LEU A CB  1 
ATOM   2992 C  CG  . LEU A 1 394 ? 20.707  24.975  -10.384 1.00 45.50 ? 394  LEU A CG  1 
ATOM   2993 C  CD1 . LEU A 1 394 ? 21.225  26.168  -11.219 1.00 42.74 ? 394  LEU A CD1 1 
ATOM   2994 C  CD2 . LEU A 1 394 ? 21.381  23.668  -10.798 1.00 41.47 ? 394  LEU A CD2 1 
ATOM   2995 N  N   . ARG A 1 395 ? 20.286  25.410  -5.799  1.00 41.05 ? 395  ARG A N   1 
ATOM   2996 C  CA  . ARG A 1 395 ? 20.699  25.601  -4.434  1.00 42.38 ? 395  ARG A CA  1 
ATOM   2997 C  C   . ARG A 1 395 ? 20.267  24.388  -3.599  1.00 43.92 ? 395  ARG A C   1 
ATOM   2998 O  O   . ARG A 1 395 ? 21.079  23.788  -2.891  1.00 45.05 ? 395  ARG A O   1 
ATOM   2999 C  CB  . ARG A 1 395 ? 20.070  26.860  -3.885  1.00 41.42 ? 395  ARG A CB  1 
ATOM   3000 C  CG  . ARG A 1 395 ? 20.278  27.011  -2.402  1.00 44.18 ? 395  ARG A CG  1 
ATOM   3001 C  CD  . ARG A 1 395 ? 18.944  26.833  -1.702  1.00 45.22 ? 395  ARG A CD  1 
ATOM   3002 N  NE  . ARG A 1 395 ? 18.340  28.125  -1.458  1.00 44.94 ? 395  ARG A NE  1 
ATOM   3003 C  CZ  . ARG A 1 395 ? 17.041  28.349  -1.342  1.00 43.38 ? 395  ARG A CZ  1 
ATOM   3004 N  NH1 . ARG A 1 395 ? 16.161  27.356  -1.449  1.00 35.40 ? 395  ARG A NH1 1 
ATOM   3005 N  NH2 . ARG A 1 395 ? 16.639  29.598  -1.125  1.00 44.51 ? 395  ARG A NH2 1 
ATOM   3006 N  N   . ASP A 1 396 ? 18.998  24.011  -3.698  1.00 43.05 ? 396  ASP A N   1 
ATOM   3007 C  CA  . ASP A 1 396 ? 18.503  22.863  -2.946  1.00 43.44 ? 396  ASP A CA  1 
ATOM   3008 C  C   . ASP A 1 396 ? 19.136  21.555  -3.410  1.00 42.10 ? 396  ASP A C   1 
ATOM   3009 O  O   . ASP A 1 396 ? 19.263  20.602  -2.642  1.00 41.05 ? 396  ASP A O   1 
ATOM   3010 C  CB  . ASP A 1 396 ? 16.975  22.781  -3.051  1.00 42.74 ? 396  ASP A CB  1 
ATOM   3011 C  CG  . ASP A 1 396 ? 16.293  23.968  -2.390  1.00 43.76 ? 396  ASP A CG  1 
ATOM   3012 O  OD1 . ASP A 1 396 ? 16.952  24.645  -1.572  1.00 45.68 ? 396  ASP A OD1 1 
ATOM   3013 O  OD2 . ASP A 1 396 ? 15.109  24.227  -2.669  1.00 45.53 ? 396  ASP A OD2 1 
ATOM   3014 N  N   . ALA A 1 397 ? 19.542  21.503  -4.668  1.00 40.52 ? 397  ALA A N   1 
ATOM   3015 C  CA  . ALA A 1 397 ? 20.159  20.273  -5.166  1.00 40.45 ? 397  ALA A CA  1 
ATOM   3016 C  C   . ALA A 1 397 ? 21.582  20.103  -4.624  1.00 40.69 ? 397  ALA A C   1 
ATOM   3017 O  O   . ALA A 1 397 ? 22.033  18.978  -4.363  1.00 42.54 ? 397  ALA A O   1 
ATOM   3018 C  CB  . ALA A 1 397 ? 20.173  20.266  -6.682  1.00 38.47 ? 397  ALA A CB  1 
ATOM   3019 N  N   . MET A 1 398 ? 22.283  21.220  -4.457  1.00 38.71 ? 398  MET A N   1 
ATOM   3020 C  CA  . MET A 1 398 ? 23.640  21.220  -3.929  1.00 38.45 ? 398  MET A CA  1 
ATOM   3021 C  C   . MET A 1 398 ? 23.595  20.699  -2.470  1.00 39.16 ? 398  MET A C   1 
ATOM   3022 O  O   . MET A 1 398 ? 24.496  19.976  -2.007  1.00 36.91 ? 398  MET A O   1 
ATOM   3023 C  CB  . MET A 1 398 ? 24.200  22.650  -3.937  1.00 37.35 ? 398  MET A CB  1 
ATOM   3024 C  CG  . MET A 1 398 ? 25.679  22.757  -3.572  1.00 37.48 ? 398  MET A CG  1 
ATOM   3025 S  SD  . MET A 1 398 ? 26.686  21.880  -4.796  1.00 40.51 ? 398  MET A SD  1 
ATOM   3026 C  CE  . MET A 1 398 ? 27.392  20.557  -3.750  1.00 35.85 ? 398  MET A CE  1 
ATOM   3027 N  N   . SER A 1 399 ? 22.557  21.120  -1.753  1.00 37.15 ? 399  SER A N   1 
ATOM   3028 C  CA  . SER A 1 399 ? 22.367  20.710  -0.380  1.00 38.34 ? 399  SER A CA  1 
ATOM   3029 C  C   . SER A 1 399 ? 22.129  19.197  -0.342  1.00 38.01 ? 399  SER A C   1 
ATOM   3030 O  O   . SER A 1 399 ? 22.763  18.485  0.433   1.00 38.23 ? 399  SER A O   1 
ATOM   3031 C  CB  . SER A 1 399 ? 21.180  21.453  0.206   1.00 36.06 ? 399  SER A CB  1 
ATOM   3032 O  OG  . SER A 1 399 ? 20.922  20.985  1.502   1.00 38.65 ? 399  SER A OG  1 
ATOM   3033 N  N   . ALA A 1 400 ? 21.243  18.716  -1.213  1.00 38.26 ? 400  ALA A N   1 
ATOM   3034 C  CA  . ALA A 1 400 ? 20.918  17.288  -1.295  1.00 37.92 ? 400  ALA A CA  1 
ATOM   3035 C  C   . ALA A 1 400 ? 22.133  16.423  -1.635  1.00 38.36 ? 400  ALA A C   1 
ATOM   3036 O  O   . ALA A 1 400 ? 22.317  15.340  -1.078  1.00 38.86 ? 400  ALA A O   1 
ATOM   3037 C  CB  . ALA A 1 400 ? 19.832  17.066  -2.327  1.00 35.28 ? 400  ALA A CB  1 
ATOM   3038 N  N   . VAL A 1 401 ? 22.955  16.889  -2.567  1.00 38.54 ? 401  VAL A N   1 
ATOM   3039 C  CA  . VAL A 1 401 ? 24.151  16.145  -2.949  1.00 38.90 ? 401  VAL A CA  1 
ATOM   3040 C  C   . VAL A 1 401 ? 25.025  15.914  -1.717  1.00 39.43 ? 401  VAL A C   1 
ATOM   3041 O  O   . VAL A 1 401 ? 25.406  14.786  -1.417  1.00 41.10 ? 401  VAL A O   1 
ATOM   3042 C  CB  . VAL A 1 401 ? 24.992  16.916  -4.032  1.00 39.25 ? 401  VAL A CB  1 
ATOM   3043 C  CG1 . VAL A 1 401 ? 26.372  16.287  -4.167  1.00 36.30 ? 401  VAL A CG1 1 
ATOM   3044 C  CG2 . VAL A 1 401 ? 24.273  16.887  -5.394  1.00 36.43 ? 401  VAL A CG2 1 
ATOM   3045 N  N   . VAL A 1 402 ? 25.322  16.980  -0.988  1.00 39.19 ? 402  VAL A N   1 
ATOM   3046 C  CA  . VAL A 1 402 ? 26.171  16.870  0.180   1.00 37.94 ? 402  VAL A CA  1 
ATOM   3047 C  C   . VAL A 1 402 ? 25.511  16.014  1.272   1.00 40.36 ? 402  VAL A C   1 
ATOM   3048 O  O   . VAL A 1 402 ? 26.161  15.148  1.874   1.00 40.28 ? 402  VAL A O   1 
ATOM   3049 C  CB  . VAL A 1 402 ? 26.516  18.276  0.677   1.00 38.50 ? 402  VAL A CB  1 
ATOM   3050 C  CG1 . VAL A 1 402 ? 27.270  18.231  2.005   1.00 35.06 ? 402  VAL A CG1 1 
ATOM   3051 C  CG2 . VAL A 1 402 ? 27.359  18.963  -0.380  1.00 34.89 ? 402  VAL A CG2 1 
ATOM   3052 N  N   . GLY A 1 403 ? 24.221  16.235  1.514   1.00 39.62 ? 403  GLY A N   1 
ATOM   3053 C  CA  . GLY A 1 403 ? 23.523  15.453  2.519   1.00 38.18 ? 403  GLY A CA  1 
ATOM   3054 C  C   . GLY A 1 403 ? 23.432  13.975  2.175   1.00 39.42 ? 403  GLY A C   1 
ATOM   3055 O  O   . GLY A 1 403 ? 23.675  13.115  3.035   1.00 38.99 ? 403  GLY A O   1 
ATOM   3056 N  N   . ASP A 1 404 ? 23.095  13.666  0.922   1.00 39.01 ? 404  ASP A N   1 
ATOM   3057 C  CA  . ASP A 1 404 ? 22.954  12.272  0.502   1.00 40.12 ? 404  ASP A CA  1 
ATOM   3058 C  C   . ASP A 1 404 ? 24.269  11.504  0.484   1.00 40.79 ? 404  ASP A C   1 
ATOM   3059 O  O   . ASP A 1 404 ? 24.342  10.361  0.936   1.00 40.36 ? 404  ASP A O   1 
ATOM   3060 C  CB  . ASP A 1 404 ? 22.309  12.181  -0.886  1.00 39.59 ? 404  ASP A CB  1 
ATOM   3061 C  CG  . ASP A 1 404 ? 20.919  12.779  -0.928  1.00 42.69 ? 404  ASP A CG  1 
ATOM   3062 O  OD1 . ASP A 1 404 ? 20.302  12.986  0.158   1.00 43.00 ? 404  ASP A OD1 1 
ATOM   3063 O  OD2 . ASP A 1 404 ? 20.435  13.044  -2.055  1.00 42.98 ? 404  ASP A OD2 1 
ATOM   3064 N  N   . HIS A 1 405 ? 25.306  12.136  -0.047  1.00 41.55 ? 405  HIS A N   1 
ATOM   3065 C  CA  . HIS A 1 405 ? 26.622  11.514  -0.143  1.00 41.12 ? 405  HIS A CA  1 
ATOM   3066 C  C   . HIS A 1 405 ? 27.248  11.237  1.228   1.00 40.86 ? 405  HIS A C   1 
ATOM   3067 O  O   . HIS A 1 405 ? 27.813  10.174  1.450   1.00 40.45 ? 405  HIS A O   1 
ATOM   3068 C  CB  . HIS A 1 405 ? 27.521  12.432  -0.967  1.00 41.00 ? 405  HIS A CB  1 
ATOM   3069 C  CG  . HIS A 1 405 ? 28.960  12.023  -1.016  1.00 39.34 ? 405  HIS A CG  1 
ATOM   3070 N  ND1 . HIS A 1 405 ? 29.378  10.835  -1.574  1.00 40.71 ? 405  HIS A ND1 1 
ATOM   3071 C  CD2 . HIS A 1 405 ? 30.085  12.698  -0.681  1.00 38.34 ? 405  HIS A CD2 1 
ATOM   3072 C  CE1 . HIS A 1 405 ? 30.698  10.799  -1.590  1.00 39.24 ? 405  HIS A CE1 1 
ATOM   3073 N  NE2 . HIS A 1 405 ? 31.152  11.919  -1.054  1.00 40.28 ? 405  HIS A NE2 1 
ATOM   3074 N  N   . ASN A 1 406 ? 27.124  12.188  2.148   1.00 41.18 ? 406  ASN A N   1 
ATOM   3075 C  CA  . ASN A 1 406 ? 27.720  12.065  3.475   1.00 39.70 ? 406  ASN A CA  1 
ATOM   3076 C  C   . ASN A 1 406 ? 26.884  11.431  4.596   1.00 40.68 ? 406  ASN A C   1 
ATOM   3077 O  O   . ASN A 1 406 ? 27.446  10.856  5.526   1.00 39.91 ? 406  ASN A O   1 
ATOM   3078 C  CB  . ASN A 1 406 ? 28.211  13.440  3.962   1.00 36.54 ? 406  ASN A CB  1 
ATOM   3079 C  CG  . ASN A 1 406 ? 29.322  14.026  3.080   1.00 38.86 ? 406  ASN A CG  1 
ATOM   3080 O  OD1 . ASN A 1 406 ? 30.431  13.471  2.974   1.00 37.86 ? 406  ASN A OD1 1 
ATOM   3081 N  ND2 . ASN A 1 406 ? 29.026  15.153  2.441   1.00 33.79 ? 406  ASN A ND2 1 
ATOM   3082 N  N   . VAL A 1 407 ? 25.557  11.520  4.525   1.00 39.91 ? 407  VAL A N   1 
ATOM   3083 C  CA  . VAL A 1 407 ? 24.746  10.985  5.611   1.00 37.59 ? 407  VAL A CA  1 
ATOM   3084 C  C   . VAL A 1 407 ? 23.632  10.042  5.203   1.00 39.44 ? 407  VAL A C   1 
ATOM   3085 O  O   . VAL A 1 407 ? 23.666  8.853   5.540   1.00 39.72 ? 407  VAL A O   1 
ATOM   3086 C  CB  . VAL A 1 407 ? 24.098  12.131  6.452   1.00 36.62 ? 407  VAL A CB  1 
ATOM   3087 C  CG1 . VAL A 1 407 ? 23.290  11.539  7.621   1.00 35.93 ? 407  VAL A CG1 1 
ATOM   3088 C  CG2 . VAL A 1 407 ? 25.172  13.077  6.995   1.00 34.62 ? 407  VAL A CG2 1 
ATOM   3089 N  N   . VAL A 1 408 ? 22.653  10.571  4.468   1.00 39.80 ? 408  VAL A N   1 
ATOM   3090 C  CA  . VAL A 1 408 ? 21.496  9.786   4.071   1.00 40.50 ? 408  VAL A CA  1 
ATOM   3091 C  C   . VAL A 1 408 ? 21.810  8.445   3.424   1.00 41.83 ? 408  VAL A C   1 
ATOM   3092 O  O   . VAL A 1 408 ? 21.360  7.411   3.914   1.00 43.20 ? 408  VAL A O   1 
ATOM   3093 C  CB  . VAL A 1 408 ? 20.538  10.590  3.147   1.00 39.49 ? 408  VAL A CB  1 
ATOM   3094 C  CG1 . VAL A 1 408 ? 19.239  9.833   2.980   1.00 38.78 ? 408  VAL A CG1 1 
ATOM   3095 C  CG2 . VAL A 1 408 ? 20.237  11.937  3.735   1.00 38.42 ? 408  VAL A CG2 1 
ATOM   3096 N  N   . CYS A 1 409 ? 22.592  8.436   2.350   1.00 41.57 ? 409  CYS A N   1 
ATOM   3097 C  CA  . CYS A 1 409 ? 22.875  7.168   1.699   1.00 41.66 ? 409  CYS A CA  1 
ATOM   3098 C  C   . CYS A 1 409 ? 23.787  6.280   2.531   1.00 42.07 ? 409  CYS A C   1 
ATOM   3099 O  O   . CYS A 1 409 ? 23.684  5.063   2.493   1.00 41.97 ? 409  CYS A O   1 
ATOM   3100 C  CB  . CYS A 1 409 ? 23.396  7.422   0.289   1.00 42.45 ? 409  CYS A CB  1 
ATOM   3101 S  SG  . CYS A 1 409 ? 22.072  8.186   -0.728  1.00 43.96 ? 409  CYS A SG  1 
ATOM   3102 N  N   . PRO A 1 410 ? 24.718  6.874   3.284   1.00 43.57 ? 410  PRO A N   1 
ATOM   3103 C  CA  . PRO A 1 410 ? 25.550  5.970   4.090   1.00 42.25 ? 410  PRO A CA  1 
ATOM   3104 C  C   . PRO A 1 410 ? 24.634  5.321   5.158   1.00 42.60 ? 410  PRO A C   1 
ATOM   3105 O  O   . PRO A 1 410 ? 24.772  4.145   5.490   1.00 43.39 ? 410  PRO A O   1 
ATOM   3106 C  CB  . PRO A 1 410 ? 26.591  6.910   4.683   1.00 40.83 ? 410  PRO A CB  1 
ATOM   3107 C  CG  . PRO A 1 410 ? 26.844  7.840   3.525   1.00 40.87 ? 410  PRO A CG  1 
ATOM   3108 C  CD  . PRO A 1 410 ? 25.414  8.157   3.055   1.00 42.95 ? 410  PRO A CD  1 
ATOM   3109 N  N   . VAL A 1 411 ? 23.690  6.088   5.685   1.00 41.21 ? 411  VAL A N   1 
ATOM   3110 C  CA  . VAL A 1 411 ? 22.770  5.545   6.663   1.00 41.47 ? 411  VAL A CA  1 
ATOM   3111 C  C   . VAL A 1 411 ? 21.893  4.445   6.030   1.00 43.25 ? 411  VAL A C   1 
ATOM   3112 O  O   . VAL A 1 411 ? 21.693  3.386   6.620   1.00 43.25 ? 411  VAL A O   1 
ATOM   3113 C  CB  . VAL A 1 411 ? 21.872  6.654   7.257   1.00 40.01 ? 411  VAL A CB  1 
ATOM   3114 C  CG1 . VAL A 1 411 ? 20.701  6.044   8.019   1.00 40.24 ? 411  VAL A CG1 1 
ATOM   3115 C  CG2 . VAL A 1 411 ? 22.683  7.518   8.214   1.00 36.71 ? 411  VAL A CG2 1 
ATOM   3116 N  N   . ALA A 1 412 ? 21.371  4.701   4.835   1.00 43.80 ? 412  ALA A N   1 
ATOM   3117 C  CA  . ALA A 1 412 ? 20.541  3.715   4.135   1.00 44.16 ? 412  ALA A CA  1 
ATOM   3118 C  C   . ALA A 1 412 ? 21.350  2.425   3.923   1.00 44.32 ? 412  ALA A C   1 
ATOM   3119 O  O   . ALA A 1 412 ? 20.853  1.308   4.095   1.00 43.05 ? 412  ALA A O   1 
ATOM   3120 C  CB  . ALA A 1 412 ? 20.095  4.287   2.787   1.00 44.78 ? 412  ALA A CB  1 
ATOM   3121 N  N   . GLN A 1 413 ? 22.611  2.594   3.554   1.00 43.94 ? 413  GLN A N   1 
ATOM   3122 C  CA  . GLN A 1 413 ? 23.507  1.469   3.345   1.00 44.85 ? 413  GLN A CA  1 
ATOM   3123 C  C   . GLN A 1 413 ? 23.591  0.657   4.655   1.00 46.10 ? 413  GLN A C   1 
ATOM   3124 O  O   . GLN A 1 413 ? 23.374  -0.569  4.664   1.00 43.46 ? 413  GLN A O   1 
ATOM   3125 C  CB  . GLN A 1 413 ? 24.871  2.020   2.952   1.00 46.59 ? 413  GLN A CB  1 
ATOM   3126 C  CG  . GLN A 1 413 ? 25.981  1.024   2.780   1.00 51.14 ? 413  GLN A CG  1 
ATOM   3127 C  CD  . GLN A 1 413 ? 25.760  0.090   1.622   1.00 56.01 ? 413  GLN A CD  1 
ATOM   3128 O  OE1 . GLN A 1 413 ? 24.901  0.330   0.756   1.00 59.18 ? 413  GLN A OE1 1 
ATOM   3129 N  NE2 . GLN A 1 413 ? 26.543  -0.993  1.585   1.00 57.61 ? 413  GLN A NE2 1 
ATOM   3130 N  N   . LEU A 1 414 ? 23.904  1.356   5.752   1.00 44.75 ? 414  LEU A N   1 
ATOM   3131 C  CA  . LEU A 1 414 ? 24.015  0.739   7.060   1.00 43.80 ? 414  LEU A CA  1 
ATOM   3132 C  C   . LEU A 1 414 ? 22.714  0.014   7.469   1.00 46.24 ? 414  LEU A C   1 
ATOM   3133 O  O   . LEU A 1 414 ? 22.741  -1.174  7.840   1.00 46.53 ? 414  LEU A O   1 
ATOM   3134 C  CB  . LEU A 1 414 ? 24.366  1.789   8.125   1.00 41.65 ? 414  LEU A CB  1 
ATOM   3135 C  CG  . LEU A 1 414 ? 24.518  1.270   9.566   1.00 40.67 ? 414  LEU A CG  1 
ATOM   3136 C  CD1 . LEU A 1 414 ? 25.663  0.255   9.644   1.00 37.97 ? 414  LEU A CD1 1 
ATOM   3137 C  CD2 . LEU A 1 414 ? 24.800  2.421   10.492  1.00 41.28 ? 414  LEU A CD2 1 
ATOM   3138 N  N   . ALA A 1 415 ? 21.584  0.719   7.409   1.00 45.16 ? 415  ALA A N   1 
ATOM   3139 C  CA  . ALA A 1 415 ? 20.310  0.109   7.801   1.00 46.76 ? 415  ALA A CA  1 
ATOM   3140 C  C   . ALA A 1 415 ? 20.094  -1.190  7.024   1.00 47.84 ? 415  ALA A C   1 
ATOM   3141 O  O   . ALA A 1 415 ? 19.724  -2.215  7.596   1.00 47.96 ? 415  ALA A O   1 
ATOM   3142 C  CB  . ALA A 1 415 ? 19.139  1.084   7.560   1.00 41.82 ? 415  ALA A CB  1 
ATOM   3143 N  N   . GLY A 1 416 ? 20.352  -1.142  5.721   1.00 49.64 ? 416  GLY A N   1 
ATOM   3144 C  CA  . GLY A 1 416 ? 20.193  -2.316  4.886   1.00 51.29 ? 416  GLY A CA  1 
ATOM   3145 C  C   . GLY A 1 416 ? 21.080  -3.489  5.269   1.00 52.99 ? 416  GLY A C   1 
ATOM   3146 O  O   . GLY A 1 416 ? 20.597  -4.613  5.394   1.00 54.62 ? 416  GLY A O   1 
ATOM   3147 N  N   . ARG A 1 417 ? 22.369  -3.256  5.463   1.00 54.14 ? 417  ARG A N   1 
ATOM   3148 C  CA  . ARG A 1 417 ? 23.244  -4.358  5.818   1.00 56.23 ? 417  ARG A CA  1 
ATOM   3149 C  C   . ARG A 1 417 ? 22.886  -4.924  7.196   1.00 56.61 ? 417  ARG A C   1 
ATOM   3150 O  O   . ARG A 1 417 ? 22.802  -6.139  7.365   1.00 57.41 ? 417  ARG A O   1 
ATOM   3151 C  CB  . ARG A 1 417 ? 24.712  -3.916  5.785   1.00 58.59 ? 417  ARG A CB  1 
ATOM   3152 C  CG  . ARG A 1 417 ? 25.174  -3.269  4.472   1.00 63.02 ? 417  ARG A CG  1 
ATOM   3153 C  CD  . ARG A 1 417 ? 24.867  -4.116  3.246   1.00 66.82 ? 417  ARG A CD  1 
ATOM   3154 N  NE  . ARG A 1 417 ? 25.355  -5.483  3.401   1.00 72.11 ? 417  ARG A NE  1 
ATOM   3155 C  CZ  . ARG A 1 417 ? 25.620  -6.313  2.392   1.00 74.87 ? 417  ARG A CZ  1 
ATOM   3156 N  NH1 . ARG A 1 417 ? 25.446  -5.918  1.127   1.00 74.95 ? 417  ARG A NH1 1 
ATOM   3157 N  NH2 . ARG A 1 417 ? 26.070  -7.539  2.652   1.00 75.46 ? 417  ARG A NH2 1 
ATOM   3158 N  N   . LEU A 1 418 ? 22.662  -4.047  8.171   1.00 56.09 ? 418  LEU A N   1 
ATOM   3159 C  CA  . LEU A 1 418 ? 22.310  -4.495  9.510   1.00 55.94 ? 418  LEU A CA  1 
ATOM   3160 C  C   . LEU A 1 418 ? 21.028  -5.327  9.487   1.00 55.54 ? 418  LEU A C   1 
ATOM   3161 O  O   . LEU A 1 418 ? 20.966  -6.401  10.072  1.00 55.46 ? 418  LEU A O   1 
ATOM   3162 C  CB  . LEU A 1 418 ? 22.143  -3.298  10.453  1.00 54.37 ? 418  LEU A CB  1 
ATOM   3163 C  CG  . LEU A 1 418 ? 23.433  -2.533  10.755  1.00 53.32 ? 418  LEU A CG  1 
ATOM   3164 C  CD1 . LEU A 1 418 ? 23.118  -1.399  11.709  1.00 52.00 ? 418  LEU A CD1 1 
ATOM   3165 C  CD2 . LEU A 1 418 ? 24.465  -3.456  11.369  1.00 51.30 ? 418  LEU A CD2 1 
ATOM   3166 N  N   . ALA A 1 419 ? 20.007  -4.834  8.807   1.00 55.59 ? 419  ALA A N   1 
ATOM   3167 C  CA  . ALA A 1 419 ? 18.755  -5.564  8.722   1.00 57.13 ? 419  ALA A CA  1 
ATOM   3168 C  C   . ALA A 1 419 ? 18.955  -6.937  8.047   1.00 60.07 ? 419  ALA A C   1 
ATOM   3169 O  O   . ALA A 1 419 ? 18.517  -7.980  8.558   1.00 61.46 ? 419  ALA A O   1 
ATOM   3170 C  CB  . ALA A 1 419 ? 17.735  -4.747  7.954   1.00 54.40 ? 419  ALA A CB  1 
ATOM   3171 N  N   . ALA A 1 420 ? 19.631  -6.947  6.905   1.00 60.84 ? 420  ALA A N   1 
ATOM   3172 C  CA  . ALA A 1 420 ? 19.858  -8.203  6.208   1.00 62.07 ? 420  ALA A CA  1 
ATOM   3173 C  C   . ALA A 1 420 ? 20.702  -9.171  7.038   1.00 63.04 ? 420  ALA A C   1 
ATOM   3174 O  O   . ALA A 1 420 ? 20.623  -10.382 6.853   1.00 64.33 ? 420  ALA A O   1 
ATOM   3175 C  CB  . ALA A 1 420 ? 20.532  -7.944  4.854   1.00 61.00 ? 420  ALA A CB  1 
ATOM   3176 N  N   . GLN A 1 421 ? 21.490  -8.663  7.976   1.00 62.44 ? 421  GLN A N   1 
ATOM   3177 C  CA  . GLN A 1 421 ? 22.324  -9.575  8.723   1.00 61.65 ? 421  GLN A CA  1 
ATOM   3178 C  C   . GLN A 1 421 ? 21.988  -9.853  10.184  1.00 60.33 ? 421  GLN A C   1 
ATOM   3179 O  O   . GLN A 1 421 ? 22.874  -10.014 11.038  1.00 59.99 ? 421  GLN A O   1 
ATOM   3180 C  CB  . GLN A 1 421 ? 23.774  -9.168  8.512   1.00 63.57 ? 421  GLN A CB  1 
ATOM   3181 C  CG  . GLN A 1 421 ? 24.117  -9.362  7.039   1.00 66.85 ? 421  GLN A CG  1 
ATOM   3182 C  CD  . GLN A 1 421 ? 25.241  -8.477  6.557   1.00 70.77 ? 421  GLN A CD  1 
ATOM   3183 O  OE1 . GLN A 1 421 ? 25.281  -8.090  5.379   1.00 72.06 ? 421  GLN A OE1 1 
ATOM   3184 N  NE2 . GLN A 1 421 ? 26.174  -8.157  7.455   1.00 71.92 ? 421  GLN A NE2 1 
ATOM   3185 N  N   . GLY A 1 422 ? 20.685  -9.930  10.450  1.00 58.55 ? 422  GLY A N   1 
ATOM   3186 C  CA  . GLY A 1 422 ? 20.210  -10.270 11.776  1.00 56.77 ? 422  GLY A CA  1 
ATOM   3187 C  C   . GLY A 1 422 ? 19.825  -9.202  12.775  1.00 56.28 ? 422  GLY A C   1 
ATOM   3188 O  O   . GLY A 1 422 ? 19.216  -9.514  13.793  1.00 56.51 ? 422  GLY A O   1 
ATOM   3189 N  N   . ALA A 1 423 ? 20.136  -7.943  12.512  1.00 54.77 ? 423  ALA A N   1 
ATOM   3190 C  CA  . ALA A 1 423 ? 19.804  -6.929  13.504  1.00 52.68 ? 423  ALA A CA  1 
ATOM   3191 C  C   . ALA A 1 423 ? 18.373  -6.444  13.447  1.00 50.16 ? 423  ALA A C   1 
ATOM   3192 O  O   . ALA A 1 423 ? 17.704  -6.544  12.424  1.00 49.34 ? 423  ALA A O   1 
ATOM   3193 C  CB  . ALA A 1 423 ? 20.759  -5.733  13.367  1.00 52.95 ? 423  ALA A CB  1 
ATOM   3194 N  N   . ARG A 1 424 ? 17.899  -5.938  14.572  1.00 49.18 ? 424  ARG A N   1 
ATOM   3195 C  CA  . ARG A 1 424 ? 16.574  -5.353  14.604  1.00 49.63 ? 424  ARG A CA  1 
ATOM   3196 C  C   . ARG A 1 424 ? 16.891  -3.871  14.410  1.00 47.42 ? 424  ARG A C   1 
ATOM   3197 O  O   . ARG A 1 424 ? 17.595  -3.276  15.224  1.00 43.69 ? 424  ARG A O   1 
ATOM   3198 C  CB  . ARG A 1 424 ? 15.889  -5.563  15.956  1.00 54.00 ? 424  ARG A CB  1 
ATOM   3199 C  CG  . ARG A 1 424 ? 14.569  -4.821  16.078  1.00 58.97 ? 424  ARG A CG  1 
ATOM   3200 C  CD  . ARG A 1 424 ? 13.397  -5.763  16.254  1.00 67.16 ? 424  ARG A CD  1 
ATOM   3201 N  NE  . ARG A 1 424 ? 12.640  -5.424  17.464  1.00 73.50 ? 424  ARG A NE  1 
ATOM   3202 C  CZ  . ARG A 1 424 ? 13.017  -5.739  18.704  1.00 76.58 ? 424  ARG A CZ  1 
ATOM   3203 N  NH1 . ARG A 1 424 ? 14.143  -6.417  18.908  1.00 77.37 ? 424  ARG A NH1 1 
ATOM   3204 N  NH2 . ARG A 1 424 ? 12.278  -5.357  19.747  1.00 77.55 ? 424  ARG A NH2 1 
ATOM   3205 N  N   . VAL A 1 425 ? 16.368  -3.290  13.333  1.00 46.98 ? 425  VAL A N   1 
ATOM   3206 C  CA  . VAL A 1 425 ? 16.622  -1.886  12.986  1.00 45.65 ? 425  VAL A CA  1 
ATOM   3207 C  C   . VAL A 1 425 ? 15.358  -1.037  12.932  1.00 44.86 ? 425  VAL A C   1 
ATOM   3208 O  O   . VAL A 1 425 ? 14.342  -1.513  12.449  1.00 43.95 ? 425  VAL A O   1 
ATOM   3209 C  CB  . VAL A 1 425 ? 17.311  -1.801  11.585  1.00 45.99 ? 425  VAL A CB  1 
ATOM   3210 C  CG1 . VAL A 1 425 ? 17.565  -0.354  11.184  1.00 43.61 ? 425  VAL A CG1 1 
ATOM   3211 C  CG2 . VAL A 1 425 ? 18.627  -2.594  11.596  1.00 46.37 ? 425  VAL A CG2 1 
ATOM   3212 N  N   . TYR A 1 426 ? 15.429  0.194   13.457  1.00 43.34 ? 426  TYR A N   1 
ATOM   3213 C  CA  . TYR A 1 426 ? 14.326  1.163   13.392  1.00 43.88 ? 426  TYR A CA  1 
ATOM   3214 C  C   . TYR A 1 426 ? 14.925  2.412   12.746  1.00 44.38 ? 426  TYR A C   1 
ATOM   3215 O  O   . TYR A 1 426 ? 16.029  2.833   13.092  1.00 45.66 ? 426  TYR A O   1 
ATOM   3216 C  CB  . TYR A 1 426 ? 13.757  1.520   14.765  1.00 45.60 ? 426  TYR A CB  1 
ATOM   3217 C  CG  . TYR A 1 426 ? 12.981  0.394   15.424  1.00 48.78 ? 426  TYR A CG  1 
ATOM   3218 C  CD1 . TYR A 1 426 ? 13.630  -0.537  16.247  1.00 48.90 ? 426  TYR A CD1 1 
ATOM   3219 C  CD2 . TYR A 1 426 ? 11.602  0.241   15.206  1.00 49.54 ? 426  TYR A CD2 1 
ATOM   3220 C  CE1 . TYR A 1 426 ? 12.940  -1.596  16.842  1.00 51.24 ? 426  TYR A CE1 1 
ATOM   3221 C  CE2 . TYR A 1 426 ? 10.890  -0.823  15.796  1.00 51.49 ? 426  TYR A CE2 1 
ATOM   3222 C  CZ  . TYR A 1 426 ? 11.571  -1.741  16.615  1.00 52.52 ? 426  TYR A CZ  1 
ATOM   3223 O  OH  . TYR A 1 426 ? 10.913  -2.812  17.192  1.00 51.42 ? 426  TYR A OH  1 
ATOM   3224 N  N   . ALA A 1 427 ? 14.190  3.013   11.819  1.00 43.32 ? 427  ALA A N   1 
ATOM   3225 C  CA  . ALA A 1 427 ? 14.680  4.171   11.073  1.00 42.56 ? 427  ALA A CA  1 
ATOM   3226 C  C   . ALA A 1 427 ? 13.713  5.343   11.064  1.00 42.19 ? 427  ALA A C   1 
ATOM   3227 O  O   . ALA A 1 427 ? 12.494  5.159   11.065  1.00 41.45 ? 427  ALA A O   1 
ATOM   3228 C  CB  . ALA A 1 427 ? 14.980  3.749   9.617   1.00 41.84 ? 427  ALA A CB  1 
ATOM   3229 N  N   . TYR A 1 428 ? 14.256  6.554   11.020  1.00 40.93 ? 428  TYR A N   1 
ATOM   3230 C  CA  . TYR A 1 428 ? 13.417  7.737   10.997  1.00 40.45 ? 428  TYR A CA  1 
ATOM   3231 C  C   . TYR A 1 428 ? 14.043  8.857   10.179  1.00 42.60 ? 428  TYR A C   1 
ATOM   3232 O  O   . TYR A 1 428 ? 15.224  8.811   9.812   1.00 42.27 ? 428  TYR A O   1 
ATOM   3233 C  CB  . TYR A 1 428 ? 13.203  8.261   12.415  1.00 39.16 ? 428  TYR A CB  1 
ATOM   3234 C  CG  . TYR A 1 428 ? 14.475  8.838   13.025  1.00 40.23 ? 428  TYR A CG  1 
ATOM   3235 C  CD1 . TYR A 1 428 ? 14.925  10.111  12.672  1.00 39.81 ? 428  TYR A CD1 1 
ATOM   3236 C  CD2 . TYR A 1 428 ? 15.268  8.078   13.876  1.00 38.10 ? 428  TYR A CD2 1 
ATOM   3237 C  CE1 . TYR A 1 428 ? 16.142  10.608  13.145  1.00 39.98 ? 428  TYR A CE1 1 
ATOM   3238 C  CE2 . TYR A 1 428 ? 16.489  8.561   14.357  1.00 40.22 ? 428  TYR A CE2 1 
ATOM   3239 C  CZ  . TYR A 1 428 ? 16.926  9.827   13.988  1.00 41.63 ? 428  TYR A CZ  1 
ATOM   3240 O  OH  . TYR A 1 428 ? 18.145  10.309  14.435  1.00 41.11 ? 428  TYR A OH  1 
ATOM   3241 N  N   . ILE A 1 429 ? 13.215  9.853   9.887   1.00 42.48 ? 429  ILE A N   1 
ATOM   3242 C  CA  . ILE A 1 429 ? 13.656  11.057  9.238   1.00 42.39 ? 429  ILE A CA  1 
ATOM   3243 C  C   . ILE A 1 429 ? 13.010  12.121  10.129  1.00 42.88 ? 429  ILE A C   1 
ATOM   3244 O  O   . ILE A 1 429 ? 11.796  12.103  10.370  1.00 43.27 ? 429  ILE A O   1 
ATOM   3245 C  CB  . ILE A 1 429 ? 13.199  11.165  7.769   1.00 44.36 ? 429  ILE A CB  1 
ATOM   3246 C  CG1 . ILE A 1 429 ? 13.719  12.477  7.193   1.00 46.16 ? 429  ILE A CG1 1 
ATOM   3247 C  CG2 . ILE A 1 429 ? 11.693  11.139  7.648   1.00 44.49 ? 429  ILE A CG2 1 
ATOM   3248 C  CD1 . ILE A 1 429 ? 13.305  12.706  5.759   1.00 49.64 ? 429  ILE A CD1 1 
ATOM   3249 N  N   . PHE A 1 430 ? 13.840  13.000  10.676  1.00 41.63 ? 430  PHE A N   1 
ATOM   3250 C  CA  . PHE A 1 430 ? 13.381  14.055  11.573  1.00 42.97 ? 430  PHE A CA  1 
ATOM   3251 C  C   . PHE A 1 430 ? 13.094  15.263  10.684  1.00 42.87 ? 430  PHE A C   1 
ATOM   3252 O  O   . PHE A 1 430 ? 13.978  15.748  9.978   1.00 40.78 ? 430  PHE A O   1 
ATOM   3253 C  CB  . PHE A 1 430 ? 14.480  14.334  12.606  1.00 41.64 ? 430  PHE A CB  1 
ATOM   3254 C  CG  . PHE A 1 430 ? 14.108  15.348  13.628  1.00 43.23 ? 430  PHE A CG  1 
ATOM   3255 C  CD1 . PHE A 1 430 ? 14.329  16.700  13.398  1.00 43.53 ? 430  PHE A CD1 1 
ATOM   3256 C  CD2 . PHE A 1 430 ? 13.533  14.956  14.830  1.00 44.74 ? 430  PHE A CD2 1 
ATOM   3257 C  CE1 . PHE A 1 430 ? 13.981  17.648  14.348  1.00 43.94 ? 430  PHE A CE1 1 
ATOM   3258 C  CE2 . PHE A 1 430 ? 13.184  15.891  15.786  1.00 45.97 ? 430  PHE A CE2 1 
ATOM   3259 C  CZ  . PHE A 1 430 ? 13.408  17.248  15.543  1.00 45.18 ? 430  PHE A CZ  1 
ATOM   3260 N  N   . GLU A 1 431 ? 11.858  15.755  10.722  1.00 44.15 ? 431  GLU A N   1 
ATOM   3261 C  CA  . GLU A 1 431 ? 11.487  16.840  9.819   1.00 44.96 ? 431  GLU A CA  1 
ATOM   3262 C  C   . GLU A 1 431 ? 11.043  18.123  10.434  1.00 44.23 ? 431  GLU A C   1 
ATOM   3263 O  O   . GLU A 1 431 ? 10.564  18.987  9.721   1.00 43.65 ? 431  GLU A O   1 
ATOM   3264 C  CB  . GLU A 1 431 ? 10.370  16.393  8.877   1.00 45.20 ? 431  GLU A CB  1 
ATOM   3265 C  CG  . GLU A 1 431 ? 10.619  15.118  8.114   1.00 49.18 ? 431  GLU A CG  1 
ATOM   3266 C  CD  . GLU A 1 431 ? 9.453   14.772  7.174   1.00 51.44 ? 431  GLU A CD  1 
ATOM   3267 O  OE1 . GLU A 1 431 ? 8.282   14.764  7.650   1.00 50.34 ? 431  GLU A OE1 1 
ATOM   3268 O  OE2 . GLU A 1 431 ? 9.714   14.514  5.967   1.00 52.17 ? 431  GLU A OE2 1 
ATOM   3269 N  N   . HIS A 1 432 ? 11.186  18.269  11.740  1.00 44.27 ? 432  HIS A N   1 
ATOM   3270 C  CA  . HIS A 1 432 ? 10.745  19.505  12.357  1.00 44.38 ? 432  HIS A CA  1 
ATOM   3271 C  C   . HIS A 1 432 ? 11.848  20.554  12.575  1.00 44.64 ? 432  HIS A C   1 
ATOM   3272 O  O   . HIS A 1 432 ? 12.891  20.265  13.182  1.00 43.21 ? 432  HIS A O   1 
ATOM   3273 C  CB  . HIS A 1 432 ? 10.075  19.200  13.689  1.00 43.95 ? 432  HIS A CB  1 
ATOM   3274 C  CG  . HIS A 1 432 ? 9.700   20.427  14.445  1.00 44.31 ? 432  HIS A CG  1 
ATOM   3275 N  ND1 . HIS A 1 432 ? 8.667   21.245  14.053  1.00 44.20 ? 432  HIS A ND1 1 
ATOM   3276 C  CD2 . HIS A 1 432 ? 10.268  21.022  15.520  1.00 43.73 ? 432  HIS A CD2 1 
ATOM   3277 C  CE1 . HIS A 1 432 ? 8.614   22.295  14.854  1.00 43.47 ? 432  HIS A CE1 1 
ATOM   3278 N  NE2 . HIS A 1 432 ? 9.576   22.184  15.751  1.00 43.76 ? 432  HIS A NE2 1 
ATOM   3279 N  N   . ARG A 1 433 ? 11.597  21.772  12.095  1.00 43.43 ? 433  ARG A N   1 
ATOM   3280 C  CA  . ARG A 1 433 ? 12.536  22.876  12.249  1.00 44.40 ? 433  ARG A CA  1 
ATOM   3281 C  C   . ARG A 1 433 ? 12.204  23.622  13.530  1.00 45.60 ? 433  ARG A C   1 
ATOM   3282 O  O   . ARG A 1 433 ? 11.085  24.115  13.692  1.00 46.16 ? 433  ARG A O   1 
ATOM   3283 C  CB  . ARG A 1 433 ? 12.446  23.863  11.073  1.00 44.16 ? 433  ARG A CB  1 
ATOM   3284 C  CG  . ARG A 1 433 ? 13.085  25.225  11.379  1.00 48.00 ? 433  ARG A CG  1 
ATOM   3285 C  CD  . ARG A 1 433 ? 12.911  26.291  10.273  1.00 47.64 ? 433  ARG A CD  1 
ATOM   3286 N  NE  . ARG A 1 433 ? 14.109  26.362  9.466   1.00 50.75 ? 433  ARG A NE  1 
ATOM   3287 C  CZ  . ARG A 1 433 ? 14.988  27.360  9.462   1.00 50.51 ? 433  ARG A CZ  1 
ATOM   3288 N  NH1 . ARG A 1 433 ? 14.826  28.438  10.219  1.00 45.63 ? 433  ARG A NH1 1 
ATOM   3289 N  NH2 . ARG A 1 433 ? 16.083  27.234  8.718   1.00 50.18 ? 433  ARG A NH2 1 
ATOM   3290 N  N   . ALA A 1 434 ? 13.172  23.718  14.436  1.00 44.94 ? 434  ALA A N   1 
ATOM   3291 C  CA  . ALA A 1 434 ? 12.954  24.412  15.699  1.00 45.14 ? 434  ALA A CA  1 
ATOM   3292 C  C   . ALA A 1 434 ? 12.471  25.833  15.443  1.00 45.83 ? 434  ALA A C   1 
ATOM   3293 O  O   . ALA A 1 434 ? 13.034  26.545  14.618  1.00 45.77 ? 434  ALA A O   1 
ATOM   3294 C  CB  . ALA A 1 434 ? 14.247  24.446  16.508  1.00 43.22 ? 434  ALA A CB  1 
ATOM   3295 N  N   . SER A 1 435 ? 11.433  26.244  16.161  1.00 46.98 ? 435  SER A N   1 
ATOM   3296 C  CA  . SER A 1 435 ? 10.897  27.591  16.012  1.00 49.03 ? 435  SER A CA  1 
ATOM   3297 C  C   . SER A 1 435 ? 11.965  28.624  16.357  1.00 49.73 ? 435  SER A C   1 
ATOM   3298 O  O   . SER A 1 435 ? 11.940  29.744  15.865  1.00 51.08 ? 435  SER A O   1 
ATOM   3299 C  CB  . SER A 1 435 ? 9.676   27.784  16.927  1.00 48.98 ? 435  SER A CB  1 
ATOM   3300 O  OG  . SER A 1 435 ? 10.032  27.824  18.299  1.00 48.71 ? 435  SER A OG  1 
ATOM   3301 N  N   . THR A 1 436 ? 12.921  28.215  17.180  1.00 50.42 ? 436  THR A N   1 
ATOM   3302 C  CA  . THR A 1 436 ? 14.006  29.077  17.646  1.00 50.65 ? 436  THR A CA  1 
ATOM   3303 C  C   . THR A 1 436 ? 15.267  29.052  16.783  1.00 50.97 ? 436  THR A C   1 
ATOM   3304 O  O   . THR A 1 436 ? 16.237  29.732  17.094  1.00 52.25 ? 436  THR A O   1 
ATOM   3305 C  CB  . THR A 1 436 ? 14.429  28.654  19.048  1.00 50.50 ? 436  THR A CB  1 
ATOM   3306 O  OG1 . THR A 1 436 ? 14.859  27.284  19.008  1.00 51.29 ? 436  THR A OG1 1 
ATOM   3307 C  CG2 . THR A 1 436 ? 13.262  28.760  20.010  1.00 51.74 ? 436  THR A CG2 1 
ATOM   3308 N  N   . LEU A 1 437 ? 15.271  28.268  15.714  1.00 50.09 ? 437  LEU A N   1 
ATOM   3309 C  CA  . LEU A 1 437 ? 16.455  28.192  14.867  1.00 50.44 ? 437  LEU A CA  1 
ATOM   3310 C  C   . LEU A 1 437 ? 16.890  29.589  14.373  1.00 50.73 ? 437  LEU A C   1 
ATOM   3311 O  O   . LEU A 1 437 ? 16.047  30.419  14.008  1.00 52.38 ? 437  LEU A O   1 
ATOM   3312 C  CB  . LEU A 1 437 ? 16.163  27.253  13.691  1.00 50.59 ? 437  LEU A CB  1 
ATOM   3313 C  CG  . LEU A 1 437 ? 17.340  26.549  13.038  1.00 51.11 ? 437  LEU A CG  1 
ATOM   3314 C  CD1 . LEU A 1 437 ? 18.186  25.904  14.061  1.00 50.44 ? 437  LEU A CD1 1 
ATOM   3315 C  CD2 . LEU A 1 437 ? 16.834  25.519  12.089  1.00 54.23 ? 437  LEU A CD2 1 
ATOM   3316 N  N   . THR A 1 438 ? 18.193  29.850  14.365  1.00 48.72 ? 438  THR A N   1 
ATOM   3317 C  CA  . THR A 1 438 ? 18.697  31.140  13.928  1.00 49.28 ? 438  THR A CA  1 
ATOM   3318 C  C   . THR A 1 438 ? 19.381  31.076  12.548  1.00 50.36 ? 438  THR A C   1 
ATOM   3319 O  O   . THR A 1 438 ? 19.890  32.087  12.036  1.00 50.32 ? 438  THR A O   1 
ATOM   3320 C  CB  . THR A 1 438 ? 19.677  31.740  14.975  1.00 50.49 ? 438  THR A CB  1 
ATOM   3321 O  OG1 . THR A 1 438 ? 20.860  30.938  15.055  1.00 52.38 ? 438  THR A OG1 1 
ATOM   3322 C  CG2 . THR A 1 438 ? 19.030  31.756  16.353  1.00 51.23 ? 438  THR A CG2 1 
ATOM   3323 N  N   . TRP A 1 439 ? 19.416  29.882  11.953  1.00 48.51 ? 439  TRP A N   1 
ATOM   3324 C  CA  . TRP A 1 439 ? 19.985  29.729  10.622  1.00 45.40 ? 439  TRP A CA  1 
ATOM   3325 C  C   . TRP A 1 439 ? 18.851  30.130  9.684   1.00 45.43 ? 439  TRP A C   1 
ATOM   3326 O  O   . TRP A 1 439 ? 17.667  29.970  10.032  1.00 44.81 ? 439  TRP A O   1 
ATOM   3327 C  CB  . TRP A 1 439 ? 20.375  28.279  10.337  1.00 42.47 ? 439  TRP A CB  1 
ATOM   3328 C  CG  . TRP A 1 439 ? 21.571  27.827  11.048  1.00 40.25 ? 439  TRP A CG  1 
ATOM   3329 C  CD1 . TRP A 1 439 ? 21.616  27.125  12.230  1.00 40.39 ? 439  TRP A CD1 1 
ATOM   3330 C  CD2 . TRP A 1 439 ? 22.930  28.078  10.675  1.00 38.75 ? 439  TRP A CD2 1 
ATOM   3331 N  NE1 . TRP A 1 439 ? 22.923  26.933  12.612  1.00 39.07 ? 439  TRP A NE1 1 
ATOM   3332 C  CE2 . TRP A 1 439 ? 23.752  27.502  11.680  1.00 37.33 ? 439  TRP A CE2 1 
ATOM   3333 C  CE3 . TRP A 1 439 ? 23.538  28.739  9.590   1.00 39.29 ? 439  TRP A CE3 1 
ATOM   3334 C  CZ2 . TRP A 1 439 ? 25.148  27.557  11.633  1.00 37.67 ? 439  TRP A CZ2 1 
ATOM   3335 C  CZ3 . TRP A 1 439 ? 24.942  28.795  9.533   1.00 37.50 ? 439  TRP A CZ3 1 
ATOM   3336 C  CH2 . TRP A 1 439 ? 25.731  28.205  10.555  1.00 39.35 ? 439  TRP A CH2 1 
ATOM   3337 N  N   . PRO A 1 440 ? 19.189  30.623  8.473   1.00 45.56 ? 440  PRO A N   1 
ATOM   3338 C  CA  . PRO A 1 440 ? 18.158  31.040  7.510   1.00 45.03 ? 440  PRO A CA  1 
ATOM   3339 C  C   . PRO A 1 440 ? 17.199  29.902  7.171   1.00 46.17 ? 440  PRO A C   1 
ATOM   3340 O  O   . PRO A 1 440 ? 17.551  28.733  7.305   1.00 46.16 ? 440  PRO A O   1 
ATOM   3341 C  CB  . PRO A 1 440 ? 18.981  31.466  6.303   1.00 43.75 ? 440  PRO A CB  1 
ATOM   3342 C  CG  . PRO A 1 440 ? 20.133  30.508  6.340   1.00 44.58 ? 440  PRO A CG  1 
ATOM   3343 C  CD  . PRO A 1 440 ? 20.506  30.515  7.810   1.00 43.60 ? 440  PRO A CD  1 
ATOM   3344 N  N   . LEU A 1 441 ? 15.992  30.243  6.732   1.00 47.49 ? 441  LEU A N   1 
ATOM   3345 C  CA  . LEU A 1 441 ? 15.001  29.244  6.354   1.00 47.36 ? 441  LEU A CA  1 
ATOM   3346 C  C   . LEU A 1 441 ? 15.432  28.315  5.230   1.00 47.45 ? 441  LEU A C   1 
ATOM   3347 O  O   . LEU A 1 441 ? 15.037  27.149  5.203   1.00 47.58 ? 441  LEU A O   1 
ATOM   3348 C  CB  . LEU A 1 441 ? 13.713  29.916  5.904   1.00 50.21 ? 441  LEU A CB  1 
ATOM   3349 C  CG  . LEU A 1 441 ? 12.959  30.677  6.973   1.00 54.90 ? 441  LEU A CG  1 
ATOM   3350 C  CD1 . LEU A 1 441 ? 11.854  31.492  6.305   1.00 55.50 ? 441  LEU A CD1 1 
ATOM   3351 C  CD2 . LEU A 1 441 ? 12.392  29.685  7.999   1.00 54.78 ? 441  LEU A CD2 1 
ATOM   3352 N  N   . TRP A 1 442 ? 16.223  28.805  4.282   1.00 46.25 ? 442  TRP A N   1 
ATOM   3353 C  CA  . TRP A 1 442 ? 16.570  27.927  3.190   1.00 44.60 ? 442  TRP A CA  1 
ATOM   3354 C  C   . TRP A 1 442 ? 17.307  26.689  3.643   1.00 44.40 ? 442  TRP A C   1 
ATOM   3355 O  O   . TRP A 1 442 ? 17.303  25.695  2.939   1.00 44.31 ? 442  TRP A O   1 
ATOM   3356 C  CB  . TRP A 1 442 ? 17.364  28.652  2.087   1.00 44.68 ? 442  TRP A CB  1 
ATOM   3357 C  CG  . TRP A 1 442 ? 18.770  29.077  2.424   1.00 44.02 ? 442  TRP A CG  1 
ATOM   3358 C  CD1 . TRP A 1 442 ? 19.178  30.324  2.794   1.00 45.95 ? 442  TRP A CD1 1 
ATOM   3359 C  CD2 . TRP A 1 442 ? 19.951  28.266  2.385   1.00 42.68 ? 442  TRP A CD2 1 
ATOM   3360 N  NE1 . TRP A 1 442 ? 20.542  30.347  2.989   1.00 45.66 ? 442  TRP A NE1 1 
ATOM   3361 C  CE2 . TRP A 1 442 ? 21.042  29.094  2.746   1.00 44.34 ? 442  TRP A CE2 1 
ATOM   3362 C  CE3 . TRP A 1 442 ? 20.197  26.925  2.078   1.00 42.92 ? 442  TRP A CE3 1 
ATOM   3363 C  CZ2 . TRP A 1 442 ? 22.361  28.621  2.810   1.00 41.86 ? 442  TRP A CZ2 1 
ATOM   3364 C  CZ3 . TRP A 1 442 ? 21.505  26.457  2.142   1.00 43.43 ? 442  TRP A CZ3 1 
ATOM   3365 C  CH2 . TRP A 1 442 ? 22.572  27.310  2.509   1.00 42.60 ? 442  TRP A CH2 1 
ATOM   3366 N  N   . MET A 1 443 ? 17.924  26.730  4.820   1.00 44.12 ? 443  MET A N   1 
ATOM   3367 C  CA  . MET A 1 443 ? 18.668  25.568  5.297   1.00 42.86 ? 443  MET A CA  1 
ATOM   3368 C  C   . MET A 1 443 ? 17.766  24.467  5.856   1.00 42.80 ? 443  MET A C   1 
ATOM   3369 O  O   . MET A 1 443 ? 18.239  23.358  6.135   1.00 43.43 ? 443  MET A O   1 
ATOM   3370 C  CB  . MET A 1 443 ? 19.709  25.996  6.343   1.00 42.52 ? 443  MET A CB  1 
ATOM   3371 C  CG  . MET A 1 443 ? 20.960  26.617  5.758   1.00 40.96 ? 443  MET A CG  1 
ATOM   3372 S  SD  . MET A 1 443 ? 22.118  27.078  7.063   1.00 45.49 ? 443  MET A SD  1 
ATOM   3373 C  CE  . MET A 1 443 ? 23.268  28.041  6.220   1.00 46.79 ? 443  MET A CE  1 
ATOM   3374 N  N   . GLY A 1 444 ? 16.476  24.764  6.013   1.00 41.09 ? 444  GLY A N   1 
ATOM   3375 C  CA  . GLY A 1 444 ? 15.533  23.778  6.521   1.00 40.49 ? 444  GLY A CA  1 
ATOM   3376 C  C   . GLY A 1 444 ? 15.820  23.230  7.923   1.00 39.38 ? 444  GLY A C   1 
ATOM   3377 O  O   . GLY A 1 444 ? 15.954  23.996  8.868   1.00 39.73 ? 444  GLY A O   1 
ATOM   3378 N  N   . VAL A 1 445 ? 15.840  21.908  8.066   1.00 38.48 ? 445  VAL A N   1 
ATOM   3379 C  CA  . VAL A 1 445 ? 16.156  21.276  9.369   1.00 38.73 ? 445  VAL A CA  1 
ATOM   3380 C  C   . VAL A 1 445 ? 17.603  20.840  9.192   1.00 38.13 ? 445  VAL A C   1 
ATOM   3381 O  O   . VAL A 1 445 ? 17.866  19.751  8.665   1.00 38.39 ? 445  VAL A O   1 
ATOM   3382 C  CB  . VAL A 1 445 ? 15.309  19.976  9.631   1.00 40.25 ? 445  VAL A CB  1 
ATOM   3383 C  CG1 . VAL A 1 445 ? 15.510  19.522  11.069  1.00 38.42 ? 445  VAL A CG1 1 
ATOM   3384 C  CG2 . VAL A 1 445 ? 13.801  20.213  9.333   1.00 39.77 ? 445  VAL A CG2 1 
ATOM   3385 N  N   . PRO A 1 446 ? 18.561  21.673  9.620   1.00 37.03 ? 446  PRO A N   1 
ATOM   3386 C  CA  . PRO A 1 446 ? 19.984  21.352  9.472   1.00 38.45 ? 446  PRO A CA  1 
ATOM   3387 C  C   . PRO A 1 446 ? 20.523  20.249  10.368  1.00 39.80 ? 446  PRO A C   1 
ATOM   3388 O  O   . PRO A 1 446 ? 19.921  19.894  11.370  1.00 39.23 ? 446  PRO A O   1 
ATOM   3389 C  CB  . PRO A 1 446 ? 20.692  22.681  9.762   1.00 37.36 ? 446  PRO A CB  1 
ATOM   3390 C  CG  . PRO A 1 446 ? 19.554  23.724  9.840   1.00 37.53 ? 446  PRO A CG  1 
ATOM   3391 C  CD  . PRO A 1 446 ? 18.398  22.914  10.374  1.00 37.08 ? 446  PRO A CD  1 
ATOM   3392 N  N   . HIS A 1 447 ? 21.676  19.730  9.957   1.00 40.66 ? 447  HIS A N   1 
ATOM   3393 C  CA  . HIS A 1 447 ? 22.437  18.698  10.645  1.00 40.81 ? 447  HIS A CA  1 
ATOM   3394 C  C   . HIS A 1 447 ? 22.619  19.120  12.115  1.00 40.25 ? 447  HIS A C   1 
ATOM   3395 O  O   . HIS A 1 447 ? 23.071  20.225  12.392  1.00 39.27 ? 447  HIS A O   1 
ATOM   3396 C  CB  . HIS A 1 447 ? 23.804  18.606  9.954   1.00 40.94 ? 447  HIS A CB  1 
ATOM   3397 C  CG  . HIS A 1 447 ? 24.668  17.484  10.431  1.00 41.48 ? 447  HIS A CG  1 
ATOM   3398 N  ND1 . HIS A 1 447 ? 24.396  16.162  10.141  1.00 41.23 ? 447  HIS A ND1 1 
ATOM   3399 C  CD2 . HIS A 1 447 ? 25.850  17.492  11.098  1.00 39.47 ? 447  HIS A CD2 1 
ATOM   3400 C  CE1 . HIS A 1 447 ? 25.380  15.407  10.598  1.00 40.98 ? 447  HIS A CE1 1 
ATOM   3401 N  NE2 . HIS A 1 447 ? 26.275  16.189  11.180  1.00 39.12 ? 447  HIS A NE2 1 
ATOM   3402 N  N   . GLY A 1 448 ? 22.245  18.246  13.040  1.00 38.99 ? 448  GLY A N   1 
ATOM   3403 C  CA  . GLY A 1 448 ? 22.390  18.542  14.452  1.00 38.01 ? 448  GLY A CA  1 
ATOM   3404 C  C   . GLY A 1 448 ? 21.192  19.145  15.166  1.00 38.18 ? 448  GLY A C   1 
ATOM   3405 O  O   . GLY A 1 448 ? 21.139  19.168  16.401  1.00 38.76 ? 448  GLY A O   1 
ATOM   3406 N  N   . TYR A 1 449 ? 20.195  19.607  14.427  1.00 37.58 ? 449  TYR A N   1 
ATOM   3407 C  CA  . TYR A 1 449 ? 19.094  20.253  15.101  1.00 38.06 ? 449  TYR A CA  1 
ATOM   3408 C  C   . TYR A 1 449 ? 17.932  19.428  15.627  1.00 39.66 ? 449  TYR A C   1 
ATOM   3409 O  O   . TYR A 1 449 ? 16.901  19.970  16.021  1.00 39.52 ? 449  TYR A O   1 
ATOM   3410 C  CB  . TYR A 1 449 ? 18.640  21.453  14.265  1.00 37.42 ? 449  TYR A CB  1 
ATOM   3411 C  CG  . TYR A 1 449 ? 19.695  22.533  14.356  1.00 37.21 ? 449  TYR A CG  1 
ATOM   3412 C  CD1 . TYR A 1 449 ? 20.775  22.574  13.460  1.00 35.38 ? 449  TYR A CD1 1 
ATOM   3413 C  CD2 . TYR A 1 449 ? 19.692  23.435  15.418  1.00 35.19 ? 449  TYR A CD2 1 
ATOM   3414 C  CE1 . TYR A 1 449 ? 21.817  23.477  13.631  1.00 32.89 ? 449  TYR A CE1 1 
ATOM   3415 C  CE2 . TYR A 1 449 ? 20.726  24.338  15.587  1.00 34.99 ? 449  TYR A CE2 1 
ATOM   3416 C  CZ  . TYR A 1 449 ? 21.783  24.349  14.699  1.00 35.34 ? 449  TYR A CZ  1 
ATOM   3417 O  OH  . TYR A 1 449 ? 22.839  25.203  14.944  1.00 40.75 ? 449  TYR A OH  1 
ATOM   3418 N  N   . GLU A 1 450 ? 18.102  18.110  15.662  1.00 41.13 ? 450  GLU A N   1 
ATOM   3419 C  CA  . GLU A 1 450 ? 17.086  17.264  16.254  1.00 39.35 ? 450  GLU A CA  1 
ATOM   3420 C  C   . GLU A 1 450 ? 17.554  17.024  17.696  1.00 39.77 ? 450  GLU A C   1 
ATOM   3421 O  O   . GLU A 1 450 ? 16.751  16.718  18.573  1.00 40.02 ? 450  GLU A O   1 
ATOM   3422 C  CB  . GLU A 1 450 ? 16.984  15.925  15.522  1.00 37.95 ? 450  GLU A CB  1 
ATOM   3423 C  CG  . GLU A 1 450 ? 17.961  14.889  15.990  1.00 37.34 ? 450  GLU A CG  1 
ATOM   3424 C  CD  . GLU A 1 450 ? 19.347  15.054  15.390  1.00 39.81 ? 450  GLU A CD  1 
ATOM   3425 O  OE1 . GLU A 1 450 ? 19.722  16.193  15.031  1.00 39.74 ? 450  GLU A OE1 1 
ATOM   3426 O  OE2 . GLU A 1 450 ? 20.076  14.038  15.287  1.00 37.72 ? 450  GLU A OE2 1 
ATOM   3427 N  N   . ILE A 1 451 ? 18.848  17.220  17.958  1.00 39.80 ? 451  ILE A N   1 
ATOM   3428 C  CA  . ILE A 1 451 ? 19.373  16.921  19.290  1.00 40.22 ? 451  ILE A CA  1 
ATOM   3429 C  C   . ILE A 1 451 ? 18.683  17.588  20.467  1.00 41.69 ? 451  ILE A C   1 
ATOM   3430 O  O   . ILE A 1 451 ? 18.345  16.908  21.442  1.00 42.09 ? 451  ILE A O   1 
ATOM   3431 C  CB  . ILE A 1 451 ? 20.896  17.188  19.396  1.00 39.82 ? 451  ILE A CB  1 
ATOM   3432 C  CG1 . ILE A 1 451 ? 21.640  16.491  18.241  1.00 38.08 ? 451  ILE A CG1 1 
ATOM   3433 C  CG2 . ILE A 1 451 ? 21.412  16.626  20.739  1.00 38.67 ? 451  ILE A CG2 1 
ATOM   3434 C  CD1 . ILE A 1 451 ? 23.129  16.839  18.168  1.00 35.30 ? 451  ILE A CD1 1 
ATOM   3435 N  N   . GLU A 1 452 ? 18.488  18.906  20.396  1.00 42.15 ? 452  GLU A N   1 
ATOM   3436 C  CA  . GLU A 1 452 ? 17.810  19.635  21.475  1.00 42.02 ? 452  GLU A CA  1 
ATOM   3437 C  C   . GLU A 1 452 ? 16.424  19.027  21.781  1.00 41.00 ? 452  GLU A C   1 
ATOM   3438 O  O   . GLU A 1 452 ? 15.938  19.141  22.895  1.00 42.32 ? 452  GLU A O   1 
ATOM   3439 C  CB  . GLU A 1 452 ? 17.661  21.117  21.109  1.00 41.70 ? 452  GLU A CB  1 
ATOM   3440 C  CG  . GLU A 1 452 ? 17.035  21.337  19.728  1.00 45.58 ? 452  GLU A CG  1 
ATOM   3441 C  CD  . GLU A 1 452 ? 17.268  22.753  19.197  1.00 47.68 ? 452  GLU A CD  1 
ATOM   3442 O  OE1 . GLU A 1 452 ? 16.363  23.594  19.302  1.00 48.01 ? 452  GLU A OE1 1 
ATOM   3443 O  OE2 . GLU A 1 452 ? 18.373  23.031  18.692  1.00 49.29 ? 452  GLU A OE2 1 
ATOM   3444 N  N   . PHE A 1 453 ? 15.795  18.380  20.804  1.00 39.59 ? 453  PHE A N   1 
ATOM   3445 C  CA  . PHE A 1 453 ? 14.490  17.767  21.051  1.00 39.34 ? 453  PHE A CA  1 
ATOM   3446 C  C   . PHE A 1 453 ? 14.599  16.406  21.746  1.00 39.82 ? 453  PHE A C   1 
ATOM   3447 O  O   . PHE A 1 453 ? 13.796  16.098  22.623  1.00 40.45 ? 453  PHE A O   1 
ATOM   3448 C  CB  . PHE A 1 453 ? 13.705  17.614  19.747  1.00 39.27 ? 453  PHE A CB  1 
ATOM   3449 C  CG  . PHE A 1 453 ? 13.185  18.917  19.208  1.00 39.32 ? 453  PHE A CG  1 
ATOM   3450 C  CD1 . PHE A 1 453 ? 12.017  19.470  19.706  1.00 37.63 ? 453  PHE A CD1 1 
ATOM   3451 C  CD2 . PHE A 1 453 ? 13.918  19.635  18.255  1.00 41.19 ? 453  PHE A CD2 1 
ATOM   3452 C  CE1 . PHE A 1 453 ? 11.587  20.728  19.270  1.00 39.80 ? 453  PHE A CE1 1 
ATOM   3453 C  CE2 . PHE A 1 453 ? 13.496  20.903  17.805  1.00 40.52 ? 453  PHE A CE2 1 
ATOM   3454 C  CZ  . PHE A 1 453 ? 12.334  21.449  18.315  1.00 40.38 ? 453  PHE A CZ  1 
ATOM   3455 N  N   . ILE A 1 454 ? 15.581  15.594  21.363  1.00 38.02 ? 454  ILE A N   1 
ATOM   3456 C  CA  . ILE A 1 454 ? 15.764  14.303  21.980  1.00 38.24 ? 454  ILE A CA  1 
ATOM   3457 C  C   . ILE A 1 454 ? 16.144  14.491  23.460  1.00 39.79 ? 454  ILE A C   1 
ATOM   3458 O  O   . ILE A 1 454 ? 15.724  13.718  24.315  1.00 39.05 ? 454  ILE A O   1 
ATOM   3459 C  CB  . ILE A 1 454 ? 16.897  13.502  21.309  1.00 39.55 ? 454  ILE A CB  1 
ATOM   3460 C  CG1 . ILE A 1 454 ? 16.663  13.377  19.799  1.00 38.88 ? 454  ILE A CG1 1 
ATOM   3461 C  CG2 . ILE A 1 454 ? 17.015  12.149  21.987  1.00 35.04 ? 454  ILE A CG2 1 
ATOM   3462 C  CD1 . ILE A 1 454 ? 15.411  12.624  19.441  1.00 42.58 ? 454  ILE A CD1 1 
ATOM   3463 N  N   . PHE A 1 455 ? 16.944  15.516  23.755  1.00 39.75 ? 455  PHE A N   1 
ATOM   3464 C  CA  . PHE A 1 455 ? 17.364  15.766  25.127  1.00 39.05 ? 455  PHE A CA  1 
ATOM   3465 C  C   . PHE A 1 455 ? 16.305  16.486  25.951  1.00 40.41 ? 455  PHE A C   1 
ATOM   3466 O  O   . PHE A 1 455 ? 16.450  16.645  27.171  1.00 39.50 ? 455  PHE A O   1 
ATOM   3467 C  CB  . PHE A 1 455 ? 18.680  16.547  25.164  1.00 36.40 ? 455  PHE A CB  1 
ATOM   3468 C  CG  . PHE A 1 455 ? 19.897  15.670  25.089  1.00 36.95 ? 455  PHE A CG  1 
ATOM   3469 C  CD1 . PHE A 1 455 ? 20.364  15.197  23.860  1.00 35.65 ? 455  PHE A CD1 1 
ATOM   3470 C  CD2 . PHE A 1 455 ? 20.568  15.295  26.256  1.00 35.70 ? 455  PHE A CD2 1 
ATOM   3471 C  CE1 . PHE A 1 455 ? 21.499  14.352  23.793  1.00 37.29 ? 455  PHE A CE1 1 
ATOM   3472 C  CE2 . PHE A 1 455 ? 21.689  14.461  26.212  1.00 35.30 ? 455  PHE A CE2 1 
ATOM   3473 C  CZ  . PHE A 1 455 ? 22.159  13.986  24.975  1.00 37.18 ? 455  PHE A CZ  1 
ATOM   3474 N  N   . GLY A 1 456 ? 15.255  16.947  25.280  1.00 41.07 ? 456  GLY A N   1 
ATOM   3475 C  CA  . GLY A 1 456 ? 14.164  17.598  25.982  1.00 41.70 ? 456  GLY A CA  1 
ATOM   3476 C  C   . GLY A 1 456 ? 14.283  19.061  26.369  1.00 43.63 ? 456  GLY A C   1 
ATOM   3477 O  O   . GLY A 1 456 ? 13.529  19.511  27.236  1.00 43.44 ? 456  GLY A O   1 
ATOM   3478 N  N   . LEU A 1 457 ? 15.191  19.816  25.749  1.00 42.28 ? 457  LEU A N   1 
ATOM   3479 C  CA  . LEU A 1 457 ? 15.315  21.233  26.090  1.00 43.54 ? 457  LEU A CA  1 
ATOM   3480 C  C   . LEU A 1 457 ? 13.994  22.003  26.001  1.00 43.97 ? 457  LEU A C   1 
ATOM   3481 O  O   . LEU A 1 457 ? 13.738  22.879  26.809  1.00 46.08 ? 457  LEU A O   1 
ATOM   3482 C  CB  . LEU A 1 457 ? 16.366  21.935  25.213  1.00 43.93 ? 457  LEU A CB  1 
ATOM   3483 C  CG  . LEU A 1 457 ? 17.805  21.871  25.749  1.00 45.30 ? 457  LEU A CG  1 
ATOM   3484 C  CD1 . LEU A 1 457 ? 18.277  20.432  25.751  1.00 45.35 ? 457  LEU A CD1 1 
ATOM   3485 C  CD2 . LEU A 1 457 ? 18.732  22.693  24.901  1.00 44.77 ? 457  LEU A CD2 1 
ATOM   3486 N  N   . PRO A 1 458 ? 13.130  21.687  25.026  1.00 43.32 ? 458  PRO A N   1 
ATOM   3487 C  CA  . PRO A 1 458 ? 11.876  22.444  24.972  1.00 43.64 ? 458  PRO A CA  1 
ATOM   3488 C  C   . PRO A 1 458 ? 11.064  22.410  26.284  1.00 46.04 ? 458  PRO A C   1 
ATOM   3489 O  O   . PRO A 1 458 ? 10.175  23.231  26.486  1.00 46.38 ? 458  PRO A O   1 
ATOM   3490 C  CB  . PRO A 1 458 ? 11.134  21.801  23.807  1.00 42.24 ? 458  PRO A CB  1 
ATOM   3491 C  CG  . PRO A 1 458 ? 12.256  21.361  22.914  1.00 44.34 ? 458  PRO A CG  1 
ATOM   3492 C  CD  . PRO A 1 458 ? 13.228  20.750  23.899  1.00 41.94 ? 458  PRO A CD  1 
ATOM   3493 N  N   . LEU A 1 459 ? 11.376  21.482  27.182  1.00 47.90 ? 459  LEU A N   1 
ATOM   3494 C  CA  . LEU A 1 459 ? 10.643  21.411  28.441  1.00 50.51 ? 459  LEU A CA  1 
ATOM   3495 C  C   . LEU A 1 459 ? 10.999  22.562  29.374  1.00 52.55 ? 459  LEU A C   1 
ATOM   3496 O  O   . LEU A 1 459 ? 10.317  22.800  30.361  1.00 53.29 ? 459  LEU A O   1 
ATOM   3497 C  CB  . LEU A 1 459 ? 10.910  20.077  29.143  1.00 50.66 ? 459  LEU A CB  1 
ATOM   3498 C  CG  . LEU A 1 459 ? 9.982   18.899  28.827  1.00 50.46 ? 459  LEU A CG  1 
ATOM   3499 C  CD1 . LEU A 1 459 ? 9.999   18.561  27.379  1.00 51.70 ? 459  LEU A CD1 1 
ATOM   3500 C  CD2 . LEU A 1 459 ? 10.441  17.709  29.597  1.00 52.25 ? 459  LEU A CD2 1 
ATOM   3501 N  N   . ASP A 1 460 ? 12.080  23.267  29.077  1.00 55.26 ? 460  ASP A N   1 
ATOM   3502 C  CA  . ASP A 1 460 ? 12.482  24.390  29.907  1.00 57.66 ? 460  ASP A CA  1 
ATOM   3503 C  C   . ASP A 1 460 ? 11.751  25.649  29.411  1.00 59.31 ? 460  ASP A C   1 
ATOM   3504 O  O   . ASP A 1 460 ? 12.061  26.185  28.347  1.00 59.75 ? 460  ASP A O   1 
ATOM   3505 C  CB  . ASP A 1 460 ? 13.992  24.589  29.813  1.00 57.69 ? 460  ASP A CB  1 
ATOM   3506 C  CG  . ASP A 1 460 ? 14.492  25.678  30.739  1.00 58.47 ? 460  ASP A CG  1 
ATOM   3507 O  OD1 . ASP A 1 460 ? 13.701  26.572  31.100  1.00 58.93 ? 460  ASP A OD1 1 
ATOM   3508 O  OD2 . ASP A 1 460 ? 15.684  25.645  31.100  1.00 61.06 ? 460  ASP A OD2 1 
ATOM   3509 N  N   . PRO A 1 461 ? 10.783  26.144  30.196  1.00 61.23 ? 461  PRO A N   1 
ATOM   3510 C  CA  . PRO A 1 461 ? 9.980   27.333  29.874  1.00 62.12 ? 461  PRO A CA  1 
ATOM   3511 C  C   . PRO A 1 461 ? 10.805  28.535  29.423  1.00 62.43 ? 461  PRO A C   1 
ATOM   3512 O  O   . PRO A 1 461 ? 10.440  29.244  28.477  1.00 63.15 ? 461  PRO A O   1 
ATOM   3513 C  CB  . PRO A 1 461 ? 9.241   27.607  31.179  1.00 62.76 ? 461  PRO A CB  1 
ATOM   3514 C  CG  . PRO A 1 461 ? 9.110   26.229  31.785  1.00 61.88 ? 461  PRO A CG  1 
ATOM   3515 C  CD  . PRO A 1 461 ? 10.487  25.676  31.560  1.00 61.49 ? 461  PRO A CD  1 
ATOM   3516 N  N   . SER A 1 462 ? 11.925  28.767  30.089  1.00 61.01 ? 462  SER A N   1 
ATOM   3517 C  CA  . SER A 1 462 ? 12.758  29.900  29.723  1.00 61.13 ? 462  SER A CA  1 
ATOM   3518 C  C   . SER A 1 462 ? 13.349  29.863  28.311  1.00 60.28 ? 462  SER A C   1 
ATOM   3519 O  O   . SER A 1 462 ? 13.866  30.873  27.841  1.00 59.77 ? 462  SER A O   1 
ATOM   3520 C  CB  . SER A 1 462 ? 13.893  30.054  30.733  1.00 61.11 ? 462  SER A CB  1 
ATOM   3521 O  OG  . SER A 1 462 ? 14.742  28.921  30.709  1.00 64.07 ? 462  SER A OG  1 
ATOM   3522 N  N   . LEU A 1 463 ? 13.283  28.719  27.629  1.00 60.23 ? 463  LEU A N   1 
ATOM   3523 C  CA  . LEU A 1 463 ? 13.860  28.631  26.282  1.00 59.92 ? 463  LEU A CA  1 
ATOM   3524 C  C   . LEU A 1 463 ? 12.944  29.041  25.115  1.00 60.39 ? 463  LEU A C   1 
ATOM   3525 O  O   . LEU A 1 463 ? 13.348  29.022  23.951  1.00 59.61 ? 463  LEU A O   1 
ATOM   3526 C  CB  . LEU A 1 463 ? 14.448  27.233  26.047  1.00 58.07 ? 463  LEU A CB  1 
ATOM   3527 C  CG  . LEU A 1 463 ? 15.621  26.900  26.981  1.00 57.79 ? 463  LEU A CG  1 
ATOM   3528 C  CD1 . LEU A 1 463 ? 16.202  25.541  26.626  1.00 53.70 ? 463  LEU A CD1 1 
ATOM   3529 C  CD2 . LEU A 1 463 ? 16.691  28.001  26.887  1.00 54.42 ? 463  LEU A CD2 1 
ATOM   3530 N  N   . ASN A 1 464 ? 11.712  29.412  25.430  1.00 62.08 ? 464  ASN A N   1 
ATOM   3531 C  CA  . ASN A 1 464 ? 10.769  29.903  24.423  1.00 64.06 ? 464  ASN A CA  1 
ATOM   3532 C  C   . ASN A 1 464 ? 10.353  29.012  23.258  1.00 60.77 ? 464  ASN A C   1 
ATOM   3533 O  O   . ASN A 1 464 ? 10.118  29.516  22.166  1.00 60.13 ? 464  ASN A O   1 
ATOM   3534 C  CB  . ASN A 1 464 ? 11.256  31.253  23.836  1.00 69.57 ? 464  ASN A CB  1 
ATOM   3535 C  CG  . ASN A 1 464 ? 11.356  32.355  24.890  1.00 76.16 ? 464  ASN A CG  1 
ATOM   3536 O  OD1 . ASN A 1 464 ? 10.597  32.357  25.859  1.00 77.55 ? 464  ASN A OD1 1 
ATOM   3537 N  ND2 . ASN A 1 464 ? 12.280  33.295  24.693  1.00 83.31 ? 464  ASN A ND2 1 
ATOM   3538 N  N   . TYR A 1 465 ? 10.262  27.709  23.486  1.00 57.03 ? 465  TYR A N   1 
ATOM   3539 C  CA  . TYR A 1 465 ? 9.803   26.780  22.458  1.00 54.28 ? 465  TYR A CA  1 
ATOM   3540 C  C   . TYR A 1 465 ? 8.269   26.821  22.517  1.00 53.75 ? 465  TYR A C   1 
ATOM   3541 O  O   . TYR A 1 465 ? 7.700   27.188  23.542  1.00 53.94 ? 465  TYR A O   1 
ATOM   3542 C  CB  . TYR A 1 465 ? 10.274  25.357  22.777  1.00 51.05 ? 465  TYR A CB  1 
ATOM   3543 C  CG  . TYR A 1 465 ? 11.711  25.074  22.423  1.00 49.11 ? 465  TYR A CG  1 
ATOM   3544 C  CD1 . TYR A 1 465 ? 12.068  24.660  21.127  1.00 46.70 ? 465  TYR A CD1 1 
ATOM   3545 C  CD2 . TYR A 1 465 ? 12.723  25.233  23.375  1.00 47.66 ? 465  TYR A CD2 1 
ATOM   3546 C  CE1 . TYR A 1 465 ? 13.397  24.417  20.792  1.00 47.59 ? 465  TYR A CE1 1 
ATOM   3547 C  CE2 . TYR A 1 465 ? 14.055  24.994  23.058  1.00 46.46 ? 465  TYR A CE2 1 
ATOM   3548 C  CZ  . TYR A 1 465 ? 14.392  24.586  21.773  1.00 48.37 ? 465  TYR A CZ  1 
ATOM   3549 O  OH  . TYR A 1 465 ? 15.714  24.335  21.485  1.00 47.27 ? 465  TYR A OH  1 
ATOM   3550 N  N   . THR A 1 466 ? 7.597   26.446  21.439  1.00 53.02 ? 466  THR A N   1 
ATOM   3551 C  CA  . THR A 1 466 ? 6.139   26.456  21.448  1.00 53.24 ? 466  THR A CA  1 
ATOM   3552 C  C   . THR A 1 466 ? 5.635   25.272  22.251  1.00 55.36 ? 466  THR A C   1 
ATOM   3553 O  O   . THR A 1 466 ? 6.352   24.296  22.461  1.00 55.62 ? 466  THR A O   1 
ATOM   3554 C  CB  . THR A 1 466 ? 5.533   26.278  20.057  1.00 51.59 ? 466  THR A CB  1 
ATOM   3555 O  OG1 . THR A 1 466 ? 5.675   24.903  19.658  1.00 49.98 ? 466  THR A OG1 1 
ATOM   3556 C  CG2 . THR A 1 466 ? 6.199   27.209  19.050  1.00 49.49 ? 466  THR A CG2 1 
ATOM   3557 N  N   . THR A 1 467 ? 4.377   25.343  22.665  1.00 56.57 ? 467  THR A N   1 
ATOM   3558 C  CA  . THR A 1 467 ? 3.772   24.257  23.413  1.00 56.45 ? 467  THR A CA  1 
ATOM   3559 C  C   . THR A 1 467 ? 3.797   22.956  22.616  1.00 55.30 ? 467  THR A C   1 
ATOM   3560 O  O   . THR A 1 467 ? 4.026   21.893  23.182  1.00 54.62 ? 467  THR A O   1 
ATOM   3561 C  CB  . THR A 1 467 ? 2.311   24.614  23.829  1.00 57.13 ? 467  THR A CB  1 
ATOM   3562 O  OG1 . THR A 1 467 ? 2.352   25.515  24.945  1.00 60.44 ? 467  THR A OG1 1 
ATOM   3563 C  CG2 . THR A 1 467 ? 1.534   23.381  24.236  1.00 56.87 ? 467  THR A CG2 1 
ATOM   3564 N  N   . GLU A 1 468 ? 3.573   23.031  21.309  1.00 55.46 ? 468  GLU A N   1 
ATOM   3565 C  CA  . GLU A 1 468 ? 3.585   21.815  20.498  1.00 56.12 ? 468  GLU A CA  1 
ATOM   3566 C  C   . GLU A 1 468 ? 4.980   21.189  20.511  1.00 53.35 ? 468  GLU A C   1 
ATOM   3567 O  O   . GLU A 1 468 ? 5.121   19.963  20.553  1.00 50.36 ? 468  GLU A O   1 
ATOM   3568 C  CB  . GLU A 1 468 ? 3.165   22.111  19.051  1.00 60.05 ? 468  GLU A CB  1 
ATOM   3569 C  CG  . GLU A 1 468 ? 1.866   22.911  18.897  1.00 67.31 ? 468  GLU A CG  1 
ATOM   3570 C  CD  . GLU A 1 468 ? 2.127   24.418  18.782  1.00 72.35 ? 468  GLU A CD  1 
ATOM   3571 O  OE1 . GLU A 1 468 ? 2.046   25.131  19.826  1.00 72.46 ? 468  GLU A OE1 1 
ATOM   3572 O  OE2 . GLU A 1 468 ? 2.437   24.877  17.639  1.00 73.52 ? 468  GLU A OE2 1 
ATOM   3573 N  N   . GLU A 1 469 ? 6.001   22.043  20.468  1.00 51.23 ? 469  GLU A N   1 
ATOM   3574 C  CA  . GLU A 1 469 ? 7.377   21.575  20.487  1.00 51.36 ? 469  GLU A CA  1 
ATOM   3575 C  C   . GLU A 1 469 ? 7.673   20.823  21.793  1.00 51.06 ? 469  GLU A C   1 
ATOM   3576 O  O   . GLU A 1 469 ? 8.354   19.801  21.790  1.00 48.62 ? 469  GLU A O   1 
ATOM   3577 C  CB  . GLU A 1 469 ? 8.334   22.754  20.287  1.00 49.48 ? 469  GLU A CB  1 
ATOM   3578 C  CG  . GLU A 1 469 ? 8.302   23.233  18.853  1.00 49.04 ? 469  GLU A CG  1 
ATOM   3579 C  CD  . GLU A 1 469 ? 9.227   24.382  18.574  1.00 49.22 ? 469  GLU A CD  1 
ATOM   3580 O  OE1 . GLU A 1 469 ? 9.204   25.365  19.351  1.00 47.72 ? 469  GLU A OE1 1 
ATOM   3581 O  OE2 . GLU A 1 469 ? 9.964   24.307  17.564  1.00 48.14 ? 469  GLU A OE2 1 
ATOM   3582 N  N   . ARG A 1 470 ? 7.127   21.328  22.894  1.00 51.45 ? 470  ARG A N   1 
ATOM   3583 C  CA  . ARG A 1 470 ? 7.306   20.709  24.194  1.00 53.79 ? 470  ARG A CA  1 
ATOM   3584 C  C   . ARG A 1 470 ? 6.635   19.324  24.210  1.00 53.25 ? 470  ARG A C   1 
ATOM   3585 O  O   . ARG A 1 470 ? 7.165   18.374  24.780  1.00 52.96 ? 470  ARG A O   1 
ATOM   3586 C  CB  . ARG A 1 470 ? 6.721   21.627  25.272  1.00 57.84 ? 470  ARG A CB  1 
ATOM   3587 C  CG  . ARG A 1 470 ? 7.112   21.300  26.706  1.00 65.74 ? 470  ARG A CG  1 
ATOM   3588 C  CD  . ARG A 1 470 ? 6.023   20.489  27.416  1.00 72.85 ? 470  ARG A CD  1 
ATOM   3589 N  NE  . ARG A 1 470 ? 4.713   21.154  27.405  1.00 78.07 ? 470  ARG A NE  1 
ATOM   3590 C  CZ  . ARG A 1 470 ? 3.551   20.533  27.635  1.00 80.37 ? 470  ARG A CZ  1 
ATOM   3591 N  NH1 . ARG A 1 470 ? 3.528   19.227  27.901  1.00 80.16 ? 470  ARG A NH1 1 
ATOM   3592 N  NH2 . ARG A 1 470 ? 2.408   21.216  27.578  1.00 81.03 ? 470  ARG A NH2 1 
ATOM   3593 N  N   . ILE A 1 471 ? 5.477   19.196  23.568  1.00 52.03 ? 471  ILE A N   1 
ATOM   3594 C  CA  . ILE A 1 471 ? 4.779   17.914  23.520  1.00 50.21 ? 471  ILE A CA  1 
ATOM   3595 C  C   . ILE A 1 471 ? 5.572   16.965  22.602  1.00 49.44 ? 471  ILE A C   1 
ATOM   3596 O  O   . ILE A 1 471 ? 5.692   15.751  22.859  1.00 48.50 ? 471  ILE A O   1 
ATOM   3597 C  CB  . ILE A 1 471 ? 3.305   18.138  23.020  1.00 51.04 ? 471  ILE A CB  1 
ATOM   3598 C  CG1 . ILE A 1 471 ? 2.522   18.870  24.110  1.00 51.56 ? 471  ILE A CG1 1 
ATOM   3599 C  CG2 . ILE A 1 471 ? 2.594   16.814  22.702  1.00 46.89 ? 471  ILE A CG2 1 
ATOM   3600 C  CD1 . ILE A 1 471 ? 1.191   19.424  23.639  1.00 53.16 ? 471  ILE A CD1 1 
ATOM   3601 N  N   . PHE A 1 472 ? 6.116   17.538  21.530  1.00 47.73 ? 472  PHE A N   1 
ATOM   3602 C  CA  . PHE A 1 472 ? 6.921   16.793  20.560  1.00 45.15 ? 472  PHE A CA  1 
ATOM   3603 C  C   . PHE A 1 472 ? 8.180   16.231  21.274  1.00 43.94 ? 472  PHE A C   1 
ATOM   3604 O  O   . PHE A 1 472 ? 8.504   15.045  21.145  1.00 42.99 ? 472  PHE A O   1 
ATOM   3605 C  CB  . PHE A 1 472 ? 7.292   17.741  19.409  1.00 43.34 ? 472  PHE A CB  1 
ATOM   3606 C  CG  . PHE A 1 472 ? 8.116   17.103  18.339  1.00 42.08 ? 472  PHE A CG  1 
ATOM   3607 C  CD1 . PHE A 1 472 ? 7.744   15.879  17.795  1.00 41.53 ? 472  PHE A CD1 1 
ATOM   3608 C  CD2 . PHE A 1 472 ? 9.268   17.723  17.878  1.00 40.06 ? 472  PHE A CD2 1 
ATOM   3609 C  CE1 . PHE A 1 472 ? 8.514   15.279  16.801  1.00 41.55 ? 472  PHE A CE1 1 
ATOM   3610 C  CE2 . PHE A 1 472 ? 10.042  17.140  16.886  1.00 40.50 ? 472  PHE A CE2 1 
ATOM   3611 C  CZ  . PHE A 1 472 ? 9.667   15.914  16.343  1.00 41.81 ? 472  PHE A CZ  1 
ATOM   3612 N  N   . ALA A 1 473 ? 8.858   17.082  22.049  1.00 43.45 ? 473  ALA A N   1 
ATOM   3613 C  CA  . ALA A 1 473 ? 10.054  16.679  22.798  1.00 44.56 ? 473  ALA A CA  1 
ATOM   3614 C  C   . ALA A 1 473 ? 9.732   15.498  23.713  1.00 45.90 ? 473  ALA A C   1 
ATOM   3615 O  O   . ALA A 1 473 ? 10.462  14.510  23.753  1.00 44.99 ? 473  ALA A O   1 
ATOM   3616 C  CB  . ALA A 1 473 ? 10.583  17.843  23.610  1.00 43.68 ? 473  ALA A CB  1 
ATOM   3617 N  N   . GLN A 1 474 ? 8.624   15.598  24.443  1.00 48.03 ? 474  GLN A N   1 
ATOM   3618 C  CA  . GLN A 1 474 ? 8.211   14.516  25.328  1.00 48.82 ? 474  GLN A CA  1 
ATOM   3619 C  C   . GLN A 1 474 ? 7.998   13.228  24.544  1.00 48.42 ? 474  GLN A C   1 
ATOM   3620 O  O   . GLN A 1 474 ? 8.381   12.156  25.010  1.00 48.47 ? 474  GLN A O   1 
ATOM   3621 C  CB  . GLN A 1 474 ? 6.945   14.913  26.096  1.00 51.29 ? 474  GLN A CB  1 
ATOM   3622 C  CG  . GLN A 1 474 ? 7.195   16.083  27.068  1.00 56.70 ? 474  GLN A CG  1 
ATOM   3623 C  CD  . GLN A 1 474 ? 5.940   16.553  27.791  1.00 60.55 ? 474  GLN A CD  1 
ATOM   3624 O  OE1 . GLN A 1 474 ? 4.898   16.808  27.176  1.00 64.64 ? 474  GLN A OE1 1 
ATOM   3625 N  NE2 . GLN A 1 474 ? 6.039   16.686  29.103  1.00 62.45 ? 474  GLN A NE2 1 
ATOM   3626 N  N   . ARG A 1 475 ? 7.413   13.321  23.348  1.00 48.06 ? 475  ARG A N   1 
ATOM   3627 C  CA  . ARG A 1 475 ? 7.209   12.117  22.529  1.00 47.91 ? 475  ARG A CA  1 
ATOM   3628 C  C   . ARG A 1 475 ? 8.553   11.468  22.183  1.00 46.76 ? 475  ARG A C   1 
ATOM   3629 O  O   . ARG A 1 475 ? 8.727   10.246  22.310  1.00 47.18 ? 475  ARG A O   1 
ATOM   3630 C  CB  . ARG A 1 475 ? 6.516   12.440  21.191  1.00 49.58 ? 475  ARG A CB  1 
ATOM   3631 C  CG  . ARG A 1 475 ? 5.017   12.534  21.217  1.00 52.26 ? 475  ARG A CG  1 
ATOM   3632 C  CD  . ARG A 1 475 ? 4.452   12.864  19.827  1.00 52.25 ? 475  ARG A CD  1 
ATOM   3633 N  NE  . ARG A 1 475 ? 4.834   11.875  18.823  1.00 50.88 ? 475  ARG A NE  1 
ATOM   3634 C  CZ  . ARG A 1 475 ? 5.081   12.181  17.548  1.00 50.73 ? 475  ARG A CZ  1 
ATOM   3635 N  NH1 . ARG A 1 475 ? 4.976   13.443  17.148  1.00 48.52 ? 475  ARG A NH1 1 
ATOM   3636 N  NH2 . ARG A 1 475 ? 5.455   11.236  16.682  1.00 47.92 ? 475  ARG A NH2 1 
ATOM   3637 N  N   . LEU A 1 476 ? 9.487   12.289  21.706  1.00 44.28 ? 476  LEU A N   1 
ATOM   3638 C  CA  . LEU A 1 476 ? 10.799  11.785  21.304  1.00 44.02 ? 476  LEU A CA  1 
ATOM   3639 C  C   . LEU A 1 476 ? 11.569  11.150  22.454  1.00 43.74 ? 476  LEU A C   1 
ATOM   3640 O  O   . LEU A 1 476 ? 12.170  10.086  22.272  1.00 43.93 ? 476  LEU A O   1 
ATOM   3641 C  CB  . LEU A 1 476 ? 11.620  12.910  20.652  1.00 43.44 ? 476  LEU A CB  1 
ATOM   3642 C  CG  . LEU A 1 476 ? 11.043  13.484  19.345  1.00 42.44 ? 476  LEU A CG  1 
ATOM   3643 C  CD1 . LEU A 1 476 ? 11.800  14.714  18.987  1.00 44.46 ? 476  LEU A CD1 1 
ATOM   3644 C  CD2 . LEU A 1 476 ? 11.117  12.482  18.218  1.00 41.78 ? 476  LEU A CD2 1 
ATOM   3645 N  N   . MET A 1 477 ? 11.537  11.787  23.630  1.00 42.93 ? 477  MET A N   1 
ATOM   3646 C  CA  . MET A 1 477 ? 12.223  11.268  24.804  1.00 44.60 ? 477  MET A CA  1 
ATOM   3647 C  C   . MET A 1 477 ? 11.663  9.885   25.129  1.00 46.04 ? 477  MET A C   1 
ATOM   3648 O  O   . MET A 1 477 ? 12.409  8.979   25.519  1.00 44.94 ? 477  MET A O   1 
ATOM   3649 C  CB  . MET A 1 477 ? 12.041  12.200  25.991  1.00 44.51 ? 477  MET A CB  1 
ATOM   3650 C  CG  . MET A 1 477 ? 12.689  13.571  25.831  1.00 48.48 ? 477  MET A CG  1 
ATOM   3651 S  SD  . MET A 1 477 ? 12.296  14.657  27.257  1.00 51.82 ? 477  MET A SD  1 
ATOM   3652 C  CE  . MET A 1 477 ? 13.478  14.127  28.388  1.00 52.13 ? 477  MET A CE  1 
ATOM   3653 N  N   . LYS A 1 478 ? 10.349  9.725   24.952  1.00 46.38 ? 478  LYS A N   1 
ATOM   3654 C  CA  . LYS A 1 478 ? 9.707   8.438   25.195  1.00 48.95 ? 478  LYS A CA  1 
ATOM   3655 C  C   . LYS A 1 478 ? 10.218  7.391   24.202  1.00 47.89 ? 478  LYS A C   1 
ATOM   3656 O  O   . LYS A 1 478 ? 10.536  6.255   24.584  1.00 47.94 ? 478  LYS A O   1 
ATOM   3657 C  CB  . LYS A 1 478 ? 8.189   8.550   25.060  1.00 52.01 ? 478  LYS A CB  1 
ATOM   3658 C  CG  . LYS A 1 478 ? 7.474   9.081   26.267  1.00 56.35 ? 478  LYS A CG  1 
ATOM   3659 C  CD  . LYS A 1 478 ? 7.104   7.949   27.210  1.00 60.75 ? 478  LYS A CD  1 
ATOM   3660 C  CE  . LYS A 1 478 ? 6.252   8.444   28.387  1.00 60.47 ? 478  LYS A CE  1 
ATOM   3661 N  NZ  . LYS A 1 478 ? 7.024   9.159   29.448  1.00 61.53 ? 478  LYS A NZ  1 
ATOM   3662 N  N   . TYR A 1 479 ? 10.293  7.761   22.924  1.00 46.60 ? 479  TYR A N   1 
ATOM   3663 C  CA  . TYR A 1 479 ? 10.786  6.820   21.917  1.00 44.23 ? 479  TYR A CA  1 
ATOM   3664 C  C   . TYR A 1 479 ? 12.193  6.331   22.246  1.00 43.63 ? 479  TYR A C   1 
ATOM   3665 O  O   . TYR A 1 479 ? 12.452  5.117   22.250  1.00 41.24 ? 479  TYR A O   1 
ATOM   3666 C  CB  . TYR A 1 479 ? 10.843  7.460   20.539  1.00 43.05 ? 479  TYR A CB  1 
ATOM   3667 C  CG  . TYR A 1 479 ? 9.513   7.714   19.896  1.00 42.80 ? 479  TYR A CG  1 
ATOM   3668 C  CD1 . TYR A 1 479 ? 8.449   6.804   20.029  1.00 41.65 ? 479  TYR A CD1 1 
ATOM   3669 C  CD2 . TYR A 1 479 ? 9.322   8.850   19.125  1.00 40.29 ? 479  TYR A CD2 1 
ATOM   3670 C  CE1 . TYR A 1 479 ? 7.205   7.041   19.395  1.00 41.07 ? 479  TYR A CE1 1 
ATOM   3671 C  CE2 . TYR A 1 479 ? 8.110   9.100   18.502  1.00 44.28 ? 479  TYR A CE2 1 
ATOM   3672 C  CZ  . TYR A 1 479 ? 7.050   8.201   18.638  1.00 42.88 ? 479  TYR A CZ  1 
ATOM   3673 O  OH  . TYR A 1 479 ? 5.851   8.524   18.044  1.00 43.76 ? 479  TYR A OH  1 
ATOM   3674 N  N   . TRP A 1 480 ? 13.090  7.287   22.513  1.00 41.14 ? 480  TRP A N   1 
ATOM   3675 C  CA  . TRP A 1 480 ? 14.478  6.976   22.798  1.00 41.37 ? 480  TRP A CA  1 
ATOM   3676 C  C   . TRP A 1 480 ? 14.655  6.132   24.057  1.00 41.85 ? 480  TRP A C   1 
ATOM   3677 O  O   . TRP A 1 480 ? 15.380  5.125   24.031  1.00 40.79 ? 480  TRP A O   1 
ATOM   3678 C  CB  . TRP A 1 480 ? 15.308  8.274   22.881  1.00 41.71 ? 480  TRP A CB  1 
ATOM   3679 C  CG  . TRP A 1 480 ? 16.110  8.616   21.616  1.00 40.25 ? 480  TRP A CG  1 
ATOM   3680 C  CD1 . TRP A 1 480 ? 17.478  8.696   21.506  1.00 38.65 ? 480  TRP A CD1 1 
ATOM   3681 C  CD2 . TRP A 1 480 ? 15.592  8.914   20.303  1.00 40.63 ? 480  TRP A CD2 1 
ATOM   3682 N  NE1 . TRP A 1 480 ? 17.836  9.021   20.220  1.00 37.03 ? 480  TRP A NE1 1 
ATOM   3683 C  CE2 . TRP A 1 480 ? 16.706  9.160   19.460  1.00 38.09 ? 480  TRP A CE2 1 
ATOM   3684 C  CE3 . TRP A 1 480 ? 14.298  8.995   19.759  1.00 40.86 ? 480  TRP A CE3 1 
ATOM   3685 C  CZ2 . TRP A 1 480 ? 16.565  9.478   18.106  1.00 40.41 ? 480  TRP A CZ2 1 
ATOM   3686 C  CZ3 . TRP A 1 480 ? 14.152  9.311   18.412  1.00 40.84 ? 480  TRP A CZ3 1 
ATOM   3687 C  CH2 . TRP A 1 480 ? 15.285  9.551   17.595  1.00 41.67 ? 480  TRP A CH2 1 
ATOM   3688 N  N   . THR A 1 481 ? 14.000  6.525   25.152  1.00 43.26 ? 481  THR A N   1 
ATOM   3689 C  CA  . THR A 1 481 ? 14.101  5.770   26.407  1.00 43.46 ? 481  THR A CA  1 
ATOM   3690 C  C   . THR A 1 481 ? 13.385  4.422   26.292  1.00 43.99 ? 481  THR A C   1 
ATOM   3691 O  O   . THR A 1 481 ? 13.855  3.435   26.852  1.00 43.20 ? 481  THR A O   1 
ATOM   3692 C  CB  . THR A 1 481 ? 13.547  6.567   27.593  1.00 44.83 ? 481  THR A CB  1 
ATOM   3693 O  OG1 . THR A 1 481 ? 12.238  7.035   27.275  1.00 47.62 ? 481  THR A OG1 1 
ATOM   3694 C  CG2 . THR A 1 481 ? 14.423  7.784   27.872  1.00 46.36 ? 481  THR A CG2 1 
ATOM   3695 N  N   . ASN A 1 482 ? 12.274  4.354   25.551  1.00 44.31 ? 482  ASN A N   1 
ATOM   3696 C  CA  . ASN A 1 482 ? 11.614  3.056   25.378  1.00 45.06 ? 482  ASN A CA  1 
ATOM   3697 C  C   . ASN A 1 482 ? 12.589  2.136   24.661  1.00 46.14 ? 482  ASN A C   1 
ATOM   3698 O  O   . ASN A 1 482 ? 12.756  0.961   25.036  1.00 47.41 ? 482  ASN A O   1 
ATOM   3699 C  CB  . ASN A 1 482 ? 10.348  3.135   24.522  1.00 47.42 ? 482  ASN A CB  1 
ATOM   3700 C  CG  . ASN A 1 482 ? 9.126   3.555   25.305  1.00 47.48 ? 482  ASN A CG  1 
ATOM   3701 O  OD1 . ASN A 1 482 ? 9.085   3.435   26.517  1.00 51.21 ? 482  ASN A OD1 1 
ATOM   3702 N  ND2 . ASN A 1 482 ? 8.111   4.034   24.602  1.00 49.89 ? 482  ASN A ND2 1 
ATOM   3703 N  N   . PHE A 1 483 ? 13.221  2.663   23.615  1.00 44.50 ? 483  PHE A N   1 
ATOM   3704 C  CA  . PHE A 1 483 ? 14.183  1.880   22.859  1.00 43.45 ? 483  PHE A CA  1 
ATOM   3705 C  C   . PHE A 1 483 ? 15.337  1.447   23.770  1.00 44.83 ? 483  PHE A C   1 
ATOM   3706 O  O   . PHE A 1 483 ? 15.821  0.308   23.686  1.00 45.01 ? 483  PHE A O   1 
ATOM   3707 C  CB  . PHE A 1 483 ? 14.754  2.684   21.688  1.00 41.25 ? 483  PHE A CB  1 
ATOM   3708 C  CG  . PHE A 1 483 ? 15.802  1.939   20.916  1.00 40.10 ? 483  PHE A CG  1 
ATOM   3709 C  CD1 . PHE A 1 483 ? 15.437  0.955   19.979  1.00 38.25 ? 483  PHE A CD1 1 
ATOM   3710 C  CD2 . PHE A 1 483 ? 17.155  2.161   21.171  1.00 37.45 ? 483  PHE A CD2 1 
ATOM   3711 C  CE1 . PHE A 1 483 ? 16.403  0.203   19.308  1.00 38.52 ? 483  PHE A CE1 1 
ATOM   3712 C  CE2 . PHE A 1 483 ? 18.133  1.414   20.509  1.00 38.44 ? 483  PHE A CE2 1 
ATOM   3713 C  CZ  . PHE A 1 483 ? 17.760  0.423   19.565  1.00 36.80 ? 483  PHE A CZ  1 
ATOM   3714 N  N   . ALA A 1 484 ? 15.795  2.347   24.636  1.00 44.94 ? 484  ALA A N   1 
ATOM   3715 C  CA  . ALA A 1 484 ? 16.894  1.999   25.531  1.00 46.61 ? 484  ALA A CA  1 
ATOM   3716 C  C   . ALA A 1 484 ? 16.469  0.894   26.494  1.00 48.71 ? 484  ALA A C   1 
ATOM   3717 O  O   . ALA A 1 484 ? 17.240  -0.008  26.797  1.00 47.70 ? 484  ALA A O   1 
ATOM   3718 C  CB  . ALA A 1 484 ? 17.335  3.204   26.310  1.00 46.30 ? 484  ALA A CB  1 
ATOM   3719 N  N   . ARG A 1 485 ? 15.229  0.964   26.962  1.00 51.17 ? 485  ARG A N   1 
ATOM   3720 C  CA  . ARG A 1 485 ? 14.730  -0.020  27.913  1.00 54.17 ? 485  ARG A CA  1 
ATOM   3721 C  C   . ARG A 1 485 ? 14.454  -1.388  27.303  1.00 54.27 ? 485  ARG A C   1 
ATOM   3722 O  O   . ARG A 1 485 ? 14.825  -2.415  27.881  1.00 53.72 ? 485  ARG A O   1 
ATOM   3723 C  CB  . ARG A 1 485 ? 13.441  0.486   28.600  1.00 57.13 ? 485  ARG A CB  1 
ATOM   3724 C  CG  . ARG A 1 485 ? 13.639  1.683   29.567  1.00 63.30 ? 485  ARG A CG  1 
ATOM   3725 C  CD  . ARG A 1 485 ? 12.312  2.123   30.270  1.00 66.96 ? 485  ARG A CD  1 
ATOM   3726 N  NE  . ARG A 1 485 ? 11.471  2.984   29.426  1.00 69.38 ? 485  ARG A NE  1 
ATOM   3727 C  CZ  . ARG A 1 485 ? 11.302  4.299   29.606  1.00 70.41 ? 485  ARG A CZ  1 
ATOM   3728 N  NH1 . ARG A 1 485 ? 11.910  4.928   30.612  1.00 68.96 ? 485  ARG A NH1 1 
ATOM   3729 N  NH2 . ARG A 1 485 ? 10.534  4.996   28.764  1.00 69.39 ? 485  ARG A NH2 1 
ATOM   3730 N  N   . THR A 1 486 ? 13.853  -1.401  26.120  1.00 52.65 ? 486  THR A N   1 
ATOM   3731 C  CA  . THR A 1 486 ? 13.449  -2.650  25.502  1.00 51.19 ? 486  THR A CA  1 
ATOM   3732 C  C   . THR A 1 486 ? 13.966  -2.978  24.113  1.00 53.06 ? 486  THR A C   1 
ATOM   3733 O  O   . THR A 1 486 ? 13.755  -4.084  23.626  1.00 53.88 ? 486  THR A O   1 
ATOM   3734 C  CB  . THR A 1 486 ? 11.951  -2.672  25.399  1.00 51.70 ? 486  THR A CB  1 
ATOM   3735 O  OG1 . THR A 1 486 ? 11.561  -1.760  24.366  1.00 52.57 ? 486  THR A OG1 1 
ATOM   3736 C  CG2 . THR A 1 486 ? 11.319  -2.200  26.700  1.00 47.95 ? 486  THR A CG2 1 
ATOM   3737 N  N   . GLY A 1 487 ? 14.618  -2.034  23.449  1.00 54.44 ? 487  GLY A N   1 
ATOM   3738 C  CA  . GLY A 1 487 ? 15.097  -2.313  22.111  1.00 52.26 ? 487  GLY A CA  1 
ATOM   3739 C  C   . GLY A 1 487 ? 13.965  -2.082  21.136  1.00 52.48 ? 487  GLY A C   1 
ATOM   3740 O  O   . GLY A 1 487 ? 14.067  -2.466  19.980  1.00 53.80 ? 487  GLY A O   1 
ATOM   3741 N  N   . ASP A 1 488 ? 12.885  -1.458  21.606  1.00 53.09 ? 488  ASP A N   1 
ATOM   3742 C  CA  . ASP A 1 488 ? 11.712  -1.142  20.781  1.00 53.77 ? 488  ASP A CA  1 
ATOM   3743 C  C   . ASP A 1 488 ? 11.243  0.265   21.161  1.00 53.37 ? 488  ASP A C   1 
ATOM   3744 O  O   . ASP A 1 488 ? 10.888  0.491   22.314  1.00 54.28 ? 488  ASP A O   1 
ATOM   3745 C  CB  . ASP A 1 488 ? 10.583  -2.127  21.083  1.00 57.29 ? 488  ASP A CB  1 
ATOM   3746 C  CG  . ASP A 1 488 ? 9.368   -1.941  20.177  1.00 59.69 ? 488  ASP A CG  1 
ATOM   3747 O  OD1 . ASP A 1 488 ? 9.039   -0.798  19.782  1.00 61.58 ? 488  ASP A OD1 1 
ATOM   3748 O  OD2 . ASP A 1 488 ? 8.716   -2.956  19.874  1.00 62.78 ? 488  ASP A OD2 1 
ATOM   3749 N  N   . PRO A 1 489 ? 11.210  1.221   20.201  1.00 53.10 ? 489  PRO A N   1 
ATOM   3750 C  CA  . PRO A 1 489 ? 10.771  2.598   20.504  1.00 52.77 ? 489  PRO A CA  1 
ATOM   3751 C  C   . PRO A 1 489 ? 9.301   2.744   20.885  1.00 54.19 ? 489  PRO A C   1 
ATOM   3752 O  O   . PRO A 1 489 ? 8.895   3.738   21.488  1.00 52.84 ? 489  PRO A O   1 
ATOM   3753 C  CB  . PRO A 1 489 ? 11.079  3.350   19.216  1.00 50.23 ? 489  PRO A CB  1 
ATOM   3754 C  CG  . PRO A 1 489 ? 10.819  2.305   18.163  1.00 50.27 ? 489  PRO A CG  1 
ATOM   3755 C  CD  . PRO A 1 489 ? 11.492  1.070   18.758  1.00 51.11 ? 489  PRO A CD  1 
ATOM   3756 N  N   . ASN A 1 490 ? 8.508   1.749   20.519  1.00 56.61 ? 490  ASN A N   1 
ATOM   3757 C  CA  . ASN A 1 490 ? 7.072   1.766   20.766  1.00 60.51 ? 490  ASN A CA  1 
ATOM   3758 C  C   . ASN A 1 490 ? 6.688   1.646   22.229  1.00 65.01 ? 490  ASN A C   1 
ATOM   3759 O  O   . ASN A 1 490 ? 7.351   0.958   23.002  1.00 65.49 ? 490  ASN A O   1 
ATOM   3760 C  CB  . ASN A 1 490 ? 6.405   0.626   19.987  1.00 56.30 ? 490  ASN A CB  1 
ATOM   3761 C  CG  . ASN A 1 490 ? 6.440   0.840   18.499  1.00 52.65 ? 490  ASN A CG  1 
ATOM   3762 O  OD1 . ASN A 1 490 ? 5.752   1.716   17.968  1.00 50.26 ? 490  ASN A OD1 1 
ATOM   3763 N  ND2 . ASN A 1 490 ? 7.234   0.041   17.815  1.00 47.91 ? 490  ASN A ND2 1 
ATOM   3764 N  N   . ASP A 1 491 ? 5.601   2.307   22.599  1.00 71.40 ? 491  ASP A N   1 
ATOM   3765 C  CA  . ASP A 1 491 ? 5.119   2.248   23.975  1.00 78.75 ? 491  ASP A CA  1 
ATOM   3766 C  C   . ASP A 1 491 ? 4.131   1.079   24.096  1.00 82.44 ? 491  ASP A C   1 
ATOM   3767 O  O   . ASP A 1 491 ? 3.071   1.094   23.475  1.00 82.67 ? 491  ASP A O   1 
ATOM   3768 C  CB  . ASP A 1 491 ? 4.426   3.563   24.340  1.00 81.27 ? 491  ASP A CB  1 
ATOM   3769 C  CG  . ASP A 1 491 ? 4.079   3.646   25.819  1.00 84.89 ? 491  ASP A CG  1 
ATOM   3770 O  OD1 . ASP A 1 491 ? 4.060   4.780   26.365  1.00 86.27 ? 491  ASP A OD1 1 
ATOM   3771 O  OD2 . ASP A 1 491 ? 3.823   2.581   26.434  1.00 85.67 ? 491  ASP A OD2 1 
ATOM   3772 N  N   . PRO A 1 492 ? 4.455   0.051   24.899  1.00 85.79 ? 492  PRO A N   1 
ATOM   3773 C  CA  . PRO A 1 492 ? 3.539   -1.097  25.043  1.00 88.69 ? 492  PRO A CA  1 
ATOM   3774 C  C   . PRO A 1 492 ? 2.097   -0.756  25.498  1.00 91.12 ? 492  PRO A C   1 
ATOM   3775 O  O   . PRO A 1 492 ? 1.128   -1.369  25.038  1.00 90.97 ? 492  PRO A O   1 
ATOM   3776 C  CB  . PRO A 1 492 ? 4.269   -1.999  26.046  1.00 88.56 ? 492  PRO A CB  1 
ATOM   3777 C  CG  . PRO A 1 492 ? 5.725   -1.660  25.810  1.00 88.22 ? 492  PRO A CG  1 
ATOM   3778 C  CD  . PRO A 1 492 ? 5.685   -0.149  25.685  1.00 86.41 ? 492  PRO A CD  1 
ATOM   3779 N  N   . ARG A 1 493 ? 1.963   0.222   26.393  1.00 93.57 ? 493  ARG A N   1 
ATOM   3780 C  CA  . ARG A 1 493 ? 0.650   0.628   26.901  1.00 95.64 ? 493  ARG A CA  1 
ATOM   3781 C  C   . ARG A 1 493 ? 0.054   1.729   26.034  1.00 96.75 ? 493  ARG A C   1 
ATOM   3782 O  O   . ARG A 1 493 ? -0.090  2.871   26.489  1.00 97.04 ? 493  ARG A O   1 
ATOM   3783 C  CB  . ARG A 1 493 ? 0.754   1.172   28.332  1.00 96.57 ? 493  ARG A CB  1 
ATOM   3784 C  CG  . ARG A 1 493 ? 1.730   0.464   29.245  1.00 97.47 ? 493  ARG A CG  1 
ATOM   3785 C  CD  . ARG A 1 493 ? 2.716   1.476   29.805  1.00 98.23 ? 493  ARG A CD  1 
ATOM   3786 N  NE  . ARG A 1 493 ? 3.464   0.948   30.941  1.00 99.28 ? 493  ARG A NE  1 
ATOM   3787 C  CZ  . ARG A 1 493 ? 4.389   1.633   31.608  1.00 99.28 ? 493  ARG A CZ  1 
ATOM   3788 N  NH1 . ARG A 1 493 ? 4.682   2.880   31.243  1.00 99.28 ? 493  ARG A NH1 1 
ATOM   3789 N  NH2 . ARG A 1 493 ? 5.007   1.076   32.647  1.00 99.21 ? 493  ARG A NH2 1 
ATOM   3790 N  N   . ASP A 1 494 ? -0.286  1.397   24.793  1.00 97.45 ? 494  ASP A N   1 
ATOM   3791 C  CA  . ASP A 1 494 ? -0.869  2.377   23.878  1.00 98.16 ? 494  ASP A CA  1 
ATOM   3792 C  C   . ASP A 1 494 ? -0.977  1.805   22.469  1.00 98.51 ? 494  ASP A C   1 
ATOM   3793 O  O   . ASP A 1 494 ? 0.013   1.744   21.733  1.00 99.15 ? 494  ASP A O   1 
ATOM   3794 C  CB  . ASP A 1 494 ? -0.017  3.649   23.841  1.00 97.90 ? 494  ASP A CB  1 
ATOM   3795 C  CG  . ASP A 1 494 ? -0.647  4.738   23.003  1.00 98.23 ? 494  ASP A CG  1 
ATOM   3796 O  OD1 . ASP A 1 494 ? -1.028  4.453   21.848  1.00 98.21 ? 494  ASP A OD1 1 
ATOM   3797 O  OD2 . ASP A 1 494 ? -0.759  5.879   23.495  1.00 98.40 ? 494  ASP A OD2 1 
ATOM   3798 N  N   . SER A 1 495 ? -2.185  1.396   22.095  1.00 98.15 ? 495  SER A N   1 
ATOM   3799 C  CA  . SER A 1 495 ? -2.421  0.820   20.775  1.00 97.58 ? 495  SER A CA  1 
ATOM   3800 C  C   . SER A 1 495 ? -2.909  1.881   19.795  1.00 96.93 ? 495  SER A C   1 
ATOM   3801 O  O   . SER A 1 495 ? -2.871  1.672   18.576  1.00 96.67 ? 495  SER A O   1 
ATOM   3802 C  CB  . SER A 1 495 ? -3.455  -0.304  20.873  1.00 98.15 ? 495  SER A CB  1 
ATOM   3803 O  OG  . SER A 1 495 ? -3.053  -1.284  21.818  1.00 98.22 ? 495  SER A OG  1 
ATOM   3804 N  N   . LYS A 1 496 ? -3.371  3.011   20.339  1.00 95.82 ? 496  LYS A N   1 
ATOM   3805 C  CA  . LYS A 1 496 ? -3.868  4.131   19.531  1.00 94.22 ? 496  LYS A CA  1 
ATOM   3806 C  C   . LYS A 1 496 ? -2.765  4.679   18.608  1.00 92.67 ? 496  LYS A C   1 
ATOM   3807 O  O   . LYS A 1 496 ? -2.832  4.523   17.376  1.00 92.55 ? 496  LYS A O   1 
ATOM   3808 C  CB  . LYS A 1 496 ? -4.405  5.252   20.448  1.00 93.32 ? 496  LYS A CB  1 
ATOM   3809 N  N   . SER A 1 497 ? -1.758  5.310   19.216  1.00 90.11 ? 497  SER A N   1 
