data_1J1B
# 
_entry.id   1J1B 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1J1B         
RCSB  RCSB005505   
WWPDB D_1000005505 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1J1C 
_pdbx_database_related.details        'human tau protein kinase I with ADP' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1J1B 
_pdbx_database_status.recvd_initial_deposition_date   2002-12-03 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Aoki, M.'      1 
'Yokota, T.'    2 
'Sugiura, I.'   3 
'Sasaki, C.'    4 
'Hasegawa, T.'  5 
'Okumura, C.'   6 
'Kohno, T.'     7 
'Sugio, S.'     8 
'Matsuzaki, T.' 9 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural insight into nucleotide recognition in tau-protein kinase I/glycogen synthase kinase 3 beta.'   
'Acta Crystallogr.,Sect.D' 60 439  446  2004 ABCRE6 DK 0907-4449 0766 ? 14993667 10.1107/S090744490302938X 
1       'Expression, purification and crystallization of human tau-protein kinase I/glycogen synthase kinase-3beta' 
'Acta Crystallogr.,Sect.D' 56 1464 1465 2000 ABCRE6 DK 0907-4449 0766 ? ?        10.1107/S0907444900010386 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Aoki, M.'          1  
primary 'Yokota, T.'        2  
primary 'Sugiura, I.'       3  
primary 'Sasaki, C.'        4  
primary 'Hasegawa, T.'      5  
primary 'Okumura, C.'       6  
primary 'Ishiguro, K.'      7  
primary 'Kohno, T.'         8  
primary 'Sugio, S.'         9  
primary 'Matsuzaki, T.'     10 
1       'Aoki, M.'          11 
1       'Iwamoto-Sugai, M.' 12 
1       'Sugiura, I.'       13 
1       'Sasaki, C.'        14 
1       'Hasegawa, T.'      15 
1       'Okumura, C.'       16 
1       'Sugio, S.'         17 
1       'Kohno, T.'         18 
1       'Matsuzaki, T.'     19 
# 
_cell.entry_id           1J1B 
_cell.length_a           82.8 
_cell.length_b           86.3 
_cell.length_c           178.4 
_cell.angle_alpha        90.0 
_cell.angle_beta         90.0 
_cell.angle_gamma        90.0 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1J1B 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glycogen synthase kinase-3 beta'             46801.215 2   2.7.1.37 ? ? ? 
2 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196   2   ?        ? ? ? 
3 water       nat water                                         18.015    419 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Tau Protein Kinase I, GSK-3 beta' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGE
LVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKL
YMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRL
LEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDA
NTGDRGQTNNAASASASNST
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGE
LVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKL
YMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRL
LEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDA
NTGDRGQTNNAASASASNST
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLY n 
1 4   ARG n 
1 5   PRO n 
1 6   ARG n 
1 7   THR n 
1 8   THR n 
1 9   SER n 
1 10  PHE n 
1 11  ALA n 
1 12  GLU n 
1 13  SER n 
1 14  CYS n 
1 15  LYS n 
1 16  PRO n 
1 17  VAL n 
1 18  GLN n 
1 19  GLN n 
1 20  PRO n 
1 21  SER n 
1 22  ALA n 
1 23  PHE n 
1 24  GLY n 
1 25  SER n 
1 26  MET n 
1 27  LYS n 
1 28  VAL n 
1 29  SER n 
1 30  ARG n 
1 31  ASP n 
1 32  LYS n 
1 33  ASP n 
1 34  GLY n 
1 35  SER n 
1 36  LYS n 
1 37  VAL n 
1 38  THR n 
1 39  THR n 
1 40  VAL n 
1 41  VAL n 
1 42  ALA n 
1 43  THR n 
1 44  PRO n 
1 45  GLY n 
1 46  GLN n 
1 47  GLY n 
1 48  PRO n 
1 49  ASP n 
1 50  ARG n 
1 51  PRO n 
1 52  GLN n 
1 53  GLU n 
1 54  VAL n 
1 55  SER n 
1 56  TYR n 
1 57  THR n 
1 58  ASP n 
1 59  THR n 
1 60  LYS n 
1 61  VAL n 
1 62  ILE n 
1 63  GLY n 
1 64  ASN n 
1 65  GLY n 
1 66  SER n 
1 67  PHE n 
1 68  GLY n 
1 69  VAL n 
1 70  VAL n 
1 71  TYR n 
1 72  GLN n 
1 73  ALA n 
1 74  LYS n 
1 75  LEU n 
1 76  CYS n 
1 77  ASP n 
1 78  SER n 
1 79  GLY n 
1 80  GLU n 
1 81  LEU n 
1 82  VAL n 
1 83  ALA n 
1 84  ILE n 
1 85  LYS n 
1 86  LYS n 
1 87  VAL n 
1 88  LEU n 
1 89  GLN n 
1 90  ASP n 
1 91  LYS n 
1 92  ARG n 
1 93  PHE n 
1 94  LYS n 
1 95  ASN n 
1 96  ARG n 
1 97  GLU n 
1 98  LEU n 
1 99  GLN n 
1 100 ILE n 
1 101 MET n 
1 102 ARG n 
1 103 LYS n 
1 104 LEU n 
1 105 ASP n 
1 106 HIS n 
1 107 CYS n 
1 108 ASN n 
1 109 ILE n 
1 110 VAL n 
1 111 ARG n 
1 112 LEU n 
1 113 ARG n 
1 114 TYR n 
1 115 PHE n 
1 116 PHE n 
1 117 TYR n 
1 118 SER n 
1 119 SER n 
1 120 GLY n 
1 121 GLU n 
1 122 LYS n 
1 123 LYS n 
1 124 ASP n 
1 125 GLU n 
1 126 VAL n 
1 127 TYR n 
1 128 LEU n 
1 129 ASN n 
1 130 LEU n 
1 131 VAL n 
1 132 LEU n 
1 133 ASP n 
1 134 TYR n 
1 135 VAL n 
1 136 PRO n 
1 137 GLU n 
1 138 THR n 
1 139 VAL n 
1 140 TYR n 
1 141 ARG n 
1 142 VAL n 
1 143 ALA n 
1 144 ARG n 
1 145 HIS n 
1 146 TYR n 
1 147 SER n 
1 148 ARG n 
1 149 ALA n 
1 150 LYS n 
1 151 GLN n 
1 152 THR n 
1 153 LEU n 
1 154 PRO n 
1 155 VAL n 
1 156 ILE n 
1 157 TYR n 
1 158 VAL n 
1 159 LYS n 
1 160 LEU n 
1 161 TYR n 
1 162 MET n 
1 163 TYR n 
1 164 GLN n 
1 165 LEU n 
1 166 PHE n 
1 167 ARG n 
1 168 SER n 
1 169 LEU n 
1 170 ALA n 
1 171 TYR n 
1 172 ILE n 
1 173 HIS n 
1 174 SER n 
1 175 PHE n 
1 176 GLY n 
1 177 ILE n 
1 178 CYS n 
1 179 HIS n 
1 180 ARG n 
1 181 ASP n 
1 182 ILE n 
1 183 LYS n 
1 184 PRO n 
1 185 GLN n 
1 186 ASN n 
1 187 LEU n 
1 188 LEU n 
1 189 LEU n 
1 190 ASP n 
1 191 PRO n 
1 192 ASP n 
1 193 THR n 
1 194 ALA n 
1 195 VAL n 
1 196 LEU n 
1 197 LYS n 
1 198 LEU n 
1 199 CYS n 
1 200 ASP n 
1 201 PHE n 
1 202 GLY n 
1 203 SER n 
1 204 ALA n 
1 205 LYS n 
1 206 GLN n 
1 207 LEU n 
1 208 VAL n 
1 209 ARG n 
1 210 GLY n 
1 211 GLU n 
1 212 PRO n 
1 213 ASN n 
1 214 VAL n 
1 215 SER n 
1 216 TYR n 
1 217 ILE n 
1 218 CYS n 
1 219 SER n 
1 220 ARG n 
1 221 TYR n 
1 222 TYR n 
1 223 ARG n 
1 224 ALA n 
1 225 PRO n 
1 226 GLU n 
1 227 LEU n 
1 228 ILE n 
1 229 PHE n 
1 230 GLY n 
1 231 ALA n 
1 232 THR n 
1 233 ASP n 
1 234 TYR n 
1 235 THR n 
1 236 SER n 
1 237 SER n 
1 238 ILE n 
1 239 ASP n 
1 240 VAL n 
1 241 TRP n 
1 242 SER n 
1 243 ALA n 
1 244 GLY n 
1 245 CYS n 
1 246 VAL n 
1 247 LEU n 
1 248 ALA n 
1 249 GLU n 
1 250 LEU n 
1 251 LEU n 
1 252 LEU n 
1 253 GLY n 
1 254 GLN n 
1 255 PRO n 
1 256 ILE n 
1 257 PHE n 
1 258 PRO n 
1 259 GLY n 
1 260 ASP n 
1 261 SER n 
1 262 GLY n 
1 263 VAL n 
1 264 ASP n 
1 265 GLN n 
1 266 LEU n 
1 267 VAL n 
1 268 GLU n 
1 269 ILE n 
1 270 ILE n 
1 271 LYS n 
1 272 VAL n 
1 273 LEU n 
1 274 GLY n 
1 275 THR n 
1 276 PRO n 
1 277 THR n 
1 278 ARG n 
1 279 GLU n 
1 280 GLN n 
1 281 ILE n 
1 282 ARG n 
1 283 GLU n 
1 284 MET n 
1 285 ASN n 
1 286 PRO n 
1 287 ASN n 
1 288 TYR n 
1 289 THR n 
1 290 GLU n 
1 291 PHE n 
1 292 LYS n 
1 293 PHE n 
1 294 PRO n 
1 295 GLN n 
1 296 ILE n 
1 297 LYS n 
1 298 ALA n 
1 299 HIS n 
1 300 PRO n 
1 301 TRP n 
1 302 THR n 
1 303 LYS n 
1 304 VAL n 
1 305 PHE n 
1 306 ARG n 
1 307 PRO n 
1 308 ARG n 
1 309 THR n 
1 310 PRO n 
1 311 PRO n 
1 312 GLU n 
1 313 ALA n 
1 314 ILE n 
1 315 ALA n 
1 316 LEU n 
1 317 CYS n 
1 318 SER n 
1 319 ARG n 
1 320 LEU n 
1 321 LEU n 
1 322 GLU n 
1 323 TYR n 
1 324 THR n 
1 325 PRO n 
1 326 THR n 
1 327 ALA n 
1 328 ARG n 
1 329 LEU n 
1 330 THR n 
1 331 PRO n 
1 332 LEU n 
1 333 GLU n 
1 334 ALA n 
1 335 CYS n 
1 336 ALA n 
1 337 HIS n 
1 338 SER n 
1 339 PHE n 
1 340 PHE n 
1 341 ASP n 
1 342 GLU n 
1 343 LEU n 
1 344 ARG n 
1 345 ASP n 
1 346 PRO n 
1 347 ASN n 
1 348 VAL n 
1 349 LYS n 
1 350 LEU n 
1 351 PRO n 
1 352 ASN n 
1 353 GLY n 
1 354 ARG n 
1 355 ASP n 
1 356 THR n 
1 357 PRO n 
1 358 ALA n 
1 359 LEU n 
1 360 PHE n 
1 361 ASN n 
1 362 PHE n 
1 363 THR n 
1 364 THR n 
1 365 GLN n 
1 366 GLU n 
1 367 LEU n 
1 368 SER n 
1 369 SER n 
1 370 ASN n 
1 371 PRO n 
1 372 PRO n 
1 373 LEU n 
1 374 ALA n 
1 375 THR n 
1 376 ILE n 
1 377 LEU n 
1 378 ILE n 
1 379 PRO n 
1 380 PRO n 
1 381 HIS n 
1 382 ALA n 
1 383 ARG n 
1 384 ILE n 
1 385 GLN n 
1 386 ALA n 
1 387 ALA n 
1 388 ALA n 
1 389 SER n 
1 390 THR n 
1 391 PRO n 
1 392 THR n 
1 393 ASN n 
1 394 ALA n 
1 395 THR n 
1 396 ALA n 
1 397 ALA n 
1 398 SER n 
1 399 ASP n 
1 400 ALA n 
1 401 ASN n 
1 402 THR n 
1 403 GLY n 
1 404 ASP n 
1 405 ARG n 
1 406 GLY n 
1 407 GLN n 
1 408 THR n 
1 409 ASN n 
1 410 ASN n 
1 411 ALA n 
1 412 ALA n 
1 413 SER n 
1 414 ALA n 
1 415 SER n 
1 416 ALA n 
1 417 SER n 
1 418 ASN n 
1 419 SER n 
1 420 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GSK3B_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGE
LVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKL
YMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRL
LEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDA
NTGDRGQTNNAASASASNST
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P49841 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1J1B A 1 ? 420 ? P49841 1 ? 420 ? 1   420 
2 1 1J1B B 1 ? 420 ? P49841 1 ? 420 ? 501 920 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ANP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ? 'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                         ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1J1B 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.66 
_exptl_crystal.density_percent_sol   66.14 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            278 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'PEG6000, sodium chloride, magnesium chloride, glycerol, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 278K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.835 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL24XU' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL24XU 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.835 
# 
_reflns.entry_id                     1J1B 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            1.7 
_reflns.d_resolution_low             19.8 
_reflns.number_all                   525584 
_reflns.number_obs                   115006 
_reflns.percent_possible_obs         90.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.88 
_reflns_shell.percent_possible_all   88.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1J1B 
_refine.ls_d_res_high                            1.8 
_refine.ls_d_res_low                             19.8 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     115006 
_refine.ls_number_reflns_obs                     110728 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.216 
_refine.ls_R_factor_R_free                       0.242 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5737 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         62 
_refine_hist.number_atoms_solvent             419 
_refine_hist.number_atoms_total               6218 
_refine_hist.d_res_high                       1.8 
_refine_hist.d_res_low                        19.8 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_angle_d   0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg 1.148 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1J1B 
_struct.title                     'Binary complex structure of human tau protein kinase I with AMPPNP' 
_struct.pdbx_descriptor           'Glycogen synthase kinase-3 beta(E.C.2.7.1.37)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1J1B 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'complex, tau, kinase, AMPPNP, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 95  ? LYS A 103 ? ASN A 95  LYS A 103 1 ? 9  
HELX_P HELX_P2  2  VAL A 139 ? ALA A 149 ? VAL A 139 ALA A 149 1 ? 11 
HELX_P HELX_P3  3  PRO A 154 ? SER A 174 ? PRO A 154 SER A 174 1 ? 21 
HELX_P HELX_P4  4  LYS A 183 ? GLN A 185 ? LYS A 183 GLN A 185 5 ? 3  
HELX_P HELX_P5  5  ALA A 224 ? PHE A 229 ? ALA A 224 PHE A 229 1 ? 6  
HELX_P HELX_P6  6  SER A 236 ? GLY A 253 ? SER A 236 GLY A 253 1 ? 18 
HELX_P HELX_P7  7  SER A 261 ? GLY A 274 ? SER A 261 GLY A 274 1 ? 14 
HELX_P HELX_P8  8  THR A 277 ? ASN A 285 ? THR A 277 ASN A 285 1 ? 9  
HELX_P HELX_P9  9  PRO A 300 ? PHE A 305 ? PRO A 300 PHE A 305 1 ? 6  
HELX_P HELX_P10 10 PRO A 310 ? LEU A 321 ? PRO A 310 LEU A 321 1 ? 12 
HELX_P HELX_P11 11 THR A 324 ? ARG A 328 ? THR A 324 ARG A 328 5 ? 5  
HELX_P HELX_P12 12 THR A 330 ? ALA A 336 ? THR A 330 ALA A 336 1 ? 7  
HELX_P HELX_P13 13 HIS A 337 ? ASP A 345 ? HIS A 337 ASP A 345 5 ? 9  
HELX_P HELX_P14 14 THR A 363 ? SER A 368 ? THR A 363 SER A 368 1 ? 6  
HELX_P HELX_P15 15 ASN A 370 ? PRO A 372 ? ASN A 370 PRO A 372 5 ? 3  
HELX_P HELX_P16 16 LEU A 373 ? ILE A 378 ? LEU A 373 ILE A 378 1 ? 6  
HELX_P HELX_P17 17 ASN B 95  ? LEU B 104 ? ASN B 595 LEU B 604 1 ? 10 
HELX_P HELX_P18 18 VAL B 139 ? ALA B 149 ? VAL B 639 ALA B 649 1 ? 11 
HELX_P HELX_P19 19 PRO B 154 ? SER B 174 ? PRO B 654 SER B 674 1 ? 21 
HELX_P HELX_P20 20 LYS B 183 ? GLN B 185 ? LYS B 683 GLN B 685 5 ? 3  
HELX_P HELX_P21 21 ALA B 224 ? PHE B 229 ? ALA B 724 PHE B 729 1 ? 6  
HELX_P HELX_P22 22 SER B 236 ? GLY B 253 ? SER B 736 GLY B 753 1 ? 18 
HELX_P HELX_P23 23 SER B 261 ? GLY B 274 ? SER B 761 GLY B 774 1 ? 14 
HELX_P HELX_P24 24 THR B 277 ? ASN B 285 ? THR B 777 ASN B 785 1 ? 9  
HELX_P HELX_P25 25 PRO B 300 ? PHE B 305 ? PRO B 800 PHE B 805 1 ? 6  
HELX_P HELX_P26 26 PRO B 310 ? LEU B 321 ? PRO B 810 LEU B 821 1 ? 12 
HELX_P HELX_P27 27 THR B 324 ? ARG B 328 ? THR B 824 ARG B 828 5 ? 5  
HELX_P HELX_P28 28 THR B 330 ? ALA B 336 ? THR B 830 ALA B 836 1 ? 7  
HELX_P HELX_P29 29 HIS B 337 ? ASP B 345 ? HIS B 837 ASP B 845 5 ? 9  
HELX_P HELX_P30 30 THR B 363 ? SER B 368 ? THR B 863 SER B 868 1 ? 6  
HELX_P HELX_P31 31 ASN B 370 ? PRO B 372 ? ASN B 870 PRO B 872 5 ? 3  
HELX_P HELX_P32 32 LEU B 373 ? ILE B 378 ? LEU B 873 ILE B 878 1 ? 6  
HELX_P HELX_P33 33 PRO B 379 ? ILE B 384 ? PRO B 879 ILE B 884 5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 3 ? 
C ? 2 ? 
D ? 8 ? 
E ? 3 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? anti-parallel 
D 6 7 ? anti-parallel 
D 7 8 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 38  ? PRO A 44  ? THR A 38  PRO A 44  
A 2 GLN A 52  ? ASN A 64  ? GLN A 52  ASN A 64  
A 3 GLY A 68  ? LEU A 75  ? GLY A 68  LEU A 75  
A 4 LEU A 81  ? LEU A 88  ? LEU A 81  LEU A 88  
A 5 GLU A 125 ? ASP A 133 ? GLU A 125 ASP A 133 
A 6 LEU A 112 ? GLY A 120 ? LEU A 112 GLY A 120 
A 7 THR A 38  ? PRO A 44  ? THR A 38  PRO A 44  
B 1 GLU A 137 ? THR A 138 ? GLU A 137 THR A 138 
B 2 LEU A 187 ? ASP A 190 ? LEU A 187 ASP A 190 
B 3 VAL A 195 ? LEU A 198 ? VAL A 195 LEU A 198 
C 1 ILE A 177 ? CYS A 178 ? ILE A 177 CYS A 178 
C 2 LYS A 205 ? GLN A 206 ? LYS A 205 GLN A 206 
D 1 MET B 26  ? ARG B 30  ? MET B 526 ARG B 530 
D 2 LYS B 36  ? PRO B 44  ? LYS B 536 PRO B 544 
D 3 GLN B 52  ? ASN B 64  ? GLN B 552 ASN B 564 
D 4 GLY B 68  ? LEU B 75  ? GLY B 568 LEU B 575 
D 5 LEU B 81  ? GLN B 89  ? LEU B 581 GLN B 589 
D 6 VAL B 126 ? ASP B 133 ? VAL B 626 ASP B 633 
D 7 LEU B 112 ? SER B 119 ? LEU B 612 SER B 619 
D 8 LYS B 36  ? PRO B 44  ? LYS B 536 PRO B 544 
E 1 GLU B 137 ? THR B 138 ? GLU B 637 THR B 638 
E 2 LEU B 187 ? ASP B 190 ? LEU B 687 ASP B 690 
E 3 VAL B 195 ? LEU B 198 ? VAL B 695 LEU B 698 
F 1 ILE B 177 ? CYS B 178 ? ILE B 677 CYS B 678 
F 2 LYS B 205 ? GLN B 206 ? LYS B 705 GLN B 706 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ALA A 42  ? O ALA A 42  N GLN A 52  ? N GLN A 52  
A 2 3 N ILE A 62  ? N ILE A 62  O VAL A 70  ? O VAL A 70  
A 3 4 O ALA A 73  ? O ALA A 73  N VAL A 82  ? N VAL A 82  
A 4 5 O VAL A 87  ? O VAL A 87  N LEU A 128 ? N LEU A 128 
A 5 6 O VAL A 131 ? O VAL A 131 N ARG A 113 ? N ARG A 113 
A 6 7 O PHE A 115 ? O PHE A 115 N THR A 43  ? N THR A 43  
B 1 2 O GLU A 137 ? O GLU A 137 N LEU A 189 ? N LEU A 189 
B 2 3 N ASP A 190 ? N ASP A 190 O VAL A 195 ? O VAL A 195 
C 1 2 N CYS A 178 ? N CYS A 178 O LYS A 205 ? O LYS A 205 
D 1 2 O SER B 29  ? O SER B 529 N VAL B 37  ? N VAL B 537 
D 2 3 N ALA B 42  ? N ALA B 542 O GLN B 52  ? O GLN B 552 
D 3 4 N ILE B 62  ? N ILE B 562 O VAL B 70  ? O VAL B 570 
D 4 5 O ALA B 73  ? O ALA B 573 N VAL B 82  ? N VAL B 582 
D 5 6 N GLN B 89  ? N GLN B 589 O VAL B 126 ? O VAL B 626 
D 6 7 O VAL B 131 ? O VAL B 631 N ARG B 113 ? N ARG B 613 
D 7 8 O PHE B 115 ? O PHE B 615 N THR B 43  ? N THR B 543 
E 1 2 O GLU B 137 ? O GLU B 637 N LEU B 189 ? N LEU B 689 
E 2 3 N ASP B 190 ? N ASP B 690 O VAL B 195 ? O VAL B 695 
F 1 2 N CYS B 178 ? N CYS B 678 O LYS B 205 ? O LYS B 705 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE ANP A 430' 
AC2 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE ANP B 930' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 ILE A 62  ? ILE A 62  . ? 1_555 ? 
2  AC1 22 ASN A 64  ? ASN A 64  . ? 1_555 ? 
3  AC1 22 GLY A 65  ? GLY A 65  . ? 1_555 ? 
4  AC1 22 PHE A 67  ? PHE A 67  . ? 1_555 ? 
5  AC1 22 VAL A 70  ? VAL A 70  . ? 1_555 ? 
6  AC1 22 ALA A 83  ? ALA A 83  . ? 1_555 ? 
7  AC1 22 LYS A 85  ? LYS A 85  . ? 1_555 ? 
8  AC1 22 VAL A 110 ? VAL A 110 . ? 1_555 ? 
9  AC1 22 ASP A 133 ? ASP A 133 . ? 1_555 ? 
10 AC1 22 TYR A 134 ? TYR A 134 . ? 1_555 ? 
11 AC1 22 VAL A 135 ? VAL A 135 . ? 1_555 ? 
12 AC1 22 ARG A 141 ? ARG A 141 . ? 1_555 ? 
13 AC1 22 GLN A 185 ? GLN A 185 . ? 1_555 ? 
14 AC1 22 ASN A 186 ? ASN A 186 . ? 1_555 ? 
15 AC1 22 LEU A 188 ? LEU A 188 . ? 1_555 ? 
16 AC1 22 ASP A 200 ? ASP A 200 . ? 1_555 ? 
17 AC1 22 HOH E .   ? HOH A 532 . ? 1_555 ? 
18 AC1 22 HOH E .   ? HOH A 533 . ? 1_555 ? 
19 AC1 22 HOH E .   ? HOH A 611 . ? 1_555 ? 
20 AC1 22 HOH E .   ? HOH A 621 . ? 1_555 ? 
21 AC1 22 HOH E .   ? HOH A 638 . ? 1_555 ? 
22 AC1 22 HOH E .   ? HOH A 644 . ? 1_555 ? 
23 AC2 25 HOH F .   ? HOH B 44  . ? 1_555 ? 
24 AC2 25 HOH F .   ? HOH B 135 . ? 1_555 ? 
25 AC2 25 HOH F .   ? HOH B 184 . ? 1_555 ? 
26 AC2 25 HOH F .   ? HOH B 193 . ? 1_555 ? 
27 AC2 25 HOH F .   ? HOH B 257 . ? 1_555 ? 
28 AC2 25 HOH F .   ? HOH B 300 . ? 1_555 ? 
29 AC2 25 HOH F .   ? HOH B 333 . ? 1_555 ? 
30 AC2 25 HOH F .   ? HOH B 363 . ? 1_555 ? 
31 AC2 25 ILE B 62  ? ILE B 562 . ? 1_555 ? 
32 AC2 25 GLY B 63  ? GLY B 563 . ? 1_555 ? 
33 AC2 25 ASN B 64  ? ASN B 564 . ? 1_555 ? 
34 AC2 25 GLY B 65  ? GLY B 565 . ? 1_555 ? 
35 AC2 25 VAL B 70  ? VAL B 570 . ? 1_555 ? 
36 AC2 25 ALA B 83  ? ALA B 583 . ? 1_555 ? 
37 AC2 25 LYS B 85  ? LYS B 585 . ? 1_555 ? 
38 AC2 25 VAL B 110 ? VAL B 610 . ? 1_555 ? 
39 AC2 25 ASP B 133 ? ASP B 633 . ? 1_555 ? 
40 AC2 25 TYR B 134 ? TYR B 634 . ? 1_555 ? 
41 AC2 25 VAL B 135 ? VAL B 635 . ? 1_555 ? 
42 AC2 25 THR B 138 ? THR B 638 . ? 1_555 ? 
43 AC2 25 LYS B 183 ? LYS B 683 . ? 1_555 ? 
44 AC2 25 GLN B 185 ? GLN B 685 . ? 1_555 ? 
45 AC2 25 ASN B 186 ? ASN B 686 . ? 1_555 ? 
46 AC2 25 LEU B 188 ? LEU B 688 . ? 1_555 ? 
47 AC2 25 ASP B 200 ? ASP B 700 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1J1B 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1J1B 
_atom_sites.fract_transf_matrix[1][1]   0.012077 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011587 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005605 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . SER A 1 35  ? 20.264 41.408  -12.172 1.00 61.63 ? 35  SER A N     1 
ATOM   2    C CA    . SER A 1 35  ? 19.523 41.119  -10.910 1.00 61.18 ? 35  SER A CA    1 
ATOM   3    C C     . SER A 1 35  ? 18.051 40.849  -11.201 1.00 60.50 ? 35  SER A C     1 
ATOM   4    O O     . SER A 1 35  ? 17.169 41.383  -10.525 1.00 61.03 ? 35  SER A O     1 
ATOM   5    C CB    . SER A 1 35  ? 19.645 42.301  -9.939  1.00 61.79 ? 35  SER A CB    1 
ATOM   6    O OG    . SER A 1 35  ? 20.308 43.405  -10.536 1.00 62.82 ? 35  SER A OG    1 
ATOM   7    N N     . LYS A 1 36  ? 17.790 40.022  -12.211 1.00 59.21 ? 36  LYS A N     1 
ATOM   8    C CA    . LYS A 1 36  ? 16.420 39.681  -12.581 1.00 57.74 ? 36  LYS A CA    1 
ATOM   9    C C     . LYS A 1 36  ? 15.801 38.771  -11.528 1.00 56.36 ? 36  LYS A C     1 
ATOM   10   O O     . LYS A 1 36  ? 16.261 37.647  -11.312 1.00 56.38 ? 36  LYS A O     1 
ATOM   11   C CB    . LYS A 1 36  ? 16.389 38.982  -13.942 1.00 58.45 ? 36  LYS A CB    1 
ATOM   12   C CG    . LYS A 1 36  ? 14.996 38.572  -14.395 1.00 59.38 ? 36  LYS A CG    1 
ATOM   13   C CD    . LYS A 1 36  ? 14.925 37.078  -14.669 1.00 60.25 ? 36  LYS A CD    1 
ATOM   14   C CE    . LYS A 1 36  ? 14.108 36.777  -15.914 1.00 60.96 ? 36  LYS A CE    1 
ATOM   15   N NZ    . LYS A 1 36  ? 14.627 35.586  -16.650 1.00 61.69 ? 36  LYS A NZ    1 
ATOM   16   N N     . VAL A 1 37  ? 14.759 39.263  -10.869 1.00 54.17 ? 37  VAL A N     1 
ATOM   17   C CA    . VAL A 1 37  ? 14.087 38.486  -9.840  1.00 51.58 ? 37  VAL A CA    1 
ATOM   18   C C     . VAL A 1 37  ? 12.867 37.764  -10.402 1.00 49.89 ? 37  VAL A C     1 
ATOM   19   O O     . VAL A 1 37  ? 12.142 38.308  -11.238 1.00 49.77 ? 37  VAL A O     1 
ATOM   20   C CB    . VAL A 1 37  ? 13.643 39.386  -8.675  1.00 51.42 ? 37  VAL A CB    1 
ATOM   21   C CG1   . VAL A 1 37  ? 12.979 38.548  -7.590  1.00 51.14 ? 37  VAL A CG1   1 
ATOM   22   C CG2   . VAL A 1 37  ? 14.843 40.133  -8.118  1.00 51.25 ? 37  VAL A CG2   1 
ATOM   23   N N     . THR A 1 38  ? 12.664 36.528  -9.953  1.00 47.17 ? 38  THR A N     1 
ATOM   24   C CA    . THR A 1 38  ? 11.524 35.725  -10.374 1.00 44.31 ? 38  THR A CA    1 
ATOM   25   C C     . THR A 1 38  ? 10.720 35.390  -9.121  1.00 42.36 ? 38  THR A C     1 
ATOM   26   O O     . THR A 1 38  ? 11.266 34.887  -8.135  1.00 41.65 ? 38  THR A O     1 
ATOM   27   C CB    . THR A 1 38  ? 11.964 34.411  -11.049 1.00 44.50 ? 38  THR A CB    1 
ATOM   28   O OG1   . THR A 1 38  ? 12.733 34.704  -12.222 1.00 44.43 ? 38  THR A OG1   1 
ATOM   29   C CG2   . THR A 1 38  ? 10.746 33.584  -11.444 1.00 44.24 ? 38  THR A CG2   1 
ATOM   30   N N     . THR A 1 39  ? 9.426  35.694  -9.155  1.00 40.03 ? 39  THR A N     1 
ATOM   31   C CA    . THR A 1 39  ? 8.549  35.424  -8.022  1.00 37.78 ? 39  THR A CA    1 
ATOM   32   C C     . THR A 1 39  ? 7.471  34.438  -8.432  1.00 36.05 ? 39  THR A C     1 
ATOM   33   O O     . THR A 1 39  ? 6.818  34.611  -9.458  1.00 36.02 ? 39  THR A O     1 
ATOM   34   C CB    . THR A 1 39  ? 7.870  36.709  -7.508  1.00 37.96 ? 39  THR A CB    1 
ATOM   35   O OG1   . THR A 1 39  ? 8.872  37.655  -7.126  1.00 38.34 ? 39  THR A OG1   1 
ATOM   36   C CG2   . THR A 1 39  ? 6.989  36.404  -6.299  1.00 37.62 ? 39  THR A CG2   1 
ATOM   37   N N     . VAL A 1 40  ? 7.299  33.399  -7.624  1.00 33.87 ? 40  VAL A N     1 
ATOM   38   C CA    . VAL A 1 40  ? 6.305  32.376  -7.896  1.00 31.64 ? 40  VAL A CA    1 
ATOM   39   C C     . VAL A 1 40  ? 5.532  32.112  -6.611  1.00 30.51 ? 40  VAL A C     1 
ATOM   40   O O     . VAL A 1 40  ? 5.933  32.555  -5.535  1.00 30.58 ? 40  VAL A O     1 
ATOM   41   C CB    . VAL A 1 40  ? 6.969  31.032  -8.363  1.00 31.35 ? 40  VAL A CB    1 
ATOM   42   C CG1   . VAL A 1 40  ? 7.819  31.262  -9.609  1.00 30.18 ? 40  VAL A CG1   1 
ATOM   43   C CG2   . VAL A 1 40  ? 7.821  30.444  -7.239  1.00 29.68 ? 40  VAL A CG2   1 
ATOM   44   N N     . VAL A 1 41  ? 4.409  31.414  -6.731  1.00 29.32 ? 41  VAL A N     1 
ATOM   45   C CA    . VAL A 1 41  ? 3.624  31.053  -5.565  1.00 28.29 ? 41  VAL A CA    1 
ATOM   46   C C     . VAL A 1 41  ? 3.844  29.555  -5.499  1.00 27.78 ? 41  VAL A C     1 
ATOM   47   O O     . VAL A 1 41  ? 3.275  28.802  -6.288  1.00 27.29 ? 41  VAL A O     1 
ATOM   48   C CB    . VAL A 1 41  ? 2.119  31.361  -5.742  1.00 28.03 ? 41  VAL A CB    1 
ATOM   49   C CG1   . VAL A 1 41  ? 1.359  30.907  -4.515  1.00 26.90 ? 41  VAL A CG1   1 
ATOM   50   C CG2   . VAL A 1 41  ? 1.908  32.857  -5.961  1.00 28.25 ? 41  VAL A CG2   1 
ATOM   51   N N     . ALA A 1 42  ? 4.692  29.132  -4.565  1.00 27.27 ? 42  ALA A N     1 
ATOM   52   C CA    . ALA A 1 42  ? 5.040  27.726  -4.425  1.00 26.99 ? 42  ALA A CA    1 
ATOM   53   C C     . ALA A 1 42  ? 4.516  27.075  -3.159  1.00 26.60 ? 42  ALA A C     1 
ATOM   54   O O     . ALA A 1 42  ? 4.343  27.722  -2.133  1.00 26.76 ? 42  ALA A O     1 
ATOM   55   C CB    . ALA A 1 42  ? 6.562  27.566  -4.505  1.00 26.37 ? 42  ALA A CB    1 
ATOM   56   N N     . THR A 1 43  ? 4.289  25.772  -3.250  1.00 26.73 ? 43  THR A N     1 
ATOM   57   C CA    . THR A 1 43  ? 3.769  24.981  -2.148  1.00 27.89 ? 43  THR A CA    1 
ATOM   58   C C     . THR A 1 43  ? 4.884  24.320  -1.342  1.00 29.20 ? 43  THR A C     1 
ATOM   59   O O     . THR A 1 43  ? 5.732  23.623  -1.903  1.00 28.45 ? 43  THR A O     1 
ATOM   60   C CB    . THR A 1 43  ? 2.857  23.861  -2.682  1.00 27.64 ? 43  THR A CB    1 
ATOM   61   O OG1   . THR A 1 43  ? 1.881  24.420  -3.569  1.00 29.09 ? 43  THR A OG1   1 
ATOM   62   C CG2   . THR A 1 43  ? 2.163  23.146  -1.551  1.00 27.70 ? 43  THR A CG2   1 
ATOM   63   N N     . PRO A 1 44  ? 4.906  24.539  -0.015  1.00 30.27 ? 44  PRO A N     1 
ATOM   64   C CA    . PRO A 1 44  ? 5.939  23.928  0.828   1.00 31.42 ? 44  PRO A CA    1 
ATOM   65   C C     . PRO A 1 44  ? 6.027  22.430  0.527   1.00 32.59 ? 44  PRO A C     1 
ATOM   66   O O     . PRO A 1 44  ? 5.006  21.751  0.390   1.00 31.42 ? 44  PRO A O     1 
ATOM   67   C CB    . PRO A 1 44  ? 5.447  24.199  2.250   1.00 31.10 ? 44  PRO A CB    1 
ATOM   68   C CG    . PRO A 1 44  ? 4.644  25.453  2.126   1.00 31.02 ? 44  PRO A CG    1 
ATOM   69   C CD    . PRO A 1 44  ? 3.989  25.393  0.766   1.00 31.14 ? 44  PRO A CD    1 
ATOM   70   N N     . GLY A 1 45  ? 7.249  21.924  0.421   1.00 34.02 ? 45  GLY A N     1 
ATOM   71   C CA    . GLY A 1 45  ? 7.449  20.523  0.112   1.00 37.27 ? 45  GLY A CA    1 
ATOM   72   C C     . GLY A 1 45  ? 6.797  19.598  1.111   1.00 40.10 ? 45  GLY A C     1 
ATOM   73   O O     . GLY A 1 45  ? 6.297  18.532  0.751   1.00 40.55 ? 45  GLY A O     1 
ATOM   74   N N     . GLN A 1 46  ? 6.802  20.002  2.374   1.00 42.60 ? 46  GLN A N     1 
ATOM   75   C CA    . GLN A 1 46  ? 6.204  19.190  3.418   1.00 45.68 ? 46  GLN A CA    1 
ATOM   76   C C     . GLN A 1 46  ? 5.259  20.035  4.258   1.00 46.67 ? 46  GLN A C     1 
ATOM   77   O O     . GLN A 1 46  ? 5.401  21.255  4.343   1.00 47.36 ? 46  GLN A O     1 
ATOM   78   C CB    . GLN A 1 46  ? 7.301  18.580  4.295   1.00 47.28 ? 46  GLN A CB    1 
ATOM   79   C CG    . GLN A 1 46  ? 8.541  18.171  3.509   1.00 49.67 ? 46  GLN A CG    1 
ATOM   80   C CD    . GLN A 1 46  ? 9.138  16.863  3.984   1.00 51.44 ? 46  GLN A CD    1 
ATOM   81   O OE1   . GLN A 1 46  ? 8.415  15.900  4.273   1.00 51.97 ? 46  GLN A OE1   1 
ATOM   82   N NE2   . GLN A 1 46  ? 10.471 16.817  4.068   1.00 51.94 ? 46  GLN A NE2   1 
ATOM   83   N N     . GLY A 1 47  ? 4.283  19.384  4.873   1.00 47.48 ? 47  GLY A N     1 
ATOM   84   C CA    . GLY A 1 47  ? 3.340  20.112  5.694   1.00 48.14 ? 47  GLY A CA    1 
ATOM   85   C C     . GLY A 1 47  ? 2.005  20.299  5.006   1.00 48.62 ? 47  GLY A C     1 
ATOM   86   O O     . GLY A 1 47  ? 1.564  19.435  4.246   1.00 49.19 ? 47  GLY A O     1 
ATOM   87   N N     . PRO A 1 48  ? 1.336  21.436  5.244   1.00 48.67 ? 48  PRO A N     1 
ATOM   88   C CA    . PRO A 1 48  ? 0.034  21.705  4.632   1.00 47.95 ? 48  PRO A CA    1 
ATOM   89   C C     . PRO A 1 48  ? 0.152  22.389  3.276   1.00 46.70 ? 48  PRO A C     1 
ATOM   90   O O     . PRO A 1 48  ? 1.090  23.155  3.040   1.00 46.78 ? 48  PRO A O     1 
ATOM   91   C CB    . PRO A 1 48  ? -0.653 22.599  5.657   1.00 48.50 ? 48  PRO A CB    1 
ATOM   92   C CG    . PRO A 1 48  ? 0.499  23.365  6.300   1.00 48.83 ? 48  PRO A CG    1 
ATOM   93   C CD    . PRO A 1 48  ? 1.775  22.556  6.098   1.00 48.81 ? 48  PRO A CD    1 
ATOM   94   N N     . ASP A 1 49  ? -0.800 22.109  2.390   1.00 45.18 ? 49  ASP A N     1 
ATOM   95   C CA    . ASP A 1 49  ? -0.798 22.716  1.066   1.00 43.75 ? 49  ASP A CA    1 
ATOM   96   C C     . ASP A 1 49  ? -1.197 24.188  1.163   1.00 41.77 ? 49  ASP A C     1 
ATOM   97   O O     . ASP A 1 49  ? -2.307 24.568  0.788   1.00 41.88 ? 49  ASP A O     1 
ATOM   98   C CB    . ASP A 1 49  ? -1.763 21.974  0.141   1.00 45.30 ? 49  ASP A CB    1 
ATOM   99   C CG    . ASP A 1 49  ? -1.121 20.775  -0.526  1.00 46.68 ? 49  ASP A CG    1 
ATOM   100  O OD1   . ASP A 1 49  ? -0.414 20.021  0.171   1.00 47.90 ? 49  ASP A OD1   1 
ATOM   101  O OD2   . ASP A 1 49  ? -1.320 20.582  -1.745  1.00 48.02 ? 49  ASP A OD2   1 
ATOM   102  N N     . ARG A 1 50  ? -0.284 25.004  1.682   1.00 39.23 ? 50  ARG A N     1 
ATOM   103  C CA    . ARG A 1 50  ? -0.506 26.436  1.841   1.00 36.73 ? 50  ARG A CA    1 
ATOM   104  C C     . ARG A 1 50  ? 0.598  27.183  1.105   1.00 34.66 ? 50  ARG A C     1 
ATOM   105  O O     . ARG A 1 50  ? 1.596  27.601  1.698   1.00 33.92 ? 50  ARG A O     1 
ATOM   106  C CB    . ARG A 1 50  ? -0.491 26.818  3.324   1.00 37.21 ? 50  ARG A CB    1 
ATOM   107  C CG    . ARG A 1 50  ? -1.612 26.194  4.139   1.00 38.57 ? 50  ARG A CG    1 
ATOM   108  C CD    . ARG A 1 50  ? -2.985 26.685  3.688   1.00 39.50 ? 50  ARG A CD    1 
ATOM   109  N NE    . ARG A 1 50  ? -4.052 25.922  4.330   1.00 41.40 ? 50  ARG A NE    1 
ATOM   110  C CZ    . ARG A 1 50  ? -4.769 24.975  3.728   1.00 41.83 ? 50  ARG A CZ    1 
ATOM   111  N NH1   . ARG A 1 50  ? -4.543 24.665  2.456   1.00 42.04 ? 50  ARG A NH1   1 
ATOM   112  N NH2   . ARG A 1 50  ? -5.699 24.318  4.407   1.00 42.59 ? 50  ARG A NH2   1 
ATOM   113  N N     . PRO A 1 51  ? 0.435  27.346  -0.211  1.00 33.21 ? 51  PRO A N     1 
ATOM   114  C CA    . PRO A 1 51  ? 1.412  28.039  -1.054  1.00 32.34 ? 51  PRO A CA    1 
ATOM   115  C C     . PRO A 1 51  ? 1.767  29.436  -0.574  1.00 32.63 ? 51  PRO A C     1 
ATOM   116  O O     . PRO A 1 51  ? 0.934  30.137  0.004   1.00 32.31 ? 51  PRO A O     1 
ATOM   117  C CB    . PRO A 1 51  ? 0.751  28.058  -2.432  1.00 31.86 ? 51  PRO A CB    1 
ATOM   118  C CG    . PRO A 1 51  ? -0.189 26.881  -2.409  1.00 31.70 ? 51  PRO A CG    1 
ATOM   119  C CD    . PRO A 1 51  ? -0.706 26.839  -0.996  1.00 32.31 ? 51  PRO A CD    1 
ATOM   120  N N     . GLN A 1 52  ? 3.010  29.838  -0.812  1.00 32.52 ? 52  GLN A N     1 
ATOM   121  C CA    . GLN A 1 52  ? 3.466  31.167  -0.427  1.00 33.23 ? 52  GLN A CA    1 
ATOM   122  C C     . GLN A 1 52  ? 4.280  31.778  -1.549  1.00 33.31 ? 52  GLN A C     1 
ATOM   123  O O     . GLN A 1 52  ? 4.777  31.073  -2.426  1.00 32.29 ? 52  GLN A O     1 
ATOM   124  C CB    . GLN A 1 52  ? 4.312  31.103  0.841   1.00 34.83 ? 52  GLN A CB    1 
ATOM   125  C CG    . GLN A 1 52  ? 5.430  30.097  0.788   1.00 37.63 ? 52  GLN A CG    1 
ATOM   126  C CD    . GLN A 1 52  ? 6.080  29.901  2.144   1.00 39.72 ? 52  GLN A CD    1 
ATOM   127  O OE1   . GLN A 1 52  ? 5.460  29.370  3.073   1.00 40.64 ? 52  GLN A OE1   1 
ATOM   128  N NE2   . GLN A 1 52  ? 7.332  30.336  2.269   1.00 39.44 ? 52  GLN A NE2   1 
ATOM   129  N N     . GLU A 1 53  ? 4.406  33.097  -1.529  1.00 33.92 ? 53  GLU A N     1 
ATOM   130  C CA    . GLU A 1 53  ? 5.171  33.788  -2.552  1.00 35.11 ? 53  GLU A CA    1 
ATOM   131  C C     . GLU A 1 53  ? 6.651  33.542  -2.283  1.00 34.32 ? 53  GLU A C     1 
ATOM   132  O O     . GLU A 1 53  ? 7.124  33.726  -1.163  1.00 34.30 ? 53  GLU A O     1 
ATOM   133  C CB    . GLU A 1 53  ? 4.867  35.290  -2.520  1.00 36.98 ? 53  GLU A CB    1 
ATOM   134  C CG    . GLU A 1 53  ? 3.761  35.724  -3.484  1.00 39.95 ? 53  GLU A CG    1 
ATOM   135  C CD    . GLU A 1 53  ? 2.737  36.665  -2.846  1.00 42.17 ? 53  GLU A CD    1 
ATOM   136  O OE1   . GLU A 1 53  ? 2.884  36.995  -1.642  1.00 43.11 ? 53  GLU A OE1   1 
ATOM   137  O OE2   . GLU A 1 53  ? 1.780  37.073  -3.552  1.00 42.04 ? 53  GLU A OE2   1 
ATOM   138  N N     . VAL A 1 54  ? 7.370  33.093  -3.306  1.00 33.56 ? 54  VAL A N     1 
ATOM   139  C CA    . VAL A 1 54  ? 8.799  32.838  -3.174  1.00 32.52 ? 54  VAL A CA    1 
ATOM   140  C C     . VAL A 1 54  ? 9.508  33.542  -4.312  1.00 32.82 ? 54  VAL A C     1 
ATOM   141  O O     . VAL A 1 54  ? 9.125  33.400  -5.473  1.00 32.55 ? 54  VAL A O     1 
ATOM   142  C CB    . VAL A 1 54  ? 9.129  31.328  -3.242  1.00 31.58 ? 54  VAL A CB    1 
ATOM   143  C CG1   . VAL A 1 54  ? 10.637 31.123  -3.126  1.00 30.56 ? 54  VAL A CG1   1 
ATOM   144  C CG2   . VAL A 1 54  ? 8.411  30.586  -2.132  1.00 30.25 ? 54  VAL A CG2   1 
ATOM   145  N N     . SER A 1 55  ? 10.534 34.314  -3.975  1.00 33.60 ? 55  SER A N     1 
ATOM   146  C CA    . SER A 1 55  ? 11.292 35.041  -4.978  1.00 34.64 ? 55  SER A CA    1 
ATOM   147  C C     . SER A 1 55  ? 12.734 34.564  -5.015  1.00 34.67 ? 55  SER A C     1 
ATOM   148  O O     . SER A 1 55  ? 13.333 34.287  -3.977  1.00 34.38 ? 55  SER A O     1 
ATOM   149  C CB    . SER A 1 55  ? 11.253 36.540  -4.680  1.00 35.66 ? 55  SER A CB    1 
ATOM   150  O OG    . SER A 1 55  ? 9.961  37.072  -4.944  1.00 37.33 ? 55  SER A OG    1 
ATOM   151  N N     . TYR A 1 56  ? 13.285 34.465  -6.219  1.00 35.48 ? 56  TYR A N     1 
ATOM   152  C CA    . TYR A 1 56  ? 14.663 34.031  -6.383  1.00 36.72 ? 56  TYR A CA    1 
ATOM   153  C C     . TYR A 1 56  ? 15.346 34.700  -7.573  1.00 37.96 ? 56  TYR A C     1 
ATOM   154  O O     . TYR A 1 56  ? 14.691 35.243  -8.465  1.00 37.76 ? 56  TYR A O     1 
ATOM   155  C CB    . TYR A 1 56  ? 14.729 32.509  -6.526  1.00 35.35 ? 56  TYR A CB    1 
ATOM   156  C CG    . TYR A 1 56  ? 13.984 31.952  -7.717  1.00 34.88 ? 56  TYR A CG    1 
ATOM   157  C CD1   . TYR A 1 56  ? 12.720 31.371  -7.566  1.00 34.70 ? 56  TYR A CD1   1 
ATOM   158  C CD2   . TYR A 1 56  ? 14.557 31.961  -8.992  1.00 34.23 ? 56  TYR A CD2   1 
ATOM   159  C CE1   . TYR A 1 56  ? 12.051 30.811  -8.652  1.00 33.87 ? 56  TYR A CE1   1 
ATOM   160  C CE2   . TYR A 1 56  ? 13.896 31.404  -10.083 1.00 33.91 ? 56  TYR A CE2   1 
ATOM   161  C CZ    . TYR A 1 56  ? 12.644 30.830  -9.902  1.00 34.19 ? 56  TYR A CZ    1 
ATOM   162  O OH    . TYR A 1 56  ? 11.991 30.270  -10.972 1.00 35.29 ? 56  TYR A OH    1 
ATOM   163  N N     . THR A 1 57  ? 16.674 34.642  -7.581  1.00 39.76 ? 57  THR A N     1 
ATOM   164  C CA    . THR A 1 57  ? 17.464 35.257  -8.640  1.00 41.45 ? 57  THR A CA    1 
ATOM   165  C C     . THR A 1 57  ? 18.740 34.459  -8.917  1.00 42.23 ? 57  THR A C     1 
ATOM   166  O O     . THR A 1 57  ? 18.948 33.387  -8.347  1.00 41.59 ? 57  THR A O     1 
ATOM   167  C CB    . THR A 1 57  ? 17.844 36.707  -8.244  1.00 42.14 ? 57  THR A CB    1 
ATOM   168  O OG1   . THR A 1 57  ? 18.424 37.381  -9.371  1.00 43.41 ? 57  THR A OG1   1 
ATOM   169  C CG2   . THR A 1 57  ? 18.826 36.703  -7.070  1.00 41.27 ? 57  THR A CG2   1 
ATOM   170  N N     . ASP A 1 58  ? 19.582 34.991  -9.800  1.00 43.12 ? 58  ASP A N     1 
ATOM   171  C CA    . ASP A 1 58  ? 20.850 34.359  -10.154 1.00 44.22 ? 58  ASP A CA    1 
ATOM   172  C C     . ASP A 1 58  ? 20.684 32.932  -10.655 1.00 44.53 ? 58  ASP A C     1 
ATOM   173  O O     . ASP A 1 58  ? 21.382 32.017  -10.218 1.00 44.28 ? 58  ASP A O     1 
ATOM   174  C CB    . ASP A 1 58  ? 21.793 34.377  -8.950  1.00 45.44 ? 58  ASP A CB    1 
ATOM   175  C CG    . ASP A 1 58  ? 22.155 35.784  -8.520  1.00 46.63 ? 58  ASP A CG    1 
ATOM   176  O OD1   . ASP A 1 58  ? 22.247 36.669  -9.400  1.00 47.30 ? 58  ASP A OD1   1 
ATOM   177  O OD2   . ASP A 1 58  ? 22.341 36.005  -7.303  1.00 47.80 ? 58  ASP A OD2   1 
ATOM   178  N N     . THR A 1 59  ? 19.758 32.756  -11.586 1.00 45.27 ? 59  THR A N     1 
ATOM   179  C CA    . THR A 1 59  ? 19.483 31.449  -12.155 1.00 46.53 ? 59  THR A CA    1 
ATOM   180  C C     . THR A 1 59  ? 20.546 31.036  -13.172 1.00 47.37 ? 59  THR A C     1 
ATOM   181  O O     . THR A 1 59  ? 21.052 31.864  -13.927 1.00 47.92 ? 59  THR A O     1 
ATOM   182  C CB    . THR A 1 59  ? 18.100 31.447  -12.835 1.00 46.76 ? 59  THR A CB    1 
ATOM   183  O OG1   . THR A 1 59  ? 17.080 31.493  -11.830 1.00 47.20 ? 59  THR A OG1   1 
ATOM   184  C CG2   . THR A 1 59  ? 17.914 30.199  -13.685 1.00 47.19 ? 59  THR A CG2   1 
ATOM   185  N N     . LYS A 1 60  ? 20.884 29.752  -13.179 1.00 47.86 ? 60  LYS A N     1 
ATOM   186  C CA    . LYS A 1 60  ? 21.867 29.219  -14.112 1.00 48.87 ? 60  LYS A CA    1 
ATOM   187  C C     . LYS A 1 60  ? 21.764 27.705  -14.132 1.00 48.85 ? 60  LYS A C     1 
ATOM   188  O O     . LYS A 1 60  ? 21.553 27.080  -13.092 1.00 48.66 ? 60  LYS A O     1 
ATOM   189  C CB    . LYS A 1 60  ? 23.285 29.643  -13.717 1.00 49.79 ? 60  LYS A CB    1 
ATOM   190  C CG    . LYS A 1 60  ? 23.554 29.624  -12.228 1.00 51.37 ? 60  LYS A CG    1 
ATOM   191  C CD    . LYS A 1 60  ? 25.041 29.749  -11.943 1.00 52.50 ? 60  LYS A CD    1 
ATOM   192  C CE    . LYS A 1 60  ? 25.786 28.476  -12.327 1.00 53.48 ? 60  LYS A CE    1 
ATOM   193  N NZ    . LYS A 1 60  ? 26.926 28.189  -11.398 1.00 54.33 ? 60  LYS A NZ    1 
ATOM   194  N N     . VAL A 1 61  ? 21.904 27.127  -15.321 1.00 48.98 ? 61  VAL A N     1 
ATOM   195  C CA    . VAL A 1 61  ? 21.814 25.683  -15.499 1.00 49.50 ? 61  VAL A CA    1 
ATOM   196  C C     . VAL A 1 61  ? 22.977 24.970  -14.827 1.00 50.24 ? 61  VAL A C     1 
ATOM   197  O O     . VAL A 1 61  ? 24.128 25.331  -15.035 1.00 50.82 ? 61  VAL A O     1 
ATOM   198  C CB    . VAL A 1 61  ? 21.802 25.318  -16.993 1.00 49.06 ? 61  VAL A CB    1 
ATOM   199  C CG1   . VAL A 1 61  ? 21.894 23.813  -17.165 1.00 48.58 ? 61  VAL A CG1   1 
ATOM   200  C CG2   . VAL A 1 61  ? 20.541 25.860  -17.641 1.00 48.42 ? 61  VAL A CG2   1 
ATOM   201  N N     . ILE A 1 62  ? 22.671 23.956  -14.022 1.00 50.92 ? 62  ILE A N     1 
ATOM   202  C CA    . ILE A 1 62  ? 23.703 23.199  -13.319 1.00 51.80 ? 62  ILE A CA    1 
ATOM   203  C C     . ILE A 1 62  ? 23.557 21.698  -13.534 1.00 52.97 ? 62  ILE A C     1 
ATOM   204  O O     . ILE A 1 62  ? 24.294 20.903  -12.944 1.00 53.03 ? 62  ILE A O     1 
ATOM   205  C CB    . ILE A 1 62  ? 23.667 23.463  -11.791 1.00 51.28 ? 62  ILE A CB    1 
ATOM   206  C CG1   . ILE A 1 62  ? 22.357 22.934  -11.198 1.00 50.53 ? 62  ILE A CG1   1 
ATOM   207  C CG2   . ILE A 1 62  ? 23.832 24.948  -11.512 1.00 50.92 ? 62  ILE A CG2   1 
ATOM   208  C CD1   . ILE A 1 62  ? 22.350 22.884  -9.684  1.00 49.61 ? 62  ILE A CD1   1 
ATOM   209  N N     . GLY A 1 63  ? 22.605 21.312  -14.375 1.00 54.15 ? 63  GLY A N     1 
ATOM   210  C CA    . GLY A 1 63  ? 22.384 19.902  -14.623 1.00 55.81 ? 63  GLY A CA    1 
ATOM   211  C C     . GLY A 1 63  ? 21.408 19.640  -15.750 1.00 57.06 ? 63  GLY A C     1 
ATOM   212  O O     . GLY A 1 63  ? 20.798 20.563  -16.294 1.00 56.85 ? 63  GLY A O     1 
ATOM   213  N N     . ASN A 1 64  ? 21.256 18.368  -16.096 1.00 58.39 ? 64  ASN A N     1 
ATOM   214  C CA    . ASN A 1 64  ? 20.363 17.972  -17.175 1.00 59.76 ? 64  ASN A CA    1 
ATOM   215  C C     . ASN A 1 64  ? 20.049 16.483  -17.090 1.00 60.30 ? 64  ASN A C     1 
ATOM   216  O O     . ASN A 1 64  ? 20.672 15.739  -16.326 1.00 60.64 ? 64  ASN A O     1 
ATOM   217  C CB    . ASN A 1 64  ? 21.014 18.282  -18.530 1.00 60.17 ? 64  ASN A CB    1 
ATOM   218  C CG    . ASN A 1 64  ? 20.102 19.068  -19.455 1.00 61.09 ? 64  ASN A CG    1 
ATOM   219  O OD1   . ASN A 1 64  ? 20.418 20.194  -19.849 1.00 61.57 ? 64  ASN A OD1   1 
ATOM   220  N ND2   . ASN A 1 64  ? 18.964 18.477  -19.808 1.00 61.26 ? 64  ASN A ND2   1 
ATOM   221  N N     . GLY A 1 65  ? 19.074 16.060  -17.885 1.00 60.55 ? 65  GLY A N     1 
ATOM   222  C CA    . GLY A 1 65  ? 18.674 14.668  -17.921 1.00 60.57 ? 65  GLY A CA    1 
ATOM   223  C C     . GLY A 1 65  ? 17.732 14.480  -19.091 1.00 60.83 ? 65  GLY A C     1 
ATOM   224  O O     . GLY A 1 65  ? 17.367 15.455  -19.752 1.00 61.38 ? 65  GLY A O     1 
ATOM   225  N N     . SER A 1 66  ? 17.340 13.241  -19.367 1.00 60.56 ? 66  SER A N     1 
ATOM   226  C CA    . SER A 1 66  ? 16.422 12.996  -20.471 1.00 60.04 ? 66  SER A CA    1 
ATOM   227  C C     . SER A 1 66  ? 15.041 13.559  -20.117 1.00 59.37 ? 66  SER A C     1 
ATOM   228  O O     . SER A 1 66  ? 14.241 13.863  -21.004 1.00 59.26 ? 66  SER A O     1 
ATOM   229  C CB    . SER A 1 66  ? 16.333 11.492  -20.768 1.00 60.06 ? 66  SER A CB    1 
ATOM   230  O OG    . SER A 1 66  ? 15.766 10.778  -19.683 1.00 60.53 ? 66  SER A OG    1 
ATOM   231  N N     . PHE A 1 67  ? 14.790 13.723  -18.815 1.00 58.83 ? 67  PHE A N     1 
ATOM   232  C CA    . PHE A 1 67  ? 13.512 14.238  -18.306 1.00 57.64 ? 67  PHE A CA    1 
ATOM   233  C C     . PHE A 1 67  ? 13.450 15.753  -18.150 1.00 56.12 ? 67  PHE A C     1 
ATOM   234  O O     . PHE A 1 67  ? 12.445 16.377  -18.489 1.00 56.04 ? 67  PHE A O     1 
ATOM   235  C CB    . PHE A 1 67  ? 13.175 13.591  -16.955 1.00 58.30 ? 67  PHE A CB    1 
ATOM   236  C CG    . PHE A 1 67  ? 12.937 12.110  -17.037 1.00 58.98 ? 67  PHE A CG    1 
ATOM   237  C CD1   . PHE A 1 67  ? 13.565 11.241  -16.148 1.00 59.13 ? 67  PHE A CD1   1 
ATOM   238  C CD2   . PHE A 1 67  ? 12.100 11.580  -18.017 1.00 59.22 ? 67  PHE A CD2   1 
ATOM   239  C CE1   . PHE A 1 67  ? 13.369 9.866   -16.230 1.00 59.42 ? 67  PHE A CE1   1 
ATOM   240  C CE2   . PHE A 1 67  ? 11.895 10.203  -18.110 1.00 59.65 ? 67  PHE A CE2   1 
ATOM   241  C CZ    . PHE A 1 67  ? 12.532 9.345   -17.214 1.00 59.85 ? 67  PHE A CZ    1 
ATOM   242  N N     . GLY A 1 68  ? 14.511 16.355  -17.631 1.00 54.42 ? 68  GLY A N     1 
ATOM   243  C CA    . GLY A 1 68  ? 14.480 17.794  -17.464 1.00 52.19 ? 68  GLY A CA    1 
ATOM   244  C C     . GLY A 1 68  ? 15.808 18.470  -17.211 1.00 50.19 ? 68  GLY A C     1 
ATOM   245  O O     . GLY A 1 68  ? 16.880 17.887  -17.401 1.00 50.40 ? 68  GLY A O     1 
ATOM   246  N N     . VAL A 1 69  ? 15.719 19.723  -16.780 1.00 47.91 ? 69  VAL A N     1 
ATOM   247  C CA    . VAL A 1 69  ? 16.891 20.531  -16.486 1.00 45.17 ? 69  VAL A CA    1 
ATOM   248  C C     . VAL A 1 69  ? 16.901 20.924  -15.020 1.00 43.06 ? 69  VAL A C     1 
ATOM   249  O O     . VAL A 1 69  ? 15.850 21.051  -14.389 1.00 42.55 ? 69  VAL A O     1 
ATOM   250  C CB    . VAL A 1 69  ? 16.901 21.829  -17.318 1.00 45.55 ? 69  VAL A CB    1 
ATOM   251  C CG1   . VAL A 1 69  ? 18.282 22.455  -17.283 1.00 45.46 ? 69  VAL A CG1   1 