ATOM   3810 C  CA  . SER A 1 497 ? -0.624  5.880   18.487  1.00 86.97 ? 497  SER A CA  1 
ATOM   3811 C  C   . SER A 1 497 ? -0.178  4.872   17.437  1.00 84.81 ? 497  SER A C   1 
ATOM   3812 O  O   . SER A 1 497 ? 0.037   3.696   17.750  1.00 85.30 ? 497  SER A O   1 
ATOM   3813 C  CB  . SER A 1 497 ? 0.539   6.158   19.446  1.00 86.94 ? 497  SER A CB  1 
ATOM   3814 O  OG  . SER A 1 497 ? 0.135   6.951   20.552  1.00 86.28 ? 497  SER A OG  1 
ATOM   3815 N  N   . PRO A 1 498 ? -0.040  5.307   16.175  1.00 82.17 ? 498  PRO A N   1 
ATOM   3816 C  CA  . PRO A 1 498 ? 0.389   4.339   15.156  1.00 79.06 ? 498  PRO A CA  1 
ATOM   3817 C  C   . PRO A 1 498 ? 1.746   3.754   15.531  1.00 75.29 ? 498  PRO A C   1 
ATOM   3818 O  O   . PRO A 1 498 ? 2.588   4.454   16.074  1.00 74.90 ? 498  PRO A O   1 
ATOM   3819 C  CB  . PRO A 1 498 ? 0.416   5.175   13.876  1.00 80.58 ? 498  PRO A CB  1 
ATOM   3820 C  CG  . PRO A 1 498 ? 0.720   6.572   14.388  1.00 81.51 ? 498  PRO A CG  1 
ATOM   3821 C  CD  . PRO A 1 498 ? -0.110  6.678   15.640  1.00 81.20 ? 498  PRO A CD  1 
ATOM   3822 N  N   . GLN A 1 499 ? 1.945   2.471   15.266  1.00 71.65 ? 499  GLN A N   1 
ATOM   3823 C  CA  . GLN A 1 499 ? 3.206   1.827   15.606  1.00 67.88 ? 499  GLN A CA  1 
ATOM   3824 C  C   . GLN A 1 499 ? 4.360   2.171   14.654  1.00 64.67 ? 499  GLN A C   1 
ATOM   3825 O  O   . GLN A 1 499 ? 4.160   2.517   13.486  1.00 64.30 ? 499  GLN A O   1 
ATOM   3826 C  CB  . GLN A 1 499 ? 3.011   0.306   15.666  1.00 68.71 ? 499  GLN A CB  1 
ATOM   3827 C  CG  . GLN A 1 499 ? 1.925   -0.111  16.644  1.00 69.45 ? 499  GLN A CG  1 
ATOM   3828 C  CD  . GLN A 1 499 ? 2.194   0.383   18.061  1.00 69.76 ? 499  GLN A CD  1 
ATOM   3829 O  OE1 . GLN A 1 499 ? 3.034   -0.170  18.777  1.00 69.98 ? 499  GLN A OE1 1 
ATOM   3830 N  NE2 . GLN A 1 499 ? 1.485   1.434   18.468  1.00 68.96 ? 499  GLN A NE2 1 
ATOM   3831 N  N   . TRP A 1 500 ? 5.573   2.074   15.179  1.00 60.42 ? 500  TRP A N   1 
ATOM   3832 C  CA  . TRP A 1 500 ? 6.783   2.335   14.420  1.00 56.68 ? 500  TRP A CA  1 
ATOM   3833 C  C   . TRP A 1 500 ? 7.283   0.935   14.046  1.00 55.02 ? 500  TRP A C   1 
ATOM   3834 O  O   . TRP A 1 500 ? 7.745   0.171   14.898  1.00 54.88 ? 500  TRP A O   1 
ATOM   3835 C  CB  . TRP A 1 500 ? 7.783   3.082   15.317  1.00 54.85 ? 500  TRP A CB  1 
ATOM   3836 C  CG  . TRP A 1 500 ? 9.096   3.500   14.706  1.00 52.77 ? 500  TRP A CG  1 
ATOM   3837 C  CD1 . TRP A 1 500 ? 9.719   2.955   13.608  1.00 53.05 ? 500  TRP A CD1 1 
ATOM   3838 C  CD2 . TRP A 1 500 ? 10.011  4.472   15.239  1.00 50.63 ? 500  TRP A CD2 1 
ATOM   3839 N  NE1 . TRP A 1 500 ? 10.963  3.526   13.435  1.00 51.49 ? 500  TRP A NE1 1 
ATOM   3840 C  CE2 . TRP A 1 500 ? 11.167  4.455   14.422  1.00 50.39 ? 500  TRP A CE2 1 
ATOM   3841 C  CE3 . TRP A 1 500 ? 9.968   5.349   16.333  1.00 49.20 ? 500  TRP A CE3 1 
ATOM   3842 C  CZ2 . TRP A 1 500 ? 12.264  5.278   14.666  1.00 48.45 ? 500  TRP A CZ2 1 
ATOM   3843 C  CZ3 . TRP A 1 500 ? 11.062  6.173   16.576  1.00 48.08 ? 500  TRP A CZ3 1 
ATOM   3844 C  CH2 . TRP A 1 500 ? 12.194  6.127   15.745  1.00 49.25 ? 500  TRP A CH2 1 
ATOM   3845 N  N   . PRO A 1 501 ? 7.168   0.567   12.761  1.00 53.76 ? 501  PRO A N   1 
ATOM   3846 C  CA  . PRO A 1 501 ? 7.623   -0.759  12.346  1.00 52.17 ? 501  PRO A CA  1 
ATOM   3847 C  C   . PRO A 1 501 ? 9.109   -0.852  12.133  1.00 52.38 ? 501  PRO A C   1 
ATOM   3848 O  O   . PRO A 1 501 ? 9.751   0.117   11.764  1.00 52.07 ? 501  PRO A O   1 
ATOM   3849 C  CB  . PRO A 1 501 ? 6.867   -0.985  11.040  1.00 51.73 ? 501  PRO A CB  1 
ATOM   3850 C  CG  . PRO A 1 501 ? 6.817   0.389   10.453  1.00 51.86 ? 501  PRO A CG  1 
ATOM   3851 C  CD  . PRO A 1 501 ? 6.466   1.255   11.658  1.00 51.64 ? 501  PRO A CD  1 
ATOM   3852 N  N   . PRO A 1 502 ? 9.681   -2.028  12.387  1.00 53.00 ? 502  PRO A N   1 
ATOM   3853 C  CA  . PRO A 1 502 ? 11.118  -2.238  12.194  1.00 52.37 ? 502  PRO A CA  1 
ATOM   3854 C  C   . PRO A 1 502 ? 11.442  -1.993  10.708  1.00 53.25 ? 502  PRO A C   1 
ATOM   3855 O  O   . PRO A 1 502 ? 10.556  -2.068  9.849   1.00 52.72 ? 502  PRO A O   1 
ATOM   3856 C  CB  . PRO A 1 502 ? 11.302  -3.702  12.563  1.00 49.77 ? 502  PRO A CB  1 
ATOM   3857 C  CG  . PRO A 1 502 ? 10.312  -3.872  13.678  1.00 51.93 ? 502  PRO A CG  1 
ATOM   3858 C  CD  . PRO A 1 502 ? 9.083   -3.123  13.173  1.00 51.82 ? 502  PRO A CD  1 
ATOM   3859 N  N   . TYR A 1 503 ? 12.704  -1.700  10.416  1.00 51.92 ? 503  TYR A N   1 
ATOM   3860 C  CA  . TYR A 1 503 ? 13.121  -1.484  9.055   1.00 51.62 ? 503  TYR A CA  1 
ATOM   3861 C  C   . TYR A 1 503 ? 13.646  -2.820  8.544   1.00 52.86 ? 503  TYR A C   1 
ATOM   3862 O  O   . TYR A 1 503 ? 14.439  -3.486  9.217   1.00 52.80 ? 503  TYR A O   1 
ATOM   3863 C  CB  . TYR A 1 503 ? 14.215  -0.414  8.996   1.00 50.49 ? 503  TYR A CB  1 
ATOM   3864 C  CG  . TYR A 1 503 ? 14.843  -0.245  7.627   1.00 48.43 ? 503  TYR A CG  1 
ATOM   3865 C  CD1 . TYR A 1 503 ? 15.921  -1.047  7.228   1.00 47.91 ? 503  TYR A CD1 1 
ATOM   3866 C  CD2 . TYR A 1 503 ? 14.349  0.701   6.724   1.00 47.98 ? 503  TYR A CD2 1 
ATOM   3867 C  CE1 . TYR A 1 503 ? 16.487  -0.917  5.975   1.00 47.66 ? 503  TYR A CE1 1 
ATOM   3868 C  CE2 . TYR A 1 503 ? 14.910  0.846   5.467   1.00 50.05 ? 503  TYR A CE2 1 
ATOM   3869 C  CZ  . TYR A 1 503 ? 15.980  0.029   5.099   1.00 50.54 ? 503  TYR A CZ  1 
ATOM   3870 O  OH  . TYR A 1 503 ? 16.532  0.150   3.848   1.00 53.11 ? 503  TYR A OH  1 
ATOM   3871 N  N   . THR A 1 504 ? 13.206  -3.200  7.349   1.00 53.71 ? 504  THR A N   1 
ATOM   3872 C  CA  . THR A 1 504 ? 13.613  -4.462  6.726   1.00 55.48 ? 504  THR A CA  1 
ATOM   3873 C  C   . THR A 1 504 ? 14.010  -4.237  5.269   1.00 56.37 ? 504  THR A C   1 
ATOM   3874 O  O   . THR A 1 504 ? 13.572  -3.267  4.643   1.00 54.62 ? 504  THR A O   1 
ATOM   3875 C  CB  . THR A 1 504 ? 12.445  -5.483  6.748   1.00 55.82 ? 504  THR A CB  1 
ATOM   3876 O  OG1 . THR A 1 504 ? 11.326  -4.960  6.006   1.00 55.66 ? 504  THR A OG1 1 
ATOM   3877 C  CG2 . THR A 1 504 ? 12.006  -5.744  8.180   1.00 55.23 ? 504  THR A CG2 1 
ATOM   3878 N  N   . THR A 1 505 ? 14.826  -5.141  4.730   1.00 57.77 ? 505  THR A N   1 
ATOM   3879 C  CA  . THR A 1 505 ? 15.265  -5.016  3.350   1.00 60.50 ? 505  THR A CA  1 
ATOM   3880 C  C   . THR A 1 505 ? 14.071  -5.137  2.415   1.00 61.19 ? 505  THR A C   1 
ATOM   3881 O  O   . THR A 1 505 ? 14.014  -4.495  1.359   1.00 60.97 ? 505  THR A O   1 
ATOM   3882 C  CB  . THR A 1 505 ? 16.272  -6.097  2.988   1.00 62.30 ? 505  THR A CB  1 
ATOM   3883 O  OG1 . THR A 1 505 ? 15.693  -7.378  3.244   1.00 63.01 ? 505  THR A OG1 1 
ATOM   3884 C  CG2 . THR A 1 505 ? 17.558  -5.922  3.808   1.00 63.26 ? 505  THR A CG2 1 
ATOM   3885 N  N   . ALA A 1 506 ? 13.108  -5.951  2.829   1.00 61.12 ? 506  ALA A N   1 
ATOM   3886 C  CA  . ALA A 1 506 ? 11.900  -6.169  2.041   1.00 61.65 ? 506  ALA A CA  1 
ATOM   3887 C  C   . ALA A 1 506 ? 11.014  -4.935  1.926   1.00 61.42 ? 506  ALA A C   1 
ATOM   3888 O  O   . ALA A 1 506 ? 10.801  -4.433  0.818   1.00 64.54 ? 506  ALA A O   1 
ATOM   3889 C  CB  . ALA A 1 506 ? 11.090  -7.315  2.641   1.00 62.90 ? 506  ALA A CB  1 
ATOM   3890 N  N   . ALA A 1 507 ? 10.494  -4.455  3.058   1.00 58.73 ? 507  ALA A N   1 
ATOM   3891 C  CA  . ALA A 1 507 ? 9.601   -3.296  3.064   1.00 56.33 ? 507  ALA A CA  1 
ATOM   3892 C  C   . ALA A 1 507 ? 10.276  -1.940  3.240   1.00 54.30 ? 507  ALA A C   1 
ATOM   3893 O  O   . ALA A 1 507 ? 9.672   -0.922  2.943   1.00 54.71 ? 507  ALA A O   1 
ATOM   3894 C  CB  . ALA A 1 507 ? 8.522   -3.470  4.129   1.00 55.75 ? 507  ALA A CB  1 
ATOM   3895 N  N   . GLN A 1 508 ? 11.501  -1.911  3.751   1.00 53.73 ? 508  GLN A N   1 
ATOM   3896 C  CA  . GLN A 1 508 ? 12.220  -0.638  3.915   1.00 53.58 ? 508  GLN A CA  1 
ATOM   3897 C  C   . GLN A 1 508 ? 11.370  0.451   4.574   1.00 52.57 ? 508  GLN A C   1 
ATOM   3898 O  O   . GLN A 1 508 ? 11.283  1.575   4.077   1.00 51.68 ? 508  GLN A O   1 
ATOM   3899 C  CB  . GLN A 1 508 ? 12.692  -0.148  2.541   1.00 54.58 ? 508  GLN A CB  1 
ATOM   3900 C  CG  . GLN A 1 508 ? 13.567  -1.164  1.816   1.00 57.56 ? 508  GLN A CG  1 
ATOM   3901 C  CD  . GLN A 1 508 ? 13.868  -0.768  0.389   1.00 60.26 ? 508  GLN A CD  1 
ATOM   3902 O  OE1 . GLN A 1 508 ? 14.362  0.332   0.129   1.00 62.13 ? 508  GLN A OE1 1 
ATOM   3903 N  NE2 . GLN A 1 508 ? 13.581  -1.669  -0.552  1.00 61.23 ? 508  GLN A NE2 1 
ATOM   3904 N  N   . GLN A 1 509 ? 10.736  0.123   5.692   1.00 50.84 ? 509  GLN A N   1 
ATOM   3905 C  CA  . GLN A 1 509 ? 9.896   1.102   6.379   1.00 51.08 ? 509  GLN A CA  1 
ATOM   3906 C  C   . GLN A 1 509 ? 10.648  1.956   7.412   1.00 49.42 ? 509  GLN A C   1 
ATOM   3907 O  O   . GLN A 1 509 ? 11.534  1.462   8.117   1.00 48.36 ? 509  GLN A O   1 
ATOM   3908 C  CB  . GLN A 1 509 ? 8.739   0.394   7.086   1.00 51.37 ? 509  GLN A CB  1 
ATOM   3909 C  CG  . GLN A 1 509 ? 7.750   -0.267  6.166   1.00 53.31 ? 509  GLN A CG  1 
ATOM   3910 C  CD  . GLN A 1 509 ? 6.721   -1.061  6.932   1.00 53.59 ? 509  GLN A CD  1 
ATOM   3911 O  OE1 . GLN A 1 509 ? 7.018   -2.146  7.431   1.00 52.80 ? 509  GLN A OE1 1 
ATOM   3912 N  NE2 . GLN A 1 509 ? 5.505   -0.517  7.046   1.00 53.32 ? 509  GLN A NE2 1 
ATOM   3913 N  N   . TYR A 1 510 ? 10.276  3.229   7.486   1.00 46.43 ? 510  TYR A N   1 
ATOM   3914 C  CA  . TYR A 1 510 ? 10.854  4.171   8.437   1.00 47.43 ? 510  TYR A CA  1 
ATOM   3915 C  C   . TYR A 1 510 ? 9.765   5.183   8.731   1.00 47.81 ? 510  TYR A C   1 
ATOM   3916 O  O   . TYR A 1 510 ? 8.815   5.302   7.960   1.00 49.84 ? 510  TYR A O   1 
ATOM   3917 C  CB  . TYR A 1 510 ? 12.071  4.895   7.851   1.00 47.35 ? 510  TYR A CB  1 
ATOM   3918 C  CG  . TYR A 1 510 ? 11.774  5.793   6.667   1.00 48.11 ? 510  TYR A CG  1 
ATOM   3919 C  CD1 . TYR A 1 510 ? 11.619  5.264   5.377   1.00 48.68 ? 510  TYR A CD1 1 
ATOM   3920 C  CD2 . TYR A 1 510 ? 11.643  7.171   6.831   1.00 47.38 ? 510  TYR A CD2 1 
ATOM   3921 C  CE1 . TYR A 1 510 ? 11.340  6.094   4.284   1.00 47.89 ? 510  TYR A CE1 1 
ATOM   3922 C  CE2 . TYR A 1 510 ? 11.365  8.001   5.759   1.00 47.13 ? 510  TYR A CE2 1 
ATOM   3923 C  CZ  . TYR A 1 510 ? 11.215  7.463   4.483   1.00 48.98 ? 510  TYR A CZ  1 
ATOM   3924 O  OH  . TYR A 1 510 ? 10.941  8.302   3.412   1.00 49.38 ? 510  TYR A OH  1 
ATOM   3925 N  N   . VAL A 1 511 ? 9.886   5.922   9.826   1.00 46.89 ? 511  VAL A N   1 
ATOM   3926 C  CA  . VAL A 1 511 ? 8.854   6.900   10.160  1.00 47.02 ? 511  VAL A CA  1 
ATOM   3927 C  C   . VAL A 1 511 ? 9.312   8.354   10.110  1.00 47.44 ? 511  VAL A C   1 
ATOM   3928 O  O   . VAL A 1 511 ? 10.508  8.648   10.196  1.00 48.38 ? 511  VAL A O   1 
ATOM   3929 C  CB  . VAL A 1 511 ? 8.266   6.630   11.577  1.00 46.36 ? 511  VAL A CB  1 
ATOM   3930 C  CG1 . VAL A 1 511 ? 7.657   5.267   11.619  1.00 46.28 ? 511  VAL A CG1 1 
ATOM   3931 C  CG2 . VAL A 1 511 ? 9.354   6.748   12.645  1.00 44.37 ? 511  VAL A CG2 1 
ATOM   3932 N  N   . SER A 1 512 ? 8.357   9.267   9.970   1.00 47.24 ? 512  SER A N   1 
ATOM   3933 C  CA  . SER A 1 512 ? 8.670   10.693  9.953   1.00 47.77 ? 512  SER A CA  1 
ATOM   3934 C  C   . SER A 1 512 ? 8.449   11.226  11.362  1.00 48.58 ? 512  SER A C   1 
ATOM   3935 O  O   . SER A 1 512 ? 7.409   10.964  11.983  1.00 48.20 ? 512  SER A O   1 
ATOM   3936 C  CB  . SER A 1 512 ? 7.762   11.461  8.977   1.00 49.29 ? 512  SER A CB  1 
ATOM   3937 O  OG  . SER A 1 512 ? 6.384   11.333  9.312   1.00 51.28 ? 512  SER A OG  1 
ATOM   3938 N  N   . LEU A 1 513 ? 9.441   11.939  11.883  1.00 47.59 ? 513  LEU A N   1 
ATOM   3939 C  CA  . LEU A 1 513 ? 9.315   12.516  13.204  1.00 46.22 ? 513  LEU A CA  1 
ATOM   3940 C  C   . LEU A 1 513 ? 9.077   13.997  13.006  1.00 45.52 ? 513  LEU A C   1 
ATOM   3941 O  O   . LEU A 1 513 ? 9.960   14.713  12.538  1.00 45.41 ? 513  LEU A O   1 
ATOM   3942 C  CB  . LEU A 1 513 ? 10.596  12.303  14.039  1.00 46.63 ? 513  LEU A CB  1 
ATOM   3943 C  CG  . LEU A 1 513 ? 10.986  10.852  14.371  1.00 48.06 ? 513  LEU A CG  1 
ATOM   3944 C  CD1 . LEU A 1 513 ? 12.274  10.798  15.181  1.00 44.77 ? 513  LEU A CD1 1 
ATOM   3945 C  CD2 . LEU A 1 513 ? 9.852   10.205  15.153  1.00 50.62 ? 513  LEU A CD2 1 
ATOM   3946 N  N   . ASN A 1 514 ? 7.871   14.445  13.334  1.00 46.20 ? 514  ASN A N   1 
ATOM   3947 C  CA  . ASN A 1 514 ? 7.504   15.863  13.249  1.00 47.62 ? 514  ASN A CA  1 
ATOM   3948 C  C   . ASN A 1 514 ? 6.324   16.088  14.175  1.00 47.37 ? 514  ASN A C   1 
ATOM   3949 O  O   . ASN A 1 514 ? 5.986   15.201  14.951  1.00 47.30 ? 514  ASN A O   1 
ATOM   3950 C  CB  . ASN A 1 514 ? 7.148   16.292  11.819  1.00 48.51 ? 514  ASN A CB  1 
ATOM   3951 C  CG  . ASN A 1 514 ? 6.121   15.391  11.181  1.00 49.79 ? 514  ASN A CG  1 
ATOM   3952 O  OD1 . ASN A 1 514 ? 5.091   15.078  11.786  1.00 51.22 ? 514  ASN A OD1 1 
ATOM   3953 N  ND2 . ASN A 1 514 ? 6.393   14.961  9.951   1.00 50.03 ? 514  ASN A ND2 1 
ATOM   3954 N  N   . LEU A 1 515 ? 5.709   17.268  14.113  1.00 49.74 ? 515  LEU A N   1 
ATOM   3955 C  CA  . LEU A 1 515 ? 4.578   17.596  14.994  1.00 51.44 ? 515  LEU A CA  1 
ATOM   3956 C  C   . LEU A 1 515 ? 3.335   16.712  14.791  1.00 52.35 ? 515  LEU A C   1 
ATOM   3957 O  O   . LEU A 1 515 ? 2.507   16.563  15.683  1.00 51.79 ? 515  LEU A O   1 
ATOM   3958 C  CB  . LEU A 1 515 ? 4.213   19.066  14.836  1.00 50.16 ? 515  LEU A CB  1 
ATOM   3959 C  CG  . LEU A 1 515 ? 5.370   20.030  15.120  1.00 52.07 ? 515  LEU A CG  1 
ATOM   3960 C  CD1 . LEU A 1 515 ? 4.878   21.482  15.034  1.00 48.26 ? 515  LEU A CD1 1 
ATOM   3961 C  CD2 . LEU A 1 515 ? 5.952   19.753  16.510  1.00 49.67 ? 515  LEU A CD2 1 
ATOM   3962 N  N   . LYS A 1 516 ? 3.226   16.129  13.611  1.00 54.46 ? 516  LYS A N   1 
ATOM   3963 C  CA  . LYS A 1 516 ? 2.131   15.231  13.261  1.00 57.08 ? 516  LYS A CA  1 
ATOM   3964 C  C   . LYS A 1 516 ? 2.401   13.873  13.889  1.00 56.84 ? 516  LYS A C   1 
ATOM   3965 O  O   . LYS A 1 516 ? 3.535   13.548  14.224  1.00 56.49 ? 516  LYS A O   1 
ATOM   3966 C  CB  . LYS A 1 516 ? 2.096   15.015  11.746  1.00 60.09 ? 516  LYS A CB  1 
ATOM   3967 C  CG  . LYS A 1 516 ? 1.188   15.916  10.942  1.00 66.74 ? 516  LYS A CG  1 
ATOM   3968 C  CD  . LYS A 1 516 ? 1.385   17.387  11.224  1.00 70.57 ? 516  LYS A CD  1 
ATOM   3969 C  CE  . LYS A 1 516 ? 0.354   18.189  10.430  1.00 74.38 ? 516  LYS A CE  1 
ATOM   3970 N  NZ  . LYS A 1 516 ? 0.259   19.615  10.867  1.00 76.99 ? 516  LYS A NZ  1 
ATOM   3971 N  N   . PRO A 1 517 ? 1.359   13.055  14.054  1.00 57.18 ? 517  PRO A N   1 
ATOM   3972 C  CA  . PRO A 1 517 ? 1.577   11.728  14.640  1.00 56.07 ? 517  PRO A CA  1 
ATOM   3973 C  C   . PRO A 1 517 ? 2.475   10.927  13.682  1.00 56.49 ? 517  PRO A C   1 
ATOM   3974 O  O   . PRO A 1 517 ? 2.581   11.266  12.502  1.00 56.63 ? 517  PRO A O   1 
ATOM   3975 C  CB  . PRO A 1 517 ? 0.161   11.157  14.717  1.00 56.65 ? 517  PRO A CB  1 
ATOM   3976 C  CG  . PRO A 1 517 ? -0.676  12.391  14.979  1.00 56.87 ? 517  PRO A CG  1 
ATOM   3977 C  CD  . PRO A 1 517 ? -0.077  13.402  14.023  1.00 56.21 ? 517  PRO A CD  1 
ATOM   3978 N  N   . LEU A 1 518 ? 3.114   9.868   14.174  1.00 56.66 ? 518  LEU A N   1 
ATOM   3979 C  CA  . LEU A 1 518 ? 3.983   9.064   13.321  1.00 57.17 ? 518  LEU A CA  1 
ATOM   3980 C  C   . LEU A 1 518 ? 3.347   8.712   11.990  1.00 57.90 ? 518  LEU A C   1 
ATOM   3981 O  O   . LEU A 1 518 ? 2.153   8.438   11.918  1.00 58.30 ? 518  LEU A O   1 
ATOM   3982 C  CB  . LEU A 1 518 ? 4.368   7.756   14.001  1.00 56.67 ? 518  LEU A CB  1 
ATOM   3983 C  CG  . LEU A 1 518 ? 5.424   7.759   15.092  1.00 58.61 ? 518  LEU A CG  1 
ATOM   3984 C  CD1 . LEU A 1 518 ? 5.890   6.319   15.267  1.00 60.69 ? 518  LEU A CD1 1 
ATOM   3985 C  CD2 . LEU A 1 518 ? 6.604   8.632   14.723  1.00 58.62 ? 518  LEU A CD2 1 
ATOM   3986 N  N   . GLU A 1 519 ? 4.158   8.709   10.940  1.00 58.68 ? 519  GLU A N   1 
ATOM   3987 C  CA  . GLU A 1 519 ? 3.703   8.353   9.601   1.00 59.35 ? 519  GLU A CA  1 
ATOM   3988 C  C   . GLU A 1 519 ? 4.741   7.391   9.047   1.00 58.48 ? 519  GLU A C   1 
ATOM   3989 O  O   . GLU A 1 519 ? 5.947   7.673   9.092   1.00 59.17 ? 519  GLU A O   1 
ATOM   3990 C  CB  . GLU A 1 519 ? 3.598   9.593   8.701   1.00 61.81 ? 519  GLU A CB  1 
ATOM   3991 C  CG  . GLU A 1 519 ? 3.489   9.264   7.208   1.00 66.14 ? 519  GLU A CG  1 
ATOM   3992 C  CD  . GLU A 1 519 ? 3.328   10.510  6.313   1.00 69.87 ? 519  GLU A CD  1 
ATOM   3993 O  OE1 . GLU A 1 519 ? 2.346   11.273  6.529   1.00 71.89 ? 519  GLU A OE1 1 
ATOM   3994 O  OE2 . GLU A 1 519 ? 4.174   10.719  5.401   1.00 68.07 ? 519  GLU A OE2 1 
ATOM   3995 N  N   . VAL A 1 520 ? 4.287   6.250   8.542   1.00 56.14 ? 520  VAL A N   1 
ATOM   3996 C  CA  . VAL A 1 520 ? 5.210   5.264   8.011   1.00 54.56 ? 520  VAL A CA  1 
ATOM   3997 C  C   . VAL A 1 520 ? 5.453   5.533   6.542   1.00 55.30 ? 520  VAL A C   1 
ATOM   3998 O  O   . VAL A 1 520 ? 4.518   5.858   5.807   1.00 56.78 ? 520  VAL A O   1 
ATOM   3999 C  CB  . VAL A 1 520 ? 4.666   3.830   8.188   1.00 53.91 ? 520  VAL A CB  1 
ATOM   4000 C  CG1 . VAL A 1 520 ? 5.581   2.832   7.498   1.00 52.94 ? 520  VAL A CG1 1 
ATOM   4001 C  CG2 . VAL A 1 520 ? 4.557   3.500   9.681   1.00 50.33 ? 520  VAL A CG2 1 
ATOM   4002 N  N   . ARG A 1 521 ? 6.711   5.427   6.123   1.00 53.06 ? 521  ARG A N   1 
ATOM   4003 C  CA  . ARG A 1 521 ? 7.069   5.646   4.730   1.00 52.53 ? 521  ARG A CA  1 
ATOM   4004 C  C   . ARG A 1 521 ? 7.918   4.488   4.273   1.00 52.27 ? 521  ARG A C   1 
ATOM   4005 O  O   . ARG A 1 521 ? 8.416   3.729   5.097   1.00 53.12 ? 521  ARG A O   1 
ATOM   4006 C  CB  . ARG A 1 521 ? 7.819   6.967   4.566   1.00 51.87 ? 521  ARG A CB  1 
ATOM   4007 C  CG  . ARG A 1 521 ? 6.966   8.183   4.919   1.00 51.60 ? 521  ARG A CG  1 
ATOM   4008 C  CD  . ARG A 1 521 ? 7.663   9.495   4.613   1.00 51.74 ? 521  ARG A CD  1 
ATOM   4009 N  NE  . ARG A 1 521 ? 6.975   10.603  5.271   1.00 51.86 ? 521  ARG A NE  1 
ATOM   4010 C  CZ  . ARG A 1 521 ? 7.507   11.808  5.474   1.00 50.83 ? 521  ARG A CZ  1 
ATOM   4011 N  NH1 . ARG A 1 521 ? 8.738   12.076  5.061   1.00 48.86 ? 521  ARG A NH1 1 
ATOM   4012 N  NH2 . ARG A 1 521 ? 6.816   12.736  6.126   1.00 48.90 ? 521  ARG A NH2 1 
ATOM   4013 N  N   . ARG A 1 522 ? 8.065   4.326   2.965   1.00 53.49 ? 522  ARG A N   1 
ATOM   4014 C  CA  . ARG A 1 522 ? 8.858   3.221   2.435   1.00 54.96 ? 522  ARG A CA  1 
ATOM   4015 C  C   . ARG A 1 522 ? 9.988   3.705   1.541   1.00 54.15 ? 522  ARG A C   1 
ATOM   4016 O  O   . ARG A 1 522 ? 9.811   4.615   0.732   1.00 54.73 ? 522  ARG A O   1 
ATOM   4017 C  CB  . ARG A 1 522 ? 7.971   2.250   1.638   1.00 56.92 ? 522  ARG A CB  1 
ATOM   4018 C  CG  . ARG A 1 522 ? 6.817   1.588   2.433   1.00 64.17 ? 522  ARG A CG  1 
ATOM   4019 C  CD  . ARG A 1 522 ? 6.246   0.408   1.646   1.00 68.69 ? 522  ARG A CD  1 
ATOM   4020 N  NE  . ARG A 1 522 ? 7.347   -0.405  1.097   1.00 74.47 ? 522  ARG A NE  1 
ATOM   4021 C  CZ  . ARG A 1 522 ? 7.219   -1.389  0.202   1.00 76.40 ? 522  ARG A CZ  1 
ATOM   4022 N  NH1 . ARG A 1 522 ? 6.016   -1.713  -0.274  1.00 78.38 ? 522  ARG A NH1 1 
ATOM   4023 N  NH2 . ARG A 1 522 ? 8.302   -2.046  -0.227  1.00 75.15 ? 522  ARG A NH2 1 
ATOM   4024 N  N   . GLY A 1 523 ? 11.146  3.073   1.681   1.00 53.59 ? 523  GLY A N   1 
ATOM   4025 C  CA  . GLY A 1 523 ? 12.292  3.433   0.875   1.00 53.86 ? 523  GLY A CA  1 
ATOM   4026 C  C   . GLY A 1 523 ? 12.929  4.743   1.288   1.00 53.62 ? 523  GLY A C   1 
ATOM   4027 O  O   . GLY A 1 523 ? 12.363  5.821   1.130   1.00 54.90 ? 523  GLY A O   1 
ATOM   4028 N  N   . LEU A 1 524 ? 14.131  4.648   1.819   1.00 52.52 ? 524  LEU A N   1 
ATOM   4029 C  CA  . LEU A 1 524 ? 14.852  5.820   2.251   1.00 52.88 ? 524  LEU A CA  1 
ATOM   4030 C  C   . LEU A 1 524 ? 15.678  6.322   1.073   1.00 51.65 ? 524  LEU A C   1 
ATOM   4031 O  O   . LEU A 1 524 ? 16.768  5.826   0.836   1.00 52.18 ? 524  LEU A O   1 
ATOM   4032 C  CB  . LEU A 1 524 ? 15.749  5.415   3.416   1.00 55.18 ? 524  LEU A CB  1 
ATOM   4033 C  CG  . LEU A 1 524 ? 16.365  6.552   4.226   1.00 59.12 ? 524  LEU A CG  1 
ATOM   4034 C  CD1 . LEU A 1 524 ? 15.349  7.675   4.463   1.00 59.16 ? 524  LEU A CD1 1 
ATOM   4035 C  CD2 . LEU A 1 524 ? 16.871  5.972   5.541   1.00 59.83 ? 524  LEU A CD2 1 
ATOM   4036 N  N   . ARG A 1 525 ? 15.164  7.296   0.332   1.00 51.42 ? 525  ARG A N   1 
ATOM   4037 C  CA  . ARG A 1 525 ? 15.869  7.809   -0.839  1.00 52.34 ? 525  ARG A CA  1 
ATOM   4038 C  C   . ARG A 1 525 ? 16.340  6.636   -1.685  1.00 51.67 ? 525  ARG A C   1 
ATOM   4039 O  O   . ARG A 1 525 ? 17.471  6.658   -2.207  1.00 51.11 ? 525  ARG A O   1 
ATOM   4040 C  CB  . ARG A 1 525 ? 17.102  8.613   -0.428  1.00 53.87 ? 525  ARG A CB  1 
ATOM   4041 C  CG  . ARG A 1 525 ? 16.806  9.933   0.236   1.00 56.98 ? 525  ARG A CG  1 
ATOM   4042 C  CD  . ARG A 1 525 ? 16.537  11.016  -0.771  1.00 58.85 ? 525  ARG A CD  1 
ATOM   4043 N  NE  . ARG A 1 525 ? 17.158  12.266  -0.336  1.00 61.33 ? 525  ARG A NE  1 
ATOM   4044 C  CZ  . ARG A 1 525 ? 16.795  12.958  0.741   1.00 61.77 ? 525  ARG A CZ  1 
ATOM   4045 N  NH1 . ARG A 1 525 ? 15.796  12.527  1.510   1.00 63.05 ? 525  ARG A NH1 1 
ATOM   4046 N  NH2 . ARG A 1 525 ? 17.445  14.075  1.057   1.00 61.16 ? 525  ARG A NH2 1 
ATOM   4047 N  N   . ALA A 1 526 ? 15.488  5.623   -1.825  1.00 49.00 ? 526  ALA A N   1 
ATOM   4048 C  CA  . ALA A 1 526 ? 15.859  4.419   -2.570  1.00 49.16 ? 526  ALA A CA  1 
ATOM   4049 C  C   . ALA A 1 526 ? 16.511  4.615   -3.952  1.00 48.21 ? 526  ALA A C   1 
ATOM   4050 O  O   . ALA A 1 526 ? 17.598  4.089   -4.175  1.00 48.57 ? 526  ALA A O   1 
ATOM   4051 C  CB  . ALA A 1 526 ? 14.666  3.495   -2.683  1.00 50.10 ? 526  ALA A CB  1 
ATOM   4052 N  N   . GLN A 1 527 ? 15.887  5.360   -4.870  1.00 47.74 ? 527  GLN A N   1 
ATOM   4053 C  CA  . GLN A 1 527 ? 16.500  5.546   -6.201  1.00 49.62 ? 527  GLN A CA  1 
ATOM   4054 C  C   . GLN A 1 527 ? 17.854  6.235   -6.095  1.00 48.92 ? 527  GLN A C   1 
ATOM   4055 O  O   . GLN A 1 527 ? 18.880  5.707   -6.538  1.00 49.35 ? 527  GLN A O   1 
ATOM   4056 C  CB  . GLN A 1 527 ? 15.621  6.383   -7.153  1.00 50.31 ? 527  GLN A CB  1 
ATOM   4057 C  CG  . GLN A 1 527 ? 14.459  5.667   -7.856  1.00 54.94 ? 527  GLN A CG  1 
ATOM   4058 C  CD  . GLN A 1 527 ? 14.783  4.237   -8.338  1.00 58.00 ? 527  GLN A CD  1 
ATOM   4059 O  OE1 . GLN A 1 527 ? 14.367  3.257   -7.703  1.00 61.02 ? 527  GLN A OE1 1 
ATOM   4060 N  NE2 . GLN A 1 527 ? 15.519  4.115   -9.450  1.00 56.53 ? 527  GLN A NE2 1 
ATOM   4061 N  N   . THR A 1 528 ? 17.854  7.430   -5.517  1.00 48.61 ? 528  THR A N   1 
ATOM   4062 C  CA  . THR A 1 528 ? 19.089  8.177   -5.359  1.00 47.84 ? 528  THR A CA  1 
ATOM   4063 C  C   . THR A 1 528 ? 20.163  7.408   -4.572  1.00 47.21 ? 528  THR A C   1 
ATOM   4064 O  O   . THR A 1 528 ? 21.338  7.444   -4.935  1.00 48.93 ? 528  THR A O   1 
ATOM   4065 C  CB  . THR A 1 528 ? 18.817  9.548   -4.695  1.00 49.09 ? 528  THR A CB  1 
ATOM   4066 O  OG1 . THR A 1 528 ? 18.176  10.415  -5.647  1.00 49.01 ? 528  THR A OG1 1 
ATOM   4067 C  CG2 . THR A 1 528 ? 20.122  10.193  -4.221  1.00 48.72 ? 528  THR A CG2 1 
ATOM   4068 N  N   . CYS A 1 529 ? 19.805  6.678   -3.524  1.00 45.20 ? 529  CYS A N   1 
ATOM   4069 C  CA  . CYS A 1 529 ? 20.872  5.991   -2.805  1.00 45.49 ? 529  CYS A CA  1 
ATOM   4070 C  C   . CYS A 1 529 ? 21.413  4.799   -3.574  1.00 46.95 ? 529  CYS A C   1 
ATOM   4071 O  O   . CYS A 1 529 ? 22.570  4.350   -3.357  1.00 44.76 ? 529  CYS A O   1 
ATOM   4072 C  CB  . CYS A 1 529 ? 20.442  5.624   -1.390  1.00 44.91 ? 529  CYS A CB  1 
ATOM   4073 S  SG  . CYS A 1 529 ? 20.377  7.104   -0.289  1.00 47.21 ? 529  CYS A SG  1 
ATOM   4074 N  N   . ALA A 1 530 ? 20.604  4.309   -4.510  1.00 46.04 ? 530  ALA A N   1 
ATOM   4075 C  CA  . ALA A 1 530 ? 21.068  3.210   -5.354  1.00 47.55 ? 530  ALA A CA  1 
ATOM   4076 C  C   . ALA A 1 530 ? 22.191  3.811   -6.224  1.00 48.05 ? 530  ALA A C   1 
ATOM   4077 O  O   . ALA A 1 530 ? 23.223  3.175   -6.461  1.00 48.63 ? 530  ALA A O   1 
ATOM   4078 C  CB  . ALA A 1 530 ? 19.927  2.677   -6.230  1.00 47.47 ? 530  ALA A CB  1 
ATOM   4079 N  N   . PHE A 1 531 ? 22.003  5.053   -6.664  1.00 45.97 ? 531  PHE A N   1 
ATOM   4080 C  CA  . PHE A 1 531 ? 23.018  5.714   -7.466  1.00 46.07 ? 531  PHE A CA  1 
ATOM   4081 C  C   . PHE A 1 531 ? 24.338  5.812   -6.676  1.00 46.96 ? 531  PHE A C   1 
ATOM   4082 O  O   . PHE A 1 531 ? 25.401  5.412   -7.159  1.00 47.14 ? 531  PHE A O   1 
ATOM   4083 C  CB  . PHE A 1 531 ? 22.539  7.112   -7.862  1.00 46.59 ? 531  PHE A CB  1 
ATOM   4084 C  CG  . PHE A 1 531 ? 23.617  7.982   -8.425  1.00 46.89 ? 531  PHE A CG  1 
ATOM   4085 C  CD1 . PHE A 1 531 ? 24.095  7.770   -9.721  1.00 47.22 ? 531  PHE A CD1 1 
ATOM   4086 C  CD2 . PHE A 1 531 ? 24.176  8.998   -7.654  1.00 45.92 ? 531  PHE A CD2 1 
ATOM   4087 C  CE1 . PHE A 1 531 ? 25.120  8.554   -10.250 1.00 46.91 ? 531  PHE A CE1 1 
ATOM   4088 C  CE2 . PHE A 1 531 ? 25.199  9.789   -8.165  1.00 47.45 ? 531  PHE A CE2 1 
ATOM   4089 C  CZ  . PHE A 1 531 ? 25.679  9.567   -9.473  1.00 47.52 ? 531  PHE A CZ  1 
ATOM   4090 N  N   . TRP A 1 532 ? 24.262  6.334   -5.451  1.00 47.28 ? 532  TRP A N   1 
ATOM   4091 C  CA  . TRP A 1 532 ? 25.445  6.496   -4.591  1.00 46.18 ? 532  TRP A CA  1 
ATOM   4092 C  C   . TRP A 1 532 ? 26.066  5.206   -4.091  1.00 47.00 ? 532  TRP A C   1 
ATOM   4093 O  O   . TRP A 1 532 ? 27.292  5.053   -4.097  1.00 45.47 ? 532  TRP A O   1 
ATOM   4094 C  CB  . TRP A 1 532 ? 25.118  7.341   -3.350  1.00 42.90 ? 532  TRP A CB  1 
ATOM   4095 C  CG  . TRP A 1 532 ? 24.870  8.789   -3.630  1.00 42.43 ? 532  TRP A CG  1 
ATOM   4096 C  CD1 . TRP A 1 532 ? 23.656  9.440   -3.655  1.00 42.67 ? 532  TRP A CD1 1 
ATOM   4097 C  CD2 . TRP A 1 532 ? 25.858  9.777   -3.937  1.00 41.19 ? 532  TRP A CD2 1 
ATOM   4098 N  NE1 . TRP A 1 532 ? 23.839  10.772  -3.958  1.00 41.24 ? 532  TRP A NE1 1 
ATOM   4099 C  CE2 . TRP A 1 532 ? 25.180  11.003  -4.139  1.00 40.76 ? 532  TRP A CE2 1 
ATOM   4100 C  CE3 . TRP A 1 532 ? 27.256  9.747   -4.062  1.00 41.29 ? 532  TRP A CE3 1 
ATOM   4101 C  CZ2 . TRP A 1 532 ? 25.854  12.183  -4.459  1.00 40.03 ? 532  TRP A CZ2 1 
ATOM   4102 C  CZ3 . TRP A 1 532 ? 27.927  10.937  -4.385  1.00 39.31 ? 532  TRP A CZ3 1 
ATOM   4103 C  CH2 . TRP A 1 532 ? 27.222  12.130  -4.575  1.00 38.66 ? 532  TRP A CH2 1 
ATOM   4104 N  N   . ASN A 1 533 ? 25.221  4.277   -3.655  1.00 47.32 ? 533  ASN A N   1 
ATOM   4105 C  CA  . ASN A 1 533 ? 25.724  3.033   -3.097  1.00 48.31 ? 533  ASN A CA  1 
ATOM   4106 C  C   . ASN A 1 533 ? 26.002  1.892   -4.065  1.00 50.03 ? 533  ASN A C   1 
ATOM   4107 O  O   . ASN A 1 533 ? 26.793  1.011   -3.745  1.00 49.18 ? 533  ASN A O   1 
ATOM   4108 C  CB  . ASN A 1 533 ? 24.784  2.541   -1.994  1.00 47.77 ? 533  ASN A CB  1 
ATOM   4109 C  CG  . ASN A 1 533 ? 24.568  3.584   -0.900  1.00 49.84 ? 533  ASN A CG  1 
ATOM   4110 O  OD1 . ASN A 1 533 ? 25.443  4.415   -0.642  1.00 50.24 ? 533  ASN A OD1 1 
ATOM   4111 N  ND2 . ASN A 1 533 ? 23.407  3.535   -0.244  1.00 48.83 ? 533  ASN A ND2 1 
ATOM   4112 N  N   . ARG A 1 534 ? 25.374  1.888   -5.236  1.00 50.82 ? 534  ARG A N   1 
ATOM   4113 C  CA  . ARG A 1 534 ? 25.616  0.789   -6.172  1.00 53.37 ? 534  ARG A CA  1 
ATOM   4114 C  C   . ARG A 1 534 ? 26.294  1.231   -7.465  1.00 55.20 ? 534  ARG A C   1 
ATOM   4115 O  O   . ARG A 1 534 ? 27.234  0.579   -7.929  1.00 56.28 ? 534  ARG A O   1 
ATOM   4116 C  CB  . ARG A 1 534 ? 24.306  0.071   -6.510  1.00 52.17 ? 534  ARG A CB  1 
ATOM   4117 C  CG  . ARG A 1 534 ? 23.559  -0.480  -5.316  1.00 54.15 ? 534  ARG A CG  1 
ATOM   4118 C  CD  . ARG A 1 534 ? 22.141  -0.897  -5.715  1.00 53.85 ? 534  ARG A CD  1 
ATOM   4119 N  NE  . ARG A 1 534 ? 21.298  -1.302  -4.587  1.00 54.67 ? 534  ARG A NE  1 
ATOM   4120 C  CZ  . ARG A 1 534 ? 21.237  -2.536  -4.076  1.00 55.84 ? 534  ARG A CZ  1 
ATOM   4121 N  NH1 . ARG A 1 534 ? 21.977  -3.524  -4.581  1.00 53.98 ? 534  ARG A NH1 1 
ATOM   4122 N  NH2 . ARG A 1 534 ? 20.414  -2.784  -3.066  1.00 52.79 ? 534  ARG A NH2 1 
ATOM   4123 N  N   . PHE A 1 535 ? 25.838  2.330   -8.059  1.00 54.92 ? 535  PHE A N   1 
ATOM   4124 C  CA  . PHE A 1 535 ? 26.468  2.736   -9.290  1.00 54.93 ? 535  PHE A CA  1 
ATOM   4125 C  C   . PHE A 1 535 ? 27.781  3.454   -9.109  1.00 56.22 ? 535  PHE A C   1 
ATOM   4126 O  O   . PHE A 1 535 ? 28.776  2.986   -9.621  1.00 58.78 ? 535  PHE A O   1 
ATOM   4127 C  CB  . PHE A 1 535 ? 25.558  3.600   -10.148 1.00 53.51 ? 535  PHE A CB  1 
ATOM   4128 C  CG  . PHE A 1 535 ? 26.197  4.006   -11.443 1.00 52.20 ? 535  PHE A CG  1 
ATOM   4129 C  CD1 . PHE A 1 535 ? 26.476  3.049   -12.420 1.00 51.44 ? 535  PHE A CD1 1 
ATOM   4130 C  CD2 . PHE A 1 535 ? 26.594  5.326   -11.657 1.00 50.97 ? 535  PHE A CD2 1 
ATOM   4131 C  CE1 . PHE A 1 535 ? 27.147  3.396   -13.591 1.00 51.02 ? 535  PHE A CE1 1 
ATOM   4132 C  CE2 . PHE A 1 535 ? 27.270  5.686   -12.830 1.00 51.73 ? 535  PHE A CE2 1 
ATOM   4133 C  CZ  . PHE A 1 535 ? 27.548  4.720   -13.798 1.00 50.74 ? 535  PHE A CZ  1 
ATOM   4134 N  N   . LEU A 1 536 ? 27.814  4.580   -8.401  1.00 57.37 ? 536  LEU A N   1 
ATOM   4135 C  CA  . LEU A 1 536 ? 29.082  5.289   -8.256  1.00 60.25 ? 536  LEU A CA  1 
ATOM   4136 C  C   . LEU A 1 536 ? 30.299  4.416   -7.943  1.00 63.48 ? 536  LEU A C   1 
ATOM   4137 O  O   . LEU A 1 536 ? 31.380  4.618   -8.513  1.00 63.67 ? 536  LEU A O   1 
ATOM   4138 C  CB  . LEU A 1 536 ? 28.986  6.388   -7.210  1.00 58.36 ? 536  LEU A CB  1 
ATOM   4139 C  CG  . LEU A 1 536 ? 28.450  7.708   -7.740  1.00 59.47 ? 536  LEU A CG  1 
ATOM   4140 C  CD1 . LEU A 1 536 ? 28.925  8.800   -6.826  1.00 57.06 ? 536  LEU A CD1 1 
ATOM   4141 C  CD2 . LEU A 1 536 ? 28.949  7.963   -9.175  1.00 59.03 ? 536  LEU A CD2 1 
ATOM   4142 N  N   . PRO A 1 537 ? 30.156  3.451   -7.018  1.00 66.12 ? 537  PRO A N   1 
ATOM   4143 C  CA  . PRO A 1 537 ? 31.321  2.617   -6.726  1.00 68.82 ? 537  PRO A CA  1 
ATOM   4144 C  C   . PRO A 1 537 ? 31.780  1.931   -8.007  1.00 72.27 ? 537  PRO A C   1 
ATOM   4145 O  O   . PRO A 1 537 ? 32.930  2.086   -8.408  1.00 74.09 ? 537  PRO A O   1 
ATOM   4146 C  CB  . PRO A 1 537 ? 30.793  1.625   -5.699  1.00 67.43 ? 537  PRO A CB  1 
ATOM   4147 C  CG  . PRO A 1 537 ? 29.737  2.399   -5.015  1.00 67.61 ? 537  PRO A CG  1 
ATOM   4148 C  CD  . PRO A 1 537 ? 29.025  3.082   -6.153  1.00 66.12 ? 537  PRO A CD  1 
ATOM   4149 N  N   . LYS A 1 538 ? 30.876  1.190   -8.654  1.00 74.73 ? 538  LYS A N   1 
ATOM   4150 C  CA  . LYS A 1 538 ? 31.203  0.485   -9.893  1.00 76.79 ? 538  LYS A CA  1 
ATOM   4151 C  C   . LYS A 1 538 ? 31.838  1.399   -10.927 1.00 78.08 ? 538  LYS A C   1 
ATOM   4152 O  O   . LYS A 1 538 ? 32.662  0.955   -11.715 1.00 78.96 ? 538  LYS A O   1 
ATOM   4153 C  CB  . LYS A 1 538 ? 29.965  -0.193  -10.476 1.00 76.53 ? 538  LYS A CB  1 
ATOM   4154 C  CG  . LYS A 1 538 ? 29.507  -1.384  -9.652  1.00 78.67 ? 538  LYS A CG  1 
ATOM   4155 C  CD  . LYS A 1 538 ? 28.906  -2.465  -10.528 1.00 81.61 ? 538  LYS A CD  1 
ATOM   4156 C  CE  . LYS A 1 538 ? 28.613  -3.726  -9.716  1.00 83.39 ? 538  LYS A CE  1 
ATOM   4157 N  NZ  . LYS A 1 538 ? 28.329  -4.899  -10.599 1.00 84.60 ? 538  LYS A NZ  1 
ATOM   4158 N  N   . LEU A 1 539 ? 31.471  2.675   -10.922 1.00 80.12 ? 539  LEU A N   1 
ATOM   4159 C  CA  . LEU A 1 539 ? 32.070  3.607   -11.865 1.00 81.94 ? 539  LEU A CA  1 
ATOM   4160 C  C   . LEU A 1 539 ? 33.538  3.649   -11.502 1.00 84.18 ? 539  LEU A C   1 
ATOM   4161 O  O   . LEU A 1 539 ? 34.404  3.627   -12.376 1.00 85.17 ? 539  LEU A O   1 
ATOM   4162 C  CB  . LEU A 1 539 ? 31.470  5.003   -11.715 1.00 80.77 ? 539  LEU A CB  1 
ATOM   4163 C  CG  . LEU A 1 539 ? 31.985  6.065   -12.687 1.00 79.22 ? 539  LEU A CG  1 
ATOM   4164 C  CD1 . LEU A 1 539 ? 31.907  5.518   -14.098 1.00 79.15 ? 539  LEU A CD1 1 
ATOM   4165 C  CD2 . LEU A 1 539 ? 31.161  7.338   -12.570 1.00 77.53 ? 539  LEU A CD2 1 
ATOM   4166 N  N   . LEU A 1 540 ? 33.789  3.658   -10.191 1.00 86.59 ? 540  LEU A N   1 
ATOM   4167 C  CA  . LEU A 1 540 ? 35.133  3.704   -9.597  1.00 88.94 ? 540  LEU A CA  1 
ATOM   4168 C  C   . LEU A 1 540 ? 36.048  2.537   -10.013 1.00 90.58 ? 540  LEU A C   1 
ATOM   4169 O  O   . LEU A 1 540 ? 37.263  2.711   -10.155 1.00 90.56 ? 540  LEU A O   1 
ATOM   4170 C  CB  . LEU A 1 540 ? 35.011  3.759   -8.067  1.00 87.88 ? 540  LEU A CB  1 
ATOM   4171 C  CG  . LEU A 1 540 ? 36.226  4.199   -7.253  1.00 87.26 ? 540  LEU A CG  1 
ATOM   4172 C  CD1 . LEU A 1 540 ? 36.700  5.573   -7.724  1.00 87.08 ? 540  LEU A CD1 1 
ATOM   4173 C  CD2 . LEU A 1 540 ? 35.845  4.232   -5.775  1.00 86.53 ? 540  LEU A CD2 1 
ATOM   4174 N  N   . SER A 1 541 ? 35.467  1.351   -10.187 1.00 92.63 ? 541  SER A N   1 
ATOM   4175 C  CA  . SER A 1 541 ? 36.220  0.175   -10.631 1.00 94.36 ? 541  SER A CA  1 
ATOM   4176 C  C   . SER A 1 541 ? 36.425  0.303   -12.158 1.00 95.97 ? 541  SER A C   1 
ATOM   4177 O  O   . SER A 1 541 ? 36.031  -0.576  -12.937 1.00 95.88 ? 541  SER A O   1 
ATOM   4178 C  CB  . SER A 1 541 ? 35.445  -1.114  -10.308 1.00 93.82 ? 541  SER A CB  1 
ATOM   4179 O  OG  . SER A 1 541 ? 35.217  -1.257  -8.915  1.00 92.71 ? 541  SER A OG  1 
ATOM   4180 N  N   . ALA A 1 542 ? 37.025  1.427   -12.560 1.00 97.25 ? 542  ALA A N   1 
ATOM   4181 C  CA  . ALA A 1 542 ? 37.320  1.757   -13.956 1.00 97.98 ? 542  ALA A CA  1 
ATOM   4182 C  C   . ALA A 1 542 ? 37.472  3.277   -14.084 1.00 98.44 ? 542  ALA A C   1 
ATOM   4183 O  O   . ALA A 1 542 ? 38.588  3.783   -13.820 1.00 98.58 ? 542  ALA A O   1 
ATOM   4184 C  CB  . ALA A 1 542 ? 36.197  1.265   -14.878 1.00 97.90 ? 542  ALA A CB  1 
ATOM   4185 N  N   . GLU B 1 4   ? -17.100 4.826   -69.327 1.00 86.72 ? 4    GLU B N   1 
ATOM   4186 C  CA  . GLU B 1 4   ? -15.983 5.629   -68.743 1.00 86.97 ? 4    GLU B CA  1 
ATOM   4187 C  C   . GLU B 1 4   ? -16.525 6.653   -67.723 1.00 85.46 ? 4    GLU B C   1 
ATOM   4188 O  O   . GLU B 1 4   ? -17.740 6.779   -67.545 1.00 86.32 ? 4    GLU B O   1 
ATOM   4189 C  CB  . GLU B 1 4   ? -15.212 6.342   -69.869 1.00 88.75 ? 4    GLU B CB  1 
ATOM   4190 C  CG  . GLU B 1 4   ? -13.737 6.666   -69.546 1.00 92.41 ? 4    GLU B CG  1 
ATOM   4191 C  CD  . GLU B 1 4   ? -12.804 5.430   -69.521 1.00 94.16 ? 4    GLU B CD  1 
ATOM   4192 O  OE1 . GLU B 1 4   ? -13.067 4.474   -68.752 1.00 95.51 ? 4    GLU B OE1 1 
ATOM   4193 O  OE2 . GLU B 1 4   ? -11.796 5.423   -70.268 1.00 94.02 ? 4    GLU B OE2 1 
ATOM   4194 N  N   . ASP B 1 5   ? -15.620 7.367   -67.053 1.00 82.76 ? 5    ASP B N   1 
ATOM   4195 C  CA  . ASP B 1 5   ? -15.970 8.374   -66.042 1.00 79.37 ? 5    ASP B CA  1 
ATOM   4196 C  C   . ASP B 1 5   ? -14.823 9.373   -65.949 1.00 78.23 ? 5    ASP B C   1 
ATOM   4197 O  O   . ASP B 1 5   ? -13.779 9.075   -65.379 1.00 78.09 ? 5    ASP B O   1 
ATOM   4198 C  CB  . ASP B 1 5   ? -16.171 7.700   -64.680 1.00 77.70 ? 5    ASP B CB  1 
ATOM   4199 C  CG  . ASP B 1 5   ? -16.488 8.695   -63.569 1.00 76.74 ? 5    ASP B CG  1 
ATOM   4200 O  OD1 . ASP B 1 5   ? -16.916 8.235   -62.484 1.00 72.48 ? 5    ASP B OD1 1 
ATOM   4201 O  OD2 . ASP B 1 5   ? -16.307 9.925   -63.777 1.00 75.68 ? 5    ASP B OD2 1 
ATOM   4202 N  N   . PRO B 1 6   ? -15.006 10.580  -66.499 1.00 77.52 ? 6    PRO B N   1 
ATOM   4203 C  CA  . PRO B 1 6   ? -13.968 11.621  -66.481 1.00 76.43 ? 6    PRO B CA  1 
ATOM   4204 C  C   . PRO B 1 6   ? -13.304 11.894  -65.133 1.00 75.32 ? 6    PRO B C   1 
ATOM   4205 O  O   . PRO B 1 6   ? -12.213 12.457  -65.082 1.00 75.61 ? 6    PRO B O   1 
ATOM   4206 C  CB  . PRO B 1 6   ? -14.690 12.848  -67.047 1.00 76.77 ? 6    PRO B CB  1 
ATOM   4207 C  CG  . PRO B 1 6   ? -16.130 12.596  -66.694 1.00 77.49 ? 6    PRO B CG  1 
ATOM   4208 C  CD  . PRO B 1 6   ? -16.286 11.121  -66.982 1.00 77.58 ? 6    PRO B CD  1 
ATOM   4209 N  N   . GLN B 1 7   ? -13.957 11.501  -64.045 1.00 74.22 ? 7    GLN B N   1 
ATOM   4210 C  CA  . GLN B 1 7   ? -13.380 11.706  -62.721 1.00 73.11 ? 7    GLN B CA  1 
ATOM   4211 C  C   . GLN B 1 7   ? -12.318 10.658  -62.416 1.00 70.80 ? 7    GLN B C   1 
ATOM   4212 O  O   . GLN B 1 7   ? -11.434 10.893  -61.594 1.00 70.58 ? 7    GLN B O   1 
ATOM   4213 C  CB  . GLN B 1 7   ? -14.466 11.679  -61.636 1.00 74.29 ? 7    GLN B CB  1 
ATOM   4214 C  CG  . GLN B 1 7   ? -15.282 12.972  -61.567 1.00 75.97 ? 7    GLN B CG  1 
ATOM   4215 C  CD  . GLN B 1 7   ? -14.438 14.168  -61.154 1.00 77.33 ? 7    GLN B CD  1 
ATOM   4216 O  OE1 . GLN B 1 7   ? -14.021 14.271  -60.001 1.00 77.94 ? 7    GLN B OE1 1 
ATOM   4217 N  NE2 . GLN B 1 7   ? -14.169 15.069  -62.096 1.00 76.95 ? 7    GLN B NE2 1 
ATOM   4218 N  N   . LEU B 1 8   ? -12.399 9.511   -63.087 1.00 67.66 ? 8    LEU B N   1 
ATOM   4219 C  CA  . LEU B 1 8   ? -11.437 8.444   -62.875 1.00 64.56 ? 8    LEU B CA  1 
ATOM   4220 C  C   . LEU B 1 8   ? -10.364 8.432   -63.949 1.00 63.72 ? 8    LEU B C   1 
ATOM   4221 O  O   . LEU B 1 8   ? -9.502  7.556   -63.966 1.00 64.96 ? 8    LEU B O   1 
ATOM   4222 C  CB  . LEU B 1 8   ? -12.130 7.090   -62.838 1.00 62.66 ? 8    LEU B CB  1 
ATOM   4223 C  CG  . LEU B 1 8   ? -13.214 6.939   -61.778 1.00 62.91 ? 8    LEU B CG  1 
ATOM   4224 C  CD1 . LEU B 1 8   ? -13.729 5.493   -61.782 1.00 61.57 ? 8    LEU B CD1 1 
ATOM   4225 C  CD2 . LEU B 1 8   ? -12.648 7.318   -60.403 1.00 62.69 ? 8    LEU B CD2 1 
ATOM   4226 N  N   . LEU B 1 9   ? -10.399 9.420   -64.831 1.00 62.02 ? 9    LEU B N   1 
ATOM   4227 C  CA  . LEU B 1 9   ? -9.417  9.495   -65.898 1.00 61.82 ? 9    LEU B CA  1 
ATOM   4228 C  C   . LEU B 1 9   ? -8.471  10.672  -65.710 1.00 60.78 ? 9    LEU B C   1 
ATOM   4229 O  O   . LEU B 1 9   ? -8.906  11.818  -65.667 1.00 60.97 ? 9    LEU B O   1 
ATOM   4230 C  CB  . LEU B 1 9   ? -10.133 9.625   -67.247 1.00 64.13 ? 9    LEU B CB  1 
ATOM   4231 C  CG  . LEU B 1 9   ? -10.061 8.457   -68.226 1.00 65.53 ? 9    LEU B CG  1 
ATOM   4232 C  CD1 . LEU B 1 9   ? -11.027 8.718   -69.383 1.00 65.92 ? 9    LEU B CD1 1 
ATOM   4233 C  CD2 . LEU B 1 9   ? -8.614  8.302   -68.740 1.00 65.90 ? 9    LEU B CD2 1 
ATOM   4234 N  N   . VAL B 1 10  ? -7.177  10.395  -65.607 1.00 59.60 ? 10   VAL B N   1 
ATOM   4235 C  CA  . VAL B 1 10  ? -6.205  11.467  -65.426 1.00 59.10 ? 10   VAL B CA  1 
ATOM   4236 C  C   . VAL B 1 10  ? -5.025  11.290  -66.352 1.00 58.97 ? 10   VAL B C   1 
ATOM   4237 O  O   . VAL B 1 10  ? -4.693  10.173  -66.742 1.00 60.10 ? 10   VAL B O   1 
ATOM   4238 C  CB  . VAL B 1 10  ? -5.642  11.500  -63.983 1.00 58.83 ? 10   VAL B CB  1 
ATOM   4239 C  CG1 . VAL B 1 10  ? -5.016  12.841  -63.708 1.00 57.70 ? 10   VAL B CG1 1 
ATOM   4240 C  CG2 . VAL B 1 10  ? -6.744  11.209  -62.981 1.00 59.83 ? 10   VAL B CG2 1 
ATOM   4241 N  N   . ARG B 1 11  ? -4.393  12.401  -66.700 1.00 58.09 ? 11   ARG B N   1 
ATOM   4242 C  CA  . ARG B 1 11  ? -3.215  12.375  -67.540 1.00 58.20 ? 11   ARG B CA  1 
ATOM   4243 C  C   . ARG B 1 11  ? -2.020  12.916  -66.749 1.00 56.86 ? 11   ARG B C   1 
ATOM   4244 O  O   . ARG B 1 11  ? -2.058  14.043  -66.274 1.00 56.71 ? 11   ARG B O   1 
ATOM   4245 C  CB  . ARG B 1 11  ? -3.435  13.232  -68.790 1.00 60.17 ? 11   ARG B CB  1 
ATOM   4246 C  CG  . ARG B 1 11  ? -2.157  13.491  -69.585 1.00 65.18 ? 11   ARG B CG  1 
ATOM   4247 C  CD  . ARG B 1 11  ? -2.412  14.027  -70.999 1.00 70.91 ? 11   ARG B CD  1 
ATOM   4248 N  NE  . ARG B 1 11  ? -2.213  12.974  -71.999 1.00 76.44 ? 11   ARG B NE  1 
ATOM   4249 C  CZ  . ARG B 1 11  ? -3.151  12.114  -72.391 1.00 79.47 ? 11   ARG B CZ  1 
ATOM   4250 N  NH1 . ARG B 1 11  ? -4.379  12.187  -71.874 1.00 80.76 ? 11   ARG B NH1 1 
ATOM   4251 N  NH2 . ARG B 1 11  ? -2.856  11.166  -73.282 1.00 80.29 ? 11   ARG B NH2 1 
ATOM   4252 N  N   . VAL B 1 12  ? -0.966  12.116  -66.612 1.00 55.95 ? 12   VAL B N   1 
ATOM   4253 C  CA  . VAL B 1 12  ? 0.240   12.534  -65.896 1.00 54.69 ? 12   VAL B CA  1 
ATOM   4254 C  C   . VAL B 1 12  ? 1.370   12.593  -66.931 1.00 55.47 ? 12   VAL B C   1 
ATOM   4255 O  O   . VAL B 1 12  ? 1.192   12.121  -68.046 1.00 56.51 ? 12   VAL B O   1 
ATOM   4256 C  CB  . VAL B 1 12  ? 0.544   11.532  -64.780 1.00 53.06 ? 12   VAL B CB  1 
ATOM   4257 C  CG1 . VAL B 1 12  ? -0.687  11.397  -63.875 1.00 52.63 ? 12   VAL B CG1 1 
ATOM   4258 C  CG2 . VAL B 1 12  ? 0.884   10.186  -65.368 1.00 50.67 ? 12   VAL B CG2 1 
ATOM   4259 N  N   . ARG B 1 13  ? 2.526   13.149  -66.593 1.00 56.36 ? 13   ARG B N   1 
ATOM   4260 C  CA  . ARG B 1 13  ? 3.586   13.234  -67.588 1.00 57.63 ? 13   ARG B CA  1 
ATOM   4261 C  C   . ARG B 1 13  ? 3.931   11.948  -68.350 1.00 56.70 ? 13   ARG B C   1 
ATOM   4262 O  O   . ARG B 1 13  ? 4.361   12.028  -69.484 1.00 56.40 ? 13   ARG B O   1 
ATOM   4263 C  CB  . ARG B 1 13  ? 4.856   13.829  -66.982 1.00 61.50 ? 13   ARG B CB  1 
ATOM   4264 C  CG  . ARG B 1 13  ? 4.722   15.305  -66.610 1.00 67.99 ? 13   ARG B CG  1 
ATOM   4265 C  CD  . ARG B 1 13  ? 6.085   15.901  -66.276 1.00 72.48 ? 13   ARG B CD  1 
ATOM   4266 N  NE  . ARG B 1 13  ? 5.992   17.185  -65.573 1.00 77.15 ? 13   ARG B NE  1 
ATOM   4267 C  CZ  . ARG B 1 13  ? 7.034   17.809  -65.017 1.00 78.86 ? 13   ARG B CZ  1 
ATOM   4268 N  NH1 . ARG B 1 13  ? 8.247   17.268  -65.089 1.00 79.53 ? 13   ARG B NH1 1 
ATOM   4269 N  NH2 . ARG B 1 13  ? 6.868   18.964  -64.376 1.00 78.36 ? 13   ARG B NH2 1 
ATOM   4270 N  N   . GLY B 1 14  ? 3.738   10.775  -67.762 1.00 55.11 ? 14   GLY B N   1 
ATOM   4271 C  CA  . GLY B 1 14  ? 4.073   9.568   -68.484 1.00 53.93 ? 14   GLY B CA  1 
ATOM   4272 C  C   . GLY B 1 14  ? 2.923   8.980   -69.275 1.00 54.40 ? 14   GLY B C   1 
ATOM   4273 O  O   . GLY B 1 14  ? 3.103   7.996   -69.998 1.00 53.68 ? 14   GLY B O   1 
ATOM   4274 N  N   . GLY B 1 15  ? 1.732   9.553   -69.138 1.00 53.98 ? 15   GLY B N   1 
ATOM   4275 C  CA  . GLY B 1 15  ? 0.598   9.018   -69.873 1.00 53.51 ? 15   GLY B CA  1 
ATOM   4276 C  C   . GLY B 1 15  ? -0.742  9.056   -69.163 1.00 54.05 ? 15   GLY B C   1 
ATOM   4277 O  O   . GLY B 1 15  ? -0.889  9.705   -68.133 1.00 54.49 ? 15   GLY B O   1 
ATOM   4278 N  N   . GLN B 1 16  ? -1.721  8.353   -69.722 1.00 53.87 ? 16   GLN B N   1 
ATOM   4279 C  CA  . GLN B 1 16  ? -3.065  8.312   -69.168 1.00 53.83 ? 16   GLN B CA  1 
ATOM   4280 C  C   . GLN B 1 16  ? -3.250  7.178   -68.191 1.00 51.67 ? 16   GLN B C   1 
ATOM   4281 O  O   . GLN B 1 16  ? -2.712  6.090   -68.377 1.00 50.77 ? 16   GLN B O   1 
ATOM   4282 C  CB  . GLN B 1 16  ? -4.102  8.173   -70.286 1.00 57.17 ? 16   GLN B CB  1 
ATOM   4283 C  CG  . GLN B 1 16  ? -4.158  9.362   -71.224 1.00 63.57 ? 16   GLN B CG  1 
ATOM   4284 C  CD  . GLN B 1 16  ? -5.382  9.324   -72.149 1.00 67.61 ? 16   GLN B CD  1 
ATOM   4285 O  OE1 . GLN B 1 16  ? -5.400  8.621   -73.176 1.00 68.40 ? 16   GLN B OE1 1 
ATOM   4286 N  NE2 . GLN B 1 16  ? -6.420  10.072  -71.773 1.00 68.90 ? 16   GLN B NE2 1 
ATOM   4287 N  N   . LEU B 1 17  ? -4.063  7.438   -67.175 1.00 50.62 ? 17   LEU B N   1 
ATOM   4288 C  CA  . LEU B 1 17  ? -4.344  6.484   -66.107 1.00 50.72 ? 17   LEU B CA  1 
ATOM   4289 C  C   . LEU B 1 17  ? -5.838  6.409   -65.875 1.00 50.53 ? 17   LEU B C   1 
ATOM   4290 O  O   . LEU B 1 17  ? -6.553  7.376   -66.102 1.00 51.91 ? 17   LEU B O   1 
ATOM   4291 C  CB  . LEU B 1 17  ? -3.730  6.976   -64.785 1.00 51.12 ? 17   LEU B CB  1 
ATOM   4292 C  CG  . LEU B 1 17  ? -2.259  7.362   -64.725 1.00 52.41 ? 17   LEU B CG  1 
ATOM   4293 C  CD1 . LEU B 1 17  ? -2.000  8.227   -63.522 1.00 52.23 ? 17   LEU B CD1 1 
ATOM   4294 C  CD2 . LEU B 1 17  ? -1.411  6.085   -64.687 1.00 54.40 ? 17   LEU B CD2 1 
ATOM   4295 N  N   . ARG B 1 18  ? -6.308  5.279   -65.383 1.00 50.41 ? 18   ARG B N   1 
ATOM   4296 C  CA  . ARG B 1 18  ? -7.709  5.152   -65.068 1.00 51.33 ? 18   ARG B CA  1 
ATOM   4297 C  C   . ARG B 1 18  ? -7.751  4.607   -63.661 1.00 51.96 ? 18   ARG B C   1 
ATOM   4298 O  O   . ARG B 1 18  ? -7.223  3.520   -63.368 1.00 49.49 ? 18   ARG B O   1 
ATOM   4299 C  CB  . ARG B 1 18  ? -8.432  4.182   -65.992 1.00 54.85 ? 18   ARG B CB  1 
ATOM   4300 C  CG  . ARG B 1 18  ? -9.945  4.394   -66.021 1.00 60.17 ? 18   ARG B CG  1 
ATOM   4301 C  CD  . ARG B 1 18  ? -10.709 3.131   -66.453 1.00 66.10 ? 18   ARG B CD  1 
ATOM   4302 N  NE  . ARG B 1 18  ? -9.848  2.169   -67.151 1.00 71.86 ? 18   ARG B NE  1 
ATOM   4303 C  CZ  . ARG B 1 18  ? -9.478  2.250   -68.431 1.00 71.92 ? 18   ARG B CZ  1 
ATOM   4304 N  NH1 . ARG B 1 18  ? -9.902  3.253   -69.194 1.00 71.66 ? 18   ARG B NH1 1 
ATOM   4305 N  NH2 . ARG B 1 18  ? -8.650  1.334   -68.932 1.00 72.60 ? 18   ARG B NH2 1 
ATOM   4306 N  N   . GLY B 1 19  ? -8.374  5.383   -62.785 1.00 51.85 ? 19   GLY B N   1 
ATOM   4307 C  CA  . GLY B 1 19  ? -8.509  4.979   -61.408 1.00 52.00 ? 19   GLY B CA  1 
ATOM   4308 C  C   . GLY B 1 19  ? -9.814  4.239   -61.198 1.00 52.58 ? 19   GLY B C   1 
ATOM   4309 O  O   . GLY B 1 19  ? -10.501 3.854   -62.146 1.00 53.50 ? 19   GLY B O   1 
ATOM   4310 N  N   . ILE B 1 20  ? -10.170 4.060   -59.940 1.00 51.89 ? 20   ILE B N   1 
ATOM   4311 C  CA  . ILE B 1 20  ? -11.377 3.356   -59.576 1.00 52.95 ? 20   ILE B CA  1 
ATOM   4312 C  C   . ILE B 1 20  ? -12.111 4.165   -58.502 1.00 55.88 ? 20   ILE B C   1 
ATOM   4313 O  O   . ILE B 1 20  ? -11.480 4.744   -57.619 1.00 56.59 ? 20   ILE B O   1 
ATOM   4314 C  CB  . ILE B 1 20  ? -11.010 1.960   -59.036 1.00 50.20 ? 20   ILE B CB  1 
ATOM   4315 C  CG1 . ILE B 1 20  ? -12.260 1.176   -58.667 1.00 49.59 ? 20   ILE B CG1 1 
ATOM   4316 C  CG2 . ILE B 1 20  ? -10.126 2.089   -57.832 1.00 48.35 ? 20   ILE B CG2 1 
ATOM   4317 C  CD1 . ILE B 1 20  ? -11.952 -0.256  -58.221 1.00 46.92 ? 20   ILE B CD1 1 
ATOM   4318 N  N   . ARG B 1 21  ? -13.437 4.218   -58.585 1.00 58.66 ? 21   ARG B N   1 
ATOM   4319 C  CA  . ARG B 1 21  ? -14.233 4.950   -57.605 1.00 59.86 ? 21   ARG B CA  1 
ATOM   4320 C  C   . ARG B 1 21  ? -14.417 4.003   -56.442 1.00 58.74 ? 21   ARG B C   1 
ATOM   4321 O  O   . ARG B 1 21  ? -14.933 2.906   -56.614 1.00 57.67 ? 21   ARG B O   1 
ATOM   4322 C  CB  . ARG B 1 21  ? -15.590 5.342   -58.192 1.00 62.98 ? 21   ARG B CB  1 
ATOM   4323 C  CG  . ARG B 1 21  ? -16.469 6.173   -57.247 1.00 68.15 ? 21   ARG B CG  1 
ATOM   4324 C  CD  . ARG B 1 21  ? -17.662 6.809   -57.988 1.00 72.53 ? 21   ARG B CD  1 
ATOM   4325 N  NE  . ARG B 1 21  ? -18.618 5.801   -58.450 1.00 76.08 ? 21   ARG B NE  1 
ATOM   4326 C  CZ  . ARG B 1 21  ? -19.485 5.171   -57.660 1.00 78.33 ? 21   ARG B CZ  1 
ATOM   4327 N  NH1 . ARG B 1 21  ? -19.531 5.446   -56.358 1.00 78.95 ? 21   ARG B NH1 1 
ATOM   4328 N  NH2 . ARG B 1 21  ? -20.298 4.252   -58.174 1.00 79.41 ? 21   ARG B NH2 1 
ATOM   4329 N  N   . LEU B 1 22  ? -13.966 4.420   -55.266 1.00 58.83 ? 22   LEU B N   1 
ATOM   4330 C  CA  . LEU B 1 22  ? -14.060 3.581   -54.089 1.00 59.92 ? 22   LEU B CA  1 
ATOM   4331 C  C   . LEU B 1 22  ? -15.080 4.104   -53.098 1.00 61.26 ? 22   LEU B C   1 
ATOM   4332 O  O   . LEU B 1 22  ? -15.369 5.300   -53.041 1.00 60.80 ? 22   LEU B O   1 
ATOM   4333 C  CB  . LEU B 1 22  ? -12.687 3.461   -53.418 1.00 61.50 ? 22   LEU B CB  1 
ATOM   4334 C  CG  . LEU B 1 22  ? -11.574 2.722   -54.176 1.00 62.04 ? 22   LEU B CG  1 
ATOM   4335 C  CD1 . LEU B 1 22  ? -10.330 2.606   -53.295 1.00 62.48 ? 22   LEU B CD1 1 
ATOM   4336 C  CD2 . LEU B 1 22  ? -12.044 1.335   -54.559 1.00 61.85 ? 22   LEU B CD2 1 
ATOM   4337 N  N   . LYS B 1 23  ? -15.603 3.189   -52.297 1.00 62.77 ? 23   LYS B N   1 
ATOM   4338 C  CA  . LYS B 1 23  ? -16.620 3.507   -51.314 1.00 65.29 ? 23   LYS B CA  1 
ATOM   4339 C  C   . LYS B 1 23  ? -16.059 3.771   -49.909 1.00 66.16 ? 23   LYS B C   1 
ATOM   4340 O  O   . LYS B 1 23  ? -15.392 2.919   -49.317 1.00 66.60 ? 23   LYS B O   1 
ATOM   4341 C  CB  . LYS B 1 23  ? -17.640 2.353   -51.295 1.00 66.82 ? 23   LYS B CB  1 
ATOM   4342 C  CG  . LYS B 1 23  ? -18.407 2.148   -49.996 1.00 72.11 ? 23   LYS B CG  1 
ATOM   4343 C  CD  . LYS B 1 23  ? -19.807 2.790   -50.007 1.00 76.02 ? 23   LYS B CD  1 
ATOM   4344 C  CE  . LYS B 1 23  ? -19.758 4.322   -50.180 1.00 77.17 ? 23   LYS B CE  1 
ATOM   4345 N  NZ  . LYS B 1 23  ? -21.018 4.988   -49.720 1.00 77.76 ? 23   LYS B NZ  1 
ATOM   4346 N  N   . ALA B 1 24  ? -16.325 4.965   -49.389 1.00 66.12 ? 24   ALA B N   1 
ATOM   4347 C  CA  . ALA B 1 24  ? -15.900 5.346   -48.042 1.00 66.47 ? 24   ALA B CA  1 
ATOM   4348 C  C   . ALA B 1 24  ? -17.186 5.508   -47.223 1.00 65.88 ? 24   ALA B C   1 
ATOM   4349 O  O   . ALA B 1 24  ? -18.239 5.834   -47.775 1.00 65.81 ? 24   ALA B O   1 
ATOM   4350 C  CB  . ALA B 1 24  ? -15.130 6.670   -48.086 1.00 66.35 ? 24   ALA B CB  1 
ATOM   4351 N  N   . PRO B 1 25  ? -17.122 5.292   -45.902 1.00 65.42 ? 25   PRO B N   1 
ATOM   4352 C  CA  . PRO B 1 25  ? -18.325 5.431   -45.074 1.00 64.69 ? 25   PRO B CA  1 
ATOM   4353 C  C   . PRO B 1 25  ? -19.276 6.573   -45.474 1.00 64.24 ? 25   PRO B C   1 
ATOM   4354 O  O   . PRO B 1 25  ? -20.467 6.343   -45.674 1.00 65.22 ? 25   PRO B O   1 
ATOM   4355 C  CB  . PRO B 1 25  ? -17.749 5.597   -43.671 1.00 65.45 ? 25   PRO B CB  1 
ATOM   4356 C  CG  . PRO B 1 25  ? -16.583 4.654   -43.702 1.00 65.97 ? 25   PRO B CG  1 
ATOM   4357 C  CD  . PRO B 1 25  ? -15.950 4.944   -45.076 1.00 65.79 ? 25   PRO B CD  1 
ATOM   4358 N  N   . GLY B 1 26  ? -18.765 7.788   -45.630 1.00 62.12 ? 26   GLY B N   1 
ATOM   4359 C  CA  . GLY B 1 26  ? -19.654 8.878   -45.977 1.00 61.56 ? 26   GLY B CA  1 
ATOM   4360 C  C   . GLY B 1 26  ? -19.731 9.308   -47.428 1.00 62.34 ? 26   GLY B C   1 
ATOM   4361 O  O   . GLY B 1 26  ? -20.243 10.393  -47.734 1.00 62.00 ? 26   GLY B O   1 
ATOM   4362 N  N   . GLY B 1 27  ? -19.230 8.480   -48.339 1.00 62.27 ? 27   GLY B N   1 
ATOM   4363 C  CA  . GLY B 1 27  ? -19.281 8.855   -49.738 1.00 60.77 ? 27   GLY B CA  1 
ATOM   4364 C  C   . GLY B 1 27  ? -18.178 8.236   -50.568 1.00 61.23 ? 27   GLY B C   1 
ATOM   4365 O  O   . GLY B 1 27  ? -17.356 7.472   -50.048 1.00 60.42 ? 27   GLY B O   1 
ATOM   4366 N  N   . PRO B 1 28  ? -18.128 8.564   -51.872 1.00 60.57 ? 28   PRO B N   1 
ATOM   4367 C  CA  . PRO B 1 28  ? -17.117 8.033   -52.792 1.00 60.22 ? 28   PRO B CA  1 
ATOM   4368 C  C   . PRO B 1 28  ? -15.790 8.795   -52.767 1.00 60.60 ? 28   PRO B C   1 
ATOM   4369 O  O   . PRO B 1 28  ? -15.746 9.967   -52.384 1.00 61.42 ? 28   PRO B O   1 
ATOM   4370 C  CB  . PRO B 1 28  ? -17.802 8.163   -54.142 1.00 58.93 ? 28   PRO B CB  1 
ATOM   4371 C  CG  . PRO B 1 28  ? -18.495 9.498   -53.993 1.00 57.92 ? 28   PRO B CG  1 
ATOM   4372 C  CD  . PRO B 1 28  ? -19.113 9.387   -52.603 1.00 59.12 ? 28   PRO B CD  1 
ATOM   4373 N  N   . VAL B 1 29  ? -14.717 8.115   -53.177 1.00 60.04 ? 29   VAL B N   1 
ATOM   4374 C  CA  . VAL B 1 29  ? -13.384 8.715   -53.263 1.00 58.98 ? 29   VAL B CA  1 
ATOM   4375 C  C   . VAL B 1 29  ? -12.773 8.182   -54.558 1.00 58.81 ? 29   VAL B C   1 
ATOM   4376 O  O   . VAL B 1 29  ? -13.125 7.092   -55.002 1.00 60.62 ? 29   VAL B O   1 
ATOM   4377 C  CB  . VAL B 1 29  ? -12.454 8.292   -52.074 1.00 59.69 ? 29   VAL B CB  1 
ATOM   4378 C  CG1 . VAL B 1 29  ? -13.125 8.572   -50.734 1.00 57.67 ? 29   VAL B CG1 1 
ATOM   4379 C  CG2 . VAL B 1 29  ? -12.096 6.806   -52.181 1.00 59.96 ? 29   VAL B CG2 1 
ATOM   4380 N  N   . SER B 1 30  ? -11.891 8.950   -55.181 1.00 56.97 ? 30   SER B N   1 
ATOM   4381 C  CA  . SER B 1 30  ? -11.221 8.498   -56.395 1.00 56.66 ? 30   SER B CA  1 
ATOM   4382 C  C   . SER B 1 30  ? -9.883  7.884   -55.959 1.00 57.35 ? 30   SER B C   1 
ATOM   4383 O  O   . SER B 1 30  ? -9.160  8.484   -55.158 1.00 58.77 ? 30   SER B O   1 
ATOM   4384 C  CB  . SER B 1 30  ? -10.930 9.678   -57.326 1.00 56.93 ? 30   SER B CB  1 
ATOM   4385 O  OG  . SER B 1 30  ? -12.106 10.382  -57.692 1.00 58.52 ? 30   SER B OG  1 
ATOM   4386 N  N   . ALA B 1 31  ? -9.541  6.705   -56.473 1.00 56.40 ? 31   ALA B N   1 
ATOM   4387 C  CA  . ALA B 1 31  ? -8.273  6.064   -56.113 1.00 53.91 ? 31   ALA B CA  1 
ATOM   4388 C  C   . ALA B 1 31  ? -7.479  5.641   -57.338 1.00 53.35 ? 31   ALA B C   1 
ATOM   4389 O  O   . ALA B 1 31  ? -7.982  4.945   -58.216 1.00 53.73 ? 31   ALA B O   1 
ATOM   4390 C  CB  . ALA B 1 31  ? -8.527  4.845   -55.205 1.00 53.40 ? 31   ALA B CB  1 
ATOM   4391 N  N   . PHE B 1 32  ? -6.232  6.075   -57.404 1.00 52.27 ? 32   PHE B N   1 
ATOM   4392 C  CA  . PHE B 1 32  ? -5.370  5.704   -58.510 1.00 49.93 ? 32   PHE B CA  1 
ATOM   4393 C  C   . PHE B 1 32  ? -4.266  4.876   -57.874 1.00 48.46 ? 32   PHE B C   1 
ATOM   4394 O  O   . PHE B 1 32  ? -3.344  5.410   -57.256 1.00 47.53 ? 32   PHE B O   1 
ATOM   4395 C  CB  . PHE B 1 32  ? -4.849  6.957   -59.184 1.00 50.08 ? 32   PHE B CB  1 
ATOM   4396 C  CG  . PHE B 1 32  ? -5.945  7.851   -59.658 1.00 52.65 ? 32   PHE B CG  1 
ATOM   4397 C  CD1 . PHE B 1 32  ? -6.568  8.736   -58.781 1.00 53.57 ? 32   PHE B CD1 1 
ATOM   4398 C  CD2 . PHE B 1 32  ? -6.411  7.766   -60.970 1.00 54.03 ? 32   PHE B CD2 1 
ATOM   4399 C  CE1 . PHE B 1 32  ? -7.645  9.530   -59.202 1.00 54.75 ? 32   PHE B CE1 1 
ATOM   4400 C  CE2 . PHE B 1 32  ? -7.488  8.553   -61.409 1.00 54.65 ? 32   PHE B CE2 1 
ATOM   4401 C  CZ  . PHE B 1 32  ? -8.106  9.438   -60.520 1.00 54.93 ? 32   PHE B CZ  1 
ATOM   4402 N  N   . LEU B 1 33  ? -4.394  3.561   -58.013 1.00 45.33 ? 33   LEU B N   1 
ATOM   4403 C  CA  . LEU B 1 33  ? -3.462  2.633   -57.409 1.00 45.29 ? 33   LEU B CA  1 
ATOM   4404 C  C   . LEU B 1 33  ? -2.485  1.973   -58.372 1.00 45.82 ? 33   LEU B C   1 
ATOM   4405 O  O   . LEU B 1 33  ? -2.821  1.713   -59.523 1.00 47.07 ? 33   LEU B O   1 
ATOM   4406 C  CB  . LEU B 1 33  ? -4.248  1.549   -56.671 1.00 41.86 ? 33   LEU B CB  1 
ATOM   4407 C  CG  . LEU B 1 33  ? -5.389  2.027   -55.763 1.00 43.58 ? 33   LEU B CG  1 
ATOM   4408 C  CD1 . LEU B 1 33  ? -6.075  0.793   -55.188 1.00 42.56 ? 33   LEU B CD1 1 
ATOM   4409 C  CD2 . LEU B 1 33  ? -4.877  2.921   -54.607 1.00 39.83 ? 33   LEU B CD2 1 
ATOM   4410 N  N   . GLY B 1 34  ? -1.282  1.691   -57.873 1.00 45.60 ? 34   GLY B N   1 
ATOM   4411 C  CA  . GLY B 1 34  ? -0.261  1.030   -58.669 1.00 44.11 ? 34   GLY B CA  1 
ATOM   4412 C  C   . GLY B 1 34  ? 0.291   1.836   -59.814 1.00 43.80 ? 34   GLY B C   1 
ATOM   4413 O  O   . GLY B 1 34  ? 0.535   1.278   -60.890 1.00 46.00 ? 34   GLY B O   1 
ATOM   4414 N  N   . ILE B 1 35  ? 0.491   3.134   -59.610 1.00 41.32 ? 35   ILE B N   1 
ATOM   4415 C  CA  . ILE B 1 35  ? 1.042   3.980   -60.665 1.00 40.50 ? 35   ILE B CA  1 
ATOM   4416 C  C   . ILE B 1 35  ? 2.551   3.809   -60.648 1.00 42.97 ? 35   ILE B C   1 
ATOM   4417 O  O   . ILE B 1 35  ? 3.175   3.976   -59.605 1.00 46.19 ? 35   ILE B O   1 
ATOM   4418 C  CB  . ILE B 1 35  ? 0.746   5.455   -60.402 1.00 39.91 ? 35   ILE B CB  1 
ATOM   4419 C  CG1 . ILE B 1 35  ? -0.764  5.653   -60.248 1.00 38.88 ? 35   ILE B CG1 1 
ATOM   4420 C  CG2 . ILE B 1 35  ? 1.373   6.325   -61.497 1.00 34.92 ? 35   ILE B CG2 1 
ATOM   4421 C  CD1 . ILE B 1 35  ? -1.172  7.099   -59.962 1.00 38.91 ? 35   ILE B CD1 1 
ATOM   4422 N  N   . PRO B 1 36  ? 3.167   3.480   -61.795 1.00 43.59 ? 36   PRO B N   1 
ATOM   4423 C  CA  . PRO B 1 36  ? 4.629   3.313   -61.777 1.00 41.60 ? 36   PRO B CA  1 
ATOM   4424 C  C   . PRO B 1 36  ? 5.359   4.639   -61.753 1.00 40.67 ? 36   PRO B C   1 
ATOM   4425 O  O   . PRO B 1 36  ? 5.049   5.528   -62.541 1.00 38.99 ? 36   PRO B O   1 
ATOM   4426 C  CB  . PRO B 1 36  ? 4.912   2.550   -63.071 1.00 43.11 ? 36   PRO B CB  1 
ATOM   4427 C  CG  . PRO B 1 36  ? 3.849   3.135   -64.033 1.00 42.73 ? 36   PRO B CG  1 
ATOM   4428 C  CD  . PRO B 1 36  ? 2.600   3.231   -63.140 1.00 42.63 ? 36   PRO B CD  1 
ATOM   4429 N  N   . PHE B 1 37  ? 6.330   4.784   -60.851 1.00 40.94 ? 37   PHE B N   1 
ATOM   4430 C  CA  . PHE B 1 37  ? 7.098   6.033   -60.817 1.00 41.05 ? 37   PHE B CA  1 
ATOM   4431 C  C   . PHE B 1 37  ? 8.571   5.817   -61.176 1.00 41.06 ? 37   PHE B C   1 
ATOM   4432 O  O   . PHE B 1 37  ? 9.356   6.761   -61.231 1.00 40.47 ? 37   PHE B O   1 
ATOM   4433 C  CB  . PHE B 1 37  ? 6.944   6.747   -59.448 1.00 39.04 ? 37   PHE B CB  1 
ATOM   4434 C  CG  . PHE B 1 37  ? 7.540   6.007   -58.290 1.00 37.15 ? 37   PHE B CG  1 
ATOM   4435 C  CD1 . PHE B 1 37  ? 8.887   6.158   -57.970 1.00 37.09 ? 37   PHE B CD1 1 
ATOM   4436 C  CD2 . PHE B 1 37  ? 6.749   5.180   -57.503 1.00 35.93 ? 37   PHE B CD2 1 
ATOM   4437 C  CE1 . PHE B 1 37  ? 9.437   5.493   -56.871 1.00 38.17 ? 37   PHE B CE1 1 
ATOM   4438 C  CE2 . PHE B 1 37  ? 7.284   4.503   -56.403 1.00 37.84 ? 37   PHE B CE2 1 
ATOM   4439 C  CZ  . PHE B 1 37  ? 8.642   4.660   -56.077 1.00 38.31 ? 37   PHE B CZ  1 
ATOM   4440 N  N   . ALA B 1 38  ? 8.946   4.570   -61.442 1.00 42.08 ? 38   ALA B N   1 
ATOM   4441 C  CA  . ALA B 1 38  ? 10.331  4.290   -61.833 1.00 42.49 ? 38   ALA B CA  1 
ATOM   4442 C  C   . ALA B 1 38  ? 10.435  3.052   -62.705 1.00 42.46 ? 38   ALA B C   1 
ATOM   4443 O  O   . ALA B 1 38  ? 9.511   2.238   -62.770 1.00 42.66 ? 38   ALA B O   1 
ATOM   4444 C  CB  . ALA B 1 38  ? 11.203  4.109   -60.586 1.00 40.73 ? 38   ALA B CB  1 
ATOM   4445 N  N   . GLU B 1 39  ? 11.570  2.914   -63.378 1.00 42.06 ? 39   GLU B N   1 
ATOM   4446 C  CA  . GLU B 1 39  ? 11.809  1.731   -64.180 1.00 42.99 ? 39   GLU B CA  1 
ATOM   4447 C  C   . GLU B 1 39  ? 11.976  0.585   -63.195 1.00 42.92 ? 39   GLU B C   1 
ATOM   4448 O  O   . GLU B 1 39  ? 12.632  0.743   -62.172 1.00 43.85 ? 39   GLU B O   1 
ATOM   4449 C  CB  . GLU B 1 39  ? 13.094  1.888   -64.988 1.00 42.21 ? 39   GLU B CB  1 
ATOM   4450 C  CG  . GLU B 1 39  ? 12.954  2.874   -66.121 1.00 45.76 ? 39   GLU B CG  1 
ATOM   4451 C  CD  . GLU B 1 39  ? 11.958  2.383   -67.158 1.00 45.80 ? 39   GLU B CD  1 
ATOM   4452 O  OE1 . GLU B 1 39  ? 12.340  1.532   -67.989 1.00 47.83 ? 39   GLU B OE1 1 
ATOM   4453 O  OE2 . GLU B 1 39  ? 10.794  2.830   -67.128 1.00 48.02 ? 39   GLU B OE2 1 
ATOM   4454 N  N   . PRO B 1 40  ? 11.355  -0.571  -63.461 1.00 42.96 ? 40   PRO B N   1 
ATOM   4455 C  CA  . PRO B 1 40  ? 11.527  -1.689  -62.515 1.00 42.50 ? 40   PRO B CA  1 
ATOM   4456 C  C   . PRO B 1 40  ? 13.034  -1.848  -62.200 1.00 44.21 ? 40   PRO B C   1 
ATOM   4457 O  O   . PRO B 1 40  ? 13.866  -1.981  -63.102 1.00 44.27 ? 40   PRO B O   1 
ATOM   4458 C  CB  . PRO B 1 40  ? 10.948  -2.867  -63.285 1.00 42.68 ? 40   PRO B CB  1 
ATOM   4459 C  CG  . PRO B 1 40  ? 9.816   -2.198  -64.099 1.00 40.91 ? 40   PRO B CG  1 
ATOM   4460 C  CD  . PRO B 1 40  ? 10.456  -0.920  -64.582 1.00 40.26 ? 40   PRO B CD  1 
ATOM   4461 N  N   . PRO B 1 41  ? 13.410  -1.821  -60.914 1.00 45.90 ? 41   PRO B N   1 
ATOM   4462 C  CA  . PRO B 1 41  ? 14.834  -1.947  -60.561 1.00 46.40 ? 41   PRO B CA  1 
ATOM   4463 C  C   . PRO B 1 41  ? 15.259  -3.409  -60.510 1.00 47.41 ? 41   PRO B C   1 
ATOM   4464 O  O   . PRO B 1 41  ? 15.718  -3.899  -59.483 1.00 47.41 ? 41   PRO B O   1 
ATOM   4465 C  CB  . PRO B 1 41  ? 14.894  -1.267  -59.194 1.00 45.43 ? 41   PRO B CB  1 
ATOM   4466 C  CG  . PRO B 1 41  ? 13.616  -1.754  -58.567 1.00 45.28 ? 41   PRO B CG  1 
ATOM   4467 C  CD  . PRO B 1 41  ? 12.578  -1.675  -59.704 1.00 45.32 ? 41   PRO B CD  1 
ATOM   4468 N  N   . VAL B 1 42  ? 15.107  -4.090  -61.640 1.00 49.05 ? 42   VAL B N   1 
ATOM   4469 C  CA  . VAL B 1 42  ? 15.412  -5.507  -61.756 1.00 47.65 ? 42   VAL B CA  1 
ATOM   4470 C  C   . VAL B 1 42  ? 16.676  -5.824  -62.555 1.00 48.05 ? 42   VAL B C   1 
ATOM   4471 O  O   . VAL B 1 42  ? 17.228  -4.974  -63.264 1.00 45.79 ? 42   VAL B O   1 
ATOM   4472 C  CB  . VAL B 1 42  ? 14.233  -6.222  -62.415 1.00 47.03 ? 42   VAL B CB  1 
ATOM   4473 C  CG1 . VAL B 1 42  ? 12.981  -6.004  -61.583 1.00 44.81 ? 42   VAL B CG1 1 
ATOM   4474 C  CG2 . VAL B 1 42  ? 14.029  -5.683  -63.828 1.00 45.21 ? 42   VAL B CG2 1 
ATOM   4475 N  N   . GLY B 1 43  ? 17.124  -7.069  -62.439 1.00 48.37 ? 43   GLY B N   1 
ATOM   4476 C  CA  . GLY B 1 43  ? 18.316  -7.481  -63.159 1.00 50.32 ? 43   GLY B CA  1 
ATOM   4477 C  C   . GLY B 1 43  ? 19.551  -6.659  -62.835 1.00 50.69 ? 43   GLY B C   1 
ATOM   4478 O  O   . GLY B 1 43  ? 20.009  -6.644  -61.697 1.00 52.97 ? 43   GLY B O   1 
ATOM   4479 N  N   . SER B 1 44  ? 20.098  -5.966  -63.819 1.00 51.16 ? 44   SER B N   1 
ATOM   4480 C  CA  . SER B 1 44  ? 21.298  -5.179  -63.577 1.00 52.27 ? 44   SER B CA  1 
ATOM   4481 C  C   . SER B 1 44  ? 20.997  -3.904  -62.812 1.00 53.26 ? 44   SER B C   1 
ATOM   4482 O  O   . SER B 1 44  ? 21.912  -3.140  -62.484 1.00 54.10 ? 44   SER B O   1 
ATOM   4483 C  CB  . SER B 1 44  ? 21.973  -4.798  -64.888 1.00 51.47 ? 44   SER B CB  1 
ATOM   4484 O  OG  . SER B 1 44  ? 21.384  -3.613  -65.408 1.00 54.17 ? 44   SER B OG  1 
ATOM   4485 N  N   . ARG B 1 45  ? 19.723  -3.642  -62.542 1.00 53.23 ? 45   ARG B N   1 
ATOM   4486 C  CA  . ARG B 1 45  ? 19.390  -2.422  -61.816 1.00 52.71 ? 45   ARG B CA  1 
ATOM   4487 C  C   . ARG B 1 45  ? 19.285  -2.698  -60.335 1.00 51.14 ? 45   ARG B C   1 
ATOM   4488 O  O   . ARG B 1 45  ? 19.046  -1.786  -59.552 1.00 52.16 ? 45   ARG B O   1 
ATOM   4489 C  CB  . ARG B 1 45  ? 18.084  -1.802  -62.318 1.00 55.87 ? 45   ARG B CB  1 
ATOM   4490 C  CG  . ARG B 1 45  ? 18.186  -1.067  -63.647 1.00 59.59 ? 45   ARG B CG  1 
ATOM   4491 C  CD  . ARG B 1 45  ? 16.850  -1.214  -64.400 1.00 67.59 ? 45   ARG B CD  1 
ATOM   4492 N  NE  . ARG B 1 45  ? 16.847  -0.619  -65.743 1.00 73.77 ? 45   ARG B NE  1 
ATOM   4493 C  CZ  . ARG B 1 45  ? 16.746  0.688   -65.974 1.00 76.88 ? 45   ARG B CZ  1 
ATOM   4494 N  NH1 . ARG B 1 45  ? 16.636  1.525   -64.951 1.00 76.65 ? 45   ARG B NH1 1 
ATOM   4495 N  NH2 . ARG B 1 45  ? 16.760  1.161   -67.219 1.00 78.49 ? 45   ARG B NH2 1 
ATOM   4496 N  N   . ARG B 1 46  ? 19.467  -3.952  -59.942 1.00 48.52 ? 46   ARG B N   1 
ATOM   4497 C  CA  . ARG B 1 46  ? 19.408  -4.287  -58.529 1.00 47.63 ? 46   ARG B CA  1 
ATOM   4498 C  C   . ARG B 1 46  ? 20.514  -3.545  -57.803 1.00 46.36 ? 46   ARG B C   1 
ATOM   4499 O  O   . ARG B 1 46  ? 21.633  -3.504  -58.293 1.00 47.87 ? 46   ARG B O   1 
ATOM   4500 C  CB  . ARG B 1 46  ? 19.596  -5.782  -58.314 1.00 45.80 ? 46   ARG B CB  1 
ATOM   4501 C  CG  . ARG B 1 46  ? 19.521  -6.170  -56.862 1.00 44.53 ? 46   ARG B CG  1 
ATOM   4502 C  CD  . ARG B 1 46  ? 19.820  -7.633  -56.704 1.00 45.30 ? 46   ARG B CD  1 
ATOM   4503 N  NE  . ARG B 1 46  ? 18.656  -8.491  -56.858 1.00 44.08 ? 46   ARG B NE  1 
ATOM   4504 C  CZ  . ARG B 1 46  ? 18.740  -9.819  -56.854 1.00 43.72 ? 46   ARG B CZ  1 
ATOM   4505 N  NH1 . ARG B 1 46  ? 19.936  -10.381 -56.721 1.00 43.30 ? 46   ARG B NH1 1 
ATOM   4506 N  NH2 . ARG B 1 46  ? 17.649  -10.581 -56.936 1.00 39.95 ? 46   ARG B NH2 1 
ATOM   4507 N  N   . PHE B 1 47  ? 20.187  -2.957  -56.651 1.00 46.51 ? 47   PHE B N   1 
ATOM   4508 C  CA  . PHE B 1 47  ? 21.132  -2.191  -55.806 1.00 45.32 ? 47   PHE B CA  1 
ATOM   4509 C  C   . PHE B 1 47  ? 21.449  -0.817  -56.382 1.00 46.43 ? 47   PHE B C   1 
ATOM   4510 O  O   . PHE B 1 47  ? 22.186  -0.030  -55.775 1.00 46.20 ? 47   PHE B O   1 
ATOM   4511 C  CB  . PHE B 1 47  ? 22.470  -2.923  -55.601 1.00 42.49 ? 47   PHE B CB  1 
ATOM   4512 C  CG  . PHE B 1 47  ? 22.329  -4.338  -55.150 1.00 43.12 ? 47   PHE B CG  1 
ATOM   4513 C  CD1 . PHE B 1 47  ? 21.602  -4.653  -54.007 1.00 44.28 ? 47   PHE B CD1 1 
ATOM   4514 C  CD2 . PHE B 1 47  ? 22.930  -5.359  -55.865 1.00 41.01 ? 47   PHE B CD2 1 
ATOM   4515 C  CE1 . PHE B 1 47  ? 21.471  -5.981  -53.576 1.00 43.75 ? 47   PHE B CE1 1 
ATOM   4516 C  CE2 . PHE B 1 47  ? 22.812  -6.666  -55.460 1.00 43.41 ? 47   PHE B CE2 1 
ATOM   4517 C  CZ  . PHE B 1 47  ? 22.077  -6.987  -54.306 1.00 44.96 ? 47   PHE B CZ  1 
ATOM   4518 N  N   . MET B 1 48  ? 20.912  -0.522  -57.557 1.00 46.07 ? 48   MET B N   1 
ATOM   4519 C  CA  . MET B 1 48  ? 21.187  0.764   -58.159 1.00 47.13 ? 48   MET B CA  1 
ATOM   4520 C  C   . MET B 1 48  ? 20.102  1.795   -57.914 1.00 45.22 ? 48   MET B C   1 
ATOM   4521 O  O   . MET B 1 48  ? 18.956  1.459   -57.598 1.00 43.10 ? 48   MET B O   1 
ATOM   4522 C  CB  . MET B 1 48  ? 21.389  0.598   -59.671 1.00 51.77 ? 48   MET B CB  1 
ATOM   4523 C  CG  . MET B 1 48  ? 22.540  -0.335  -60.039 1.00 57.07 ? 48   MET B CG  1 
ATOM   4524 S  SD  . MET B 1 48  ? 23.134  0.027   -61.701 1.00 66.47 ? 48   MET B SD  1 
ATOM   4525 C  CE  . MET B 1 48  ? 24.245  1.499   -61.339 1.00 60.08 ? 48   MET B CE  1 
ATOM   4526 N  N   . PRO B 1 49  ? 20.465  3.075   -58.026 1.00 43.78 ? 49   PRO B N   1 
ATOM   4527 C  CA  . PRO B 1 49  ? 19.528  4.180   -57.840 1.00 44.41 ? 49   PRO B CA  1 
ATOM   4528 C  C   . PRO B 1 49  ? 18.372  3.998   -58.834 1.00 45.62 ? 49   PRO B C   1 
ATOM   4529 O  O   . PRO B 1 49  ? 18.559  3.487   -59.934 1.00 44.04 ? 49   PRO B O   1 
ATOM   4530 C  CB  . PRO B 1 49  ? 20.366  5.403   -58.202 1.00 43.56 ? 49   PRO B CB  1 
ATOM   4531 C  CG  . PRO B 1 49  ? 21.717  5.024   -57.719 1.00 43.90 ? 49   PRO B CG  1 
ATOM   4532 C  CD  . PRO B 1 49  ? 21.848  3.567   -58.143 1.00 43.49 ? 49   PRO B CD  1 
ATOM   4533 N  N   . PRO B 1 50  ? 17.163  4.435   -58.464 1.00 46.43 ? 50   PRO B N   1 
ATOM   4534 C  CA  . PRO B 1 50  ? 16.030  4.290   -59.380 1.00 44.66 ? 50   PRO B CA  1 
ATOM   4535 C  C   . PRO B 1 50  ? 16.138  5.261   -60.551 1.00 45.30 ? 50   PRO B C   1 
ATOM   4536 O  O   . PRO B 1 50  ? 16.752  6.322   -60.436 1.00 46.04 ? 50   PRO B O   1 
ATOM   4537 C  CB  . PRO B 1 50  ? 14.845  4.627   -58.495 1.00 43.91 ? 50   PRO B CB  1 
ATOM   4538 C  CG  . PRO B 1 50  ? 15.400  5.734   -57.635 1.00 44.56 ? 50   PRO B CG  1 
ATOM   4539 C  CD  . PRO B 1 50  ? 16.770  5.183   -57.255 1.00 45.08 ? 50   PRO B CD  1 
ATOM   4540 N  N   . GLU B 1 51  ? 15.551  4.891   -61.679 1.00 46.33 ? 51   GLU B N   1 
ATOM   4541 C  CA  . GLU B 1 51  ? 15.519  5.759   -62.850 1.00 48.17 ? 51   GLU B CA  1 
ATOM   4542 C  C   . GLU B 1 51  ? 14.050  6.067   -63.099 1.00 45.86 ? 51   GLU B C   1 
ATOM   4543 O  O   . GLU B 1 51  ? 13.183  5.237   -62.832 1.00 44.92 ? 51   GLU B O   1 
ATOM   4544 C  CB  . GLU B 1 51  ? 16.133  5.060   -64.063 1.00 54.02 ? 51   GLU B CB  1 
ATOM   4545 C  CG  . GLU B 1 51  ? 17.656  4.949   -63.979 1.00 62.36 ? 51   GLU B CG  1 
ATOM   4546 C  CD  . GLU B 1 51  ? 18.259  4.324   -65.229 1.00 70.04 ? 51   GLU B CD  1 
ATOM   4547 O  OE1 . GLU B 1 51  ? 18.246  3.072   -65.369 1.00 72.64 ? 51   GLU B OE1 1 
ATOM   4548 O  OE2 . GLU B 1 51  ? 18.741  5.097   -66.097 1.00 75.33 ? 51   GLU B OE2 1 
ATOM   4549 N  N   . PRO B 1 52  ? 13.741  7.267   -63.594 1.00 45.24 ? 52   PRO B N   1 
ATOM   4550 C  CA  . PRO B 1 52  ? 12.328  7.579   -63.833 1.00 45.84 ? 52   PRO B CA  1 
ATOM   4551 C  C   . PRO B 1 52  ? 11.650  6.670   -64.855 1.00 46.98 ? 52   PRO B C   1 
ATOM   4552 O  O   . PRO B 1 52  ? 12.266  6.197   -65.815 1.00 45.64 ? 52   PRO B O   1 
ATOM   4553 C  CB  . PRO B 1 52  ? 12.347  9.055   -64.255 1.00 46.68 ? 52   PRO B CB  1 
ATOM   4554 C  CG  . PRO B 1 52  ? 13.724  9.256   -64.832 1.00 47.33 ? 52   PRO B CG  1 
ATOM   4555 C  CD  . PRO B 1 52  ? 14.618  8.400   -63.943 1.00 46.83 ? 52   PRO B CD  1 
ATOM   4556 N  N   . LYS B 1 53  ? 10.369  6.417   -64.614 1.00 47.40 ? 53   LYS B N   1 
ATOM   4557 C  CA  . LYS B 1 53  ? 9.561   5.568   -65.462 1.00 47.32 ? 53   LYS B CA  1 
ATOM   4558 C  C   . LYS B 1 53  ? 9.390   6.147   -66.846 1.00 48.35 ? 53   LYS B C   1 
ATOM   4559 O  O   . LYS B 1 53  ? 8.976   7.304   -66.998 1.00 47.99 ? 53   LYS B O   1 
ATOM   4560 C  CB  . LYS B 1 53  ? 8.172   5.383   -64.861 1.00 47.29 ? 53   LYS B CB  1 
ATOM   4561 C  CG  . LYS B 1 53  ? 7.213   4.613   -65.755 1.00 46.90 ? 53   LYS B CG  1 
ATOM   4562 C  CD  . LYS B 1 53  ? 7.575   3.139   -65.780 1.00 47.03 ? 53   LYS B CD  1 
ATOM   4563 C  CE  . LYS B 1 53  ? 6.548   2.313   -66.555 1.00 47.10 ? 53   LYS B CE  1 
ATOM   4564 N  NZ  . LYS B 1 53  ? 6.718   2.504   -68.025 1.00 49.62 ? 53   LYS B NZ  1 
ATOM   4565 N  N   . ARG B 1 54  ? 9.699   5.340   -67.859 1.00 48.72 ? 54   ARG B N   1 
ATOM   4566 C  CA  . ARG B 1 54  ? 9.527   5.768   -69.244 1.00 48.33 ? 54   ARG B CA  1 
ATOM   4567 C  C   . ARG B 1 54  ? 8.028   5.878   -69.533 1.00 48.28 ? 54   ARG B C   1 
ATOM   4568 O  O   . ARG B 1 54  ? 7.215   5.118   -68.980 1.00 45.71 ? 54   ARG B O   1 
ATOM   4569 C  CB  . ARG B 1 54  ? 10.111  4.732   -70.219 1.00 48.73 ? 54   ARG B CB  1 
ATOM   4570 C  CG  . ARG B 1 54  ? 11.632  4.637   -70.258 1.00 51.63 ? 54   ARG B CG  1 
ATOM   4571 C  CD  . ARG B 1 54  ? 12.080  3.459   -71.121 1.00 50.38 ? 54   ARG B CD  1 
ATOM   4572 N  NE  . ARG B 1 54  ? 11.462  2.234   -70.632 1.00 50.55 ? 54   ARG B NE  1 
ATOM   4573 C  CZ  . ARG B 1 54  ? 10.682  1.432   -71.356 1.00 52.44 ? 54   ARG B CZ  1 
ATOM   4574 N  NH1 . ARG B 1 54  ? 10.162  0.350   -70.797 1.00 49.85 ? 54   ARG B NH1 1 
ATOM   4575 N  NH2 . ARG B 1 54  ? 10.432  1.695   -72.640 1.00 49.33 ? 54   ARG B NH2 1 
ATOM   4576 N  N   . PRO B 1 55  ? 7.648   6.820   -70.409 1.00 48.71 ? 55   PRO B N   1 
ATOM   4577 C  CA  . PRO B 1 55  ? 6.266   7.085   -70.842 1.00 49.85 ? 55   PRO B CA  1 
ATOM   4578 C  C   . PRO B 1 55  ? 5.616   5.829   -71.421 1.00 49.95 ? 55   PRO B C   1 
ATOM   4579 O  O   . PRO B 1 55  ? 6.290   5.007   -72.045 1.00 53.01 ? 55   PRO B O   1 
ATOM   4580 C  CB  . PRO B 1 55  ? 6.443   8.145   -71.922 1.00 51.34 ? 55   PRO B CB  1 
ATOM   4581 C  CG  . PRO B 1 55  ? 7.661   8.912   -71.429 1.00 52.05 ? 55   PRO B CG  1 
ATOM   4582 C  CD  . PRO B 1 55  ? 8.584   7.802   -70.992 1.00 49.40 ? 55   PRO B CD  1 
ATOM   4583 N  N   . TRP B 1 56  ? 4.315   5.679   -71.222 1.00 49.00 ? 56   TRP B N   1 
ATOM   4584 C  CA  . TRP B 1 56  ? 3.595   4.526   -71.719 1.00 48.44 ? 56   TRP B CA  1 
ATOM   4585 C  C   . TRP B 1 56  ? 2.507   4.951   -72.713 1.00 50.03 ? 56   TRP B C   1 
ATOM   4586 O  O   . TRP B 1 56  ? 2.129   6.123   -72.781 1.00 50.27 ? 56   TRP B O   1 
ATOM   4587 C  CB  . TRP B 1 56  ? 2.967   3.773   -70.560 1.00 47.75 ? 56   TRP B CB  1 
ATOM   4588 C  CG  . TRP B 1 56  ? 2.054   4.612   -69.754 1.00 50.98 ? 56   TRP B CG  1 
ATOM   4589 C  CD1 . TRP B 1 56  ? 0.742   4.869   -70.006 1.00 50.96 ? 56   TRP B CD1 1 
ATOM   4590 C  CD2 . TRP B 1 56  ? 2.379   5.321   -68.554 1.00 50.87 ? 56   TRP B CD2 1 
ATOM   4591 N  NE1 . TRP B 1 56  ? 0.222   5.694   -69.037 1.00 50.13 ? 56   TRP B NE1 1 
ATOM   4592 C  CE2 . TRP B 1 56  ? 1.204   5.989   -68.131 1.00 50.98 ? 56   TRP B CE2 1 
ATOM   4593 C  CE3 . TRP B 1 56  ? 3.550   5.461   -67.794 1.00 49.73 ? 56   TRP B CE3 1 
ATOM   4594 C  CZ2 . TRP B 1 56  ? 1.161   6.784   -66.973 1.00 49.41 ? 56   TRP B CZ2 1 
ATOM   4595 C  CZ3 . TRP B 1 56  ? 3.509   6.252   -66.645 1.00 49.46 ? 56   TRP B CZ3 1 
ATOM   4596 C  CH2 . TRP B 1 56  ? 2.318   6.903   -66.249 1.00 48.25 ? 56   TRP B CH2 1 
ATOM   4597 N  N   . SER B 1 57  ? 2.004   3.987   -73.477 1.00 48.70 ? 57   SER B N   1 
ATOM   4598 C  CA  . SER B 1 57  ? 0.987   4.247   -74.470 1.00 48.06 ? 57   SER B CA  1 
ATOM   4599 C  C   . SER B 1 57  ? -0.349  3.846   -73.905 1.00 48.34 ? 57   SER B C   1 
ATOM   4600 O  O   . SER B 1 57  ? -0.407  3.006   -73.018 1.00 47.16 ? 57   SER B O   1 
ATOM   4601 C  CB  . SER B 1 57  ? 1.224   3.376   -75.702 1.00 49.55 ? 57   SER B CB  1 
ATOM   4602 O  OG  . SER B 1 57  ? 0.882   2.007   -75.400 1.00 48.22 ? 57   SER B OG  1 
ATOM   4603 N  N   . GLY B 1 58  ? -1.424  4.415   -74.453 1.00 48.83 ? 58   GLY B N   1 
ATOM   4604 C  CA  . GLY B 1 58  ? -2.765  4.049   -74.008 1.00 49.41 ? 58   GLY B CA  1 
ATOM   4605 C  C   . GLY B 1 58  ? -3.157  4.498   -72.606 1.00 50.92 ? 58   GLY B C   1 
ATOM   4606 O  O   . GLY B 1 58  ? -2.606  5.449   -72.053 1.00 48.76 ? 58   GLY B O   1 
ATOM   4607 N  N   . VAL B 1 59  ? -4.136  3.813   -72.036 1.00 50.67 ? 59   VAL B N   1 
ATOM   4608 C  CA  . VAL B 1 59  ? -4.595  4.142   -70.711 1.00 51.78 ? 59   VAL B CA  1 
ATOM   4609 C  C   . VAL B 1 59  ? -4.130  3.061   -69.764 1.00 53.01 ? 59   VAL B C   1 
ATOM   4610 O  O   . VAL B 1 59  ? -4.590  1.910   -69.853 1.00 53.69 ? 59   VAL B O   1 
ATOM   4611 C  CB  . VAL B 1 59  ? -6.133  4.227   -70.651 1.00 52.74 ? 59   VAL B CB  1 
ATOM   4612 C  CG1 . VAL B 1 59  ? -6.586  4.543   -69.212 1.00 51.19 ? 59   VAL B CG1 1 
ATOM   4613 C  CG2 . VAL B 1 59  ? -6.639  5.295   -71.646 1.00 50.55 ? 59   VAL B CG2 1 
ATOM   4614 N  N   . LEU B 1 60  ? -3.224  3.441   -68.858 1.00 52.51 ? 60   LEU B N   1 
ATOM   4615 C  CA  . LEU B 1 60  ? -2.671  2.520   -67.875 1.00 51.29 ? 60   LEU B CA  1 
ATOM   4616 C  C   . LEU B 1 60  ? -3.706  2.268   -66.804 1.00 50.57 ? 60   LEU B C   1 
ATOM   4617 O  O   . LEU B 1 60  ? -4.273  3.195   -66.241 1.00 51.48 ? 60   LEU B O   1 
ATOM   4618 C  CB  . LEU B 1 60  ? -1.401  3.109   -67.251 1.00 51.65 ? 60   LEU B CB  1 
ATOM   4619 C  CG  . LEU B 1 60  ? -0.622  2.150   -66.329 1.00 53.07 ? 60   LEU B CG  1 
ATOM   4620 C  CD1 . LEU B 1 60  ? -0.279  0.859   -67.090 1.00 54.06 ? 60   LEU B CD1 1 
ATOM   4621 C  CD2 . LEU B 1 60  ? 0.644   2.801   -65.886 1.00 50.47 ? 60   LEU B CD2 1 
ATOM   4622 N  N   . ASP B 1 61  ? -3.956  1.006   -66.521 1.00 50.87 ? 61   ASP B N   1 
ATOM   4623 C  CA  . ASP B 1 61  ? -4.930  0.654   -65.511 1.00 51.59 ? 61   ASP B CA  1 
ATOM   4624 C  C   . ASP B 1 61  ? -4.406  0.846   -64.066 1.00 51.83 ? 61   ASP B C   1 
ATOM   4625 O  O   . ASP B 1 61  ? -3.515  0.116   -63.609 1.00 51.97 ? 61   ASP B O   1 
ATOM   4626 C  CB  . ASP B 1 61  ? -5.348  -0.786  -65.711 1.00 52.52 ? 61   ASP B CB  1 
ATOM   4627 C  CG  . ASP B 1 61  ? -5.971  -1.359  -64.482 1.00 55.42 ? 61   ASP B CG  1 
ATOM   4628 O  OD1 . ASP B 1 61  ? -5.706  -2.539  -64.181 1.00 57.92 ? 61   ASP B OD1 1 
ATOM   4629 O  OD2 . ASP B 1 61  ? -6.719  -0.619  -63.813 1.00 56.10 ? 61   ASP B OD2 1 
ATOM   4630 N  N   . ALA B 1 62  ? -4.986  1.813   -63.350 1.00 50.56 ? 62   ALA B N   1 
ATOM   4631 C  CA  . ALA B 1 62  ? -4.584  2.113   -61.973 1.00 48.56 ? 62   ALA B CA  1 
ATOM   4632 C  C   . ALA B 1 62  ? -5.713  1.845   -61.001 1.00 48.11 ? 62   ALA B C   1 
ATOM   4633 O  O   . ALA B 1 62  ? -6.054  2.710   -60.190 1.00 48.35 ? 62   ALA B O   1 
ATOM   4634 C  CB  . ALA B 1 62  ? -4.160  3.569   -61.861 1.00 45.60 ? 62   ALA B CB  1 
ATOM   4635 N  N   . THR B 1 63  ? -6.285  0.650   -61.056 1.00 46.95 ? 63   THR B N   1 
ATOM   4636 C  CA  . THR B 1 63  ? -7.396  0.347   -60.167 1.00 47.51 ? 63   THR B CA  1 
ATOM   4637 C  C   . THR B 1 63  ? -7.081  -0.694  -59.110 1.00 47.17 ? 63   THR B C   1 
ATOM   4638 O  O   . THR B 1 63  ? -7.953  -1.057  -58.310 1.00 46.59 ? 63   THR B O   1 
ATOM   4639 C  CB  . THR B 1 63  ? -8.627  -0.121  -60.972 1.00 49.04 ? 63   THR B CB  1 
ATOM   4640 O  OG1 . THR B 1 63  ? -8.350  -1.393  -61.594 1.00 49.11 ? 63   THR B OG1 1 
ATOM   4641 C  CG2 . THR B 1 63  ? -8.966  0.917   -62.044 1.00 47.10 ? 63   THR B CG2 1 
ATOM   4642 N  N   . THR B 1 64  ? -5.832  -1.146  -59.078 1.00 46.54 ? 64   THR B N   1 
ATOM   4643 C  CA  . THR B 1 64  ? -5.430  -2.164  -58.116 1.00 47.29 ? 64   THR B CA  1 
ATOM   4644 C  C   . THR B 1 64  ? -4.008  -1.943  -57.589 1.00 45.79 ? 64   THR B C   1 
ATOM   4645 O  O   . THR B 1 64  ? -3.154  -1.400  -58.288 1.00 45.13 ? 64   THR B O   1 
ATOM   4646 C  CB  . THR B 1 64  ? -5.525  -3.562  -58.788 1.00 50.56 ? 64   THR B CB  1 
ATOM   4647 O  OG1 . THR B 1 64  ? -5.312  -4.581  -57.807 1.00 55.62 ? 64   THR B OG1 1 
ATOM   4648 C  CG2 . THR B 1 64  ? -4.458  -3.705  -59.901 1.00 49.38 ? 64   THR B CG2 1 
ATOM   4649 N  N   . PHE B 1 65  ? -3.753  -2.358  -56.353 1.00 46.05 ? 65   PHE B N   1 
ATOM   4650 C  CA  . PHE B 1 65  ? -2.428  -2.210  -55.761 1.00 46.96 ? 65   PHE B CA  1 
ATOM   4651 C  C   . PHE B 1 65  ? -1.428  -3.080  -56.509 1.00 47.76 ? 65   PHE B C   1 
ATOM   4652 O  O   . PHE B 1 65  ? -1.734  -4.214  -56.878 1.00 47.83 ? 65   PHE B O   1 
ATOM   4653 C  CB  . PHE B 1 65  ? -2.424  -2.644  -54.291 1.00 45.73 ? 65   PHE B CB  1 
ATOM   4654 C  CG  . PHE B 1 65  ? -2.992  -1.616  -53.346 1.00 48.79 ? 65   PHE B CG  1 
ATOM   4655 C  CD1 . PHE B 1 65  ? -2.465  -0.319  -53.308 1.00 47.21 ? 65   PHE B CD1 1 
ATOM   4656 C  CD2 . PHE B 1 65  ? -4.061  -1.944  -52.493 1.00 46.94 ? 65   PHE B CD2 1 
ATOM   4657 C  CE1 . PHE B 1 65  ? -2.985  0.628   -52.451 1.00 47.80 ? 65   PHE B CE1 1 
ATOM   4658 C  CE2 . PHE B 1 65  ? -4.586  -1.006  -51.630 1.00 46.83 ? 65   PHE B CE2 1 
ATOM   4659 C  CZ  . PHE B 1 65  ? -4.048  0.293   -51.604 1.00 47.69 ? 65   PHE B CZ  1 
ATOM   4660 N  N   . GLN B 1 66  ? -0.230  -2.548  -56.710 1.00 47.49 ? 66   GLN B N   1 
ATOM   4661 C  CA  . GLN B 1 66  ? 0.838   -3.285  -57.378 1.00 47.18 ? 66   GLN B CA  1 
ATOM   4662 C  C   . GLN B 1 66  ? 1.576   -4.222  -56.412 1.00 46.39 ? 66   GLN B C   1 
ATOM   4663 O  O   . GLN B 1 66  ? 1.242   -4.311  -55.226 1.00 45.76 ? 66   GLN B O   1 
ATOM   4664 C  CB  . GLN B 1 66  ? 1.823   -2.302  -57.994 1.00 47.19 ? 66   GLN B CB  1 
ATOM   4665 C  CG  . GLN B 1 66  ? 1.531   -2.011  -59.437 1.00 48.09 ? 66   GLN B CG  1 
ATOM   4666 C  CD  . GLN B 1 66  ? 1.784   -3.232  -60.304 1.00 51.24 ? 66   GLN B CD  1 
ATOM   4667 O  OE1 . GLN B 1 66  ? 2.272   -4.272  -59.822 1.00 52.08 ? 66   GLN B OE1 1 
ATOM   4668 N  NE2 . GLN B 1 66  ? 1.464   -3.117  -61.590 1.00 49.72 ? 66   GLN B NE2 1 
ATOM   4669 N  N   . ASN B 1 67  ? 2.597   -4.906  -56.904 1.00 45.33 ? 67   ASN B N   1 
ATOM   4670 C  CA  . ASN B 1 67  ? 3.326   -5.822  -56.041 1.00 45.17 ? 67   ASN B CA  1 
ATOM   4671 C  C   . ASN B 1 67  ? 4.095   -5.174  -54.879 1.00 44.67 ? 67   ASN B C   1 
ATOM   4672 O  O   . ASN B 1 67  ? 4.514   -4.024  -54.942 1.00 45.39 ? 67   ASN B O   1 
ATOM   4673 C  CB  . ASN B 1 67  ? 4.302   -6.661  -56.868 1.00 47.03 ? 67   ASN B CB  1 
ATOM   4674 C  CG  . ASN B 1 67  ? 3.590   -7.588  -57.861 1.00 51.66 ? 67   ASN B CG  1 
ATOM   4675 O  OD1 . ASN B 1 67  ? 2.491   -8.088  -57.597 1.00 50.70 ? 67   ASN B OD1 1 
ATOM   4676 N  ND2 . ASN B 1 67  ? 4.231   -7.835  -58.997 1.00 53.73 ? 67   ASN B ND2 1 
ATOM   4677 N  N   . VAL B 1 68  ? 4.289   -5.952  -53.826 1.00 42.20 ? 68   VAL B N   1 
ATOM   4678 C  CA  . VAL B 1 68  ? 5.032   -5.537  -52.665 1.00 41.69 ? 68   VAL B CA  1 
ATOM   4679 C  C   . VAL B 1 68  ? 6.532   -5.760  -52.909 1.00 42.55 ? 68   VAL B C   1 
ATOM   4680 O  O   . VAL B 1 68  ? 6.920   -6.803  -53.462 1.00 42.11 ? 68   VAL B O   1 
ATOM   4681 C  CB  . VAL B 1 68  ? 4.605   -6.378  -51.460 1.00 41.59 ? 68   VAL B CB  1 
ATOM   4682 C  CG1 . VAL B 1 68  ? 5.548   -6.162  -50.308 1.00 39.91 ? 68   VAL B CG1 1 
ATOM   4683 C  CG2 . VAL B 1 68  ? 3.184   -6.013  -51.062 1.00 42.80 ? 68   VAL B CG2 1 
ATOM   4684 N  N   . CYS B 1 69  ? 7.378   -4.813  -52.500 1.00 40.70 ? 69   CYS B N   1 
ATOM   4685 C  CA  . CYS B 1 69  ? 8.817   -4.983  -52.683 1.00 41.89 ? 69   CYS B CA  1 
ATOM   4686 C  C   . CYS B 1 69  ? 9.290   -6.249  -51.979 1.00 42.87 ? 69   CYS B C   1 
ATOM   4687 O  O   . CYS B 1 69  ? 8.870   -6.537  -50.847 1.00 42.51 ? 69   CYS B O   1 
ATOM   4688 C  CB  . CYS B 1 69  ? 9.571   -3.764  -52.166 1.00 43.73 ? 69   CYS B CB  1 
ATOM   4689 S  SG  . CYS B 1 69  ? 9.355   -2.312  -53.241 1.00 49.19 ? 69   CYS B SG  1 
ATOM   4690 N  N   . TYR B 1 70  ? 10.160  -7.007  -52.656 1.00 44.15 ? 70   TYR B N   1 
ATOM   4691 C  CA  . TYR B 1 70  ? 10.657  -8.270  -52.121 1.00 43.74 ? 70   TYR B CA  1 
ATOM   4692 C  C   . TYR B 1 70  ? 11.200  -8.103  -50.710 1.00 43.90 ? 70   TYR B C   1 
ATOM   4693 O  O   . TYR B 1 70  ? 12.071  -7.263  -50.461 1.00 42.16 ? 70   TYR B O   1 
ATOM   4694 C  CB  . TYR B 1 70  ? 11.722  -8.877  -53.039 1.00 45.08 ? 70   TYR B CB  1 
ATOM   4695 C  CG  . TYR B 1 70  ? 11.675  -10.384 -52.972 1.00 46.63 ? 70   TYR B CG  1 
ATOM   4696 C  CD1 . TYR B 1 70  ? 10.837  -11.114 -53.820 1.00 47.54 ? 70   TYR B CD1 1 
ATOM   4697 C  CD2 . TYR B 1 70  ? 12.335  -11.065 -51.952 1.00 46.04 ? 70   TYR B CD2 1 
ATOM   4698 C  CE1 . TYR B 1 70  ? 10.640  -12.502 -53.640 1.00 48.23 ? 70   TYR B CE1 1 
ATOM   4699 C  CE2 . TYR B 1 70  ? 12.148  -12.430 -51.762 1.00 49.48 ? 70   TYR B CE2 1 
ATOM   4700 C  CZ  . TYR B 1 70  ? 11.293  -13.146 -52.601 1.00 50.02 ? 70   TYR B CZ  1 
ATOM   4701 O  OH  . TYR B 1 70  ? 11.052  -14.472 -52.330 1.00 48.32 ? 70   TYR B OH  1 
ATOM   4702 N  N   . GLN B 1 71  ? 10.694  -8.919  -49.790 1.00 44.15 ? 71   GLN B N   1 
ATOM   4703 C  CA  . GLN B 1 71  ? 11.100  -8.780  -48.402 1.00 45.89 ? 71   GLN B CA  1 
ATOM   4704 C  C   . GLN B 1 71  ? 10.838  -10.015 -47.574 1.00 48.06 ? 71   GLN B C   1 
ATOM   4705 O  O   . GLN B 1 71  ? 10.043  -10.880 -47.951 1.00 48.91 ? 71   GLN B O   1 
ATOM   4706 C  CB  . GLN B 1 71  ? 10.323  -7.623  -47.764 1.00 45.44 ? 71   GLN B CB  1 
ATOM   4707 C  CG  . GLN B 1 71  ? 8.827   -7.938  -47.616 1.00 44.61 ? 71   GLN B CG  1 
ATOM   4708 C  CD  . GLN B 1 71  ? 7.983   -6.724  -47.237 1.00 45.67 ? 71   GLN B CD  1 
ATOM   4709 O  OE1 . GLN B 1 71  ? 7.299   -6.728  -46.218 1.00 45.61 ? 71   GLN B OE1 1 
ATOM   4710 N  NE2 . GLN B 1 71  ? 8.018   -5.698  -48.062 1.00 42.55 ? 71   GLN B NE2 1 
ATOM   4711 N  N   . TYR B 1 72  ? 11.497  -10.067 -46.424 1.00 48.78 ? 72   TYR B N   1 
ATOM   4712 C  CA  . TYR B 1 72  ? 11.322  -11.154 -45.485 1.00 51.63 ? 72   TYR B CA  1 
ATOM   4713 C  C   . TYR B 1 72  ? 9.869   -11.108 -44.989 1.00 52.55 ? 72   TYR B C   1 
ATOM   4714 O  O   . TYR B 1 72  ? 9.296   -10.027 -44.825 1.00 53.00 ? 72   TYR B O   1 
ATOM   4715 C  CB  . TYR B 1 72  ? 12.319  -10.973 -44.329 1.00 55.42 ? 72   TYR B CB  1 
ATOM   4716 C  CG  . TYR B 1 72  ? 12.036  -11.836 -43.126 1.00 58.10 ? 72   TYR B CG  1 
ATOM   4717 C  CD1 . TYR B 1 72  ? 11.199  -11.386 -42.109 1.00 57.87 ? 72   TYR B CD1 1 
ATOM   4718 C  CD2 . TYR B 1 72  ? 12.566  -13.124 -43.030 1.00 59.52 ? 72   TYR B CD2 1 
ATOM   4719 C  CE1 . TYR B 1 72  ? 10.892  -12.188 -41.025 1.00 60.25 ? 72   TYR B CE1 1 
ATOM   4720 C  CE2 . TYR B 1 72  ? 12.261  -13.944 -41.949 1.00 61.03 ? 72   TYR B CE2 1 
ATOM   4721 C  CZ  . TYR B 1 72  ? 11.424  -13.468 -40.945 1.00 61.81 ? 72   TYR B CZ  1 
ATOM   4722 O  OH  . TYR B 1 72  ? 11.129  -14.265 -39.852 1.00 64.21 ? 72   TYR B OH  1 
ATOM   4723 N  N   . VAL B 1 73  ? 9.272   -12.276 -44.763 1.00 53.26 ? 73   VAL B N   1 
ATOM   4724 C  CA  . VAL B 1 73  ? 7.887   -12.370 -44.296 1.00 54.49 ? 73   VAL B CA  1 
ATOM   4725 C  C   . VAL B 1 73  ? 7.878   -12.970 -42.889 1.00 57.32 ? 73   VAL B C   1 
ATOM   4726 O  O   . VAL B 1 73  ? 8.471   -14.029 -42.659 1.00 56.53 ? 73   VAL B O   1 
ATOM   4727 C  CB  . VAL B 1 73  ? 7.039   -13.265 -45.250 1.00 53.70 ? 73   VAL B CB  1 
ATOM   4728 C  CG1 . VAL B 1 73  ? 5.711   -13.612 -44.604 1.00 51.16 ? 73   VAL B CG1 1 
ATOM   4729 C  CG2 . VAL B 1 73  ? 6.802   -12.535 -46.586 1.00 51.75 ? 73   VAL B CG2 1 
ATOM   4730 N  N   . ASP B 1 74  ? 7.206   -12.295 -41.953 1.00 59.78 ? 74   ASP B N   1 
ATOM   4731 C  CA  . ASP B 1 74  ? 7.160   -12.759 -40.563 1.00 61.35 ? 74   ASP B CA  1 
ATOM   4732 C  C   . ASP B 1 74  ? 6.396   -14.066 -40.374 1.00 62.44 ? 74   ASP B C   1 
ATOM   4733 O  O   . ASP B 1 74  ? 5.284   -14.247 -40.889 1.00 62.44 ? 74   ASP B O   1 
ATOM   4734 C  CB  . ASP B 1 74  ? 6.571   -11.687 -39.650 1.00 61.78 ? 74   ASP B CB  1 
ATOM   4735 C  CG  . ASP B 1 74  ? 6.824   -11.984 -38.187 1.00 63.70 ? 74   ASP B CG  1 
ATOM   4736 O  OD1 . ASP B 1 74  ? 6.085   -12.794 -37.582 1.00 64.16 ? 74   ASP B OD1 1 
ATOM   4737 O  OD2 . ASP B 1 74  ? 7.792   -11.426 -37.647 1.00 64.47 ? 74   ASP B OD2 1 
ATOM   4738 N  N   . THR B 1 75  ? 7.004   -14.965 -39.609 1.00 63.31 ? 75   THR B N   1 
ATOM   4739 C  CA  . THR B 1 75  ? 6.436   -16.281 -39.363 1.00 65.23 ? 75   THR B CA  1 
ATOM   4740 C  C   . THR B 1 75  ? 6.433   -16.663 -37.886 1.00 65.73 ? 75   THR B C   1 
ATOM   4741 O  O   . THR B 1 75  ? 6.111   -17.797 -37.545 1.00 66.75 ? 75   THR B O   1 
ATOM   4742 C  CB  . THR B 1 75  ? 7.247   -17.350 -40.139 1.00 65.73 ? 75   THR B CB  1 
ATOM   4743 O  OG1 . THR B 1 75  ? 8.637   -17.248 -39.783 1.00 65.25 ? 75   THR B OG1 1 
ATOM   4744 C  CG2 . THR B 1 75  ? 7.109   -17.140 -41.656 1.00 65.01 ? 75   THR B CG2 1 
ATOM   4745 N  N   . LEU B 1 76  ? 6.781   -15.723 -37.015 1.00 66.75 ? 76   LEU B N   1 
ATOM   4746 C  CA  . LEU B 1 76  ? 6.833   -16.002 -35.580 1.00 68.54 ? 76   LEU B CA  1 
ATOM   4747 C  C   . LEU B 1 76  ? 5.515   -16.520 -35.004 1.00 68.81 ? 76   LEU B C   1 
ATOM   4748 O  O   . LEU B 1 76  ? 5.521   -17.441 -34.179 1.00 70.51 ? 76   LEU B O   1 
ATOM   4749 C  CB  . LEU B 1 76  ? 7.284   -14.753 -34.800 1.00 69.85 ? 76   LEU B CB  1 
ATOM   4750 C  CG  . LEU B 1 76  ? 7.274   -14.807 -33.258 1.00 71.30 ? 76   LEU B CG  1 
ATOM   4751 C  CD1 . LEU B 1 76  ? 8.219   -15.896 -32.752 1.00 70.39 ? 76   LEU B CD1 1 
ATOM   4752 C  CD2 . LEU B 1 76  ? 7.682   -13.446 -32.693 1.00 71.12 ? 76   LEU B CD2 1 
ATOM   4753 N  N   . TYR B 1 77  ? 4.394   -15.940 -35.429 1.00 68.28 ? 77   TYR B N   1 
ATOM   4754 C  CA  . TYR B 1 77  ? 3.082   -16.365 -34.944 1.00 68.16 ? 77   TYR B CA  1 
ATOM   4755 C  C   . TYR B 1 77  ? 2.119   -16.626 -36.094 1.00 67.94 ? 77   TYR B C   1 
ATOM   4756 O  O   . TYR B 1 77  ? 1.210   -15.839 -36.354 1.00 68.62 ? 77   TYR B O   1 
ATOM   4757 C  CB  . TYR B 1 77  ? 2.487   -15.304 -34.023 1.00 69.08 ? 77   TYR B CB  1 
ATOM   4758 C  CG  . TYR B 1 77  ? 3.254   -15.104 -32.745 1.00 70.08 ? 77   TYR B CG  1 
ATOM   4759 C  CD1 . TYR B 1 77  ? 3.277   -16.088 -31.767 1.00 71.04 ? 77   TYR B CD1 1 
ATOM   4760 C  CD2 . TYR B 1 77  ? 3.943   -13.922 -32.504 1.00 70.63 ? 77   TYR B CD2 1 
ATOM   4761 C  CE1 . TYR B 1 77  ? 3.964   -15.901 -30.578 1.00 72.05 ? 77   TYR B CE1 1 
ATOM   4762 C  CE2 . TYR B 1 77  ? 4.636   -13.722 -31.321 1.00 71.29 ? 77   TYR B CE2 1 
ATOM   4763 C  CZ  . TYR B 1 77  ? 4.643   -14.713 -30.361 1.00 72.45 ? 77   TYR B CZ  1 
ATOM   4764 O  OH  . TYR B 1 77  ? 5.333   -14.522 -29.184 1.00 74.03 ? 77   TYR B OH  1 
ATOM   4765 N  N   . PRO B 1 78  ? 2.295   -17.750 -36.791 1.00 67.80 ? 78   PRO B N   1 
ATOM   4766 C  CA  . PRO B 1 78  ? 1.428   -18.098 -37.921 1.00 67.30 ? 78   PRO B CA  1 
ATOM   4767 C  C   . PRO B 1 78  ? -0.075  -17.979 -37.649 1.00 66.79 ? 78   PRO B C   1 
ATOM   4768 O  O   . PRO B 1 78  ? -0.583  -18.542 -36.674 1.00 67.10 ? 78   PRO B O   1 
ATOM   4769 C  CB  . PRO B 1 78  ? 1.860   -19.522 -38.244 1.00 68.27 ? 78   PRO B CB  1 
ATOM   4770 C  CG  . PRO B 1 78  ? 3.350   -19.492 -37.923 1.00 67.86 ? 78   PRO B CG  1 
ATOM   4771 C  CD  . PRO B 1 78  ? 3.351   -18.763 -36.597 1.00 67.96 ? 78   PRO B CD  1 
ATOM   4772 N  N   . GLY B 1 79  ? -0.768  -17.230 -38.510 1.00 65.73 ? 79   GLY B N   1 
ATOM   4773 C  CA  . GLY B 1 79  ? -2.209  -17.046 -38.377 1.00 64.86 ? 79   GLY B CA  1 
ATOM   4774 C  C   . GLY B 1 79  ? -2.654  -15.950 -37.423 1.00 65.19 ? 79   GLY B C   1 
ATOM   4775 O  O   . GLY B 1 79  ? -3.854  -15.620 -37.334 1.00 64.02 ? 79   GLY B O   1 
ATOM   4776 N  N   . PHE B 1 80  ? -1.678  -15.383 -36.710 1.00 64.58 ? 80   PHE B N   1 
ATOM   4777 C  CA  . PHE B 1 80  ? -1.926  -14.320 -35.739 1.00 63.53 ? 80   PHE B CA  1 
ATOM   4778 C  C   . PHE B 1 80  ? -2.134  -12.959 -36.395 1.00 62.89 ? 80   PHE B C   1 
ATOM   4779 O  O   . PHE B 1 80  ? -1.243  -12.434 -37.049 1.00 62.65 ? 80   PHE B O   1 
ATOM   4780 C  CB  . PHE B 1 80  ? -0.761  -14.249 -34.740 1.00 62.84 ? 80   PHE B CB  1 
ATOM   4781 C  CG  . PHE B 1 80  ? -0.957  -13.231 -33.651 1.00 63.95 ? 80   PHE B CG  1 
ATOM   4782 C  CD1 . PHE B 1 80  ? -2.208  -13.071 -33.042 1.00 63.97 ? 80   PHE B CD1 1 
ATOM   4783 C  CD2 . PHE B 1 80  ? 0.106   -12.432 -33.226 1.00 63.73 ? 80   PHE B CD2 1 
ATOM   4784 C  CE1 . PHE B 1 80  ? -2.400  -12.128 -32.026 1.00 64.28 ? 80   PHE B CE1 1 
ATOM   4785 C  CE2 . PHE B 1 80  ? -0.073  -11.490 -32.215 1.00 63.63 ? 80   PHE B CE2 1 
ATOM   4786 C  CZ  . PHE B 1 80  ? -1.333  -11.338 -31.613 1.00 64.36 ? 80   PHE B CZ  1 
ATOM   4787 N  N   . GLU B 1 81  ? -3.324  -12.403 -36.214 1.00 63.41 ? 81   GLU B N   1 
ATOM   4788 C  CA  . GLU B 1 81  ? -3.677  -11.100 -36.756 1.00 65.39 ? 81   GLU B CA  1 
ATOM   4789 C  C   . GLU B 1 81  ? -2.644  -10.024 -36.378 1.00 64.94 ? 81   GLU B C   1 
ATOM   4790 O  O   . GLU B 1 81  ? -2.278  -9.181  -37.193 1.00 66.02 ? 81   GLU B O   1 
ATOM   4791 C  CB  . GLU B 1 81  ? -5.039  -10.692 -36.207 1.00 69.48 ? 81   GLU B CB  1 
ATOM   4792 C  CG  . GLU B 1 81  ? -5.471  -9.305  -36.609 1.00 76.79 ? 81   GLU B CG  1 
ATOM   4793 C  CD  . GLU B 1 81  ? -6.257  -9.314  -37.904 1.00 81.61 ? 81   GLU B CD  1 
ATOM   4794 O  OE1 . GLU B 1 81  ? -7.392  -9.862  -37.892 1.00 84.68 ? 81   GLU B OE1 1 
ATOM   4795 O  OE2 . GLU B 1 81  ? -5.743  -8.787  -38.927 1.00 83.52 ? 81   GLU B OE2 1 
ATOM   4796 N  N   . GLY B 1 82  ? -2.186  -10.057 -35.132 1.00 63.02 ? 82   GLY B N   1 
ATOM   4797 C  CA  . GLY B 1 82  ? -1.223  -9.078  -34.668 1.00 61.86 ? 82   GLY B CA  1 
ATOM   4798 C  C   . GLY B 1 82  ? 0.021   -8.952  -35.518 1.00 60.98 ? 82   GLY B C   1 
ATOM   4799 O  O   . GLY B 1 82  ? 0.628   -7.882  -35.597 1.00 61.05 ? 82   GLY B O   1 
ATOM   4800 N  N   . THR B 1 83  ? 0.419   -10.041 -36.157 1.00 60.70 ? 83   THR B N   1 
ATOM   4801 C  CA  . THR B 1 83  ? 1.600   -10.019 -36.999 1.00 59.47 ? 83   THR B CA  1 
ATOM   4802 C  C   . THR B 1 83  ? 1.229   -9.988  -38.478 1.00 59.49 ? 83   THR B C   1 
ATOM   4803 O  O   . THR B 1 83  ? 1.834   -9.262  -39.266 1.00 58.57 ? 83   THR B O   1 
ATOM   4804 C  CB  . THR B 1 83  ? 2.499   -11.253 -36.732 1.00 59.66 ? 83   THR B CB  1 
ATOM   4805 O  OG1 . THR B 1 83  ? 1.673   -12.416 -36.563 1.00 58.80 ? 83   THR B OG1 1 
ATOM   4806 C  CG2 . THR B 1 83  ? 3.359   -11.046 -35.491 1.00 57.39 ? 83   THR B CG2 1 
ATOM   4807 N  N   . GLU B 1 84  ? 0.216   -10.761 -38.849 1.00 60.21 ? 84   GLU B N   1 
ATOM   4808 C  CA  . GLU B 1 84  ? -0.193  -10.841 -40.254 1.00 61.09 ? 84   GLU B CA  1 
ATOM   4809 C  C   . GLU B 1 84  ? -0.602  -9.496  -40.832 1.00 58.75 ? 84   GLU B C   1 
ATOM   4810 O  O   . GLU B 1 84  ? -0.474  -9.272  -42.036 1.00 58.98 ? 84   GLU B O   1 
ATOM   4811 C  CB  . GLU B 1 84  ? -1.363  -11.825 -40.432 1.00 64.96 ? 84   GLU B CB  1 
ATOM   4812 C  CG  . GLU B 1 84  ? -1.146  -13.211 -39.823 1.00 70.53 ? 84   GLU B CG  1 
ATOM   4813 C  CD  . GLU B 1 84  ? -0.258  -14.124 -40.663 1.00 73.39 ? 84   GLU B CD  1 
ATOM   4814 O  OE1 . GLU B 1 84  ? 0.597   -13.595 -41.422 1.00 74.83 ? 84   GLU B OE1 1 
ATOM   4815 O  OE2 . GLU B 1 84  ? -0.414  -15.371 -40.538 1.00 72.92 ? 84   GLU B OE2 1 
ATOM   4816 N  N   . MET B 1 85  ? -1.106  -8.601  -39.988 1.00 56.17 ? 85   MET B N   1 
ATOM   4817 C  CA  . MET B 1 85  ? -1.544  -7.303  -40.485 1.00 53.62 ? 85   MET B CA  1 
ATOM   4818 C  C   . MET B 1 85  ? -0.394  -6.473  -41.062 1.00 51.56 ? 85   MET B C   1 
ATOM   4819 O  O   . MET B 1 85  ? -0.636  -5.515  -41.799 1.00 50.16 ? 85   MET B O   1 
ATOM   4820 C  CB  . MET B 1 85  ? -2.276  -6.520  -39.393 1.00 55.03 ? 85   MET B CB  1 
ATOM   4821 C  CG  . MET B 1 85  ? -1.407  -5.984  -38.266 1.00 56.58 ? 85   MET B CG  1 
ATOM   4822 S  SD  . MET B 1 85  ? -2.435  -5.018  -37.157 1.00 59.28 ? 85   MET B SD  1 
ATOM   4823 C  CE  . MET B 1 85  ? -2.604  -3.541  -38.136 1.00 56.29 ? 85   MET B CE  1 
ATOM   4824 N  N   . TRP B 1 86  ? 0.843   -6.853  -40.739 1.00 48.36 ? 86   TRP B N   1 
ATOM   4825 C  CA  . TRP B 1 86  ? 2.020   -6.152  -41.263 1.00 48.54 ? 86   TRP B CA  1 
ATOM   4826 C  C   . TRP B 1 86  ? 2.693   -6.916  -42.435 1.00 48.97 ? 86   TRP B C   1 
ATOM   4827 O  O   . TRP B 1 86  ? 3.608   -6.393  -43.079 1.00 46.28 ? 86   TRP B O   1 
ATOM   4828 C  CB  . TRP B 1 86  ? 3.070   -5.912  -40.147 1.00 46.55 ? 86   TRP B CB  1 
ATOM   4829 C  CG  . TRP B 1 86  ? 2.529   -5.225  -38.902 1.00 45.10 ? 86   TRP B CG  1 
ATOM   4830 C  CD1 . TRP B 1 86  ? 2.280   -5.808  -37.697 1.00 43.94 ? 86   TRP B CD1 1 
ATOM   4831 C  CD2 . TRP B 1 86  ? 2.059   -3.870  -38.794 1.00 44.65 ? 86   TRP B CD2 1 
ATOM   4832 N  NE1 . TRP B 1 86  ? 1.670   -4.911  -36.850 1.00 45.79 ? 86   TRP B NE1 1 
ATOM   4833 C  CE2 . TRP B 1 86  ? 1.525   -3.713  -37.499 1.00 45.79 ? 86   TRP B CE2 1 
ATOM   4834 C  CE3 . TRP B 1 86  ? 2.038   -2.773  -39.668 1.00 44.36 ? 86   TRP B CE3 1 
ATOM   4835 C  CZ2 . TRP B 1 86  ? 0.970   -2.498  -37.054 1.00 45.86 ? 86   TRP B CZ2 1 
ATOM   4836 C  CZ3 . TRP B 1 86  ? 1.488   -1.565  -39.224 1.00 42.82 ? 86   TRP B CZ3 1 
ATOM   4837 C  CH2 . TRP B 1 86  ? 0.963   -1.442  -37.933 1.00 42.35 ? 86   TRP B CH2 1 
ATOM   4838 N  N   . ASN B 1 87  ? 2.256   -8.151  -42.691 1.00 49.13 ? 87   ASN B N   1 
ATOM   4839 C  CA  . ASN B 1 87  ? 2.832   -8.949  -43.774 1.00 50.73 ? 87   ASN B CA  1 
ATOM   4840 C  C   . ASN B 1 87  ? 2.326   -8.518  -45.148 1.00 49.39 ? 87   ASN B C   1 
ATOM   4841 O  O   . ASN B 1 87  ? 1.250   -7.924  -45.275 1.00 50.35 ? 87   ASN B O   1 
ATOM   4842 C  CB  . ASN B 1 87  ? 2.542   -10.438 -43.568 1.00 53.08 ? 87   ASN B CB  1 
ATOM   4843 C  CG  . ASN B 1 87  ? 3.525   -11.109 -42.615 1.00 55.85 ? 87   ASN B CG  1 
ATOM   4844 O  OD1 . ASN B 1 87  ? 4.722   -10.748 -42.556 1.00 56.61 ? 87   ASN B OD1 1 
ATOM   4845 N  ND2 . ASN B 1 87  ? 3.039   -12.111 -41.885 1.00 55.44 ? 87   ASN B ND2 1 
ATOM   4846 N  N   . PRO B 1 88  ? 3.099   -8.810  -46.202 1.00 48.69 ? 88   PRO B N   1 
ATOM   4847 C  CA  . PRO B 1 88  ? 2.700   -8.431  -47.566 1.00 48.28 ? 88   PRO B CA  1 
ATOM   4848 C  C   . PRO B 1 88  ? 1.278   -8.895  -47.888 1.00 48.17 ? 88   PRO B C   1 
ATOM   4849 O  O   . PRO B 1 88  ? 0.887   -9.997  -47.523 1.00 49.01 ? 88   PRO B O   1 
ATOM   4850 C  CB  . PRO B 1 88  ? 3.740   -9.132  -48.434 1.00 47.00 ? 88   PRO B CB  1 
ATOM   4851 C  CG  . PRO B 1 88  ? 4.955   -9.206  -47.532 1.00 45.38 ? 88   PRO B CG  1 
ATOM   4852 C  CD  . PRO B 1 88  ? 4.334   -9.617  -46.219 1.00 47.91 ? 88   PRO B CD  1 
ATOM   4853 N  N   . ASN B 1 89  ? 0.499   -8.057  -48.551 1.00 47.57 ? 89   ASN B N   1 
ATOM   4854 C  CA  . ASN B 1 89  ? -0.852  -8.454  -48.897 1.00 47.54 ? 89   ASN B CA  1 
ATOM   4855 C  C   . ASN B 1 89  ? -1.027  -8.477  -50.417 1.00 48.17 ? 89   ASN B C   1 
ATOM   4856 O  O   . ASN B 1 89  ? -2.141  -8.379  -50.930 1.00 49.62 ? 89   ASN B O   1 
ATOM   4857 C  CB  . ASN B 1 89  ? -1.890  -7.539  -48.203 1.00 46.41 ? 89   ASN B CB  1 
ATOM   4858 C  CG  . ASN B 1 89  ? -1.822  -6.090  -48.667 1.00 46.12 ? 89   ASN B CG  1 
ATOM   4859 O  OD1 . ASN B 1 89  ? -0.792  -5.618  -49.146 1.00 45.79 ? 89   ASN B OD1 1 
ATOM   4860 N  ND2 . ASN B 1 89  ? -2.924  -5.375  -48.508 1.00 47.07 ? 89   ASN B ND2 1 
ATOM   4861 N  N   . ARG B 1 90  ? 0.094   -8.592  -51.121 1.00 46.95 ? 90   ARG B N   1 
ATOM   4862 C  CA  . ARG B 1 90  ? 0.107   -8.703  -52.575 1.00 48.87 ? 90   ARG B CA  1 
ATOM   4863 C  C   . ARG B 1 90  ? 1.363   -9.512  -52.920 1.00 49.43 ? 90   ARG B C   1 
ATOM   4864 O  O   . ARG B 1 90  ? 2.175   -9.790  -52.041 1.00 47.59 ? 90   ARG B O   1 
ATOM   4865 C  CB  . ARG B 1 90  ? 0.135   -7.327  -53.246 1.00 47.53 ? 90   ARG B CB  1 
ATOM   4866 C  CG  . ARG B 1 90  ? -1.174  -6.566  -53.119 1.00 48.57 ? 90   ARG B CG  1 
ATOM   4867 C  CD  . ARG B 1 90  ? -2.322  -7.254  -53.843 1.00 49.46 ? 90   ARG B CD  1 
ATOM   4868 N  NE  . ARG B 1 90  ? -3.512  -6.407  -53.916 1.00 50.47 ? 90   ARG B NE  1 
ATOM   4869 C  CZ  . ARG B 1 90  ? -4.366  -6.187  -52.907 1.00 50.29 ? 90   ARG B CZ  1 
ATOM   4870 N  NH1 . ARG B 1 90  ? -4.183  -6.763  -51.723 1.00 45.51 ? 90   ARG B NH1 1 
ATOM   4871 N  NH2 . ARG B 1 90  ? -5.399  -5.358  -53.076 1.00 46.15 ? 90   ARG B NH2 1 
ATOM   4872 N  N   . GLU B 1 91  ? 1.490   -9.927  -54.176 1.00 50.53 ? 91   GLU B N   1 
ATOM   4873 C  CA  . GLU B 1 91  ? 2.650   -10.685 -54.617 1.00 51.35 ? 91   GLU B CA  1 
ATOM   4874 C  C   . GLU B 1 91  ? 3.965   -9.933  -54.369 1.00 49.95 ? 91   GLU B C   1 
ATOM   4875 O  O   . GLU B 1 91  ? 4.042   -8.712  -54.541 1.00 50.07 ? 91   GLU B O   1 
ATOM   4876 C  CB  . GLU B 1 91  ? 2.544   -10.967 -56.119 1.00 56.46 ? 91   GLU B CB  1 
ATOM   4877 C  CG  . GLU B 1 91  ? 1.552   -12.033 -56.495 1.00 62.11 ? 91   GLU B CG  1 
ATOM   4878 C  CD  . GLU B 1 91  ? 1.978   -13.366 -55.962 1.00 65.79 ? 91   GLU B CD  1 
ATOM   4879 O  OE1 . GLU B 1 91  ? 3.091   -13.818 -56.333 1.00 68.92 ? 91   GLU B OE1 1 
ATOM   4880 O  OE2 . GLU B 1 91  ? 1.211   -13.949 -55.163 1.00 67.22 ? 91   GLU B OE2 1 
ATOM   4881 N  N   . LEU B 1 92  ? 4.991   -10.679 -53.982 1.00 47.71 ? 92   LEU B N   1 
ATOM   4882 C  CA  . LEU B 1 92  ? 6.313   -10.126 -53.759 1.00 47.27 ? 92   LEU B CA  1 
ATOM   4883 C  C   . LEU B 1 92  ? 7.018   -10.055 -55.102 1.00 47.06 ? 92   LEU B C   1 
ATOM   4884 O  O   . LEU B 1 92  ? 6.901   -10.962 -55.924 1.00 49.65 ? 92   LEU B O   1 
ATOM   4885 C  CB  . LEU B 1 92  ? 7.134   -11.039 -52.852 1.00 46.39 ? 92   LEU B CB  1 
ATOM   4886 C  CG  . LEU B 1 92  ? 6.765   -11.141 -51.387 1.00 46.17 ? 92   LEU B CG  1 
ATOM   4887 C  CD1 . LEU B 1 92  ? 7.824   -11.962 -50.687 1.00 43.49 ? 92   LEU B CD1 1 
ATOM   4888 C  CD2 . LEU B 1 92  ? 6.687   -9.761  -50.792 1.00 45.75 ? 92   LEU B CD2 1 
ATOM   4889 N  N   . SER B 1 93  ? 7.773   -9.001  -55.332 1.00 45.74 ? 93   SER B N   1 
ATOM   4890 C  CA  . SER B 1 93  ? 8.484   -8.901  -56.583 1.00 43.50 ? 93   SER B CA  1 
ATOM   4891 C  C   . SER B 1 93  ? 9.486   -7.779  -56.473 1.00 43.70 ? 93   SER B C   1 
ATOM   4892 O  O   . SER B 1 93  ? 9.268   -6.840  -55.702 1.00 43.41 ? 93   SER B O   1 
ATOM   4893 C  CB  . SER B 1 93  ? 7.482   -8.611  -57.712 1.00 43.13 ? 93   SER B CB  1 
ATOM   4894 O  OG  . SER B 1 93  ? 8.122   -7.984  -58.816 1.00 43.76 ? 93   SER B OG  1 
ATOM   4895 N  N   . GLU B 1 94  ? 10.587  -7.863  -57.220 1.00 43.12 ? 94   GLU B N   1 
ATOM   4896 C  CA  . GLU B 1 94  ? 11.552  -6.766  -57.205 1.00 41.88 ? 94   GLU B CA  1 
ATOM   4897 C  C   . GLU B 1 94  ? 11.027  -5.627  -58.064 1.00 41.50 ? 94   GLU B C   1 
ATOM   4898 O  O   . GLU B 1 94  ? 11.551  -4.504  -58.002 1.00 39.99 ? 94   GLU B O   1 
ATOM   4899 C  CB  . GLU B 1 94  ? 12.903  -7.215  -57.717 1.00 42.37 ? 94   GLU B CB  1 
ATOM   4900 C  CG  . GLU B 1 94  ? 13.671  -8.022  -56.686 1.00 43.86 ? 94   GLU B CG  1 
ATOM   4901 C  CD  . GLU B 1 94  ? 15.091  -8.249  -57.128 1.00 46.60 ? 94   GLU B CD  1 
ATOM   4902 O  OE1 . GLU B 1 94  ? 15.885  -7.284  -57.144 1.00 51.44 ? 94   GLU B OE1 1 
ATOM   4903 O  OE2 . GLU B 1 94  ? 15.408  -9.390  -57.480 1.00 48.72 ? 94   GLU B OE2 1 
ATOM   4904 N  N   . ASP B 1 95  ? 10.012  -5.938  -58.877 1.00 40.14 ? 95   ASP B N   1 
ATOM   4905 C  CA  . ASP B 1 95  ? 9.369   -4.948  -59.727 1.00 42.30 ? 95   ASP B CA  1 
ATOM   4906 C  C   . ASP B 1 95  ? 8.275   -4.430  -58.794 1.00 41.46 ? 95   ASP B C   1 
ATOM   4907 O  O   . ASP B 1 95  ? 7.181   -4.990  -58.733 1.00 38.11 ? 95   ASP B O   1 
ATOM   4908 C  CB  . ASP B 1 95  ? 8.770   -5.618  -60.974 1.00 44.50 ? 95   ASP B CB  1 
ATOM   4909 C  CG  . ASP B 1 95  ? 7.996   -4.649  -61.844 1.00 46.30 ? 95   ASP B CG  1 
ATOM   4910 O  OD1 . ASP B 1 95  ? 7.909   -3.457  -61.471 1.00 46.25 ? 95   ASP B OD1 1 
ATOM   4911 O  OD2 . ASP B 1 95  ? 7.470   -5.083  -62.889 1.00 45.18 ? 95   ASP B OD2 1 
ATOM   4912 N  N   . CYS B 1 96  ? 8.582   -3.349  -58.070 1.00 41.64 ? 96   CYS B N   1 
ATOM   4913 C  CA  . CYS B 1 96  ? 7.658   -2.837  -57.058 1.00 41.76 ? 96   CYS B CA  1 
ATOM   4914 C  C   . CYS B 1 96  ? 7.571   -1.324  -56.871 1.00 41.33 ? 96   CYS B C   1 
ATOM   4915 O  O   . CYS B 1 96  ? 6.878   -0.841  -55.973 1.00 40.40 ? 96   CYS B O   1 
ATOM   4916 C  CB  . CYS B 1 96  ? 8.040   -3.487  -55.713 1.00 43.84 ? 96   CYS B CB  1 
ATOM   4917 S  SG  . CYS B 1 96  ? 9.725   -3.054  -55.132 1.00 45.21 ? 96   CYS B SG  1 
ATOM   4918 N  N   . LEU B 1 97  ? 8.255   -0.570  -57.715 1.00 40.90 ? 97   LEU B N   1 
ATOM   4919 C  CA  . LEU B 1 97  ? 8.260   0.861   -57.565 1.00 39.22 ? 97   LEU B CA  1 
ATOM   4920 C  C   . LEU B 1 97  ? 7.019   1.525   -58.150 1.00 39.91 ? 97   LEU B C   1 
ATOM   4921 O  O   . LEU B 1 97  ? 7.017   2.089   -59.248 1.00 38.01 ? 97   LEU B O   1 
ATOM   4922 C  CB  . LEU B 1 97  ? 9.571   1.436   -58.145 1.00 39.61 ? 97   LEU B CB  1 
ATOM   4923 C  CG  . LEU B 1 97  ? 10.855  0.940   -57.398 1.00 39.81 ? 97   LEU B CG  1 
ATOM   4924 C  CD1 . LEU B 1 97  ? 12.107  1.687   -57.885 1.00 34.50 ? 97   LEU B CD1 1 
ATOM   4925 C  CD2 . LEU B 1 97  ? 10.697  1.126   -55.870 1.00 38.24 ? 97   LEU B CD2 1 
ATOM   4926 N  N   . TYR B 1 98  ? 5.958   1.470   -57.360 1.00 41.52 ? 98   TYR B N   1 
ATOM   4927 C  CA  . TYR B 1 98  ? 4.670   2.042   -57.720 1.00 43.69 ? 98   TYR B CA  1 
ATOM   4928 C  C   . TYR B 1 98  ? 4.145   2.868   -56.536 1.00 44.17 ? 98   TYR B C   1 
ATOM   4929 O  O   . TYR B 1 98  ? 4.465   2.580   -55.368 1.00 45.11 ? 98   TYR B O   1 
ATOM   4930 C  CB  . TYR B 1 98  ? 3.689   0.904   -58.031 1.00 43.27 ? 98   TYR B CB  1 
ATOM   4931 C  CG  . TYR B 1 98  ? 4.140   0.046   -59.188 1.00 46.70 ? 98   TYR B CG  1 
ATOM   4932 C  CD1 . TYR B 1 98  ? 3.812   0.398   -60.505 1.00 47.77 ? 98   TYR B CD1 1 
ATOM   4933 C  CD2 . TYR B 1 98  ? 4.947   -1.084  -58.980 1.00 44.92 ? 98   TYR B CD2 1 
ATOM   4934 C  CE1 . TYR B 1 98  ? 4.276   -0.355  -61.582 1.00 48.64 ? 98   TYR B CE1 1 
ATOM   4935 C  CE2 . TYR B 1 98  ? 5.419   -1.833  -60.045 1.00 46.94 ? 98   TYR B CE2 1 
ATOM   4936 C  CZ  . TYR B 1 98  ? 5.080   -1.461  -61.348 1.00 48.50 ? 98   TYR B CZ  1 
ATOM   4937 O  OH  . TYR B 1 98  ? 5.548   -2.158  -62.430 1.00 46.91 ? 98   TYR B OH  1 
ATOM   4938 N  N   . LEU B 1 99  ? 3.334   3.879   -56.833 1.00 41.96 ? 99   LEU B N   1 
ATOM   4939 C  CA  . LEU B 1 99  ? 2.753   4.689   -55.789 1.00 41.82 ? 99   LEU B CA  1 
ATOM   4940 C  C   . LEU B 1 99  ? 1.233   4.702   -55.911 1.00 42.91 ? 99   LEU B C   1 
ATOM   4941 O  O   . LEU B 1 99  ? 0.674   4.247   -56.907 1.00 42.88 ? 99   LEU B O   1 
ATOM   4942 C  CB  . LEU B 1 99  ? 3.324   6.113   -55.839 1.00 41.40 ? 99   LEU B CB  1 
ATOM   4943 C  CG  . LEU B 1 99  ? 3.265   6.945   -57.120 1.00 40.99 ? 99   LEU B CG  1 
ATOM   4944 C  CD1 . LEU B 1 99  ? 1.840   7.512   -57.337 1.00 37.64 ? 99   LEU B CD1 1 
ATOM   4945 C  CD2 . LEU B 1 99  ? 4.296   8.079   -56.992 1.00 40.27 ? 99   LEU B CD2 1 
ATOM   4946 N  N   . ASN B 1 100 ? 0.570   5.226   -54.886 1.00 42.83 ? 100  ASN B N   1 
ATOM   4947 C  CA  . ASN B 1 100 ? -0.881  5.283   -54.848 1.00 43.11 ? 100  ASN B CA  1 
ATOM   4948 C  C   . ASN B 1 100 ? -1.386  6.690   -54.527 1.00 43.32 ? 100  ASN B C   1 
ATOM   4949 O  O   . ASN B 1 100 ? -0.744  7.452   -53.804 1.00 43.93 ? 100  ASN B O   1 
ATOM   4950 C  CB  . ASN B 1 100 ? -1.378  4.311   -53.795 1.00 40.43 ? 100  ASN B CB  1 
ATOM   4951 C  CG  . ASN B 1 100 ? -0.710  2.972   -53.908 1.00 41.18 ? 100  ASN B CG  1 
ATOM   4952 O  OD1 . ASN B 1 100 ? -0.809  2.328   -54.937 1.00 41.19 ? 100  ASN B OD1 1 
ATOM   4953 N  ND2 . ASN B 1 100 ? -0.012  2.544   -52.851 1.00 40.04 ? 100  ASN B ND2 1 
ATOM   4954 N  N   . VAL B 1 101 ? -2.545  7.029   -55.070 1.00 43.33 ? 101  VAL B N   1 
ATOM   4955 C  CA  . VAL B 1 101 ? -3.133  8.325   -54.830 1.00 42.83 ? 101  VAL B CA  1 
ATOM   4956 C  C   . VAL B 1 101 ? -4.620  8.206   -54.511 1.00 44.94 ? 101  VAL B C   1 
ATOM   4957 O  O   . VAL B 1 101 ? -5.353  7.490   -55.188 1.00 44.98 ? 101  VAL B O   1 
ATOM   4958 C  CB  . VAL B 1 101 ? -2.985  9.247   -56.056 1.00 42.26 ? 101  VAL B CB  1 
ATOM   4959 C  CG1 . VAL B 1 101 ? -3.563  10.627  -55.740 1.00 41.29 ? 101  VAL B CG1 1 
ATOM   4960 C  CG2 . VAL B 1 101 ? -1.502  9.356   -56.476 1.00 39.57 ? 101  VAL B CG2 1 
ATOM   4961 N  N   . TRP B 1 102 ? -5.055  8.896   -53.459 1.00 46.52 ? 102  TRP B N   1 
ATOM   4962 C  CA  . TRP B 1 102 ? -6.465  8.945   -53.091 1.00 46.07 ? 102  TRP B CA  1 
ATOM   4963 C  C   . TRP B 1 102 ? -6.872  10.413  -53.148 1.00 47.99 ? 102  TRP B C   1 
ATOM   4964 O  O   . TRP B 1 102 ? -6.111  11.301  -52.743 1.00 47.53 ? 102  TRP B O   1 
ATOM   4965 C  CB  . TRP B 1 102 ? -6.668  8.424   -51.687 1.00 44.85 ? 102  TRP B CB  1 
ATOM   4966 C  CG  . TRP B 1 102 ? -6.691  6.956   -51.593 1.00 44.38 ? 102  TRP B CG  1 
ATOM   4967 C  CD1 . TRP B 1 102 ? -7.782  6.147   -51.701 1.00 44.37 ? 102  TRP B CD1 1 
ATOM   4968 C  CD2 . TRP B 1 102 ? -5.595  6.110   -51.245 1.00 45.72 ? 102  TRP B CD2 1 
ATOM   4969 N  NE1 . TRP B 1 102 ? -7.446  4.843   -51.420 1.00 44.54 ? 102  TRP B NE1 1 
ATOM   4970 C  CE2 . TRP B 1 102 ? -6.106  4.789   -51.136 1.00 45.38 ? 102  TRP B CE2 1 
ATOM   4971 C  CE3 . TRP B 1 102 ? -4.232  6.337   -51.000 1.00 42.71 ? 102  TRP B CE3 1 
ATOM   4972 C  CZ2 . TRP B 1 102 ? -5.303  3.705   -50.790 1.00 42.84 ? 102  TRP B CZ2 1 
ATOM   4973 C  CZ3 . TRP B 1 102 ? -3.438  5.264   -50.657 1.00 43.18 ? 102  TRP B CZ3 1 
ATOM   4974 C  CH2 . TRP B 1 102 ? -3.974  3.960   -50.553 1.00 44.15 ? 102  TRP B CH2 1 
ATOM   4975 N  N   . THR B 1 103 ? -8.049  10.685  -53.689 1.00 49.48 ? 103  THR B N   1 
ATOM   4976 C  CA  . THR B 1 103 ? -8.515  12.058  -53.743 1.00 53.63 ? 103  THR B CA  1 
ATOM   4977 C  C   . THR B 1 103 ? -10.003 12.031  -53.550 1.00 55.65 ? 103  THR B C   1 
ATOM   4978 O  O   . THR B 1 103 ? -10.633 10.986  -53.714 1.00 54.54 ? 103  THR B O   1 
ATOM   4979 C  CB  . THR B 1 103 ? -8.253  12.737  -55.091 1.00 54.79 ? 103  THR B CB  1 
ATOM   4980 O  OG1 . THR B 1 103 ? -9.041  12.098  -56.104 1.00 58.20 ? 103  THR B OG1 1 
ATOM   4981 C  CG2 . THR B 1 103 ? -6.789  12.650  -55.451 1.00 56.12 ? 103  THR B CG2 1 
ATOM   4982 N  N   . PRO B 1 104 ? -10.586 13.168  -53.140 1.00 58.26 ? 104  PRO B N   1 
ATOM   4983 C  CA  . PRO B 1 104 ? -12.038 13.164  -52.965 1.00 60.01 ? 104  PRO B CA  1 
ATOM   4984 C  C   . PRO B 1 104 ? -12.743 13.031  -54.322 1.00 61.40 ? 104  PRO B C   1 
ATOM   4985 O  O   . PRO B 1 104 ? -12.192 13.370  -55.374 1.00 59.78 ? 104  PRO B O   1 
ATOM   4986 C  CB  . PRO B 1 104 ? -12.313 14.495  -52.262 1.00 60.48 ? 104  PRO B CB  1 
ATOM   4987 C  CG  . PRO B 1 104 ? -11.127 15.340  -52.616 1.00 60.64 ? 104  PRO B CG  1 
ATOM   4988 C  CD  . PRO B 1 104 ? -9.987  14.379  -52.553 1.00 59.12 ? 104  PRO B CD  1 
ATOM   4989 N  N   . TYR B 1 105 ? -13.954 12.493  -54.281 1.00 64.00 ? 105  TYR B N   1 
ATOM   4990 C  CA  . TYR B 1 105 ? -14.760 12.291  -55.470 1.00 65.44 ? 105  TYR B CA  1 
ATOM   4991 C  C   . TYR B 1 105 ? -15.982 13.201  -55.387 1.00 66.37 ? 105  TYR B C   1 
ATOM   4992 O  O   . TYR B 1 105 ? -16.840 13.021  -54.514 1.00 66.10 ? 105  TYR B O   1 
ATOM   4993 C  CB  . TYR B 1 105 ? -15.224 10.842  -55.533 1.00 66.72 ? 105  TYR B CB  1 
ATOM   4994 C  CG  . TYR B 1 105 ? -15.963 10.514  -56.804 1.00 69.99 ? 105  TYR B CG  1 
ATOM   4995 C  CD1 . TYR B 1 105 ? -15.288 10.008  -57.914 1.00 70.70 ? 105  TYR B CD1 1 
ATOM   4996 C  CD2 . TYR B 1 105 ? -17.336 10.709  -56.901 1.00 70.85 ? 105  TYR B CD2 1 
ATOM   4997 C  CE1 . TYR B 1 105 ? -15.963 9.695   -59.086 1.00 72.07 ? 105  TYR B CE1 1 
ATOM   4998 C  CE2 . TYR B 1 105 ? -18.021 10.402  -58.069 1.00 73.09 ? 105  TYR B CE2 1 
ATOM   4999 C  CZ  . TYR B 1 105 ? -17.330 9.893   -59.158 1.00 73.16 ? 105  TYR B CZ  1 
ATOM   5000 O  OH  . TYR B 1 105 ? -18.019 9.565   -60.305 1.00 73.88 ? 105  TYR B OH  1 
ATOM   5001 N  N   . PRO B 1 106 ? -16.104 14.166  -56.310 1.00 66.80 ? 106  PRO B N   1 
ATOM   5002 C  CA  . PRO B 1 106 ? -15.234 14.502  -57.437 1.00 68.15 ? 106  PRO B CA  1 
ATOM   5003 C  C   . PRO B 1 106 ? -13.949 15.212  -57.032 1.00 69.22 ? 106  PRO B C   1 
ATOM   5004 O  O   . PRO B 1 106 ? -13.895 15.873  -55.995 1.00 67.96 ? 106  PRO B O   1 
ATOM   5005 C  CB  . PRO B 1 106 ? -16.118 15.413  -58.274 1.00 68.54 ? 106  PRO B CB  1 
ATOM   5006 C  CG  . PRO B 1 106 ? -16.800 16.227  -57.204 1.00 66.82 ? 106  PRO B CG  1 
ATOM   5007 C  CD  . PRO B 1 106 ? -17.209 15.140  -56.210 1.00 67.61 ? 106  PRO B CD  1 
ATOM   5008 N  N   . ARG B 1 107 ? -12.932 15.092  -57.885 1.00 70.89 ? 107  ARG B N   1 
ATOM   5009 C  CA  . ARG B 1 107 ? -11.634 15.717  -57.661 1.00 72.65 ? 107  ARG B CA  1 
ATOM   5010 C  C   . ARG B 1 107 ? -11.808 17.177  -57.255 1.00 72.59 ? 107  ARG B C   1 
ATOM   5011 O  O   . ARG B 1 107 ? -12.577 17.905  -57.868 1.00 72.20 ? 107  ARG B O   1 
ATOM   5012 C  CB  . ARG B 1 107 ? -10.768 15.621  -58.934 1.00 73.95 ? 107  ARG B CB  1 
ATOM   5013 C  CG  . ARG B 1 107 ? -10.594 14.171  -59.428 1.00 77.90 ? 107  ARG B CG  1 
ATOM   5014 C  CD  . ARG B 1 107 ? -9.227  13.907  -60.044 1.00 78.28 ? 107  ARG B CD  1 
ATOM   5015 N  NE  . ARG B 1 107 ? -8.990  14.588  -61.321 1.00 79.50 ? 107  ARG B NE  1 
ATOM   5016 C  CZ  . ARG B 1 107 ? -9.294  14.091  -62.524 1.00 79.87 ? 107  ARG B CZ  1 
ATOM   5017 N  NH1 . ARG B 1 107 ? -9.866  12.896  -62.634 1.00 79.62 ? 107  ARG B NH1 1 
ATOM   5018 N  NH2 . ARG B 1 107 ? -8.982  14.770  -63.628 1.00 78.59 ? 107  ARG B NH2 1 
ATOM   5019 N  N   . PRO B 1 108 ? -11.080 17.619  -56.219 1.00 72.82 ? 108  PRO B N   1 
ATOM   5020 C  CA  . PRO B 1 108 ? -11.091 18.977  -55.662 1.00 73.10 ? 108  PRO B CA  1 
ATOM   5021 C  C   . PRO B 1 108 ? -11.087 20.097  -56.699 1.00 73.51 ? 108  PRO B C   1 
ATOM   5022 O  O   . PRO B 1 108 ? -10.337 20.045  -57.681 1.00 74.07 ? 108  PRO B O   1 
ATOM   5023 C  CB  . PRO B 1 108 ? -9.820  19.009  -54.823 1.00 73.34 ? 108  PRO B CB  1 
ATOM   5024 C  CG  . PRO B 1 108 ? -9.694  17.615  -54.359 1.00 73.20 ? 108  PRO B CG  1 
ATOM   5025 C  CD  . PRO B 1 108 ? -10.018 16.815  -55.588 1.00 73.15 ? 108  PRO B CD  1 
ATOM   5026 N  N   . ALA B 1 109 ? -11.899 21.124  -56.452 1.00 73.09 ? 109  ALA B N   1 
ATOM   5027 C  CA  . ALA B 1 109 ? -12.002 22.278  -57.350 1.00 72.59 ? 109  ALA B CA  1 
ATOM   5028 C  C   . ALA B 1 109 ? -10.761 23.173  -57.264 1.00 71.53 ? 109  ALA B C   1 
ATOM   5029 O  O   . ALA B 1 109 ? -10.291 23.716  -58.274 1.00 70.64 ? 109  ALA B O   1 
ATOM   5030 C  CB  . ALA B 1 109 ? -13.251 23.090  -57.002 1.00 73.15 ? 109  ALA B CB  1 
ATOM   5031 N  N   . SER B 1 110 ? -10.248 23.333  -56.046 1.00 69.71 ? 110  SER B N   1 
ATOM   5032 C  CA  . SER B 1 110 ? -9.057  24.150  -55.808 1.00 67.74 ? 110  SER B CA  1 
ATOM   5033 C  C   . SER B 1 110 ? -7.949  23.280  -55.212 1.00 65.53 ? 110  SER B C   1 
ATOM   5034 O  O   . SER B 1 110 ? -8.235  22.303  -54.525 1.00 65.80 ? 110  SER B O   1 
ATOM   5035 C  CB  . SER B 1 110 ? -9.401  25.303  -54.854 1.00 67.28 ? 110  SER B CB  1 
ATOM   5036 O  OG  . SER B 1 110 ? -10.223 24.844  -53.795 1.00 66.62 ? 110  SER B OG  1 
ATOM   5037 N  N   . PRO B 1 111 ? -6.672  23.623  -55.475 1.00 63.57 ? 111  PRO B N   1 
ATOM   5038 C  CA  . PRO B 1 111 ? -5.502  22.890  -54.974 1.00 61.37 ? 111  PRO B CA  1 
ATOM   5039 C  C   . PRO B 1 111 ? -5.622  22.503  -53.504 1.00 60.49 ? 111  PRO B C   1 
ATOM   5040 O  O   . PRO B 1 111 ? -5.785  23.358  -52.640 1.00 59.94 ? 111  PRO B O   1 
ATOM   5041 C  CB  . PRO B 1 111 ? -4.364  23.865  -55.225 1.00 62.08 ? 111  PRO B CB  1 
ATOM   5042 C  CG  . PRO B 1 111 ? -4.779  24.501  -56.528 1.00 62.64 ? 111  PRO B CG  1 
ATOM   5043 C  CD  . PRO B 1 111 ? -6.252  24.779  -56.292 1.00 63.15 ? 111  PRO B CD  1 
ATOM   5044 N  N   . THR B 1 112 ? -5.523  21.206  -53.234 1.00 59.51 ? 112  THR B N   1 
ATOM   5045 C  CA  . THR B 1 112 ? -5.643  20.659  -51.892 1.00 59.05 ? 112  THR B CA  1 
ATOM   5046 C  C   . THR B 1 112 ? -4.307  20.224  -51.290 1.00 57.91 ? 112  THR B C   1 
ATOM   5047 O  O   . THR B 1 112 ? -3.493  19.596  -51.961 1.00 59.07 ? 112  THR B O   1 
ATOM   5048 C  CB  . THR B 1 112 ? -6.552  19.458  -51.926 1.00 60.51 ? 112  THR B CB  1 
ATOM   5049 O  OG1 . THR B 1 112 ? -7.780  19.842  -52.550 1.00 65.27 ? 112  THR B OG1 1 
ATOM   5050 C  CG2 . THR B 1 112 ? -6.820  18.936  -50.515 1.00 59.94 ? 112  THR B CG2 1 
ATOM   5051 N  N   . PRO B 1 113 ? -4.061  20.550  -50.015 1.00 56.19 ? 113  PRO B N   1 
ATOM   5052 C  CA  . PRO B 1 113 ? -2.786  20.133  -49.434 1.00 54.60 ? 113  PRO B CA  1 
ATOM   5053 C  C   . PRO B 1 113 ? -2.621  18.630  -49.569 1.00 52.14 ? 113  PRO B C   1 
ATOM   5054 O  O   . PRO B 1 113 ? -3.588  17.887  -49.446 1.00 52.21 ? 113  PRO B O   1 
ATOM   5055 C  CB  . PRO B 1 113 ? -2.883  20.615  -47.983 1.00 56.47 ? 113  PRO B CB  1 
ATOM   5056 C  CG  . PRO B 1 113 ? -4.370  20.726  -47.742 1.00 57.24 ? 113  PRO B CG  1 
ATOM   5057 C  CD  . PRO B 1 113 ? -4.867  21.296  -49.037 1.00 56.88 ? 113  PRO B CD  1 
ATOM   5058 N  N   . VAL B 1 114 ? -1.391  18.205  -49.851 1.00 49.11 ? 114  VAL B N   1 
ATOM   5059 C  CA  . VAL B 1 114 ? -1.050  16.803  -50.050 1.00 45.14 ? 114  VAL B CA  1 
ATOM   5060 C  C   . VAL B 1 114 ? -0.322  16.164  -48.866 1.00 44.40 ? 114  VAL B C   1 
ATOM   5061 O  O   . VAL B 1 114 ? 0.608   16.730  -48.303 1.00 43.70 ? 114  VAL B O   1 
ATOM   5062 C  CB  . VAL B 1 114 ? -0.128  16.642  -51.283 1.00 45.61 ? 114  VAL B CB  1 
ATOM   5063 C  CG1 . VAL B 1 114 ? 0.172   15.184  -51.511 1.00 44.72 ? 114  VAL B CG1 1 
ATOM   5064 C  CG2 . VAL B 1 114 ? -0.752  17.274  -52.506 1.00 41.31 ? 114  VAL B CG2 1 
ATOM   5065 N  N   . LEU B 1 115 ? -0.745  14.965  -48.503 1.00 44.20 ? 115  LEU B N   1 
ATOM   5066 C  CA  . LEU B 1 115 ? -0.111  14.208  -47.428 1.00 43.38 ? 115  LEU B CA  1 
ATOM   5067 C  C   . LEU B 1 115 ? 0.585   12.987  -48.065 1.00 43.50 ? 115  LEU B C   1 
ATOM   5068 O  O   . LEU B 1 115 ? -0.047  12.200  -48.766 1.00 43.08 ? 115  LEU B O   1 
ATOM   5069 C  CB  . LEU B 1 115 ? -1.168  13.725  -46.441 1.00 44.36 ? 115  LEU B CB  1 
ATOM   5070 C  CG  . LEU B 1 115 ? -1.516  14.538  -45.196 1.00 44.46 ? 115  LEU B CG  1 
ATOM   5071 C  CD1 . LEU B 1 115 ? -2.845  14.141  -44.632 1.00 45.72 ? 115  LEU B CD1 1 
ATOM   5072 C  CD2 . LEU B 1 115 ? -0.470  14.251  -44.184 1.00 48.33 ? 115  LEU B CD2 1 
ATOM   5073 N  N   . ILE B 1 116 ? 1.882   12.831  -47.838 1.00 42.21 ? 116  ILE B N   1 
ATOM   5074 C  CA  . ILE B 1 116 ? 2.582   11.690  -48.400 1.00 39.87 ? 116  ILE B CA  1 
ATOM   5075 C  C   . ILE B 1 116 ? 3.028   10.745  -47.301 1.00 39.01 ? 116  ILE B C   1 
ATOM   5076 O  O   . ILE B 1 116 ? 3.855   11.103  -46.454 1.00 40.32 ? 116  ILE B O   1 
ATOM   5077 C  CB  . ILE B 1 116 ? 3.820   12.124  -49.218 1.00 39.82 ? 116  ILE B CB  1 
ATOM   5078 C  CG1 . ILE B 1 116 ? 3.404   13.039  -50.384 1.00 38.83 ? 116  ILE B CG1 1 
ATOM   5079 C  CG2 . ILE B 1 116 ? 4.532   10.884  -49.755 1.00 37.87 ? 116  ILE B CG2 1 
ATOM   5080 C  CD1 . ILE B 1 116 ? 4.574   13.589  -51.203 1.00 37.10 ? 116  ILE B CD1 1 
ATOM   5081 N  N   . TRP B 1 117 ? 2.482   9.535   -47.315 1.00 36.53 ? 117  TRP B N   1 
ATOM   5082 C  CA  . TRP B 1 117 ? 2.812   8.512   -46.323 1.00 36.67 ? 117  TRP B CA  1 
ATOM   5083 C  C   . TRP B 1 117 ? 4.018   7.648   -46.721 1.00 37.80 ? 117  TRP B C   1 
ATOM   5084 O  O   . TRP B 1 117 ? 4.149   7.237   -47.871 1.00 37.75 ? 117  TRP B O   1 
ATOM   5085 C  CB  . TRP B 1 117 ? 1.603   7.602   -46.100 1.00 35.21 ? 117  TRP B CB  1 
ATOM   5086 C  CG  . TRP B 1 117 ? 1.857   6.461   -45.172 1.00 38.30 ? 117  TRP B CG  1 
ATOM   5087 C  CD1 . TRP B 1 117 ? 1.975   5.125   -45.497 1.00 37.82 ? 117  TRP B CD1 1 
ATOM   5088 C  CD2 . TRP B 1 117 ? 2.016   6.544   -43.749 1.00 37.84 ? 117  TRP B CD2 1 
ATOM   5089 N  NE1 . TRP B 1 117 ? 2.197   4.376   -44.355 1.00 37.67 ? 117  TRP B NE1 1 
ATOM   5090 C  CE2 . TRP B 1 117 ? 2.220   5.218   -43.271 1.00 38.51 ? 117  TRP B CE2 1 
ATOM   5091 C  CE3 . TRP B 1 117 ? 2.002   7.611   -42.830 1.00 37.17 ? 117  TRP B CE3 1 
ATOM   5092 C  CZ2 . TRP B 1 117 ? 2.404   4.932   -41.905 1.00 39.99 ? 117  TRP B CZ2 1 
ATOM   5093 C  CZ3 . TRP B 1 117 ? 2.185   7.337   -41.482 1.00 38.15 ? 117  TRP B CZ3 1 
ATOM   5094 C  CH2 . TRP B 1 117 ? 2.385   5.998   -41.025 1.00 41.48 ? 117  TRP B CH2 1 
ATOM   5095 N  N   . ILE B 1 118 ? 4.901   7.393   -45.761 1.00 38.15 ? 118  ILE B N   1 
ATOM   5096 C  CA  . ILE B 1 118 ? 6.069   6.553   -45.981 1.00 38.05 ? 118  ILE B CA  1 
ATOM   5097 C  C   . ILE B 1 118 ? 6.005   5.495   -44.895 1.00 40.25 ? 118  ILE B C   1 
ATOM   5098 O  O   . ILE B 1 118 ? 6.205   5.800   -43.714 1.00 41.64 ? 118  ILE B O   1 
ATOM   5099 C  CB  . ILE B 1 118 ? 7.378   7.323   -45.822 1.00 35.66 ? 118  ILE B CB  1 
ATOM   5100 C  CG1 . ILE B 1 118 ? 7.440   8.442   -46.838 1.00 34.25 ? 118  ILE B CG1 1 
ATOM   5101 C  CG2 . ILE B 1 118 ? 8.569   6.403   -46.055 1.00 32.99 ? 118  ILE B CG2 1 
ATOM   5102 C  CD1 . ILE B 1 118 ? 8.655   9.280   -46.651 1.00 34.85 ? 118  ILE B CD1 1 
ATOM   5103 N  N   . TYR B 1 119 ? 5.727   4.253   -45.279 1.00 40.62 ? 119  TYR B N   1 
ATOM   5104 C  CA  . TYR B 1 119 ? 5.608   3.189   -44.289 1.00 40.37 ? 119  TYR B CA  1 
ATOM   5105 C  C   . TYR B 1 119 ? 6.891   2.796   -43.578 1.00 41.36 ? 119  TYR B C   1 
ATOM   5106 O  O   . TYR B 1 119 ? 8.004   3.098   -44.022 1.00 39.35 ? 119  TYR B O   1 
ATOM   5107 C  CB  . TYR B 1 119 ? 5.007   1.918   -44.907 1.00 40.97 ? 119  TYR B CB  1 
ATOM   5108 C  CG  . TYR B 1 119 ? 5.795   1.333   -46.075 1.00 41.37 ? 119  TYR B CG  1 
ATOM   5109 C  CD1 . TYR B 1 119 ? 7.037   0.699   -45.882 1.00 39.33 ? 119  TYR B CD1 1 
ATOM   5110 C  CD2 . TYR B 1 119 ? 5.295   1.430   -47.377 1.00 39.77 ? 119  TYR B CD2 1 
ATOM   5111 C  CE1 . TYR B 1 119 ? 7.759   0.180   -46.986 1.00 39.91 ? 119  TYR B CE1 1 
ATOM   5112 C  CE2 . TYR B 1 119 ? 5.997   0.923   -48.472 1.00 40.45 ? 119  TYR B CE2 1 
ATOM   5113 C  CZ  . TYR B 1 119 ? 7.220   0.303   -48.282 1.00 39.79 ? 119  TYR B CZ  1 
ATOM   5114 O  OH  . TYR B 1 119 ? 7.884   -0.156  -49.397 1.00 36.56 ? 119  TYR B OH  1 
ATOM   5115 N  N   . GLY B 1 120 ? 6.692   2.081   -42.472 1.00 42.45 ? 120  GLY B N   1 
ATOM   5116 C  CA  . GLY B 1 120 ? 7.783   1.581   -41.659 1.00 43.70 ? 120  GLY B CA  1 
ATOM   5117 C  C   . GLY B 1 120 ? 7.907   0.085   -41.869 1.00 44.79 ? 120  GLY B C   1 
ATOM   5118 O  O   . GLY B 1 120 ? 7.236   -0.486  -42.738 1.00 46.02 ? 120  GLY B O   1 
ATOM   5119 N  N   . GLY B 1 121 ? 8.746   -0.553  -41.059 1.00 45.24 ? 121  GLY B N   1 
ATOM   5120 C  CA  . GLY B 1 121 ? 9.000   -1.979  -41.177 1.00 43.67 ? 121  GLY B CA  1 
ATOM   5121 C  C   . GLY B 1 121 ? 10.500  -2.240  -41.052 1.00 44.81 ? 121  GLY B C   1 
ATOM   5122 O  O   . GLY B 1 121 ? 11.052  -3.120  -41.722 1.00 45.22 ? 121  GLY B O   1 
ATOM   5123 N  N   . GLY B 1 122 ? 11.160  -1.448  -40.198 1.00 44.84 ? 122  GLY B N   1 
ATOM   5124 C  CA  . GLY B 1 122 ? 12.591  -1.571  -39.948 1.00 43.40 ? 122  GLY B CA  1 
ATOM   5125 C  C   . GLY B 1 122 ? 13.493  -1.509  -41.167 1.00 44.06 ? 122  GLY B C   1 
ATOM   5126 O  O   . GLY B 1 122 ? 14.635  -1.973  -41.127 1.00 43.23 ? 122  GLY B O   1 
ATOM   5127 N  N   . PHE B 1 123 ? 12.993  -0.928  -42.252 1.00 43.51 ? 123  PHE B N   1 
ATOM   5128 C  CA  . PHE B 1 123 ? 13.761  -0.825  -43.489 1.00 43.31 ? 123  PHE B CA  1 
ATOM   5129 C  C   . PHE B 1 123 ? 13.960  -2.182  -44.152 1.00 44.78 ? 123  PHE B C   1 
ATOM   5130 O  O   . PHE B 1 123 ? 14.729  -2.277  -45.117 1.00 42.98 ? 123  PHE B O   1 
ATOM   5131 C  CB  . PHE B 1 123 ? 15.145  -0.198  -43.246 1.00 42.23 ? 123  PHE B CB  1 
ATOM   5132 C  CG  . PHE B 1 123 ? 15.109  1.286   -42.986 1.00 42.61 ? 123  PHE B CG  1 
ATOM   5133 C  CD1 . PHE B 1 123 ? 14.653  2.168   -43.967 1.00 41.49 ? 123  PHE B CD1 1 
ATOM   5134 C  CD2 . PHE B 1 123 ? 15.495  1.799   -41.747 1.00 40.67 ? 123  PHE B CD2 1 
ATOM   5135 C  CE1 . PHE B 1 123 ? 14.577  3.535   -43.713 1.00 41.69 ? 123  PHE B CE1 1 
ATOM   5136 C  CE2 . PHE B 1 123 ? 15.429  3.165   -41.477 1.00 40.64 ? 123  PHE B CE2 1 
ATOM   5137 C  CZ  . PHE B 1 123 ? 14.969  4.036   -42.457 1.00 41.47 ? 123  PHE B CZ  1 
ATOM   5138 N  N   . TYR B 1 124 ? 13.297  -3.226  -43.637 1.00 43.13 ? 124  TYR B N   1 
ATOM   5139 C  CA  . TYR B 1 124 ? 13.427  -4.551  -44.234 1.00 43.03 ? 124  TYR B CA  1 
ATOM   5140 C  C   . TYR B 1 124 ? 12.061  -5.093  -44.668 1.00 44.23 ? 124  TYR B C   1 
ATOM   5141 O  O   . TYR B 1 124 ? 11.976  -6.189  -45.229 1.00 45.54 ? 124  TYR B O   1 
ATOM   5142 C  CB  . TYR B 1 124 ? 14.090  -5.545  -43.258 1.00 42.64 ? 124  TYR B CB  1 
ATOM   5143 C  CG  . TYR B 1 124 ? 13.207  -5.971  -42.107 1.00 42.02 ? 124  TYR B CG  1 
ATOM   5144 C  CD1 . TYR B 1 124 ? 12.233  -6.961  -42.269 1.00 41.21 ? 124  TYR B CD1 1 
ATOM   5145 C  CD2 . TYR B 1 124 ? 13.276  -5.311  -40.880 1.00 41.10 ? 124  TYR B CD2 1 
ATOM   5146 C  CE1 . TYR B 1 124 ? 11.331  -7.277  -41.242 1.00 41.25 ? 124  TYR B CE1 1 
ATOM   5147 C  CE2 . TYR B 1 124 ? 12.380  -5.611  -39.840 1.00 42.74 ? 124  TYR B CE2 1 
ATOM   5148 C  CZ  . TYR B 1 124 ? 11.409  -6.591  -40.023 1.00 43.96 ? 124  TYR B CZ  1 
ATOM   5149 O  OH  . TYR B 1 124 ? 10.519  -6.859  -38.999 1.00 42.89 ? 124  TYR B OH  1 
ATOM   5150 N  N   . SER B 1 125 ? 10.994  -4.331  -44.425 1.00 42.58 ? 125  SER B N   1 
ATOM   5151 C  CA  . SER B 1 125 ? 9.658   -4.790  -44.788 1.00 39.28 ? 125  SER B CA  1 
ATOM   5152 C  C   . SER B 1 125 ? 8.689   -3.640  -44.892 1.00 39.58 ? 125  SER B C   1 
ATOM   5153 O  O   . SER B 1 125 ? 9.058   -2.491  -44.649 1.00 38.81 ? 125  SER B O   1 
ATOM   5154 C  CB  . SER B 1 125 ? 9.153   -5.779  -43.747 1.00 38.44 ? 125  SER B CB  1 
ATOM   5155 O  OG  . SER B 1 125 ? 9.125   -5.181  -42.462 1.00 37.64 ? 125  SER B OG  1 
ATOM   5156 N  N   . GLY B 1 126 ? 7.446   -3.961  -45.252 1.00 39.28 ? 126  GLY B N   1 
ATOM   5157 C  CA  . GLY B 1 126 ? 6.405   -2.956  -45.378 1.00 37.49 ? 126  GLY B CA  1 
ATOM   5158 C  C   . GLY B 1 126 ? 5.891   -2.818  -46.792 1.00 38.33 ? 126  GLY B C   1 
ATOM   5159 O  O   . GLY B 1 126 ? 6.498   -3.320  -47.731 1.00 37.70 ? 126  GLY B O   1 
ATOM   5160 N  N   . ALA B 1 127 ? 4.780   -2.111  -46.944 1.00 37.50 ? 127  ALA B N   1 
ATOM   5161 C  CA  . ALA B 1 127 ? 4.172   -1.920  -48.244 1.00 37.31 ? 127  ALA B CA  1 
ATOM   5162 C  C   . ALA B 1 127 ? 3.071   -0.872  -48.100 1.00 37.50 ? 127  ALA B C   1 
ATOM   5163 O  O   . ALA B 1 127 ? 2.431   -0.789  -47.062 1.00 36.77 ? 127  ALA B O   1 
ATOM   5164 C  CB  . ALA B 1 127 ? 3.582   -3.252  -48.738 1.00 37.01 ? 127  ALA B CB  1 
ATOM   5165 N  N   . ALA B 1 128 ? 2.854   -0.091  -49.149 1.00 37.40 ? 128  ALA B N   1 
ATOM   5166 C  CA  . ALA B 1 128 ? 1.845   0.953   -49.125 1.00 39.64 ? 128  ALA B CA  1 
ATOM   5167 C  C   . ALA B 1 128 ? 0.431   0.410   -49.309 1.00 41.70 ? 128  ALA B C   1 
ATOM   5168 O  O   . ALA B 1 128 ? -0.542  1.164   -49.240 1.00 42.08 ? 128  ALA B O   1 
ATOM   5169 C  CB  . ALA B 1 128 ? 2.138   1.983   -50.197 1.00 35.29 ? 128  ALA B CB  1 
ATOM   5170 N  N   . SER B 1 129 ? 0.316   -0.902  -49.498 1.00 42.70 ? 129  SER B N   1 
ATOM   5171 C  CA  . SER B 1 129 ? -0.984  -1.509  -49.747 1.00 42.58 ? 129  SER B CA  1 
ATOM   5172 C  C   . SER B 1 129 ? -1.650  -2.119  -48.529 1.00 42.66 ? 129  SER B C   1 
ATOM   5173 O  O   . SER B 1 129 ? -2.751  -2.652  -48.640 1.00 40.37 ? 129  SER B O   1 
ATOM   5174 C  CB  . SER B 1 129 ? -0.836  -2.568  -50.842 1.00 43.95 ? 129  SER B CB  1 
ATOM   5175 O  OG  . SER B 1 129 ? 0.131   -3.529  -50.457 1.00 41.49 ? 129  SER B OG  1 
ATOM   5176 N  N   . LEU B 1 130 ? -0.992  -2.043  -47.373 1.00 44.22 ? 130  LEU B N   1 
ATOM   5177 C  CA  . LEU B 1 130 ? -1.561  -2.605  -46.139 1.00 47.10 ? 130  LEU B CA  1 
ATOM   5178 C  C   . LEU B 1 130 ? -2.891  -1.916  -45.780 1.00 47.99 ? 130  LEU B C   1 
ATOM   5179 O  O   . LEU B 1 130 ? -3.116  -0.750  -46.136 1.00 48.21 ? 130  LEU B O   1 
ATOM   5180 C  CB  . LEU B 1 130 ? -0.552  -2.489  -44.975 1.00 47.39 ? 130  LEU B CB  1 
ATOM   5181 C  CG  . LEU B 1 130 ? 0.839   -3.166  -45.140 1.00 48.53 ? 130  LEU B CG  1 
ATOM   5182 C  CD1 . LEU B 1 130 ? 1.630   -3.072  -43.817 1.00 45.45 ? 130  LEU B CD1 1 
ATOM   5183 C  CD2 . LEU B 1 130 ? 0.683   -4.639  -45.551 1.00 44.84 ? 130  LEU B CD2 1 
ATOM   5184 N  N   . ASP B 1 131 ? -3.785  -2.631  -45.100 1.00 48.09 ? 131  ASP B N   1 
ATOM   5185 C  CA  . ASP B 1 131 ? -5.085  -2.047  -44.760 1.00 49.51 ? 131  ASP B CA  1 
ATOM   5186 C  C   . ASP B 1 131 ? -4.998  -0.835  -43.829 1.00 49.66 ? 131  ASP B C   1 
ATOM   5187 O  O   . ASP B 1 131 ? -5.817  0.086   -43.944 1.00 49.34 ? 131  ASP B O   1 
ATOM   5188 C  CB  . ASP B 1 131 ? -6.015  -3.070  -44.107 1.00 51.72 ? 131  ASP B CB  1 
ATOM   5189 C  CG  . ASP B 1 131 ? -6.328  -4.248  -45.005 1.00 55.34 ? 131  ASP B CG  1 
ATOM   5190 O  OD1 . ASP B 1 131 ? -6.303  -4.091  -46.255 1.00 53.77 ? 131  ASP B OD1 1 
ATOM   5191 O  OD2 . ASP B 1 131 ? -6.615  -5.335  -44.438 1.00 56.27 ? 131  ASP B OD2 1 
ATOM   5192 N  N   . VAL B 1 132 ? -4.034  -0.825  -42.909 1.00 46.85 ? 132  VAL B N   1 
ATOM   5193 C  CA  . VAL B 1 132 ? -3.926  0.322   -42.014 1.00 46.55 ? 132  VAL B CA  1 
ATOM   5194 C  C   . VAL B 1 132 ? -3.451  1.601   -42.690 1.00 45.45 ? 132  VAL B C   1 
ATOM   5195 O  O   . VAL B 1 132 ? -3.469  2.662   -42.071 1.00 44.97 ? 132  VAL B O   1 
ATOM   5196 C  CB  . VAL B 1 132 ? -3.001  0.061   -40.836 1.00 46.56 ? 132  VAL B CB  1 
ATOM   5197 C  CG1 . VAL B 1 132 ? -3.656  -0.904  -39.891 1.00 46.98 ? 132  VAL B CG1 1 
ATOM   5198 C  CG2 . VAL B 1 132 ? -1.670  -0.467  -41.328 1.00 46.60 ? 132  VAL B CG2 1 
ATOM   5199 N  N   . TYR B 1 133 ? -3.032  1.520   -43.950 1.00 43.84 ? 133  TYR B N   1 
ATOM   5200 C  CA  . TYR B 1 133 ? -2.583  2.726   -44.643 1.00 43.06 ? 133  TYR B CA  1 
ATOM   5201 C  C   . TYR B 1 133 ? -3.600  3.145   -45.673 1.00 42.54 ? 133  TYR B C   1 
ATOM   5202 O  O   . TYR B 1 133 ? -3.302  3.947   -46.542 1.00 43.19 ? 133  TYR B O   1 
ATOM   5203 C  CB  . TYR B 1 133 ? -1.245  2.509   -45.361 1.00 42.50 ? 133  TYR B CB  1 
ATOM   5204 C  CG  . TYR B 1 133 ? -0.139  1.949   -44.510 1.00 39.90 ? 133  TYR B CG  1 
ATOM   5205 C  CD1 . TYR B 1 133 ? 0.016   2.347   -43.184 1.00 38.98 ? 133  TYR B CD1 1 
ATOM   5206 C  CD2 . TYR B 1 133 ? 0.735   0.986   -45.023 1.00 38.59 ? 133  TYR B CD2 1 
ATOM   5207 C  CE1 . TYR B 1 133 ? 1.015   1.780   -42.377 1.00 40.62 ? 133  TYR B CE1 1 
ATOM   5208 C  CE2 . TYR B 1 133 ? 1.745   0.411   -44.228 1.00 39.88 ? 133  TYR B CE2 1 
ATOM   5209 C  CZ  . TYR B 1 133 ? 1.872   0.810   -42.901 1.00 40.36 ? 133  TYR B CZ  1 
ATOM   5210 O  OH  . TYR B 1 133 ? 2.801   0.211   -42.083 1.00 40.02 ? 133  TYR B OH  1 
ATOM   5211 N  N   . ASP B 1 134 ? -4.798  2.585   -45.592 1.00 43.82 ? 134  ASP B N   1 
ATOM   5212 C  CA  . ASP B 1 134 ? -5.856  2.903   -46.544 1.00 43.40 ? 134  ASP B CA  1 
ATOM   5213 C  C   . ASP B 1 134 ? -6.136  4.396   -46.454 1.00 44.36 ? 134  ASP B C   1 
ATOM   5214 O  O   . ASP B 1 134 ? -6.530  4.879   -45.394 1.00 44.06 ? 134  ASP B O   1 
ATOM   5215 C  CB  . ASP B 1 134 ? -7.095  2.109   -46.160 1.00 44.59 ? 134  ASP B CB  1 
ATOM   5216 C  CG  . ASP B 1 134 ? -8.227  2.245   -47.159 1.00 47.19 ? 134  ASP B CG  1 
ATOM   5217 O  OD1 . ASP B 1 134 ? -8.247  3.164   -48.003 1.00 47.66 ? 134  ASP B OD1 1 
ATOM   5218 O  OD2 . ASP B 1 134 ? -9.136  1.406   -47.078 1.00 51.75 ? 134  ASP B OD2 1 
ATOM   5219 N  N   . GLY B 1 135 ? -5.948  5.125   -47.550 1.00 45.04 ? 135  GLY B N   1 
ATOM   5220 C  CA  . GLY B 1 135 ? -6.185  6.560   -47.525 1.00 45.31 ? 135  GLY B CA  1 
ATOM   5221 C  C   . GLY B 1 135 ? -7.576  7.066   -47.879 1.00 46.55 ? 135  GLY B C   1 
ATOM   5222 O  O   . GLY B 1 135 ? -7.768  8.280   -48.012 1.00 44.62 ? 135  GLY B O   1 
ATOM   5223 N  N   . ARG B 1 136 ? -8.562  6.179   -48.021 1.00 47.97 ? 136  ARG B N   1 
ATOM   5224 C  CA  . ARG B 1 136 ? -9.900  6.652   -48.412 1.00 50.33 ? 136  ARG B CA  1 
ATOM   5225 C  C   . ARG B 1 136 ? -10.557 7.564   -47.363 1.00 48.95 ? 136  ARG B C   1 
ATOM   5226 O  O   . ARG B 1 136 ? -11.192 8.577   -47.713 1.00 47.48 ? 136  ARG B O   1 
ATOM   5227 C  CB  . ARG B 1 136 ? -10.841 5.474   -48.735 1.00 52.28 ? 136  ARG B CB  1 
ATOM   5228 C  CG  . ARG B 1 136 ? -11.361 4.735   -47.520 1.00 57.07 ? 136  ARG B CG  1 
ATOM   5229 C  CD  . ARG B 1 136 ? -11.245 3.232   -47.711 1.00 61.26 ? 136  ARG B CD  1 
ATOM   5230 N  NE  . ARG B 1 136 ? -12.145 2.744   -48.739 1.00 63.96 ? 136  ARG B NE  1 
ATOM   5231 C  CZ  . ARG B 1 136 ? -11.938 1.658   -49.484 1.00 66.22 ? 136  ARG B CZ  1 
ATOM   5232 N  NH1 . ARG B 1 136 ? -10.842 0.920   -49.335 1.00 67.27 ? 136  ARG B NH1 1 
ATOM   5233 N  NH2 . ARG B 1 136 ? -12.842 1.305   -50.386 1.00 67.16 ? 136  ARG B NH2 1 
ATOM   5234 N  N   . PHE B 1 137 ? -10.398 7.202   -46.091 1.00 47.62 ? 137  PHE B N   1 
ATOM   5235 C  CA  . PHE B 1 137 ? -10.981 7.979   -44.994 1.00 49.13 ? 137  PHE B CA  1 
ATOM   5236 C  C   . PHE B 1 137 ? -10.513 9.436   -44.947 1.00 48.82 ? 137  PHE B C   1 
ATOM   5237 O  O   . PHE B 1 137 ? -11.342 10.346  -44.909 1.00 48.88 ? 137  PHE B O   1 
ATOM   5238 C  CB  . PHE B 1 137 ? -10.694 7.295   -43.668 1.00 48.39 ? 137  PHE B CB  1 
ATOM   5239 C  CG  . PHE B 1 137 ? -11.075 5.854   -43.655 1.00 50.34 ? 137  PHE B CG  1 
ATOM   5240 C  CD1 . PHE B 1 137 ? -12.413 5.476   -43.665 1.00 52.20 ? 137  PHE B CD1 1 
ATOM   5241 C  CD2 . PHE B 1 137 ? -10.097 4.865   -43.651 1.00 50.52 ? 137  PHE B CD2 1 
ATOM   5242 C  CE1 . PHE B 1 137 ? -12.775 4.125   -43.671 1.00 52.56 ? 137  PHE B CE1 1 
ATOM   5243 C  CE2 . PHE B 1 137 ? -10.439 3.513   -43.656 1.00 51.40 ? 137  PHE B CE2 1 
ATOM   5244 C  CZ  . PHE B 1 137 ? -11.783 3.141   -43.666 1.00 53.08 ? 137  PHE B CZ  1 
ATOM   5245 N  N   . LEU B 1 138 ? -9.199  9.657   -44.951 1.00 48.63 ? 138  LEU B N   1 
ATOM   5246 C  CA  . LEU B 1 138 ? -8.661  11.015  -44.928 1.00 48.20 ? 138  LEU B CA  1 
ATOM   5247 C  C   . LEU B 1 138 ? -9.094  11.785  -46.176 1.00 49.75 ? 138  LEU B C   1 
ATOM   5248 O  O   . LEU B 1 138 ? -9.361  13.005  -46.124 1.00 49.60 ? 138  LEU B O   1 
ATOM   5249 C  CB  . LEU B 1 138 ? -7.128  10.989  -44.823 1.00 46.77 ? 138  LEU B CB  1 
ATOM   5250 C  CG  . LEU B 1 138 ? -6.554  10.619  -43.449 1.00 44.75 ? 138  LEU B CG  1 
ATOM   5251 C  CD1 . LEU B 1 138 ? -5.125  10.129  -43.581 1.00 44.28 ? 138  LEU B CD1 1 
ATOM   5252 C  CD2 . LEU B 1 138 ? -6.627  11.836  -42.536 1.00 44.51 ? 138  LEU B CD2 1 
ATOM   5253 N  N   . ALA B 1 139 ? -9.183  11.076  -47.299 1.00 49.42 ? 139  ALA B N   1 
ATOM   5254 C  CA  . ALA B 1 139 ? -9.589  11.704  -48.556 1.00 50.68 ? 139  ALA B CA  1 
ATOM   5255 C  C   . ALA B 1 139 ? -11.052 12.147  -48.517 1.00 52.14 ? 139  ALA B C   1 
ATOM   5256 O  O   . ALA B 1 139 ? -11.388 13.265  -48.905 1.00 51.92 ? 139  ALA B O   1 
ATOM   5257 C  CB  . ALA B 1 139 ? -9.389  10.734  -49.712 1.00 49.94 ? 139  ALA B CB  1 
ATOM   5258 N  N   . GLN B 1 140 ? -11.916 11.260  -48.040 1.00 53.31 ? 140  GLN B N   1 
ATOM   5259 C  CA  . GLN B 1 140 ? -13.342 11.555  -47.999 1.00 55.02 ? 140  GLN B CA  1 
ATOM   5260 C  C   . GLN B 1 140 ? -13.739 12.554  -46.909 1.00 55.00 ? 140  GLN B C   1 
ATOM   5261 O  O   . GLN B 1 140 ? -14.397 13.568  -47.170 1.00 53.90 ? 140  GLN B O   1 
ATOM   5262 C  CB  . GLN B 1 140 ? -14.127 10.248  -47.816 1.00 56.64 ? 140  GLN B CB  1 
ATOM   5263 C  CG  . GLN B 1 140 ? -15.576 10.291  -48.294 1.00 57.38 ? 140  GLN B CG  1 
ATOM   5264 C  CD  . GLN B 1 140 ? -16.487 11.016  -47.327 1.00 58.32 ? 140  GLN B CD  1 
ATOM   5265 O  OE1 . GLN B 1 140 ? -16.557 10.672  -46.142 1.00 57.92 ? 140  GLN B OE1 1 
ATOM   5266 N  NE2 . GLN B 1 140 ? -17.192 12.022  -47.826 1.00 58.60 ? 140  GLN B NE2 1 
ATOM   5267 N  N   . VAL B 1 141 ? -13.332 12.263  -45.686 1.00 54.13 ? 141  VAL B N   1 
ATOM   5268 C  CA  . VAL B 1 141 ? -13.685 13.110  -44.569 1.00 53.21 ? 141  VAL B CA  1 
ATOM   5269 C  C   . VAL B 1 141 ? -13.007 14.472  -44.505 1.00 54.51 ? 141  VAL B C   1 
ATOM   5270 O  O   . VAL B 1 141 ? -13.663 15.448  -44.157 1.00 55.27 ? 141  VAL B O   1 
ATOM   5271 C  CB  . VAL B 1 141 ? -13.451 12.373  -43.274 1.00 52.66 ? 141  VAL B CB  1 
ATOM   5272 C  CG1 . VAL B 1 141 ? -13.853 13.242  -42.111 1.00 54.25 ? 141  VAL B CG1 1 
ATOM   5273 C  CG2 . VAL B 1 141 ? -14.246 11.074  -43.290 1.00 51.89 ? 141  VAL B CG2 1 
ATOM   5274 N  N   . GLU B 1 142 ? -11.719 14.554  -44.846 1.00 54.00 ? 142  GLU B N   1 
ATOM   5275 C  CA  . GLU B 1 142 ? -10.998 15.826  -44.788 1.00 52.65 ? 142  GLU B CA  1 
ATOM   5276 C  C   . GLU B 1 142 ? -10.706 16.440  -46.148 1.00 52.89 ? 142  GLU B C   1 
ATOM   5277 O  O   . GLU B 1 142 ? -10.111 17.527  -46.242 1.00 52.13 ? 142  GLU B O   1 
ATOM   5278 C  CB  . GLU B 1 142 ? -9.683  15.654  -44.046 1.00 54.75 ? 142  GLU B CB  1 
ATOM   5279 C  CG  . GLU B 1 142 ? -9.820  15.241  -42.597 1.00 58.36 ? 142  GLU B CG  1 
ATOM   5280 C  CD  . GLU B 1 142 ? -10.571 16.276  -41.778 1.00 60.94 ? 142  GLU B CD  1 
ATOM   5281 O  OE1 . GLU B 1 142 ? -10.467 17.491  -42.097 1.00 61.13 ? 142  GLU B OE1 1 
ATOM   5282 O  OE2 . GLU B 1 142 ? -11.251 15.869  -40.810 1.00 61.77 ? 142  GLU B OE2 1 
ATOM   5283 N  N   . GLY B 1 143 ? -11.103 15.746  -47.208 1.00 51.94 ? 143  GLY B N   1 
ATOM   5284 C  CA  . GLY B 1 143 ? -10.868 16.267  -48.540 1.00 50.78 ? 143  GLY B CA  1 
ATOM   5285 C  C   . GLY B 1 143 ? -9.393  16.315  -48.887 1.00 51.26 ? 143  GLY B C   1 
ATOM   5286 O  O   . GLY B 1 143 ? -8.948  17.134  -49.694 1.00 51.12 ? 143  GLY B O   1 
ATOM   5287 N  N   . ALA B 1 144 ? -8.618  15.423  -48.281 1.00 51.62 ? 144  ALA B N   1 
ATOM   5288 C  CA  . ALA B 1 144 ? -7.185  15.388  -48.547 1.00 50.86 ? 144  ALA B CA  1 
ATOM   5289 C  C   . ALA B 1 144 ? -6.774  14.530  -49.755 1.00 50.37 ? 144  ALA B C   1 
ATOM   5290 O  O   . ALA B 1 144 ? -7.446  13.565  -50.123 1.00 49.14 ? 144  ALA B O   1 
ATOM   5291 C  CB  . ALA B 1 144 ? -6.456  14.893  -47.316 1.00 50.34 ? 144  ALA B CB  1 
ATOM   5292 N  N   . VAL B 1 145 ? -5.673  14.928  -50.385 1.00 49.82 ? 145  VAL B N   1 
ATOM   5293 C  CA  . VAL B 1 145 ? -5.093  14.163  -51.471 1.00 47.66 ? 145  VAL B CA  1 
ATOM   5294 C  C   . VAL B 1 145 ? -3.966  13.397  -50.754 1.00 47.80 ? 145  VAL B C   1 
ATOM   5295 O  O   . VAL B 1 145 ? -2.985  13.986  -50.290 1.00 48.17 ? 145  VAL B O   1 
ATOM   5296 C  CB  . VAL B 1 145 ? -4.474  15.043  -52.559 1.00 46.75 ? 145  VAL B CB  1 
ATOM   5297 C  CG1 . VAL B 1 145 ? -3.598  14.174  -53.468 1.00 46.12 ? 145  VAL B CG1 1 
ATOM   5298 C  CG2 . VAL B 1 145 ? -5.568  15.698  -53.393 1.00 44.43 ? 145  VAL B CG2 1 
ATOM   5299 N  N   . LEU B 1 146 ? -4.133  12.089  -50.632 1.00 47.38 ? 146  LEU B N   1 
ATOM   5300 C  CA  . LEU B 1 146 ? -3.150  11.258  -49.966 1.00 47.84 ? 146  LEU B CA  1 
ATOM   5301 C  C   . LEU B 1 146 ? -2.335  10.405  -50.953 1.00 47.83 ? 146  LEU B C   1 
ATOM   5302 O  O   . LEU B 1 146 ? -2.882  9.798   -51.878 1.00 50.70 ? 146  LEU B O   1 
ATOM   5303 C  CB  . LEU B 1 146 ? -3.865  10.372  -48.961 1.00 46.81 ? 146  LEU B CB  1 
ATOM   5304 C  CG  . LEU B 1 146 ? -2.932  9.785   -47.911 1.00 49.66 ? 146  LEU B CG  1 
ATOM   5305 C  CD1 . LEU B 1 146 ? -3.532  10.012  -46.554 1.00 49.03 ? 146  LEU B CD1 1 
ATOM   5306 C  CD2 . LEU B 1 146 ? -2.679  8.286   -48.182 1.00 47.81 ? 146  LEU B CD2 1 
ATOM   5307 N  N   . VAL B 1 147 ? -1.019  10.375  -50.767 1.00 46.70 ? 147  VAL B N   1 
ATOM   5308 C  CA  . VAL B 1 147 ? -0.142  9.600   -51.632 1.00 43.83 ? 147  VAL B CA  1 
ATOM   5309 C  C   . VAL B 1 147 ? 0.693   8.660   -50.780 1.00 43.97 ? 147  VAL B C   1 
ATOM   5310 O  O   . VAL B 1 147 ? 1.075   9.013   -49.664 1.00 43.24 ? 147  VAL B O   1 
ATOM   5311 C  CB  . VAL B 1 147 ? 0.831   10.501  -52.413 1.00 43.81 ? 147  VAL B CB  1 
ATOM   5312 C  CG1 . VAL B 1 147 ? 1.597   9.664   -53.428 1.00 43.30 ? 147  VAL B CG1 1 
ATOM   5313 C  CG2 . VAL B 1 147 ? 0.090   11.615  -53.109 1.00 41.54 ? 147  VAL B CG2 1 
ATOM   5314 N  N   . SER B 1 148 ? 0.938   7.448   -51.278 1.00 43.30 ? 148  SER B N   1 
ATOM   5315 C  CA  . SER B 1 148 ? 1.799   6.483   -50.565 1.00 43.30 ? 148  SER B CA  1 
ATOM   5316 C  C   . SER B 1 148 ? 2.597   5.725   -51.628 1.00 42.53 ? 148  SER B C   1 
ATOM   5317 O  O   . SER B 1 148 ? 2.050   5.368   -52.666 1.00 42.55 ? 148  SER B O   1 
ATOM   5318 C  CB  . SER B 1 148 ? 0.994   5.497   -49.705 1.00 42.87 ? 148  SER B CB  1 
ATOM   5319 O  OG  . SER B 1 148 ? 0.064   4.771   -50.481 1.00 44.92 ? 148  SER B OG  1 
ATOM   5320 N  N   . MET B 1 149 ? 3.896   5.523   -51.395 1.00 41.68 ? 149  MET B N   1 
ATOM   5321 C  CA  . MET B 1 149 ? 4.720   4.819   -52.371 1.00 39.32 ? 149  MET B CA  1 
ATOM   5322 C  C   . MET B 1 149 ? 5.391   3.595   -51.791 1.00 39.92 ? 149  MET B C   1 
ATOM   5323 O  O   . MET B 1 149 ? 5.585   3.478   -50.581 1.00 39.56 ? 149  MET B O   1 
ATOM   5324 C  CB  . MET B 1 149 ? 5.821   5.732   -52.927 1.00 39.15 ? 149  MET B CB  1 
ATOM   5325 C  CG  . MET B 1 149 ? 7.093   5.798   -52.068 1.00 38.71 ? 149  MET B CG  1 
ATOM   5326 S  SD  . MET B 1 149 ? 6.865   6.503   -50.375 1.00 41.53 ? 149  MET B SD  1 
ATOM   5327 C  CE  . MET B 1 149 ? 6.927   8.274   -50.813 1.00 37.65 ? 149  MET B CE  1 
ATOM   5328 N  N   . ASN B 1 150 ? 5.729   2.669   -52.671 1.00 38.84 ? 150  ASN B N   1 
ATOM   5329 C  CA  . ASN B 1 150 ? 6.454   1.492   -52.262 1.00 37.83 ? 150  ASN B CA  1 
ATOM   5330 C  C   . ASN B 1 150 ? 7.906   1.902   -52.458 1.00 37.46 ? 150  ASN B C   1 
ATOM   5331 O  O   . ASN B 1 150 ? 8.202   2.677   -53.367 1.00 35.43 ? 150  ASN B O   1 
ATOM   5332 C  CB  . ASN B 1 150 ? 6.154   0.317   -53.192 1.00 38.92 ? 150  ASN B CB  1 
ATOM   5333 C  CG  . ASN B 1 150 ? 4.953   -0.489  -52.743 1.00 43.77 ? 150  ASN B CG  1 
ATOM   5334 O  OD1 . ASN B 1 150 ? 4.286   -0.148  -51.753 1.00 45.58 ? 150  ASN B OD1 1 
ATOM   5335 N  ND2 . ASN B 1 150 ? 4.669   -1.574  -53.462 1.00 43.63 ? 150  ASN B ND2 1 
ATOM   5336 N  N   . TYR B 1 151 ? 8.807   1.420   -51.602 1.00 36.43 ? 151  TYR B N   1 
ATOM   5337 C  CA  . TYR B 1 151 ? 10.213  1.714   -51.802 1.00 35.43 ? 151  TYR B CA  1 
ATOM   5338 C  C   . TYR B 1 151 ? 10.955  0.439   -51.438 1.00 35.21 ? 151  TYR B C   1 
ATOM   5339 O  O   . TYR B 1 151 ? 10.479  -0.346  -50.620 1.00 35.28 ? 151  TYR B O   1 
ATOM   5340 C  CB  . TYR B 1 151 ? 10.665  2.918   -50.958 1.00 37.75 ? 151  TYR B CB  1 
ATOM   5341 C  CG  . TYR B 1 151 ? 10.582  2.724   -49.480 1.00 34.43 ? 151  TYR B CG  1 
ATOM   5342 C  CD1 . TYR B 1 151 ? 9.438   3.108   -48.773 1.00 36.71 ? 151  TYR B CD1 1 
ATOM   5343 C  CD2 . TYR B 1 151 ? 11.630  2.136   -48.785 1.00 32.77 ? 151  TYR B CD2 1 
ATOM   5344 C  CE1 . TYR B 1 151 ? 9.344   2.907   -47.392 1.00 36.17 ? 151  TYR B CE1 1 
ATOM   5345 C  CE2 . TYR B 1 151 ? 11.543  1.921   -47.405 1.00 35.70 ? 151  TYR B CE2 1 
ATOM   5346 C  CZ  . TYR B 1 151 ? 10.400  2.301   -46.719 1.00 36.67 ? 151  TYR B CZ  1 
ATOM   5347 O  OH  . TYR B 1 151 ? 10.278  1.988   -45.385 1.00 37.49 ? 151  TYR B OH  1 
ATOM   5348 N  N   . ARG B 1 152 ? 12.104  0.217   -52.060 1.00 34.46 ? 152  ARG B N   1 
ATOM   5349 C  CA  . ARG B 1 152 ? 12.855  -0.998  -51.792 1.00 36.64 ? 152  ARG B CA  1 
ATOM   5350 C  C   . ARG B 1 152 ? 13.339  -1.131  -50.358 1.00 36.47 ? 152  ARG B C   1 
ATOM   5351 O  O   . ARG B 1 152 ? 13.799  -0.165  -49.743 1.00 37.54 ? 152  ARG B O   1 
ATOM   5352 C  CB  . ARG B 1 152 ? 14.031  -1.112  -52.777 1.00 36.54 ? 152  ARG B CB  1 
ATOM   5353 C  CG  . ARG B 1 152 ? 13.600  -1.516  -54.201 1.00 37.23 ? 152  ARG B CG  1 
ATOM   5354 C  CD  . ARG B 1 152 ? 14.750  -1.421  -55.172 1.00 36.17 ? 152  ARG B CD  1 
ATOM   5355 N  NE  . ARG B 1 152 ? 14.991  -0.029  -55.523 1.00 37.26 ? 152  ARG B NE  1 
ATOM   5356 C  CZ  . ARG B 1 152 ? 16.072  0.404   -56.161 1.00 38.03 ? 152  ARG B CZ  1 
ATOM   5357 N  NH1 . ARG B 1 152 ? 17.022  -0.458  -56.518 1.00 36.31 ? 152  ARG B NH1 1 
ATOM   5358 N  NH2 . ARG B 1 152 ? 16.209  1.701   -56.431 1.00 34.64 ? 152  ARG B NH2 1 
ATOM   5359 N  N   . VAL B 1 153 ? 13.220  -2.333  -49.822 1.00 36.31 ? 153  VAL B N   1 
ATOM   5360 C  CA  . VAL B 1 153 ? 13.669  -2.608  -48.473 1.00 37.89 ? 153  VAL B CA  1 
ATOM   5361 C  C   . VAL B 1 153 ? 14.712  -3.737  -48.437 1.00 41.35 ? 153  VAL B C   1 
ATOM   5362 O  O   . VAL B 1 153 ? 15.052  -4.346  -49.471 1.00 42.68 ? 153  VAL B O   1 
ATOM   5363 C  CB  . VAL B 1 153 ? 12.487  -3.015  -47.556 1.00 39.49 ? 153  VAL B CB  1 
ATOM   5364 C  CG1 . VAL B 1 153 ? 11.524  -1.824  -47.380 1.00 35.69 ? 153  VAL B CG1 1 
ATOM   5365 C  CG2 . VAL B 1 153 ? 11.773  -4.232  -48.135 1.00 35.78 ? 153  VAL B CG2 1 
ATOM   5366 N  N   . GLY B 1 154 ? 15.219  -4.022  -47.238 1.00 42.33 ? 154  GLY B N   1 
ATOM   5367 C  CA  . GLY B 1 154 ? 16.210  -5.071  -47.077 1.00 42.62 ? 154  GLY B CA  1 
ATOM   5368 C  C   . GLY B 1 154 ? 17.431  -4.800  -47.930 1.00 43.15 ? 154  GLY B C   1 
ATOM   5369 O  O   . GLY B 1 154 ? 17.811  -3.634  -48.160 1.00 42.63 ? 154  GLY B O   1 
ATOM   5370 N  N   . THR B 1 155 ? 18.043  -5.881  -48.409 1.00 42.88 ? 155  THR B N   1 
ATOM   5371 C  CA  . THR B 1 155 ? 19.231  -5.784  -49.255 1.00 42.74 ? 155  THR B CA  1 
ATOM   5372 C  C   . THR B 1 155 ? 18.936  -5.012  -50.540 1.00 42.78 ? 155  THR B C   1 
ATOM   5373 O  O   . THR B 1 155 ? 19.729  -4.173  -50.974 1.00 43.72 ? 155  THR B O   1 
ATOM   5374 C  CB  . THR B 1 155 ? 19.756  -7.184  -49.633 1.00 43.40 ? 155  THR B CB  1 
ATOM   5375 O  OG1 . THR B 1 155 ? 18.715  -7.913  -50.279 1.00 43.53 ? 155  THR B OG1 1 
ATOM   5376 C  CG2 . THR B 1 155 ? 20.182  -7.959  -48.390 1.00 41.23 ? 155  THR B CG2 1 
ATOM   5377 N  N   . PHE B 1 156 ? 17.775  -5.246  -51.132 1.00 40.94 ? 156  PHE B N   1 
ATOM   5378 C  CA  . PHE B 1 156 ? 17.474  -4.568  -52.391 1.00 42.02 ? 156  PHE B CA  1 
ATOM   5379 C  C   . PHE B 1 156 ? 17.485  -3.066  -52.265 1.00 42.58 ? 156  PHE B C   1 
ATOM   5380 O  O   . PHE B 1 156 ? 17.872  -2.364  -53.203 1.00 44.63 ? 156  PHE B O   1 
ATOM   5381 C  CB  . PHE B 1 156 ? 16.133  -5.043  -52.926 1.00 40.63 ? 156  PHE B CB  1 
ATOM   5382 C  CG  . PHE B 1 156 ? 15.975  -6.516  -52.857 1.00 42.03 ? 156  PHE B CG  1 
ATOM   5383 C  CD1 . PHE B 1 156 ? 16.516  -7.331  -53.853 1.00 43.88 ? 156  PHE B CD1 1 
ATOM   5384 C  CD2 . PHE B 1 156 ? 15.345  -7.105  -51.765 1.00 42.24 ? 156  PHE B CD2 1 
ATOM   5385 C  CE1 . PHE B 1 156 ? 16.437  -8.727  -53.762 1.00 44.66 ? 156  PHE B CE1 1 
ATOM   5386 C  CE2 . PHE B 1 156 ? 15.257  -8.502  -51.654 1.00 44.57 ? 156  PHE B CE2 1 
ATOM   5387 C  CZ  . PHE B 1 156 ? 15.806  -9.316  -52.656 1.00 45.74 ? 156  PHE B CZ  1 
ATOM   5388 N  N   . GLY B 1 157 ? 17.075  -2.550  -51.111 1.00 41.79 ? 157  GLY B N   1 
ATOM   5389 C  CA  . GLY B 1 157 ? 17.064  -1.108  -50.967 1.00 39.94 ? 157  GLY B CA  1 
ATOM   5390 C  C   . GLY B 1 157 ? 18.215  -0.496  -50.185 1.00 40.40 ? 157  GLY B C   1 
ATOM   5391 O  O   . GLY B 1 157 ? 18.471  0.696   -50.314 1.00 39.76 ? 157  GLY B O   1 
ATOM   5392 N  N   . PHE B 1 158 ? 18.936  -1.300  -49.404 1.00 41.49 ? 158  PHE B N   1 
ATOM   5393 C  CA  . PHE B 1 158 ? 20.001  -0.732  -48.581 1.00 43.57 ? 158  PHE B CA  1 
ATOM   5394 C  C   . PHE B 1 158 ? 21.342  -1.425  -48.528 1.00 43.86 ? 158  PHE B C   1 
ATOM   5395 O  O   . PHE B 1 158 ? 22.240  -0.948  -47.835 1.00 45.76 ? 158  PHE B O   1 
ATOM   5396 C  CB  . PHE B 1 158 ? 19.466  -0.499  -47.149 1.00 40.38 ? 158  PHE B CB  1 
ATOM   5397 C  CG  . PHE B 1 158 ? 18.287  0.436   -47.117 1.00 40.15 ? 158  PHE B CG  1 
ATOM   5398 C  CD1 . PHE B 1 158 ? 18.471  1.818   -47.239 1.00 39.38 ? 158  PHE B CD1 1 
ATOM   5399 C  CD2 . PHE B 1 158 ? 16.987  -0.067  -47.118 1.00 37.50 ? 158  PHE B CD2 1 
ATOM   5400 C  CE1 . PHE B 1 158 ? 17.377  2.684   -47.376 1.00 37.76 ? 158  PHE B CE1 1 
ATOM   5401 C  CE2 . PHE B 1 158 ? 15.885  0.786   -47.257 1.00 36.88 ? 158  PHE B CE2 1 
ATOM   5402 C  CZ  . PHE B 1 158 ? 16.075  2.159   -47.390 1.00 37.71 ? 158  PHE B CZ  1 
ATOM   5403 N  N   . LEU B 1 159 ? 21.508  -2.528  -49.244 1.00 43.88 ? 159  LEU B N   1 
ATOM   5404 C  CA  . LEU B 1 159 ? 22.810  -3.179  -49.241 1.00 44.22 ? 159  LEU B CA  1 
ATOM   5405 C  C   . LEU B 1 159 ? 23.776  -2.201  -49.892 1.00 45.59 ? 159  LEU B C   1 
ATOM   5406 O  O   . LEU B 1 159 ? 23.521  -1.689  -50.983 1.00 44.02 ? 159  LEU B O   1 
ATOM   5407 C  CB  . LEU B 1 159 ? 22.782  -4.485  -50.026 1.00 44.07 ? 159  LEU B CB  1 
ATOM   5408 C  CG  . LEU B 1 159 ? 24.127  -5.218  -50.074 1.00 43.39 ? 159  LEU B CG  1 
ATOM   5409 C  CD1 . LEU B 1 159 ? 23.906  -6.713  -49.892 1.00 43.55 ? 159  LEU B CD1 1 
ATOM   5410 C  CD2 . LEU B 1 159 ? 24.816  -4.924  -51.390 1.00 42.89 ? 159  LEU B CD2 1 
ATOM   5411 N  N   . ALA B 1 160 ? 24.888  -1.921  -49.221 1.00 47.43 ? 160  ALA B N   1 
ATOM   5412 C  CA  . ALA B 1 160 ? 25.837  -0.971  -49.779 1.00 48.57 ? 160  ALA B CA  1 
ATOM   5413 C  C   . ALA B 1 160 ? 27.301  -1.378  -49.708 1.00 49.78 ? 160  ALA B C   1 
ATOM   5414 O  O   . ALA B 1 160 ? 27.740  -2.070  -48.786 1.00 49.16 ? 160  ALA B O   1 
ATOM   5415 C  CB  . ALA B 1 160 ? 25.663  0.388   -49.095 1.00 48.70 ? 160  ALA B CB  1 
ATOM   5416 N  N   . LEU B 1 161 ? 28.032  -0.964  -50.734 1.00 50.30 ? 161  LEU B N   1 
ATOM   5417 C  CA  . LEU B 1 161 ? 29.467  -1.146  -50.807 1.00 50.64 ? 161  LEU B CA  1 
ATOM   5418 C  C   . LEU B 1 161 ? 29.847  0.313   -51.048 1.00 50.98 ? 161  LEU B C   1 
ATOM   5419 O  O   . LEU B 1 161 ? 30.090  0.733   -52.173 1.00 50.77 ? 161  LEU B O   1 
ATOM   5420 C  CB  . LEU B 1 161 ? 29.859  -2.054  -51.966 1.00 50.88 ? 161  LEU B CB  1 
ATOM   5421 C  CG  . LEU B 1 161 ? 29.491  -3.517  -51.661 1.00 51.77 ? 161  LEU B CG  1 
ATOM   5422 C  CD1 . LEU B 1 161 ? 29.908  -4.395  -52.800 1.00 54.13 ? 161  LEU B CD1 1 
ATOM   5423 C  CD2 . LEU B 1 161 ? 30.176  -3.987  -50.397 1.00 53.17 ? 161  LEU B CD2 1 
ATOM   5424 N  N   . PRO B 1 162 ? 29.858  1.111   -49.963 1.00 51.27 ? 162  PRO B N   1 
ATOM   5425 C  CA  . PRO B 1 162 ? 30.179  2.532   -49.982 1.00 52.81 ? 162  PRO B CA  1 
ATOM   5426 C  C   . PRO B 1 162 ? 31.343  2.881   -50.880 1.00 54.44 ? 162  PRO B C   1 
ATOM   5427 O  O   . PRO B 1 162 ? 32.407  2.270   -50.794 1.00 55.62 ? 162  PRO B O   1 
ATOM   5428 C  CB  . PRO B 1 162 ? 30.446  2.837   -48.512 1.00 51.69 ? 162  PRO B CB  1 
ATOM   5429 C  CG  . PRO B 1 162 ? 29.524  1.907   -47.814 1.00 50.10 ? 162  PRO B CG  1 
ATOM   5430 C  CD  . PRO B 1 162 ? 29.752  0.634   -48.569 1.00 49.79 ? 162  PRO B CD  1 
ATOM   5431 N  N   . GLY B 1 163 ? 31.127  3.865   -51.745 1.00 55.51 ? 163  GLY B N   1 
ATOM   5432 C  CA  . GLY B 1 163 ? 32.173  4.293   -52.649 1.00 57.15 ? 163  GLY B CA  1 
ATOM   5433 C  C   . GLY B 1 163 ? 32.068  3.649   -54.013 1.00 58.75 ? 163  GLY B C   1 
ATOM   5434 O  O   . GLY B 1 163 ? 32.552  4.207   -55.003 1.00 57.04 ? 163  GLY B O   1 
ATOM   5435 N  N   . SER B 1 164 ? 31.444  2.473   -54.074 1.00 60.22 ? 164  SER B N   1 
ATOM   5436 C  CA  . SER B 1 164 ? 31.284  1.780   -55.352 1.00 62.03 ? 164  SER B CA  1 
ATOM   5437 C  C   . SER B 1 164 ? 30.237  2.489   -56.203 1.00 63.79 ? 164  SER B C   1 
ATOM   5438 O  O   . SER B 1 164 ? 29.480  3.334   -55.705 1.00 64.07 ? 164  SER B O   1 
ATOM   5439 C  CB  . SER B 1 164 ? 30.839  0.338   -55.137 1.00 61.67 ? 164  SER B CB  1 
ATOM   5440 O  OG  . SER B 1 164 ? 29.476  0.293   -54.773 1.00 61.49 ? 164  SER B OG  1 
ATOM   5441 N  N   . ARG B 1 165 ? 30.191  2.145   -57.486 1.00 64.75 ? 165  ARG B N   1 
ATOM   5442 C  CA  . ARG B 1 165 ? 29.217  2.753   -58.379 1.00 65.80 ? 165  ARG B CA  1 
ATOM   5443 C  C   . ARG B 1 165 ? 27.983  1.891   -58.513 1.00 64.08 ? 165  ARG B C   1 
ATOM   5444 O  O   . ARG B 1 165 ? 26.896  2.403   -58.769 1.00 64.06 ? 165  ARG B O   1 
ATOM   5445 C  CB  . ARG B 1 165 ? 29.801  2.960   -59.778 1.00 71.12 ? 165  ARG B CB  1 