ATOM   252  C CG2   . VAL A 1 69  ? 16.482 21.531  -18.743 1.00 46.13 ? 69  VAL A CG2   1 
ATOM   253  N N     . VAL A 1 70  ? 18.099 21.115  -14.488 1.00 40.33 ? 70  VAL A N     1 
ATOM   254  C CA    . VAL A 1 70  ? 18.266 21.520  -13.108 1.00 38.29 ? 70  VAL A CA    1 
ATOM   255  C C     . VAL A 1 70  ? 19.019 22.846  -13.122 1.00 37.97 ? 70  VAL A C     1 
ATOM   256  O O     . VAL A 1 70  ? 20.072 22.972  -13.754 1.00 37.50 ? 70  VAL A O     1 
ATOM   257  C CB    . VAL A 1 70  ? 19.061 20.470  -12.304 1.00 37.51 ? 70  VAL A CB    1 
ATOM   258  C CG1   . VAL A 1 70  ? 19.235 20.933  -10.870 1.00 36.72 ? 70  VAL A CG1   1 
ATOM   259  C CG2   . VAL A 1 70  ? 18.337 19.136  -12.345 1.00 36.54 ? 70  VAL A CG2   1 
ATOM   260  N N     . TYR A 1 71  ? 18.452 23.844  -12.453 1.00 36.90 ? 71  TYR A N     1 
ATOM   261  C CA    . TYR A 1 71  ? 19.059 25.162  -12.378 1.00 36.62 ? 71  TYR A CA    1 
ATOM   262  C C     . TYR A 1 71  ? 19.426 25.434  -10.946 1.00 35.82 ? 71  TYR A C     1 
ATOM   263  O O     . TYR A 1 71  ? 18.956 24.764  -10.030 1.00 35.47 ? 71  TYR A O     1 
ATOM   264  C CB    . TYR A 1 71  ? 18.084 26.264  -12.807 1.00 38.17 ? 71  TYR A CB    1 
ATOM   265  C CG    . TYR A 1 71  ? 17.419 26.057  -14.142 1.00 40.50 ? 71  TYR A CG    1 
ATOM   266  C CD1   . TYR A 1 71  ? 17.760 26.847  -15.241 1.00 41.56 ? 71  TYR A CD1   1 
ATOM   267  C CD2   . TYR A 1 71  ? 16.442 25.075  -14.310 1.00 41.25 ? 71  TYR A CD2   1 
ATOM   268  C CE1   . TYR A 1 71  ? 17.146 26.664  -16.477 1.00 42.12 ? 71  TYR A CE1   1 
ATOM   269  C CE2   . TYR A 1 71  ? 15.823 24.881  -15.541 1.00 42.36 ? 71  TYR A CE2   1 
ATOM   270  C CZ    . TYR A 1 71  ? 16.179 25.678  -16.619 1.00 43.04 ? 71  TYR A CZ    1 
ATOM   271  O OH    . TYR A 1 71  ? 15.568 25.480  -17.838 1.00 43.85 ? 71  TYR A OH    1 
ATOM   272  N N     . GLN A 1 72  ? 20.274 26.429  -10.761 1.00 34.98 ? 72  GLN A N     1 
ATOM   273  C CA    . GLN A 1 72  ? 20.660 26.843  -9.434  1.00 34.69 ? 72  GLN A CA    1 
ATOM   274  C C     . GLN A 1 72  ? 20.089 28.245  -9.341  1.00 34.07 ? 72  GLN A C     1 
ATOM   275  O O     . GLN A 1 72  ? 19.994 28.944  -10.348 1.00 33.61 ? 72  GLN A O     1 
ATOM   276  C CB    . GLN A 1 72  ? 22.177 26.884  -9.284  1.00 35.05 ? 72  GLN A CB    1 
ATOM   277  C CG    . GLN A 1 72  ? 22.629 27.200  -7.870  1.00 35.66 ? 72  GLN A CG    1 
ATOM   278  C CD    . GLN A 1 72  ? 24.032 27.756  -7.827  1.00 36.51 ? 72  GLN A CD    1 
ATOM   279  O OE1   . GLN A 1 72  ? 24.339 28.745  -8.490  1.00 36.73 ? 72  GLN A OE1   1 
ATOM   280  N NE2   . GLN A 1 72  ? 24.897 27.120  -7.047  1.00 37.24 ? 72  GLN A NE2   1 
ATOM   281  N N     . ALA A 1 73  ? 19.683 28.642  -8.146  1.00 33.89 ? 73  ALA A N     1 
ATOM   282  C CA    . ALA A 1 73  ? 19.126 29.968  -7.941  1.00 33.95 ? 73  ALA A CA    1 
ATOM   283  C C     . ALA A 1 73  ? 19.335 30.345  -6.491  1.00 34.18 ? 73  ALA A C     1 
ATOM   284  O O     . ALA A 1 73  ? 19.630 29.492  -5.654  1.00 33.79 ? 73  ALA A O     1 
ATOM   285  C CB    . ALA A 1 73  ? 17.636 29.979  -8.285  1.00 33.93 ? 73  ALA A CB    1 
ATOM   286  N N     . LYS A 1 74  ? 19.195 31.630  -6.197  1.00 35.25 ? 74  LYS A N     1 
ATOM   287  C CA    . LYS A 1 74  ? 19.375 32.117  -4.842  1.00 36.39 ? 74  LYS A CA    1 
ATOM   288  C C     . LYS A 1 74  ? 18.073 32.710  -4.348  1.00 36.44 ? 74  LYS A C     1 
ATOM   289  O O     . LYS A 1 74  ? 17.483 33.562  -5.010  1.00 36.40 ? 74  LYS A O     1 
ATOM   290  C CB    . LYS A 1 74  ? 20.474 33.178  -4.810  1.00 37.81 ? 74  LYS A CB    1 
ATOM   291  C CG    . LYS A 1 74  ? 20.680 33.818  -3.454  1.00 40.22 ? 74  LYS A CG    1 
ATOM   292  C CD    . LYS A 1 74  ? 21.254 35.215  -3.609  1.00 43.26 ? 74  LYS A CD    1 
ATOM   293  C CE    . LYS A 1 74  ? 22.367 35.470  -2.604  1.00 45.31 ? 74  LYS A CE    1 
ATOM   294  N NZ    . LYS A 1 74  ? 23.014 36.805  -2.817  1.00 47.13 ? 74  LYS A NZ    1 
ATOM   295  N N     . LEU A 1 75  ? 17.615 32.245  -3.193  1.00 36.95 ? 75  LEU A N     1 
ATOM   296  C CA    . LEU A 1 75  ? 16.382 32.751  -2.614  1.00 37.84 ? 75  LEU A CA    1 
ATOM   297  C C     . LEU A 1 75  ? 16.664 34.163  -2.130  1.00 39.06 ? 75  LEU A C     1 
ATOM   298  O O     . LEU A 1 75  ? 17.597 34.379  -1.364  1.00 39.10 ? 75  LEU A O     1 
ATOM   299  C CB    . LEU A 1 75  ? 15.948 31.871  -1.445  1.00 36.84 ? 75  LEU A CB    1 
ATOM   300  C CG    . LEU A 1 75  ? 15.616 30.420  -1.793  1.00 36.03 ? 75  LEU A CG    1 
ATOM   301  C CD1   . LEU A 1 75  ? 15.043 29.735  -0.573  1.00 35.52 ? 75  LEU A CD1   1 
ATOM   302  C CD2   . LEU A 1 75  ? 14.624 30.373  -2.944  1.00 35.58 ? 75  LEU A CD2   1 
ATOM   303  N N     . CYS A 1 76  ? 15.864 35.120  -2.588  1.00 40.97 ? 76  CYS A N     1 
ATOM   304  C CA    . CYS A 1 76  ? 16.041 36.523  -2.216  1.00 42.81 ? 76  CYS A CA    1 
ATOM   305  C C     . CYS A 1 76  ? 15.968 36.788  -0.724  1.00 44.18 ? 76  CYS A C     1 
ATOM   306  O O     . CYS A 1 76  ? 16.781 37.531  -0.177  1.00 44.94 ? 76  CYS A O     1 
ATOM   307  C CB    . CYS A 1 76  ? 14.996 37.387  -2.912  1.00 41.94 ? 76  CYS A CB    1 
ATOM   308  S SG    . CYS A 1 76  ? 15.114 37.349  -4.690  1.00 43.44 ? 76  CYS A SG    1 
ATOM   309  N N     . ASP A 1 77  ? 14.991 36.182  -0.065  1.00 45.94 ? 77  ASP A N     1 
ATOM   310  C CA    . ASP A 1 77  ? 14.813 36.387  1.363   1.00 47.52 ? 77  ASP A CA    1 
ATOM   311  C C     . ASP A 1 77  ? 15.966 35.874  2.222   1.00 47.59 ? 77  ASP A C     1 
ATOM   312  O O     . ASP A 1 77  ? 16.476 36.598  3.077   1.00 48.39 ? 77  ASP A O     1 
ATOM   313  C CB    . ASP A 1 77  ? 13.497 35.747  1.817   1.00 49.38 ? 77  ASP A CB    1 
ATOM   314  C CG    . ASP A 1 77  ? 12.302 36.676  1.621   1.00 51.45 ? 77  ASP A CG    1 
ATOM   315  O OD1   . ASP A 1 77  ? 12.086 37.146  0.478   1.00 52.02 ? 77  ASP A OD1   1 
ATOM   316  O OD2   . ASP A 1 77  ? 11.581 36.940  2.612   1.00 52.70 ? 77  ASP A OD2   1 
ATOM   317  N N     . SER A 1 78  ? 16.391 34.638  1.988   1.00 46.78 ? 78  SER A N     1 
ATOM   318  C CA    . SER A 1 78  ? 17.461 34.047  2.782   1.00 45.51 ? 78  SER A CA    1 
ATOM   319  C C     . SER A 1 78  ? 18.839 34.036  2.126   1.00 44.89 ? 78  SER A C     1 
ATOM   320  O O     . SER A 1 78  ? 19.845 33.830  2.804   1.00 45.51 ? 78  SER A O     1 
ATOM   321  C CB    . SER A 1 78  ? 17.081 32.614  3.160   1.00 45.36 ? 78  SER A CB    1 
ATOM   322  O OG    . SER A 1 78  ? 16.998 31.792  2.005   1.00 45.00 ? 78  SER A OG    1 
ATOM   323  N N     . GLY A 1 79  ? 18.894 34.247  0.817   1.00 43.74 ? 79  GLY A N     1 
ATOM   324  C CA    . GLY A 1 79  ? 20.176 34.220  0.134   1.00 41.98 ? 79  GLY A CA    1 
ATOM   325  C C     . GLY A 1 79  ? 20.670 32.787  -0.013  1.00 41.13 ? 79  GLY A C     1 
ATOM   326  O O     . GLY A 1 79  ? 21.760 32.544  -0.533  1.00 41.11 ? 79  GLY A O     1 
ATOM   327  N N     . GLU A 1 80  ? 19.861 31.835  0.446   1.00 39.93 ? 80  GLU A N     1 
ATOM   328  C CA    . GLU A 1 80  ? 20.207 30.418  0.360   1.00 38.74 ? 80  GLU A CA    1 
ATOM   329  C C     . GLU A 1 80  ? 20.160 29.930  -1.080  1.00 36.93 ? 80  GLU A C     1 
ATOM   330  O O     . GLU A 1 80  ? 19.308 30.351  -1.865  1.00 36.28 ? 80  GLU A O     1 
ATOM   331  C CB    . GLU A 1 80  ? 19.247 29.580  1.201   1.00 40.37 ? 80  GLU A CB    1 
ATOM   332  C CG    . GLU A 1 80  ? 19.627 29.486  2.668   1.00 43.42 ? 80  GLU A CG    1 
ATOM   333  C CD    . GLU A 1 80  ? 18.583 28.759  3.496   1.00 45.32 ? 80  GLU A CD    1 
ATOM   334  O OE1   . GLU A 1 80  ? 18.941 28.208  4.564   1.00 47.42 ? 80  GLU A OE1   1 
ATOM   335  O OE2   . GLU A 1 80  ? 17.404 28.740  3.082   1.00 46.18 ? 80  GLU A OE2   1 
ATOM   336  N N     . LEU A 1 81  ? 21.081 29.038  -1.424  1.00 34.98 ? 81  LEU A N     1 
ATOM   337  C CA    . LEU A 1 81  ? 21.138 28.496  -2.770  1.00 32.90 ? 81  LEU A CA    1 
ATOM   338  C C     . LEU A 1 81  ? 20.263 27.262  -2.864  1.00 31.01 ? 81  LEU A C     1 
ATOM   339  O O     . LEU A 1 81  ? 20.237 26.436  -1.957  1.00 31.13 ? 81  LEU A O     1 
ATOM   340  C CB    . LEU A 1 81  ? 22.575 28.128  -3.138  1.00 33.42 ? 81  LEU A CB    1 
ATOM   341  C CG    . LEU A 1 81  ? 23.580 29.273  -3.267  1.00 34.05 ? 81  LEU A CG    1 
ATOM   342  C CD1   . LEU A 1 81  ? 24.945 28.687  -3.579  1.00 33.97 ? 81  LEU A CD1   1 
ATOM   343  C CD2   . LEU A 1 81  ? 23.147 30.244  -4.364  1.00 33.47 ? 81  LEU A CD2   1 
ATOM   344  N N     . VAL A 1 82  ? 19.543 27.143  -3.970  1.00 29.13 ? 82  VAL A N     1 
ATOM   345  C CA    . VAL A 1 82  ? 18.679 26.000  -4.181  1.00 27.77 ? 82  VAL A CA    1 
ATOM   346  C C     . VAL A 1 82  ? 18.866 25.512  -5.604  1.00 27.03 ? 82  VAL A C     1 
ATOM   347  O O     . VAL A 1 82  ? 19.435 26.209  -6.449  1.00 26.68 ? 82  VAL A O     1 
ATOM   348  C CB    . VAL A 1 82  ? 17.173 26.363  -3.992  1.00 28.04 ? 82  VAL A CB    1 
ATOM   349  C CG1   . VAL A 1 82  ? 16.907 26.806  -2.557  1.00 27.42 ? 82  VAL A CG1   1 
ATOM   350  C CG2   . VAL A 1 82  ? 16.767 27.463  -4.980  1.00 27.47 ? 82  VAL A CG2   1 
ATOM   351  N N     . ALA A 1 83  ? 18.385 24.303  -5.856  1.00 25.58 ? 83  ALA A N     1 
ATOM   352  C CA    . ALA A 1 83  ? 18.440 23.718  -7.178  1.00 25.36 ? 83  ALA A CA    1 
ATOM   353  C C     . ALA A 1 83  ? 16.982 23.534  -7.583  1.00 25.89 ? 83  ALA A C     1 
ATOM   354  O O     . ALA A 1 83  ? 16.172 23.048  -6.795  1.00 25.58 ? 83  ALA A O     1 
ATOM   355  C CB    . ALA A 1 83  ? 19.143 22.385  -7.134  1.00 25.09 ? 83  ALA A CB    1 
ATOM   356  N N     . ILE A 1 84  ? 16.637 23.956  -8.791  1.00 25.16 ? 84  ILE A N     1 
ATOM   357  C CA    . ILE A 1 84  ? 15.274 23.803  -9.257  1.00 25.88 ? 84  ILE A CA    1 
ATOM   358  C C     . ILE A 1 84  ? 15.270 22.781  -10.375 1.00 25.92 ? 84  ILE A C     1 
ATOM   359  O O     . ILE A 1 84  ? 15.844 23.016  -11.436 1.00 26.67 ? 84  ILE A O     1 
ATOM   360  C CB    . ILE A 1 84  ? 14.702 25.139  -9.779  1.00 25.89 ? 84  ILE A CB    1 
ATOM   361  C CG1   . ILE A 1 84  ? 14.741 26.191  -8.665  1.00 25.94 ? 84  ILE A CG1   1 
ATOM   362  C CG2   . ILE A 1 84  ? 13.271 24.929  -10.294 1.00 25.74 ? 84  ILE A CG2   1 
ATOM   363  C CD1   . ILE A 1 84  ? 14.260 27.567  -9.105  1.00 26.90 ? 84  ILE A CD1   1 
ATOM   364  N N     . LYS A 1 85  ? 14.644 21.636  -10.123 1.00 26.17 ? 85  LYS A N     1 
ATOM   365  C CA    . LYS A 1 85  ? 14.554 20.578  -11.119 1.00 27.08 ? 85  LYS A CA    1 
ATOM   366  C C     . LYS A 1 85  ? 13.246 20.776  -11.876 1.00 28.95 ? 85  LYS A C     1 
ATOM   367  O O     . LYS A 1 85  ? 12.158 20.649  -11.305 1.00 27.78 ? 85  LYS A O     1 
ATOM   368  C CB    . LYS A 1 85  ? 14.573 19.206  -10.442 1.00 26.75 ? 85  LYS A CB    1 
ATOM   369  C CG    . LYS A 1 85  ? 14.419 18.035  -11.409 1.00 26.66 ? 85  LYS A CG    1 
ATOM   370  C CD    . LYS A 1 85  ? 14.577 16.701  -10.687 1.00 25.86 ? 85  LYS A CD    1 
ATOM   371  C CE    . LYS A 1 85  ? 14.606 15.539  -11.666 1.00 26.65 ? 85  LYS A CE    1 
ATOM   372  N NZ    . LYS A 1 85  ? 14.853 14.240  -10.974 1.00 25.51 ? 85  LYS A NZ    1 
ATOM   373  N N     . LYS A 1 86  ? 13.358 21.094  -13.160 1.00 30.23 ? 86  LYS A N     1 
ATOM   374  C CA    . LYS A 1 86  ? 12.194 21.335  -13.997 1.00 32.89 ? 86  LYS A CA    1 
ATOM   375  C C     . LYS A 1 86  ? 11.863 20.131  -14.874 1.00 34.47 ? 86  LYS A C     1 
ATOM   376  O O     . LYS A 1 86  ? 12.715 19.638  -15.618 1.00 34.68 ? 86  LYS A O     1 
ATOM   377  C CB    . LYS A 1 86  ? 12.450 22.561  -14.867 1.00 33.71 ? 86  LYS A CB    1 
ATOM   378  C CG    . LYS A 1 86  ? 11.214 23.163  -15.483 1.00 35.13 ? 86  LYS A CG    1 
ATOM   379  C CD    . LYS A 1 86  ? 11.601 24.352  -16.324 1.00 36.77 ? 86  LYS A CD    1 
ATOM   380  C CE    . LYS A 1 86  ? 10.398 24.962  -17.000 1.00 38.55 ? 86  LYS A CE    1 
ATOM   381  N NZ    . LYS A 1 86  ? 10.787 26.241  -17.671 1.00 40.57 ? 86  LYS A NZ    1 
ATOM   382  N N     . VAL A 1 87  ? 10.622 19.665  -14.792 1.00 35.83 ? 87  VAL A N     1 
ATOM   383  C CA    . VAL A 1 87  ? 10.190 18.511  -15.568 1.00 37.77 ? 87  VAL A CA    1 
ATOM   384  C C     . VAL A 1 87  ? 8.810  18.724  -16.202 1.00 39.71 ? 87  VAL A C     1 
ATOM   385  O O     . VAL A 1 87  ? 7.938  19.363  -15.615 1.00 39.02 ? 87  VAL A O     1 
ATOM   386  C CB    . VAL A 1 87  ? 10.162 17.247  -14.670 1.00 37.66 ? 87  VAL A CB    1 
ATOM   387  C CG1   . VAL A 1 87  ? 9.444  16.109  -15.369 1.00 38.38 ? 87  VAL A CG1   1 
ATOM   388  C CG2   . VAL A 1 87  ? 11.585 16.836  -14.322 1.00 37.16 ? 87  VAL A CG2   1 
ATOM   389  N N     . LEU A 1 88  ? 8.629  18.200  -17.412 1.00 41.91 ? 88  LEU A N     1 
ATOM   390  C CA    . LEU A 1 88  ? 7.358  18.310  -18.118 1.00 44.42 ? 88  LEU A CA    1 
ATOM   391  C C     . LEU A 1 88  ? 6.347  17.451  -17.371 1.00 46.27 ? 88  LEU A C     1 
ATOM   392  O O     . LEU A 1 88  ? 6.567  16.259  -17.177 1.00 46.39 ? 88  LEU A O     1 
ATOM   393  C CB    . LEU A 1 88  ? 7.507  17.800  -19.551 1.00 44.54 ? 88  LEU A CB    1 
ATOM   394  C CG    . LEU A 1 88  ? 6.405  18.192  -20.530 1.00 44.72 ? 88  LEU A CG    1 
ATOM   395  C CD1   . LEU A 1 88  ? 6.600  19.634  -20.974 1.00 44.54 ? 88  LEU A CD1   1 
ATOM   396  C CD2   . LEU A 1 88  ? 6.434  17.246  -21.720 1.00 44.91 ? 88  LEU A CD2   1 
ATOM   397  N N     . GLN A 1 89  ? 5.241  18.050  -16.947 1.00 48.79 ? 89  GLN A N     1 
ATOM   398  C CA    . GLN A 1 89  ? 4.238  17.297  -16.209 1.00 51.70 ? 89  GLN A CA    1 
ATOM   399  C C     . GLN A 1 89  ? 3.001  16.961  -17.024 1.00 53.45 ? 89  GLN A C     1 
ATOM   400  O O     . GLN A 1 89  ? 2.442  17.812  -17.714 1.00 53.42 ? 89  GLN A O     1 
ATOM   401  C CB    . GLN A 1 89  ? 3.822  18.063  -14.948 1.00 52.32 ? 89  GLN A CB    1 
ATOM   402  C CG    . GLN A 1 89  ? 3.073  17.220  -13.912 1.00 53.75 ? 89  GLN A CG    1 
ATOM   403  C CD    . GLN A 1 89  ? 3.407  15.731  -13.994 1.00 54.85 ? 89  GLN A CD    1 
ATOM   404  O OE1   . GLN A 1 89  ? 2.516  14.889  -14.116 1.00 55.12 ? 89  GLN A OE1   1 
ATOM   405  N NE2   . GLN A 1 89  ? 4.695  15.405  -13.925 1.00 54.81 ? 89  GLN A NE2   1 
ATOM   406  N N     . ASP A 1 90  ? 2.583  15.704  -16.947 1.00 55.78 ? 90  ASP A N     1 
ATOM   407  C CA    . ASP A 1 90  ? 1.391  15.273  -17.650 1.00 58.36 ? 90  ASP A CA    1 
ATOM   408  C C     . ASP A 1 90  ? 0.221  15.824  -16.848 1.00 59.35 ? 90  ASP A C     1 
ATOM   409  O O     . ASP A 1 90  ? -0.003 15.421  -15.704 1.00 59.27 ? 90  ASP A O     1 
ATOM   410  C CB    . ASP A 1 90  ? 1.310  13.746  -17.701 1.00 59.84 ? 90  ASP A CB    1 
ATOM   411  C CG    . ASP A 1 90  ? 0.254  13.253  -18.681 1.00 61.59 ? 90  ASP A CG    1 
ATOM   412  O OD1   . ASP A 1 90  ? 0.230  12.035  -18.969 1.00 62.48 ? 90  ASP A OD1   1 
ATOM   413  O OD2   . ASP A 1 90  ? -0.550 14.086  -19.164 1.00 62.23 ? 90  ASP A OD2   1 
ATOM   414  N N     . LYS A 1 91  ? -0.512 16.756  -17.448 1.00 60.51 ? 91  LYS A N     1 
ATOM   415  C CA    . LYS A 1 91  ? -1.655 17.381  -16.790 1.00 61.49 ? 91  LYS A CA    1 
ATOM   416  C C     . LYS A 1 91  ? -2.656 16.367  -16.241 1.00 61.34 ? 91  LYS A C     1 
ATOM   417  O O     . LYS A 1 91  ? -3.161 16.521  -15.128 1.00 61.46 ? 91  LYS A O     1 
ATOM   418  C CB    . LYS A 1 91  ? -2.370 18.318  -17.769 1.00 62.41 ? 91  LYS A CB    1 
ATOM   419  C CG    . LYS A 1 91  ? -2.661 17.688  -19.124 1.00 63.40 ? 91  LYS A CG    1 
ATOM   420  C CD    . LYS A 1 91  ? -3.709 18.486  -19.883 1.00 64.50 ? 91  LYS A CD    1 
ATOM   421  C CE    . LYS A 1 91  ? -4.523 17.601  -20.818 1.00 64.77 ? 91  LYS A CE    1 
ATOM   422  N NZ    . LYS A 1 91  ? -5.008 18.365  -22.004 1.00 65.26 ? 91  LYS A NZ    1 
ATOM   423  N N     . ARG A 1 92  ? -2.925 15.325  -17.022 1.00 61.12 ? 92  ARG A N     1 
ATOM   424  C CA    . ARG A 1 92  ? -3.891 14.302  -16.635 1.00 60.92 ? 92  ARG A CA    1 
ATOM   425  C C     . ARG A 1 92  ? -3.453 13.293  -15.574 1.00 59.60 ? 92  ARG A C     1 
ATOM   426  O O     . ARG A 1 92  ? -4.228 12.408  -15.207 1.00 59.89 ? 92  ARG A O     1 
ATOM   427  C CB    . ARG A 1 92  ? -4.365 13.548  -17.883 1.00 62.67 ? 92  ARG A CB    1 
ATOM   428  C CG    . ARG A 1 92  ? -5.326 14.342  -18.764 1.00 64.65 ? 92  ARG A CG    1 
ATOM   429  C CD    . ARG A 1 92  ? -6.530 14.847  -17.967 1.00 66.50 ? 92  ARG A CD    1 
ATOM   430  N NE    . ARG A 1 92  ? -7.399 13.757  -17.525 1.00 67.94 ? 92  ARG A NE    1 
ATOM   431  C CZ    . ARG A 1 92  ? -8.506 13.928  -16.808 1.00 68.88 ? 92  ARG A CZ    1 
ATOM   432  N NH1   . ARG A 1 92  ? -8.883 15.149  -16.450 1.00 69.58 ? 92  ARG A NH1   1 
ATOM   433  N NH2   . ARG A 1 92  ? -9.243 12.881  -16.457 1.00 69.26 ? 92  ARG A NH2   1 
ATOM   434  N N     . PHE A 1 93  ? -2.225 13.406  -15.078 1.00 57.75 ? 93  PHE A N     1 
ATOM   435  C CA    . PHE A 1 93  ? -1.751 12.467  -14.060 1.00 55.49 ? 93  PHE A CA    1 
ATOM   436  C C     . PHE A 1 93  ? -0.796 13.131  -13.075 1.00 52.97 ? 93  PHE A C     1 
ATOM   437  O O     . PHE A 1 93  ? -0.183 14.154  -13.389 1.00 53.04 ? 93  PHE A O     1 
ATOM   438  C CB    . PHE A 1 93  ? -1.077 11.271  -14.736 1.00 56.72 ? 93  PHE A CB    1 
ATOM   439  C CG    . PHE A 1 93  ? -1.877 10.698  -15.872 1.00 58.15 ? 93  PHE A CG    1 
ATOM   440  C CD1   . PHE A 1 93  ? -2.830 9.710   -15.641 1.00 58.80 ? 93  PHE A CD1   1 
ATOM   441  C CD2   . PHE A 1 93  ? -1.710 11.180  -17.168 1.00 58.67 ? 93  PHE A CD2   1 
ATOM   442  C CE1   . PHE A 1 93  ? -3.609 9.210   -16.686 1.00 59.02 ? 93  PHE A CE1   1 
ATOM   443  C CE2   . PHE A 1 93  ? -2.481 10.689  -18.221 1.00 58.89 ? 93  PHE A CE2   1 
ATOM   444  C CZ    . PHE A 1 93  ? -3.433 9.704   -17.979 1.00 59.04 ? 93  PHE A CZ    1 
ATOM   445  N N     . LYS A 1 94  ? -0.674 12.564  -11.878 1.00 49.47 ? 94  LYS A N     1 
ATOM   446  C CA    . LYS A 1 94  ? 0.218  13.164  -10.901 1.00 46.34 ? 94  LYS A CA    1 
ATOM   447  C C     . LYS A 1 94  ? 1.631  12.613  -10.943 1.00 43.22 ? 94  LYS A C     1 
ATOM   448  O O     . LYS A 1 94  ? 1.854  11.435  -11.226 1.00 43.06 ? 94  LYS A O     1 
ATOM   449  C CB    . LYS A 1 94  ? -0.339 13.046  -9.484  1.00 46.81 ? 94  LYS A CB    1 
ATOM   450  C CG    . LYS A 1 94  ? 0.165  14.172  -8.561  1.00 47.68 ? 94  LYS A CG    1 
ATOM   451  C CD    . LYS A 1 94  ? 0.401  15.495  -9.321  1.00 46.88 ? 94  LYS A CD    1 
ATOM   452  C CE    . LYS A 1 94  ? 1.851  15.972  -9.229  1.00 46.37 ? 94  LYS A CE    1 
ATOM   453  N NZ    . LYS A 1 94  ? 2.226  16.978  -10.282 1.00 44.20 ? 94  LYS A NZ    1 
ATOM   454  N N     . ASN A 1 95  ? 2.579  13.495  -10.656 1.00 39.55 ? 95  ASN A N     1 
ATOM   455  C CA    . ASN A 1 95  ? 3.994  13.166  -10.669 1.00 35.49 ? 95  ASN A CA    1 
ATOM   456  C C     . ASN A 1 95  ? 4.400  12.258  -9.514  1.00 33.02 ? 95  ASN A C     1 
ATOM   457  O O     . ASN A 1 95  ? 4.295  12.635  -8.346  1.00 31.46 ? 95  ASN A O     1 
ATOM   458  C CB    . ASN A 1 95  ? 4.801  14.459  -10.632 1.00 34.96 ? 95  ASN A CB    1 
ATOM   459  C CG    . ASN A 1 95  ? 6.233  14.253  -11.039 1.00 34.43 ? 95  ASN A CG    1 
ATOM   460  O OD1   . ASN A 1 95  ? 6.605  14.481  -12.194 1.00 34.43 ? 95  ASN A OD1   1 
ATOM   461  N ND2   . ASN A 1 95  ? 7.051  13.813  -10.095 1.00 32.82 ? 95  ASN A ND2   1 
ATOM   462  N N     . ARG A 1 96  ? 4.864  11.058  -9.849  1.00 30.82 ? 96  ARG A N     1 
ATOM   463  C CA    . ARG A 1 96  ? 5.289  10.091  -8.843  1.00 29.39 ? 96  ARG A CA    1 
ATOM   464  C C     . ARG A 1 96  ? 6.502  10.584  -8.049  1.00 27.57 ? 96  ARG A C     1 
ATOM   465  O O     . ARG A 1 96  ? 6.582  10.381  -6.835  1.00 26.70 ? 96  ARG A O     1 
ATOM   466  C CB    . ARG A 1 96  ? 5.624  8.748   -9.498  1.00 29.94 ? 96  ARG A CB    1 
ATOM   467  C CG    . ARG A 1 96  ? 5.964  7.650   -8.507  1.00 32.00 ? 96  ARG A CG    1 
ATOM   468  C CD    . ARG A 1 96  ? 6.301  6.342   -9.210  1.00 34.25 ? 96  ARG A CD    1 
ATOM   469  N NE    . ARG A 1 96  ? 5.127  5.754   -9.853  1.00 36.93 ? 96  ARG A NE    1 
ATOM   470  C CZ    . ARG A 1 96  ? 5.157  4.690   -10.651 1.00 38.08 ? 96  ARG A CZ    1 
ATOM   471  N NH1   . ARG A 1 96  ? 6.304  4.081   -10.915 1.00 39.05 ? 96  ARG A NH1   1 
ATOM   472  N NH2   . ARG A 1 96  ? 4.035  4.236   -11.191 1.00 39.31 ? 96  ARG A NH2   1 
ATOM   473  N N     . GLU A 1 97  ? 7.444  11.222  -8.736  1.00 25.99 ? 97  GLU A N     1 
ATOM   474  C CA    . GLU A 1 97  ? 8.642  11.729  -8.074  1.00 24.79 ? 97  GLU A CA    1 
ATOM   475  C C     . GLU A 1 97  ? 8.238  12.750  -7.003  1.00 24.37 ? 97  GLU A C     1 
ATOM   476  O O     . GLU A 1 97  ? 8.761  12.737  -5.885  1.00 22.97 ? 97  GLU A O     1 
ATOM   477  C CB    . GLU A 1 97  ? 9.583  12.373  -9.106  1.00 24.53 ? 97  GLU A CB    1 
ATOM   478  C CG    . GLU A 1 97  ? 10.971 12.732  -8.565  1.00 24.69 ? 97  GLU A CG    1 
ATOM   479  C CD    . GLU A 1 97  ? 11.881 13.371  -9.615  1.00 25.38 ? 97  GLU A CD    1 
ATOM   480  O OE1   . GLU A 1 97  ? 12.966 13.865  -9.240  1.00 26.51 ? 97  GLU A OE1   1 
ATOM   481  O OE2   . GLU A 1 97  ? 11.521 13.382  -10.814 1.00 25.91 ? 97  GLU A OE2   1 
ATOM   482  N N     . LEU A 1 98  ? 7.293  13.623  -7.343  1.00 23.64 ? 98  LEU A N     1 
ATOM   483  C CA    . LEU A 1 98  ? 6.829  14.634  -6.401  1.00 23.75 ? 98  LEU A CA    1 
ATOM   484  C C     . LEU A 1 98  ? 6.138  13.984  -5.204  1.00 24.38 ? 98  LEU A C     1 
ATOM   485  O O     . LEU A 1 98  ? 6.398  14.331  -4.053  1.00 23.47 ? 98  LEU A O     1 
ATOM   486  C CB    . LEU A 1 98  ? 5.854  15.593  -7.097  1.00 23.38 ? 98  LEU A CB    1 
ATOM   487  C CG    . LEU A 1 98  ? 5.135  16.580  -6.173  1.00 23.81 ? 98  LEU A CG    1 
ATOM   488  C CD1   . LEU A 1 98  ? 6.166  17.473  -5.487  1.00 23.56 ? 98  LEU A CD1   1 
ATOM   489  C CD2   . LEU A 1 98  ? 4.150  17.421  -6.969  1.00 23.71 ? 98  LEU A CD2   1 
ATOM   490  N N     . GLN A 1 99  ? 5.252  13.035  -5.484  1.00 25.85 ? 99  GLN A N     1 
ATOM   491  C CA    . GLN A 1 99  ? 4.517  12.357  -4.426  1.00 26.99 ? 99  GLN A CA    1 
ATOM   492  C C     . GLN A 1 99  ? 5.454  11.666  -3.444  1.00 26.52 ? 99  GLN A C     1 
ATOM   493  O O     . GLN A 1 99  ? 5.229  11.702  -2.235  1.00 26.05 ? 99  GLN A O     1 
ATOM   494  C CB    . GLN A 1 99  ? 3.551  11.333  -5.026  1.00 29.47 ? 99  GLN A CB    1 
ATOM   495  C CG    . GLN A 1 99  ? 2.476  11.924  -5.937  1.00 33.61 ? 99  GLN A CG    1 
ATOM   496  C CD    . GLN A 1 99  ? 2.178  13.397  -5.655  1.00 36.63 ? 99  GLN A CD    1 
ATOM   497  O OE1   . GLN A 1 99  ? 1.775  13.773  -4.543  1.00 38.60 ? 99  GLN A OE1   1 
ATOM   498  N NE2   . GLN A 1 99  ? 2.368  14.239  -6.670  1.00 38.74 ? 99  GLN A NE2   1 
ATOM   499  N N     . ILE A 1 100 ? 6.504  11.037  -3.967  1.00 25.89 ? 100 ILE A N     1 
ATOM   500  C CA    . ILE A 1 100 ? 7.460  10.342  -3.116  1.00 25.21 ? 100 ILE A CA    1 
ATOM   501  C C     . ILE A 1 100 ? 8.284  11.341  -2.308  1.00 25.13 ? 100 ILE A C     1 
ATOM   502  O O     . ILE A 1 100 ? 8.434  11.176  -1.102  1.00 24.42 ? 100 ILE A O     1 
ATOM   503  C CB    . ILE A 1 100 ? 8.403  9.433   -3.951  1.00 25.36 ? 100 ILE A CB    1 
ATOM   504  C CG1   . ILE A 1 100 ? 7.656  8.160   -4.368  1.00 25.10 ? 100 ILE A CG1   1 
ATOM   505  C CG2   . ILE A 1 100 ? 9.639  9.054   -3.131  1.00 24.69 ? 100 ILE A CG2   1 
ATOM   506  C CD1   . ILE A 1 100 ? 8.367  7.342   -5.444  1.00 24.77 ? 100 ILE A CD1   1 
ATOM   507  N N     . MET A 1 101 ? 8.796  12.381  -2.968  1.00 25.51 ? 101 MET A N     1 
ATOM   508  C CA    . MET A 1 101 ? 9.605  13.408  -2.300  1.00 26.76 ? 101 MET A CA    1 
ATOM   509  C C     . MET A 1 101 ? 8.861  14.103  -1.162  1.00 26.96 ? 101 MET A C     1 
ATOM   510  O O     . MET A 1 101 ? 9.441  14.404  -0.122  1.00 25.78 ? 101 MET A O     1 
ATOM   511  C CB    . MET A 1 101 ? 10.026 14.504  -3.282  1.00 29.54 ? 101 MET A CB    1 
ATOM   512  C CG    . MET A 1 101 ? 11.010 14.105  -4.343  1.00 33.44 ? 101 MET A CG    1 
ATOM   513  S SD    . MET A 1 101 ? 12.543 13.608  -3.632  1.00 41.28 ? 101 MET A SD    1 
ATOM   514  C CE    . MET A 1 101 ? 13.354 15.192  -3.356  1.00 37.45 ? 101 MET A CE    1 
ATOM   515  N N     . ARG A 1 102 ? 7.581  14.391  -1.379  1.00 26.75 ? 102 ARG A N     1 
ATOM   516  C CA    . ARG A 1 102 ? 6.786  15.080  -0.378  1.00 27.51 ? 102 ARG A CA    1 
ATOM   517  C C     . ARG A 1 102 ? 6.730  14.358  0.957   1.00 27.69 ? 102 ARG A C     1 
ATOM   518  O O     . ARG A 1 102 ? 6.557  14.986  1.999   1.00 28.47 ? 102 ARG A O     1 
ATOM   519  C CB    . ARG A 1 102 ? 5.368  15.301  -0.898  1.00 27.83 ? 102 ARG A CB    1 
ATOM   520  C CG    . ARG A 1 102 ? 5.280  16.308  -2.015  1.00 29.77 ? 102 ARG A CG    1 
ATOM   521  C CD    . ARG A 1 102 ? 3.869  16.862  -2.126  1.00 31.34 ? 102 ARG A CD    1 
ATOM   522  N NE    . ARG A 1 102 ? 3.669  17.942  -1.165  1.00 33.72 ? 102 ARG A NE    1 
ATOM   523  C CZ    . ARG A 1 102 ? 2.529  18.606  -1.008  1.00 35.16 ? 102 ARG A CZ    1 
ATOM   524  N NH1   . ARG A 1 102 ? 1.475  18.299  -1.754  1.00 34.91 ? 102 ARG A NH1   1 
ATOM   525  N NH2   . ARG A 1 102 ? 2.449  19.585  -0.110  1.00 35.66 ? 102 ARG A NH2   1 
ATOM   526  N N     . LYS A 1 103 ? 6.886  13.042  0.943   1.00 27.67 ? 103 LYS A N     1 
ATOM   527  C CA    . LYS A 1 103 ? 6.822  12.294  2.192   1.00 28.31 ? 103 LYS A CA    1 
ATOM   528  C C     . LYS A 1 103 ? 8.170  11.938  2.833   1.00 27.25 ? 103 LYS A C     1 
ATOM   529  O O     . LYS A 1 103 ? 8.209  11.366  3.919   1.00 27.49 ? 103 LYS A O     1 
ATOM   530  C CB    . LYS A 1 103 ? 6.006  11.020  1.989   1.00 30.67 ? 103 LYS A CB    1 
ATOM   531  C CG    . LYS A 1 103 ? 6.688  9.971   1.148   1.00 33.55 ? 103 LYS A CG    1 
ATOM   532  C CD    . LYS A 1 103 ? 5.823  8.715   1.049   1.00 36.56 ? 103 LYS A CD    1 
ATOM   533  C CE    . LYS A 1 103 ? 4.487  8.999   0.363   1.00 37.77 ? 103 LYS A CE    1 
ATOM   534  N NZ    . LYS A 1 103 ? 3.717  7.752   0.039   1.00 38.91 ? 103 LYS A NZ    1 
ATOM   535  N N     . LEU A 1 104 ? 9.273  12.282  2.179   1.00 25.69 ? 104 LEU A N     1 
ATOM   536  C CA    . LEU A 1 104 ? 10.591 11.965  2.730   1.00 23.92 ? 104 LEU A CA    1 
ATOM   537  C C     . LEU A 1 104 ? 11.180 13.089  3.564   1.00 23.59 ? 104 LEU A C     1 
ATOM   538  O O     . LEU A 1 104 ? 11.125 14.259  3.190   1.00 23.50 ? 104 LEU A O     1 
ATOM   539  C CB    . LEU A 1 104 ? 11.572 11.619  1.604   1.00 22.45 ? 104 LEU A CB    1 
ATOM   540  C CG    . LEU A 1 104 ? 11.114 10.520  0.641   1.00 22.07 ? 104 LEU A CG    1 
ATOM   541  C CD1   . LEU A 1 104 ? 12.111 10.367  -0.500  1.00 21.66 ? 104 LEU A CD1   1 
ATOM   542  C CD2   . LEU A 1 104 ? 10.954 9.220   1.404   1.00 22.46 ? 104 LEU A CD2   1 
ATOM   543  N N     . ASP A 1 105 ? 11.757 12.717  4.698   1.00 23.09 ? 105 ASP A N     1 
ATOM   544  C CA    . ASP A 1 105 ? 12.384 13.680  5.587   1.00 23.71 ? 105 ASP A CA    1 
ATOM   545  C C     . ASP A 1 105 ? 13.516 12.958  6.301   1.00 23.01 ? 105 ASP A C     1 
ATOM   546  O O     . ASP A 1 105 ? 13.307 12.340  7.350   1.00 22.48 ? 105 ASP A O     1 
ATOM   547  C CB    . ASP A 1 105 ? 11.379 14.207  6.606   1.00 25.65 ? 105 ASP A CB    1 
ATOM   548  C CG    . ASP A 1 105 ? 12.025 15.097  7.647   1.00 28.68 ? 105 ASP A CG    1 
ATOM   549  O OD1   . ASP A 1 105 ? 13.110 15.658  7.371   1.00 29.91 ? 105 ASP A OD1   1 
ATOM   550  O OD2   . ASP A 1 105 ? 11.452 15.235  8.749   1.00 30.43 ? 105 ASP A OD2   1 
ATOM   551  N N     . HIS A 1 106 ? 14.712 13.031  5.717   1.00 21.20 ? 106 HIS A N     1 
ATOM   552  C CA    . HIS A 1 106 ? 15.891 12.370  6.272   1.00 19.57 ? 106 HIS A CA    1 
ATOM   553  C C     . HIS A 1 106 ? 17.134 13.216  5.967   1.00 19.09 ? 106 HIS A C     1 
ATOM   554  O O     . HIS A 1 106 ? 17.225 13.822  4.898   1.00 18.69 ? 106 HIS A O     1 
ATOM   555  C CB    . HIS A 1 106 ? 16.013 10.976  5.660   1.00 18.78 ? 106 HIS A CB    1 
ATOM   556  C CG    . HIS A 1 106 ? 17.030 10.105  6.324   1.00 18.65 ? 106 HIS A CG    1 
ATOM   557  N ND1   . HIS A 1 106 ? 18.367 10.139  5.992   1.00 19.25 ? 106 HIS A ND1   1 
ATOM   558  C CD2   . HIS A 1 106 ? 16.899 9.131   7.256   1.00 18.72 ? 106 HIS A CD2   1 
ATOM   559  C CE1   . HIS A 1 106 ? 19.017 9.222   6.689   1.00 18.24 ? 106 HIS A CE1   1 
ATOM   560  N NE2   . HIS A 1 106 ? 18.149 8.596   7.464   1.00 17.99 ? 106 HIS A NE2   1 
ATOM   561  N N     . CYS A 1 107 ? 18.083 13.256  6.905   1.00 18.59 ? 107 CYS A N     1 
ATOM   562  C CA    . CYS A 1 107 ? 19.299 14.057  6.737   1.00 18.83 ? 107 CYS A CA    1 
ATOM   563  C C     . CYS A 1 107 ? 20.196 13.621  5.579   1.00 17.88 ? 107 CYS A C     1 
ATOM   564  O O     . CYS A 1 107 ? 21.058 14.386  5.132   1.00 18.37 ? 107 CYS A O     1 
ATOM   565  C CB    . CYS A 1 107 ? 20.102 14.082  8.047   1.00 19.38 ? 107 CYS A CB    1 
ATOM   566  S SG    . CYS A 1 107 ? 20.689 12.479  8.625   1.00 24.38 ? 107 CYS A SG    1 
ATOM   567  N N     . ASN A 1 108 ? 19.984 12.409  5.076   1.00 16.29 ? 108 ASN A N     1 
ATOM   568  C CA    . ASN A 1 108 ? 20.776 11.907  3.961   1.00 15.53 ? 108 ASN A CA    1 
ATOM   569  C C     . ASN A 1 108 ? 19.992 11.794  2.645   1.00 15.57 ? 108 ASN A C     1 
ATOM   570  O O     . ASN A 1 108 ? 20.342 11.008  1.762   1.00 14.72 ? 108 ASN A O     1 
ATOM   571  C CB    . ASN A 1 108 ? 21.402 10.569  4.350   1.00 15.33 ? 108 ASN A CB    1 
ATOM   572  C CG    . ASN A 1 108 ? 22.453 10.734  5.429   1.00 15.93 ? 108 ASN A CG    1 
ATOM   573  O OD1   . ASN A 1 108 ? 23.326 11.601  5.319   1.00 18.33 ? 108 ASN A OD1   1 
ATOM   574  N ND2   . ASN A 1 108 ? 22.372 9.930   6.477   1.00 14.24 ? 108 ASN A ND2   1 
ATOM   575  N N     . ILE A 1 109 ? 18.929 12.586  2.526   1.00 15.43 ? 109 ILE A N     1 
ATOM   576  C CA    . ILE A 1 109 ? 18.121 12.620  1.305   1.00 16.31 ? 109 ILE A CA    1 
ATOM   577  C C     . ILE A 1 109 ? 17.884 14.090  1.025   1.00 16.85 ? 109 ILE A C     1 
ATOM   578  O O     . ILE A 1 109 ? 17.482 14.831  1.926   1.00 17.31 ? 109 ILE A O     1 
ATOM   579  C CB    . ILE A 1 109 ? 16.764 11.886  1.479   1.00 16.00 ? 109 ILE A CB    1 
ATOM   580  C CG1   . ILE A 1 109 ? 17.017 10.402  1.763   1.00 16.89 ? 109 ILE A CG1   1 
ATOM   581  C CG2   . ILE A 1 109 ? 15.909 12.055  0.210   1.00 16.29 ? 109 ILE A CG2   1 
ATOM   582  C CD1   . ILE A 1 109 ? 15.746 9.567   1.897   1.00 17.10 ? 109 ILE A CD1   1 
ATOM   583  N N     . VAL A 1 110 ? 18.148 14.524  -0.204  1.00 17.54 ? 110 VAL A N     1 
ATOM   584  C CA    . VAL A 1 110 ? 17.968 15.933  -0.554  1.00 19.50 ? 110 VAL A CA    1 
ATOM   585  C C     . VAL A 1 110 ? 16.540 16.387  -0.249  1.00 20.12 ? 110 VAL A C     1 
ATOM   586  O O     . VAL A 1 110 ? 15.565 15.732  -0.612  1.00 19.72 ? 110 VAL A O     1 
ATOM   587  C CB    . VAL A 1 110 ? 18.338 16.201  -2.046  1.00 20.31 ? 110 VAL A CB    1 
ATOM   588  C CG1   . VAL A 1 110 ? 17.245 15.703  -2.976  1.00 20.04 ? 110 VAL A CG1   1 
ATOM   589  C CG2   . VAL A 1 110 ? 18.591 17.690  -2.251  1.00 22.22 ? 110 VAL A CG2   1 
ATOM   590  N N     . ARG A 1 111 ? 16.428 17.521  0.427   1.00 20.98 ? 111 ARG A N     1 
ATOM   591  C CA    . ARG A 1 111 ? 15.129 18.037  0.836   1.00 22.15 ? 111 ARG A CA    1 
ATOM   592  C C     . ARG A 1 111 ? 14.345 18.803  -0.229  1.00 21.70 ? 111 ARG A C     1 
ATOM   593  O O     . ARG A 1 111 ? 14.899 19.639  -0.948  1.00 20.88 ? 111 ARG A O     1 
ATOM   594  C CB    . ARG A 1 111 ? 15.311 18.925  2.076   1.00 24.43 ? 111 ARG A CB    1 
ATOM   595  C CG    . ARG A 1 111 ? 14.050 19.637  2.534   1.00 28.08 ? 111 ARG A CG    1 
ATOM   596  C CD    . ARG A 1 111 ? 14.339 20.578  3.687   1.00 31.44 ? 111 ARG A CD    1 
ATOM   597  N NE    . ARG A 1 111 ? 15.334 21.582  3.318   1.00 36.77 ? 111 ARG A NE    1 
ATOM   598  C CZ    . ARG A 1 111 ? 15.815 22.509  4.147   1.00 38.67 ? 111 ARG A CZ    1 
ATOM   599  N NH1   . ARG A 1 111 ? 15.389 22.563  5.403   1.00 40.36 ? 111 ARG A NH1   1 
ATOM   600  N NH2   . ARG A 1 111 ? 16.730 23.376  3.729   1.00 39.57 ? 111 ARG A NH2   1 
ATOM   601  N N     . LEU A 1 112 ? 13.053 18.497  -0.340  1.00 21.24 ? 112 LEU A N     1 
ATOM   602  C CA    . LEU A 1 112 ? 12.192 19.213  -1.278  1.00 21.82 ? 112 LEU A CA    1 
ATOM   603  C C     . LEU A 1 112 ? 11.676 20.429  -0.500  1.00 22.24 ? 112 LEU A C     1 
ATOM   604  O O     . LEU A 1 112 ? 10.883 20.285  0.429   1.00 22.39 ? 112 LEU A O     1 
ATOM   605  C CB    . LEU A 1 112 ? 11.014 18.336  -1.724  1.00 20.92 ? 112 LEU A CB    1 
ATOM   606  C CG    . LEU A 1 112 ? 10.022 19.067  -2.643  1.00 21.42 ? 112 LEU A CG    1 
ATOM   607  C CD1   . LEU A 1 112 ? 10.663 19.284  -4.004  1.00 20.84 ? 112 LEU A CD1   1 
ATOM   608  C CD2   . LEU A 1 112 ? 8.728  18.256  -2.779  1.00 21.11 ? 112 LEU A CD2   1 
ATOM   609  N N     . ARG A 1 113 ? 12.147 21.617  -0.857  1.00 22.87 ? 113 ARG A N     1 
ATOM   610  C CA    . ARG A 1 113 ? 11.733 22.833  -0.169  1.00 24.46 ? 113 ARG A CA    1 
ATOM   611  C C     . ARG A 1 113 ? 10.344 23.304  -0.603  1.00 24.46 ? 113 ARG A C     1 
ATOM   612  O O     . ARG A 1 113 ? 9.483  23.584  0.236   1.00 23.86 ? 113 ARG A O     1 
ATOM   613  C CB    . ARG A 1 113 ? 12.745 23.942  -0.424  1.00 26.41 ? 113 ARG A CB    1 
ATOM   614  C CG    . ARG A 1 113 ? 14.048 23.806  0.339   1.00 30.64 ? 113 ARG A CG    1 
ATOM   615  C CD    . ARG A 1 113 ? 14.803 25.121  0.245   1.00 35.39 ? 113 ARG A CD    1 
ATOM   616  N NE    . ARG A 1 113 ? 16.009 25.155  1.068   1.00 40.10 ? 113 ARG A NE    1 
ATOM   617  C CZ    . ARG A 1 113 ? 16.744 26.246  1.260   1.00 41.14 ? 113 ARG A CZ    1 
ATOM   618  N NH1   . ARG A 1 113 ? 16.393 27.390  0.690   1.00 43.00 ? 113 ARG A NH1   1 
ATOM   619  N NH2   . ARG A 1 113 ? 17.837 26.192  2.009   1.00 42.71 ? 113 ARG A NH2   1 
ATOM   620  N N     . TYR A 1 114 ? 10.140 23.392  -1.914  1.00 24.70 ? 114 TYR A N     1 
ATOM   621  C CA    . TYR A 1 114 ? 8.866  23.821  -2.495  1.00 25.11 ? 114 TYR A CA    1 
ATOM   622  C C     . TYR A 1 114 ? 8.712  23.174  -3.853  1.00 25.40 ? 114 TYR A C     1 
ATOM   623  O O     . TYR A 1 114 ? 9.621  22.518  -4.357  1.00 24.21 ? 114 TYR A O     1 
ATOM   624  C CB    . TYR A 1 114 ? 8.837  25.333  -2.771  1.00 26.14 ? 114 TYR A CB    1 
ATOM   625  C CG    . TYR A 1 114 ? 9.195  26.235  -1.626  1.00 29.01 ? 114 TYR A CG    1 
ATOM   626  C CD1   . TYR A 1 114 ? 8.239  26.605  -0.683  1.00 30.13 ? 114 TYR A CD1   1 
ATOM   627  C CD2   . TYR A 1 114 ? 10.493 26.731  -1.486  1.00 30.06 ? 114 TYR A CD2   1 
ATOM   628  C CE1   . TYR A 1 114 ? 8.565  27.446  0.377   1.00 31.89 ? 114 TYR A CE1   1 
ATOM   629  C CE2   . TYR A 1 114 ? 10.831 27.570  -0.434  1.00 31.34 ? 114 TYR A CE2   1 
ATOM   630  C CZ    . TYR A 1 114 ? 9.864  27.922  0.495   1.00 32.58 ? 114 TYR A CZ    1 
ATOM   631  O OH    . TYR A 1 114 ? 10.195 28.738  1.553   1.00 35.02 ? 114 TYR A OH    1 
ATOM   632  N N     . PHE A 1 115 ? 7.542  23.379  -4.445  1.00 24.51 ? 115 PHE A N     1 
ATOM   633  C CA    . PHE A 1 115 ? 7.292  22.931  -5.795  1.00 24.60 ? 115 PHE A CA    1 
ATOM   634  C C     . PHE A 1 115 ? 6.267  23.902  -6.353  1.00 24.74 ? 115 PHE A C     1 
ATOM   635  O O     . PHE A 1 115 ? 5.468  24.470  -5.607  1.00 24.21 ? 115 PHE A O     1 
ATOM   636  C CB    . PHE A 1 115 ? 6.809  21.475  -5.856  1.00 24.60 ? 115 PHE A CB    1 
ATOM   637  C CG    . PHE A 1 115 ? 5.447  21.237  -5.272  1.00 25.91 ? 115 PHE A CG    1 
ATOM   638  C CD1   . PHE A 1 115 ? 5.308  20.825  -3.949  1.00 25.87 ? 115 PHE A CD1   1 
ATOM   639  C CD2   . PHE A 1 115 ? 4.302  21.350  -6.065  1.00 26.60 ? 115 PHE A CD2   1 
ATOM   640  C CE1   . PHE A 1 115 ? 4.043  20.517  -3.417  1.00 26.55 ? 115 PHE A CE1   1 
ATOM   641  C CE2   . PHE A 1 115 ? 3.035  21.048  -5.542  1.00 26.34 ? 115 PHE A CE2   1 
ATOM   642  C CZ    . PHE A 1 115 ? 2.909  20.630  -4.218  1.00 25.78 ? 115 PHE A CZ    1 
ATOM   643  N N     . PHE A 1 116 ? 6.336  24.141  -7.652  1.00 24.85 ? 116 PHE A N     1 
ATOM   644  C CA    . PHE A 1 116 ? 5.406  25.042  -8.303  1.00 25.99 ? 116 PHE A CA    1 
ATOM   645  C C     . PHE A 1 116 ? 5.320  24.675  -9.774  1.00 27.44 ? 116 PHE A C     1 
ATOM   646  O O     . PHE A 1 116 ? 6.123  23.875  -10.271 1.00 27.14 ? 116 PHE A O     1 
ATOM   647  C CB    . PHE A 1 116 ? 5.846  26.501  -8.122  1.00 25.22 ? 116 PHE A CB    1 
ATOM   648  C CG    . PHE A 1 116 ? 7.147  26.844  -8.793  1.00 25.73 ? 116 PHE A CG    1 
ATOM   649  C CD1   . PHE A 1 116 ? 8.352  26.761  -8.092  1.00 25.69 ? 116 PHE A CD1   1 
ATOM   650  C CD2   . PHE A 1 116 ? 7.169  27.276  -10.117 1.00 25.25 ? 116 PHE A CD2   1 
ATOM   651  C CE1   . PHE A 1 116 ? 9.562  27.105  -8.701  1.00 24.81 ? 116 PHE A CE1   1 
ATOM   652  C CE2   . PHE A 1 116 ? 8.374  27.625  -10.737 1.00 26.05 ? 116 PHE A CE2   1 
ATOM   653  C CZ    . PHE A 1 116 ? 9.573  27.538  -10.026 1.00 25.01 ? 116 PHE A CZ    1 
ATOM   654  N N     . TYR A 1 117 ? 4.331  25.239  -10.460 1.00 28.42 ? 117 TYR A N     1 
ATOM   655  C CA    . TYR A 1 117 ? 4.136  24.967  -11.876 1.00 30.06 ? 117 TYR A CA    1 
ATOM   656  C C     . TYR A 1 117 ? 4.384  26.214  -12.701 1.00 32.32 ? 117 TYR A C     1 
ATOM   657  O O     . TYR A 1 117 ? 4.090  27.320  -12.263 1.00 32.65 ? 117 TYR A O     1 
ATOM   658  C CB    . TYR A 1 117 ? 2.717  24.458  -12.116 1.00 28.26 ? 117 TYR A CB    1 
ATOM   659  C CG    . TYR A 1 117 ? 2.416  23.196  -11.360 1.00 26.68 ? 117 TYR A CG    1 
ATOM   660  C CD1   . TYR A 1 117 ? 2.648  21.953  -11.937 1.00 25.86 ? 117 TYR A CD1   1 
ATOM   661  C CD2   . TYR A 1 117 ? 1.951  23.243  -10.045 1.00 25.77 ? 117 TYR A CD2   1 
ATOM   662  C CE1   . TYR A 1 117 ? 2.434  20.786  -11.224 1.00 26.16 ? 117 TYR A CE1   1 
ATOM   663  C CE2   . TYR A 1 117 ? 1.733  22.081  -9.321  1.00 26.30 ? 117 TYR A CE2   1 
ATOM   664  C CZ    . TYR A 1 117 ? 1.979  20.856  -9.916  1.00 26.12 ? 117 TYR A CZ    1 
ATOM   665  O OH    . TYR A 1 117 ? 1.780  19.695  -9.212  1.00 27.47 ? 117 TYR A OH    1 
ATOM   666  N N     . SER A 1 118 ? 4.949  26.029  -13.886 1.00 35.51 ? 118 SER A N     1 
ATOM   667  C CA    . SER A 1 118 ? 5.229  27.132  -14.795 1.00 39.40 ? 118 SER A CA    1 
ATOM   668  C C     . SER A 1 118 ? 4.873  26.640  -16.189 1.00 42.93 ? 118 SER A C     1 
ATOM   669  O O     . SER A 1 118 ? 4.934  25.441  -16.465 1.00 43.17 ? 118 SER A O     1 
ATOM   670  C CB    . SER A 1 118 ? 6.706  27.537  -14.728 1.00 38.98 ? 118 SER A CB    1 
ATOM   671  O OG    . SER A 1 118 ? 7.567  26.434  -14.938 1.00 38.76 ? 118 SER A OG    1 
ATOM   672  N N     . SER A 1 119 ? 4.487  27.555  -17.067 1.00 47.35 ? 119 SER A N     1 
ATOM   673  C CA    . SER A 1 119 ? 4.097  27.163  -18.414 1.00 51.99 ? 119 SER A CA    1 
ATOM   674  C C     . SER A 1 119 ? 5.237  27.246  -19.414 1.00 54.89 ? 119 SER A C     1 
ATOM   675  O O     . SER A 1 119 ? 6.060  28.163  -19.363 1.00 55.28 ? 119 SER A O     1 
ATOM   676  C CB    . SER A 1 119 ? 2.922  28.021  -18.897 1.00 52.50 ? 119 SER A CB    1 
ATOM   677  O OG    . SER A 1 119 ? 1.739  27.713  -18.175 1.00 53.25 ? 119 SER A OG    1 
ATOM   678  N N     . GLY A 1 120 ? 5.278  26.269  -20.316 1.00 58.17 ? 120 GLY A N     1 
ATOM   679  C CA    . GLY A 1 120 ? 6.303  26.241  -21.342 1.00 62.10 ? 120 GLY A CA    1 
ATOM   680  C C     . GLY A 1 120 ? 5.719  26.892  -22.576 1.00 64.93 ? 120 GLY A C     1 
ATOM   681  O O     . GLY A 1 120 ? 4.925  26.276  -23.289 1.00 65.55 ? 120 GLY A O     1 
ATOM   682  N N     . GLU A 1 121 ? 6.104  28.142  -22.819 1.00 67.32 ? 121 GLU A N     1 
ATOM   683  C CA    . GLU A 1 121 ? 5.607  28.909  -23.960 1.00 69.77 ? 121 GLU A CA    1 
ATOM   684  C C     . GLU A 1 121 ? 5.568  28.132  -25.271 1.00 70.77 ? 121 GLU A C     1 
ATOM   685  O O     . GLU A 1 121 ? 4.772  28.447  -26.159 1.00 71.08 ? 121 GLU A O     1 
ATOM   686  C CB    . GLU A 1 121 ? 6.443  30.181  -24.140 1.00 70.70 ? 121 GLU A CB    1 
ATOM   687  C CG    . GLU A 1 121 ? 6.038  31.324  -23.212 1.00 72.36 ? 121 GLU A CG    1 
ATOM   688  C CD    . GLU A 1 121 ? 5.294  30.843  -21.972 1.00 73.13 ? 121 GLU A CD    1 
ATOM   689  O OE1   . GLU A 1 121 ? 4.049  30.969  -21.933 1.00 73.53 ? 121 GLU A OE1   1 
ATOM   690  O OE2   . GLU A 1 121 ? 5.957  30.341  -21.036 1.00 73.62 ? 121 GLU A OE2   1 
ATOM   691  N N     . LYS A 1 122 ? 6.422  27.118  -25.392 1.00 71.68 ? 122 LYS A N     1 
ATOM   692  C CA    . LYS A 1 122 ? 6.467  26.308  -26.605 1.00 72.57 ? 122 LYS A CA    1 
ATOM   693  C C     . LYS A 1 122 ? 5.082  25.768  -26.963 1.00 72.52 ? 122 LYS A C     1 
ATOM   694  O O     . LYS A 1 122 ? 4.840  25.358  -28.100 1.00 72.93 ? 122 LYS A O     1 
ATOM   695  C CB    . LYS A 1 122 ? 7.449  25.144  -26.431 1.00 73.28 ? 122 LYS A CB    1 
ATOM   696  C CG    . LYS A 1 122 ? 7.843  24.468  -27.737 1.00 74.02 ? 122 LYS A CG    1 
ATOM   697  C CD    . LYS A 1 122 ? 8.395  23.073  -27.494 1.00 74.56 ? 122 LYS A CD    1 
ATOM   698  C CE    . LYS A 1 122 ? 8.644  22.346  -28.806 1.00 75.00 ? 122 LYS A CE    1 
ATOM   699  N NZ    . LYS A 1 122 ? 9.266  21.007  -28.593 1.00 75.26 ? 122 LYS A NZ    1 
ATOM   700  N N     . LYS A 1 123 ? 4.177  25.777  -25.988 1.00 71.92 ? 123 LYS A N     1 
ATOM   701  C CA    . LYS A 1 123 ? 2.815  25.296  -26.192 1.00 71.21 ? 123 LYS A CA    1 
ATOM   702  C C     . LYS A 1 123 ? 2.016  25.487  -24.912 1.00 70.26 ? 123 LYS A C     1 
ATOM   703  O O     . LYS A 1 123 ? 2.309  26.377  -24.114 1.00 70.59 ? 123 LYS A O     1 
ATOM   704  C CB    . LYS A 1 123 ? 2.833  23.813  -26.569 1.00 71.90 ? 123 LYS A CB    1 
ATOM   705  C CG    . LYS A 1 123 ? 1.643  23.371  -27.401 1.00 73.11 ? 123 LYS A CG    1 
ATOM   706  C CD    . LYS A 1 123 ? 1.635  21.864  -27.599 1.00 74.20 ? 123 LYS A CD    1 
ATOM   707  C CE    . LYS A 1 123 ? 0.244  21.365  -27.973 1.00 74.79 ? 123 LYS A CE    1 
ATOM   708  N NZ    . LYS A 1 123 ? 0.286  20.038  -28.658 1.00 75.44 ? 123 LYS A NZ    1 
ATOM   709  N N     . ASP A 1 124 ? 0.996  24.658  -24.727 1.00 68.77 ? 124 ASP A N     1 