ATOM   5446 C  CG  . ARG B 1 165 ? 30.897  4.011   -59.861 1.00 78.79 ? 165  ARG B CG  1 
ATOM   5447 C  CD  . ARG B 1 165 ? 31.346  4.289   -61.319 1.00 84.83 ? 165  ARG B CD  1 
ATOM   5448 N  NE  . ARG B 1 165 ? 30.457  5.228   -62.013 1.00 90.33 ? 165  ARG B NE  1 
ATOM   5449 C  CZ  . ARG B 1 165 ? 29.288  4.908   -62.576 1.00 93.14 ? 165  ARG B CZ  1 
ATOM   5450 N  NH1 . ARG B 1 165 ? 28.843  3.652   -62.547 1.00 93.19 ? 165  ARG B NH1 1 
ATOM   5451 N  NH2 . ARG B 1 165 ? 28.550  5.855   -63.155 1.00 93.38 ? 165  ARG B NH2 1 
ATOM   5452 N  N   . GLU B 1 166 ? 28.145  0.586   -58.330 1.00 62.08 ? 166  GLU B N   1 
ATOM   5453 C  CA  . GLU B 1 166 ? 27.024  -0.323  -58.498 1.00 62.65 ? 166  GLU B CA  1 
ATOM   5454 C  C   . GLU B 1 166 ? 26.178  -0.629  -57.271 1.00 60.24 ? 166  GLU B C   1 
ATOM   5455 O  O   . GLU B 1 166 ? 25.121  -1.240  -57.396 1.00 60.74 ? 166  GLU B O   1 
ATOM   5456 C  CB  . GLU B 1 166 ? 27.492  -1.630  -59.169 1.00 66.13 ? 166  GLU B CB  1 
ATOM   5457 C  CG  . GLU B 1 166 ? 28.926  -2.078  -58.830 1.00 72.32 ? 166  GLU B CG  1 
ATOM   5458 C  CD  . GLU B 1 166 ? 30.030  -1.260  -59.525 1.00 73.33 ? 166  GLU B CD  1 
ATOM   5459 O  OE1 . GLU B 1 166 ? 30.048  -1.216  -60.774 1.00 73.79 ? 166  GLU B OE1 1 
ATOM   5460 O  OE2 . GLU B 1 166 ? 30.880  -0.675  -58.813 1.00 73.97 ? 166  GLU B OE2 1 
ATOM   5461 N  N   . ALA B 1 167 ? 26.630  -0.200  -56.098 1.00 56.98 ? 167  ALA B N   1 
ATOM   5462 C  CA  . ALA B 1 167 ? 25.884  -0.419  -54.860 1.00 54.15 ? 167  ALA B CA  1 
ATOM   5463 C  C   . ALA B 1 167 ? 26.237  0.707   -53.898 1.00 52.18 ? 167  ALA B C   1 
ATOM   5464 O  O   . ALA B 1 167 ? 26.810  0.467   -52.840 1.00 51.61 ? 167  ALA B O   1 
ATOM   5465 C  CB  . ALA B 1 167 ? 26.252  -1.753  -54.257 1.00 54.94 ? 167  ALA B CB  1 
ATOM   5466 N  N   . PRO B 1 168 ? 25.887  1.954   -54.262 1.00 50.55 ? 168  PRO B N   1 
ATOM   5467 C  CA  . PRO B 1 168 ? 26.169  3.145   -53.454 1.00 49.32 ? 168  PRO B CA  1 
ATOM   5468 C  C   . PRO B 1 168 ? 25.438  3.245   -52.111 1.00 50.11 ? 168  PRO B C   1 
ATOM   5469 O  O   . PRO B 1 168 ? 25.844  4.024   -51.248 1.00 49.38 ? 168  PRO B O   1 
ATOM   5470 C  CB  . PRO B 1 168 ? 25.808  4.290   -54.400 1.00 48.64 ? 168  PRO B CB  1 
ATOM   5471 C  CG  . PRO B 1 168 ? 24.642  3.715   -55.170 1.00 48.61 ? 168  PRO B CG  1 
ATOM   5472 C  CD  . PRO B 1 168 ? 25.090  2.301   -55.461 1.00 49.07 ? 168  PRO B CD  1 
ATOM   5473 N  N   . GLY B 1 169 ? 24.381  2.454   -51.925 1.00 48.67 ? 169  GLY B N   1 
ATOM   5474 C  CA  . GLY B 1 169 ? 23.636  2.526   -50.677 1.00 47.56 ? 169  GLY B CA  1 
ATOM   5475 C  C   . GLY B 1 169 ? 22.509  3.557   -50.728 1.00 46.53 ? 169  GLY B C   1 
ATOM   5476 O  O   . GLY B 1 169 ? 22.485  4.424   -51.617 1.00 44.14 ? 169  GLY B O   1 
ATOM   5477 N  N   . ASN B 1 170 ? 21.573  3.447   -49.784 1.00 45.08 ? 170  ASN B N   1 
ATOM   5478 C  CA  . ASN B 1 170 ? 20.423  4.348   -49.682 1.00 45.06 ? 170  ASN B CA  1 
ATOM   5479 C  C   . ASN B 1 170 ? 19.491  4.429   -50.916 1.00 45.17 ? 170  ASN B C   1 
ATOM   5480 O  O   . ASN B 1 170 ? 18.717  5.390   -51.045 1.00 45.12 ? 170  ASN B O   1 
ATOM   5481 C  CB  . ASN B 1 170 ? 20.892  5.775   -49.340 1.00 42.87 ? 170  ASN B CB  1 
ATOM   5482 C  CG  . ASN B 1 170 ? 21.691  5.837   -48.061 1.00 44.18 ? 170  ASN B CG  1 
ATOM   5483 O  OD1 . ASN B 1 170 ? 21.338  5.224   -47.050 1.00 45.33 ? 170  ASN B OD1 1 
ATOM   5484 N  ND2 . ASN B 1 170 ? 22.773  6.599   -48.089 1.00 45.10 ? 170  ASN B ND2 1 
ATOM   5485 N  N   . VAL B 1 171 ? 19.534  3.447   -51.818 1.00 44.74 ? 171  VAL B N   1 
ATOM   5486 C  CA  . VAL B 1 171 ? 18.673  3.559   -52.992 1.00 41.61 ? 171  VAL B CA  1 
ATOM   5487 C  C   . VAL B 1 171 ? 17.201  3.524   -52.592 1.00 41.46 ? 171  VAL B C   1 
ATOM   5488 O  O   . VAL B 1 171 ? 16.361  4.147   -53.251 1.00 40.48 ? 171  VAL B O   1 
ATOM   5489 C  CB  . VAL B 1 171 ? 19.015  2.499   -54.108 1.00 40.50 ? 171  VAL B CB  1 
ATOM   5490 C  CG1 . VAL B 1 171 ? 20.482  2.635   -54.475 1.00 41.14 ? 171  VAL B CG1 1 
ATOM   5491 C  CG2 . VAL B 1 171 ? 18.674  1.066   -53.689 1.00 38.35 ? 171  VAL B CG2 1 
ATOM   5492 N  N   . GLY B 1 172 ? 16.892  2.833   -51.498 1.00 40.01 ? 172  GLY B N   1 
ATOM   5493 C  CA  . GLY B 1 172 ? 15.515  2.817   -51.035 1.00 40.91 ? 172  GLY B CA  1 
ATOM   5494 C  C   . GLY B 1 172 ? 15.065  4.245   -50.670 1.00 42.38 ? 172  GLY B C   1 
ATOM   5495 O  O   . GLY B 1 172 ? 13.890  4.618   -50.812 1.00 41.57 ? 172  GLY B O   1 
ATOM   5496 N  N   . LEU B 1 173 ? 15.996  5.061   -50.185 1.00 41.92 ? 173  LEU B N   1 
ATOM   5497 C  CA  . LEU B 1 173 ? 15.642  6.433   -49.838 1.00 42.47 ? 173  LEU B CA  1 
ATOM   5498 C  C   . LEU B 1 173 ? 15.498  7.209   -51.138 1.00 42.33 ? 173  LEU B C   1 
ATOM   5499 O  O   . LEU B 1 173 ? 14.686  8.125   -51.232 1.00 44.77 ? 173  LEU B O   1 
ATOM   5500 C  CB  . LEU B 1 173 ? 16.711  7.084   -48.932 1.00 41.35 ? 173  LEU B CB  1 
ATOM   5501 C  CG  . LEU B 1 173 ? 16.738  6.588   -47.477 1.00 41.42 ? 173  LEU B CG  1 
ATOM   5502 C  CD1 . LEU B 1 173 ? 17.937  7.155   -46.768 1.00 40.05 ? 173  LEU B CD1 1 
ATOM   5503 C  CD2 . LEU B 1 173 ? 15.468  6.994   -46.753 1.00 38.99 ? 173  LEU B CD2 1 
ATOM   5504 N  N   . LEU B 1 174 ? 16.284  6.854   -52.149 1.00 40.64 ? 174  LEU B N   1 
ATOM   5505 C  CA  . LEU B 1 174 ? 16.167  7.545   -53.425 1.00 40.16 ? 174  LEU B CA  1 
ATOM   5506 C  C   . LEU B 1 174 ? 14.843  7.190   -54.112 1.00 39.33 ? 174  LEU B C   1 
ATOM   5507 O  O   . LEU B 1 174 ? 14.305  7.999   -54.871 1.00 36.81 ? 174  LEU B O   1 
ATOM   5508 C  CB  . LEU B 1 174 ? 17.349  7.219   -54.328 1.00 40.53 ? 174  LEU B CB  1 
ATOM   5509 C  CG  . LEU B 1 174 ? 18.683  7.804   -53.832 1.00 41.74 ? 174  LEU B CG  1 
ATOM   5510 C  CD1 . LEU B 1 174 ? 19.839  7.207   -54.635 1.00 40.63 ? 174  LEU B CD1 1 
ATOM   5511 C  CD2 . LEU B 1 174 ? 18.658  9.310   -53.941 1.00 39.74 ? 174  LEU B CD2 1 
ATOM   5512 N  N   . ASP B 1 175 ? 14.315  5.997   -53.836 1.00 38.89 ? 175  ASP B N   1 
ATOM   5513 C  CA  . ASP B 1 175 ? 13.023  5.597   -54.403 1.00 38.76 ? 175  ASP B CA  1 
ATOM   5514 C  C   . ASP B 1 175 ? 11.986  6.564   -53.841 1.00 39.96 ? 175  ASP B C   1 
ATOM   5515 O  O   . ASP B 1 175 ? 11.153  7.114   -54.565 1.00 39.24 ? 175  ASP B O   1 
ATOM   5516 C  CB  . ASP B 1 175 ? 12.623  4.189   -53.959 1.00 37.45 ? 175  ASP B CB  1 
ATOM   5517 C  CG  . ASP B 1 175 ? 13.518  3.123   -54.524 1.00 37.58 ? 175  ASP B CG  1 
ATOM   5518 O  OD1 . ASP B 1 175 ? 14.266  3.438   -55.478 1.00 37.81 ? 175  ASP B OD1 1 
ATOM   5519 O  OD2 . ASP B 1 175 ? 13.464  1.967   -54.023 1.00 38.49 ? 175  ASP B OD2 1 
ATOM   5520 N  N   . GLN B 1 176 ? 12.035  6.761   -52.530 1.00 38.90 ? 176  GLN B N   1 
ATOM   5521 C  CA  . GLN B 1 176 ? 11.093  7.661   -51.895 1.00 39.06 ? 176  GLN B CA  1 
ATOM   5522 C  C   . GLN B 1 176 ? 11.251  9.060   -52.494 1.00 39.60 ? 176  GLN B C   1 
ATOM   5523 O  O   . GLN B 1 176 ? 10.257  9.721   -52.819 1.00 38.55 ? 176  GLN B O   1 
ATOM   5524 C  CB  . GLN B 1 176 ? 11.326  7.707   -50.383 1.00 39.62 ? 176  GLN B CB  1 
ATOM   5525 C  CG  . GLN B 1 176 ? 11.215  6.363   -49.607 1.00 36.19 ? 176  GLN B CG  1 
ATOM   5526 C  CD  . GLN B 1 176 ? 11.755  6.522   -48.188 1.00 37.71 ? 176  GLN B CD  1 
ATOM   5527 O  OE1 . GLN B 1 176 ? 11.988  7.654   -47.737 1.00 35.69 ? 176  GLN B OE1 1 
ATOM   5528 N  NE2 . GLN B 1 176 ? 11.955  5.402   -47.478 1.00 35.73 ? 176  GLN B NE2 1 
ATOM   5529 N  N   . ARG B 1 177 ? 12.494  9.500   -52.675 1.00 39.55 ? 177  ARG B N   1 
ATOM   5530 C  CA  . ARG B 1 177 ? 12.731  10.830  -53.231 1.00 40.50 ? 177  ARG B CA  1 
ATOM   5531 C  C   . ARG B 1 177 ? 12.156  10.966  -54.636 1.00 41.34 ? 177  ARG B C   1 
ATOM   5532 O  O   . ARG B 1 177 ? 11.575  12.000  -54.965 1.00 41.91 ? 177  ARG B O   1 
ATOM   5533 C  CB  . ARG B 1 177 ? 14.224  11.162  -53.251 1.00 40.87 ? 177  ARG B CB  1 
ATOM   5534 C  CG  . ARG B 1 177 ? 14.535  12.499  -53.918 1.00 44.76 ? 177  ARG B CG  1 
ATOM   5535 C  CD  . ARG B 1 177 ? 16.002  12.814  -53.860 1.00 46.43 ? 177  ARG B CD  1 
ATOM   5536 N  NE  . ARG B 1 177 ? 16.404  13.159  -52.496 1.00 52.74 ? 177  ARG B NE  1 
ATOM   5537 C  CZ  . ARG B 1 177 ? 17.668  13.262  -52.090 1.00 52.56 ? 177  ARG B CZ  1 
ATOM   5538 N  NH1 . ARG B 1 177 ? 18.655  13.036  -52.950 1.00 53.07 ? 177  ARG B NH1 1 
ATOM   5539 N  NH2 . ARG B 1 177 ? 17.944  13.613  -50.839 1.00 51.23 ? 177  ARG B NH2 1 
ATOM   5540 N  N   . LEU B 1 178 ? 12.312  9.931   -55.464 1.00 41.00 ? 178  LEU B N   1 
ATOM   5541 C  CA  . LEU B 1 178 ? 11.780  9.974   -56.820 1.00 39.77 ? 178  LEU B CA  1 
ATOM   5542 C  C   . LEU B 1 178 ? 10.249  10.079  -56.752 1.00 38.80 ? 178  LEU B C   1 
ATOM   5543 O  O   . LEU B 1 178 ? 9.637   10.823  -57.514 1.00 36.99 ? 178  LEU B O   1 
ATOM   5544 C  CB  . LEU B 1 178 ? 12.214  8.732   -57.619 1.00 38.39 ? 178  LEU B CB  1 
ATOM   5545 C  CG  . LEU B 1 178 ? 11.755  8.645   -59.079 1.00 39.48 ? 178  LEU B CG  1 
ATOM   5546 C  CD1 . LEU B 1 178 ? 12.221  9.855   -59.860 1.00 39.92 ? 178  LEU B CD1 1 
ATOM   5547 C  CD2 . LEU B 1 178 ? 12.334  7.372   -59.723 1.00 43.56 ? 178  LEU B CD2 1 
ATOM   5548 N  N   . ALA B 1 179 ? 9.632   9.336   -55.845 1.00 38.86 ? 179  ALA B N   1 
ATOM   5549 C  CA  . ALA B 1 179 ? 8.180   9.412   -55.682 1.00 40.33 ? 179  ALA B CA  1 
ATOM   5550 C  C   . ALA B 1 179 ? 7.804   10.853  -55.289 1.00 41.42 ? 179  ALA B C   1 
ATOM   5551 O  O   . ALA B 1 179 ? 6.800   11.390  -55.758 1.00 41.21 ? 179  ALA B O   1 
ATOM   5552 C  CB  . ALA B 1 179 ? 7.709   8.436   -54.606 1.00 38.87 ? 179  ALA B CB  1 
ATOM   5553 N  N   . LEU B 1 180 ? 8.607   11.481  -54.430 1.00 42.14 ? 180  LEU B N   1 
ATOM   5554 C  CA  . LEU B 1 180 ? 8.338   12.866  -54.038 1.00 41.66 ? 180  LEU B CA  1 
ATOM   5555 C  C   . LEU B 1 180 ? 8.441   13.795  -55.259 1.00 43.31 ? 180  LEU B C   1 
ATOM   5556 O  O   . LEU B 1 180 ? 7.635   14.727  -55.394 1.00 43.99 ? 180  LEU B O   1 
ATOM   5557 C  CB  . LEU B 1 180 ? 9.317   13.311  -52.952 1.00 40.17 ? 180  LEU B CB  1 
ATOM   5558 C  CG  . LEU B 1 180 ? 8.972   13.052  -51.476 1.00 41.01 ? 180  LEU B CG  1 
ATOM   5559 C  CD1 . LEU B 1 180 ? 8.210   11.766  -51.256 1.00 38.41 ? 180  LEU B CD1 1 
ATOM   5560 C  CD2 . LEU B 1 180 ? 10.251  13.077  -50.689 1.00 41.08 ? 180  LEU B CD2 1 
ATOM   5561 N  N   . GLN B 1 181 ? 9.413   13.552  -56.144 1.00 43.06 ? 181  GLN B N   1 
ATOM   5562 C  CA  . GLN B 1 181 ? 9.570   14.382  -57.345 1.00 45.38 ? 181  GLN B CA  1 
ATOM   5563 C  C   . GLN B 1 181 ? 8.363   14.147  -58.246 1.00 45.30 ? 181  GLN B C   1 
ATOM   5564 O  O   . GLN B 1 181 ? 7.840   15.079  -58.875 1.00 44.91 ? 181  GLN B O   1 
ATOM   5565 C  CB  . GLN B 1 181 ? 10.865  14.045  -58.120 1.00 47.40 ? 181  GLN B CB  1 
ATOM   5566 C  CG  . GLN B 1 181 ? 12.114  14.725  -57.544 1.00 55.42 ? 181  GLN B CG  1 
ATOM   5567 C  CD  . GLN B 1 181 ? 13.467  14.028  -57.892 1.00 59.74 ? 181  GLN B CD  1 
ATOM   5568 O  OE1 . GLN B 1 181 ? 13.515  12.833  -58.261 1.00 62.24 ? 181  GLN B OE1 1 
ATOM   5569 N  NE2 . GLN B 1 181 ? 14.571  14.779  -57.743 1.00 58.57 ? 181  GLN B NE2 1 
ATOM   5570 N  N   . TRP B 1 182 ? 7.908   12.897  -58.291 1.00 44.19 ? 182  TRP B N   1 
ATOM   5571 C  CA  . TRP B 1 182 ? 6.774   12.560  -59.123 1.00 43.57 ? 182  TRP B CA  1 
ATOM   5572 C  C   . TRP B 1 182 ? 5.580   13.374  -58.645 1.00 43.44 ? 182  TRP B C   1 
ATOM   5573 O  O   . TRP B 1 182 ? 4.794   13.870  -59.456 1.00 43.51 ? 182  TRP B O   1 
ATOM   5574 C  CB  . TRP B 1 182 ? 6.463   11.065  -59.054 1.00 43.03 ? 182  TRP B CB  1 
ATOM   5575 C  CG  . TRP B 1 182 ? 5.304   10.665  -59.947 1.00 44.32 ? 182  TRP B CG  1 
ATOM   5576 C  CD1 . TRP B 1 182 ? 5.372   10.207  -61.237 1.00 45.00 ? 182  TRP B CD1 1 
ATOM   5577 C  CD2 . TRP B 1 182 ? 3.918   10.714  -59.614 1.00 43.31 ? 182  TRP B CD2 1 
ATOM   5578 N  NE1 . TRP B 1 182 ? 4.110   9.966   -61.721 1.00 45.95 ? 182  TRP B NE1 1 
ATOM   5579 C  CE2 . TRP B 1 182 ? 3.199   10.268  -60.746 1.00 43.94 ? 182  TRP B CE2 1 
ATOM   5580 C  CE3 . TRP B 1 182 ? 3.212   11.090  -58.467 1.00 43.14 ? 182  TRP B CE3 1 
ATOM   5581 C  CZ2 . TRP B 1 182 ? 1.806   10.188  -60.768 1.00 45.90 ? 182  TRP B CZ2 1 
ATOM   5582 C  CZ3 . TRP B 1 182 ? 1.824   11.009  -58.481 1.00 44.86 ? 182  TRP B CZ3 1 
ATOM   5583 C  CH2 . TRP B 1 182 ? 1.132   10.559  -59.625 1.00 44.96 ? 182  TRP B CH2 1 
ATOM   5584 N  N   . VAL B 1 183 ? 5.440   13.500  -57.329 1.00 42.77 ? 183  VAL B N   1 
ATOM   5585 C  CA  . VAL B 1 183 ? 4.352   14.293  -56.771 1.00 43.53 ? 183  VAL B CA  1 
ATOM   5586 C  C   . VAL B 1 183 ? 4.452   15.773  -57.195 1.00 45.17 ? 183  VAL B C   1 
ATOM   5587 O  O   . VAL B 1 183 ? 3.451   16.367  -57.587 1.00 46.12 ? 183  VAL B O   1 
ATOM   5588 C  CB  . VAL B 1 183 ? 4.317   14.157  -55.235 1.00 43.35 ? 183  VAL B CB  1 
ATOM   5589 C  CG1 . VAL B 1 183 ? 3.454   15.258  -54.599 1.00 39.46 ? 183  VAL B CG1 1 
ATOM   5590 C  CG2 . VAL B 1 183 ? 3.769   12.767  -54.880 1.00 41.28 ? 183  VAL B CG2 1 
ATOM   5591 N  N   . GLN B 1 184 ? 5.641   16.368  -57.131 1.00 46.11 ? 184  GLN B N   1 
ATOM   5592 C  CA  . GLN B 1 184 ? 5.783   17.759  -57.557 1.00 48.49 ? 184  GLN B CA  1 
ATOM   5593 C  C   . GLN B 1 184 ? 5.313   17.953  -58.989 1.00 50.57 ? 184  GLN B C   1 
ATOM   5594 O  O   . GLN B 1 184 ? 4.640   18.939  -59.311 1.00 51.92 ? 184  GLN B O   1 
ATOM   5595 C  CB  . GLN B 1 184 ? 7.244   18.231  -57.506 1.00 47.95 ? 184  GLN B CB  1 
ATOM   5596 C  CG  . GLN B 1 184 ? 7.730   18.588  -56.146 1.00 52.45 ? 184  GLN B CG  1 
ATOM   5597 C  CD  . GLN B 1 184 ? 6.843   19.622  -55.504 1.00 54.41 ? 184  GLN B CD  1 
ATOM   5598 O  OE1 . GLN B 1 184 ? 6.857   20.787  -55.906 1.00 57.31 ? 184  GLN B OE1 1 
ATOM   5599 N  NE2 . GLN B 1 184 ? 6.045   19.204  -54.514 1.00 51.44 ? 184  GLN B NE2 1 
ATOM   5600 N  N   . GLU B 1 185 ? 5.685   17.015  -59.853 1.00 51.71 ? 185  GLU B N   1 
ATOM   5601 C  CA  . GLU B 1 185 ? 5.364   17.113  -61.272 1.00 53.41 ? 185  GLU B CA  1 
ATOM   5602 C  C   . GLU B 1 185 ? 3.961   16.732  -61.700 1.00 52.00 ? 185  GLU B C   1 
ATOM   5603 O  O   . GLU B 1 185 ? 3.473   17.237  -62.706 1.00 53.16 ? 185  GLU B O   1 
ATOM   5604 C  CB  . GLU B 1 185 ? 6.337   16.253  -62.093 1.00 56.17 ? 185  GLU B CB  1 
ATOM   5605 C  CG  . GLU B 1 185 ? 7.802   16.530  -61.835 1.00 62.55 ? 185  GLU B CG  1 
ATOM   5606 C  CD  . GLU B 1 185 ? 8.707   15.424  -62.376 1.00 67.48 ? 185  GLU B CD  1 
ATOM   5607 O  OE1 . GLU B 1 185 ? 8.274   14.236  -62.409 1.00 70.11 ? 185  GLU B OE1 1 
ATOM   5608 O  OE2 . GLU B 1 185 ? 9.862   15.741  -62.750 1.00 69.74 ? 185  GLU B OE2 1 
ATOM   5609 N  N   . ASN B 1 186 ? 3.309   15.865  -60.941 1.00 50.38 ? 186  ASN B N   1 
ATOM   5610 C  CA  . ASN B 1 186 ? 2.007   15.368  -61.359 1.00 50.14 ? 186  ASN B CA  1 
ATOM   5611 C  C   . ASN B 1 186 ? 0.829   15.532  -60.425 1.00 49.41 ? 186  ASN B C   1 
ATOM   5612 O  O   . ASN B 1 186 ? -0.315  15.383  -60.853 1.00 50.75 ? 186  ASN B O   1 
ATOM   5613 C  CB  . ASN B 1 186 ? 2.132   13.864  -61.683 1.00 48.80 ? 186  ASN B CB  1 
ATOM   5614 C  CG  . ASN B 1 186 ? 3.188   13.581  -62.727 1.00 47.71 ? 186  ASN B CG  1 
ATOM   5615 O  OD1 . ASN B 1 186 ? 2.991   13.858  -63.904 1.00 50.04 ? 186  ASN B OD1 1 
ATOM   5616 N  ND2 . ASN B 1 186 ? 4.323   13.049  -62.301 1.00 45.94 ? 186  ASN B ND2 1 
ATOM   5617 N  N   . ILE B 1 187 ? 1.077   15.824  -59.157 1.00 48.33 ? 187  ILE B N   1 
ATOM   5618 C  CA  . ILE B 1 187 ? -0.034  15.890  -58.224 1.00 47.12 ? 187  ILE B CA  1 
ATOM   5619 C  C   . ILE B 1 187 ? -1.129  16.888  -58.594 1.00 46.29 ? 187  ILE B C   1 
ATOM   5620 O  O   . ILE B 1 187 ? -2.306  16.634  -58.352 1.00 46.09 ? 187  ILE B O   1 
ATOM   5621 C  CB  . ILE B 1 187 ? 0.461   16.129  -56.777 1.00 45.71 ? 187  ILE B CB  1 
ATOM   5622 C  CG1 . ILE B 1 187 ? -0.494  15.427  -55.813 1.00 43.08 ? 187  ILE B CG1 1 
ATOM   5623 C  CG2 . ILE B 1 187 ? 0.536   17.634  -56.471 1.00 46.03 ? 187  ILE B CG2 1 
ATOM   5624 C  CD1 . ILE B 1 187 ? -0.695  13.977  -56.154 1.00 40.89 ? 187  ILE B CD1 1 
ATOM   5625 N  N   . ALA B 1 188 ? -0.744  18.011  -59.180 1.00 46.41 ? 188  ALA B N   1 
ATOM   5626 C  CA  . ALA B 1 188 ? -1.722  19.010  -59.593 1.00 48.53 ? 188  ALA B CA  1 
ATOM   5627 C  C   . ALA B 1 188 ? -2.839  18.397  -60.471 1.00 49.10 ? 188  ALA B C   1 
ATOM   5628 O  O   . ALA B 1 188 ? -4.004  18.753  -60.335 1.00 48.86 ? 188  ALA B O   1 
ATOM   5629 C  CB  . ALA B 1 188 ? -1.026  20.125  -60.348 1.00 45.91 ? 188  ALA B CB  1 
ATOM   5630 N  N   . ALA B 1 189 ? -2.479  17.471  -61.355 1.00 50.20 ? 189  ALA B N   1 
ATOM   5631 C  CA  . ALA B 1 189 ? -3.455  16.836  -62.240 1.00 50.99 ? 189  ALA B CA  1 
ATOM   5632 C  C   . ALA B 1 189 ? -4.568  16.139  -61.467 1.00 51.87 ? 189  ALA B C   1 
ATOM   5633 O  O   . ALA B 1 189 ? -5.634  15.885  -62.025 1.00 52.97 ? 189  ALA B O   1 
ATOM   5634 C  CB  . ALA B 1 189 ? -2.757  15.846  -63.166 1.00 49.99 ? 189  ALA B CB  1 
ATOM   5635 N  N   . PHE B 1 190 ? -4.326  15.845  -60.187 1.00 51.31 ? 190  PHE B N   1 
ATOM   5636 C  CA  . PHE B 1 190 ? -5.304  15.175  -59.333 1.00 50.93 ? 190  PHE B CA  1 
ATOM   5637 C  C   . PHE B 1 190 ? -6.002  16.159  -58.399 1.00 52.60 ? 190  PHE B C   1 
ATOM   5638 O  O   . PHE B 1 190 ? -6.870  15.768  -57.613 1.00 53.11 ? 190  PHE B O   1 
ATOM   5639 C  CB  . PHE B 1 190 ? -4.631  14.114  -58.452 1.00 50.09 ? 190  PHE B CB  1 
ATOM   5640 C  CG  . PHE B 1 190 ? -3.972  12.997  -59.209 1.00 49.68 ? 190  PHE B CG  1 
ATOM   5641 C  CD1 . PHE B 1 190 ? -2.704  13.160  -59.758 1.00 50.04 ? 190  PHE B CD1 1 
ATOM   5642 C  CD2 . PHE B 1 190 ? -4.604  11.766  -59.341 1.00 50.03 ? 190  PHE B CD2 1 
ATOM   5643 C  CE1 . PHE B 1 190 ? -2.067  12.105  -60.428 1.00 50.75 ? 190  PHE B CE1 1 
ATOM   5644 C  CE2 . PHE B 1 190 ? -3.976  10.703  -60.012 1.00 50.69 ? 190  PHE B CE2 1 
ATOM   5645 C  CZ  . PHE B 1 190 ? -2.703  10.880  -60.554 1.00 48.34 ? 190  PHE B CZ  1 
ATOM   5646 N  N   . GLY B 1 191 ? -5.611  17.427  -58.469 1.00 53.40 ? 191  GLY B N   1 
ATOM   5647 C  CA  . GLY B 1 191 ? -6.192  18.419  -57.583 1.00 54.52 ? 191  GLY B CA  1 
ATOM   5648 C  C   . GLY B 1 191 ? -5.373  18.644  -56.308 1.00 55.61 ? 191  GLY B C   1 
ATOM   5649 O  O   . GLY B 1 191 ? -5.854  19.258  -55.342 1.00 56.17 ? 191  GLY B O   1 
ATOM   5650 N  N   . GLY B 1 192 ? -4.139  18.140  -56.289 1.00 54.84 ? 192  GLY B N   1 
ATOM   5651 C  CA  . GLY B 1 192 ? -3.289  18.326  -55.126 1.00 52.58 ? 192  GLY B CA  1 
ATOM   5652 C  C   . GLY B 1 192 ? -2.431  19.566  -55.303 1.00 52.40 ? 192  GLY B C   1 
ATOM   5653 O  O   . GLY B 1 192 ? -2.079  19.933  -56.422 1.00 53.12 ? 192  GLY B O   1 
ATOM   5654 N  N   . ASP B 1 193 ? -2.085  20.214  -54.200 1.00 52.03 ? 193  ASP B N   1 
ATOM   5655 C  CA  . ASP B 1 193 ? -1.272  21.428  -54.253 1.00 51.67 ? 193  ASP B CA  1 
ATOM   5656 C  C   . ASP B 1 193 ? 0.203   21.059  -54.068 1.00 50.65 ? 193  ASP B C   1 
ATOM   5657 O  O   . ASP B 1 193 ? 0.617   20.704  -52.974 1.00 50.87 ? 193  ASP B O   1 
ATOM   5658 C  CB  . ASP B 1 193 ? -1.745  22.373  -53.137 1.00 53.38 ? 193  ASP B CB  1 
ATOM   5659 C  CG  . ASP B 1 193 ? -0.980  23.664  -53.089 1.00 54.16 ? 193  ASP B CG  1 
ATOM   5660 O  OD1 . ASP B 1 193 ? -0.081  23.882  -53.934 1.00 54.81 ? 193  ASP B OD1 1 
ATOM   5661 O  OD2 . ASP B 1 193 ? -1.290  24.476  -52.184 1.00 58.53 ? 193  ASP B OD2 1 
ATOM   5662 N  N   . PRO B 1 194 ? 1.012   21.126  -55.140 1.00 50.52 ? 194  PRO B N   1 
ATOM   5663 C  CA  . PRO B 1 194 ? 2.424   20.773  -54.969 1.00 50.54 ? 194  PRO B CA  1 
ATOM   5664 C  C   . PRO B 1 194 ? 3.138   21.725  -54.027 1.00 51.64 ? 194  PRO B C   1 
ATOM   5665 O  O   . PRO B 1 194 ? 4.239   21.436  -53.545 1.00 51.14 ? 194  PRO B O   1 
ATOM   5666 C  CB  . PRO B 1 194 ? 2.983   20.842  -56.393 1.00 49.96 ? 194  PRO B CB  1 
ATOM   5667 C  CG  . PRO B 1 194 ? 2.090   21.864  -57.051 1.00 50.19 ? 194  PRO B CG  1 
ATOM   5668 C  CD  . PRO B 1 194 ? 0.728   21.469  -56.544 1.00 49.65 ? 194  PRO B CD  1 
ATOM   5669 N  N   . MET B 1 195 ? 2.513   22.863  -53.757 1.00 52.16 ? 195  MET B N   1 
ATOM   5670 C  CA  . MET B 1 195 ? 3.134   23.845  -52.872 1.00 53.19 ? 195  MET B CA  1 
ATOM   5671 C  C   . MET B 1 195 ? 2.832   23.594  -51.406 1.00 51.09 ? 195  MET B C   1 
ATOM   5672 O  O   . MET B 1 195 ? 3.280   24.342  -50.547 1.00 50.99 ? 195  MET B O   1 
ATOM   5673 C  CB  . MET B 1 195 ? 2.712   25.265  -53.268 1.00 56.10 ? 195  MET B CB  1 
ATOM   5674 C  CG  . MET B 1 195 ? 3.017   25.580  -54.727 1.00 61.05 ? 195  MET B CG  1 
ATOM   5675 S  SD  . MET B 1 195 ? 3.826   27.172  -54.989 1.00 69.14 ? 195  MET B SD  1 
ATOM   5676 C  CE  . MET B 1 195 ? 2.388   28.237  -55.062 1.00 66.56 ? 195  MET B CE  1 
ATOM   5677 N  N   . SER B 1 196 ? 2.062   22.548  -51.122 1.00 48.77 ? 196  SER B N   1 
ATOM   5678 C  CA  . SER B 1 196 ? 1.748   22.198  -49.741 1.00 47.04 ? 196  SER B CA  1 
ATOM   5679 C  C   . SER B 1 196 ? 1.781   20.677  -49.599 1.00 46.32 ? 196  SER B C   1 
ATOM   5680 O  O   . SER B 1 196 ? 0.747   20.000  -49.652 1.00 46.64 ? 196  SER B O   1 
ATOM   5681 C  CB  . SER B 1 196 ? 0.371   22.725  -49.324 1.00 47.12 ? 196  SER B CB  1 
ATOM   5682 O  OG  . SER B 1 196 ? 0.036   22.277  -48.008 1.00 44.16 ? 196  SER B OG  1 
ATOM   5683 N  N   . VAL B 1 197 ? 2.988   20.146  -49.446 1.00 44.42 ? 197  VAL B N   1 
ATOM   5684 C  CA  . VAL B 1 197 ? 3.190   18.706  -49.312 1.00 41.88 ? 197  VAL B CA  1 
ATOM   5685 C  C   . VAL B 1 197 ? 3.708   18.405  -47.925 1.00 41.81 ? 197  VAL B C   1 
ATOM   5686 O  O   . VAL B 1 197 ? 4.735   18.943  -47.509 1.00 43.23 ? 197  VAL B O   1 
ATOM   5687 C  CB  . VAL B 1 197 ? 4.235   18.184  -50.337 1.00 40.37 ? 197  VAL B CB  1 
ATOM   5688 C  CG1 . VAL B 1 197 ? 4.596   16.730  -50.049 1.00 37.34 ? 197  VAL B CG1 1 
ATOM   5689 C  CG2 . VAL B 1 197 ? 3.696   18.345  -51.739 1.00 38.89 ? 197  VAL B CG2 1 
ATOM   5690 N  N   . THR B 1 198 ? 2.999   17.544  -47.214 1.00 40.55 ? 198  THR B N   1 
ATOM   5691 C  CA  . THR B 1 198 ? 3.401   17.147  -45.883 1.00 40.10 ? 198  THR B CA  1 
ATOM   5692 C  C   . THR B 1 198 ? 3.789   15.677  -45.910 1.00 40.93 ? 198  THR B C   1 
ATOM   5693 O  O   . THR B 1 198 ? 3.012   14.844  -46.386 1.00 42.30 ? 198  THR B O   1 
ATOM   5694 C  CB  . THR B 1 198 ? 2.237   17.306  -44.911 1.00 40.00 ? 198  THR B CB  1 
ATOM   5695 O  OG1 . THR B 1 198 ? 1.781   18.658  -44.960 1.00 42.36 ? 198  THR B OG1 1 
ATOM   5696 C  CG2 . THR B 1 198 ? 2.664   16.959  -43.496 1.00 37.91 ? 198  THR B CG2 1 
ATOM   5697 N  N   . LEU B 1 199 ? 4.978   15.345  -45.419 1.00 40.61 ? 199  LEU B N   1 
ATOM   5698 C  CA  . LEU B 1 199 ? 5.402   13.942  -45.361 1.00 39.46 ? 199  LEU B CA  1 
ATOM   5699 C  C   . LEU B 1 199 ? 5.073   13.416  -43.977 1.00 40.48 ? 199  LEU B C   1 
ATOM   5700 O  O   . LEU B 1 199 ? 5.204   14.133  -42.981 1.00 42.43 ? 199  LEU B O   1 
ATOM   5701 C  CB  . LEU B 1 199 ? 6.919   13.794  -45.543 1.00 38.40 ? 199  LEU B CB  1 
ATOM   5702 C  CG  . LEU B 1 199 ? 7.623   14.465  -46.742 1.00 41.20 ? 199  LEU B CG  1 
ATOM   5703 C  CD1 . LEU B 1 199 ? 9.157   14.272  -46.632 1.00 36.87 ? 199  LEU B CD1 1 
ATOM   5704 C  CD2 . LEU B 1 199 ? 7.076   13.890  -48.049 1.00 36.99 ? 199  LEU B CD2 1 
ATOM   5705 N  N   . PHE B 1 200 ? 4.608   12.182  -43.894 1.00 40.01 ? 200  PHE B N   1 
ATOM   5706 C  CA  . PHE B 1 200 ? 4.389   11.583  -42.588 1.00 38.79 ? 200  PHE B CA  1 
ATOM   5707 C  C   . PHE B 1 200 ? 4.645   10.105  -42.710 1.00 38.35 ? 200  PHE B C   1 
ATOM   5708 O  O   . PHE B 1 200 ? 4.461   9.504   -43.775 1.00 39.10 ? 200  PHE B O   1 
ATOM   5709 C  CB  . PHE B 1 200 ? 3.000   11.900  -42.002 1.00 40.58 ? 200  PHE B CB  1 
ATOM   5710 C  CG  . PHE B 1 200 ? 1.844   11.138  -42.604 1.00 42.39 ? 200  PHE B CG  1 
ATOM   5711 C  CD1 . PHE B 1 200 ? 1.595   11.157  -43.976 1.00 41.40 ? 200  PHE B CD1 1 
ATOM   5712 C  CD2 . PHE B 1 200 ? 0.901   10.531  -41.761 1.00 42.20 ? 200  PHE B CD2 1 
ATOM   5713 C  CE1 . PHE B 1 200 ? 0.423   10.601  -44.492 1.00 41.89 ? 200  PHE B CE1 1 
ATOM   5714 C  CE2 . PHE B 1 200 ? -0.275  9.972   -42.274 1.00 42.13 ? 200  PHE B CE2 1 
ATOM   5715 C  CZ  . PHE B 1 200 ? -0.517  10.010  -43.641 1.00 41.23 ? 200  PHE B CZ  1 
ATOM   5716 N  N   . GLY B 1 201 ? 5.144   9.530   -41.633 1.00 38.69 ? 201  GLY B N   1 
ATOM   5717 C  CA  . GLY B 1 201 ? 5.473   8.131   -41.649 1.00 38.45 ? 201  GLY B CA  1 
ATOM   5718 C  C   . GLY B 1 201 ? 5.680   7.663   -40.241 1.00 40.56 ? 201  GLY B C   1 
ATOM   5719 O  O   . GLY B 1 201 ? 5.759   8.482   -39.317 1.00 43.02 ? 201  GLY B O   1 
ATOM   5720 N  N   . GLU B 1 202 ? 5.784   6.352   -40.076 1.00 39.45 ? 202  GLU B N   1 
ATOM   5721 C  CA  . GLU B 1 202 ? 5.943   5.764   -38.777 1.00 40.24 ? 202  GLU B CA  1 
ATOM   5722 C  C   . GLU B 1 202 ? 7.146   4.839   -38.747 1.00 40.45 ? 202  GLU B C   1 
ATOM   5723 O  O   . GLU B 1 202 ? 7.458   4.144   -39.722 1.00 40.99 ? 202  GLU B O   1 
ATOM   5724 C  CB  . GLU B 1 202 ? 4.653   5.014   -38.417 1.00 42.32 ? 202  GLU B CB  1 
ATOM   5725 C  CG  . GLU B 1 202 ? 4.528   4.501   -36.989 1.00 44.03 ? 202  GLU B CG  1 
ATOM   5726 C  CD  . GLU B 1 202 ? 5.086   3.104   -36.800 1.00 46.81 ? 202  GLU B CD  1 
ATOM   5727 O  OE1 . GLU B 1 202 ? 5.408   2.459   -37.824 1.00 48.35 ? 202  GLU B OE1 1 
ATOM   5728 O  OE2 . GLU B 1 202 ? 5.197   2.647   -35.630 1.00 47.32 ? 202  GLU B OE2 1 
ATOM   5729 N  N   . SER B 1 203 ? 7.826   4.848   -37.609 1.00 40.62 ? 203  SER B N   1 
ATOM   5730 C  CA  . SER B 1 203 ? 9.003   4.027   -37.387 1.00 40.09 ? 203  SER B CA  1 
ATOM   5731 C  C   . SER B 1 203 ? 10.089  4.280   -38.452 1.00 40.49 ? 203  SER B C   1 
ATOM   5732 O  O   . SER B 1 203 ? 10.555  5.412   -38.598 1.00 39.70 ? 203  SER B O   1 
ATOM   5733 C  CB  . SER B 1 203 ? 8.570   2.578   -37.380 1.00 39.71 ? 203  SER B CB  1 
ATOM   5734 O  OG  . SER B 1 203 ? 9.470   1.861   -36.599 1.00 41.72 ? 203  SER B OG  1 
ATOM   5735 N  N   . ALA B 1 204 ? 10.488  3.246   -39.198 1.00 39.94 ? 204  ALA B N   1 
ATOM   5736 C  CA  . ALA B 1 204 ? 11.487  3.434   -40.247 1.00 38.59 ? 204  ALA B CA  1 
ATOM   5737 C  C   . ALA B 1 204 ? 10.970  4.511   -41.217 1.00 38.03 ? 204  ALA B C   1 
ATOM   5738 O  O   . ALA B 1 204 ? 11.758  5.260   -41.810 1.00 38.15 ? 204  ALA B O   1 
ATOM   5739 C  CB  . ALA B 1 204 ? 11.748  2.119   -40.982 1.00 39.79 ? 204  ALA B CB  1 
ATOM   5740 N  N   . GLY B 1 205 ? 9.644   4.592   -41.354 1.00 36.34 ? 205  GLY B N   1 
ATOM   5741 C  CA  . GLY B 1 205 ? 9.032   5.601   -42.207 1.00 36.92 ? 205  GLY B CA  1 
ATOM   5742 C  C   . GLY B 1 205 ? 9.270   6.995   -41.606 1.00 38.43 ? 205  GLY B C   1 
ATOM   5743 O  O   . GLY B 1 205 ? 9.461   7.993   -42.315 1.00 37.51 ? 205  GLY B O   1 
ATOM   5744 N  N   . ALA B 1 206 ? 9.253   7.061   -40.280 1.00 38.63 ? 206  ALA B N   1 
ATOM   5745 C  CA  . ALA B 1 206 ? 9.489   8.316   -39.581 1.00 39.49 ? 206  ALA B CA  1 
ATOM   5746 C  C   . ALA B 1 206 ? 10.973  8.656   -39.761 1.00 39.73 ? 206  ALA B C   1 
ATOM   5747 O  O   . ALA B 1 206 ? 11.320  9.790   -40.088 1.00 39.02 ? 206  ALA B O   1 
ATOM   5748 C  CB  . ALA B 1 206 ? 9.142   8.169   -38.088 1.00 39.75 ? 206  ALA B CB  1 
ATOM   5749 N  N   . ALA B 1 207 ? 11.846  7.671   -39.579 1.00 39.87 ? 207  ALA B N   1 
ATOM   5750 C  CA  . ALA B 1 207 ? 13.269  7.922   -39.757 1.00 40.33 ? 207  ALA B CA  1 
ATOM   5751 C  C   . ALA B 1 207 ? 13.513  8.362   -41.202 1.00 41.22 ? 207  ALA B C   1 
ATOM   5752 O  O   . ALA B 1 207 ? 14.382  9.219   -41.468 1.00 41.96 ? 207  ALA B O   1 
ATOM   5753 C  CB  . ALA B 1 207 ? 14.075  6.677   -39.448 1.00 39.75 ? 207  ALA B CB  1 
ATOM   5754 N  N   . SER B 1 208 ? 12.754  7.791   -42.143 1.00 40.26 ? 208  SER B N   1 
ATOM   5755 C  CA  . SER B 1 208 ? 12.925  8.191   -43.551 1.00 39.93 ? 208  SER B CA  1 
ATOM   5756 C  C   . SER B 1 208 ? 12.551  9.643   -43.713 1.00 38.13 ? 208  SER B C   1 
ATOM   5757 O  O   . SER B 1 208 ? 13.279  10.400  -44.334 1.00 39.90 ? 208  SER B O   1 
ATOM   5758 C  CB  . SER B 1 208 ? 12.099  7.322   -44.495 1.00 38.03 ? 208  SER B CB  1 
ATOM   5759 O  OG  . SER B 1 208 ? 12.637  6.013   -44.517 1.00 39.73 ? 208  SER B OG  1 
ATOM   5760 N  N   . VAL B 1 209 ? 11.414  10.036  -43.157 1.00 37.59 ? 209  VAL B N   1 
ATOM   5761 C  CA  . VAL B 1 209 ? 11.010  11.440  -43.215 1.00 37.61 ? 209  VAL B CA  1 
ATOM   5762 C  C   . VAL B 1 209 ? 12.176  12.297  -42.650 1.00 38.20 ? 209  VAL B C   1 
ATOM   5763 O  O   . VAL B 1 209 ? 12.585  13.294  -43.254 1.00 38.50 ? 209  VAL B O   1 
ATOM   5764 C  CB  . VAL B 1 209 ? 9.737   11.679  -42.364 1.00 35.83 ? 209  VAL B CB  1 
ATOM   5765 C  CG1 . VAL B 1 209 ? 9.465   13.176  -42.222 1.00 31.41 ? 209  VAL B CG1 1 
ATOM   5766 C  CG2 . VAL B 1 209 ? 8.555   10.997  -43.030 1.00 35.76 ? 209  VAL B CG2 1 
ATOM   5767 N  N   . GLY B 1 210 ? 12.711  11.889  -41.502 1.00 37.83 ? 210  GLY B N   1 
ATOM   5768 C  CA  . GLY B 1 210 ? 13.811  12.611  -40.894 1.00 39.11 ? 210  GLY B CA  1 
ATOM   5769 C  C   . GLY B 1 210 ? 15.007  12.745  -41.820 1.00 39.95 ? 210  GLY B C   1 
ATOM   5770 O  O   . GLY B 1 210 ? 15.687  13.776  -41.855 1.00 39.18 ? 210  GLY B O   1 
ATOM   5771 N  N   . MET B 1 211 ? 15.274  11.699  -42.588 1.00 40.42 ? 211  MET B N   1 
ATOM   5772 C  CA  . MET B 1 211 ? 16.384  11.763  -43.508 1.00 41.45 ? 211  MET B CA  1 
ATOM   5773 C  C   . MET B 1 211 ? 16.141  12.704  -44.676 1.00 42.46 ? 211  MET B C   1 
ATOM   5774 O  O   . MET B 1 211 ? 17.081  13.320  -45.185 1.00 40.37 ? 211  MET B O   1 
ATOM   5775 C  CB  . MET B 1 211 ? 16.752  10.361  -43.964 1.00 45.45 ? 211  MET B CB  1 
ATOM   5776 C  CG  . MET B 1 211 ? 17.778  9.762   -43.001 1.00 48.76 ? 211  MET B CG  1 
ATOM   5777 S  SD  . MET B 1 211 ? 17.744  8.011   -42.964 1.00 55.85 ? 211  MET B SD  1 
ATOM   5778 C  CE  . MET B 1 211 ? 17.783  7.661   -41.172 1.00 51.49 ? 211  MET B CE  1 
ATOM   5779 N  N   . HIS B 1 212 ? 14.886  12.851  -45.093 1.00 41.48 ? 212  HIS B N   1 
ATOM   5780 C  CA  . HIS B 1 212 ? 14.599  13.788  -46.169 1.00 41.23 ? 212  HIS B CA  1 
ATOM   5781 C  C   . HIS B 1 212 ? 14.780  15.203  -45.626 1.00 42.22 ? 212  HIS B C   1 
ATOM   5782 O  O   . HIS B 1 212 ? 15.153  16.109  -46.360 1.00 43.72 ? 212  HIS B O   1 
ATOM   5783 C  CB  . HIS B 1 212 ? 13.181  13.576  -46.708 1.00 37.97 ? 212  HIS B CB  1 
ATOM   5784 C  CG  . HIS B 1 212 ? 13.043  12.323  -47.513 1.00 36.81 ? 212  HIS B CG  1 
ATOM   5785 N  ND1 . HIS B 1 212 ? 13.713  12.130  -48.706 1.00 35.34 ? 212  HIS B ND1 1 
ATOM   5786 C  CD2 . HIS B 1 212 ? 12.406  11.157  -47.244 1.00 34.35 ? 212  HIS B CD2 1 
ATOM   5787 C  CE1 . HIS B 1 212 ? 13.504  10.897  -49.130 1.00 35.43 ? 212  HIS B CE1 1 
ATOM   5788 N  NE2 . HIS B 1 212 ? 12.717  10.287  -48.260 1.00 36.04 ? 212  HIS B NE2 1 
ATOM   5789 N  N   . ILE B 1 213 ? 14.535  15.386  -44.332 1.00 42.03 ? 213  ILE B N   1 
ATOM   5790 C  CA  . ILE B 1 213 ? 14.701  16.693  -43.718 1.00 42.50 ? 213  ILE B CA  1 
ATOM   5791 C  C   . ILE B 1 213 ? 16.193  17.030  -43.701 1.00 43.09 ? 213  ILE B C   1 
ATOM   5792 O  O   . ILE B 1 213 ? 16.595  18.181  -43.868 1.00 43.62 ? 213  ILE B O   1 
ATOM   5793 C  CB  . ILE B 1 213 ? 14.182  16.701  -42.252 1.00 41.36 ? 213  ILE B CB  1 
ATOM   5794 C  CG1 . ILE B 1 213 ? 12.653  16.694  -42.241 1.00 39.31 ? 213  ILE B CG1 1 
ATOM   5795 C  CG2 . ILE B 1 213 ? 14.758  17.925  -41.493 1.00 39.61 ? 213  ILE B CG2 1 
ATOM   5796 C  CD1 . ILE B 1 213 ? 12.021  16.324  -40.895 1.00 36.72 ? 213  ILE B CD1 1 
ATOM   5797 N  N   . LEU B 1 214 ? 17.009  16.004  -43.511 1.00 42.93 ? 214  LEU B N   1 
ATOM   5798 C  CA  . LEU B 1 214 ? 18.450  16.188  -43.430 1.00 42.92 ? 214  LEU B CA  1 
ATOM   5799 C  C   . LEU B 1 214 ? 19.230  16.087  -44.737 1.00 43.35 ? 214  LEU B C   1 
ATOM   5800 O  O   . LEU B 1 214 ? 20.451  16.216  -44.724 1.00 44.18 ? 214  LEU B O   1 
ATOM   5801 C  CB  . LEU B 1 214 ? 19.027  15.195  -42.411 1.00 40.86 ? 214  LEU B CB  1 
ATOM   5802 C  CG  . LEU B 1 214 ? 18.406  15.282  -41.011 1.00 41.80 ? 214  LEU B CG  1 
ATOM   5803 C  CD1 . LEU B 1 214 ? 19.008  14.204  -40.135 1.00 40.92 ? 214  LEU B CD1 1 
ATOM   5804 C  CD2 . LEU B 1 214 ? 18.655  16.684  -40.392 1.00 40.75 ? 214  LEU B CD2 1 
ATOM   5805 N  N   . SER B 1 215 ? 18.553  15.860  -45.861 1.00 44.95 ? 215  SER B N   1 
ATOM   5806 C  CA  . SER B 1 215 ? 19.249  15.753  -47.143 1.00 44.55 ? 215  SER B CA  1 
ATOM   5807 C  C   . SER B 1 215 ? 18.758  16.859  -48.055 1.00 45.60 ? 215  SER B C   1 
ATOM   5808 O  O   . SER B 1 215 ? 17.628  16.843  -48.538 1.00 45.50 ? 215  SER B O   1 
ATOM   5809 C  CB  . SER B 1 215 ? 18.992  14.386  -47.764 1.00 45.68 ? 215  SER B CB  1 
ATOM   5810 O  OG  . SER B 1 215 ? 19.829  14.178  -48.890 1.00 48.63 ? 215  SER B OG  1 
ATOM   5811 N  N   . LEU B 1 216 ? 19.625  17.822  -48.313 1.00 47.36 ? 216  LEU B N   1 
ATOM   5812 C  CA  . LEU B 1 216 ? 19.243  18.971  -49.117 1.00 50.10 ? 216  LEU B CA  1 
ATOM   5813 C  C   . LEU B 1 216 ? 18.383  18.754  -50.368 1.00 50.23 ? 216  LEU B C   1 
ATOM   5814 O  O   . LEU B 1 216 ? 17.351  19.425  -50.541 1.00 51.99 ? 216  LEU B O   1 
ATOM   5815 C  CB  . LEU B 1 216 ? 20.475  19.767  -49.506 1.00 53.66 ? 216  LEU B CB  1 
ATOM   5816 C  CG  . LEU B 1 216 ? 20.074  21.234  -49.699 1.00 57.18 ? 216  LEU B CG  1 
ATOM   5817 C  CD1 . LEU B 1 216 ? 19.845  21.857  -48.298 1.00 58.73 ? 216  LEU B CD1 1 
ATOM   5818 C  CD2 . LEU B 1 216 ? 21.165  21.989  -50.466 1.00 58.33 ? 216  LEU B CD2 1 
ATOM   5819 N  N   . PRO B 1 217 ? 18.787  17.828  -51.260 1.00 48.07 ? 217  PRO B N   1 
ATOM   5820 C  CA  . PRO B 1 217 ? 17.993  17.596  -52.476 1.00 47.45 ? 217  PRO B CA  1 
ATOM   5821 C  C   . PRO B 1 217 ? 16.523  17.254  -52.209 1.00 46.80 ? 217  PRO B C   1 
ATOM   5822 O  O   . PRO B 1 217 ? 15.701  17.422  -53.085 1.00 47.92 ? 217  PRO B O   1 
ATOM   5823 C  CB  . PRO B 1 217 ? 18.727  16.437  -53.172 1.00 47.36 ? 217  PRO B CB  1 
ATOM   5824 C  CG  . PRO B 1 217 ? 20.141  16.544  -52.611 1.00 46.52 ? 217  PRO B CG  1 
ATOM   5825 C  CD  . PRO B 1 217 ? 19.898  16.866  -51.165 1.00 46.12 ? 217  PRO B CD  1 
ATOM   5826 N  N   . SER B 1 218 ? 16.192  16.763  -51.016 1.00 46.78 ? 218  SER B N   1 
ATOM   5827 C  CA  . SER B 1 218 ? 14.800  16.422  -50.701 1.00 45.28 ? 218  SER B CA  1 
ATOM   5828 C  C   . SER B 1 218 ? 14.000  17.626  -50.237 1.00 46.38 ? 218  SER B C   1 
ATOM   5829 O  O   . SER B 1 218 ? 12.797  17.702  -50.465 1.00 45.28 ? 218  SER B O   1 
ATOM   5830 C  CB  . SER B 1 218 ? 14.718  15.352  -49.600 1.00 42.88 ? 218  SER B CB  1 
ATOM   5831 O  OG  . SER B 1 218 ? 14.975  14.048  -50.088 1.00 39.40 ? 218  SER B OG  1 
ATOM   5832 N  N   . ARG B 1 219 ? 14.682  18.566  -49.591 1.00 48.79 ? 219  ARG B N   1 
ATOM   5833 C  CA  . ARG B 1 219 ? 14.034  19.739  -49.027 1.00 50.50 ? 219  ARG B CA  1 
ATOM   5834 C  C   . ARG B 1 219 ? 13.155  20.578  -49.938 1.00 51.13 ? 219  ARG B C   1 
ATOM   5835 O  O   . ARG B 1 219 ? 12.249  21.256  -49.463 1.00 54.06 ? 219  ARG B O   1 
ATOM   5836 C  CB  . ARG B 1 219 ? 15.083  20.612  -48.334 1.00 52.30 ? 219  ARG B CB  1 
ATOM   5837 C  CG  . ARG B 1 219 ? 15.635  19.967  -47.066 1.00 54.84 ? 219  ARG B CG  1 
ATOM   5838 C  CD  . ARG B 1 219 ? 14.525  19.756  -46.035 1.00 55.82 ? 219  ARG B CD  1 
ATOM   5839 N  NE  . ARG B 1 219 ? 14.104  21.028  -45.462 1.00 57.94 ? 219  ARG B NE  1 
ATOM   5840 C  CZ  . ARG B 1 219 ? 14.740  21.646  -44.468 1.00 59.83 ? 219  ARG B CZ  1 
ATOM   5841 N  NH1 . ARG B 1 219 ? 15.825  21.099  -43.923 1.00 57.96 ? 219  ARG B NH1 1 
ATOM   5842 N  NH2 . ARG B 1 219 ? 14.305  22.827  -44.033 1.00 61.10 ? 219  ARG B NH2 1 
ATOM   5843 N  N   . SER B 1 220 ? 13.384  20.535  -51.242 1.00 50.79 ? 220  SER B N   1 
ATOM   5844 C  CA  . SER B 1 220 ? 12.554  21.321  -52.142 1.00 50.12 ? 220  SER B CA  1 
ATOM   5845 C  C   . SER B 1 220 ? 11.323  20.539  -52.579 1.00 49.62 ? 220  SER B C   1 
ATOM   5846 O  O   . SER B 1 220 ? 10.518  21.038  -53.355 1.00 49.72 ? 220  SER B O   1 
ATOM   5847 C  CB  . SER B 1 220 ? 13.357  21.736  -53.379 1.00 51.08 ? 220  SER B CB  1 
ATOM   5848 O  OG  . SER B 1 220 ? 13.963  20.605  -54.001 1.00 55.06 ? 220  SER B OG  1 
ATOM   5849 N  N   . LEU B 1 221 ? 11.174  19.316  -52.077 1.00 48.56 ? 221  LEU B N   1 
ATOM   5850 C  CA  . LEU B 1 221 ? 10.055  18.467  -52.453 1.00 45.52 ? 221  LEU B CA  1 
ATOM   5851 C  C   . LEU B 1 221 ? 8.945   18.409  -51.420 1.00 45.79 ? 221  LEU B C   1 
ATOM   5852 O  O   . LEU B 1 221 ? 7.906   17.803  -51.665 1.00 45.61 ? 221  LEU B O   1 
ATOM   5853 C  CB  . LEU B 1 221 ? 10.555  17.057  -52.730 1.00 43.85 ? 221  LEU B CB  1 
ATOM   5854 C  CG  . LEU B 1 221 ? 11.756  16.983  -53.686 1.00 45.41 ? 221  LEU B CG  1 
ATOM   5855 C  CD1 . LEU B 1 221 ? 12.228  15.526  -53.809 1.00 43.97 ? 221  LEU B CD1 1 
ATOM   5856 C  CD2 . LEU B 1 221 ? 11.375  17.537  -55.055 1.00 41.94 ? 221  LEU B CD2 1 
ATOM   5857 N  N   . PHE B 1 222 ? 9.164   18.998  -50.249 1.00 45.01 ? 222  PHE B N   1 
ATOM   5858 C  CA  . PHE B 1 222 ? 8.117   19.004  -49.222 1.00 45.42 ? 222  PHE B CA  1 
ATOM   5859 C  C   . PHE B 1 222 ? 8.213   20.230  -48.323 1.00 45.27 ? 222  PHE B C   1 
ATOM   5860 O  O   . PHE B 1 222 ? 9.233   20.906  -48.287 1.00 45.20 ? 222  PHE B O   1 
ATOM   5861 C  CB  . PHE B 1 222 ? 8.153   17.726  -48.371 1.00 43.45 ? 222  PHE B CB  1 
ATOM   5862 C  CG  . PHE B 1 222 ? 9.388   17.578  -47.543 1.00 41.05 ? 222  PHE B CG  1 
ATOM   5863 C  CD1 . PHE B 1 222 ? 10.593  17.180  -48.133 1.00 38.42 ? 222  PHE B CD1 1 
ATOM   5864 C  CD2 . PHE B 1 222 ? 9.342   17.812  -46.158 1.00 38.85 ? 222  PHE B CD2 1 
ATOM   5865 C  CE1 . PHE B 1 222 ? 11.749  17.006  -47.357 1.00 40.51 ? 222  PHE B CE1 1 
ATOM   5866 C  CE2 . PHE B 1 222 ? 10.490  17.643  -45.364 1.00 38.59 ? 222  PHE B CE2 1 
ATOM   5867 C  CZ  . PHE B 1 222 ? 11.707  17.236  -45.962 1.00 39.40 ? 222  PHE B CZ  1 
ATOM   5868 N  N   . HIS B 1 223 ? 7.149   20.491  -47.581 1.00 46.12 ? 223  HIS B N   1 
ATOM   5869 C  CA  . HIS B 1 223 ? 7.093   21.671  -46.734 1.00 48.53 ? 223  HIS B CA  1 
ATOM   5870 C  C   . HIS B 1 223 ? 7.007   21.443  -45.237 1.00 47.63 ? 223  HIS B C   1 
ATOM   5871 O  O   . HIS B 1 223 ? 7.534   22.243  -44.471 1.00 49.16 ? 223  HIS B O   1 
ATOM   5872 C  CB  . HIS B 1 223 ? 5.904   22.514  -47.188 1.00 49.83 ? 223  HIS B CB  1 
ATOM   5873 C  CG  . HIS B 1 223 ? 5.838   22.666  -48.674 1.00 51.64 ? 223  HIS B CG  1 
ATOM   5874 N  ND1 . HIS B 1 223 ? 6.688   23.499  -49.374 1.00 51.89 ? 223  HIS B ND1 1 
ATOM   5875 C  CD2 . HIS B 1 223 ? 5.098   22.014  -49.603 1.00 51.20 ? 223  HIS B CD2 1 
ATOM   5876 C  CE1 . HIS B 1 223 ? 6.478   23.350  -50.671 1.00 51.87 ? 223  HIS B CE1 1 
ATOM   5877 N  NE2 . HIS B 1 223 ? 5.521   22.453  -50.836 1.00 52.21 ? 223  HIS B NE2 1 
ATOM   5878 N  N   . ARG B 1 224 ? 6.340   20.365  -44.830 1.00 45.73 ? 224  ARG B N   1 
ATOM   5879 C  CA  . ARG B 1 224 ? 6.155   20.041  -43.422 1.00 43.35 ? 224  ARG B CA  1 
ATOM   5880 C  C   . ARG B 1 224 ? 6.406   18.555  -43.236 1.00 42.66 ? 224  ARG B C   1 
ATOM   5881 O  O   . ARG B 1 224 ? 6.406   17.792  -44.205 1.00 42.58 ? 224  ARG B O   1 
ATOM   5882 C  CB  . ARG B 1 224 ? 4.727   20.367  -42.996 1.00 45.85 ? 224  ARG B CB  1 
ATOM   5883 C  CG  . ARG B 1 224 ? 4.445   21.820  -42.865 1.00 49.46 ? 224  ARG B CG  1 
ATOM   5884 C  CD  . ARG B 1 224 ? 2.975   22.104  -42.671 1.00 50.01 ? 224  ARG B CD  1 
ATOM   5885 N  NE  . ARG B 1 224 ? 2.325   22.408  -43.938 1.00 55.38 ? 224  ARG B NE  1 
ATOM   5886 C  CZ  . ARG B 1 224 ? 2.720   23.348  -44.798 1.00 57.61 ? 224  ARG B CZ  1 
ATOM   5887 N  NH1 . ARG B 1 224 ? 3.779   24.116  -44.545 1.00 57.52 ? 224  ARG B NH1 1 
ATOM   5888 N  NH2 . ARG B 1 224 ? 2.068   23.494  -45.946 1.00 59.67 ? 224  ARG B NH2 1 
ATOM   5889 N  N   . ALA B 1 225 ? 6.595   18.134  -41.989 1.00 40.58 ? 225  ALA B N   1 
ATOM   5890 C  CA  . ALA B 1 225 ? 6.878   16.736  -41.718 1.00 38.73 ? 225  ALA B CA  1 
ATOM   5891 C  C   . ALA B 1 225 ? 6.298   16.239  -40.405 1.00 38.27 ? 225  ALA B C   1 
ATOM   5892 O  O   . ALA B 1 225 ? 6.150   16.995  -39.438 1.00 39.49 ? 225  ALA B O   1 
ATOM   5893 C  CB  . ALA B 1 225 ? 8.390   16.506  -41.735 1.00 36.02 ? 225  ALA B CB  1 
ATOM   5894 N  N   . VAL B 1 226 ? 5.990   14.946  -40.384 1.00 38.64 ? 226  VAL B N   1 
ATOM   5895 C  CA  . VAL B 1 226 ? 5.449   14.277  -39.214 1.00 37.29 ? 226  VAL B CA  1 
ATOM   5896 C  C   . VAL B 1 226 ? 6.233   13.002  -39.021 1.00 38.74 ? 226  VAL B C   1 
ATOM   5897 O  O   . VAL B 1 226 ? 6.305   12.175  -39.929 1.00 40.47 ? 226  VAL B O   1 
ATOM   5898 C  CB  . VAL B 1 226 ? 3.998   13.889  -39.432 1.00 35.84 ? 226  VAL B CB  1 
ATOM   5899 C  CG1 . VAL B 1 226 ? 3.453   13.244  -38.197 1.00 35.99 ? 226  VAL B CG1 1 
ATOM   5900 C  CG2 . VAL B 1 226 ? 3.194   15.113  -39.831 1.00 36.42 ? 226  VAL B CG2 1 
ATOM   5901 N  N   . LEU B 1 227 ? 6.807   12.826  -37.839 1.00 40.31 ? 227  LEU B N   1 
ATOM   5902 C  CA  . LEU B 1 227 ? 7.572   11.621  -37.550 1.00 40.27 ? 227  LEU B CA  1 
ATOM   5903 C  C   . LEU B 1 227 ? 6.923   10.920  -36.369 1.00 41.82 ? 227  LEU B C   1 
ATOM   5904 O  O   . LEU B 1 227 ? 6.979   11.416  -35.238 1.00 42.78 ? 227  LEU B O   1 
ATOM   5905 C  CB  . LEU B 1 227 ? 9.029   11.954  -37.211 1.00 38.00 ? 227  LEU B CB  1 
ATOM   5906 C  CG  . LEU B 1 227 ? 9.883   12.552  -38.334 1.00 37.49 ? 227  LEU B CG  1 
ATOM   5907 C  CD1 . LEU B 1 227 ? 9.675   14.094  -38.437 1.00 33.82 ? 227  LEU B CD1 1 
ATOM   5908 C  CD2 . LEU B 1 227 ? 11.348  12.229  -38.019 1.00 33.76 ? 227  LEU B CD2 1 
ATOM   5909 N  N   . GLN B 1 228 ? 6.312   9.771   -36.637 1.00 40.61 ? 228  GLN B N   1 
ATOM   5910 C  CA  . GLN B 1 228 ? 5.639   8.998   -35.609 1.00 39.11 ? 228  GLN B CA  1 
ATOM   5911 C  C   . GLN B 1 228 ? 6.512   7.832   -35.160 1.00 40.00 ? 228  GLN B C   1 
ATOM   5912 O  O   . GLN B 1 228 ? 6.854   6.937   -35.950 1.00 39.65 ? 228  GLN B O   1 
ATOM   5913 C  CB  . GLN B 1 228 ? 4.321   8.458   -36.160 1.00 39.36 ? 228  GLN B CB  1 
ATOM   5914 C  CG  . GLN B 1 228 ? 3.417   9.523   -36.762 1.00 40.93 ? 228  GLN B CG  1 
ATOM   5915 C  CD  . GLN B 1 228 ? 2.186   8.939   -37.487 1.00 43.57 ? 228  GLN B CD  1 
ATOM   5916 O  OE1 . GLN B 1 228 ? 1.587   9.605   -38.336 1.00 44.11 ? 228  GLN B OE1 1 
ATOM   5917 N  NE2 . GLN B 1 228 ? 1.805   7.704   -37.143 1.00 41.68 ? 228  GLN B NE2 1 
ATOM   5918 N  N   . SER B 1 229 ? 6.876   7.841   -33.888 1.00 38.89 ? 229  SER B N   1 
ATOM   5919 C  CA  . SER B 1 229 ? 7.692   6.780   -33.307 1.00 38.92 ? 229  SER B CA  1 
ATOM   5920 C  C   . SER B 1 229 ? 8.929   6.402   -34.100 1.00 38.68 ? 229  SER B C   1 
ATOM   5921 O  O   . SER B 1 229 ? 9.193   5.218   -34.283 1.00 38.50 ? 229  SER B O   1 
ATOM   5922 C  CB  . SER B 1 229 ? 6.857   5.515   -33.098 1.00 38.89 ? 229  SER B CB  1 
ATOM   5923 O  OG  . SER B 1 229 ? 5.703   5.788   -32.335 1.00 38.07 ? 229  SER B OG  1 
ATOM   5924 N  N   . GLY B 1 230 ? 9.688   7.394   -34.552 1.00 37.81 ? 230  GLY B N   1 
ATOM   5925 C  CA  . GLY B 1 230 ? 10.909  7.100   -35.286 1.00 37.88 ? 230  GLY B CA  1 
ATOM   5926 C  C   . GLY B 1 230 ? 11.693  8.354   -35.609 1.00 37.79 ? 230  GLY B C   1 
ATOM   5927 O  O   . GLY B 1 230 ? 11.110  9.430   -35.770 1.00 38.14 ? 230  GLY B O   1 
ATOM   5928 N  N   . THR B 1 231 ? 13.008  8.222   -35.753 1.00 37.75 ? 231  THR B N   1 
ATOM   5929 C  CA  . THR B 1 231 ? 13.861  9.387   -36.023 1.00 37.91 ? 231  THR B CA  1 
ATOM   5930 C  C   . THR B 1 231 ? 15.065  9.006   -36.848 1.00 36.56 ? 231  THR B C   1 
ATOM   5931 O  O   . THR B 1 231 ? 15.458  7.858   -36.854 1.00 36.41 ? 231  THR B O   1 
ATOM   5932 C  CB  . THR B 1 231 ? 14.435  9.990   -34.690 1.00 38.99 ? 231  THR B CB  1 
ATOM   5933 O  OG1 . THR B 1 231 ? 15.214  8.989   -34.026 1.00 39.61 ? 231  THR B OG1 1 
ATOM   5934 C  CG2 . THR B 1 231 ? 13.318  10.442  -33.750 1.00 38.42 ? 231  THR B CG2 1 
ATOM   5935 N  N   . PRO B 1 232 ? 15.691  9.974   -37.532 1.00 36.72 ? 232  PRO B N   1 
ATOM   5936 C  CA  . PRO B 1 232 ? 16.874  9.625   -38.332 1.00 38.17 ? 232  PRO B CA  1 
ATOM   5937 C  C   . PRO B 1 232 ? 18.064  9.334   -37.418 1.00 39.95 ? 232  PRO B C   1 
ATOM   5938 O  O   . PRO B 1 232 ? 18.900  8.498   -37.731 1.00 42.84 ? 232  PRO B O   1 
ATOM   5939 C  CB  . PRO B 1 232 ? 17.087  10.854  -39.226 1.00 36.29 ? 232  PRO B CB  1 
ATOM   5940 C  CG  . PRO B 1 232 ? 16.516  11.978  -38.385 1.00 37.82 ? 232  PRO B CG  1 
ATOM   5941 C  CD  . PRO B 1 232 ? 15.288  11.375  -37.748 1.00 36.08 ? 232  PRO B CD  1 
ATOM   5942 N  N   . ASN B 1 233 ? 18.135  10.026  -36.287 1.00 40.89 ? 233  ASN B N   1 
ATOM   5943 C  CA  . ASN B 1 233 ? 19.194  9.816   -35.307 1.00 40.31 ? 233  ASN B CA  1 
ATOM   5944 C  C   . ASN B 1 233 ? 18.751  8.622   -34.475 1.00 41.48 ? 233  ASN B C   1 
ATOM   5945 O  O   . ASN B 1 233 ? 17.610  8.161   -34.588 1.00 40.79 ? 233  ASN B O   1 
ATOM   5946 C  CB  . ASN B 1 233 ? 19.317  11.038  -34.383 1.00 41.83 ? 233  ASN B CB  1 
ATOM   5947 C  CG  . ASN B 1 233 ? 17.991  11.392  -33.709 1.00 41.57 ? 233  ASN B CG  1 
ATOM   5948 O  OD1 . ASN B 1 233 ? 17.041  11.845  -34.353 1.00 41.80 ? 233  ASN B OD1 1 
ATOM   5949 N  ND2 . ASN B 1 233 ? 17.921  11.169  -32.415 1.00 41.85 ? 233  ASN B ND2 1 
ATOM   5950 N  N   . GLY B 1 234 ? 19.620  8.147   -33.592 1.00 42.13 ? 234  GLY B N   1 
ATOM   5951 C  CA  . GLY B 1 234 ? 19.250  6.991   -32.796 1.00 42.58 ? 234  GLY B CA  1 
ATOM   5952 C  C   . GLY B 1 234 ? 20.121  5.799   -33.153 1.00 44.23 ? 234  GLY B C   1 
ATOM   5953 O  O   . GLY B 1 234 ? 20.805  5.808   -34.172 1.00 44.50 ? 234  GLY B O   1 
ATOM   5954 N  N   . PRO B 1 235 ? 20.061  4.724   -32.365 1.00 45.31 ? 235  PRO B N   1 
ATOM   5955 C  CA  . PRO B 1 235 ? 20.853  3.509   -32.558 1.00 45.83 ? 235  PRO B CA  1 
ATOM   5956 C  C   . PRO B 1 235 ? 20.557  2.536   -33.681 1.00 46.08 ? 235  PRO B C   1 
ATOM   5957 O  O   . PRO B 1 235 ? 21.395  1.681   -33.961 1.00 47.57 ? 235  PRO B O   1 
ATOM   5958 C  CB  . PRO B 1 235 ? 20.737  2.819   -31.210 1.00 46.60 ? 235  PRO B CB  1 
ATOM   5959 C  CG  . PRO B 1 235 ? 19.281  3.084   -30.858 1.00 46.77 ? 235  PRO B CG  1 
ATOM   5960 C  CD  . PRO B 1 235 ? 19.046  4.533   -31.310 1.00 45.09 ? 235  PRO B CD  1 
ATOM   5961 N  N   . TRP B 1 236 ? 19.410  2.651   -34.342 1.00 45.82 ? 236  TRP B N   1 
ATOM   5962 C  CA  . TRP B 1 236 ? 19.071  1.673   -35.384 1.00 44.35 ? 236  TRP B CA  1 
ATOM   5963 C  C   . TRP B 1 236 ? 18.833  2.138   -36.808 1.00 44.59 ? 236  TRP B C   1 
ATOM   5964 O  O   . TRP B 1 236 ? 18.942  1.340   -37.750 1.00 46.97 ? 236  TRP B O   1 
ATOM   5965 C  CB  . TRP B 1 236 ? 17.832  0.914   -34.949 1.00 43.74 ? 236  TRP B CB  1 
ATOM   5966 C  CG  . TRP B 1 236 ? 16.676  1.833   -34.678 1.00 45.00 ? 236  TRP B CG  1 
ATOM   5967 C  CD1 . TRP B 1 236 ? 16.346  2.420   -33.476 1.00 44.03 ? 236  TRP B CD1 1 
ATOM   5968 C  CD2 . TRP B 1 236 ? 15.724  2.320   -35.631 1.00 45.09 ? 236  TRP B CD2 1 
ATOM   5969 N  NE1 . TRP B 1 236 ? 15.255  3.238   -33.629 1.00 43.33 ? 236  TRP B NE1 1 
ATOM   5970 C  CE2 . TRP B 1 236 ? 14.849  3.199   -34.937 1.00 45.85 ? 236  TRP B CE2 1 
ATOM   5971 C  CE3 . TRP B 1 236 ? 15.521  2.100   -37.001 1.00 45.82 ? 236  TRP B CE3 1 
ATOM   5972 C  CZ2 . TRP B 1 236 ? 13.785  3.855   -35.571 1.00 45.17 ? 236  TRP B CZ2 1 
ATOM   5973 C  CZ3 . TRP B 1 236 ? 14.455  2.757   -37.638 1.00 46.03 ? 236  TRP B CZ3 1 
ATOM   5974 C  CH2 . TRP B 1 236 ? 13.601  3.626   -36.915 1.00 45.79 ? 236  TRP B CH2 1 
ATOM   5975 N  N   . ALA B 1 237 ? 18.497  3.409   -36.978 1.00 44.31 ? 237  ALA B N   1 
ATOM   5976 C  CA  . ALA B 1 237 ? 18.175  3.957   -38.286 1.00 42.47 ? 237  ALA B CA  1 
ATOM   5977 C  C   . ALA B 1 237 ? 19.321  4.111   -39.297 1.00 42.86 ? 237  ALA B C   1 
ATOM   5978 O  O   . ALA B 1 237 ? 19.074  4.206   -40.510 1.00 43.23 ? 237  ALA B O   1 
ATOM   5979 C  CB  . ALA B 1 237 ? 17.445  5.285   -38.107 1.00 42.92 ? 237  ALA B CB  1 
ATOM   5980 N  N   . THR B 1 238 ? 20.564  4.146   -38.825 1.00 41.33 ? 238  THR B N   1 
ATOM   5981 C  CA  . THR B 1 238 ? 21.708  4.286   -39.737 1.00 41.36 ? 238  THR B CA  1 
ATOM   5982 C  C   . THR B 1 238 ? 22.877  3.403   -39.323 1.00 42.60 ? 238  THR B C   1 
ATOM   5983 O  O   . THR B 1 238 ? 22.905  2.865   -38.221 1.00 44.09 ? 238  THR B O   1 
ATOM   5984 C  CB  . THR B 1 238 ? 22.276  5.742   -39.787 1.00 39.71 ? 238  THR B CB  1 
ATOM   5985 O  OG1 . THR B 1 238 ? 22.755  6.111   -38.487 1.00 40.45 ? 238  THR B OG1 1 
ATOM   5986 C  CG2 . THR B 1 238 ? 21.231  6.733   -40.243 1.00 37.56 ? 238  THR B CG2 1 
ATOM   5987 N  N   . VAL B 1 239 ? 23.824  3.233   -40.234 1.00 43.15 ? 239  VAL B N   1 
ATOM   5988 C  CA  . VAL B 1 239 ? 25.044  2.491   -39.960 1.00 44.31 ? 239  VAL B CA  1 
ATOM   5989 C  C   . VAL B 1 239 ? 26.145  3.267   -40.668 1.00 45.74 ? 239  VAL B C   1 
ATOM   5990 O  O   . VAL B 1 239 ? 25.881  4.063   -41.590 1.00 47.02 ? 239  VAL B O   1 
ATOM   5991 C  CB  . VAL B 1 239 ? 25.017  1.018   -40.480 1.00 44.67 ? 239  VAL B CB  1 
ATOM   5992 C  CG1 . VAL B 1 239 ? 24.003  0.218   -39.682 1.00 42.76 ? 239  VAL B CG1 1 
ATOM   5993 C  CG2 . VAL B 1 239 ? 24.712  0.971   -41.982 1.00 42.01 ? 239  VAL B CG2 1 
ATOM   5994 N  N   . SER B 1 240 ? 27.372  3.064   -40.216 1.00 45.99 ? 240  SER B N   1 
ATOM   5995 C  CA  . SER B 1 240 ? 28.530  3.739   -40.809 1.00 46.30 ? 240  SER B CA  1 
ATOM   5996 C  C   . SER B 1 240 ? 28.840  3.068   -42.131 1.00 46.23 ? 240  SER B C   1 
ATOM   5997 O  O   . SER B 1 240 ? 28.419  1.932   -42.371 1.00 44.24 ? 240  SER B O   1 
ATOM   5998 C  CB  . SER B 1 240 ? 29.752  3.558   -39.909 1.00 46.29 ? 240  SER B CB  1 
ATOM   5999 O  OG  . SER B 1 240 ? 30.046  2.165   -39.785 1.00 47.20 ? 240  SER B OG  1 
ATOM   6000 N  N   . ALA B 1 241 ? 29.601  3.753   -42.977 1.00 47.86 ? 241  ALA B N   1 
ATOM   6001 C  CA  . ALA B 1 241 ? 29.994  3.170   -44.255 1.00 49.45 ? 241  ALA B CA  1 
ATOM   6002 C  C   . ALA B 1 241 ? 30.738  1.868   -43.967 1.00 50.45 ? 241  ALA B C   1 
ATOM   6003 O  O   . ALA B 1 241 ? 30.539  0.851   -44.644 1.00 49.92 ? 241  ALA B O   1 
ATOM   6004 C  CB  . ALA B 1 241 ? 30.888  4.118   -45.012 1.00 47.77 ? 241  ALA B CB  1 
ATOM   6005 N  N   . GLY B 1 242 ? 31.584  1.908   -42.940 1.00 51.28 ? 242  GLY B N   1 
ATOM   6006 C  CA  . GLY B 1 242 ? 32.341  0.730   -42.559 1.00 51.26 ? 242  GLY B CA  1 
ATOM   6007 C  C   . GLY B 1 242 ? 31.472  -0.449  -42.199 1.00 51.05 ? 242  GLY B C   1 
ATOM   6008 O  O   . GLY B 1 242 ? 31.689  -1.559  -42.672 1.00 53.30 ? 242  GLY B O   1 
ATOM   6009 N  N   . GLU B 1 243 ? 30.476  -0.222  -41.365 1.00 51.58 ? 243  GLU B N   1 
ATOM   6010 C  CA  . GLU B 1 243 ? 29.612  -1.311  -40.953 1.00 51.07 ? 243  GLU B CA  1 
ATOM   6011 C  C   . GLU B 1 243 ? 28.750  -1.833  -42.111 1.00 50.96 ? 243  GLU B C   1 
ATOM   6012 O  O   . GLU B 1 243 ? 28.448  -3.035  -42.174 1.00 52.24 ? 243  GLU B O   1 
ATOM   6013 C  CB  . GLU B 1 243 ? 28.745  -0.856  -39.778 1.00 51.02 ? 243  GLU B CB  1 
ATOM   6014 C  CG  . GLU B 1 243 ? 27.759  -1.902  -39.258 1.00 51.64 ? 243  GLU B CG  1 
ATOM   6015 C  CD  . GLU B 1 243 ? 28.444  -3.127  -38.675 1.00 52.97 ? 243  GLU B CD  1 
ATOM   6016 O  OE1 . GLU B 1 243 ? 27.721  -4.017  -38.174 1.00 49.88 ? 243  GLU B OE1 1 
ATOM   6017 O  OE2 . GLU B 1 243 ? 29.698  -3.201  -38.713 1.00 55.43 ? 243  GLU B OE2 1 
ATOM   6018 N  N   . ALA B 1 244 ? 28.357  -0.947  -43.033 1.00 49.97 ? 244  ALA B N   1 
ATOM   6019 C  CA  . ALA B 1 244 ? 27.537  -1.365  -44.188 1.00 48.61 ? 244  ALA B CA  1 
ATOM   6020 C  C   . ALA B 1 244 ? 28.382  -2.305  -45.051 1.00 48.52 ? 244  ALA B C   1 
ATOM   6021 O  O   . ALA B 1 244 ? 27.952  -3.398  -45.410 1.00 47.29 ? 244  ALA B O   1 
ATOM   6022 C  CB  . ALA B 1 244 ? 27.103  -0.165  -45.000 1.00 45.54 ? 244  ALA B CB  1 
ATOM   6023 N  N   . ARG B 1 245 ? 29.604  -1.880  -45.344 1.00 49.68 ? 245  ARG B N   1 
ATOM   6024 C  CA  . ARG B 1 245 ? 30.513  -2.694  -46.136 1.00 52.31 ? 245  ARG B CA  1 
ATOM   6025 C  C   . ARG B 1 245 ? 30.714  -4.066  -45.503 1.00 53.51 ? 245  ARG B C   1 
ATOM   6026 O  O   . ARG B 1 245 ? 30.675  -5.099  -46.179 1.00 53.99 ? 245  ARG B O   1 
ATOM   6027 C  CB  . ARG B 1 245 ? 31.862  -2.004  -46.278 1.00 53.25 ? 245  ARG B CB  1 
ATOM   6028 C  CG  . ARG B 1 245 ? 32.822  -2.763  -47.197 1.00 53.87 ? 245  ARG B CG  1 
ATOM   6029 C  CD  . ARG B 1 245 ? 34.039  -1.934  -47.461 1.00 54.36 ? 245  ARG B CD  1 
ATOM   6030 N  NE  . ARG B 1 245 ? 33.815  -0.950  -48.511 1.00 55.06 ? 245  ARG B NE  1 
ATOM   6031 C  CZ  . ARG B 1 245 ? 33.657  -1.275  -49.785 1.00 56.28 ? 245  ARG B CZ  1 
ATOM   6032 N  NH1 . ARG B 1 245 ? 33.459  -0.337  -50.704 1.00 54.59 ? 245  ARG B NH1 1 
ATOM   6033 N  NH2 . ARG B 1 245 ? 33.701  -2.554  -50.134 1.00 58.29 ? 245  ARG B NH2 1 
ATOM   6034 N  N   . ARG B 1 246 ? 30.917  -4.076  -44.196 1.00 54.26 ? 246  ARG B N   1 
ATOM   6035 C  CA  . ARG B 1 246 ? 31.117  -5.327  -43.500 1.00 55.63 ? 246  ARG B CA  1 
ATOM   6036 C  C   . ARG B 1 246 ? 29.943  -6.274  -43.734 1.00 55.88 ? 246  ARG B C   1 
ATOM   6037 O  O   . ARG B 1 246 ? 30.123  -7.408  -44.182 1.00 56.80 ? 246  ARG B O   1 
ATOM   6038 C  CB  . ARG B 1 246 ? 31.262  -5.077  -41.998 1.00 56.83 ? 246  ARG B CB  1 
ATOM   6039 C  CG  . ARG B 1 246 ? 31.879  -6.236  -41.260 1.00 57.10 ? 246  ARG B CG  1 
ATOM   6040 C  CD  . ARG B 1 246 ? 31.471  -6.229  -39.818 1.00 57.76 ? 246  ARG B CD  1 
ATOM   6041 N  NE  . ARG B 1 246 ? 30.512  -7.296  -39.573 1.00 61.15 ? 246  ARG B NE  1 
ATOM   6042 C  CZ  . ARG B 1 246 ? 29.300  -7.097  -39.076 1.00 61.08 ? 246  ARG B CZ  1 
ATOM   6043 N  NH1 . ARG B 1 246 ? 28.915  -5.870  -38.777 1.00 61.50 ? 246  ARG B NH1 1 
ATOM   6044 N  NH2 . ARG B 1 246 ? 28.481  -8.116  -38.878 1.00 61.89 ? 246  ARG B NH2 1 
ATOM   6045 N  N   . ARG B 1 247 ? 28.739  -5.801  -43.423 1.00 55.85 ? 247  ARG B N   1 
ATOM   6046 C  CA  . ARG B 1 247 ? 27.542  -6.617  -43.571 1.00 53.28 ? 247  ARG B CA  1 
ATOM   6047 C  C   . ARG B 1 247 ? 27.307  -7.055  -45.011 1.00 52.74 ? 247  ARG B C   1 
ATOM   6048 O  O   . ARG B 1 247 ? 26.860  -8.184  -45.260 1.00 51.76 ? 247  ARG B O   1 
ATOM   6049 C  CB  . ARG B 1 247 ? 26.324  -5.852  -43.046 1.00 52.96 ? 247  ARG B CB  1 
ATOM   6050 C  CG  . ARG B 1 247 ? 26.481  -5.306  -41.617 1.00 51.86 ? 247  ARG B CG  1 
ATOM   6051 C  CD  . ARG B 1 247 ? 25.174  -4.686  -41.102 1.00 52.49 ? 247  ARG B CD  1 
ATOM   6052 N  NE  . ARG B 1 247 ? 25.289  -4.105  -39.764 1.00 52.87 ? 247  ARG B NE  1 
ATOM   6053 C  CZ  . ARG B 1 247 ? 24.262  -3.640  -39.050 1.00 53.65 ? 247  ARG B CZ  1 
ATOM   6054 N  NH1 . ARG B 1 247 ? 23.026  -3.683  -39.536 1.00 54.15 ? 247  ARG B NH1 1 
ATOM   6055 N  NH2 . ARG B 1 247 ? 24.465  -3.119  -37.847 1.00 51.68 ? 247  ARG B NH2 1 
ATOM   6056 N  N   . ALA B 1 248 ? 27.614  -6.171  -45.959 1.00 52.44 ? 248  ALA B N   1 
ATOM   6057 C  CA  . ALA B 1 248 ? 27.413  -6.477  -47.377 1.00 53.33 ? 248  ALA B CA  1 
ATOM   6058 C  C   . ALA B 1 248 ? 28.337  -7.599  -47.832 1.00 55.02 ? 248  ALA B C   1 
ATOM   6059 O  O   . ALA B 1 248 ? 27.902  -8.568  -48.470 1.00 54.84 ? 248  ALA B O   1 
ATOM   6060 C  CB  . ALA B 1 248 ? 27.655  -5.238  -48.224 1.00 51.08 ? 248  ALA B CB  1 
ATOM   6061 N  N   . THR B 1 249 ? 29.618  -7.469  -47.495 1.00 55.65 ? 249  THR B N   1 
ATOM   6062 C  CA  . THR B 1 249 ? 30.586  -8.481  -47.876 1.00 56.57 ? 249  THR B CA  1 
ATOM   6063 C  C   . THR B 1 249 ? 30.262  -9.796  -47.143 1.00 56.37 ? 249  THR B C   1 
ATOM   6064 O  O   . THR B 1 249 ? 30.357  -10.882 -47.725 1.00 57.68 ? 249  THR B O   1 
ATOM   6065 C  CB  . THR B 1 249 ? 32.035  -8.013  -47.570 1.00 57.00 ? 249  THR B CB  1 
ATOM   6066 O  OG1 . THR B 1 249 ? 32.196  -7.917  -46.159 1.00 63.90 ? 249  THR B OG1 1 
ATOM   6067 C  CG2 . THR B 1 249 ? 32.307  -6.625  -48.153 1.00 54.41 ? 249  THR B CG2 1 
ATOM   6068 N  N   . LEU B 1 250 ? 29.840  -9.706  -45.888 1.00 54.61 ? 250  LEU B N   1 
ATOM   6069 C  CA  . LEU B 1 250 ? 29.500  -10.915 -45.152 1.00 55.85 ? 250  LEU B CA  1 
ATOM   6070 C  C   . LEU B 1 250 ? 28.301  -11.621 -45.775 1.00 56.74 ? 250  LEU B C   1 
ATOM   6071 O  O   . LEU B 1 250 ? 28.246  -12.867 -45.832 1.00 57.64 ? 250  LEU B O   1 
ATOM   6072 C  CB  . LEU B 1 250 ? 29.211  -10.602 -43.678 1.00 55.38 ? 250  LEU B CB  1 
ATOM   6073 C  CG  . LEU B 1 250 ? 28.686  -11.786 -42.845 1.00 56.57 ? 250  LEU B CG  1 
ATOM   6074 C  CD1 . LEU B 1 250 ? 29.619  -12.985 -42.988 1.00 55.42 ? 250  LEU B CD1 1 
ATOM   6075 C  CD2 . LEU B 1 250 ? 28.562  -11.388 -41.382 1.00 53.90 ? 250  LEU B CD2 1 
ATOM   6076 N  N   . LEU B 1 251 ? 27.334  -10.842 -46.245 1.00 56.88 ? 251  LEU B N   1 
ATOM   6077 C  CA  . LEU B 1 251 ? 26.161  -11.446 -46.869 1.00 57.59 ? 251  LEU B CA  1 
ATOM   6078 C  C   . LEU B 1 251 ? 26.583  -12.085 -48.197 1.00 58.21 ? 251  LEU B C   1 
ATOM   6079 O  O   . LEU B 1 251 ? 26.093  -13.155 -48.579 1.00 56.26 ? 251  LEU B O   1 
ATOM   6080 C  CB  . LEU B 1 251 ? 25.088  -10.399 -47.129 1.00 58.70 ? 251  LEU B CB  1 
ATOM   6081 C  CG  . LEU B 1 251 ? 23.927  -10.999 -47.916 1.00 59.38 ? 251  LEU B CG  1 
ATOM   6082 C  CD1 . LEU B 1 251 ? 22.942  -11.676 -46.973 1.00 58.74 ? 251  LEU B CD1 1 
ATOM   6083 C  CD2 . LEU B 1 251 ? 23.272  -9.904  -48.715 1.00 60.09 ? 251  LEU B CD2 1 
ATOM   6084 N  N   . ALA B 1 252 ? 27.493  -11.413 -48.899 1.00 59.50 ? 252  ALA B N   1 
ATOM   6085 C  CA  . ALA B 1 252 ? 28.000  -11.912 -50.172 1.00 61.29 ? 252  ALA B CA  1 
ATOM   6086 C  C   . ALA B 1 252 ? 28.561  -13.300 -49.911 1.00 63.25 ? 252  ALA B C   1 
ATOM   6087 O  O   . ALA B 1 252 ? 28.196  -14.283 -50.562 1.00 63.93 ? 252  ALA B O   1 
ATOM   6088 C  CB  . ALA B 1 252 ? 29.096  -10.994 -50.693 1.00 59.91 ? 252  ALA B CB  1 
ATOM   6089 N  N   . ARG B 1 253 ? 29.436  -13.376 -48.922 1.00 64.09 ? 253  ARG B N   1 
ATOM   6090 C  CA  . ARG B 1 253 ? 30.057  -14.627 -48.560 1.00 64.75 ? 253  ARG B CA  1 
ATOM   6091 C  C   . ARG B 1 253 ? 28.995  -15.686 -48.256 1.00 64.26 ? 253  ARG B C   1 
ATOM   6092 O  O   . ARG B 1 253 ? 29.024  -16.782 -48.816 1.00 65.20 ? 253  ARG B O   1 
ATOM   6093 C  CB  . ARG B 1 253 ? 30.961  -14.377 -47.360 1.00 68.23 ? 253  ARG B CB  1 
ATOM   6094 C  CG  . ARG B 1 253 ? 31.947  -15.456 -47.056 1.00 72.54 ? 253  ARG B CG  1 
ATOM   6095 C  CD  . ARG B 1 253 ? 32.886  -14.986 -45.963 1.00 76.77 ? 253  ARG B CD  1 
ATOM   6096 N  NE  . ARG B 1 253 ? 33.461  -16.106 -45.220 1.00 81.42 ? 253  ARG B NE  1 
ATOM   6097 C  CZ  . ARG B 1 253 ? 32.867  -16.744 -44.206 1.00 83.71 ? 253  ARG B CZ  1 
ATOM   6098 N  NH1 . ARG B 1 253 ? 31.659  -16.385 -43.777 1.00 82.86 ? 253  ARG B NH1 1 
ATOM   6099 N  NH2 . ARG B 1 253 ? 33.490  -17.765 -43.621 1.00 84.48 ? 253  ARG B NH2 1 
ATOM   6100 N  N   . LEU B 1 254 ? 28.034  -15.364 -47.403 1.00 63.27 ? 254  LEU B N   1 
ATOM   6101 C  CA  . LEU B 1 254 ? 27.005  -16.343 -47.058 1.00 62.93 ? 254  LEU B CA  1 
ATOM   6102 C  C   . LEU B 1 254 ? 26.247  -16.950 -48.240 1.00 63.43 ? 254  LEU B C   1 
ATOM   6103 O  O   . LEU B 1 254 ? 25.679  -18.046 -48.121 1.00 62.04 ? 254  LEU B O   1 
ATOM   6104 C  CB  . LEU B 1 254 ? 26.014  -15.739 -46.064 1.00 62.74 ? 254  LEU B CB  1 
ATOM   6105 C  CG  . LEU B 1 254 ? 26.600  -15.402 -44.684 1.00 63.26 ? 254  LEU B CG  1 
ATOM   6106 C  CD1 . LEU B 1 254 ? 25.568  -14.712 -43.802 1.00 61.00 ? 254  LEU B CD1 1 
ATOM   6107 C  CD2 . LEU B 1 254 ? 27.065  -16.689 -44.030 1.00 61.47 ? 254  LEU B CD2 1 
ATOM   6108 N  N   . VAL B 1 255 ? 26.230  -16.253 -49.374 1.00 63.99 ? 255  VAL B N   1 
ATOM   6109 C  CA  . VAL B 1 255 ? 25.525  -16.781 -50.548 1.00 66.12 ? 255  VAL B CA  1 
ATOM   6110 C  C   . VAL B 1 255 ? 26.460  -17.239 -51.671 1.00 67.07 ? 255  VAL B C   1 
ATOM   6111 O  O   . VAL B 1 255 ? 26.026  -17.460 -52.797 1.00 67.63 ? 255  VAL B O   1 
ATOM   6112 C  CB  . VAL B 1 255 ? 24.496  -15.762 -51.138 1.00 64.26 ? 255  VAL B CB  1 
ATOM   6113 C  CG1 . VAL B 1 255 ? 23.370  -15.546 -50.156 1.00 64.23 ? 255  VAL B CG1 1 
ATOM   6114 C  CG2 . VAL B 1 255 ? 25.175  -14.458 -51.494 1.00 62.17 ? 255  VAL B CG2 1 
ATOM   6115 N  N   . GLY B 1 256 ? 27.744  -17.365 -51.360 1.00 67.79 ? 256  GLY B N   1 
ATOM   6116 C  CA  . GLY B 1 256 ? 28.686  -17.837 -52.349 1.00 70.07 ? 256  GLY B CA  1 
ATOM   6117 C  C   . GLY B 1 256 ? 29.357  -16.823 -53.250 1.00 72.75 ? 256  GLY B C   1 
ATOM   6118 O  O   . GLY B 1 256 ? 29.823  -17.172 -54.334 1.00 73.60 ? 256  GLY B O   1 
ATOM   6119 N  N   . CYS B 1 257 ? 29.423  -15.570 -52.837 1.00 74.37 ? 257  CYS B N   1 
ATOM   6120 C  CA  . CYS B 1 257 ? 30.084  -14.571 -53.668 1.00 76.99 ? 257  CYS B CA  1 
ATOM   6121 C  C   . CYS B 1 257 ? 31.178  -13.970 -52.810 1.00 79.98 ? 257  CYS B C   1 
ATOM   6122 O  O   . CYS B 1 257 ? 30.945  -13.675 -51.640 1.00 80.64 ? 257  CYS B O   1 
ATOM   6123 C  CB  . CYS B 1 257 ? 29.106  -13.468 -54.061 1.00 75.39 ? 257  CYS B CB  1 
ATOM   6124 S  SG  . CYS B 1 257 ? 27.634  -13.901 -55.055 1.00 75.60 ? 257  CYS B SG  1 
ATOM   6125 N  N   . PRO B 1 258 ? 32.382  -13.725 -53.360 1.00 82.82 ? 258  PRO B N   1 
ATOM   6126 C  CA  . PRO B 1 258 ? 33.050  -13.867 -54.656 1.00 84.31 ? 258  PRO B CA  1 
ATOM   6127 C  C   . PRO B 1 258 ? 33.470  -15.295 -54.986 1.00 85.47 ? 258  PRO B C   1 
ATOM   6128 O  O   . PRO B 1 258 ? 32.646  -16.110 -55.403 1.00 85.98 ? 258  PRO B O   1 
ATOM   6129 C  CB  . PRO B 1 258 ? 34.247  -12.926 -54.512 1.00 85.23 ? 258  PRO B CB  1 
ATOM   6130 C  CG  . PRO B 1 258 ? 34.641  -13.142 -53.077 1.00 85.25 ? 258  PRO B CG  1 
ATOM   6131 C  CD  . PRO B 1 258 ? 33.289  -13.093 -52.385 1.00 84.42 ? 258  PRO B CD  1 
ATOM   6132 N  N   . ASN B 1 265 ? 37.605  -6.596  -54.965 1.00 75.08 ? 265  ASN B N   1 
ATOM   6133 C  CA  . ASN B 1 265 ? 37.008  -5.750  -56.002 1.00 75.77 ? 265  ASN B CA  1 
ATOM   6134 C  C   . ASN B 1 265 ? 35.470  -5.708  -55.895 1.00 73.94 ? 265  ASN B C   1 
ATOM   6135 O  O   . ASN B 1 265 ? 34.808  -6.754  -55.942 1.00 73.46 ? 265  ASN B O   1 
ATOM   6136 C  CB  . ASN B 1 265 ? 37.436  -6.266  -57.378 1.00 77.99 ? 265  ASN B CB  1 
ATOM   6137 C  CG  . ASN B 1 265 ? 36.813  -5.486  -58.511 1.00 80.61 ? 265  ASN B CG  1 
ATOM   6138 O  OD1 . ASN B 1 265 ? 35.633  -5.661  -58.820 1.00 82.38 ? 265  ASN B OD1 1 
ATOM   6139 N  ND2 . ASN B 1 265 ? 37.599  -4.609  -59.135 1.00 81.49 ? 265  ASN B ND2 1 
ATOM   6140 N  N   . ASP B 1 266 ? 34.906  -4.506  -55.758 1.00 71.45 ? 266  ASP B N   1 
ATOM   6141 C  CA  . ASP B 1 266 ? 33.449  -4.359  -55.613 1.00 69.83 ? 266  ASP B CA  1 
ATOM   6142 C  C   . ASP B 1 266 ? 32.623  -4.830  -56.806 1.00 69.14 ? 266  ASP B C   1 
ATOM   6143 O  O   . ASP B 1 266 ? 31.648  -5.571  -56.647 1.00 67.95 ? 266  ASP B O   1 
ATOM   6144 C  CB  . ASP B 1 266 ? 33.057  -2.900  -55.319 1.00 68.45 ? 266  ASP B CB  1 
ATOM   6145 C  CG  . ASP B 1 266 ? 33.476  -2.438  -53.925 1.00 67.99 ? 266  ASP B CG  1 
ATOM   6146 O  OD1 . ASP B 1 266 ? 33.563  -3.281  -52.999 1.00 66.51 ? 266  ASP B OD1 1 
ATOM   6147 O  OD2 . ASP B 1 266 ? 33.696  -1.216  -53.758 1.00 66.54 ? 266  ASP B OD2 1 
ATOM   6148 N  N   . THR B 1 267 ? 33.011  -4.389  -57.998 1.00 68.35 ? 267  THR B N   1 
ATOM   6149 C  CA  . THR B 1 267 ? 32.284  -4.744  -59.201 1.00 67.44 ? 267  THR B CA  1 
ATOM   6150 C  C   . THR B 1 267 ? 31.988  -6.228  -59.309 1.00 66.79 ? 267  THR B C   1 
ATOM   6151 O  O   . THR B 1 267 ? 30.874  -6.612  -59.630 1.00 66.45 ? 267  THR B O   1 
ATOM   6152 C  CB  . THR B 1 267 ? 33.044  -4.285  -60.451 1.00 68.49 ? 267  THR B CB  1 
ATOM   6153 O  OG1 . THR B 1 267 ? 33.254  -2.868  -60.391 1.00 69.09 ? 267  THR B OG1 1 
ATOM   6154 C  CG2 . THR B 1 267 ? 32.245  -4.604  -61.700 1.00 68.81 ? 267  THR B CG2 1 
ATOM   6155 N  N   . GLU B 1 268 ? 32.975  -7.061  -59.017 1.00 67.69 ? 268  GLU B N   1 
ATOM   6156 C  CA  . GLU B 1 268 ? 32.802  -8.500  -59.123 1.00 68.84 ? 268  GLU B CA  1 
ATOM   6157 C  C   . GLU B 1 268 ? 31.807  -9.019  -58.111 1.00 66.94 ? 268  GLU B C   1 
ATOM   6158 O  O   . GLU B 1 268 ? 30.915  -9.809  -58.438 1.00 66.70 ? 268  GLU B O   1 
ATOM   6159 C  CB  . GLU B 1 268 ? 34.143  -9.217  -58.914 1.00 74.35 ? 268  GLU B CB  1 
ATOM   6160 C  CG  . GLU B 1 268 ? 35.202  -9.015  -60.021 1.00 81.38 ? 268  GLU B CG  1 
ATOM   6161 C  CD  . GLU B 1 268 ? 36.597  -9.561  -59.617 1.00 85.35 ? 268  GLU B CD  1 
ATOM   6162 O  OE1 . GLU B 1 268 ? 36.691  -10.774 -59.281 1.00 86.09 ? 268  GLU B OE1 1 
ATOM   6163 O  OE2 . GLU B 1 268 ? 37.587  -8.775  -59.635 1.00 86.36 ? 268  GLU B OE2 1 
ATOM   6164 N  N   . LEU B 1 269 ? 31.983  -8.573  -56.872 1.00 64.71 ? 269  LEU B N   1 
ATOM   6165 C  CA  . LEU B 1 269 ? 31.137  -8.985  -55.766 1.00 62.29 ? 269  LEU B CA  1 
ATOM   6166 C  C   . LEU B 1 269 ? 29.676  -8.659  -56.048 1.00 60.17 ? 269  LEU B C   1 
ATOM   6167 O  O   . LEU B 1 269 ? 28.806  -9.527  -55.965 1.00 59.11 ? 269  LEU B O   1 
ATOM   6168 C  CB  . LEU B 1 269 ? 31.629  -8.295  -54.490 1.00 63.11 ? 269  LEU B CB  1 
ATOM   6169 C  CG  . LEU B 1 269 ? 31.043  -8.727  -53.151 1.00 64.39 ? 269  LEU B CG  1 
ATOM   6170 C  CD1 . LEU B 1 269 ? 32.137  -8.796  -52.101 1.00 64.38 ? 269  LEU B CD1 1 
ATOM   6171 C  CD2 . LEU B 1 269 ? 29.955  -7.745  -52.745 1.00 64.36 ? 269  LEU B CD2 1 
ATOM   6172 N  N   . ILE B 1 270 ? 29.418  -7.406  -56.398 1.00 58.13 ? 270  ILE B N   1 
ATOM   6173 C  CA  . ILE B 1 270 ? 28.069  -6.969  -56.704 1.00 58.07 ? 270  ILE B CA  1 
ATOM   6174 C  C   . ILE B 1 270 ? 27.491  -7.700  -57.920 1.00 58.00 ? 270  ILE B C   1 
ATOM   6175 O  O   . ILE B 1 270 ? 26.320  -8.104  -57.912 1.00 58.39 ? 270  ILE B O   1 
ATOM   6176 C  CB  . ILE B 1 270 ? 28.049  -5.472  -56.941 1.00 58.00 ? 270  ILE B CB  1 
ATOM   6177 C  CG1 . ILE B 1 270 ? 28.558  -4.775  -55.682 1.00 57.95 ? 270  ILE B CG1 1 
ATOM   6178 C  CG2 . ILE B 1 270 ? 26.638  -5.011  -57.260 1.00 56.19 ? 270  ILE B CG2 1 
ATOM   6179 C  CD1 . ILE B 1 270 ? 28.845  -3.307  -55.877 1.00 59.42 ? 270  ILE B CD1 1 
ATOM   6180 N  N   . ALA B 1 271 ? 28.301  -7.877  -58.963 1.00 56.84 ? 271  ALA B N   1 
ATOM   6181 C  CA  . ALA B 1 271 ? 27.832  -8.597  -60.141 1.00 55.97 ? 271  ALA B CA  1 
ATOM   6182 C  C   . ALA B 1 271 ? 27.317  -9.968  -59.730 1.00 55.29 ? 271  ALA B C   1 
ATOM   6183 O  O   . ALA B 1 271 ? 26.272  -10.413 -60.203 1.00 55.20 ? 271  ALA B O   1 
ATOM   6184 C  CB  . ALA B 1 271 ? 28.946  -8.759  -61.148 1.00 55.43 ? 271  ALA B CB  1 
ATOM   6185 N  N   . CYS B 1 272 ? 28.042  -10.640 -58.842 1.00 55.78 ? 272  CYS B N   1 
ATOM   6186 C  CA  . CYS B 1 272 ? 27.621  -11.966 -58.406 1.00 57.84 ? 272  CYS B CA  1 
ATOM   6187 C  C   . CYS B 1 272 ? 26.372  -11.900 -57.544 1.00 57.20 ? 272  CYS B C   1 
ATOM   6188 O  O   . CYS B 1 272 ? 25.511  -12.793 -57.610 1.00 57.54 ? 272  CYS B O   1 
ATOM   6189 C  CB  . CYS B 1 272 ? 28.750  -12.662 -57.650 1.00 61.11 ? 272  CYS B CB  1 
ATOM   6190 S  SG  . CYS B 1 272 ? 28.389  -14.309 -56.938 1.00 67.73 ? 272  CYS B SG  1 
ATOM   6191 N  N   . LEU B 1 273 ? 26.266  -10.846 -56.734 1.00 56.28 ? 273  LEU B N   1 
ATOM   6192 C  CA  . LEU B 1 273 ? 25.090  -10.683 -55.880 1.00 54.50 ? 273  LEU B CA  1 
ATOM   6193 C  C   . LEU B 1 273 ? 23.869  -10.504 -56.774 1.00 53.86 ? 273  LEU B C   1 
ATOM   6194 O  O   . LEU B 1 273 ? 22.781  -10.990 -56.458 1.00 54.72 ? 273  LEU B O   1 
ATOM   6195 C  CB  . LEU B 1 273 ? 25.245  -9.476  -54.941 1.00 53.55 ? 273  LEU B CB  1 
ATOM   6196 C  CG  . LEU B 1 273 ? 26.047  -9.701  -53.655 1.00 51.99 ? 273  LEU B CG  1 
ATOM   6197 C  CD1 . LEU B 1 273 ? 26.245  -8.390  -52.925 1.00 52.12 ? 273  LEU B CD1 1 
ATOM   6198 C  CD2 . LEU B 1 273 ? 25.324  -10.687 -52.771 1.00 51.17 ? 273  LEU B CD2 1 
ATOM   6199 N  N   . ARG B 1 274 ? 24.053  -9.821  -57.900 1.00 53.14 ? 274  ARG B N   1 
ATOM   6200 C  CA  . ARG B 1 274 ? 22.945  -9.618  -58.829 1.00 53.31 ? 274  ARG B CA  1 
ATOM   6201 C  C   . ARG B 1 274 ? 22.457  -10.886 -59.524 1.00 53.70 ? 274  ARG B C   1 
ATOM   6202 O  O   . ARG B 1 274 ? 21.325  -10.931 -59.985 1.00 54.60 ? 274  ARG B O   1 
ATOM   6203 C  CB  . ARG B 1 274 ? 23.297  -8.561  -59.872 1.00 50.71 ? 274  ARG B CB  1 
ATOM   6204 C  CG  . ARG B 1 274 ? 23.274  -7.166  -59.284 1.00 53.54 ? 274  ARG B CG  1 
ATOM   6205 C  CD  . ARG B 1 274 ? 23.312  -6.110  -60.334 1.00 55.22 ? 274  ARG B CD  1 
ATOM   6206 N  NE  . ARG B 1 274 ? 24.387  -6.369  -61.268 1.00 58.12 ? 274  ARG B NE  1 
ATOM   6207 C  CZ  . ARG B 1 274 ? 25.397  -5.539  -61.466 1.00 61.73 ? 274  ARG B CZ  1 
ATOM   6208 N  NH1 . ARG B 1 274 ? 25.450  -4.391  -60.779 1.00 62.51 ? 274  ARG B NH1 1 
ATOM   6209 N  NH2 . ARG B 1 274 ? 26.348  -5.861  -62.341 1.00 61.16 ? 274  ARG B NH2 1 
ATOM   6210 N  N   . THR B 1 275 ? 23.282  -11.923 -59.589 1.00 53.87 ? 275  THR B N   1 
ATOM   6211 C  CA  . THR B 1 275 ? 22.844  -13.154 -60.243 1.00 53.77 ? 275  THR B CA  1 
ATOM   6212 C  C   . THR B 1 275 ? 22.068  -14.043 -59.292 1.00 54.75 ? 275  THR B C   1 
ATOM   6213 O  O   . THR B 1 275 ? 21.532  -15.065 -59.694 1.00 55.83 ? 275  THR B O   1 
ATOM   6214 C  CB  . THR B 1 275 ? 24.021  -13.980 -60.722 1.00 54.41 ? 275  THR B CB  1 
ATOM   6215 O  OG1 . THR B 1 275 ? 24.628  -14.621 -59.582 1.00 53.20 ? 275  THR B OG1 1 
ATOM   6216 C  CG2 . THR B 1 275 ? 25.041  -13.080 -61.448 1.00 51.36 ? 275  THR B CG2 1 
ATOM   6217 N  N   . ARG B 1 276 ? 21.996  -13.666 -58.028 1.00 55.69 ? 276  ARG B N   1 
ATOM   6218 C  CA  . ARG B 1 276 ? 21.293  -14.502 -57.076 1.00 56.61 ? 276  ARG B CA  1 
ATOM   6219 C  C   . ARG B 1 276 ? 19.779  -14.269 -56.967 1.00 56.17 ? 276  ARG B C   1 
ATOM   6220 O  O   . ARG B 1 276 ? 19.300  -13.142 -57.041 1.00 55.75 ? 276  ARG B O   1 
ATOM   6221 C  CB  . ARG B 1 276 ? 21.954  -14.352 -55.696 1.00 59.25 ? 276  ARG B CB  1 
ATOM   6222 C  CG  . ARG B 1 276 ? 23.400  -14.859 -55.636 1.00 62.35 ? 276  ARG B CG  1 
ATOM   6223 C  CD  . ARG B 1 276 ? 23.456  -16.394 -55.597 1.00 65.68 ? 276  ARG B CD  1 
ATOM   6224 N  NE  . ARG B 1 276 ? 24.821  -16.880 -55.386 1.00 68.89 ? 276  ARG B NE  1 
ATOM   6225 C  CZ  . ARG B 1 276 ? 25.773  -16.902 -56.318 1.00 68.88 ? 276  ARG B CZ  1 
ATOM   6226 N  NH1 . ARG B 1 276 ? 25.518  -16.473 -57.545 1.00 71.06 ? 276  ARG B NH1 1 
ATOM   6227 N  NH2 . ARG B 1 276 ? 26.990  -17.330 -56.016 1.00 67.58 ? 276  ARG B NH2 1 
ATOM   6228 N  N   . PRO B 1 277 ? 19.002  -15.354 -56.815 1.00 55.17 ? 277  PRO B N   1 
ATOM   6229 C  CA  . PRO B 1 277 ? 17.553  -15.205 -56.685 1.00 54.77 ? 277  PRO B CA  1 
ATOM   6230 C  C   . PRO B 1 277 ? 17.237  -14.336 -55.450 1.00 56.16 ? 277  PRO B C   1 
ATOM   6231 O  O   . PRO B 1 277 ? 17.943  -14.387 -54.434 1.00 55.31 ? 277  PRO B O   1 
ATOM   6232 C  CB  . PRO B 1 277 ? 17.070  -16.647 -56.511 1.00 52.72 ? 277  PRO B CB  1 
ATOM   6233 C  CG  . PRO B 1 277 ? 18.046  -17.410 -57.310 1.00 53.74 ? 277  PRO B CG  1 
ATOM   6234 C  CD  . PRO B 1 277 ? 19.367  -16.773 -56.975 1.00 54.10 ? 277  PRO B CD  1 
ATOM   6235 N  N   . ALA B 1 278 ? 16.161  -13.561 -55.528 1.00 56.27 ? 278  ALA B N   1 
ATOM   6236 C  CA  . ALA B 1 278 ? 15.786  -12.684 -54.429 1.00 55.41 ? 278  ALA B CA  1 
ATOM   6237 C  C   . ALA B 1 278 ? 15.685  -13.398 -53.089 1.00 56.49 ? 278  ALA B C   1 
ATOM   6238 O  O   . ALA B 1 278 ? 16.241  -12.937 -52.094 1.00 55.73 ? 278  ALA B O   1 
ATOM   6239 C  CB  . ALA B 1 278 ? 14.472  -11.998 -54.735 1.00 52.71 ? 278  ALA B CB  1 
ATOM   6240 N  N   . GLN B 1 279 ? 14.972  -14.520 -53.045 1.00 56.97 ? 279  GLN B N   1 
ATOM   6241 C  CA  . GLN B 1 279 ? 14.801  -15.213 -51.773 1.00 56.15 ? 279  GLN B CA  1 
ATOM   6242 C  C   . GLN B 1 279 ? 16.095  -15.694 -51.144 1.00 56.97 ? 279  GLN B C   1 
ATOM   6243 O  O   . GLN B 1 279 ? 16.145  -15.927 -49.940 1.00 57.03 ? 279  GLN B O   1 
ATOM   6244 C  CB  . GLN B 1 279 ? 13.840  -16.385 -51.901 1.00 54.40 ? 279  GLN B CB  1 
ATOM   6245 C  CG  . GLN B 1 279 ? 13.493  -17.004 -50.570 1.00 52.78 ? 279  GLN B CG  1 
ATOM   6246 C  CD  . GLN B 1 279 ? 12.905  -15.992 -49.595 1.00 54.02 ? 279  GLN B CD  1 
ATOM   6247 O  OE1 . GLN B 1 279 ? 12.094  -15.157 -49.972 1.00 52.49 ? 279  GLN B OE1 1 
ATOM   6248 N  NE2 . GLN B 1 279 ? 13.304  -16.078 -48.333 1.00 53.80 ? 279  GLN B NE2 1 
ATOM   6249 N  N   . ASP B 1 280 ? 17.133  -15.859 -51.956 1.00 57.76 ? 280  ASP B N   1 
ATOM   6250 C  CA  . ASP B 1 280 ? 18.437  -16.278 -51.446 1.00 58.87 ? 280  ASP B CA  1 
ATOM   6251 C  C   . ASP B 1 280 ? 18.999  -15.162 -50.561 1.00 58.75 ? 280  ASP B C   1 
ATOM   6252 O  O   . ASP B 1 280 ? 19.536  -15.427 -49.481 1.00 59.70 ? 280  ASP B O   1 
ATOM   6253 C  CB  . ASP B 1 280 ? 19.422  -16.532 -52.596 1.00 60.67 ? 280  ASP B CB  1 
ATOM   6254 C  CG  . ASP B 1 280 ? 19.244  -17.903 -53.249 1.00 63.83 ? 280  ASP B CG  1 
ATOM   6255 O  OD1 . ASP B 1 280 ? 18.288  -18.657 -52.901 1.00 64.96 ? 280  ASP B OD1 1 
ATOM   6256 O  OD2 . ASP B 1 280 ? 20.087  -18.211 -54.125 1.00 63.70 ? 280  ASP B OD2 1 
ATOM   6257 N  N   . LEU B 1 281 ? 18.893  -13.919 -51.035 1.00 57.34 ? 281  LEU B N   1 
ATOM   6258 C  CA  . LEU B 1 281 ? 19.366  -12.769 -50.278 1.00 55.73 ? 281  LEU B CA  1 
ATOM   6259 C  C   . LEU B 1 281 ? 18.547  -12.611 -48.993 1.00 55.43 ? 281  LEU B C   1 
ATOM   6260 O  O   . LEU B 1 281 ? 19.108  -12.444 -47.913 1.00 57.15 ? 281  LEU B O   1 
ATOM   6261 C  CB  . LEU B 1 281 ? 19.286  -11.515 -51.140 1.00 55.24 ? 281  LEU B CB  1 
ATOM   6262 C  CG  . LEU B 1 281 ? 20.573  -11.164 -51.895 1.00 55.58 ? 281  LEU B CG  1 
ATOM   6263 C  CD1 . LEU B 1 281 ? 21.297  -12.403 -52.317 1.00 53.27 ? 281  LEU B CD1 1 
ATOM   6264 C  CD2 . LEU B 1 281 ? 20.252  -10.281 -53.087 1.00 52.83 ? 281  LEU B CD2 1 
ATOM   6265 N  N   . VAL B 1 282 ? 17.228  -12.692 -49.088 1.00 53.29 ? 282  VAL B N   1 
ATOM   6266 C  CA  . VAL B 1 282 ? 16.418  -12.577 -47.892 1.00 52.84 ? 282  VAL B CA  1 
ATOM   6267 C  C   . VAL B 1 282 ? 16.742  -13.696 -46.887 1.00 54.82 ? 282  VAL B C   1 
ATOM   6268 O  O   . VAL B 1 282 ? 16.803  -13.454 -45.681 1.00 54.80 ? 282  VAL B O   1 
ATOM   6269 C  CB  . VAL B 1 282 ? 14.940  -12.587 -48.256 1.00 51.66 ? 282  VAL B CB  1 
ATOM   6270 C  CG1 . VAL B 1 282 ? 14.091  -12.790 -47.032 1.00 48.49 ? 282  VAL B CG1 1 
ATOM   6271 C  CG2 . VAL B 1 282 ? 14.597  -11.271 -48.946 1.00 49.62 ? 282  VAL B CG2 1 
ATOM   6272 N  N   . ASP B 1 283 ? 16.963  -14.911 -47.381 1.00 55.85 ? 283  ASP B N   1 
ATOM   6273 C  CA  . ASP B 1 283 ? 17.297  -16.069 -46.530 1.00 57.05 ? 283  ASP B CA  1 
ATOM   6274 C  C   . ASP B 1 283 ? 18.445  -15.824 -45.530 1.00 57.45 ? 283  ASP B C   1 
ATOM   6275 O  O   . ASP B 1 283 ? 18.437  -16.374 -44.426 1.00 57.00 ? 283  ASP B O   1 
ATOM   6276 C  CB  . ASP B 1 283 ? 17.716  -17.274 -47.395 1.00 58.12 ? 283  ASP B CB  1 
ATOM   6277 C  CG  . ASP B 1 283 ? 16.541  -18.154 -47.820 1.00 61.00 ? 283  ASP B CG  1 
ATOM   6278 O  OD1 . ASP B 1 283 ? 15.414  -17.971 -47.296 1.00 61.55 ? 283  ASP B OD1 1 
ATOM   6279 O  OD2 . ASP B 1 283 ? 16.766  -19.054 -48.678 1.00 62.01 ? 283  ASP B OD2 1 
ATOM   6280 N  N   . HIS B 1 284 ? 19.436  -15.030 -45.935 1.00 58.06 ? 284  HIS B N   1 
ATOM   6281 C  CA  . HIS B 1 284 ? 20.607  -14.735 -45.103 1.00 59.27 ? 284  HIS B CA  1 
ATOM   6282 C  C   . HIS B 1 284 ? 20.671  -13.328 -44.524 1.00 58.86 ? 284  HIS B C   1 
ATOM   6283 O  O   . HIS B 1 284 ? 21.625  -12.986 -43.828 1.00 58.79 ? 284  HIS B O   1 
ATOM   6284 C  CB  . HIS B 1 284 ? 21.902  -14.943 -45.897 1.00 61.74 ? 284  HIS B CB  1 
ATOM   6285 C  CG  . HIS B 1 284 ? 22.222  -16.376 -46.150 1.00 66.23 ? 284  HIS B CG  1 
ATOM   6286 N  ND1 . HIS B 1 284 ? 22.375  -17.290 -45.130 1.00 67.52 ? 284  HIS B ND1 1 
ATOM   6287 C  CD2 . HIS B 1 284 ? 22.366  -17.067 -47.304 1.00 66.85 ? 284  HIS B CD2 1 
ATOM   6288 C  CE1 . HIS B 1 284 ? 22.593  -18.486 -45.647 1.00 68.74 ? 284  HIS B CE1 1 
ATOM   6289 N  NE2 . HIS B 1 284 ? 22.590  -18.378 -46.964 1.00 68.55 ? 284  HIS B NE2 1 
ATOM   6290 N  N   . GLU B 1 285 ? 19.676  -12.516 -44.837 1.00 58.17 ? 285  GLU B N   1 
ATOM   6291 C  CA  . GLU B 1 285 ? 19.610  -11.133 -44.386 1.00 57.54 ? 285  GLU B CA  1 
ATOM   6292 C  C   . GLU B 1 285 ? 19.918  -10.960 -42.887 1.00 56.02 ? 285  GLU B C   1 
ATOM   6293 O  O   . GLU B 1 285 ? 20.742  -10.129 -42.483 1.00 51.02 ? 285  GLU B O   1 
ATOM   6294 C  CB  . GLU B 1 285 ? 18.209  -10.603 -44.695 1.00 59.16 ? 285  GLU B CB  1 
ATOM   6295 C  CG  . GLU B 1 285 ? 18.102  -9.127  -44.811 1.00 62.10 ? 285  GLU B CG  1 
ATOM   6296 C  CD  . GLU B 1 285 ? 16.707  -8.708  -45.178 1.00 64.07 ? 285  GLU B CD  1 
ATOM   6297 O  OE1 . GLU B 1 285 ? 16.157  -9.267  -46.145 1.00 64.30 ? 285  GLU B OE1 1 
ATOM   6298 O  OE2 . GLU B 1 285 ? 16.162  -7.817  -44.497 1.00 68.03 ? 285  GLU B OE2 1 
ATOM   6299 N  N   . TRP B 1 286 ? 19.257  -11.767 -42.073 1.00 56.87 ? 286  TRP B N   1 
ATOM   6300 C  CA  . TRP B 1 286 ? 19.429  -11.683 -40.639 1.00 60.96 ? 286  TRP B CA  1 
ATOM   6301 C  C   . TRP B 1 286 ? 20.730  -12.211 -40.062 1.00 61.10 ? 286  TRP B C   1 
ATOM   6302 O  O   . TRP B 1 286 ? 21.011  -12.002 -38.891 1.00 63.70 ? 286  TRP B O   1 
ATOM   6303 C  CB  . TRP B 1 286 ? 18.257  -12.365 -39.946 1.00 62.84 ? 286  TRP B CB  1 
ATOM   6304 C  CG  . TRP B 1 286 ? 16.962  -11.623 -40.152 1.00 69.38 ? 286  TRP B CG  1 
ATOM   6305 C  CD1 . TRP B 1 286 ? 15.940  -11.944 -41.027 1.00 70.37 ? 286  TRP B CD1 1 
ATOM   6306 C  CD2 . TRP B 1 286 ? 16.545  -10.431 -39.470 1.00 71.49 ? 286  TRP B CD2 1 
ATOM   6307 N  NE1 . TRP B 1 286 ? 14.919  -11.025 -40.920 1.00 71.58 ? 286  TRP B NE1 1 
ATOM   6308 C  CE2 . TRP B 1 286 ? 15.260  -10.088 -39.975 1.00 72.54 ? 286  TRP B CE2 1 
ATOM   6309 C  CE3 . TRP B 1 286 ? 17.130  -9.619  -38.481 1.00 72.35 ? 286  TRP B CE3 1 
ATOM   6310 C  CZ2 . TRP B 1 286 ? 14.553  -8.965  -39.519 1.00 72.78 ? 286  TRP B CZ2 1 
ATOM   6311 C  CZ3 . TRP B 1 286 ? 16.428  -8.502  -38.031 1.00 73.24 ? 286  TRP B CZ3 1 
ATOM   6312 C  CH2 . TRP B 1 286 ? 15.148  -8.187  -38.552 1.00 73.97 ? 286  TRP B CH2 1 
ATOM   6313 N  N   . HIS B 1 287 ? 21.548  -12.874 -40.860 1.00 61.39 ? 287  HIS B N   1 
ATOM   6314 C  CA  . HIS B 1 287 ? 22.782  -13.416 -40.318 1.00 60.79 ? 287  HIS B CA  1 
ATOM   6315 C  C   . HIS B 1 287 ? 23.965  -12.473 -40.333 1.00 59.56 ? 287  HIS B C   1 
ATOM   6316 O  O   . HIS B 1 287 ? 25.075  -12.889 -40.046 1.00 60.57 ? 287  HIS B O   1 
ATOM   6317 C  CB  . HIS B 1 287 ? 23.141  -14.702 -41.045 1.00 62.88 ? 287  HIS B CB  1 
ATOM   6318 C  CG  . HIS B 1 287 ? 22.073  -15.740 -40.964 1.00 66.21 ? 287  HIS B CG  1 
ATOM   6319 N  ND1 . HIS B 1 287 ? 21.961  -16.767 -41.874 1.00 69.16 ? 287  HIS B ND1 1 
ATOM   6320 C  CD2 . HIS B 1 287 ? 21.047  -15.893 -40.094 1.00 68.03 ? 287  HIS B CD2 1 
ATOM   6321 C  CE1 . HIS B 1 287 ? 20.909  -17.508 -41.570 1.00 70.89 ? 287  HIS B CE1 1 
ATOM   6322 N  NE2 . HIS B 1 287 ? 20.337  -16.999 -40.493 1.00 71.44 ? 287  HIS B NE2 1 
ATOM   6323 N  N   . VAL B 1 288 ? 23.754  -11.204 -40.654 1.00 57.38 ? 288  VAL B N   1 
ATOM   6324 C  CA  . VAL B 1 288 ? 24.887  -10.290 -40.669 1.00 55.47 ? 288  VAL B CA  1 
ATOM   6325 C  C   . VAL B 1 288 ? 24.940  -9.326  -39.485 1.00 54.77 ? 288  VAL B C   1 
ATOM   6326 O  O   . VAL B 1 288 ? 25.886  -8.530  -39.380 1.00 52.77 ? 288  VAL B O   1 
ATOM   6327 C  CB  . VAL B 1 288 ? 24.949  -9.462  -41.970 1.00 56.30 ? 288  VAL B CB  1 
ATOM   6328 C  CG1 . VAL B 1 288 ? 25.179  -10.379 -43.159 1.00 57.11 ? 288  VAL B CG1 1 
ATOM   6329 C  CG2 . VAL B 1 288 ? 23.672  -8.662  -42.139 1.00 57.03 ? 288  VAL B CG2 1 
ATOM   6330 N  N   . LEU B 1 289 ? 23.934  -9.384  -38.608 1.00 53.81 ? 289  LEU B N   1 
ATOM   6331 C  CA  . LEU B 1 289 ? 23.909  -8.524  -37.426 1.00 54.55 ? 289  LEU B CA  1 
ATOM   6332 C  C   . LEU B 1 289 ? 25.105  -8.857  -36.517 1.00 56.84 ? 289  LEU B C   1 
ATOM   6333 O  O   . LEU B 1 289 ? 25.377  -10.032 -36.231 1.00 56.76 ? 289  LEU B O   1 
ATOM   6334 C  CB  . LEU B 1 289 ? 22.589  -8.693  -36.664 1.00 51.72 ? 289  LEU B CB  1 
ATOM   6335 C  CG  . LEU B 1 289 ? 21.404  -7.952  -37.290 1.00 49.80 ? 289  LEU B CG  1 
ATOM   6336 C  CD1 . LEU B 1 289 ? 20.110  -8.274  -36.559 1.00 45.81 ? 289  LEU B CD1 1 
ATOM   6337 C  CD2 . LEU B 1 289 ? 21.687  -6.459  -37.266 1.00 48.42 ? 289  LEU B CD2 1 
ATOM   6338 N  N   . PRO B 1 290 ? 25.831  -7.820  -36.055 1.00 58.20 ? 290  PRO B N   1 
ATOM   6339 C  CA  . PRO B 1 290 ? 27.006  -7.960  -35.189 1.00 59.21 ? 290  PRO B CA  1 
ATOM   6340 C  C   . PRO B 1 290 ? 26.834  -8.674  -33.849 1.00 59.76 ? 290  PRO B C   1 
ATOM   6341 O  O   . PRO B 1 290 ? 27.756  -9.342  -33.404 1.00 60.15 ? 290  PRO B O   1 
ATOM   6342 C  CB  . PRO B 1 290 ? 27.515  -6.519  -35.048 1.00 58.66 ? 290  PRO B CB  1 
ATOM   6343 C  CG  . PRO B 1 290 ? 26.294  -5.711  -35.202 1.00 60.42 ? 290  PRO B CG  1 
ATOM   6344 C  CD  . PRO B 1 290 ? 25.564  -6.400  -36.337 1.00 59.13 ? 290  PRO B CD  1 
ATOM   6345 N  N   . GLN B 1 291 ? 25.679  -8.550  -33.205 1.00 60.69 ? 291  GLN B N   1 
ATOM   6346 C  CA  . GLN B 1 291 ? 25.458  -9.237  -31.929 1.00 61.27 ? 291  GLN B CA  1 
ATOM   6347 C  C   . GLN B 1 291 ? 24.019  -9.685  -31.831 1.00 60.84 ? 291  GLN B C   1 
ATOM   6348 O  O   . GLN B 1 291 ? 23.185  -9.299  -32.640 1.00 59.89 ? 291  GLN B O   1 
ATOM   6349 C  CB  . GLN B 1 291 ? 25.715  -8.319  -30.724 1.00 63.66 ? 291  GLN B CB  1 
ATOM   6350 C  CG  . GLN B 1 291 ? 27.024  -7.528  -30.716 1.00 66.43 ? 291  GLN B CG  1 
ATOM   6351 C  CD  . GLN B 1 291 ? 26.854  -6.138  -31.283 1.00 67.36 ? 291  GLN B CD  1 
ATOM   6352 O  OE1 . GLN B 1 291 ? 25.754  -5.590  -31.260 1.00 68.85 ? 291  GLN B OE1 1 
ATOM   6353 N  NE2 . GLN B 1 291 ? 27.941  -5.551  -31.780 1.00 65.87 ? 291  GLN B NE2 1 
ATOM   6354 N  N   . GLU B 1 292 ? 23.730  -10.497 -30.823 1.00 61.95 ? 292  GLU B N   1 
ATOM   6355 C  CA  . GLU B 1 292 ? 22.366  -10.963 -30.584 1.00 63.49 ? 292  GLU B CA  1 
ATOM   6356 C  C   . GLU B 1 292 ? 21.622  -9.685  -30.176 1.00 62.09 ? 292  GLU B C   1 
ATOM   6357 O  O   . GLU B 1 292 ? 22.118  -8.933  -29.325 1.00 62.97 ? 292  GLU B O   1 
ATOM   6358 C  CB  . GLU B 1 292 ? 22.362  -11.967 -29.424 1.00 66.33 ? 292  GLU B CB  1 
ATOM   6359 C  CG  . GLU B 1 292 ? 21.063  -12.750 -29.238 1.00 70.79 ? 292  GLU B CG  1 
ATOM   6360 C  CD  . GLU B 1 292 ? 21.040  -13.536 -27.917 1.00 73.95 ? 292  GLU B CD  1 
ATOM   6361 O  OE1 . GLU B 1 292 ? 22.137  -13.792 -27.353 1.00 73.72 ? 292  GLU B OE1 1 
ATOM   6362 O  OE2 . GLU B 1 292 ? 19.928  -13.906 -27.451 1.00 74.82 ? 292  GLU B OE2 1 
ATOM   6363 N  N   . SER B 1 293 ? 20.461  -9.410  -30.763 1.00 58.72 ? 293  SER B N   1 
ATOM   6364 C  CA  . SER B 1 293 ? 19.770  -8.188  -30.382 1.00 56.40 ? 293  SER B CA  1 
ATOM   6365 C  C   . SER B 1 293 ? 18.353  -8.080  -30.850 1.00 55.10 ? 293  SER B C   1 
ATOM   6366 O  O   . SER B 1 293 ? 17.835  -8.983  -31.500 1.00 57.06 ? 293  SER B O   1 
ATOM   6367 C  CB  . SER B 1 293 ? 20.538  -6.973  -30.895 1.00 55.99 ? 293  SER B CB  1 
ATOM   6368 O  OG  . SER B 1 293 ? 20.729  -7.038  -32.293 1.00 56.84 ? 293  SER B OG  1 
ATOM   6369 N  N   . ILE B 1 294 ? 17.711  -6.984  -30.465 1.00 52.54 ? 294  ILE B N   1 
ATOM   6370 C  CA  . ILE B 1 294 ? 16.356  -6.698  -30.909 1.00 50.26 ? 294  ILE B CA  1 
ATOM   6371 C  C   . ILE B 1 294 ? 16.400  -5.251  -31.343 1.00 48.20 ? 294  ILE B C   1 
ATOM   6372 O  O   . ILE B 1 294 ? 17.341  -4.543  -31.015 1.00 48.25 ? 294  ILE B O   1 
ATOM   6373 C  CB  . ILE B 1 294 ? 15.290  -6.881  -29.813 1.00 50.68 ? 294  ILE B CB  1 
ATOM   6374 C  CG1 . ILE B 1 294 ? 15.680  -6.119  -28.559 1.00 50.51 ? 294  ILE B CG1 1 
ATOM   6375 C  CG2 . ILE B 1 294 ? 15.078  -8.356  -29.518 1.00 49.88 ? 294  ILE B CG2 1 
ATOM   6376 C  CD1 . ILE B 1 294 ? 14.531  -6.062  -27.572 1.00 52.27 ? 294  ILE B CD1 1 
ATOM   6377 N  N   . PHE B 1 295 ? 15.405  -4.823  -32.106 1.00 47.39 ? 295  PHE B N   1 
ATOM   6378 C  CA  . PHE B 1 295 ? 15.344  -3.456  -32.609 1.00 46.06 ? 295  PHE B CA  1 
ATOM   6379 C  C   . PHE B 1 295 ? 16.619  -3.077  -33.342 1.00 46.15 ? 295  PHE B C   1 
ATOM   6380 O  O   . PHE B 1 295 ? 17.101  -1.952  -33.225 1.00 46.60 ? 295  PHE B O   1 
ATOM   6381 C  CB  . PHE B 1 295 ? 15.075  -2.437  -31.480 1.00 43.90 ? 295  PHE B CB  1 
ATOM   6382 C  CG  . PHE B 1 295 ? 14.118  -1.341  -31.882 1.00 42.05 ? 295  PHE B CG  1 
ATOM   6383 C  CD1 . PHE B 1 295 ? 14.337  -0.601  -33.046 1.00 41.70 ? 295  PHE B CD1 1 
ATOM   6384 C  CD2 . PHE B 1 295 ? 12.958  -1.099  -31.142 1.00 42.67 ? 295  PHE B CD2 1 
ATOM   6385 C  CE1 . PHE B 1 295 ? 13.408  0.362   -33.486 1.00 40.73 ? 295  PHE B CE1 1 
ATOM   6386 C  CE2 . PHE B 1 295 ? 12.030  -0.147  -31.561 1.00 42.13 ? 295  PHE B CE2 1 
ATOM   6387 C  CZ  . PHE B 1 295 ? 12.260  0.589   -32.754 1.00 41.97 ? 295  PHE B CZ  1 
ATOM   6388 N  N   . ARG B 1 296 ? 17.170  -4.040  -34.072 1.00 46.21 ? 296  ARG B N   1 
ATOM   6389 C  CA  . ARG B 1 296 ? 18.350  -3.827  -34.890 1.00 46.23 ? 296  ARG B CA  1 
ATOM   6390 C  C   . ARG B 1 296 ? 18.025  -4.477  -36.243 1.00 47.68 ? 296  ARG B C   1 
ATOM   6391 O  O   . ARG B 1 296 ? 17.444  -5.561  -36.296 1.00 49.54 ? 296  ARG B O   1 
ATOM   6392 C  CB  . ARG B 1 296 ? 19.571  -4.442  -34.232 1.00 44.76 ? 296  ARG B CB  1 
ATOM   6393 C  CG  . ARG B 1 296 ? 20.038  -3.633  -33.038 1.00 47.67 ? 296  ARG B CG  1 
ATOM   6394 C  CD  . ARG B 1 296 ? 20.439  -2.221  -33.409 1.00 46.60 ? 296  ARG B CD  1 
ATOM   6395 N  NE  . ARG B 1 296 ? 20.893  -1.514  -32.218 1.00 49.25 ? 296  ARG B NE  1 
ATOM   6396 C  CZ  . ARG B 1 296 ? 20.097  -0.924  -31.323 1.00 49.24 ? 296  ARG B CZ  1 
ATOM   6397 N  NH1 . ARG B 1 296 ? 18.781  -0.920  -31.471 1.00 49.95 ? 296  ARG B NH1 1 
ATOM   6398 N  NH2 . ARG B 1 296 ? 20.617  -0.379  -30.243 1.00 47.77 ? 296  ARG B NH2 1 
ATOM   6399 N  N   . PHE B 1 297 ? 18.400  -3.812  -37.328 1.00 45.61 ? 297  PHE B N   1 
ATOM   6400 C  CA  . PHE B 1 297 ? 18.068  -4.278  -38.659 1.00 44.95 ? 297  PHE B CA  1 
ATOM   6401 C  C   . PHE B 1 297 ? 19.297  -4.296  -39.541 1.00 46.08 ? 297  PHE B C   1 
ATOM   6402 O  O   . PHE B 1 297 ? 20.101  -3.359  -39.523 1.00 44.42 ? 297  PHE B O   1 
ATOM   6403 C  CB  . PHE B 1 297 ? 17.001  -3.352  -39.201 1.00 42.80 ? 297  PHE B CB  1 
ATOM   6404 C  CG  . PHE B 1 297 ? 15.901  -3.117  -38.227 1.00 41.32 ? 297  PHE B CG  1 
ATOM   6405 C  CD1 . PHE B 1 297 ? 15.099  -4.173  -37.803 1.00 41.26 ? 297  PHE B CD1 1 
ATOM   6406 C  CD2 . PHE B 1 297 ? 15.682  -1.847  -37.694 1.00 41.11 ? 297  PHE B CD2 1 
ATOM   6407 C  CE1 . PHE B 1 297 ? 14.080  -3.970  -36.850 1.00 41.89 ? 297  PHE B CE1 1 
ATOM   6408 C  CE2 . PHE B 1 297 ? 14.667  -1.622  -36.735 1.00 39.60 ? 297  PHE B CE2 1 
ATOM   6409 C  CZ  . PHE B 1 297 ? 13.867  -2.683  -36.315 1.00 41.29 ? 297  PHE B CZ  1 
ATOM   6410 N  N   . SER B 1 298 ? 19.428  -5.361  -40.330 1.00 46.63 ? 298  SER B N   1 
ATOM   6411 C  CA  . SER B 1 298 ? 20.614  -5.543  -41.154 1.00 45.73 ? 298  SER B CA  1 
ATOM   6412 C  C   . SER B 1 298 ? 20.961  -4.520  -42.194 1.00 45.45 ? 298  SER B C   1 
ATOM   6413 O  O   . SER B 1 298 ? 22.100  -4.043  -42.238 1.00 44.32 ? 298  SER B O   1 
ATOM   6414 C  CB  . SER B 1 298 ? 20.575  -6.915  -41.799 1.00 47.01 ? 298  SER B CB  1 
ATOM   6415 O  OG  . SER B 1 298 ? 20.493  -7.916  -40.793 1.00 50.37 ? 298  SER B OG  1 
ATOM   6416 N  N   . PHE B 1 299 ? 19.997  -4.168  -43.036 1.00 45.17 ? 299  PHE B N   1 
ATOM   6417 C  CA  . PHE B 1 299 ? 20.279  -3.223  -44.103 1.00 44.00 ? 299  PHE B CA  1 
ATOM   6418 C  C   . PHE B 1 299 ? 19.447  -1.967  -43.953 1.00 44.09 ? 299  PHE B C   1 
ATOM   6419 O  O   . PHE B 1 299 ? 18.246  -1.968  -44.197 1.00 44.12 ? 299  PHE B O   1 
ATOM   6420 C  CB  . PHE B 1 299 ? 20.042  -3.935  -45.436 1.00 44.30 ? 299  PHE B CB  1 
ATOM   6421 C  CG  . PHE B 1 299 ? 21.003  -5.062  -45.672 1.00 44.23 ? 299  PHE B CG  1 
ATOM   6422 C  CD1 . PHE B 1 299 ? 22.312  -4.796  -46.044 1.00 44.03 ? 299  PHE B CD1 1 
ATOM   6423 C  CD2 . PHE B 1 299 ? 20.659  -6.370  -45.354 1.00 45.36 ? 299  PHE B CD2 1 
ATOM   6424 C  CE1 . PHE B 1 299 ? 23.268  -5.821  -46.076 1.00 43.31 ? 299  PHE B CE1 1 
ATOM   6425 C  CE2 . PHE B 1 299 ? 21.611  -7.396  -45.385 1.00 44.31 ? 299  PHE B CE2 1 
ATOM   6426 C  CZ  . PHE B 1 299 ? 22.915  -7.117  -45.742 1.00 42.59 ? 299  PHE B CZ  1 
ATOM   6427 N  N   . VAL B 1 300 ? 20.108  -0.889  -43.558 1.00 41.92 ? 300  VAL B N   1 
ATOM   6428 C  CA  . VAL B 1 300 ? 19.429  0.367   -43.306 1.00 39.84 ? 300  VAL B CA  1 
ATOM   6429 C  C   . VAL B 1 300 ? 20.198  1.501   -43.955 1.00 39.98 ? 300  VAL B C   1 
ATOM   6430 O  O   . VAL B 1 300 ? 21.257  1.278   -44.534 1.00 38.79 ? 300  VAL B O   1 
ATOM   6431 C  CB  . VAL B 1 300 ? 19.319  0.613   -41.775 1.00 40.68 ? 300  VAL B CB  1 
ATOM   6432 C  CG1 . VAL B 1 300 ? 18.666  -0.597  -41.098 1.00 37.35 ? 300  VAL B CG1 1 
ATOM   6433 C  CG2 . VAL B 1 300 ? 20.707  0.850   -41.171 1.00 40.13 ? 300  VAL B CG2 1 
ATOM   6434 N  N   . PRO B 1 301 ? 19.673  2.737   -43.875 1.00 39.49 ? 301  PRO B N   1 
ATOM   6435 C  CA  . PRO B 1 301 ? 20.422  3.829   -44.506 1.00 39.42 ? 301  PRO B CA  1 
ATOM   6436 C  C   . PRO B 1 301 ? 21.862  3.864   -43.993 1.00 41.55 ? 301  PRO B C   1 
ATOM   6437 O  O   . PRO B 1 301 ? 22.132  3.475   -42.848 1.00 42.12 ? 301  PRO B O   1 
ATOM   6438 C  CB  . PRO B 1 301 ? 19.610  5.061   -44.125 1.00 38.84 ? 301  PRO B CB  1 
ATOM   6439 C  CG  . PRO B 1 301 ? 18.192  4.525   -44.199 1.00 37.49 ? 301  PRO B CG  1 
ATOM   6440 C  CD  . PRO B 1 301 ? 18.330  3.182   -43.460 1.00 35.87 ? 301  PRO B CD  1 
ATOM   6441 N  N   . VAL B 1 302 ? 22.779  4.317   -44.851 1.00 42.11 ? 302  VAL B N   1 
ATOM   6442 C  CA  . VAL B 1 302 ? 24.197  4.390   -44.525 1.00 42.20 ? 302  VAL B CA  1 
ATOM   6443 C  C   . VAL B 1 302 ? 24.704  5.822   -44.603 1.00 43.61 ? 302  VAL B C   1 
ATOM   6444 O  O   . VAL B 1 302 ? 24.299  6.585   -45.485 1.00 43.17 ? 302  VAL B O   1 
ATOM   6445 C  CB  . VAL B 1 302 ? 25.051  3.532   -45.491 1.00 42.03 ? 302  VAL B CB  1 
ATOM   6446 C  CG1 . VAL B 1 302 ? 24.843  4.006   -46.948 1.00 41.74 ? 302  VAL B CG1 1 
ATOM   6447 C  CG2 . VAL B 1 302 ? 26.527  3.656   -45.122 1.00 41.54 ? 302  VAL B CG2 1 
ATOM   6448 N  N   . VAL B 1 303 ? 25.581  6.188   -43.672 1.00 43.41 ? 303  VAL B N   1 
ATOM   6449 C  CA  . VAL B 1 303 ? 26.132  7.530   -43.691 1.00 45.51 ? 303  VAL B CA  1 
ATOM   6450 C  C   . VAL B 1 303 ? 27.182  7.456   -44.780 1.00 47.71 ? 303  VAL B C   1 
ATOM   6451 O  O   . VAL B 1 303 ? 28.339  7.097   -44.544 1.00 48.21 ? 303  VAL B O   1 
ATOM   6452 C  CB  . VAL B 1 303 ? 26.765  7.918   -42.323 1.00 44.92 ? 303  VAL B CB  1 
ATOM   6453 C  CG1 . VAL B 1 303 ? 27.280  9.356   -42.365 1.00 42.21 ? 303  VAL B CG1 1 
ATOM   6454 C  CG2 . VAL B 1 303 ? 25.738  7.766   -41.227 1.00 42.84 ? 303  VAL B CG2 1 
ATOM   6455 N  N   . ASP B 1 304 ? 26.742  7.785   -45.988 1.00 50.15 ? 304  ASP B N   1 
ATOM   6456 C  CA  . ASP B 1 304 ? 27.559  7.718   -47.185 1.00 51.10 ? 304  ASP B CA  1 
ATOM   6457 C  C   . ASP B 1 304 ? 28.327  8.981   -47.510 1.00 52.27 ? 304  ASP B C   1 
ATOM   6458 O  O   . ASP B 1 304 ? 29.183  8.973   -48.385 1.00 53.06 ? 304  ASP B O   1 
ATOM   6459 C  CB  . ASP B 1 304 ? 26.654  7.374   -48.360 1.00 51.49 ? 304  ASP B CB  1 
ATOM   6460 C  CG  . ASP B 1 304 ? 25.547  8.413   -48.575 1.00 53.04 ? 304  ASP B CG  1 
ATOM   6461 O  OD1 . ASP B 1 304 ? 25.392  9.305   -47.722 1.00 52.30 ? 304  ASP B OD1 1 
ATOM   6462 O  OD2 . ASP B 1 304 ? 24.820  8.338   -49.601 1.00 54.63 ? 304  ASP B OD2 1 
ATOM   6463 N  N   . GLY B 1 305 ? 28.025  10.069  -46.818 1.00 52.57 ? 305  GLY B N   1 
ATOM   6464 C  CA  . GLY B 1 305 ? 28.690  11.314  -47.125 1.00 52.46 ? 305  GLY B CA  1 
ATOM   6465 C  C   . GLY B 1 305 ? 28.100  11.865  -48.411 1.00 54.26 ? 305  GLY B C   1 
ATOM   6466 O  O   . GLY B 1 305 ? 28.666  12.772  -49.019 1.00 55.96 ? 305  GLY B O   1 
ATOM   6467 N  N   . ASP B 1 306 ? 26.958  11.320  -48.833 1.00 53.81 ? 306  ASP B N   1 
ATOM   6468 C  CA  . ASP B 1 306 ? 26.290  11.767  -50.057 1.00 53.87 ? 306  ASP B CA  1 
ATOM   6469 C  C   . ASP B 1 306 ? 24.832  12.123  -49.733 1.00 52.44 ? 306  ASP B C   1 
ATOM   6470 O  O   . ASP B 1 306 ? 24.518  13.300  -49.557 1.00 52.04 ? 306  ASP B O   1 
ATOM   6471 C  CB  . ASP B 1 306 ? 26.361  10.665  -51.127 1.00 54.73 ? 306  ASP B CB  1 
ATOM   6472 C  CG  . ASP B 1 306 ? 25.779  11.104  -52.459 1.00 57.64 ? 306  ASP B CG  1 
ATOM   6473 O  OD1 . ASP B 1 306 ? 25.335  12.271  -52.568 1.00 57.77 ? 306  ASP B OD1 1 
ATOM   6474 O  OD2 . ASP B 1 306 ? 25.763  10.275  -53.406 1.00 61.65 ? 306  ASP B OD2 1 
ATOM   6475 N  N   . PHE B 1 307 ? 23.945  11.124  -49.659 1.00 50.76 ? 307  PHE B N   1 
ATOM   6476 C  CA  . PHE B 1 307 ? 22.538  11.386  -49.318 1.00 49.66 ? 307  PHE B CA  1 
ATOM   6477 C  C   . PHE B 1 307 ? 22.594  12.023  -47.928 1.00 49.34 ? 307  PHE B C   1 
ATOM   6478 O  O   . PHE B 1 307 ? 21.937  13.035  -47.662 1.00 47.64 ? 307  PHE B O   1 
ATOM   6479 C  CB  . PHE B 1 307 ? 21.722  10.081  -49.281 1.00 47.43 ? 307  PHE B CB  1 
ATOM   6480 C  CG  . PHE B 1 307 ? 20.235  10.297  -49.186 1.00 46.76 ? 307  PHE B CG  1 
ATOM   6481 C  CD1 . PHE B 1 307 ? 19.631  10.608  -47.968 1.00 48.35 ? 307  PHE B CD1 1 
ATOM   6482 C  CD2 . PHE B 1 307 ? 19.435  10.236  -50.325 1.00 47.42 ? 307  PHE B CD2 1 
ATOM   6483 C  CE1 . PHE B 1 307 ? 18.254  10.862  -47.887 1.00 45.81 ? 307  PHE B CE1 1 
ATOM   6484 C  CE2 . PHE B 1 307 ? 18.052  10.486  -50.259 1.00 45.47 ? 307  PHE B CE2 1 
ATOM   6485 C  CZ  . PHE B 1 307 ? 17.465  10.802  -49.032 1.00 47.11 ? 307  PHE B CZ  1 
ATOM   6486 N  N   . LEU B 1 308 ? 23.396  11.403  -47.058 1.00 48.95 ? 308  LEU B N   1 
ATOM   6487 C  CA  . LEU B 1 308 ? 23.632  11.885  -45.707 1.00 48.94 ? 308  LEU B CA  1 
ATOM   6488 C  C   . LEU B 1 308 ? 25.065  12.415  -45.654 1.00 50.12 ? 308  LEU B C   1 
ATOM   6489 O  O   . LEU B 1 308 ? 26.019  11.638  -45.566 1.00 48.70 ? 308  LEU B O   1 
ATOM   6490 C  CB  . LEU B 1 308 ? 23.467  10.757  -44.690 1.00 47.35 ? 308  LEU B CB  1 
ATOM   6491 C  CG  . LEU B 1 308 ? 22.036  10.239  -44.544 1.00 47.23 ? 308  LEU B CG  1 
ATOM   6492 C  CD1 . LEU B 1 308 ? 22.006  9.131   -43.520 1.00 46.78 ? 308  LEU B CD1 1 
ATOM   6493 C  CD2 . LEU B 1 308 ? 21.108  11.369  -44.124 1.00 46.10 ? 308  LEU B CD2 1 
ATOM   6494 N  N   . SER B 1 309 ? 25.209  13.737  -45.713 1.00 51.51 ? 309  SER B N   1 
ATOM   6495 C  CA  . SER B 1 309 ? 26.527  14.371  -45.677 1.00 53.96 ? 309  SER B CA  1 
ATOM   6496 C  C   . SER B 1 309 ? 27.335  14.046  -44.416 1.00 54.30 ? 309  SER B C   1 
ATOM   6497 O  O   . SER B 1 309 ? 28.564  14.051  -44.438 1.00 55.07 ? 309  SER B O   1 
ATOM   6498 C  CB  . SER B 1 309 ? 26.383  15.889  -45.825 1.00 54.49 ? 309  SER B CB  1 
ATOM   6499 O  OG  . SER B 1 309 ? 25.737  16.467  -44.698 1.00 59.23 ? 309  SER B OG  1 
ATOM   6500 N  N   . ASP B 1 310 ? 26.649  13.748  -43.321 1.00 53.57 ? 310  ASP B N   1 
ATOM   6501 C  CA  . ASP B 1 310 ? 27.321  13.407  -42.071 1.00 53.80 ? 310  ASP B CA  1 
ATOM   6502 C  C   . ASP B 1 310 ? 26.337  12.527  -41.298 1.00 53.58 ? 310  ASP B C   1 
ATOM   6503 O  O   . ASP B 1 310 ? 25.287  12.166  -41.826 1.00 54.41 ? 310  ASP B O   1 
ATOM   6504 C  CB  . ASP B 1 310 ? 27.619  14.691  -41.276 1.00 55.62 ? 310  ASP B CB  1 
ATOM   6505 C  CG  . ASP B 1 310 ? 28.818  14.545  -40.318 1.00 58.51 ? 310  ASP B CG  1 
ATOM   6506 O  OD1 . ASP B 1 310 ? 29.006  13.462  -39.712 1.00 58.33 ? 310  ASP B OD1 1 
ATOM   6507 O  OD2 . ASP B 1 310 ? 29.570  15.535  -40.160 1.00 59.11 ? 310  ASP B OD2 1 
ATOM   6508 N  N   . THR B 1 311 ? 26.657  12.163  -40.063 1.00 52.75 ? 311  THR B N   1 
ATOM   6509 C  CA  . THR B 1 311 ? 25.730  11.363  -39.273 1.00 51.64 ? 311  THR B CA  1 
ATOM   6510 C  C   . THR B 1 311 ? 24.498  12.208  -38.934 1.00 51.89 ? 311  THR B C   1 
ATOM   6511 O  O   . THR B 1 311 ? 24.565  13.438  -38.831 1.00 52.26 ? 311  THR B O   1 
ATOM   6512 C  CB  . THR B 1 311 ? 26.343  10.945  -37.953 1.00 52.12 ? 311  THR B CB  1 
ATOM   6513 O  OG1 . THR B 1 311 ? 26.625  12.118  -37.184 1.00 48.60 ? 311  THR B OG1 1 
ATOM   6514 C  CG2 . THR B 1 311 ? 27.608  10.171  -38.180 1.00 50.69 ? 311  THR B CG2 1 
ATOM   6515 N  N   . PRO B 1 312 ? 23.349  11.561  -38.769 1.00 51.74 ? 312  PRO B N   1 
ATOM   6516 C  CA  . PRO B 1 312 ? 22.145  12.325  -38.434 1.00 52.65 ? 312  PRO B CA  1 
ATOM   6517 C  C   . PRO B 1 312 ? 22.370  13.152  -37.154 1.00 52.97 ? 312  PRO B C   1 
ATOM   6518 O  O   . PRO B 1 312 ? 21.817  14.240  -36.996 1.00 51.68 ? 312  PRO B O   1 
ATOM   6519 C  CB  . PRO B 1 312 ? 21.091  11.237  -38.250 1.00 52.84 ? 312  PRO B CB  1 
ATOM   6520 C  CG  . PRO B 1 312 ? 21.548  10.174  -39.231 1.00 53.93 ? 312  PRO B CG  1 
ATOM   6521 C  CD  . PRO B 1 312 ? 23.044  10.145  -39.033 1.00 52.02 ? 312  PRO B CD  1 
ATOM   6522 N  N   . GLU B 1 313 ? 23.193  12.620  -36.258 1.00 53.97 ? 313  GLU B N   1 
ATOM   6523 C  CA  . GLU B 1 313 ? 23.515  13.284  -35.003 1.00 56.94 ? 313  GLU B CA  1 
ATOM   6524 C  C   . GLU B 1 313 ? 24.154  14.643  -35.292 1.00 56.33 ? 313  GLU B C   1 
ATOM   6525 O  O   . GLU B 1 313 ? 23.687  15.682  -34.831 1.00 56.02 ? 313  GLU B O   1 
ATOM   6526 C  CB  . GLU B 1 313 ? 24.486  12.415  -34.212 1.00 60.63 ? 313  GLU B CB  1 
ATOM   6527 C  CG  . GLU B 1 313 ? 24.672  12.844  -32.771 1.00 68.49 ? 313  GLU B CG  1 
ATOM   6528 C  CD  . GLU B 1 313 ? 23.443  12.538  -31.909 1.00 73.85 ? 313  GLU B CD  1 
ATOM   6529 O  OE1 . GLU B 1 313 ? 22.459  11.956  -32.443 1.00 75.62 ? 313  GLU B OE1 1 
ATOM   6530 O  OE2 . GLU B 1 313 ? 23.464  12.874  -30.698 1.00 74.90 ? 313  GLU B OE2 1 
ATOM   6531 N  N   . ALA B 1 314 ? 25.223  14.630  -36.075 1.00 55.56 ? 314  ALA B N   1 
ATOM   6532 C  CA  . ALA B 1 314 ? 25.921  15.860  -36.425 1.00 55.70 ? 314  ALA B CA  1 
ATOM   6533 C  C   . ALA B 1 314 ? 24.992  16.822  -37.142 1.00 56.88 ? 314  ALA B C   1 
ATOM   6534 O  O   . ALA B 1 314 ? 24.962  18.019  -36.833 1.00 57.32 ? 314  ALA B O   1 
ATOM   6535 C  CB  . ALA B 1 314 ? 27.127  15.559  -37.323 1.00 52.45 ? 314  ALA B CB  1 
ATOM   6536 N  N   . LEU B 1 315 ? 24.233  16.296  -38.103 1.00 56.90 ? 315  LEU B N   1 
ATOM   6537 C  CA  . LEU B 1 315 ? 23.330  17.121  -38.890 1.00 55.54 ? 315  LEU B CA  1 
ATOM   6538 C  C   . LEU B 1 315 ? 22.226  17.786  -38.090 1.00 55.67 ? 315  LEU B C   1 
ATOM   6539 O  O   . LEU B 1 315 ? 21.872  18.923  -38.389 1.00 54.79 ? 315  LEU B O   1 
ATOM   6540 C  CB  . LEU B 1 315 ? 22.729  16.302  -40.034 1.00 55.65 ? 315  LEU B CB  1 
ATOM   6541 C  CG  . LEU B 1 315 ? 23.751  15.730  -41.027 1.00 56.23 ? 315  LEU B CG  1 
ATOM   6542 C  CD1 . LEU B 1 315 ? 23.041  14.949  -42.120 1.00 53.38 ? 315  LEU B CD1 1 
ATOM   6543 C  CD2 . LEU B 1 315 ? 24.571  16.879  -41.635 1.00 54.48 ? 315  LEU B CD2 1 
ATOM   6544 N  N   . ILE B 1 316 ? 21.675  17.106  -37.086 1.00 55.92 ? 316  ILE B N   1 
ATOM   6545 C  CA  . ILE B 1 316 ? 20.617  17.743  -36.310 1.00 58.88 ? 316  ILE B CA  1 
ATOM   6546 C  C   . ILE B 1 316 ? 21.202  18.691  -35.260 1.00 61.40 ? 316  ILE B C   1 
ATOM   6547 O  O   . ILE B 1 316 ? 20.492  19.563  -34.756 1.00 62.47 ? 316  ILE B O   1 
ATOM   6548 C  CB  . ILE B 1 316 ? 19.663  16.725  -35.603 1.00 57.47 ? 316  ILE B CB  1 
ATOM   6549 C  CG1 . ILE B 1 316 ? 20.412  15.951  -34.514 1.00 58.48 ? 316  ILE B CG1 1 
ATOM   6550 C  CG2 . ILE B 1 316 ? 19.034  15.813  -36.623 1.00 55.42 ? 316  ILE B CG2 1 
ATOM   6551 C  CD1 . ILE B 1 316 ? 19.505  15.117  -33.585 1.00 57.58 ? 316  ILE B CD1 1 
ATOM   6552 N  N   . ASN B 1 317 ? 22.486  18.530  -34.931 1.00 63.58 ? 317  ASN B N   1 
ATOM   6553 C  CA  . ASN B 1 317 ? 23.124  19.418  -33.952 1.00 65.76 ? 317  ASN B CA  1 
ATOM   6554 C  C   . ASN B 1 317 ? 23.548  20.728  -34.605 1.00 66.55 ? 317  ASN B C   1 
ATOM   6555 O  O   . ASN B 1 317 ? 23.560  21.774  -33.959 1.00 68.84 ? 317  ASN B O   1 
ATOM   6556 C  CB  . ASN B 1 317 ? 24.372  18.791  -33.329 1.00 65.42 ? 317  ASN B CB  1 
ATOM   6557 C  CG  . ASN B 1 317 ? 24.051  17.666  -32.376 1.00 67.28 ? 317  ASN B CG  1 
ATOM   6558 O  OD1 . ASN B 1 317 ? 22.983  17.640  -31.754 1.00 68.27 ? 317  ASN B OD1 1 
ATOM   6559 N  ND2 . ASN B 1 317 ? 24.991  16.728  -32.234 1.00 67.86 ? 317  ASN B ND2 1 
ATOM   6560 N  N   . THR B 1 318 ? 23.873  20.679  -35.889 1.00 65.67 ? 318  THR B N   1 
ATOM   6561 C  CA  . THR B 1 318 ? 24.338  21.868  -36.581 1.00 65.27 ? 318  THR B CA  1 
ATOM   6562 C  C   . THR B 1 318 ? 23.423  22.355  -37.679 1.00 65.64 ? 318  THR B C   1 
ATOM   6563 O  O   . THR B 1 318 ? 23.807  23.236  -38.446 1.00 66.12 ? 318  THR B O   1 
ATOM   6564 C  CB  . THR B 1 318 ? 25.693  21.621  -37.245 1.00 65.37 ? 318  THR B CB  1 
ATOM   6565 O  OG1 . THR B 1 318 ? 25.500  20.778  -38.391 1.00 64.96 ? 318  THR B OG1 1 
ATOM   6566 C  CG2 . THR B 1 318 ? 26.653  20.938  -36.272 1.00 65.56 ? 318  THR B CG2 1 
ATOM   6567 N  N   . GLY B 1 319 ? 22.229  21.795  -37.786 1.00 64.21 ? 319  GLY B N   1 
ATOM   6568 C  CA  . GLY B 1 319 ? 21.353  22.241  -38.844 1.00 63.53 ? 319  GLY B CA  1 
ATOM   6569 C  C   . GLY B 1 319 ? 20.544  23.481  -38.516 1.00 64.29 ? 319  GLY B C   1 
ATOM   6570 O  O   . GLY B 1 319 ? 20.293  23.780  -37.352 1.00 63.81 ? 319  GLY B O   1 
ATOM   6571 N  N   . ASP B 1 320 ? 20.153  24.202  -39.562 1.00 64.48 ? 320  ASP B N   1 
ATOM   6572 C  CA  . ASP B 1 320 ? 19.327  25.390  -39.440 1.00 65.89 ? 320  ASP B CA  1 
ATOM   6573 C  C   . ASP B 1 320 ? 17.952  24.953  -39.925 1.00 65.86 ? 320  ASP B C   1 
ATOM   6574 O  O   . ASP B 1 320 ? 17.771  24.665  -41.110 1.00 66.57 ? 320  ASP B O   1 
ATOM   6575 C  CB  . ASP B 1 320 ? 19.846  26.528  -40.332 1.00 67.40 ? 320  ASP B CB  1 
ATOM   6576 C  CG  . ASP B 1 320 ? 18.839  27.688  -40.455 1.00 69.56 ? 320  ASP B CG  1 
ATOM   6577 O  OD1 . ASP B 1 320 ? 18.203  28.038  -39.435 1.00 70.24 ? 320  ASP B OD1 1 
ATOM   6578 O  OD2 . ASP B 1 320 ? 18.688  28.256  -41.566 1.00 70.63 ? 320  ASP B OD2 1 
ATOM   6579 N  N   . PHE B 1 321 ? 16.983  24.915  -39.016 1.00 64.69 ? 321  PHE B N   1 
ATOM   6580 C  CA  . PHE B 1 321 ? 15.642  24.477  -39.368 1.00 63.65 ? 321  PHE B CA  1 
ATOM   6581 C  C   . PHE B 1 321 ? 14.611  25.583  -39.229 1.00 65.45 ? 321  PHE B C   1 
ATOM   6582 O  O   . PHE B 1 321 ? 13.466  25.339  -38.844 1.00 65.12 ? 321  PHE B O   1 
ATOM   6583 C  CB  . PHE B 1 321 ? 15.287  23.284  -38.493 1.00 59.42 ? 321  PHE B CB  1 
ATOM   6584 C  CG  . PHE B 1 321 ? 16.303  22.176  -38.557 1.00 55.47 ? 321  PHE B CG  1 
ATOM   6585 C  CD1 . PHE B 1 321 ? 16.444  21.404  -39.706 1.00 52.67 ? 321  PHE B CD1 1 
ATOM   6586 C  CD2 . PHE B 1 321 ? 17.117  21.901  -37.471 1.00 52.67 ? 321  PHE B CD2 1 
ATOM   6587 C  CE1 . PHE B 1 321 ? 17.379  20.374  -39.766 1.00 50.59 ? 321  PHE B CE1 1 
ATOM   6588 C  CE2 . PHE B 1 321 ? 18.049  20.875  -37.526 1.00 52.09 ? 321  PHE B CE2 1 
ATOM   6589 C  CZ  . PHE B 1 321 ? 18.179  20.108  -38.681 1.00 49.97 ? 321  PHE B CZ  1 
ATOM   6590 N  N   . GLN B 1 322 ? 15.034  26.794  -39.579 1.00 68.51 ? 322  GLN B N   1 
ATOM   6591 C  CA  . GLN B 1 322 ? 14.205  27.989  -39.494 1.00 71.55 ? 322  GLN B CA  1 
ATOM   6592 C  C   . GLN B 1 322 ? 12.787  27.890  -40.041 1.00 72.30 ? 322  GLN B C   1 
ATOM   6593 O  O   . GLN B 1 322 ? 11.822  28.118  -39.300 1.00 73.80 ? 322  GLN B O   1 
ATOM   6594 C  CB  . GLN B 1 322 ? 14.913  29.179  -40.161 1.00 74.95 ? 322  GLN B CB  1 
ATOM   6595 C  CG  . GLN B 1 322 ? 15.767  30.002  -39.204 1.00 80.45 ? 322  GLN B CG  1 
ATOM   6596 C  CD  . GLN B 1 322 ? 14.933  30.658  -38.095 1.00 84.67 ? 322  GLN B CD  1 
ATOM   6597 O  OE1 . GLN B 1 322 ? 15.448  31.009  -37.020 1.00 85.44 ? 322  GLN B OE1 1 
ATOM   6598 N  NE2 . GLN B 1 322 ? 13.635  30.833  -38.359 1.00 85.90 ? 322  GLN B NE2 1 
ATOM   6599 N  N   . ASP B 1 323 ? 12.638  27.556  -41.319 1.00 71.73 ? 323  ASP B N   1 
ATOM   6600 C  CA  . ASP B 1 323 ? 11.296  27.502  -41.900 1.00 71.52 ? 323  ASP B CA  1 
ATOM   6601 C  C   . ASP B 1 323 ? 10.694  26.116  -42.032 1.00 69.03 ? 323  ASP B C   1 
ATOM   6602 O  O   . ASP B 1 323 ? 10.206  25.734  -43.095 1.00 68.74 ? 323  ASP B O   1 
ATOM   6603 C  CB  . ASP B 1 323 ? 11.290  28.214  -43.261 1.00 75.20 ? 323  ASP B CB  1 
ATOM   6604 C  CG  . ASP B 1 323 ? 11.094  29.744  -43.125 1.00 79.28 ? 323  ASP B CG  1 
ATOM   6605 O  OD1 . ASP B 1 323 ? 9.975   30.171  -42.724 1.00 80.84 ? 323  ASP B OD1 1 
ATOM   6606 O  OD2 . ASP B 1 323 ? 12.054  30.510  -43.406 1.00 79.63 ? 323  ASP B OD2 1 
ATOM   6607 N  N   . LEU B 1 324 ? 10.693  25.380  -40.927 1.00 64.53 ? 324  LEU B N   1 
ATOM   6608 C  CA  . LEU B 1 324 ? 10.178  24.024  -40.932 1.00 59.18 ? 324  LEU B CA  1 
ATOM   6609 C  C   . LEU B 1 324 ? 9.194   23.806  -39.798 1.00 55.19 ? 324  LEU B C   1 
ATOM   6610 O  O   . LEU B 1 324 ? 9.427   24.257  -38.689 1.00 54.20 ? 324  LEU B O   1 
ATOM   6611 C  CB  . LEU B 1 324 ? 11.352  23.045  -40.777 1.00 58.24 ? 324  LEU B CB  1 
ATOM   6612 C  CG  . LEU B 1 324 ? 11.011  21.561  -40.790 1.00 57.04 ? 324  LEU B CG  1 
ATOM   6613 C  CD1 . LEU B 1 324 ? 10.608  21.165  -42.199 1.00 57.86 ? 324  LEU B CD1 1 
ATOM   6614 C  CD2 . LEU B 1 324 ? 12.190  20.754  -40.339 1.00 56.71 ? 324  LEU B CD2 1 
ATOM   6615 N  N   . GLN B 1 325 ? 8.083   23.145  -40.082 1.00 51.57 ? 325  GLN B N   1 
ATOM   6616 C  CA  . GLN B 1 325 ? 7.137   22.812  -39.026 1.00 50.03 ? 325  GLN B CA  1 
ATOM   6617 C  C   . GLN B 1 325 ? 7.169   21.290  -38.935 1.00 47.80 ? 325  GLN B C   1 
ATOM   6618 O  O   . GLN B 1 325 ? 7.101   20.599  -39.948 1.00 48.82 ? 325  GLN B O   1 
ATOM   6619 C  CB  . GLN B 1 325 ? 5.725   23.273  -39.348 1.00 50.79 ? 325  GLN B CB  1 
ATOM   6620 C  CG  . GLN B 1 325 ? 5.569   24.747  -39.520 1.00 53.30 ? 325  GLN B CG  1 
ATOM   6621 C  CD  . GLN B 1 325 ? 5.716   25.152  -40.964 1.00 55.36 ? 325  GLN B CD  1 
ATOM   6622 O  OE1 . GLN B 1 325 ? 5.039   24.616  -41.840 1.00 55.63 ? 325  GLN B OE1 1 
ATOM   6623 N  NE2 . GLN B 1 325 ? 6.606   26.104  -41.226 1.00 58.01 ? 325  GLN B NE2 1 
ATOM   6624 N  N   . VAL B 1 326 ? 7.283   20.763  -37.728 1.00 45.96 ? 326  VAL B N   1 
ATOM   6625 C  CA  . VAL B 1 326 ? 7.353   19.328  -37.547 1.00 44.24 ? 326  VAL B CA  1 
ATOM   6626 C  C   . VAL B 1 326 ? 6.458   18.845  -36.422 1.00 43.56 ? 326  VAL B C   1 
ATOM   6627 O  O   . VAL B 1 326 ? 6.354   19.492  -35.388 1.00 44.34 ? 326  VAL B O   1 
ATOM   6628 C  CB  . VAL B 1 326 ? 8.805   18.897  -37.214 1.00 45.27 ? 326  VAL B CB  1 
ATOM   6629 C  CG1 . VAL B 1 326 ? 8.870   17.414  -36.959 1.00 44.77 ? 326  VAL B CG1 1 
ATOM   6630 C  CG2 . VAL B 1 326 ? 9.732   19.268  -38.339 1.00 45.05 ? 326  VAL B CG2 1 
ATOM   6631 N  N   . LEU B 1 327 ? 5.811   17.703  -36.631 1.00 42.52 ? 327  LEU B N   1 
ATOM   6632 C  CA  . LEU B 1 327 ? 4.965   17.083  -35.619 1.00 40.70 ? 327  LEU B CA  1 
ATOM   6633 C  C   . LEU B 1 327 ? 5.635   15.733  -35.309 1.00 40.50 ? 327  LEU B C   1 
ATOM   6634 O  O   . LEU B 1 327 ? 5.924   14.948  -36.219 1.00 41.52 ? 327  LEU B O   1 
ATOM   6635 C  CB  . LEU B 1 327 ? 3.548   16.889  -36.163 1.00 40.18 ? 327  LEU B CB  1 
ATOM   6636 C  CG  . LEU B 1 327 ? 2.628   15.978  -35.345 1.00 42.31 ? 327  LEU B CG  1 
ATOM   6637 C  CD1 . LEU B 1 327 ? 2.274   16.627  -34.016 1.00 42.14 ? 327  LEU B CD1 1 
ATOM   6638 C  CD2 . LEU B 1 327 ? 1.361   15.703  -36.154 1.00 42.32 ? 327  LEU B CD2 1 
ATOM   6639 N  N   . VAL B 1 328 ? 5.933   15.478  -34.041 1.00 39.18 ? 328  VAL B N   1 
ATOM   6640 C  CA  . VAL B 1 328 ? 6.588   14.238  -33.649 1.00 39.11 ? 328  VAL B CA  1 
ATOM   6641 C  C   . VAL B 1 328 ? 5.920   13.655  -32.413 1.00 40.64 ? 328  VAL B C   1 
ATOM   6642 O  O   . VAL B 1 328 ? 5.319   14.383  -31.613 1.00 42.44 ? 328  VAL B O   1 
ATOM   6643 C  CB  . VAL B 1 328 ? 8.085   14.459  -33.302 1.00 39.22 ? 328  VAL B CB  1 
ATOM   6644 C  CG1 . VAL B 1 328 ? 8.799   15.057  -34.459 1.00 39.13 ? 328  VAL B CG1 1 
ATOM   6645 C  CG2 . VAL B 1 328 ? 8.210   15.388  -32.086 1.00 39.78 ? 328  VAL B CG2 1 
ATOM   6646 N  N   . GLY B 1 329 ? 6.042   12.347  -32.224 1.00 40.58 ? 329  GLY B N   1 
ATOM   6647 C  CA  . GLY B 1 329 ? 5.419   11.750  -31.061 1.00 39.61 ? 329  GLY B CA  1 
ATOM   6648 C  C   . GLY B 1 329 ? 5.729   10.281  -30.933 1.00 40.69 ? 329  GLY B C   1 
ATOM   6649 O  O   . GLY B 1 329 ? 6.340   9.683   -31.828 1.00 38.99 ? 329  GLY B O   1 
ATOM   6650 N  N   . VAL B 1 330 ? 5.297   9.699   -29.817 1.00 38.80 ? 330  VAL B N   1 
ATOM   6651 C  CA  . VAL B 1 330 ? 5.534   8.296   -29.536 1.00 39.56 ? 330  VAL B CA  1 
ATOM   6652 C  C   . VAL B 1 330 ? 4.247   7.676   -28.997 1.00 41.10 ? 330  VAL B C   1 
ATOM   6653 O  O   . VAL B 1 330 ? 3.299   8.403   -28.697 1.00 40.65 ? 330  VAL B O   1 
ATOM   6654 C  CB  . VAL B 1 330 ? 6.630   8.123   -28.442 1.00 39.01 ? 330  VAL B CB  1 
ATOM   6655 C  CG1 . VAL B 1 330 ? 7.963   8.668   -28.926 1.00 37.36 ? 330  VAL B CG1 1 
ATOM   6656 C  CG2 . VAL B 1 330 ? 6.193   8.838   -27.166 1.00 36.65 ? 330  VAL B CG2 1 
ATOM   6657 N  N   . VAL B 1 331 ? 4.221   6.344   -28.884 1.00 39.75 ? 331  VAL B N   1 
ATOM   6658 C  CA  . VAL B 1 331 ? 3.061   5.653   -28.335 1.00 40.43 ? 331  VAL B CA  1 
ATOM   6659 C  C   . VAL B 1 331 ? 3.452   5.325   -26.904 1.00 43.04 ? 331  VAL B C   1 
ATOM   6660 O  O   . VAL B 1 331 ? 4.639   5.400   -26.549 1.00 43.74 ? 331  VAL B O   1 
ATOM   6661 C  CB  . VAL B 1 331 ? 2.683   4.315   -29.113 1.00 40.17 ? 331  VAL B CB  1 
ATOM   6662 C  CG1 . VAL B 1 331 ? 2.140   4.668   -30.500 1.00 37.03 ? 331  VAL B CG1 1 
ATOM   6663 C  CG2 . VAL B 1 331 ? 3.890   3.335   -29.201 1.00 32.63 ? 331  VAL B CG2 1 
ATOM   6664 N  N   . LYS B 1 332 ? 2.473   4.944   -26.087 1.00 44.31 ? 332  LYS B N   1 
ATOM   6665 C  CA  . LYS B 1 332 ? 2.734   4.656   -24.679 1.00 44.90 ? 332  LYS B CA  1 
ATOM   6666 C  C   . LYS B 1 332 ? 3.732   3.538   -24.392 1.00 45.54 ? 332  LYS B C   1 
ATOM   6667 O  O   . LYS B 1 332 ? 4.488   3.619   -23.413 1.00 43.08 ? 332  LYS B O   1 
ATOM   6668 C  CB  . LYS B 1 332 ? 1.416   4.385   -23.938 1.00 47.60 ? 332  LYS B CB  1 
ATOM   6669 C  CG  . LYS B 1 332 ? 1.561   4.357   -22.407 1.00 49.48 ? 332  LYS B CG  1 
ATOM   6670 C  CD  . LYS B 1 332 ? 0.209   4.285   -21.672 1.00 54.15 ? 332  LYS B CD  1 
ATOM   6671 C  CE  . LYS B 1 332 ? 0.127   3.059   -20.718 1.00 57.69 ? 332  LYS B CE  1 
ATOM   6672 N  NZ  . LYS B 1 332 ? 0.132   1.691   -21.402 1.00 56.24 ? 332  LYS B NZ  1 
ATOM   6673 N  N   . ASP B 1 333 ? 3.755   2.491   -25.219 1.00 45.19 ? 333  ASP B N   1 
ATOM   6674 C  CA  . ASP B 1 333 ? 4.696   1.387   -24.960 1.00 45.59 ? 333  ASP B CA  1 
ATOM   6675 C  C   . ASP B 1 333 ? 5.520   1.000   -26.194 1.00 47.00 ? 333  ASP B C   1 
ATOM   6676 O  O   . ASP B 1 333 ? 5.358   -0.087  -26.777 1.00 48.01 ? 333  ASP B O   1 
ATOM   6677 C  CB  . ASP B 1 333 ? 3.933   0.168   -24.420 1.00 45.50 ? 333  ASP B CB  1 
ATOM   6678 C  CG  . ASP B 1 333 ? 3.097   0.492   -23.178 1.00 46.61 ? 333  ASP B CG  1 
ATOM   6679 O  OD1 . ASP B 1 333 ? 1.898   0.856   -23.294 1.00 43.15 ? 333  ASP B OD1 1 
ATOM   6680 O  OD2 . ASP B 1 333 ? 3.662   0.383   -22.066 1.00 51.78 ? 333  ASP B OD2 1 
ATOM   6681 N  N   . GLU B 1 334 ? 6.421   1.893   -26.584 1.00 46.33 ? 334  GLU B N   1 
ATOM   6682 C  CA  . GLU B 1 334 ? 7.263   1.678   -27.757 1.00 45.09 ? 334  GLU B CA  1 
ATOM   6683 C  C   . GLU B 1 334 ? 8.004   0.345   -27.777 1.00 44.07 ? 334  GLU B C   1 
ATOM   6684 O  O   . GLU B 1 334 ? 8.166   -0.252  -28.831 1.00 43.61 ? 334  GLU B O   1 
ATOM   6685 C  CB  . GLU B 1 334 ? 8.278   2.828   -27.889 1.00 44.59 ? 334  GLU B CB  1 
ATOM   6686 C  CG  . GLU B 1 334 ? 7.664   4.173   -28.240 1.00 43.69 ? 334  GLU B CG  1 
ATOM   6687 C  CD  . GLU B 1 334 ? 7.094   4.212   -29.657 1.00 49.50 ? 334  GLU B CD  1 
ATOM   6688 O  OE1 . GLU B 1 334 ? 7.346   3.258   -30.438 1.00 47.92 ? 334  GLU B OE1 1 
ATOM   6689 O  OE2 . GLU B 1 334 ? 6.397   5.204   -29.998 1.00 49.67 ? 334  GLU B OE2 1 
ATOM   6690 N  N   . GLY B 1 335 ? 8.432   -0.148  -26.625 1.00 43.66 ? 335  GLY B N   1 
ATOM   6691 C  CA  . GLY B 1 335 ? 9.195   -1.379  -26.648 1.00 45.02 ? 335  GLY B CA  1 
ATOM   6692 C  C   . GLY B 1 335 ? 8.566   -2.753  -26.465 1.00 45.31 ? 335  GLY B C   1 
ATOM   6693 O  O   . GLY B 1 335 ? 9.185   -3.745  -26.836 1.00 45.14 ? 335  GLY B O   1 
ATOM   6694 N  N   . SER B 1 336 ? 7.361   -2.834  -25.922 1.00 46.45 ? 336  SER B N   1 
ATOM   6695 C  CA  . SER B 1 336 ? 6.744   -4.132  -25.662 1.00 48.56 ? 336  SER B CA  1 
ATOM   6696 C  C   . SER B 1 336 ? 6.851   -5.117  -26.826 1.00 51.04 ? 336  SER B C   1 
ATOM   6697 O  O   . SER B 1 336 ? 7.345   -6.230  -26.672 1.00 51.72 ? 336  SER B O   1 
ATOM   6698 C  CB  . SER B 1 336 ? 5.281   -3.936  -25.279 1.00 48.79 ? 336  SER B CB  1 
ATOM   6699 O  OG  . SER B 1 336 ? 4.587   -3.247  -26.303 1.00 49.85 ? 336  SER B OG  1 
ATOM   6700 N  N   . TYR B 1 337 ? 6.384   -4.682  -27.983 1.00 52.50 ? 337  TYR B N   1 
ATOM   6701 C  CA  . TYR B 1 337 ? 6.388   -5.450  -29.220 1.00 54.14 ? 337  TYR B CA  1 
ATOM   6702 C  C   . TYR B 1 337 ? 7.681   -6.233  -29.453 1.00 53.66 ? 337  TYR B C   1 
ATOM   6703 O  O   . TYR B 1 337 ? 7.675   -7.448  -29.631 1.00 53.83 ? 337  TYR B O   1 
ATOM   6704 C  CB  . TYR B 1 337 ? 6.209   -4.462  -30.377 1.00 59.17 ? 337  TYR B CB  1 
ATOM   6705 C  CG  . TYR B 1 337 ? 5.718   -5.042  -31.661 1.00 62.43 ? 337  TYR B CG  1 
ATOM   6706 C  CD1 . TYR B 1 337 ? 4.356   -5.187  -31.888 1.00 65.45 ? 337  TYR B CD1 1 
ATOM   6707 C  CD2 . TYR B 1 337 ? 6.608   -5.454  -32.652 1.00 65.55 ? 337  TYR B CD2 1 
ATOM   6708 C  CE1 . TYR B 1 337 ? 3.865   -5.732  -33.080 1.00 67.96 ? 337  TYR B CE1 1 
ATOM   6709 C  CE2 . TYR B 1 337 ? 6.134   -6.007  -33.861 1.00 69.21 ? 337  TYR B CE2 1 
ATOM   6710 C  CZ  . TYR B 1 337 ? 4.749   -6.140  -34.063 1.00 68.47 ? 337  TYR B CZ  1 
ATOM   6711 O  OH  . TYR B 1 337 ? 4.237   -6.656  -35.236 1.00 69.14 ? 337  TYR B OH  1 
ATOM   6712 N  N   . PHE B 1 338 ? 8.793   -5.515  -29.456 1.00 51.93 ? 338  PHE B N   1 
ATOM   6713 C  CA  . PHE B 1 338 ? 10.085  -6.100  -29.741 1.00 52.16 ? 338  PHE B CA  1 
ATOM   6714 C  C   . PHE B 1 338 ? 10.605  -7.161  -28.801 1.00 53.09 ? 338  PHE B C   1 
ATOM   6715 O  O   . PHE B 1 338 ? 11.432  -7.992  -29.198 1.00 53.82 ? 338  PHE B O   1 
ATOM   6716 C  CB  . PHE B 1 338 ? 11.129  -4.989  -29.877 1.00 51.56 ? 338  PHE B CB  1 
ATOM   6717 C  CG  . PHE B 1 338 ? 10.782  -3.963  -30.928 1.00 51.01 ? 338  PHE B CG  1 
ATOM   6718 C  CD1 . PHE B 1 338 ? 9.862   -2.940  -30.653 1.00 50.80 ? 338  PHE B CD1 1 
ATOM   6719 C  CD2 . PHE B 1 338 ? 11.327  -4.051  -32.210 1.00 47.71 ? 338  PHE B CD2 1 
ATOM   6720 C  CE1 . PHE B 1 338 ? 9.486   -2.020  -31.642 1.00 50.15 ? 338  PHE B CE1 1 
ATOM   6721 C  CE2 . PHE B 1 338 ? 10.961  -3.141  -33.210 1.00 48.13 ? 338  PHE B CE2 1 
ATOM   6722 C  CZ  . PHE B 1 338 ? 10.038  -2.123  -32.930 1.00 49.04 ? 338  PHE B CZ  1 
ATOM   6723 N  N   . LEU B 1 339 ? 10.129  -7.151  -27.566 1.00 53.46 ? 339  LEU B N   1 
ATOM   6724 C  CA  . LEU B 1 339 ? 10.606  -8.109  -26.573 1.00 54.73 ? 339  LEU B CA  1 
ATOM   6725 C  C   . LEU B 1 339 ? 10.363  -9.582  -26.953 1.00 56.03 ? 339  LEU B C   1 
ATOM   6726 O  O   . LEU B 1 339 ? 11.221  -10.435 -26.682 1.00 57.05 ? 339  LEU B O   1 
ATOM   6727 C  CB  . LEU B 1 339 ? 9.984   -7.782  -25.204 1.00 52.65 ? 339  LEU B CB  1 
ATOM   6728 C  CG  . LEU B 1 339 ? 10.281  -6.358  -24.676 1.00 52.65 ? 339  LEU B CG  1 
ATOM   6729 C  CD1 . LEU B 1 339 ? 9.530   -6.081  -23.379 1.00 49.38 ? 339  LEU B CD1 1 
ATOM   6730 C  CD2 . LEU B 1 339 ? 11.775  -6.214  -24.454 1.00 52.03 ? 339  LEU B CD2 1 
ATOM   6731 N  N   . VAL B 1 340 ? 9.229   -9.870  -27.598 1.00 56.12 ? 340  VAL B N   1 
ATOM   6732 C  CA  . VAL B 1 340 ? 8.888   -11.246 -27.988 1.00 57.24 ? 340  VAL B CA  1 
ATOM   6733 C  C   . VAL B 1 340 ? 9.686   -11.774 -29.178 1.00 58.24 ? 340  VAL B C   1 
ATOM   6734 O  O   . VAL B 1 340 ? 9.569   -12.943 -29.541 1.00 58.74 ? 340  VAL B O   1 
ATOM   6735 C  CB  . VAL B 1 340 ? 7.396   -11.386 -28.340 1.00 56.93 ? 340  VAL B CB  1 
ATOM   6736 C  CG1 . VAL B 1 340 ? 6.542   -10.773 -27.237 1.00 57.01 ? 340  VAL B CG1 1 
ATOM   6737 C  CG2 . VAL B 1 340 ? 7.120   -10.721 -29.678 1.00 55.61 ? 340  VAL B CG2 1 
ATOM   6738 N  N   . TYR B 1 341 ? 10.488  -10.913 -29.792 1.00 59.47 ? 341  TYR B N   1 
ATOM   6739 C  CA  . TYR B 1 341 ? 11.305  -11.324 -30.924 1.00 59.27 ? 341  TYR B CA  1 
ATOM   6740 C  C   . TYR B 1 341 ? 12.752  -11.613 -30.539 1.00 60.54 ? 341  TYR B C   1 
ATOM   6741 O  O   . TYR B 1 341 ? 13.665  -11.434 -31.352 1.00 61.24 ? 341  TYR B O   1 
ATOM   6742 C  CB  . TYR B 1 341 ? 11.305  -10.259 -32.015 1.00 58.19 ? 341  TYR B CB  1 
ATOM   6743 C  CG  . TYR B 1 341 ? 10.050  -10.244 -32.843 1.00 60.51 ? 341  TYR B CG  1 
ATOM   6744 C  CD1 . TYR B 1 341 ? 8.914   -9.573  -32.404 1.00 59.79 ? 341  TYR B CD1 1 
ATOM   6745 C  CD2 . TYR B 1 341 ? 9.989   -10.927 -34.070 1.00 59.71 ? 341  TYR B CD2 1 
ATOM   6746 C  CE1 . TYR B 1 341 ? 7.748   -9.574  -33.158 1.00 61.01 ? 341  TYR B CE1 1 
ATOM   6747 C  CE2 . TYR B 1 341 ? 8.828   -10.937 -34.827 1.00 59.35 ? 341  TYR B CE2 1 
ATOM   6748 C  CZ  . TYR B 1 341 ? 7.711   -10.258 -34.368 1.00 60.82 ? 341  TYR B CZ  1 
ATOM   6749 O  OH  . TYR B 1 341 ? 6.551   -10.248 -35.106 1.00 62.35 ? 341  TYR B OH  1 
ATOM   6750 N  N   . GLY B 1 342 ? 12.991  -12.048 -29.311 1.00 60.90 ? 342  GLY B N   1 
ATOM   6751 C  CA  . GLY B 1 342 ? 14.371  -12.328 -28.963 1.00 61.33 ? 342  GLY B CA  1 
ATOM   6752 C  C   . GLY B 1 342 ? 14.809  -12.249 -27.518 1.00 60.47 ? 342  GLY B C   1 
ATOM   6753 O  O   . GLY B 1 342 ? 15.909  -12.680 -27.203 1.00 61.48 ? 342  GLY B O   1 
ATOM   6754 N  N   . VAL B 1 343 ? 13.990  -11.689 -26.641 1.00 60.42 ? 343  VAL B N   1 
ATOM   6755 C  CA  . VAL B 1 343 ? 14.381  -11.619 -25.239 1.00 60.89 ? 343  VAL B CA  1 
ATOM   6756 C  C   . VAL B 1 343 ? 13.810  -12.827 -24.487 1.00 60.37 ? 343  VAL B C   1 
ATOM   6757 O  O   . VAL B 1 343 ? 12.588  -12.987 -24.382 1.00 61.19 ? 343  VAL B O   1 
ATOM   6758 C  CB  . VAL B 1 343 ? 13.856  -10.327 -24.560 1.00 62.32 ? 343  VAL B CB  1 
ATOM   6759 C  CG1 . VAL B 1 343 ? 14.432  -10.214 -23.141 1.00 60.79 ? 343  VAL B CG1 1 
ATOM   6760 C  CG2 . VAL B 1 343 ? 14.247  -9.112  -25.383 1.00 63.56 ? 343  VAL B CG2 1 
ATOM   6761 N  N   . PRO B 1 344 ? 14.684  -13.694 -23.953 1.00 59.52 ? 344  PRO B N   1 
ATOM   6762 C  CA  . PRO B 1 344 ? 14.206  -14.872 -23.220 1.00 60.36 ? 344  PRO B CA  1 
ATOM   6763 C  C   . PRO B 1 344 ? 13.232  -14.493 -22.112 1.00 60.51 ? 344  PRO B C   1 
ATOM   6764 O  O   . PRO B 1 344 ? 13.498  -13.581 -21.322 1.00 60.79 ? 344  PRO B O   1 
ATOM   6765 C  CB  . PRO B 1 344 ? 15.488  -15.484 -22.650 1.00 59.47 ? 344  PRO B CB  1 
ATOM   6766 C  CG  . PRO B 1 344 ? 16.528  -15.080 -23.641 1.00 60.43 ? 344  PRO B CG  1 
ATOM   6767 C  CD  . PRO B 1 344 ? 16.155  -13.639 -23.954 1.00 60.16 ? 344  PRO B CD  1 
ATOM   6768 N  N   . GLY B 1 345 ? 12.101  -15.186 -22.065 1.00 60.74 ? 345  GLY B N   1 
ATOM   6769 C  CA  . GLY B 1 345 ? 11.128  -14.922 -21.027 1.00 59.81 ? 345  GLY B CA  1 
ATOM   6770 C  C   . GLY B 1 345 ? 9.911   -14.197 -21.535 1.00 60.65 ? 345  GLY B C   1 
ATOM   6771 O  O   . GLY B 1 345 ? 8.872   -14.154 -20.866 1.00 61.87 ? 345  GLY B O   1 
ATOM   6772 N  N   . PHE B 1 346 ? 10.008  -13.621 -22.723 1.00 60.12 ? 346  PHE B N   1 
ATOM   6773 C  CA  . PHE B 1 346 ? 8.854   -12.897 -23.238 1.00 60.75 ? 346  PHE B CA  1 
ATOM   6774 C  C   . PHE B 1 346 ? 8.095   -13.637 -24.329 1.00 62.02 ? 346  PHE B C   1 
ATOM   6775 O  O   . PHE B 1 346 ? 8.689   -14.255 -25.217 1.00 62.80 ? 346  PHE B O   1 
ATOM   6776 C  CB  . PHE B 1 346 ? 9.271   -11.501 -23.719 1.00 59.46 ? 346  PHE B CB  1 
ATOM   6777 C  CG  . PHE B 1 346 ? 9.722   -10.584 -22.599 1.00 57.49 ? 346  PHE B CG  1 
ATOM   6778 C  CD1 . PHE B 1 346 ? 11.010  -10.681 -22.070 1.00 56.82 ? 346  PHE B CD1 1 
ATOM   6779 C  CD2 . PHE B 1 346 ? 8.842   -9.637  -22.061 1.00 56.95 ? 346  PHE B CD2 1 
ATOM   6780 C  CE1 . PHE B 1 346 ? 11.418  -9.843  -21.020 1.00 57.60 ? 346  PHE B CE1 1 
ATOM   6781 C  CE2 . PHE B 1 346 ? 9.233   -8.801  -21.020 1.00 56.51 ? 346  PHE B CE2 1 
ATOM   6782 C  CZ  . PHE B 1 346 ? 10.526  -8.902  -20.495 1.00 57.68 ? 346  PHE B CZ  1 
ATOM   6783 N  N   . SER B 1 347 ? 6.771   -13.586 -24.236 1.00 62.57 ? 347  SER B N   1 
ATOM   6784 C  CA  . SER B 1 347 ? 5.895   -14.232 -25.198 1.00 62.85 ? 347  SER B CA  1 
ATOM   6785 C  C   . SER B 1 347 ? 4.583   -13.490 -25.212 1.00 62.92 ? 347  SER B C   1 
ATOM   6786 O  O   . SER B 1 347 ? 4.236   -12.829 -24.242 1.00 63.22 ? 347  SER B O   1 
ATOM   6787 C  CB  . SER B 1 347 ? 5.635   -15.688 -24.803 1.00 64.18 ? 347  SER B CB  1 
ATOM   6788 O  OG  . SER B 1 347 ? 4.436   -16.163 -25.409 1.00 65.19 ? 347  SER B OG  1 
ATOM   6789 N  N   . LYS B 1 348 ? 3.849   -13.592 -26.310 1.00 63.67 ? 348  LYS B N   1 
ATOM   6790 C  CA  . LYS B 1 348 ? 2.571   -12.918 -26.395 1.00 64.92 ? 348  LYS B CA  1 
ATOM   6791 C  C   . LYS B 1 348 ? 1.531   -13.781 -25.722 1.00 66.11 ? 348  LYS B C   1 
ATOM   6792 O  O   . LYS B 1 348 ? 0.419   -13.334 -25.440 1.00 66.12 ? 348  LYS B O   1 
ATOM   6793 C  CB  . LYS B 1 348 ? 2.159   -12.709 -27.853 1.00 65.68 ? 348  LYS B CB  1 
ATOM   6794 C  CG  . LYS B 1 348 ? 1.583   -13.953 -28.544 1.00 66.43 ? 348  LYS B CG  1 
ATOM   6795 C  CD  . LYS B 1 348 ? 1.056   -13.626 -29.945 1.00 66.92 ? 348  LYS B CD  1 
ATOM   6796 C  CE  . LYS B 1 348 ? 0.339   -14.811 -30.598 1.00 66.76 ? 348  LYS B CE  1 
ATOM   6797 N  NZ  . LYS B 1 348 ? -0.959  -15.127 -29.929 1.00 66.83 ? 348  LYS B NZ  1 
ATOM   6798 N  N   . ASP B 1 349 ? 1.904   -15.022 -25.446 1.00 68.09 ? 349  ASP B N   1 
ATOM   6799 C  CA  . ASP B 1 349 ? 0.959   -15.968 -24.867 1.00 71.33 ? 349  ASP B CA  1 
ATOM   6800 C  C   . ASP B 1 349 ? 0.842   -16.099 -23.333 1.00 72.99 ? 349  ASP B C   1 
ATOM   6801 O  O   . ASP B 1 349 ? -0.070  -16.764 -22.840 1.00 73.09 ? 349  ASP B O   1 
ATOM   6802 C  CB  . ASP B 1 349 ? 1.171   -17.332 -25.545 1.00 70.42 ? 349  ASP B CB  1 
ATOM   6803 C  CG  . ASP B 1 349 ? 0.909   -17.272 -27.061 1.00 69.49 ? 349  ASP B CG  1 
ATOM   6804 O  OD1 . ASP B 1 349 ? -0.147  -16.721 -27.457 1.00 68.58 ? 349  ASP B OD1 1 
ATOM   6805 O  OD2 . ASP B 1 349 ? 1.751   -17.772 -27.850 1.00 69.38 ? 349  ASP B OD2 1 
ATOM   6806 N  N   . ASN B 1 350 ? 1.754   -15.484 -22.581 1.00 75.41 ? 350  ASN B N   1 
ATOM   6807 C  CA  . ASN B 1 350 ? 1.648   -15.478 -21.117 1.00 76.66 ? 350  ASN B CA  1 
ATOM   6808 C  C   . ASN B 1 350 ? 1.951   -14.063 -20.600 1.00 75.88 ? 350  ASN B C   1 
ATOM   6809 O  O   . ASN B 1 350 ? 2.239   -13.164 -21.389 1.00 76.37 ? 350  ASN B O   1 
ATOM   6810 C  CB  . ASN B 1 350 ? 2.559   -16.532 -20.452 1.00 79.35 ? 350  ASN B CB  1 
ATOM   6811 C  CG  . ASN B 1 350 ? 4.019   -16.391 -20.822 1.00 84.50 ? 350  ASN B CG  1 
ATOM   6812 O  OD1 . ASN B 1 350 ? 4.531   -15.283 -20.959 1.00 85.67 ? 350  ASN B OD1 1 
ATOM   6813 N  ND2 . ASN B 1 350 ? 4.692   -17.535 -20.950 1.00 89.84 ? 350  ASN B ND2 1 
ATOM   6814 N  N   . GLU B 1 351 ? 1.863   -13.860 -19.288 1.00 75.05 ? 351  GLU B N   1 
ATOM   6815 C  CA  . GLU B 1 351 ? 2.106   -12.553 -18.671 1.00 73.31 ? 351  GLU B CA  1 
ATOM   6816 C  C   . GLU B 1 351 ? 3.525   -12.030 -18.824 1.00 71.14 ? 351  GLU B C   1 
ATOM   6817 O  O   . GLU B 1 351 ? 3.786   -10.846 -18.620 1.00 69.70 ? 351  GLU B O   1 
ATOM   6818 C  CB  . GLU B 1 351 ? 1.780   -12.604 -17.177 1.00 76.40 ? 351  GLU B CB  1 
ATOM   6819 C  CG  . GLU B 1 351 ? 0.311   -12.700 -16.838 1.00 79.44 ? 351  GLU B CG  1 
ATOM   6820 C  CD  . GLU B 1 351 ? -0.501  -11.633 -17.525 1.00 81.52 ? 351  GLU B CD  1 
ATOM   6821 O  OE1 . GLU B 1 351 ? -1.642  -11.370 -17.077 1.00 83.89 ? 351  GLU B OE1 1 
ATOM   6822 O  OE2 . GLU B 1 351 ? -0.004  -11.062 -18.520 1.00 83.01 ? 351  GLU B OE2 1 
ATOM   6823 N  N   . SER B 1 352 ? 4.442   -12.931 -19.143 1.00 69.13 ? 352  SER B N   1 
ATOM   6824 C  CA  . SER B 1 352 ? 5.833   -12.572 -19.330 1.00 67.99 ? 352  SER B CA  1 
ATOM   6825 C  C   . SER B 1 352 ? 6.472   -11.980 -18.082 1.00 67.52 ? 352  SER B C   1 
ATOM   6826 O  O   . SER B 1 352 ? 7.353   -11.126 -18.177 1.00 68.05 ? 352  SER B O   1 
ATOM   6827 C  CB  . SER B 1 352 ? 5.970   -11.589 -20.498 1.00 68.37 ? 352  SER B CB  1 
ATOM   6828 O  OG  . SER B 1 352 ? 5.573   -12.171 -21.726 1.00 67.37 ? 352  SER B OG  1 
ATOM   6829 N  N   . LEU B 1 353 ? 6.030   -12.418 -16.909 1.00 66.48 ? 353  LEU B N   1 
ATOM   6830 C  CA  . LEU B 1 353 ? 6.625   -11.933 -15.663 1.00 64.79 ? 353  LEU B CA  1 
ATOM   6831 C  C   . LEU B 1 353 ? 8.029   -12.515 -15.646 1.00 64.29 ? 353  LEU B C   1 
ATOM   6832 O  O   . LEU B 1 353 ? 8.197   -13.718 -15.712 1.00 65.06 ? 353  LEU B O   1 
ATOM   6833 C  CB  . LEU B 1 353 ? 5.814   -12.424 -14.468 1.00 63.39 ? 353  LEU B CB  1 
ATOM   6834 C  CG  . LEU B 1 353 ? 4.349   -11.957 -14.538 1.00 63.42 ? 353  LEU B CG  1 
ATOM   6835 C  CD1 . LEU B 1 353 ? 3.525   -12.555 -13.392 1.00 62.46 ? 353  LEU B CD1 1 
ATOM   6836 C  CD2 . LEU B 1 353 ? 4.307   -10.450 -14.493 1.00 61.59 ? 353  LEU B CD2 1 
ATOM   6837 N  N   . ILE B 1 354 ? 9.041   -11.664 -15.575 1.00 63.86 ? 354  ILE B N   1 
ATOM   6838 C  CA  . ILE B 1 354 ? 10.410  -12.145 -15.607 1.00 63.42 ? 354  ILE B CA  1 
ATOM   6839 C  C   . ILE B 1 354 ? 11.197  -12.001 -14.297 1.00 64.18 ? 354  ILE B C   1 
ATOM   6840 O  O   . ILE B 1 354 ? 10.816  -11.259 -13.391 1.00 63.61 ? 354  ILE B O   1 
ATOM   6841 C  CB  . ILE B 1 354 ? 11.208  -11.433 -16.732 1.00 63.52 ? 354  ILE B CB  1 
ATOM   6842 C  CG1 . ILE B 1 354 ? 11.054  -9.910  -16.601 1.00 62.74 ? 354  ILE B CG1 1 
ATOM   6843 C  CG2 . ILE B 1 354 ? 10.727  -11.903 -18.093 1.00 64.00 ? 354  ILE B CG2 1 
ATOM   6844 C  CD1 . ILE B 1 354 ? 12.206  -9.115  -17.223 1.00 62.28 ? 354  ILE B CD1 1 
ATOM   6845 N  N   . SER B 1 355 ? 12.311  -12.721 -14.231 1.00 65.03 ? 355  SER B N   1 
ATOM   6846 C  CA  . SER B 1 355 ? 13.204  -12.712 -13.084 1.00 66.37 ? 355  SER B CA  1 
ATOM   6847 C  C   . SER B 1 355 ? 14.186  -11.577 -13.277 1.00 67.36 ? 355  SER B C   1 
ATOM   6848 O  O   . SER B 1 355 ? 14.349  -11.060 -14.388 1.00 67.76 ? 355  SER B O   1 
ATOM   6849 C  CB  . SER B 1 355 ? 14.024  -13.991 -13.052 1.00 67.40 ? 355  SER B CB  1 
ATOM   6850 O  OG  . SER B 1 355 ? 15.056  -13.905 -14.034 1.00 67.44 ? 355  SER B OG  1 
ATOM   6851 N  N   . ARG B 1 356 ? 14.885  -11.229 -12.206 1.00 67.34 ? 356  ARG B N   1 
ATOM   6852 C  CA  . ARG B 1 356 ? 15.870  -10.172 -12.291 1.00 67.62 ? 356  ARG B CA  1 
ATOM   6853 C  C   . ARG B 1 356 ? 17.007  -10.606 -13.211 1.00 67.72 ? 356  ARG B C   1 
ATOM   6854 O  O   . ARG B 1 356 ? 17.572  -9.789  -13.950 1.00 68.51 ? 356  ARG B O   1 
ATOM   6855 C  CB  . ARG B 1 356 ? 16.403  -9.829  -10.895 1.00 68.10 ? 356  ARG B CB  1 
ATOM   6856 C  CG  . ARG B 1 356 ? 17.391  -8.678  -10.896 1.00 68.99 ? 356  ARG B CG  1 
ATOM   6857 C  CD  . ARG B 1 356 ? 17.415  -7.889  -9.582  1.00 69.71 ? 356  ARG B CD  1 
ATOM   6858 N  NE  . ARG B 1 356 ? 18.371  -6.787  -9.695  1.00 70.74 ? 356  ARG B NE  1 
ATOM   6859 C  CZ  . ARG B 1 356 ? 18.092  -5.596  -10.222 1.00 70.33 ? 356  ARG B CZ  1 
ATOM   6860 N  NH1 . ARG B 1 356 ? 16.870  -5.330  -10.670 1.00 69.27 ? 356  ARG B NH1 1 
ATOM   6861 N  NH2 . ARG B 1 356 ? 19.055  -4.688  -10.351 1.00 69.93 ? 356  ARG B NH2 1 
ATOM   6862 N  N   . ALA B 1 357 ? 17.338  -11.894 -13.180 1.00 67.08 ? 357  ALA B N   1 
ATOM   6863 C  CA  . ALA B 1 357 ? 18.417  -12.404 -14.022 1.00 66.47 ? 357  ALA B CA  1 
ATOM   6864 C  C   . ALA B 1 357 ? 18.046  -12.238 -15.494 1.00 64.63 ? 357  ALA B C   1 
ATOM   6865 O  O   . ALA B 1 357 ? 18.870  -11.820 -16.301 1.00 63.38 ? 357  ALA B O   1 
ATOM   6866 C  CB  . ALA B 1 357 ? 18.692  -13.886 -13.700 1.00 66.01 ? 357  ALA B CB  1 
ATOM   6867 N  N   . GLN B 1 358 ? 16.794  -12.556 -15.820 1.00 65.21 ? 358  GLN B N   1 
ATOM   6868 C  CA  . GLN B 1 358 ? 16.302  -12.459 -17.196 1.00 65.47 ? 358  GLN B CA  1 
ATOM   6869 C  C   . GLN B 1 358 ? 16.366  -11.012 -17.656 1.00 65.69 ? 358  GLN B C   1 
ATOM   6870 O  O   . GLN B 1 358 ? 16.632  -10.730 -18.833 1.00 66.29 ? 358  GLN B O   1 
ATOM   6871 C  CB  . GLN B 1 358 ? 14.867  -12.987 -17.273 1.00 66.13 ? 358  GLN B CB  1 
ATOM   6872 C  CG  . GLN B 1 358 ? 14.773  -14.486 -17.015 1.00 68.14 ? 358  GLN B CG  1 
ATOM   6873 C  CD  . GLN B 1 358 ? 13.341  -15.020 -17.039 1.00 70.03 ? 358  GLN B CD  1 
ATOM   6874 O  OE1 . GLN B 1 358 ? 12.503  -14.636 -16.213 1.00 70.32 ? 358  GLN B OE1 1 
ATOM   6875 N  NE2 . GLN B 1 358 ? 13.057  -15.916 -17.989 1.00 69.74 ? 358  GLN B NE2 1 
ATOM   6876 N  N   . PHE B 1 359 ? 16.149  -10.104 -16.702 1.00 65.17 ? 359  PHE B N   1 
ATOM   6877 C  CA  . PHE B 1 359 ? 16.174  -8.669  -16.946 1.00 62.92 ? 359  PHE B CA  1 
ATOM   6878 C  C   . PHE B 1 359 ? 17.576  -8.222  -17.346 1.00 62.34 ? 359  PHE B C   1 
ATOM   6879 O  O   . PHE B 1 359 ? 17.736  -7.533  -18.357 1.00 62.69 ? 359  PHE B O   1 
ATOM   6880 C  CB  . PHE B 1 359 ? 15.686  -7.916  -15.690 1.00 63.64 ? 359  PHE B CB  1 
ATOM   6881 C  CG  . PHE B 1 359 ? 15.727  -6.401  -15.809 1.00 62.96 ? 359  PHE B CG  1 
ATOM   6882 C  CD1 . PHE B 1 359 ? 16.425  -5.633  -14.876 1.00 62.52 ? 359  PHE B CD1 1 
ATOM   6883 C  CD2 . PHE B 1 359 ? 15.079  -5.744  -16.853 1.00 64.28 ? 359  PHE B CD2 1 
ATOM   6884 C  CE1 . PHE B 1 359 ? 16.479  -4.234  -14.978 1.00 62.65 ? 359  PHE B CE1 1 
ATOM   6885 C  CE2 . PHE B 1 359 ? 15.126  -4.339  -16.966 1.00 63.29 ? 359  PHE B CE2 1 
ATOM   6886 C  CZ  . PHE B 1 359 ? 15.827  -3.588  -16.025 1.00 62.68 ? 359  PHE B CZ  1 
ATOM   6887 N  N   . LEU B 1 360 ? 18.599  -8.617  -16.589 1.00 61.71 ? 360  LEU B N   1 
ATOM   6888 C  CA  . LEU B 1 360 ? 19.962  -8.194  -16.936 1.00 62.78 ? 360  LEU B CA  1 
ATOM   6889 C  C   . LEU B 1 360 ? 20.358  -8.769  -18.286 1.00 61.70 ? 360  LEU B C   1 
ATOM   6890 O  O   . LEU B 1 360 ? 21.110  -8.150  -19.046 1.00 61.40 ? 360  LEU B O   1 
ATOM   6891 C  CB  . LEU B 1 360 ? 20.990  -8.641  -15.888 1.00 64.42 ? 360  LEU B CB  1 
ATOM   6892 C  CG  . LEU B 1 360 ? 20.716  -8.394  -14.397 1.00 68.82 ? 360  LEU B CG  1 
ATOM   6893 C  CD1 . LEU B 1 360 ? 22.051  -8.492  -13.643 1.00 69.71 ? 360  LEU B CD1 1 
ATOM   6894 C  CD2 . LEU B 1 360 ? 20.083  -7.014  -14.159 1.00 69.67 ? 360  LEU B CD2 1 
ATOM   6895 N  N   . ALA B 1 361 ? 19.843  -9.960  -18.573 1.00 60.53 ? 361  ALA B N   1 
ATOM   6896 C  CA  . ALA B 1 361 ? 20.128  -10.638 -19.831 1.00 59.54 ? 361  ALA B CA  1 
ATOM   6897 C  C   . ALA B 1 361 ? 19.436  -9.890  -20.964 1.00 57.59 ? 361  ALA B C   1 
ATOM   6898 O  O   . ALA B 1 361 ? 20.013  -9.690  -22.037 1.00 57.54 ? 361  ALA B O   1 
ATOM   6899 C  CB  . ALA B 1 361 ? 19.622  -12.097 -19.761 1.00 59.79 ? 361  ALA B CB  1 
ATOM   6900 N  N   . GLY B 1 362 ? 18.192  -9.486  -20.703 1.00 56.39 ? 362  GLY B N   1 
ATOM   6901 C  CA  . GLY B 1 362 ? 17.405  -8.757  -21.681 1.00 55.71 ? 362  GLY B CA  1 
ATOM   6902 C  C   . GLY B 1 362 ? 18.081  -7.461  -22.084 1.00 56.67 ? 362  GLY B C   1 
ATOM   6903 O  O   . GLY B 1 362 ? 18.140  -7.113  -23.276 1.00 56.69 ? 362  GLY B O   1 
ATOM   6904 N  N   . VAL B 1 363 ? 18.604  -6.747  -21.085 1.00 55.79 ? 363  VAL B N   1 
ATOM   6905 C  CA  . VAL B 1 363 ? 19.293  -5.478  -21.314 1.00 53.91 ? 363  VAL B CA  1 
ATOM   6906 C  C   . VAL B 1 363 ? 20.492  -5.635  -22.258 1.00 54.42 ? 363  VAL B C   1 
ATOM   6907 O  O   . VAL B 1 363 ? 20.751  -4.743  -23.067 1.00 53.45 ? 363  VAL B O   1 
ATOM   6908 C  CB  . VAL B 1 363 ? 19.773  -4.844  -19.965 1.00 53.12 ? 363  VAL B CB  1 
ATOM   6909 C  CG1 . VAL B 1 363 ? 20.673  -3.651  -20.230 1.00 51.37 ? 363  VAL B CG1 1 
ATOM   6910 C  CG2 . VAL B 1 363 ? 18.577  -4.433  -19.131 1.00 50.41 ? 363  VAL B CG2 1 
ATOM   6911 N  N   . ARG B 1 364 ? 21.222  -6.749  -22.166 1.00 54.32 ? 364  ARG B N   1 
ATOM   6912 C  CA  . ARG B 1 364 ? 22.373  -6.933  -23.048 1.00 56.32 ? 364  ARG B CA  1 
ATOM   6913 C  C   . ARG B 1 364 ? 21.910  -7.105  -24.493 1.00 56.61 ? 364  ARG B C   1 
ATOM   6914 O  O   . ARG B 1 364 ? 22.615  -6.744  -25.428 1.00 55.31 ? 364  ARG B O   1 
ATOM   6915 C  CB  . ARG B 1 364 ? 23.208  -8.140  -22.630 1.00 56.97 ? 364  ARG B CB  1 
ATOM   6916 C  CG  . ARG B 1 364 ? 23.678  -8.112  -21.169 1.00 59.41 ? 364  ARG B CG  1 
ATOM   6917 C  CD  . ARG B 1 364 ? 24.193  -6.748  -20.753 1.00 59.56 ? 364  ARG B CD  1 
ATOM   6918 N  NE  . ARG B 1 364 ? 25.339  -6.293  -21.536 1.00 59.38 ? 364  ARG B NE  1 
ATOM   6919 C  CZ  . ARG B 1 364 ? 26.602  -6.602  -21.263 1.00 60.99 ? 364  ARG B CZ  1 
ATOM   6920 N  NH1 . ARG B 1 364 ? 26.883  -7.385  -20.217 1.00 60.32 ? 364  ARG B NH1 1 
ATOM   6921 N  NH2 . ARG B 1 364 ? 27.581  -6.099  -22.013 1.00 59.72 ? 364  ARG B NH2 1 
ATOM   6922 N  N   . ILE B 1 365 ? 20.710  -7.650  -24.652 1.00 57.80 ? 365  ILE B N   1 
ATOM   6923 C  CA  . ILE B 1 365 ? 20.110  -7.876  -25.965 1.00 58.16 ? 365  ILE B CA  1 
ATOM   6924 C  C   . ILE B 1 365 ? 19.429  -6.574  -26.414 1.00 57.65 ? 365  ILE B C   1 
ATOM   6925 O  O   . ILE B 1 365 ? 19.439  -6.224  -27.605 1.00 57.17 ? 365  ILE B O   1 
ATOM   6926 C  CB  . ILE B 1 365 ? 19.031  -8.999  -25.890 1.00 58.71 ? 365  ILE B CB  1 
ATOM   6927 C  CG1 . ILE B 1 365 ? 19.666  -10.315 -25.452 1.00 59.23 ? 365  ILE B CG1 1 
ATOM   6928 C  CG2 . ILE B 1 365 ? 18.358  -9.195  -27.243 1.00 58.69 ? 365  ILE B CG2 1 
ATOM   6929 C  CD1 . ILE B 1 365 ? 18.631  -11.372 -25.126 1.00 58.73 ? 365  ILE B CD1 1 
ATOM   6930 N  N   . GLY B 1 366 ? 18.844  -5.870  -25.444 1.00 56.06 ? 366  GLY B N   1 
ATOM   6931 C  CA  . GLY B 1 366 ? 18.149  -4.626  -25.723 1.00 54.71 ? 366  GLY B CA  1 
ATOM   6932 C  C   . GLY B 1 366 ? 19.071  -3.454  -26.017 1.00 53.98 ? 366  GLY B C   1 
ATOM   6933 O  O   . GLY B 1 366 ? 18.692  -2.513  -26.705 1.00 53.77 ? 366  GLY B O   1 
ATOM   6934 N  N   . VAL B 1 367 ? 20.286  -3.504  -25.493 1.00 53.41 ? 367  VAL B N   1 
ATOM   6935 C  CA  . VAL B 1 367 ? 21.240  -2.434  -25.708 1.00 53.25 ? 367  VAL B CA  1 
ATOM   6936 C  C   . VAL B 1 367 ? 22.521  -3.158  -26.088 1.00 55.09 ? 367  VAL B C   1 
ATOM   6937 O  O   . VAL B 1 367 ? 23.548  -3.088  -25.408 1.00 53.86 ? 367  VAL B O   1 
ATOM   6938 C  CB  . VAL B 1 367 ? 21.417  -1.567  -24.417 1.00 53.18 ? 367  VAL B CB  1 
ATOM   6939 C  CG1 . VAL B 1 367 ? 22.157  -0.268  -24.754 1.00 49.31 ? 367  VAL B CG1 1 
ATOM   6940 C  CG2 . VAL B 1 367 ? 20.034  -1.250  -23.795 1.00 50.18 ? 367  VAL B CG2 1 
ATOM   6941 N  N   . PRO B 1 368 ? 22.466  -3.860  -27.223 1.00 57.60 ? 368  PRO B N   1 
ATOM   6942 C  CA  . PRO B 1 368 ? 23.563  -4.649  -27.788 1.00 58.39 ? 368  PRO B CA  1 
ATOM   6943 C  C   . PRO B 1 368 ? 24.899  -3.934  -27.901 1.00 59.54 ? 368  PRO B C   1 
ATOM   6944 O  O   . PRO B 1 368 ? 25.949  -4.561  -27.807 1.00 60.04 ? 368  PRO B O   1 
ATOM   6945 C  CB  . PRO B 1 368 ? 23.010  -5.071  -29.148 1.00 58.71 ? 368  PRO B CB  1 
ATOM   6946 C  CG  . PRO B 1 368 ? 22.158  -3.906  -29.524 1.00 58.41 ? 368  PRO B CG  1 
ATOM   6947 C  CD  . PRO B 1 368 ? 21.411  -3.645  -28.235 1.00 57.64 ? 368  PRO B CD  1 
ATOM   6948 N  N   . GLN B 1 369 ? 24.873  -2.628  -28.109 1.00 60.60 ? 369  GLN B N   1 
ATOM   6949 C  CA  . GLN B 1 369 ? 26.122  -1.894  -28.239 1.00 62.70 ? 369  GLN B CA  1 
ATOM   6950 C  C   . GLN B 1 369 ? 26.719  -1.448  -26.898 1.00 63.85 ? 369  GLN B C   1 
ATOM   6951 O  O   . GLN B 1 369 ? 27.798  -0.853  -26.868 1.00 63.91 ? 369  GLN B O   1 
ATOM   6952 C  CB  . GLN B 1 369 ? 25.921  -0.678  -29.153 1.00 63.58 ? 369  GLN B CB  1 
ATOM   6953 C  CG  . GLN B 1 369 ? 25.954  -1.009  -30.668 1.00 65.28 ? 369  GLN B CG  1 
ATOM   6954 C  CD  . GLN B 1 369 ? 24.755  -1.844  -31.145 1.00 64.96 ? 369  GLN B CD  1 
ATOM   6955 O  OE1 . GLN B 1 369 ? 23.632  -1.346  -31.277 1.00 63.58 ? 369  GLN B OE1 1 
ATOM   6956 N  NE2 . GLN B 1 369 ? 24.999  -3.121  -31.397 1.00 65.28 ? 369  GLN B NE2 1 
ATOM   6957 N  N   . ALA B 1 370 ? 26.036  -1.764  -25.797 1.00 64.20 ? 370  ALA B N   1 
ATOM   6958 C  CA  . ALA B 1 370 ? 26.480  -1.360  -24.456 1.00 65.67 ? 370  ALA B CA  1 
ATOM   6959 C  C   . ALA B 1 370 ? 27.590  -2.176  -23.803 1.00 66.18 ? 370  ALA B C   1 
ATOM   6960 O  O   . ALA B 1 370 ? 27.592  -3.412  -23.855 1.00 66.59 ? 370  ALA B O   1 
ATOM   6961 C  CB  . ALA B 1 370 ? 25.276  -1.315  -23.495 1.00 64.93 ? 370  ALA B CB  1 
ATOM   6962 N  N   . SER B 1 371 ? 28.521  -1.471  -23.160 1.00 66.54 ? 371  SER B N   1 
ATOM   6963 C  CA  . SER B 1 371 ? 29.617  -2.127  -22.456 1.00 67.58 ? 371  SER B CA  1 
ATOM   6964 C  C   . SER B 1 371 ? 29.011  -2.736  -21.200 1.00 67.66 ? 371  SER B C   1 
ATOM   6965 O  O   . SER B 1 371 ? 27.819  -2.563  -20.942 1.00 67.84 ? 371  SER B O   1 
ATOM   6966 C  CB  . SER B 1 371 ? 30.698  -1.117  -22.064 1.00 68.01 ? 371  SER B CB  1 
ATOM   6967 O  OG  . SER B 1 371 ? 30.253  -0.235  -21.042 1.00 70.25 ? 371  SER B OG  1 
ATOM   6968 N  N   . ASP B 1 372 ? 29.812  -3.450  -20.419 1.00 67.95 ? 372  ASP B N   1 
ATOM   6969 C  CA  . ASP B 1 372 ? 29.286  -4.046  -19.195 1.00 68.14 ? 372  ASP B CA  1 
ATOM   6970 C  C   . ASP B 1 372 ? 28.963  -2.952  -18.178 1.00 66.67 ? 372  ASP B C   1 
ATOM   6971 O  O   . ASP B 1 372 ? 27.982  -3.048  -17.432 1.00 65.48 ? 372  ASP B O   1 
ATOM   6972 C  CB  . ASP B 1 372 ? 30.286  -5.033  -18.596 1.00 72.21 ? 372  ASP B CB  1 
ATOM   6973 C  CG  . ASP B 1 372 ? 30.720  -6.091  -19.593 1.00 76.21 ? 372  ASP B CG  1 
ATOM   6974 O  OD1 . ASP B 1 372 ? 29.835  -6.729  -20.202 1.00 78.14 ? 372  ASP B OD1 1 
ATOM   6975 O  OD2 . ASP B 1 372 ? 31.944  -6.282  -19.771 1.00 78.01 ? 372  ASP B OD2 1 
ATOM   6976 N  N   . LEU B 1 373 ? 29.783  -1.906  -18.149 1.00 63.92 ? 373  LEU B N   1 
ATOM   6977 C  CA  . LEU B 1 373 ? 29.528  -0.818  -17.226 1.00 62.16 ? 373  LEU B CA  1 
ATOM   6978 C  C   . LEU B 1 373 ? 28.253  -0.085  -17.649 1.00 61.83 ? 373  LEU B C   1 
ATOM   6979 O  O   . LEU B 1 373 ? 27.404  0.239   -16.816 1.00 62.70 ? 373  LEU B O   1 
ATOM   6980 C  CB  . LEU B 1 373 ? 30.714  0.143   -17.187 1.00 60.94 ? 373  LEU B CB  1 
ATOM   6981 C  CG  . LEU B 1 373 ? 30.559  1.321   -16.226 1.00 59.98 ? 373  LEU B CG  1 
ATOM   6982 C  CD1 . LEU B 1 373 ? 30.247  0.822   -14.825 1.00 57.34 ? 373  LEU B CD1 1 
ATOM   6983 C  CD2 . LEU B 1 373 ? 31.831  2.146   -16.252 1.00 59.53 ? 373  LEU B CD2 1 
ATOM   6984 N  N   . ALA B 1 374 ? 28.112  0.150   -18.949 1.00 60.98 ? 374  ALA B N   1 
ATOM   6985 C  CA  . ALA B 1 374 ? 26.941  0.831   -19.484 1.00 59.66 ? 374  ALA B CA  1 
ATOM   6986 C  C   . ALA B 1 374 ? 25.685  0.013   -19.202 1.00 58.87 ? 374  ALA B C   1 
ATOM   6987 O  O   . ALA B 1 374 ? 24.646  0.562   -18.823 1.00 58.86 ? 374  ALA B O   1 
ATOM   6988 C  CB  . ALA B 1 374 ? 27.107  1.048   -20.981 1.00 60.09 ? 374  ALA B CB  1 
ATOM   6989 N  N   . ALA B 1 375 ? 25.781  -1.301  -19.384 1.00 58.05 ? 375  ALA B N   1 
ATOM   6990 C  CA  . ALA B 1 375 ? 24.646  -2.190  -19.130 1.00 57.78 ? 375  ALA B CA  1 
ATOM   6991 C  C   . ALA B 1 375 ? 24.266  -2.090  -17.665 1.00 57.97 ? 375  ALA B C   1 
ATOM   6992 O  O   . ALA B 1 375 ? 23.085  -2.021  -17.306 1.00 58.28 ? 375  ALA B O   1 
ATOM   6993 C  CB  . ALA B 1 375 ? 25.009  -3.631  -19.465 1.00 57.95 ? 375  ALA B CB  1 
ATOM   6994 N  N   . GLU B 1 376 ? 25.276  -2.078  -16.809 1.00 58.11 ? 376  GLU B N   1 
ATOM   6995 C  CA  . GLU B 1 376 ? 25.023  -1.975  -15.381 1.00 57.63 ? 376  GLU B CA  1 
ATOM   6996 C  C   . GLU B 1 376 ? 24.291  -0.650  -15.061 1.00 55.39 ? 376  GLU B C   1 
ATOM   6997 O  O   . GLU B 1 376 ? 23.323  -0.630  -14.285 1.00 53.39 ? 376  GLU B O   1 
ATOM   6998 C  CB  . GLU B 1 376 ? 26.350  -2.081  -14.622 1.00 61.32 ? 376  GLU B CB  1 
ATOM   6999 C  CG  . GLU B 1 376 ? 26.181  -2.377  -13.140 1.00 68.03 ? 376  GLU B CG  1 
ATOM   7000 C  CD  . GLU B 1 376 ? 25.227  -3.532  -12.888 1.00 72.08 ? 376  GLU B CD  1 
ATOM   7001 O  OE1 . GLU B 1 376 ? 25.409  -4.591  -13.534 1.00 75.34 ? 376  GLU B OE1 1 
ATOM   7002 O  OE2 . GLU B 1 376 ? 24.301  -3.387  -12.052 1.00 74.06 ? 376  GLU B OE2 1 
ATOM   7003 N  N   . ALA B 1 377 ? 24.736  0.451   -15.666 1.00 52.16 ? 377  ALA B N   1 
ATOM   7004 C  CA  . ALA B 1 377 ? 24.076  1.726   -15.418 1.00 50.62 ? 377  ALA B CA  1 
ATOM   7005 C  C   . ALA B 1 377 ? 22.601  1.656   -15.828 1.00 51.12 ? 377  ALA B C   1 
ATOM   7006 O  O   . ALA B 1 377 ? 21.735  2.189   -15.124 1.00 51.09 ? 377  ALA B O   1 
ATOM   7007 C  CB  . ALA B 1 377 ? 24.778  2.860   -16.156 1.00 49.26 ? 377  ALA B CB  1 
ATOM   7008 N  N   . VAL B 1 378 ? 22.309  0.998   -16.955 1.00 49.83 ? 378  VAL B N   1 
ATOM   7009 C  CA  . VAL B 1 378 ? 20.931  0.886   -17.402 1.00 48.35 ? 378  VAL B CA  1 
ATOM   7010 C  C   . VAL B 1 378 ? 20.144  0.109   -16.368 1.00 49.07 ? 378  VAL B C   1 
ATOM   7011 O  O   . VAL B 1 378 ? 19.055  0.517   -15.960 1.00 49.23 ? 378  VAL B O   1 
ATOM   7012 C  CB  . VAL B 1 378 ? 20.814  0.155   -18.779 1.00 50.00 ? 378  VAL B CB  1 
ATOM   7013 C  CG1 . VAL B 1 378 ? 19.342  -0.156  -19.104 1.00 45.44 ? 378  VAL B CG1 1 
ATOM   7014 C  CG2 . VAL B 1 378 ? 21.419  1.028   -19.871 1.00 47.73 ? 378  VAL B CG2 1 
ATOM   7015 N  N   . VAL B 1 379 ? 20.690  -1.015  -15.935 1.00 49.15 ? 379  VAL B N   1 
ATOM   7016 C  CA  . VAL B 1 379 ? 19.990  -1.820  -14.957 1.00 50.21 ? 379  VAL B CA  1 
ATOM   7017 C  C   . VAL B 1 379 ? 19.718  -1.059  -13.657 1.00 51.30 ? 379  VAL B C   1 
ATOM   7018 O  O   . VAL B 1 379 ? 18.598  -1.079  -13.128 1.00 49.20 ? 379  VAL B O   1 
ATOM   7019 C  CB  . VAL B 1 379 ? 20.772  -3.112  -14.642 1.00 50.93 ? 379  VAL B CB  1 
ATOM   7020 C  CG1 . VAL B 1 379 ? 20.152  -3.823  -13.449 1.00 49.49 ? 379  VAL B CG1 1 
ATOM   7021 C  CG2 . VAL B 1 379 ? 20.738  -4.022  -15.852 1.00 51.45 ? 379  VAL B CG2 1 
ATOM   7022 N  N   . LEU B 1 380 ? 20.734  -0.372  -13.149 1.00 52.49 ? 380  LEU B N   1 
ATOM   7023 C  CA  . LEU B 1 380 ? 20.549  0.362   -11.906 1.00 53.96 ? 380  LEU B CA  1 
ATOM   7024 C  C   . LEU B 1 380 ? 19.571  1.529   -12.078 1.00 53.97 ? 380  LEU B C   1 
ATOM   7025 O  O   . LEU B 1 380 ? 18.848  1.887   -11.151 1.00 55.28 ? 380  LEU B O   1 
ATOM   7026 C  CB  . LEU B 1 380 ? 21.907  0.843   -11.371 1.00 56.03 ? 380  LEU B CB  1 
ATOM   7027 C  CG  . LEU B 1 380 ? 22.893  -0.296  -11.017 1.00 56.87 ? 380  LEU B CG  1 
ATOM   7028 C  CD1 . LEU B 1 380 ? 24.178  0.259   -10.425 1.00 54.87 ? 380  LEU B CD1 1 
ATOM   7029 C  CD2 . LEU B 1 380 ? 22.231  -1.254  -10.028 1.00 57.60 ? 380  LEU B CD2 1 
ATOM   7030 N  N   . HIS B 1 381 ? 19.514  2.105   -13.269 1.00 53.27 ? 381  HIS B N   1 
ATOM   7031 C  CA  . HIS B 1 381 ? 18.600  3.216   -13.509 1.00 51.96 ? 381  HIS B CA  1 
ATOM   7032 C  C   . HIS B 1 381 ? 17.152  2.761   -13.622 1.00 51.42 ? 381  HIS B C   1 
ATOM   7033 O  O   . HIS B 1 381 ? 16.255  3.435   -13.131 1.00 51.71 ? 381  HIS B O   1 
ATOM   7034 C  CB  . HIS B 1 381 ? 18.979  3.951   -14.795 1.00 52.72 ? 381  HIS B CB  1 
ATOM   7035 C  CG  . HIS B 1 381 ? 18.100  5.126   -15.093 1.00 52.25 ? 381  HIS B CG  1 
ATOM   7036 N  ND1 . HIS B 1 381 ? 18.388  6.403   -14.654 1.00 52.39 ? 381  HIS B ND1 1 
ATOM   7037 C  CD2 . HIS B 1 381 ? 16.917  5.209   -15.751 1.00 51.40 ? 381  HIS B CD2 1 
ATOM   7038 C  CE1 . HIS B 1 381 ? 17.417  7.219   -15.027 1.00 53.17 ? 381  HIS B CE1 1 
ATOM   7039 N  NE2 . HIS B 1 381 ? 16.512  6.520   -15.693 1.00 52.05 ? 381  HIS B NE2 1 
ATOM   7040 N  N   . TYR B 1 382 ? 16.912  1.623   -14.271 1.00 51.57 ? 382  TYR B N   1 
ATOM   7041 C  CA  . TYR B 1 382 ? 15.536  1.152   -14.429 1.00 51.48 ? 382  TYR B CA  1 
ATOM   7042 C  C   . TYR B 1 382 ? 15.011  0.275   -13.302 1.00 53.56 ? 382  TYR B C   1 
ATOM   7043 O  O   . TYR B 1 382 ? 13.787  0.101   -13.180 1.00 52.52 ? 382  TYR B O   1 
ATOM   7044 C  CB  . TYR B 1 382 ? 15.331  0.431   -15.772 1.00 49.17 ? 382  TYR B CB  1 
ATOM   7045 C  CG  . TYR B 1 382 ? 15.239  1.379   -16.941 1.00 46.75 ? 382  TYR B CG  1 
ATOM   7046 C  CD1 . TYR B 1 382 ? 16.396  1.883   -17.540 1.00 43.61 ? 382  TYR B CD1 1 
ATOM   7047 C  CD2 . TYR B 1 382 ? 13.995  1.790   -17.433 1.00 43.29 ? 382  TYR B CD2 1 
ATOM   7048 C  CE1 . TYR B 1 382 ? 16.323  2.773   -18.609 1.00 44.80 ? 382  TYR B CE1 1 
ATOM   7049 C  CE2 . TYR B 1 382 ? 13.908  2.685   -18.502 1.00 43.31 ? 382  TYR B CE2 1 
ATOM   7050 C  CZ  . TYR B 1 382 ? 15.081  3.173   -19.090 1.00 44.62 ? 382  TYR B CZ  1 
ATOM   7051 O  OH  . TYR B 1 382 ? 15.030  4.052   -20.163 1.00 45.02 ? 382  TYR B OH  1 
ATOM   7052 N  N   . THR B 1 383 ? 15.909  -0.287  -12.492 1.00 54.01 ? 383  THR B N   1 
ATOM   7053 C  CA  . THR B 1 383 ? 15.455  -1.087  -11.367 1.00 55.26 ? 383  THR B CA  1 
ATOM   7054 C  C   . THR B 1 383 ? 14.671  -0.178  -10.423 1.00 56.23 ? 383  THR B C   1 
ATOM   7055 O  O   . THR B 1 383 ? 15.032  0.973   -10.211 1.00 56.91 ? 383  THR B O   1 
ATOM   7056 C  CB  . THR B 1 383 ? 16.627  -1.672  -10.569 1.00 56.44 ? 383  THR B CB  1 
ATOM   7057 O  OG1 . THR B 1 383 ? 17.359  -2.575  -11.397 1.00 57.64 ? 383  THR B OG1 1 
ATOM   7058 C  CG2 . THR B 1 383 ? 16.119  -2.415  -9.315  1.00 56.22 ? 383  THR B CG2 1 
ATOM   7059 N  N   . ASP B 1 384 ? 13.568  -0.679  -9.892  1.00 58.40 ? 384  ASP B N   1 
ATOM   7060 C  CA  . ASP B 1 384 ? 12.779  0.080   -8.920  1.00 60.14 ? 384  ASP B CA  1 
ATOM   7061 C  C   . ASP B 1 384 ? 13.286  -0.459  -7.576  1.00 59.87 ? 384  ASP B C   1 
ATOM   7062 O  O   . ASP B 1 384 ? 12.900  -1.557  -7.145  1.00 57.71 ? 384  ASP B O   1 
ATOM   7063 C  CB  . ASP B 1 384 ? 11.290  -0.220  -9.061  1.00 62.58 ? 384  ASP B CB  1 
ATOM   7064 C  CG  . ASP B 1 384 ? 10.456  0.512   -8.029  1.00 66.75 ? 384  ASP B CG  1 
ATOM   7065 O  OD1 . ASP B 1 384 ? 10.788  0.420   -6.824  1.00 68.60 ? 384  ASP B OD1 1 
ATOM   7066 O  OD2 . ASP B 1 384 ? 9.468   1.177   -8.416  1.00 69.25 ? 384  ASP B OD2 1 
ATOM   7067 N  N   . TRP B 1 385 ? 14.145  0.317   -6.922  1.00 59.99 ? 385  TRP B N   1 
ATOM   7068 C  CA  . TRP B 1 385 ? 14.766  -0.117  -5.678  1.00 61.11 ? 385  TRP B CA  1 
ATOM   7069 C  C   . TRP B 1 385 ? 13.897  -0.481  -4.473  1.00 62.17 ? 385  TRP B C   1 
ATOM   7070 O  O   . TRP B 1 385 ? 14.386  -1.029  -3.479  1.00 63.24 ? 385  TRP B O   1 
ATOM   7071 C  CB  . TRP B 1 385 ? 15.860  0.881   -5.357  1.00 57.52 ? 385  TRP B CB  1 
ATOM   7072 C  CG  . TRP B 1 385 ? 16.879  0.717   -6.403  1.00 55.89 ? 385  TRP B CG  1 
ATOM   7073 C  CD1 . TRP B 1 385 ? 17.146  1.561   -7.438  1.00 54.48 ? 385  TRP B CD1 1 
ATOM   7074 C  CD2 . TRP B 1 385 ? 17.697  -0.438  -6.605  1.00 55.12 ? 385  TRP B CD2 1 
ATOM   7075 N  NE1 . TRP B 1 385 ? 18.084  1.004   -8.273  1.00 52.45 ? 385  TRP B NE1 1 
ATOM   7076 C  CE2 . TRP B 1 385 ? 18.437  -0.224  -7.786  1.00 53.70 ? 385  TRP B CE2 1 
ATOM   7077 C  CE3 . TRP B 1 385 ? 17.872  -1.636  -5.903  1.00 54.39 ? 385  TRP B CE3 1 
ATOM   7078 C  CZ2 . TRP B 1 385 ? 19.340  -1.166  -8.283  1.00 55.28 ? 385  TRP B CZ2 1 
ATOM   7079 C  CZ3 . TRP B 1 385 ? 18.769  -2.576  -6.399  1.00 55.14 ? 385  TRP B CZ3 1 
ATOM   7080 C  CH2 . TRP B 1 385 ? 19.492  -2.335  -7.579  1.00 55.07 ? 385  TRP B CH2 1 
ATOM   7081 N  N   . LEU B 1 386 ? 12.602  -0.223  -4.604  1.00 63.27 ? 386  LEU B N   1 
ATOM   7082 C  CA  . LEU B 1 386 ? 11.629  -0.561  -3.586  1.00 66.51 ? 386  LEU B CA  1 