ATOM   710  C CA    . ASP A 1 124 ? 0.178  24.712  -23.524 1.00 67.11 ? 124 ASP A CA    1 
ATOM   711  C C     . ASP A 1 124 ? 0.780  23.671  -22.587 1.00 65.13 ? 124 ASP A C     1 
ATOM   712  O O     . ASP A 1 124 ? 0.080  23.036  -21.793 1.00 65.22 ? 124 ASP A O     1 
ATOM   713  C CB    . ASP A 1 124 ? -1.275 24.360  -23.845 1.00 68.50 ? 124 ASP A CB    1 
ATOM   714  C CG    . ASP A 1 124 ? -1.425 23.699  -25.199 1.00 69.77 ? 124 ASP A CG    1 
ATOM   715  O OD1   . ASP A 1 124 ? -1.222 24.389  -26.224 1.00 70.55 ? 124 ASP A OD1   1 
ATOM   716  O OD2   . ASP A 1 124 ? -1.745 22.489  -25.239 1.00 70.78 ? 124 ASP A OD2   1 
ATOM   717  N N     . GLU A 1 125 ? 2.094  23.501  -22.710 1.00 62.21 ? 125 GLU A N     1 
ATOM   718  C CA    . GLU A 1 125 ? 2.851  22.553  -21.906 1.00 58.88 ? 125 GLU A CA    1 
ATOM   719  C C     . GLU A 1 125 ? 3.076  23.113  -20.506 1.00 55.55 ? 125 GLU A C     1 
ATOM   720  O O     . GLU A 1 125 ? 3.433  24.282  -20.345 1.00 54.77 ? 125 GLU A O     1 
ATOM   721  C CB    . GLU A 1 125 ? 4.204  22.266  -22.571 1.00 60.34 ? 125 GLU A CB    1 
ATOM   722  C CG    . GLU A 1 125 ? 4.567  23.244  -23.692 1.00 62.12 ? 125 GLU A CG    1 
ATOM   723  C CD    . GLU A 1 125 ? 6.028  23.152  -24.121 1.00 63.22 ? 125 GLU A CD    1 
ATOM   724  O OE1   . GLU A 1 125 ? 6.417  22.115  -24.703 1.00 63.90 ? 125 GLU A OE1   1 
ATOM   725  O OE2   . GLU A 1 125 ? 6.785  24.118  -23.881 1.00 63.76 ? 125 GLU A OE2   1 
ATOM   726  N N     . VAL A 1 126 ? 2.858  22.268  -19.500 1.00 51.70 ? 126 VAL A N     1 
ATOM   727  C CA    . VAL A 1 126 ? 3.041  22.662  -18.109 1.00 47.65 ? 126 VAL A CA    1 
ATOM   728  C C     . VAL A 1 126 ? 4.221  21.929  -17.481 1.00 44.86 ? 126 VAL A C     1 
ATOM   729  O O     . VAL A 1 126 ? 4.384  20.721  -17.655 1.00 43.95 ? 126 VAL A O     1 
ATOM   730  C CB    . VAL A 1 126 ? 1.786  22.366  -17.275 1.00 47.49 ? 126 VAL A CB    1 
ATOM   731  C CG1   . VAL A 1 126 ? 2.024  22.748  -15.820 1.00 46.91 ? 126 VAL A CG1   1 
ATOM   732  C CG2   . VAL A 1 126 ? 0.610  23.137  -17.836 1.00 47.79 ? 126 VAL A CG2   1 
ATOM   733  N N     . TYR A 1 127 ? 5.035  22.675  -16.745 1.00 41.67 ? 127 TYR A N     1 
ATOM   734  C CA    . TYR A 1 127 ? 6.200  22.110  -16.089 1.00 38.42 ? 127 TYR A CA    1 
ATOM   735  C C     . TYR A 1 127 ? 6.065  22.096  -14.579 1.00 35.42 ? 127 TYR A C     1 
ATOM   736  O O     . TYR A 1 127 ? 5.557  23.041  -13.983 1.00 34.33 ? 127 TYR A O     1 
ATOM   737  C CB    . TYR A 1 127 ? 7.445  22.911  -16.456 1.00 39.92 ? 127 TYR A CB    1 
ATOM   738  C CG    . TYR A 1 127 ? 7.866  22.729  -17.884 1.00 41.87 ? 127 TYR A CG    1 
ATOM   739  C CD1   . TYR A 1 127 ? 7.436  23.611  -18.876 1.00 42.86 ? 127 TYR A CD1   1 
ATOM   740  C CD2   . TYR A 1 127 ? 8.672  21.655  -18.255 1.00 42.87 ? 127 TYR A CD2   1 
ATOM   741  C CE1   . TYR A 1 127 ? 7.798  23.424  -20.210 1.00 43.96 ? 127 TYR A CE1   1 
ATOM   742  C CE2   . TYR A 1 127 ? 9.040  21.458  -19.582 1.00 43.97 ? 127 TYR A CE2   1 
ATOM   743  C CZ    . TYR A 1 127 ? 8.601  22.343  -20.552 1.00 44.50 ? 127 TYR A CZ    1 
ATOM   744  O OH    . TYR A 1 127 ? 8.963  22.133  -21.862 1.00 45.92 ? 127 TYR A OH    1 
ATOM   745  N N     . LEU A 1 128 ? 6.521  21.006  -13.974 1.00 32.37 ? 128 LEU A N     1 
ATOM   746  C CA    . LEU A 1 128 ? 6.526  20.866  -12.529 1.00 29.70 ? 128 LEU A CA    1 
ATOM   747  C C     . LEU A 1 128 ? 7.943  21.283  -12.147 1.00 28.59 ? 128 LEU A C     1 
ATOM   748  O O     . LEU A 1 128 ? 8.913  20.817  -12.755 1.00 28.16 ? 128 LEU A O     1 
ATOM   749  C CB    . LEU A 1 128 ? 6.282  19.413  -12.120 1.00 28.45 ? 128 LEU A CB    1 
ATOM   750  C CG    . LEU A 1 128 ? 6.661  19.061  -10.674 1.00 28.49 ? 128 LEU A CG    1 
ATOM   751  C CD1   . LEU A 1 128 ? 5.820  19.880  -9.695  1.00 26.67 ? 128 LEU A CD1   1 
ATOM   752  C CD2   . LEU A 1 128 ? 6.460  17.566  -10.442 1.00 27.32 ? 128 LEU A CD2   1 
ATOM   753  N N     . ASN A 1 129 ? 8.062  22.170  -11.166 1.00 26.78 ? 129 ASN A N     1 
ATOM   754  C CA    . ASN A 1 129 ? 9.361  22.662  -10.714 1.00 25.23 ? 129 ASN A CA    1 
ATOM   755  C C     . ASN A 1 129 ? 9.618  22.248  -9.278  1.00 24.38 ? 129 ASN A C     1 
ATOM   756  O O     . ASN A 1 129 ? 8.913  22.686  -8.365  1.00 23.41 ? 129 ASN A O     1 
ATOM   757  C CB    . ASN A 1 129 ? 9.414  24.188  -10.801 1.00 25.58 ? 129 ASN A CB    1 
ATOM   758  C CG    . ASN A 1 129 ? 9.340  24.698  -12.226 1.00 26.46 ? 129 ASN A CG    1 
ATOM   759  O OD1   . ASN A 1 129 ? 10.355 25.064  -12.811 1.00 26.68 ? 129 ASN A OD1   1 
ATOM   760  N ND2   . ASN A 1 129 ? 8.133  24.730  -12.792 1.00 26.29 ? 129 ASN A ND2   1 
ATOM   761  N N     . LEU A 1 130 ? 10.626 21.403  -9.076  1.00 23.30 ? 130 LEU A N     1 
ATOM   762  C CA    . LEU A 1 130 ? 10.985 20.939  -7.738  1.00 23.29 ? 130 LEU A CA    1 
ATOM   763  C C     . LEU A 1 130 ? 12.116 21.798  -7.181  1.00 22.94 ? 130 LEU A C     1 
ATOM   764  O O     . LEU A 1 130 ? 13.222 21.808  -7.733  1.00 23.43 ? 130 LEU A O     1 
ATOM   765  C CB    . LEU A 1 130 ? 11.431 19.475  -7.783  1.00 22.29 ? 130 LEU A CB    1 
ATOM   766  C CG    . LEU A 1 130 ? 10.473 18.486  -8.451  1.00 23.97 ? 130 LEU A CG    1 
ATOM   767  C CD1   . LEU A 1 130 ? 11.093 17.097  -8.448  1.00 23.75 ? 130 LEU A CD1   1 
ATOM   768  C CD2   . LEU A 1 130 ? 9.141  18.486  -7.704  1.00 24.33 ? 130 LEU A CD2   1 
ATOM   769  N N     . VAL A 1 131 ? 11.840 22.528  -6.102  1.00 22.63 ? 131 VAL A N     1 
ATOM   770  C CA    . VAL A 1 131 ? 12.854 23.380  -5.487  1.00 22.33 ? 131 VAL A CA    1 
ATOM   771  C C     . VAL A 1 131 ? 13.508 22.597  -4.357  1.00 22.06 ? 131 VAL A C     1 
ATOM   772  O O     . VAL A 1 131 ? 12.891 22.332  -3.322  1.00 21.64 ? 131 VAL A O     1 
ATOM   773  C CB    . VAL A 1 131 ? 12.254 24.686  -4.931  1.00 22.68 ? 131 VAL A CB    1 
ATOM   774  C CG1   . VAL A 1 131 ? 13.357 25.548  -4.337  1.00 22.89 ? 131 VAL A CG1   1 
ATOM   775  C CG2   . VAL A 1 131 ? 11.552 25.453  -6.049  1.00 23.17 ? 131 VAL A CG2   1 
ATOM   776  N N     . LEU A 1 132 ? 14.769 22.232  -4.569  1.00 22.12 ? 132 LEU A N     1 
ATOM   777  C CA    . LEU A 1 132 ? 15.513 21.441  -3.604  1.00 21.23 ? 132 LEU A CA    1 
ATOM   778  C C     . LEU A 1 132 ? 16.692 22.176  -3.005  1.00 21.66 ? 132 LEU A C     1 
ATOM   779  O O     . LEU A 1 132 ? 17.122 23.209  -3.511  1.00 21.74 ? 132 LEU A O     1 
ATOM   780  C CB    . LEU A 1 132 ? 16.032 20.163  -4.272  1.00 21.38 ? 132 LEU A CB    1 
ATOM   781  C CG    . LEU A 1 132 ? 15.144 19.473  -5.304  1.00 20.94 ? 132 LEU A CG    1 
ATOM   782  C CD1   . LEU A 1 132 ? 15.991 18.672  -6.277  1.00 21.93 ? 132 LEU A CD1   1 
ATOM   783  C CD2   . LEU A 1 132 ? 14.181 18.559  -4.583  1.00 21.73 ? 132 LEU A CD2   1 
ATOM   784  N N     . ASP A 1 133 ? 17.211 21.631  -1.912  1.00 22.28 ? 133 ASP A N     1 
ATOM   785  C CA    . ASP A 1 133 ? 18.395 22.202  -1.280  1.00 23.15 ? 133 ASP A CA    1 
ATOM   786  C C     . ASP A 1 133 ? 19.505 22.015  -2.307  1.00 22.82 ? 133 ASP A C     1 
ATOM   787  O O     . ASP A 1 133 ? 19.567 20.976  -2.977  1.00 21.97 ? 133 ASP A O     1 
ATOM   788  C CB    . ASP A 1 133 ? 18.764 21.417  -0.027  1.00 24.36 ? 133 ASP A CB    1 
ATOM   789  C CG    . ASP A 1 133 ? 18.020 21.883  1.186   1.00 25.74 ? 133 ASP A CG    1 
ATOM   790  O OD1   . ASP A 1 133 ? 18.005 21.138  2.176   1.00 28.30 ? 133 ASP A OD1   1 
ATOM   791  O OD2   . ASP A 1 133 ? 17.451 22.991  1.158   1.00 27.40 ? 133 ASP A OD2   1 
ATOM   792  N N     . TYR A 1 134 ? 20.369 23.012  -2.444  1.00 22.80 ? 134 TYR A N     1 
ATOM   793  C CA    . TYR A 1 134 ? 21.470 22.895  -3.383  1.00 22.89 ? 134 TYR A CA    1 
ATOM   794  C C     . TYR A 1 134 ? 22.657 22.233  -2.675  1.00 22.28 ? 134 TYR A C     1 
ATOM   795  O O     . TYR A 1 134 ? 23.008 22.599  -1.548  1.00 21.22 ? 134 TYR A O     1 
ATOM   796  C CB    . TYR A 1 134 ? 21.865 24.274  -3.914  1.00 24.91 ? 134 TYR A CB    1 
ATOM   797  C CG    . TYR A 1 134 ? 23.153 24.276  -4.698  1.00 25.56 ? 134 TYR A CG    1 
ATOM   798  C CD1   . TYR A 1 134 ? 24.348 24.662  -4.095  1.00 26.87 ? 134 TYR A CD1   1 
ATOM   799  C CD2   . TYR A 1 134 ? 23.183 23.874  -6.030  1.00 26.17 ? 134 TYR A CD2   1 
ATOM   800  C CE1   . TYR A 1 134 ? 25.548 24.646  -4.798  1.00 27.31 ? 134 TYR A CE1   1 
ATOM   801  C CE2   . TYR A 1 134 ? 24.379 23.853  -6.746  1.00 27.47 ? 134 TYR A CE2   1 
ATOM   802  C CZ    . TYR A 1 134 ? 25.558 24.243  -6.113  1.00 27.42 ? 134 TYR A CZ    1 
ATOM   803  O OH    . TYR A 1 134 ? 26.752 24.229  -6.791  1.00 28.82 ? 134 TYR A OH    1 
ATOM   804  N N     . VAL A 1 135 ? 23.238 21.230  -3.329  1.00 21.42 ? 135 VAL A N     1 
ATOM   805  C CA    . VAL A 1 135 ? 24.395 20.511  -2.796  1.00 20.96 ? 135 VAL A CA    1 
ATOM   806  C C     . VAL A 1 135 ? 25.462 20.658  -3.884  1.00 21.11 ? 135 VAL A C     1 
ATOM   807  O O     . VAL A 1 135 ? 25.237 20.298  -5.034  1.00 20.82 ? 135 VAL A O     1 
ATOM   808  C CB    . VAL A 1 135 ? 24.055 19.044  -2.529  1.00 19.97 ? 135 VAL A CB    1 
ATOM   809  C CG1   . VAL A 1 135 ? 25.167 18.393  -1.721  1.00 19.94 ? 135 VAL A CG1   1 
ATOM   810  C CG2   . VAL A 1 135 ? 22.742 18.968  -1.746  1.00 19.59 ? 135 VAL A CG2   1 
ATOM   811  N N     . PRO A 1 136 ? 26.651 21.161  -3.515  1.00 21.90 ? 136 PRO A N     1 
ATOM   812  C CA    . PRO A 1 136 ? 27.762 21.397  -4.447  1.00 21.92 ? 136 PRO A CA    1 
ATOM   813  C C     . PRO A 1 136 ? 28.454 20.299  -5.248  1.00 22.49 ? 136 PRO A C     1 
ATOM   814  O O     . PRO A 1 136 ? 28.887 20.560  -6.372  1.00 22.96 ? 136 PRO A O     1 
ATOM   815  C CB    . PRO A 1 136 ? 28.759 22.190  -3.606  1.00 21.68 ? 136 PRO A CB    1 
ATOM   816  C CG    . PRO A 1 136 ? 28.518 21.720  -2.223  1.00 21.71 ? 136 PRO A CG    1 
ATOM   817  C CD    . PRO A 1 136 ? 27.027 21.492  -2.128  1.00 21.11 ? 136 PRO A CD    1 
ATOM   818  N N     . GLU A 1 137 ? 28.565 19.090  -4.709  1.00 21.94 ? 137 GLU A N     1 
ATOM   819  C CA    . GLU A 1 137 ? 29.265 18.023  -5.425  1.00 22.34 ? 137 GLU A CA    1 
ATOM   820  C C     . GLU A 1 137 ? 28.487 16.715  -5.515  1.00 21.88 ? 137 GLU A C     1 
ATOM   821  O O     . GLU A 1 137 ? 27.365 16.618  -5.047  1.00 21.12 ? 137 GLU A O     1 
ATOM   822  C CB    . GLU A 1 137 ? 30.602 17.748  -4.729  1.00 24.10 ? 137 GLU A CB    1 
ATOM   823  C CG    . GLU A 1 137 ? 31.637 18.826  -4.937  1.00 27.56 ? 137 GLU A CG    1 
ATOM   824  C CD    . GLU A 1 137 ? 32.217 18.782  -6.338  1.00 30.63 ? 137 GLU A CD    1 
ATOM   825  O OE1   . GLU A 1 137 ? 32.890 19.759  -6.739  1.00 32.82 ? 137 GLU A OE1   1 
ATOM   826  O OE2   . GLU A 1 137 ? 31.994 17.767  -7.039  1.00 32.01 ? 137 GLU A OE2   1 
ATOM   827  N N     . THR A 1 138 ? 29.110 15.716  -6.133  1.00 21.29 ? 138 THR A N     1 
ATOM   828  C CA    . THR A 1 138 ? 28.529 14.384  -6.258  1.00 21.06 ? 138 THR A CA    1 
ATOM   829  C C     . THR A 1 138 ? 29.664 13.400  -6.035  1.00 20.80 ? 138 THR A C     1 
ATOM   830  O O     . THR A 1 138 ? 30.840 13.742  -6.217  1.00 20.20 ? 138 THR A O     1 
ATOM   831  C CB    . THR A 1 138 ? 27.943 14.114  -7.657  1.00 20.77 ? 138 THR A CB    1 
ATOM   832  O OG1   . THR A 1 138 ? 29.001 14.122  -8.623  1.00 21.51 ? 138 THR A OG1   1 
ATOM   833  C CG2   . THR A 1 138 ? 26.906 15.156  -8.020  1.00 20.96 ? 138 THR A CG2   1 
ATOM   834  N N     . VAL A 1 139 ? 29.320 12.185  -5.633  1.00 20.06 ? 139 VAL A N     1 
ATOM   835  C CA    . VAL A 1 139 ? 30.330 11.154  -5.402  1.00 20.98 ? 139 VAL A CA    1 
ATOM   836  C C     . VAL A 1 139 ? 31.026 10.877  -6.734  1.00 21.61 ? 139 VAL A C     1 
ATOM   837  O O     . VAL A 1 139 ? 32.207 10.524  -6.777  1.00 21.73 ? 139 VAL A O     1 
ATOM   838  C CB    . VAL A 1 139 ? 29.675 9.852   -4.873  1.00 20.81 ? 139 VAL A CB    1 
ATOM   839  C CG1   . VAL A 1 139 ? 30.620 8.675   -5.038  1.00 20.94 ? 139 VAL A CG1   1 
ATOM   840  C CG2   . VAL A 1 139 ? 29.291 10.031  -3.414  1.00 20.07 ? 139 VAL A CG2   1 
ATOM   841  N N     . TYR A 1 140 ? 30.284 11.046  -7.820  1.00 21.82 ? 140 TYR A N     1 
ATOM   842  C CA    . TYR A 1 140 ? 30.834 10.821  -9.148  1.00 23.36 ? 140 TYR A CA    1 
ATOM   843  C C     . TYR A 1 140 ? 32.026 11.748  -9.420  1.00 23.94 ? 140 TYR A C     1 
ATOM   844  O O     . TYR A 1 140 ? 33.112 11.291  -9.784  1.00 23.20 ? 140 TYR A O     1 
ATOM   845  C CB    . TYR A 1 140 ? 29.753 11.056  -10.201 1.00 24.63 ? 140 TYR A CB    1 
ATOM   846  C CG    . TYR A 1 140 ? 30.271 10.962  -11.612 1.00 27.88 ? 140 TYR A CG    1 
ATOM   847  C CD1   . TYR A 1 140 ? 30.634 12.109  -12.315 1.00 28.82 ? 140 TYR A CD1   1 
ATOM   848  C CD2   . TYR A 1 140 ? 30.416 9.726   -12.239 1.00 28.50 ? 140 TYR A CD2   1 
ATOM   849  C CE1   . TYR A 1 140 ? 31.130 12.032  -13.612 1.00 31.07 ? 140 TYR A CE1   1 
ATOM   850  C CE2   . TYR A 1 140 ? 30.910 9.636   -13.540 1.00 31.03 ? 140 TYR A CE2   1 
ATOM   851  C CZ    . TYR A 1 140 ? 31.264 10.796  -14.217 1.00 31.62 ? 140 TYR A CZ    1 
ATOM   852  O OH    . TYR A 1 140 ? 31.736 10.726  -15.510 1.00 34.75 ? 140 TYR A OH    1 
ATOM   853  N N     . ARG A 1 141 ? 31.818 13.049  -9.243  1.00 23.69 ? 141 ARG A N     1 
ATOM   854  C CA    . ARG A 1 141 ? 32.872 14.028  -9.497  1.00 25.22 ? 141 ARG A CA    1 
ATOM   855  C C     . ARG A 1 141 ? 34.063 13.855  -8.564  1.00 24.60 ? 141 ARG A C     1 
ATOM   856  O O     . ARG A 1 141 ? 35.212 13.881  -9.001  1.00 24.36 ? 141 ARG A O     1 
ATOM   857  C CB    . ARG A 1 141 ? 32.326 15.444  -9.356  1.00 27.20 ? 141 ARG A CB    1 
ATOM   858  C CG    . ARG A 1 141 ? 31.417 15.878  -10.482 1.00 31.12 ? 141 ARG A CG    1 
ATOM   859  C CD    . ARG A 1 141 ? 30.689 17.158  -10.090 1.00 35.40 ? 141 ARG A CD    1 
ATOM   860  N NE    . ARG A 1 141 ? 29.407 17.287  -10.779 1.00 39.94 ? 141 ARG A NE    1 
ATOM   861  C CZ    . ARG A 1 141 ? 28.433 18.114  -10.403 1.00 41.91 ? 141 ARG A CZ    1 
ATOM   862  N NH1   . ARG A 1 141 ? 28.594 18.890  -9.334  1.00 42.69 ? 141 ARG A NH1   1 
ATOM   863  N NH2   . ARG A 1 141 ? 27.304 18.182  -11.106 1.00 43.21 ? 141 ARG A NH2   1 
ATOM   864  N N     . VAL A 1 142 ? 33.795 13.677  -7.278  1.00 24.15 ? 142 VAL A N     1 
ATOM   865  C CA    . VAL A 1 142 ? 34.873 13.502  -6.314  1.00 24.53 ? 142 VAL A CA    1 
ATOM   866  C C     . VAL A 1 142 ? 35.700 12.257  -6.638  1.00 25.52 ? 142 VAL A C     1 
ATOM   867  O O     . VAL A 1 142 ? 36.928 12.306  -6.613  1.00 25.40 ? 142 VAL A O     1 
ATOM   868  C CB    . VAL A 1 142 ? 34.322 13.407  -4.871  1.00 24.07 ? 142 VAL A CB    1 
ATOM   869  C CG1   . VAL A 1 142 ? 35.397 12.892  -3.927  1.00 23.32 ? 142 VAL A CG1   1 
ATOM   870  C CG2   . VAL A 1 142 ? 33.839 14.791  -4.418  1.00 23.41 ? 142 VAL A CG2   1 
ATOM   871  N N     . ALA A 1 143 ? 35.032 11.148  -6.947  1.00 25.74 ? 143 ALA A N     1 
ATOM   872  C CA    . ALA A 1 143 ? 35.738 9.909   -7.285  1.00 26.55 ? 143 ALA A CA    1 
ATOM   873  C C     . ALA A 1 143 ? 36.557 10.084  -8.568  1.00 27.56 ? 143 ALA A C     1 
ATOM   874  O O     . ALA A 1 143 ? 37.637 9.502   -8.715  1.00 27.86 ? 143 ALA A O     1 
ATOM   875  C CB    . ALA A 1 143 ? 34.740 8.753   -7.455  1.00 25.28 ? 143 ALA A CB    1 
ATOM   876  N N     . ARG A 1 144 ? 36.039 10.883  -9.496  1.00 28.39 ? 144 ARG A N     1 
ATOM   877  C CA    . ARG A 1 144 ? 36.728 11.123  -10.757 1.00 30.27 ? 144 ARG A CA    1 
ATOM   878  C C     . ARG A 1 144 ? 38.019 11.902  -10.528 1.00 31.03 ? 144 ARG A C     1 
ATOM   879  O O     . ARG A 1 144 ? 39.014 11.695  -11.226 1.00 30.59 ? 144 ARG A O     1 
ATOM   880  C CB    . ARG A 1 144 ? 35.822 11.892  -11.714 1.00 31.15 ? 144 ARG A CB    1 
ATOM   881  C CG    . ARG A 1 144 ? 36.287 11.851  -13.156 1.00 34.23 ? 144 ARG A CG    1 
ATOM   882  C CD    . ARG A 1 144 ? 35.296 12.541  -14.092 1.00 37.20 ? 144 ARG A CD    1 
ATOM   883  N NE    . ARG A 1 144 ? 34.832 13.822  -13.558 1.00 39.57 ? 144 ARG A NE    1 
ATOM   884  C CZ    . ARG A 1 144 ? 33.984 14.631  -14.188 1.00 41.01 ? 144 ARG A CZ    1 
ATOM   885  N NH1   . ARG A 1 144 ? 33.502 14.295  -15.381 1.00 41.87 ? 144 ARG A NH1   1 
ATOM   886  N NH2   . ARG A 1 144 ? 33.611 15.774  -13.624 1.00 41.63 ? 144 ARG A NH2   1 
ATOM   887  N N     . HIS A 1 145 ? 38.002 12.800  -9.549  1.00 32.00 ? 145 HIS A N     1 
ATOM   888  C CA    . HIS A 1 145 ? 39.185 13.588  -9.236  1.00 32.93 ? 145 HIS A CA    1 
ATOM   889  C C     . HIS A 1 145 ? 40.309 12.658  -8.783  1.00 32.84 ? 145 HIS A C     1 
ATOM   890  O O     . HIS A 1 145 ? 41.435 12.741  -9.281  1.00 32.94 ? 145 HIS A O     1 
ATOM   891  C CB    . HIS A 1 145 ? 38.885 14.612  -8.132  1.00 34.62 ? 145 HIS A CB    1 
ATOM   892  C CG    . HIS A 1 145 ? 40.107 15.081  -7.398  1.00 37.08 ? 145 HIS A CG    1 
ATOM   893  N ND1   . HIS A 1 145 ? 40.814 16.206  -7.768  1.00 37.93 ? 145 HIS A ND1   1 
ATOM   894  C CD2   . HIS A 1 145 ? 40.772 14.549  -6.344  1.00 37.90 ? 145 HIS A CD2   1 
ATOM   895  C CE1   . HIS A 1 145 ? 41.861 16.347  -6.974  1.00 38.16 ? 145 HIS A CE1   1 
ATOM   896  N NE2   . HIS A 1 145 ? 41.859 15.355  -6.102  1.00 38.42 ? 145 HIS A NE2   1 
ATOM   897  N N     . TYR A 1 146 ? 40.005 11.777  -7.835  1.00 31.94 ? 146 TYR A N     1 
ATOM   898  C CA    . TYR A 1 146 ? 41.000 10.848  -7.328  1.00 32.69 ? 146 TYR A CA    1 
ATOM   899  C C     . TYR A 1 146 ? 41.427 9.869   -8.415  1.00 34.32 ? 146 TYR A C     1 
ATOM   900  O O     . TYR A 1 146 ? 42.587 9.469   -8.484  1.00 34.37 ? 146 TYR A O     1 
ATOM   901  C CB    . TYR A 1 146 ? 40.453 10.091  -6.118  1.00 30.56 ? 146 TYR A CB    1 
ATOM   902  C CG    . TYR A 1 146 ? 40.386 10.942  -4.871  1.00 29.38 ? 146 TYR A CG    1 
ATOM   903  C CD1   . TYR A 1 146 ? 39.258 11.717  -4.593  1.00 28.59 ? 146 TYR A CD1   1 
ATOM   904  C CD2   . TYR A 1 146 ? 41.467 11.007  -3.984  1.00 28.51 ? 146 TYR A CD2   1 
ATOM   905  C CE1   . TYR A 1 146 ? 39.206 12.540  -3.468  1.00 27.76 ? 146 TYR A CE1   1 
ATOM   906  C CE2   . TYR A 1 146 ? 41.424 11.827  -2.857  1.00 27.64 ? 146 TYR A CE2   1 
ATOM   907  C CZ    . TYR A 1 146 ? 40.293 12.591  -2.607  1.00 27.60 ? 146 TYR A CZ    1 
ATOM   908  O OH    . TYR A 1 146 ? 40.244 13.408  -1.504  1.00 27.28 ? 146 TYR A OH    1 
ATOM   909  N N     . SER A 1 147 ? 40.485 9.485   -9.265  1.00 35.57 ? 147 SER A N     1 
ATOM   910  C CA    . SER A 1 147 ? 40.786 8.565   -10.349 1.00 38.08 ? 147 SER A CA    1 
ATOM   911  C C     . SER A 1 147 ? 41.823 9.192   -11.269 1.00 38.83 ? 147 SER A C     1 
ATOM   912  O O     . SER A 1 147 ? 42.846 8.585   -11.581 1.00 39.16 ? 147 SER A O     1 
ATOM   913  C CB    . SER A 1 147 ? 39.516 8.260   -11.143 1.00 38.72 ? 147 SER A CB    1 
ATOM   914  O OG    . SER A 1 147 ? 39.265 6.869   -11.165 1.00 41.59 ? 147 SER A OG    1 
ATOM   915  N N     . ARG A 1 148 ? 41.550 10.420  -11.691 1.00 40.37 ? 148 ARG A N     1 
ATOM   916  C CA    . ARG A 1 148 ? 42.440 11.147  -12.583 1.00 42.13 ? 148 ARG A CA    1 
ATOM   917  C C     . ARG A 1 148 ? 43.810 11.393  -11.951 1.00 42.81 ? 148 ARG A C     1 
ATOM   918  O O     . ARG A 1 148 ? 44.840 11.248  -12.612 1.00 43.23 ? 148 ARG A O     1 
ATOM   919  C CB    . ARG A 1 148 ? 41.790 12.475  -12.984 1.00 42.99 ? 148 ARG A CB    1 
ATOM   920  C CG    . ARG A 1 148 ? 40.653 12.321  -13.987 1.00 44.60 ? 148 ARG A CG    1 
ATOM   921  C CD    . ARG A 1 148 ? 39.757 13.556  -14.014 1.00 47.07 ? 148 ARG A CD    1 
ATOM   922  N NE    . ARG A 1 148 ? 38.918 13.622  -15.213 1.00 48.76 ? 148 ARG A NE    1 
ATOM   923  C CZ    . ARG A 1 148 ? 38.083 14.624  -15.495 1.00 49.47 ? 148 ARG A CZ    1 
ATOM   924  N NH1   . ARG A 1 148 ? 37.968 15.656  -14.664 1.00 49.38 ? 148 ARG A NH1   1 
ATOM   925  N NH2   . ARG A 1 148 ? 37.366 14.601  -16.612 1.00 49.63 ? 148 ARG A NH2   1 
ATOM   926  N N     . ALA A 1 149 ? 43.822 11.763  -10.674 1.00 43.05 ? 149 ALA A N     1 
ATOM   927  C CA    . ALA A 1 149 ? 45.070 12.022  -9.968  1.00 43.22 ? 149 ALA A CA    1 
ATOM   928  C C     . ALA A 1 149 ? 45.754 10.711  -9.610  1.00 43.67 ? 149 ALA A C     1 
ATOM   929  O O     . ALA A 1 149 ? 46.723 10.699  -8.850  1.00 44.06 ? 149 ALA A O     1 
ATOM   930  C CB    . ALA A 1 149 ? 44.803 12.828  -8.700  1.00 42.78 ? 149 ALA A CB    1 
ATOM   931  N N     . LYS A 1 150 ? 45.251 9.609   -10.160 1.00 43.86 ? 150 LYS A N     1 
ATOM   932  C CA    . LYS A 1 150 ? 45.815 8.293   -9.876  1.00 44.36 ? 150 LYS A CA    1 
ATOM   933  C C     . LYS A 1 150 ? 45.988 8.144   -8.364  1.00 43.96 ? 150 LYS A C     1 
ATOM   934  O O     . LYS A 1 150 ? 47.002 7.644   -7.879  1.00 43.96 ? 150 LYS A O     1 
ATOM   935  C CB    . LYS A 1 150 ? 47.163 8.136   -10.590 1.00 45.75 ? 150 LYS A CB    1 
ATOM   936  C CG    . LYS A 1 150 ? 47.249 8.904   -11.905 1.00 47.52 ? 150 LYS A CG    1 
ATOM   937  C CD    . LYS A 1 150 ? 48.317 8.339   -12.832 1.00 49.38 ? 150 LYS A CD    1 
ATOM   938  C CE    . LYS A 1 150 ? 48.352 9.089   -14.163 1.00 50.29 ? 150 LYS A CE    1 
ATOM   939  N NZ    . LYS A 1 150 ? 49.672 8.953   -14.853 1.00 51.41 ? 150 LYS A NZ    1 
ATOM   940  N N     . GLN A 1 151 ? 44.979 8.597   -7.629  1.00 43.19 ? 151 GLN A N     1 
ATOM   941  C CA    . GLN A 1 151 ? 44.973 8.548   -6.174  1.00 42.93 ? 151 GLN A CA    1 
ATOM   942  C C     . GLN A 1 151 ? 43.761 7.753   -5.709  1.00 41.91 ? 151 GLN A C     1 
ATOM   943  O O     . GLN A 1 151 ? 42.768 7.639   -6.429  1.00 42.17 ? 151 GLN A O     1 
ATOM   944  C CB    . GLN A 1 151 ? 44.879 9.967   -5.607  1.00 44.48 ? 151 GLN A CB    1 
ATOM   945  C CG    . GLN A 1 151 ? 46.205 10.601  -5.253  1.00 47.33 ? 151 GLN A CG    1 
ATOM   946  C CD    . GLN A 1 151 ? 46.989 9.774   -4.253  1.00 49.43 ? 151 GLN A CD    1 
ATOM   947  O OE1   . GLN A 1 151 ? 46.412 9.047   -3.434  1.00 51.06 ? 151 GLN A OE1   1 
ATOM   948  N NE2   . GLN A 1 151 ? 48.313 9.875   -4.313  1.00 50.37 ? 151 GLN A NE2   1 
ATOM   949  N N     . THR A 1 152 ? 43.846 7.207   -4.504  1.00 40.53 ? 152 THR A N     1 
ATOM   950  C CA    . THR A 1 152 ? 42.744 6.445   -3.927  1.00 39.29 ? 152 THR A CA    1 
ATOM   951  C C     . THR A 1 152 ? 41.960 7.365   -2.996  1.00 36.78 ? 152 THR A C     1 
ATOM   952  O O     . THR A 1 152 ? 42.554 8.156   -2.261  1.00 36.56 ? 152 THR A O     1 
ATOM   953  C CB    . THR A 1 152 ? 43.260 5.264   -3.081  1.00 40.71 ? 152 THR A CB    1 
ATOM   954  O OG1   . THR A 1 152 ? 44.042 4.384   -3.899  1.00 43.49 ? 152 THR A OG1   1 
ATOM   955  C CG2   . THR A 1 152 ? 42.097 4.493   -2.475  1.00 41.95 ? 152 THR A CG2   1 
ATOM   956  N N     . LEU A 1 153 ? 40.634 7.282   -3.025  1.00 33.62 ? 153 LEU A N     1 
ATOM   957  C CA    . LEU A 1 153 ? 39.844 8.107   -2.125  1.00 30.70 ? 153 LEU A CA    1 
ATOM   958  C C     . LEU A 1 153 ? 40.100 7.542   -0.725  1.00 28.98 ? 153 LEU A C     1 
ATOM   959  O O     . LEU A 1 153 ? 39.935 6.337   -0.496  1.00 28.07 ? 153 LEU A O     1 
ATOM   960  C CB    . LEU A 1 153 ? 38.347 8.024   -2.466  1.00 30.13 ? 153 LEU A CB    1 
ATOM   961  C CG    . LEU A 1 153 ? 37.378 8.603   -1.424  1.00 29.97 ? 153 LEU A CG    1 
ATOM   962  C CD1   . LEU A 1 153 ? 37.488 10.122  -1.398  1.00 30.14 ? 153 LEU A CD1   1 
ATOM   963  C CD2   . LEU A 1 153 ? 35.952 8.191   -1.750  1.00 30.35 ? 153 LEU A CD2   1 
ATOM   964  N N     . PRO A 1 154 ? 40.552 8.394   0.218   1.00 27.59 ? 154 PRO A N     1 
ATOM   965  C CA    . PRO A 1 154 ? 40.819 7.926   1.582   1.00 26.73 ? 154 PRO A CA    1 
ATOM   966  C C     . PRO A 1 154 ? 39.640 7.122   2.132   1.00 26.57 ? 154 PRO A C     1 
ATOM   967  O O     . PRO A 1 154 ? 38.481 7.524   1.995   1.00 25.64 ? 154 PRO A O     1 
ATOM   968  C CB    . PRO A 1 154 ? 41.067 9.217   2.361   1.00 26.95 ? 154 PRO A CB    1 
ATOM   969  C CG    . PRO A 1 154 ? 41.594 10.162  1.335   1.00 26.50 ? 154 PRO A CG    1 
ATOM   970  C CD    . PRO A 1 154 ? 40.860 9.828   0.061   1.00 27.32 ? 154 PRO A CD    1 
ATOM   971  N N     . VAL A 1 155 ? 39.946 5.989   2.756   1.00 25.82 ? 155 VAL A N     1 
ATOM   972  C CA    . VAL A 1 155 ? 38.923 5.109   3.297   1.00 25.68 ? 155 VAL A CA    1 
ATOM   973  C C     . VAL A 1 155 ? 37.970 5.771   4.288   1.00 24.69 ? 155 VAL A C     1 
ATOM   974  O O     . VAL A 1 155 ? 36.827 5.340   4.427   1.00 24.60 ? 155 VAL A O     1 
ATOM   975  C CB    . VAL A 1 155 ? 39.561 3.869   3.961   1.00 26.40 ? 155 VAL A CB    1 
ATOM   976  C CG1   . VAL A 1 155 ? 38.483 2.854   4.332   1.00 27.62 ? 155 VAL A CG1   1 
ATOM   977  C CG2   . VAL A 1 155 ? 40.553 3.232   3.001   1.00 28.20 ? 155 VAL A CG2   1 
ATOM   978  N N     . ILE A 1 156 ? 38.423 6.811   4.979   1.00 23.35 ? 156 ILE A N     1 
ATOM   979  C CA    . ILE A 1 156 ? 37.550 7.469   5.937   1.00 22.39 ? 156 ILE A CA    1 
ATOM   980  C C     . ILE A 1 156 ? 36.329 8.019   5.186   1.00 21.81 ? 156 ILE A C     1 
ATOM   981  O O     . ILE A 1 156 ? 35.209 7.968   5.694   1.00 21.64 ? 156 ILE A O     1 
ATOM   982  C CB    . ILE A 1 156 ? 38.292 8.605   6.687   1.00 21.78 ? 156 ILE A CB    1 
ATOM   983  C CG1   . ILE A 1 156 ? 37.352 9.277   7.690   1.00 22.58 ? 156 ILE A CG1   1 
ATOM   984  C CG2   . ILE A 1 156 ? 38.799 9.639   5.708   1.00 20.64 ? 156 ILE A CG2   1 
ATOM   985  C CD1   . ILE A 1 156 ? 36.625 8.316   8.622   1.00 23.23 ? 156 ILE A CD1   1 
ATOM   986  N N     . TYR A 1 157 ? 36.550 8.523   3.972   1.00 21.66 ? 157 TYR A N     1 
ATOM   987  C CA    . TYR A 1 157 ? 35.467 9.064   3.150   1.00 21.13 ? 157 TYR A CA    1 
ATOM   988  C C     . TYR A 1 157 ? 34.610 7.935   2.592   1.00 21.08 ? 157 TYR A C     1 
ATOM   989  O O     . TYR A 1 157 ? 33.397 8.071   2.485   1.00 21.08 ? 157 TYR A O     1 
ATOM   990  C CB    . TYR A 1 157 ? 36.019 9.889   1.988   1.00 22.43 ? 157 TYR A CB    1 
ATOM   991  C CG    . TYR A 1 157 ? 36.674 11.173  2.427   1.00 24.60 ? 157 TYR A CG    1 
ATOM   992  C CD1   . TYR A 1 157 ? 38.020 11.416  2.155   1.00 25.62 ? 157 TYR A CD1   1 
ATOM   993  C CD2   . TYR A 1 157 ? 35.961 12.126  3.153   1.00 24.96 ? 157 TYR A CD2   1 
ATOM   994  C CE1   . TYR A 1 157 ? 38.646 12.579  2.597   1.00 26.81 ? 157 TYR A CE1   1 
ATOM   995  C CE2   . TYR A 1 157 ? 36.574 13.294  3.602   1.00 27.34 ? 157 TYR A CE2   1 
ATOM   996  C CZ    . TYR A 1 157 ? 37.921 13.512  3.317   1.00 27.77 ? 157 TYR A CZ    1 
ATOM   997  O OH    . TYR A 1 157 ? 38.534 14.667  3.740   1.00 29.58 ? 157 TYR A OH    1 
ATOM   998  N N     . VAL A 1 158 ? 35.239 6.828   2.216   1.00 20.40 ? 158 VAL A N     1 
ATOM   999  C CA    . VAL A 1 158 ? 34.488 5.691   1.695   1.00 20.07 ? 158 VAL A CA    1 
ATOM   1000 C C     . VAL A 1 158 ? 33.520 5.219   2.798   1.00 19.96 ? 158 VAL A C     1 
ATOM   1001 O O     . VAL A 1 158 ? 32.373 4.850   2.524   1.00 18.77 ? 158 VAL A O     1 
ATOM   1002 C CB    . VAL A 1 158 ? 35.440 4.530   1.290   1.00 20.30 ? 158 VAL A CB    1 
ATOM   1003 C CG1   . VAL A 1 158 ? 34.636 3.277   0.935   1.00 20.95 ? 158 VAL A CG1   1 
ATOM   1004 C CG2   . VAL A 1 158 ? 36.291 4.957   0.095   1.00 20.29 ? 158 VAL A CG2   1 
ATOM   1005 N N     . LYS A 1 159 ? 33.991 5.238   4.045   1.00 18.59 ? 159 LYS A N     1 
ATOM   1006 C CA    . LYS A 1 159 ? 33.162 4.830   5.180   1.00 18.87 ? 159 LYS A CA    1 
ATOM   1007 C C     . LYS A 1 159 ? 32.020 5.822   5.362   1.00 18.53 ? 159 LYS A C     1 
ATOM   1008 O O     . LYS A 1 159 ? 30.857 5.436   5.456   1.00 18.33 ? 159 LYS A O     1 
ATOM   1009 C CB    . LYS A 1 159 ? 33.993 4.776   6.472   1.00 19.47 ? 159 LYS A CB    1 
ATOM   1010 C CG    . LYS A 1 159 ? 34.984 3.629   6.514   1.00 20.34 ? 159 LYS A CG    1 
ATOM   1011 C CD    . LYS A 1 159 ? 35.814 3.634   7.786   1.00 20.89 ? 159 LYS A CD    1 
ATOM   1012 C CE    . LYS A 1 159 ? 36.759 2.430   7.797   1.00 21.57 ? 159 LYS A CE    1 
ATOM   1013 N NZ    . LYS A 1 159 ? 37.720 2.451   8.936   1.00 23.26 ? 159 LYS A NZ    1 
ATOM   1014 N N     . LEU A 1 160 ? 32.357 7.104   5.407   1.00 17.89 ? 160 LEU A N     1 
ATOM   1015 C CA    . LEU A 1 160 ? 31.355 8.143   5.597   1.00 18.57 ? 160 LEU A CA    1 
ATOM   1016 C C     . LEU A 1 160 ? 30.274 8.166   4.520   1.00 18.90 ? 160 LEU A C     1 
ATOM   1017 O O     . LEU A 1 160 ? 29.081 8.229   4.826   1.00 19.19 ? 160 LEU A O     1 
ATOM   1018 C CB    . LEU A 1 160 ? 32.025 9.519   5.651   1.00 18.33 ? 160 LEU A CB    1 
ATOM   1019 C CG    . LEU A 1 160 ? 32.679 9.906   6.983   1.00 18.68 ? 160 LEU A CG    1 
ATOM   1020 C CD1   . LEU A 1 160 ? 33.681 11.041  6.727   1.00 18.74 ? 160 LEU A CD1   1 
ATOM   1021 C CD2   . LEU A 1 160 ? 31.606 10.331  8.002   1.00 19.29 ? 160 LEU A CD2   1 
ATOM   1022 N N     . TYR A 1 161 ? 30.691 8.118   3.259   1.00 18.53 ? 161 TYR A N     1 
ATOM   1023 C CA    . TYR A 1 161 ? 29.741 8.172   2.154   1.00 19.08 ? 161 TYR A CA    1 
ATOM   1024 C C     . TYR A 1 161 ? 28.846 6.949   2.075   1.00 18.45 ? 161 TYR A C     1 
ATOM   1025 O O     . TYR A 1 161 ? 27.629 7.077   1.935   1.00 18.20 ? 161 TYR A O     1 
ATOM   1026 C CB    . TYR A 1 161 ? 30.480 8.355   0.825   1.00 20.47 ? 161 TYR A CB    1 
ATOM   1027 C CG    . TYR A 1 161 ? 31.256 9.648   0.744   1.00 22.58 ? 161 TYR A CG    1 
ATOM   1028 C CD1   . TYR A 1 161 ? 31.013 10.682  1.646   1.00 23.90 ? 161 TYR A CD1   1 
ATOM   1029 C CD2   . TYR A 1 161 ? 32.245 9.836   -0.222  1.00 23.92 ? 161 TYR A CD2   1 
ATOM   1030 C CE1   . TYR A 1 161 ? 31.731 11.866  1.594   1.00 26.61 ? 161 TYR A CE1   1 
ATOM   1031 C CE2   . TYR A 1 161 ? 32.973 11.027  -0.285  1.00 25.49 ? 161 TYR A CE2   1 
ATOM   1032 C CZ    . TYR A 1 161 ? 32.705 12.032  0.626   1.00 26.29 ? 161 TYR A CZ    1 
ATOM   1033 O OH    . TYR A 1 161 ? 33.382 13.230  0.568   1.00 30.94 ? 161 TYR A OH    1 
ATOM   1034 N N     . MET A 1 162 ? 29.443 5.767   2.165   1.00 17.42 ? 162 MET A N     1 
ATOM   1035 C CA    . MET A 1 162 ? 28.673 4.529   2.096   1.00 17.69 ? 162 MET A CA    1 
ATOM   1036 C C     . MET A 1 162 ? 27.711 4.365   3.284   1.00 17.21 ? 162 MET A C     1 
ATOM   1037 O O     . MET A 1 162 ? 26.590 3.903   3.108   1.00 17.09 ? 162 MET A O     1 
ATOM   1038 C CB    . MET A 1 162 ? 29.624 3.336   2.000   1.00 18.41 ? 162 MET A CB    1 
ATOM   1039 C CG    . MET A 1 162 ? 30.372 3.273   0.656   1.00 19.20 ? 162 MET A CG    1 
ATOM   1040 S SD    . MET A 1 162 ? 29.279 3.310   -0.800  1.00 20.62 ? 162 MET A SD    1 
ATOM   1041 C CE    . MET A 1 162 ? 28.198 1.875   -0.436  1.00 21.54 ? 162 MET A CE    1 
ATOM   1042 N N     . TYR A 1 163 ? 28.142 4.752   4.484   1.00 16.40 ? 163 TYR A N     1 
ATOM   1043 C CA    . TYR A 1 163 ? 27.298 4.656   5.676   1.00 16.00 ? 163 TYR A CA    1 
ATOM   1044 C C     . TYR A 1 163 ? 26.051 5.516   5.509   1.00 16.21 ? 163 TYR A C     1 
ATOM   1045 O O     . TYR A 1 163 ? 24.928 5.091   5.814   1.00 16.01 ? 163 TYR A O     1 
ATOM   1046 C CB    . TYR A 1 163 ? 28.062 5.144   6.911   1.00 16.22 ? 163 TYR A CB    1 
ATOM   1047 C CG    . TYR A 1 163 ? 27.210 5.193   8.166   1.00 16.21 ? 163 TYR A CG    1 
ATOM   1048 C CD1   . TYR A 1 163 ? 26.549 6.361   8.543   1.00 17.25 ? 163 TYR A CD1   1 
ATOM   1049 C CD2   . TYR A 1 163 ? 27.080 4.071   8.983   1.00 16.57 ? 163 TYR A CD2   1 
ATOM   1050 C CE1   . TYR A 1 163 ? 25.774 6.410   9.713   1.00 16.51 ? 163 TYR A CE1   1 
ATOM   1051 C CE2   . TYR A 1 163 ? 26.318 4.109   10.142  1.00 16.17 ? 163 TYR A CE2   1 
ATOM   1052 C CZ    . TYR A 1 163 ? 25.672 5.278   10.504  1.00 16.63 ? 163 TYR A CZ    1 
ATOM   1053 O OH    . TYR A 1 163 ? 24.941 5.325   11.669  1.00 17.13 ? 163 TYR A OH    1 
ATOM   1054 N N     . GLN A 1 164 ? 26.258 6.741   5.038   1.00 15.69 ? 164 GLN A N     1 
ATOM   1055 C CA    . GLN A 1 164 ? 25.155 7.664   4.833   1.00 15.63 ? 164 GLN A CA    1 
ATOM   1056 C C     . GLN A 1 164 ? 24.230 7.170   3.720   1.00 16.14 ? 164 GLN A C     1 
ATOM   1057 O O     . GLN A 1 164 ? 23.009 7.326   3.814   1.00 15.63 ? 164 GLN A O     1 
ATOM   1058 C CB    . GLN A 1 164 ? 25.701 9.062   4.542   1.00 15.91 ? 164 GLN A CB    1 
ATOM   1059 C CG    . GLN A 1 164 ? 26.371 9.682   5.767   1.00 15.22 ? 164 GLN A CG    1 
ATOM   1060 C CD    . GLN A 1 164 ? 27.060 10.984  5.447   1.00 16.39 ? 164 GLN A CD    1 
ATOM   1061 O OE1   . GLN A 1 164 ? 28.232 10.998  5.047   1.00 18.24 ? 164 GLN A OE1   1 
ATOM   1062 N NE2   . GLN A 1 164 ? 26.345 12.090  5.614   1.00 14.14 ? 164 GLN A NE2   1 
ATOM   1063 N N     . LEU A 1 165 ? 24.798 6.556   2.679   1.00 14.93 ? 165 LEU A N     1 
ATOM   1064 C CA    . LEU A 1 165 ? 23.976 6.013   1.599   1.00 14.80 ? 165 LEU A CA    1 
ATOM   1065 C C     . LEU A 1 165 ? 23.086 4.897   2.171   1.00 15.71 ? 165 LEU A C     1 
ATOM   1066 O O     . LEU A 1 165 ? 21.887 4.842   1.894   1.00 15.65 ? 165 LEU A O     1 
ATOM   1067 C CB    . LEU A 1 165 ? 24.849 5.432   0.480   1.00 14.40 ? 165 LEU A CB    1 
ATOM   1068 C CG    . LEU A 1 165 ? 24.103 4.553   -0.546  1.00 14.94 ? 165 LEU A CG    1 
ATOM   1069 C CD1   . LEU A 1 165 ? 22.926 5.337   -1.149  1.00 14.06 ? 165 LEU A CD1   1 
ATOM   1070 C CD2   . LEU A 1 165 ? 25.063 4.120   -1.636  1.00 14.75 ? 165 LEU A CD2   1 
ATOM   1071 N N     . PHE A 1 166 ? 23.669 4.014   2.978   1.00 15.23 ? 166 PHE A N     1 
ATOM   1072 C CA    . PHE A 1 166 ? 22.887 2.929   3.550   1.00 15.73 ? 166 PHE A CA    1 
ATOM   1073 C C     . PHE A 1 166 ? 21.783 3.448   4.475   1.00 16.26 ? 166 PHE A C     1 
ATOM   1074 O O     . PHE A 1 166 ? 20.694 2.875   4.527   1.00 16.41 ? 166 PHE A O     1 
ATOM   1075 C CB    . PHE A 1 166 ? 23.811 1.940   4.261   1.00 16.40 ? 166 PHE A CB    1 
ATOM   1076 C CG    . PHE A 1 166 ? 24.556 1.043   3.317   1.00 16.67 ? 166 PHE A CG    1 
ATOM   1077 C CD1   . PHE A 1 166 ? 25.948 0.968   3.357   1.00 18.69 ? 166 PHE A CD1   1 
ATOM   1078 C CD2   . PHE A 1 166 ? 23.865 0.282   2.372   1.00 18.23 ? 166 PHE A CD2   1 
ATOM   1079 C CE1   . PHE A 1 166 ? 26.650 0.137   2.459   1.00 19.49 ? 166 PHE A CE1   1 
ATOM   1080 C CE2   . PHE A 1 166 ? 24.547 -0.550  1.467   1.00 19.45 ? 166 PHE A CE2   1 
ATOM   1081 C CZ    . PHE A 1 166 ? 25.946 -0.622  1.512   1.00 18.61 ? 166 PHE A CZ    1 
ATOM   1082 N N     . ARG A 1 167 ? 22.042 4.543   5.190   1.00 16.25 ? 167 ARG A N     1 
ATOM   1083 C CA    . ARG A 1 167 ? 21.023 5.123   6.065   1.00 15.49 ? 167 ARG A CA    1 
ATOM   1084 C C     . ARG A 1 167 ? 19.863 5.618   5.211   1.00 16.08 ? 167 ARG A C     1 
ATOM   1085 O O     . ARG A 1 167 ? 18.701 5.395   5.551   1.00 16.88 ? 167 ARG A O     1 
ATOM   1086 C CB    . ARG A 1 167 ? 21.600 6.290   6.862   1.00 15.45 ? 167 ARG A CB    1 
ATOM   1087 C CG    . ARG A 1 167 ? 22.324 5.875   8.119   1.00 15.48 ? 167 ARG A CG    1 
ATOM   1088 C CD    . ARG A 1 167 ? 22.469 7.063   9.069   1.00 17.50 ? 167 ARG A CD    1 
ATOM   1089 N NE    . ARG A 1 167 ? 21.199 7.436   9.691   1.00 16.65 ? 167 ARG A NE    1 
ATOM   1090 C CZ    . ARG A 1 167 ? 20.975 8.586   10.317  1.00 17.52 ? 167 ARG A CZ    1 
ATOM   1091 N NH1   . ARG A 1 167 ? 21.937 9.500   10.411  1.00 16.44 ? 167 ARG A NH1   1 
ATOM   1092 N NH2   . ARG A 1 167 ? 19.787 8.815   10.866  1.00 17.95 ? 167 ARG A NH2   1 
ATOM   1093 N N     . SER A 1 168 ? 20.164 6.293   4.099   1.00 15.10 ? 168 SER A N     1 
ATOM   1094 C CA    . SER A 1 168 ? 19.100 6.791   3.232   1.00 15.10 ? 168 SER A CA    1 
ATOM   1095 C C     . SER A 1 168 ? 18.268 5.637   2.653   1.00 14.97 ? 168 SER A C     1 
ATOM   1096 O O     . SER A 1 168 ? 17.046 5.765   2.520   1.00 15.45 ? 168 SER A O     1 
ATOM   1097 C CB    . SER A 1 168 ? 19.666 7.677   2.099   1.00 14.28 ? 168 SER A CB    1 
ATOM   1098 O OG    . SER A 1 168 ? 20.280 6.928   1.068   1.00 13.30 ? 168 SER A OG    1 
ATOM   1099 N N     . LEU A 1 169 ? 18.922 4.519   2.322   1.00 14.72 ? 169 LEU A N     1 
ATOM   1100 C CA    . LEU A 1 169 ? 18.229 3.346   1.778   1.00 14.87 ? 169 LEU A CA    1 
ATOM   1101 C C     . LEU A 1 169 ? 17.383 2.665   2.868   1.00 16.00 ? 169 LEU A C     1 
ATOM   1102 O O     . LEU A 1 169 ? 16.260 2.226   2.602   1.00 16.34 ? 169 LEU A O     1 
ATOM   1103 C CB    . LEU A 1 169 ? 19.240 2.343   1.202   1.00 12.90 ? 169 LEU A CB    1 
ATOM   1104 C CG    . LEU A 1 169 ? 20.017 2.823   -0.033  1.00 13.64 ? 169 LEU A CG    1 
ATOM   1105 C CD1   . LEU A 1 169 ? 20.911 1.696   -0.560  1.00 13.79 ? 169 LEU A CD1   1 
ATOM   1106 C CD2   . LEU A 1 169 ? 19.044 3.309   -1.112  1.00 13.80 ? 169 LEU A CD2   1 
ATOM   1107 N N     . ALA A 1 170 ? 17.925 2.563   4.082   1.00 16.54 ? 170 ALA A N     1 
ATOM   1108 C CA    . ALA A 1 170 ? 17.172 1.977   5.193   1.00 16.68 ? 170 ALA A CA    1 
ATOM   1109 C C     . ALA A 1 170 ? 15.882 2.789   5.350   1.00 17.35 ? 170 ALA A C     1 
ATOM   1110 O O     . ALA A 1 170 ? 14.789 2.238   5.498   1.00 17.37 ? 170 ALA A O     1 
ATOM   1111 C CB    . ALA A 1 170 ? 17.992 2.036   6.488   1.00 15.70 ? 170 ALA A CB    1 
ATOM   1112 N N     . TYR A 1 171 ? 16.011 4.107   5.296   1.00 16.49 ? 171 TYR A N     1 
ATOM   1113 C CA    . TYR A 1 171 ? 14.859 4.969   5.441   1.00 17.72 ? 171 TYR A CA    1 
ATOM   1114 C C     . TYR A 1 171 ? 13.813 4.783   4.320   1.00 18.25 ? 171 TYR A C     1 
ATOM   1115 O O     . TYR A 1 171 ? 12.643 4.536   4.605   1.00 18.87 ? 171 TYR A O     1 
ATOM   1116 C CB    . TYR A 1 171 ? 15.312 6.433   5.515   1.00 17.51 ? 171 TYR A CB    1 
ATOM   1117 C CG    . TYR A 1 171 ? 14.179 7.421   5.658   1.00 18.90 ? 171 TYR A CG    1 
ATOM   1118 C CD1   . TYR A 1 171 ? 13.727 8.149   4.562   1.00 19.12 ? 171 TYR A CD1   1 
ATOM   1119 C CD2   . TYR A 1 171 ? 13.557 7.629   6.892   1.00 19.48 ? 171 TYR A CD2   1 
ATOM   1120 C CE1   . TYR A 1 171 ? 12.693 9.059   4.678   1.00 20.56 ? 171 TYR A CE1   1 
ATOM   1121 C CE2   . TYR A 1 171 ? 12.507 8.546   7.021   1.00 21.03 ? 171 TYR A CE2   1 
ATOM   1122 C CZ    . TYR A 1 171 ? 12.083 9.257   5.912   1.00 20.29 ? 171 TYR A CZ    1 
ATOM   1123 O OH    . TYR A 1 171 ? 11.066 10.192  6.022   1.00 22.06 ? 171 TYR A OH    1 
ATOM   1124 N N     . ILE A 1 172 ? 14.204 4.890   3.052   1.00 16.85 ? 172 ILE A N     1 
ATOM   1125 C CA    . ILE A 1 172 ? 13.190 4.728   2.010   1.00 17.09 ? 172 ILE A CA    1 
ATOM   1126 C C     . ILE A 1 172 ? 12.623 3.314   1.931   1.00 16.51 ? 172 ILE A C     1 
ATOM   1127 O O     . ILE A 1 172 ? 11.437 3.144   1.666   1.00 16.94 ? 172 ILE A O     1 
ATOM   1128 C CB    . ILE A 1 172 ? 13.693 5.151   0.601   1.00 16.71 ? 172 ILE A CB    1 
ATOM   1129 C CG1   . ILE A 1 172 ? 14.902 4.321   0.167   1.00 16.41 ? 172 ILE A CG1   1 
ATOM   1130 C CG2   . ILE A 1 172 ? 13.997 6.631   0.601   1.00 16.80 ? 172 ILE A CG2   1 
ATOM   1131 C CD1   . ILE A 1 172 ? 15.300 4.567   -1.307  1.00 16.65 ? 172 ILE A CD1   1 
ATOM   1132 N N     . HIS A 1 173 ? 13.451 2.305   2.175   1.00 17.07 ? 173 HIS A N     1 
ATOM   1133 C CA    . HIS A 1 173 ? 12.987 0.922   2.108   1.00 18.02 ? 173 HIS A CA    1 
ATOM   1134 C C     . HIS A 1 173 ? 11.953 0.606   3.189   1.00 19.53 ? 173 HIS A C     1 
ATOM   1135 O O     . HIS A 1 173 ? 11.100 -0.275  3.001   1.00 19.96 ? 173 HIS A O     1 
ATOM   1136 C CB    . HIS A 1 173 ? 14.161 -0.047  2.236   1.00 17.17 ? 173 HIS A CB    1 
ATOM   1137 C CG    . HIS A 1 173 ? 15.026 -0.098  1.018   1.00 17.15 ? 173 HIS A CG    1 
ATOM   1138 N ND1   . HIS A 1 173 ? 16.119 -0.927  0.913   1.00 18.09 ? 173 HIS A ND1   1 
ATOM   1139 C CD2   . HIS A 1 173 ? 14.966 0.595   -0.145  1.00 17.84 ? 173 HIS A CD2   1 
ATOM   1140 C CE1   . HIS A 1 173 ? 16.697 -0.744  -0.263  1.00 18.88 ? 173 HIS A CE1   1 
ATOM   1141 N NE2   . HIS A 1 173 ? 16.016 0.177   -0.924  1.00 18.01 ? 173 HIS A NE2   1 
ATOM   1142 N N     . SER A 1 174 ? 12.023 1.318   4.312   1.00 19.07 ? 174 SER A N     1 
ATOM   1143 C CA    . SER A 1 174 ? 11.084 1.084   5.402   1.00 20.01 ? 174 SER A CA    1 
ATOM   1144 C C     . SER A 1 174 ? 9.676  1.506   4.987   1.00 21.95 ? 174 SER A C     1 
ATOM   1145 O O     . SER A 1 174 ? 8.695  1.131   5.630   1.00 23.74 ? 174 SER A O     1 
ATOM   1146 C CB    . SER A 1 174 ? 11.533 1.823   6.677   1.00 18.49 ? 174 SER A CB    1 
ATOM   1147 O OG    . SER A 1 174 ? 11.275 3.213   6.595   1.00 17.80 ? 174 SER A OG    1 
ATOM   1148 N N     . PHE A 1 175 ? 9.573  2.298   3.922   1.00 22.58 ? 175 PHE A N     1 
ATOM   1149 C CA    . PHE A 1 175 ? 8.269  2.719   3.408   1.00 23.49 ? 175 PHE A CA    1 
ATOM   1150 C C     . PHE A 1 175 ? 7.948  1.872   2.179   1.00 23.21 ? 175 PHE A C     1 
ATOM   1151 O O     . PHE A 1 175 ? 6.979  2.141   1.477   1.00 23.94 ? 175 PHE A O     1 
ATOM   1152 C CB    . PHE A 1 175 ? 8.280  4.188   2.980   1.00 24.97 ? 175 PHE A CB    1 
ATOM   1153 C CG    . PHE A 1 175 ? 8.400  5.155   4.122   1.00 28.40 ? 175 PHE A CG    1 
ATOM   1154 C CD1   . PHE A 1 175 ? 7.315  5.389   4.973   1.00 29.22 ? 175 PHE A CD1   1 
ATOM   1155 C CD2   . PHE A 1 175 ? 9.603  5.823   4.361   1.00 28.17 ? 175 PHE A CD2   1 
ATOM   1156 C CE1   . PHE A 1 175 ? 7.430  6.271   6.047   1.00 30.69 ? 175 PHE A CE1   1 
ATOM   1157 C CE2   . PHE A 1 175 ? 9.727  6.700   5.425   1.00 30.02 ? 175 PHE A CE2   1 
ATOM   1158 C CZ    . PHE A 1 175 ? 8.643  6.929   6.275   1.00 30.44 ? 175 PHE A CZ    1 
ATOM   1159 N N     . GLY A 1 176 ? 8.772  0.858   1.920   1.00 22.98 ? 176 GLY A N     1 
ATOM   1160 C CA    . GLY A 1 176 ? 8.566  0.001   0.764   1.00 22.64 ? 176 GLY A CA    1 
ATOM   1161 C C     . GLY A 1 176 ? 8.995  0.655   -0.543  1.00 22.97 ? 176 GLY A C     1 
ATOM   1162 O O     . GLY A 1 176 ? 8.752  0.112   -1.624  1.00 23.29 ? 176 GLY A O     1 
ATOM   1163 N N     . ILE A 1 177 ? 9.643  1.820   -0.450  1.00 21.88 ? 177 ILE A N     1 
ATOM   1164 C CA    . ILE A 1 177 ? 10.092 2.552   -1.638  1.00 20.29 ? 177 ILE A CA    1 
ATOM   1165 C C     . ILE A 1 177 ? 11.506 2.148   -2.052  1.00 20.12 ? 177 ILE A C     1 
ATOM   1166 O O     . ILE A 1 177 ? 12.435 2.147   -1.237  1.00 19.01 ? 177 ILE A O     1 
ATOM   1167 C CB    . ILE A 1 177 ? 10.061 4.087   -1.404  1.00 20.51 ? 177 ILE A CB    1 
ATOM   1168 C CG1   . ILE A 1 177 ? 8.611  4.558   -1.252  1.00 21.13 ? 177 ILE A CG1   1 