ATOM   7083 C  C   . LEU B 1 386 ? 11.137  -1.992  -3.811  1.00 68.15 ? 386  LEU B C   1 
ATOM   7084 O  O   . LEU B 1 386 ? 10.736  -2.671  -2.869  1.00 69.62 ? 386  LEU B O   1 
ATOM   7085 C  CB  . LEU B 1 386 ? 10.431  0.384   -3.665  1.00 67.19 ? 386  LEU B CB  1 
ATOM   7086 C  CG  . LEU B 1 386 ? 10.317  1.434   -2.555  1.00 69.54 ? 386  LEU B CG  1 
ATOM   7087 C  CD1 . LEU B 1 386 ? 9.004   2.197   -2.700  1.00 69.10 ? 386  LEU B CD1 1 
ATOM   7088 C  CD2 . LEU B 1 386 ? 10.374  0.738   -1.190  1.00 68.80 ? 386  LEU B CD2 1 
ATOM   7089 N  N   . HIS B 1 387 ? 11.153  -2.425  -5.074  1.00 69.51 ? 387  HIS B N   1 
ATOM   7090 C  CA  . HIS B 1 387 ? 10.708  -3.766  -5.487  1.00 70.19 ? 387  HIS B CA  1 
ATOM   7091 C  C   . HIS B 1 387 ? 11.696  -4.289  -6.539  1.00 69.27 ? 387  HIS B C   1 
ATOM   7092 O  O   . HIS B 1 387 ? 11.305  -4.621  -7.653  1.00 69.04 ? 387  HIS B O   1 
ATOM   7093 C  CB  . HIS B 1 387 ? 9.313   -3.699  -6.146  1.00 71.84 ? 387  HIS B CB  1 
ATOM   7094 C  CG  . HIS B 1 387 ? 8.312   -2.851  -5.413  1.00 74.95 ? 387  HIS B CG  1 
ATOM   7095 N  ND1 . HIS B 1 387 ? 7.860   -1.641  -5.904  1.00 76.01 ? 387  HIS B ND1 1 
ATOM   7096 C  CD2 . HIS B 1 387 ? 7.652   -3.051  -4.245  1.00 75.87 ? 387  HIS B CD2 1 
ATOM   7097 C  CE1 . HIS B 1 387 ? 6.966   -1.133  -5.071  1.00 75.84 ? 387  HIS B CE1 1 
ATOM   7098 N  NE2 . HIS B 1 387 ? 6.822   -1.968  -4.056  1.00 76.85 ? 387  HIS B NE2 1 
ATOM   7099 N  N   . PRO B 1 388 ? 12.984  -4.380  -6.197  1.00 69.15 ? 388  PRO B N   1 
ATOM   7100 C  CA  . PRO B 1 388 ? 14.012  -4.853  -7.134  1.00 69.26 ? 388  PRO B CA  1 
ATOM   7101 C  C   . PRO B 1 388 ? 13.851  -6.238  -7.739  1.00 69.57 ? 388  PRO B C   1 
ATOM   7102 O  O   . PRO B 1 388 ? 14.478  -6.552  -8.754  1.00 70.49 ? 388  PRO B O   1 
ATOM   7103 C  CB  . PRO B 1 388 ? 15.300  -4.732  -6.315  1.00 69.93 ? 388  PRO B CB  1 
ATOM   7104 C  CG  . PRO B 1 388 ? 14.818  -4.947  -4.888  1.00 68.57 ? 388  PRO B CG  1 
ATOM   7105 C  CD  . PRO B 1 388 ? 13.553  -4.130  -4.857  1.00 68.51 ? 388  PRO B CD  1 
ATOM   7106 N  N   . GLU B 1 389 ? 13.013  -7.060  -7.123  1.00 70.56 ? 389  GLU B N   1 
ATOM   7107 C  CA  . GLU B 1 389 ? 12.821  -8.433  -7.579  1.00 71.17 ? 389  GLU B CA  1 
ATOM   7108 C  C   . GLU B 1 389 ? 11.439  -8.695  -8.164  1.00 69.81 ? 389  GLU B C   1 
ATOM   7109 O  O   . GLU B 1 389 ? 11.196  -9.766  -8.731  1.00 70.36 ? 389  GLU B O   1 
ATOM   7110 C  CB  . GLU B 1 389 ? 13.086  -9.397  -6.411  1.00 73.89 ? 389  GLU B CB  1 
ATOM   7111 C  CG  . GLU B 1 389 ? 14.522  -9.359  -5.854  1.00 78.20 ? 389  GLU B CG  1 
ATOM   7112 C  CD  . GLU B 1 389 ? 15.507  -10.216 -6.660  1.00 82.16 ? 389  GLU B CD  1 
ATOM   7113 O  OE1 . GLU B 1 389 ? 15.220  -10.522 -7.844  1.00 84.76 ? 389  GLU B OE1 1 
ATOM   7114 O  OE2 . GLU B 1 389 ? 16.579  -10.580 -6.117  1.00 83.12 ? 389  GLU B OE2 1 
ATOM   7115 N  N   . ASP B 1 390 ? 10.537  -7.726  -8.031  1.00 68.05 ? 390  ASP B N   1 
ATOM   7116 C  CA  . ASP B 1 390 ? 9.181   -7.877  -8.554  1.00 67.65 ? 390  ASP B CA  1 
ATOM   7117 C  C   . ASP B 1 390 ? 9.156   -8.140  -10.061 1.00 68.20 ? 390  ASP B C   1 
ATOM   7118 O  O   . ASP B 1 390 ? 9.587   -7.311  -10.868 1.00 68.58 ? 390  ASP B O   1 
ATOM   7119 C  CB  . ASP B 1 390 ? 8.339   -6.641  -8.260  1.00 66.93 ? 390  ASP B CB  1 
ATOM   7120 C  CG  . ASP B 1 390 ? 6.930   -6.758  -8.813  1.00 68.16 ? 390  ASP B CG  1 
ATOM   7121 O  OD1 . ASP B 1 390 ? 6.227   -7.718  -8.451  1.00 69.30 ? 390  ASP B OD1 1 
ATOM   7122 O  OD2 . ASP B 1 390 ? 6.513   -5.895  -9.612  1.00 69.43 ? 390  ASP B OD2 1 
ATOM   7123 N  N   . PRO B 1 391 ? 8.626   -9.304  -10.454 1.00 68.31 ? 391  PRO B N   1 
ATOM   7124 C  CA  . PRO B 1 391 ? 8.511   -9.747  -11.851 1.00 67.52 ? 391  PRO B CA  1 
ATOM   7125 C  C   . PRO B 1 391 ? 7.764   -8.777  -12.779 1.00 66.20 ? 391  PRO B C   1 
ATOM   7126 O  O   . PRO B 1 391 ? 8.218   -8.516  -13.895 1.00 65.97 ? 391  PRO B O   1 
ATOM   7127 C  CB  . PRO B 1 391 ? 7.810   -11.099 -11.723 1.00 68.19 ? 391  PRO B CB  1 
ATOM   7128 C  CG  . PRO B 1 391 ? 6.950   -10.906 -10.472 1.00 69.23 ? 391  PRO B CG  1 
ATOM   7129 C  CD  . PRO B 1 391 ? 7.924   -10.227 -9.543  1.00 68.41 ? 391  PRO B CD  1 
ATOM   7130 N  N   . THR B 1 392 ? 6.629   -8.248  -12.322 1.00 64.66 ? 392  THR B N   1 
ATOM   7131 C  CA  . THR B 1 392 ? 5.850   -7.309  -13.125 1.00 63.71 ? 392  THR B CA  1 
ATOM   7132 C  C   . THR B 1 392 ? 6.618   -6.015  -13.407 1.00 64.11 ? 392  THR B C   1 
ATOM   7133 O  O   . THR B 1 392 ? 6.547   -5.485  -14.517 1.00 64.84 ? 392  THR B O   1 
ATOM   7134 C  CB  . THR B 1 392 ? 4.519   -6.928  -12.435 1.00 64.12 ? 392  THR B CB  1 
ATOM   7135 O  OG1 . THR B 1 392 ? 3.797   -8.114  -12.104 1.00 65.51 ? 392  THR B OG1 1 
ATOM   7136 C  CG2 . THR B 1 392 ? 3.654   -6.069  -13.357 1.00 63.64 ? 392  THR B CG2 1 
ATOM   7137 N  N   . HIS B 1 393 ? 7.334   -5.487  -12.413 1.00 63.55 ? 393  HIS B N   1 
ATOM   7138 C  CA  . HIS B 1 393 ? 8.099   -4.260  -12.630 1.00 63.53 ? 393  HIS B CA  1 
ATOM   7139 C  C   . HIS B 1 393 ? 9.253   -4.530  -13.569 1.00 59.99 ? 393  HIS B C   1 
ATOM   7140 O  O   . HIS B 1 393 ? 9.537   -3.731  -14.451 1.00 58.30 ? 393  HIS B O   1 
ATOM   7141 C  CB  . HIS B 1 393 ? 8.671   -3.689  -11.324 1.00 68.18 ? 393  HIS B CB  1 
ATOM   7142 C  CG  . HIS B 1 393 ? 7.725   -2.793  -10.582 1.00 73.59 ? 393  HIS B CG  1 
ATOM   7143 N  ND1 . HIS B 1 393 ? 6.666   -3.272  -9.836  1.00 75.70 ? 393  HIS B ND1 1 
ATOM   7144 C  CD2 . HIS B 1 393 ? 7.698   -1.444  -10.449 1.00 75.84 ? 393  HIS B CD2 1 
ATOM   7145 C  CE1 . HIS B 1 393 ? 6.031   -2.257  -9.273  1.00 76.43 ? 393  HIS B CE1 1 
ATOM   7146 N  NE2 . HIS B 1 393 ? 6.637   -1.137  -9.629  1.00 76.77 ? 393  HIS B NE2 1 
ATOM   7147 N  N   . LEU B 1 394 ? 9.916   -5.662  -13.372 1.00 57.56 ? 394  LEU B N   1 
ATOM   7148 C  CA  . LEU B 1 394 ? 11.046  -6.012  -14.205 1.00 56.57 ? 394  LEU B CA  1 
ATOM   7149 C  C   . LEU B 1 394 ? 10.642  -6.174  -15.668 1.00 55.19 ? 394  LEU B C   1 
ATOM   7150 O  O   . LEU B 1 394 ? 11.382  -5.777  -16.555 1.00 52.63 ? 394  LEU B O   1 
ATOM   7151 C  CB  . LEU B 1 394 ? 11.704  -7.285  -13.673 1.00 58.04 ? 394  LEU B CB  1 
ATOM   7152 C  CG  . LEU B 1 394 ? 12.469  -7.116  -12.350 1.00 59.51 ? 394  LEU B CG  1 
ATOM   7153 C  CD1 . LEU B 1 394 ? 13.074  -8.446  -11.936 1.00 60.64 ? 394  LEU B CD1 1 
ATOM   7154 C  CD2 . LEU B 1 394 ? 13.570  -6.076  -12.510 1.00 57.06 ? 394  LEU B CD2 1 
ATOM   7155 N  N   . ARG B 1 395 ? 9.463   -6.746  -15.898 1.00 55.33 ? 395  ARG B N   1 
ATOM   7156 C  CA  . ARG B 1 395 ? 8.940   -6.959  -17.241 1.00 55.75 ? 395  ARG B CA  1 
ATOM   7157 C  C   . ARG B 1 395 ? 8.659   -5.586  -17.876 1.00 55.63 ? 395  ARG B C   1 
ATOM   7158 O  O   . ARG B 1 395 ? 9.121   -5.286  -18.983 1.00 55.62 ? 395  ARG B O   1 
ATOM   7159 C  CB  . ARG B 1 395 ? 7.666   -7.828  -17.163 1.00 55.96 ? 395  ARG B CB  1 
ATOM   7160 C  CG  . ARG B 1 395 ? 6.896   -7.997  -18.472 1.00 57.89 ? 395  ARG B CG  1 
ATOM   7161 C  CD  . ARG B 1 395 ? 5.647   -7.119  -18.488 1.00 60.10 ? 395  ARG B CD  1 
ATOM   7162 N  NE  . ARG B 1 395 ? 4.462   -7.828  -18.018 1.00 61.93 ? 395  ARG B NE  1 
ATOM   7163 C  CZ  . ARG B 1 395 ? 3.380   -7.253  -17.482 1.00 63.58 ? 395  ARG B CZ  1 
ATOM   7164 N  NH1 . ARG B 1 395 ? 3.307   -5.939  -17.326 1.00 60.25 ? 395  ARG B NH1 1 
ATOM   7165 N  NH2 . ARG B 1 395 ? 2.347   -8.008  -17.104 1.00 65.72 ? 395  ARG B NH2 1 
ATOM   7166 N  N   . ASP B 1 396 ? 7.921   -4.743  -17.164 1.00 55.01 ? 396  ASP B N   1 
ATOM   7167 C  CA  . ASP B 1 396 ? 7.613   -3.406  -17.658 1.00 54.32 ? 396  ASP B CA  1 
ATOM   7168 C  C   . ASP B 1 396 ? 8.875   -2.554  -17.809 1.00 52.94 ? 396  ASP B C   1 
ATOM   7169 O  O   . ASP B 1 396 ? 8.944   -1.656  -18.644 1.00 52.97 ? 396  ASP B O   1 
ATOM   7170 C  CB  . ASP B 1 396 ? 6.631   -2.715  -16.714 1.00 55.08 ? 396  ASP B CB  1 
ATOM   7171 C  CG  . ASP B 1 396 ? 5.253   -3.325  -16.780 1.00 57.26 ? 396  ASP B CG  1 
ATOM   7172 O  OD1 . ASP B 1 396 ? 5.090   -4.261  -17.584 1.00 58.88 ? 396  ASP B OD1 1 
ATOM   7173 O  OD2 . ASP B 1 396 ? 4.334   -2.878  -16.049 1.00 59.06 ? 396  ASP B OD2 1 
ATOM   7174 N  N   . ALA B 1 397 ? 9.887   -2.846  -17.014 1.00 51.41 ? 397  ALA B N   1 
ATOM   7175 C  CA  . ALA B 1 397 ? 11.106  -2.074  -17.104 1.00 51.63 ? 397  ALA B CA  1 
ATOM   7176 C  C   . ALA B 1 397 ? 11.908  -2.447  -18.361 1.00 50.78 ? 397  ALA B C   1 
ATOM   7177 O  O   . ALA B 1 397 ? 12.560  -1.588  -18.975 1.00 51.54 ? 397  ALA B O   1 
ATOM   7178 C  CB  . ALA B 1 397 ? 11.936  -2.282  -15.845 1.00 49.13 ? 397  ALA B CB  1 
ATOM   7179 N  N   . MET B 1 398 ? 11.859  -3.721  -18.740 1.00 49.16 ? 398  MET B N   1 
ATOM   7180 C  CA  . MET B 1 398 ? 12.583  -4.197  -19.913 1.00 48.98 ? 398  MET B CA  1 
ATOM   7181 C  C   . MET B 1 398 ? 11.960  -3.530  -21.145 1.00 49.16 ? 398  MET B C   1 
ATOM   7182 O  O   . MET B 1 398 ? 12.659  -3.132  -22.087 1.00 49.38 ? 398  MET B O   1 
ATOM   7183 C  CB  . MET B 1 398 ? 12.453  -5.717  -20.015 1.00 51.15 ? 398  MET B CB  1 
ATOM   7184 C  CG  . MET B 1 398 ? 13.277  -6.336  -21.109 1.00 52.24 ? 398  MET B CG  1 
ATOM   7185 S  SD  . MET B 1 398 ? 15.040  -6.173  -20.803 1.00 57.21 ? 398  MET B SD  1 
ATOM   7186 C  CE  . MET B 1 398 ? 15.508  -5.069  -22.140 1.00 55.70 ? 398  MET B CE  1 
ATOM   7187 N  N   . SER B 1 399 ? 10.634  -3.414  -21.129 1.00 47.11 ? 399  SER B N   1 
ATOM   7188 C  CA  . SER B 1 399 ? 9.918   -2.785  -22.216 1.00 46.65 ? 399  SER B CA  1 
ATOM   7189 C  C   . SER B 1 399 ? 10.351  -1.319  -22.325 1.00 47.06 ? 399  SER B C   1 
ATOM   7190 O  O   . SER B 1 399 ? 10.646  -0.838  -23.425 1.00 47.37 ? 399  SER B O   1 
ATOM   7191 C  CB  . SER B 1 399 ? 8.414   -2.876  -21.976 1.00 45.17 ? 399  SER B CB  1 
ATOM   7192 O  OG  . SER B 1 399 ? 7.705   -2.143  -22.961 1.00 45.55 ? 399  SER B OG  1 
ATOM   7193 N  N   . ALA B 1 400 ? 10.421  -0.635  -21.179 1.00 46.51 ? 400  ALA B N   1 
ATOM   7194 C  CA  . ALA B 1 400 ? 10.818  0.780   -21.130 1.00 46.26 ? 400  ALA B CA  1 
ATOM   7195 C  C   . ALA B 1 400 ? 12.233  0.997   -21.649 1.00 46.22 ? 400  ALA B C   1 
ATOM   7196 O  O   . ALA B 1 400 ? 12.498  1.944   -22.405 1.00 46.45 ? 400  ALA B O   1 
ATOM   7197 C  CB  . ALA B 1 400 ? 10.708  1.307   -19.708 1.00 45.98 ? 400  ALA B CB  1 
ATOM   7198 N  N   . VAL B 1 401 ? 13.150  0.132   -21.234 1.00 44.94 ? 401  VAL B N   1 
ATOM   7199 C  CA  . VAL B 1 401 ? 14.523  0.235   -21.707 1.00 45.35 ? 401  VAL B CA  1 
ATOM   7200 C  C   . VAL B 1 401 ? 14.546  0.224   -23.245 1.00 46.11 ? 401  VAL B C   1 
ATOM   7201 O  O   . VAL B 1 401 ? 15.125  1.115   -23.884 1.00 45.66 ? 401  VAL B O   1 
ATOM   7202 C  CB  . VAL B 1 401 ? 15.390  -0.940  -21.192 1.00 44.97 ? 401  VAL B CB  1 
ATOM   7203 C  CG1 . VAL B 1 401 ? 16.721  -0.976  -21.929 1.00 44.63 ? 401  VAL B CG1 1 
ATOM   7204 C  CG2 . VAL B 1 401 ? 15.623  -0.780  -19.699 1.00 44.88 ? 401  VAL B CG2 1 
ATOM   7205 N  N   . VAL B 1 402 ? 13.893  -0.768  -23.840 1.00 45.33 ? 402  VAL B N   1 
ATOM   7206 C  CA  . VAL B 1 402 ? 13.897  -0.863  -25.288 1.00 44.61 ? 402  VAL B CA  1 
ATOM   7207 C  C   . VAL B 1 402 ? 13.210  0.330   -25.942 1.00 44.35 ? 402  VAL B C   1 
ATOM   7208 O  O   . VAL B 1 402 ? 13.740  0.923   -26.888 1.00 43.62 ? 402  VAL B O   1 
ATOM   7209 C  CB  . VAL B 1 402 ? 13.252  -2.213  -25.759 1.00 45.60 ? 402  VAL B CB  1 
ATOM   7210 C  CG1 . VAL B 1 402 ? 13.050  -2.222  -27.279 1.00 40.61 ? 402  VAL B CG1 1 
ATOM   7211 C  CG2 . VAL B 1 402 ? 14.174  -3.370  -25.355 1.00 42.89 ? 402  VAL B CG2 1 
ATOM   7212 N  N   . GLY B 1 403 ? 12.041  0.692   -25.435 1.00 43.67 ? 403  GLY B N   1 
ATOM   7213 C  CA  . GLY B 1 403 ? 11.334  1.820   -26.017 1.00 44.25 ? 403  GLY B CA  1 
ATOM   7214 C  C   . GLY B 1 403 ? 12.048  3.168   -25.877 1.00 43.83 ? 403  GLY B C   1 
ATOM   7215 O  O   . GLY B 1 403 ? 12.038  3.996   -26.807 1.00 42.25 ? 403  GLY B O   1 
ATOM   7216 N  N   . ASP B 1 404 ? 12.654  3.396   -24.714 1.00 42.65 ? 404  ASP B N   1 
ATOM   7217 C  CA  . ASP B 1 404 ? 13.337  4.662   -24.460 1.00 42.87 ? 404  ASP B CA  1 
ATOM   7218 C  C   . ASP B 1 404 ? 14.609  4.796   -25.281 1.00 41.26 ? 404  ASP B C   1 
ATOM   7219 O  O   . ASP B 1 404 ? 14.855  5.832   -25.906 1.00 40.54 ? 404  ASP B O   1 
ATOM   7220 C  CB  . ASP B 1 404 ? 13.660  4.802   -22.959 1.00 43.49 ? 404  ASP B CB  1 
ATOM   7221 C  CG  . ASP B 1 404 ? 12.405  4.857   -22.099 1.00 45.53 ? 404  ASP B CG  1 
ATOM   7222 O  OD1 . ASP B 1 404 ? 11.306  5.116   -22.648 1.00 44.00 ? 404  ASP B OD1 1 
ATOM   7223 O  OD2 . ASP B 1 404 ? 12.524  4.651   -20.864 1.00 46.20 ? 404  ASP B OD2 1 
ATOM   7224 N  N   . HIS B 1 405 ? 15.408  3.732   -25.282 1.00 41.44 ? 405  HIS B N   1 
ATOM   7225 C  CA  . HIS B 1 405 ? 16.662  3.684   -26.017 1.00 41.82 ? 405  HIS B CA  1 
ATOM   7226 C  C   . HIS B 1 405 ? 16.477  3.859   -27.537 1.00 43.22 ? 405  HIS B C   1 
ATOM   7227 O  O   . HIS B 1 405 ? 17.228  4.602   -28.183 1.00 42.61 ? 405  HIS B O   1 
ATOM   7228 C  CB  . HIS B 1 405 ? 17.355  2.351   -25.711 1.00 42.07 ? 405  HIS B CB  1 
ATOM   7229 C  CG  . HIS B 1 405 ? 18.581  2.085   -26.536 1.00 43.86 ? 405  HIS B CG  1 
ATOM   7230 N  ND1 . HIS B 1 405 ? 19.662  2.947   -26.570 1.00 42.28 ? 405  HIS B ND1 1 
ATOM   7231 C  CD2 . HIS B 1 405 ? 18.916  1.023   -27.317 1.00 42.23 ? 405  HIS B CD2 1 
ATOM   7232 C  CE1 . HIS B 1 405 ? 20.609  2.426   -27.335 1.00 44.73 ? 405  HIS B CE1 1 
ATOM   7233 N  NE2 . HIS B 1 405 ? 20.182  1.260   -27.798 1.00 43.71 ? 405  HIS B NE2 1 
ATOM   7234 N  N   . ASN B 1 406 ? 15.461  3.204   -28.093 1.00 42.33 ? 406  ASN B N   1 
ATOM   7235 C  CA  . ASN B 1 406 ? 15.240  3.253   -29.534 1.00 42.83 ? 406  ASN B CA  1 
ATOM   7236 C  C   . ASN B 1 406 ? 14.335  4.318   -30.074 1.00 43.13 ? 406  ASN B C   1 
ATOM   7237 O  O   . ASN B 1 406 ? 14.532  4.747   -31.212 1.00 42.30 ? 406  ASN B O   1 
ATOM   7238 C  CB  . ASN B 1 406 ? 14.712  1.908   -30.039 1.00 40.42 ? 406  ASN B CB  1 
ATOM   7239 C  CG  . ASN B 1 406 ? 15.718  0.803   -29.865 1.00 40.63 ? 406  ASN B CG  1 
ATOM   7240 O  OD1 . ASN B 1 406 ? 16.790  0.814   -30.483 1.00 41.53 ? 406  ASN B OD1 1 
ATOM   7241 N  ND2 . ASN B 1 406 ? 15.391  -0.160  -29.018 1.00 37.05 ? 406  ASN B ND2 1 
ATOM   7242 N  N   . VAL B 1 407 ? 13.371  4.770   -29.277 1.00 42.47 ? 407  VAL B N   1 
ATOM   7243 C  CA  . VAL B 1 407 ? 12.423  5.744   -29.794 1.00 43.72 ? 407  VAL B CA  1 
ATOM   7244 C  C   . VAL B 1 407 ? 12.219  7.021   -28.981 1.00 44.31 ? 407  VAL B C   1 
ATOM   7245 O  O   . VAL B 1 407 ? 12.532  8.119   -29.446 1.00 44.91 ? 407  VAL B O   1 
ATOM   7246 C  CB  . VAL B 1 407 ? 11.010  5.061   -30.020 1.00 42.93 ? 407  VAL B CB  1 
ATOM   7247 C  CG1 . VAL B 1 407 ? 10.028  6.049   -30.622 1.00 42.87 ? 407  VAL B CG1 1 
ATOM   7248 C  CG2 . VAL B 1 407 ? 11.144  3.853   -30.925 1.00 42.22 ? 407  VAL B CG2 1 
ATOM   7249 N  N   . VAL B 1 408 ? 11.690  6.878   -27.771 1.00 45.20 ? 408  VAL B N   1 
ATOM   7250 C  CA  . VAL B 1 408 ? 11.389  8.046   -26.943 1.00 45.11 ? 408  VAL B CA  1 
ATOM   7251 C  C   . VAL B 1 408 ? 12.552  9.015   -26.758 1.00 45.01 ? 408  VAL B C   1 
ATOM   7252 O  O   . VAL B 1 408 ? 12.437  10.203  -27.060 1.00 45.61 ? 408  VAL B O   1 
ATOM   7253 C  CB  . VAL B 1 408 ? 10.857  7.643   -25.547 1.00 45.64 ? 408  VAL B CB  1 
ATOM   7254 C  CG1 . VAL B 1 408 ? 10.359  8.886   -24.820 1.00 43.88 ? 408  VAL B CG1 1 
ATOM   7255 C  CG2 . VAL B 1 408 ? 9.739   6.600   -25.682 1.00 42.87 ? 408  VAL B CG2 1 
ATOM   7256 N  N   . CYS B 1 409 ? 13.684  8.536   -26.280 1.00 43.97 ? 409  CYS B N   1 
ATOM   7257 C  CA  . CYS B 1 409 ? 14.780  9.458   -26.094 1.00 42.99 ? 409  CYS B CA  1 
ATOM   7258 C  C   . CYS B 1 409 ? 15.320  9.971   -27.436 1.00 43.72 ? 409  CYS B C   1 
ATOM   7259 O  O   . CYS B 1 409 ? 15.693  11.157  -27.563 1.00 43.45 ? 409  CYS B O   1 
ATOM   7260 C  CB  . CYS B 1 409 ? 15.842  8.821   -25.215 1.00 44.19 ? 409  CYS B CB  1 
ATOM   7261 S  SG  . CYS B 1 409 ? 15.170  8.544   -23.540 1.00 47.90 ? 409  CYS B SG  1 
ATOM   7262 N  N   . PRO B 1 410 ? 15.394  9.094   -28.453 1.00 41.88 ? 410  PRO B N   1 
ATOM   7263 C  CA  . PRO B 1 410 ? 15.888  9.655   -29.714 1.00 41.86 ? 410  PRO B CA  1 
ATOM   7264 C  C   . PRO B 1 410 ? 14.898  10.727  -30.193 1.00 41.07 ? 410  PRO B C   1 
ATOM   7265 O  O   . PRO B 1 410 ? 15.303  11.735  -30.771 1.00 42.99 ? 410  PRO B O   1 
ATOM   7266 C  CB  . PRO B 1 410 ? 15.960  8.437   -30.631 1.00 40.66 ? 410  PRO B CB  1 
ATOM   7267 C  CG  . PRO B 1 410 ? 16.442  7.368   -29.671 1.00 39.06 ? 410  PRO B CG  1 
ATOM   7268 C  CD  . PRO B 1 410 ? 15.603  7.633   -28.405 1.00 41.50 ? 410  PRO B CD  1 
ATOM   7269 N  N   . VAL B 1 411 ? 13.607  10.532  -29.935 1.00 39.92 ? 411  VAL B N   1 
ATOM   7270 C  CA  . VAL B 1 411 ? 12.624  11.545  -30.338 1.00 41.10 ? 411  VAL B CA  1 
ATOM   7271 C  C   . VAL B 1 411 ? 12.759  12.834  -29.498 1.00 42.28 ? 411  VAL B C   1 
ATOM   7272 O  O   . VAL B 1 411 ? 12.629  13.945  -30.034 1.00 42.28 ? 411  VAL B O   1 
ATOM   7273 C  CB  . VAL B 1 411 ? 11.169  11.015  -30.216 1.00 39.77 ? 411  VAL B CB  1 
ATOM   7274 C  CG1 . VAL B 1 411 ? 10.181  12.144  -30.149 1.00 36.94 ? 411  VAL B CG1 1 
ATOM   7275 C  CG2 . VAL B 1 411 ? 10.859  10.173  -31.406 1.00 42.49 ? 411  VAL B CG2 1 
ATOM   7276 N  N   . ALA B 1 412 ? 13.013  12.686  -28.197 1.00 41.58 ? 412  ALA B N   1 
ATOM   7277 C  CA  . ALA B 1 412 ? 13.155  13.853  -27.332 1.00 44.23 ? 412  ALA B CA  1 
ATOM   7278 C  C   . ALA B 1 412 ? 14.352  14.647  -27.818 1.00 44.53 ? 412  ALA B C   1 
ATOM   7279 O  O   . ALA B 1 412 ? 14.334  15.881  -27.864 1.00 43.96 ? 412  ALA B O   1 
ATOM   7280 C  CB  . ALA B 1 412 ? 13.365  13.436  -25.847 1.00 42.16 ? 412  ALA B CB  1 
ATOM   7281 N  N   . GLN B 1 413 ? 15.398  13.920  -28.178 1.00 45.89 ? 413  GLN B N   1 
ATOM   7282 C  CA  . GLN B 1 413 ? 16.616  14.528  -28.671 1.00 45.36 ? 413  GLN B CA  1 
ATOM   7283 C  C   . GLN B 1 413 ? 16.327  15.356  -29.937 1.00 44.48 ? 413  GLN B C   1 
ATOM   7284 O  O   . GLN B 1 413 ? 16.733  16.529  -30.059 1.00 42.54 ? 413  GLN B O   1 
ATOM   7285 C  CB  . GLN B 1 413 ? 17.624  13.430  -28.966 1.00 48.32 ? 413  GLN B CB  1 
ATOM   7286 C  CG  . GLN B 1 413 ? 18.785  13.878  -29.779 1.00 56.28 ? 413  GLN B CG  1 
ATOM   7287 C  CD  . GLN B 1 413 ? 20.007  14.040  -28.937 1.00 62.51 ? 413  GLN B CD  1 
ATOM   7288 O  OE1 . GLN B 1 413 ? 20.005  14.787  -27.940 1.00 66.28 ? 413  GLN B OE1 1 
ATOM   7289 N  NE2 . GLN B 1 413 ? 21.075  13.329  -29.313 1.00 65.08 ? 413  GLN B NE2 1 
ATOM   7290 N  N   . LEU B 1 414 ? 15.622  14.745  -30.881 1.00 42.90 ? 414  LEU B N   1 
ATOM   7291 C  CA  . LEU B 1 414 ? 15.296  15.427  -32.125 1.00 41.98 ? 414  LEU B CA  1 
ATOM   7292 C  C   . LEU B 1 414 ? 14.416  16.656  -31.866 1.00 42.98 ? 414  LEU B C   1 
ATOM   7293 O  O   . LEU B 1 414 ? 14.687  17.736  -32.396 1.00 42.51 ? 414  LEU B O   1 
ATOM   7294 C  CB  . LEU B 1 414 ? 14.591  14.465  -33.100 1.00 41.83 ? 414  LEU B CB  1 
ATOM   7295 C  CG  . LEU B 1 414 ? 14.243  15.094  -34.459 1.00 42.48 ? 414  LEU B CG  1 
ATOM   7296 C  CD1 . LEU B 1 414 ? 15.518  15.377  -35.223 1.00 38.60 ? 414  LEU B CD1 1 
ATOM   7297 C  CD2 . LEU B 1 414 ? 13.359  14.181  -35.264 1.00 42.54 ? 414  LEU B CD2 1 
ATOM   7298 N  N   . ALA B 1 415 ? 13.367  16.494  -31.057 1.00 43.00 ? 415  ALA B N   1 
ATOM   7299 C  CA  . ALA B 1 415 ? 12.459  17.598  -30.741 1.00 43.22 ? 415  ALA B CA  1 
ATOM   7300 C  C   . ALA B 1 415 ? 13.254  18.784  -30.202 1.00 44.28 ? 415  ALA B C   1 
ATOM   7301 O  O   . ALA B 1 415 ? 13.066  19.931  -30.629 1.00 45.21 ? 415  ALA B O   1 
ATOM   7302 C  CB  . ALA B 1 415 ? 11.430  17.151  -29.700 1.00 42.01 ? 415  ALA B CB  1 
ATOM   7303 N  N   . GLY B 1 416 ? 14.145  18.495  -29.262 1.00 43.74 ? 416  GLY B N   1 
ATOM   7304 C  CA  . GLY B 1 416 ? 14.964  19.534  -28.673 1.00 45.39 ? 416  GLY B CA  1 
ATOM   7305 C  C   . GLY B 1 416 ? 15.880  20.247  -29.659 1.00 46.26 ? 416  GLY B C   1 
ATOM   7306 O  O   . GLY B 1 416 ? 15.935  21.478  -29.654 1.00 47.14 ? 416  GLY B O   1 
ATOM   7307 N  N   . ARG B 1 417 ? 16.601  19.507  -30.502 1.00 44.95 ? 417  ARG B N   1 
ATOM   7308 C  CA  . ARG B 1 417 ? 17.481  20.178  -31.457 1.00 47.06 ? 417  ARG B CA  1 
ATOM   7309 C  C   . ARG B 1 417 ? 16.691  20.971  -32.476 1.00 45.88 ? 417  ARG B C   1 
ATOM   7310 O  O   . ARG B 1 417 ? 17.057  22.095  -32.791 1.00 46.99 ? 417  ARG B O   1 
ATOM   7311 C  CB  . ARG B 1 417 ? 18.391  19.202  -32.215 1.00 48.13 ? 417  ARG B CB  1 
ATOM   7312 C  CG  . ARG B 1 417 ? 19.194  18.273  -31.343 1.00 52.42 ? 417  ARG B CG  1 
ATOM   7313 C  CD  . ARG B 1 417 ? 20.000  18.992  -30.290 1.00 55.78 ? 417  ARG B CD  1 
ATOM   7314 N  NE  . ARG B 1 417 ? 20.830  20.035  -30.875 1.00 63.27 ? 417  ARG B NE  1 
ATOM   7315 C  CZ  . ARG B 1 417 ? 22.003  20.436  -30.376 1.00 66.27 ? 417  ARG B CZ  1 
ATOM   7316 N  NH1 . ARG B 1 417 ? 22.491  19.871  -29.273 1.00 66.02 ? 417  ARG B NH1 1 
ATOM   7317 N  NH2 . ARG B 1 417 ? 22.689  21.405  -30.984 1.00 66.42 ? 417  ARG B NH2 1 
ATOM   7318 N  N   . LEU B 1 418 ? 15.617  20.394  -33.008 1.00 45.32 ? 418  LEU B N   1 
ATOM   7319 C  CA  . LEU B 1 418 ? 14.806  21.098  -33.990 1.00 45.08 ? 418  LEU B CA  1 
ATOM   7320 C  C   . LEU B 1 418 ? 14.218  22.381  -33.391 1.00 46.16 ? 418  LEU B C   1 
ATOM   7321 O  O   . LEU B 1 418 ? 14.227  23.426  -34.035 1.00 45.56 ? 418  LEU B O   1 
ATOM   7322 C  CB  . LEU B 1 418 ? 13.677  20.194  -34.506 1.00 45.86 ? 418  LEU B CB  1 
ATOM   7323 C  CG  . LEU B 1 418 ? 14.014  18.957  -35.370 1.00 47.55 ? 418  LEU B CG  1 
ATOM   7324 C  CD1 . LEU B 1 418 ? 12.794  18.066  -35.512 1.00 45.93 ? 418  LEU B CD1 1 
ATOM   7325 C  CD2 . LEU B 1 418 ? 14.506  19.378  -36.728 1.00 45.26 ? 418  LEU B CD2 1 
ATOM   7326 N  N   . ALA B 1 419 ? 13.723  22.305  -32.158 1.00 46.89 ? 419  ALA B N   1 
ATOM   7327 C  CA  . ALA B 1 419 ? 13.136  23.479  -31.513 1.00 49.28 ? 419  ALA B CA  1 
ATOM   7328 C  C   . ALA B 1 419 ? 14.199  24.546  -31.239 1.00 50.80 ? 419  ALA B C   1 
ATOM   7329 O  O   . ALA B 1 419 ? 13.980  25.731  -31.488 1.00 52.02 ? 419  ALA B O   1 
ATOM   7330 C  CB  . ALA B 1 419 ? 12.443  23.076  -30.215 1.00 45.76 ? 419  ALA B CB  1 
ATOM   7331 N  N   . ALA B 1 420 ? 15.353  24.116  -30.742 1.00 52.21 ? 420  ALA B N   1 
ATOM   7332 C  CA  . ALA B 1 420 ? 16.443  25.033  -30.447 1.00 53.32 ? 420  ALA B CA  1 
ATOM   7333 C  C   . ALA B 1 420 ? 16.962  25.682  -31.719 1.00 55.26 ? 420  ALA B C   1 
ATOM   7334 O  O   . ALA B 1 420 ? 17.425  26.822  -31.702 1.00 56.52 ? 420  ALA B O   1 
ATOM   7335 C  CB  . ALA B 1 420 ? 17.575  24.289  -29.764 1.00 51.40 ? 420  ALA B CB  1 
ATOM   7336 N  N   . GLN B 1 421 ? 16.878  24.975  -32.836 1.00 55.58 ? 421  GLN B N   1 
ATOM   7337 C  CA  . GLN B 1 421 ? 17.412  25.528  -34.061 1.00 55.19 ? 421  GLN B CA  1 
ATOM   7338 C  C   . GLN B 1 421 ? 16.462  26.137  -35.064 1.00 55.12 ? 421  GLN B C   1 
ATOM   7339 O  O   . GLN B 1 421 ? 16.689  26.040  -36.270 1.00 55.68 ? 421  GLN B O   1 
ATOM   7340 C  CB  . GLN B 1 421 ? 18.303  24.500  -34.746 1.00 56.38 ? 421  GLN B CB  1 
ATOM   7341 C  CG  . GLN B 1 421 ? 19.716  24.504  -34.176 1.00 59.94 ? 421  GLN B CG  1 
ATOM   7342 C  CD  . GLN B 1 421 ? 20.195  23.131  -33.747 1.00 62.26 ? 421  GLN B CD  1 
ATOM   7343 O  OE1 . GLN B 1 421 ? 20.240  22.814  -32.553 1.00 64.47 ? 421  GLN B OE1 1 
ATOM   7344 N  NE2 . GLN B 1 421 ? 20.554  22.306  -34.717 1.00 62.88 ? 421  GLN B NE2 1 
ATOM   7345 N  N   . GLY B 1 422 ? 15.395  26.760  -34.579 1.00 54.00 ? 422  GLY B N   1 
ATOM   7346 C  CA  . GLY B 1 422 ? 14.494  27.434  -35.496 1.00 53.86 ? 422  GLY B CA  1 
ATOM   7347 C  C   . GLY B 1 422 ? 13.206  26.781  -35.951 1.00 53.22 ? 422  GLY B C   1 
ATOM   7348 O  O   . GLY B 1 422 ? 12.333  27.473  -36.474 1.00 52.89 ? 422  GLY B O   1 
ATOM   7349 N  N   . ALA B 1 423 ? 13.061  25.474  -35.765 1.00 51.93 ? 423  ALA B N   1 
ATOM   7350 C  CA  . ALA B 1 423 ? 11.829  24.827  -36.209 1.00 50.91 ? 423  ALA B CA  1 
ATOM   7351 C  C   . ALA B 1 423 ? 10.634  25.041  -35.297 1.00 49.85 ? 423  ALA B C   1 
ATOM   7352 O  O   . ALA B 1 423 ? 10.763  25.377  -34.125 1.00 50.14 ? 423  ALA B O   1 
ATOM   7353 C  CB  . ALA B 1 423 ? 12.053  23.339  -36.393 1.00 48.54 ? 423  ALA B CB  1 
ATOM   7354 N  N   . ARG B 1 424 ? 9.459   24.860  -35.875 1.00 49.19 ? 424  ARG B N   1 
ATOM   7355 C  CA  . ARG B 1 424 ? 8.205   24.940  -35.152 1.00 48.50 ? 424  ARG B CA  1 
ATOM   7356 C  C   . ARG B 1 424 ? 7.904   23.463  -34.898 1.00 46.18 ? 424  ARG B C   1 
ATOM   7357 O  O   . ARG B 1 424 ? 7.737   22.690  -35.840 1.00 43.10 ? 424  ARG B O   1 
ATOM   7358 C  CB  . ARG B 1 424 ? 7.164   25.543  -36.063 1.00 52.06 ? 424  ARG B CB  1 
ATOM   7359 C  CG  . ARG B 1 424 ? 5.850   25.855  -35.420 1.00 56.64 ? 424  ARG B CG  1 
ATOM   7360 C  CD  . ARG B 1 424 ? 4.996   26.615  -36.451 1.00 60.27 ? 424  ARG B CD  1 
ATOM   7361 N  NE  . ARG B 1 424 ? 3.901   27.329  -35.823 1.00 63.36 ? 424  ARG B NE  1 
ATOM   7362 C  CZ  . ARG B 1 424 ? 4.016   28.032  -34.695 1.00 61.76 ? 424  ARG B CZ  1 
ATOM   7363 N  NH1 . ARG B 1 424 ? 5.167   28.130  -34.049 1.00 60.47 ? 424  ARG B NH1 1 
ATOM   7364 N  NH2 . ARG B 1 424 ? 2.961   28.633  -34.208 1.00 62.55 ? 424  ARG B NH2 1 
ATOM   7365 N  N   . VAL B 1 425 ? 7.849   23.075  -33.631 1.00 44.88 ? 425  VAL B N   1 
ATOM   7366 C  CA  . VAL B 1 425 ? 7.633   21.680  -33.258 1.00 42.75 ? 425  VAL B CA  1 
ATOM   7367 C  C   . VAL B 1 425 ? 6.420   21.417  -32.382 1.00 43.33 ? 425  VAL B C   1 
ATOM   7368 O  O   . VAL B 1 425 ? 6.135   22.178  -31.461 1.00 43.17 ? 425  VAL B O   1 
ATOM   7369 C  CB  . VAL B 1 425 ? 8.856   21.144  -32.466 1.00 41.99 ? 425  VAL B CB  1 
ATOM   7370 C  CG1 . VAL B 1 425 ? 8.645   19.676  -32.092 1.00 39.99 ? 425  VAL B CG1 1 
ATOM   7371 C  CG2 . VAL B 1 425 ? 10.149  21.367  -33.264 1.00 39.94 ? 425  VAL B CG2 1 
ATOM   7372 N  N   . TYR B 1 426 ? 5.720   20.321  -32.661 1.00 43.32 ? 426  TYR B N   1 
ATOM   7373 C  CA  . TYR B 1 426 ? 4.587   19.892  -31.841 1.00 42.32 ? 426  TYR B CA  1 
ATOM   7374 C  C   . TYR B 1 426 ? 4.862   18.437  -31.483 1.00 42.27 ? 426  TYR B C   1 
ATOM   7375 O  O   . TYR B 1 426 ? 5.299   17.652  -32.331 1.00 43.68 ? 426  TYR B O   1 
ATOM   7376 C  CB  . TYR B 1 426 ? 3.274   19.995  -32.599 1.00 41.22 ? 426  TYR B CB  1 
ATOM   7377 C  CG  . TYR B 1 426 ? 2.863   21.405  -32.913 1.00 39.14 ? 426  TYR B CG  1 
ATOM   7378 C  CD1 . TYR B 1 426 ? 3.235   22.002  -34.119 1.00 37.20 ? 426  TYR B CD1 1 
ATOM   7379 C  CD2 . TYR B 1 426 ? 2.101   22.152  -31.997 1.00 38.00 ? 426  TYR B CD2 1 
ATOM   7380 C  CE1 . TYR B 1 426 ? 2.863   23.306  -34.416 1.00 38.21 ? 426  TYR B CE1 1 
ATOM   7381 C  CE2 . TYR B 1 426 ? 1.720   23.465  -32.281 1.00 36.23 ? 426  TYR B CE2 1 
ATOM   7382 C  CZ  . TYR B 1 426 ? 2.102   24.035  -33.489 1.00 38.03 ? 426  TYR B CZ  1 
ATOM   7383 O  OH  . TYR B 1 426 ? 1.722   25.326  -33.796 1.00 38.00 ? 426  TYR B OH  1 
ATOM   7384 N  N   . ALA B 1 427 ? 4.620   18.075  -30.232 1.00 41.07 ? 427  ALA B N   1 
ATOM   7385 C  CA  . ALA B 1 427 ? 4.886   16.719  -29.783 1.00 40.54 ? 427  ALA B CA  1 
ATOM   7386 C  C   . ALA B 1 427 ? 3.709   16.105  -29.044 1.00 41.40 ? 427  ALA B C   1 
ATOM   7387 O  O   . ALA B 1 427 ? 2.884   16.813  -28.458 1.00 41.51 ? 427  ALA B O   1 
ATOM   7388 C  CB  . ALA B 1 427 ? 6.129   16.701  -28.906 1.00 37.45 ? 427  ALA B CB  1 
ATOM   7389 N  N   . TYR B 1 428 ? 3.634   14.779  -29.087 1.00 42.36 ? 428  TYR B N   1 
ATOM   7390 C  CA  . TYR B 1 428 ? 2.558   14.061  -28.434 1.00 41.53 ? 428  TYR B CA  1 
ATOM   7391 C  C   . TYR B 1 428 ? 2.990   12.696  -27.946 1.00 43.05 ? 428  TYR B C   1 
ATOM   7392 O  O   . TYR B 1 428 ? 4.068   12.188  -28.267 1.00 39.25 ? 428  TYR B O   1 
ATOM   7393 C  CB  . TYR B 1 428 ? 1.390   13.849  -29.407 1.00 43.26 ? 428  TYR B CB  1 
ATOM   7394 C  CG  . TYR B 1 428 ? 1.713   12.867  -30.526 1.00 44.72 ? 428  TYR B CG  1 
ATOM   7395 C  CD1 . TYR B 1 428 ? 1.767   11.485  -30.282 1.00 45.38 ? 428  TYR B CD1 1 
ATOM   7396 C  CD2 . TYR B 1 428 ? 2.091   13.323  -31.791 1.00 43.50 ? 428  TYR B CD2 1 
ATOM   7397 C  CE1 . TYR B 1 428 ? 2.206   10.588  -31.262 1.00 45.63 ? 428  TYR B CE1 1 
ATOM   7398 C  CE2 . TYR B 1 428 ? 2.529   12.435  -32.776 1.00 45.52 ? 428  TYR B CE2 1 
ATOM   7399 C  CZ  . TYR B 1 428 ? 2.589   11.070  -32.505 1.00 46.63 ? 428  TYR B CZ  1 
ATOM   7400 O  OH  . TYR B 1 428 ? 3.069   10.201  -33.465 1.00 46.81 ? 428  TYR B OH  1 
ATOM   7401 N  N   . ILE B 1 429 ? 2.128   12.123  -27.123 1.00 45.06 ? 429  ILE B N   1 
ATOM   7402 C  CA  . ILE B 1 429 ? 2.312   10.770  -26.665 1.00 46.36 ? 429  ILE B CA  1 
ATOM   7403 C  C   . ILE B 1 429 ? 0.897   10.197  -26.858 1.00 47.27 ? 429  ILE B C   1 
ATOM   7404 O  O   . ILE B 1 429 ? -0.098  10.752  -26.366 1.00 46.87 ? 429  ILE B O   1 
ATOM   7405 C  CB  . ILE B 1 429 ? 2.785   10.686  -25.221 1.00 46.41 ? 429  ILE B CB  1 
ATOM   7406 C  CG1 . ILE B 1 429 ? 2.937   9.207   -24.846 1.00 45.19 ? 429  ILE B CG1 1 
ATOM   7407 C  CG2 . ILE B 1 429 ? 1.821   11.425  -24.308 1.00 49.29 ? 429  ILE B CG2 1 
ATOM   7408 C  CD1 . ILE B 1 429 ? 3.711   8.954   -23.568 1.00 46.96 ? 429  ILE B CD1 1 
ATOM   7409 N  N   . PHE B 1 430 ? 0.814   9.134   -27.652 1.00 47.01 ? 430  PHE B N   1 
ATOM   7410 C  CA  . PHE B 1 430 ? -0.452  8.485   -27.971 1.00 46.51 ? 430  PHE B CA  1 
ATOM   7411 C  C   . PHE B 1 430 ? -0.637  7.427   -26.911 1.00 46.69 ? 430  PHE B C   1 
ATOM   7412 O  O   . PHE B 1 430 ? 0.246   6.589   -26.713 1.00 46.46 ? 430  PHE B O   1 
ATOM   7413 C  CB  . PHE B 1 430 ? -0.354  7.886   -29.363 1.00 45.27 ? 430  PHE B CB  1 
ATOM   7414 C  CG  . PHE B 1 430 ? -1.626  7.318   -29.859 1.00 45.99 ? 430  PHE B CG  1 
ATOM   7415 C  CD1 . PHE B 1 430 ? -1.955  5.985   -29.601 1.00 44.96 ? 430  PHE B CD1 1 
ATOM   7416 C  CD2 . PHE B 1 430 ? -2.488  8.099   -30.619 1.00 45.13 ? 430  PHE B CD2 1 
ATOM   7417 C  CE1 . PHE B 1 430 ? -3.126  5.435   -30.102 1.00 45.52 ? 430  PHE B CE1 1 
ATOM   7418 C  CE2 . PHE B 1 430 ? -3.676  7.563   -31.130 1.00 46.89 ? 430  PHE B CE2 1 
ATOM   7419 C  CZ  . PHE B 1 430 ? -3.995  6.228   -30.872 1.00 45.22 ? 430  PHE B CZ  1 
ATOM   7420 N  N   . GLU B 1 431 ? -1.775  7.464   -26.218 1.00 48.20 ? 431  GLU B N   1 
ATOM   7421 C  CA  . GLU B 1 431 ? -1.984  6.531   -25.107 1.00 50.12 ? 431  GLU B CA  1 
ATOM   7422 C  C   . GLU B 1 431 ? -3.216  5.656   -25.161 1.00 51.06 ? 431  GLU B C   1 
ATOM   7423 O  O   . GLU B 1 431 ? -3.520  4.978   -24.179 1.00 50.79 ? 431  GLU B O   1 
ATOM   7424 C  CB  . GLU B 1 431 ? -2.000  7.298   -23.770 1.00 50.13 ? 431  GLU B CB  1 
ATOM   7425 C  CG  . GLU B 1 431 ? -0.724  8.092   -23.456 1.00 51.01 ? 431  GLU B CG  1 
ATOM   7426 C  CD  . GLU B 1 431 ? -0.769  8.761   -22.075 1.00 52.51 ? 431  GLU B CD  1 
ATOM   7427 O  OE1 . GLU B 1 431 ? -1.750  9.506   -21.815 1.00 50.86 ? 431  GLU B OE1 1 
ATOM   7428 O  OE2 . GLU B 1 431 ? 0.174   8.532   -21.269 1.00 50.98 ? 431  GLU B OE2 1 
ATOM   7429 N  N   . HIS B 1 432 ? -3.935  5.665   -26.279 1.00 51.88 ? 432  HIS B N   1 
ATOM   7430 C  CA  . HIS B 1 432 ? -5.120  4.816   -26.369 1.00 53.44 ? 432  HIS B CA  1 
ATOM   7431 C  C   . HIS B 1 432 ? -4.864  3.439   -27.002 1.00 52.39 ? 432  HIS B C   1 
ATOM   7432 O  O   . HIS B 1 432 ? -4.335  3.343   -28.117 1.00 52.01 ? 432  HIS B O   1 
ATOM   7433 C  CB  . HIS B 1 432 ? -6.243  5.511   -27.144 1.00 54.66 ? 432  HIS B CB  1 
ATOM   7434 C  CG  . HIS B 1 432 ? -7.434  4.628   -27.356 1.00 57.75 ? 432  HIS B CG  1 
ATOM   7435 N  ND1 . HIS B 1 432 ? -8.113  4.038   -26.311 1.00 58.15 ? 432  HIS B ND1 1 
ATOM   7436 C  CD2 . HIS B 1 432 ? -8.021  4.172   -28.492 1.00 58.44 ? 432  HIS B CD2 1 
ATOM   7437 C  CE1 . HIS B 1 432 ? -9.063  3.255   -26.793 1.00 58.13 ? 432  HIS B CE1 1 
ATOM   7438 N  NE2 . HIS B 1 432 ? -9.029  3.318   -28.112 1.00 57.83 ? 432  HIS B NE2 1 
ATOM   7439 N  N   . ARG B 1 433 ? -5.240  2.384   -26.283 1.00 51.64 ? 433  ARG B N   1 
ATOM   7440 C  CA  . ARG B 1 433 ? -5.085  1.025   -26.777 1.00 53.31 ? 433  ARG B CA  1 
ATOM   7441 C  C   . ARG B 1 433 ? -6.363  0.607   -27.511 1.00 54.32 ? 433  ARG B C   1 
ATOM   7442 O  O   . ARG B 1 433 ? -7.443  0.593   -26.926 1.00 55.12 ? 433  ARG B O   1 
ATOM   7443 C  CB  . ARG B 1 433 ? -4.819  0.059   -25.628 1.00 52.90 ? 433  ARG B CB  1 
ATOM   7444 C  CG  . ARG B 1 433 ? -4.838  -1.395  -26.060 1.00 54.92 ? 433  ARG B CG  1 
ATOM   7445 C  CD  . ARG B 1 433 ? -4.399  -2.326  -24.945 1.00 54.64 ? 433  ARG B CD  1 
ATOM   7446 N  NE  . ARG B 1 433 ? -4.761  -3.717  -25.225 1.00 55.59 ? 433  ARG B NE  1 
ATOM   7447 C  CZ  . ARG B 1 433 ? -3.889  -4.711  -25.373 1.00 56.47 ? 433  ARG B CZ  1 
ATOM   7448 N  NH1 . ARG B 1 433 ? -2.589  -4.490  -25.272 1.00 53.58 ? 433  ARG B NH1 1 
ATOM   7449 N  NH2 . ARG B 1 433 ? -4.325  -5.939  -25.626 1.00 57.38 ? 433  ARG B NH2 1 
ATOM   7450 N  N   . ALA B 1 434 ? -6.233  0.282   -28.794 1.00 55.30 ? 434  ALA B N   1 
ATOM   7451 C  CA  . ALA B 1 434 ? -7.373  -0.138  -29.619 1.00 56.19 ? 434  ALA B CA  1 
ATOM   7452 C  C   . ALA B 1 434 ? -8.181  -1.264  -28.956 1.00 55.88 ? 434  ALA B C   1 
ATOM   7453 O  O   . ALA B 1 434 ? -7.613  -2.265  -28.492 1.00 54.14 ? 434  ALA B O   1 
ATOM   7454 C  CB  . ALA B 1 434 ? -6.877  -0.597  -30.985 1.00 54.85 ? 434  ALA B CB  1 
ATOM   7455 N  N   . SER B 1 435 ? -9.499  -1.095  -28.911 1.00 55.37 ? 435  SER B N   1 
ATOM   7456 C  CA  . SER B 1 435 ? -10.364 -2.104  -28.312 1.00 57.91 ? 435  SER B CA  1 
ATOM   7457 C  C   . SER B 1 435 ? -10.201 -3.453  -29.013 1.00 58.52 ? 435  SER B C   1 
ATOM   7458 O  O   . SER B 1 435 ? -10.388 -4.508  -28.407 1.00 57.90 ? 435  SER B O   1 
ATOM   7459 C  CB  . SER B 1 435 ? -11.829 -1.673  -28.394 1.00 58.09 ? 435  SER B CB  1 
ATOM   7460 O  OG  . SER B 1 435 ? -12.263 -1.587  -29.739 1.00 60.59 ? 435  SER B OG  1 
ATOM   7461 N  N   . THR B 1 436 ? -9.821  -3.409  -30.285 1.00 59.19 ? 436  THR B N   1 
ATOM   7462 C  CA  . THR B 1 436 ? -9.640  -4.618  -31.085 1.00 60.51 ? 436  THR B CA  1 
ATOM   7463 C  C   . THR B 1 436 ? -8.233  -5.212  -31.085 1.00 61.37 ? 436  THR B C   1 
ATOM   7464 O  O   . THR B 1 436 ? -7.974  -6.199  -31.778 1.00 62.86 ? 436  THR B O   1 
ATOM   7465 C  CB  . THR B 1 436 ? -9.995  -4.341  -32.533 1.00 60.01 ? 436  THR B CB  1 
ATOM   7466 O  OG1 . THR B 1 436 ? -9.119  -3.324  -33.035 1.00 62.52 ? 436  THR B OG1 1 
ATOM   7467 C  CG2 . THR B 1 436 ? -11.438 -3.856  -32.641 1.00 60.17 ? 436  THR B CG2 1 
ATOM   7468 N  N   . LEU B 1 437 ? -7.317  -4.631  -30.323 1.00 61.22 ? 437  LEU B N   1 
ATOM   7469 C  CA  . LEU B 1 437 ? -5.948  -5.137  -30.304 1.00 60.62 ? 437  LEU B CA  1 
ATOM   7470 C  C   . LEU B 1 437 ? -5.942  -6.615  -29.970 1.00 60.45 ? 437  LEU B C   1 
ATOM   7471 O  O   . LEU B 1 437 ? -6.686  -7.044  -29.088 1.00 61.43 ? 437  LEU B O   1 
ATOM   7472 C  CB  . LEU B 1 437 ? -5.109  -4.390  -29.268 1.00 60.82 ? 437  LEU B CB  1 
ATOM   7473 C  CG  . LEU B 1 437 ? -3.612  -4.535  -29.538 1.00 62.93 ? 437  LEU B CG  1 
ATOM   7474 C  CD1 . LEU B 1 437 ? -3.276  -3.786  -30.802 1.00 63.83 ? 437  LEU B CD1 1 
ATOM   7475 C  CD2 . LEU B 1 437 ? -2.800  -3.991  -28.385 1.00 65.27 ? 437  LEU B CD2 1 
ATOM   7476 N  N   . THR B 1 438 ? -5.103  -7.392  -30.653 1.00 59.67 ? 438  THR B N   1 
ATOM   7477 C  CA  . THR B 1 438 ? -5.030  -8.832  -30.387 1.00 58.95 ? 438  THR B CA  1 
ATOM   7478 C  C   . THR B 1 438 ? -3.760  -9.235  -29.651 1.00 57.65 ? 438  THR B C   1 
ATOM   7479 O  O   . THR B 1 438 ? -3.562  -10.423 -29.353 1.00 57.81 ? 438  THR B O   1 
ATOM   7480 C  CB  . THR B 1 438 ? -5.130  -9.682  -31.681 1.00 59.62 ? 438  THR B CB  1 
ATOM   7481 O  OG1 . THR B 1 438 ? -3.942  -9.513  -32.463 1.00 61.70 ? 438  THR B OG1 1 
ATOM   7482 C  CG2 . THR B 1 438 ? -6.331  -9.263  -32.501 1.00 59.72 ? 438  THR B CG2 1 
ATOM   7483 N  N   . TRP B 1 439 ? -2.879  -8.273  -29.381 1.00 55.07 ? 439  TRP B N   1 
ATOM   7484 C  CA  . TRP B 1 439 ? -1.679  -8.602  -28.611 1.00 53.33 ? 439  TRP B CA  1 
ATOM   7485 C  C   . TRP B 1 439 ? -2.141  -8.609  -27.156 1.00 52.51 ? 439  TRP B C   1 
ATOM   7486 O  O   . TRP B 1 439 ? -3.161  -7.986  -26.813 1.00 52.97 ? 439  TRP B O   1 
ATOM   7487 C  CB  . TRP B 1 439 ? -0.580  -7.556  -28.776 1.00 52.01 ? 439  TRP B CB  1 
ATOM   7488 C  CG  . TRP B 1 439 ? 0.042   -7.555  -30.110 1.00 49.59 ? 439  TRP B CG  1 
ATOM   7489 C  CD1 . TRP B 1 439 ? -0.280  -6.756  -31.168 1.00 48.13 ? 439  TRP B CD1 1 
ATOM   7490 C  CD2 . TRP B 1 439 ? 1.112   -8.393  -30.544 1.00 48.68 ? 439  TRP B CD2 1 
ATOM   7491 N  NE1 . TRP B 1 439 ? 0.532   -7.041  -32.236 1.00 47.52 ? 439  TRP B NE1 1 
ATOM   7492 C  CE2 . TRP B 1 439 ? 1.397   -8.044  -31.880 1.00 47.45 ? 439  TRP B CE2 1 
ATOM   7493 C  CE3 . TRP B 1 439 ? 1.859   -9.408  -29.931 1.00 47.63 ? 439  TRP B CE3 1 
ATOM   7494 C  CZ2 . TRP B 1 439 ? 2.400   -8.675  -32.620 1.00 47.74 ? 439  TRP B CZ2 1 
ATOM   7495 C  CZ3 . TRP B 1 439 ? 2.855   -10.035 -30.661 1.00 48.58 ? 439  TRP B CZ3 1 
ATOM   7496 C  CH2 . TRP B 1 439 ? 3.118   -9.665  -31.999 1.00 49.56 ? 439  TRP B CH2 1 
ATOM   7497 N  N   . PRO B 1 440 ? -1.407  -9.299  -26.279 1.00 51.19 ? 440  PRO B N   1 
ATOM   7498 C  CA  . PRO B 1 440 ? -1.803  -9.343  -24.865 1.00 53.16 ? 440  PRO B CA  1 
ATOM   7499 C  C   . PRO B 1 440 ? -1.807  -7.949  -24.183 1.00 54.75 ? 440  PRO B C   1 
ATOM   7500 O  O   . PRO B 1 440 ? -1.154  -7.009  -24.648 1.00 55.06 ? 440  PRO B O   1 
ATOM   7501 C  CB  . PRO B 1 440 ? -0.784  -10.299 -24.259 1.00 52.45 ? 440  PRO B CB  1 
ATOM   7502 C  CG  . PRO B 1 440 ? 0.456   -10.011 -25.090 1.00 53.31 ? 440  PRO B CG  1 
ATOM   7503 C  CD  . PRO B 1 440 ? -0.088  -9.914  -26.494 1.00 50.95 ? 440  PRO B CD  1 
ATOM   7504 N  N   . LEU B 1 441 ? -2.548  -7.827  -23.087 1.00 55.21 ? 441  LEU B N   1 
ATOM   7505 C  CA  . LEU B 1 441 ? -2.644  -6.572  -22.358 1.00 55.74 ? 441  LEU B CA  1 
ATOM   7506 C  C   . LEU B 1 441 ? -1.323  -6.015  -21.854 1.00 55.42 ? 441  LEU B C   1 
ATOM   7507 O  O   . LEU B 1 441 ? -1.096  -4.799  -21.881 1.00 55.42 ? 441  LEU B O   1 
ATOM   7508 C  CB  . LEU B 1 441 ? -3.578  -6.724  -21.160 1.00 57.07 ? 441  LEU B CB  1 
ATOM   7509 C  CG  . LEU B 1 441 ? -5.079  -6.674  -21.452 1.00 59.33 ? 441  LEU B CG  1 
ATOM   7510 C  CD1 . LEU B 1 441 ? -5.844  -6.797  -20.127 1.00 62.27 ? 441  LEU B CD1 1 
ATOM   7511 C  CD2 . LEU B 1 441 ? -5.444  -5.375  -22.141 1.00 59.46 ? 441  LEU B CD2 1 
ATOM   7512 N  N   . TRP B 1 442 ? -0.441  -6.885  -21.394 1.00 54.28 ? 442  TRP B N   1 
ATOM   7513 C  CA  . TRP B 1 442 ? 0.806   -6.382  -20.859 1.00 55.71 ? 442  TRP B CA  1 
ATOM   7514 C  C   . TRP B 1 442 ? 1.619   -5.545  -21.849 1.00 56.64 ? 442  TRP B C   1 
ATOM   7515 O  O   . TRP B 1 442 ? 2.504   -4.785  -21.443 1.00 58.02 ? 442  TRP B O   1 
ATOM   7516 C  CB  . TRP B 1 442 ? 1.658   -7.523  -20.297 1.00 55.89 ? 442  TRP B CB  1 
ATOM   7517 C  CG  . TRP B 1 442 ? 2.249   -8.444  -21.319 1.00 58.23 ? 442  TRP B CG  1 
ATOM   7518 C  CD1 . TRP B 1 442 ? 1.769   -9.666  -21.703 1.00 58.46 ? 442  TRP B CD1 1 
ATOM   7519 C  CD2 . TRP B 1 442 ? 3.487   -8.261  -22.019 1.00 58.43 ? 442  TRP B CD2 1 
ATOM   7520 N  NE1 . TRP B 1 442 ? 2.641   -10.259 -22.587 1.00 58.49 ? 442  TRP B NE1 1 
ATOM   7521 C  CE2 . TRP B 1 442 ? 3.701   -9.419  -22.800 1.00 58.27 ? 442  TRP B CE2 1 
ATOM   7522 C  CE3 . TRP B 1 442 ? 4.439   -7.231  -22.059 1.00 57.69 ? 442  TRP B CE3 1 
ATOM   7523 C  CZ2 . TRP B 1 442 ? 4.832   -9.575  -23.612 1.00 58.73 ? 442  TRP B CZ2 1 
ATOM   7524 C  CZ3 . TRP B 1 442 ? 5.558   -7.387  -22.863 1.00 57.81 ? 442  TRP B CZ3 1 
ATOM   7525 C  CH2 . TRP B 1 442 ? 5.747   -8.551  -23.630 1.00 57.98 ? 442  TRP B CH2 1 
ATOM   7526 N  N   . MET B 1 443 ? 1.330   -5.670  -23.140 1.00 55.63 ? 443  MET B N   1 
ATOM   7527 C  CA  . MET B 1 443 ? 2.060   -4.895  -24.133 1.00 54.94 ? 443  MET B CA  1 
ATOM   7528 C  C   . MET B 1 443 ? 1.557   -3.443  -24.267 1.00 54.90 ? 443  MET B C   1 
ATOM   7529 O  O   . MET B 1 443 ? 2.197   -2.615  -24.922 1.00 54.82 ? 443  MET B O   1 
ATOM   7530 C  CB  . MET B 1 443 ? 2.019   -5.603  -25.484 1.00 54.67 ? 443  MET B CB  1 
ATOM   7531 C  CG  . MET B 1 443 ? 2.861   -6.872  -25.540 1.00 56.30 ? 443  MET B CG  1 
ATOM   7532 S  SD  . MET B 1 443 ? 2.921   -7.569  -27.251 1.00 58.97 ? 443  MET B SD  1 
ATOM   7533 C  CE  . MET B 1 443 ? 4.007   -8.945  -27.013 1.00 57.37 ? 443  MET B CE  1 
ATOM   7534 N  N   . GLY B 1 444 ? 0.416   -3.144  -23.646 1.00 54.03 ? 444  GLY B N   1 
ATOM   7535 C  CA  . GLY B 1 444 ? -0.126  -1.795  -23.679 1.00 53.24 ? 444  GLY B CA  1 
ATOM   7536 C  C   . GLY B 1 444 ? -0.453  -1.260  -25.058 1.00 53.77 ? 444  GLY B C   1 
ATOM   7537 O  O   . GLY B 1 444 ? -1.170  -1.905  -25.823 1.00 55.54 ? 444  GLY B O   1 
ATOM   7538 N  N   . VAL B 1 445 ? 0.026   -0.057  -25.366 1.00 51.91 ? 445  VAL B N   1 
ATOM   7539 C  CA  . VAL B 1 445 ? -0.195  0.556   -26.680 1.00 49.93 ? 445  VAL B CA  1 
ATOM   7540 C  C   . VAL B 1 445 ? 1.129   0.283   -27.382 1.00 49.67 ? 445  VAL B C   1 
ATOM   7541 O  O   . VAL B 1 445 ? 2.086   1.026   -27.216 1.00 49.99 ? 445  VAL B O   1 
ATOM   7542 C  CB  . VAL B 1 445 ? -0.408  2.076   -26.555 1.00 49.56 ? 445  VAL B CB  1 
ATOM   7543 C  CG1 . VAL B 1 445 ? -0.816  2.661   -27.889 1.00 48.33 ? 445  VAL B CG1 1 
ATOM   7544 C  CG2 . VAL B 1 445 ? -1.458  2.369   -25.485 1.00 49.85 ? 445  VAL B CG2 1 
ATOM   7545 N  N   . PRO B 1 446 ? 1.199   -0.795  -28.182 1.00 49.72 ? 446  PRO B N   1 
ATOM   7546 C  CA  . PRO B 1 446 ? 2.432   -1.169  -28.890 1.00 48.32 ? 446  PRO B CA  1 
ATOM   7547 C  C   . PRO B 1 446 ? 2.802   -0.302  -30.063 1.00 46.36 ? 446  PRO B C   1 
ATOM   7548 O  O   . PRO B 1 446 ? 1.973   0.403   -30.613 1.00 45.94 ? 446  PRO B O   1 
ATOM   7549 C  CB  . PRO B 1 446 ? 2.171   -2.618  -29.335 1.00 48.15 ? 446  PRO B CB  1 
ATOM   7550 C  CG  . PRO B 1 446 ? 0.931   -3.042  -28.551 1.00 48.10 ? 446  PRO B CG  1 
ATOM   7551 C  CD  . PRO B 1 446 ? 0.133   -1.761  -28.483 1.00 49.10 ? 446  PRO B CD  1 
ATOM   7552 N  N   . HIS B 1 447 ? 4.077   -0.381  -30.417 1.00 46.21 ? 447  HIS B N   1 
ATOM   7553 C  CA  . HIS B 1 447 ? 4.680   0.330   -31.534 1.00 46.08 ? 447  HIS B CA  1 
ATOM   7554 C  C   . HIS B 1 447 ? 3.824   0.091   -32.784 1.00 47.74 ? 447  HIS B C   1 
ATOM   7555 O  O   . HIS B 1 447 ? 3.564   -1.053  -33.145 1.00 47.28 ? 447  HIS B O   1 
ATOM   7556 C  CB  . HIS B 1 447 ? 6.069   -0.253  -31.735 1.00 44.96 ? 447  HIS B CB  1 
ATOM   7557 C  CG  . HIS B 1 447 ? 6.892   0.445   -32.763 1.00 47.48 ? 447  HIS B CG  1 
ATOM   7558 N  ND1 . HIS B 1 447 ? 7.390   1.717   -32.580 1.00 48.43 ? 447  HIS B ND1 1 
ATOM   7559 C  CD2 . HIS B 1 447 ? 7.379   0.015   -33.951 1.00 47.41 ? 447  HIS B CD2 1 
ATOM   7560 C  CE1 . HIS B 1 447 ? 8.157   2.038   -33.607 1.00 47.40 ? 447  HIS B CE1 1 
ATOM   7561 N  NE2 . HIS B 1 447 ? 8.167   1.022   -34.452 1.00 47.32 ? 447  HIS B NE2 1 
ATOM   7562 N  N   . GLY B 1 448 ? 3.366   1.161   -33.425 1.00 48.32 ? 448  GLY B N   1 
ATOM   7563 C  CA  . GLY B 1 448 ? 2.571   1.002   -34.628 1.00 46.52 ? 448  GLY B CA  1 
ATOM   7564 C  C   . GLY B 1 448 ? 1.064   1.068   -34.463 1.00 47.71 ? 448  GLY B C   1 
ATOM   7565 O  O   . GLY B 1 448 ? 0.359   1.286   -35.452 1.00 49.56 ? 448  GLY B O   1 
ATOM   7566 N  N   . TYR B 1 449 ? 0.535   0.926   -33.250 1.00 46.05 ? 449  TYR B N   1 
ATOM   7567 C  CA  . TYR B 1 449 ? -0.923  0.942   -33.126 1.00 45.81 ? 449  TYR B CA  1 
ATOM   7568 C  C   . TYR B 1 449 ? -1.696  2.258   -33.016 1.00 45.52 ? 449  TYR B C   1 
ATOM   7569 O  O   . TYR B 1 449 ? -2.847  2.281   -32.598 1.00 45.66 ? 449  TYR B O   1 
ATOM   7570 C  CB  . TYR B 1 449 ? -1.359  -0.042  -32.042 1.00 44.41 ? 449  TYR B CB  1 
ATOM   7571 C  CG  . TYR B 1 449 ? -1.059  -1.436  -32.508 1.00 44.26 ? 449  TYR B CG  1 
ATOM   7572 C  CD1 . TYR B 1 449 ? 0.220   -1.968  -32.381 1.00 44.42 ? 449  TYR B CD1 1 
ATOM   7573 C  CD2 . TYR B 1 449 ? -2.016  -2.170  -33.209 1.00 44.87 ? 449  TYR B CD2 1 
ATOM   7574 C  CE1 . TYR B 1 449 ? 0.551   -3.200  -32.943 1.00 47.14 ? 449  TYR B CE1 1 
ATOM   7575 C  CE2 . TYR B 1 449 ? -1.706  -3.406  -33.783 1.00 47.22 ? 449  TYR B CE2 1 
ATOM   7576 C  CZ  . TYR B 1 449 ? -0.421  -3.913  -33.650 1.00 49.69 ? 449  TYR B CZ  1 
ATOM   7577 O  OH  . TYR B 1 449 ? -0.104  -5.121  -34.235 1.00 51.83 ? 449  TYR B OH  1 
ATOM   7578 N  N   . GLU B 1 450 ? -1.074  3.351   -33.427 1.00 45.04 ? 450  GLU B N   1 
ATOM   7579 C  CA  . GLU B 1 450 ? -1.769  4.618   -33.431 1.00 43.77 ? 450  GLU B CA  1 
ATOM   7580 C  C   . GLU B 1 450 ? -2.135  4.842   -34.909 1.00 43.90 ? 450  GLU B C   1 
ATOM   7581 O  O   . GLU B 1 450 ? -3.075  5.582   -35.234 1.00 45.01 ? 450  GLU B O   1 
ATOM   7582 C  CB  . GLU B 1 450 ? -0.853  5.752   -32.936 1.00 42.36 ? 450  GLU B CB  1 
ATOM   7583 C  CG  . GLU B 1 450 ? 0.051   6.375   -34.015 1.00 40.25 ? 450  GLU B CG  1 
ATOM   7584 C  CD  . GLU B 1 450 ? 1.300   5.554   -34.319 1.00 40.82 ? 450  GLU B CD  1 
ATOM   7585 O  OE1 . GLU B 1 450 ? 1.369   4.352   -33.954 1.00 38.42 ? 450  GLU B OE1 1 
ATOM   7586 O  OE2 . GLU B 1 450 ? 2.221   6.121   -34.939 1.00 40.15 ? 450  GLU B OE2 1 
ATOM   7587 N  N   . ILE B 1 451 ? -1.406  4.176   -35.807 1.00 42.79 ? 451  ILE B N   1 
ATOM   7588 C  CA  . ILE B 1 451 ? -1.627  4.355   -37.240 1.00 42.45 ? 451  ILE B CA  1 
ATOM   7589 C  C   . ILE B 1 451 ? -3.069  4.206   -37.711 1.00 42.85 ? 451  ILE B C   1 
ATOM   7590 O  O   . ILE B 1 451 ? -3.580  5.079   -38.432 1.00 43.03 ? 451  ILE B O   1 
ATOM   7591 C  CB  . ILE B 1 451 ? -0.741  3.390   -38.098 1.00 43.64 ? 451  ILE B CB  1 
ATOM   7592 C  CG1 . ILE B 1 451 ? 0.751   3.656   -37.855 1.00 42.74 ? 451  ILE B CG1 1 
ATOM   7593 C  CG2 . ILE B 1 451 ? -1.051  3.578   -39.592 1.00 42.85 ? 451  ILE B CG2 1 
ATOM   7594 C  CD1 . ILE B 1 451 ? 1.670   2.589   -38.468 1.00 38.69 ? 451  ILE B CD1 1 
ATOM   7595 N  N   . GLU B 1 452 ? -3.716  3.103   -37.332 1.00 43.79 ? 452  GLU B N   1 
ATOM   7596 C  CA  . GLU B 1 452 ? -5.107  2.849   -37.740 1.00 46.61 ? 452  GLU B CA  1 
ATOM   7597 C  C   . GLU B 1 452 ? -6.042  4.001   -37.334 1.00 46.66 ? 452  GLU B C   1 
ATOM   7598 O  O   . GLU B 1 452 ? -7.044  4.268   -38.015 1.00 47.09 ? 452  GLU B O   1 
ATOM   7599 C  CB  . GLU B 1 452 ? -5.609  1.528   -37.143 1.00 47.51 ? 452  GLU B CB  1 
ATOM   7600 C  CG  . GLU B 1 452 ? -5.467  1.437   -35.619 1.00 50.63 ? 452  GLU B CG  1 
ATOM   7601 C  CD  . GLU B 1 452 ? -5.459  -0.008  -35.124 1.00 50.86 ? 452  GLU B CD  1 
ATOM   7602 O  OE1 . GLU B 1 452 ? -6.511  -0.509  -34.663 1.00 53.31 ? 452  GLU B OE1 1 
ATOM   7603 O  OE2 . GLU B 1 452 ? -4.392  -0.654  -35.208 1.00 50.84 ? 452  GLU B OE2 1 
ATOM   7604 N  N   . PHE B 1 453 ? -5.696  4.698   -36.251 1.00 45.51 ? 453  PHE B N   1 
ATOM   7605 C  CA  . PHE B 1 453 ? -6.498  5.835   -35.800 1.00 43.57 ? 453  PHE B CA  1 
ATOM   7606 C  C   . PHE B 1 453 ? -6.264  7.084   -36.631 1.00 43.26 ? 453  PHE B C   1 
ATOM   7607 O  O   . PHE B 1 453 ? -7.220  7.757   -36.998 1.00 42.55 ? 453  PHE B O   1 
ATOM   7608 C  CB  . PHE B 1 453 ? -6.236  6.088   -34.322 1.00 42.62 ? 453  PHE B CB  1 
ATOM   7609 C  CG  . PHE B 1 453 ? -6.828  5.039   -33.440 1.00 42.70 ? 453  PHE B CG  1 
ATOM   7610 C  CD1 . PHE B 1 453 ? -8.199  5.020   -33.190 1.00 44.10 ? 453  PHE B CD1 1 
ATOM   7611 C  CD2 . PHE B 1 453 ? -6.033  4.038   -32.898 1.00 42.58 ? 453  PHE B CD2 1 
ATOM   7612 C  CE1 . PHE B 1 453 ? -8.775  4.008   -32.401 1.00 45.41 ? 453  PHE B CE1 1 
ATOM   7613 C  CE2 . PHE B 1 453 ? -6.587  3.015   -32.109 1.00 44.41 ? 453  PHE B CE2 1 
ATOM   7614 C  CZ  . PHE B 1 453 ? -7.967  3.001   -31.856 1.00 45.04 ? 453  PHE B CZ  1 
ATOM   7615 N  N   . ILE B 1 454 ? -5.004  7.378   -36.960 1.00 44.31 ? 454  ILE B N   1 
ATOM   7616 C  CA  . ILE B 1 454 ? -4.663  8.546   -37.782 1.00 43.13 ? 454  ILE B CA  1 
ATOM   7617 C  C   . ILE B 1 454 ? -5.270  8.398   -39.181 1.00 44.44 ? 454  ILE B C   1 
ATOM   7618 O  O   . ILE B 1 454 ? -5.723  9.387   -39.779 1.00 43.20 ? 454  ILE B O   1 
ATOM   7619 C  CB  . ILE B 1 454 ? -3.124  8.700   -37.954 1.00 44.44 ? 454  ILE B CB  1 
ATOM   7620 C  CG1 . ILE B 1 454 ? -2.443  8.873   -36.587 1.00 46.83 ? 454  ILE B CG1 1 
ATOM   7621 C  CG2 . ILE B 1 454 ? -2.808  9.863   -38.893 1.00 41.08 ? 454  ILE B CG2 1 
ATOM   7622 C  CD1 . ILE B 1 454 ? -2.974  10.046  -35.757 1.00 51.29 ? 454  ILE B CD1 1 
ATOM   7623 N  N   . PHE B 1 455 ? -5.252  7.174   -39.720 1.00 45.01 ? 455  PHE B N   1 
ATOM   7624 C  CA  . PHE B 1 455 ? -5.817  6.931   -41.060 1.00 46.29 ? 455  PHE B CA  1 
ATOM   7625 C  C   . PHE B 1 455 ? -7.354  6.868   -41.059 1.00 46.87 ? 455  PHE B C   1 
ATOM   7626 O  O   . PHE B 1 455 ? -7.991  6.879   -42.118 1.00 45.06 ? 455  PHE B O   1 
ATOM   7627 C  CB  . PHE B 1 455 ? -5.221  5.662   -41.700 1.00 44.82 ? 455  PHE B CB  1 
ATOM   7628 C  CG  . PHE B 1 455 ? -3.930  5.914   -42.451 1.00 44.42 ? 455  PHE B CG  1 
ATOM   7629 C  CD1 . PHE B 1 455 ? -2.698  5.912   -41.790 1.00 45.80 ? 455  PHE B CD1 1 
ATOM   7630 C  CD2 . PHE B 1 455 ? -3.951  6.227   -43.797 1.00 43.17 ? 455  PHE B CD2 1 
ATOM   7631 C  CE1 . PHE B 1 455 ? -1.512  6.228   -42.465 1.00 43.27 ? 455  PHE B CE1 1 
ATOM   7632 C  CE2 . PHE B 1 455 ? -2.765  6.550   -44.484 1.00 43.80 ? 455  PHE B CE2 1 
ATOM   7633 C  CZ  . PHE B 1 455 ? -1.547  6.551   -43.810 1.00 41.45 ? 455  PHE B CZ  1 
ATOM   7634 N  N   . GLY B 1 456 ? -7.932  6.787   -39.864 1.00 47.19 ? 456  GLY B N   1 
ATOM   7635 C  CA  . GLY B 1 456 ? -9.376  6.801   -39.745 1.00 49.35 ? 456  GLY B CA  1 
ATOM   7636 C  C   . GLY B 1 456 ? -10.136 5.508   -39.910 1.00 50.57 ? 456  GLY B C   1 
ATOM   7637 O  O   . GLY B 1 456 ? -11.339 5.543   -40.162 1.00 50.77 ? 456  GLY B O   1 
ATOM   7638 N  N   . LEU B 1 457 ? -9.463  4.372   -39.766 1.00 51.28 ? 457  LEU B N   1 
ATOM   7639 C  CA  . LEU B 1 457 ? -10.143 3.088   -39.907 1.00 52.08 ? 457  LEU B CA  1 
ATOM   7640 C  C   . LEU B 1 457 ? -11.383 2.932   -39.009 1.00 54.31 ? 457  LEU B C   1 
ATOM   7641 O  O   . LEU B 1 457 ? -12.382 2.353   -39.432 1.00 54.25 ? 457  LEU B O   1 
ATOM   7642 C  CB  . LEU B 1 457 ? -9.182  1.939   -39.618 1.00 50.00 ? 457  LEU B CB  1 
ATOM   7643 C  CG  . LEU B 1 457 ? -8.508  1.272   -40.821 1.00 50.14 ? 457  LEU B CG  1 
ATOM   7644 C  CD1 . LEU B 1 457 ? -7.621  2.268   -41.578 1.00 47.84 ? 457  LEU B CD1 1 
ATOM   7645 C  CD2 . LEU B 1 457 ? -7.684  0.087   -40.287 1.00 49.82 ? 457  LEU B CD2 1 
ATOM   7646 N  N   . PRO B 1 458 ? -11.341 3.443   -37.759 1.00 54.42 ? 458  PRO B N   1 
ATOM   7647 C  CA  . PRO B 1 458 ? -12.531 3.280   -36.913 1.00 54.61 ? 458  PRO B CA  1 
ATOM   7648 C  C   . PRO B 1 458 ? -13.829 3.815   -37.515 1.00 55.45 ? 458  PRO B C   1 
ATOM   7649 O  O   . PRO B 1 458 ? -14.915 3.479   -37.058 1.00 55.37 ? 458  PRO B O   1 
ATOM   7650 C  CB  . PRO B 1 458 ? -12.126 3.976   -35.613 1.00 55.10 ? 458  PRO B CB  1 
ATOM   7651 C  CG  . PRO B 1 458 ? -10.629 3.696   -35.557 1.00 53.44 ? 458  PRO B CG  1 
ATOM   7652 C  CD  . PRO B 1 458 ? -10.209 3.985   -36.983 1.00 52.74 ? 458  PRO B CD  1 
ATOM   7653 N  N   . LEU B 1 459 ? -13.729 4.629   -38.554 1.00 56.95 ? 459  LEU B N   1 
ATOM   7654 C  CA  . LEU B 1 459 ? -14.936 5.141   -39.184 1.00 59.13 ? 459  LEU B CA  1 
ATOM   7655 C  C   . LEU B 1 459 ? -15.648 4.088   -40.042 1.00 62.09 ? 459  LEU B C   1 
ATOM   7656 O  O   . LEU B 1 459 ? -16.732 4.338   -40.567 1.00 62.94 ? 459  LEU B O   1 
ATOM   7657 C  CB  . LEU B 1 459 ? -14.614 6.349   -40.051 1.00 59.23 ? 459  LEU B CB  1 
ATOM   7658 C  CG  . LEU B 1 459 ? -14.549 7.684   -39.325 1.00 59.29 ? 459  LEU B CG  1 
ATOM   7659 C  CD1 . LEU B 1 459 ? -13.560 7.618   -38.171 1.00 59.20 ? 459  LEU B CD1 1 
ATOM   7660 C  CD2 . LEU B 1 459 ? -14.176 8.752   -40.342 1.00 59.04 ? 459  LEU B CD2 1 
ATOM   7661 N  N   . ASP B 1 460 ? -15.029 2.922   -40.210 1.00 64.41 ? 460  ASP B N   1 
ATOM   7662 C  CA  . ASP B 1 460 ? -15.626 1.837   -40.997 1.00 65.97 ? 460  ASP B CA  1 
ATOM   7663 C  C   . ASP B 1 460 ? -16.402 0.970   -40.008 1.00 66.99 ? 460  ASP B C   1 
ATOM   7664 O  O   . ASP B 1 460 ? -15.817 0.214   -39.213 1.00 66.73 ? 460  ASP B O   1 
ATOM   7665 C  CB  . ASP B 1 460 ? -14.547 0.991   -41.681 1.00 66.65 ? 460  ASP B CB  1 
ATOM   7666 C  CG  . ASP B 1 460 ? -15.134 -0.069  -42.606 1.00 68.39 ? 460  ASP B CG  1 
ATOM   7667 O  OD1 . ASP B 1 460 ? -16.244 -0.569  -42.317 1.00 68.13 ? 460  ASP B OD1 1 
ATOM   7668 O  OD2 . ASP B 1 460 ? -14.480 -0.415  -43.620 1.00 69.65 ? 460  ASP B OD2 1 
ATOM   7669 N  N   . PRO B 1 461 ? -17.738 1.044   -40.067 1.00 67.84 ? 461  PRO B N   1 
ATOM   7670 C  CA  . PRO B 1 461 ? -18.617 0.285   -39.173 1.00 68.41 ? 461  PRO B CA  1 
ATOM   7671 C  C   . PRO B 1 461 ? -18.282 -1.195  -39.054 1.00 68.51 ? 461  PRO B C   1 
ATOM   7672 O  O   . PRO B 1 461 ? -18.338 -1.765  -37.966 1.00 69.74 ? 461  PRO B O   1 
ATOM   7673 C  CB  . PRO B 1 461 ? -20.001 0.525   -39.773 1.00 68.58 ? 461  PRO B CB  1 
ATOM   7674 C  CG  . PRO B 1 461 ? -19.854 1.877   -40.453 1.00 67.63 ? 461  PRO B CG  1 
ATOM   7675 C  CD  . PRO B 1 461 ? -18.523 1.689   -41.134 1.00 67.76 ? 461  PRO B CD  1 
ATOM   7676 N  N   . SER B 1 462 ? -17.917 -1.812  -40.168 1.00 67.81 ? 462  SER B N   1 
ATOM   7677 C  CA  . SER B 1 462 ? -17.612 -3.229  -40.163 1.00 68.26 ? 462  SER B CA  1 
ATOM   7678 C  C   . SER B 1 462 ? -16.390 -3.612  -39.354 1.00 69.05 ? 462  SER B C   1 
ATOM   7679 O  O   . SER B 1 462 ? -16.174 -4.798  -39.092 1.00 69.52 ? 462  SER B O   1 
ATOM   7680 C  CB  . SER B 1 462 ? -17.436 -3.736  -41.597 1.00 69.30 ? 462  SER B CB  1 
ATOM   7681 O  OG  . SER B 1 462 ? -16.284 -3.187  -42.215 1.00 70.14 ? 462  SER B OG  1 
ATOM   7682 N  N   . LEU B 1 463 ? -15.594 -2.629  -38.940 1.00 69.37 ? 463  LEU B N   1 
ATOM   7683 C  CA  . LEU B 1 463 ? -14.379 -2.942  -38.199 1.00 69.38 ? 463  LEU B CA  1 
ATOM   7684 C  C   . LEU B 1 463 ? -14.548 -3.106  -36.694 1.00 70.48 ? 463  LEU B C   1 
ATOM   7685 O  O   . LEU B 1 463 ? -13.606 -3.474  -35.988 1.00 71.02 ? 463  LEU B O   1 
ATOM   7686 C  CB  . LEU B 1 463 ? -13.291 -1.918  -38.539 1.00 69.36 ? 463  LEU B CB  1 
ATOM   7687 C  CG  . LEU B 1 463 ? -12.769 -2.029  -39.984 1.00 69.04 ? 463  LEU B CG  1 
ATOM   7688 C  CD1 . LEU B 1 463 ? -11.723 -0.955  -40.282 1.00 67.32 ? 463  LEU B CD1 1 
ATOM   7689 C  CD2 . LEU B 1 463 ? -12.164 -3.416  -40.175 1.00 67.54 ? 463  LEU B CD2 1 
ATOM   7690 N  N   . ASN B 1 464 ? -15.755 -2.844  -36.210 1.00 71.00 ? 464  ASN B N   1 
ATOM   7691 C  CA  . ASN B 1 464 ? -16.086 -3.017  -34.799 1.00 72.67 ? 464  ASN B CA  1 
ATOM   7692 C  C   . ASN B 1 464 ? -15.338 -2.222  -33.724 1.00 72.23 ? 464  ASN B C   1 
ATOM   7693 O  O   . ASN B 1 464 ? -15.042 -2.748  -32.639 1.00 71.92 ? 464  ASN B O   1 
ATOM   7694 C  CB  . ASN B 1 464 ? -16.035 -4.507  -34.442 1.00 74.98 ? 464  ASN B CB  1 
ATOM   7695 C  CG  . ASN B 1 464 ? -16.974 -5.338  -35.300 1.00 77.74 ? 464  ASN B CG  1 
ATOM   7696 O  OD1 . ASN B 1 464 ? -18.069 -4.883  -35.658 1.00 78.55 ? 464  ASN B OD1 1 
ATOM   7697 N  ND2 . ASN B 1 464 ? -16.559 -6.567  -35.628 1.00 79.05 ? 464  ASN B ND2 1 
ATOM   7698 N  N   . TYR B 1 465 ? -15.049 -0.957  -34.013 1.00 70.31 ? 465  TYR B N   1 
ATOM   7699 C  CA  . TYR B 1 465 ? -14.398 -0.099  -33.029 1.00 67.61 ? 465  TYR B CA  1 
ATOM   7700 C  C   . TYR B 1 465 ? -15.539 0.539   -32.239 1.00 66.74 ? 465  TYR B C   1 
ATOM   7701 O  O   . TYR B 1 465 ? -16.663 0.622   -32.741 1.00 65.54 ? 465  TYR B O   1 
ATOM   7702 C  CB  . TYR B 1 465 ? -13.600 1.002   -33.720 1.00 66.64 ? 465  TYR B CB  1 
ATOM   7703 C  CG  . TYR B 1 465 ? -12.286 0.562   -34.313 1.00 64.93 ? 465  TYR B CG  1 
ATOM   7704 C  CD1 . TYR B 1 465 ? -11.149 0.423   -33.517 1.00 63.99 ? 465  TYR B CD1 1 
ATOM   7705 C  CD2 . TYR B 1 465 ? -12.166 0.344   -35.681 1.00 63.87 ? 465  TYR B CD2 1 
ATOM   7706 C  CE1 . TYR B 1 465 ? -9.918  0.086   -34.075 1.00 63.87 ? 465  TYR B CE1 1 
ATOM   7707 C  CE2 . TYR B 1 465 ? -10.946 0.010   -36.248 1.00 63.62 ? 465  TYR B CE2 1 
ATOM   7708 C  CZ  . TYR B 1 465 ? -9.826  -0.111  -35.448 1.00 63.71 ? 465  TYR B CZ  1 
ATOM   7709 O  OH  . TYR B 1 465 ? -8.618  -0.369  -36.043 1.00 61.41 ? 465  TYR B OH  1 
ATOM   7710 N  N   . THR B 1 466 ? -15.255 0.988   -31.018 1.00 65.04 ? 466  THR B N   1 
ATOM   7711 C  CA  . THR B 1 466 ? -16.270 1.627   -30.190 1.00 64.93 ? 466  THR B CA  1 
ATOM   7712 C  C   . THR B 1 466 ? -16.619 3.000   -30.745 1.00 65.38 ? 466  THR B C   1 
ATOM   7713 O  O   . THR B 1 466 ? -15.858 3.580   -31.514 1.00 65.39 ? 466  THR B O   1 
ATOM   7714 C  CB  . THR B 1 466 ? -15.784 1.847   -28.747 1.00 65.97 ? 466  THR B CB  1 
ATOM   7715 O  OG1 . THR B 1 466 ? -14.805 2.898   -28.731 1.00 66.96 ? 466  THR B OG1 1 
ATOM   7716 C  CG2 . THR B 1 466 ? -15.169 0.575   -28.185 1.00 64.67 ? 466  THR B CG2 1 
ATOM   7717 N  N   . THR B 1 467 ? -17.772 3.520   -30.340 1.00 66.10 ? 467  THR B N   1 
ATOM   7718 C  CA  . THR B 1 467 ? -18.224 4.841   -30.774 1.00 66.68 ? 467  THR B CA  1 
ATOM   7719 C  C   . THR B 1 467 ? -17.207 5.906   -30.367 1.00 66.36 ? 467  THR B C   1 
ATOM   7720 O  O   . THR B 1 467 ? -16.991 6.884   -31.090 1.00 66.29 ? 467  THR B O   1 
ATOM   7721 C  CB  . THR B 1 467 ? -19.585 5.204   -30.124 1.00 67.47 ? 467  THR B CB  1 
ATOM   7722 O  OG1 . THR B 1 467 ? -20.621 4.408   -30.706 1.00 69.28 ? 467  THR B OG1 1 
ATOM   7723 C  CG2 . THR B 1 467 ? -19.909 6.674   -30.330 1.00 67.21 ? 467  THR B CG2 1 
ATOM   7724 N  N   . GLU B 1 468 ? -16.607 5.723   -29.194 1.00 65.98 ? 468  GLU B N   1 
ATOM   7725 C  CA  . GLU B 1 468 ? -15.617 6.671   -28.691 1.00 66.75 ? 468  GLU B CA  1 
ATOM   7726 C  C   . GLU B 1 468 ? -14.401 6.706   -29.612 1.00 65.33 ? 468  GLU B C   1 
ATOM   7727 O  O   . GLU B 1 468 ? -13.897 7.783   -29.978 1.00 63.28 ? 468  GLU B O   1 
ATOM   7728 C  CB  . GLU B 1 468 ? -15.159 6.283   -27.281 1.00 69.72 ? 468  GLU B CB  1 
ATOM   7729 C  CG  . GLU B 1 468 ? -16.207 6.475   -26.195 1.00 75.82 ? 468  GLU B CG  1 
ATOM   7730 C  CD  . GLU B 1 468 ? -16.856 5.160   -25.759 1.00 79.83 ? 468  GLU B CD  1 
ATOM   7731 O  OE1 . GLU B 1 468 ? -17.707 4.609   -26.510 1.00 80.21 ? 468  GLU B OE1 1 
ATOM   7732 O  OE2 . GLU B 1 468 ? -16.493 4.678   -24.655 1.00 82.18 ? 468  GLU B OE2 1 
ATOM   7733 N  N   . GLU B 1 469 ? -13.942 5.507   -29.973 1.00 64.18 ? 469  GLU B N   1 
ATOM   7734 C  CA  . GLU B 1 469 ? -12.796 5.338   -30.850 1.00 62.29 ? 469  GLU B CA  1 
ATOM   7735 C  C   . GLU B 1 469 ? -13.030 6.032   -32.186 1.00 61.88 ? 469  GLU B C   1 
ATOM   7736 O  O   . GLU B 1 469 ? -12.115 6.621   -32.759 1.00 63.12 ? 469  GLU B O   1 
ATOM   7737 C  CB  . GLU B 1 469 ? -12.506 3.850   -31.055 1.00 60.65 ? 469  GLU B CB  1 
ATOM   7738 C  CG  . GLU B 1 469 ? -11.954 3.181   -29.818 1.00 61.04 ? 469  GLU B CG  1 
ATOM   7739 C  CD  . GLU B 1 469 ? -11.611 1.708   -30.025 1.00 62.01 ? 469  GLU B CD  1 
ATOM   7740 O  OE1 . GLU B 1 469 ? -12.468 0.964   -30.556 1.00 63.75 ? 469  GLU B OE1 1 
ATOM   7741 O  OE2 . GLU B 1 469 ? -10.496 1.281   -29.638 1.00 61.06 ? 469  GLU B OE2 1 
ATOM   7742 N  N   . ARG B 1 470 ? -14.263 5.995   -32.666 1.00 60.89 ? 470  ARG B N   1 
ATOM   7743 C  CA  . ARG B 1 470 ? -14.585 6.619   -33.930 1.00 61.12 ? 470  ARG B CA  1 
ATOM   7744 C  C   . ARG B 1 470 ? -14.518 8.148   -33.817 1.00 59.12 ? 470  ARG B C   1 
ATOM   7745 O  O   . ARG B 1 470 ? -14.146 8.841   -34.762 1.00 57.94 ? 470  ARG B O   1 
ATOM   7746 C  CB  . ARG B 1 470 ? -15.968 6.146   -34.382 1.00 63.06 ? 470  ARG B CB  1 
ATOM   7747 C  CG  . ARG B 1 470 ? -16.318 6.528   -35.800 1.00 70.46 ? 470  ARG B CG  1 
ATOM   7748 C  CD  . ARG B 1 470 ? -17.206 7.753   -35.836 1.00 76.07 ? 470  ARG B CD  1 
ATOM   7749 N  NE  . ARG B 1 470 ? -18.492 7.477   -35.191 1.00 82.49 ? 470  ARG B NE  1 
ATOM   7750 C  CZ  . ARG B 1 470 ? -19.428 8.390   -34.942 1.00 85.08 ? 470  ARG B CZ  1 
ATOM   7751 N  NH1 . ARG B 1 470 ? -19.236 9.667   -35.282 1.00 85.42 ? 470  ARG B NH1 1 
ATOM   7752 N  NH2 . ARG B 1 470 ? -20.559 8.022   -34.345 1.00 86.09 ? 470  ARG B NH2 1 
ATOM   7753 N  N   . ILE B 1 471 ? -14.878 8.673   -32.652 1.00 58.76 ? 471  ILE B N   1 
ATOM   7754 C  CA  . ILE B 1 471 ? -14.844 10.120  -32.430 1.00 57.73 ? 471  ILE B CA  1 
ATOM   7755 C  C   . ILE B 1 471 ? -13.381 10.522  -32.255 1.00 55.52 ? 471  ILE B C   1 
ATOM   7756 O  O   . ILE B 1 471 ? -12.951 11.581  -32.717 1.00 54.72 ? 471  ILE B O   1 
ATOM   7757 C  CB  . ILE B 1 471 ? -15.671 10.517  -31.168 1.00 59.64 ? 471  ILE B CB  1 
ATOM   7758 C  CG1 . ILE B 1 471 ? -17.165 10.315  -31.460 1.00 59.31 ? 471  ILE B CG1 1 
ATOM   7759 C  CG2 . ILE B 1 471 ? -15.384 11.978  -30.772 1.00 55.95 ? 471  ILE B CG2 1 
ATOM   7760 C  CD1 . ILE B 1 471 ? -18.089 10.796  -30.346 1.00 61.27 ? 471  ILE B CD1 1 
ATOM   7761 N  N   . PHE B 1 472 ? -12.629 9.655   -31.583 1.00 53.41 ? 472  PHE B N   1 
ATOM   7762 C  CA  . PHE B 1 472 ? -11.200 9.857   -31.370 1.00 53.36 ? 472  PHE B CA  1 
ATOM   7763 C  C   . PHE B 1 472 ? -10.472 9.962   -32.733 1.00 54.32 ? 472  PHE B C   1 
ATOM   7764 O  O   . PHE B 1 472 ? -9.726  10.932  -32.994 1.00 52.49 ? 472  PHE B O   1 
ATOM   7765 C  CB  . PHE B 1 472 ? -10.649 8.686   -30.562 1.00 52.26 ? 472  PHE B CB  1 
ATOM   7766 C  CG  . PHE B 1 472 ? -9.194  8.806   -30.223 1.00 51.35 ? 472  PHE B CG  1 
ATOM   7767 C  CD1 . PHE B 1 472 ? -8.649  10.032  -29.835 1.00 50.13 ? 472  PHE B CD1 1 
ATOM   7768 C  CD2 . PHE B 1 472 ? -8.382  7.673   -30.203 1.00 50.05 ? 472  PHE B CD2 1 
ATOM   7769 C  CE1 . PHE B 1 472 ? -7.313  10.131  -29.417 1.00 49.05 ? 472  PHE B CE1 1 
ATOM   7770 C  CE2 . PHE B 1 472 ? -7.048  7.761   -29.789 1.00 51.35 ? 472  PHE B CE2 1 
ATOM   7771 C  CZ  . PHE B 1 472 ? -6.514  9.002   -29.391 1.00 49.31 ? 472  PHE B CZ  1 
ATOM   7772 N  N   . ALA B 1 473 ? -10.717 8.979   -33.607 1.00 53.46 ? 473  ALA B N   1 
ATOM   7773 C  CA  . ALA B 1 473 ? -10.103 8.969   -34.930 1.00 52.46 ? 473  ALA B CA  1 
ATOM   7774 C  C   . ALA B 1 473 ? -10.447 10.237  -35.680 1.00 52.87 ? 473  ALA B C   1 
ATOM   7775 O  O   . ALA B 1 473 ? -9.598  10.807  -36.366 1.00 54.72 ? 473  ALA B O   1 
ATOM   7776 C  CB  . ALA B 1 473 ? -10.552 7.768   -35.712 1.00 52.46 ? 473  ALA B CB  1 
ATOM   7777 N  N   . GLN B 1 474 ? -11.683 10.706  -35.571 1.00 53.59 ? 474  GLN B N   1 
ATOM   7778 C  CA  . GLN B 1 474 ? -12.028 11.943  -36.270 1.00 55.21 ? 474  GLN B CA  1 
ATOM   7779 C  C   . GLN B 1 474 ? -11.191 13.101  -35.707 1.00 54.33 ? 474  GLN B C   1 
ATOM   7780 O  O   . GLN B 1 474 ? -10.751 13.977  -36.446 1.00 55.52 ? 474  GLN B O   1 
ATOM   7781 C  CB  . GLN B 1 474 ? -13.529 12.237  -36.144 1.00 57.60 ? 474  GLN B CB  1 
ATOM   7782 C  CG  . GLN B 1 474 ? -14.401 11.212  -36.882 1.00 61.61 ? 474  GLN B CG  1 
ATOM   7783 C  CD  . GLN B 1 474 ? -15.911 11.498  -36.796 1.00 63.65 ? 474  GLN B CD  1 
ATOM   7784 O  OE1 . GLN B 1 474 ? -16.556 11.271  -35.756 1.00 62.81 ? 474  GLN B OE1 1 
ATOM   7785 N  NE2 . GLN B 1 474 ? -16.476 12.004  -37.901 1.00 64.29 ? 474  GLN B NE2 1 
ATOM   7786 N  N   . ARG B 1 475 ? -10.957 13.095  -34.402 1.00 52.57 ? 475  ARG B N   1 
ATOM   7787 C  CA  . ARG B 1 475 ? -10.153 14.157  -33.809 1.00 53.59 ? 475  ARG B CA  1 
ATOM   7788 C  C   . ARG B 1 475 ? -8.748  14.151  -34.421 1.00 51.84 ? 475  ARG B C   1 
ATOM   7789 O  O   . ARG B 1 475 ? -8.248  15.185  -34.890 1.00 52.37 ? 475  ARG B O   1 
ATOM   7790 C  CB  . ARG B 1 475 ? -10.016 13.967  -32.281 1.00 53.83 ? 475  ARG B CB  1 
ATOM   7791 C  CG  . ARG B 1 475 ? -11.284 14.194  -31.472 1.00 55.17 ? 475  ARG B CG  1 
ATOM   7792 C  CD  . ARG B 1 475 ? -11.043 13.959  -29.966 1.00 55.58 ? 475  ARG B CD  1 
ATOM   7793 N  NE  . ARG B 1 475 ? -9.848  14.663  -29.500 1.00 53.42 ? 475  ARG B NE  1 
ATOM   7794 C  CZ  . ARG B 1 475 ? -9.070  14.229  -28.519 1.00 52.00 ? 475  ARG B CZ  1 
ATOM   7795 N  NH1 . ARG B 1 475 ? -9.355  13.098  -27.888 1.00 50.98 ? 475  ARG B NH1 1 
ATOM   7796 N  NH2 . ARG B 1 475 ? -7.977  14.910  -28.204 1.00 53.28 ? 475  ARG B NH2 1 
ATOM   7797 N  N   . LEU B 1 476 ? -8.120  12.977  -34.400 1.00 48.95 ? 476  LEU B N   1 
ATOM   7798 C  CA  . LEU B 1 476 ? -6.766  12.812  -34.899 1.00 47.51 ? 476  LEU B CA  1 
ATOM   7799 C  C   . LEU B 1 476 ? -6.617  13.206  -36.355 1.00 48.08 ? 476  LEU B C   1 
ATOM   7800 O  O   . LEU B 1 476 ? -5.667  13.913  -36.708 1.00 48.91 ? 476  LEU B O   1 
ATOM   7801 C  CB  . LEU B 1 476 ? -6.296  11.373  -34.677 1.00 46.85 ? 476  LEU B CB  1 
ATOM   7802 C  CG  . LEU B 1 476 ? -6.264  11.010  -33.191 1.00 46.95 ? 476  LEU B CG  1 
ATOM   7803 C  CD1 . LEU B 1 476 ? -5.783  9.573   -32.959 1.00 47.88 ? 476  LEU B CD1 1 
ATOM   7804 C  CD2 . LEU B 1 476 ? -5.345  11.998  -32.503 1.00 46.60 ? 476  LEU B CD2 1 
ATOM   7805 N  N   . MET B 1 477 ? -7.553  12.762  -37.193 1.00 46.45 ? 477  MET B N   1 
ATOM   7806 C  CA  . MET B 1 477 ? -7.523  13.081  -38.608 1.00 46.36 ? 477  MET B CA  1 
ATOM   7807 C  C   . MET B 1 477 ? -7.502  14.594  -38.780 1.00 46.03 ? 477  MET B C   1 
ATOM   7808 O  O   . MET B 1 477 ? -6.836  15.118  -39.679 1.00 42.66 ? 477  MET B O   1 
ATOM   7809 C  CB  . MET B 1 477 ? -8.748  12.483  -39.311 1.00 48.89 ? 477  MET B CB  1 
ATOM   7810 C  CG  . MET B 1 477 ? -8.723  10.947  -39.455 1.00 52.50 ? 477  MET B CG  1 
ATOM   7811 S  SD  . MET B 1 477 ? -10.240 10.276  -40.251 1.00 55.92 ? 477  MET B SD  1 
ATOM   7812 C  CE  . MET B 1 477 ? -10.046 10.791  -41.879 1.00 49.29 ? 477  MET B CE  1 
ATOM   7813 N  N   . LYS B 1 478 ? -8.249  15.284  -37.915 1.00 46.02 ? 478  LYS B N   1 
ATOM   7814 C  CA  . LYS B 1 478 ? -8.322  16.757  -37.926 1.00 46.30 ? 478  LYS B CA  1 
ATOM   7815 C  C   . LYS B 1 478 ? -6.949  17.345  -37.587 1.00 42.92 ? 478  LYS B C   1 
ATOM   7816 O  O   . LYS B 1 478 ? -6.468  18.251  -38.279 1.00 41.36 ? 478  LYS B O   1 
ATOM   7817 C  CB  . LYS B 1 478 ? -9.329  17.260  -36.868 1.00 50.42 ? 478  LYS B CB  1 
ATOM   7818 C  CG  . LYS B 1 478 ? -10.684 17.693  -37.384 1.00 57.51 ? 478  LYS B CG  1 
ATOM   7819 C  CD  . LYS B 1 478 ? -10.585 18.913  -38.284 1.00 61.88 ? 478  LYS B CD  1 
ATOM   7820 C  CE  . LYS B 1 478 ? -11.968 19.279  -38.852 1.00 67.24 ? 478  LYS B CE  1 
ATOM   7821 N  NZ  . LYS B 1 478 ? -12.684 18.138  -39.553 1.00 69.67 ? 478  LYS B NZ  1 
ATOM   7822 N  N   . TYR B 1 479 ? -6.339  16.827  -36.514 1.00 40.45 ? 479  TYR B N   1 
ATOM   7823 C  CA  . TYR B 1 479 ? -5.036  17.302  -36.076 1.00 41.55 ? 479  TYR B CA  1 
ATOM   7824 C  C   . TYR B 1 479 ? -4.028  17.200  -37.204 1.00 42.79 ? 479  TYR B C   1 
ATOM   7825 O  O   . TYR B 1 479 ? -3.366  18.198  -37.568 1.00 41.77 ? 479  TYR B O   1 
ATOM   7826 C  CB  . TYR B 1 479 ? -4.491  16.491  -34.915 1.00 41.54 ? 479  TYR B CB  1 
ATOM   7827 C  CG  . TYR B 1 479 ? -5.173  16.697  -33.592 1.00 43.98 ? 479  TYR B CG  1 
ATOM   7828 C  CD1 . TYR B 1 479 ? -5.702  17.944  -33.224 1.00 45.27 ? 479  TYR B CD1 1 
ATOM   7829 C  CD2 . TYR B 1 479 ? -5.278  15.645  -32.689 1.00 42.80 ? 479  TYR B CD2 1 
ATOM   7830 C  CE1 . TYR B 1 479 ? -6.331  18.121  -31.971 1.00 45.23 ? 479  TYR B CE1 1 
ATOM   7831 C  CE2 . TYR B 1 479 ? -5.895  15.808  -31.460 1.00 45.42 ? 479  TYR B CE2 1 
ATOM   7832 C  CZ  . TYR B 1 479 ? -6.423  17.047  -31.104 1.00 45.71 ? 479  TYR B CZ  1 
ATOM   7833 O  OH  . TYR B 1 479 ? -7.045  17.158  -29.880 1.00 48.11 ? 479  TYR B OH  1 
ATOM   7834 N  N   . TRP B 1 480 ? -3.924  15.991  -37.767 1.00 42.12 ? 480  TRP B N   1 
ATOM   7835 C  CA  . TRP B 1 480 ? -2.969  15.752  -38.848 1.00 42.11 ? 480  TRP B CA  1 
ATOM   7836 C  C   . TRP B 1 480 ? -3.210  16.607  -40.079 1.00 42.01 ? 480  TRP B C   1 
ATOM   7837 O  O   . TRP B 1 480 ? -2.273  17.207  -40.621 1.00 41.95 ? 480  TRP B O   1 
ATOM   7838 C  CB  . TRP B 1 480 ? -2.953  14.266  -39.233 1.00 42.36 ? 480  TRP B CB  1 
ATOM   7839 C  CG  . TRP B 1 480 ? -1.854  13.459  -38.577 1.00 40.41 ? 480  TRP B CG  1 
ATOM   7840 C  CD1 . TRP B 1 480 ? -0.887  12.744  -39.220 1.00 41.28 ? 480  TRP B CD1 1 
ATOM   7841 C  CD2 . TRP B 1 480 ? -1.629  13.258  -37.167 1.00 40.77 ? 480  TRP B CD2 1 
ATOM   7842 N  NE1 . TRP B 1 480 ? -0.072  12.108  -38.311 1.00 40.69 ? 480  TRP B NE1 1 
ATOM   7843 C  CE2 . TRP B 1 480 ? -0.502  12.404  -37.042 1.00 40.61 ? 480  TRP B CE2 1 
ATOM   7844 C  CE3 . TRP B 1 480 ? -2.262  13.720  -35.999 1.00 41.77 ? 480  TRP B CE3 1 
ATOM   7845 C  CZ2 . TRP B 1 480 ? 0.007   11.995  -35.790 1.00 38.86 ? 480  TRP B CZ2 1 
ATOM   7846 C  CZ3 . TRP B 1 480 ? -1.761  13.319  -34.759 1.00 39.48 ? 480  TRP B CZ3 1 
ATOM   7847 C  CH2 . TRP B 1 480 ? -0.631  12.458  -34.666 1.00 41.78 ? 480  TRP B CH2 1 
ATOM   7848 N  N   . THR B 1 481 ? -4.463  16.692  -40.518 1.00 42.65 ? 481  THR B N   1 
ATOM   7849 C  CA  . THR B 1 481 ? -4.768  17.466  -41.708 1.00 43.98 ? 481  THR B CA  1 
ATOM   7850 C  C   . THR B 1 481 ? -4.677  18.961  -41.417 1.00 43.68 ? 481  THR B C   1 
ATOM   7851 O  O   . THR B 1 481 ? -4.305  19.743  -42.293 1.00 43.49 ? 481  THR B O   1 
ATOM   7852 C  CB  . THR B 1 481 ? -6.151  17.058  -42.289 1.00 46.03 ? 481  THR B CB  1 
ATOM   7853 O  OG1 . THR B 1 481 ? -7.122  17.023  -41.240 1.00 47.94 ? 481  THR B OG1 1 
ATOM   7854 C  CG2 . THR B 1 481 ? -6.082  15.658  -42.901 1.00 45.93 ? 481  THR B CG2 1 
ATOM   7855 N  N   . ASN B 1 482 ? -4.990  19.374  -40.187 1.00 45.55 ? 482  ASN B N   1 
ATOM   7856 C  CA  . ASN B 1 482 ? -4.846  20.800  -39.854 1.00 45.54 ? 482  ASN B CA  1 
ATOM   7857 C  C   . ASN B 1 482 ? -3.367  21.120  -39.948 1.00 42.33 ? 482  ASN B C   1 
ATOM   7858 O  O   . ASN B 1 482 ? -2.961  22.129  -40.549 1.00 41.16 ? 482  ASN B O   1 
ATOM   7859 C  CB  . ASN B 1 482 ? -5.338  21.111  -38.441 1.00 49.63 ? 482  ASN B CB  1 
ATOM   7860 C  CG  . ASN B 1 482 ? -6.836  21.342  -38.393 1.00 52.91 ? 482  ASN B CG  1 
ATOM   7861 O  OD1 . ASN B 1 482 ? -7.420  21.872  -39.345 1.00 54.54 ? 482  ASN B OD1 1 
ATOM   7862 N  ND2 . ASN B 1 482 ? -7.464  20.966  -37.275 1.00 56.12 ? 482  ASN B ND2 1 
ATOM   7863 N  N   . PHE B 1 483 ? -2.564  20.237  -39.366 1.00 39.79 ? 483  PHE B N   1 
ATOM   7864 C  CA  . PHE B 1 483 ? -1.125  20.414  -39.412 1.00 41.50 ? 483  PHE B CA  1 
ATOM   7865 C  C   . PHE B 1 483 ? -0.627  20.457  -40.866 1.00 42.91 ? 483  PHE B C   1 
ATOM   7866 O  O   . PHE B 1 483 ? 0.247   21.264  -41.216 1.00 42.96 ? 483  PHE B O   1 
ATOM   7867 C  CB  . PHE B 1 483 ? -0.397  19.295  -38.671 1.00 39.58 ? 483  PHE B CB  1 
ATOM   7868 C  CG  . PHE B 1 483 ? 1.096   19.419  -38.750 1.00 41.14 ? 483  PHE B CG  1 
ATOM   7869 C  CD1 . PHE B 1 483 ? 1.776   20.379  -37.981 1.00 41.31 ? 483  PHE B CD1 1 
ATOM   7870 C  CD2 . PHE B 1 483 ? 1.826   18.623  -39.621 1.00 40.09 ? 483  PHE B CD2 1 
ATOM   7871 C  CE1 . PHE B 1 483 ? 3.164   20.533  -38.086 1.00 40.00 ? 483  PHE B CE1 1 
ATOM   7872 C  CE2 . PHE B 1 483 ? 3.216   18.764  -39.734 1.00 40.67 ? 483  PHE B CE2 1 
ATOM   7873 C  CZ  . PHE B 1 483 ? 3.886   19.722  -38.963 1.00 41.03 ? 483  PHE B CZ  1 
ATOM   7874 N  N   . ALA B 1 484 ? -1.189  19.605  -41.722 1.00 42.65 ? 484  ALA B N   1 
ATOM   7875 C  CA  . ALA B 1 484 ? -0.756  19.590  -43.120 1.00 43.34 ? 484  ALA B CA  1 
ATOM   7876 C  C   . ALA B 1 484 ? -1.163  20.884  -43.821 1.00 43.70 ? 484  ALA B C   1 
ATOM   7877 O  O   . ALA B 1 484 ? -0.421  21.441  -44.644 1.00 41.29 ? 484  ALA B O   1 
ATOM   7878 C  CB  . ALA B 1 484 ? -1.357  18.372  -43.853 1.00 41.14 ? 484  ALA B CB  1 
ATOM   7879 N  N   . ARG B 1 485 ? -2.355  21.359  -43.495 1.00 45.78 ? 485  ARG B N   1 
ATOM   7880 C  CA  . ARG B 1 485 ? -2.865  22.583  -44.097 1.00 50.32 ? 485  ARG B CA  1 
ATOM   7881 C  C   . ARG B 1 485 ? -2.119  23.839  -43.658 1.00 50.73 ? 485  ARG B C   1 
ATOM   7882 O  O   . ARG B 1 485 ? -1.802  24.695  -44.476 1.00 51.27 ? 485  ARG B O   1 
ATOM   7883 C  CB  . ARG B 1 485 ? -4.334  22.793  -43.715 1.00 53.42 ? 485  ARG B CB  1 
ATOM   7884 C  CG  . ARG B 1 485 ? -5.396  22.272  -44.658 1.00 60.60 ? 485  ARG B CG  1 
ATOM   7885 C  CD  . ARG B 1 485 ? -6.794  22.658  -44.131 1.00 63.37 ? 485  ARG B CD  1 
ATOM   7886 N  NE  . ARG B 1 485 ? -7.187  21.879  -42.945 1.00 66.01 ? 485  ARG B NE  1 
ATOM   7887 C  CZ  . ARG B 1 485 ? -7.798  20.690  -42.985 1.00 68.56 ? 485  ARG B CZ  1 
ATOM   7888 N  NH1 . ARG B 1 485 ? -8.094  20.135  -44.164 1.00 68.52 ? 485  ARG B NH1 1 
ATOM   7889 N  NH2 . ARG B 1 485 ? -8.115  20.049  -41.847 1.00 67.55 ? 485  ARG B NH2 1 
ATOM   7890 N  N   . THR B 1 486 ? -1.820  23.930  -42.368 1.00 50.72 ? 486  THR B N   1 
ATOM   7891 C  CA  . THR B 1 486 ? -1.236  25.150  -41.825 1.00 52.41 ? 486  THR B CA  1 
ATOM   7892 C  C   . THR B 1 486 ? 0.068   25.062  -41.047 1.00 53.08 ? 486  THR B C   1 
ATOM   7893 O  O   . THR B 1 486 ? 0.664   26.090  -40.717 1.00 53.25 ? 486  THR B O   1 
ATOM   7894 C  CB  . THR B 1 486 ? -2.242  25.788  -40.880 1.00 52.29 ? 486  THR B CB  1 
ATOM   7895 O  OG1 . THR B 1 486 ? -2.417  24.925  -39.740 1.00 52.68 ? 486  THR B OG1 1 
ATOM   7896 C  CG2 . THR B 1 486 ? -3.589  25.954  -41.571 1.00 50.31 ? 486  THR B CG2 1 
ATOM   7897 N  N   . GLY B 1 487 ? 0.504   23.851  -40.728 1.00 52.79 ? 487  GLY B N   1 
ATOM   7898 C  CA  . GLY B 1 487 ? 1.719   23.707  -39.948 1.00 52.05 ? 487  GLY B CA  1 
ATOM   7899 C  C   . GLY B 1 487 ? 1.382   23.824  -38.473 1.00 51.89 ? 487  GLY B C   1 
ATOM   7900 O  O   . GLY B 1 487 ? 2.269   23.922  -37.632 1.00 52.33 ? 487  GLY B O   1 
ATOM   7901 N  N   . ASP B 1 488 ? 0.086   23.799  -38.163 1.00 51.95 ? 488  ASP B N   1 
ATOM   7902 C  CA  . ASP B 1 488 ? -0.408  23.921  -36.785 1.00 51.45 ? 488  ASP B CA  1 
ATOM   7903 C  C   . ASP B 1 488 ? -1.581  22.942  -36.651 1.00 49.17 ? 488  ASP B C   1 
ATOM   7904 O  O   . ASP B 1 488 ? -2.576  23.064  -37.358 1.00 49.57 ? 488  ASP B O   1 
ATOM   7905 C  CB  . ASP B 1 488 ? -0.873  25.371  -36.557 1.00 51.75 ? 488  ASP B CB  1 
ATOM   7906 C  CG  . ASP B 1 488 ? -1.320  25.645  -35.125 1.00 52.92 ? 488  ASP B CG  1 
ATOM   7907 O  OD1 . ASP B 1 488 ? -1.696  24.698  -34.397 1.00 51.38 ? 488  ASP B OD1 1 
ATOM   7908 O  OD2 . ASP B 1 488 ? -1.305  26.836  -34.737 1.00 55.86 ? 488  ASP B OD2 1 
ATOM   7909 N  N   . PRO B 1 489 ? -1.481  21.967  -35.744 1.00 48.69 ? 489  PRO B N   1 
ATOM   7910 C  CA  . PRO B 1 489 ? -2.549  20.975  -35.546 1.00 50.14 ? 489  PRO B CA  1 
ATOM   7911 C  C   . PRO B 1 489 ? -3.860  21.490  -34.955 1.00 54.29 ? 489  PRO B C   1 
ATOM   7912 O  O   . PRO B 1 489 ? -4.890  20.823  -35.046 1.00 56.49 ? 489  PRO B O   1 
ATOM   7913 C  CB  . PRO B 1 489 ? -1.894  19.924  -34.651 1.00 48.52 ? 489  PRO B CB  1 
ATOM   7914 C  CG  . PRO B 1 489 ? -0.969  20.731  -33.792 1.00 47.77 ? 489  PRO B CG  1 
ATOM   7915 C  CD  . PRO B 1 489 ? -0.378  21.769  -34.781 1.00 48.40 ? 489  PRO B CD  1 
ATOM   7916 N  N   . ASN B 1 490 ? -3.829  22.673  -34.356 1.00 57.16 ? 490  ASN B N   1 
ATOM   7917 C  CA  . ASN B 1 490 ? -5.020  23.247  -33.741 1.00 60.77 ? 490  ASN B CA  1 
ATOM   7918 C  C   . ASN B 1 490 ? -6.043  23.710  -34.768 1.00 64.51 ? 490  ASN B C   1 
ATOM   7919 O  O   . ASN B 1 490 ? -5.683  24.190  -35.852 1.00 64.33 ? 490  ASN B O   1 
ATOM   7920 C  CB  . ASN B 1 490 ? -4.634  24.422  -32.833 1.00 56.38 ? 490  ASN B CB  1 
ATOM   7921 C  CG  . ASN B 1 490 ? -3.806  23.997  -31.653 1.00 53.01 ? 490  ASN B CG  1 
ATOM   7922 O  OD1 . ASN B 1 490 ? -4.314  23.454  -30.688 1.00 53.89 ? 490  ASN B OD1 1 
ATOM   7923 N  ND2 . ASN B 1 490 ? -2.514  24.238  -31.729 1.00 53.15 ? 490  ASN B ND2 1 
ATOM   7924 N  N   . ASP B 1 491 ? -7.317  23.575  -34.399 1.00 71.01 ? 491  ASP B N   1 
ATOM   7925 C  CA  . ASP B 1 491 ? -8.439  23.969  -35.256 1.00 77.36 ? 491  ASP B CA  1 
ATOM   7926 C  C   . ASP B 1 491 ? -8.602  25.495  -35.233 1.00 79.99 ? 491  ASP B C   1 
ATOM   7927 O  O   . ASP B 1 491 ? -9.082  26.067  -34.237 1.00 80.70 ? 491  ASP B O   1 
ATOM   7928 C  CB  . ASP B 1 491 ? -9.733  23.286  -34.780 1.00 80.12 ? 491  ASP B CB  1 
ATOM   7929 C  CG  . ASP B 1 491 ? -10.727 23.054  -35.917 1.00 83.70 ? 491  ASP B CG  1 
ATOM   7930 O  OD1 . ASP B 1 491 ? -10.836 23.931  -36.808 1.00 85.58 ? 491  ASP B OD1 1 
ATOM   7931 O  OD2 . ASP B 1 491 ? -11.409 22.000  -35.921 1.00 85.09 ? 491  ASP B OD2 1 
ATOM   7932 N  N   . PRO B 1 492 ? -8.219  26.153  -36.353 1.00 82.93 ? 492  PRO B N   1 
ATOM   7933 C  CA  . PRO B 1 492 ? -8.217  27.589  -36.683 1.00 85.85 ? 492  PRO B CA  1 
ATOM   7934 C  C   . PRO B 1 492 ? -9.470  28.303  -36.242 1.00 88.36 ? 492  PRO B C   1 
ATOM   7935 O  O   . PRO B 1 492 ? -9.442  29.475  -35.854 1.00 88.30 ? 492  PRO B O   1 
ATOM   7936 C  CB  . PRO B 1 492 ? -8.091  27.607  -38.207 1.00 86.06 ? 492  PRO B CB  1 
ATOM   7937 C  CG  . PRO B 1 492 ? -7.361  26.352  -38.503 1.00 86.00 ? 492  PRO B CG  1 
ATOM   7938 C  CD  . PRO B 1 492 ? -8.047  25.368  -37.591 1.00 84.78 ? 492  PRO B CD  1 
ATOM   7939 N  N   . ARG B 1 493 ? -10.578 27.584  -36.339 1.00 90.71 ? 493  ARG B N   1 
ATOM   7940 C  CA  . ARG B 1 493 ? -11.866 28.118  -35.962 1.00 92.76 ? 493  ARG B CA  1 
ATOM   7941 C  C   . ARG B 1 493 ? -12.540 27.038  -35.122 1.00 93.81 ? 493  ARG B C   1 
ATOM   7942 O  O   . ARG B 1 493 ? -12.893 25.950  -35.585 1.00 94.20 ? 493  ARG B O   1 
ATOM   7943 C  CB  . ARG B 1 493 ? -12.656 28.493  -37.225 1.00 93.67 ? 493  ARG B CB  1 
ATOM   7944 C  CG  . ARG B 1 493 ? -11.762 29.187  -38.288 1.00 94.74 ? 493  ARG B CG  1 
ATOM   7945 C  CD  . ARG B 1 493 ? -12.551 29.929  -39.357 1.00 95.30 ? 493  ARG B CD  1 
ATOM   7946 N  NE  . ARG B 1 493 ? -12.479 31.390  -39.221 1.00 95.63 ? 493  ARG B NE  1 
ATOM   7947 C  CZ  . ARG B 1 493 ? -12.637 32.058  -38.076 1.00 95.93 ? 493  ARG B CZ  1 
ATOM   7948 N  NH1 . ARG B 1 493 ? -12.864 31.408  -36.942 1.00 96.77 ? 493  ARG B NH1 1 
ATOM   7949 N  NH2 . ARG B 1 493 ? -12.608 33.386  -38.063 1.00 95.68 ? 493  ARG B NH2 1 
ATOM   7950 N  N   . ASP B 1 494 ? -12.640 27.382  -33.851 1.00 94.60 ? 494  ASP B N   1 
ATOM   7951 C  CA  . ASP B 1 494 ? -13.197 26.599  -32.761 1.00 95.09 ? 494  ASP B CA  1 
ATOM   7952 C  C   . ASP B 1 494 ? -12.487 27.440  -31.716 1.00 95.94 ? 494  ASP B C   1 
ATOM   7953 O  O   . ASP B 1 494 ? -11.245 27.488  -31.694 1.00 95.69 ? 494  ASP B O   1 
ATOM   7954 C  CB  . ASP B 1 494 ? -12.648 25.170  -32.712 1.00 93.83 ? 494  ASP B CB  1 
ATOM   7955 C  CG  . ASP B 1 494 ? -12.863 24.515  -31.346 1.00 93.71 ? 494  ASP B CG  1 
ATOM   7956 O  OD1 . ASP B 1 494 ? -14.020 24.173  -31.014 1.00 93.35 ? 494  ASP B OD1 1 
ATOM   7957 O  OD2 . ASP B 1 494 ? -11.878 24.363  -30.589 1.00 92.92 ? 494  ASP B OD2 1 
ATOM   7958 N  N   . SER B 1 495 ? -13.258 28.117  -30.872 1.00 95.98 ? 495  SER B N   1 
ATOM   7959 C  CA  . SER B 1 495 ? -12.664 29.001  -29.888 1.00 95.07 ? 495  SER B CA  1 
ATOM   7960 C  C   . SER B 1 495 ? -12.450 28.523  -28.448 1.00 94.36 ? 495  SER B C   1 
ATOM   7961 O  O   . SER B 1 495 ? -12.369 29.344  -27.539 1.00 94.04 ? 495  SER B O   1 
ATOM   7962 C  CB  . SER B 1 495 ? -13.420 30.305  -29.899 1.00 95.76 ? 495  SER B CB  1 
ATOM   7963 N  N   . LYS B 1 496 ? -12.367 27.216  -28.231 1.00 93.58 ? 496  LYS B N   1 
ATOM   7964 C  CA  . LYS B 1 496 ? -12.077 26.698  -26.897 1.00 93.63 ? 496  LYS B CA  1 
ATOM   7965 C  C   . LYS B 1 496 ? -11.818 25.225  -27.032 1.00 93.97 ? 496  LYS B C   1 
ATOM   7966 O  O   . LYS B 1 496 ? -12.759 24.417  -27.039 1.00 94.59 ? 496  LYS B O   1 
ATOM   7967 C  CB  . LYS B 1 496 ? -13.211 26.941  -25.908 1.00 94.23 ? 496  LYS B CB  1 
ATOM   7968 C  CG  . LYS B 1 496 ? -12.709 27.597  -24.611 1.00 93.99 ? 496  LYS B CG  1 
ATOM   7969 C  CD  . LYS B 1 496 ? -13.686 27.431  -23.473 1.00 93.13 ? 496  LYS B CD  1 
ATOM   7970 C  CE  . LYS B 1 496 ? -13.706 25.986  -23.013 1.00 93.04 ? 496  LYS B CE  1 
ATOM   7971 N  NZ  . LYS B 1 496 ? -14.626 25.777  -21.862 1.00 92.20 ? 496  LYS B NZ  1 
ATOM   7972 N  N   . SER B 1 497 ? -10.524 24.894  -27.112 1.00 92.69 ? 497  SER B N   1 
ATOM   7973 C  CA  . SER B 1 497 ? -10.045 23.521  -27.324 1.00 89.86 ? 497  SER B CA  1 
ATOM   7974 C  C   . SER B 1 497 ? -9.959  22.475  -26.184 1.00 85.67 ? 497  SER B C   1 
ATOM   7975 O  O   . SER B 1 497 ? -10.862 21.629  -26.080 1.00 86.14 ? 497  SER B O   1 
ATOM   7976 C  CB  . SER B 1 497 ? -8.728  23.603  -28.088 1.00 92.27 ? 497  SER B CB  1 
ATOM   7977 O  OG  . SER B 1 497 ? -8.906  24.360  -29.282 1.00 96.04 ? 497  SER B OG  1 
ATOM   7978 N  N   . PRO B 1 498 ? -8.902  22.486  -25.326 1.00 80.89 ? 498  PRO B N   1 
ATOM   7979 C  CA  . PRO B 1 498 ? -7.692  23.282  -25.092 1.00 76.25 ? 498  PRO B CA  1 
ATOM   7980 C  C   . PRO B 1 498 ? -6.675  23.218  -26.212 1.00 72.62 ? 498  PRO B C   1 
ATOM   7981 O  O   . PRO B 1 498 ? -6.630  22.254  -26.970 1.00 72.78 ? 498  PRO B O   1 
ATOM   7982 C  CB  . PRO B 1 498 ? -7.145  22.700  -23.795 1.00 76.00 ? 498  PRO B CB  1 
ATOM   7983 C  CG  . PRO B 1 498 ? -7.461  21.278  -23.937 1.00 76.91 ? 498  PRO B CG  1 
ATOM   7984 C  CD  . PRO B 1 498 ? -8.892  21.318  -24.422 1.00 79.21 ? 498  PRO B CD  1 
ATOM   7985 N  N   . GLN B 1 499 ? -5.858  24.260  -26.300 1.00 67.96 ? 499  GLN B N   1 
ATOM   7986 C  CA  . GLN B 1 499 ? -4.856  24.374  -27.344 1.00 63.34 ? 499  GLN B CA  1 
ATOM   7987 C  C   . GLN B 1 499 ? -3.655  23.454  -27.170 1.00 58.58 ? 499  GLN B C   1 
ATOM   7988 O  O   . GLN B 1 499 ? -3.235  23.173  -26.060 1.00 57.56 ? 499  GLN B O   1 
ATOM   7989 C  CB  . GLN B 1 499 ? -4.350  25.824  -27.432 1.00 65.29 ? 499  GLN B CB  1 
ATOM   7990 C  CG  . GLN B 1 499 ? -5.389  26.861  -27.786 1.00 66.19 ? 499  GLN B CG  1 
ATOM   7991 C  CD  . GLN B 1 499 ? -5.989  26.663  -29.163 1.00 69.98 ? 499  GLN B CD  1 
ATOM   7992 O  OE1 . GLN B 1 499 ? -5.324  26.868  -30.185 1.00 72.52 ? 499  GLN B OE1 1 
ATOM   7993 N  NE2 . GLN B 1 499 ? -7.260  26.272  -29.203 1.00 71.07 ? 499  GLN B NE2 1 
ATOM   7994 N  N   . TRP B 1 500 ? -3.112  23.003  -28.297 1.00 54.19 ? 500  TRP B N   1 
ATOM   7995 C  CA  . TRP B 1 500 ? -1.919  22.151  -28.330 1.00 50.70 ? 500  TRP B CA  1 
ATOM   7996 C  C   . TRP B 1 500 ? -0.747  23.149  -28.486 1.00 47.35 ? 500  TRP B C   1 
ATOM   7997 O  O   . TRP B 1 500 ? -0.579  23.745  -29.545 1.00 45.65 ? 500  TRP B O   1 
ATOM   7998 C  CB  . TRP B 1 500 ? -1.984  21.229  -29.563 1.00 49.67 ? 500  TRP B CB  1 
ATOM   7999 C  CG  . TRP B 1 500 ? -0.877  20.216  -29.665 1.00 50.16 ? 500  TRP B CG  1 
ATOM   8000 C  CD1 . TRP B 1 500 ? 0.370   20.299  -29.113 1.00 50.12 ? 500  TRP B CD1 1 
ATOM   8001 C  CD2 . TRP B 1 500 ? -0.905  18.982  -30.402 1.00 50.77 ? 500  TRP B CD2 1 
ATOM   8002 N  NE1 . TRP B 1 500 ? 1.116   19.199  -29.454 1.00 49.88 ? 500  TRP B NE1 1 
ATOM   8003 C  CE2 . TRP B 1 500 ? 0.361   18.375  -30.247 1.00 50.47 ? 500  TRP B CE2 1 
ATOM   8004 C  CE3 . TRP B 1 500 ? -1.878  18.327  -31.178 1.00 50.28 ? 500  TRP B CE3 1 
ATOM   8005 C  CZ2 . TRP B 1 500 ? 0.679   17.147  -30.838 1.00 50.01 ? 500  TRP B CZ2 1 
ATOM   8006 C  CZ3 . TRP B 1 500 ? -1.557  17.103  -31.760 1.00 49.44 ? 500  TRP B CZ3 1 
ATOM   8007 C  CH2 . TRP B 1 500 ? -0.292  16.530  -31.586 1.00 48.51 ? 500  TRP B CH2 1 
ATOM   8008 N  N   . PRO B 1 501 ? 0.050   23.361  -27.426 1.00 45.36 ? 501  PRO B N   1 
ATOM   8009 C  CA  . PRO B 1 501 ? 1.173   24.303  -27.544 1.00 44.88 ? 501  PRO B CA  1 
ATOM   8010 C  C   . PRO B 1 501 ? 2.419   23.725  -28.238 1.00 45.19 ? 501  PRO B C   1 
ATOM   8011 O  O   . PRO B 1 501 ? 2.707   22.518  -28.152 1.00 43.72 ? 501  PRO B O   1 
ATOM   8012 C  CB  . PRO B 1 501 ? 1.482   24.665  -26.086 1.00 42.38 ? 501  PRO B CB  1 
ATOM   8013 C  CG  . PRO B 1 501 ? 1.235   23.362  -25.380 1.00 44.07 ? 501  PRO B CG  1 
ATOM   8014 C  CD  . PRO B 1 501 ? -0.062  22.851  -26.043 1.00 42.88 ? 501  PRO B CD  1 
ATOM   8015 N  N   . PRO B 1 502 ? 3.181   24.591  -28.920 1.00 44.12 ? 502  PRO B N   1 
ATOM   8016 C  CA  . PRO B 1 502 ? 4.401   24.177  -29.612 1.00 43.76 ? 502  PRO B CA  1 
ATOM   8017 C  C   . PRO B 1 502 ? 5.356   23.645  -28.561 1.00 43.68 ? 502  PRO B C   1 
ATOM   8018 O  O   . PRO B 1 502 ? 5.272   24.024  -27.393 1.00 44.55 ? 502  PRO B O   1 
ATOM   8019 C  CB  . PRO B 1 502 ? 4.916   25.483  -30.217 1.00 43.22 ? 502  PRO B CB  1 
ATOM   8020 C  CG  . PRO B 1 502 ? 3.663   26.256  -30.478 1.00 44.43 ? 502  PRO B CG  1 
ATOM   8021 C  CD  . PRO B 1 502 ? 2.884   26.006  -29.189 1.00 43.03 ? 502  PRO B CD  1 
ATOM   8022 N  N   . TYR B 1 503 ? 6.248   22.754  -28.970 1.00 43.09 ? 503  TYR B N   1 
ATOM   8023 C  CA  . TYR B 1 503 ? 7.226   22.178  -28.067 1.00 42.50 ? 503  TYR B CA  1 
ATOM   8024 C  C   . TYR B 1 503 ? 8.454   23.081  -28.109 1.00 44.18 ? 503  TYR B C   1 
ATOM   8025 O  O   . TYR B 1 503 ? 8.897   23.457  -29.199 1.00 43.84 ? 503  TYR B O   1 
ATOM   8026 C  CB  . TYR B 1 503 ? 7.597   20.782  -28.543 1.00 41.04 ? 503  TYR B CB  1 
ATOM   8027 C  CG  . TYR B 1 503 ? 8.707   20.134  -27.763 1.00 39.72 ? 503  TYR B CG  1 
ATOM   8028 C  CD1 . TYR B 1 503 ? 10.047  20.385  -28.065 1.00 38.63 ? 503  TYR B CD1 1 
ATOM   8029 C  CD2 . TYR B 1 503 ? 8.412   19.275  -26.692 1.00 38.94 ? 503  TYR B CD2 1 
ATOM   8030 C  CE1 . TYR B 1 503 ? 11.073  19.790  -27.306 1.00 40.38 ? 503  TYR B CE1 1 
ATOM   8031 C  CE2 . TYR B 1 503 ? 9.414   18.682  -25.940 1.00 38.69 ? 503  TYR B CE2 1 
ATOM   8032 C  CZ  . TYR B 1 503 ? 10.742  18.942  -26.245 1.00 40.37 ? 503  TYR B CZ  1 
ATOM   8033 O  OH  . TYR B 1 503 ? 11.727  18.335  -25.480 1.00 43.97 ? 503  TYR B OH  1 
ATOM   8034 N  N   . THR B 1 504 ? 9.003   23.413  -26.942 1.00 43.31 ? 504  THR B N   1 
ATOM   8035 C  CA  . THR B 1 504 ? 10.177  24.293  -26.867 1.00 44.70 ? 504  THR B CA  1 
ATOM   8036 C  C   . THR B 1 504 ? 11.172  23.727  -25.888 1.00 45.44 ? 504  THR B C   1 
ATOM   8037 O  O   . THR B 1 504 ? 10.813  22.898  -25.066 1.00 45.52 ? 504  THR B O   1 
ATOM   8038 C  CB  . THR B 1 504 ? 9.799   25.703  -26.383 1.00 42.94 ? 504  THR B CB  1 
ATOM   8039 O  OG1 . THR B 1 504 ? 9.212   25.596  -25.084 1.00 40.36 ? 504  THR B OG1 1 
ATOM   8040 C  CG2 . THR B 1 504 ? 8.790   26.366  -27.358 1.00 42.66 ? 504  THR B CG2 1 
ATOM   8041 N  N   . THR B 1 505 ? 12.429  24.149  -25.989 1.00 48.52 ? 505  THR B N   1 
ATOM   8042 C  CA  . THR B 1 505 ? 13.449  23.653  -25.061 1.00 50.52 ? 505  THR B CA  1 
ATOM   8043 C  C   . THR B 1 505 ? 13.180  24.170  -23.644 1.00 51.14 ? 505  THR B C   1 
ATOM   8044 O  O   . THR B 1 505 ? 13.452  23.475  -22.672 1.00 50.50 ? 505  THR B O   1 
ATOM   8045 C  CB  . THR B 1 505 ? 14.880  24.051  -25.514 1.00 51.51 ? 505  THR B CB  1 
ATOM   8046 O  OG1 . THR B 1 505 ? 14.926  25.449  -25.823 1.00 52.94 ? 505  THR B OG1 1 
ATOM   8047 C  CG2 . THR B 1 505 ? 15.278  23.260  -26.753 1.00 51.16 ? 505  THR B CG2 1 
ATOM   8048 N  N   . ALA B 1 506 ? 12.593  25.364  -23.548 1.00 51.61 ? 506  ALA B N   1 
ATOM   8049 C  CA  . ALA B 1 506 ? 12.265  25.970  -22.263 1.00 52.21 ? 506  ALA B CA  1 
ATOM   8050 C  C   . ALA B 1 506 ? 11.165  25.214  -21.517 1.00 53.01 ? 506  ALA B C   1 
ATOM   8051 O  O   . ALA B 1 506 ? 11.413  24.647  -20.453 1.00 54.28 ? 506  ALA B O   1 
ATOM   8052 C  CB  . ALA B 1 506 ? 11.833  27.406  -22.477 1.00 52.80 ? 506  ALA B CB  1 
ATOM   8053 N  N   . ALA B 1 507 ? 9.957   25.199  -22.085 1.00 51.87 ? 507  ALA B N   1 
ATOM   8054 C  CA  . ALA B 1 507 ? 8.813   24.554  -21.446 1.00 49.63 ? 507  ALA B CA  1 
ATOM   8055 C  C   . ALA B 1 507 ? 8.649   23.062  -21.726 1.00 49.09 ? 507  ALA B C   1 
ATOM   8056 O  O   . ALA B 1 507 ? 8.020   22.370  -20.951 1.00 49.01 ? 507  ALA B O   1 
ATOM   8057 C  CB  . ALA B 1 507 ? 7.542   25.288  -21.830 1.00 49.68 ? 507  ALA B CB  1 
ATOM   8058 N  N   . GLN B 1 508 ? 9.203   22.575  -22.837 1.00 49.59 ? 508  GLN B N   1 
ATOM   8059 C  CA  . GLN B 1 508 ? 9.115   21.150  -23.228 1.00 47.26 ? 508  GLN B CA  1 
ATOM   8060 C  C   . GLN B 1 508 ? 7.692   20.593  -23.153 1.00 46.03 ? 508  GLN B C   1 
ATOM   8061 O  O   . GLN B 1 508 ? 7.462   19.505  -22.650 1.00 45.70 ? 508  GLN B O   1 
ATOM   8062 C  CB  . GLN B 1 508 ? 10.030  20.309  -22.350 1.00 46.53 ? 508  GLN B CB  1 
ATOM   8063 C  CG  . GLN B 1 508 ? 11.438  20.809  -22.319 1.00 50.48 ? 508  GLN B CG  1 
ATOM   8064 C  CD  . GLN B 1 508 ? 12.304  19.987  -21.397 1.00 54.36 ? 508  GLN B CD  1 
ATOM   8065 O  OE1 . GLN B 1 508 ? 12.373  18.762  -21.521 1.00 55.43 ? 508  GLN B OE1 1 
ATOM   8066 N  NE2 . GLN B 1 508 ? 12.973  20.653  -20.458 1.00 54.50 ? 508  GLN B NE2 1 
ATOM   8067 N  N   . GLN B 1 509 ? 6.735   21.350  -23.663 1.00 44.47 ? 509  GLN B N   1 
ATOM   8068 C  CA  . GLN B 1 509 ? 5.355   20.930  -23.637 1.00 43.74 ? 509  GLN B CA  1 
ATOM   8069 C  C   . GLN B 1 509 ? 4.947   19.986  -24.776 1.00 44.53 ? 509  GLN B C   1 
ATOM   8070 O  O   . GLN B 1 509 ? 5.291   20.203  -25.954 1.00 41.51 ? 509  GLN B O   1 
ATOM   8071 C  CB  . GLN B 1 509 ? 4.459   22.160  -23.690 1.00 43.17 ? 509  GLN B CB  1 
ATOM   8072 C  CG  . GLN B 1 509 ? 4.608   23.080  -22.508 1.00 46.58 ? 509  GLN B CG  1 
ATOM   8073 C  CD  . GLN B 1 509 ? 3.751   24.319  -22.659 1.00 45.86 ? 509  GLN B CD  1 
ATOM   8074 O  OE1 . GLN B 1 509 ? 4.044   25.208  -23.465 1.00 47.14 ? 509  GLN B OE1 1 
ATOM   8075 N  NE2 . GLN B 1 509 ? 2.671   24.371  -21.903 1.00 46.07 ? 509  GLN B NE2 1 
ATOM   8076 N  N   . TYR B 1 510 ? 4.175   18.967  -24.413 1.00 43.54 ? 510  TYR B N   1 
ATOM   8077 C  CA  . TYR B 1 510 ? 3.654   18.008  -25.369 1.00 44.80 ? 510  TYR B CA  1 
ATOM   8078 C  C   . TYR B 1 510 ? 2.268   17.598  -24.869 1.00 45.36 ? 510  TYR B C   1 
ATOM   8079 O  O   . TYR B 1 510 ? 1.952   17.815  -23.694 1.00 45.99 ? 510  TYR B O   1 
ATOM   8080 C  CB  . TYR B 1 510 ? 4.575   16.801  -25.469 1.00 42.99 ? 510  TYR B CB  1 
ATOM   8081 C  CG  . TYR B 1 510 ? 4.649   16.002  -24.200 1.00 43.74 ? 510  TYR B CG  1 
ATOM   8082 C  CD1 . TYR B 1 510 ? 5.463   16.413  -23.138 1.00 43.56 ? 510  TYR B CD1 1 
ATOM   8083 C  CD2 . TYR B 1 510 ? 3.919   14.821  -24.068 1.00 42.22 ? 510  TYR B CD2 1 
ATOM   8084 C  CE1 . TYR B 1 510 ? 5.556   15.662  -21.979 1.00 44.03 ? 510  TYR B CE1 1 
ATOM   8085 C  CE2 . TYR B 1 510 ? 3.995   14.061  -22.918 1.00 44.27 ? 510  TYR B CE2 1 
ATOM   8086 C  CZ  . TYR B 1 510 ? 4.824   14.485  -21.880 1.00 44.88 ? 510  TYR B CZ  1 
ATOM   8087 O  OH  . TYR B 1 510 ? 4.940   13.703  -20.768 1.00 46.21 ? 510  TYR B OH  1 
ATOM   8088 N  N   . VAL B 1 511 ? 1.445   17.010  -25.736 1.00 44.64 ? 511  VAL B N   1 
ATOM   8089 C  CA  . VAL B 1 511 ? 0.092   16.632  -25.341 1.00 45.57 ? 511  VAL B CA  1 
ATOM   8090 C  C   . VAL B 1 511 ? -0.160  15.131  -25.356 1.00 47.33 ? 511  VAL B C   1 
ATOM   8091 O  O   . VAL B 1 511 ? 0.518   14.383  -26.063 1.00 47.89 ? 511  VAL B O   1 
ATOM   8092 C  CB  . VAL B 1 511 ? -0.943  17.301  -26.253 1.00 45.60 ? 511  VAL B CB  1 
ATOM   8093 C  CG1 . VAL B 1 511 ? -0.706  18.805  -26.286 1.00 44.93 ? 511  VAL B CG1 1 
ATOM   8094 C  CG2 . VAL B 1 511 ? -0.837  16.735  -27.674 1.00 45.44 ? 511  VAL B CG2 1 
ATOM   8095 N  N   . SER B 1 512 ? -1.124  14.685  -24.554 1.00 46.76 ? 512  SER B N   1 
ATOM   8096 C  CA  . SER B 1 512 ? -1.460  13.269  -24.527 1.00 46.09 ? 512  SER B CA  1 
ATOM   8097 C  C   . SER B 1 512 ? -2.638  13.061  -25.480 1.00 45.67 ? 512  SER B C   1 
ATOM   8098 O  O   . SER B 1 512 ? -3.615  13.795  -25.437 1.00 45.10 ? 512  SER B O   1 
ATOM   8099 C  CB  . SER B 1 512 ? -1.853  12.829  -23.125 1.00 46.15 ? 512  SER B CB  1 
ATOM   8100 O  OG  . SER B 1 512 ? -2.982  13.565  -22.702 1.00 50.34 ? 512  SER B OG  1 
ATOM   8101 N  N   . LEU B 1 513 ? -2.526  12.082  -26.370 1.00 44.95 ? 513  LEU B N   1 
ATOM   8102 C  CA  . LEU B 1 513 ? -3.604  11.809  -27.301 1.00 44.88 ? 513  LEU B CA  1 
ATOM   8103 C  C   . LEU B 1 513 ? -4.285  10.542  -26.803 1.00 46.13 ? 513  LEU B C   1 
ATOM   8104 O  O   . LEU B 1 513 ? -3.675  9.462   -26.812 1.00 46.50 ? 513  LEU B O   1 
ATOM   8105 C  CB  . LEU B 1 513 ? -3.041  11.604  -28.701 1.00 42.99 ? 513  LEU B CB  1 
ATOM   8106 C  CG  . LEU B 1 513 ? -2.377  12.825  -29.331 1.00 43.24 ? 513  LEU B CG  1 
ATOM   8107 C  CD1 . LEU B 1 513 ? -1.808  12.470  -30.696 1.00 40.89 ? 513  LEU B CD1 1 
ATOM   8108 C  CD2 . LEU B 1 513 ? -3.405  13.938  -29.470 1.00 42.23 ? 513  LEU B CD2 1 
ATOM   8109 N  N   . ASN B 1 514 ? -5.522  10.686  -26.331 1.00 46.45 ? 514  ASN B N   1 
ATOM   8110 C  CA  . ASN B 1 514 ? -6.309  9.557   -25.833 1.00 47.41 ? 514  ASN B CA  1 
ATOM   8111 C  C   . ASN B 1 514 ? -7.771  9.938   -25.917 1.00 48.69 ? 514  ASN B C   1 
ATOM   8112 O  O   . ASN B 1 514 ? -8.107  10.960  -26.533 1.00 47.86 ? 514  ASN B O   1 
ATOM   8113 C  CB  . ASN B 1 514 ? -5.927  9.194   -24.399 1.00 48.57 ? 514  ASN B CB  1 
ATOM   8114 C  CG  . ASN B 1 514 ? -6.052  10.373  -23.438 1.00 51.30 ? 514  ASN B CG  1 
ATOM   8115 O  OD1 . ASN B 1 514 ? -7.039  11.130  -23.468 1.00 52.36 ? 514  ASN B OD1 1 
ATOM   8116 N  ND2 . ASN B 1 514 ? -5.057  10.530  -22.573 1.00 51.41 ? 514  ASN B ND2 1 
ATOM   8117 N  N   . LEU B 1 515 ? -8.647  9.136   -25.312 1.00 51.46 ? 515  LEU B N   1 
ATOM   8118 C  CA  . LEU B 1 515 ? -10.095 9.416   -25.386 1.00 52.62 ? 515  LEU B CA  1 
ATOM   8119 C  C   . LEU B 1 515 ? -10.500 10.695  -24.663 1.00 52.70 ? 515  LEU B C   1 
ATOM   8120 O  O   . LEU B 1 515 ? -11.508 11.303  -25.000 1.00 51.44 ? 515  LEU B O   1 
ATOM   8121 C  CB  . LEU B 1 515 ? -10.892 8.220   -24.860 1.00 51.79 ? 515  LEU B CB  1 
ATOM   8122 C  CG  . LEU B 1 515 ? -10.589 6.941   -25.653 1.00 53.30 ? 515  LEU B CG  1 
ATOM   8123 C  CD1 . LEU B 1 515 ? -11.200 5.726   -24.944 1.00 51.07 ? 515  LEU B CD1 1 
ATOM   8124 C  CD2 . LEU B 1 515 ? -11.123 7.093   -27.070 1.00 49.79 ? 515  LEU B CD2 1 
ATOM   8125 N  N   . LYS B 1 516 ? -9.697  11.113  -23.689 1.00 53.95 ? 516  LYS B N   1 
ATOM   8126 C  CA  . LYS B 1 516 ? -9.987  12.350  -22.968 1.00 56.61 ? 516  LYS B CA  1 
ATOM   8127 C  C   . LYS B 1 516 ? -9.530  13.550  -23.780 1.00 56.15 ? 516  LYS B C   1 
ATOM   8128 O  O   . LYS B 1 516 ? -8.737  13.415  -24.700 1.00 57.81 ? 516  LYS B O   1 
ATOM   8129 C  CB  . LYS B 1 516 ? -9.304  12.333  -21.606 1.00 56.96 ? 516  LYS B CB  1 
ATOM   8130 C  CG  . LYS B 1 516 ? -9.834  11.211  -20.752 1.00 60.72 ? 516  LYS B CG  1 
ATOM   8131 C  CD  . LYS B 1 516 ? -9.424  11.319  -19.293 1.00 65.16 ? 516  LYS B CD  1 
ATOM   8132 C  CE  . LYS B 1 516 ? -7.986  10.881  -19.078 1.00 66.34 ? 516  LYS B CE  1 
ATOM   8133 N  NZ  . LYS B 1 516 ? -7.736  10.582  -17.627 1.00 68.44 ? 516  LYS B NZ  1 
ATOM   8134 N  N   . PRO B 1 517 ? -10.055 14.738  -23.478 1.00 56.06 ? 517  PRO B N   1 
ATOM   8135 C  CA  . PRO B 1 517 ? -9.653  15.945  -24.218 1.00 55.77 ? 517  PRO B CA  1 
ATOM   8136 C  C   . PRO B 1 517 ? -8.139  16.134  -24.083 1.00 54.85 ? 517  PRO B C   1 
ATOM   8137 O  O   . PRO B 1 517 ? -7.531  15.591  -23.149 1.00 53.41 ? 517  PRO B O   1 
ATOM   8138 C  CB  . PRO B 1 517 ? -10.429 17.061  -23.511 1.00 56.07 ? 517  PRO B CB  1 
ATOM   8139 C  CG  . PRO B 1 517 ? -11.656 16.352  -23.019 1.00 56.46 ? 517  PRO B CG  1 
ATOM   8140 C  CD  . PRO B 1 517 ? -11.082 15.050  -22.475 1.00 55.55 ? 517  PRO B CD  1 
ATOM   8141 N  N   . LEU B 1 518 ? -7.525  16.886  -24.998 1.00 54.74 ? 518  LEU B N   1 
ATOM   8142 C  CA  . LEU B 1 518 ? -6.073  17.107  -24.922 1.00 54.94 ? 518  LEU B CA  1 
ATOM   8143 C  C   . LEU B 1 518 ? -5.644  17.545  -23.540 1.00 55.87 ? 518  LEU B C   1 
ATOM   8144 O  O   . LEU B 1 518 ? -6.320  18.333  -22.880 1.00 56.45 ? 518  LEU B O   1 
ATOM   8145 C  CB  . LEU B 1 518 ? -5.597  18.200  -25.879 1.00 54.75 ? 518  LEU B CB  1 
ATOM   8146 C  CG  . LEU B 1 518 ? -5.477  17.967  -27.371 1.00 56.44 ? 518  LEU B CG  1 
ATOM   8147 C  CD1 . LEU B 1 518 ? -4.815  19.202  -27.963 1.00 55.70 ? 518  LEU B CD1 1 
ATOM   8148 C  CD2 . LEU B 1 518 ? -4.650  16.716  -27.671 1.00 56.04 ? 518  LEU B CD2 1 
ATOM   8149 N  N   . GLU B 1 519 ? -4.495  17.048  -23.118 1.00 55.19 ? 519  GLU B N   1 
ATOM   8150 C  CA  . GLU B 1 519 ? -3.939  17.407  -21.831 1.00 55.48 ? 519  GLU B CA  1 
ATOM   8151 C  C   . GLU B 1 519 ? -2.479  17.791  -22.120 1.00 54.74 ? 519  GLU B C   1 
ATOM   8152 O  O   . GLU B 1 519 ? -1.752  17.045  -22.789 1.00 55.81 ? 519  GLU B O   1 
ATOM   8153 C  CB  . GLU B 1 519 ? -4.009  16.203  -20.865 1.00 55.50 ? 519  GLU B CB  1 
ATOM   8154 C  CG  . GLU B 1 519 ? -3.170  16.366  -19.606 1.00 58.62 ? 519  GLU B CG  1 
ATOM   8155 C  CD  . GLU B 1 519 ? -3.085  15.103  -18.746 1.00 61.89 ? 519  GLU B CD  1 
ATOM   8156 O  OE1 . GLU B 1 519 ? -4.152  14.513  -18.464 1.00 65.71 ? 519  GLU B OE1 1 
ATOM   8157 O  OE2 . GLU B 1 519 ? -1.963  14.707  -18.337 1.00 58.51 ? 519  GLU B OE2 1 
ATOM   8158 N  N   . VAL B 1 520 ? -2.057  18.955  -21.642 1.00 52.39 ? 520  VAL B N   1 
ATOM   8159 C  CA  . VAL B 1 520 ? -0.684  19.396  -21.844 1.00 50.11 ? 520  VAL B CA  1 
ATOM   8160 C  C   . VAL B 1 520 ? 0.202   18.879  -20.715 1.00 48.84 ? 520  VAL B C   1 
ATOM   8161 O  O   . VAL B 1 520 ? -0.183  18.949  -19.558 1.00 50.18 ? 520  VAL B O   1 
ATOM   8162 C  CB  . VAL B 1 520 ? -0.589  20.942  -21.875 1.00 47.76 ? 520  VAL B CB  1 
ATOM   8163 C  CG1 . VAL B 1 520 ? 0.871   21.373  -21.981 1.00 47.78 ? 520  VAL B CG1 1 
ATOM   8164 C  CG2 . VAL B 1 520 ? -1.387  21.491  -23.036 1.00 45.02 ? 520  VAL B CG2 1 
ATOM   8165 N  N   . ARG B 1 521 ? 1.374   18.348  -21.056 1.00 48.29 ? 521  ARG B N   1 
ATOM   8166 C  CA  . ARG B 1 521 ? 2.330   17.850  -20.063 1.00 48.40 ? 521  ARG B CA  1 
ATOM   8167 C  C   . ARG B 1 521 ? 3.696   18.474  -20.341 1.00 49.31 ? 521  ARG B C   1 
ATOM   8168 O  O   . ARG B 1 521 ? 3.918   19.045  -21.413 1.00 49.89 ? 521  ARG B O   1 
ATOM   8169 C  CB  . ARG B 1 521 ? 2.440   16.331  -20.118 1.00 48.10 ? 521  ARG B CB  1 
ATOM   8170 C  CG  . ARG B 1 521 ? 1.119   15.638  -19.858 1.00 49.86 ? 521  ARG B CG  1 
ATOM   8171 C  CD  . ARG B 1 521 ? 1.256   14.126  -19.744 1.00 51.46 ? 521  ARG B CD  1 
ATOM   8172 N  NE  . ARG B 1 521 ? -0.075  13.529  -19.665 1.00 52.81 ? 521  ARG B NE  1 
ATOM   8173 C  CZ  . ARG B 1 521 ? -0.356  12.257  -19.943 1.00 52.84 ? 521  ARG B CZ  1 
ATOM   8174 N  NH1 . ARG B 1 521 ? 0.608   11.420  -20.322 1.00 48.89 ? 521  ARG B NH1 1 
ATOM   8175 N  NH2 . ARG B 1 521 ? -1.619  11.837  -19.867 1.00 51.33 ? 521  ARG B NH2 1 
ATOM   8176 N  N   . ARG B 1 522 ? 4.617   18.381  -19.387 1.00 49.95 ? 522  ARG B N   1 
ATOM   8177 C  CA  . ARG B 1 522 ? 5.928   18.982  -19.585 1.00 51.21 ? 522  ARG B CA  1 
ATOM   8178 C  C   . ARG B 1 522 ? 7.049   18.004  -19.359 1.00 52.01 ? 522  ARG B C   1 
ATOM   8179 O  O   . ARG B 1 522 ? 7.017   17.209  -18.418 1.00 53.33 ? 522  ARG B O   1 
ATOM   8180 C  CB  . ARG B 1 522 ? 6.093   20.221  -18.689 1.00 50.19 ? 522  ARG B CB  1 
ATOM   8181 C  CG  . ARG B 1 522 ? 5.166   21.357  -19.125 1.00 52.97 ? 522  ARG B CG  1 
ATOM   8182 C  CD  . ARG B 1 522 ? 5.280   22.625  -18.281 1.00 55.42 ? 522  ARG B CD  1 
ATOM   8183 N  NE  . ARG B 1 522 ? 6.631   23.194  -18.296 1.00 59.75 ? 522  ARG B NE  1 
ATOM   8184 C  CZ  . ARG B 1 522 ? 6.956   24.391  -17.800 1.00 60.30 ? 522  ARG B CZ  1 
ATOM   8185 N  NH1 . ARG B 1 522 ? 6.019   25.158  -17.253 1.00 57.67 ? 522  ARG B NH1 1 
ATOM   8186 N  NH2 . ARG B 1 522 ? 8.227   24.806  -17.825 1.00 60.49 ? 522  ARG B NH2 1 
ATOM   8187 N  N   . GLY B 1 523 ? 8.038   18.055  -20.245 1.00 51.18 ? 523  GLY B N   1 
ATOM   8188 C  CA  . GLY B 1 523 ? 9.177   17.164  -20.139 1.00 51.53 ? 523  GLY B CA  1 
ATOM   8189 C  C   . GLY B 1 523 ? 8.841   15.767  -20.620 1.00 52.82 ? 523  GLY B C   1 
ATOM   8190 O  O   . GLY B 1 523 ? 8.044   15.061  -20.009 1.00 53.11 ? 523  GLY B O   1 
ATOM   8191 N  N   . LEU B 1 524 ? 9.450   15.374  -21.730 1.00 52.36 ? 524  LEU B N   1 
ATOM   8192 C  CA  . LEU B 1 524 ? 9.224   14.067  -22.311 1.00 51.78 ? 524  LEU B CA  1 
ATOM   8193 C  C   . LEU B 1 524 ? 10.272  13.113  -21.752 1.00 51.51 ? 524  LEU B C   1 
ATOM   8194 O  O   . LEU B 1 524 ? 11.379  13.041  -22.277 1.00 51.08 ? 524  LEU B O   1 
ATOM   8195 C  CB  . LEU B 1 524 ? 9.363   14.181  -23.828 1.00 53.22 ? 524  LEU B CB  1 
ATOM   8196 C  CG  . LEU B 1 524 ? 8.868   13.015  -24.667 1.00 55.16 ? 524  LEU B CG  1 
ATOM   8197 C  CD1 . LEU B 1 524 ? 7.435   12.700  -24.269 1.00 55.92 ? 524  LEU B CD1 1 
ATOM   8198 C  CD2 . LEU B 1 524 ? 8.961   13.368  -26.151 1.00 55.05 ? 524  LEU B CD2 1 
ATOM   8199 N  N   . ARG B 1 525 ? 9.929   12.394  -20.683 1.00 52.46 ? 525  ARG B N   1 
ATOM   8200 C  CA  . ARG B 1 525 ? 10.864  11.460  -20.044 1.00 52.25 ? 525  ARG B CA  1 
ATOM   8201 C  C   . ARG B 1 525 ? 12.173  12.197  -19.765 1.00 51.08 ? 525  ARG B C   1 
ATOM   8202 O  O   . ARG B 1 525 ? 13.264  11.632  -19.948 1.00 49.09 ? 525  ARG B O   1 
ATOM   8203 C  CB  . ARG B 1 525 ? 11.158  10.299  -20.987 1.00 55.60 ? 525  ARG B CB  1 
ATOM   8204 C  CG  . ARG B 1 525 ? 9.999   9.389   -21.235 1.00 59.08 ? 525  ARG B CG  1 
ATOM   8205 C  CD  . ARG B 1 525 ? 9.917   8.333   -20.154 1.00 61.73 ? 525  ARG B CD  1 
ATOM   8206 N  NE  . ARG B 1 525 ? 9.502   7.063   -20.738 1.00 65.66 ? 525  ARG B NE  1 
ATOM   8207 C  CZ  . ARG B 1 525 ? 8.304   6.827   -21.270 1.00 66.66 ? 525  ARG B CZ  1 
ATOM   8208 N  NH1 . ARG B 1 525 ? 7.372   7.780   -21.292 1.00 66.63 ? 525  ARG B NH1 1 
ATOM   8209 N  NH2 . ARG B 1 525 ? 8.044   5.630   -21.792 1.00 67.86 ? 525  ARG B NH2 1 
ATOM   8210 N  N   . ALA B 1 526 ? 12.054  13.442  -19.306 1.00 49.78 ? 526  ALA B N   1 
ATOM   8211 C  CA  . ALA B 1 526 ? 13.206  14.310  -19.088 1.00 48.64 ? 526  ALA B CA  1 
ATOM   8212 C  C   . ALA B 1 526 ? 14.389  13.726  -18.356 1.00 47.96 ? 526  ALA B C   1 
ATOM   8213 O  O   . ALA B 1 526 ? 15.502  13.751  -18.882 1.00 48.98 ? 526  ALA B O   1 
ATOM   8214 C  CB  . ALA B 1 526 ? 12.761  15.581  -18.419 1.00 49.24 ? 526  ALA B CB  1 
ATOM   8215 N  N   . GLN B 1 527 ? 14.167  13.194  -17.157 1.00 48.18 ? 527  GLN B N   1 
ATOM   8216 C  CA  . GLN B 1 527 ? 15.264  12.613  -16.376 1.00 47.54 ? 527  GLN B CA  1 
ATOM   8217 C  C   . GLN B 1 527 ? 15.861  11.403  -17.071 1.00 45.78 ? 527  GLN B C   1 
ATOM   8218 O  O   . GLN B 1 527 ? 17.073  11.320  -17.263 1.00 45.21 ? 527  GLN B O   1 
ATOM   8219 C  CB  . GLN B 1 527 ? 14.798  12.187  -14.963 1.00 49.55 ? 527  GLN B CB  1 
ATOM   8220 C  CG  . GLN B 1 527 ? 14.478  13.313  -13.998 1.00 52.52 ? 527  GLN B CG  1 
ATOM   8221 C  CD  . GLN B 1 527 ? 15.549  14.402  -13.983 1.00 55.03 ? 527  GLN B CD  1 
ATOM   8222 O  OE1 . GLN B 1 527 ? 15.368  15.479  -14.575 1.00 54.15 ? 527  GLN B OE1 1 
ATOM   8223 N  NE2 . GLN B 1 527 ? 16.677  14.124  -13.310 1.00 54.90 ? 527  GLN B NE2 1 
ATOM   8224 N  N   . THR B 1 528 ? 15.008  10.456  -17.441 1.00 45.87 ? 528  THR B N   1 
ATOM   8225 C  CA  . THR B 1 528 ? 15.481  9.251   -18.091 1.00 46.57 ? 528  THR B CA  1 
ATOM   8226 C  C   . THR B 1 528 ? 16.176  9.530   -19.416 1.00 46.91 ? 528  THR B C   1 
ATOM   8227 O  O   . THR B 1 528 ? 17.222  8.941   -19.693 1.00 47.45 ? 528  THR B O   1 
ATOM   8228 C  CB  . THR B 1 528 ? 14.328  8.229   -18.281 1.00 48.03 ? 528  THR B CB  1 
ATOM   8229 O  OG1 . THR B 1 528 ? 14.045  7.605   -17.017 1.00 49.29 ? 528  THR B OG1 1 
ATOM   8230 C  CG2 . THR B 1 528 ? 14.711  7.139   -19.299 1.00 46.11 ? 528  THR B CG2 1 
ATOM   8231 N  N   . CYS B 1 529 ? 15.641  10.437  -20.229 1.00 46.71 ? 529  CYS B N   1 
ATOM   8232 C  CA  . CYS B 1 529 ? 16.310  10.692  -21.498 1.00 47.97 ? 529  CYS B CA  1 
ATOM   8233 C  C   . CYS B 1 529 ? 17.637  11.432  -21.307 1.00 48.62 ? 529  CYS B C   1 
ATOM   8234 O  O   . CYS B 1 529 ? 18.535  11.331  -22.156 1.00 48.29 ? 529  CYS B O   1 
ATOM   8235 C  CB  . CYS B 1 529 ? 15.373  11.405  -22.481 1.00 48.31 ? 529  CYS B CB  1 
ATOM   8236 S  SG  . CYS B 1 529 ? 14.105  10.251  -23.152 1.00 51.63 ? 529  CYS B SG  1 
ATOM   8237 N  N   . ALA B 1 530 ? 17.781  12.145  -20.185 1.00 47.42 ? 530  ALA B N   1 
ATOM   8238 C  CA  . ALA B 1 530 ? 19.051  12.831  -19.899 1.00 47.38 ? 530  ALA B CA  1 
ATOM   8239 C  C   . ALA B 1 530 ? 20.083  11.714  -19.674 1.00 45.98 ? 530  ALA B C   1 
ATOM   8240 O  O   . ALA B 1 530 ? 21.247  11.830  -20.049 1.00 46.77 ? 530  ALA B O   1 
ATOM   8241 C  CB  . ALA B 1 530 ? 18.931  13.726  -18.627 1.00 47.50 ? 530  ALA B CB  1 
ATOM   8242 N  N   . PHE B 1 531 ? 19.638  10.632  -19.053 1.00 44.16 ? 531  PHE B N   1 
ATOM   8243 C  CA  . PHE B 1 531 ? 20.489  9.478   -18.826 1.00 45.47 ? 531  PHE B CA  1 
ATOM   8244 C  C   . PHE B 1 531 ? 21.012  8.932   -20.164 1.00 47.38 ? 531  PHE B C   1 
ATOM   8245 O  O   . PHE B 1 531 ? 22.225  8.747   -20.356 1.00 47.71 ? 531  PHE B O   1 
ATOM   8246 C  CB  . PHE B 1 531 ? 19.674  8.391   -18.132 1.00 45.46 ? 531  PHE B CB  1 
ATOM   8247 C  CG  . PHE B 1 531 ? 20.381  7.085   -18.039 1.00 46.30 ? 531  PHE B CG  1 
ATOM   8248 C  CD1 . PHE B 1 531 ? 21.527  6.948   -17.260 1.00 46.43 ? 531  PHE B CD1 1 
ATOM   8249 C  CD2 . PHE B 1 531 ? 19.890  5.976   -18.715 1.00 47.21 ? 531  PHE B CD2 1 
ATOM   8250 C  CE1 . PHE B 1 531 ? 22.165  5.721   -17.153 1.00 48.24 ? 531  PHE B CE1 1 
ATOM   8251 C  CE2 . PHE B 1 531 ? 20.522  4.739   -18.615 1.00 47.71 ? 531  PHE B CE2 1 
ATOM   8252 C  CZ  . PHE B 1 531 ? 21.658  4.606   -17.833 1.00 47.27 ? 531  PHE B CZ  1 
ATOM   8253 N  N   . TRP B 1 532 ? 20.077  8.670   -21.081 1.00 47.77 ? 532  TRP B N   1 
ATOM   8254 C  CA  . TRP B 1 532 ? 20.404  8.149   -22.404 1.00 48.36 ? 532  TRP B CA  1 
ATOM   8255 C  C   . TRP B 1 532 ? 21.117  9.156   -23.308 1.00 48.64 ? 532  TRP B C   1 
ATOM   8256 O  O   . TRP B 1 532 ? 22.113  8.823   -23.940 1.00 49.58 ? 532  TRP B O   1 
ATOM   8257 C  CB  . TRP B 1 532 ? 19.139  7.683   -23.133 1.00 46.13 ? 532  TRP B CB  1 
ATOM   8258 C  CG  . TRP B 1 532 ? 18.543  6.448   -22.597 1.00 44.37 ? 532  TRP B CG  1 
ATOM   8259 C  CD1 . TRP B 1 532 ? 17.404  6.344   -21.861 1.00 43.30 ? 532  TRP B CD1 1 
ATOM   8260 C  CD2 . TRP B 1 532 ? 19.047  5.119   -22.761 1.00 42.19 ? 532  TRP B CD2 1 
ATOM   8261 N  NE1 . TRP B 1 532 ? 17.163  5.024   -21.553 1.00 44.43 ? 532  TRP B NE1 1 
ATOM   8262 C  CE2 . TRP B 1 532 ? 18.160  4.251   -22.092 1.00 41.77 ? 532  TRP B CE2 1 
ATOM   8263 C  CE3 . TRP B 1 532 ? 20.166  4.576   -23.406 1.00 41.61 ? 532  TRP B CE3 1 
ATOM   8264 C  CZ2 . TRP B 1 532 ? 18.354  2.860   -22.044 1.00 42.50 ? 532  TRP B CZ2 1 
ATOM   8265 C  CZ3 . TRP B 1 532 ? 20.365  3.189   -23.359 1.00 40.89 ? 532  TRP B CZ3 1 
ATOM   8266 C  CH2 . TRP B 1 532 ? 19.462  2.349   -22.681 1.00 41.16 ? 532  TRP B CH2 1 
ATOM   8267 N  N   . ASN B 1 533 ? 20.621  10.384  -23.357 1.00 48.17 ? 533  ASN B N   1 
ATOM   8268 C  CA  . ASN B 1 533 ? 21.201  11.369  -24.257 1.00 49.52 ? 533  ASN B CA  1 
ATOM   8269 C  C   . ASN B 1 533 ? 22.422  12.135  -23.808 1.00 50.77 ? 533  ASN B C   1 
ATOM   8270 O  O   . ASN B 1 533 ? 23.184  12.623  -24.645 1.00 51.39 ? 533  ASN B O   1 
ATOM   8271 C  CB  . ASN B 1 533 ? 20.122  12.353  -24.701 1.00 47.70 ? 533  ASN B CB  1 
ATOM   8272 C  CG  . ASN B 1 533 ? 18.984  11.653  -25.401 1.00 47.99 ? 533  ASN B CG  1 
ATOM   8273 O  OD1 . ASN B 1 533 ? 19.168  10.559  -25.934 1.00 48.34 ? 533  ASN B OD1 1 
ATOM   8274 N  ND2 . ASN B 1 533 ? 17.809  12.267  -25.409 1.00 48.02 ? 533  ASN B ND2 1 
ATOM   8275 N  N   . ARG B 1 534 ? 22.633  12.239  -22.502 1.00 51.86 ? 534  ARG B N   1 
ATOM   8276 C  CA  . ARG B 1 534 ? 23.787  12.984  -22.003 1.00 52.93 ? 534  ARG B CA  1 
ATOM   8277 C  C   . ARG B 1 534 ? 24.790  12.125  -21.256 1.00 53.46 ? 534  ARG B C   1 
ATOM   8278 O  O   . ARG B 1 534 ? 25.994  12.252  -21.463 1.00 54.86 ? 534  ARG B O   1 
ATOM   8279 C  CB  . ARG B 1 534 ? 23.341  14.133  -21.086 1.00 52.67 ? 534  ARG B CB  1 
ATOM   8280 C  CG  . ARG B 1 534 ? 22.571  15.245  -21.773 1.00 53.13 ? 534  ARG B CG  1 
ATOM   8281 C  CD  . ARG B 1 534 ? 21.767  16.020  -20.746 1.00 55.07 ? 534  ARG B CD  1 
ATOM   8282 N  NE  . ARG B 1 534 ? 20.832  16.974  -21.343 1.00 57.64 ? 534  ARG B NE  1 
ATOM   8283 C  CZ  . ARG B 1 534 ? 21.173  18.179  -21.799 1.00 59.18 ? 534  ARG B CZ  1 
ATOM   8284 N  NH1 . ARG B 1 534 ? 22.449  18.576  -21.719 1.00 57.01 ? 534  ARG B NH1 1 
ATOM   8285 N  NH2 . ARG B 1 534 ? 20.238  18.981  -22.329 1.00 56.31 ? 534  ARG B NH2 1 
ATOM   8286 N  N   . PHE B 1 535 ? 24.323  11.239  -20.389 1.00 53.12 ? 535  PHE B N   1 
ATOM   8287 C  CA  . PHE B 1 535 ? 25.279  10.442  -19.646 1.00 52.03 ? 535  PHE B CA  1 
ATOM   8288 C  C   . PHE B 1 535 ? 25.878  9.268   -20.383 1.00 53.06 ? 535  PHE B C   1 
ATOM   8289 O  O   . PHE B 1 535 ? 27.091  9.172   -20.471 1.00 53.38 ? 535  PHE B O   1 
ATOM   8290 C  CB  . PHE B 1 535 ? 24.688  9.929   -18.342 1.00 49.50 ? 535  PHE B CB  1 
ATOM   8291 C  CG  . PHE B 1 535 ? 25.665  9.158   -17.519 1.00 47.40 ? 535  PHE B CG  1 
ATOM   8292 C  CD1 . PHE B 1 535 ? 26.731  9.806   -16.905 1.00 46.81 ? 535  PHE B CD1 1 
ATOM   8293 C  CD2 . PHE B 1 535 ? 25.541  7.781   -17.379 1.00 47.68 ? 535  PHE B CD2 1 
ATOM   8294 C  CE1 . PHE B 1 535 ? 27.659  9.100   -16.165 1.00 45.16 ? 535  PHE B CE1 1 
ATOM   8295 C  CE2 . PHE B 1 535 ? 26.467  7.060   -16.638 1.00 47.45 ? 535  PHE B CE2 1 
ATOM   8296 C  CZ  . PHE B 1 535 ? 27.531  7.728   -16.027 1.00 45.96 ? 535  PHE B CZ  1 
ATOM   8297 N  N   . LEU B 1 536 ? 25.051  8.356   -20.887 1.00 55.24 ? 536  LEU B N   1 
ATOM   8298 C  CA  . LEU B 1 536 ? 25.603  7.192   -21.591 1.00 58.51 ? 536  LEU B CA  1 
ATOM   8299 C  C   . LEU B 1 536 ? 26.637  7.514   -22.664 1.00 60.88 ? 536  LEU B C   1 
ATOM   8300 O  O   . LEU B 1 536 ? 27.636  6.807   -22.782 1.00 60.28 ? 536  LEU B O   1 
ATOM   8301 C  CB  . LEU B 1 536 ? 24.490  6.319   -22.164 1.00 56.63 ? 536  LEU B CB  1 
ATOM   8302 C  CG  . LEU B 1 536 ? 23.896  5.472   -21.043 1.00 56.63 ? 536  LEU B CG  1 
ATOM   8303 C  CD1 . LEU B 1 536 ? 22.889  4.494   -21.597 1.00 55.85 ? 536  LEU B CD1 1 
ATOM   8304 C  CD2 . LEU B 1 536 ? 25.028  4.719   -20.334 1.00 55.80 ? 536  LEU B CD2 1 
ATOM   8305 N  N   . PRO B 1 537 ? 26.413  8.574   -23.462 1.00 63.95 ? 537  PRO B N   1 
ATOM   8306 C  CA  . PRO B 1 537 ? 27.405  8.901   -24.487 1.00 67.78 ? 537  PRO B CA  1 
ATOM   8307 C  C   . PRO B 1 537 ? 28.744  9.138   -23.784 1.00 72.11 ? 537  PRO B C   1 
ATOM   8308 O  O   . PRO B 1 537 ? 29.729  8.442   -24.057 1.00 73.57 ? 537  PRO B O   1 
ATOM   8309 C  CB  . PRO B 1 537 ? 26.851  10.181  -25.112 1.00 66.35 ? 537  PRO B CB  1 
ATOM   8310 C  CG  . PRO B 1 537 ? 25.388  10.002  -24.986 1.00 64.82 ? 537  PRO B CG  1 
ATOM   8311 C  CD  . PRO B 1 537 ? 25.239  9.457   -23.577 1.00 64.07 ? 537  PRO B CD  1 
ATOM   8312 N  N   . LYS B 1 538 ? 28.764  10.114  -22.870 1.00 75.66 ? 538  LYS B N   1 
ATOM   8313 C  CA  . LYS B 1 538 ? 29.969  10.452  -22.100 1.00 78.68 ? 538  LYS B CA  1 
ATOM   8314 C  C   . LYS B 1 538 ? 30.624  9.208   -21.528 1.00 80.29 ? 538  LYS B C   1 
ATOM   8315 O  O   . LYS B 1 538 ? 31.844  9.131   -21.406 1.00 81.06 ? 538  LYS B O   1 
ATOM   8316 C  CB  . LYS B 1 538 ? 29.646  11.389  -20.927 1.00 78.93 ? 538  LYS B CB  1 
ATOM   8317 C  CG  . LYS B 1 538 ? 29.732  12.866  -21.243 1.00 81.67 ? 538  LYS B CG  1 
ATOM   8318 C  CD  . LYS B 1 538 ? 29.888  13.694  -19.973 1.00 82.91 ? 538  LYS B CD  1 
ATOM   8319 C  CE  . LYS B 1 538 ? 30.260  15.138  -20.319 1.00 85.39 ? 538  LYS B CE  1 
ATOM   8320 N  NZ  . LYS B 1 538 ? 30.852  15.888  -19.164 1.00 85.13 ? 538  LYS B NZ  1 
ATOM   8321 N  N   . LEU B 1 539 ? 29.810  8.231   -21.171 1.00 82.35 ? 539  LEU B N   1 
ATOM   8322 C  CA  . LEU B 1 539 ? 30.350  7.020   -20.601 1.00 85.57 ? 539  LEU B CA  1 
ATOM   8323 C  C   . LEU B 1 539 ? 31.202  6.252   -21.586 1.00 88.37 ? 539  LEU B C   1 
ATOM   8324 O  O   . LEU B 1 539 ? 32.362  5.967   -21.318 1.00 89.18 ? 539  LEU B O   1 
ATOM   8325 C  CB  . LEU B 1 539 ? 29.227  6.116   -20.097 1.00 84.28 ? 539  LEU B CB  1 
ATOM   8326 C  CG  . LEU B 1 539 ? 29.678  4.782   -19.510 1.00 82.51 ? 539  LEU B CG  1 
ATOM   8327 C  CD1 . LEU B 1 539 ? 30.734  5.003   -18.446 1.00 82.16 ? 539  LEU B CD1 1 
ATOM   8328 C  CD2 . LEU B 1 539 ? 28.481  4.082   -18.931 1.00 82.24 ? 539  LEU B CD2 1 
ATOM   8329 N  N   . LEU B 1 540 ? 30.638  5.911   -22.734 1.00 91.79 ? 540  LEU B N   1 
ATOM   8330 C  CA  . LEU B 1 540 ? 31.395  5.128   -23.698 1.00 94.86 ? 540  LEU B CA  1 
ATOM   8331 C  C   . LEU B 1 540 ? 32.617  5.816   -24.329 1.00 95.83 ? 540  LEU B C   1 
ATOM   8332 O  O   . LEU B 1 540 ? 33.575  5.138   -24.714 1.00 95.98 ? 540  LEU B O   1 
ATOM   8333 C  CB  . LEU B 1 540 ? 30.430  4.562   -24.748 1.00 95.96 ? 540  LEU B CB  1 
ATOM   8334 C  CG  . LEU B 1 540 ? 29.292  3.793   -24.031 1.00 97.22 ? 540  LEU B CG  1 
ATOM   8335 C  CD1 . LEU B 1 540 ? 28.593  2.855   -25.018 1.00 97.04 ? 540  LEU B CD1 1 
ATOM   8336 C  CD2 . LEU B 1 540 ? 29.854  2.989   -22.833 1.00 96.00 ? 540  LEU B CD2 1 
ATOM   8337 N  N   . SER B 1 541 ? 32.604  7.146   -24.414 1.00 96.76 ? 541  SER B N   1 
ATOM   8338 C  CA  . SER B 1 541 ? 33.754  7.877   -24.963 1.00 97.98 ? 541  SER B CA  1 
ATOM   8339 C  C   . SER B 1 541 ? 34.763  8.121   -23.823 1.00 99.04 ? 541  SER B C   1 
ATOM   8340 O  O   . SER B 1 541 ? 35.029  9.271   -23.438 1.00 98.85 ? 541  SER B O   1 
ATOM   8341 C  CB  . SER B 1 541 ? 33.314  9.216   -25.581 1.00 97.71 ? 541  SER B CB  1 
ATOM   8342 O  OG  . SER B 1 541 ? 32.744  10.086  -24.615 1.00 96.76 ? 541  SER B OG  1 
ATOM   8343 N  N   . ALA B 1 542 ? 35.303  7.012   -23.300 1.00 99.28 ? 542  ALA B N   1 
ATOM   8344 C  CA  . ALA B 1 542 ? 36.273  6.980   -22.194 1.00 99.21 ? 542  ALA B CA  1 
ATOM   8345 C  C   . ALA B 1 542 ? 36.097  5.635   -21.470 1.00 99.25 ? 542  ALA B C   1 
ATOM   8346 O  O   . ALA B 1 542 ? 36.804  4.663   -21.758 1.00 98.79 ? 542  ALA B O   1 
ATOM   8347 C  CB  . ALA B 1 542 ? 36.021  8.144   -21.215 1.00 98.65 ? 542  ALA B CB  1 
ATOM   8348 N  N   . THR B 1 543 ? 35.136  5.612   -20.539 1.00 99.28 ? 543  THR B N   1 
ATOM   8349 C  CA  . THR B 1 543 ? 34.754  4.443   -19.727 1.00 99.28 ? 543  THR B CA  1 
ATOM   8350 C  C   . THR B 1 543 ? 35.701  4.135   -18.539 1.00 99.28 ? 543  THR B C   1 
ATOM   8351 O  O   . THR B 1 543 ? 36.032  2.945   -18.299 1.00 99.14 ? 543  THR B O   1 
ATOM   8352 C  CB  . THR B 1 543 ? 34.574  3.157   -20.631 1.00 99.28 ? 543  THR B CB  1 
ATOM   8353 O  OG1 . THR B 1 543 ? 34.519  3.532   -22.017 1.00 99.28 ? 543  THR B OG1 1 
ATOM   8354 C  CG2 . THR B 1 543 ? 33.256  2.422   -20.281 1.00 99.28 ? 543  THR B CG2 1 
ATOM   8355 O  OXT . THR B 1 543 ? 36.082  5.099   -17.832 1.00 99.28 ? 543  THR B OXT 1 
HETATM 8356 C  C1  . NAG C 2 .   ? 25.238  35.530  -1.012  1.00 84.87 ? 1    NAG C C1  1 
HETATM 8357 C  C2  . NAG C 2 .   ? 25.352  36.110  -2.447  1.00 87.15 ? 1    NAG C C2  1 
HETATM 8358 C  C3  . NAG C 2 .   ? 26.603  35.563  -3.167  1.00 88.54 ? 1    NAG C C3  1 
HETATM 8359 C  C4  . NAG C 2 .   ? 27.857  35.695  -2.306  1.00 89.45 ? 1    NAG C C4  1 
HETATM 8360 C  C5  . NAG C 2 .   ? 27.616  35.091  -0.919  1.00 90.20 ? 1    NAG C C5  1 
HETATM 8361 C  C6  . NAG C 2 .   ? 28.805  35.293  0.027   1.00 92.92 ? 1    NAG C C6  1 
HETATM 8362 C  C7  . NAG C 2 .   ? 23.532  36.708  -3.931  1.00 88.99 ? 1    NAG C C7  1 
HETATM 8363 C  C8  . NAG C 2 .   ? 23.480  36.523  -5.448  1.00 88.84 ? 1    NAG C C8  1 
HETATM 8364 N  N2  . NAG C 2 .   ? 24.159  35.775  -3.215  1.00 88.75 ? 1    NAG C N2  1 
HETATM 8365 O  O3  . NAG C 2 .   ? 26.812  36.277  -4.374  1.00 89.02 ? 1    NAG C O3  1 
HETATM 8366 O  O4  . NAG C 2 .   ? 28.947  35.036  -2.942  1.00 89.23 ? 1    NAG C O4  1 
HETATM 8367 O  O5  . NAG C 2 .   ? 26.473  35.724  -0.298  1.00 87.75 ? 1    NAG C O5  1 
HETATM 8368 O  O6  . NAG C 2 .   ? 29.111  36.704  0.162   1.00 95.75 ? 1    NAG C O6  1 
HETATM 8369 O  O7  . NAG C 2 .   ? 23.004  37.699  -3.416  1.00 89.13 ? 1    NAG C O7  1 
HETATM 8370 C  C1  . FUC C 2 .   ? 29.021  37.159  1.490   1.00 97.77 ? 2    FUC C C1  1 
HETATM 8371 C  C2  . FUC C 2 .   ? 29.968  38.353  1.710   1.00 98.96 ? 2    FUC C C2  1 
HETATM 8372 C  C3  . FUC C 2 .   ? 29.436  39.634  1.036   1.00 99.28 ? 2    FUC C C3  1 
HETATM 8373 C  C4  . FUC C 2 .   ? 27.956  39.895  1.388   1.00 99.28 ? 2    FUC C C4  1 
HETATM 8374 C  C5  . FUC C 2 .   ? 27.103  38.629  1.176   1.00 99.22 ? 2    FUC C C5  1 
HETATM 8375 C  C6  . FUC C 2 .   ? 25.676  38.800  1.679   1.00 98.11 ? 2    FUC C C6  1 
HETATM 8376 O  O2  . FUC C 2 .   ? 31.255  38.043  1.187   1.00 99.28 ? 2    FUC C O2  1 
HETATM 8377 O  O3  . FUC C 2 .   ? 30.226  40.749  1.441   1.00 99.28 ? 2    FUC C O3  1 
HETATM 8378 O  O4  . FUC C 2 .   ? 27.829  40.352  2.732   1.00 99.28 ? 2    FUC C O4  1 
HETATM 8379 O  O5  . FUC C 2 .   ? 27.683  37.500  1.883   1.00 98.27 ? 2    FUC C O5  1 
HETATM 8380 C  C1  . NAG D 3 .   ? 12.438  34.385  25.645  1.00 90.36 ? 701  NAG A C1  1 
HETATM 8381 C  C2  . NAG D 3 .   ? 13.799  35.072  25.441  1.00 93.31 ? 701  NAG A C2  1 
HETATM 8382 C  C3  . NAG D 3 .   ? 13.960  36.254  26.420  1.00 95.13 ? 701  NAG A C3  1 
HETATM 8383 C  C4  . NAG D 3 .   ? 12.764  37.210  26.296  1.00 96.04 ? 701  NAG A C4  1 
HETATM 8384 C  C5  . NAG D 3 .   ? 11.449  36.424  26.471  1.00 95.66 ? 701  NAG A C5  1 
HETATM 8385 C  C6  . NAG D 3 .   ? 10.216  37.296  26.268  1.00 96.20 ? 701  NAG A C6  1 
HETATM 8386 C  C7  . NAG D 3 .   ? 15.264  33.355  24.597  1.00 94.61 ? 701  NAG A C7  1 
HETATM 8387 C  C8  . NAG D 3 .   ? 15.603  31.897  24.894  1.00 94.23 ? 701  NAG A C8  1 
HETATM 8388 N  N2  . NAG D 3 .   ? 14.880  34.117  25.620  1.00 94.02 ? 701  NAG A N2  1 
HETATM 8389 O  O3  . NAG D 3 .   ? 15.166  36.961  26.141  1.00 95.45 ? 701  NAG A O3  1 
HETATM 8390 O  O4  . NAG D 3 .   ? 12.859  38.241  27.278  1.00 97.54 ? 701  NAG A O4  1 
HETATM 8391 O  O5  . NAG D 3 .   ? 11.376  35.346  25.501  1.00 93.33 ? 701  NAG A O5  1 
HETATM 8392 O  O6  . NAG D 3 .   ? 10.249  37.958  25.007  1.00 96.91 ? 701  NAG A O6  1 
HETATM 8393 O  O7  . NAG D 3 .   ? 15.339  33.782  23.439  1.00 94.45 ? 701  NAG A O7  1 
HETATM 8394 C  C   . CO3 E 4 .   ? 29.931  16.158  12.390  1.00 64.93 ? 903  CO3 A C   1 
HETATM 8395 O  O1  . CO3 E 4 .   ? 29.780  16.884  11.337  1.00 66.05 ? 903  CO3 A O1  1 
HETATM 8396 O  O2  . CO3 E 4 .   ? 30.479  14.955  12.263  1.00 62.06 ? 903  CO3 A O2  1 
HETATM 8397 O  O3  . CO3 E 4 .   ? 29.493  16.590  13.578  1.00 61.00 ? 903  CO3 A O3  1 
HETATM 8398 CL CL  . CL  F 5 .   ? 33.069  22.578  8.849   1.00 85.10 ? 999  CL  A CL  1 
HETATM 8399 CL CL  . CL  G 5 .   ? 36.394  28.362  7.623   0.80 90.87 ? 1867 CL  A CL  1 
HETATM 8400 C  C2  . DCU H 6 .   ? 39.111  24.078  4.951   1.00 91.86 ? 951  DCU A C2  1 
HETATM 8401 C  C3  . DCU H 6 .   ? 38.871  24.003  3.408   1.00 92.83 ? 951  DCU A C3  1 
HETATM 8402 C  C4  . DCU H 6 .   ? 39.099  22.666  2.667   1.00 93.02 ? 951  DCU A C4  1 
HETATM 8403 C  C5  . DCU H 6 .   ? 40.585  22.253  2.724   1.00 94.44 ? 951  DCU A C5  1 
HETATM 8404 C  C6  . DCU H 6 .   ? 41.331  22.526  1.435   1.00 95.59 ? 951  DCU A C6  1 
HETATM 8405 C  C7  . DCU H 6 .   ? 42.634  21.962  1.312   1.00 96.13 ? 951  DCU A C7  1 
HETATM 8406 C  C8  . DCU H 6 .   ? 43.321  22.170  -0.031  1.00 96.48 ? 951  DCU A C8  1 
HETATM 8407 C  C9  . DCU H 6 .   ? 44.852  22.381  0.078   1.00 97.86 ? 951  DCU A C9  1 
HETATM 8408 C  C10 . DCU H 6 .   ? 45.594  21.689  -1.065  1.00 98.55 ? 951  DCU A C10 1 
HETATM 8409 C  C11 . DCU H 6 .   ? 46.836  22.410  -1.665  1.00 99.28 ? 951  DCU A C11 1 
HETATM 8410 N  N12 . DCU H 6 .   ? 48.167  21.719  -1.441  1.00 99.28 ? 951  DCU A N12 1 
HETATM 8411 C  C13 . DCU H 6 .   ? 49.241  22.599  -1.915  1.00 99.28 ? 951  DCU A C13 1 
HETATM 8412 C  C14 . DCU H 6 .   ? 48.258  20.436  -2.198  1.00 99.28 ? 951  DCU A C14 1 
HETATM 8413 C  C15 . DCU H 6 .   ? 48.428  21.438  -0.007  1.00 99.28 ? 951  DCU A C15 1 
HETATM 8414 C  C16 . DCU H 6 .   ? 41.184  27.210  9.487   1.00 90.14 ? 951  DCU A C16 1 
HETATM 8415 C  C17 . DCU H 6 .   ? 40.531  26.697  8.321   1.00 90.14 ? 951  DCU A C17 1 
HETATM 8416 C  C18 . DCU H 6 .   ? 41.324  26.690  7.056   1.00 90.75 ? 951  DCU A C18 1 
HETATM 8417 C  C19 . DCU H 6 .   ? 42.654  27.267  7.117   1.00 90.16 ? 951  DCU A C19 1 
HETATM 8418 C  C20 . DCU H 6 .   ? 43.247  27.780  8.304   1.00 90.37 ? 951  DCU A C20 1 
HETATM 8419 C  C21 . DCU H 6 .   ? 42.507  27.748  9.505   1.00 90.06 ? 951  DCU A C21 1 
HETATM 8420 C  C22 . DCU H 6 .   ? 40.885  25.836  5.978   1.00 91.07 ? 951  DCU A C22 1 
HETATM 8421 N  N23 . DCU H 6 .   ? 39.631  25.127  6.040   1.00 91.12 ? 951  DCU A N23 1 
HETATM 8422 C  C24 . DCU H 6 .   ? 38.786  25.303  7.185   1.00 90.02 ? 951  DCU A C24 1 
HETATM 8423 C  C25 . DCU H 6 .   ? 39.208  26.164  8.312   1.00 88.99 ? 951  DCU A C25 1 
HETATM 8424 C  C26 . DCU H 6 .   ? 37.568  24.552  7.413   1.00 89.26 ? 951  DCU A C26 1 
HETATM 8425 C  C27 . DCU H 6 .   ? 36.787  24.588  8.599   1.00 88.31 ? 951  DCU A C27 1 
HETATM 8426 C  C28 . DCU H 6 .   ? 37.210  25.411  9.639   1.00 88.09 ? 951  DCU A C28 1 
HETATM 8427 C  C29 . DCU H 6 .   ? 38.396  26.171  9.466   1.00 88.12 ? 951  DCU A C29 1 
HETATM 8428 C  C30 . DCU H 6 .   ? 41.756  25.744  4.755   1.00 91.85 ? 951  DCU A C30 1 
HETATM 8429 C  C31 . DCU H 6 .   ? 42.774  24.733  4.683   1.00 91.59 ? 951  DCU A C31 1 
HETATM 8430 C  C32 . DCU H 6 .   ? 43.643  24.672  3.556   1.00 91.17 ? 951  DCU A C32 1 
HETATM 8431 C  C33 . DCU H 6 .   ? 43.505  25.605  2.500   1.00 91.57 ? 951  DCU A C33 1 
HETATM 8432 C  C34 . DCU H 6 .   ? 42.492  26.607  2.564   1.00 92.40 ? 951  DCU A C34 1 
HETATM 8433 C  C35 . DCU H 6 .   ? 41.618  26.673  3.694   1.00 92.12 ? 951  DCU A C35 1 
HETATM 8434 N  N36 . DCU H 6 .   ? 44.540  28.337  8.304   1.00 89.04 ? 951  DCU A N36 1 
HETATM 8435 N  N37 . DCU H 6 .   ? 35.622  23.815  8.769   1.00 87.46 ? 951  DCU A N37 1 
HETATM 8436 C  C1  . NAG I 3 .   ? 6.138   -17.565 -21.140 1.00 94.65 ? 601  NAG B C1  1 
HETATM 8437 C  C2  . NAG I 3 .   ? 6.828   -18.133 -19.877 1.00 97.06 ? 601  NAG B C2  1 
HETATM 8438 C  C3  . NAG I 3 .   ? 8.346   -18.295 -20.096 1.00 97.70 ? 601  NAG B C3  1 
HETATM 8439 C  C4  . NAG I 3 .   ? 8.645   -19.067 -21.391 1.00 97.59 ? 601  NAG B C4  1 
HETATM 8440 C  C5  . NAG I 3 .   ? 7.873   -18.455 -22.574 1.00 97.62 ? 601  NAG B C5  1 
HETATM 8441 C  C6  . NAG I 3 .   ? 8.033   -19.276 -23.860 1.00 98.76 ? 601  NAG B C6  1 
HETATM 8442 C  C7  . NAG I 3 .   ? 5.655   -17.580 -17.836 1.00 99.28 ? 601  NAG B C7  1 
HETATM 8443 C  C8  . NAG I 3 .   ? 4.729   -16.446 -17.376 1.00 98.80 ? 601  NAG B C8  1 
HETATM 8444 N  N2  . NAG I 3 .   ? 6.595   -17.269 -18.728 1.00 98.67 ? 601  NAG B N2  1 
HETATM 8445 O  O3  . NAG I 3 .   ? 8.919   -18.984 -18.990 1.00 97.92 ? 601  NAG B O3  1 
HETATM 8446 O  O4  . NAG I 3 .   ? 10.046  -19.032 -21.657 1.00 96.66 ? 601  NAG B O4  1 
HETATM 8447 O  O5  . NAG I 3 .   ? 6.454   -18.393 -22.276 1.00 96.18 ? 601  NAG B O5  1 
HETATM 8448 O  O6  . NAG I 3 .   ? 6.811   -19.896 -24.267 1.00 99.28 ? 601  NAG B O6  1 
HETATM 8449 O  O7  . NAG I 3 .   ? 5.507   -18.729 -17.387 1.00 98.86 ? 601  NAG B O7  1 
HETATM 8450 C  C   . CO3 J 4 .   ? 10.038  -0.409  -37.417 1.00 76.82 ? 904  CO3 B C   1 
HETATM 8451 O  O1  . CO3 J 4 .   ? 11.066  0.247   -37.819 1.00 76.12 ? 904  CO3 B O1  1 
HETATM 8452 O  O2  . CO3 J 4 .   ? 9.029   -0.636  -38.265 1.00 74.80 ? 904  CO3 B O2  1 
HETATM 8453 O  O3  . CO3 J 4 .   ? 9.980   -0.798  -36.148 1.00 75.87 ? 904  CO3 B O3  1 
HETATM 8454 O  O1  . P6G K 7 .   ? 15.500  6.569   -11.950 1.00 77.14 ? 901  P6G B O1  1 
HETATM 8455 C  C2  . P6G K 7 .   ? 16.667  6.949   -11.193 1.00 75.69 ? 901  P6G B C2  1 
HETATM 8456 C  C3  . P6G K 7 .   ? 18.169  6.629   -11.397 1.00 73.34 ? 901  P6G B C3  1 
HETATM 8457 O  O4  . P6G K 7 .   ? 18.961  6.230   -10.106 1.00 71.21 ? 901  P6G B O4  1 
HETATM 8458 C  C5  . P6G K 7 .   ? 19.253  4.824   -10.008 1.00 69.80 ? 901  P6G B C5  1 
HETATM 8459 C  C6  . P6G K 7 .   ? 20.678  4.679   -10.085 1.00 68.09 ? 901  P6G B C6  1 
HETATM 8460 O  O7  . P6G K 7 .   ? 21.379  5.168   -11.362 1.00 67.42 ? 901  P6G B O7  1 
HETATM 8461 C  C8  . P6G K 7 .   ? 22.500  4.352   -11.749 1.00 64.43 ? 901  P6G B C8  1 
HETATM 8462 C  C9  . P6G K 7 .   ? 23.137  4.920   -13.025 1.00 63.61 ? 901  P6G B C9  1 
HETATM 8463 O  O10 . P6G K 7 .   ? 23.236  6.526   -13.076 1.00 61.25 ? 901  P6G B O10 1 
HETATM 8464 C  C11 . P6G K 7 .   ? 23.962  7.117   -14.160 1.00 59.65 ? 901  P6G B C11 1 
HETATM 8465 C  C12 . P6G K 7 .   ? 23.959  8.560   -14.041 1.00 61.02 ? 901  P6G B C12 1 
HETATM 8466 O  O13 . P6G K 7 .   ? 22.591  9.328   -14.198 1.00 63.29 ? 901  P6G B O13 1 
HETATM 8467 C  C14 . P6G K 7 .   ? 22.592  10.456  -15.113 1.00 64.57 ? 901  P6G B C14 1 
HETATM 8468 C  C15 . P6G K 7 .   ? 21.277  11.044  -15.250 1.00 66.78 ? 901  P6G B C15 1 
HETATM 8469 O  O16 . P6G K 7 .   ? 20.168  10.342  -14.400 1.00 70.10 ? 901  P6G B O16 1 
HETATM 8470 C  C17 . P6G K 7 .   ? 18.972  11.098  -14.140 1.00 69.48 ? 901  P6G B C17 1 
HETATM 8471 C  C18 . P6G K 7 .   ? 18.158  10.330  -13.280 1.00 70.15 ? 901  P6G B C18 1 
HETATM 8472 O  O19 . P6G K 7 .   ? 17.715  11.092  -11.957 1.00 71.45 ? 901  P6G B O19 1 
HETATM 8473 C  C1  . PG4 L 8 .   ? 8.663   8.013   -9.750  1.00 97.14 ? 902  PG4 B C1  1 
HETATM 8474 C  C2  . PG4 L 8 .   ? 9.795   7.120   -9.752  1.00 97.86 ? 902  PG4 B C2  1 
HETATM 8475 O  O2  . PG4 L 8 .   ? 9.358   5.733   -9.658  1.00 98.04 ? 902  PG4 B O2  1 
HETATM 8476 C  C3  . PG4 L 8 .   ? 10.503  4.587   -9.658  1.00 97.61 ? 902  PG4 B C3  1 
HETATM 8477 C  C4  . PG4 L 8 .   ? 11.530  4.701   -10.788 1.00 97.68 ? 902  PG4 B C4  1 
HETATM 8478 O  O3  . PG4 L 8 .   ? 11.494  3.552   -11.637 1.00 97.76 ? 902  PG4 B O3  1 
HETATM 8479 C  C5  . PG4 L 8 .   ? 12.499  3.658   -12.795 1.00 98.09 ? 902  PG4 B C5  1 
HETATM 8480 C  C6  . PG4 L 8 .   ? 11.992  4.120   -14.057 1.00 98.24 ? 902  PG4 B C6  1 
HETATM 8481 O  O4  . PG4 L 8 .   ? 11.618  2.939   -14.808 1.00 98.49 ? 902  PG4 B O4  1 
HETATM 8482 C  C7  . PG4 L 8 .   ? 10.205  3.015   -15.485 1.00 97.17 ? 902  PG4 B C7  1 
HETATM 8483 C  C8  . PG4 L 8 .   ? 9.500   1.653   -15.675 1.00 95.78 ? 902  PG4 B C8  1 
HETATM 8484 C  C2  . DCU M 6 .   ? 17.407  -12.111 -35.165 0.80 90.33 ? 952  DCU B C2  1 
HETATM 8485 C  C3  . DCU M 6 .   ? 18.331  -12.211 -33.910 0.80 90.60 ? 952  DCU B C3  1 
HETATM 8486 C  C4  . DCU M 6 .   ? 19.471  -11.177 -33.723 0.80 89.86 ? 952  DCU B C4  1 
HETATM 8487 C  C5  . DCU M 6 .   ? 20.663  -11.496 -34.652 0.80 90.28 ? 952  DCU B C5  1 
HETATM 8488 C  C6  . DCU M 6 .   ? 21.786  -12.228 -33.946 0.80 89.77 ? 952  DCU B C6  1 
HETATM 8489 C  C7  . DCU M 6 .   ? 22.970  -12.475 -34.697 0.80 89.83 ? 952  DCU B C7  1 
HETATM 8490 C  C8  . DCU M 6 .   ? 24.268  -12.414 -33.908 0.80 90.16 ? 952  DCU B C8  1 
HETATM 8491 C  C9  . DCU M 6 .   ? 24.852  -13.796 -33.512 0.80 90.50 ? 952  DCU B C9  1 
HETATM 8492 C  C10 . DCU M 6 .   ? 26.356  -13.823 -33.755 0.80 91.47 ? 952  DCU B C10 1 
HETATM 8493 C  C11 . DCU M 6 .   ? 26.926  -14.884 -34.735 0.80 93.12 ? 952  DCU B C11 1 
HETATM 8494 N  N12 . DCU M 6 .   ? 27.968  -14.365 -35.694 0.80 94.34 ? 952  DCU B N12 1 
HETATM 8495 C  C13 . DCU M 6 .   ? 28.400  -15.463 -36.564 0.80 94.10 ? 952  DCU B C13 1 
HETATM 8496 C  C14 . DCU M 6 .   ? 29.173  -13.842 -34.983 0.80 93.54 ? 952  DCU B C14 1 
HETATM 8497 C  C15 . DCU M 6 .   ? 27.435  -13.285 -36.566 0.80 94.35 ? 952  DCU B C15 1 
HETATM 8498 C  C16 . DCU M 6 .   ? 14.718  -15.092 -39.558 0.80 89.20 ? 952  DCU B C16 1 
HETATM 8499 C  C17 . DCU M 6 .   ? 15.234  -14.484 -38.371 0.80 89.98 ? 952  DCU B C17 1 
HETATM 8500 C  C18 . DCU M 6 .   ? 16.598  -14.921 -37.948 0.80 90.05 ? 952  DCU B C18 1 
HETATM 8501 C  C19 . DCU M 6 .   ? 17.280  -15.858 -38.812 0.80 88.94 ? 952  DCU B C19 1 
HETATM 8502 C  C20 . DCU M 6 .   ? 16.726  -16.410 -39.988 0.80 88.73 ? 952  DCU B C20 1 
HETATM 8503 C  C21 . DCU M 6 .   ? 15.428  -16.028 -40.369 0.80 88.50 ? 952  DCU B C21 1 
HETATM 8504 C  C22 . DCU M 6 .   ? 17.271  -14.197 -36.892 0.80 90.39 ? 952  DCU B C22 1 
HETATM 8505 N  N23 . DCU M 6 .   ? 16.700  -13.033 -36.265 0.80 90.66 ? 952  DCU B N23 1 
HETATM 8506 C  C24 . DCU M 6 .   ? 15.394  -12.602 -36.684 0.80 90.53 ? 952  DCU B C24 1 
HETATM 8507 C  C25 . DCU M 6 .   ? 14.654  -13.323 -37.759 0.80 90.01 ? 952  DCU B C25 1 
HETATM 8508 C  C26 . DCU M 6 .   ? 14.745  -11.398 -36.197 0.80 90.41 ? 952  DCU B C26 1 
HETATM 8509 C  C27 . DCU M 6 .   ? 13.517  -10.864 -36.690 0.80 90.48 ? 952  DCU B C27 1 
HETATM 8510 C  C28 . DCU M 6 .   ? 12.862  -11.547 -37.725 0.80 90.02 ? 952  DCU B C28 1 
HETATM 8511 C  C29 . DCU M 6 .   ? 13.445  -12.745 -38.227 0.80 89.87 ? 952  DCU B C29 1 
HETATM 8512 C  C30 . DCU M 6 .   ? 18.584  -14.735 -36.405 0.80 91.02 ? 952  DCU B C30 1 
HETATM 8513 C  C31 . DCU M 6 .   ? 19.804  -14.330 -37.046 0.80 91.64 ? 952  DCU B C31 1 
HETATM 8514 C  C32 . DCU M 6 .   ? 21.051  -14.868 -36.613 0.80 91.20 ? 952  DCU B C32 1 
HETATM 8515 C  C33 . DCU M 6 .   ? 21.090  -15.800 -35.544 0.80 91.42 ? 952  DCU B C33 1 
HETATM 8516 C  C34 . DCU M 6 .   ? 19.881  -16.197 -34.905 0.80 91.63 ? 952  DCU B C34 1 
HETATM 8517 C  C35 . DCU M 6 .   ? 18.630  -15.659 -35.342 0.80 91.31 ? 952  DCU B C35 1 
HETATM 8518 N  N36 . DCU M 6 .   ? 17.447  -17.315 -40.786 0.80 88.52 ? 952  DCU B N36 1 
HETATM 8519 N  N37 . DCU M 6 .   ? 12.945  -9.673  -36.191 0.80 89.72 ? 952  DCU B N37 1 
HETATM 8520 O  O   . HOH N 9 .   ? 19.386  12.449  13.275  1.00 37.02 ? 1868 HOH A O   1 
HETATM 8521 O  O   . HOH N 9 .   ? 18.040  15.359  29.030  1.00 39.03 ? 1869 HOH A O   1 
HETATM 8522 O  O   . HOH N 9 .   ? 26.609  15.817  18.499  1.00 33.22 ? 1870 HOH A O   1 
HETATM 8523 O  O   . HOH N 9 .   ? 29.981  12.672  24.790  1.00 33.29 ? 1871 HOH A O   1 
HETATM 8524 O  O   . HOH N 9 .   ? 54.008  26.244  8.525   1.00 43.33 ? 1872 HOH A O   1 
HETATM 8525 O  O   . HOH N 9 .   ? 40.419  20.855  16.469  1.00 39.09 ? 1873 HOH A O   1 
HETATM 8526 O  O   . HOH N 9 .   ? 37.353  13.162  6.931   1.00 43.03 ? 1874 HOH A O   1 
HETATM 8527 O  O   . HOH N 9 .   ? 47.783  7.836   17.882  1.00 38.15 ? 1875 HOH A O   1 
HETATM 8528 O  O   . HOH N 9 .   ? 29.748  18.472  19.865  1.00 37.65 ? 1876 HOH A O   1 
HETATM 8529 O  O   . HOH N 9 .   ? 21.709  15.479  12.959  1.00 41.93 ? 1877 HOH A O   1 
HETATM 8530 O  O   . HOH N 9 .   ? 31.403  8.580   6.652   1.00 41.23 ? 1878 HOH A O   1 
HETATM 8531 O  O   . HOH N 9 .   ? 28.293  -0.993  37.561  1.00 41.56 ? 1879 HOH A O   1 
HETATM 8532 O  O   . HOH N 9 .   ? 11.429  18.125  34.082  1.00 44.92 ? 1880 HOH A O   1 
HETATM 8533 O  O   . HOH N 9 .   ? 32.984  17.234  32.588  1.00 40.77 ? 1881 HOH A O   1 
HETATM 8534 O  O   . HOH N 9 .   ? 22.795  20.525  7.433   1.00 34.06 ? 1882 HOH A O   1 
HETATM 8535 O  O   . HOH N 9 .   ? 36.828  2.123   36.995  1.00 42.83 ? 1883 HOH A O   1 
HETATM 8536 O  O   . HOH N 9 .   ? 39.438  16.479  1.091   1.00 42.21 ? 1884 HOH A O   1 
HETATM 8537 O  O   . HOH N 9 .   ? 31.244  16.478  1.035   1.00 43.35 ? 1885 HOH A O   1 
HETATM 8538 O  O   . HOH N 9 .   ? 38.843  15.640  12.664  1.00 36.52 ? 1886 HOH A O   1 
HETATM 8539 O  O   . HOH N 9 .   ? 42.204  19.391  18.219  1.00 39.83 ? 1887 HOH A O   1 
HETATM 8540 O  O   . HOH N 9 .   ? 42.839  1.280   45.207  1.00 46.74 ? 1888 HOH A O   1 
HETATM 8541 O  O   . HOH N 9 .   ? 26.332  15.584  28.180  1.00 41.38 ? 1889 HOH A O   1 
HETATM 8542 O  O   . HOH N 9 .   ? 24.656  24.011  23.358  1.00 35.77 ? 1890 HOH A O   1 
HETATM 8543 O  O   . HOH N 9 .   ? 35.830  17.735  24.581  1.00 35.33 ? 1891 HOH A O   1 
HETATM 8544 O  O   . HOH N 9 .   ? 9.822   -2.342  6.887   1.00 47.03 ? 1892 HOH A O   1 
HETATM 8545 O  O   . HOH N 9 .   ? 34.186  11.835  -2.568  1.00 45.35 ? 1893 HOH A O   1 
HETATM 8546 O  O   . HOH N 9 .   ? 47.173  11.180  10.981  1.00 40.46 ? 1894 HOH A O   1 
HETATM 8547 O  O   . HOH N 9 .   ? 20.389  18.215  2.654   1.00 43.08 ? 1895 HOH A O   1 
HETATM 8548 O  O   . HOH N 9 .   ? 41.251  12.904  33.780  1.00 42.64 ? 1896 HOH A O   1 
HETATM 8549 O  O   . HOH N 9 .   ? 43.114  7.952   14.157  1.00 36.23 ? 1897 HOH A O   1 
HETATM 8550 O  O   . HOH N 9 .   ? 24.241  9.008   48.283  1.00 48.06 ? 1898 HOH A O   1 
HETATM 8551 O  O   . HOH N 9 .   ? 15.017  21.499  14.295  1.00 39.78 ? 1899 HOH A O   1 
HETATM 8552 O  O   . HOH N 9 .   ? 30.344  20.939  19.036  1.00 36.50 ? 1900 HOH A O   1 
HETATM 8553 O  O   . HOH N 9 .   ? 46.559  12.889  22.721  1.00 43.10 ? 1901 HOH A O   1 
HETATM 8554 O  O   . HOH N 9 .   ? 5.911   12.203  14.140  1.00 45.15 ? 1902 HOH A O   1 
HETATM 8555 O  O   . HOH N 9 .   ? 41.323  17.030  21.738  1.00 41.46 ? 1903 HOH A O   1 
HETATM 8556 O  O   . HOH N 9 .   ? 30.389  27.362  -6.206  1.00 43.47 ? 1904 HOH A O   1 
HETATM 8557 O  O   . HOH N 9 .   ? 11.762  1.790   10.746  1.00 39.53 ? 1905 HOH A O   1 
HETATM 8558 O  O   . HOH N 9 .   ? 32.528  0.973   41.771  1.00 41.86 ? 1906 HOH A O   1 
HETATM 8559 O  O   . HOH N 9 .   ? 26.957  -5.222  21.692  1.00 45.58 ? 1907 HOH A O   1 
HETATM 8560 O  O   . HOH N 9 .   ? 37.060  -4.425  13.968  1.00 50.92 ? 1908 HOH A O   1 
HETATM 8561 O  O   . HOH N 9 .   ? 38.478  8.915   47.667  1.00 47.28 ? 1909 HOH A O   1 
HETATM 8562 O  O   . HOH N 9 .   ? 19.608  18.834  52.113  1.00 52.84 ? 1910 HOH A O   1 
HETATM 8563 O  O   . HOH N 9 .   ? 41.472  7.416   2.953   1.00 44.91 ? 1911 HOH A O   1 
HETATM 8564 O  O   . HOH N 9 .   ? 34.825  6.583   -10.542 1.00 54.72 ? 1912 HOH A O   1 
HETATM 8565 O  O   . HOH N 9 .   ? 44.321  19.143  16.448  1.00 39.38 ? 1913 HOH A O   1 
HETATM 8566 O  O   . HOH N 9 .   ? 15.378  2.270   1.994   1.00 50.58 ? 1914 HOH A O   1 
HETATM 8567 O  O   . HOH N 9 .   ? 43.568  9.788   11.326  1.00 40.48 ? 1915 HOH A O   1 
HETATM 8568 O  O   . HOH N 9 .   ? 29.221  0.424   29.497  1.00 34.08 ? 1916 HOH A O   1 
HETATM 8569 O  O   . HOH N 9 .   ? 32.480  17.191  29.824  1.00 36.95 ? 1917 HOH A O   1 
HETATM 8570 O  O   . HOH N 9 .   ? 10.632  11.058  3.533   1.00 55.79 ? 1918 HOH A O   1 
HETATM 8571 O  O   . HOH N 9 .   ? 25.791  23.033  29.887  1.00 45.48 ? 1919 HOH A O   1 
HETATM 8572 O  O   . HOH N 9 .   ? 45.896  8.373   29.820  1.00 48.26 ? 1920 HOH A O   1 
HETATM 8573 O  O   . HOH N 9 .   ? 38.753  12.474  4.785   1.00 35.25 ? 1921 HOH A O   1 
HETATM 8574 O  O   . HOH N 9 .   ? 27.266  18.173  14.806  1.00 63.20 ? 1922 HOH A O   1 
HETATM 8575 O  O   . HOH N 9 .   ? 44.832  11.606  9.389   1.00 45.01 ? 1923 HOH A O   1 
HETATM 8576 O  O   . HOH N 9 .   ? 40.883  -1.309  23.795  1.00 58.20 ? 1924 HOH A O   1 
HETATM 8577 O  O   . HOH N 9 .   ? 29.758  2.673   45.840  1.00 36.39 ? 1925 HOH A O   1 
HETATM 8578 O  O   . HOH N 9 .   ? 40.388  15.121  45.720  1.00 70.39 ? 1926 HOH A O   1 
HETATM 8579 O  O   . HOH N 9 .   ? 19.663  1.185   28.084  1.00 39.84 ? 1927 HOH A O   1 
HETATM 8580 O  O   . HOH N 9 .   ? 41.741  26.678  19.554  1.00 48.03 ? 1928 HOH A O   1 
HETATM 8581 O  O   . HOH N 9 .   ? 19.870  20.509  18.631  1.00 35.12 ? 1929 HOH A O   1 
HETATM 8582 O  O   . HOH N 9 .   ? 8.693   12.189  28.052  1.00 51.29 ? 1930 HOH A O   1 
HETATM 8583 O  O   . HOH N 9 .   ? 41.729  1.145   39.353  1.00 59.94 ? 1931 HOH A O   1 
HETATM 8584 O  O   . HOH N 9 .   ? 37.846  10.070  4.495   1.00 37.94 ? 1932 HOH A O   1 
HETATM 8585 O  O   . HOH N 9 .   ? 36.412  19.955  4.420   1.00 57.63 ? 1933 HOH A O   1 
HETATM 8586 O  O   . HOH N 9 .   ? 17.159  26.101  18.008  1.00 49.77 ? 1934 HOH A O   1 
HETATM 8587 O  O   . HOH N 9 .   ? 25.667  19.108  28.972  1.00 37.03 ? 1935 HOH A O   1 
HETATM 8588 O  O   . HOH N 9 .   ? 35.557  16.241  -7.605  1.00 62.06 ? 1936 HOH A O   1 
HETATM 8589 O  O   . HOH N 9 .   ? 42.253  14.408  31.774  1.00 44.03 ? 1937 HOH A O   1 
HETATM 8590 O  O   . HOH N 9 .   ? 44.090  1.191   6.016   1.00 44.41 ? 1938 HOH A O   1 
HETATM 8591 O  O   . HOH N 9 .   ? 15.094  -5.014  11.301  1.00 45.90 ? 1939 HOH A O   1 
HETATM 8592 O  O   . HOH N 9 .   ? 46.663  15.091  24.404  1.00 42.32 ? 1940 HOH A O   1 
HETATM 8593 O  O   . HOH N 9 .   ? 34.181  -1.264  41.678  1.00 48.65 ? 1941 HOH A O   1 
HETATM 8594 O  O   . HOH N 9 .   ? 47.235  8.392   27.159  1.00 59.23 ? 1942 HOH A O   1 
HETATM 8595 O  O   . HOH N 9 .   ? 37.180  17.155  38.440  1.00 49.36 ? 1943 HOH A O   1 
HETATM 8596 O  O   . HOH N 9 .   ? 40.983  17.108  12.558  1.00 40.84 ? 1944 HOH A O   1 
HETATM 8597 O  O   . HOH N 9 .   ? 44.206  15.788  25.233  1.00 44.48 ? 1945 HOH A O   1 
HETATM 8598 O  O   . HOH N 9 .   ? 53.177  9.807   21.788  1.00 44.72 ? 1946 HOH A O   1 
HETATM 8599 O  O   . HOH N 9 .   ? 28.289  4.766   46.994  1.00 38.89 ? 1947 HOH A O   1 
HETATM 8600 O  O   . HOH N 9 .   ? 33.554  19.642  29.115  1.00 38.60 ? 1948 HOH A O   1 
HETATM 8601 O  O   . HOH N 9 .   ? 36.639  9.641   0.642   1.00 49.25 ? 1949 HOH A O   1 
HETATM 8602 O  O   . HOH N 9 .   ? 34.309  5.252   6.462   1.00 39.04 ? 1950 HOH A O   1 
HETATM 8603 O  O   . HOH N 9 .   ? 51.352  3.595   7.529   1.00 49.91 ? 1951 HOH A O   1 
HETATM 8604 O  O   . HOH N 9 .   ? 41.043  11.770  1.450   1.00 48.69 ? 1952 HOH A O   1 
HETATM 8605 O  O   . HOH N 9 .   ? 52.847  16.807  24.675  1.00 46.02 ? 1953 HOH A O   1 
HETATM 8606 O  O   . HOH N 9 .   ? 38.573  3.842   38.375  1.00 44.38 ? 1954 HOH A O   1 
HETATM 8607 O  O   . HOH N 9 .   ? 17.661  19.701  -0.539  1.00 44.12 ? 1955 HOH A O   1 
HETATM 8608 O  O   . HOH N 9 .   ? 31.639  25.892  -12.791 1.00 48.59 ? 1956 HOH A O   1 
HETATM 8609 O  O   . HOH N 9 .   ? 50.457  6.527   28.134  1.00 48.01 ? 1957 HOH A O   1 
HETATM 8610 O  O   . HOH N 9 .   ? 17.725  3.103   0.532   1.00 60.32 ? 1958 HOH A O   1 
HETATM 8611 O  O   . HOH N 9 .   ? 16.537  14.404  -8.769  1.00 57.05 ? 1959 HOH A O   1 
HETATM 8612 O  O   . HOH N 9 .   ? 20.279  15.312  1.878   1.00 42.45 ? 1960 HOH A O   1 
HETATM 8613 O  O   . HOH N 9 .   ? 15.323  8.478   -4.269  1.00 55.29 ? 1961 HOH A O   1 
HETATM 8614 O  O   . HOH N 9 .   ? 37.666  19.534  -4.835  1.00 45.55 ? 1962 HOH A O   1 
HETATM 8615 O  O   . HOH N 9 .   ? 9.827   7.299   0.957   1.00 46.51 ? 1963 HOH A O   1 
HETATM 8616 O  O   . HOH N 9 .   ? 53.257  14.319  3.938   1.00 45.16 ? 1964 HOH A O   1 
HETATM 8617 O  O   . HOH N 9 .   ? 16.468  -2.857  29.846  1.00 57.06 ? 1965 HOH A O   1 
HETATM 8618 O  O   . HOH N 9 .   ? 19.238  36.864  -1.350  1.00 57.46 ? 1966 HOH A O   1 
HETATM 8619 O  O   . HOH N 9 .   ? 18.761  15.387  4.080   1.00 42.33 ? 1967 HOH A O   1 
HETATM 8620 O  O   . HOH N 9 .   ? 28.058  8.219   -0.245  1.00 54.78 ? 1968 HOH A O   1 
HETATM 8621 O  O   . HOH N 9 .   ? 51.533  7.549   2.929   1.00 51.70 ? 1969 HOH A O   1 
HETATM 8622 O  O   . HOH N 9 .   ? 25.758  4.701   46.198  1.00 42.76 ? 1970 HOH A O   1 
HETATM 8623 O  O   . HOH N 9 .   ? 12.412  28.186  12.383  1.00 52.82 ? 1971 HOH A O   1 
HETATM 8624 O  O   . HOH N 9 .   ? 39.951  28.068  26.882  1.00 49.28 ? 1972 HOH A O   1 
HETATM 8625 O  O   . HOH N 9 .   ? 7.133   25.920  26.716  1.00 59.74 ? 1973 HOH A O   1 
HETATM 8626 O  O   . HOH N 9 .   ? 36.930  6.194   2.541   1.00 74.61 ? 1974 HOH A O   1 
HETATM 8627 O  O   . HOH N 9 .   ? 34.918  -2.559  33.362  1.00 46.69 ? 1975 HOH A O   1 
HETATM 8628 O  O   . HOH N 9 .   ? 15.860  31.509  3.501   1.00 59.23 ? 1976 HOH A O   1 
HETATM 8629 O  O   . HOH N 9 .   ? 31.383  21.446  16.510  1.00 39.17 ? 1977 HOH A O   1 
HETATM 8630 O  O   . HOH N 9 .   ? 36.937  3.488   46.235  1.00 46.03 ? 1978 HOH A O   1 
HETATM 8631 O  O   . HOH N 9 .   ? 23.448  20.501  45.807  1.00 47.32 ? 1979 HOH A O   1 
HETATM 8632 O  O   . HOH N 9 .   ? 4.465   -1.902  17.522  1.00 60.72 ? 1980 HOH A O   1 
HETATM 8633 O  O   . HOH N 9 .   ? 54.124  20.188  25.946  1.00 74.95 ? 1981 HOH A O   1 
HETATM 8634 O  O   . HOH N 9 .   ? 19.669  24.255  38.978  1.00 53.47 ? 1982 HOH A O   1 
HETATM 8635 O  O   . HOH N 9 .   ? 34.775  24.083  18.668  1.00 49.10 ? 1983 HOH A O   1 
HETATM 8636 O  O   . HOH N 9 .   ? 41.939  0.689   4.594   1.00 57.40 ? 1984 HOH A O   1 
HETATM 8637 O  O   . HOH N 9 .   ? 17.229  -2.088  34.014  1.00 43.85 ? 1985 HOH A O   1 
HETATM 8638 O  O   . HOH N 9 .   ? 42.853  17.699  23.910  1.00 61.13 ? 1986 HOH A O   1 
HETATM 8639 O  O   . HOH N 9 .   ? 39.746  19.059  10.439  1.00 55.07 ? 1987 HOH A O   1 
HETATM 8640 O  O   . HOH N 9 .   ? 15.172  16.245  -9.955  1.00 57.85 ? 1988 HOH A O   1 
HETATM 8641 O  O   . HOH N 9 .   ? 18.437  21.421  1.839   1.00 52.82 ? 1989 HOH A O   1 
HETATM 8642 O  O   . HOH N 9 .   ? 50.022  0.352   16.160  1.00 52.75 ? 1990 HOH A O   1 
HETATM 8643 O  O   . HOH N 9 .   ? 39.589  4.272   45.553  1.00 54.80 ? 1991 HOH A O   1 
HETATM 8644 O  O   . HOH N 9 .   ? 36.713  5.369   39.176  1.00 40.68 ? 1992 HOH A O   1 
HETATM 8645 O  O   . HOH N 9 .   ? 3.655   7.261   18.306  1.00 48.75 ? 1993 HOH A O   1 
HETATM 8646 O  O   . HOH N 9 .   ? 51.080  17.946  26.266  1.00 45.51 ? 1994 HOH A O   1 
HETATM 8647 O  O   . HOH N 9 .   ? 49.448  4.582   27.368  1.00 57.50 ? 1995 HOH A O   1 
HETATM 8648 O  O   . HOH N 9 .   ? 21.849  20.179  52.937  1.00 61.89 ? 1996 HOH A O   1 
HETATM 8649 O  O   . HOH N 9 .   ? 27.680  9.160   7.657   1.00 46.51 ? 1997 HOH A O   1 
HETATM 8650 O  O   . HOH N 9 .   ? 15.838  26.551  -15.984 1.00 49.96 ? 1998 HOH A O   1 
HETATM 8651 O  O   . HOH N 9 .   ? 53.890  11.481  2.742   1.00 54.03 ? 1999 HOH A O   1 
HETATM 8652 O  O   . HOH N 9 .   ? 47.388  3.054   41.251  1.00 52.71 ? 2000 HOH A O   1 
HETATM 8653 O  O   . HOH N 9 .   ? 5.669   24.625  17.093  1.00 52.20 ? 2001 HOH A O   1 
HETATM 8654 O  O   . HOH N 9 .   ? 26.687  20.049  46.212  1.00 55.03 ? 2002 HOH A O   1 
HETATM 8655 O  O   . HOH N 9 .   ? 20.538  22.826  29.019  1.00 53.30 ? 2003 HOH A O   1 
HETATM 8656 O  O   . HOH N 9 .   ? 30.954  19.383  -11.897 1.00 53.71 ? 2004 HOH A O   1 
HETATM 8657 O  O   . HOH N 9 .   ? 40.665  3.865   39.754  1.00 56.78 ? 2005 HOH A O   1 
HETATM 8658 O  O   . HOH N 9 .   ? 26.163  29.099  -15.386 1.00 49.51 ? 2006 HOH A O   1 
HETATM 8659 O  O   . HOH N 9 .   ? 40.541  2.107   26.080  1.00 50.61 ? 2007 HOH A O   1 
HETATM 8660 O  O   . HOH N 9 .   ? 44.285  2.320   38.108  1.00 50.20 ? 2008 HOH A O   1 
HETATM 8661 O  O   . HOH N 9 .   ? 34.308  18.785  38.778  1.00 66.26 ? 2009 HOH A O   1 
HETATM 8662 O  O   . HOH N 9 .   ? 48.530  1.402   14.180  1.00 52.56 ? 2010 HOH A O   1 
HETATM 8663 O  O   . HOH N 9 .   ? 18.212  24.073  0.682   1.00 51.21 ? 2011 HOH A O   1 
HETATM 8664 O  O   . HOH N 9 .   ? 39.677  16.663  47.414  1.00 55.96 ? 2012 HOH A O   1 
HETATM 8665 O  O   . HOH N 9 .   ? 26.697  25.433  25.362  1.00 55.90 ? 2013 HOH A O   1 
HETATM 8666 O  O   . HOH N 9 .   ? 42.551  13.605  36.168  1.00 48.08 ? 2014 HOH A O   1 
HETATM 8667 O  O   . HOH N 9 .   ? 7.927   -2.918  16.672  1.00 51.91 ? 2015 HOH A O   1 
HETATM 8668 O  O   . HOH N 9 .   ? 16.745  13.581  -5.695  1.00 64.59 ? 2016 HOH A O   1 
HETATM 8669 O  O   . HOH N 9 .   ? 28.589  4.110   2.580   1.00 56.82 ? 2017 HOH A O   1 
HETATM 8670 O  O   . HOH N 9 .   ? 46.420  2.379   39.128  1.00 62.23 ? 2018 HOH A O   1 
HETATM 8671 O  O   . HOH N 9 .   ? 48.635  21.565  26.521  1.00 51.37 ? 2019 HOH A O   1 
HETATM 8672 O  O   . HOH N 9 .   ? 26.733  -7.500  25.386  1.00 55.59 ? 2020 HOH A O   1 
HETATM 8673 O  O   . HOH N 9 .   ? 47.955  -0.006  11.925  1.00 49.87 ? 2021 HOH A O   1 
HETATM 8674 O  O   . HOH N 9 .   ? 37.169  2.161   34.463  1.00 46.12 ? 2022 HOH A O   1 
HETATM 8675 O  O   . HOH N 9 .   ? 37.483  -5.998  16.354  1.00 47.97 ? 2023 HOH A O   1 
HETATM 8676 O  O   . HOH N 9 .   ? 37.663  7.005   37.899  1.00 54.15 ? 2024 HOH A O   1 
HETATM 8677 O  O   . HOH N 9 .   ? 14.612  5.281   37.122  1.00 47.41 ? 2025 HOH A O   1 
HETATM 8678 O  O   . HOH N 9 .   ? 0.780   11.404  18.453  1.00 58.57 ? 2026 HOH A O   1 
HETATM 8679 O  O   . HOH N 9 .   ? 35.088  23.567  -7.514  1.00 59.06 ? 2027 HOH A O   1 
HETATM 8680 O  O   . HOH N 9 .   ? 21.783  0.672   -0.092  1.00 57.94 ? 2028 HOH A O   1 
HETATM 8681 O  O   . HOH N 9 .   ? 37.886  15.400  51.200  1.00 55.24 ? 2029 HOH A O   1 
HETATM 8682 O  O   . HOH N 9 .   ? 47.423  -0.724  17.534  1.00 54.41 ? 2030 HOH A O   1 
HETATM 8683 O  O   . HOH N 9 .   ? 6.516   20.168  12.013  1.00 62.04 ? 2031 HOH A O   1 
HETATM 8684 O  O   . HOH N 9 .   ? 39.364  -4.958  17.682  1.00 60.77 ? 2032 HOH A O   1 
HETATM 8685 O  O   . HOH N 9 .   ? 50.553  23.060  24.964  1.00 63.49 ? 2033 HOH A O   1 
HETATM 8686 O  O   . HOH N 9 .   ? 38.707  4.698   34.594  1.00 51.15 ? 2034 HOH A O   1 
HETATM 8687 O  O   . HOH N 9 .   ? 18.059  1.938   -2.339  1.00 54.63 ? 2035 HOH A O   1 
HETATM 8688 O  O   . HOH N 9 .   ? 2.915   -1.147  21.312  1.00 69.32 ? 2036 HOH A O   1 
HETATM 8689 O  O   . HOH N 9 .   ? 54.548  22.832  24.479  1.00 76.87 ? 2037 HOH A O   1 
HETATM 8690 O  O   . HOH N 9 .   ? 48.904  25.760  23.468  1.00 56.80 ? 2038 HOH A O   1 
HETATM 8691 O  O   . HOH N 9 .   ? 33.083  22.024  21.768  1.00 44.62 ? 2039 HOH A O   1 
HETATM 8692 O  O   . HOH N 9 .   ? 16.724  23.662  33.008  1.00 54.64 ? 2040 HOH A O   1 
HETATM 8693 O  O   . HOH N 9 .   ? 33.511  24.054  13.738  1.00 48.36 ? 2041 HOH A O   1 
HETATM 8694 O  O   . HOH N 9 .   ? 43.166  27.678  15.268  1.00 48.46 ? 2042 HOH A O   1 
HETATM 8695 O  O   . HOH N 9 .   ? 17.377  16.949  -6.588  1.00 70.62 ? 2043 HOH A O   1 
HETATM 8696 O  O   . HOH N 9 .   ? 25.845  20.684  -16.870 1.00 53.55 ? 2044 HOH A O   1 
HETATM 8697 O  O   . HOH N 9 .   ? 41.003  15.267  43.323  1.00 55.88 ? 2045 HOH A O   1 
HETATM 8698 O  O   . HOH N 9 .   ? 46.690  2.103   3.292   1.00 58.87 ? 2046 HOH A O   1 
HETATM 8699 O  O   . HOH N 9 .   ? 59.133  15.223  23.449  1.00 61.87 ? 2047 HOH A O   1 
HETATM 8700 O  O   . HOH N 9 .   ? 33.719  15.058  17.277  1.00 30.05 ? 2048 HOH A O   1 
HETATM 8701 O  O   . HOH N 9 .   ? 27.201  5.846   0.796   1.00 61.21 ? 2049 HOH A O   1 
HETATM 8702 O  O   . HOH N 9 .   ? 32.263  2.805   3.482   1.00 45.46 ? 2050 HOH A O   1 
HETATM 8703 O  O   . HOH N 9 .   ? 45.598  3.741   45.319  1.00 54.52 ? 2051 HOH A O   1 
HETATM 8704 O  O   . HOH N 9 .   ? 12.232  22.961  6.669   1.00 54.66 ? 2052 HOH A O   1 
HETATM 8705 O  O   . HOH N 9 .   ? 2.182   9.520   16.982  1.00 53.72 ? 2053 HOH A O   1 
HETATM 8706 O  O   . HOH N 9 .   ? 3.591   16.553  18.697  1.00 58.73 ? 2054 HOH A O   1 
HETATM 8707 O  O   . HOH N 9 .   ? 51.239  14.862  1.877   1.00 62.49 ? 2055 HOH A O   1 
HETATM 8708 O  O   . HOH N 9 .   ? 26.709  37.797  9.166   1.00 52.86 ? 2056 HOH A O   1 
HETATM 8709 O  O   . HOH N 9 .   ? 26.429  -7.453  30.118  1.00 64.77 ? 2057 HOH A O   1 
HETATM 8710 O  O   . HOH N 9 .   ? 48.112  -3.437  14.032  1.00 63.15 ? 2058 HOH A O   1 
HETATM 8711 O  O   . HOH N 9 .   ? 45.587  11.773  -0.767  1.00 54.40 ? 2059 HOH A O   1 
HETATM 8712 O  O   . HOH N 9 .   ? 38.063  17.581  -6.541  1.00 73.05 ? 2060 HOH A O   1 
HETATM 8713 O  O   . HOH N 9 .   ? 12.735  -8.236  4.961   1.00 63.97 ? 2061 HOH A O   1 
HETATM 8714 O  O   . HOH N 9 .   ? 14.326  23.880  35.366  1.00 67.38 ? 2062 HOH A O   1 
HETATM 8715 O  O   . HOH N 9 .   ? 43.992  16.219  36.285  1.00 51.83 ? 2063 HOH A O   1 
HETATM 8716 O  O   . HOH N 9 .   ? 12.496  6.288   -1.513  1.00 60.44 ? 2064 HOH A O   1 
HETATM 8717 O  O   . HOH N 9 .   ? 31.961  14.893  52.332  1.00 59.30 ? 2065 HOH A O   1 
HETATM 8718 O  O   . HOH N 9 .   ? 27.178  -5.867  32.366  1.00 57.26 ? 2066 HOH A O   1 