ATOM   1169 C CG2   . ILE A 1 177 ? 10.714 4.824   -2.569  1.00 19.47 ? 177 ILE A CG2   1 
ATOM   1170 C CD1   . ILE A 1 177 ? 8.487  5.936   -0.621  1.00 22.20 ? 177 ILE A CD1   1 
ATOM   1171 N N     . CYS A 1 178 ? 11.646 1.803   -3.328  1.00 19.64 ? 178 CYS A N     1 
ATOM   1172 C CA    . CYS A 1 178 ? 12.929 1.405   -3.912  1.00 19.22 ? 178 CYS A CA    1 
ATOM   1173 C C     . CYS A 1 178 ? 13.357 2.555   -4.830  1.00 18.68 ? 178 CYS A C     1 
ATOM   1174 O O     . CYS A 1 178 ? 12.552 3.065   -5.601  1.00 18.08 ? 178 CYS A O     1 
ATOM   1175 C CB    . CYS A 1 178 ? 12.756 0.107   -4.717  1.00 19.13 ? 178 CYS A CB    1 
ATOM   1176 S SG    . CYS A 1 178 ? 14.273 -0.615  -5.409  1.00 20.10 ? 178 CYS A SG    1 
ATOM   1177 N N     . HIS A 1 179 ? 14.624 2.959   -4.743  1.00 17.54 ? 179 HIS A N     1 
ATOM   1178 C CA    . HIS A 1 179 ? 15.132 4.059   -5.555  1.00 16.53 ? 179 HIS A CA    1 
ATOM   1179 C C     . HIS A 1 179 ? 15.257 3.656   -7.029  1.00 16.17 ? 179 HIS A C     1 
ATOM   1180 O O     . HIS A 1 179 ? 14.853 4.407   -7.911  1.00 15.54 ? 179 HIS A O     1 
ATOM   1181 C CB    . HIS A 1 179 ? 16.485 4.523   -5.001  1.00 15.47 ? 179 HIS A CB    1 
ATOM   1182 C CG    . HIS A 1 179 ? 17.081 5.677   -5.743  1.00 15.98 ? 179 HIS A CG    1 
ATOM   1183 N ND1   . HIS A 1 179 ? 17.039 6.973   -5.267  1.00 16.20 ? 179 HIS A ND1   1 
ATOM   1184 C CD2   . HIS A 1 179 ? 17.734 5.732   -6.928  1.00 14.32 ? 179 HIS A CD2   1 
ATOM   1185 C CE1   . HIS A 1 179 ? 17.638 7.774   -6.130  1.00 14.72 ? 179 HIS A CE1   1 
ATOM   1186 N NE2   . HIS A 1 179 ? 18.069 7.046   -7.145  1.00 17.10 ? 179 HIS A NE2   1 
ATOM   1187 N N     . ARG A 1 180 ? 15.826 2.474   -7.271  1.00 16.06 ? 180 ARG A N     1 
ATOM   1188 C CA    . ARG A 1 180 ? 15.990 1.909   -8.614  1.00 16.96 ? 180 ARG A CA    1 
ATOM   1189 C C     . ARG A 1 180 ? 17.013 2.578   -9.543  1.00 17.37 ? 180 ARG A C     1 
ATOM   1190 O O     . ARG A 1 180 ? 17.134 2.176   -10.706 1.00 18.13 ? 180 ARG A O     1 
ATOM   1191 C CB    . ARG A 1 180 ? 14.624 1.825   -9.320  1.00 16.22 ? 180 ARG A CB    1 
ATOM   1192 C CG    . ARG A 1 180 ? 13.562 1.049   -8.518  1.00 16.42 ? 180 ARG A CG    1 
ATOM   1193 C CD    . ARG A 1 180 ? 12.513 0.433   -9.442  1.00 16.49 ? 180 ARG A CD    1 
ATOM   1194 N NE    . ARG A 1 180 ? 11.716 1.457   -10.113 1.00 17.03 ? 180 ARG A NE    1 
ATOM   1195 C CZ    . ARG A 1 180 ? 10.698 1.193   -10.927 1.00 17.60 ? 180 ARG A CZ    1 
ATOM   1196 N NH1   . ARG A 1 180 ? 10.353 -0.067  -11.175 1.00 16.74 ? 180 ARG A NH1   1 
ATOM   1197 N NH2   . ARG A 1 180 ? 10.008 2.189   -11.472 1.00 17.50 ? 180 ARG A NH2   1 
ATOM   1198 N N     . ASP A 1 181 ? 17.745 3.580   -9.046  1.00 17.23 ? 181 ASP A N     1 
ATOM   1199 C CA    . ASP A 1 181 ? 18.783 4.240   -9.852  1.00 17.37 ? 181 ASP A CA    1 
ATOM   1200 C C     . ASP A 1 181 ? 19.949 4.701   -8.976  1.00 16.56 ? 181 ASP A C     1 
ATOM   1201 O O     . ASP A 1 181 ? 20.403 5.848   -9.076  1.00 16.89 ? 181 ASP A O     1 
ATOM   1202 C CB    . ASP A 1 181 ? 18.214 5.444   -10.610 1.00 17.87 ? 181 ASP A CB    1 
ATOM   1203 C CG    . ASP A 1 181 ? 19.094 5.871   -11.776 1.00 19.99 ? 181 ASP A CG    1 
ATOM   1204 O OD1   . ASP A 1 181 ? 19.907 5.046   -12.261 1.00 20.78 ? 181 ASP A OD1   1 
ATOM   1205 O OD2   . ASP A 1 181 ? 18.971 7.034   -12.208 1.00 21.11 ? 181 ASP A OD2   1 
ATOM   1206 N N     . ILE A 1 182 ? 20.425 3.810   -8.110  1.00 16.14 ? 182 ILE A N     1 
ATOM   1207 C CA    . ILE A 1 182 ? 21.543 4.138   -7.232  1.00 15.87 ? 182 ILE A CA    1 
ATOM   1208 C C     . ILE A 1 182 ? 22.832 4.120   -8.058  1.00 16.14 ? 182 ILE A C     1 
ATOM   1209 O O     . ILE A 1 182 ? 23.188 3.100   -8.662  1.00 15.99 ? 182 ILE A O     1 
ATOM   1210 C CB    . ILE A 1 182 ? 21.658 3.132   -6.054  1.00 15.34 ? 182 ILE A CB    1 
ATOM   1211 C CG1   . ILE A 1 182 ? 20.428 3.242   -5.131  1.00 14.60 ? 182 ILE A CG1   1 
ATOM   1212 C CG2   . ILE A 1 182 ? 22.975 3.369   -5.281  1.00 15.87 ? 182 ILE A CG2   1 
ATOM   1213 C CD1   . ILE A 1 182 ? 20.216 4.611   -4.467  1.00 14.54 ? 182 ILE A CD1   1 
ATOM   1214 N N     . LYS A 1 183 ? 23.518 5.260   -8.084  1.00 16.34 ? 183 LYS A N     1 
ATOM   1215 C CA    . LYS A 1 183 ? 24.763 5.411   -8.836  1.00 16.91 ? 183 LYS A CA    1 
ATOM   1216 C C     . LYS A 1 183 ? 25.483 6.664   -8.328  1.00 17.49 ? 183 LYS A C     1 
ATOM   1217 O O     . LYS A 1 183 ? 24.857 7.554   -7.744  1.00 16.90 ? 183 LYS A O     1 
ATOM   1218 C CB    . LYS A 1 183 ? 24.462 5.537   -10.336 1.00 16.32 ? 183 LYS A CB    1 
ATOM   1219 C CG    . LYS A 1 183 ? 23.633 6.747   -10.696 1.00 18.06 ? 183 LYS A CG    1 
ATOM   1220 C CD    . LYS A 1 183 ? 23.372 6.796   -12.193 1.00 19.29 ? 183 LYS A CD    1 
ATOM   1221 C CE    . LYS A 1 183 ? 22.628 8.054   -12.573 1.00 22.44 ? 183 LYS A CE    1 
ATOM   1222 N NZ    . LYS A 1 183 ? 22.262 8.026   -14.019 1.00 26.60 ? 183 LYS A NZ    1 
ATOM   1223 N N     . PRO A 1 184 ? 26.801 6.768   -8.572  1.00 18.65 ? 184 PRO A N     1 
ATOM   1224 C CA    . PRO A 1 184 ? 27.573 7.930   -8.106  1.00 18.72 ? 184 PRO A CA    1 
ATOM   1225 C C     . PRO A 1 184 ? 27.009 9.304   -8.415  1.00 18.58 ? 184 PRO A C     1 
ATOM   1226 O O     . PRO A 1 184 ? 27.101 10.206  -7.585  1.00 18.74 ? 184 PRO A O     1 
ATOM   1227 C CB    . PRO A 1 184 ? 28.959 7.716   -8.724  1.00 19.35 ? 184 PRO A CB    1 
ATOM   1228 C CG    . PRO A 1 184 ? 29.048 6.219   -8.893  1.00 19.38 ? 184 PRO A CG    1 
ATOM   1229 C CD    . PRO A 1 184 ? 27.651 5.808   -9.301  1.00 18.87 ? 184 PRO A CD    1 
ATOM   1230 N N     . GLN A 1 185 ? 26.427 9.465   -9.596  1.00 19.00 ? 185 GLN A N     1 
ATOM   1231 C CA    . GLN A 1 185 ? 25.866 10.748  -9.998  1.00 20.70 ? 185 GLN A CA    1 
ATOM   1232 C C     . GLN A 1 185 ? 24.618 11.143  -9.213  1.00 19.85 ? 185 GLN A C     1 
ATOM   1233 O O     . GLN A 1 185 ? 24.219 12.310  -9.215  1.00 19.57 ? 185 GLN A O     1 
ATOM   1234 C CB    . GLN A 1 185 ? 25.532 10.731  -11.487 1.00 24.20 ? 185 GLN A CB    1 
ATOM   1235 C CG    . GLN A 1 185 ? 26.753 10.651  -12.379 1.00 30.41 ? 185 GLN A CG    1 
ATOM   1236 C CD    . GLN A 1 185 ? 26.414 10.161  -13.774 1.00 35.02 ? 185 GLN A CD    1 
ATOM   1237 O OE1   . GLN A 1 185 ? 25.746 10.861  -14.547 1.00 37.97 ? 185 GLN A OE1   1 
ATOM   1238 N NE2   . GLN A 1 185 ? 26.865 8.948   -14.106 1.00 36.63 ? 185 GLN A NE2   1 
ATOM   1239 N N     . ASN A 1 186 ? 23.998 10.174  -8.548  1.00 18.81 ? 186 ASN A N     1 
ATOM   1240 C CA    . ASN A 1 186 ? 22.803 10.466  -7.765  1.00 18.38 ? 186 ASN A CA    1 
ATOM   1241 C C     . ASN A 1 186 ? 23.103 10.572  -6.278  1.00 18.18 ? 186 ASN A C     1 
ATOM   1242 O O     . ASN A 1 186 ? 22.191 10.561  -5.449  1.00 17.88 ? 186 ASN A O     1 
ATOM   1243 C CB    . ASN A 1 186 ? 21.730 9.402   -8.027  1.00 17.74 ? 186 ASN A CB    1 
ATOM   1244 C CG    . ASN A 1 186 ? 21.085 9.571   -9.385  1.00 18.36 ? 186 ASN A CG    1 
ATOM   1245 O OD1   . ASN A 1 186 ? 21.151 10.651  -9.973  1.00 18.43 ? 186 ASN A OD1   1 
ATOM   1246 N ND2   . ASN A 1 186 ? 20.462 8.513   -9.895  1.00 16.98 ? 186 ASN A ND2   1 
ATOM   1247 N N     . LEU A 1 187 ? 24.384 10.688  -5.944  1.00 17.16 ? 187 LEU A N     1 
ATOM   1248 C CA    . LEU A 1 187 ? 24.810 10.819  -4.556  1.00 17.18 ? 187 LEU A CA    1 
ATOM   1249 C C     . LEU A 1 187 ? 25.466 12.186  -4.393  1.00 17.84 ? 187 LEU A C     1 
ATOM   1250 O O     . LEU A 1 187 ? 26.655 12.356  -4.704  1.00 17.58 ? 187 LEU A O     1 
ATOM   1251 C CB    . LEU A 1 187 ? 25.802 9.712   -4.202  1.00 16.88 ? 187 LEU A CB    1 
ATOM   1252 C CG    . LEU A 1 187 ? 25.303 8.284   -4.439  1.00 17.08 ? 187 LEU A CG    1 
ATOM   1253 C CD1   . LEU A 1 187 ? 26.398 7.298   -4.066  1.00 17.96 ? 187 LEU A CD1   1 
ATOM   1254 C CD2   . LEU A 1 187 ? 24.032 8.033   -3.605  1.00 16.41 ? 187 LEU A CD2   1 
ATOM   1255 N N     . LEU A 1 188 ? 24.686 13.161  -3.931  1.00 17.62 ? 188 LEU A N     1 
ATOM   1256 C CA    . LEU A 1 188 ? 25.195 14.520  -3.745  1.00 17.83 ? 188 LEU A CA    1 
ATOM   1257 C C     . LEU A 1 188 ? 26.084 14.599  -2.504  1.00 18.43 ? 188 LEU A C     1 
ATOM   1258 O O     . LEU A 1 188 ? 25.862 13.886  -1.524  1.00 17.26 ? 188 LEU A O     1 
ATOM   1259 C CB    . LEU A 1 188 ? 24.032 15.515  -3.635  1.00 17.84 ? 188 LEU A CB    1 
ATOM   1260 C CG    . LEU A 1 188 ? 22.995 15.468  -4.764  1.00 17.71 ? 188 LEU A CG    1 
ATOM   1261 C CD1   . LEU A 1 188 ? 21.947 16.548  -4.530  1.00 18.68 ? 188 LEU A CD1   1 
ATOM   1262 C CD2   . LEU A 1 188 ? 23.670 15.661  -6.115  1.00 18.05 ? 188 LEU A CD2   1 
ATOM   1263 N N     . LEU A 1 189 ? 27.087 15.471  -2.559  1.00 18.94 ? 189 LEU A N     1 
ATOM   1264 C CA    . LEU A 1 189 ? 28.036 15.631  -1.463  1.00 21.11 ? 189 LEU A CA    1 
ATOM   1265 C C     . LEU A 1 189 ? 28.392 17.073  -1.161  1.00 22.19 ? 189 LEU A C     1 
ATOM   1266 O O     . LEU A 1 189 ? 28.506 17.896  -2.068  1.00 21.41 ? 189 LEU A O     1 
ATOM   1267 C CB    . LEU A 1 189 ? 29.366 14.954  -1.801  1.00 21.94 ? 189 LEU A CB    1 
ATOM   1268 C CG    . LEU A 1 189 ? 29.565 13.455  -1.898  1.00 24.21 ? 189 LEU A CG    1 
ATOM   1269 C CD1   . LEU A 1 189 ? 30.993 13.177  -2.390  1.00 23.13 ? 189 LEU A CD1   1 
ATOM   1270 C CD2   . LEU A 1 189 ? 29.322 12.831  -0.526  1.00 24.55 ? 189 LEU A CD2   1 
ATOM   1271 N N     . ASP A 1 190 ? 28.575 17.363  0.121   1.00 24.06 ? 190 ASP A N     1 
ATOM   1272 C CA    . ASP A 1 190 ? 29.046 18.673  0.540   1.00 26.82 ? 190 ASP A CA    1 
ATOM   1273 C C     . ASP A 1 190 ? 30.417 18.299  1.106   1.00 27.64 ? 190 ASP A C     1 
ATOM   1274 O O     . ASP A 1 190 ? 30.517 17.841  2.241   1.00 27.08 ? 190 ASP A O     1 
ATOM   1275 C CB    . ASP A 1 190 ? 28.193 19.272  1.649   1.00 29.14 ? 190 ASP A CB    1 
ATOM   1276 C CG    . ASP A 1 190 ? 28.704 20.633  2.087   1.00 31.91 ? 190 ASP A CG    1 
ATOM   1277 O OD1   . ASP A 1 190 ? 29.887 20.941  1.821   1.00 34.82 ? 190 ASP A OD1   1 
ATOM   1278 O OD2   . ASP A 1 190 ? 27.931 21.396  2.694   1.00 34.09 ? 190 ASP A OD2   1 
ATOM   1279 N N     . PRO A 1 191 ? 31.487 18.474  0.309   1.00 29.12 ? 191 PRO A N     1 
ATOM   1280 C CA    . PRO A 1 191 ? 32.870 18.153  0.696   1.00 29.84 ? 191 PRO A CA    1 
ATOM   1281 C C     . PRO A 1 191 ? 33.369 18.672  2.039   1.00 29.82 ? 191 PRO A C     1 
ATOM   1282 O O     . PRO A 1 191 ? 34.106 17.974  2.737   1.00 30.70 ? 191 PRO A O     1 
ATOM   1283 C CB    . PRO A 1 191 ? 33.715 18.693  -0.467  1.00 30.37 ? 191 PRO A CB    1 
ATOM   1284 C CG    . PRO A 1 191 ? 32.803 19.610  -1.232  1.00 30.71 ? 191 PRO A CG    1 
ATOM   1285 C CD    . PRO A 1 191 ? 31.428 19.035  -1.051  1.00 30.27 ? 191 PRO A CD    1 
ATOM   1286 N N     . ASP A 1 192 ? 32.979 19.887  2.402   1.00 29.62 ? 192 ASP A N     1 
ATOM   1287 C CA    . ASP A 1 192 ? 33.431 20.464  3.658   1.00 29.78 ? 192 ASP A CA    1 
ATOM   1288 C C     . ASP A 1 192 ? 32.856 19.787  4.897   1.00 28.64 ? 192 ASP A C     1 
ATOM   1289 O O     . ASP A 1 192 ? 33.561 19.612  5.896   1.00 28.92 ? 192 ASP A O     1 
ATOM   1290 C CB    . ASP A 1 192 ? 33.112 21.957  3.687   1.00 32.57 ? 192 ASP A CB    1 
ATOM   1291 C CG    . ASP A 1 192 ? 33.903 22.741  2.645   1.00 35.15 ? 192 ASP A CG    1 
ATOM   1292 O OD1   . ASP A 1 192 ? 33.546 23.917  2.403   1.00 37.32 ? 192 ASP A OD1   1 
ATOM   1293 O OD2   . ASP A 1 192 ? 34.872 22.184  2.068   1.00 35.97 ? 192 ASP A OD2   1 
ATOM   1294 N N     . THR A 1 193 ? 31.586 19.398  4.838   1.00 26.28 ? 193 THR A N     1 
ATOM   1295 C CA    . THR A 1 193 ? 30.940 18.741  5.977   1.00 24.30 ? 193 THR A CA    1 
ATOM   1296 C C     . THR A 1 193 ? 30.929 17.214  5.858   1.00 23.06 ? 193 THR A C     1 
ATOM   1297 O O     . THR A 1 193 ? 30.677 16.505  6.834   1.00 22.25 ? 193 THR A O     1 
ATOM   1298 C CB    . THR A 1 193 ? 29.491 19.219  6.128   1.00 24.35 ? 193 THR A CB    1 
ATOM   1299 O OG1   . THR A 1 193 ? 28.758 18.859  4.953   1.00 22.93 ? 193 THR A OG1   1 
ATOM   1300 C CG2   . THR A 1 193 ? 29.441 20.735  6.298   1.00 23.99 ? 193 THR A CG2   1 
ATOM   1301 N N     . ALA A 1 194 ? 31.207 16.721  4.657   1.00 21.83 ? 194 ALA A N     1 
ATOM   1302 C CA    . ALA A 1 194 ? 31.220 15.289  4.380   1.00 21.37 ? 194 ALA A CA    1 
ATOM   1303 C C     . ALA A 1 194 ? 29.804 14.694  4.410   1.00 20.98 ? 194 ALA A C     1 
ATOM   1304 O O     . ALA A 1 194 ? 29.622 13.484  4.560   1.00 21.21 ? 194 ALA A O     1 
ATOM   1305 C CB    . ALA A 1 194 ? 32.124 14.569  5.366   1.00 21.40 ? 194 ALA A CB    1 
ATOM   1306 N N     . VAL A 1 195 ? 28.802 15.550  4.248   1.00 20.61 ? 195 VAL A N     1 
ATOM   1307 C CA    . VAL A 1 195 ? 27.421 15.096  4.233   1.00 19.54 ? 195 VAL A CA    1 
ATOM   1308 C C     . VAL A 1 195 ? 27.048 14.606  2.837   1.00 19.26 ? 195 VAL A C     1 
ATOM   1309 O O     . VAL A 1 195 ? 27.361 15.253  1.834   1.00 18.91 ? 195 VAL A O     1 
ATOM   1310 C CB    . VAL A 1 195 ? 26.446 16.230  4.634   1.00 19.96 ? 195 VAL A CB    1 
ATOM   1311 C CG1   . VAL A 1 195 ? 24.999 15.805  4.348   1.00 20.22 ? 195 VAL A CG1   1 
ATOM   1312 C CG2   . VAL A 1 195 ? 26.622 16.561  6.105   1.00 18.92 ? 195 VAL A CG2   1 
ATOM   1313 N N     . LEU A 1 196 ? 26.401 13.444  2.785   1.00 18.17 ? 196 LEU A N     1 
ATOM   1314 C CA    . LEU A 1 196 ? 25.948 12.860  1.525   1.00 17.36 ? 196 LEU A CA    1 
ATOM   1315 C C     . LEU A 1 196 ? 24.420 12.923  1.528   1.00 17.10 ? 196 LEU A C     1 
ATOM   1316 O O     . LEU A 1 196 ? 23.780 12.689  2.564   1.00 16.50 ? 196 LEU A O     1 
ATOM   1317 C CB    . LEU A 1 196 ? 26.400 11.393  1.409   1.00 17.05 ? 196 LEU A CB    1 
ATOM   1318 C CG    . LEU A 1 196 ? 25.885 10.601  0.190   1.00 17.81 ? 196 LEU A CG    1 
ATOM   1319 C CD1   . LEU A 1 196 ? 26.912 9.546   -0.207  1.00 18.37 ? 196 LEU A CD1   1 
ATOM   1320 C CD2   . LEU A 1 196 ? 24.530 9.945   0.497   1.00 17.36 ? 196 LEU A CD2   1 
ATOM   1321 N N     . LYS A 1 197 ? 23.845 13.255  0.379   1.00 16.59 ? 197 LYS A N     1 
ATOM   1322 C CA    . LYS A 1 197 ? 22.397 13.326  0.231   1.00 16.75 ? 197 LYS A CA    1 
ATOM   1323 C C     . LYS A 1 197 ? 21.974 12.636  -1.054  1.00 16.20 ? 197 LYS A C     1 
ATOM   1324 O O     . LYS A 1 197 ? 22.411 13.002  -2.147  1.00 15.79 ? 197 LYS A O     1 
ATOM   1325 C CB    . LYS A 1 197 ? 21.926 14.782  0.214   1.00 17.73 ? 197 LYS A CB    1 
ATOM   1326 C CG    . LYS A 1 197 ? 21.916 15.416  1.606   1.00 20.93 ? 197 LYS A CG    1 
ATOM   1327 C CD    . LYS A 1 197 ? 21.480 16.856  1.549   1.00 22.66 ? 197 LYS A CD    1 
ATOM   1328 C CE    . LYS A 1 197 ? 21.746 17.541  2.873   1.00 22.69 ? 197 LYS A CE    1 
ATOM   1329 N NZ    . LYS A 1 197 ? 21.280 16.717  4.013   1.00 25.66 ? 197 LYS A NZ    1 
ATOM   1330 N N     . LEU A 1 198 ? 21.130 11.623  -0.909  1.00 15.31 ? 198 LEU A N     1 
ATOM   1331 C CA    . LEU A 1 198 ? 20.608 10.871  -2.042  1.00 15.04 ? 198 LEU A CA    1 
ATOM   1332 C C     . LEU A 1 198 ? 19.635 11.758  -2.823  1.00 14.91 ? 198 LEU A C     1 
ATOM   1333 O O     . LEU A 1 198 ? 18.832 12.480  -2.228  1.00 14.30 ? 198 LEU A O     1 
ATOM   1334 C CB    . LEU A 1 198 ? 19.886 9.616   -1.530  1.00 14.31 ? 198 LEU A CB    1 
ATOM   1335 C CG    . LEU A 1 198 ? 19.180 8.718   -2.555  1.00 14.96 ? 198 LEU A CG    1 
ATOM   1336 C CD1   . LEU A 1 198 ? 20.179 8.073   -3.517  1.00 15.25 ? 198 LEU A CD1   1 
ATOM   1337 C CD2   . LEU A 1 198 ? 18.408 7.648   -1.784  1.00 14.83 ? 198 LEU A CD2   1 
ATOM   1338 N N     . CYS A 1 199 ? 19.715 11.720  -4.147  1.00 14.78 ? 199 CYS A N     1 
ATOM   1339 C CA    . CYS A 1 199 ? 18.831 12.528  -4.973  1.00 17.27 ? 199 CYS A CA    1 
ATOM   1340 C C     . CYS A 1 199 ? 18.285 11.753  -6.164  1.00 17.25 ? 199 CYS A C     1 
ATOM   1341 O O     . CYS A 1 199 ? 18.566 10.566  -6.332  1.00 18.09 ? 199 CYS A O     1 
ATOM   1342 C CB    . CYS A 1 199 ? 19.553 13.786  -5.472  1.00 17.23 ? 199 CYS A CB    1 
ATOM   1343 S SG    . CYS A 1 199 ? 20.688 13.521  -6.867  1.00 20.31 ? 199 CYS A SG    1 
ATOM   1344 N N     . ASP A 1 200 ? 17.488 12.445  -6.971  1.00 18.32 ? 200 ASP A N     1 
ATOM   1345 C CA    . ASP A 1 200 ? 16.865 11.892  -8.169  1.00 18.75 ? 200 ASP A CA    1 
ATOM   1346 C C     . ASP A 1 200 ? 15.924 10.736  -7.897  1.00 18.92 ? 200 ASP A C     1 
ATOM   1347 O O     . ASP A 1 200 ? 16.297 9.565   -8.029  1.00 19.47 ? 200 ASP A O     1 
ATOM   1348 C CB    . ASP A 1 200 ? 17.922 11.443  -9.175  1.00 19.25 ? 200 ASP A CB    1 
ATOM   1349 C CG    . ASP A 1 200 ? 17.308 11.004  -10.492 1.00 20.73 ? 200 ASP A CG    1 
ATOM   1350 O OD1   . ASP A 1 200 ? 16.068 11.141  -10.647 1.00 20.80 ? 200 ASP A OD1   1 
ATOM   1351 O OD2   . ASP A 1 200 ? 18.057 10.520  -11.364 1.00 21.57 ? 200 ASP A OD2   1 
ATOM   1352 N N     . PHE A 1 201 ? 14.691 11.063  -7.536  1.00 19.27 ? 201 PHE A N     1 
ATOM   1353 C CA    . PHE A 1 201 ? 13.708 10.027  -7.267  1.00 19.43 ? 201 PHE A CA    1 
ATOM   1354 C C     . PHE A 1 201 ? 12.814 9.787   -8.483  1.00 19.74 ? 201 PHE A C     1 
ATOM   1355 O O     . PHE A 1 201 ? 11.692 9.290   -8.361  1.00 19.89 ? 201 PHE A O     1 
ATOM   1356 C CB    . PHE A 1 201 ? 12.900 10.406  -6.027  1.00 19.36 ? 201 PHE A CB    1 
ATOM   1357 C CG    . PHE A 1 201 ? 13.680 10.236  -4.759  1.00 19.69 ? 201 PHE A CG    1 
ATOM   1358 C CD1   . PHE A 1 201 ? 14.594 11.208  -4.354  1.00 19.13 ? 201 PHE A CD1   1 
ATOM   1359 C CD2   . PHE A 1 201 ? 13.595 9.054   -4.037  1.00 18.92 ? 201 PHE A CD2   1 
ATOM   1360 C CE1   . PHE A 1 201 ? 15.415 10.997  -3.256  1.00 19.25 ? 201 PHE A CE1   1 
ATOM   1361 C CE2   . PHE A 1 201 ? 14.417 8.834   -2.935  1.00 19.21 ? 201 PHE A CE2   1 
ATOM   1362 C CZ    . PHE A 1 201 ? 15.328 9.806   -2.548  1.00 18.93 ? 201 PHE A CZ    1 
ATOM   1363 N N     . GLY A 1 202 ? 13.353 10.111  -9.655  1.00 19.05 ? 202 GLY A N     1 
ATOM   1364 C CA    . GLY A 1 202 ? 12.622 9.942   -10.900 1.00 19.94 ? 202 GLY A CA    1 
ATOM   1365 C C     . GLY A 1 202 ? 12.367 8.504   -11.323 1.00 20.34 ? 202 GLY A C     1 
ATOM   1366 O O     . GLY A 1 202 ? 11.568 8.261   -12.221 1.00 21.95 ? 202 GLY A O     1 
ATOM   1367 N N     . SER A 1 203 ? 13.037 7.546   -10.698 1.00 19.56 ? 203 SER A N     1 
ATOM   1368 C CA    . SER A 1 203 ? 12.837 6.142   -11.046 1.00 19.88 ? 203 SER A CA    1 
ATOM   1369 C C     . SER A 1 203 ? 12.257 5.397   -9.861  1.00 19.50 ? 203 SER A C     1 
ATOM   1370 O O     . SER A 1 203 ? 11.930 4.220   -9.966  1.00 19.59 ? 203 SER A O     1 
ATOM   1371 C CB    . SER A 1 203 ? 14.167 5.475   -11.421 1.00 20.18 ? 203 SER A CB    1 
ATOM   1372 O OG    . SER A 1 203 ? 14.681 5.998   -12.628 1.00 22.54 ? 203 SER A OG    1 
ATOM   1373 N N     . ALA A 1 204 ? 12.141 6.094   -8.733  1.00 19.37 ? 204 ALA A N     1 
ATOM   1374 C CA    . ALA A 1 204 ? 11.648 5.505   -7.496  1.00 19.97 ? 204 ALA A CA    1 
ATOM   1375 C C     . ALA A 1 204 ? 10.208 5.000   -7.570  1.00 20.54 ? 204 ALA A C     1 
ATOM   1376 O O     . ALA A 1 204 ? 9.368  5.559   -8.269  1.00 20.42 ? 204 ALA A O     1 
ATOM   1377 C CB    . ALA A 1 204 ? 11.804 6.508   -6.351  1.00 19.59 ? 204 ALA A CB    1 
ATOM   1378 N N     . LYS A 1 205 ? 9.935  3.933   -6.833  1.00 22.86 ? 205 LYS A N     1 
ATOM   1379 C CA    . LYS A 1 205 ? 8.606  3.337   -6.826  1.00 24.27 ? 205 LYS A CA    1 
ATOM   1380 C C     . LYS A 1 205 ? 8.391  2.415   -5.637  1.00 25.17 ? 205 LYS A C     1 
ATOM   1381 O O     . LYS A 1 205 ? 9.299  1.693   -5.207  1.00 23.72 ? 205 LYS A O     1 
ATOM   1382 C CB    . LYS A 1 205 ? 8.395  2.545   -8.122  1.00 24.60 ? 205 LYS A CB    1 
ATOM   1383 C CG    . LYS A 1 205 ? 7.029  1.882   -8.253  1.00 25.34 ? 205 LYS A CG    1 
ATOM   1384 C CD    . LYS A 1 205 ? 6.815  1.391   -9.682  1.00 26.14 ? 205 LYS A CD    1 
ATOM   1385 C CE    . LYS A 1 205 ? 5.352  1.025   -9.931  1.00 27.10 ? 205 LYS A CE    1 
ATOM   1386 N NZ    . LYS A 1 205 ? 5.010  -0.260  -9.279  1.00 26.87 ? 205 LYS A NZ    1 
ATOM   1387 N N     . GLN A 1 206 ? 7.183  2.438   -5.096  1.00 26.44 ? 206 GLN A N     1 
ATOM   1388 C CA    . GLN A 1 206 ? 6.886  1.558   -3.988  1.00 28.38 ? 206 GLN A CA    1 
ATOM   1389 C C     . GLN A 1 206 ? 6.695  0.168   -4.590  1.00 28.46 ? 206 GLN A C     1 
ATOM   1390 O O     . GLN A 1 206 ? 5.870  -0.018  -5.491  1.00 28.34 ? 206 GLN A O     1 
ATOM   1391 C CB    . GLN A 1 206 ? 5.611  2.005   -3.278  1.00 31.11 ? 206 GLN A CB    1 
ATOM   1392 C CG    . GLN A 1 206 ? 4.918  0.871   -2.547  1.00 35.55 ? 206 GLN A CG    1 
ATOM   1393 C CD    . GLN A 1 206 ? 4.331  1.307   -1.233  1.00 38.10 ? 206 GLN A CD    1 
ATOM   1394 O OE1   . GLN A 1 206 ? 4.355  2.493   -0.894  1.00 40.54 ? 206 GLN A OE1   1 
ATOM   1395 N NE2   . GLN A 1 206 ? 3.799  0.350   -0.475  1.00 38.77 ? 206 GLN A NE2   1 
ATOM   1396 N N     . LEU A 1 207 ? 7.470  -0.800  -4.113  1.00 28.61 ? 207 LEU A N     1 
ATOM   1397 C CA    . LEU A 1 207 ? 7.376  -2.162  -4.621  1.00 30.02 ? 207 LEU A CA    1 
ATOM   1398 C C     . LEU A 1 207 ? 6.431  -2.974  -3.760  1.00 31.68 ? 207 LEU A C     1 
ATOM   1399 O O     . LEU A 1 207 ? 6.610  -3.071  -2.546  1.00 32.11 ? 207 LEU A O     1 
ATOM   1400 C CB    . LEU A 1 207 ? 8.751  -2.824  -4.639  1.00 28.91 ? 207 LEU A CB    1 
ATOM   1401 C CG    . LEU A 1 207 ? 9.812  -2.085  -5.460  1.00 28.08 ? 207 LEU A CG    1 
ATOM   1402 C CD1   . LEU A 1 207 ? 11.073 -2.921  -5.533  1.00 27.86 ? 207 LEU A CD1   1 
ATOM   1403 C CD2   . LEU A 1 207 ? 9.273  -1.779  -6.850  1.00 27.16 ? 207 LEU A CD2   1 
ATOM   1404 N N     . VAL A 1 208 ? 5.424  -3.556  -4.401  1.00 33.22 ? 208 VAL A N     1 
ATOM   1405 C CA    . VAL A 1 208 ? 4.430  -4.360  -3.704  1.00 35.53 ? 208 VAL A CA    1 
ATOM   1406 C C     . VAL A 1 208 ? 4.592  -5.822  -4.088  1.00 37.14 ? 208 VAL A C     1 
ATOM   1407 O O     . VAL A 1 208 ? 4.523  -6.174  -5.266  1.00 37.42 ? 208 VAL A O     1 
ATOM   1408 C CB    . VAL A 1 208 ? 3.003  -3.902  -4.060  1.00 35.36 ? 208 VAL A CB    1 
ATOM   1409 C CG1   . VAL A 1 208 ? 1.987  -4.669  -3.226  1.00 35.74 ? 208 VAL A CG1   1 
ATOM   1410 C CG2   . VAL A 1 208 ? 2.869  -2.406  -3.830  1.00 35.13 ? 208 VAL A CG2   1 
ATOM   1411 N N     . ARG A 1 209 ? 4.821  -6.667  -3.091  1.00 39.36 ? 209 ARG A N     1 
ATOM   1412 C CA    . ARG A 1 209 ? 4.993  -8.091  -3.329  1.00 41.61 ? 209 ARG A CA    1 
ATOM   1413 C C     . ARG A 1 209 ? 3.896  -8.592  -4.271  1.00 41.55 ? 209 ARG A C     1 
ATOM   1414 O O     . ARG A 1 209 ? 2.715  -8.312  -4.066  1.00 41.91 ? 209 ARG A O     1 
ATOM   1415 C CB    . ARG A 1 209 ? 4.941  -8.841  -1.996  1.00 44.20 ? 209 ARG A CB    1 
ATOM   1416 C CG    . ARG A 1 209 ? 4.902  -10.350 -2.124  1.00 48.00 ? 209 ARG A CG    1 
ATOM   1417 C CD    . ARG A 1 209 ? 6.198  -10.882 -2.699  1.00 51.23 ? 209 ARG A CD    1 
ATOM   1418 N NE    . ARG A 1 209 ? 6.360  -12.315 -2.461  1.00 54.10 ? 209 ARG A NE    1 
ATOM   1419 C CZ    . ARG A 1 209 ? 7.444  -13.007 -2.804  1.00 55.55 ? 209 ARG A CZ    1 
ATOM   1420 N NH1   . ARG A 1 209 ? 8.461  -12.394 -3.402  1.00 56.47 ? 209 ARG A NH1   1 
ATOM   1421 N NH2   . ARG A 1 209 ? 7.515  -14.309 -2.549  1.00 55.99 ? 209 ARG A NH2   1 
ATOM   1422 N N     . GLY A 1 210 ? 4.288  -9.302  -5.324  1.00 41.32 ? 210 GLY A N     1 
ATOM   1423 C CA    . GLY A 1 210 ? 3.303  -9.817  -6.261  1.00 40.52 ? 210 GLY A CA    1 
ATOM   1424 C C     . GLY A 1 210 ? 2.967  -8.922  -7.442  1.00 40.22 ? 210 GLY A C     1 
ATOM   1425 O O     . GLY A 1 210 ? 2.395  -9.393  -8.421  1.00 40.50 ? 210 GLY A O     1 
ATOM   1426 N N     . GLU A 1 211 ? 3.296  -7.635  -7.354  1.00 39.50 ? 211 GLU A N     1 
ATOM   1427 C CA    . GLU A 1 211 ? 3.030  -6.700  -8.450  1.00 38.99 ? 211 GLU A CA    1 
ATOM   1428 C C     . GLU A 1 211 ? 4.276  -6.607  -9.331  1.00 37.48 ? 211 GLU A C     1 
ATOM   1429 O O     . GLU A 1 211 ? 5.365  -6.317  -8.840  1.00 37.85 ? 211 GLU A O     1 
ATOM   1430 C CB    . GLU A 1 211 ? 2.702  -5.315  -7.907  1.00 40.48 ? 211 GLU A CB    1 
ATOM   1431 C CG    . GLU A 1 211 ? 1.291  -5.174  -7.373  1.00 43.65 ? 211 GLU A CG    1 
ATOM   1432 C CD    . GLU A 1 211 ? 1.083  -3.854  -6.647  1.00 45.70 ? 211 GLU A CD    1 
ATOM   1433 O OE1   . GLU A 1 211 ? 1.902  -2.927  -6.856  1.00 47.37 ? 211 GLU A OE1   1 
ATOM   1434 O OE2   . GLU A 1 211 ? 0.106  -3.746  -5.870  1.00 46.69 ? 211 GLU A OE2   1 
ATOM   1435 N N     . PRO A 1 212 ? 4.130  -6.840  -10.645 1.00 35.99 ? 212 PRO A N     1 
ATOM   1436 C CA    . PRO A 1 212 ? 5.292  -6.771  -11.541 1.00 34.39 ? 212 PRO A CA    1 
ATOM   1437 C C     . PRO A 1 212 ? 5.830  -5.359  -11.760 1.00 32.64 ? 212 PRO A C     1 
ATOM   1438 O O     . PRO A 1 212 ? 5.084  -4.381  -11.718 1.00 32.41 ? 212 PRO A O     1 
ATOM   1439 C CB    . PRO A 1 212 ? 4.780  -7.395  -12.839 1.00 34.56 ? 212 PRO A CB    1 
ATOM   1440 C CG    . PRO A 1 212 ? 3.320  -7.111  -12.819 1.00 35.16 ? 212 PRO A CG    1 
ATOM   1441 C CD    . PRO A 1 212 ? 2.894  -7.172  -11.375 1.00 35.28 ? 212 PRO A CD    1 
ATOM   1442 N N     . ASN A 1 213 ? 7.133  -5.268  -12.001 1.00 30.54 ? 213 ASN A N     1 
ATOM   1443 C CA    . ASN A 1 213 ? 7.777  -3.987  -12.246 1.00 28.58 ? 213 ASN A CA    1 
ATOM   1444 C C     . ASN A 1 213 ? 8.767  -4.100  -13.411 1.00 27.27 ? 213 ASN A C     1 
ATOM   1445 O O     . ASN A 1 213 ? 9.305  -5.178  -13.662 1.00 27.19 ? 213 ASN A O     1 
ATOM   1446 C CB    . ASN A 1 213 ? 8.471  -3.526  -10.971 1.00 28.23 ? 213 ASN A CB    1 
ATOM   1447 C CG    . ASN A 1 213 ? 7.479  -3.057  -9.918  1.00 28.73 ? 213 ASN A CG    1 
ATOM   1448 O OD1   . ASN A 1 213 ? 6.863  -1.990  -10.052 1.00 28.14 ? 213 ASN A OD1   1 
ATOM   1449 N ND2   . ASN A 1 213 ? 7.310  -3.856  -8.872  1.00 28.42 ? 213 ASN A ND2   1 
ATOM   1450 N N     . VAL A 1 214 ? 8.995  -2.996  -14.121 1.00 26.23 ? 214 VAL A N     1 
ATOM   1451 C CA    . VAL A 1 214 ? 9.900  -3.010  -15.270 1.00 26.34 ? 214 VAL A CA    1 
ATOM   1452 C C     . VAL A 1 214 ? 11.346 -3.303  -14.916 1.00 26.69 ? 214 VAL A C     1 
ATOM   1453 O O     . VAL A 1 214 ? 11.876 -2.811  -13.918 1.00 26.08 ? 214 VAL A O     1 
ATOM   1454 C CB    . VAL A 1 214 ? 9.852  -1.693  -16.053 1.00 26.47 ? 214 VAL A CB    1 
ATOM   1455 C CG1   . VAL A 1 214 ? 8.456  -1.476  -16.561 1.00 27.19 ? 214 VAL A CG1   1 
ATOM   1456 C CG2   . VAL A 1 214 ? 10.311 -0.533  -15.186 1.00 26.10 ? 214 VAL A CG2   1 
ATOM   1457 N N     . SER A 1 215 ? 11.990 -4.103  -15.757 1.00 26.38 ? 215 SER A N     1 
ATOM   1458 C CA    . SER A 1 215 ? 13.365 -4.485  -15.514 1.00 26.27 ? 215 SER A CA    1 
ATOM   1459 C C     . SER A 1 215 ? 14.373 -3.582  -16.219 1.00 25.32 ? 215 SER A C     1 
ATOM   1460 O O     . SER A 1 215 ? 15.573 -3.825  -16.131 1.00 26.31 ? 215 SER A O     1 
ATOM   1461 C CB    . SER A 1 215 ? 13.577 -5.940  -15.939 1.00 26.15 ? 215 SER A CB    1 
ATOM   1462 O OG    . SER A 1 215 ? 13.360 -6.083  -17.331 1.00 28.59 ? 215 SER A OG    1 
ATOM   1463 N N     . TYR A 1 216 ? 13.903 -2.539  -16.899 1.00 23.98 ? 216 TYR A N     1 
ATOM   1464 C CA    . TYR A 1 216 ? 14.836 -1.659  -17.590 1.00 23.65 ? 216 TYR A CA    1 
ATOM   1465 C C     . TYR A 1 216 ? 15.225 -0.394  -16.843 1.00 23.10 ? 216 TYR A C     1 
ATOM   1466 O O     . TYR A 1 216 ? 15.728 0.555   -17.450 1.00 22.56 ? 216 TYR A O     1 
ATOM   1467 C CB    . TYR A 1 216 ? 14.325 -1.284  -18.987 1.00 25.29 ? 216 TYR A CB    1 
ATOM   1468 C CG    . TYR A 1 216 ? 12.897 -0.825  -19.038 1.00 27.09 ? 216 TYR A CG    1 
ATOM   1469 C CD1   . TYR A 1 216 ? 12.554 0.496   -18.756 1.00 28.31 ? 216 TYR A CD1   1 
ATOM   1470 C CD2   . TYR A 1 216 ? 11.887 -1.708  -19.409 1.00 28.28 ? 216 TYR A CD2   1 
ATOM   1471 C CE1   . TYR A 1 216 ? 11.227 0.926   -18.850 1.00 30.07 ? 216 TYR A CE1   1 
ATOM   1472 C CE2   . TYR A 1 216 ? 10.568 -1.294  -19.507 1.00 30.17 ? 216 TYR A CE2   1 
ATOM   1473 C CZ    . TYR A 1 216 ? 10.243 0.021   -19.229 1.00 30.49 ? 216 TYR A CZ    1 
ATOM   1474 O OH    . TYR A 1 216 ? 8.934  0.423   -19.356 1.00 32.88 ? 216 TYR A OH    1 
ATOM   1475 N N     . ILE A 1 217 ? 14.990 -0.360  -15.534 1.00 21.38 ? 217 ILE A N     1 
ATOM   1476 C CA    . ILE A 1 217 ? 15.405 0.802   -14.766 1.00 20.75 ? 217 ILE A CA    1 
ATOM   1477 C C     . ILE A 1 217 ? 16.845 0.517   -14.327 1.00 20.88 ? 217 ILE A C     1 
ATOM   1478 O O     . ILE A 1 217 ? 17.373 -0.573  -14.585 1.00 20.46 ? 217 ILE A O     1 
ATOM   1479 C CB    . ILE A 1 217 ? 14.505 1.052   -13.502 1.00 20.37 ? 217 ILE A CB    1 
ATOM   1480 C CG1   . ILE A 1 217 ? 13.950 -0.258  -12.941 1.00 19.60 ? 217 ILE A CG1   1 
ATOM   1481 C CG2   . ILE A 1 217 ? 13.362 2.001   -13.871 1.00 20.30 ? 217 ILE A CG2   1 
ATOM   1482 C CD1   . ILE A 1 217 ? 14.984 -1.143  -12.270 1.00 19.20 ? 217 ILE A CD1   1 
ATOM   1483 N N     . CYS A 1 218 ? 17.473 1.497   -13.684 1.00 21.34 ? 218 CYS A N     1 
ATOM   1484 C CA    . CYS A 1 218 ? 18.845 1.387   -13.183 1.00 21.86 ? 218 CYS A CA    1 
ATOM   1485 C C     . CYS A 1 218 ? 19.926 1.483   -14.259 1.00 23.03 ? 218 CYS A C     1 
ATOM   1486 O O     . CYS A 1 218 ? 19.852 0.842   -15.310 1.00 22.13 ? 218 CYS A O     1 
ATOM   1487 C CB    . CYS A 1 218 ? 19.031 0.101   -12.385 1.00 20.82 ? 218 CYS A CB    1 
ATOM   1488 S SG    . CYS A 1 218 ? 20.400 0.200   -11.201 1.00 24.28 ? 218 CYS A SG    1 
ATOM   1489 N N     . SER A 1 219 ? 20.945 2.287   -13.977 1.00 24.17 ? 219 SER A N     1 
ATOM   1490 C CA    . SER A 1 219 ? 22.031 2.502   -14.928 1.00 25.31 ? 219 SER A CA    1 
ATOM   1491 C C     . SER A 1 219 ? 23.022 1.363   -15.039 1.00 25.86 ? 219 SER A C     1 
ATOM   1492 O O     . SER A 1 219 ? 23.304 0.662   -14.068 1.00 24.07 ? 219 SER A O     1 
ATOM   1493 C CB    . SER A 1 219 ? 22.772 3.788   -14.579 1.00 26.07 ? 219 SER A CB    1 
ATOM   1494 O OG    . SER A 1 219 ? 21.839 4.849   -14.491 1.00 29.89 ? 219 SER A OG    1 
ATOM   1495 N N     . ARG A 1 220 ? 23.552 1.201   -16.246 1.00 27.86 ? 220 ARG A N     1 
ATOM   1496 C CA    . ARG A 1 220 ? 24.539 0.171   -16.539 1.00 30.34 ? 220 ARG A CA    1 
ATOM   1497 C C     . ARG A 1 220 ? 25.742 0.314   -15.608 1.00 29.39 ? 220 ARG A C     1 
ATOM   1498 O O     . ARG A 1 220 ? 26.188 1.426   -15.308 1.00 30.16 ? 220 ARG A O     1 
ATOM   1499 C CB    . ARG A 1 220 ? 24.990 0.289   -18.000 1.00 33.98 ? 220 ARG A CB    1 
ATOM   1500 C CG    . ARG A 1 220 ? 25.729 1.591   -18.325 1.00 38.78 ? 220 ARG A CG    1 
ATOM   1501 C CD    . ARG A 1 220 ? 26.655 1.406   -19.529 1.00 43.51 ? 220 ARG A CD    1 
ATOM   1502 N NE    . ARG A 1 220 ? 27.693 2.435   -19.601 1.00 47.58 ? 220 ARG A NE    1 
ATOM   1503 C CZ    . ARG A 1 220 ? 28.623 2.490   -20.551 1.00 49.23 ? 220 ARG A CZ    1 
ATOM   1504 N NH1   . ARG A 1 220 ? 29.528 3.464   -20.538 1.00 49.82 ? 220 ARG A NH1   1 
ATOM   1505 N NH2   . ARG A 1 220 ? 28.644 1.572   -21.515 1.00 49.85 ? 220 ARG A NH2   1 
ATOM   1506 N N     . TYR A 1 221 ? 26.264 -0.828  -15.183 1.00 28.03 ? 221 TYR A N     1 
ATOM   1507 C CA    . TYR A 1 221 ? 27.387 -0.943  -14.255 1.00 26.93 ? 221 TYR A CA    1 
ATOM   1508 C C     . TYR A 1 221 ? 26.830 -1.191  -12.862 1.00 24.44 ? 221 TYR A C     1 
ATOM   1509 O O     . TYR A 1 221 ? 27.443 -1.915  -12.087 1.00 23.81 ? 221 TYR A O     1 
ATOM   1510 C CB    . TYR A 1 221 ? 28.258 0.323   -14.190 1.00 28.75 ? 221 TYR A CB    1 
ATOM   1511 C CG    . TYR A 1 221 ? 29.073 0.623   -15.426 1.00 31.35 ? 221 TYR A CG    1 
ATOM   1512 C CD1   . TYR A 1 221 ? 28.968 -0.167  -16.574 1.00 32.69 ? 221 TYR A CD1   1 
ATOM   1513 C CD2   . TYR A 1 221 ? 29.920 1.733   -15.462 1.00 32.51 ? 221 TYR A CD2   1 
ATOM   1514 C CE1   . TYR A 1 221 ? 29.687 0.146   -17.730 1.00 34.45 ? 221 TYR A CE1   1 
ATOM   1515 C CE2   . TYR A 1 221 ? 30.641 2.054   -16.608 1.00 33.34 ? 221 TYR A CE2   1 
ATOM   1516 C CZ    . TYR A 1 221 ? 30.520 1.259   -17.735 1.00 34.43 ? 221 TYR A CZ    1 
ATOM   1517 O OH    . TYR A 1 221 ? 31.236 1.577   -18.868 1.00 36.93 ? 221 TYR A OH    1 
ATOM   1518 N N     . TYR A 1 222 ? 25.662 -0.608  -12.561 1.00 22.56 ? 222 TYR A N     1 
ATOM   1519 C CA    . TYR A 1 222 ? 25.046 -0.732  -11.227 1.00 21.05 ? 222 TYR A CA    1 
ATOM   1520 C C     . TYR A 1 222 ? 23.802 -1.618  -11.142 1.00 21.29 ? 222 TYR A C     1 
ATOM   1521 O O     . TYR A 1 222 ? 23.233 -1.787  -10.063 1.00 20.02 ? 222 TYR A O     1 
ATOM   1522 C CB    . TYR A 1 222 ? 24.720 0.672   -10.680 1.00 20.73 ? 222 TYR A CB    1 
ATOM   1523 C CG    . TYR A 1 222 ? 25.891 1.615   -10.812 1.00 19.56 ? 222 TYR A CG    1 
ATOM   1524 C CD1   . TYR A 1 222 ? 26.957 1.557   -9.914  1.00 19.82 ? 222 TYR A CD1   1 
ATOM   1525 C CD2   . TYR A 1 222 ? 25.997 2.475   -11.909 1.00 21.14 ? 222 TYR A CD2   1 
ATOM   1526 C CE1   . TYR A 1 222 ? 28.108 2.322   -10.109 1.00 20.32 ? 222 TYR A CE1   1 
ATOM   1527 C CE2   . TYR A 1 222 ? 27.141 3.247   -12.117 1.00 20.19 ? 222 TYR A CE2   1 
ATOM   1528 C CZ    . TYR A 1 222 ? 28.195 3.161   -11.216 1.00 21.23 ? 222 TYR A CZ    1 
ATOM   1529 O OH    . TYR A 1 222 ? 29.341 3.892   -11.442 1.00 20.73 ? 222 TYR A OH    1 
ATOM   1530 N N     . ARG A 1 223 ? 23.398 -2.192  -12.274 1.00 21.47 ? 223 ARG A N     1 
ATOM   1531 C CA    . ARG A 1 223 ? 22.216 -3.061  -12.341 1.00 22.16 ? 223 ARG A CA    1 
ATOM   1532 C C     . ARG A 1 223 ? 22.404 -4.423  -11.673 1.00 21.59 ? 223 ARG A C     1 
ATOM   1533 O O     . ARG A 1 223 ? 23.375 -5.133  -11.964 1.00 21.52 ? 223 ARG A O     1 
ATOM   1534 C CB    . ARG A 1 223 ? 21.838 -3.301  -13.802 1.00 23.78 ? 223 ARG A CB    1 
ATOM   1535 C CG    . ARG A 1 223 ? 21.136 -2.146  -14.467 1.00 26.69 ? 223 ARG A CG    1 
ATOM   1536 C CD    . ARG A 1 223 ? 21.252 -2.235  -15.978 1.00 28.95 ? 223 ARG A CD    1 
ATOM   1537 N NE    . ARG A 1 223 ? 20.514 -3.358  -16.555 1.00 32.16 ? 223 ARG A NE    1 
ATOM   1538 C CZ    . ARG A 1 223 ? 19.190 -3.497  -16.522 1.00 32.05 ? 223 ARG A CZ    1 
ATOM   1539 N NH1   . ARG A 1 223 ? 18.431 -2.587  -15.935 1.00 32.53 ? 223 ARG A NH1   1 
ATOM   1540 N NH2   . ARG A 1 223 ? 18.621 -4.543  -17.100 1.00 33.88 ? 223 ARG A NH2   1 
ATOM   1541 N N     . ALA A 1 224 ? 21.469 -4.802  -10.799 1.00 20.66 ? 224 ALA A N     1 
ATOM   1542 C CA    . ALA A 1 224 ? 21.544 -6.106  -10.134 1.00 20.92 ? 224 ALA A CA    1 
ATOM   1543 C C     . ALA A 1 224 ? 21.393 -7.176  -11.214 1.00 20.91 ? 224 ALA A C     1 
ATOM   1544 O O     . ALA A 1 224 ? 20.741 -6.942  -12.235 1.00 20.20 ? 224 ALA A O     1 
ATOM   1545 C CB    . ALA A 1 224 ? 20.434 -6.242  -9.092  1.00 20.50 ? 224 ALA A CB    1 
ATOM   1546 N N     . PRO A 1 225 ? 22.013 -8.352  -11.018 1.00 21.79 ? 225 PRO A N     1 
ATOM   1547 C CA    . PRO A 1 225 ? 21.917 -9.427  -12.014 1.00 22.54 ? 225 PRO A CA    1 
ATOM   1548 C C     . PRO A 1 225 ? 20.494 -9.844  -12.370 1.00 23.24 ? 225 PRO A C     1 
ATOM   1549 O O     . PRO A 1 225 ? 20.205 -10.135 -13.531 1.00 23.99 ? 225 PRO A O     1 
ATOM   1550 C CB    . PRO A 1 225 ? 22.734 -10.571 -11.404 1.00 22.60 ? 225 PRO A CB    1 
ATOM   1551 C CG    . PRO A 1 225 ? 22.876 -10.225 -9.943  1.00 21.81 ? 225 PRO A CG    1 
ATOM   1552 C CD    . PRO A 1 225 ? 22.860 -8.730  -9.874  1.00 21.70 ? 225 PRO A CD    1 
ATOM   1553 N N     . GLU A 1 226 ? 19.595 -9.865  -11.389 1.00 23.24 ? 226 GLU A N     1 
ATOM   1554 C CA    . GLU A 1 226 ? 18.226 -10.251 -11.677 1.00 23.14 ? 226 GLU A CA    1 
ATOM   1555 C C     . GLU A 1 226 ? 17.604 -9.299  -12.695 1.00 22.91 ? 226 GLU A C     1 
ATOM   1556 O O     . GLU A 1 226 ? 16.727 -9.701  -13.466 1.00 22.52 ? 226 GLU A O     1 
ATOM   1557 C CB    . GLU A 1 226 ? 17.381 -10.309 -10.392 1.00 23.00 ? 226 GLU A CB    1 
ATOM   1558 C CG    . GLU A 1 226 ? 17.327 -9.033  -9.572  1.00 23.44 ? 226 GLU A CG    1 
ATOM   1559 C CD    . GLU A 1 226 ? 18.328 -9.034  -8.428  1.00 24.29 ? 226 GLU A CD    1 
ATOM   1560 O OE1   . GLU A 1 226 ? 19.437 -9.591  -8.597  1.00 24.32 ? 226 GLU A OE1   1 
ATOM   1561 O OE2   . GLU A 1 226 ? 18.008 -8.471  -7.358  1.00 23.95 ? 226 GLU A OE2   1 
ATOM   1562 N N     . LEU A 1 227 ? 18.064 -8.045  -12.707 1.00 22.14 ? 227 LEU A N     1 
ATOM   1563 C CA    . LEU A 1 227 ? 17.564 -7.051  -13.658 1.00 22.30 ? 227 LEU A CA    1 
ATOM   1564 C C     . LEU A 1 227 ? 18.122 -7.371  -15.053 1.00 22.66 ? 227 LEU A C     1 
ATOM   1565 O O     . LEU A 1 227 ? 17.405 -7.297  -16.054 1.00 22.56 ? 227 LEU A O     1 
ATOM   1566 C CB    . LEU A 1 227 ? 17.999 -5.632  -13.254 1.00 21.85 ? 227 LEU A CB    1 
ATOM   1567 C CG    . LEU A 1 227 ? 17.365 -4.989  -12.009 1.00 21.73 ? 227 LEU A CG    1 
ATOM   1568 C CD1   . LEU A 1 227 ? 17.962 -3.606  -11.826 1.00 20.70 ? 227 LEU A CD1   1 
ATOM   1569 C CD2   . LEU A 1 227 ? 15.849 -4.904  -12.144 1.00 21.68 ? 227 LEU A CD2   1 
ATOM   1570 N N     . ILE A 1 228 ? 19.403 -7.720  -15.116 1.00 22.74 ? 228 ILE A N     1 
ATOM   1571 C CA    . ILE A 1 228 ? 20.013 -8.058  -16.394 1.00 23.58 ? 228 ILE A CA    1 
ATOM   1572 C C     . ILE A 1 228 ? 19.288 -9.291  -16.948 1.00 24.53 ? 228 ILE A C     1 
ATOM   1573 O O     . ILE A 1 228 ? 19.051 -9.396  -18.151 1.00 25.21 ? 228 ILE A O     1 
ATOM   1574 C CB    . ILE A 1 228 ? 21.519 -8.346  -16.237 1.00 23.35 ? 228 ILE A CB    1 
ATOM   1575 C CG1   . ILE A 1 228 ? 22.238 -7.087  -15.730 1.00 23.51 ? 228 ILE A CG1   1 
ATOM   1576 C CG2   . ILE A 1 228 ? 22.116 -8.728  -17.586 1.00 23.72 ? 228 ILE A CG2   1 
ATOM   1577 C CD1   . ILE A 1 228 ? 23.639 -7.335  -15.208 1.00 22.46 ? 228 ILE A CD1   1 
ATOM   1578 N N     . PHE A 1 229 ? 18.925 -10.209 -16.059 1.00 25.17 ? 229 PHE A N     1 
ATOM   1579 C CA    . PHE A 1 229 ? 18.211 -11.423 -16.445 1.00 26.66 ? 229 PHE A CA    1 
ATOM   1580 C C     . PHE A 1 229 ? 16.736 -11.149 -16.726 1.00 27.14 ? 229 PHE A C     1 
ATOM   1581 O O     . PHE A 1 229 ? 15.972 -12.080 -16.945 1.00 28.69 ? 229 PHE A O     1 
ATOM   1582 C CB    . PHE A 1 229 ? 18.314 -12.482 -15.343 1.00 26.43 ? 229 PHE A CB    1 
ATOM   1583 C CG    . PHE A 1 229 ? 19.608 -13.238 -15.342 1.00 27.67 ? 229 PHE A CG    1 
ATOM   1584 C CD1   . PHE A 1 229 ? 20.405 -13.273 -14.204 1.00 28.72 ? 229 PHE A CD1   1 
ATOM   1585 C CD2   . PHE A 1 229 ? 20.027 -13.927 -16.469 1.00 28.89 ? 229 PHE A CD2   1 
ATOM   1586 C CE1   . PHE A 1 229 ? 21.603 -13.985 -14.187 1.00 29.55 ? 229 PHE A CE1   1 
ATOM   1587 C CE2   . PHE A 1 229 ? 21.225 -14.644 -16.464 1.00 29.82 ? 229 PHE A CE2   1 
ATOM   1588 C CZ    . PHE A 1 229 ? 22.014 -14.673 -15.321 1.00 30.01 ? 229 PHE A CZ    1 
ATOM   1589 N N     . GLY A 1 230 ? 16.328 -9.884  -16.690 1.00 27.29 ? 230 GLY A N     1 
ATOM   1590 C CA    . GLY A 1 230 ? 14.946 -9.530  -16.976 1.00 27.25 ? 230 GLY A CA    1 
ATOM   1591 C C     . GLY A 1 230 ? 13.847 -9.801  -15.950 1.00 28.08 ? 230 GLY A C     1 
ATOM   1592 O O     . GLY A 1 230 ? 12.667 -9.835  -16.310 1.00 27.16 ? 230 GLY A O     1 
ATOM   1593 N N     . ALA A 1 231 ? 14.200 -9.984  -14.681 1.00 28.10 ? 231 ALA A N     1 
ATOM   1594 C CA    . ALA A 1 231 ? 13.182 -10.235 -13.662 1.00 27.61 ? 231 ALA A CA    1 
ATOM   1595 C C     . ALA A 1 231 ? 12.242 -9.041  -13.502 1.00 27.90 ? 231 ALA A C     1 
ATOM   1596 O O     . ALA A 1 231 ? 12.640 -7.893  -13.698 1.00 27.71 ? 231 ALA A O     1 
ATOM   1597 C CB    . ALA A 1 231 ? 13.841 -10.557 -12.332 1.00 27.81 ? 231 ALA A CB    1 
ATOM   1598 N N     . THR A 1 232 ? 10.987 -9.320  -13.158 1.00 27.86 ? 232 THR A N     1 
ATOM   1599 C CA    . THR A 1 232 ? 9.990  -8.267  -12.952 1.00 27.90 ? 232 THR A CA    1 
ATOM   1600 C C     . THR A 1 232 ? 9.436  -8.384  -11.530 1.00 27.72 ? 232 THR A C     1 
ATOM   1601 O O     . THR A 1 232 ? 8.595  -7.592  -11.106 1.00 27.49 ? 232 THR A O     1 
ATOM   1602 C CB    . THR A 1 232 ? 8.821  -8.389  -13.950 1.00 28.28 ? 232 THR A CB    1 
ATOM   1603 O OG1   . THR A 1 232 ? 8.291  -9.720  -13.892 1.00 28.83 ? 232 THR A OG1   1 
ATOM   1604 C CG2   . THR A 1 232 ? 9.286  -8.080  -15.370 1.00 27.88 ? 232 THR A CG2   1 
ATOM   1605 N N     . ASP A 1 233 ? 9.921  -9.385  -10.806 1.00 28.01 ? 233 ASP A N     1 
ATOM   1606 C CA    . ASP A 1 233 ? 9.501  -9.638  -9.434  1.00 28.94 ? 233 ASP A CA    1 
ATOM   1607 C C     . ASP A 1 233 ? 10.620 -9.297  -8.443  1.00 27.93 ? 233 ASP A C     1 
ATOM   1608 O O     . ASP A 1 233 ? 10.674 -9.839  -7.335  1.00 27.39 ? 233 ASP A O     1 
ATOM   1609 C CB    . ASP A 1 233 ? 9.114  -11.111 -9.273  1.00 30.79 ? 233 ASP A CB    1 
ATOM   1610 C CG    . ASP A 1 233 ? 10.298 -12.049 -9.444  1.00 33.35 ? 233 ASP A CG    1 
ATOM   1611 O OD1   . ASP A 1 233 ? 11.331 -11.629 -10.014 1.00 34.35 ? 233 ASP A OD1   1 
ATOM   1612 O OD2   . ASP A 1 233 ? 10.199 -13.214 -9.003  1.00 35.14 ? 233 ASP A OD2   1 
ATOM   1613 N N     . TYR A 1 234 ? 11.517 -8.404  -8.847  1.00 26.37 ? 234 TYR A N     1 
ATOM   1614 C CA    . TYR A 1 234 ? 12.622 -8.013  -7.979  1.00 24.75 ? 234 TYR A CA    1 
ATOM   1615 C C     . TYR A 1 234 ? 12.144 -7.198  -6.772  1.00 24.28 ? 234 TYR A C     1 
ATOM   1616 O O     . TYR A 1 234 ? 11.022 -6.696  -6.742  1.00 24.07 ? 234 TYR A O     1 
ATOM   1617 C CB    . TYR A 1 234 ? 13.661 -7.219  -8.780  1.00 23.32 ? 234 TYR A CB    1 
ATOM   1618 C CG    . TYR A 1 234 ? 13.120 -5.979  -9.445  1.00 21.72 ? 234 TYR A CG    1 
ATOM   1619 C CD1   . TYR A 1 234 ? 13.053 -4.762  -8.755  1.00 21.02 ? 234 TYR A CD1   1 
ATOM   1620 C CD2   . TYR A 1 234 ? 12.695 -6.008  -10.771 1.00 20.85 ? 234 TYR A CD2   1 
ATOM   1621 C CE1   . TYR A 1 234 ? 12.578 -3.610  -9.372  1.00 19.82 ? 234 TYR A CE1   1 
ATOM   1622 C CE2   . TYR A 1 234 ? 12.220 -4.862  -11.400 1.00 20.73 ? 234 TYR A CE2   1 
ATOM   1623 C CZ    . TYR A 1 234 ? 12.162 -3.666  -10.698 1.00 20.46 ? 234 TYR A CZ    1 
ATOM   1624 O OH    . TYR A 1 234 ? 11.686 -2.534  -11.324 1.00 20.23 ? 234 TYR A OH    1 
ATOM   1625 N N     . THR A 1 235 ? 13.017 -7.068  -5.781  1.00 24.65 ? 235 THR A N     1 
ATOM   1626 C CA    . THR A 1 235 ? 12.702 -6.336  -4.558  1.00 24.05 ? 235 THR A CA    1 
ATOM   1627 C C     . THR A 1 235 ? 13.648 -5.148  -4.359  1.00 24.28 ? 235 THR A C     1 
ATOM   1628 O O     . THR A 1 235 ? 14.468 -4.834  -5.225  1.00 23.17 ? 235 THR A O     1 
ATOM   1629 C CB    . THR A 1 235 ? 12.847 -7.243  -3.344  1.00 24.63 ? 235 THR A CB    1 
ATOM   1630 O OG1   . THR A 1 235 ? 14.233 -7.565  -3.168  1.00 25.44 ? 235 THR A OG1   1 
ATOM   1631 C CG2   . THR A 1 235 ? 12.054 -8.533  -3.546  1.00 25.06 ? 235 THR A CG2   1 
ATOM   1632 N N     . SER A 1 236 ? 13.536 -4.508  -3.200  1.00 23.65 ? 236 SER A N     1 
ATOM   1633 C CA    . SER A 1 236 ? 14.365 -3.353  -2.867  1.00 23.21 ? 236 SER A CA    1 
ATOM   1634 C C     . SER A 1 236 ? 15.839 -3.722  -2.768  1.00 22.22 ? 236 SER A C     1 
ATOM   1635 O O     . SER A 1 236 ? 16.705 -2.839  -2.746  1.00 21.41 ? 236 SER A O     1 
ATOM   1636 C CB    . SER A 1 236 ? 13.894 -2.741  -1.544  1.00 23.60 ? 236 SER A CB    1 
ATOM   1637 O OG    . SER A 1 236 ? 12.630 -2.122  -1.714  1.00 27.21 ? 236 SER A OG    1 
ATOM   1638 N N     . SER A 1 237 ? 16.128 -5.019  -2.694  1.00 20.75 ? 237 SER A N     1 
ATOM   1639 C CA    . SER A 1 237 ? 17.507 -5.471  -2.602  1.00 20.59 ? 237 SER A CA    1 
ATOM   1640 C C     . SER A 1 237 ? 18.304 -5.148  -3.871  1.00 19.50 ? 237 SER A C     1 
ATOM   1641 O O     . SER A 1 237 ? 19.513 -5.360  -3.904  1.00 18.81 ? 237 SER A O     1 
ATOM   1642 C CB    . SER A 1 237 ? 17.574 -6.971  -2.310  1.00 21.22 ? 237 SER A CB    1 
ATOM   1643 O OG    . SER A 1 237 ? 17.136 -7.730  -3.419  1.00 24.47 ? 237 SER A OG    1 
ATOM   1644 N N     . ILE A 1 238 ? 17.641 -4.657  -4.918  1.00 18.94 ? 238 ILE A N     1 
ATOM   1645 C CA    . ILE A 1 238 ? 18.393 -4.287  -6.118  1.00 18.51 ? 238 ILE A CA    1 
ATOM   1646 C C     . ILE A 1 238 ? 19.191 -3.011  -5.782  1.00 18.30 ? 238 ILE A C     1 
ATOM   1647 O O     . ILE A 1 238 ? 20.240 -2.750  -6.373  1.00 18.27 ? 238 ILE A O     1 
ATOM   1648 C CB    . ILE A 1 238 ? 17.481 -4.013  -7.358  1.00 18.89 ? 238 ILE A CB    1 
ATOM   1649 C CG1   . ILE A 1 238 ? 16.558 -2.816  -7.106  1.00 18.22 ? 238 ILE A CG1   1 
ATOM   1650 C CG2   . ILE A 1 238 ? 16.671 -5.258  -7.704  1.00 18.53 ? 238 ILE A CG2   1 
ATOM   1651 C CD1   . ILE A 1 238 ? 15.963 -2.226  -8.386  1.00 18.53 ? 238 ILE A CD1   1 
ATOM   1652 N N     . ASP A 1 239 ? 18.698 -2.229  -4.821  1.00 17.90 ? 239 ASP A N     1 
ATOM   1653 C CA    . ASP A 1 239 ? 19.378 -0.988  -4.414  1.00 17.15 ? 239 ASP A CA    1 
ATOM   1654 C C     . ASP A 1 239 ? 20.646 -1.344  -3.648  1.00 17.15 ? 239 ASP A C     1 
ATOM   1655 O O     . ASP A 1 239 ? 21.638 -0.609  -3.675  1.00 16.70 ? 239 ASP A O     1 
ATOM   1656 C CB    . ASP A 1 239 ? 18.496 -0.141  -3.485  1.00 16.86 ? 239 ASP A CB    1 
ATOM   1657 C CG    . ASP A 1 239 ? 17.470 0.714   -4.233  1.00 16.61 ? 239 ASP A CG    1 
ATOM   1658 O OD1   . ASP A 1 239 ? 16.552 1.228   -3.553  1.00 16.56 ? 239 ASP A OD1   1 
ATOM   1659 O OD2   . ASP A 1 239 ? 17.570 0.885   -5.471  1.00 16.52 ? 239 ASP A OD2   1 
ATOM   1660 N N     . VAL A 1 240 ? 20.601 -2.469  -2.944  1.00 17.30 ? 240 VAL A N     1 
ATOM   1661 C CA    . VAL A 1 240 ? 21.752 -2.913  -2.159  1.00 17.26 ? 240 VAL A CA    1 
ATOM   1662 C C     . VAL A 1 240 ? 22.867 -3.409  -3.093  1.00 17.52 ? 240 VAL A C     1 
ATOM   1663 O O     . VAL A 1 240 ? 24.057 -3.197  -2.832  1.00 16.51 ? 240 VAL A O     1 
ATOM   1664 C CB    . VAL A 1 240 ? 21.338 -4.019  -1.166  1.00 17.80 ? 240 VAL A CB    1 
ATOM   1665 C CG1   . VAL A 1 240 ? 22.558 -4.653  -0.548  1.00 17.88 ? 240 VAL A CG1   1 
ATOM   1666 C CG2   . VAL A 1 240 ? 20.453 -3.423  -0.076  1.00 17.18 ? 240 VAL A CG2   1 
ATOM   1667 N N     . TRP A 1 241 ? 22.489 -4.066  -4.186  1.00 16.75 ? 241 TRP A N     1 
ATOM   1668 C CA    . TRP A 1 241 ? 23.491 -4.527  -5.136  1.00 17.39 ? 241 TRP A CA    1 
ATOM   1669 C C     . TRP A 1 241 ? 24.174 -3.276  -5.698  1.00 16.88 ? 241 TRP A C     1 
ATOM   1670 O O     . TRP A 1 241 ? 25.404 -3.200  -5.725  1.00 16.80 ? 241 TRP A O     1 
ATOM   1671 C CB    . TRP A 1 241 ? 22.845 -5.334  -6.276  1.00 17.62 ? 241 TRP A CB    1 
ATOM   1672 C CG    . TRP A 1 241 ? 23.800 -5.636  -7.393  1.00 18.12 ? 241 TRP A CG    1 
ATOM   1673 C CD1   . TRP A 1 241 ? 24.155 -4.802  -8.421  1.00 18.60 ? 241 TRP A CD1   1 
ATOM   1674 C CD2   . TRP A 1 241 ? 24.557 -6.840  -7.576  1.00 19.40 ? 241 TRP A CD2   1 
ATOM   1675 N NE1   . TRP A 1 241 ? 25.088 -5.411  -9.228  1.00 18.63 ? 241 TRP A NE1   1 
ATOM   1676 C CE2   . TRP A 1 241 ? 25.354 -6.661  -8.735  1.00 18.98 ? 241 TRP A CE2   1 
ATOM   1677 C CE3   . TRP A 1 241 ? 24.642 -8.053  -6.875  1.00 19.12 ? 241 TRP A CE3   1 
ATOM   1678 C CZ2   . TRP A 1 241 ? 26.226 -7.650  -9.208  1.00 20.50 ? 241 TRP A CZ2   1 
ATOM   1679 C CZ3   . TRP A 1 241 ? 25.512 -9.039  -7.347  1.00 19.19 ? 241 TRP A CZ3   1 
ATOM   1680 C CH2   . TRP A 1 241 ? 26.292 -8.828  -8.504  1.00 19.46 ? 241 TRP A CH2   1 
ATOM   1681 N N     . SER A 1 242 ? 23.368 -2.299  -6.127  1.00 16.77 ? 242 SER A N     1 
ATOM   1682 C CA    . SER A 1 242 ? 23.882 -1.049  -6.686  1.00 17.01 ? 242 SER A CA    1 
ATOM   1683 C C     . SER A 1 242 ? 24.817 -0.360  -5.700  1.00 17.45 ? 242 SER A C     1 
ATOM   1684 O O     . SER A 1 242 ? 25.881 0.131   -6.086  1.00 17.12 ? 242 SER A O     1 
ATOM   1685 C CB    . SER A 1 242 ? 22.739 -0.099  -7.046  1.00 16.10 ? 242 SER A CB    1 
ATOM   1686 O OG    . SER A 1 242 ? 21.908 -0.655  -8.052  1.00 16.64 ? 242 SER A OG    1 
ATOM   1687 N N     . ALA A 1 243 ? 24.414 -0.314  -4.431  1.00 16.83 ? 243 ALA A N     1 
ATOM   1688 C CA    . ALA A 1 243 ? 25.255 0.293   -3.399  1.00 16.66 ? 243 ALA A CA    1 
ATOM   1689 C C     . ALA A 1 243 ? 26.590 -0.470  -3.313  1.00 16.83 ? 243 ALA A C     1 
ATOM   1690 O O     . ALA A 1 243 ? 27.660 0.128   -3.168  1.00 16.33 ? 243 ALA A O     1 
ATOM   1691 C CB    . ALA A 1 243 ? 24.531 0.269   -2.046  1.00 16.30 ? 243 ALA A CB    1 
ATOM   1692 N N     . GLY A 1 244 ? 26.525 -1.795  -3.407  1.00 17.52 ? 244 GLY A N     1 
ATOM   1693 C CA    . GLY A 1 244 ? 27.734 -2.600  -3.365  1.00 17.55 ? 244 GLY A CA    1 
ATOM   1694 C C     . GLY A 1 244 ? 28.645 -2.289  -4.542  1.00 18.17 ? 244 GLY A C     1 
ATOM   1695 O O     . GLY A 1 244 ? 29.867 -2.357  -4.427  1.00 18.24 ? 244 GLY A O     1 
ATOM   1696 N N     . CYS A 1 245 ? 28.060 -1.947  -5.685  1.00 18.75 ? 245 CYS A N     1 
ATOM   1697 C CA    . CYS A 1 245 ? 28.848 -1.622  -6.873  1.00 18.28 ? 245 CYS A CA    1 
ATOM   1698 C C     . CYS A 1 245 ? 29.543 -0.288  -6.651  1.00 18.29 ? 245 CYS A C     1 
ATOM   1699 O O     . CYS A 1 245 ? 30.663 -0.077  -7.115  1.00 18.06 ? 245 CYS A O     1 
ATOM   1700 C CB    . CYS A 1 245 ? 27.948 -1.533  -8.103  1.00 19.08 ? 245 CYS A CB    1 
ATOM   1701 S SG    . CYS A 1 245 ? 27.376 -3.137  -8.714  1.00 20.26 ? 245 CYS A SG    1 
ATOM   1702 N N     . VAL A 1 246 ? 28.875 0.621   -5.945  1.00 17.90 ? 246 VAL A N     1 
ATOM   1703 C CA    . VAL A 1 246 ? 29.463 1.925   -5.654  1.00 17.15 ? 246 VAL A CA    1 
ATOM   1704 C C     . VAL A 1 246 ? 30.643 1.749   -4.691  1.00 17.78 ? 246 VAL A C     1 
ATOM   1705 O O     . VAL A 1 246 ? 31.707 2.336   -4.895  1.00 18.21 ? 246 VAL A O     1 
ATOM   1706 C CB    . VAL A 1 246 ? 28.423 2.906   -5.031  1.00 17.18 ? 246 VAL A CB    1 
ATOM   1707 C CG1   . VAL A 1 246 ? 29.116 4.194   -4.592  1.00 16.99 ? 246 VAL A CG1   1 
ATOM   1708 C CG2   . VAL A 1 246 ? 27.350 3.246   -6.059  1.00 16.85 ? 246 VAL A CG2   1 
ATOM   1709 N N     . LEU A 1 247 ? 30.461 0.942   -3.647  1.00 17.68 ? 247 LEU A N     1 
ATOM   1710 C CA    . LEU A 1 247 ? 31.534 0.693   -2.685  1.00 18.89 ? 247 LEU A CA    1 
ATOM   1711 C C     . LEU A 1 247 ? 32.768 0.125   -3.396  1.00 19.64 ? 247 LEU A C     1 
ATOM   1712 O O     . LEU A 1 247 ? 33.873 0.630   -3.229  1.00 19.09 ? 247 LEU A O     1 
ATOM   1713 C CB    . LEU A 1 247 ? 31.073 -0.295  -1.600  1.00 19.28 ? 247 LEU A CB    1 
ATOM   1714 C CG    . LEU A 1 247 ? 32.163 -0.848  -0.660  1.00 20.45 ? 247 LEU A CG    1 
ATOM   1715 C CD1   . LEU A 1 247 ? 32.785 0.301   0.140   1.00 20.61 ? 247 LEU A CD1   1 
ATOM   1716 C CD2   . LEU A 1 247 ? 31.568 -1.897  0.283   1.00 20.73 ? 247 LEU A CD2   1 
ATOM   1717 N N     . ALA A 1 248 ? 32.575 -0.923  -4.190  1.00 19.60 ? 248 ALA A N     1 
ATOM   1718 C CA    . ALA A 1 248 ? 33.688 -1.548  -4.909  1.00 20.28 ? 248 ALA A CA    1 
ATOM   1719 C C     . ALA A 1 248 ? 34.400 -0.541  -5.802  1.00 20.56 ? 248 ALA A C     1 
ATOM   1720 O O     . ALA A 1 248 ? 35.629 -0.524  -5.876  1.00 21.26 ? 248 ALA A O     1 
ATOM   1721 C CB    . ALA A 1 248 ? 33.178 -2.734  -5.747  1.00 19.90 ? 248 ALA A CB    1 
ATOM   1722 N N     . GLU A 1 249 ? 33.624 0.310   -6.468  1.00 20.35 ? 249 GLU A N     1 
ATOM   1723 C CA    . GLU A 1 249 ? 34.177 1.330   -7.358  1.00 20.36 ? 249 GLU A CA    1 
ATOM   1724 C C     . GLU A 1 249 ? 35.027 2.363   -6.608  1.00 20.46 ? 249 GLU A C     1 
ATOM   1725 O O     . GLU A 1 249 ? 36.045 2.826   -7.119  1.00 20.00 ? 249 GLU A O     1 
ATOM   1726 C CB    . GLU A 1 249 ? 33.043 2.032   -8.103  1.00 19.88 ? 249 GLU A CB    1 
ATOM   1727 C CG    . GLU A 1 249 ? 33.478 3.193   -8.979  1.00 21.12 ? 249 GLU A CG    1 
ATOM   1728 C CD    . GLU A 1 249 ? 32.455 3.526   -10.052 1.00 21.83 ? 249 GLU A CD    1 
ATOM   1729 O OE1   . GLU A 1 249 ? 31.437 2.793   -10.173 1.00 22.86 ? 249 GLU A OE1   1 
ATOM   1730 O OE2   . GLU A 1 249 ? 32.671 4.520   -10.775 1.00 21.44 ? 249 GLU A OE2   1 
ATOM   1731 N N     . LEU A 1 250 ? 34.602 2.738   -5.404  1.00 21.55 ? 250 LEU A N     1 
ATOM   1732 C CA    . LEU A 1 250 ? 35.364 3.709   -4.612  1.00 22.73 ? 250 LEU A CA    1 
ATOM   1733 C C     . LEU A 1 250 ? 36.662 3.074   -4.120  1.00 23.58 ? 250 LEU A C     1 
ATOM   1734 O O     . LEU A 1 250 ? 37.673 3.756   -3.954  1.00 25.01 ? 250 LEU A O     1 
ATOM   1735 C CB    . LEU A 1 250 ? 34.541 4.191   -3.415  1.00 22.21 ? 250 LEU A CB    1 
ATOM   1736 C CG    . LEU A 1 250 ? 33.324 5.052   -3.763  1.00 22.05 ? 250 LEU A CG    1 
ATOM   1737 C CD1   . LEU A 1 250 ? 32.571 5.424   -2.483  1.00 22.14 ? 250 LEU A CD1   1 
ATOM   1738 C CD2   . LEU A 1 250 ? 33.776 6.299   -4.504  1.00 21.65 ? 250 LEU A CD2   1 
ATOM   1739 N N     . LEU A 1 251 ? 36.627 1.765   -3.883  1.00 23.62 ? 251 LEU A N     1 
ATOM   1740 C CA    . LEU A 1 251 ? 37.800 1.026   -3.421  1.00 24.65 ? 251 LEU A CA    1 
ATOM   1741 C C     . LEU A 1 251 ? 38.755 0.746   -4.582  1.00 25.37 ? 251 LEU A C     1 
ATOM   1742 O O     . LEU A 1 251 ? 39.975 0.845   -4.429  1.00 26.02 ? 251 LEU A O     1 
ATOM   1743 C CB    . LEU A 1 251 ? 37.378 -0.307  -2.790  1.00 24.21 ? 251 LEU A CB    1 
ATOM   1744 C CG    . LEU A 1 251 ? 36.574 -0.262  -1.488  1.00 24.27 ? 251 LEU A CG    1 
ATOM   1745 C CD1   . LEU A 1 251 ? 36.139 -1.666  -1.087  1.00 24.15 ? 251 LEU A CD1   1 
ATOM   1746 C CD2   . LEU A 1 251 ? 37.427 0.370   -0.399  1.00 24.65 ? 251 LEU A CD2   1 
ATOM   1747 N N     . LEU A 1 252 ? 38.192 0.404   -5.738  1.00 25.36 ? 252 LEU A N     1 
ATOM   1748 C CA    . LEU A 1 252 ? 38.969 0.082   -6.935  1.00 26.35 ? 252 LEU A CA    1 
ATOM   1749 C C     . LEU A 1 252 ? 39.458 1.280   -7.726  1.00 26.41 ? 252 LEU A C     1 
ATOM   1750 O O     . LEU A 1 252 ? 40.559 1.256   -8.276  1.00 27.37 ? 252 LEU A O     1 
ATOM   1751 C CB    . LEU A 1 252 ? 38.143 -0.785  -7.880  1.00 27.06 ? 252 LEU A CB    1 
ATOM   1752 C CG    . LEU A 1 252 ? 38.018 -2.263  -7.542  1.00 28.09 ? 252 LEU A CG    1 
ATOM   1753 C CD1   . LEU A 1 252 ? 36.922 -2.877  -8.403  1.00 28.82 ? 252 LEU A CD1   1 
ATOM   1754 C CD2   . LEU A 1 252 ? 39.360 -2.954  -7.779  1.00 29.19 ? 252 LEU A CD2   1 
ATOM   1755 N N     . GLY A 1 253 ? 38.634 2.317   -7.808  1.00 26.02 ? 253 GLY A N     1 
ATOM   1756 C CA    . GLY A 1 253 ? 39.017 3.490   -8.569  1.00 25.20 ? 253 GLY A CA    1 
ATOM   1757 C C     . GLY A 1 253 ? 38.383 3.461   -9.944  1.00 25.65 ? 253 GLY A C     1 
ATOM   1758 O O     . GLY A 1 253 ? 38.647 4.326   -10.780 1.00 26.10 ? 253 GLY A O     1 
ATOM   1759 N N     . GLN A 1 254 ? 37.540 2.460   -10.179 1.00 25.64 ? 254 GLN A N     1 
ATOM   1760 C CA    . GLN A 1 254 ? 36.837 2.318   -11.454 1.00 26.35 ? 254 GLN A CA    1 
ATOM   1761 C C     . GLN A 1 254 ? 35.677 1.338   -11.270 1.00 25.54 ? 254 GLN A C     1 
ATOM   1762 O O     . GLN A 1 254 ? 35.674 0.549   -10.326 1.00 24.24 ? 254 GLN A O     1 
ATOM   1763 C CB    . GLN A 1 254 ? 37.795 1.790   -12.525 1.00 28.07 ? 254 GLN A CB    1 
ATOM   1764 C CG    . GLN A 1 254 ? 38.511 0.532   -12.095 1.00 30.94 ? 254 GLN A CG    1 
ATOM   1765 C CD    . GLN A 1 254 ? 39.407 -0.024  -13.177 1.00 33.92 ? 254 GLN A CD    1 
ATOM   1766 O OE1   . GLN A 1 254 ? 40.372 0.618   -13.587 1.00 35.58 ? 254 GLN A OE1   1 
ATOM   1767 N NE2   . GLN A 1 254 ? 39.097 -1.228  -13.644 1.00 35.30 ? 254 GLN A NE2   1 
ATOM   1768 N N     . PRO A 1 255 ? 34.679 1.368   -12.175 1.00 25.24 ? 255 PRO A N     1 
ATOM   1769 C CA    . PRO A 1 255 ? 33.539 0.443   -12.040 1.00 25.27 ? 255 PRO A CA    1 
ATOM   1770 C C     . PRO A 1 255 ? 33.990 -1.016  -11.944 1.00 25.23 ? 255 PRO A C     1 
ATOM   1771 O O     . PRO A 1 255 ? 34.923 -1.431  -12.638 1.00 24.56 ? 255 PRO A O     1 
ATOM   1772 C CB    . PRO A 1 255 ? 32.699 0.706   -13.297 1.00 24.85 ? 255 PRO A CB    1 
ATOM   1773 C CG    . PRO A 1 255 ? 33.097 2.095   -13.740 1.00 25.82 ? 255 PRO A CG    1 
ATOM   1774 C CD    . PRO A 1 255 ? 34.547 2.251   -13.348 1.00 25.23 ? 255 PRO A CD    1 
ATOM   1775 N N     . ILE A 1 256 ? 33.330 -1.797  -11.094 1.00 24.75 ? 256 ILE A N     1 
ATOM   1776 C CA    . ILE A 1 256 ? 33.710 -3.197  -10.933 1.00 24.93 ? 256 ILE A CA    1 
ATOM   1777 C C     . ILE A 1 256 ? 33.090 -4.150  -11.962 1.00 24.78 ? 256 ILE A C     1 
ATOM   1778 O O     . ILE A 1 256 ? 33.675 -5.186  -12.269 1.00 25.38 ? 256 ILE A O     1 
ATOM   1779 C CB    . ILE A 1 256 ? 33.395 -3.705  -9.500  1.00 24.77 ? 256 ILE A CB    1 
ATOM   1780 C CG1   . ILE A 1 256 ? 33.991 -5.105  -9.315  1.00 25.80 ? 256 ILE A CG1   1 
ATOM   1781 C CG2   . ILE A 1 256 ? 31.899 -3.682  -9.247  1.00 24.04 ? 256 ILE A CG2   1 
ATOM   1782 C CD1   . ILE A 1 256 ? 34.116 -5.550  -7.863  1.00 27.04 ? 256 ILE A CD1   1 
ATOM   1783 N N     . PHE A 1 257 ? 31.930 -3.805  -12.507 1.00 24.03 ? 257 PHE A N     1 
ATOM   1784 C CA    . PHE A 1 257 ? 31.277 -4.663  -13.498 1.00 25.00 ? 257 PHE A CA    1 
ATOM   1785 C C     . PHE A 1 257 ? 30.937 -3.883  -14.768 1.00 25.84 ? 257 PHE A C     1 
ATOM   1786 O O     . PHE A 1 257 ? 29.770 -3.686  -15.092 1.00 25.96 ? 257 PHE A O     1 
ATOM   1787 C CB    . PHE A 1 257 ? 29.988 -5.282  -12.932 1.00 23.87 ? 257 PHE A CB    1 
ATOM   1788 C CG    . PHE A 1 257 ? 30.197 -6.099  -11.679 1.00 23.89 ? 257 PHE A CG    1 
ATOM   1789 C CD1   . PHE A 1 257 ? 29.366 -5.922  -10.573 1.00 22.58 ? 257 PHE A CD1   1 
ATOM   1790 C CD2   . PHE A 1 257 ? 31.222 -7.044  -11.603 1.00 24.11 ? 257 PHE A CD2   1 
ATOM   1791 C CE1   . PHE A 1 257 ? 29.549 -6.669  -9.409  1.00 22.39 ? 257 PHE A CE1   1 
ATOM   1792 C CE2   . PHE A 1 257 ? 31.414 -7.800  -10.439 1.00 23.56 ? 257 PHE A CE2   1 
ATOM   1793 C CZ    . PHE A 1 257 ? 30.570 -7.607  -9.341  1.00 23.10 ? 257 PHE A CZ    1 
ATOM   1794 N N     . PRO A 1 258 ? 31.960 -3.433  -15.511 1.00 26.72 ? 258 PRO A N     1 
ATOM   1795 C CA    . PRO A 1 258 ? 31.705 -2.680  -16.741 1.00 27.01 ? 258 PRO A CA    1 
ATOM   1796 C C     . PRO A 1 258 ? 31.240 -3.600  -17.863 1.00 27.75 ? 258 PRO A C     1 
ATOM   1797 O O     . PRO A 1 258 ? 31.330 -4.819  -17.751 1.00 27.94 ? 258 PRO A O     1 
ATOM   1798 C CB    . PRO A 1 258 ? 33.054 -2.045  -17.047 1.00 27.43 ? 258 PRO A CB    1 
ATOM   1799 C CG    . PRO A 1 258 ? 34.039 -3.049  -16.522 1.00 26.75 ? 258 PRO A CG    1 
ATOM   1800 C CD    . PRO A 1 258 ? 33.402 -3.605  -15.264 1.00 26.71 ? 258 PRO A CD    1 
ATOM   1801 N N     . GLY A 1 259 ? 30.745 -3.009  -18.946 1.00 28.87 ? 259 GLY A N     1 
ATOM   1802 C CA    . GLY A 1 259 ? 30.272 -3.794  -20.072 1.00 30.22 ? 259 GLY A CA    1 
ATOM   1803 C C     . GLY A 1 259 ? 29.275 -3.010  -20.902 1.00 31.52 ? 259 GLY A C     1 
ATOM   1804 O O     . GLY A 1 259 ? 28.410 -2.325  -20.353 1.00 31.99 ? 259 GLY A O     1 
ATOM   1805 N N     . ASP A 1 260 ? 29.388 -3.107  -22.224 1.00 31.83 ? 260 ASP A N     1 
ATOM   1806 C CA    . ASP A 1 260 ? 28.481 -2.383  -23.109 1.00 32.22 ? 260 ASP A CA    1 
ATOM   1807 C C     . ASP A 1 260 ? 27.170 -3.126  -23.350 1.00 30.95 ? 260 ASP A C     1 
ATOM   1808 O O     . ASP A 1 260 ? 26.191 -2.536  -23.805 1.00 31.14 ? 260 ASP A O     1 
ATOM   1809 C CB    . ASP A 1 260 ? 29.172 -2.076  -24.441 1.00 34.69 ? 260 ASP A CB    1 
ATOM   1810 C CG    . ASP A 1 260 ? 30.107 -0.873  -24.347 1.00 37.00 ? 260 ASP A CG    1 
ATOM   1811 O OD1   . ASP A 1 260 ? 29.879 0.004   -23.481 1.00 38.41 ? 260 ASP A OD1   1 
ATOM   1812 O OD2   . ASP A 1 260 ? 31.075 -0.806  -25.139 1.00 39.25 ? 260 ASP A OD2   1 
ATOM   1813 N N     . SER A 1 261 ? 27.154 -4.417  -23.047 1.00 29.28 ? 261 SER A N     1 
ATOM   1814 C CA    . SER A 1 261 ? 25.948 -5.220  -23.205 1.00 28.10 ? 261 SER A CA    1 
ATOM   1815 C C     . SER A 1 261 ? 25.707 -5.999  -21.918 1.00 27.14 ? 261 SER A C     1 
ATOM   1816 O O     . SER A 1 261 ? 26.609 -6.125  -21.090 1.00 25.99 ? 261 SER A O     1 
ATOM   1817 C CB    . SER A 1 261 ? 26.097 -6.201  -24.370 1.00 28.03 ? 261 SER A CB    1 
ATOM   1818 O OG    . SER A 1 261 ? 26.859 -7.337  -23.997 1.00 28.52 ? 261 SER A OG    1 
ATOM   1819 N N     . GLY A 1 262 ? 24.493 -6.519  -21.762 1.00 26.70 ? 262 GLY A N     1 
ATOM   1820 C CA    . GLY A 1 262 ? 24.166 -7.294  -20.581 1.00 26.50 ? 262 GLY A CA    1 
ATOM   1821 C C     . GLY A 1 262 ? 25.054 -8.513  -20.455 1.00 26.46 ? 262 GLY A C     1 
ATOM   1822 O O     . GLY A 1 262 ? 25.481 -8.872  -19.364 1.00 25.26 ? 262 GLY A O     1 
ATOM   1823 N N     . VAL A 1 263 ? 25.336 -9.161  -21.580 1.00 27.12 ? 263 VAL A N     1 
ATOM   1824 C CA    . VAL A 1 263 ? 26.189 -10.347 -21.566 1.00 27.81 ? 263 VAL A CA    1 
ATOM   1825 C C     . VAL A 1 263 ? 27.579 -10.018 -21.016 1.00 26.79 ? 263 VAL A C     1 
ATOM   1826 O O     . VAL A 1 263 ? 28.121 -10.769 -20.203 1.00 26.59 ? 263 VAL A O     1 
ATOM   1827 C CB    . VAL A 1 263 ? 26.352 -10.948 -22.987 1.00 29.01 ? 263 VAL A CB    1 
ATOM   1828 C CG1   . VAL A 1 263 ? 27.340 -12.113 -22.942 1.00 30.65 ? 263 VAL A CG1   1 
ATOM   1829 C CG2   . VAL A 1 263 ? 25.009 -11.409 -23.513 1.00 30.19 ? 263 VAL A CG2   1 
ATOM   1830 N N     . ASP A 1 264 ? 28.147 -8.896  -21.457 1.00 26.07 ? 264 ASP A N     1 
ATOM   1831 C CA    . ASP A 1 264 ? 29.472 -8.481  -21.003 1.00 26.36 ? 264 ASP A CA    1 
ATOM   1832 C C     . ASP A 1 264 ? 29.478 -8.219  -19.506 1.00 26.01 ? 264 ASP A C     1 
ATOM   1833 O O     . ASP A 1 264 ? 30.381 -8.658  -18.797 1.00 25.69 ? 264 ASP A O     1 
ATOM   1834 C CB    . ASP A 1 264 ? 29.920 -7.220  -21.736 1.00 27.76 ? 264 ASP A CB    1 
ATOM   1835 C CG    . ASP A 1 264 ? 30.183 -7.467  -23.209 1.00 30.84 ? 264 ASP A CG    1 
ATOM   1836 O OD1   . ASP A 1 264 ? 30.015 -6.520  -24.005 1.00 32.52 ? 264 ASP A OD1   1 
ATOM   1837 O OD2   . ASP A 1 264 ? 30.553 -8.606  -23.570 1.00 30.73 ? 264 ASP A OD2   1 
ATOM   1838 N N     . GLN A 1 265 ? 28.473 -7.486  -19.039 1.00 25.63 ? 265 GLN A N     1 
ATOM   1839 C CA    . GLN A 1 265 ? 28.334 -7.179  -17.621 1.00 26.02 ? 265 GLN A CA    1 
ATOM   1840 C C     . GLN A 1 265 ? 28.253 -8.476  -16.811 1.00 25.77 ? 265 GLN A C     1 
ATOM   1841 O O     . GLN A 1 265 ? 28.926 -8.619  -15.795 1.00 25.33 ? 265 GLN A O     1 
ATOM   1842 C CB    . GLN A 1 265 ? 27.068 -6.353  -17.384 1.00 26.12 ? 265 GLN A CB    1 
ATOM   1843 C CG    . GLN A 1 265 ? 27.217 -4.874  -17.718 1.00 28.57 ? 265 GLN A CG    1 
ATOM   1844 C CD    . GLN A 1 265 ? 25.885 -4.197  -18.024 1.00 29.22 ? 265 GLN A CD    1 
ATOM   1845 O OE1   . GLN A 1 265 ? 25.824 -3.272  -18.828 1.00 32.42 ? 265 GLN A OE1   1 
ATOM   1846 N NE2   . GLN A 1 265 ? 24.822 -4.657  -17.392 1.00 29.38 ? 265 GLN A NE2   1 
ATOM   1847 N N     . LEU A 1 266 ? 27.430 -9.418  -17.269 1.00 26.24 ? 266 LEU A N     1 
ATOM   1848 C CA    . LEU A 1 266 ? 27.269 -10.706 -16.589 1.00 26.80 ? 266 LEU A CA    1 
ATOM   1849 C C     . LEU A 1 266 ? 28.566 -11.495 -16.556 1.00 27.38 ? 266 LEU A C     1 
ATOM   1850 O O     . LEU A 1 266 ? 28.867 -12.168 -15.574 1.00 27.91 ? 266 LEU A O     1 
ATOM   1851 C CB    . LEU A 1 266 ? 26.187 -11.544 -17.270 1.00 26.90 ? 266 LEU A CB    1 
ATOM   1852 C CG    . LEU A 1 266 ? 24.753 -11.194 -16.873 1.00 27.03 ? 266 LEU A CG    1 
ATOM   1853 C CD1   . LEU A 1 266 ? 23.790 -11.992 -17.723 1.00 27.40 ? 266 LEU A CD1   1 
ATOM   1854 C CD2   . LEU A 1 266 ? 24.538 -11.488 -15.393 1.00 27.05 ? 266 LEU A CD2   1 
ATOM   1855 N N     . VAL A 1 267 ? 29.338 -11.420 -17.631 1.00 28.01 ? 267 VAL A N     1 
ATOM   1856 C CA    . VAL A 1 267 ? 30.609 -12.131 -17.676 1.00 28.96 ? 267 VAL A CA    1 
ATOM   1857 C C     . VAL A 1 267 ? 31.558 -11.541 -16.636 1.00 29.03 ? 267 VAL A C     1 
ATOM   1858 O O     . VAL A 1 267 ? 32.305 -12.269 -15.987 1.00 28.97 ? 267 VAL A O     1 
ATOM   1859 C CB    . VAL A 1 267 ? 31.261 -12.040 -19.082 1.00 29.65 ? 267 VAL A CB    1 
ATOM   1860 C CG1   . VAL A 1 267 ? 32.735 -12.424 -19.005 1.00 29.89 ? 267 VAL A CG1   1 
ATOM   1861 C CG2   . VAL A 1 267 ? 30.522 -12.954 -20.058 1.00 29.77 ? 267 VAL A CG2   1 
ATOM   1862 N N     . GLU A 1 268 ? 31.526 -10.219 -16.484 1.00 28.89 ? 268 GLU A N     1 
ATOM   1863 C CA    . GLU A 1 268 ? 32.376 -9.535  -15.513 1.00 29.15 ? 268 GLU A CA    1 
ATOM   1864 C C     . GLU A 1 268 ? 31.950 -9.904  -14.092 1.00 28.50 ? 268 GLU A C     1 
ATOM   1865 O O     . GLU A 1 268 ? 32.772 -9.950  -13.179 1.00 28.41 ? 268 GLU A O     1 
ATOM   1866 C CB    . GLU A 1 268 ? 32.277 -8.018  -15.688 1.00 30.10 ? 268 GLU A CB    1 
ATOM   1867 C CG    . GLU A 1 268 ? 32.830 -7.495  -17.005 1.00 32.57 ? 268 GLU A CG    1 
ATOM   1868 C CD    . GLU A 1 268 ? 34.304 -7.821  -17.193 1.00 33.83 ? 268 GLU A CD    1 
ATOM   1869 O OE1   . GLU A 1 268 ? 34.999 -8.074  -16.189 1.00 34.94 ? 268 GLU A OE1   1 
ATOM   1870 O OE2   . GLU A 1 268 ? 34.772 -7.822  -18.351 1.00 35.92 ? 268 GLU A OE2   1 
ATOM   1871 N N     . ILE A 1 269 ? 30.659 -10.161 -13.908 1.00 28.62 ? 269 ILE A N     1 
ATOM   1872 C CA    . ILE A 1 269 ? 30.147 -10.534 -12.596 1.00 28.60 ? 269 ILE A CA    1 
ATOM   1873 C C     . ILE A 1 269 ? 30.566 -11.973 -12.312 1.00 29.72 ? 269 ILE A C     1 
ATOM   1874 O O     . ILE A 1 269 ? 31.012 -12.300 -11.214 1.00 29.46 ? 269 ILE A O     1 
ATOM   1875 C CB    . ILE A 1 269 ? 28.605 -10.432 -12.537 1.00 27.34 ? 269 ILE A CB    1 
ATOM   1876 C CG1   . ILE A 1 269 ? 28.181 -8.966  -12.594 1.00 25.81 ? 269 ILE A CG1   1 
ATOM   1877 C CG2   . ILE A 1 269 ? 28.076 -11.059 -11.245 1.00 26.78 ? 269 ILE A CG2   1 
ATOM   1878 C CD1   . ILE A 1 269 ? 26.687 -8.774  -12.686 1.00 24.23 ? 269 ILE A CD1   1 
ATOM   1879 N N     . ILE A 1 270 ? 30.432 -12.823 -13.324 1.00 30.53 ? 270 ILE A N     1 
ATOM   1880 C CA    . ILE A 1 270 ? 30.792 -14.227 -13.191 1.00 31.40 ? 270 ILE A CA    1 
ATOM   1881 C C     . ILE A 1 270 ? 32.285 -14.402 -12.915 1.00 32.02 ? 270 ILE A C     1 
ATOM   1882 O O     . ILE A 1 270 ? 32.684 -15.301 -12.176 1.00 32.55 ? 270 ILE A O     1 
ATOM   1883 C CB    . ILE A 1 270 ? 30.380 -15.012 -14.460 1.00 31.05 ? 270 ILE A CB    1 
ATOM   1884 C CG1   . ILE A 1 270 ? 28.866 -15.242 -14.434 1.00 30.38 ? 270 ILE A CG1   1 
ATOM   1885 C CG2   . ILE A 1 270 ? 31.121 -16.342 -14.524 1.00 31.54 ? 270 ILE A CG2   1 
ATOM   1886 C CD1   . ILE A 1 270 ? 28.259 -15.600 -15.773 1.00 29.33 ? 270 ILE A CD1   1 
ATOM   1887 N N     . LYS A 1 271 ? 33.110 -13.538 -13.490 1.00 32.50 ? 271 LYS A N     1 
ATOM   1888 C CA    . LYS A 1 271 ? 34.544 -13.631 -13.268 1.00 33.95 ? 271 LYS A CA    1 
ATOM   1889 C C     . LYS A 1 271 ? 34.888 -13.423 -11.795 1.00 34.73 ? 271 LYS A C     1 
ATOM   1890 O O     . LYS A 1 271 ? 35.833 -14.026 -11.278 1.00 35.15 ? 271 LYS A O     1 
ATOM   1891 C CB    . LYS A 1 271 ? 35.277 -12.600 -14.122 1.00 34.47 ? 271 LYS A CB    1 
ATOM   1892 C CG    . LYS A 1 271 ? 35.253 -12.926 -15.603 1.00 36.34 ? 271 LYS A CG    1 
ATOM   1893 C CD    . LYS A 1 271 ? 36.460 -12.353 -16.310 1.00 37.59 ? 271 LYS A CD    1 
ATOM   1894 C CE    . LYS A 1 271 ? 36.063 -11.740 -17.632 1.00 38.86 ? 271 LYS A CE    1 
ATOM   1895 N NZ    . LYS A 1 271 ? 36.886 -10.538 -17.927 1.00 40.46 ? 271 LYS A NZ    1 
ATOM   1896 N N     . VAL A 1 272 ? 34.118 -12.577 -11.116 1.00 34.44 ? 272 VAL A N     1 
ATOM   1897 C CA    . VAL A 1 272 ? 34.367 -12.307 -9.707  1.00 34.55 ? 272 VAL A CA    1 
ATOM   1898 C C     . VAL A 1 272 ? 33.604 -13.270 -8.805  1.00 35.00 ? 272 VAL A C     1 
ATOM   1899 O O     . VAL A 1 272 ? 34.195 -13.912 -7.940  1.00 35.39 ? 272 VAL A O     1 
ATOM   1900 C CB    . VAL A 1 272 ? 33.966 -10.861 -9.320  1.00 33.98 ? 272 VAL A CB    1 
ATOM   1901 C CG1   . VAL A 1 272 ? 34.153 -10.655 -7.819  1.00 34.16 ? 272 VAL A CG1   1 
ATOM   1902 C CG2   . VAL A 1 272 ? 34.802 -9.858  -10.089 1.00 33.30 ? 272 VAL A CG2   1 
ATOM   1903 N N     . LEU A 1 273 ? 32.296 -13.379 -9.014  1.00 35.19 ? 273 LEU A N     1 
ATOM   1904 C CA    . LEU A 1 273 ? 31.458 -14.247 -8.189  1.00 35.64 ? 273 LEU A CA    1 
ATOM   1905 C C     . LEU A 1 273 ? 31.440 -15.713 -8.598  1.00 36.34 ? 273 LEU A C     1 
ATOM   1906 O O     . LEU A 1 273 ? 30.957 -16.551 -7.848  1.00 36.80 ? 273 LEU A O     1 
ATOM   1907 C CB    . LEU A 1 273 ? 30.010 -13.738 -8.173  1.00 34.72 ? 273 LEU A CB    1 
ATOM   1908 C CG    . LEU A 1 273 ? 29.695 -12.324 -7.662  1.00 34.10 ? 273 LEU A CG    1 
ATOM   1909 C CD1   . LEU A 1 273 ? 28.200 -12.191 -7.441  1.00 33.44 ? 273 LEU A CD1   1 
ATOM   1910 C CD2   . LEU A 1 273 ? 30.444 -12.054 -6.380  1.00 34.20 ? 273 LEU A CD2   1 
ATOM   1911 N N     . GLY A 1 274 ? 31.963 -16.030 -9.775  1.00 37.21 ? 274 GLY A N     1 
ATOM   1912 C CA    . GLY A 1 274 ? 31.930 -17.408 -10.224 1.00 37.99 ? 274 GLY A CA    1 
ATOM   1913 C C     . GLY A 1 274 ? 30.571 -17.677 -10.846 1.00 39.00 ? 274 GLY A C     1 
ATOM   1914 O O     . GLY A 1 274 ? 29.648 -16.882 -10.689 1.00 38.89 ? 274 GLY A O     1 
ATOM   1915 N N     . THR A 1 275 ? 30.436 -18.793 -11.554 1.00 40.09 ? 275 THR A N     1 
ATOM   1916 C CA    . THR A 1 275 ? 29.174 -19.134 -12.207 1.00 41.26 ? 275 THR A CA    1 
ATOM   1917 C C     . THR A 1 275 ? 28.030 -19.316 -11.212 1.00 42.23 ? 275 THR A C     1 
ATOM   1918 O O     . THR A 1 275 ? 28.186 -19.962 -10.179 1.00 42.29 ? 275 THR A O     1 
ATOM   1919 C CB    . THR A 1 275 ? 29.329 -20.418 -13.049 1.00 41.39 ? 275 THR A CB    1 
ATOM   1920 O OG1   . THR A 1 275 ? 30.382 -20.232 -14.004 1.00 41.23 ? 275 THR A OG1   1 
ATOM   1921 C CG2   . THR A 1 275 ? 28.037 -20.740 -13.784 1.00 40.96 ? 275 THR A CG2   1 
ATOM   1922 N N     . PRO A 1 276 ? 26.859 -18.737 -11.509 1.00 43.11 ? 276 PRO A N     1 
ATOM   1923 C CA    . PRO A 1 276 ? 25.715 -18.863 -10.605 1.00 44.36 ? 276 PRO A CA    1 
ATOM   1924 C C     . PRO A 1 276 ? 25.081 -20.253 -10.612 1.00 46.11 ? 276 PRO A C     1 
ATOM   1925 O O     . PRO A 1 276 ? 24.840 -20.841 -11.665 1.00 46.18 ? 276 PRO A O     1 
ATOM   1926 C CB    . PRO A 1 276 ? 24.746 -17.799 -11.103 1.00 43.58 ? 276 PRO A CB    1 
ATOM   1927 C CG    . PRO A 1 276 ? 25.047 -17.692 -12.554 1.00 43.14 ? 276 PRO A CG    1 
ATOM   1928 C CD    . PRO A 1 276 ? 26.531 -17.923 -12.693 1.00 42.98 ? 276 PRO A CD    1 
ATOM   1929 N N     . THR A 1 277 ? 24.813 -20.758 -9.415  1.00 47.89 ? 277 THR A N     1 
ATOM   1930 C CA    . THR A 1 277 ? 24.192 -22.059 -9.215  1.00 49.05 ? 277 THR A CA    1 
ATOM   1931 C C     . THR A 1 277 ? 22.843 -22.066 -9.913  1.00 50.09 ? 277 THR A C     1 
ATOM   1932 O O     . THR A 1 277 ? 22.316 -21.011 -10.258 1.00 50.56 ? 277 THR A O     1 
ATOM   1933 C CB    . THR A 1 277 ? 23.998 -22.305 -7.706  1.00 48.94 ? 277 THR A CB    1 
ATOM   1934 O OG1   . THR A 1 277 ? 25.120 -23.035 -7.206  1.00 49.58 ? 277 THR A OG1   1 
ATOM   1935 C CG2   . THR A 1 277 ? 22.724 -23.070 -7.422  1.00 49.72 ? 277 THR A CG2   1 
ATOM   1936 N N     . ARG A 1 278 ? 22.284 -23.251 -10.132 1.00 51.32 ? 278 ARG A N     1 
ATOM   1937 C CA    . ARG A 1 278 ? 20.984 -23.344 -10.777 1.00 52.37 ? 278 ARG A CA    1 
ATOM   1938 C C     . ARG A 1 278 ? 19.945 -22.693 -9.867  1.00 52.10 ? 278 ARG A C     1 
ATOM   1939 O O     . ARG A 1 278 ? 19.047 -21.995 -10.338 1.00 51.84 ? 278 ARG A O     1 
ATOM   1940 C CB    . ARG A 1 278 ? 20.620 -24.808 -11.038 1.00 54.12 ? 278 ARG A CB    1 
ATOM   1941 C CG    . ARG A 1 278 ? 20.055 -25.063 -12.427 1.00 56.69 ? 278 ARG A CG    1 
ATOM   1942 C CD    . ARG A 1 278 ? 19.779 -26.546 -12.643 1.00 59.31 ? 278 ARG A CD    1 
ATOM   1943 N NE    . ARG A 1 278 ? 18.731 -26.778 -13.637 1.00 61.46 ? 278 ARG A NE    1 
ATOM   1944 C CZ    . ARG A 1 278 ? 18.111 -27.945 -13.815 1.00 62.58 ? 278 ARG A CZ    1 
ATOM   1945 N NH1   . ARG A 1 278 ? 18.430 -28.995 -13.063 1.00 62.82 ? 278 ARG A NH1   1 
ATOM   1946 N NH2   . ARG A 1 278 ? 17.172 -28.064 -14.748 1.00 62.97 ? 278 ARG A NH2   1 
ATOM   1947 N N     . GLU A 1 279 ? 20.077 -22.919 -8.562  1.00 52.06 ? 279 GLU A N     1 
ATOM   1948 C CA    . GLU A 1 279 ? 19.156 -22.337 -7.586  1.00 52.48 ? 279 GLU A CA    1 
ATOM   1949 C C     . GLU A 1 279 ? 19.314 -20.815 -7.566  1.00 51.47 ? 279 GLU A C     1 
ATOM   1950 O O     . GLU A 1 279 ? 18.330 -20.082 -7.491  1.00 51.46 ? 279 GLU A O     1 
ATOM   1951 C CB    . GLU A 1 279 ? 19.426 -22.898 -6.182  1.00 54.05 ? 279 GLU A CB    1 
ATOM   1952 C CG    . GLU A 1 279 ? 18.221 -23.582 -5.531  1.00 56.86 ? 279 GLU A CG    1 
ATOM   1953 C CD    . GLU A 1 279 ? 17.145 -22.601 -5.054  1.00 58.64 ? 279 GLU A CD    1 
ATOM   1954 O OE1   . GLU A 1 279 ? 16.399 -22.058 -5.905  1.00 59.30 ? 279 GLU A OE1   1 
ATOM   1955 O OE2   . GLU A 1 279 ? 17.042 -22.379 -3.824  1.00 59.52 ? 279 GLU A OE2   1 
ATOM   1956 N N     . GLN A 1 280 ? 20.557 -20.349 -7.634  1.00 50.20 ? 280 GLN A N     1 
ATOM   1957 C CA    . GLN A 1 280 ? 20.839 -18.920 -7.635  1.00 48.85 ? 280 GLN A CA    1 
ATOM   1958 C C     . GLN A 1 280 ? 20.196 -18.255 -8.843  1.00 48.85 ? 280 GLN A C     1 
ATOM   1959 O O     . GLN A 1 280 ? 19.614 -17.180 -8.732  1.00 48.30 ? 280 GLN A O     1 
ATOM   1960 C CB    . GLN A 1 280 ? 22.344 -18.689 -7.650  1.00 47.47 ? 280 GLN A CB    1 
ATOM   1961 C CG    . GLN A 1 280 ? 22.982 -18.900 -6.304  1.00 45.99 ? 280 GLN A CG    1 
ATOM   1962 C CD    . GLN A 1 280 ? 24.475 -18.744 -6.349  1.00 45.46 ? 280 GLN A CD    1 
ATOM   1963 O OE1   . GLN A 1 280 ? 25.123 -19.148 -7.312  1.00 45.26 ? 280 GLN A OE1   1 
ATOM   1964 N NE2   . GLN A 1 280 ? 25.038 -18.155 -5.306  1.00 45.57 ? 280 GLN A NE2   1 
ATOM   1965 N N     . ILE A 1 281 ? 20.304 -18.897 -9.999  1.00 49.28 ? 281 ILE A N     1 
ATOM   1966 C CA    . ILE A 1 281 ? 19.706 -18.368 -11.215 1.00 50.11 ? 281 ILE A CA    1 
ATOM   1967 C C     . ILE A 1 281 ? 18.194 -18.326 -11.027 1.00 50.79 ? 281 ILE A C     1 
ATOM   1968 O O     . ILE A 1 281 ? 17.523 -17.390 -11.456 1.00 50.17 ? 281 ILE A O     1 
ATOM   1969 C CB    . ILE A 1 281 ? 20.040 -19.259 -12.425 1.00 49.95 ? 281 ILE A CB    1 
ATOM   1970 C CG1   . ILE A 1 281 ? 21.505 -19.066 -12.815 1.00 49.84 ? 281 ILE A CG1   1 
ATOM   1971 C CG2   . ILE A 1 281 ? 19.129 -18.920 -13.592 1.00 49.82 ? 281 ILE A CG2   1 
ATOM   1972 C CD1   . ILE A 1 281 ? 22.042 -20.145 -13.723 1.00 50.29 ? 281 ILE A CD1   1 
ATOM   1973 N N     . ARG A 1 282 ? 17.673 -19.356 -10.372 1.00 52.50 ? 282 ARG A N     1 
ATOM   1974 C CA    . ARG A 1 282 ? 16.248 -19.476 -10.098 1.00 54.20 ? 282 ARG A CA    1 
ATOM   1975 C C     . ARG A 1 282 ? 15.818 -18.369 -9.133  1.00 54.50 ? 282 ARG A C     1 
ATOM   1976 O O     . ARG A 1 282 ? 14.718 -17.825 -9.246  1.00 54.07 ? 282 ARG A O     1 
ATOM   1977 C CB    . ARG A 1 282 ? 15.966 -20.858 -9.495  1.00 56.08 ? 282 ARG A CB    1 
ATOM   1978 C CG    . ARG A 1 282 ? 14.505 -21.156 -9.189  1.00 58.70 ? 282 ARG A CG    1 
ATOM   1979 C CD    . ARG A 1 282 ? 14.381 -22.397 -8.301  1.00 61.15 ? 282 ARG A CD    1 
ATOM   1980 N NE    . ARG A 1 282 ? 13.090 -22.471 -7.614  1.00 63.47 ? 282 ARG A NE    1 
ATOM   1981 C CZ    . ARG A 1 282 ? 12.820 -23.296 -6.601  1.00 64.59 ? 282 ARG A CZ    1 
ATOM   1982 N NH1   . ARG A 1 282 ? 13.753 -24.126 -6.144  1.00 64.84 ? 282 ARG A NH1   1 
ATOM   1983 N NH2   . ARG A 1 282 ? 11.613 -23.296 -6.044  1.00 64.76 ? 282 ARG A NH2   1 
ATOM   1984 N N     . GLU A 1 283 ? 16.697 -18.043 -8.189  1.00 55.35 ? 283 GLU A N     1 
ATOM   1985 C CA    . GLU A 1 283 ? 16.443 -16.996 -7.199  1.00 56.58 ? 283 GLU A CA    1 
ATOM   1986 C C     . GLU A 1 283 ? 16.323 -15.623 -7.864  1.00 56.96 ? 283 GLU A C     1 
ATOM   1987 O O     . GLU A 1 283 ? 15.480 -14.808 -7.491  1.00 56.57 ? 283 GLU A O     1 
ATOM   1988 C CB    . GLU A 1 283 ? 17.581 -16.945 -6.176  1.00 57.23 ? 283 GLU A CB    1 
ATOM   1989 C CG    . GLU A 1 283 ? 17.845 -18.250 -5.458  1.00 58.84 ? 283 GLU A CG    1 
ATOM   1990 C CD    . GLU A 1 283 ? 17.131 -18.328 -4.126  1.00 60.04 ? 283 GLU A CD    1 
ATOM   1991 O OE1   . GLU A 1 283 ? 17.615 -19.064 -3.234  1.00 60.70 ? 283 GLU A OE1   1 
ATOM   1992 O OE2   . GLU A 1 283 ? 16.087 -17.653 -3.971  1.00 60.51 ? 283 GLU A OE2   1 
ATOM   1993 N N     . MET A 1 284 ? 17.180 -15.375 -8.846  1.00 57.64 ? 284 MET A N     1 
ATOM   1994 C CA    . MET A 1 284 ? 17.181 -14.108 -9.560  1.00 59.11 ? 284 MET A CA    1 
ATOM   1995 C C     . MET A 1 284 ? 15.986 -13.978 -10.487 1.00 61.44 ? 284 MET A C     1 
ATOM   1996 O O     . MET A 1 284 ? 15.235 -13.008 -10.418 1.00 61.21 ? 284 MET A O     1 
ATOM   1997 C CB    . MET A 1 284 ? 18.468 -13.974 -10.364 1.00 56.78 ? 284 MET A CB    1 
ATOM   1998 C CG    . MET A 1 284 ? 19.699 -14.092 -9.513  1.00 55.02 ? 284 MET A CG    1 
ATOM   1999 S SD    . MET A 1 284 ? 21.195 -14.143 -10.468 1.00 52.21 ? 284 MET A SD    1 
ATOM   2000 C CE    . MET A 1 284 ? 22.150 -13.180 -9.521  1.00 53.52 ? 284 MET A CE    1 
ATOM   2001 N N     . ASN A 1 285 ? 15.824 -14.960 -11.363 1.00 64.96 ? 285 ASN A N     1 
ATOM   2002 C CA    . ASN A 1 285 ? 14.725 -14.967 -12.317 1.00 68.61 ? 285 ASN A CA    1 
ATOM   2003 C C     . ASN A 1 285 ? 14.590 -16.365 -12.888 1.00 71.56 ? 285 ASN A C     1 
ATOM   2004 O O     . ASN A 1 285 ? 15.363 -16.768 -13.761 1.00 71.52 ? 285 ASN A O     1 
ATOM   2005 C CB    . ASN A 1 285 ? 14.992 -13.980 -13.456 1.00 68.36 ? 285 ASN A CB    1 
ATOM   2006 C CG    . ASN A 1 285 ? 13.838 -13.898 -14.434 1.00 68.41 ? 285 ASN A CG    1 
ATOM   2007 O OD1   . ASN A 1 285 ? 14.017 -14.041 -15.644 1.00 67.90 ? 285 ASN A OD1   1 
ATOM   2008 N ND2   . ASN A 1 285 ? 12.640 -13.667 -13.911 1.00 68.45 ? 285 ASN A ND2   1 
ATOM   2009 N N     . PRO A 1 286 ? 13.603 -17.128 -12.398 1.00 74.64 ? 286 PRO A N     1 
ATOM   2010 C CA    . PRO A 1 286 ? 13.382 -18.495 -12.880 1.00 77.37 ? 286 PRO A CA    1 
ATOM   2011 C C     . PRO A 1 286 ? 12.685 -18.493 -14.236 1.00 80.02 ? 286 PRO A C     1 
ATOM   2012 O O     . PRO A 1 286 ? 11.578 -19.013 -14.372 1.00 80.39 ? 286 PRO A O     1 
ATOM   2013 C CB    . PRO A 1 286 ? 12.516 -19.116 -11.791 1.00 76.79 ? 286 PRO A CB    1 
ATOM   2014 C CG    . PRO A 1 286 ? 11.749 -17.954 -11.230 1.00 76.05 ? 286 PRO A CG    1 
ATOM   2015 C CD    . PRO A 1 286 ? 12.631 -16.736 -11.361 1.00 75.04 ? 286 PRO A CD    1 
ATOM   2016 N N     . ASN A 1 287 ? 13.340 -17.908 -15.237 1.00 82.95 ? 287 ASN A N     1 
ATOM   2017 C CA    . ASN A 1 287 ? 12.760 -17.828 -16.570 1.00 85.82 ? 287 ASN A CA    1 
ATOM   2018 C C     . ASN A 1 287 ? 13.780 -17.879 -17.701 1.00 87.77 ? 287 ASN A C     1 
ATOM   2019 O O     . ASN A 1 287 ? 13.772 -18.814 -18.501 1.00 88.15 ? 287 ASN A O     1 
ATOM   2020 C CB    . ASN A 1 287 ? 11.929 -16.546 -16.701 1.00 86.15 ? 287 ASN A CB    1 
ATOM   2021 C CG    . ASN A 1 287 ? 10.788 -16.482 -15.700 1.00 86.78 ? 287 ASN A CG    1 
ATOM   2022 O OD1   . ASN A 1 287 ? 9.790  -17.195 -15.830 1.00 86.95 ? 287 ASN A OD1   1 
ATOM   2023 N ND2   . ASN A 1 287 ? 10.927 -15.621 -14.698 1.00 87.01 ? 287 ASN A ND2   1 
ATOM   2024 N N     . TYR A 1 288 ? 14.654 -16.874 -17.766 1.00 89.95 ? 288 TYR A N     1 
ATOM   2025 C CA    . TYR A 1 288 ? 15.656 -16.786 -18.831 1.00 91.78 ? 288 TYR A CA    1 
ATOM   2026 C C     . TYR A 1 288 ? 16.249 -18.109 -19.283 1.00 92.48 ? 288 TYR A C     1 
ATOM   2027 O O     . TYR A 1 288 ? 16.817 -18.865 -18.490 1.00 92.80 ? 288 TYR A O     1 
ATOM   2028 C CB    . TYR A 1 288 ? 16.768 -15.819 -18.439 1.00 92.56 ? 288 TYR A CB    1 
ATOM   2029 C CG    . TYR A 1 288 ? 16.485 -14.422 -18.924 1.00 93.87 ? 288 TYR A CG    1 
ATOM   2030 C CD1   . TYR A 1 288 ? 15.188 -13.909 -18.897 1.00 94.63 ? 288 TYR A CD1   1 
ATOM   2031 C CD2   . TYR A 1 288 ? 17.504 -13.605 -19.397 1.00 94.45 ? 288 TYR A CD2   1 
ATOM   2032 C CE1   . TYR A 1 288 ? 14.919 -12.616 -19.322 1.00 95.23 ? 288 TYR A CE1   1 
ATOM   2033 C CE2   . TYR A 1 288 ? 17.243 -12.306 -19.826 1.00 95.18 ? 288 TYR A CE2   1 
ATOM   2034 C CZ    . TYR A 1 288 ? 15.952 -11.817 -19.781 1.00 95.48 ? 288 TYR A CZ    1 
ATOM   2035 O OH    . TYR A 1 288 ? 15.703 -10.515 -20.137 1.00 96.00 ? 288 TYR A OH    1 
ATOM   2036 N N     . THR A 1 289 ? 16.114 -18.356 -20.584 1.00 92.92 ? 289 THR A N     1 
ATOM   2037 C CA    . THR A 1 289 ? 16.568 -19.581 -21.227 1.00 93.33 ? 289 THR A CA    1 
ATOM   2038 C C     . THR A 1 289 ? 18.072 -19.847 -21.241 1.00 93.51 ? 289 THR A C     1 
ATOM   2039 O O     . THR A 1 289 ? 18.524 -20.861 -20.707 1.00 93.46 ? 289 THR A O     1 
ATOM   2040 C CB    . THR A 1 289 ? 16.051 -19.638 -22.674 1.00 93.42 ? 289 THR A CB    1 
ATOM   2041 O OG1   . THR A 1 289 ? 15.037 -18.640 -22.852 1.00 93.51 ? 289 THR A OG1   1 
ATOM   2042 C CG2   . THR A 1 289 ? 15.466 -21.011 -22.976 1.00 93.37 ? 289 THR A CG2   1 
ATOM   2043 N N     . GLU A 1 290 ? 18.844 -18.957 -21.860 1.00 93.71 ? 290 GLU A N     1 
ATOM   2044 C CA    . GLU A 1 290 ? 20.292 -19.144 -21.936 1.00 93.85 ? 290 GLU A CA    1 
ATOM   2045 C C     . GLU A 1 290 ? 20.877 -19.537 -20.592 1.00 93.96 ? 290 GLU A C     1 
ATOM   2046 O O     . GLU A 1 290 ? 20.788 -18.789 -19.616 1.00 94.40 ? 290 GLU A O     1 
ATOM   2047 C CB    . GLU A 1 290 ? 20.987 -17.871 -22.429 1.00 93.81 ? 290 GLU A CB    1 
ATOM   2048 C CG    . GLU A 1 290 ? 22.386 -18.089 -22.985 1.00 93.52 ? 290 GLU A CG    1 
ATOM   2049 C CD    . GLU A 1 290 ? 22.575 -17.464 -24.360 1.00 93.31 ? 290 GLU A CD    1 
ATOM   2050 O OE1   . GLU A 1 290 ? 23.344 -16.484 -24.468 1.00 93.15 ? 290 GLU A OE1   1 
ATOM   2051 O OE2   . GLU A 1 290 ? 21.956 -17.955 -25.328 1.00 92.73 ? 290 GLU A OE2   1 
ATOM   2052 N N     . PHE A 1 291 ? 21.468 -20.723 -20.549 1.00 93.78 ? 291 PHE A N     1 
ATOM   2053 C CA    . PHE A 1 291 ? 22.087 -21.230 -19.335 1.00 93.59 ? 291 PHE A CA    1 
ATOM   2054 C C     . PHE A 1 291 ? 23.533 -21.564 -19.678 1.00 93.27 ? 291 PHE A C     1 
ATOM   2055 O O     . PHE A 1 291 ? 24.273 -22.116 -18.861 1.00 93.36 ? 291 PHE A O     1 
ATOM   2056 C CB    . PHE A 1 291 ? 21.346 -22.479 -18.842 1.00 93.80 ? 291 PHE A CB    1 
ATOM   2057 C CG    . PHE A 1 291 ? 20.159 -22.182 -17.952 1.00 94.02 ? 291 PHE A CG    1 
ATOM   2058 C CD1   . PHE A 1 291 ? 19.541 -23.203 -17.236 1.00 93.85 ? 291 PHE A CD1   1 
ATOM   2059 C CD2   . PHE A 1 291 ? 19.657 -20.885 -17.830 1.00 94.17 ? 291 PHE A CD2   1 
ATOM   2060 C CE1   . PHE A 1 291 ? 18.444 -22.940 -16.412 1.00 93.76 ? 291 PHE A CE1   1 
ATOM   2061 C CE2   . PHE A 1 291 ? 18.559 -20.611 -17.008 1.00 93.98 ? 291 PHE A CE2   1 
ATOM   2062 C CZ    . PHE A 1 291 ? 17.953 -21.642 -16.299 1.00 93.84 ? 291 PHE A CZ    1 
ATOM   2063 N N     . LYS A 1 292 ? 23.921 -21.213 -20.902 1.00 92.66 ? 292 LYS A N     1 
ATOM   2064 C CA    . LYS A 1 292 ? 25.271 -21.453 -21.395 1.00 92.05 ? 292 LYS A CA    1 
ATOM   2065 C C     . LYS A 1 292 ? 26.194 -20.322 -20.962 1.00 91.38 ? 292 LYS A C     1 
ATOM   2066 O O     . LYS A 1 292 ? 26.215 -19.255 -21.574 1.00 91.23 ? 292 LYS A O     1 
ATOM   2067 C CB    . LYS A 1 292 ? 25.257 -21.565 -22.926 1.00 92.38 ? 292 LYS A CB    1 
ATOM   2068 C CG    . LYS A 1 292 ? 26.568 -21.186 -23.615 1.00 92.72 ? 292 LYS A CG    1 
ATOM   2069 C CD    . LYS A 1 292 ? 26.333 -20.778 -25.065 1.00 92.83 ? 292 LYS A CD    1 
ATOM   2070 C CE    . LYS A 1 292 ? 27.356 -21.415 -25.998 1.00 92.77 ? 292 LYS A CE    1 
ATOM   2071 N NZ    . LYS A 1 292 ? 27.054 -22.846 -26.291 1.00 92.60 ? 292 LYS A NZ    1 
ATOM   2072 N N     . PHE A 1 293 ? 26.948 -20.557 -19.894 1.00 90.72 ? 293 PHE A N     1 
ATOM   2073 C CA    . PHE A 1 293 ? 27.875 -19.556 -19.391 1.00 90.04 ? 293 PHE A CA    1 
ATOM   2074 C C     . PHE A 1 293 ? 29.100 -20.203 -18.774 1.00 89.29 ? 293 PHE A C     1 
ATOM   2075 O O     . PHE A 1 293 ? 28.994 -20.983 -17.827 1.00 89.28 ? 293 PHE A O     1 
ATOM   2076 C CB    . PHE A 1 293 ? 27.190 -18.653 -18.364 1.00 90.41 ? 293 PHE A CB    1 
ATOM   2077 C CG    . PHE A 1 293 ? 27.064 -17.226 -18.813 1.00 90.82 ? 293 PHE A CG    1 
ATOM   2078 C CD1   . PHE A 1 293 ? 25.816 -16.615 -18.901 1.00 90.90 ? 293 PHE A CD1   1 
ATOM   2079 C CD2   . PHE A 1 293 ? 28.194 -16.498 -19.182 1.00 90.92 ? 293 PHE A CD2   1 
ATOM   2080 C CE1   . PHE A 1 293 ? 25.694 -15.300 -19.353 1.00 90.91 ? 293 PHE A CE1   1 
ATOM   2081 C CE2   . PHE A 1 293 ? 28.084 -15.185 -19.636 1.00 90.97 ? 293 PHE A CE2   1 
ATOM   2082 C CZ    . PHE A 1 293 ? 26.831 -14.585 -19.722 1.00 90.96 ? 293 PHE A CZ    1 
ATOM   2083 N N     . PRO A 1 294 ? 30.284 -19.885 -19.316 1.00 88.62 ? 294 PRO A N     1 
ATOM   2084 C CA    . PRO A 1 294 ? 31.572 -20.410 -18.853 1.00 87.94 ? 294 PRO A CA    1 
ATOM   2085 C C     . PRO A 1 294 ? 31.635 -20.619 -17.345 1.00 87.02 ? 294 PRO A C     1 