HETATM 8719 O  O   . HOH N 9 .   ? 19.717  -5.261  28.226  1.00 50.29 ? 2067 HOH A O   1 
HETATM 8720 O  O   . HOH N 9 .   ? 35.655  -3.257  30.936  1.00 61.97 ? 2068 HOH A O   1 
HETATM 8721 O  O   . HOH N 9 .   ? 35.060  4.425   1.734   1.00 70.04 ? 2069 HOH A O   1 
HETATM 8722 O  O   . HOH N 9 .   ? 47.327  8.739   0.413   1.00 62.94 ? 2070 HOH A O   1 
HETATM 8723 O  O   . HOH N 9 .   ? 49.590  1.422   3.466   1.00 63.53 ? 2071 HOH A O   1 
HETATM 8724 O  O   . HOH N 9 .   ? 57.370  14.227  25.512  1.00 47.35 ? 2072 HOH A O   1 
HETATM 8725 O  O   . HOH N 9 .   ? 47.919  18.273  1.094   1.00 59.15 ? 2073 HOH A O   1 
HETATM 8726 O  O   . HOH N 9 .   ? 33.099  21.087  6.107   1.00 51.56 ? 2074 HOH A O   1 
HETATM 8727 O  O   . HOH N 9 .   ? 39.161  14.028  1.981   1.00 46.75 ? 2075 HOH A O   1 
HETATM 8728 O  O   . HOH N 9 .   ? 6.906   25.558  14.863  1.00 49.79 ? 2076 HOH A O   1 
HETATM 8729 O  O   . HOH N 9 .   ? 39.756  29.792  7.852   1.00 64.23 ? 2077 HOH A O   1 
HETATM 8730 O  O   . HOH N 9 .   ? 41.115  27.723  17.063  1.00 46.94 ? 2078 HOH A O   1 
HETATM 8731 O  O   . HOH N 9 .   ? 31.204  31.141  14.307  1.00 51.42 ? 2079 HOH A O   1 
HETATM 8732 O  O   . HOH N 9 .   ? 18.078  12.677  49.724  1.00 67.17 ? 2080 HOH A O   1 
HETATM 8733 O  O   . HOH N 9 .   ? 39.729  9.264   2.570   1.00 47.51 ? 2081 HOH A O   1 
HETATM 8734 O  O   . HOH N 9 .   ? 51.132  3.253   4.837   1.00 58.88 ? 2082 HOH A O   1 
HETATM 8735 O  O   . HOH N 9 .   ? 18.992  -5.564  32.471  1.00 58.28 ? 2083 HOH A O   1 
HETATM 8736 O  O   . HOH N 9 .   ? 49.619  23.025  3.231   1.00 60.24 ? 2084 HOH A O   1 
HETATM 8737 O  O   . HOH N 9 .   ? 41.220  12.622  -6.182  1.00 65.17 ? 2085 HOH A O   1 
HETATM 8738 O  O   . HOH N 9 .   ? 39.764  14.409  -9.026  1.00 72.80 ? 2086 HOH A O   1 
HETATM 8739 O  O   . HOH N 9 .   ? 14.165  23.750  2.104   1.00 50.82 ? 2087 HOH A O   1 
HETATM 8740 O  O   . HOH N 9 .   ? 45.201  -2.634  7.914   1.00 45.47 ? 2088 HOH A O   1 
HETATM 8741 O  O   . HOH N 9 .   ? 40.820  -2.434  19.828  1.00 59.13 ? 2089 HOH A O   1 
HETATM 8742 O  O   . HOH N 9 .   ? 31.106  34.480  -3.956  1.00 61.26 ? 2090 HOH A O   1 
HETATM 8743 O  O   . HOH O 9 .   ? 3.995   3.918   -33.546 1.00 44.61 ? 953  HOH B O   1 
HETATM 8744 O  O   . HOH O 9 .   ? 13.619  -8.269  -46.174 1.00 47.62 ? 954  HOH B O   1 
HETATM 8745 O  O   . HOH O 9 .   ? 3.580   7.637   -32.780 1.00 38.80 ? 955  HOH B O   1 
HETATM 8746 O  O   . HOH O 9 .   ? 4.464   4.582   -48.110 1.00 36.21 ? 956  HOH B O   1 
HETATM 8747 O  O   . HOH O 9 .   ? -0.871  7.121   -72.456 1.00 45.54 ? 957  HOH B O   1 
HETATM 8748 O  O   . HOH O 9 .   ? 17.499  -3.122  -55.686 1.00 51.10 ? 958  HOH B O   1 
HETATM 8749 O  O   . HOH O 9 .   ? 6.831   23.999  -24.865 1.00 47.31 ? 959  HOH B O   1 
HETATM 8750 O  O   . HOH O 9 .   ? 0.377   19.581  -47.017 1.00 36.95 ? 960  HOH B O   1 
HETATM 8751 O  O   . HOH O 9 .   ? 5.755   -1.881  -28.897 1.00 48.68 ? 961  HOH B O   1 
HETATM 8752 O  O   . HOH O 9 .   ? 9.152   1.003   -68.050 1.00 46.50 ? 962  HOH B O   1 
HETATM 8753 O  O   . HOH O 9 .   ? 19.588  -1.215  -37.309 1.00 46.54 ? 963  HOH B O   1 
HETATM 8754 O  O   . HOH O 9 .   ? 10.647  -0.227  -43.789 1.00 39.25 ? 964  HOH B O   1 
HETATM 8755 O  O   . HOH O 9 .   ? 8.623   24.841  -31.581 1.00 35.72 ? 965  HOH B O   1 
HETATM 8756 O  O   . HOH O 9 .   ? -0.840  3.746   -48.501 1.00 39.97 ? 966  HOH B O   1 
HETATM 8757 O  O   . HOH O 9 .   ? 3.893   19.770  -28.310 1.00 41.03 ? 967  HOH B O   1 
HETATM 8758 O  O   . HOH O 9 .   ? 0.172   26.878  -32.181 1.00 43.01 ? 968  HOH B O   1 
HETATM 8759 O  O   . HOH O 9 .   ? -6.375  13.805  -26.251 1.00 49.22 ? 969  HOH B O   1 
HETATM 8760 O  O   . HOH O 9 .   ? 22.870  0.912   -36.316 1.00 42.30 ? 970  HOH B O   1 
HETATM 8761 O  O   . HOH O 9 .   ? 12.806  -4.859  -51.495 1.00 39.56 ? 971  HOH B O   1 
HETATM 8762 O  O   . HOH O 9 .   ? -5.485  -2.641  -48.297 1.00 47.61 ? 972  HOH B O   1 
HETATM 8763 O  O   . HOH O 9 .   ? 4.726   1.994   -40.804 1.00 44.24 ? 973  HOH B O   1 
HETATM 8764 O  O   . HOH O 9 .   ? 0.400   -0.007  -55.581 1.00 46.26 ? 974  HOH B O   1 
HETATM 8765 O  O   . HOH O 9 .   ? 6.216   16.476  -53.452 1.00 44.27 ? 975  HOH B O   1 
HETATM 8766 O  O   . HOH O 9 .   ? -1.119  26.598  -29.605 1.00 48.87 ? 976  HOH B O   1 
HETATM 8767 O  O   . HOH O 9 .   ? 25.403  -3.119  -46.746 1.00 47.94 ? 977  HOH B O   1 
HETATM 8768 O  O   . HOH O 9 .   ? 7.001   -8.557  -44.305 1.00 49.24 ? 978  HOH B O   1 
HETATM 8769 O  O   . HOH O 9 .   ? -3.389  -5.388  -44.696 1.00 49.77 ? 979  HOH B O   1 
HETATM 8770 O  O   . HOH O 9 .   ? 17.047  -2.406  -28.655 1.00 58.39 ? 980  HOH B O   1 
HETATM 8771 O  O   . HOH O 9 .   ? 13.832  6.521   -33.295 1.00 34.52 ? 981  HOH B O   1 
HETATM 8772 O  O   . HOH O 9 .   ? 10.085  -6.027  -64.299 1.00 42.61 ? 982  HOH B O   1 
HETATM 8773 O  O   . HOH O 9 .   ? 10.277  23.816  -49.553 1.00 65.63 ? 983  HOH B O   1 
HETATM 8774 O  O   . HOH O 9 .   ? 16.548  -3.215  -42.587 1.00 40.17 ? 984  HOH B O   1 
HETATM 8775 O  O   . HOH O 9 .   ? -3.146  27.786  -30.853 1.00 62.81 ? 985  HOH B O   1 
HETATM 8776 O  O   . HOH O 9 .   ? 5.241   -6.150  -60.323 1.00 51.68 ? 986  HOH B O   1 
HETATM 8777 O  O   . HOH O 9 .   ? 14.310  -7.519  -48.845 1.00 49.56 ? 987  HOH B O   1 
HETATM 8778 O  O   . HOH O 9 .   ? 16.854  -8.484  -48.555 1.00 37.99 ? 988  HOH B O   1 
HETATM 8779 O  O   . HOH O 9 .   ? -2.413  0.979   -36.392 1.00 48.16 ? 989  HOH B O   1 
HETATM 8780 O  O   . HOH O 9 .   ? 23.651  -3.431  -34.403 1.00 51.55 ? 990  HOH B O   1 
HETATM 8781 O  O   . HOH O 9 .   ? 11.913  21.505  -46.636 1.00 59.29 ? 991  HOH B O   1 
HETATM 8782 O  O   . HOH O 9 .   ? 12.553  27.592  -25.364 1.00 63.08 ? 992  HOH B O   1 
HETATM 8783 O  O   . HOH O 9 .   ? 21.833  1.751   -47.495 1.00 49.47 ? 993  HOH B O   1 
HETATM 8784 O  O   . HOH O 9 .   ? 23.751  1.326   -32.296 1.00 49.83 ? 994  HOH B O   1 
HETATM 8785 O  O   . HOH O 9 .   ? 7.699   0.709   -61.745 1.00 37.19 ? 995  HOH B O   1 
HETATM 8786 O  O   . HOH O 9 .   ? 7.150   4.200   -24.627 1.00 51.71 ? 996  HOH B O   1 
HETATM 8787 O  O   . HOH O 9 .   ? 13.420  14.982  -22.759 1.00 46.78 ? 997  HOH B O   1 
HETATM 8788 O  O   . HOH O 9 .   ? 17.526  5.120   -34.674 1.00 38.82 ? 998  HOH B O   1 
HETATM 8789 O  O   . HOH O 9 .   ? 6.801   -2.618  -50.454 1.00 45.93 ? 999  HOH B O   1 
HETATM 8790 O  O   . HOH O 9 .   ? -8.244  7.014   -23.285 1.00 59.78 ? 1000 HOH B O   1 
HETATM 8791 O  O   . HOH O 9 .   ? 10.122  -13.903 -48.347 1.00 51.03 ? 1001 HOH B O   1 
HETATM 8792 O  O   . HOH O 9 .   ? 6.551   -8.135  -41.104 1.00 52.75 ? 1002 HOH B O   1 
HETATM 8793 O  O   . HOH O 9 .   ? 7.840   0.658   -24.036 1.00 61.94 ? 1003 HOH B O   1 
HETATM 8794 O  O   . HOH O 9 .   ? 8.883   -1.352  -60.445 1.00 44.39 ? 1004 HOH B O   1 
HETATM 8795 O  O   . HOH O 9 .   ? 11.555  16.728  -23.094 1.00 46.32 ? 1005 HOH B O   1 
HETATM 8796 O  O   . HOH O 9 .   ? 21.107  6.984   -36.704 1.00 39.94 ? 1006 HOH B O   1 
HETATM 8797 O  O   . HOH O 9 .   ? 22.337  -1.726  -36.698 1.00 44.33 ? 1007 HOH B O   1 
HETATM 8798 O  O   . HOH O 9 .   ? 4.699   -1.082  -43.073 1.00 49.12 ? 1008 HOH B O   1 
HETATM 8799 O  O   . HOH O 9 .   ? 9.398   3.364   -23.886 1.00 48.29 ? 1009 HOH B O   1 
HETATM 8800 O  O   . HOH O 9 .   ? -1.461  -7.339  -44.515 1.00 48.02 ? 1010 HOH B O   1 
HETATM 8801 O  O   . HOH O 9 .   ? 5.854   14.662  -18.385 1.00 42.91 ? 1011 HOH B O   1 
HETATM 8802 O  O   . HOH O 9 .   ? 4.751   -3.940  -42.382 1.00 38.08 ? 1012 HOH B O   1 
HETATM 8803 O  O   . HOH O 9 .   ? -3.421  0.942   -48.077 1.00 45.97 ? 1013 HOH B O   1 
HETATM 8804 O  O   . HOH O 9 .   ? 8.001   -1.018  -66.780 1.00 46.10 ? 1014 HOH B O   1 
HETATM 8805 O  O   . HOH O 9 .   ? 23.187  0.353   -53.145 1.00 51.25 ? 1015 HOH B O   1 
HETATM 8806 O  O   . HOH O 9 .   ? -4.021  1.322   -30.166 1.00 49.88 ? 1016 HOH B O   1 
HETATM 8807 O  O   . HOH O 9 .   ? 1.739   -0.254  -52.857 1.00 38.94 ? 1017 HOH B O   1 
HETATM 8808 O  O   . HOH O 9 .   ? 16.655  -8.330  -59.963 1.00 52.74 ? 1018 HOH B O   1 
HETATM 8809 O  O   . HOH O 9 .   ? 19.022  6.609   -27.056 1.00 58.98 ? 1019 HOH B O   1 
HETATM 8810 O  O   . HOH O 9 .   ? 18.855  12.421  -55.608 1.00 51.73 ? 1020 HOH B O   1 
HETATM 8811 O  O   . HOH O 9 .   ? 14.888  2.137   -61.903 1.00 41.38 ? 1021 HOH B O   1 
HETATM 8812 O  O   . HOH O 9 .   ? 22.975  15.372  -45.885 1.00 48.93 ? 1022 HOH B O   1 
HETATM 8813 O  O   . HOH O 9 .   ? 13.333  -4.391  -55.642 1.00 48.47 ? 1023 HOH B O   1 
HETATM 8814 O  O   . HOH O 9 .   ? -2.818  -1.053  -61.243 1.00 49.48 ? 1024 HOH B O   1 
HETATM 8815 O  O   . HOH O 9 .   ? 12.452  26.203  -28.062 1.00 53.43 ? 1025 HOH B O   1 
HETATM 8816 O  O   . HOH O 9 .   ? 16.759  -3.892  -66.174 1.00 55.82 ? 1026 HOH B O   1 
HETATM 8817 O  O   . HOH O 9 .   ? 4.261   10.545  -65.066 1.00 44.35 ? 1027 HOH B O   1 
HETATM 8818 O  O   . HOH O 9 .   ? 5.038   8.013   -63.986 1.00 43.85 ? 1028 HOH B O   1 
HETATM 8819 O  O   . HOH O 9 .   ? -14.252 33.567  -35.051 1.00 54.16 ? 1029 HOH B O   1 
HETATM 8820 O  O   . HOH O 9 .   ? 25.650  -5.018  -24.062 1.00 63.49 ? 1030 HOH B O   1 
HETATM 8821 O  O   . HOH O 9 .   ? 26.108  1.781   -33.389 1.00 49.58 ? 1031 HOH B O   1 
HETATM 8822 O  O   . HOH O 9 .   ? -5.756  13.506  -22.892 1.00 56.46 ? 1032 HOH B O   1 
HETATM 8823 O  O   . HOH O 9 .   ? 1.895   -2.794  -52.829 1.00 40.66 ? 1033 HOH B O   1 
HETATM 8824 O  O   . HOH O 9 .   ? -3.782  20.822  -20.187 1.00 54.67 ? 1034 HOH B O   1 
HETATM 8825 O  O   . HOH O 9 .   ? -0.981  24.679  -47.261 1.00 48.44 ? 1035 HOH B O   1 
HETATM 8826 O  O   . HOH O 9 .   ? -3.661  24.204  -50.855 1.00 55.49 ? 1036 HOH B O   1 
HETATM 8827 O  O   . HOH O 9 .   ? 23.099  -0.491  -28.175 1.00 64.43 ? 1037 HOH B O   1 
HETATM 8828 O  O   . HOH O 9 .   ? 2.739   25.142  -48.056 1.00 59.80 ? 1038 HOH B O   1 
HETATM 8829 O  O   . HOH O 9 .   ? 1.809   18.984  -59.858 1.00 50.32 ? 1039 HOH B O   1 
HETATM 8830 O  O   . HOH O 9 .   ? -7.981  15.563  -20.563 1.00 73.01 ? 1040 HOH B O   1 
HETATM 8831 O  O   . HOH O 9 .   ? 3.240   28.162  -43.329 1.00 65.40 ? 1041 HOH B O   1 
HETATM 8832 O  O   . HOH O 9 .   ? 2.234   21.532  -61.291 1.00 54.08 ? 1042 HOH B O   1 
HETATM 8833 O  O   . HOH O 9 .   ? 4.250   0.800   -68.886 1.00 42.01 ? 1043 HOH B O   1 
HETATM 8834 O  O   . HOH O 9 .   ? 14.299  -1.793  -65.877 1.00 54.61 ? 1044 HOH B O   1 
HETATM 8835 O  O   . HOH O 9 .   ? 37.935  -3.457  -61.324 1.00 70.28 ? 1045 HOH B O   1 
HETATM 8836 O  O   . HOH O 9 .   ? -2.995  -3.853  -42.327 1.00 57.10 ? 1046 HOH B O   1 
HETATM 8837 O  O   . HOH O 9 .   ? -6.149  -3.623  -55.017 1.00 60.49 ? 1047 HOH B O   1 
HETATM 8838 O  O   . HOH O 9 .   ? 9.621   14.068  -17.947 1.00 61.15 ? 1048 HOH B O   1 
HETATM 8839 O  O   . HOH O 9 .   ? 11.789  3.539   -74.496 1.00 40.52 ? 1049 HOH B O   1 
HETATM 8840 O  O   . HOH O 9 .   ? 8.921   9.089   -62.555 1.00 60.51 ? 1050 HOH B O   1 
HETATM 8841 O  O   . HOH O 9 .   ? 12.202  -1.350  -68.143 1.00 52.96 ? 1051 HOH B O   1 
HETATM 8842 O  O   . HOH O 9 .   ? 7.335   -0.132  -19.354 1.00 51.67 ? 1052 HOH B O   1 
HETATM 8843 O  O   . HOH O 9 .   ? 28.655  5.173   -51.580 1.00 53.83 ? 1053 HOH B O   1 
HETATM 8844 O  O   . HOH O 9 .   ? -2.423  0.277   -22.106 1.00 56.90 ? 1054 HOH B O   1 
HETATM 8845 O  O   . HOH O 9 .   ? -0.032  -12.497 -50.195 1.00 60.13 ? 1055 HOH B O   1 
HETATM 8846 O  O   . HOH O 9 .   ? 15.898  9.750   -56.479 1.00 51.75 ? 1056 HOH B O   1 
HETATM 8847 O  O   . HOH O 9 .   ? 29.818  -4.785  -26.110 1.00 66.37 ? 1057 HOH B O   1 
HETATM 8848 O  O   . HOH O 9 .   ? 10.797  -14.640 -45.882 1.00 50.74 ? 1058 HOH B O   1 
HETATM 8849 O  O   . HOH O 9 .   ? 4.610   -5.649  -45.996 1.00 47.33 ? 1059 HOH B O   1 
HETATM 8850 O  O   . HOH O 9 .   ? 1.020   27.768  -44.390 1.00 63.74 ? 1060 HOH B O   1 
HETATM 8851 O  O   . HOH O 9 .   ? 10.547  9.718   -67.964 1.00 62.99 ? 1061 HOH B O   1 
HETATM 8852 O  O   . HOH O 9 .   ? -12.637 2.332   -62.730 1.00 49.01 ? 1062 HOH B O   1 
HETATM 8853 O  O   . HOH O 9 .   ? -5.022  1.239   -73.210 1.00 49.69 ? 1063 HOH B O   1 
HETATM 8854 O  O   . HOH O 9 .   ? 32.913  -2.038  -38.976 1.00 71.93 ? 1064 HOH B O   1 
HETATM 8855 O  O   . HOH O 9 .   ? 21.496  -5.590  -10.540 1.00 54.85 ? 1065 HOH B O   1 
HETATM 8856 O  O   . HOH O 9 .   ? 3.086   -12.023 -50.798 1.00 63.92 ? 1066 HOH B O   1 
HETATM 8857 O  O   . HOH O 9 .   ? -3.874  -7.118  -33.690 1.00 72.49 ? 1067 HOH B O   1 
HETATM 8858 O  O   . HOH O 9 .   ? 23.025  6.941   -52.821 1.00 44.69 ? 1068 HOH B O   1 
HETATM 8859 O  O   . HOH O 9 .   ? 14.148  4.650   -74.206 1.00 48.95 ? 1069 HOH B O   1 
HETATM 8860 O  O   . HOH O 9 .   ? 12.884  16.631  -14.540 1.00 56.88 ? 1070 HOH B O   1 
HETATM 8861 O  O   . HOH O 9 .   ? 11.317  -7.372  -35.146 1.00 52.13 ? 1071 HOH B O   1 
HETATM 8862 O  O   . HOH O 9 .   ? 22.518  17.027  -47.865 1.00 44.33 ? 1072 HOH B O   1 
HETATM 8863 O  O   . HOH O 9 .   ? -0.933  6.635   -76.662 1.00 56.69 ? 1073 HOH B O   1 
HETATM 8864 O  O   . HOH O 9 .   ? 26.152  -2.569  -35.362 1.00 51.04 ? 1074 HOH B O   1 
HETATM 8865 O  O   . HOH O 9 .   ? 22.795  15.434  -50.159 1.00 45.30 ? 1075 HOH B O   1 
HETATM 8866 O  O   . HOH O 9 .   ? -4.949  -6.761  -47.144 1.00 60.77 ? 1076 HOH B O   1 
HETATM 8867 O  O   . HOH O 9 .   ? 11.357  7.199   -16.790 1.00 72.04 ? 1077 HOH B O   1 
HETATM 8868 O  O   . HOH O 9 .   ? 5.854   -1.546  -37.994 1.00 67.00 ? 1078 HOH B O   1 
HETATM 8869 O  O   . HOH O 9 .   ? 17.494  -5.609  -43.406 1.00 50.56 ? 1079 HOH B O   1 
HETATM 8870 O  O   . HOH O 9 .   ? 23.460  9.685   -35.843 1.00 56.22 ? 1080 HOH B O   1 
HETATM 8871 O  O   . HOH O 9 .   ? 22.163  9.441   -33.079 1.00 51.25 ? 1081 HOH B O   1 
HETATM 8872 O  O   . HOH O 9 .   ? 10.866  -7.036  -4.966  1.00 62.25 ? 1082 HOH B O   1 
HETATM 8873 O  O   . HOH O 9 .   ? 12.226  10.465  -16.883 1.00 45.27 ? 1083 HOH B O   1 
HETATM 8874 O  O   . HOH O 9 .   ? -11.823 14.222  -39.023 1.00 59.58 ? 1084 HOH B O   1 
HETATM 8875 O  O   . HOH O 9 .   ? 14.346  6.721   -67.334 1.00 66.59 ? 1085 HOH B O   1 
HETATM 8876 O  O   . HOH O 9 .   ? -4.647  12.530  -20.522 1.00 55.82 ? 1086 HOH B O   1 
HETATM 8877 O  O   . HOH O 9 .   ? -6.605  14.493  -18.845 1.00 56.92 ? 1087 HOH B O   1 
HETATM 8878 O  O   . HOH O 9 .   ? 11.560  12.967  -15.766 1.00 48.42 ? 1088 HOH B O   1 
HETATM 8879 O  O   . HOH O 9 .   ? 15.136  4.413   -69.088 1.00 63.40 ? 1089 HOH B O   1 
HETATM 8880 O  O   . HOH O 9 .   ? 8.842   -8.717  -39.598 1.00 54.73 ? 1090 HOH B O   1 
HETATM 8881 O  O   . HOH O 9 .   ? 23.108  -5.796  -33.440 1.00 63.97 ? 1091 HOH B O   1 
HETATM 8882 O  O   . HOH O 9 .   ? -8.984  26.583  -24.624 1.00 59.49 ? 1092 HOH B O   1 
HETATM 8883 O  O   . HOH O 9 .   ? 6.555   -7.622  -36.779 1.00 73.57 ? 1093 HOH B O   1 
HETATM 8884 O  O   . HOH O 9 .   ? 3.902   -14.321 -37.505 1.00 58.12 ? 1094 HOH B O   1 
HETATM 8885 O  O   . HOH O 9 .   ? 23.071  -0.568  -45.187 1.00 39.61 ? 1095 HOH B O   1 
HETATM 8886 O  O   . HOH O 9 .   ? 12.107  -5.750  -54.009 1.00 53.06 ? 1096 HOH B O   1 
HETATM 8887 O  O   . HOH O 9 .   ? 22.763  9.513   -53.005 1.00 50.94 ? 1097 HOH B O   1 
HETATM 8888 O  O   . HOH O 9 .   ? 25.192  6.657   -51.760 1.00 53.24 ? 1098 HOH B O   1 
HETATM 8889 O  O   . HOH O 9 .   ? 8.830   27.528  -39.068 1.00 63.72 ? 1099 HOH B O   1 
HETATM 8890 O  O   . HOH O 9 .   ? 7.598   12.058  -18.509 1.00 61.33 ? 1100 HOH B O   1 
HETATM 8891 O  O   . HOH O 9 .   ? 2.764   8.905   -73.091 1.00 59.74 ? 1101 HOH B O   1 
HETATM 8892 O  O   . HOH O 9 .   ? -14.908 2.542   -60.694 1.00 54.95 ? 1102 HOH B O   1 
HETATM 8893 O  O   . HOH O 9 .   ? -16.149 8.629   -44.760 1.00 62.78 ? 1103 HOH B O   1 
HETATM 8894 O  O   . HOH O 9 .   ? 4.607   -13.452 -53.123 1.00 52.34 ? 1104 HOH B O   1 
HETATM 8895 O  O   . HOH O 9 .   ? 27.549  1.386   -37.626 1.00 45.33 ? 1105 HOH B O   1 
HETATM 8896 O  O   . HOH O 9 .   ? 28.246  -3.045  -33.525 1.00 63.39 ? 1106 HOH B O   1 
HETATM 8897 O  O   . HOH O 9 .   ? 2.664   -0.416  -18.498 1.00 65.78 ? 1107 HOH B O   1 
HETATM 8898 O  O   . HOH O 9 .   ? -1.327  -9.626  -20.782 1.00 58.61 ? 1108 HOH B O   1 
HETATM 8899 O  O   . HOH O 9 .   ? -1.888  -12.242 -28.184 1.00 67.68 ? 1109 HOH B O   1 
HETATM 8900 O  O   . HOH O 9 .   ? -14.996 14.414  -38.939 1.00 58.72 ? 1110 HOH B O   1 
HETATM 8901 O  O   . HOH O 9 .   ? -6.930  -8.466  -54.448 1.00 63.31 ? 1111 HOH B O   1 
HETATM 8902 O  O   . HOH O 9 .   ? 31.870  9.197   -45.781 1.00 51.41 ? 1112 HOH B O   1 
HETATM 8903 O  O   . HOH O 9 .   ? 31.196  10.916  -43.807 1.00 54.20 ? 1113 HOH B O   1 
HETATM 8904 O  O   . HOH O 9 .   ? 0.439   -2.071  -19.313 1.00 51.63 ? 1114 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLU 1   1   1   GLU GLU A . n 
A 1 2   GLY 2   2   2   GLY GLY A . n 
A 1 3   ARG 3   3   3   ARG ARG A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   ASP 5   5   5   ASP ASP A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   GLN 7   7   7   GLN GLN A . n 
A 1 8   LEU 8   8   8   LEU LEU A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  ARG 11  11  11  ARG ARG A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ARG 13  13  13  ARG ARG A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLY 15  15  15  GLY GLY A . n 
A 1 16  GLN 16  16  16  GLN GLN A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ARG 18  18  18  ARG ARG A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  ILE 20  20  20  ILE ILE A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  PRO 25  25  25  PRO PRO A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  SER 30  30  30  SER SER A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  PRO 36  36  36  PRO PRO A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  PRO 40  40  40  PRO PRO A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  PHE 47  47  47  PHE PHE A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PRO 49  49  49  PRO PRO A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  GLU 51  51  51  GLU GLU A . n 
A 1 52  PRO 52  52  52  PRO PRO A . n 
A 1 53  LYS 53  53  53  LYS LYS A . n 
A 1 54  ARG 54  54  54  ARG ARG A . n 
A 1 55  PRO 55  55  55  PRO PRO A . n 
A 1 56  TRP 56  56  56  TRP TRP A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  GLY 58  58  58  GLY GLY A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  ALA 62  62  62  ALA ALA A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  THR 64  64  64  THR THR A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  GLN 66  66  66  GLN GLN A . n 
A 1 67  ASN 67  67  67  ASN ASN A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  CYS 69  69  69  CYS CYS A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  TYR 72  72  72  TYR TYR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  THR 75  75  75  THR THR A . n 
A 1 76  LEU 76  76  76  LEU LEU A . n 
A 1 77  TYR 77  77  77  TYR TYR A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  THR 83  83  83  THR THR A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  TRP 86  86  86  TRP TRP A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PRO 88  88  88  PRO PRO A . n 
A 1 89  ASN 89  89  89  ASN ASN A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  CYS 96  96  96  CYS CYS A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  TYR 98  98  98  TYR TYR A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ASN 100 100 100 ASN ASN A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 TYR 105 105 105 TYR TYR A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 ARG 107 107 107 ARG ARG A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 PRO 111 111 111 PRO PRO A . n 
A 1 112 THR 112 112 112 THR THR A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ILE 116 116 116 ILE ILE A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 ILE 118 118 118 ILE ILE A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 PHE 123 123 123 PHE PHE A . n 
A 1 124 TYR 124 124 124 TYR TYR A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 PHE 137 137 137 PHE PHE A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ALA 139 139 139 ALA ALA A . n 
A 1 140 GLN 140 140 140 GLN GLN A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 SER 148 148 148 SER SER A . n 
A 1 149 MET 149 149 149 MET MET A . n 
A 1 150 ASN 150 150 150 ASN ASN A . n 
A 1 151 TYR 151 151 151 TYR TYR A . n 
A 1 152 ARG 152 152 152 ARG ARG A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 THR 155 155 155 THR THR A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 GLY 157 157 157 GLY GLY A . n 
A 1 158 PHE 158 158 158 PHE PHE A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 PRO 162 162 162 PRO PRO A . n 
A 1 163 GLY 163 163 163 GLY GLY A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 ALA 167 167 167 ALA ALA A . n 
A 1 168 PRO 168 168 168 PRO PRO A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 VAL 171 171 171 VAL VAL A . n 
A 1 172 GLY 172 172 172 GLY GLY A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 GLN 176 176 176 GLN GLN A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 ALA 179 179 179 ALA ALA A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 TRP 182 182 182 TRP TRP A . n 
A 1 183 VAL 183 183 183 VAL VAL A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 ILE 187 187 187 ILE ILE A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 GLY 191 191 191 GLY GLY A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 PRO 194 194 194 PRO PRO A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 PHE 200 200 200 PHE PHE A . n 
A 1 201 GLY 201 201 201 GLY GLY A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 SER 208 208 208 SER SER A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 MET 211 211 211 MET MET A . n 
A 1 212 HIS 212 212 212 HIS HIS A . n 
A 1 213 ILE 213 213 213 ILE ILE A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 ARG 219 219 219 ARG ARG A . n 
A 1 220 SER 220 220 220 SER SER A . n 
A 1 221 LEU 221 221 221 LEU LEU A . n 
A 1 222 PHE 222 222 222 PHE PHE A . n 
A 1 223 HIS 223 223 223 HIS HIS A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 ALA 225 225 225 ALA ALA A . n 
A 1 226 VAL 226 226 226 VAL VAL A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 GLN 228 228 228 GLN GLN A . n 
A 1 229 SER 229 229 229 SER SER A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 THR 231 231 231 THR THR A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PRO 235 235 235 PRO PRO A . n 
A 1 236 TRP 236 236 236 TRP TRP A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 THR 238 238 238 THR THR A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 SER 240 240 240 SER SER A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLY 242 242 242 GLY GLY A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ALA 244 244 244 ALA ALA A . n 
A 1 245 ARG 245 245 245 ARG ARG A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 THR 249 249 249 THR THR A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 CYS 257 257 257 CYS CYS A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 PRO 259 259 ?   ?   ?   A . n 
A 1 260 GLY 260 260 ?   ?   ?   A . n 
A 1 261 GLY 261 261 ?   ?   ?   A . n 
A 1 262 ALA 262 262 ?   ?   ?   A . n 
A 1 263 GLY 263 263 ?   ?   ?   A . n 
A 1 264 GLY 264 264 ?   ?   ?   A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 ASP 266 266 266 ASP ASP A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 ALA 271 271 271 ALA ALA A . n 
A 1 272 CYS 272 272 272 CYS CYS A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 ARG 276 276 276 ARG ARG A . n 
A 1 277 PRO 277 277 277 PRO PRO A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLN 279 279 279 GLN GLN A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 HIS 284 284 284 HIS HIS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 TRP 286 286 286 TRP TRP A . n 
A 1 287 HIS 287 287 287 HIS HIS A . n 
A 1 288 VAL 288 288 288 VAL VAL A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 GLN 291 291 291 GLN GLN A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 PHE 295 295 295 PHE PHE A . n 
A 1 296 ARG 296 296 296 ARG ARG A . n 
A 1 297 PHE 297 297 297 PHE PHE A . n 
A 1 298 SER 298 298 298 SER SER A . n 
A 1 299 PHE 299 299 299 PHE PHE A . n 
A 1 300 VAL 300 300 300 VAL VAL A . n 
A 1 301 PRO 301 301 301 PRO PRO A . n 
A 1 302 VAL 302 302 302 VAL VAL A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 ASP 304 304 304 ASP ASP A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 PHE 307 307 307 PHE PHE A . n 
A 1 308 LEU 308 308 308 LEU LEU A . n 
A 1 309 SER 309 309 309 SER SER A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 THR 311 311 311 THR THR A . n 
A 1 312 PRO 312 312 312 PRO PRO A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ALA 314 314 314 ALA ALA A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 THR 318 318 318 THR THR A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ASP 320 320 320 ASP ASP A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 GLN 322 322 322 GLN GLN A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 GLN 325 325 325 GLN GLN A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 LEU 327 327 327 LEU LEU A . n 
A 1 328 VAL 328 328 328 VAL VAL A . n 
A 1 329 GLY 329 329 329 GLY GLY A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 VAL 331 331 331 VAL VAL A . n 
A 1 332 LYS 332 332 332 LYS LYS A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 SER 336 336 336 SER SER A . n 
A 1 337 TYR 337 337 337 TYR TYR A . n 
A 1 338 PHE 338 338 338 PHE PHE A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 VAL 340 340 340 VAL VAL A . n 
A 1 341 TYR 341 341 341 TYR TYR A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 VAL 343 343 343 VAL VAL A . n 
A 1 344 PRO 344 344 344 PRO PRO A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 PHE 346 346 346 PHE PHE A . n 
A 1 347 SER 347 347 347 SER SER A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 ASN 350 350 350 ASN ASN A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 LEU 353 353 353 LEU LEU A . n 
A 1 354 ILE 354 354 354 ILE ILE A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 ARG 356 356 356 ARG ARG A . n 
A 1 357 ALA 357 357 357 ALA ALA A . n 
A 1 358 GLN 358 358 358 GLN GLN A . n 
A 1 359 PHE 359 359 359 PHE PHE A . n 
A 1 360 LEU 360 360 360 LEU LEU A . n 
A 1 361 ALA 361 361 361 ALA ALA A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 VAL 363 363 363 VAL VAL A . n 
A 1 364 ARG 364 364 364 ARG ARG A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 GLY 366 366 366 GLY GLY A . n 
A 1 367 VAL 367 367 367 VAL VAL A . n 
A 1 368 PRO 368 368 368 PRO PRO A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 SER 371 371 371 SER SER A . n 
A 1 372 ASP 372 372 372 ASP ASP A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 GLU 376 376 376 GLU GLU A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 VAL 378 378 378 VAL VAL A . n 
A 1 379 VAL 379 379 379 VAL VAL A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 TYR 382 382 382 TYR TYR A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASP 384 384 384 ASP ASP A . n 
A 1 385 TRP 385 385 385 TRP TRP A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLU 389 389 389 GLU GLU A . n 
A 1 390 ASP 390 390 390 ASP ASP A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 HIS 393 393 393 HIS HIS A . n 
A 1 394 LEU 394 394 394 LEU LEU A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 ASP 396 396 396 ASP ASP A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 MET 398 398 398 MET MET A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ALA 400 400 400 ALA ALA A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 VAL 402 402 402 VAL VAL A . n 
A 1 403 GLY 403 403 403 GLY GLY A . n 
A 1 404 ASP 404 404 404 ASP ASP A . n 
A 1 405 HIS 405 405 405 HIS HIS A . n 
A 1 406 ASN 406 406 406 ASN ASN A . n 
A 1 407 VAL 407 407 407 VAL VAL A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 CYS 409 409 409 CYS CYS A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 VAL 411 411 411 VAL VAL A . n 
A 1 412 ALA 412 412 412 ALA ALA A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 GLY 416 416 416 GLY GLY A . n 
A 1 417 ARG 417 417 417 ARG ARG A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ALA 419 419 419 ALA ALA A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 GLN 421 421 421 GLN GLN A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 ARG 424 424 424 ARG ARG A . n 
A 1 425 VAL 425 425 425 VAL VAL A . n 
A 1 426 TYR 426 426 426 TYR TYR A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 TYR 428 428 428 TYR TYR A . n 
A 1 429 ILE 429 429 429 ILE ILE A . n 
A 1 430 PHE 430 430 430 PHE PHE A . n 
A 1 431 GLU 431 431 431 GLU GLU A . n 
A 1 432 HIS 432 432 432 HIS HIS A . n 
A 1 433 ARG 433 433 433 ARG ARG A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 SER 435 435 435 SER SER A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 THR 438 438 438 THR THR A . n 
A 1 439 TRP 439 439 439 TRP TRP A . n 
A 1 440 PRO 440 440 440 PRO PRO A . n 
A 1 441 LEU 441 441 441 LEU LEU A . n 
A 1 442 TRP 442 442 442 TRP TRP A . n 
A 1 443 MET 443 443 443 MET MET A . n 
A 1 444 GLY 444 444 444 GLY GLY A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 PRO 446 446 446 PRO PRO A . n 
A 1 447 HIS 447 447 447 HIS HIS A . n 
A 1 448 GLY 448 448 448 GLY GLY A . n 
A 1 449 TYR 449 449 449 TYR TYR A . n 
A 1 450 GLU 450 450 450 GLU GLU A . n 
A 1 451 ILE 451 451 451 ILE ILE A . n 
A 1 452 GLU 452 452 452 GLU GLU A . n 
A 1 453 PHE 453 453 453 PHE PHE A . n 
A 1 454 ILE 454 454 454 ILE ILE A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 GLY 456 456 456 GLY GLY A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 PRO 458 458 458 PRO PRO A . n 
A 1 459 LEU 459 459 459 LEU LEU A . n 
A 1 460 ASP 460 460 460 ASP ASP A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 SER 462 462 462 SER SER A . n 
A 1 463 LEU 463 463 463 LEU LEU A . n 
A 1 464 ASN 464 464 464 ASN ASN A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 THR 466 466 466 THR THR A . n 
A 1 467 THR 467 467 467 THR THR A . n 
A 1 468 GLU 468 468 468 GLU GLU A . n 
A 1 469 GLU 469 469 469 GLU GLU A . n 
A 1 470 ARG 470 470 470 ARG ARG A . n 
A 1 471 ILE 471 471 471 ILE ILE A . n 
A 1 472 PHE 472 472 472 PHE PHE A . n 
A 1 473 ALA 473 473 473 ALA ALA A . n 
A 1 474 GLN 474 474 474 GLN GLN A . n 
A 1 475 ARG 475 475 475 ARG ARG A . n 
A 1 476 LEU 476 476 476 LEU LEU A . n 
A 1 477 MET 477 477 477 MET MET A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 TRP 480 480 480 TRP TRP A . n 
A 1 481 THR 481 481 481 THR THR A . n 
A 1 482 ASN 482 482 482 ASN ASN A . n 
A 1 483 PHE 483 483 483 PHE PHE A . n 
A 1 484 ALA 484 484 484 ALA ALA A . n 
A 1 485 ARG 485 485 485 ARG ARG A . n 
A 1 486 THR 486 486 486 THR THR A . n 
A 1 487 GLY 487 487 487 GLY GLY A . n 
A 1 488 ASP 488 488 488 ASP ASP A . n 
A 1 489 PRO 489 489 489 PRO PRO A . n 
A 1 490 ASN 490 490 490 ASN ASN A . n 
A 1 491 ASP 491 491 491 ASP ASP A . n 
A 1 492 PRO 492 492 492 PRO PRO A . n 
A 1 493 ARG 493 493 493 ARG ARG A . n 
A 1 494 ASP 494 494 494 ASP ASP A . n 
A 1 495 SER 495 495 495 SER SER A . n 
A 1 496 LYS 496 496 496 LYS ALA A . n 
A 1 497 SER 497 497 497 SER SER A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 GLN 499 499 499 GLN GLN A . n 
A 1 500 TRP 500 500 500 TRP TRP A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 PRO 502 502 502 PRO PRO A . n 
A 1 503 TYR 503 503 503 TYR TYR A . n 
A 1 504 THR 504 504 504 THR THR A . n 
A 1 505 THR 505 505 505 THR THR A . n 
A 1 506 ALA 506 506 506 ALA ALA A . n 
A 1 507 ALA 507 507 507 ALA ALA A . n 
A 1 508 GLN 508 508 508 GLN GLN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 VAL 511 511 511 VAL VAL A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 ASN 514 514 514 ASN ASN A . n 
A 1 515 LEU 515 515 515 LEU LEU A . n 
A 1 516 LYS 516 516 516 LYS LYS A . n 
A 1 517 PRO 517 517 517 PRO PRO A . n 
A 1 518 LEU 518 518 518 LEU LEU A . n 
A 1 519 GLU 519 519 519 GLU GLU A . n 
A 1 520 VAL 520 520 520 VAL VAL A . n 
A 1 521 ARG 521 521 521 ARG ARG A . n 
A 1 522 ARG 522 522 522 ARG ARG A . n 
A 1 523 GLY 523 523 523 GLY GLY A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ARG 525 525 525 ARG ARG A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 GLN 527 527 527 GLN GLN A . n 
A 1 528 THR 528 528 528 THR THR A . n 
A 1 529 CYS 529 529 529 CYS CYS A . n 
A 1 530 ALA 530 530 530 ALA ALA A . n 
A 1 531 PHE 531 531 531 PHE PHE A . n 
A 1 532 TRP 532 532 532 TRP TRP A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ARG 534 534 534 ARG ARG A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LEU 536 536 536 LEU LEU A . n 
A 1 537 PRO 537 537 537 PRO PRO A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 SER 541 541 541 SER SER A . n 
A 1 542 ALA 542 542 542 ALA ALA A . n 
A 1 543 THR 543 543 ?   ?   ?   A . n 
B 1 1   GLU 1   1   ?   ?   ?   B . n 
B 1 2   GLY 2   2   ?   ?   ?   B . n 
B 1 3   ARG 3   3   ?   ?   ?   B . n 
B 1 4   GLU 4   4   4   GLU GLU B . n 
B 1 5   ASP 5   5   5   ASP ASP B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   GLN 7   7   7   GLN GLN B . n 
B 1 8   LEU 8   8   8   LEU LEU B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  VAL 10  10  10  VAL VAL B . n 
B 1 11  ARG 11  11  11  ARG ARG B . n 
B 1 12  VAL 12  12  12  VAL VAL B . n 
B 1 13  ARG 13  13  13  ARG ARG B . n 
B 1 14  GLY 14  14  14  GLY GLY B . n 
B 1 15  GLY 15  15  15  GLY GLY B . n 
B 1 16  GLN 16  16  16  GLN GLN B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  ARG 18  18  18  ARG ARG B . n 
B 1 19  GLY 19  19  19  GLY GLY B . n 
B 1 20  ILE 20  20  20  ILE ILE B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  PRO 25  25  25  PRO PRO B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  SER 30  30  30  SER SER B . n 
B 1 31  ALA 31  31  31  ALA ALA B . n 
B 1 32  PHE 32  32  32  PHE PHE B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  PRO 36  36  36  PRO PRO B . n 
B 1 37  PHE 37  37  37  PHE PHE B . n 
B 1 38  ALA 38  38  38  ALA ALA B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  PRO 40  40  40  PRO PRO B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  VAL 42  42  42  VAL VAL B . n 
B 1 43  GLY 43  43  43  GLY GLY B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  ARG 46  46  46  ARG ARG B . n 
B 1 47  PHE 47  47  47  PHE PHE B . n 
B 1 48  MET 48  48  48  MET MET B . n 
B 1 49  PRO 49  49  49  PRO PRO B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  GLU 51  51  51  GLU GLU B . n 
B 1 52  PRO 52  52  52  PRO PRO B . n 
B 1 53  LYS 53  53  53  LYS LYS B . n 
B 1 54  ARG 54  54  54  ARG ARG B . n 
B 1 55  PRO 55  55  55  PRO PRO B . n 
B 1 56  TRP 56  56  56  TRP TRP B . n 
B 1 57  SER 57  57  57  SER SER B . n 
B 1 58  GLY 58  58  58  GLY GLY B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  LEU 60  60  60  LEU LEU B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  ALA 62  62  62  ALA ALA B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  THR 64  64  64  THR THR B . n 
B 1 65  PHE 65  65  65  PHE PHE B . n 
B 1 66  GLN 66  66  66  GLN GLN B . n 
B 1 67  ASN 67  67  67  ASN ASN B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  CYS 69  69  69  CYS CYS B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  GLN 71  71  71  GLN GLN B . n 
B 1 72  TYR 72  72  72  TYR TYR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  ASP 74  74  74  ASP ASP B . n 
B 1 75  THR 75  75  75  THR THR B . n 
B 1 76  LEU 76  76  76  LEU LEU B . n 
B 1 77  TYR 77  77  77  TYR TYR B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  GLU 81  81  81  GLU GLU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  THR 83  83  83  THR THR B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  TRP 86  86  86  TRP TRP B . n 
B 1 87  ASN 87  87  87  ASN ASN B . n 
B 1 88  PRO 88  88  88  PRO PRO B . n 
B 1 89  ASN 89  89  89  ASN ASN B . n 
B 1 90  ARG 90  90  90  ARG ARG B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  SER 93  93  93  SER SER B . n 
B 1 94  GLU 94  94  94  GLU GLU B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  CYS 96  96  96  CYS CYS B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  TYR 98  98  98  TYR TYR B . n 
B 1 99  LEU 99  99  99  LEU LEU B . n 
B 1 100 ASN 100 100 100 ASN ASN B . n 
B 1 101 VAL 101 101 101 VAL VAL B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 TYR 105 105 105 TYR TYR B . n 
B 1 106 PRO 106 106 106 PRO PRO B . n 
B 1 107 ARG 107 107 107 ARG ARG B . n 
B 1 108 PRO 108 108 108 PRO PRO B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 SER 110 110 110 SER SER B . n 
B 1 111 PRO 111 111 111 PRO PRO B . n 
B 1 112 THR 112 112 112 THR THR B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ILE 116 116 116 ILE ILE B . n 
B 1 117 TRP 117 117 117 TRP TRP B . n 
B 1 118 ILE 118 118 118 ILE ILE B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 GLY 120 120 120 GLY GLY B . n 
B 1 121 GLY 121 121 121 GLY GLY B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 PHE 123 123 123 PHE PHE B . n 
B 1 124 TYR 124 124 124 TYR TYR B . n 
B 1 125 SER 125 125 125 SER SER B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 ALA 127 127 127 ALA ALA B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 LEU 130 130 130 LEU LEU B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 VAL 132 132 132 VAL VAL B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 PHE 137 137 137 PHE PHE B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ALA 139 139 139 ALA ALA B . n 
B 1 140 GLN 140 140 140 GLN GLN B . n 
B 1 141 VAL 141 141 141 VAL VAL B . n 
B 1 142 GLU 142 142 142 GLU GLU B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 VAL 147 147 147 VAL VAL B . n 
B 1 148 SER 148 148 148 SER SER B . n 
B 1 149 MET 149 149 149 MET MET B . n 
B 1 150 ASN 150 150 150 ASN ASN B . n 
B 1 151 TYR 151 151 151 TYR TYR B . n 
B 1 152 ARG 152 152 152 ARG ARG B . n 
B 1 153 VAL 153 153 153 VAL VAL B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 THR 155 155 155 THR THR B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 GLY 157 157 157 GLY GLY B . n 
B 1 158 PHE 158 158 158 PHE PHE B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 ALA 160 160 160 ALA ALA B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 PRO 162 162 162 PRO PRO B . n 
B 1 163 GLY 163 163 163 GLY GLY B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 ALA 167 167 167 ALA ALA B . n 
B 1 168 PRO 168 168 168 PRO PRO B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 VAL 171 171 171 VAL VAL B . n 
B 1 172 GLY 172 172 172 GLY GLY B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LEU 174 174 174 LEU LEU B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 GLN 176 176 176 GLN GLN B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 LEU 178 178 178 LEU LEU B . n 
B 1 179 ALA 179 179 179 ALA ALA B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 TRP 182 182 182 TRP TRP B . n 
B 1 183 VAL 183 183 183 VAL VAL B . n 
B 1 184 GLN 184 184 184 GLN GLN B . n 
B 1 185 GLU 185 185 185 GLU GLU B . n 
B 1 186 ASN 186 186 186 ASN ASN B . n 
B 1 187 ILE 187 187 187 ILE ILE B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 ALA 189 189 189 ALA ALA B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 GLY 191 191 191 GLY GLY B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 ASP 193 193 193 ASP ASP B . n 
B 1 194 PRO 194 194 194 PRO PRO B . n 
B 1 195 MET 195 195 195 MET MET B . n 
B 1 196 SER 196 196 196 SER SER B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 THR 198 198 198 THR THR B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 PHE 200 200 200 PHE PHE B . n 
B 1 201 GLY 201 201 201 GLY GLY B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 SER 203 203 203 SER SER B . n 
B 1 204 ALA 204 204 204 ALA ALA B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 SER 208 208 208 SER SER B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 GLY 210 210 210 GLY GLY B . n 
B 1 211 MET 211 211 211 MET MET B . n 
B 1 212 HIS 212 212 212 HIS HIS B . n 
B 1 213 ILE 213 213 213 ILE ILE B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 SER 215 215 215 SER SER B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 ARG 219 219 219 ARG ARG B . n 
B 1 220 SER 220 220 220 SER SER B . n 
B 1 221 LEU 221 221 221 LEU LEU B . n 
B 1 222 PHE 222 222 222 PHE PHE B . n 
B 1 223 HIS 223 223 223 HIS HIS B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 ALA 225 225 225 ALA ALA B . n 
B 1 226 VAL 226 226 226 VAL VAL B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 GLN 228 228 228 GLN GLN B . n 
B 1 229 SER 229 229 229 SER SER B . n 
B 1 230 GLY 230 230 230 GLY GLY B . n 
B 1 231 THR 231 231 231 THR THR B . n 
B 1 232 PRO 232 232 232 PRO PRO B . n 
B 1 233 ASN 233 233 233 ASN ASN B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PRO 235 235 235 PRO PRO B . n 
B 1 236 TRP 236 236 236 TRP TRP B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 THR 238 238 238 THR THR B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 SER 240 240 240 SER SER B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 GLY 242 242 242 GLY GLY B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ALA 244 244 244 ALA ALA B . n 
B 1 245 ARG 245 245 245 ARG ARG B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ARG 247 247 247 ARG ARG B . n 
B 1 248 ALA 248 248 248 ALA ALA B . n 
B 1 249 THR 249 249 249 THR THR B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ARG 253 253 253 ARG ARG B . n 
B 1 254 LEU 254 254 254 LEU LEU B . n 
B 1 255 VAL 255 255 255 VAL VAL B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 CYS 257 257 257 CYS CYS B . n 
B 1 258 PRO 258 258 258 PRO PRO B . n 
B 1 259 PRO 259 259 ?   ?   ?   B . n 
B 1 260 GLY 260 260 ?   ?   ?   B . n 
B 1 261 GLY 261 261 ?   ?   ?   B . n 
B 1 262 ALA 262 262 ?   ?   ?   B . n 
B 1 263 GLY 263 263 ?   ?   ?   B . n 
B 1 264 GLY 264 264 ?   ?   ?   B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 ASP 266 266 266 ASP ASP B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 ILE 270 270 270 ILE ILE B . n 
B 1 271 ALA 271 271 271 ALA ALA B . n 
B 1 272 CYS 272 272 272 CYS CYS B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ARG 274 274 274 ARG ARG B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 ARG 276 276 276 ARG ARG B . n 
B 1 277 PRO 277 277 277 PRO PRO B . n 
B 1 278 ALA 278 278 278 ALA ALA B . n 
B 1 279 GLN 279 279 279 GLN GLN B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 VAL 282 282 282 VAL VAL B . n 
B 1 283 ASP 283 283 283 ASP ASP B . n 
B 1 284 HIS 284 284 284 HIS HIS B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 TRP 286 286 286 TRP TRP B . n 
B 1 287 HIS 287 287 287 HIS HIS B . n 
B 1 288 VAL 288 288 288 VAL VAL B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 GLN 291 291 291 GLN GLN B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 SER 293 293 293 SER SER B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 PHE 295 295 295 PHE PHE B . n 
B 1 296 ARG 296 296 296 ARG ARG B . n 
B 1 297 PHE 297 297 297 PHE PHE B . n 
B 1 298 SER 298 298 298 SER SER B . n 
B 1 299 PHE 299 299 299 PHE PHE B . n 
B 1 300 VAL 300 300 300 VAL VAL B . n 
B 1 301 PRO 301 301 301 PRO PRO B . n 
B 1 302 VAL 302 302 302 VAL VAL B . n 
B 1 303 VAL 303 303 303 VAL VAL B . n 
B 1 304 ASP 304 304 304 ASP ASP B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 PHE 307 307 307 PHE PHE B . n 
B 1 308 LEU 308 308 308 LEU LEU B . n 
B 1 309 SER 309 309 309 SER SER B . n 
B 1 310 ASP 310 310 310 ASP ASP B . n 
B 1 311 THR 311 311 311 THR THR B . n 
B 1 312 PRO 312 312 312 PRO PRO B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ALA 314 314 314 ALA ALA B . n 
B 1 315 LEU 315 315 315 LEU LEU B . n 
B 1 316 ILE 316 316 316 ILE ILE B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 THR 318 318 318 THR THR B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ASP 320 320 320 ASP ASP B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 GLN 322 322 322 GLN GLN B . n 
B 1 323 ASP 323 323 323 ASP ASP B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 GLN 325 325 325 GLN GLN B . n 
B 1 326 VAL 326 326 326 VAL VAL B . n 
B 1 327 LEU 327 327 327 LEU LEU B . n 
B 1 328 VAL 328 328 328 VAL VAL B . n 
B 1 329 GLY 329 329 329 GLY GLY B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 VAL 331 331 331 VAL VAL B . n 
B 1 332 LYS 332 332 332 LYS LYS B . n 
B 1 333 ASP 333 333 333 ASP ASP B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 GLY 335 335 335 GLY GLY B . n 
B 1 336 SER 336 336 336 SER SER B . n 
B 1 337 TYR 337 337 337 TYR TYR B . n 
B 1 338 PHE 338 338 338 PHE PHE B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 VAL 340 340 340 VAL VAL B . n 
B 1 341 TYR 341 341 341 TYR TYR B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 VAL 343 343 343 VAL VAL B . n 
B 1 344 PRO 344 344 344 PRO PRO B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 PHE 346 346 346 PHE PHE B . n 
B 1 347 SER 347 347 347 SER SER B . n 
B 1 348 LYS 348 348 348 LYS LYS B . n 
B 1 349 ASP 349 349 349 ASP ASP B . n 
B 1 350 ASN 350 350 350 ASN ASN B . n 
B 1 351 GLU 351 351 351 GLU GLU B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 LEU 353 353 353 LEU LEU B . n 
B 1 354 ILE 354 354 354 ILE ILE B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 ARG 356 356 356 ARG ARG B . n 
B 1 357 ALA 357 357 357 ALA ALA B . n 
B 1 358 GLN 358 358 358 GLN GLN B . n 
B 1 359 PHE 359 359 359 PHE PHE B . n 
B 1 360 LEU 360 360 360 LEU LEU B . n 
B 1 361 ALA 361 361 361 ALA ALA B . n 
B 1 362 GLY 362 362 362 GLY GLY B . n 
B 1 363 VAL 363 363 363 VAL VAL B . n 
B 1 364 ARG 364 364 364 ARG ARG B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 GLY 366 366 366 GLY GLY B . n 
B 1 367 VAL 367 367 367 VAL VAL B . n 
B 1 368 PRO 368 368 368 PRO PRO B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ALA 370 370 370 ALA ALA B . n 
B 1 371 SER 371 371 371 SER SER B . n 
B 1 372 ASP 372 372 372 ASP ASP B . n 
B 1 373 LEU 373 373 373 LEU LEU B . n 
B 1 374 ALA 374 374 374 ALA ALA B . n 
B 1 375 ALA 375 375 375 ALA ALA B . n 
B 1 376 GLU 376 376 376 GLU GLU B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 VAL 378 378 378 VAL VAL B . n 
B 1 379 VAL 379 379 379 VAL VAL B . n 
B 1 380 LEU 380 380 380 LEU LEU B . n 
B 1 381 HIS 381 381 381 HIS HIS B . n 
B 1 382 TYR 382 382 382 TYR TYR B . n 
B 1 383 THR 383 383 383 THR THR B . n 
B 1 384 ASP 384 384 384 ASP ASP B . n 
B 1 385 TRP 385 385 385 TRP TRP B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 HIS 387 387 387 HIS HIS B . n 
B 1 388 PRO 388 388 388 PRO PRO B . n 
B 1 389 GLU 389 389 389 GLU GLU B . n 
B 1 390 ASP 390 390 390 ASP ASP B . n 
B 1 391 PRO 391 391 391 PRO PRO B . n 
B 1 392 THR 392 392 392 THR THR B . n 
B 1 393 HIS 393 393 393 HIS HIS B . n 
B 1 394 LEU 394 394 394 LEU LEU B . n 
B 1 395 ARG 395 395 395 ARG ARG B . n 
B 1 396 ASP 396 396 396 ASP ASP B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 MET 398 398 398 MET MET B . n 
B 1 399 SER 399 399 399 SER SER B . n 
B 1 400 ALA 400 400 400 ALA ALA B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 VAL 402 402 402 VAL VAL B . n 
B 1 403 GLY 403 403 403 GLY GLY B . n 
B 1 404 ASP 404 404 404 ASP ASP B . n 
B 1 405 HIS 405 405 405 HIS HIS B . n 
B 1 406 ASN 406 406 406 ASN ASN B . n 
B 1 407 VAL 407 407 407 VAL VAL B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 CYS 409 409 409 CYS CYS B . n 
B 1 410 PRO 410 410 410 PRO PRO B . n 
B 1 411 VAL 411 411 411 VAL VAL B . n 
B 1 412 ALA 412 412 412 ALA ALA B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 ALA 415 415 415 ALA ALA B . n 
B 1 416 GLY 416 416 416 GLY GLY B . n 
B 1 417 ARG 417 417 417 ARG ARG B . n 
B 1 418 LEU 418 418 418 LEU LEU B . n 
B 1 419 ALA 419 419 419 ALA ALA B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 GLN 421 421 421 GLN GLN B . n 
B 1 422 GLY 422 422 422 GLY GLY B . n 
B 1 423 ALA 423 423 423 ALA ALA B . n 
B 1 424 ARG 424 424 424 ARG ARG B . n 
B 1 425 VAL 425 425 425 VAL VAL B . n 
B 1 426 TYR 426 426 426 TYR TYR B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 TYR 428 428 428 TYR TYR B . n 
B 1 429 ILE 429 429 429 ILE ILE B . n 
B 1 430 PHE 430 430 430 PHE PHE B . n 
B 1 431 GLU 431 431 431 GLU GLU B . n 
B 1 432 HIS 432 432 432 HIS HIS B . n 
B 1 433 ARG 433 433 433 ARG ARG B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 SER 435 435 435 SER SER B . n 
B 1 436 THR 436 436 436 THR THR B . n 
B 1 437 LEU 437 437 437 LEU LEU B . n 
B 1 438 THR 438 438 438 THR THR B . n 
B 1 439 TRP 439 439 439 TRP TRP B . n 
B 1 440 PRO 440 440 440 PRO PRO B . n 
B 1 441 LEU 441 441 441 LEU LEU B . n 
B 1 442 TRP 442 442 442 TRP TRP B . n 
B 1 443 MET 443 443 443 MET MET B . n 
B 1 444 GLY 444 444 444 GLY GLY B . n 
B 1 445 VAL 445 445 445 VAL VAL B . n 
B 1 446 PRO 446 446 446 PRO PRO B . n 
B 1 447 HIS 447 447 447 HIS HIS B . n 
B 1 448 GLY 448 448 448 GLY GLY B . n 
B 1 449 TYR 449 449 449 TYR TYR B . n 
B 1 450 GLU 450 450 450 GLU GLU B . n 
B 1 451 ILE 451 451 451 ILE ILE B . n 
B 1 452 GLU 452 452 452 GLU GLU B . n 
B 1 453 PHE 453 453 453 PHE PHE B . n 
B 1 454 ILE 454 454 454 ILE ILE B . n 
B 1 455 PHE 455 455 455 PHE PHE B . n 
B 1 456 GLY 456 456 456 GLY GLY B . n 
B 1 457 LEU 457 457 457 LEU LEU B . n 
B 1 458 PRO 458 458 458 PRO PRO B . n 
B 1 459 LEU 459 459 459 LEU LEU B . n 
B 1 460 ASP 460 460 460 ASP ASP B . n 
B 1 461 PRO 461 461 461 PRO PRO B . n 
B 1 462 SER 462 462 462 SER SER B . n 
B 1 463 LEU 463 463 463 LEU LEU B . n 
B 1 464 ASN 464 464 464 ASN ASN B . n 
B 1 465 TYR 465 465 465 TYR TYR B . n 
B 1 466 THR 466 466 466 THR THR B . n 
B 1 467 THR 467 467 467 THR THR B . n 
B 1 468 GLU 468 468 468 GLU GLU B . n 
B 1 469 GLU 469 469 469 GLU GLU B . n 
B 1 470 ARG 470 470 470 ARG ARG B . n 
B 1 471 ILE 471 471 471 ILE ILE B . n 
B 1 472 PHE 472 472 472 PHE PHE B . n 
B 1 473 ALA 473 473 473 ALA ALA B . n 
B 1 474 GLN 474 474 474 GLN GLN B . n 
B 1 475 ARG 475 475 475 ARG ARG B . n 
B 1 476 LEU 476 476 476 LEU LEU B . n 
B 1 477 MET 477 477 477 MET MET B . n 
B 1 478 LYS 478 478 478 LYS LYS B . n 
B 1 479 TYR 479 479 479 TYR TYR B . n 
B 1 480 TRP 480 480 480 TRP TRP B . n 
B 1 481 THR 481 481 481 THR THR B . n 
B 1 482 ASN 482 482 482 ASN ASN B . n 
B 1 483 PHE 483 483 483 PHE PHE B . n 
B 1 484 ALA 484 484 484 ALA ALA B . n 
B 1 485 ARG 485 485 485 ARG ARG B . n 
B 1 486 THR 486 486 486 THR THR B . n 
B 1 487 GLY 487 487 487 GLY GLY B . n 
B 1 488 ASP 488 488 488 ASP ASP B . n 
B 1 489 PRO 489 489 489 PRO PRO B . n 
B 1 490 ASN 490 490 490 ASN ASN B . n 
B 1 491 ASP 491 491 491 ASP ASP B . n 
B 1 492 PRO 492 492 492 PRO PRO B . n 
B 1 493 ARG 493 493 493 ARG ARG B . n 
B 1 494 ASP 494 494 494 ASP ASP B . n 
B 1 495 SER 495 495 495 SER ALA B . n 
B 1 496 LYS 496 496 496 LYS LYS B . n 
B 1 497 SER 497 497 497 SER SER B . n 
B 1 498 PRO 498 498 498 PRO PRO B . n 
B 1 499 GLN 499 499 499 GLN GLN B . n 
B 1 500 TRP 500 500 500 TRP TRP B . n 
B 1 501 PRO 501 501 501 PRO PRO B . n 
B 1 502 PRO 502 502 502 PRO PRO B . n 
B 1 503 TYR 503 503 503 TYR TYR B . n 
B 1 504 THR 504 504 504 THR THR B . n 
B 1 505 THR 505 505 505 THR THR B . n 
B 1 506 ALA 506 506 506 ALA ALA B . n 
B 1 507 ALA 507 507 507 ALA ALA B . n 
B 1 508 GLN 508 508 508 GLN GLN B . n 
B 1 509 GLN 509 509 509 GLN GLN B . n 
B 1 510 TYR 510 510 510 TYR TYR B . n 
B 1 511 VAL 511 511 511 VAL VAL B . n 
B 1 512 SER 512 512 512 SER SER B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 ASN 514 514 514 ASN ASN B . n 
B 1 515 LEU 515 515 515 LEU LEU B . n 
B 1 516 LYS 516 516 516 LYS LYS B . n 
B 1 517 PRO 517 517 517 PRO PRO B . n 
B 1 518 LEU 518 518 518 LEU LEU B . n 
B 1 519 GLU 519 519 519 GLU GLU B . n 
B 1 520 VAL 520 520 520 VAL VAL B . n 
B 1 521 ARG 521 521 521 ARG ARG B . n 
B 1 522 ARG 522 522 522 ARG ARG B . n 
B 1 523 GLY 523 523 523 GLY GLY B . n 
B 1 524 LEU 524 524 524 LEU LEU B . n 
B 1 525 ARG 525 525 525 ARG ARG B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 GLN 527 527 527 GLN GLN B . n 
B 1 528 THR 528 528 528 THR THR B . n 
B 1 529 CYS 529 529 529 CYS CYS B . n 
B 1 530 ALA 530 530 530 ALA ALA B . n 
B 1 531 PHE 531 531 531 PHE PHE B . n 
B 1 532 TRP 532 532 532 TRP TRP B . n 
B 1 533 ASN 533 533 533 ASN ASN B . n 
B 1 534 ARG 534 534 534 ARG ARG B . n 
B 1 535 PHE 535 535 535 PHE PHE B . n 
B 1 536 LEU 536 536 536 LEU LEU B . n 
B 1 537 PRO 537 537 537 PRO PRO B . n 
B 1 538 LYS 538 538 538 LYS LYS B . n 
B 1 539 LEU 539 539 539 LEU LEU B . n 
B 1 540 LEU 540 540 540 LEU LEU B . n 
B 1 541 SER 541 541 541 SER SER B . n 
B 1 542 ALA 542 542 542 ALA ALA B . n 
B 1 543 THR 543 543 543 THR THR B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 NAG 1   701  701 NAG NAG A . 
E 4 CO3 1   903  903 CO3 CO3 A . 
F 5 CL  1   999  999 CL  CL1 A . 
G 5 CL  1   1867 867 CL  CL1 A . 
H 6 DCU 1   951  951 DCU DEC A . 
I 3 NAG 1   601  601 NAG NAG B . 
J 4 CO3 1   904  904 CO3 CO3 B . 
K 7 P6G 1   901  901 P6G PEG B . 
L 8 PG4 1   902  902 PG4 PEB B . 
M 6 DCU 1   952  952 DCU DEC B . 
N 9 HOH 1   1868 501 HOH WAT A . 
N 9 HOH 2   1869 502 HOH WAT A . 
N 9 HOH 3   1870 503 HOH WAT A . 
N 9 HOH 4   1871 506 HOH WAT A . 
N 9 HOH 5   1872 507 HOH WAT A . 
N 9 HOH 6   1873 510 HOH WAT A . 
N 9 HOH 7   1874 513 HOH WAT A . 
N 9 HOH 8   1875 515 HOH WAT A . 
N 9 HOH 9   1876 516 HOH WAT A . 
N 9 HOH 10  1877 517 HOH WAT A . 
N 9 HOH 11  1878 519 HOH WAT A . 
N 9 HOH 12  1879 521 HOH WAT A . 
N 9 HOH 13  1880 522 HOH WAT A . 
N 9 HOH 14  1881 523 HOH WAT A . 
N 9 HOH 15  1882 524 HOH WAT A . 
N 9 HOH 16  1883 526 HOH WAT A . 
N 9 HOH 17  1884 527 HOH WAT A . 
N 9 HOH 18  1885 528 HOH WAT A . 
N 9 HOH 19  1886 529 HOH WAT A . 
N 9 HOH 20  1887 531 HOH WAT A . 
N 9 HOH 21  1888 532 HOH WAT A . 
N 9 HOH 22  1889 534 HOH WAT A . 
N 9 HOH 23  1890 536 HOH WAT A . 
N 9 HOH 24  1891 537 HOH WAT A . 
N 9 HOH 25  1892 541 HOH WAT A . 
N 9 HOH 26  1893 542 HOH WAT A . 
N 9 HOH 27  1894 544 HOH WAT A . 
N 9 HOH 28  1895 545 HOH WAT A . 
N 9 HOH 29  1896 546 HOH WAT A . 
N 9 HOH 30  1897 547 HOH WAT A . 
N 9 HOH 31  1898 548 HOH WAT A . 
N 9 HOH 32  1899 552 HOH WAT A . 
N 9 HOH 33  1900 553 HOH WAT A . 
N 9 HOH 34  1901 557 HOH WAT A . 
N 9 HOH 35  1902 558 HOH WAT A . 
N 9 HOH 36  1903 561 HOH WAT A . 
N 9 HOH 37  1904 567 HOH WAT A . 
N 9 HOH 38  1905 568 HOH WAT A . 
N 9 HOH 39  1906 569 HOH WAT A . 
N 9 HOH 40  1907 571 HOH WAT A . 
N 9 HOH 41  1908 572 HOH WAT A . 
N 9 HOH 42  1909 573 HOH WAT A . 
N 9 HOH 43  1910 574 HOH WAT A . 
N 9 HOH 44  1911 576 HOH WAT A . 
N 9 HOH 45  1912 577 HOH WAT A . 
N 9 HOH 46  1913 578 HOH WAT A . 
N 9 HOH 47  1914 579 HOH WAT A . 
N 9 HOH 48  1915 580 HOH WAT A . 
N 9 HOH 49  1916 583 HOH WAT A . 
N 9 HOH 50  1917 584 HOH WAT A . 
N 9 HOH 51  1918 585 HOH WAT A . 
N 9 HOH 52  1919 587 HOH WAT A . 
N 9 HOH 53  1920 591 HOH WAT A . 
N 9 HOH 54  1921 592 HOH WAT A . 
N 9 HOH 55  1922 596 HOH WAT A . 
N 9 HOH 56  1923 597 HOH WAT A . 
N 9 HOH 57  1924 598 HOH WAT A . 
N 9 HOH 58  1925 599 HOH WAT A . 
N 9 HOH 59  1926 600 HOH WAT A . 
N 9 HOH 60  1927 602 HOH WAT A . 
N 9 HOH 61  1928 603 HOH WAT A . 
N 9 HOH 62  1929 605 HOH WAT A . 
N 9 HOH 63  1930 606 HOH WAT A . 
N 9 HOH 64  1931 609 HOH WAT A . 
N 9 HOH 65  1932 610 HOH WAT A . 
N 9 HOH 66  1933 611 HOH WAT A . 
N 9 HOH 67  1934 612 HOH WAT A . 
N 9 HOH 68  1935 614 HOH WAT A . 
N 9 HOH 69  1936 616 HOH WAT A . 
N 9 HOH 70  1937 617 HOH WAT A . 
N 9 HOH 71  1938 620 HOH WAT A . 
N 9 HOH 72  1939 621 HOH WAT A . 
N 9 HOH 73  1940 622 HOH WAT A . 
N 9 HOH 74  1941 624 HOH WAT A . 
N 9 HOH 75  1942 625 HOH WAT A . 
N 9 HOH 76  1943 626 HOH WAT A . 
N 9 HOH 77  1944 629 HOH WAT A . 
N 9 HOH 78  1945 632 HOH WAT A . 
N 9 HOH 79  1946 633 HOH WAT A . 
N 9 HOH 80  1947 637 HOH WAT A . 
N 9 HOH 81  1948 638 HOH WAT A . 
N 9 HOH 82  1949 639 HOH WAT A . 
N 9 HOH 83  1950 640 HOH WAT A . 
N 9 HOH 84  1951 642 HOH WAT A . 
N 9 HOH 85  1952 643 HOH WAT A . 
N 9 HOH 86  1953 645 HOH WAT A . 
N 9 HOH 87  1954 647 HOH WAT A . 
N 9 HOH 88  1955 649 HOH WAT A . 
N 9 HOH 89  1956 652 HOH WAT A . 
N 9 HOH 90  1957 653 HOH WAT A . 
N 9 HOH 91  1958 654 HOH WAT A . 
N 9 HOH 92  1959 655 HOH WAT A . 
N 9 HOH 93  1960 656 HOH WAT A . 
N 9 HOH 94  1961 657 HOH WAT A . 
N 9 HOH 95  1962 659 HOH WAT A . 
N 9 HOH 96  1963 661 HOH WAT A . 
N 9 HOH 97  1964 662 HOH WAT A . 
N 9 HOH 98  1965 664 HOH WAT A . 
N 9 HOH 99  1966 665 HOH WAT A . 
N 9 HOH 100 1967 666 HOH WAT A . 
N 9 HOH 101 1968 669 HOH WAT A . 
N 9 HOH 102 1969 670 HOH WAT A . 
N 9 HOH 103 1970 675 HOH WAT A . 
N 9 HOH 104 1971 676 HOH WAT A . 
N 9 HOH 105 1972 678 HOH WAT A . 
N 9 HOH 106 1973 680 HOH WAT A . 
N 9 HOH 107 1974 685 HOH WAT A . 
N 9 HOH 108 1975 688 HOH WAT A . 
N 9 HOH 109 1976 689 HOH WAT A . 
N 9 HOH 110 1977 690 HOH WAT A . 
N 9 HOH 111 1978 692 HOH WAT A . 
N 9 HOH 112 1979 694 HOH WAT A . 
N 9 HOH 113 1980 699 HOH WAT A . 
N 9 HOH 114 1981 700 HOH WAT A . 
N 9 HOH 115 1982 702 HOH WAT A . 
N 9 HOH 116 1983 703 HOH WAT A . 
N 9 HOH 117 1984 704 HOH WAT A . 
N 9 HOH 118 1985 711 HOH WAT A . 
N 9 HOH 119 1986 712 HOH WAT A . 
N 9 HOH 120 1987 713 HOH WAT A . 
N 9 HOH 121 1988 714 HOH WAT A . 
N 9 HOH 122 1989 715 HOH WAT A . 
N 9 HOH 123 1990 719 HOH WAT A . 
N 9 HOH 124 1991 720 HOH WAT A . 
N 9 HOH 125 1992 721 HOH WAT A . 
N 9 HOH 126 1993 722 HOH WAT A . 
N 9 HOH 127 1994 726 HOH WAT A . 
N 9 HOH 128 1995 727 HOH WAT A . 
N 9 HOH 129 1996 728 HOH WAT A . 
N 9 HOH 130 1997 730 HOH WAT A . 
N 9 HOH 131 1998 731 HOH WAT A . 
N 9 HOH 132 1999 732 HOH WAT A . 
N 9 HOH 133 2000 734 HOH WAT A . 
N 9 HOH 134 2001 737 HOH WAT A . 
N 9 HOH 135 2002 738 HOH WAT A . 
N 9 HOH 136 2003 739 HOH WAT A . 
N 9 HOH 137 2004 742 HOH WAT A . 
N 9 HOH 138 2005 744 HOH WAT A . 
N 9 HOH 139 2006 746 HOH WAT A . 
N 9 HOH 140 2007 747 HOH WAT A . 
N 9 HOH 141 2008 748 HOH WAT A . 
N 9 HOH 142 2009 749 HOH WAT A . 
N 9 HOH 143 2010 750 HOH WAT A . 
N 9 HOH 144 2011 753 HOH WAT A . 
N 9 HOH 145 2012 754 HOH WAT A . 
N 9 HOH 146 2013 757 HOH WAT A . 
N 9 HOH 147 2014 763 HOH WAT A . 
N 9 HOH 148 2015 764 HOH WAT A . 
N 9 HOH 149 2016 766 HOH WAT A . 
N 9 HOH 150 2017 768 HOH WAT A . 
N 9 HOH 151 2018 769 HOH WAT A . 
N 9 HOH 152 2019 771 HOH WAT A . 
N 9 HOH 153 2020 772 HOH WAT A . 
N 9 HOH 154 2021 774 HOH WAT A . 
N 9 HOH 155 2022 776 HOH WAT A . 
N 9 HOH 156 2023 779 HOH WAT A . 
N 9 HOH 157 2024 780 HOH WAT A . 
N 9 HOH 158 2025 781 HOH WAT A . 
N 9 HOH 159 2026 782 HOH WAT A . 
N 9 HOH 160 2027 783 HOH WAT A . 
N 9 HOH 161 2028 785 HOH WAT A . 
N 9 HOH 162 2029 786 HOH WAT A . 
N 9 HOH 163 2030 787 HOH WAT A . 
N 9 HOH 164 2031 790 HOH WAT A . 
N 9 HOH 165 2032 791 HOH WAT A . 
N 9 HOH 166 2033 793 HOH WAT A . 
N 9 HOH 167 2034 794 HOH WAT A . 
N 9 HOH 168 2035 796 HOH WAT A . 
N 9 HOH 169 2036 797 HOH WAT A . 
N 9 HOH 170 2037 798 HOH WAT A . 
N 9 HOH 171 2038 799 HOH WAT A . 
N 9 HOH 172 2039 800 HOH WAT A . 
N 9 HOH 173 2040 801 HOH WAT A . 
N 9 HOH 174 2041 802 HOH WAT A . 
N 9 HOH 175 2042 803 HOH WAT A . 
N 9 HOH 176 2043 804 HOH WAT A . 
N 9 HOH 177 2044 805 HOH WAT A . 
N 9 HOH 178 2045 807 HOH WAT A . 
N 9 HOH 179 2046 808 HOH WAT A . 
N 9 HOH 180 2047 809 HOH WAT A . 
N 9 HOH 181 2048 810 HOH WAT A . 
N 9 HOH 182 2049 811 HOH WAT A . 
N 9 HOH 183 2050 812 HOH WAT A . 
N 9 HOH 184 2051 813 HOH WAT A . 
N 9 HOH 185 2052 814 HOH WAT A . 
N 9 HOH 186 2053 816 HOH WAT A . 
N 9 HOH 187 2054 818 HOH WAT A . 
N 9 HOH 188 2055 819 HOH WAT A . 
N 9 HOH 189 2056 820 HOH WAT A . 
N 9 HOH 190 2057 823 HOH WAT A . 
N 9 HOH 191 2058 824 HOH WAT A . 
N 9 HOH 192 2059 825 HOH WAT A . 
N 9 HOH 193 2060 826 HOH WAT A . 
N 9 HOH 194 2061 827 HOH WAT A . 
N 9 HOH 195 2062 828 HOH WAT A . 
N 9 HOH 196 2063 829 HOH WAT A . 
N 9 HOH 197 2064 830 HOH WAT A . 
N 9 HOH 198 2065 835 HOH WAT A . 
N 9 HOH 199 2066 836 HOH WAT A . 
N 9 HOH 200 2067 837 HOH WAT A . 
N 9 HOH 201 2068 838 HOH WAT A . 
N 9 HOH 202 2069 839 HOH WAT A . 
N 9 HOH 203 2070 840 HOH WAT A . 
N 9 HOH 204 2071 841 HOH WAT A . 
N 9 HOH 205 2072 842 HOH WAT A . 
N 9 HOH 206 2073 843 HOH WAT A . 
N 9 HOH 207 2074 844 HOH WAT A . 
N 9 HOH 208 2075 845 HOH WAT A . 
N 9 HOH 209 2076 846 HOH WAT A . 
N 9 HOH 210 2077 849 HOH WAT A . 
N 9 HOH 211 2078 850 HOH WAT A . 
N 9 HOH 212 2079 851 HOH WAT A . 
N 9 HOH 213 2080 852 HOH WAT A . 
N 9 HOH 214 2081 873 HOH WAT A . 
N 9 HOH 215 2082 874 HOH WAT A . 
N 9 HOH 216 2083 875 HOH WAT A . 
N 9 HOH 217 2084 876 HOH WAT A . 
N 9 HOH 218 2085 877 HOH WAT A . 
N 9 HOH 219 2086 878 HOH WAT A . 
N 9 HOH 220 2087 880 HOH WAT A . 
N 9 HOH 221 2088 881 HOH WAT A . 
N 9 HOH 222 2089 885 HOH WAT A . 
N 9 HOH 223 2090 886 HOH WAT A . 
O 9 HOH 1   953  504 HOH WAT B . 
O 9 HOH 2   954  505 HOH WAT B . 
O 9 HOH 3   955  508 HOH WAT B . 
O 9 HOH 4   956  509 HOH WAT B . 
O 9 HOH 5   957  511 HOH WAT B . 
O 9 HOH 6   958  512 HOH WAT B . 
O 9 HOH 7   959  514 HOH WAT B . 
O 9 HOH 8   960  518 HOH WAT B . 
O 9 HOH 9   961  520 HOH WAT B . 
O 9 HOH 10  962  525 HOH WAT B . 
O 9 HOH 11  963  530 HOH WAT B . 
O 9 HOH 12  964  533 HOH WAT B . 
O 9 HOH 13  965  535 HOH WAT B . 
O 9 HOH 14  966  538 HOH WAT B . 
O 9 HOH 15  967  539 HOH WAT B . 
O 9 HOH 16  968  540 HOH WAT B . 
O 9 HOH 17  969  543 HOH WAT B . 
O 9 HOH 18  970  549 HOH WAT B . 
O 9 HOH 19  971  550 HOH WAT B . 
O 9 HOH 20  972  551 HOH WAT B . 
O 9 HOH 21  973  554 HOH WAT B . 
O 9 HOH 22  974  555 HOH WAT B . 
O 9 HOH 23  975  556 HOH WAT B . 
O 9 HOH 24  976  559 HOH WAT B . 
O 9 HOH 25  977  560 HOH WAT B . 
O 9 HOH 26  978  562 HOH WAT B . 
O 9 HOH 27  979  563 HOH WAT B . 
O 9 HOH 28  980  564 HOH WAT B . 
O 9 HOH 29  981  565 HOH WAT B . 
O 9 HOH 30  982  566 HOH WAT B . 
O 9 HOH 31  983  570 HOH WAT B . 
O 9 HOH 32  984  575 HOH WAT B . 
O 9 HOH 33  985  581 HOH WAT B . 
O 9 HOH 34  986  582 HOH WAT B . 
O 9 HOH 35  987  586 HOH WAT B . 
O 9 HOH 36  988  588 HOH WAT B . 
O 9 HOH 37  989  589 HOH WAT B . 
O 9 HOH 38  990  590 HOH WAT B . 
O 9 HOH 39  991  593 HOH WAT B . 
O 9 HOH 40  992  594 HOH WAT B . 
O 9 HOH 41  993  595 HOH WAT B . 
O 9 HOH 42  994  601 HOH WAT B . 
O 9 HOH 43  995  604 HOH WAT B . 
O 9 HOH 44  996  607 HOH WAT B . 
O 9 HOH 45  997  608 HOH WAT B . 
O 9 HOH 46  998  613 HOH WAT B . 
O 9 HOH 47  999  615 HOH WAT B . 
O 9 HOH 48  1000 618 HOH WAT B . 
O 9 HOH 49  1001 619 HOH WAT B . 
O 9 HOH 50  1002 623 HOH WAT B . 
O 9 HOH 51  1003 627 HOH WAT B . 
O 9 HOH 52  1004 628 HOH WAT B . 
O 9 HOH 53  1005 630 HOH WAT B . 
O 9 HOH 54  1006 631 HOH WAT B . 
O 9 HOH 55  1007 634 HOH WAT B . 
O 9 HOH 56  1008 635 HOH WAT B . 
O 9 HOH 57  1009 636 HOH WAT B . 
O 9 HOH 58  1010 641 HOH WAT B . 
O 9 HOH 59  1011 644 HOH WAT B . 
O 9 HOH 60  1012 646 HOH WAT B . 
O 9 HOH 61  1013 648 HOH WAT B . 
O 9 HOH 62  1014 650 HOH WAT B . 
O 9 HOH 63  1015 651 HOH WAT B . 
O 9 HOH 64  1016 658 HOH WAT B . 
O 9 HOH 65  1017 660 HOH WAT B . 
O 9 HOH 66  1018 663 HOH WAT B . 
O 9 HOH 67  1019 667 HOH WAT B . 
O 9 HOH 68  1020 668 HOH WAT B . 
O 9 HOH 69  1021 671 HOH WAT B . 
O 9 HOH 70  1022 672 HOH WAT B . 
O 9 HOH 71  1023 673 HOH WAT B . 
O 9 HOH 72  1024 674 HOH WAT B . 
O 9 HOH 73  1025 677 HOH WAT B . 
O 9 HOH 74  1026 679 HOH WAT B . 
O 9 HOH 75  1027 681 HOH WAT B . 
O 9 HOH 76  1028 682 HOH WAT B . 
O 9 HOH 77  1029 683 HOH WAT B . 
O 9 HOH 78  1030 684 HOH WAT B . 
O 9 HOH 79  1031 686 HOH WAT B . 
O 9 HOH 80  1032 687 HOH WAT B . 
O 9 HOH 81  1033 691 HOH WAT B . 
O 9 HOH 82  1034 693 HOH WAT B . 
O 9 HOH 83  1035 695 HOH WAT B . 
O 9 HOH 84  1036 696 HOH WAT B . 
O 9 HOH 85  1037 697 HOH WAT B . 
O 9 HOH 86  1038 698 HOH WAT B . 
O 9 HOH 87  1039 701 HOH WAT B . 
O 9 HOH 88  1040 705 HOH WAT B . 
O 9 HOH 89  1041 706 HOH WAT B . 
O 9 HOH 90  1042 707 HOH WAT B . 
O 9 HOH 91  1043 708 HOH WAT B . 
O 9 HOH 92  1044 709 HOH WAT B . 
O 9 HOH 93  1045 710 HOH WAT B . 
O 9 HOH 94  1046 716 HOH WAT B . 
O 9 HOH 95  1047 717 HOH WAT B . 
O 9 HOH 96  1048 718 HOH WAT B . 
O 9 HOH 97  1049 723 HOH WAT B . 
O 9 HOH 98  1050 724 HOH WAT B . 
O 9 HOH 99  1051 725 HOH WAT B . 
O 9 HOH 100 1052 729 HOH WAT B . 
O 9 HOH 101 1053 733 HOH WAT B . 
O 9 HOH 102 1054 735 HOH WAT B . 
O 9 HOH 103 1055 736 HOH WAT B . 
O 9 HOH 104 1056 740 HOH WAT B . 
O 9 HOH 105 1057 741 HOH WAT B . 
O 9 HOH 106 1058 743 HOH WAT B . 
O 9 HOH 107 1059 745 HOH WAT B . 
O 9 HOH 108 1060 751 HOH WAT B . 
O 9 HOH 109 1061 752 HOH WAT B . 
O 9 HOH 110 1062 755 HOH WAT B . 
O 9 HOH 111 1063 756 HOH WAT B . 
O 9 HOH 112 1064 758 HOH WAT B . 
O 9 HOH 113 1065 759 HOH WAT B . 
O 9 HOH 114 1066 760 HOH WAT B . 
O 9 HOH 115 1067 761 HOH WAT B . 
O 9 HOH 116 1068 762 HOH WAT B . 
O 9 HOH 117 1069 765 HOH WAT B . 
O 9 HOH 118 1070 767 HOH WAT B . 
O 9 HOH 119 1071 770 HOH WAT B . 
O 9 HOH 120 1072 773 HOH WAT B . 
O 9 HOH 121 1073 775 HOH WAT B . 
O 9 HOH 122 1074 777 HOH WAT B . 
O 9 HOH 123 1075 778 HOH WAT B . 
O 9 HOH 124 1076 784 HOH WAT B . 
O 9 HOH 125 1077 788 HOH WAT B . 
O 9 HOH 126 1078 789 HOH WAT B . 
O 9 HOH 127 1079 792 HOH WAT B . 
O 9 HOH 128 1080 795 HOH WAT B . 
O 9 HOH 129 1081 806 HOH WAT B . 
O 9 HOH 130 1082 815 HOH WAT B . 
O 9 HOH 131 1083 817 HOH WAT B . 
O 9 HOH 132 1084 821 HOH WAT B . 
O 9 HOH 133 1085 822 HOH WAT B . 
O 9 HOH 134 1086 831 HOH WAT B . 
O 9 HOH 135 1087 832 HOH WAT B . 
O 9 HOH 136 1088 833 HOH WAT B . 
O 9 HOH 137 1089 834 HOH WAT B . 
O 9 HOH 138 1090 847 HOH WAT B . 
O 9 HOH 139 1091 848 HOH WAT B . 
O 9 HOH 140 1092 853 HOH WAT B . 
O 9 HOH 141 1093 854 HOH WAT B . 
O 9 HOH 142 1094 855 HOH WAT B . 
O 9 HOH 143 1095 857 HOH WAT B . 
O 9 HOH 144 1096 858 HOH WAT B . 
O 9 HOH 145 1097 859 HOH WAT B . 
O 9 HOH 146 1098 860 HOH WAT B . 
O 9 HOH 147 1099 861 HOH WAT B . 
O 9 HOH 148 1100 862 HOH WAT B . 
O 9 HOH 149 1101 863 HOH WAT B . 
O 9 HOH 150 1102 864 HOH WAT B . 
O 9 HOH 151 1103 865 HOH WAT B . 
O 9 HOH 152 1104 866 HOH WAT B . 
O 9 HOH 153 1105 867 HOH WAT B . 
O 9 HOH 154 1106 868 HOH WAT B . 
O 9 HOH 155 1107 869 HOH WAT B . 
O 9 HOH 156 1108 870 HOH WAT B . 
O 9 HOH 157 1109 871 HOH WAT B . 
O 9 HOH 158 1110 872 HOH WAT B . 
O 9 HOH 159 1111 879 HOH WAT B . 
O 9 HOH 160 1112 882 HOH WAT B . 
O 9 HOH 161 1113 883 HOH WAT B . 
O 9 HOH 162 1114 884 HOH WAT B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 350 A ASN 350 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 464 A ASN 464 ? ASN 'GLYCOSYLATION SITE' 
3 B ASN 350 B ASN 350 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-02-04 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-02-07 
5 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 5 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Experimental preparation'  
5 5 'Structure model' Advisory                    
6 5 'Structure model' 'Atomic model'              
7 5 'Structure model' 'Data collection'           
8 5 'Structure model' 'Derived calculations'      
9 5 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' exptl_crystal_grow            
2  5 'Structure model' atom_site                     
3  5 'Structure model' chem_comp                     
4  5 'Structure model' entity                        
5  5 'Structure model' pdbx_branch_scheme            
6  5 'Structure model' pdbx_chem_comp_identifier     
7  5 'Structure model' pdbx_entity_branch            
8  5 'Structure model' pdbx_entity_branch_descriptor 
9  5 'Structure model' pdbx_entity_branch_link       
10 5 'Structure model' pdbx_entity_branch_list       
11 5 'Structure model' pdbx_entity_nonpoly           
12 5 'Structure model' pdbx_nonpoly_scheme           
13 5 'Structure model' pdbx_struct_assembly_gen      
14 5 'Structure model' pdbx_unobs_or_zero_occ_atoms  
15 5 'Structure model' struct_asym                   
16 5 'Structure model' struct_conn                   
17 5 'Structure model' struct_site                   
18 5 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_exptl_crystal_grow.pdbx_details'            
2  4 'Structure model' '_exptl_crystal_grow.temp'                    
3  5 'Structure model' '_atom_site.auth_asym_id'                     
4  5 'Structure model' '_atom_site.auth_seq_id'                      
5  5 'Structure model' '_atom_site.label_asym_id'                    
6  5 'Structure model' '_atom_site.label_entity_id'                  
7  5 'Structure model' '_chem_comp.name'                             
8  5 'Structure model' '_chem_comp.type'                             
9  5 'Structure model' '_entity.formula_weight'                      
10 5 'Structure model' '_entity.pdbx_description'                    
11 5 'Structure model' '_entity.pdbx_number_of_molecules'            
12 5 'Structure model' '_entity.type'                                
13 5 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
14 5 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.label_asym_id' 
15 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
16 5 'Structure model' '_struct_conn.pdbx_role'                      
17 5 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
18 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
19 5 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
20 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
21 5 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
DENZO 'data reduction' .         ? 1 ? ? ? ? 
SCALA 'data scaling'   .         ? 2 ? ? ? ? 
CNS   refinement       .         ? 3 ? ? ? ? 
CCP4  'data scaling'   '(SCALA)' ? 4 ? ? ? ? 
CNS   phasing          .         ? 5 ? ? ? ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   C 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   CYS 
_pdbx_validate_close_contact.auth_seq_id_1    257 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   CD 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   PRO 
_pdbx_validate_close_contact.auth_seq_id_2    258 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.75 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C A CYS 257 ? ? N  A PRO 258 ? ? CA A PRO 258 ? ? 179.44 119.30 60.14  1.50 Y 
2 1 C A CYS 257 ? ? N  A PRO 258 ? ? CD A PRO 258 ? ? 76.37  128.40 -52.03 2.10 Y 
3 1 C B ASP 491 ? ? N  B PRO 492 ? ? CA B PRO 492 ? ? 131.23 119.30 11.93  1.50 Y 
4 1 N B ASP 494 ? ? CA B ASP 494 ? ? C  B ASP 494 ? ? 92.21  111.00 -18.79 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 75.84   -7.30   
2  1 ALA A 62  ? ? -119.33 51.39   
3  1 ALA A 127 ? ? -173.46 145.79  
4  1 LEU A 161 ? ? -119.22 79.97   
5  1 ALA A 167 ? ? -151.36 67.04   
6  1 ASN A 170 ? ? 57.84   19.43   
7  1 SER A 203 ? ? 59.71   -115.94 
8  1 ASP A 306 ? ? -127.47 -87.00  
9  1 ASP A 323 ? ? -101.87 55.35   
10 1 VAL A 407 ? ? -128.77 -65.04  
11 1 ASP A 494 ? ? 171.69  102.10  
12 1 PRO B 6   ? ? -48.65  -19.96  
13 1 PHE B 47  ? ? 75.08   -3.27   
14 1 ALA B 62  ? ? -116.08 52.39   
15 1 ALA B 127 ? ? -170.16 147.68  
16 1 ALA B 167 ? ? -151.98 63.82   
17 1 ASN B 170 ? ? 58.24   18.84   
18 1 SER B 203 ? ? 56.26   -120.79 
19 1 ASP B 306 ? ? -126.62 -81.39  
20 1 ASP B 323 ? ? -100.60 52.27   
21 1 TRP B 385 ? ? -59.01  -7.52   
22 1 VAL B 407 ? ? -127.89 -64.56  
23 1 ASP B 494 ? ? 160.98  117.11  
24 1 LYS B 496 ? ? -170.41 96.66   
25 1 SER B 497 ? ? -79.74  -80.70  
26 1 ALA B 542 ? ? 152.26  -84.92  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    TYR 
_pdbx_validate_planes.auth_asym_id    B 
_pdbx_validate_planes.auth_seq_id     70 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.071 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A LYS 496 ? CG ? A LYS 496 CG 
2 1 Y 1 A LYS 496 ? CD ? A LYS 496 CD 
3 1 Y 1 A LYS 496 ? CE ? A LYS 496 CE 
4 1 Y 1 A LYS 496 ? NZ ? A LYS 496 NZ 
5 1 Y 1 B SER 495 ? OG ? B SER 495 OG 
6 1 N 1 B PG4 902 ? O1 ? L PG4 1   O1 
7 1 N 1 B PG4 902 ? O5 ? L PG4 1   O5 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A PRO 259 ? A PRO 259 
2  1 Y 1 A GLY 260 ? A GLY 260 
3  1 Y 1 A GLY 261 ? A GLY 261 
4  1 Y 1 A ALA 262 ? A ALA 262 
5  1 Y 1 A GLY 263 ? A GLY 263 
6  1 Y 1 A GLY 264 ? A GLY 264 
7  1 Y 1 A THR 543 ? A THR 543 
8  1 Y 1 B GLU 1   ? B GLU 1   
9  1 Y 1 B GLY 2   ? B GLY 2   
10 1 Y 1 B ARG 3   ? B ARG 3   
11 1 Y 1 B PRO 259 ? B PRO 259 
12 1 Y 1 B GLY 260 ? B GLY 260 
13 1 Y 1 B GLY 261 ? B GLY 261 
14 1 Y 1 B ALA 262 ? B ALA 262 
15 1 Y 1 B GLY 263 ? B GLY 263 
16 1 Y 1 B GLY 264 ? B GLY 264 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 C NAG 501 n 
C 2 FUC 2 C FUC 2 C FUC 502 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 LFucpa1-6DGlcpNAcb1-                                                 'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,2,1/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-2/a6-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(6+1)][a-L-Fucp]{}}}'                      LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  2 
_pdbx_entity_branch_link.entity_branch_list_num_1   2 
_pdbx_entity_branch_link.comp_id_1                  FUC 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   1 
_pdbx_entity_branch_link.comp_id_2                  NAG 
_pdbx_entity_branch_link.atom_id_2                  O6 
_pdbx_entity_branch_link.leaving_atom_id_2          HO6 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 FUC 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 2-acetamido-2-deoxy-beta-D-glucopyranose                               NAG 
4 'CARBONATE ION'                                                        CO3 
5 'CHLORIDE ION'                                                         CL  
6 
;3,8-DIAMINO-5,10'-(TRIMETHYLAMMONIUM)DECYL-6-PHENYL PHENANTHRIDINIUM
;
DCU 
7 'HEXAETHYLENE GLYCOL'                                                  P6G 
8 'TETRAETHYLENE GLYCOL'                                                 PG4 
9 water                                                                  HOH 
#