ATOM   2086 O O     . PRO A 1 294 ? 31.454 -19.679 -16.570 1.00 86.86 ? 294 PRO A O     1 
ATOM   2087 C CB    . PRO A 1 294 ? 32.587 -19.366 -19.330 1.00 88.22 ? 294 PRO A CB    1 
ATOM   2088 C CG    . PRO A 1 294 ? 31.824 -18.417 -20.241 1.00 88.48 ? 294 PRO A CG    1 
ATOM   2089 C CD    . PRO A 1 294 ? 30.453 -18.973 -20.456 1.00 88.59 ? 294 PRO A CD    1 
ATOM   2090 N N     . GLN A 1 295 ? 31.889 -21.859 -16.938 1.00 85.88 ? 295 GLN A N     1 
ATOM   2091 C CA    . GLN A 1 295 ? 31.986 -22.188 -15.525 1.00 84.68 ? 295 GLN A CA    1 
ATOM   2092 C C     . GLN A 1 295 ? 33.292 -21.645 -14.969 1.00 83.40 ? 295 GLN A C     1 
ATOM   2093 O O     . GLN A 1 295 ? 34.343 -22.266 -15.119 1.00 83.51 ? 295 GLN A O     1 
ATOM   2094 C CB    . GLN A 1 295 ? 31.934 -23.705 -15.315 1.00 85.11 ? 295 GLN A CB    1 
ATOM   2095 C CG    . GLN A 1 295 ? 31.552 -24.496 -16.551 1.00 85.45 ? 295 GLN A CG    1 
ATOM   2096 C CD    . GLN A 1 295 ? 30.130 -24.224 -16.989 1.00 85.87 ? 295 GLN A CD    1 
ATOM   2097 O OE1   . GLN A 1 295 ? 29.845 -24.121 -18.184 1.00 86.06 ? 295 GLN A OE1   1 
ATOM   2098 N NE2   . GLN A 1 295 ? 29.226 -24.104 -16.022 1.00 85.88 ? 295 GLN A NE2   1 
ATOM   2099 N N     . ILE A 1 296 ? 33.228 -20.476 -14.341 1.00 81.73 ? 296 ILE A N     1 
ATOM   2100 C CA    . ILE A 1 296 ? 34.414 -19.870 -13.758 1.00 80.04 ? 296 ILE A CA    1 
ATOM   2101 C C     . ILE A 1 296 ? 34.327 -19.987 -12.248 1.00 78.91 ? 296 ILE A C     1 
ATOM   2102 O O     . ILE A 1 296 ? 33.264 -19.788 -11.662 1.00 78.75 ? 296 ILE A O     1 
ATOM   2103 C CB    . ILE A 1 296 ? 34.540 -18.379 -14.148 1.00 79.87 ? 296 ILE A CB    1 
ATOM   2104 C CG1   . ILE A 1 296 ? 35.330 -18.251 -15.450 1.00 79.82 ? 296 ILE A CG1   1 
ATOM   2105 C CG2   . ILE A 1 296 ? 35.249 -17.600 -13.048 1.00 79.81 ? 296 ILE A CG2   1 
ATOM   2106 C CD1   . ILE A 1 296 ? 34.495 -18.441 -16.691 1.00 79.53 ? 296 ILE A CD1   1 
ATOM   2107 N N     . LYS A 1 297 ? 35.446 -20.326 -11.624 1.00 77.60 ? 297 LYS A N     1 
ATOM   2108 C CA    . LYS A 1 297 ? 35.491 -20.455 -10.179 1.00 76.20 ? 297 LYS A CA    1 
ATOM   2109 C C     . LYS A 1 297 ? 35.466 -19.053 -9.587  1.00 74.61 ? 297 LYS A C     1 
ATOM   2110 O O     . LYS A 1 297 ? 35.975 -18.106 -10.190 1.00 74.19 ? 297 LYS A O     1 
ATOM   2111 C CB    . LYS A 1 297 ? 36.766 -21.191 -9.749  1.00 77.20 ? 297 LYS A CB    1 
ATOM   2112 C CG    . LYS A 1 297 ? 38.061 -20.436 -10.043 1.00 78.38 ? 297 LYS A CG    1 
ATOM   2113 C CD    . LYS A 1 297 ? 38.550 -20.688 -11.466 1.00 79.34 ? 297 LYS A CD    1 
ATOM   2114 C CE    . LYS A 1 297 ? 39.343 -19.500 -12.004 1.00 80.02 ? 297 LYS A CE    1 
ATOM   2115 N NZ    . LYS A 1 297 ? 39.300 -19.423 -13.494 1.00 80.33 ? 297 LYS A NZ    1 
ATOM   2116 N N     . ALA A 1 298 ? 34.859 -18.918 -8.414  1.00 72.90 ? 298 ALA A N     1 
ATOM   2117 C CA    . ALA A 1 298 ? 34.783 -17.625 -7.757  1.00 71.06 ? 298 ALA A CA    1 
ATOM   2118 C C     . ALA A 1 298 ? 36.187 -17.057 -7.625  1.00 69.77 ? 298 ALA A C     1 
ATOM   2119 O O     . ALA A 1 298 ? 37.121 -17.768 -7.255  1.00 69.73 ? 298 ALA A O     1 
ATOM   2120 C CB    . ALA A 1 298 ? 34.146 -17.771 -6.384  1.00 71.19 ? 298 ALA A CB    1 
ATOM   2121 N N     . HIS A 1 299 ? 36.335 -15.778 -7.946  1.00 68.14 ? 299 HIS A N     1 
ATOM   2122 C CA    . HIS A 1 299 ? 37.627 -15.117 -7.843  1.00 66.55 ? 299 HIS A CA    1 
ATOM   2123 C C     . HIS A 1 299 ? 37.785 -14.566 -6.423  1.00 65.14 ? 299 HIS A C     1 
ATOM   2124 O O     . HIS A 1 299 ? 37.006 -13.714 -5.989  1.00 65.15 ? 299 HIS A O     1 
ATOM   2125 C CB    . HIS A 1 299 ? 37.711 -13.982 -8.863  1.00 67.02 ? 299 HIS A CB    1 
ATOM   2126 C CG    . HIS A 1 299 ? 39.075 -13.383 -8.988  1.00 67.42 ? 299 HIS A CG    1 
ATOM   2127 N ND1   . HIS A 1 299 ? 40.217 -14.041 -8.585  1.00 67.64 ? 299 HIS A ND1   1 
ATOM   2128 C CD2   . HIS A 1 299 ? 39.481 -12.182 -9.464  1.00 68.02 ? 299 HIS A CD2   1 
ATOM   2129 C CE1   . HIS A 1 299 ? 41.268 -13.272 -8.809  1.00 67.80 ? 299 HIS A CE1   1 
ATOM   2130 N NE2   . HIS A 1 299 ? 40.849 -12.138 -9.341  1.00 68.11 ? 299 HIS A NE2   1 
ATOM   2131 N N     . PRO A 1 300 ? 38.795 -15.051 -5.680  1.00 63.57 ? 300 PRO A N     1 
ATOM   2132 C CA    . PRO A 1 300 ? 39.032 -14.594 -4.305  1.00 61.99 ? 300 PRO A CA    1 
ATOM   2133 C C     . PRO A 1 300 ? 38.888 -13.080 -4.172  1.00 60.22 ? 300 PRO A C     1 
ATOM   2134 O O     . PRO A 1 300 ? 39.703 -12.317 -4.695  1.00 60.13 ? 300 PRO A O     1 
ATOM   2135 C CB    . PRO A 1 300 ? 40.457 -15.073 -3.997  1.00 62.42 ? 300 PRO A CB    1 
ATOM   2136 C CG    . PRO A 1 300 ? 40.988 -15.668 -5.296  1.00 62.83 ? 300 PRO A CG    1 
ATOM   2137 C CD    . PRO A 1 300 ? 39.789 -16.052 -6.097  1.00 63.34 ? 300 PRO A CD    1 
ATOM   2138 N N     . TRP A 1 301 ? 37.840 -12.661 -3.469  1.00 58.14 ? 301 TRP A N     1 
ATOM   2139 C CA    . TRP A 1 301 ? 37.551 -11.249 -3.264  1.00 55.93 ? 301 TRP A CA    1 
ATOM   2140 C C     . TRP A 1 301 ? 38.782 -10.447 -2.843  1.00 55.52 ? 301 TRP A C     1 
ATOM   2141 O O     . TRP A 1 301 ? 38.872 -9.249  -3.117  1.00 55.41 ? 301 TRP A O     1 
ATOM   2142 C CB    . TRP A 1 301 ? 36.445 -11.091 -2.217  1.00 53.87 ? 301 TRP A CB    1 
ATOM   2143 C CG    . TRP A 1 301 ? 35.056 -11.015 -2.792  1.00 51.58 ? 301 TRP A CG    1 
ATOM   2144 C CD1   . TRP A 1 301 ? 34.052 -11.928 -2.632  1.00 50.76 ? 301 TRP A CD1   1 
ATOM   2145 C CD2   . TRP A 1 301 ? 34.508 -9.953  -3.583  1.00 50.26 ? 301 TRP A CD2   1 
ATOM   2146 N NE1   . TRP A 1 301 ? 32.914 -11.500 -3.272  1.00 49.81 ? 301 TRP A NE1   1 
ATOM   2147 C CE2   . TRP A 1 301 ? 33.167 -10.292 -3.865  1.00 49.68 ? 301 TRP A CE2   1 
ATOM   2148 C CE3   . TRP A 1 301 ? 35.023 -8.750  -4.084  1.00 49.86 ? 301 TRP A CE3   1 
ATOM   2149 C CZ2   . TRP A 1 301 ? 32.330 -9.468  -4.621  1.00 49.33 ? 301 TRP A CZ2   1 
ATOM   2150 C CZ3   . TRP A 1 301 ? 34.189 -7.929  -4.838  1.00 49.43 ? 301 TRP A CZ3   1 
ATOM   2151 C CH2   . TRP A 1 301 ? 32.857 -8.295  -5.101  1.00 49.28 ? 301 TRP A CH2   1 
ATOM   2152 N N     . THR A 1 302 ? 39.731 -11.108 -2.185  1.00 55.13 ? 302 THR A N     1 
ATOM   2153 C CA    . THR A 1 302 ? 40.946 -10.435 -1.737  1.00 54.68 ? 302 THR A CA    1 
ATOM   2154 C C     . THR A 1 302 ? 41.849 -10.043 -2.906  1.00 54.21 ? 302 THR A C     1 
ATOM   2155 O O     . THR A 1 302 ? 42.491 -8.990  -2.871  1.00 54.51 ? 302 THR A O     1 
ATOM   2156 C CB    . THR A 1 302 ? 41.748 -11.316 -0.758  1.00 54.88 ? 302 THR A CB    1 
ATOM   2157 O OG1   . THR A 1 302 ? 40.962 -11.556 0.417   1.00 54.85 ? 302 THR A OG1   1 
ATOM   2158 C CG2   . THR A 1 302 ? 43.046 -10.624 -0.353  1.00 54.61 ? 302 THR A CG2   1 
ATOM   2159 N N     . LYS A 1 303 ? 41.894 -10.885 -3.936  1.00 53.25 ? 303 LYS A N     1 
ATOM   2160 C CA    . LYS A 1 303 ? 42.721 -10.604 -5.108  1.00 52.57 ? 303 LYS A CA    1 
ATOM   2161 C C     . LYS A 1 303 ? 42.057 -9.573  -6.022  1.00 51.06 ? 303 LYS A C     1 
ATOM   2162 O O     . LYS A 1 303 ? 42.677 -9.070  -6.958  1.00 50.71 ? 303 LYS A O     1 
ATOM   2163 C CB    . LYS A 1 303 ? 42.992 -11.895 -5.896  1.00 54.40 ? 303 LYS A CB    1 
ATOM   2164 C CG    . LYS A 1 303 ? 43.879 -11.694 -7.138  1.00 56.26 ? 303 LYS A CG    1 
ATOM   2165 C CD    . LYS A 1 303 ? 44.444 -13.007 -7.687  1.00 57.37 ? 303 LYS A CD    1 
ATOM   2166 C CE    . LYS A 1 303 ? 44.865 -12.855 -9.151  1.00 58.49 ? 303 LYS A CE    1 
ATOM   2167 N NZ    . LYS A 1 303 ? 44.752 -14.122 -9.944  1.00 58.94 ? 303 LYS A NZ    1 
ATOM   2168 N N     . VAL A 1 304 ? 40.797 -9.255  -5.741  1.00 49.52 ? 304 VAL A N     1 
ATOM   2169 C CA    . VAL A 1 304 ? 40.054 -8.285  -6.538  1.00 47.52 ? 304 VAL A CA    1 
ATOM   2170 C C     . VAL A 1 304 ? 40.530 -6.856  -6.286  1.00 46.65 ? 304 VAL A C     1 
ATOM   2171 O O     . VAL A 1 304 ? 40.646 -6.061  -7.217  1.00 46.01 ? 304 VAL A O     1 
ATOM   2172 C CB    . VAL A 1 304 ? 38.541 -8.358  -6.235  1.00 47.39 ? 304 VAL A CB    1 
ATOM   2173 C CG1   . VAL A 1 304 ? 37.821 -7.195  -6.895  1.00 47.26 ? 304 VAL A CG1   1 
ATOM   2174 C CG2   . VAL A 1 304 ? 37.973 -9.678  -6.727  1.00 47.02 ? 304 VAL A CG2   1 
ATOM   2175 N N     . PHE A 1 305 ? 40.812 -6.537  -5.026  1.00 45.57 ? 305 PHE A N     1 
ATOM   2176 C CA    . PHE A 1 305 ? 41.255 -5.194  -4.665  1.00 45.14 ? 305 PHE A CA    1 
ATOM   2177 C C     . PHE A 1 305 ? 42.758 -5.098  -4.395  1.00 46.09 ? 305 PHE A C     1 
ATOM   2178 O O     . PHE A 1 305 ? 43.434 -6.116  -4.241  1.00 46.26 ? 305 PHE A O     1 
ATOM   2179 C CB    . PHE A 1 305 ? 40.490 -4.719  -3.426  1.00 43.11 ? 305 PHE A CB    1 
ATOM   2180 C CG    . PHE A 1 305 ? 38.999 -4.783  -3.575  1.00 40.70 ? 305 PHE A CG    1 
ATOM   2181 C CD1   . PHE A 1 305 ? 38.283 -5.844  -3.043  1.00 39.45 ? 305 PHE A CD1   1 
ATOM   2182 C CD2   . PHE A 1 305 ? 38.313 -3.786  -4.263  1.00 40.00 ? 305 PHE A CD2   1 
ATOM   2183 C CE1   . PHE A 1 305 ? 36.902 -5.914  -3.197  1.00 39.33 ? 305 PHE A CE1   1 
ATOM   2184 C CE2   . PHE A 1 305 ? 36.931 -3.846  -4.422  1.00 38.44 ? 305 PHE A CE2   1 
ATOM   2185 C CZ    . PHE A 1 305 ? 36.225 -4.910  -3.889  1.00 38.61 ? 305 PHE A CZ    1 
ATOM   2186 N N     . ARG A 1 306 ? 43.269 -3.869  -4.342  1.00 47.01 ? 306 ARG A N     1 
ATOM   2187 C CA    . ARG A 1 306 ? 44.684 -3.630  -4.064  1.00 48.19 ? 306 ARG A CA    1 
ATOM   2188 C C     . ARG A 1 306 ? 45.019 -4.225  -2.690  1.00 48.41 ? 306 ARG A C     1 
ATOM   2189 O O     . ARG A 1 306 ? 44.139 -4.391  -1.842  1.00 47.94 ? 306 ARG A O     1 
ATOM   2190 C CB    . ARG A 1 306 ? 44.982 -2.128  -4.082  1.00 49.43 ? 306 ARG A CB    1 
ATOM   2191 C CG    . ARG A 1 306 ? 44.633 -1.406  -2.791  1.00 52.11 ? 306 ARG A CG    1 
ATOM   2192 C CD    . ARG A 1 306 ? 44.721 0.106   -2.950  1.00 54.45 ? 306 ARG A CD    1 
ATOM   2193 N NE    . ARG A 1 306 ? 44.626 0.796   -1.664  1.00 56.91 ? 306 ARG A NE    1 
ATOM   2194 C CZ    . ARG A 1 306 ? 43.530 0.834   -0.908  1.00 58.37 ? 306 ARG A CZ    1 
ATOM   2195 N NH1   . ARG A 1 306 ? 42.420 0.219   -1.305  1.00 58.89 ? 306 ARG A NH1   1 
ATOM   2196 N NH2   . ARG A 1 306 ? 43.540 1.489   0.251   1.00 58.84 ? 306 ARG A NH2   1 
ATOM   2197 N N     . PRO A 1 307 ? 46.300 -4.548  -2.449  1.00 48.75 ? 307 PRO A N     1 
ATOM   2198 C CA    . PRO A 1 307 ? 46.726 -5.132  -1.170  1.00 48.81 ? 307 PRO A CA    1 
ATOM   2199 C C     . PRO A 1 307 ? 46.391 -4.332  0.091   1.00 48.58 ? 307 PRO A C     1 
ATOM   2200 O O     . PRO A 1 307 ? 46.026 -4.905  1.116   1.00 48.53 ? 307 PRO A O     1 
ATOM   2201 C CB    . PRO A 1 307 ? 48.236 -5.327  -1.343  1.00 48.69 ? 307 PRO A CB    1 
ATOM   2202 C CG    . PRO A 1 307 ? 48.452 -5.334  -2.821  1.00 49.15 ? 307 PRO A CG    1 
ATOM   2203 C CD    . PRO A 1 307 ? 47.435 -4.378  -3.373  1.00 49.04 ? 307 PRO A CD    1 
ATOM   2204 N N     . ARG A 1 308 ? 46.515 -3.014  0.017   1.00 48.74 ? 308 ARG A N     1 
ATOM   2205 C CA    . ARG A 1 308 ? 46.237 -2.158  1.168   1.00 49.27 ? 308 ARG A CA    1 
ATOM   2206 C C     . ARG A 1 308 ? 44.773 -2.164  1.631   1.00 47.63 ? 308 ARG A C     1 
ATOM   2207 O O     . ARG A 1 308 ? 44.480 -1.813  2.776   1.00 47.68 ? 308 ARG A O     1 
ATOM   2208 C CB    . ARG A 1 308 ? 46.639 -0.713  0.855   1.00 51.84 ? 308 ARG A CB    1 
ATOM   2209 C CG    . ARG A 1 308 ? 48.128 -0.480  0.644   1.00 55.42 ? 308 ARG A CG    1 
ATOM   2210 C CD    . ARG A 1 308 ? 48.355 0.903   0.039   1.00 58.48 ? 308 ARG A CD    1 
ATOM   2211 N NE    . ARG A 1 308 ? 49.764 1.293   0.045   1.00 61.53 ? 308 ARG A NE    1 
ATOM   2212 C CZ    . ARG A 1 308 ? 50.241 2.377   -0.565  1.00 62.90 ? 308 ARG A CZ    1 
ATOM   2213 N NH1   . ARG A 1 308 ? 51.539 2.660   -0.512  1.00 63.50 ? 308 ARG A NH1   1 
ATOM   2214 N NH2   . ARG A 1 308 ? 49.415 3.179   -1.231  1.00 63.57 ? 308 ARG A NH2   1 
ATOM   2215 N N     . THR A 1 309 ? 43.862 -2.554  0.741   1.00 45.26 ? 309 THR A N     1 
ATOM   2216 C CA    . THR A 1 309 ? 42.430 -2.575  1.041   1.00 42.40 ? 309 THR A CA    1 
ATOM   2217 C C     . THR A 1 309 ? 42.036 -3.250  2.350   1.00 40.90 ? 309 THR A C     1 
ATOM   2218 O O     . THR A 1 309 ? 42.322 -4.424  2.563   1.00 40.48 ? 309 THR A O     1 
ATOM   2219 C CB    . THR A 1 309 ? 41.649 -3.247  -0.098  1.00 41.82 ? 309 THR A CB    1 
ATOM   2220 O OG1   . THR A 1 309 ? 42.024 -2.643  -1.340  1.00 41.09 ? 309 THR A OG1   1 
ATOM   2221 C CG2   . THR A 1 309 ? 40.149 -3.079  0.108   1.00 40.95 ? 309 THR A CG2   1 
ATOM   2222 N N     . PRO A 1 310 ? 41.353 -2.509  3.239   1.00 39.82 ? 310 PRO A N     1 
ATOM   2223 C CA    . PRO A 1 310 ? 40.914 -3.047  4.535   1.00 38.56 ? 310 PRO A CA    1 
ATOM   2224 C C     . PRO A 1 310 ? 40.061 -4.302  4.375   1.00 37.85 ? 310 PRO A C     1 
ATOM   2225 O O     . PRO A 1 310 ? 39.128 -4.328  3.575   1.00 37.86 ? 310 PRO A O     1 
ATOM   2226 C CB    . PRO A 1 310 ? 40.119 -1.898  5.158   1.00 38.61 ? 310 PRO A CB    1 
ATOM   2227 C CG    . PRO A 1 310 ? 40.571 -0.676  4.438   1.00 38.74 ? 310 PRO A CG    1 
ATOM   2228 C CD    . PRO A 1 310 ? 40.953 -1.102  3.059   1.00 39.18 ? 310 PRO A CD    1 
ATOM   2229 N N     . PRO A 1 311 ? 40.376 -5.367  5.134   1.00 37.21 ? 311 PRO A N     1 
ATOM   2230 C CA    . PRO A 1 311 ? 39.613 -6.614  5.050   1.00 36.25 ? 311 PRO A CA    1 
ATOM   2231 C C     . PRO A 1 311 ? 38.127 -6.421  5.324   1.00 35.50 ? 311 PRO A C     1 
ATOM   2232 O O     . PRO A 1 311 ? 37.289 -7.117  4.753   1.00 35.49 ? 311 PRO A O     1 
ATOM   2233 C CB    . PRO A 1 311 ? 40.271 -7.522  6.093   1.00 36.15 ? 311 PRO A CB    1 
ATOM   2234 C CG    . PRO A 1 311 ? 41.031 -6.612  6.979   1.00 36.57 ? 311 PRO A CG    1 
ATOM   2235 C CD    . PRO A 1 311 ? 41.468 -5.466  6.117   1.00 37.01 ? 311 PRO A CD    1 
ATOM   2236 N N     . GLU A 1 312 ? 37.796 -5.484  6.204   1.00 34.54 ? 312 GLU A N     1 
ATOM   2237 C CA    . GLU A 1 312 ? 36.394 -5.231  6.519   1.00 34.34 ? 312 GLU A CA    1 
ATOM   2238 C C     . GLU A 1 312 ? 35.637 -4.708  5.295   1.00 32.49 ? 312 GLU A C     1 
ATOM   2239 O O     . GLU A 1 312 ? 34.476 -5.056  5.085   1.00 31.68 ? 312 GLU A O     1 
ATOM   2240 C CB    . GLU A 1 312 ? 36.278 -4.232  7.672   1.00 36.20 ? 312 GLU A CB    1 
ATOM   2241 C CG    . GLU A 1 312 ? 36.611 -4.828  9.030   1.00 39.55 ? 312 GLU A CG    1 
ATOM   2242 C CD    . GLU A 1 312 ? 35.876 -6.132  9.295   1.00 42.16 ? 312 GLU A CD    1 
ATOM   2243 O OE1   . GLU A 1 312 ? 36.275 -6.863  10.229  1.00 44.23 ? 312 GLU A OE1   1 
ATOM   2244 O OE2   . GLU A 1 312 ? 34.897 -6.431  8.575   1.00 43.94 ? 312 GLU A OE2   1 
ATOM   2245 N N     . ALA A 1 313 ? 36.297 -3.874  4.495   1.00 30.91 ? 313 ALA A N     1 
ATOM   2246 C CA    . ALA A 1 313 ? 35.674 -3.333  3.290   1.00 30.37 ? 313 ALA A CA    1 
ATOM   2247 C C     . ALA A 1 313 ? 35.390 -4.467  2.304   1.00 30.20 ? 313 ALA A C     1 
ATOM   2248 O O     . ALA A 1 313 ? 34.339 -4.502  1.668   1.00 29.63 ? 313 ALA A O     1 
ATOM   2249 C CB    . ALA A 1 313 ? 36.581 -2.297  2.643   1.00 29.45 ? 313 ALA A CB    1 
ATOM   2250 N N     . ILE A 1 314 ? 36.338 -5.389  2.176   1.00 30.12 ? 314 ILE A N     1 
ATOM   2251 C CA    . ILE A 1 314 ? 36.180 -6.521  1.274   1.00 29.93 ? 314 ILE A CA    1 
ATOM   2252 C C     . ILE A 1 314 ? 35.042 -7.418  1.769   1.00 29.90 ? 314 ILE A C     1 
ATOM   2253 O O     . ILE A 1 314 ? 34.182 -7.847  0.988   1.00 29.87 ? 314 ILE A O     1 
ATOM   2254 C CB    . ILE A 1 314 ? 37.499 -7.333  1.182   1.00 30.54 ? 314 ILE A CB    1 
ATOM   2255 C CG1   . ILE A 1 314 ? 38.632 -6.418  0.712   1.00 30.48 ? 314 ILE A CG1   1 
ATOM   2256 C CG2   . ILE A 1 314 ? 37.338 -8.500  0.217   1.00 30.36 ? 314 ILE A CG2   1 
ATOM   2257 C CD1   . ILE A 1 314 ? 39.958 -7.127  0.470   1.00 31.35 ? 314 ILE A CD1   1 
ATOM   2258 N N     . ALA A 1 315 ? 35.029 -7.687  3.072   1.00 29.15 ? 315 ALA A N     1 
ATOM   2259 C CA    . ALA A 1 315 ? 33.993 -8.529  3.671   1.00 29.00 ? 315 ALA A CA    1 
ATOM   2260 C C     . ALA A 1 315 ? 32.595 -7.949  3.440   1.00 28.56 ? 315 ALA A C     1 
ATOM   2261 O O     . ALA A 1 315 ? 31.674 -8.675  3.070   1.00 28.57 ? 315 ALA A O     1 
ATOM   2262 C CB    . ALA A 1 315 ? 34.253 -8.688  5.167   1.00 29.33 ? 315 ALA A CB    1 
ATOM   2263 N N     . LEU A 1 316 ? 32.438 -6.647  3.671   1.00 27.37 ? 316 LEU A N     1 
ATOM   2264 C CA    . LEU A 1 316 ? 31.149 -5.988  3.463   1.00 26.65 ? 316 LEU A CA    1 
ATOM   2265 C C     . LEU A 1 316 ? 30.750 -6.156  1.994   1.00 27.11 ? 316 LEU A C     1 
ATOM   2266 O O     . LEU A 1 316 ? 29.617 -6.510  1.668   1.00 26.70 ? 316 LEU A O     1 
ATOM   2267 C CB    . LEU A 1 316 ? 31.252 -4.498  3.805   1.00 24.60 ? 316 LEU A CB    1 
ATOM   2268 C CG    . LEU A 1 316 ? 30.065 -3.622  3.387   1.00 23.73 ? 316 LEU A CG    1 
ATOM   2269 C CD1   . LEU A 1 316 ? 28.774 -4.170  3.996   1.00 22.40 ? 316 LEU A CD1   1 
ATOM   2270 C CD2   . LEU A 1 316 ? 30.310 -2.185  3.826   1.00 22.00 ? 316 LEU A CD2   1 
ATOM   2271 N N     . CYS A 1 317 ? 31.706 -5.912  1.109   1.00 27.56 ? 317 CYS A N     1 
ATOM   2272 C CA    . CYS A 1 317 ? 31.478 -6.039  -0.317  1.00 29.44 ? 317 CYS A CA    1 
ATOM   2273 C C     . CYS A 1 317 ? 30.900 -7.394  -0.718  1.00 28.71 ? 317 CYS A C     1 
ATOM   2274 O O     . CYS A 1 317 ? 29.919 -7.471  -1.459  1.00 28.02 ? 317 CYS A O     1 
ATOM   2275 C CB    . CYS A 1 317 ? 32.791 -5.819  -1.048  1.00 31.59 ? 317 CYS A CB    1 
ATOM   2276 S SG    . CYS A 1 317 ? 32.621 -4.794  -2.469  1.00 39.09 ? 317 CYS A SG    1 
ATOM   2277 N N     . SER A 1 318 ? 31.517 -8.464  -0.230  1.00 28.62 ? 318 SER A N     1 
ATOM   2278 C CA    . SER A 1 318 ? 31.072 -9.813  -0.552  1.00 28.69 ? 318 SER A CA    1 
ATOM   2279 C C     . SER A 1 318 ? 29.677 -10.103 -0.036  1.00 28.16 ? 318 SER A C     1 
ATOM   2280 O O     . SER A 1 318 ? 29.008 -11.021 -0.520  1.00 28.72 ? 318 SER A O     1 
ATOM   2281 C CB    . SER A 1 318 ? 32.040 -10.832 0.030   1.00 29.27 ? 318 SER A CB    1 
ATOM   2282 O OG    . SER A 1 318 ? 31.888 -10.884 1.435   1.00 31.20 ? 318 SER A OG    1 
ATOM   2283 N N     . ARG A 1 319 ? 29.236 -9.319  0.943   1.00 27.55 ? 319 ARG A N     1 
ATOM   2284 C CA    . ARG A 1 319 ? 27.910 -9.494  1.532   1.00 26.84 ? 319 ARG A CA    1 
ATOM   2285 C C     . ARG A 1 319 ? 26.834 -8.655  0.848   1.00 25.10 ? 319 ARG A C     1 
ATOM   2286 O O     . ARG A 1 319 ? 25.648 -8.811  1.126   1.00 24.70 ? 319 ARG A O     1 
ATOM   2287 C CB    . ARG A 1 319 ? 27.953 -9.164  3.029   1.00 28.50 ? 319 ARG A CB    1 
ATOM   2288 C CG    . ARG A 1 319 ? 28.850 -10.102 3.831   1.00 31.35 ? 319 ARG A CG    1 
ATOM   2289 C CD    . ARG A 1 319 ? 28.335 -11.528 3.782   1.00 34.11 ? 319 ARG A CD    1 
ATOM   2290 N NE    . ARG A 1 319 ? 27.107 -11.671 4.560   1.00 37.45 ? 319 ARG A NE    1 
ATOM   2291 C CZ    . ARG A 1 319 ? 25.910 -11.918 4.034   1.00 38.58 ? 319 ARG A CZ    1 
ATOM   2292 N NH1   . ARG A 1 319 ? 25.772 -12.053 2.719   1.00 38.77 ? 319 ARG A NH1   1 
ATOM   2293 N NH2   . ARG A 1 319 ? 24.846 -12.020 4.824   1.00 39.92 ? 319 ARG A NH2   1 
ATOM   2294 N N     . LEU A 1 320 ? 27.249 -7.759  -0.039  1.00 23.96 ? 320 LEU A N     1 
ATOM   2295 C CA    . LEU A 1 320 ? 26.301 -6.926  -0.772  1.00 22.99 ? 320 LEU A CA    1 
ATOM   2296 C C     . LEU A 1 320 ? 26.140 -7.479  -2.182  1.00 23.00 ? 320 LEU A C     1 
ATOM   2297 O O     . LEU A 1 320 ? 25.026 -7.594  -2.700  1.00 22.20 ? 320 LEU A O     1 
ATOM   2298 C CB    . LEU A 1 320 ? 26.797 -5.477  -0.851  1.00 21.80 ? 320 LEU A CB    1 
ATOM   2299 C CG    . LEU A 1 320 ? 26.999 -4.748  0.478   1.00 21.35 ? 320 LEU A CG    1 
ATOM   2300 C CD1   . LEU A 1 320 ? 27.793 -3.479  0.236   1.00 21.80 ? 320 LEU A CD1   1 
ATOM   2301 C CD2   . LEU A 1 320 ? 25.661 -4.423  1.097   1.00 20.58 ? 320 LEU A CD2   1 
ATOM   2302 N N     . LEU A 1 321 ? 27.265 -7.818  -2.800  1.00 23.74 ? 321 LEU A N     1 
ATOM   2303 C CA    . LEU A 1 321 ? 27.255 -8.347  -4.156  1.00 24.29 ? 321 LEU A CA    1 
ATOM   2304 C C     . LEU A 1 321 ? 27.075 -9.868  -4.161  1.00 25.65 ? 321 LEU A C     1 
ATOM   2305 O O     . LEU A 1 321 ? 28.013 -10.621 -4.421  1.00 26.65 ? 321 LEU A O     1 
ATOM   2306 C CB    . LEU A 1 321 ? 28.545 -7.935  -4.861  1.00 22.91 ? 321 LEU A CB    1 
ATOM   2307 C CG    . LEU A 1 321 ? 28.725 -6.409  -4.893  1.00 22.10 ? 321 LEU A CG    1 
ATOM   2308 C CD1   . LEU A 1 321 ? 30.063 -6.039  -5.509  1.00 21.82 ? 321 LEU A CD1   1 
ATOM   2309 C CD2   . LEU A 1 321 ? 27.587 -5.785  -5.682  1.00 20.60 ? 321 LEU A CD2   1 
ATOM   2310 N N     . GLU A 1 322 ? 25.854 -10.300 -3.854  1.00 26.77 ? 322 GLU A N     1 
ATOM   2311 C CA    . GLU A 1 322 ? 25.494 -11.718 -3.812  1.00 27.73 ? 322 GLU A CA    1 
ATOM   2312 C C     . GLU A 1 322 ? 24.463 -11.995 -4.897  1.00 27.14 ? 322 GLU A C     1 
ATOM   2313 O O     . GLU A 1 322 ? 23.582 -11.172 -5.128  1.00 26.21 ? 322 GLU A O     1 
ATOM   2314 C CB    . GLU A 1 322 ? 24.879 -12.083 -2.452  1.00 29.03 ? 322 GLU A CB    1 
ATOM   2315 C CG    . GLU A 1 322 ? 25.800 -11.881 -1.260  1.00 32.25 ? 322 GLU A CG    1 
ATOM   2316 C CD    . GLU A 1 322 ? 26.353 -13.181 -0.707  1.00 34.09 ? 322 GLU A CD    1 
ATOM   2317 O OE1   . GLU A 1 322 ? 26.374 -14.190 -1.445  1.00 36.01 ? 322 GLU A OE1   1 
ATOM   2318 O OE2   . GLU A 1 322 ? 26.776 -13.192 0.469   1.00 35.35 ? 322 GLU A OE2   1 
ATOM   2319 N N     . TYR A 1 323 ? 24.566 -13.153 -5.550  1.00 27.04 ? 323 TYR A N     1 
ATOM   2320 C CA    . TYR A 1 323 ? 23.618 -13.534 -6.598  1.00 27.27 ? 323 TYR A CA    1 
ATOM   2321 C C     . TYR A 1 323 ? 22.181 -13.621 -6.055  1.00 27.29 ? 323 TYR A C     1 
ATOM   2322 O O     . TYR A 1 323 ? 21.261 -13.013 -6.595  1.00 27.58 ? 323 TYR A O     1 
ATOM   2323 C CB    . TYR A 1 323 ? 23.997 -14.896 -7.206  1.00 27.27 ? 323 TYR A CB    1 
ATOM   2324 C CG    . TYR A 1 323 ? 25.106 -14.873 -8.244  1.00 27.42 ? 323 TYR A CG    1 
ATOM   2325 C CD1   . TYR A 1 323 ? 25.037 -14.044 -9.364  1.00 27.96 ? 323 TYR A CD1   1 
ATOM   2326 C CD2   . TYR A 1 323 ? 26.216 -15.701 -8.114  1.00 27.97 ? 323 TYR A CD2   1 
ATOM   2327 C CE1   . TYR A 1 323 ? 26.047 -14.043 -10.324 1.00 28.00 ? 323 TYR A CE1   1 
ATOM   2328 C CE2   . TYR A 1 323 ? 27.232 -15.707 -9.070  1.00 28.54 ? 323 TYR A CE2   1 
ATOM   2329 C CZ    . TYR A 1 323 ? 27.141 -14.875 -10.171 1.00 28.28 ? 323 TYR A CZ    1 
ATOM   2330 O OH    . TYR A 1 323 ? 28.150 -14.876 -11.110 1.00 28.75 ? 323 TYR A OH    1 
ATOM   2331 N N     . THR A 1 324 ? 21.982 -14.393 -4.992  1.00 27.87 ? 324 THR A N     1 
ATOM   2332 C CA    . THR A 1 324 ? 20.645 -14.537 -4.421  1.00 28.21 ? 324 THR A CA    1 
ATOM   2333 C C     . THR A 1 324 ? 20.240 -13.248 -3.729  1.00 27.66 ? 324 THR A C     1 
ATOM   2334 O O     . THR A 1 324 ? 20.828 -12.867 -2.717  1.00 27.93 ? 324 THR A O     1 
ATOM   2335 C CB    . THR A 1 324 ? 20.584 -15.690 -3.396  1.00 28.87 ? 324 THR A CB    1 
ATOM   2336 O OG1   . THR A 1 324 ? 21.106 -16.884 -3.990  1.00 30.23 ? 324 THR A OG1   1 
ATOM   2337 C CG2   . THR A 1 324 ? 19.154 -15.926 -2.959  1.00 28.56 ? 324 THR A CG2   1 
ATOM   2338 N N     . PRO A 1 325 ? 19.223 -12.562 -4.262  1.00 27.92 ? 325 PRO A N     1 
ATOM   2339 C CA    . PRO A 1 325 ? 18.735 -11.296 -3.696  1.00 27.92 ? 325 PRO A CA    1 
ATOM   2340 C C     . PRO A 1 325 ? 18.515 -11.291 -2.180  1.00 28.47 ? 325 PRO A C     1 
ATOM   2341 O O     . PRO A 1 325 ? 18.943 -10.366 -1.484  1.00 27.37 ? 325 PRO A O     1 
ATOM   2342 C CB    . PRO A 1 325 ? 17.442 -11.031 -4.468  1.00 27.98 ? 325 PRO A CB    1 
ATOM   2343 C CG    . PRO A 1 325 ? 17.656 -11.727 -5.791  1.00 28.64 ? 325 PRO A CG    1 
ATOM   2344 C CD    . PRO A 1 325 ? 18.468 -12.963 -5.463  1.00 28.09 ? 325 PRO A CD    1 
ATOM   2345 N N     . THR A 1 326 ? 17.852 -12.327 -1.672  1.00 28.30 ? 326 THR A N     1 
ATOM   2346 C CA    . THR A 1 326 ? 17.564 -12.431 -0.249  1.00 27.74 ? 326 THR A CA    1 
ATOM   2347 C C     . THR A 1 326 ? 18.807 -12.659 0.596   1.00 27.18 ? 326 THR A C     1 
ATOM   2348 O O     . THR A 1 326 ? 18.768 -12.489 1.811   1.00 28.05 ? 326 THR A O     1 
ATOM   2349 C CB    . THR A 1 326 ? 16.575 -13.580 0.030   1.00 28.21 ? 326 THR A CB    1 
ATOM   2350 O OG1   . THR A 1 326 ? 17.102 -14.802 -0.496  1.00 29.51 ? 326 THR A OG1   1 
ATOM   2351 C CG2   . THR A 1 326 ? 15.242 -13.303 -0.627  1.00 28.02 ? 326 THR A CG2   1 
ATOM   2352 N N     . ALA A 1 327 ? 19.911 -13.041 -0.034  1.00 26.42 ? 327 ALA A N     1 
ATOM   2353 C CA    . ALA A 1 327 ? 21.141 -13.287 0.708   1.00 25.77 ? 327 ALA A CA    1 
ATOM   2354 C C     . ALA A 1 327 ? 21.913 -12.007 1.013   1.00 26.00 ? 327 ALA A C     1 
ATOM   2355 O O     . ALA A 1 327 ? 22.782 -11.994 1.888   1.00 26.61 ? 327 ALA A O     1 
ATOM   2356 C CB    . ALA A 1 327 ? 22.026 -14.245 -0.051  1.00 25.51 ? 327 ALA A CB    1 
ATOM   2357 N N     . ARG A 1 328 ? 21.599 -10.930 0.300   1.00 25.49 ? 328 ARG A N     1 
ATOM   2358 C CA    . ARG A 1 328 ? 22.291 -9.660  0.514   1.00 24.66 ? 328 ARG A CA    1 
ATOM   2359 C C     . ARG A 1 328 ? 21.896 -9.003  1.832   1.00 24.26 ? 328 ARG A C     1 
ATOM   2360 O O     . ARG A 1 328 ? 20.766 -9.144  2.295   1.00 23.90 ? 328 ARG A O     1 
ATOM   2361 C CB    . ARG A 1 328 ? 21.994 -8.695  -0.640  1.00 24.45 ? 328 ARG A CB    1 
ATOM   2362 C CG    . ARG A 1 328 ? 22.310 -9.276  -2.007  1.00 23.81 ? 328 ARG A CG    1 
ATOM   2363 C CD    . ARG A 1 328 ? 21.803 -8.415  -3.151  1.00 23.78 ? 328 ARG A CD    1 
ATOM   2364 N NE    . ARG A 1 328 ? 21.870 -9.168  -4.399  1.00 22.98 ? 328 ARG A NE    1 
ATOM   2365 C CZ    . ARG A 1 328 ? 21.080 -8.968  -5.446  1.00 23.28 ? 328 ARG A CZ    1 
ATOM   2366 N NH1   . ARG A 1 328 ? 20.148 -8.023  -5.414  1.00 22.10 ? 328 ARG A NH1   1 
ATOM   2367 N NH2   . ARG A 1 328 ? 21.207 -9.744  -6.517  1.00 23.59 ? 328 ARG A NH2   1 
ATOM   2368 N N     . LEU A 1 329 ? 22.841 -8.288  2.434   1.00 24.26 ? 329 LEU A N     1 
ATOM   2369 C CA    . LEU A 1 329 ? 22.582 -7.580  3.683   1.00 23.29 ? 329 LEU A CA    1 
ATOM   2370 C C     . LEU A 1 329 ? 21.479 -6.561  3.443   1.00 23.04 ? 329 LEU A C     1 
ATOM   2371 O O     . LEU A 1 329 ? 21.297 -6.099  2.319   1.00 23.30 ? 329 LEU A O     1 
ATOM   2372 C CB    . LEU A 1 329 ? 23.829 -6.817  4.127   1.00 23.00 ? 329 LEU A CB    1 
ATOM   2373 C CG    . LEU A 1 329 ? 25.028 -7.592  4.655   1.00 23.73 ? 329 LEU A CG    1 
ATOM   2374 C CD1   . LEU A 1 329 ? 26.146 -6.613  4.992   1.00 22.52 ? 329 LEU A CD1   1 
ATOM   2375 C CD2   . LEU A 1 329 ? 24.619 -8.391  5.883   1.00 23.85 ? 329 LEU A CD2   1 
ATOM   2376 N N     . THR A 1 330 ? 20.725 -6.219  4.480   1.00 22.04 ? 330 THR A N     1 
ATOM   2377 C CA    . THR A 1 330 ? 19.713 -5.184  4.329   1.00 22.37 ? 330 THR A CA    1 
ATOM   2378 C C     . THR A 1 330 ? 20.512 -3.902  4.589   1.00 21.46 ? 330 THR A C     1 
ATOM   2379 O O     . THR A 1 330 ? 21.611 -3.957  5.145   1.00 21.47 ? 330 THR A O     1 
ATOM   2380 C CB    . THR A 1 330 ? 18.633 -5.256  5.410   1.00 22.84 ? 330 THR A CB    1 
ATOM   2381 O OG1   . THR A 1 330 ? 19.260 -5.111  6.687   1.00 23.53 ? 330 THR A OG1   1 
ATOM   2382 C CG2   . THR A 1 330 ? 17.877 -6.579  5.348   1.00 23.90 ? 330 THR A CG2   1 
ATOM   2383 N N     . PRO A 1 331 ? 19.995 -2.742  4.165   1.00 20.86 ? 331 PRO A N     1 
ATOM   2384 C CA    . PRO A 1 331 ? 20.730 -1.496  4.409   1.00 20.36 ? 331 PRO A CA    1 
ATOM   2385 C C     . PRO A 1 331 ? 21.062 -1.262  5.885   1.00 19.82 ? 331 PRO A C     1 
ATOM   2386 O O     . PRO A 1 331 ? 22.162 -0.821  6.209   1.00 18.98 ? 331 PRO A O     1 
ATOM   2387 C CB    . PRO A 1 331 ? 19.806 -0.420  3.845   1.00 20.17 ? 331 PRO A CB    1 
ATOM   2388 C CG    . PRO A 1 331 ? 19.019 -1.133  2.793   1.00 20.92 ? 331 PRO A CG    1 
ATOM   2389 C CD    . PRO A 1 331 ? 18.778 -2.509  3.369   1.00 20.91 ? 331 PRO A CD    1 
ATOM   2390 N N     . LEU A 1 332 ? 20.118 -1.557  6.778   1.00 20.47 ? 332 LEU A N     1 
ATOM   2391 C CA    . LEU A 1 332 ? 20.365 -1.362  8.208   1.00 20.98 ? 332 LEU A CA    1 
ATOM   2392 C C     . LEU A 1 332 ? 21.502 -2.275  8.690   1.00 21.47 ? 332 LEU A C     1 
ATOM   2393 O O     . LEU A 1 332 ? 22.347 -1.852  9.477   1.00 21.30 ? 332 LEU A O     1 
ATOM   2394 C CB    . LEU A 1 332 ? 19.085 -1.615  9.025   1.00 20.60 ? 332 LEU A CB    1 
ATOM   2395 C CG    . LEU A 1 332 ? 19.038 -0.954  10.408  1.00 20.67 ? 332 LEU A CG    1 
ATOM   2396 C CD1   . LEU A 1 332 ? 19.141 0.563   10.269  1.00 20.62 ? 332 LEU A CD1   1 
ATOM   2397 C CD2   . LEU A 1 332 ? 17.740 -1.313  11.097  1.00 21.04 ? 332 LEU A CD2   1 
ATOM   2398 N N     . GLU A 1 333 ? 21.533 -3.516  8.209   1.00 21.87 ? 333 GLU A N     1 
ATOM   2399 C CA    . GLU A 1 333 ? 22.593 -4.443  8.588   1.00 22.85 ? 333 GLU A CA    1 
ATOM   2400 C C     . GLU A 1 333 ? 23.937 -3.927  8.080   1.00 22.66 ? 333 GLU A C     1 
ATOM   2401 O O     . GLU A 1 333 ? 24.960 -4.051  8.765   1.00 22.18 ? 333 GLU A O     1 
ATOM   2402 C CB    . GLU A 1 333 ? 22.327 -5.837  8.012   1.00 24.71 ? 333 GLU A CB    1 
ATOM   2403 C CG    . GLU A 1 333 ? 21.180 -6.575  8.701   1.00 28.13 ? 333 GLU A CG    1 
ATOM   2404 C CD    . GLU A 1 333 ? 20.730 -7.821  7.946   1.00 30.12 ? 333 GLU A CD    1 
ATOM   2405 O OE1   . GLU A 1 333 ? 21.158 -8.026  6.787   1.00 30.20 ? 333 GLU A OE1   1 
ATOM   2406 O OE2   . GLU A 1 333 ? 19.941 -8.603  8.519   1.00 31.59 ? 333 GLU A OE2   1 
ATOM   2407 N N     . ALA A 1 334 ? 23.936 -3.350  6.877   1.00 21.98 ? 334 ALA A N     1 
ATOM   2408 C CA    . ALA A 1 334 ? 25.161 -2.801  6.303   1.00 21.38 ? 334 ALA A CA    1 
ATOM   2409 C C     . ALA A 1 334 ? 25.680 -1.699  7.228   1.00 20.76 ? 334 ALA A C     1 
ATOM   2410 O O     . ALA A 1 334 ? 26.861 -1.665  7.550   1.00 20.84 ? 334 ALA A O     1 
ATOM   2411 C CB    . ALA A 1 334 ? 24.891 -2.235  4.890   1.00 20.79 ? 334 ALA A CB    1 
ATOM   2412 N N     . CYS A 1 335 ? 24.789 -0.814  7.670   1.00 20.84 ? 335 CYS A N     1 
ATOM   2413 C CA    . CYS A 1 335 ? 25.170 0.280   8.568   1.00 20.58 ? 335 CYS A CA    1 
ATOM   2414 C C     . CYS A 1 335 ? 25.867 -0.251  9.831   1.00 21.42 ? 335 CYS A C     1 
ATOM   2415 O O     . CYS A 1 335 ? 26.801 0.368   10.346  1.00 20.25 ? 335 CYS A O     1 
ATOM   2416 C CB    . CYS A 1 335 ? 23.927 1.088   8.982   1.00 20.48 ? 335 CYS A CB    1 
ATOM   2417 S SG    . CYS A 1 335 ? 23.286 2.240   7.744   1.00 20.41 ? 335 CYS A SG    1 
ATOM   2418 N N     . ALA A 1 336 ? 25.409 -1.406  10.314  1.00 21.93 ? 336 ALA A N     1 
ATOM   2419 C CA    . ALA A 1 336 ? 25.958 -2.019  11.524  1.00 22.73 ? 336 ALA A CA    1 
ATOM   2420 C C     . ALA A 1 336 ? 27.241 -2.826  11.307  1.00 23.52 ? 336 ALA A C     1 
ATOM   2421 O O     . ALA A 1 336 ? 27.843 -3.315  12.271  1.00 23.81 ? 336 ALA A O     1 
ATOM   2422 C CB    . ALA A 1 336 ? 24.889 -2.899  12.176  1.00 22.45 ? 336 ALA A CB    1 
ATOM   2423 N N     . HIS A 1 337 ? 27.666 -2.954  10.051  1.00 23.84 ? 337 HIS A N     1 
ATOM   2424 C CA    . HIS A 1 337 ? 28.874 -3.707  9.708   1.00 23.72 ? 337 HIS A CA    1 
ATOM   2425 C C     . HIS A 1 337 ? 30.151 -3.130  10.322  1.00 24.13 ? 337 HIS A C     1 
ATOM   2426 O O     . HIS A 1 337 ? 30.278 -1.917  10.505  1.00 24.01 ? 337 HIS A O     1 
ATOM   2427 C CB    . HIS A 1 337 ? 29.029 -3.773  8.184   1.00 23.77 ? 337 HIS A CB    1 
ATOM   2428 C CG    . HIS A 1 337 ? 30.057 -4.758  7.723   1.00 23.56 ? 337 HIS A CG    1 
ATOM   2429 N ND1   . HIS A 1 337 ? 29.729 -6.021  7.275   1.00 23.69 ? 337 HIS A ND1   1 
ATOM   2430 C CD2   . HIS A 1 337 ? 31.406 -4.671  7.648   1.00 23.04 ? 337 HIS A CD2   1 
ATOM   2431 C CE1   . HIS A 1 337 ? 30.831 -6.669  6.947   1.00 23.05 ? 337 HIS A CE1   1 
ATOM   2432 N NE2   . HIS A 1 337 ? 31.864 -5.873  7.164   1.00 23.83 ? 337 HIS A NE2   1 
ATOM   2433 N N     . SER A 1 338 ? 31.103 -4.013  10.614  1.00 24.85 ? 338 SER A N     1 
ATOM   2434 C CA    . SER A 1 338 ? 32.388 -3.634  11.206  1.00 25.77 ? 338 SER A CA    1 
ATOM   2435 C C     . SER A 1 338 ? 33.172 -2.601  10.411  1.00 24.78 ? 338 SER A C     1 
ATOM   2436 O O     . SER A 1 338 ? 33.958 -1.842  10.978  1.00 25.45 ? 338 SER A O     1 
ATOM   2437 C CB    . SER A 1 338 ? 33.258 -4.875  11.394  1.00 27.29 ? 338 SER A CB    1 
ATOM   2438 O OG    . SER A 1 338 ? 32.697 -5.708  12.393  1.00 31.63 ? 338 SER A OG    1 
ATOM   2439 N N     . PHE A 1 339 ? 32.971 -2.575  9.099   1.00 23.59 ? 339 PHE A N     1 
ATOM   2440 C CA    . PHE A 1 339 ? 33.674 -1.615  8.257   1.00 22.62 ? 339 PHE A CA    1 
ATOM   2441 C C     . PHE A 1 339 ? 33.382 -0.192  8.726   1.00 21.83 ? 339 PHE A C     1 
ATOM   2442 O O     . PHE A 1 339 ? 34.203 0.700   8.567   1.00 22.20 ? 339 PHE A O     1 
ATOM   2443 C CB    . PHE A 1 339 ? 33.246 -1.783  6.788   1.00 22.14 ? 339 PHE A CB    1 
ATOM   2444 C CG    . PHE A 1 339 ? 33.863 -0.777  5.848   1.00 22.07 ? 339 PHE A CG    1 
ATOM   2445 C CD1   . PHE A 1 339 ? 35.247 -0.658  5.733   1.00 22.02 ? 339 PHE A CD1   1 
ATOM   2446 C CD2   . PHE A 1 339 ? 33.053 0.055   5.071   1.00 21.91 ? 339 PHE A CD2   1 
ATOM   2447 C CE1   . PHE A 1 339 ? 35.821 0.277   4.858   1.00 22.07 ? 339 PHE A CE1   1 
ATOM   2448 C CE2   . PHE A 1 339 ? 33.612 0.993   4.194   1.00 21.40 ? 339 PHE A CE2   1 
ATOM   2449 C CZ    . PHE A 1 339 ? 35.002 1.106   4.086   1.00 22.06 ? 339 PHE A CZ    1 
ATOM   2450 N N     . PHE A 1 340 ? 32.217 0.020   9.324   1.00 21.52 ? 340 PHE A N     1 
ATOM   2451 C CA    . PHE A 1 340 ? 31.851 1.360   9.781   1.00 21.27 ? 340 PHE A CA    1 
ATOM   2452 C C     . PHE A 1 340 ? 32.162 1.636   11.248  1.00 21.92 ? 340 PHE A C     1 
ATOM   2453 O O     . PHE A 1 340 ? 31.736 2.660   11.787  1.00 22.39 ? 340 PHE A O     1 
ATOM   2454 C CB    . PHE A 1 340 ? 30.362 1.612   9.509   1.00 20.14 ? 340 PHE A CB    1 
ATOM   2455 C CG    . PHE A 1 340 ? 29.997 1.531   8.049   1.00 19.83 ? 340 PHE A CG    1 
ATOM   2456 C CD1   . PHE A 1 340 ? 30.555 2.420   7.129   1.00 19.47 ? 340 PHE A CD1   1 
ATOM   2457 C CD2   . PHE A 1 340 ? 29.120 0.555   7.590   1.00 19.02 ? 340 PHE A CD2   1 
ATOM   2458 C CE1   . PHE A 1 340 ? 30.244 2.340   5.766   1.00 19.77 ? 340 PHE A CE1   1 
ATOM   2459 C CE2   . PHE A 1 340 ? 28.798 0.460   6.226   1.00 19.64 ? 340 PHE A CE2   1 
ATOM   2460 C CZ    . PHE A 1 340 ? 29.362 1.357   5.312   1.00 19.52 ? 340 PHE A CZ    1 
ATOM   2461 N N     . ASP A 1 341 ? 32.916 0.743   11.888  1.00 22.31 ? 341 ASP A N     1 
ATOM   2462 C CA    . ASP A 1 341 ? 33.257 0.905   13.302  1.00 22.58 ? 341 ASP A CA    1 
ATOM   2463 C C     . ASP A 1 341 ? 34.010 2.195   13.625  1.00 22.55 ? 341 ASP A C     1 
ATOM   2464 O O     . ASP A 1 341 ? 33.798 2.787   14.686  1.00 23.03 ? 341 ASP A O     1 
ATOM   2465 C CB    . ASP A 1 341 ? 34.064 -0.299  13.794  1.00 23.86 ? 341 ASP A CB    1 
ATOM   2466 C CG    . ASP A 1 341 ? 33.199 -1.522  14.029  1.00 25.06 ? 341 ASP A CG    1 
ATOM   2467 O OD1   . ASP A 1 341 ? 31.957 -1.388  14.051  1.00 26.19 ? 341 ASP A OD1   1 
ATOM   2468 O OD2   . ASP A 1 341 ? 33.759 -2.629  14.189  1.00 26.78 ? 341 ASP A OD2   1 
ATOM   2469 N N     . GLU A 1 342 ? 34.884 2.639   12.729  1.00 22.03 ? 342 GLU A N     1 
ATOM   2470 C CA    . GLU A 1 342 ? 35.626 3.870   12.971  1.00 22.43 ? 342 GLU A CA    1 
ATOM   2471 C C     . GLU A 1 342 ? 34.689 5.066   13.116  1.00 22.02 ? 342 GLU A C     1 
ATOM   2472 O O     . GLU A 1 342 ? 34.970 5.993   13.876  1.00 22.20 ? 342 GLU A O     1 
ATOM   2473 C CB    . GLU A 1 342 ? 36.615 4.150   11.836  1.00 23.59 ? 342 GLU A CB    1 
ATOM   2474 C CG    . GLU A 1 342 ? 37.243 5.539   11.918  1.00 26.04 ? 342 GLU A CG    1 
ATOM   2475 C CD    . GLU A 1 342 ? 38.423 5.734   10.974  1.00 27.61 ? 342 GLU A CD    1 
ATOM   2476 O OE1   . GLU A 1 342 ? 38.534 4.998   9.966   1.00 28.14 ? 342 GLU A OE1   1 
ATOM   2477 O OE2   . GLU A 1 342 ? 39.242 6.640   11.240  1.00 29.03 ? 342 GLU A OE2   1 
ATOM   2478 N N     . LEU A 1 343 ? 33.579 5.054   12.382  1.00 20.52 ? 343 LEU A N     1 
ATOM   2479 C CA    . LEU A 1 343 ? 32.620 6.153   12.453  1.00 19.72 ? 343 LEU A CA    1 
ATOM   2480 C C     . LEU A 1 343 ? 31.978 6.233   13.840  1.00 20.37 ? 343 LEU A C     1 
ATOM   2481 O O     . LEU A 1 343 ? 31.524 7.297   14.257  1.00 20.38 ? 343 LEU A O     1 
ATOM   2482 C CB    . LEU A 1 343 ? 31.529 5.985   11.384  1.00 18.48 ? 343 LEU A CB    1 
ATOM   2483 C CG    . LEU A 1 343 ? 31.983 5.895   9.920   1.00 17.97 ? 343 LEU A CG    1 
ATOM   2484 C CD1   . LEU A 1 343 ? 30.772 6.057   9.002   1.00 19.03 ? 343 LEU A CD1   1 
ATOM   2485 C CD2   . LEU A 1 343 ? 33.021 6.970   9.617   1.00 17.84 ? 343 LEU A CD2   1 
ATOM   2486 N N     . ARG A 1 344 ? 31.953 5.110   14.550  1.00 20.97 ? 344 ARG A N     1 
ATOM   2487 C CA    . ARG A 1 344 ? 31.363 5.065   15.886  1.00 22.54 ? 344 ARG A CA    1 
ATOM   2488 C C     . ARG A 1 344 ? 32.377 5.360   17.004  1.00 24.58 ? 344 ARG A C     1 
ATOM   2489 O O     . ARG A 1 344 ? 32.045 5.285   18.195  1.00 25.02 ? 344 ARG A O     1 
ATOM   2490 C CB    . ARG A 1 344 ? 30.699 3.700   16.111  1.00 21.72 ? 344 ARG A CB    1 
ATOM   2491 C CG    . ARG A 1 344 ? 29.401 3.528   15.317  1.00 21.23 ? 344 ARG A CG    1 
ATOM   2492 C CD    . ARG A 1 344 ? 28.802 2.143   15.489  1.00 21.44 ? 344 ARG A CD    1 
ATOM   2493 N NE    . ARG A 1 344 ? 29.472 1.127   14.670  1.00 21.76 ? 344 ARG A NE    1 
ATOM   2494 C CZ    . ARG A 1 344 ? 29.070 0.745   13.458  1.00 21.52 ? 344 ARG A CZ    1 
ATOM   2495 N NH1   . ARG A 1 344 ? 27.998 1.289   12.905  1.00 20.98 ? 344 ARG A NH1   1 
ATOM   2496 N NH2   . ARG A 1 344 ? 29.736 -0.191  12.802  1.00 22.23 ? 344 ARG A NH2   1 
ATOM   2497 N N     . ASP A 1 345 ? 33.605 5.696   16.618  1.00 25.91 ? 345 ASP A N     1 
ATOM   2498 C CA    . ASP A 1 345 ? 34.661 6.021   17.577  1.00 27.76 ? 345 ASP A CA    1 
ATOM   2499 C C     . ASP A 1 345 ? 34.425 7.448   18.056  1.00 28.56 ? 345 ASP A C     1 
ATOM   2500 O O     . ASP A 1 345 ? 34.305 8.365   17.249  1.00 28.55 ? 345 ASP A O     1 
ATOM   2501 C CB    . ASP A 1 345 ? 36.033 5.924   16.897  1.00 29.23 ? 345 ASP A CB    1 
ATOM   2502 C CG    . ASP A 1 345 ? 37.201 6.086   17.878  1.00 31.54 ? 345 ASP A CG    1 
ATOM   2503 O OD1   . ASP A 1 345 ? 37.197 7.023   18.708  1.00 32.30 ? 345 ASP A OD1   1 
ATOM   2504 O OD2   . ASP A 1 345 ? 38.138 5.268   17.806  1.00 32.93 ? 345 ASP A OD2   1 
ATOM   2505 N N     . PRO A 1 346 ? 34.377 7.660   19.382  1.00 29.61 ? 346 PRO A N     1 
ATOM   2506 C CA    . PRO A 1 346 ? 34.150 8.996   19.943  1.00 30.02 ? 346 PRO A CA    1 
ATOM   2507 C C     . PRO A 1 346 ? 35.168 10.063  19.542  1.00 31.11 ? 346 PRO A C     1 
ATOM   2508 O O     . PRO A 1 346 ? 34.868 11.257  19.586  1.00 31.55 ? 346 PRO A O     1 
ATOM   2509 C CB    . PRO A 1 346 ? 34.147 8.756   21.452  1.00 30.05 ? 346 PRO A CB    1 
ATOM   2510 C CG    . PRO A 1 346 ? 34.885 7.485   21.636  1.00 29.55 ? 346 PRO A CG    1 
ATOM   2511 C CD    . PRO A 1 346 ? 34.552 6.651   20.437  1.00 29.82 ? 346 PRO A CD    1 
ATOM   2512 N N     . ASN A 1 347 ? 36.367 9.647   19.146  1.00 31.84 ? 347 ASN A N     1 
ATOM   2513 C CA    . ASN A 1 347 ? 37.397 10.612  18.760  1.00 32.63 ? 347 ASN A CA    1 
ATOM   2514 C C     . ASN A 1 347 ? 37.564 10.830  17.262  1.00 32.27 ? 347 ASN A C     1 
ATOM   2515 O O     . ASN A 1 347 ? 38.476 11.540  16.843  1.00 32.43 ? 347 ASN A O     1 
ATOM   2516 C CB    . ASN A 1 347 ? 38.742 10.193  19.341  1.00 34.12 ? 347 ASN A CB    1 
ATOM   2517 C CG    . ASN A 1 347 ? 38.665 9.912   20.812  1.00 35.24 ? 347 ASN A CG    1 
ATOM   2518 O OD1   . ASN A 1 347 ? 38.953 8.801   21.259  1.00 37.43 ? 347 ASN A OD1   1 
ATOM   2519 N ND2   . ASN A 1 347 ? 38.267 10.914  21.582  1.00 35.33 ? 347 ASN A ND2   1 
ATOM   2520 N N     . VAL A 1 348 ? 36.696 10.224  16.457  1.00 31.60 ? 348 VAL A N     1 
ATOM   2521 C CA    . VAL A 1 348 ? 36.788 10.376  15.011  1.00 30.70 ? 348 VAL A CA    1 
ATOM   2522 C C     . VAL A 1 348 ? 36.574 11.832  14.601  1.00 30.02 ? 348 VAL A C     1 
ATOM   2523 O O     . VAL A 1 348 ? 35.750 12.544  15.176  1.00 29.81 ? 348 VAL A O     1 
ATOM   2524 C CB    . VAL A 1 348 ? 35.758 9.468   14.277  1.00 30.91 ? 348 VAL A CB    1 
ATOM   2525 C CG1   . VAL A 1 348 ? 34.347 10.020  14.447  1.00 30.72 ? 348 VAL A CG1   1 
ATOM   2526 C CG2   . VAL A 1 348 ? 36.122 9.359   12.800  1.00 30.78 ? 348 VAL A CG2   1 
ATOM   2527 N N     . LYS A 1 349 ? 37.338 12.264  13.606  1.00 29.56 ? 349 LYS A N     1 
ATOM   2528 C CA    . LYS A 1 349 ? 37.261 13.624  13.094  1.00 29.31 ? 349 LYS A CA    1 
ATOM   2529 C C     . LYS A 1 349 ? 37.462 13.610  11.586  1.00 28.21 ? 349 LYS A C     1 
ATOM   2530 O O     . LYS A 1 349 ? 38.040 12.671  11.038  1.00 28.14 ? 349 LYS A O     1 
ATOM   2531 C CB    . LYS A 1 349 ? 38.354 14.484  13.729  1.00 30.96 ? 349 LYS A CB    1 
ATOM   2532 C CG    . LYS A 1 349 ? 38.080 14.877  15.157  1.00 33.30 ? 349 LYS A CG    1 
ATOM   2533 C CD    . LYS A 1 349 ? 37.414 16.239  15.217  1.00 36.02 ? 349 LYS A CD    1 
ATOM   2534 C CE    . LYS A 1 349 ? 37.113 16.643  16.652  1.00 37.89 ? 349 LYS A CE    1 
ATOM   2535 N NZ    . LYS A 1 349 ? 35.902 15.947  17.187  1.00 39.42 ? 349 LYS A NZ    1 
ATOM   2536 N N     . LEU A 1 350 ? 36.990 14.649  10.913  1.00 27.23 ? 350 LEU A N     1 
ATOM   2537 C CA    . LEU A 1 350 ? 37.167 14.733  9.471   1.00 26.95 ? 350 LEU A CA    1 
ATOM   2538 C C     . LEU A 1 350 ? 38.603 15.182  9.181   1.00 27.76 ? 350 LEU A C     1 
ATOM   2539 O O     . LEU A 1 350 ? 39.232 15.860  10.001  1.00 27.43 ? 350 LEU A O     1 
ATOM   2540 C CB    . LEU A 1 350 ? 36.195 15.751  8.865   1.00 25.94 ? 350 LEU A CB    1 
ATOM   2541 C CG    . LEU A 1 350 ? 34.696 15.463  8.952   1.00 25.35 ? 350 LEU A CG    1 
ATOM   2542 C CD1   . LEU A 1 350 ? 33.931 16.561  8.227   1.00 24.40 ? 350 LEU A CD1   1 
ATOM   2543 C CD2   . LEU A 1 350 ? 34.394 14.096  8.343   1.00 24.66 ? 350 LEU A CD2   1 
ATOM   2544 N N     . PRO A 1 351 ? 39.150 14.779  8.026   1.00 28.60 ? 351 PRO A N     1 
ATOM   2545 C CA    . PRO A 1 351 ? 40.517 15.192  7.691   1.00 28.97 ? 351 PRO A CA    1 
ATOM   2546 C C     . PRO A 1 351 ? 40.696 16.714  7.713   1.00 29.14 ? 351 PRO A C     1 
ATOM   2547 O O     . PRO A 1 351 ? 41.807 17.203  7.924   1.00 29.61 ? 351 PRO A O     1 
ATOM   2548 C CB    . PRO A 1 351 ? 40.739 14.596  6.301   1.00 28.98 ? 351 PRO A CB    1 
ATOM   2549 C CG    . PRO A 1 351 ? 39.814 13.405  6.272   1.00 28.93 ? 351 PRO A CG    1 
ATOM   2550 C CD    . PRO A 1 351 ? 38.587 13.878  7.006   1.00 28.60 ? 351 PRO A CD    1 
ATOM   2551 N N     . ASN A 1 352 ? 39.617 17.466  7.504   1.00 28.89 ? 352 ASN A N     1 
ATOM   2552 C CA    . ASN A 1 352 ? 39.734 18.920  7.524   1.00 28.97 ? 352 ASN A CA    1 
ATOM   2553 C C     . ASN A 1 352 ? 39.613 19.491  8.934   1.00 28.66 ? 352 ASN A C     1 
ATOM   2554 O O     . ASN A 1 352 ? 39.513 20.701  9.117   1.00 28.26 ? 352 ASN A O     1 
ATOM   2555 C CB    . ASN A 1 352 ? 38.709 19.573  6.578   1.00 29.50 ? 352 ASN A CB    1 
ATOM   2556 C CG    . ASN A 1 352 ? 37.270 19.435  7.058   1.00 29.50 ? 352 ASN A CG    1 
ATOM   2557 O OD1   . ASN A 1 352 ? 36.344 19.866  6.371   1.00 30.82 ? 352 ASN A OD1   1 
ATOM   2558 N ND2   . ASN A 1 352 ? 37.076 18.842  8.226   1.00 29.01 ? 352 ASN A ND2   1 
ATOM   2559 N N     . GLY A 1 353 ? 39.630 18.611  9.928   1.00 28.79 ? 353 GLY A N     1 
ATOM   2560 C CA    . GLY A 1 353 ? 39.552 19.061  11.305  1.00 30.12 ? 353 GLY A CA    1 
ATOM   2561 C C     . GLY A 1 353 ? 38.159 19.208  11.881  1.00 30.77 ? 353 GLY A C     1 
ATOM   2562 O O     . GLY A 1 353 ? 38.000 19.318  13.093  1.00 31.69 ? 353 GLY A O     1 
ATOM   2563 N N     . ARG A 1 354 ? 37.144 19.211  11.028  1.00 31.33 ? 354 ARG A N     1 
ATOM   2564 C CA    . ARG A 1 354 ? 35.764 19.349  11.494  1.00 31.90 ? 354 ARG A CA    1 
ATOM   2565 C C     . ARG A 1 354 ? 35.248 18.065  12.136  1.00 31.36 ? 354 ARG A C     1 
ATOM   2566 O O     . ARG A 1 354 ? 35.837 16.997  11.982  1.00 30.25 ? 354 ARG A O     1 
ATOM   2567 C CB    . ARG A 1 354 ? 34.847 19.695  10.328  1.00 33.26 ? 354 ARG A CB    1 
ATOM   2568 C CG    . ARG A 1 354 ? 35.040 21.067  9.745   1.00 35.89 ? 354 ARG A CG    1 
ATOM   2569 C CD    . ARG A 1 354 ? 33.849 21.395  8.873   1.00 38.88 ? 354 ARG A CD    1 
ATOM   2570 N NE    . ARG A 1 354 ? 34.010 22.632  8.118   1.00 40.85 ? 354 ARG A NE    1 
ATOM   2571 C CZ    . ARG A 1 354 ? 32.994 23.292  7.572   1.00 42.36 ? 354 ARG A CZ    1 
ATOM   2572 N NH1   . ARG A 1 354 ? 31.755 22.830  7.705   1.00 43.46 ? 354 ARG A NH1   1 
ATOM   2573 N NH2   . ARG A 1 354 ? 33.212 24.403  6.885   1.00 43.34 ? 354 ARG A NH2   1 
ATOM   2574 N N     . ASP A 1 355 ? 34.146 18.172  12.869  1.00 31.41 ? 355 ASP A N     1 
ATOM   2575 C CA    . ASP A 1 355 ? 33.557 16.985  13.473  1.00 31.83 ? 355 ASP A CA    1 
ATOM   2576 C C     . ASP A 1 355 ? 32.792 16.285  12.358  1.00 30.36 ? 355 ASP A C     1 
ATOM   2577 O O     . ASP A 1 355 ? 32.459 16.895  11.338  1.00 29.51 ? 355 ASP A O     1 
ATOM   2578 C CB    . ASP A 1 355 ? 32.571 17.356  14.578  1.00 34.99 ? 355 ASP A CB    1 
ATOM   2579 C CG    . ASP A 1 355 ? 33.235 18.067  15.730  1.00 38.01 ? 355 ASP A CG    1 
ATOM   2580 O OD1   . ASP A 1 355 ? 34.291 17.581  16.193  1.00 39.73 ? 355 ASP A OD1   1 
ATOM   2581 O OD2   . ASP A 1 355 ? 32.698 19.111  16.166  1.00 40.58 ? 355 ASP A OD2   1 
ATOM   2582 N N     . THR A 1 356 ? 32.519 15.005  12.548  1.00 28.83 ? 356 THR A N     1 
ATOM   2583 C CA    . THR A 1 356 ? 31.771 14.259  11.548  1.00 27.94 ? 356 THR A CA    1 
ATOM   2584 C C     . THR A 1 356 ? 30.335 14.806  11.532  1.00 26.44 ? 356 THR A C     1 
ATOM   2585 O O     . THR A 1 356 ? 29.880 15.405  12.508  1.00 25.93 ? 356 THR A O     1 
ATOM   2586 C CB    . THR A 1 356 ? 31.738 12.769  11.908  1.00 28.39 ? 356 THR A CB    1 
ATOM   2587 O OG1   . THR A 1 356 ? 31.337 12.624  13.275  1.00 29.61 ? 356 THR A OG1   1 
ATOM   2588 C CG2   . THR A 1 356 ? 33.116 12.145  11.722  1.00 29.08 ? 356 THR A CG2   1 
ATOM   2589 N N     . PRO A 1 357 ? 29.613 14.626  10.413  1.00 24.63 ? 357 PRO A N     1 
ATOM   2590 C CA    . PRO A 1 357 ? 28.232 15.119  10.344  1.00 23.96 ? 357 PRO A CA    1 
ATOM   2591 C C     . PRO A 1 357 ? 27.324 14.214  11.176  1.00 23.22 ? 357 PRO A C     1 
ATOM   2592 O O     . PRO A 1 357 ? 27.803 13.320  11.873  1.00 22.84 ? 357 PRO A O     1 
ATOM   2593 C CB    . PRO A 1 357 ? 27.898 15.040  8.855   1.00 23.87 ? 357 PRO A CB    1 
ATOM   2594 C CG    . PRO A 1 357 ? 28.774 13.931  8.343   1.00 23.09 ? 357 PRO A CG    1 
ATOM   2595 C CD    . PRO A 1 357 ? 30.039 13.975  9.162   1.00 24.14 ? 357 PRO A CD    1 
ATOM   2596 N N     . ALA A 1 358 ? 26.019 14.445  11.104  1.00 23.59 ? 358 ALA A N     1 
ATOM   2597 C CA    . ALA A 1 358 ? 25.058 13.623  11.846  1.00 23.21 ? 358 ALA A CA    1 
ATOM   2598 C C     . ALA A 1 358 ? 25.143 12.176  11.348  1.00 22.74 ? 358 ALA A C     1 
ATOM   2599 O O     . ALA A 1 358 ? 25.121 11.928  10.138  1.00 23.02 ? 358 ALA A O     1 
ATOM   2600 C CB    . ALA A 1 358 ? 23.644 14.170  11.646  1.00 23.32 ? 358 ALA A CB    1 
ATOM   2601 N N     . LEU A 1 359 ? 25.235 11.225  12.274  1.00 20.64 ? 359 LEU A N     1 
ATOM   2602 C CA    . LEU A 1 359 ? 25.341 9.815   11.904  1.00 20.22 ? 359 LEU A CA    1 
ATOM   2603 C C     . LEU A 1 359 ? 24.496 8.886   12.756  1.00 19.31 ? 359 LEU A C     1 
ATOM   2604 O O     . LEU A 1 359 ? 24.266 7.730   12.387  1.00 18.97 ? 359 LEU A O     1 
ATOM   2605 C CB    . LEU A 1 359 ? 26.789 9.338   12.042  1.00 20.68 ? 359 LEU A CB    1 
ATOM   2606 C CG    . LEU A 1 359 ? 27.901 9.972   11.216  1.00 20.76 ? 359 LEU A CG    1 
ATOM   2607 C CD1   . LEU A 1 359 ? 29.233 9.476   11.755  1.00 21.18 ? 359 LEU A CD1   1 
ATOM   2608 C CD2   . LEU A 1 359 ? 27.751 9.602   9.758   1.00 20.51 ? 359 LEU A CD2   1 
ATOM   2609 N N     . PHE A 1 360 ? 24.044 9.380   13.901  1.00 19.23 ? 360 PHE A N     1 
ATOM   2610 C CA    . PHE A 1 360 ? 23.307 8.523   14.824  1.00 19.47 ? 360 PHE A CA    1 
ATOM   2611 C C     . PHE A 1 360 ? 21.887 8.933   15.196  1.00 19.94 ? 360 PHE A C     1 
ATOM   2612 O O     . PHE A 1 360 ? 21.284 8.311   16.079  1.00 19.83 ? 360 PHE A O     1 
ATOM   2613 C CB    . PHE A 1 360 ? 24.140 8.351   16.101  1.00 19.92 ? 360 PHE A CB    1 
ATOM   2614 C CG    . PHE A 1 360 ? 25.606 8.098   15.841  1.00 20.76 ? 360 PHE A CG    1 
ATOM   2615 C CD1   . PHE A 1 360 ? 26.571 9.012   16.256  1.00 21.61 ? 360 PHE A CD1   1 
ATOM   2616 C CD2   . PHE A 1 360 ? 26.017 6.952   15.174  1.00 20.58 ? 360 PHE A CD2   1 
ATOM   2617 C CE1   . PHE A 1 360 ? 27.928 8.787   16.004  1.00 22.55 ? 360 PHE A CE1   1 
ATOM   2618 C CE2   . PHE A 1 360 ? 27.364 6.713   14.918  1.00 22.08 ? 360 PHE A CE2   1 
ATOM   2619 C CZ    . PHE A 1 360 ? 28.324 7.632   15.332  1.00 22.43 ? 360 PHE A CZ    1 
ATOM   2620 N N     . ASN A 1 361 ? 21.342 9.950   14.530  1.00 20.16 ? 361 ASN A N     1 
ATOM   2621 C CA    . ASN A 1 361 ? 19.990 10.395  14.840  1.00 21.31 ? 361 ASN A CA    1 
ATOM   2622 C C     . ASN A 1 361 ? 18.922 9.514   14.194  1.00 21.02 ? 361 ASN A C     1 
ATOM   2623 O O     . ASN A 1 361 ? 18.068 9.988   13.451  1.00 21.55 ? 361 ASN A O     1 
ATOM   2624 C CB    . ASN A 1 361 ? 19.799 11.869  14.444  1.00 21.58 ? 361 ASN A CB    1 
ATOM   2625 C CG    . ASN A 1 361 ? 20.164 12.159  12.994  1.00 23.84 ? 361 ASN A CG    1 
ATOM   2626 O OD1   . ASN A 1 361 ? 19.747 13.178  12.437  1.00 27.29 ? 361 ASN A OD1   1 
ATOM   2627 N ND2   . ASN A 1 361 ? 20.939 11.281  12.380  1.00 22.41 ? 361 ASN A ND2   1 
ATOM   2628 N N     . PHE A 1 362 ? 18.980 8.220   14.490  1.00 21.35 ? 362 PHE A N     1 
ATOM   2629 C CA    . PHE A 1 362 ? 18.018 7.267   13.951  1.00 22.25 ? 362 PHE A CA    1 
ATOM   2630 C C     . PHE A 1 362 ? 16.640 7.461   14.576  1.00 22.59 ? 362 PHE A C     1 
ATOM   2631 O O     . PHE A 1 362 ? 16.521 7.843   15.744  1.00 22.76 ? 362 PHE A O     1 
ATOM   2632 C CB    . PHE A 1 362 ? 18.464 5.836   14.240  1.00 21.79 ? 362 PHE A CB    1 
ATOM   2633 C CG    . PHE A 1 362 ? 19.652 5.391   13.442  1.00 22.45 ? 362 PHE A CG    1 
ATOM   2634 C CD1   . PHE A 1 362 ? 19.485 4.823   12.179  1.00 22.52 ? 362 PHE A CD1   1 
ATOM   2635 C CD2   . PHE A 1 362 ? 20.940 5.524   13.956  1.00 21.64 ? 362 PHE A CD2   1 
ATOM   2636 C CE1   . PHE A 1 362 ? 20.590 4.391   11.436  1.00 21.72 ? 362 PHE A CE1   1 
ATOM   2637 C CE2   . PHE A 1 362 ? 22.051 5.096   13.224  1.00 22.32 ? 362 PHE A CE2   1 
ATOM   2638 C CZ    . PHE A 1 362 ? 21.874 4.528   11.960  1.00 21.52 ? 362 PHE A CZ    1 
ATOM   2639 N N     . THR A 1 363 ? 15.604 7.182   13.789  1.00 22.87 ? 363 THR A N     1 
ATOM   2640 C CA    . THR A 1 363 ? 14.224 7.271   14.256  1.00 22.58 ? 363 THR A CA    1 
ATOM   2641 C C     . THR A 1 363 ? 13.676 5.845   14.301  1.00 23.05 ? 363 THR A C     1 
ATOM   2642 O O     . THR A 1 363 ? 14.277 4.910   13.758  1.00 22.28 ? 363 THR A O     1 
ATOM   2643 C CB    . THR A 1 363 ? 13.334 8.090   13.294  1.00 22.26 ? 363 THR A CB    1 
ATOM   2644 O OG1   . THR A 1 363 ? 13.347 7.474   12.001  1.00 22.03 ? 363 THR A OG1   1 
ATOM   2645 C CG2   . THR A 1 363 ? 13.830 9.510   13.171  1.00 21.25 ? 363 THR A CG2   1 
ATOM   2646 N N     . THR A 1 364 ? 12.538 5.675   14.963  1.00 23.23 ? 364 THR A N     1 
ATOM   2647 C CA    . THR A 1 364 ? 11.909 4.369   15.055  1.00 23.84 ? 364 THR A CA    1 
ATOM   2648 C C     . THR A 1 364 ? 11.649 3.817   13.654  1.00 23.69 ? 364 THR A C     1 
ATOM   2649 O O     . THR A 1 364 ? 11.919 2.646   13.376  1.00 24.32 ? 364 THR A O     1 
ATOM   2650 C CB    . THR A 1 364 ? 10.580 4.471   15.811  1.00 24.26 ? 364 THR A CB    1 
ATOM   2651 O OG1   . THR A 1 364 ? 10.842 4.881   17.160  1.00 26.24 ? 364 THR A OG1   1 
ATOM   2652 C CG2   . THR A 1 364 ? 9.860  3.135   15.806  1.00 24.47 ? 364 THR A CG2   1 
ATOM   2653 N N     . GLN A 1 365 ? 11.129 4.671   12.779  1.00 23.80 ? 365 GLN A N     1 
ATOM   2654 C CA    . GLN A 1 365 ? 10.826 4.290   11.399  1.00 23.65 ? 365 GLN A CA    1 
ATOM   2655 C C     . GLN A 1 365 ? 12.067 3.731   10.697  1.00 23.26 ? 365 GLN A C     1 
ATOM   2656 O O     . GLN A 1 365 ? 12.018 2.679   10.062  1.00 22.58 ? 365 GLN A O     1 
ATOM   2657 C CB    . GLN A 1 365 ? 10.310 5.509   10.631  1.00 24.34 ? 365 GLN A CB    1 
ATOM   2658 C CG    . GLN A 1 365 ? 10.060 5.259   9.145   1.00 26.76 ? 365 GLN A CG    1 
ATOM   2659 C CD    . GLN A 1 365 ? 8.843  4.384   8.892   1.00 27.43 ? 365 GLN A CD    1 
ATOM   2660 O OE1   . GLN A 1 365 ? 7.911  4.344   9.698   1.00 29.13 ? 365 GLN A OE1   1 
ATOM   2661 N NE2   . GLN A 1 365 ? 8.844  3.680   7.775   1.00 26.82 ? 365 GLN A NE2   1 
ATOM   2662 N N     . GLU A 1 366 ? 13.184 4.438   10.825  1.00 22.54 ? 366 GLU A N     1 
ATOM   2663 C CA    . GLU A 1 366 ? 14.441 4.021   10.190  1.00 22.32 ? 366 GLU A CA    1 
ATOM   2664 C C     . GLU A 1 366 ? 14.979 2.681   10.708  1.00 22.25 ? 366 GLU A C     1 
ATOM   2665 O O     . GLU A 1 366 ? 15.601 1.920   9.961   1.00 20.58 ? 366 GLU A O     1 
ATOM   2666 C CB    . GLU A 1 366 ? 15.500 5.116   10.393  1.00 22.20 ? 366 GLU A CB    1 
ATOM   2667 C CG    . GLU A 1 366 ? 16.717 5.000   9.480   1.00 22.76 ? 366 GLU A CG    1 
ATOM   2668 C CD    . GLU A 1 366 ? 17.663 6.184   9.628   1.00 23.87 ? 366 GLU A CD    1 
ATOM   2669 O OE1   . GLU A 1 366 ? 18.730 6.171   8.977   1.00 23.14 ? 366 GLU A OE1   1 
ATOM   2670 O OE2   . GLU A 1 366 ? 17.338 7.121   10.395  1.00 23.36 ? 366 GLU A OE2   1 
ATOM   2671 N N     . LEU A 1 367 ? 14.740 2.391   11.987  1.00 22.47 ? 367 LEU A N     1 
ATOM   2672 C CA    . LEU A 1 367 ? 15.221 1.150   12.594  1.00 22.87 ? 367 LEU A CA    1 
ATOM   2673 C C     . LEU A 1 367 ? 14.205 0.020   12.537  1.00 23.66 ? 367 LEU A C     1 
ATOM   2674 O O     . LEU A 1 367 ? 14.508 -1.105  12.928  1.00 23.90 ? 367 LEU A O     1 
ATOM   2675 C CB    . LEU A 1 367 ? 15.575 1.387   14.069  1.00 23.18 ? 367 LEU A CB    1 
ATOM   2676 C CG    . LEU A 1 367 ? 16.772 2.288   14.377  1.00 23.26 ? 367 LEU A CG    1 
ATOM   2677 C CD1   . LEU A 1 367 ? 16.598 2.924   15.770  1.00 24.08 ? 367 LEU A CD1   1 
ATOM   2678 C CD2   . LEU A 1 367 ? 18.049 1.471   14.302  1.00 22.28 ? 367 LEU A CD2   1 
ATOM   2679 N N     . SER A 1 368 ? 13.009 0.314   12.043  1.00 25.09 ? 368 SER A N     1 
ATOM   2680 C CA    . SER A 1 368 ? 11.927 -0.670  12.018  1.00 26.71 ? 368 SER A CA    1 
ATOM   2681 C C     . SER A 1 368 ? 12.212 -2.053  11.440  1.00 27.68 ? 368 SER A C     1 
ATOM   2682 O O     . SER A 1 368 ? 11.613 -3.036  11.880  1.00 28.18 ? 368 SER A O     1 
ATOM   2683 C CB    . SER A 1 368 ? 10.680 -0.066  11.354  1.00 26.67 ? 368 SER A CB    1 
ATOM   2684 O OG    . SER A 1 368 ? 10.873 0.160   9.973   1.00 27.42 ? 368 SER A OG    1 
ATOM   2685 N N     . SER A 1 369 ? 13.127 -2.159  10.485  1.00 28.08 ? 369 SER A N     1 
ATOM   2686 C CA    . SER A 1 369 ? 13.412 -3.469  9.906   1.00 28.52 ? 369 SER A CA    1 
ATOM   2687 C C     . SER A 1 369 ? 14.167 -4.391  10.865  1.00 29.40 ? 369 SER A C     1 
ATOM   2688 O O     . SER A 1 369 ? 14.248 -5.599  10.630  1.00 29.75 ? 369 SER A O     1 
ATOM   2689 C CB    . SER A 1 369 ? 14.212 -3.318  8.604   1.00 28.17 ? 369 SER A CB    1 
ATOM   2690 O OG    . SER A 1 369 ? 15.606 -3.273  8.862   1.00 27.80 ? 369 SER A OG    1 
ATOM   2691 N N     . ASN A 1 370 ? 14.714 -3.831  11.943  1.00 29.19 ? 370 ASN A N     1 
ATOM   2692 C CA    . ASN A 1 370 ? 15.476 -4.620  12.915  1.00 29.09 ? 370 ASN A CA    1 
ATOM   2693 C C     . ASN A 1 370 ? 15.891 -3.715  14.078  1.00 28.73 ? 370 ASN A C     1 
ATOM   2694 O O     . ASN A 1 370 ? 17.063 -3.365  14.225  1.00 28.09 ? 370 ASN A O     1 
ATOM   2695 C CB    . ASN A 1 370 ? 16.718 -5.207  12.235  1.00 30.03 ? 370 ASN A CB    1 
ATOM   2696 C CG    . ASN A 1 370 ? 17.362 -6.317  13.038  1.00 31.07 ? 370 ASN A CG    1 
ATOM   2697 O OD1   . ASN A 1 370 ? 17.170 -6.426  14.252  1.00 32.05 ? 370 ASN A OD1   1 
ATOM   2698 N ND2   . ASN A 1 370 ? 18.137 -7.153  12.360  1.00 32.10 ? 370 ASN A ND2   1 
ATOM   2699 N N     . PRO A 1 371 ? 14.922 -3.323  14.920  1.00 28.65 ? 371 PRO A N     1 
ATOM   2700 C CA    . PRO A 1 371 ? 15.181 -2.449  16.071  1.00 28.13 ? 371 PRO A CA    1 
ATOM   2701 C C     . PRO A 1 371 ? 16.396 -2.798  16.931  1.00 27.75 ? 371 PRO A C     1 
ATOM   2702 O O     . PRO A 1 371 ? 17.144 -1.914  17.337  1.00 27.90 ? 371 PRO A O     1 
ATOM   2703 C CB    . PRO A 1 371 ? 13.872 -2.501  16.854  1.00 28.10 ? 371 PRO A CB    1 
ATOM   2704 C CG    . PRO A 1 371 ? 12.836 -2.773  15.812  1.00 28.06 ? 371 PRO A CG    1 
ATOM   2705 C CD    . PRO A 1 371 ? 13.497 -3.701  14.829  1.00 28.09 ? 371 PRO A CD    1 
ATOM   2706 N N     . PRO A 1 372 ? 16.608 -4.087  17.233  1.00 27.57 ? 372 PRO A N     1 
ATOM   2707 C CA    . PRO A 1 372 ? 17.761 -4.468  18.057  1.00 27.44 ? 372 PRO A CA    1 
ATOM   2708 C C     . PRO A 1 372 ? 19.128 -3.959  17.603  1.00 27.58 ? 372 PRO A C     1 
ATOM   2709 O O     . PRO A 1 372 ? 20.081 -3.948  18.387  1.00 27.57 ? 372 PRO A O     1 
ATOM   2710 C CB    . PRO A 1 372 ? 17.703 -5.995  18.073  1.00 27.53 ? 372 PRO A CB    1 
ATOM   2711 C CG    . PRO A 1 372 ? 16.257 -6.309  17.837  1.00 27.99 ? 372 PRO A CG    1 
ATOM   2712 C CD    . PRO A 1 372 ? 15.777 -5.254  16.883  1.00 27.70 ? 372 PRO A CD    1 
ATOM   2713 N N     . LEU A 1 373 ? 19.241 -3.547  16.345  1.00 26.92 ? 373 LEU A N     1 
ATOM   2714 C CA    . LEU A 1 373 ? 20.520 -3.048  15.844  1.00 26.94 ? 373 LEU A CA    1 
ATOM   2715 C C     . LEU A 1 373 ? 20.895 -1.692  16.451  1.00 26.75 ? 373 LEU A C     1 
ATOM   2716 O O     . LEU A 1 373 ? 22.047 -1.261  16.362  1.00 26.56 ? 373 LEU A O     1 
ATOM   2717 C CB    . LEU A 1 373 ? 20.485 -2.946  14.316  1.00 26.66 ? 373 LEU A CB    1 
ATOM   2718 C CG    . LEU A 1 373 ? 20.536 -4.280  13.565  1.00 27.04 ? 373 LEU A CG    1 
ATOM   2719 C CD1   . LEU A 1 373 ? 20.539 -4.019  12.061  1.00 26.48 ? 373 LEU A CD1   1 
ATOM   2720 C CD2   . LEU A 1 373 ? 21.776 -5.065  13.978  1.00 26.59 ? 373 LEU A CD2   1 
ATOM   2721 N N     . ALA A 1 374 ? 19.923 -1.026  17.072  1.00 27.26 ? 374 ALA A N     1 
ATOM   2722 C CA    . ALA A 1 374 ? 20.161 0.275   17.697  1.00 27.96 ? 374 ALA A CA    1 
ATOM   2723 C C     . ALA A 1 374 ? 21.312 0.189   18.690  1.00 28.51 ? 374 ALA A C     1 
ATOM   2724 O O     . ALA A 1 374 ? 22.036 1.155   18.906  1.00 28.80 ? 374 ALA A O     1 
ATOM   2725 C CB    . ALA A 1 374 ? 18.904 0.751   18.405  1.00 27.56 ? 374 ALA A CB    1 
ATOM   2726 N N     . THR A 1 375 ? 21.471 -0.982  19.293  1.00 29.23 ? 375 THR A N     1 
ATOM   2727 C CA    . THR A 1 375 ? 22.522 -1.230  20.268  1.00 29.85 ? 375 THR A CA    1 
ATOM   2728 C C     . THR A 1 375 ? 23.903 -1.049  19.659  1.00 29.43 ? 375 THR A C     1 
ATOM   2729 O O     . THR A 1 375 ? 24.865 -0.699  20.354  1.00 29.19 ? 375 THR A O     1 
ATOM   2730 C CB    . THR A 1 375 ? 22.391 -2.651  20.815  1.00 30.84 ? 375 THR A CB    1 
ATOM   2731 O OG1   . THR A 1 375 ? 21.361 -2.666  21.804  1.00 34.26 ? 375 THR A OG1   1 
ATOM   2732 C CG2   . THR A 1 375 ? 23.684 -3.121  21.436  1.00 33.07 ? 375 THR A CG2   1 
ATOM   2733 N N     . ILE A 1 376 ? 24.003 -1.304  18.359  1.00 28.66 ? 376 ILE A N     1 
ATOM   2734 C CA    . ILE A 1 376 ? 25.269 -1.153  17.651  1.00 28.03 ? 376 ILE A CA    1 
ATOM   2735 C C     . ILE A 1 376 ? 25.325 0.209   16.984  1.00 27.34 ? 376 ILE A C     1 
ATOM   2736 O O     . ILE A 1 376 ? 26.340 0.905   17.051  1.00 27.30 ? 376 ILE A O     1 
ATOM   2737 C CB    . ILE A 1 376 ? 25.432 -2.208  16.543  1.00 28.68 ? 376 ILE A CB    1 
ATOM   2738 C CG1   . ILE A 1 376 ? 25.583 -3.595  17.155  1.00 28.44 ? 376 ILE A CG1   1 
ATOM   2739 C CG2   . ILE A 1 376 ? 26.646 -1.875  15.675  1.00 29.53 ? 376 ILE A CG2   1 
ATOM   2740 C CD1   . ILE A 1 376 ? 25.248 -4.698  16.184  1.00 28.94 ? 376 ILE A CD1   1 
ATOM   2741 N N     . LEU A 1 377 ? 24.213 0.578   16.349  1.00 26.06 ? 377 LEU A N     1 
ATOM   2742 C CA    . LEU A 1 377 ? 24.102 1.824   15.601  1.00 24.88 ? 377 LEU A CA    1 
ATOM   2743 C C     . LEU A 1 377 ? 24.227 3.126   16.376  1.00 24.72 ? 377 LEU A C     1 
ATOM   2744 O O     . LEU A 1 377 ? 24.730 4.114   15.836  1.00 24.32 ? 377 LEU A O     1 
ATOM   2745 C CB    . LEU A 1 377 ? 22.800 1.816   14.799  1.00 23.45 ? 377 LEU A CB    1 
ATOM   2746 C CG    . LEU A 1 377 ? 22.761 0.694   13.758  1.00 23.82 ? 377 LEU A CG    1 
ATOM   2747 C CD1   . LEU A 1 377 ? 21.368 0.616   13.135  1.00 22.21 ? 377 LEU A CD1   1 
ATOM   2748 C CD2   . LEU A 1 377 ? 23.832 0.948   12.680  1.00 22.41 ? 377 LEU A CD2   1 
ATOM   2749 N N     . ILE A 1 378 ? 23.757 3.151   17.619  1.00 23.94 ? 378 ILE A N     1 
ATOM   2750 C CA    . ILE A 1 378 ? 23.873 4.361   18.422  1.00 24.66 ? 378 ILE A CA    1 
ATOM   2751 C C     . ILE A 1 378 ? 24.882 4.060   19.521  1.00 25.46 ? 378 ILE A C     1 
ATOM   2752 O O     . ILE A 1 378 ? 24.547 3.431   20.524  1.00 25.58 ? 378 ILE A O     1 
ATOM   2753 C CB    . ILE A 1 378 ? 22.516 4.773   19.047  1.00 25.40 ? 378 ILE A CB    1 
ATOM   2754 C CG1   . ILE A 1 378 ? 21.449 4.866   17.948  1.00 25.25 ? 378 ILE A CG1   1 
ATOM   2755 C CG2   . ILE A 1 378 ? 22.645 6.120   19.751  1.00 24.40 ? 378 ILE A CG2   1 
ATOM   2756 C CD1   . ILE A 1 378 ? 20.138 5.505   18.403  1.00 25.99 ? 378 ILE A CD1   1 
ATOM   2757 N N     . PRO A 1 379 ? 26.144 4.479   19.327  1.00 25.55 ? 379 PRO A N     1 
ATOM   2758 C CA    . PRO A 1 379 ? 27.205 4.245   20.311  1.00 25.97 ? 379 PRO A CA    1 
ATOM   2759 C C     . PRO A 1 379 ? 26.956 4.940   21.652  1.00 26.18 ? 379 PRO A C     1 
ATOM   2760 O O     . PRO A 1 379 ? 26.177 5.886   21.744  1.00 25.49 ? 379 PRO A O     1 
ATOM   2761 C CB    . PRO A 1 379 ? 28.469 4.748   19.609  1.00 25.55 ? 379 PRO A CB    1 
ATOM   2762 C CG    . PRO A 1 379 ? 27.981 5.706   18.593  1.00 25.32 ? 379 PRO A CG    1 
ATOM   2763 C CD    . PRO A 1 379 ? 26.644 5.205   18.146  1.00 25.72 ? 379 PRO A CD    1 
ATOM   2764 N N     . PRO A 1 380 ? 27.615 4.459   22.716  1.00 27.30 ? 380 PRO A N     1 
ATOM   2765 C CA    . PRO A 1 380 ? 27.474 5.022   24.067  1.00 28.29 ? 380 PRO A CA    1 
ATOM   2766 C C     . PRO A 1 380 ? 27.540 6.544   24.183  1.00 29.56 ? 380 PRO A C     1 
ATOM   2767 O O     . PRO A 1 380 ? 26.744 7.152   24.895  1.00 29.85 ? 380 PRO A O     1 
ATOM   2768 C CB    . PRO A 1 380 ? 28.589 4.335   24.854  1.00 27.49 ? 380 PRO A CB    1 
ATOM   2769 C CG    . PRO A 1 380 ? 28.746 3.014   24.177  1.00 27.06 ? 380 PRO A CG    1 
ATOM   2770 C CD    . PRO A 1 380 ? 28.533 3.305   22.700  1.00 26.88 ? 380 PRO A CD    1 
ATOM   2771 N N     . HIS A 1 381 ? 28.479 7.161   23.475  1.00 30.81 ? 381 HIS A N     1 
ATOM   2772 C CA    . HIS A 1 381 ? 28.658 8.609   23.534  1.00 32.55 ? 381 HIS A CA    1 
ATOM   2773 C C     . HIS A 1 381 ? 27.669 9.428   22.724  1.00 34.64 ? 381 HIS A C     1 
ATOM   2774 O O     . HIS A 1 381 ? 27.476 10.615  22.989  1.00 34.58 ? 381 HIS A O     1 
ATOM   2775 C CB    . HIS A 1 381 ? 30.068 8.965   23.069  1.00 31.69 ? 381 HIS A CB    1 
ATOM   2776 C CG    . HIS A 1 381 ? 30.282 8.763   21.603  1.00 31.32 ? 381 HIS A CG    1 
ATOM   2777 N ND1   . HIS A 1 381 ? 30.633 7.543   21.065  1.00 31.33 ? 381 HIS A ND1   1 
ATOM   2778 C CD2   . HIS A 1 381 ? 30.173 9.618   20.559  1.00 30.72 ? 381 HIS A CD2   1 
ATOM   2779 C CE1   . HIS A 1 381 ? 30.732 7.655   19.753  1.00 30.69 ? 381 HIS A CE1   1 
ATOM   2780 N NE2   . HIS A 1 381 ? 30.458 8.904   19.420  1.00 30.67 ? 381 HIS A NE2   1 
ATOM   2781 N N     . ALA A 1 382 ? 27.038 8.802   21.741  1.00 37.33 ? 382 ALA A N     1 
ATOM   2782 C CA    . ALA A 1 382 ? 26.115 9.503   20.856  1.00 41.07 ? 382 ALA A CA    1 
ATOM   2783 C C     . ALA A 1 382 ? 24.764 9.927   21.423  1.00 44.20 ? 382 ALA A C     1 
ATOM   2784 O O     . ALA A 1 382 ? 24.137 9.204   22.198  1.00 43.99 ? 382 ALA A O     1 
ATOM   2785 C CB    . ALA A 1 382 ? 25.899 8.670   19.604  1.00 40.35 ? 382 ALA A CB    1 
ATOM   2786 N N     . ARG A 1 383 ? 24.332 11.117  21.015  1.00 48.34 ? 383 ARG A N     1 
ATOM   2787 C CA    . ARG A 1 383 ? 23.044 11.678  21.401  1.00 53.05 ? 383 ARG A CA    1 
ATOM   2788 C C     . ARG A 1 383 ? 22.766 11.755  22.897  1.00 56.29 ? 383 ARG A C     1 
ATOM   2789 O O     . ARG A 1 383 ? 21.607 11.735  23.316  1.00 56.96 ? 383 ARG A O     1 
ATOM   2790 C CB    . ARG A 1 383 ? 21.925 10.884  20.723  1.00 53.17 ? 383 ARG A CB    1 
ATOM   2791 C CG    . ARG A 1 383 ? 22.052 10.784  19.214  1.00 53.98 ? 383 ARG A CG    1 
ATOM   2792 C CD    . ARG A 1 383 ? 20.871 10.038  18.619  1.00 55.01 ? 383 ARG A CD    1 
ATOM   2793 N NE    . ARG A 1 383 ? 19.604 10.772  18.700  1.00 55.60 ? 383 ARG A NE    1 
ATOM   2794 C CZ    . ARG A 1 383 ? 19.438 12.011  18.238  1.00 55.79 ? 383 ARG A CZ    1 
ATOM   2795 N NH1   . ARG A 1 383 ? 20.452 12.658  17.663  1.00 56.05 ? 383 ARG A NH1   1 
ATOM   2796 N NH2   . ARG A 1 383 ? 18.253 12.608  18.332  1.00 56.05 ? 383 ARG A NH2   1 
ATOM   2797 N N     . ILE A 1 384 ? 23.818 11.836  23.707  1.00 60.04 ? 384 ILE A N     1 
ATOM   2798 C CA    . ILE A 1 384 ? 23.625 11.923  25.150  1.00 63.74 ? 384 ILE A CA    1 
ATOM   2799 C C     . ILE A 1 384 ? 23.079 13.312  25.468  1.00 66.41 ? 384 ILE A C     1 
ATOM   2800 O O     . ILE A 1 384 ? 23.754 14.324  25.244  1.00 66.91 ? 384 ILE A O     1 
ATOM   2801 C CB    . ILE A 1 384 ? 24.958 11.711  25.918  1.00 63.70 ? 384 ILE A CB    1 
ATOM   2802 C CG1   . ILE A 1 384 ? 25.365 10.237  25.875  1.00 63.75 ? 384 ILE A CG1   1 
ATOM   2803 C CG2   . ILE A 1 384 ? 24.802 12.125  27.369  1.00 63.94 ? 384 ILE A CG2   1 
ATOM   2804 C CD1   . ILE A 1 384 ? 24.302 9.298   26.397  1.00 63.98 ? 384 ILE A CD1   1 
ATOM   2805 N N     . GLN A 1 385 ? 21.848 13.355  25.971  1.00 69.29 ? 385 GLN A N     1 
ATOM   2806 C CA    . GLN A 1 385 ? 21.215 14.621  26.320  1.00 71.88 ? 385 GLN A CA    1 
ATOM   2807 C C     . GLN A 1 385 ? 20.277 14.491  27.528  1.00 73.23 ? 385 GLN A C     1 
ATOM   2808 O O     . GLN A 1 385 ? 19.319 13.714  27.516  1.00 73.41 ? 385 GLN A O     1 
ATOM   2809 C CB    . GLN A 1 385 ? 20.459 15.181  25.103  1.00 72.44 ? 385 GLN A CB    1 
ATOM   2810 C CG    . GLN A 1 385 ? 18.965 14.879  25.054  1.00 73.59 ? 385 GLN A CG    1 
ATOM   2811 C CD    . GLN A 1 385 ? 18.153 16.038  24.513  1.00 74.32 ? 385 GLN A CD    1 
ATOM   2812 O OE1   . GLN A 1 385 ? 17.437 15.907  23.516  1.00 74.85 ? 385 GLN A OE1   1 
ATOM   2813 N NE2   . GLN A 1 385 ? 18.272 17.191  25.162  1.00 74.56 ? 385 GLN A NE2   1 
ATOM   2814 N N     . ALA A 1 386 ? 20.580 15.251  28.576  1.00 74.89 ? 386 ALA A N     1 
ATOM   2815 C CA    . ALA A 1 386 ? 19.777 15.249  29.796  1.00 76.31 ? 386 ALA A CA    1 
ATOM   2816 C C     . ALA A 1 386 ? 18.630 16.253  29.672  1.00 77.33 ? 386 ALA A C     1 
ATOM   2817 O O     . ALA A 1 386 ? 18.573 17.031  28.719  1.00 77.53 ? 386 ALA A O     1 
ATOM   2818 C CB    . ALA A 1 386 ? 20.655 15.589  30.998  1.00 76.07 ? 386 ALA A CB    1 
ATOM   2819 N N     . ALA A 1 387 ? 17.722 16.232  30.642  1.00 78.58 ? 387 ALA A N     1 
ATOM   2820 C CA    . ALA A 1 387 ? 16.577 17.135  30.637  1.00 79.69 ? 387 ALA A CA    1 
ATOM   2821 C C     . ALA A 1 387 ? 16.790 18.334  31.560  1.00 80.52 ? 387 ALA A C     1 
ATOM   2822 O O     . ALA A 1 387 ? 15.827 18.970  31.993  1.00 80.83 ? 387 ALA A O     1 
ATOM   2823 C CB    . ALA A 1 387 ? 15.311 16.380  31.047  1.00 79.56 ? 387 ALA A CB    1 
ATOM   2824 N N     . ALA A 1 388 ? 18.055 18.635  31.856  1.00 81.27 ? 388 ALA A N     1 
ATOM   2825 C CA    . ALA A 1 388 ? 18.411 19.765  32.712  1.00 82.09 ? 388 ALA A CA    1 
ATOM   2826 C C     . ALA A 1 388 ? 17.773 19.691  34.103  1.00 82.61 ? 388 ALA A C     1 
ATOM   2827 O O     . ALA A 1 388 ? 16.557 19.960  34.217  1.00 82.95 ? 388 ALA A O     1 
ATOM   2828 C CB    . ALA A 1 388 ? 18.029 21.085  32.024  1.00 82.14 ? 388 ALA A CB    1 
ATOM   2829 N N     . PHE B 1 23  ? 41.874 -30.025 -28.159 1.00 92.76 ? 523 PHE B N     1 
ATOM   2830 C CA    . PHE B 1 23  ? 43.174 -30.344 -27.502 1.00 92.81 ? 523 PHE B CA    1 
ATOM   2831 C C     . PHE B 1 23  ? 44.307 -30.568 -28.503 1.00 92.52 ? 523 PHE B C     1 
ATOM   2832 O O     . PHE B 1 23  ? 44.535 -31.685 -28.970 1.00 92.61 ? 523 PHE B O     1 
ATOM   2833 C CB    . PHE B 1 23  ? 43.029 -31.574 -26.588 1.00 93.55 ? 523 PHE B CB    1 
ATOM   2834 C CG    . PHE B 1 23  ? 42.384 -32.779 -27.246 1.00 94.36 ? 523 PHE B CG    1 
ATOM   2835 C CD1   . PHE B 1 23  ? 41.676 -32.668 -28.444 1.00 94.74 ? 523 PHE B CD1   1 
ATOM   2836 C CD2   . PHE B 1 23  ? 42.475 -34.032 -26.642 1.00 94.56 ? 523 PHE B CD2   1 
ATOM   2837 C CE1   . PHE B 1 23  ? 41.068 -33.783 -29.028 1.00 94.92 ? 523 PHE B CE1   1 
ATOM   2838 C CE2   . PHE B 1 23  ? 41.871 -35.153 -27.217 1.00 94.82 ? 523 PHE B CE2   1 
ATOM   2839 C CZ    . PHE B 1 23  ? 41.167 -35.027 -28.412 1.00 94.92 ? 523 PHE B CZ    1 
ATOM   2840 N N     . GLY B 1 24  ? 45.015 -29.489 -28.824 1.00 92.02 ? 524 GLY B N     1 
ATOM   2841 C CA    . GLY B 1 24  ? 46.123 -29.566 -29.759 1.00 91.28 ? 524 GLY B CA    1 
ATOM   2842 C C     . GLY B 1 24  ? 47.349 -28.882 -29.186 1.00 90.72 ? 524 GLY B C     1 
ATOM   2843 O O     . GLY B 1 24  ? 47.380 -28.560 -27.999 1.00 90.71 ? 524 GLY B O     1 
ATOM   2844 N N     . SER B 1 25  ? 48.357 -28.651 -30.022 1.00 90.14 ? 525 SER B N     1 
ATOM   2845 C CA    . SER B 1 25  ? 49.584 -28.005 -29.568 1.00 89.44 ? 525 SER B CA    1 
ATOM   2846 C C     . SER B 1 25  ? 50.269 -27.207 -30.672 1.00 88.95 ? 525 SER B C     1 
ATOM   2847 O O     . SER B 1 25  ? 49.906 -27.302 -31.845 1.00 88.90 ? 525 SER B O     1 
ATOM   2848 C CB    . SER B 1 25  ? 50.555 -29.055 -29.029 1.00 89.41 ? 525 SER B CB    1 
ATOM   2849 O OG    . SER B 1 25  ? 50.816 -30.046 -30.009 1.00 89.34 ? 525 SER B OG    1 
ATOM   2850 N N     . MET B 1 26  ? 51.270 -26.423 -30.283 1.00 88.30 ? 526 MET B N     1 
ATOM   2851 C CA    . MET B 1 26  ? 52.019 -25.604 -31.228 1.00 87.66 ? 526 MET B CA    1 
ATOM   2852 C C     . MET B 1 26  ? 53.506 -25.916 -31.183 1.00 87.18 ? 526 MET B C     1 
ATOM   2853 O O     . MET B 1 26  ? 53.962 -26.729 -30.381 1.00 87.12 ? 526 MET B O     1 
ATOM   2854 C CB    . MET B 1 26  ? 51.824 -24.119 -30.926 1.00 87.65 ? 526 MET B CB    1 
ATOM   2855 C CG    . MET B 1 26  ? 50.413 -23.725 -30.554 1.00 87.69 ? 526 MET B CG    1 
ATOM   2856 S SD    . MET B 1 26  ? 50.353 -21.991 -30.104 1.00 87.57 ? 526 MET B SD    1 
ATOM   2857 C CE    . MET B 1 26  ? 51.604 -21.938 -28.814 1.00 87.75 ? 526 MET B CE    1 
ATOM   2858 N N     . LYS B 1 27  ? 54.257 -25.252 -32.051 1.00 86.59 ? 527 LYS B N     1 
ATOM   2859 C CA    . LYS B 1 27  ? 55.697 -25.432 -32.123 1.00 86.11 ? 527 LYS B CA    1 
ATOM   2860 C C     . LYS B 1 27  ? 56.340 -24.075 -32.372 1.00 86.14 ? 527 LYS B C     1 
ATOM   2861 O O     . LYS B 1 27  ? 56.198 -23.496 -33.448 1.00 86.11 ? 527 LYS B O     1 
ATOM   2862 C CB    . LYS B 1 27  ? 56.055 -26.399 -33.255 1.00 85.68 ? 527 LYS B CB    1 
ATOM   2863 C CG    . LYS B 1 27  ? 55.539 -27.814 -33.050 1.00 85.12 ? 527 LYS B CG    1 
ATOM   2864 C CD    . LYS B 1 27  ? 56.650 -28.836 -33.219 1.00 84.68 ? 527 LYS B CD    1 
ATOM   2865 C CE    . LYS B 1 27  ? 56.107 -30.253 -33.182 1.00 84.38 ? 527 LYS B CE    1 
ATOM   2866 N NZ    . LYS B 1 27  ? 55.953 -30.824 -34.547 1.00 83.90 ? 527 LYS B NZ    1 
ATOM   2867 N N     . VAL B 1 28  ? 57.040 -23.567 -31.367 1.00 86.35 ? 528 VAL B N     1 
ATOM   2868 C CA    . VAL B 1 28  ? 57.700 -22.275 -31.475 1.00 86.61 ? 528 VAL B CA    1 
ATOM   2869 C C     . VAL B 1 28  ? 59.182 -22.441 -31.798 1.00 86.95 ? 528 VAL B C     1 
ATOM   2870 O O     . VAL B 1 28  ? 59.831 -23.370 -31.320 1.00 86.99 ? 528 VAL B O     1 
ATOM   2871 C CB    . VAL B 1 28  ? 57.560 -21.478 -30.165 1.00 86.42 ? 528 VAL B CB    1 
ATOM   2872 C CG1   . VAL B 1 28  ? 58.038 -20.055 -30.373 1.00 86.64 ? 528 VAL B CG1   1 
ATOM   2873 C CG2   . VAL B 1 28  ? 56.111 -21.492 -29.701 1.00 86.35 ? 528 VAL B CG2   1 
ATOM   2874 N N     . SER B 1 29  ? 59.710 -21.539 -32.618 1.00 87.42 ? 529 SER B N     1 
ATOM   2875 C CA    . SER B 1 29  ? 61.116 -21.577 -33.005 1.00 87.98 ? 529 SER B CA    1 
ATOM   2876 C C     . SER B 1 29  ? 61.570 -20.181 -33.408 1.00 88.71 ? 529 SER B C     1 
ATOM   2877 O O     . SER B 1 29  ? 60.864 -19.204 -33.166 1.00 88.78 ? 529 SER B O     1 
ATOM   2878 C CB    . SER B 1 29  ? 61.319 -22.549 -34.169 1.00 87.66 ? 529 SER B CB    1 
ATOM   2879 O OG    . SER B 1 29  ? 60.699 -22.075 -35.352 1.00 87.31 ? 529 SER B OG    1 
ATOM   2880 N N     . ARG B 1 30  ? 62.749 -20.087 -34.016 1.00 89.64 ? 530 ARG B N     1 
ATOM   2881 C CA    . ARG B 1 30  ? 63.287 -18.801 -34.453 1.00 90.53 ? 530 ARG B CA    1 
ATOM   2882 C C     . ARG B 1 30  ? 63.817 -18.901 -35.876 1.00 90.75 ? 530 ARG B C     1 
ATOM   2883 O O     . ARG B 1 30  ? 64.964 -19.295 -36.088 1.00 90.88 ? 530 ARG B O     1 
ATOM   2884 C CB    . ARG B 1 30  ? 64.417 -18.346 -33.524 1.00 91.05 ? 530 ARG B CB    1 
ATOM   2885 C CG    . ARG B 1 30  ? 63.954 -17.877 -32.156 1.00 92.16 ? 530 ARG B CG    1 
ATOM   2886 C CD    . ARG B 1 30  ? 65.138 -17.618 -31.238 1.00 93.25 ? 530 ARG B CD    1 
ATOM   2887 N NE    . ARG B 1 30  ? 64.736 -17.476 -29.840 1.00 94.28 ? 530 ARG B NE    1 
ATOM   2888 C CZ    . ARG B 1 30  ? 65.575 -17.215 -28.840 1.00 94.73 ? 530 ARG B CZ    1 
ATOM   2889 N NH1   . ARG B 1 30  ? 66.872 -17.066 -29.078 1.00 94.88 ? 530 ARG B NH1   1 
ATOM   2890 N NH2   . ARG B 1 30  ? 65.117 -17.102 -27.598 1.00 95.02 ? 530 ARG B NH2   1 
ATOM   2891 N N     . ASP B 1 31  ? 62.979 -18.540 -36.846 1.00 90.95 ? 531 ASP B N     1 
ATOM   2892 C CA    . ASP B 1 31  ? 63.359 -18.592 -38.255 1.00 91.14 ? 531 ASP B CA    1 
ATOM   2893 C C     . ASP B 1 31  ? 64.763 -18.041 -38.467 1.00 90.84 ? 531 ASP B C     1 
ATOM   2894 O O     . ASP B 1 31  ? 65.654 -18.748 -38.940 1.00 90.99 ? 531 ASP B O     1 
ATOM   2895 C CB    . ASP B 1 31  ? 62.361 -17.799 -39.104 1.00 91.87 ? 531 ASP B CB    1 
ATOM   2896 C CG    . ASP B 1 31  ? 61.508 -18.694 -39.987 1.00 92.69 ? 531 ASP B CG    1 
ATOM   2897 O OD1   . ASP B 1 31  ? 61.298 -18.345 -41.170 1.00 92.97 ? 531 ASP B OD1   1 
ATOM   2898 O OD2   . ASP B 1 31  ? 61.049 -19.750 -39.497 1.00 93.20 ? 531 ASP B OD2   1 
ATOM   2899 N N     . LYS B 1 32  ? 64.953 -16.775 -38.115 1.00 90.23 ? 532 LYS B N     1 
ATOM   2900 C CA    . LYS B 1 32  ? 66.250 -16.124 -38.250 1.00 89.47 ? 532 LYS B CA    1 
ATOM   2901 C C     . LYS B 1 32  ? 66.186 -14.720 -37.663 1.00 88.60 ? 532 LYS B C     1 
ATOM   2902 O O     . LYS B 1 32  ? 65.116 -14.109 -37.610 1.00 88.58 ? 532 LYS B O     1 
ATOM   2903 C CB    . LYS B 1 32  ? 66.676 -16.064 -39.723 1.00 89.73 ? 532 LYS B CB    1 
ATOM   2904 C CG    . LYS B 1 32  ? 65.713 -15.324 -40.630 1.00 90.09 ? 532 LYS B CG    1 
ATOM   2905 C CD    . LYS B 1 32  ? 66.439 -14.772 -41.844 1.00 90.37 ? 532 LYS B CD    1 
ATOM   2906 C CE    . LYS B 1 32  ? 65.542 -14.767 -43.070 1.00 90.69 ? 532 LYS B CE    1 
ATOM   2907 N NZ    . LYS B 1 32  ? 66.309 -14.482 -44.315 1.00 90.75 ? 532 LYS B NZ    1 
ATOM   2908 N N     . ASP B 1 33  ? 67.336 -14.218 -37.222 1.00 87.41 ? 533 ASP B N     1 
ATOM   2909 C CA    . ASP B 1 33  ? 67.431 -12.892 -36.617 1.00 85.93 ? 533 ASP B CA    1 
ATOM   2910 C C     . ASP B 1 33  ? 66.756 -12.905 -35.249 1.00 84.24 ? 533 ASP B C     1 
ATOM   2911 O O     . ASP B 1 33  ? 66.466 -11.853 -34.676 1.00 84.38 ? 533 ASP B O     1 
ATOM   2912 C CB    . ASP B 1 33  ? 66.768 -11.839 -37.516 1.00 86.68 ? 533 ASP B CB    1 
ATOM   2913 C CG    . ASP B 1 33  ? 67.152 -11.991 -38.978 1.00 87.36 ? 533 ASP B CG    1 
ATOM   2914 O OD1   . ASP B 1 33  ? 68.238 -11.502 -39.363 1.00 87.81 ? 533 ASP B OD1   1 
ATOM   2915 O OD2   . ASP B 1 33  ? 66.366 -12.597 -39.741 1.00 87.57 ? 533 ASP B OD2   1 
ATOM   2916 N N     . GLY B 1 34  ? 66.514 -14.107 -34.732 1.00 82.04 ? 534 GLY B N     1 
ATOM   2917 C CA    . GLY B 1 34  ? 65.867 -14.246 -33.441 1.00 78.95 ? 534 GLY B CA    1 
ATOM   2918 C C     . GLY B 1 34  ? 64.359 -14.220 -33.593 1.00 76.71 ? 534 GLY B C     1 
ATOM   2919 O O     . GLY B 1 34  ? 63.628 -14.392 -32.617 1.00 77.00 ? 534 GLY B O     1 
ATOM   2920 N N     . SER B 1 35  ? 63.901 -14.012 -34.826 1.00 74.00 ? 535 SER B N     1 
ATOM   2921 C CA    . SER B 1 35  ? 62.474 -13.951 -35.139 1.00 71.03 ? 535 SER B CA    1 
ATOM   2922 C C     . SER B 1 35  ? 61.719 -15.198 -34.694 1.00 68.53 ? 535 SER B C     1 
ATOM   2923 O O     . SER B 1 35  ? 61.947 -16.288 -35.216 1.00 68.56 ? 535 SER B O     1 
ATOM   2924 C CB    . SER B 1 35  ? 62.274 -13.754 -36.644 1.00 71.51 ? 535 SER B CB    1 
ATOM   2925 O OG    . SER B 1 35  ? 60.936 -13.385 -36.934 1.00 71.80 ? 535 SER B OG    1 
ATOM   2926 N N     . LYS B 1 36  ? 60.814 -15.024 -33.737 1.00 65.23 ? 536 LYS B N     1 
ATOM   2927 C CA    . LYS B 1 36  ? 60.019 -16.129 -33.216 1.00 61.84 ? 536 LYS B CA    1 
ATOM   2928 C C     . LYS B 1 36  ? 58.942 -16.564 -34.207 1.00 59.46 ? 536 LYS B C     1 
ATOM   2929 O O     . LYS B 1 36  ? 58.136 -15.751 -34.664 1.00 59.51 ? 536 LYS B O     1 
ATOM   2930 C CB    . LYS B 1 36  ? 59.366 -15.728 -31.890 1.00 61.97 ? 536 LYS B CB    1 
ATOM   2931 C CG    . LYS B 1 36  ? 58.395 -16.763 -31.337 1.00 62.12 ? 536 LYS B CG    1 
ATOM   2932 C CD    . LYS B 1 36  ? 57.718 -16.268 -30.067 1.00 62.41 ? 536 LYS B CD    1 
ATOM   2933 C CE    . LYS B 1 36  ? 56.500 -17.113 -29.722 1.00 62.45 ? 536 LYS B CE    1 
ATOM   2934 N NZ    . LYS B 1 36  ? 56.419 -17.399 -28.264 1.00 62.66 ? 536 LYS B NZ    1 
ATOM   2935 N N     . VAL B 1 37  ? 58.933 -17.852 -34.531 1.00 56.14 ? 537 VAL B N     1 
ATOM   2936 C CA    . VAL B 1 37  ? 57.963 -18.413 -35.461 1.00 52.49 ? 537 VAL B CA    1 
ATOM   2937 C C     . VAL B 1 37  ? 57.112 -19.460 -34.754 1.00 50.15 ? 537 VAL B C     1 
ATOM   2938 O O     . VAL B 1 37  ? 57.637 -20.363 -34.110 1.00 49.66 ? 537 VAL B O     1 
ATOM   2939 C CB    . VAL B 1 37  ? 58.668 -19.085 -36.656 1.00 52.41 ? 537 VAL B CB    1 
ATOM   2940 C CG1   . VAL B 1 37  ? 57.664 -19.875 -37.483 1.00 52.09 ? 537 VAL B CG1   1 
ATOM   2941 C CG2   . VAL B 1 37  ? 59.353 -18.038 -37.503 1.00 51.83 ? 537 VAL B CG2   1 
ATOM   2942 N N     . THR B 1 38  ? 55.795 -19.331 -34.869 1.00 47.44 ? 538 THR B N     1 
ATOM   2943 C CA    . THR B 1 38  ? 54.890 -20.287 -34.252 1.00 44.90 ? 538 THR B CA    1 
ATOM   2944 C C     . THR B 1 38  ? 54.263 -21.140 -35.342 1.00 43.23 ? 538 THR B C     1 
ATOM   2945 O O     . THR B 1 38  ? 53.684 -20.625 -36.296 1.00 42.83 ? 538 THR B O     1 
ATOM   2946 C CB    . THR B 1 38  ? 53.765 -19.591 -33.471 1.00 44.96 ? 538 THR B CB    1 
ATOM   2947 O OG1   . THR B 1 38  ? 54.331 -18.818 -32.406 1.00 44.88 ? 538 THR B OG1   1 
ATOM   2948 C CG2   . THR B 1 38  ? 52.817 -20.621 -32.886 1.00 44.57 ? 538 THR B CG2   1 
ATOM   2949 N N     . THR B 1 39  ? 54.399 -22.450 -35.207 1.00 41.33 ? 539 THR B N     1 
ATOM   2950 C CA    . THR B 1 39  ? 53.839 -23.361 -36.186 1.00 39.35 ? 539 THR B CA    1 
ATOM   2951 C C     . THR B 1 39  ? 52.762 -24.180 -35.520 1.00 37.80 ? 539 THR B C     1 
ATOM   2952 O O     . THR B 1 39  ? 52.972 -24.745 -34.449 1.00 37.03 ? 539 THR B O     1 
ATOM   2953 C CB    . THR B 1 39  ? 54.907 -24.307 -36.759 1.00 39.12 ? 539 THR B CB    1 
ATOM   2954 O OG1   . THR B 1 39  ? 55.850 -23.547 -37.523 1.00 39.25 ? 539 THR B OG1   1 
ATOM   2955 C CG2   . THR B 1 39  ? 54.265 -25.353 -37.659 1.00 38.92 ? 539 THR B CG2   1 
ATOM   2956 N N     . VAL B 1 40  ? 51.600 -24.227 -36.160 1.00 36.73 ? 540 VAL B N     1 
ATOM   2957 C CA    . VAL B 1 40  ? 50.469 -24.977 -35.638 1.00 35.44 ? 540 VAL B CA    1 
ATOM   2958 C C     . VAL B 1 40  ? 49.862 -25.817 -36.757 1.00 35.16 ? 540 VAL B C     1 
ATOM   2959 O O     . VAL B 1 40  ? 50.160 -25.607 -37.931 1.00 34.35 ? 540 VAL B O     1 
ATOM   2960 C CB    . VAL B 1 40  ? 49.387 -24.018 -35.087 1.00 35.18 ? 540 VAL B CB    1 
ATOM   2961 C CG1   . VAL B 1 40  ? 49.993 -23.081 -34.056 1.00 34.54 ? 540 VAL B CG1   1 
ATOM   2962 C CG2   . VAL B 1 40  ? 48.783 -23.214 -36.224 1.00 34.74 ? 540 VAL B CG2   1 
ATOM   2963 N N     . VAL B 1 41  ? 49.031 -26.782 -36.381 1.00 34.74 ? 541 VAL B N     1 
ATOM   2964 C CA    . VAL B 1 41  ? 48.347 -27.619 -37.355 1.00 35.22 ? 541 VAL B CA    1 
ATOM   2965 C C     . VAL B 1 41  ? 46.876 -27.227 -37.216 1.00 35.47 ? 541 VAL B C     1 
ATOM   2966 O O     . VAL B 1 41  ? 46.252 -27.483 -36.185 1.00 35.53 ? 541 VAL B O     1 
ATOM   2967 C CB    . VAL B 1 41  ? 48.553 -29.135 -37.053 1.00 35.02 ? 541 VAL B CB    1 
ATOM   2968 C CG1   . VAL B 1 41  ? 47.675 -29.990 -37.973 1.00 34.29 ? 541 VAL B CG1   1 
ATOM   2969 C CG2   . VAL B 1 41  ? 50.020 -29.501 -37.244 1.00 33.43 ? 541 VAL B CG2   1 
ATOM   2970 N N     . ALA B 1 42  ? 46.335 -26.591 -38.251 1.00 36.28 ? 542 ALA B N     1 
ATOM   2971 C CA    . ALA B 1 42  ? 44.951 -26.116 -38.226 1.00 37.28 ? 542 ALA B CA    1 
ATOM   2972 C C     . ALA B 1 42  ? 43.988 -26.811 -39.182 1.00 38.01 ? 542 ALA B C     1 
ATOM   2973 O O     . ALA B 1 42  ? 44.391 -27.360 -40.203 1.00 37.78 ? 542 ALA B O     1 
ATOM   2974 C CB    . ALA B 1 42  ? 44.930 -24.613 -38.492 1.00 36.73 ? 542 ALA B CB    1 
ATOM   2975 N N     . THR B 1 43  ? 42.705 -26.764 -38.836 1.00 39.03 ? 543 THR B N     1 
ATOM   2976 C CA    . THR B 1 43  ? 41.644 -27.352 -39.649 1.00 40.91 ? 543 THR B CA    1 
ATOM   2977 C C     . THR B 1 43  ? 41.054 -26.274 -40.552 1.00 42.21 ? 543 THR B C     1 
ATOM   2978 O O     . THR B 1 43  ? 40.622 -25.222 -40.072 1.00 41.60 ? 543 THR B O     1 
ATOM   2979 C CB    . THR B 1 43  ? 40.511 -27.901 -38.775 1.00 40.99 ? 543 THR B CB    1 
ATOM   2980 O OG1   . THR B 1 43  ? 41.032 -28.892 -37.885 1.00 41.95 ? 543 THR B OG1   1 
ATOM   2981 C CG2   . THR B 1 43  ? 39.422 -28.513 -39.636 1.00 41.30 ? 543 THR B CG2   1 
ATOM   2982 N N     . PRO B 1 44  ? 41.006 -26.526 -41.870 1.00 43.71 ? 544 PRO B N     1 
ATOM   2983 C CA    . PRO B 1 44  ? 40.453 -25.526 -42.788 1.00 45.11 ? 544 PRO B CA    1 
ATOM   2984 C C     . PRO B 1 44  ? 39.088 -25.027 -42.319 1.00 46.66 ? 544 PRO B C     1 
ATOM   2985 O O     . PRO B 1 44  ? 38.267 -25.806 -41.827 1.00 46.12 ? 544 PRO B O     1 
ATOM   2986 C CB    . PRO B 1 44  ? 40.382 -26.265 -44.122 1.00 44.94 ? 544 PRO B CB    1 
ATOM   2987 C CG    . PRO B 1 44  ? 41.440 -27.310 -44.016 1.00 44.20 ? 544 PRO B CG    1 
ATOM   2988 C CD    . PRO B 1 44  ? 41.426 -27.746 -42.582 1.00 43.81 ? 544 PRO B CD    1 
ATOM   2989 N N     . GLY B 1 45  ? 38.861 -23.724 -42.465 1.00 48.46 ? 545 GLY B N     1 
ATOM   2990 C CA    . GLY B 1 45  ? 37.604 -23.137 -42.042 1.00 50.98 ? 545 GLY B CA    1 
ATOM   2991 C C     . GLY B 1 45  ? 36.401 -23.558 -42.861 1.00 52.93 ? 545 GLY B C     1 
ATOM   2992 O O     . GLY B 1 45  ? 35.353 -23.885 -42.306 1.00 53.06 ? 545 GLY B O     1 
ATOM   2993 N N     . GLN B 1 46  ? 36.544 -23.561 -44.182 1.00 54.87 ? 546 GLN B N     1 
ATOM   2994 C CA    . GLN B 1 46  ? 35.433 -23.931 -45.045 1.00 57.00 ? 546 GLN B CA    1 
ATOM   2995 C C     . GLN B 1 46  ? 35.633 -25.260 -45.766 1.00 57.82 ? 546 GLN B C     1 
ATOM   2996 O O     . GLN B 1 46  ? 34.728 -26.095 -45.788 1.00 58.39 ? 546 GLN B O     1 
ATOM   2997 C CB    . GLN B 1 46  ? 35.170 -22.817 -46.068 1.00 57.98 ? 546 GLN B CB    1 
ATOM   2998 C CG    . GLN B 1 46  ? 33.875 -22.990 -46.874 1.00 59.74 ? 546 GLN B CG    1 
ATOM   2999 C CD    . GLN B 1 46  ? 32.625 -22.572 -46.103 1.00 60.52 ? 546 GLN B CD    1 
ATOM   3000 O OE1   . GLN B 1 46  ? 31.512 -23.004 -46.419 1.00 60.99 ? 546 GLN B OE1   1 
ATOM   3001 N NE2   . GLN B 1 46  ? 32.806 -21.727 -45.091 1.00 60.71 ? 546 GLN B NE2   1 
ATOM   3002 N N     . GLY B 1 47  ? 36.811 -25.462 -46.347 1.00 58.40 ? 547 GLY B N     1 
ATOM   3003 C CA    . GLY B 1 47  ? 37.072 -26.695 -47.073 1.00 59.23 ? 547 GLY B CA    1 
ATOM   3004 C C     . GLY B 1 47  ? 36.917 -27.965 -46.252 1.00 59.50 ? 547 GLY B C     1 
ATOM   3005 O O     . GLY B 1 47  ? 36.513 -27.900 -45.089 1.00 60.04 ? 547 GLY B O     1 
ATOM   3006 N N     . PRO B 1 48  ? 37.214 -29.144 -46.836 1.00 59.24 ? 548 PRO B N     1 
ATOM   3007 C CA    . PRO B 1 48  ? 37.103 -30.423 -46.120 1.00 58.56 ? 548 PRO B CA    1 
ATOM   3008 C C     . PRO B 1 48  ? 38.220 -30.529 -45.082 1.00 57.91 ? 548 PRO B C     1 
ATOM   3009 O O     . PRO B 1 48  ? 39.246 -29.860 -45.211 1.00 58.16 ? 548 PRO B O     1 
ATOM   3010 C CB    . PRO B 1 48  ? 37.239 -31.468 -47.223 1.00 58.80 ? 548 PRO B CB    1 
ATOM   3011 C CG    . PRO B 1 48  ? 38.035 -30.785 -48.289 1.00 59.08 ? 548 PRO B CG    1 
ATOM   3012 C CD    . PRO B 1 48  ? 37.669 -29.326 -48.229 1.00 59.23 ? 548 PRO B CD    1 
ATOM   3013 N N     . ASP B 1 49  ? 38.029 -31.370 -44.066 1.00 57.03 ? 549 ASP B N     1 
ATOM   3014 C CA    . ASP B 1 49  ? 39.021 -31.523 -42.996 1.00 55.94 ? 549 ASP B CA    1 
ATOM   3015 C C     . ASP B 1 49  ? 40.378 -32.092 -43.395 1.00 54.70 ? 549 ASP B C     1 
ATOM   3016 O O     . ASP B 1 49  ? 40.651 -33.275 -43.202 1.00 54.48 ? 549 ASP B O     1 
ATOM   3017 C CB    . ASP B 1 49  ? 38.457 -32.367 -41.850 1.00 56.52 ? 549 ASP B CB    1 
ATOM   3018 C CG    . ASP B 1 49  ? 39.353 -32.348 -40.614 1.00 57.17 ? 549 ASP B CG    1 
ATOM   3019 O OD1   . ASP B 1 49  ? 40.366 -31.611 -40.606 1.00 57.17 ? 549 ASP B OD1   1 
ATOM   3020 O OD2   . ASP B 1 49  ? 39.045 -33.072 -39.644 1.00 57.84 ? 549 ASP B OD2   1 
ATOM   3021 N N     . ARG B 1 50  ? 41.226 -31.231 -43.941 1.00 53.35 ? 550 ARG B N     1 
ATOM   3022 C CA    . ARG B 1 50  ? 42.573 -31.609 -44.340 1.00 52.05 ? 550 ARG B CA    1 
ATOM   3023 C C     . ARG B 1 50  ? 43.463 -30.709 -43.501 1.00 49.87 ? 550 ARG B C     1 
ATOM   3024 O O     . ARG B 1 50  ? 43.690 -29.554 -43.851 1.00 49.67 ? 550 ARG B O     1 
ATOM   3025 C CB    . ARG B 1 50  ? 42.806 -31.304 -45.817 1.00 53.48 ? 550 ARG B CB    1 
ATOM   3026 C CG    . ARG B 1 50  ? 42.304 -32.365 -46.767 1.00 55.60 ? 550 ARG B CG    1 
ATOM   3027 C CD    . ARG B 1 50  ? 42.308 -31.835 -48.192 1.00 57.56 ? 550 ARG B CD    1 
ATOM   3028 N NE    . ARG B 1 50  ? 41.312 -32.507 -49.019 1.00 59.06 ? 550 ARG B NE    1 
ATOM   3029 C CZ    . ARG B 1 50  ? 41.092 -32.218 -50.295 1.00 59.85 ? 550 ARG B CZ    1 
ATOM   3030 N NH1   . ARG B 1 50  ? 41.802 -31.264 -50.887 1.00 60.38 ? 550 ARG B NH1   1 
ATOM   3031 N NH2   . ARG B 1 50  ? 40.173 -32.891 -50.977 1.00 60.35 ? 550 ARG B NH2   1 
ATOM   3032 N N     . PRO B 1 51  ? 43.984 -31.227 -42.382 1.00 48.04 ? 551 PRO B N     1 
ATOM   3033 C CA    . PRO B 1 51  ? 44.838 -30.380 -41.547 1.00 46.43 ? 551 PRO B CA    1 
ATOM   3034 C C     . PRO B 1 51  ? 46.015 -29.816 -42.314 1.00 45.13 ? 551 PRO B C     1 
ATOM   3035 O O     . PRO B 1 51  ? 46.649 -30.515 -43.106 1.00 44.47 ? 551 PRO B O     1 
ATOM   3036 C CB    . PRO B 1 51  ? 45.284 -31.304 -40.416 1.00 46.77 ? 551 PRO B CB    1 
ATOM   3037 C CG    . PRO B 1 51  ? 44.299 -32.433 -40.423 1.00 47.75 ? 551 PRO B CG    1 
ATOM   3038 C CD    . PRO B 1 51  ? 43.853 -32.591 -41.844 1.00 47.60 ? 551 PRO B CD    1 
ATOM   3039 N N     . GLN B 1 52  ? 46.297 -28.540 -42.093 1.00 43.86 ? 552 GLN B N     1 
ATOM   3040 C CA    . GLN B 1 52  ? 47.425 -27.907 -42.747 1.00 43.10 ? 552 GLN B CA    1 
ATOM   3041 C C     . GLN B 1 52  ? 48.310 -27.257 -41.697 1.00 41.70 ? 552 GLN B C     1 
ATOM   3042 O O     . GLN B 1 52  ? 47.855 -26.883 -40.616 1.00 40.72 ? 552 GLN B O     1 
ATOM   3043 C CB    . GLN B 1 52  ? 46.961 -26.863 -43.768 1.00 44.58 ? 552 GLN B CB    1 
ATOM   3044 C CG    . GLN B 1 52  ? 45.710 -26.107 -43.377 1.00 47.30 ? 552 GLN B CG    1 
ATOM   3045 C CD    . GLN B 1 52  ? 45.285 -25.106 -44.440 1.00 49.02 ? 552 GLN B CD    1 
ATOM   3046 O OE1   . GLN B 1 52  ? 46.126 -24.454 -45.074 1.00 49.87 ? 552 GLN B OE1   1 
ATOM   3047 N NE2   . GLN B 1 52  ? 43.975 -24.979 -44.641 1.00 49.84 ? 552 GLN B NE2   1 
ATOM   3048 N N     . GLU B 1 53  ? 49.585 -27.148 -42.025 1.00 40.58 ? 553 GLU B N     1 
ATOM   3049 C CA    . GLU B 1 53  ? 50.564 -26.551 -41.145 1.00 39.99 ? 553 GLU B CA    1 
ATOM   3050 C C     . GLU B 1 53  ? 50.576 -25.059 -41.433 1.00 39.35 ? 553 GLU B C     1 
ATOM   3051 O O     . GLU B 1 53  ? 50.679 -24.647 -42.586 1.00 39.19 ? 553 GLU B O     1 
ATOM   3052 C CB    . GLU B 1 53  ? 51.934 -27.147 -41.440 1.00 40.61 ? 553 GLU B CB    1 
ATOM   3053 C CG    . GLU B 1 53  ? 52.773 -27.441 -40.234 1.00 41.26 ? 553 GLU B CG    1 
ATOM   3054 C CD    . GLU B 1 53  ? 53.984 -28.269 -40.591 1.00 41.90 ? 553 GLU B CD    1 
ATOM   3055 O OE1   . GLU B 1 53  ? 54.751 -27.845 -41.479 1.00 43.11 ? 553 GLU B OE1   1 
ATOM   3056 O OE2   . GLU B 1 53  ? 54.169 -29.347 -39.990 1.00 42.88 ? 553 GLU B OE2   1 
ATOM   3057 N N     . VAL B 1 54  ? 50.468 -24.253 -40.384 1.00 38.57 ? 554 VAL B N     1 
ATOM   3058 C CA    . VAL B 1 54  ? 50.461 -22.800 -40.529 1.00 37.78 ? 554 VAL B CA    1 
ATOM   3059 C C     . VAL B 1 54  ? 51.508 -22.173 -39.613 1.00 37.27 ? 554 VAL B C     1 
ATOM   3060 O O     . VAL B 1 54  ? 51.532 -22.438 -38.413 1.00 37.44 ? 554 VAL B O     1 
ATOM   3061 C CB    . VAL B 1 54  ? 49.073 -22.214 -40.171 1.00 37.64 ? 554 VAL B CB    1 
ATOM   3062 C CG1   . VAL B 1 54  ? 49.052 -20.717 -40.440 1.00 37.32 ? 554 VAL B CG1   1 
ATOM   3063 C CG2   . VAL B 1 54  ? 47.989 -22.915 -40.973 1.00 37.42 ? 554 VAL B CG2   1 
ATOM   3064 N N     . SER B 1 55  ? 52.372 -21.344 -40.186 1.00 37.11 ? 555 SER B N     1 
ATOM   3065 C CA    . SER B 1 55  ? 53.419 -20.676 -39.423 1.00 37.51 ? 555 SER B CA    1 
ATOM   3066 C C     . SER B 1 55  ? 53.235 -19.165 -39.491 1.00 37.28 ? 555 SER B C     1 
ATOM   3067 O O     . SER B 1 55  ? 52.981 -18.609 -40.561 1.00 36.76 ? 555 SER B O     1 
ATOM   3068 C CB    . SER B 1 55  ? 54.799 -21.046 -39.974 1.00 38.18 ? 555 SER B CB    1 
ATOM   3069 O OG    . SER B 1 55  ? 55.101 -22.406 -39.719 1.00 39.03 ? 555 SER B OG    1 
ATOM   3070 N N     . TYR B 1 56  ? 53.371 -18.501 -38.350 1.00 37.39 ? 556 TYR B N     1 
ATOM   3071 C CA    . TYR B 1 56  ? 53.202 -17.059 -38.311 1.00 38.37 ? 556 TYR B CA    1 
ATOM   3072 C C     . TYR B 1 56  ? 54.122 -16.373 -37.312 1.00 39.38 ? 556 TYR B C     1 
ATOM   3073 O O     . TYR B 1 56  ? 54.628 -16.997 -36.374 1.00 39.27 ? 556 TYR B O     1 
ATOM   3074 C CB    . TYR B 1 56  ? 51.746 -16.711 -37.997 1.00 37.18 ? 556 TYR B CB    1 
ATOM   3075 C CG    . TYR B 1 56  ? 51.234 -17.328 -36.722 1.00 35.86 ? 556 TYR B CG    1 
ATOM   3076 C CD1   . TYR B 1 56  ? 50.486 -18.502 -36.746 1.00 35.00 ? 556 TYR B CD1   1 
ATOM   3077 C CD2   . TYR B 1 56  ? 51.478 -16.726 -35.492 1.00 35.49 ? 556 TYR B CD2   1 
ATOM   3078 C CE1   . TYR B 1 56  ? 49.990 -19.058 -35.576 1.00 34.90 ? 556 TYR B CE1   1 
ATOM   3079 C CE2   . TYR B 1 56  ? 50.989 -17.273 -34.317 1.00 35.28 ? 556 TYR B CE2   1 
ATOM   3080 C CZ    . TYR B 1 56  ? 50.246 -18.437 -34.365 1.00 35.21 ? 556 TYR B CZ    1 
ATOM   3081 O OH    . TYR B 1 56  ? 49.769 -18.979 -33.199 1.00 35.53 ? 556 TYR B OH    1 
ATOM   3082 N N     . THR B 1 57  ? 54.322 -15.077 -37.524 1.00 40.85 ? 557 THR B N     1 
ATOM   3083 C CA    . THR B 1 57  ? 55.188 -14.275 -36.674 1.00 42.47 ? 557 THR B CA    1 
ATOM   3084 C C     . THR B 1 57  ? 54.557 -12.922 -36.365 1.00 43.09 ? 557 THR B C     1 
ATOM   3085 O O     . THR B 1 57  ? 53.407 -12.664 -36.712 1.00 42.98 ? 557 THR B O     1 
ATOM   3086 C CB    . THR B 1 57  ? 56.537 -14.009 -37.368 1.00 42.88 ? 557 THR B CB    1 
ATOM   3087 O OG1   . THR B 1 57  ? 56.321 -13.168 -38.510 1.00 43.88 ? 557 THR B OG1   1 
ATOM   3088 C CG2   . THR B 1 57  ? 57.170 -15.310 -37.834 1.00 43.81 ? 557 THR B CG2   1 
ATOM   3089 N N     . ASP B 1 58  ? 55.338 -12.068 -35.711 1.00 44.12 ? 558 ASP B N     1 
ATOM   3090 C CA    . ASP B 1 58  ? 54.929 -10.716 -35.351 1.00 45.02 ? 558 ASP B CA    1 
ATOM   3091 C C     . ASP B 1 58  ? 53.525 -10.593 -34.780 1.00 45.16 ? 558 ASP B C     1 
ATOM   3092 O O     . ASP B 1 58  ? 52.697 -9.846  -35.295 1.00 45.32 ? 558 ASP B O     1 
ATOM   3093 C CB    . ASP B 1 58  ? 55.077 -9.803  -36.567 1.00 46.24 ? 558 ASP B CB    1 
ATOM   3094 C CG    . ASP B 1 58  ? 56.471 -9.860  -37.164 1.00 47.49 ? 558 ASP B CG    1 
ATOM   3095 O OD1   . ASP B 1 58  ? 57.447 -9.721  -36.397 1.00 48.17 ? 558 ASP B OD1   1 
ATOM   3096 O OD2   . ASP B 1 58  ? 56.593 -10.047 -38.395 1.00 48.59 ? 558 ASP B OD2   1 
ATOM   3097 N N     . THR B 1 59  ? 53.272 -11.324 -33.702 1.00 45.36 ? 559 THR B N     1 
ATOM   3098 C CA    . THR B 1 59  ? 51.977 -11.306 -33.040 1.00 46.08 ? 559 THR B CA    1 
ATOM   3099 C C     . THR B 1 59  ? 51.835 -10.043 -32.185 1.00 46.11 ? 559 THR B C     1 
ATOM   3100 O O     . THR B 1 59  ? 52.811 -9.553  -31.617 1.00 46.38 ? 559 THR B O     1 
ATOM   3101 C CB    . THR B 1 59  ? 51.813 -12.558 -32.143 1.00 46.48 ? 559 THR B CB    1 
ATOM   3102 O OG1   . THR B 1 59  ? 51.471 -13.685 -32.959 1.00 47.15 ? 559 THR B OG1   1 
ATOM   3103 C CG2   . THR B 1 59  ? 50.725 -12.349 -31.105 1.00 47.30 ? 559 THR B CG2   1 
ATOM   3104 N N     . LYS B 1 60  ? 50.615 -9.519  -32.109 1.00 45.78 ? 560 LYS B N     1 
ATOM   3105 C CA    . LYS B 1 60  ? 50.329 -8.326  -31.318 1.00 45.47 ? 560 LYS B CA    1 
ATOM   3106 C C     . LYS B 1 60  ? 48.822 -8.192  -31.127 1.00 44.84 ? 560 LYS B C     1 
ATOM   3107 O O     . LYS B 1 60  ? 48.049 -8.381  -32.068 1.00 44.85 ? 560 LYS B O     1 
ATOM   3108 C CB    . LYS B 1 60  ? 50.874 -7.079  -32.014 1.00 45.75 ? 560 LYS B CB    1 
ATOM   3109 C CG    . LYS B 1 60  ? 50.528 -7.000  -33.484 1.00 46.99 ? 560 LYS B CG    1 
ATOM   3110 C CD    . LYS B 1 60  ? 50.890 -5.643  -34.062 1.00 48.02 ? 560 LYS B CD    1 
ATOM   3111 C CE    . LYS B 1 60  ? 49.707 -4.682  -34.014 1.00 48.65 ? 560 LYS B CE    1 
ATOM   3112 N NZ    . LYS B 1 60  ? 49.608 -3.843  -35.250 1.00 49.09 ? 560 LYS B NZ    1 
ATOM   3113 N N     . VAL B 1 61  ? 48.406 -7.871  -29.908 1.00 43.98 ? 561 VAL B N     1 
ATOM   3114 C CA    . VAL B 1 61  ? 46.989 -7.723  -29.617 1.00 43.42 ? 561 VAL B CA    1 
ATOM   3115 C C     . VAL B 1 61  ? 46.401 -6.560  -30.401 1.00 43.45 ? 561 VAL B C     1 
ATOM   3116 O O     . VAL B 1 61  ? 46.999 -5.489  -30.482 1.00 43.15 ? 561 VAL B O     1 
ATOM   3117 C CB    . VAL B 1 61  ? 46.748 -7.495  -28.111 1.00 42.98 ? 561 VAL B CB    1 
ATOM   3118 C CG1   . VAL B 1 61  ? 45.272 -7.236  -27.849 1.00 42.26 ? 561 VAL B CG1   1 
ATOM   3119 C CG2   . VAL B 1 61  ? 47.213 -8.712  -27.331 1.00 42.64 ? 561 VAL B CG2   1 
ATOM   3120 N N     . ILE B 1 62  ? 45.231 -6.781  -30.991 1.00 43.60 ? 562 ILE B N     1 
ATOM   3121 C CA    . ILE B 1 62  ? 44.566 -5.745  -31.769 1.00 44.34 ? 562 ILE B CA    1 
ATOM   3122 C C     . ILE B 1 62  ? 43.105 -5.614  -31.362 1.00 45.23 ? 562 ILE B C     1 
ATOM   3123 O O     . ILE B 1 62  ? 42.358 -4.826  -31.936 1.00 45.02 ? 562 ILE B O     1 
ATOM   3124 C CB    . ILE B 1 62  ? 44.634 -6.037  -33.292 1.00 43.52 ? 562 ILE B CB    1 
ATOM   3125 C CG1   . ILE B 1 62  ? 43.976 -7.384  -33.607 1.00 42.75 ? 562 ILE B CG1   1 
ATOM   3126 C CG2   . ILE B 1 62  ? 46.084 -6.018  -33.758 1.00 43.21 ? 562 ILE B CG2   1 
ATOM   3127 C CD1   . ILE B 1 62  ? 43.754 -7.623  -35.089 1.00 41.15 ? 562 ILE B CD1   1 
ATOM   3128 N N     . GLY B 1 63  ? 42.704 -6.390  -30.363 1.00 46.52 ? 563 GLY B N     1 
ATOM   3129 C CA    . GLY B 1 63  ? 41.329 -6.335  -29.911 1.00 48.75 ? 563 GLY B CA    1 
ATOM   3130 C C     . GLY B 1 63  ? 41.116 -7.093  -28.622 1.00 50.41 ? 563 GLY B C     1 
ATOM   3131 O O     . GLY B 1 63  ? 41.967 -7.874  -28.198 1.00 50.21 ? 563 GLY B O     1 
ATOM   3132 N N     . ASN B 1 64  ? 39.969 -6.868  -27.995 1.00 52.47 ? 564 ASN B N     1 
ATOM   3133 C CA    . ASN B 1 64  ? 39.661 -7.539  -26.744 1.00 54.69 ? 564 ASN B CA    1 
ATOM   3134 C C     . ASN B 1 64  ? 38.165 -7.636  -26.500 1.00 55.54 ? 564 ASN B C     1 
ATOM   3135 O O     . ASN B 1 64  ? 37.358 -6.997  -27.184 1.00 55.40 ? 564 ASN B O     1 
ATOM   3136 C CB    . ASN B 1 64  ? 40.316 -6.801  -25.574 1.00 55.99 ? 564 ASN B CB    1 
ATOM   3137 C CG    . ASN B 1 64  ? 41.203 -7.704  -24.737 1.00 57.59 ? 564 ASN B CG    1 
ATOM   3138 O OD1   . ASN B 1 64  ? 42.428 -7.538  -24.706 1.00 58.69 ? 564 ASN B OD1   1 
ATOM   3139 N ND2   . ASN B 1 64  ? 40.590 -8.670  -24.052 1.00 58.08 ? 564 ASN B ND2   1 
ATOM   3140 N N     . GLY B 1 65  ? 37.819 -8.447  -25.506 1.00 56.19 ? 565 GLY B N     1 
ATOM   3141 C CA    . GLY B 1 65  ? 36.436 -8.656  -25.126 1.00 57.22 ? 565 GLY B CA    1 
ATOM   3142 C C     . GLY B 1 65  ? 36.434 -9.540  -23.895 1.00 57.92 ? 565 GLY B C     1 
ATOM   3143 O O     . GLY B 1 65  ? 37.417 -10.241 -23.639 1.00 58.05 ? 565 GLY B O     1 
ATOM   3144 N N     . SER B 1 66  ? 35.347 -9.511  -23.130 1.00 58.43 ? 566 SER B N     1 
ATOM   3145 C CA    . SER B 1 66  ? 35.254 -10.327 -21.922 1.00 58.92 ? 566 SER B CA    1 
ATOM   3146 C C     . SER B 1 66  ? 35.399 -11.816 -22.250 1.00 59.15 ? 566 SER B C     1 
ATOM   3147 O O     . SER B 1 66  ? 35.684 -12.630 -21.368 1.00 59.46 ? 566 SER B O     1 
ATOM   3148 C CB    . SER B 1 66  ? 33.918 -10.067 -21.201 1.00 58.98 ? 566 SER B CB    1 
ATOM   3149 O OG    . SER B 1 66  ? 32.841 -9.890  -22.110 1.00 58.14 ? 566 SER B OG    1 
ATOM   3150 N N     . PHE B 1 67  ? 35.220 -12.159 -23.525 1.00 59.41 ? 567 PHE B N     1 
ATOM   3151 C CA    . PHE B 1 67  ? 35.316 -13.547 -23.982 1.00 59.09 ? 567 PHE B CA    1 
ATOM   3152 C C     . PHE B 1 67  ? 36.746 -13.927 -24.363 1.00 57.75 ? 567 PHE B C     1 
ATOM   3153 O O     . PHE B 1 67  ? 37.206 -15.028 -24.050 1.00 58.14 ? 567 PHE B O     1 
ATOM   3154 C CB    . PHE B 1 67  ? 34.391 -13.797 -25.192 1.00 60.54 ? 567 PHE B CB    1 
ATOM   3155 C CG    . PHE B 1 67  ? 32.995 -13.216 -25.048 1.00 62.08 ? 567 PHE B CG    1 
ATOM   3156 C CD1   . PHE B 1 67  ? 32.196 -13.016 -26.175 1.00 62.59 ? 567 PHE B CD1   1 
ATOM   3157 C CD2   . PHE B 1 67  ? 32.485 -12.854 -23.798 1.00 62.82 ? 567 PHE B CD2   1 
ATOM   3158 C CE1   . PHE B 1 67  ? 30.912 -12.464 -26.064 1.00 62.94 ? 567 PHE B CE1   1 
ATOM   3159 C CE2   . PHE B 1 67  ? 31.204 -12.300 -23.676 1.00 63.22 ? 567 PHE B CE2   1 
ATOM   3160 C CZ    . PHE B 1 67  ? 30.417 -12.105 -24.813 1.00 63.29 ? 567 PHE B CZ    1 
ATOM   3161 N N     . GLY B 1 68  ? 37.447 -13.021 -25.041 1.00 55.98 ? 568 GLY B N     1 
ATOM   3162 C CA    . GLY B 1 68  ? 38.811 -13.322 -25.439 1.00 53.60 ? 568 GLY B CA    1 
ATOM   3163 C C     . GLY B 1 68  ? 39.670 -12.158 -25.900 1.00 51.65 ? 568 GLY B C     1 
ATOM   3164 O O     . GLY B 1 68  ? 39.446 -11.006 -25.523 1.00 51.32 ? 568 GLY B O     1 
ATOM   3165 N N     . VAL B 1 69  ? 40.670 -12.482 -26.719 1.00 49.52 ? 569 VAL B N     1 
ATOM   3166 C CA    . VAL B 1 69  ? 41.602 -11.501 -27.264 1.00 47.32 ? 569 VAL B CA    1 
ATOM   3167 C C     . VAL B 1 69  ? 41.835 -11.768 -28.747 1.00 45.70 ? 569 VAL B C     1 
ATOM   3168 O O     . VAL B 1 69  ? 41.891 -12.920 -29.177 1.00 45.60 ? 569 VAL B O     1 
ATOM   3169 C CB    . VAL B 1 69  ? 42.972 -11.571 -26.551 1.00 47.23 ? 569 VAL B CB    1 
ATOM   3170 C CG1   . VAL B 1 69  ? 43.913 -10.520 -27.116 1.00 46.96 ? 569 VAL B CG1   1 
ATOM   3171 C CG2   . VAL B 1 69  ? 42.790 -11.367 -25.064 1.00 47.77 ? 569 VAL B CG2   1 
ATOM   3172 N N     . VAL B 1 70  ? 41.966 -10.703 -29.527 1.00 43.29 ? 570 VAL B N     1 
ATOM   3173 C CA    . VAL B 1 70  ? 42.217 -10.842 -30.953 1.00 41.38 ? 570 VAL B CA    1 
ATOM   3174 C C     . VAL B 1 70  ? 43.622 -10.336 -31.258 1.00 41.21 ? 570 VAL B C     1 
ATOM   3175 O O     . VAL B 1 70  ? 43.967 -9.202  -30.932 1.00 40.74 ? 570 VAL B O     1 
ATOM   3176 C CB    . VAL B 1 70  ? 41.202 -10.040 -31.788 1.00 40.40 ? 570 VAL B CB    1 
ATOM   3177 C CG1   . VAL B 1 70  ? 41.463 -10.254 -33.271 1.00 39.00 ? 570 VAL B CG1   1 
ATOM   3178 C CG2   . VAL B 1 70  ? 39.791 -10.468 -31.431 1.00 39.25 ? 570 VAL B CG2   1 
ATOM   3179 N N     . TYR B 1 71  ? 44.434 -11.189 -31.872 1.00 40.63 ? 571 TYR B N     1 
ATOM   3180 C CA    . TYR B 1 71  ? 45.796 -10.817 -32.220 1.00 40.43 ? 571 TYR B CA    1 
ATOM   3181 C C     . TYR B 1 71  ? 45.940 -10.649 -33.707 1.00 39.97 ? 571 TYR B C     1 
ATOM   3182 O O     . TYR B 1 71  ? 45.143 -11.169 -34.487 1.00 39.85 ? 571 TYR B O     1 
ATOM   3183 C CB    . TYR B 1 71  ? 46.798 -11.900 -31.821 1.00 40.90 ? 571 TYR B CB    1 
ATOM   3184 C CG    . TYR B 1 71  ? 46.742 -12.341 -30.392 1.00 41.93 ? 571 TYR B CG    1 
ATOM   3185 C CD1   . TYR B 1 71  ? 47.623 -11.814 -29.450 1.00 42.27 ? 571 TYR B CD1   1 
ATOM   3186 C CD2   . TYR B 1 71  ? 45.838 -13.317 -29.984 1.00 42.27 ? 571 TYR B CD2   1 
ATOM   3187 C CE1   . TYR B 1 71  ? 47.610 -12.250 -28.134 1.00 43.23 ? 571 TYR B CE1   1 
ATOM   3188 C CE2   . TYR B 1 71  ? 45.812 -13.764 -28.669 1.00 43.52 ? 571 TYR B CE2   1 
ATOM   3189 C CZ    . TYR B 1 71  ? 46.703 -13.226 -27.749 1.00 43.82 ? 571 TYR B CZ    1 
ATOM   3190 O OH    . TYR B 1 71  ? 46.689 -13.671 -26.447 1.00 45.03 ? 571 TYR B OH    1 
ATOM   3191 N N     . GLN B 1 72  ? 46.971 -9.915  -34.095 1.00 39.61 ? 572 GLN B N     1 
ATOM   3192 C CA    . GLN B 1 72  ? 47.283 -9.758  -35.496 1.00 39.77 ? 572 GLN B CA    1 
ATOM   3193 C C     . GLN B 1 72  ? 48.537 -10.608 -35.633 1.00 39.67 ? 572 GLN B C     1 
ATOM   3194 O O     . GLN B 1 72  ? 49.332 -10.698 -34.699 1.00 39.62 ? 572 GLN B O     1 
ATOM   3195 C CB    . GLN B 1 72  ? 47.614 -8.316  -35.850 1.00 40.10 ? 572 GLN B CB    1 
ATOM   3196 C CG    . GLN B 1 72  ? 47.964 -8.164  -37.316 1.00 41.01 ? 572 GLN B CG    1 
ATOM   3197 C CD    . GLN B 1 72  ? 48.675 -6.871  -37.615 1.00 41.84 ? 572 GLN B CD    1 
ATOM   3198 O OE1   . GLN B 1 72  ? 49.788 -6.638  -37.141 1.00 42.38 ? 572 GLN B OE1   1 
ATOM   3199 N NE2   . GLN B 1 72  ? 48.040 -6.017  -38.408 1.00 42.55 ? 572 GLN B NE2   1 
ATOM   3200 N N     . ALA B 1 73  ? 48.706 -11.249 -36.778 1.00 39.80 ? 573 ALA B N     1 
ATOM   3201 C CA    . ALA B 1 73  ? 49.881 -12.078 -36.993 1.00 40.10 ? 573 ALA B CA    1 
ATOM   3202 C C     . ALA B 1 73  ? 50.203 -12.088 -38.475 1.00 40.49 ? 573 ALA B C     1 
ATOM   3203 O O     . ALA B 1 73  ? 49.328 -11.864 -39.312 1.00 39.85 ? 573 ALA B O     1 
ATOM   3204 C CB    . ALA B 1 73  ? 49.629 -13.502 -36.490 1.00 40.02 ? 573 ALA B CB    1 
ATOM   3205 N N     . LYS B 1 74  ? 51.466 -12.337 -38.797 1.00 40.99 ? 574 LYS B N     1 
ATOM   3206 C CA    . LYS B 1 74  ? 51.887 -12.371 -40.181 1.00 41.78 ? 574 LYS B CA    1 
ATOM   3207 C C     . LYS B 1 74  ? 52.223 -13.796 -40.596 1.00 42.07 ? 574 LYS B C     1 
ATOM   3208 O O     . LYS B 1 74  ? 53.006 -14.478 -39.932 1.00 41.81 ? 574 LYS B O     1 
ATOM   3209 C CB    . LYS B 1 74  ? 53.104 -11.471 -40.382 1.00 42.77 ? 574 LYS B CB    1 
ATOM   3210 C CG    . LYS B 1 74  ? 53.411 -11.185 -41.839 1.00 44.19 ? 574 LYS B CG    1 
ATOM   3211 C CD    . LYS B 1 74  ? 54.880 -10.884 -42.036 1.00 46.14 ? 574 LYS B CD    1 
ATOM   3212 C CE    . LYS B 1 74  ? 55.295 -9.651  -41.250 1.00 47.57 ? 574 LYS B CE    1 
ATOM   3213 N NZ    . LYS B 1 74  ? 56.737 -9.318  -41.461 1.00 49.05 ? 574 LYS B NZ    1 
ATOM   3214 N N     . LEU B 1 75  ? 51.614 -14.242 -41.690 1.00 42.07 ? 575 LEU B N     1 
ATOM   3215 C CA    . LEU B 1 75  ? 51.864 -15.580 -42.197 1.00 42.84 ? 575 LEU B CA    1 
ATOM   3216 C C     . LEU B 1 75  ? 53.275 -15.600 -42.763 1.00 44.01 ? 575 LEU B C     1 
ATOM   3217 O O     . LEU B 1 75  ? 53.620 -14.799 -43.629 1.00 44.03 ? 575 LEU B O     1 
ATOM   3218 C CB    . LEU B 1 75  ? 50.845 -15.935 -43.276 1.00 41.54 ? 575 LEU B CB    1 
ATOM   3219 C CG    . LEU B 1 75  ? 49.421 -16.105 -42.749 1.00 40.73 ? 575 LEU B CG    1 
ATOM   3220 C CD1   . LEU B 1 75  ? 48.545 -16.670 -43.846 1.00 40.16 ? 575 LEU B CD1   1 
ATOM   3221 C CD2   . LEU B 1 75  ? 49.423 -17.012 -41.532 1.00 39.64 ? 575 LEU B CD2   1 
ATOM   3222 N N     . CYS B 1 76  ? 54.083 -16.526 -42.258 1.00 45.47 ? 576 CYS B N     1 
ATOM   3223 C CA    . CYS B 1 76  ? 55.479 -16.661 -42.650 1.00 47.39 ? 576 CYS B CA    1 
ATOM   3224 C C     . CYS B 1 76  ? 55.813 -16.677 -44.131 1.00 48.87 ? 576 CYS B C     1 
ATOM   3225 O O     . CYS B 1 76  ? 56.788 -16.055 -44.556 1.00 49.64 ? 576 CYS B O     1 
ATOM   3226 C CB    . CYS B 1 76  ? 56.070 -17.908 -42.004 1.00 46.95 ? 576 CYS B CB    1 
ATOM   3227 S SG    . CYS B 1 76  ? 56.513 -17.639 -40.301 1.00 47.61 ? 576 CYS B SG    1 
ATOM   3228 N N     . ASP B 1 77  ? 55.025 -17.378 -44.931 1.00 50.26 ? 577 ASP B N     1 
ATOM   3229 C CA    . ASP B 1 77  ? 55.352 -17.442 -46.344 1.00 51.58 ? 577 ASP B CA    1 
ATOM   3230 C C     . ASP B 1 77  ? 54.684 -16.376 -47.196 1.00 51.83 ? 577 ASP B C     1 
ATOM   3231 O O     . ASP B 1 77  ? 55.365 -15.603 -47.871 1.00 52.35 ? 577 ASP B O     1 
ATOM   3232 C CB    . ASP B 1 77  ? 55.056 -18.846 -46.872 1.00 52.55 ? 577 ASP B CB    1 
ATOM   3233 C CG    . ASP B 1 77  ? 56.135 -19.844 -46.470 1.00 53.65 ? 577 ASP B CG    1 
ATOM   3234 O OD1   . ASP B 1 77  ? 57.329 -19.558 -46.722 1.00 54.40 ? 577 ASP B OD1   1 
ATOM   3235 O OD2   . ASP B 1 77  ? 55.799 -20.904 -45.895 1.00 54.05 ? 577 ASP B OD2   1 
ATOM   3236 N N     . SER B 1 78  ? 53.359 -16.319 -47.164 1.00 51.58 ? 578 SER B N     1 
ATOM   3237 C CA    . SER B 1 78  ? 52.654 -15.324 -47.954 1.00 50.90 ? 578 SER B CA    1 
ATOM   3238 C C     . SER B 1 78  ? 52.993 -13.929 -47.451 1.00 50.25 ? 578 SER B C     1 
ATOM   3239 O O     . SER B 1 78  ? 52.976 -12.966 -48.216 1.00 50.65 ? 578 SER B O     1 
ATOM   3240 C CB    . SER B 1 78  ? 51.143 -15.555 -47.875 1.00 51.37 ? 578 SER B CB    1 
ATOM   3241 O OG    . SER B 1 78  ? 50.668 -15.364 -46.556 1.00 51.78 ? 578 SER B OG    1 
ATOM   3242 N N     . GLY B 1 79  ? 53.321 -13.828 -46.165 1.00 49.24 ? 579 GLY B N     1 
ATOM   3243 C CA    . GLY B 1 79  ? 53.631 -12.534 -45.582 1.00 47.45 ? 579 GLY B CA    1 
ATOM   3244 C C     . GLY B 1 79  ? 52.321 -11.842 -45.258 1.00 46.13 ? 579 GLY B C     1 
ATOM   3245 O O     . GLY B 1 79  ? 52.288 -10.735 -44.732 1.00 46.07 ? 579 GLY B O     1 
ATOM   3246 N N     . GLU B 1 80  ? 51.232 -12.527 -45.584 1.00 44.82 ? 580 GLU B N     1 
ATOM   3247 C CA    . GLU B 1 80  ? 49.878 -12.038 -45.359 1.00 43.67 ? 580 GLU B CA    1 
ATOM   3248 C C     . GLU B 1 80  ? 49.579 -11.835 -43.885 1.00 41.76 ? 580 GLU B C     1 
ATOM   3249 O O     . GLU B 1 80  ? 50.034 -12.600 -43.036 1.00 41.47 ? 580 GLU B O     1 
ATOM   3250 C CB    . GLU B 1 80  ? 48.876 -13.045 -45.907 1.00 45.15 ? 580 GLU B CB    1 
ATOM   3251 C CG    . GLU B 1 80  ? 47.955 -12.516 -46.959 1.00 47.44 ? 580 GLU B CG    1 
ATOM   3252 C CD    . GLU B 1 80  ? 47.090 -13.616 -47.531 1.00 49.23 ? 580 GLU B CD    1 
ATOM   3253 O OE1   . GLU B 1 80  ? 45.948 -13.315 -47.943 1.00 50.82 ? 580 GLU B OE1   1 
ATOM   3254 O OE2   . GLU B 1 80  ? 47.554 -14.780 -47.563 1.00 49.63 ? 580 GLU B OE2   1 
ATOM   3255 N N     . LEU B 1 81  ? 48.794 -10.806 -43.591 1.00 39.82 ? 581 LEU B N     1 
ATOM   3256 C CA    . LEU B 1 81  ? 48.408 -10.523 -42.219 1.00 37.86 ? 581 LEU B CA    1 
ATOM   3257 C C     . LEU B 1 81  ? 47.074 -11.213 -41.985 1.00 36.49 ? 581 LEU B C     1 
ATOM   3258 O O     . LEU B 1 81  ? 46.258 -11.337 -42.900 1.00 36.34 ? 581 LEU B O     1 
ATOM   3259 C CB    . LEU B 1 81  ? 48.249 -9.015  -42.000 1.00 38.14 ? 581 LEU B CB    1 
ATOM   3260 C CG    . LEU B 1 81  ? 49.526 -8.185  -41.833 1.00 38.24 ? 581 LEU B CG    1 
ATOM   3261 C CD1   . LEU B 1 81  ? 49.179 -6.711  -41.845 1.00 38.09 ? 581 LEU B CD1   1 
ATOM   3262 C CD2   . LEU B 1 81  ? 50.212 -8.551  -40.531 1.00 38.58 ? 581 LEU B CD2   1 
ATOM   3263 N N     . VAL B 1 82  ? 46.864 -11.682 -40.765 1.00 34.75 ? 582 VAL B N     1 
ATOM   3264 C CA    . VAL B 1 82  ? 45.621 -12.341 -40.406 1.00 33.31 ? 582 VAL B CA    1 
ATOM   3265 C C     . VAL B 1 82  ? 45.323 -11.939 -38.984 1.00 32.44 ? 582 VAL B C     1 
ATOM   3266 O O     . VAL B 1 82  ? 46.166 -11.351 -38.306 1.00 32.27 ? 582 VAL B O     1 
ATOM   3267 C CB    . VAL B 1 82  ? 45.731 -13.896 -40.456 1.00 33.32 ? 582 VAL B CB    1 
ATOM   3268 C CG1   . VAL B 1 82  ? 45.950 -14.364 -41.891 1.00 32.45 ? 582 VAL B CG1   1 
ATOM   3269 C CG2   . VAL B 1 82  ? 46.861 -14.375 -39.549 1.00 32.79 ? 582 VAL B CG2   1 
ATOM   3270 N N     . ALA B 1 83  ? 44.116 -12.245 -38.537 1.00 32.13 ? 583 ALA B N     1 
ATOM   3271 C CA    . ALA B 1 83  ? 43.722 -11.945 -37.171 1.00 31.52 ? 583 ALA B CA    1 
ATOM   3272 C C     . ALA B 1 83  ? 43.441 -13.295 -36.536 1.00 31.28 ? 583 ALA B C     1 
ATOM   3273 O O     . ALA B 1 83  ? 42.928 -14.193 -37.196 1.00 31.50 ? 583 ALA B O     1 
ATOM   3274 C CB    . ALA B 1 83  ? 42.467 -11.077 -37.157 1.00 30.85 ? 583 ALA B CB    1 
ATOM   3275 N N     . ILE B 1 84  ? 43.798 -13.453 -35.271 1.00 30.83 ? 584 ILE B N     1 
ATOM   3276 C CA    . ILE B 1 84  ? 43.542 -14.704 -34.581 1.00 31.25 ? 584 ILE B CA    1 
ATOM   3277 C C     . ILE B 1 84  ? 42.719 -14.418 -33.333 1.00 31.45 ? 584 ILE B C     1 
ATOM   3278 O O     . ILE B 1 84  ? 43.219 -13.818 -32.381 1.00 31.29 ? 584 ILE B O     1 
ATOM   3279 C CB    . ILE B 1 84  ? 44.860 -15.405 -34.168 1.00 31.65 ? 584 ILE B CB    1 
ATOM   3280 C CG1   . ILE B 1 84  ? 45.724 -15.665 -35.404 1.00 31.94 ? 584 ILE B CG1   1 
ATOM   3281 C CG2   . ILE B 1 84  ? 44.553 -16.711 -33.449 1.00 31.25 ? 584 ILE B CG2   1 
ATOM   3282 C CD1   . ILE B 1 84  ? 47.115 -16.162 -35.076 1.00 32.20 ? 584 ILE B CD1   1 
ATOM   3283 N N     . LYS B 1 85  ? 41.454 -14.833 -33.347 1.00 31.58 ? 585 LYS B N     1 
ATOM   3284 C CA    . LYS B 1 85  ? 40.572 -14.625 -32.203 1.00 32.02 ? 585 LYS B CA    1 
ATOM   3285 C C     . LYS B 1 85  ? 40.704 -15.816 -31.261 1.00 33.38 ? 585 LYS B C     1 
ATOM   3286 O O     . LYS B 1 85  ? 40.312 -16.932 -31.597 1.00 33.08 ? 585 LYS B O     1 
ATOM   3287 C CB    . LYS B 1 85  ? 39.116 -14.476 -32.665 1.00 30.77 ? 585 LYS B CB    1 
ATOM   3288 C CG    . LYS B 1 85  ? 38.131 -14.199 -31.536 1.00 29.28 ? 585 LYS B CG    1 
ATOM   3289 C CD    . LYS B 1 85  ? 36.769 -13.742 -32.060 1.00 28.90 ? 585 LYS B CD    1 
ATOM   3290 C CE    . LYS B 1 85  ? 35.796 -13.498 -30.914 1.00 27.66 ? 585 LYS B CE    1 
ATOM   3291 N NZ    . LYS B 1 85  ? 34.506 -12.935 -31.387 1.00 28.53 ? 585 LYS B NZ    1 
ATOM   3292 N N     . LYS B 1 86  ? 41.266 -15.570 -30.082 1.00 34.96 ? 586 LYS B N     1 
ATOM   3293 C CA    . LYS B 1 86  ? 41.473 -16.617 -29.089 1.00 36.96 ? 586 LYS B CA    1 
ATOM   3294 C C     . LYS B 1 86  ? 40.396 -16.571 -28.017 1.00 38.37 ? 586 LYS B C     1 
ATOM   3295 O O     . LYS B 1 86  ? 40.253 -15.578 -27.304 1.00 37.52 ? 586 LYS B O     1 
ATOM   3296 C CB    . LYS B 1 86  ? 42.850 -16.461 -28.446 1.00 37.42 ? 586 LYS B CB    1 
ATOM   3297 C CG    . LYS B 1 86  ? 43.241 -17.605 -27.541 1.00 38.04 ? 586 LYS B CG    1 
ATOM   3298 C CD    . LYS B 1 86  ? 44.698 -17.499 -27.143 1.00 38.75 ? 586 LYS B CD    1 
ATOM   3299 C CE    . LYS B 1 86  ? 45.209 -18.817 -26.596 1.00 39.59 ? 586 LYS B CE    1 
ATOM   3300 N NZ    . LYS B 1 86  ? 46.699 -18.881 -26.632 1.00 41.32 ? 586 LYS B NZ    1 
ATOM   3301 N N     . VAL B 1 87  ? 39.652 -17.666 -27.902 1.00 40.15 ? 587 VAL B N     1 
ATOM   3302 C CA    . VAL B 1 87  ? 38.564 -17.771 -26.942 1.00 42.57 ? 587 VAL B CA    1 
ATOM   3303 C C     . VAL B 1 87  ? 38.667 -19.054 -26.114 1.00 44.52 ? 587 VAL B C     1 
ATOM   3304 O O     . VAL B 1 87  ? 39.025 -20.110 -26.636 1.00 44.09 ? 587 VAL B O     1 
ATOM   3305 C CB    . VAL B 1 87  ? 37.205 -17.747 -27.683 1.00 42.46 ? 587 VAL B CB    1 
ATOM   3306 C CG1   . VAL B 1 87  ? 36.122 -18.376 -26.827 1.00 43.21 ? 587 VAL B CG1   1 
ATOM   3307 C CG2   . VAL B 1 87  ? 36.841 -16.315 -28.046 1.00 41.98 ? 587 VAL B CG2   1 
ATOM   3308 N N     . LEU B 1 88  ? 38.356 -18.958 -24.824 1.00 46.86 ? 588 LEU B N     1 
ATOM   3309 C CA    . LEU B 1 88  ? 38.404 -20.127 -23.954 1.00 49.52 ? 588 LEU B CA    1 
ATOM   3310 C C     . LEU B 1 88  ? 37.324 -21.104 -24.400 1.00 51.67 ? 588 LEU B C     1 
ATOM   3311 O O     . LEU B 1 88  ? 36.162 -20.726 -24.567 1.00 51.61 ? 588 LEU B O     1 
ATOM   3312 C CB    . LEU B 1 88  ? 38.173 -19.728 -22.500 1.00 49.52 ? 588 LEU B CB    1 
ATOM   3313 C CG    . LEU B 1 88  ? 38.521 -20.811 -21.482 1.00 49.74 ? 588 LEU B CG    1 
ATOM   3314 C CD1   . LEU B 1 88  ? 39.978 -20.680 -21.069 1.00 49.53 ? 588 LEU B CD1   1 
ATOM   3315 C CD2   . LEU B 1 88  ? 37.603 -20.687 -20.280 1.00 50.26 ? 588 LEU B CD2   1 
ATOM   3316 N N     . GLN B 1 89  ? 37.713 -22.359 -24.594 1.00 54.29 ? 589 GLN B N     1 
ATOM   3317 C CA    . GLN B 1 89  ? 36.774 -23.373 -25.047 1.00 57.23 ? 589 GLN B CA    1 
ATOM   3318 C C     . GLN B 1 89  ? 36.234 -24.248 -23.930 1.00 58.83 ? 589 GLN B C     1 
ATOM   3319 O O     . GLN B 1 89  ? 36.994 -24.795 -23.132 1.00 59.12 ? 589 GLN B O     1 
ATOM   3320 C CB    . GLN B 1 89  ? 37.429 -24.263 -26.107 1.00 58.05 ? 589 GLN B CB    1 
ATOM   3321 C CG    . GLN B 1 89  ? 36.464 -25.241 -26.771 1.00 59.63 ? 589 GLN B CG    1 
ATOM   3322 C CD    . GLN B 1 89  ? 35.107 -24.620 -27.055 1.00 60.45 ? 589 GLN B CD    1 
ATOM   3323 O OE1   . GLN B 1 89  ? 34.064 -25.183 -26.713 1.00 60.97 ? 589 GLN B OE1   1 
ATOM   3324 N NE2   . GLN B 1 89  ? 35.115 -23.450 -27.683 1.00 61.25 ? 589 GLN B NE2   1 
ATOM   3325 N N     . ASP B 1 90  ? 34.911 -24.376 -23.892 1.00 60.67 ? 590 ASP B N     1 
ATOM   3326 C CA    . ASP B 1 90  ? 34.232 -25.198 -22.899 1.00 62.70 ? 590 ASP B CA    1 
ATOM   3327 C C     . ASP B 1 90  ? 34.242 -26.645 -23.394 1.00 63.41 ? 590 ASP B C     1 
ATOM   3328 O O     . ASP B 1 90  ? 33.661 -26.954 -24.435 1.00 63.59 ? 590 ASP B O     1 
ATOM   3329 C CB    . ASP B 1 90  ? 32.783 -24.718 -22.724 1.00 63.77 ? 590 ASP B CB    1 
ATOM   3330 C CG    . ASP B 1 90  ? 32.154 -25.198 -21.418 1.00 65.38 ? 590 ASP B CG    1 
ATOM   3331 O OD1   . ASP B 1 90  ? 31.065 -24.692 -21.063 1.00 65.85 ? 590 ASP B OD1   1 
ATOM   3332 O OD2   . ASP B 1 90  ? 32.744 -26.077 -20.748 1.00 66.42 ? 590 ASP B OD2   1 
ATOM   3333 N N     . LYS B 1 91  ? 34.908 -27.527 -22.657 1.00 64.23 ? 591 LYS B N     1 
ATOM   3334 C CA    . LYS B 1 91  ? 34.970 -28.934 -23.045 1.00 65.03 ? 591 LYS B CA    1 
ATOM   3335 C C     . LYS B 1 91  ? 33.564 -29.539 -22.987 1.00 65.00 ? 591 LYS B C     1 
ATOM   3336 O O     . LYS B 1 91  ? 33.330 -30.647 -23.470 1.00 65.21 ? 591 LYS B O     1 
ATOM   3337 C CB    . LYS B 1 91  ? 35.913 -29.705 -22.109 1.00 65.50 ? 591 LYS B CB    1 
ATOM   3338 C CG    . LYS B 1 91  ? 37.402 -29.531 -22.416 1.00 65.98 ? 591 LYS B CG    1 
ATOM   3339 C CD    . LYS B 1 91  ? 38.016 -28.366 -21.637 1.00 66.54 ? 591 LYS B CD    1 
ATOM   3340 C CE    . LYS B 1 91  ? 37.967 -28.594 -20.130 1.00 66.75 ? 591 LYS B CE    1 
ATOM   3341 N NZ    . LYS B 1 91  ? 36.621 -28.294 -19.560 1.00 66.73 ? 591 LYS B NZ    1 
ATOM   3342 N N     . ARG B 1 92  ? 32.633 -28.788 -22.404 1.00 64.84 ? 592 ARG B N     1 
ATOM   3343 C CA    . ARG B 1 92  ? 31.242 -29.213 -22.256 1.00 64.60 ? 592 ARG B CA    1 
ATOM   3344 C C     . ARG B 1 92  ? 30.476 -29.319 -23.579 1.00 63.54 ? 592 ARG B C     1 
ATOM   3345 O O     . ARG B 1 92  ? 29.984 -30.392 -23.925 1.00 63.79 ? 592 ARG B O     1 
ATOM   3346 C CB    . ARG B 1 92  ? 30.518 -28.250 -21.308 1.00 66.23 ? 592 ARG B CB    1 
ATOM   3347 C CG    . ARG B 1 92  ? 29.106 -28.663 -20.934 1.00 68.27 ? 592 ARG B CG    1 
ATOM   3348 C CD    . ARG B 1 92  ? 29.026 -30.114 -20.485 1.00 70.65 ? 592 ARG B CD    1 
ATOM   3349 N NE    . ARG B 1 92  ? 27.681 -30.467 -20.033 1.00 72.39 ? 592 ARG B NE    1 
ATOM   3350 C CZ    . ARG B 1 92  ? 27.357 -31.633 -19.478 1.00 73.07 ? 592 ARG B CZ    1 
ATOM   3351 N NH1   . ARG B 1 92  ? 28.279 -32.574 -19.300 1.00 73.31 ? 592 ARG B NH1   1 
ATOM   3352 N NH2   . ARG B 1 92  ? 26.107 -31.860 -19.092 1.00 73.68 ? 592 ARG B NH2   1 
ATOM   3353 N N     . PHE B 1 93  ? 30.355 -28.210 -24.306 1.00 61.96 ? 593 PHE B N     1 
ATOM   3354 C CA    . PHE B 1 93  ? 29.651 -28.222 -25.591 1.00 59.89 ? 593 PHE B CA    1 
ATOM   3355 C C     . PHE B 1 93  ? 30.531 -27.681 -26.712 1.00 57.71 ? 593 PHE B C     1 
ATOM   3356 O O     . PHE B 1 93  ? 31.688 -27.321 -26.496 1.00 57.54 ? 593 PHE B O     1 
ATOM   3357 C CB    . PHE B 1 93  ? 28.362 -27.386 -25.542 1.00 61.21 ? 593 PHE B CB    1 
ATOM   3358 C CG    . PHE B 1 93  ? 27.898 -27.033 -24.152 1.00 62.51 ? 593 PHE B CG    1 
ATOM   3359 C CD1   . PHE B 1 93  ? 26.974 -27.839 -23.490 1.00 63.09 ? 593 PHE B CD1   1 
ATOM   3360 C CD2   . PHE B 1 93  ? 28.352 -25.873 -23.521 1.00 63.09 ? 593 PHE B CD2   1 
ATOM   3361 C CE1   . PHE B 1 93  ? 26.501 -27.498 -22.217 1.00 63.48 ? 593 PHE B CE1   1 
ATOM   3362 C CE2   . PHE B 1 93  ? 27.888 -25.521 -22.247 1.00 63.56 ? 593 PHE B CE2   1 
ATOM   3363 C CZ    . PHE B 1 93  ? 26.959 -26.336 -21.594 1.00 63.55 ? 593 PHE B CZ    1 
ATOM   3364 N N     . LYS B 1 94  ? 29.968 -27.624 -27.912 1.00 54.88 ? 594 LYS B N     1 
ATOM   3365 C CA    . LYS B 1 94  ? 30.687 -27.115 -29.071 1.00 51.86 ? 594 LYS B CA    1 
ATOM   3366 C C     . LYS B 1 94  ? 30.586 -25.600 -29.109 1.00 48.79 ? 594 LYS B C     1 
ATOM   3367 O O     . LYS B 1 94  ? 29.642 -25.020 -28.571 1.00 48.03 ? 594 LYS B O     1 
ATOM   3368 C CB    . LYS B 1 94  ? 30.095 -27.697 -30.355 1.00 53.21 ? 594 LYS B CB    1 
ATOM   3369 C CG    . LYS B 1 94  ? 30.034 -29.213 -30.367 1.00 54.88 ? 594 LYS B CG    1 
ATOM   3370 C CD    . LYS B 1 94  ? 29.960 -29.756 -31.781 1.00 56.39 ? 594 LYS B CD    1 
ATOM   3371 C CE    . LYS B 1 94  ? 29.419 -31.177 -31.790 1.00 57.46 ? 594 LYS B CE    1 
ATOM   3372 N NZ    . LYS B 1 94  ? 28.826 -31.523 -33.114 1.00 58.45 ? 594 LYS B NZ    1 
ATOM   3373 N N     . ASN B 1 95  ? 31.562 -24.961 -29.748 1.00 45.47 ? 595 ASN B N     1 
ATOM   3374 C CA    . ASN B 1 95  ? 31.563 -23.505 -29.853 1.00 42.06 ? 595 ASN B CA    1 
ATOM   3375 C C     . ASN B 1 95  ? 30.568 -23.049 -30.921 1.00 39.88 ? 595 ASN B C     1 
ATOM   3376 O O     . ASN B 1 95  ? 30.750 -23.317 -32.105 1.00 39.20 ? 595 ASN B O     1 
ATOM   3377 C CB    . ASN B 1 95  ? 32.961 -23.014 -30.207 1.00 41.25 ? 595 ASN B CB    1 
ATOM   3378 C CG    . ASN B 1 95  ? 33.089 -21.518 -30.075 1.00 40.68 ? 595 ASN B CG    1 
ATOM   3379 O OD1   . ASN B 1 95  ? 33.328 -21.001 -28.985 1.00 40.48 ? 595 ASN B OD1   1 
ATOM   3380 N ND2   . ASN B 1 95  ? 32.922 -20.813 -31.182 1.00 39.13 ? 595 ASN B ND2   1 
ATOM   3381 N N     . ARG B 1 96  ? 29.512 -22.356 -30.490 1.00 37.44 ? 596 ARG B N     1 
ATOM   3382 C CA    . ARG B 1 96  ? 28.478 -21.885 -31.408 1.00 35.72 ? 596 ARG B CA    1 
ATOM   3383 C C     . ARG B 1 96  ? 29.021 -20.904 -32.442 1.00 34.32 ? 596 ARG B C     1 
ATOM   3384 O O     . ARG B 1 96  ? 28.607 -20.920 -33.603 1.00 33.38 ? 596 ARG B O     1 
ATOM   3385 C CB    . ARG B 1 96  ? 27.342 -21.225 -30.627 1.00 35.93 ? 596 ARG B CB    1 
ATOM   3386 C CG    . ARG B 1 96  ? 26.140 -20.867 -31.479 1.00 37.17 ? 596 ARG B CG    1 
ATOM   3387 C CD    . ARG B 1 96  ? 25.037 -20.234 -30.641 1.00 39.04 ? 596 ARG B CD    1 
ATOM   3388 N NE    . ARG B 1 96  ? 24.404 -21.215 -29.763 1.00 41.22 ? 596 ARG B NE    1 
ATOM   3389 C CZ    . ARG B 1 96  ? 23.583 -20.889 -28.764 1.00 42.76 ? 596 ARG B CZ    1 
ATOM   3390 N NH1   . ARG B 1 96  ? 23.295 -19.608 -28.513 1.00 43.05 ? 596 ARG B NH1   1 
ATOM   3391 N NH2   . ARG B 1 96  ? 23.041 -21.843 -28.007 1.00 42.99 ? 596 ARG B NH2   1 
ATOM   3392 N N     . GLU B 1 97  ? 29.946 -20.049 -32.017 1.00 32.78 ? 597 GLU B N     1 
ATOM   3393 C CA    . GLU B 1 97  ? 30.543 -19.070 -32.914 1.00 31.60 ? 597 GLU B CA    1 
ATOM   3394 C C     . GLU B 1 97  ? 31.254 -19.795 -34.064 1.00 31.16 ? 597 GLU B C     1 
ATOM   3395 O O     . GLU B 1 97  ? 31.063 -19.456 -35.234 1.00 30.05 ? 597 GLU B O     1 
ATOM   3396 C CB    . GLU B 1 97  ? 31.537 -18.192 -32.139 1.00 31.36 ? 597 GLU B CB    1 
ATOM   3397 C CG    . GLU B 1 97  ? 32.173 -17.072 -32.965 1.00 32.30 ? 597 GLU B CG    1 
ATOM   3398 C CD    . GLU B 1 97  ? 32.970 -16.084 -32.115 1.00 33.01 ? 597 GLU B CD    1 
ATOM   3399 O OE1   . GLU B 1 97  ? 33.478 -15.089 -32.677 1.00 32.57 ? 597 GLU B OE1   1 
ATOM   3400 O OE2   . GLU B 1 97  ? 33.092 -16.303 -30.889 1.00 32.96 ? 597 GLU B OE2   1 
ATOM   3401 N N     . LEU B 1 98  ? 32.069 -20.793 -33.728 1.00 31.00 ? 598 LEU B N     1 
ATOM   3402 C CA    . LEU B 1 98  ? 32.801 -21.559 -34.727 1.00 31.67 ? 598 LEU B CA    1 
ATOM   3403 C C     . LEU B 1 98  ? 31.832 -22.274 -35.670 1.00 32.40 ? 598 LEU B C     1 
ATOM   3404 O O     . LEU B 1 98  ? 31.953 -22.182 -36.894 1.00 32.52 ? 598 LEU B O     1 
ATOM   3405 C CB    . LEU B 1 98  ? 33.701 -22.593 -34.043 1.00 31.37 ? 598 LEU B CB    1 
ATOM   3406 C CG    . LEU B 1 98  ? 34.385 -23.615 -34.960 1.00 30.61 ? 598 LEU B CG    1 
ATOM   3407 C CD1   . LEU B 1 98  ? 35.276 -22.909 -35.955 1.00 29.99 ? 598 LEU B CD1   1 
ATOM   3408 C CD2   . LEU B 1 98  ? 35.210 -24.589 -34.129 1.00 30.20 ? 598 LEU B CD2   1 
ATOM   3409 N N     . GLN B 1 99  ? 30.866 -22.983 -35.100 1.00 32.89 ? 599 GLN B N     1 
ATOM   3410 C CA    . GLN B 1 99  ? 29.897 -23.712 -35.905 1.00 34.02 ? 599 GLN B CA    1 
ATOM   3411 C C     . GLN B 1 99  ? 29.188 -22.802 -36.914 1.00 33.80 ? 599 GLN B C     1 
ATOM   3412 O O     . GLN B 1 99  ? 28.891 -23.217 -38.035 1.00 32.91 ? 599 GLN B O     1 
ATOM   3413 C CB    . GLN B 1 99  ? 28.876 -24.390 -34.990 1.00 36.06 ? 599 GLN B CB    1 
ATOM   3414 C CG    . GLN B 1 99  ? 29.485 -25.402 -33.998 1.00 40.12 ? 599 GLN B CG    1 
ATOM   3415 C CD    . GLN B 1 99  ? 30.822 -25.999 -34.464 1.00 42.71 ? 599 GLN B CD    1 
ATOM   3416 O OE1   . GLN B 1 99  ? 30.946 -26.510 -35.589 1.00 44.16 ? 599 GLN B OE1   1 
ATOM   3417 N NE2   . GLN B 1 99  ? 31.829 -25.937 -33.590 1.00 43.58 ? 599 GLN B NE2   1 
ATOM   3418 N N     . ILE B 1 100 ? 28.924 -21.559 -36.522 1.00 33.42 ? 600 ILE B N     1 
ATOM   3419 C CA    . ILE B 1 100 ? 28.257 -20.623 -37.415 1.00 32.86 ? 600 ILE B CA    1 
ATOM   3420 C C     . ILE B 1 100 ? 29.252 -20.095 -38.451 1.00 33.29 ? 600 ILE B C     1 
ATOM   3421 O O     . ILE B 1 100 ? 28.980 -20.120 -39.655 1.00 33.29 ? 600 ILE B O     1 
ATOM   3422 C CB    . ILE B 1 100 ? 27.636 -19.449 -36.608 1.00 32.68 ? 600 ILE B CB    1 
ATOM   3423 C CG1   . ILE B 1 100 ? 26.321 -19.906 -35.965 1.00 32.22 ? 600 ILE B CG1   1 
ATOM   3424 C CG2   . ILE B 1 100 ? 27.387 -18.245 -37.511 1.00 31.97 ? 600 ILE B CG2   1 
ATOM   3425 C CD1   . ILE B 1 100 ? 25.796 -18.982 -34.877 1.00 31.74 ? 600 ILE B CD1   1 
ATOM   3426 N N     . MET B 1 101 ? 30.405 -19.626 -37.985 1.00 33.64 ? 601 MET B N     1 
ATOM   3427 C CA    . MET B 1 101 ? 31.432 -19.091 -38.879 1.00 34.97 ? 601 MET B CA    1 
ATOM   3428 C C     . MET B 1 101 ? 31.806 -20.081 -39.979 1.00 35.28 ? 601 MET B C     1 
ATOM   3429 O O     . MET B 1 101 ? 32.124 -19.685 -41.103 1.00 34.49 ? 601 MET B O     1 
ATOM   3430 C CB    . MET B 1 101 ? 32.704 -18.752 -38.095 1.00 36.66 ? 601 MET B CB    1 
ATOM   3431 C CG    . MET B 1 101 ? 32.590 -17.587 -37.135 1.00 38.72 ? 601 MET B CG    1 
ATOM   3432 S SD    . MET B 1 101 ? 33.180 -16.045 -37.824 1.00 43.53 ? 601 MET B SD    1 
ATOM   3433 C CE    . MET B 1 101 ? 34.750 -16.403 -38.314 1.00 41.22 ? 601 MET B CE    1 
ATOM   3434 N N     . ARG B 1 102 ? 31.782 -21.366 -39.640 1.00 35.41 ? 602 ARG B N     1 
ATOM   3435 C CA    . ARG B 1 102 ? 32.153 -22.422 -40.574 1.00 36.34 ? 602 ARG B CA    1 
ATOM   3436 C C     . ARG B 1 102 ? 31.243 -22.584 -41.777 1.00 36.12 ? 602 ARG B C     1 
ATOM   3437 O O     . ARG B 1 102 ? 31.691 -22.999 -42.843 1.00 37.03 ? 602 ARG B O     1 
ATOM   3438 C CB    . ARG B 1 102 ? 32.241 -23.752 -39.840 1.00 36.64 ? 602 ARG B CB    1 
ATOM   3439 C CG    . ARG B 1 102 ? 33.411 -23.828 -38.895 1.00 38.25 ? 602 ARG B CG    1 
ATOM   3440 C CD    . ARG B 1 102 ? 33.506 -25.217 -38.308 1.00 39.47 ? 602 ARG B CD    1 
ATOM   3441 N NE    . ARG B 1 102 ? 34.108 -26.125 -39.266 1.00 40.29 ? 602 ARG B NE    1 
ATOM   3442 C CZ    . ARG B 1 102 ? 34.325 -27.409 -39.013 1.00 40.70 ? 602 ARG B CZ    1 
ATOM   3443 N NH1   . ARG B 1 102 ? 33.987 -27.929 -37.834 1.00 40.88 ? 602 ARG B NH1   1 
ATOM   3444 N NH2   . ARG B 1 102 ? 34.896 -28.176 -39.934 1.00 41.37 ? 602 ARG B NH2   1 
ATOM   3445 N N     . LYS B 1 103 ? 29.967 -22.265 -41.624 1.00 36.09 ? 603 LYS B N     1 
ATOM   3446 C CA    . LYS B 1 103 ? 29.058 -22.417 -42.741 1.00 36.26 ? 603 LYS B CA    1 
ATOM   3447 C C     . LYS B 1 103 ? 28.816 -21.123 -43.522 1.00 35.28 ? 603 LYS B C     1 
ATOM   3448 O O     . LYS B 1 103 ? 28.031 -21.102 -44.469 1.00 35.94 ? 603 LYS B O     1 
ATOM   3449 C CB    . LYS B 1 103 ? 27.733 -22.991 -42.244 1.00 38.30 ? 603 LYS B CB    1 
ATOM   3450 C CG    . LYS B 1 103 ? 26.974 -22.100 -41.288 1.00 41.24 ? 603 LYS B CG    1 
ATOM   3451 C CD    . LYS B 1 103 ? 25.731 -22.803 -40.757 1.00 43.37 ? 603 LYS B CD    1 
ATOM   3452 C CE    . LYS B 1 103 ? 26.092 -23.823 -39.681 1.00 45.06 ? 603 LYS B CE    1 
ATOM   3453 N NZ    . LYS B 1 103 ? 25.093 -24.934 -39.578 1.00 46.49 ? 603 LYS B NZ    1 
ATOM   3454 N N     . LEU B 1 104 ? 29.505 -20.048 -43.148 1.00 33.16 ? 604 LEU B N     1 
ATOM   3455 C CA    . LEU B 1 104 ? 29.318 -18.774 -43.831 1.00 31.45 ? 604 LEU B CA    1 
ATOM   3456 C C     . LEU B 1 104 ? 30.336 -18.506 -44.931 1.00 30.70 ? 604 LEU B C     1 
ATOM   3457 O O     . LEU B 1 104 ? 31.522 -18.785 -44.781 1.00 30.82 ? 604 LEU B O     1 
ATOM   3458 C CB    . LEU B 1 104 ? 29.355 -17.622 -42.823 1.00 31.74 ? 604 LEU B CB    1 
ATOM   3459 C CG    . LEU B 1 104 ? 28.357 -17.694 -41.659 1.00 31.08 ? 604 LEU B CG    1 
ATOM   3460 C CD1   . LEU B 1 104 ? 28.456 -16.429 -40.821 1.00 30.92 ? 604 LEU B CD1   1 
ATOM   3461 C CD2   . LEU B 1 104 ? 26.943 -17.870 -42.187 1.00 30.51 ? 604 LEU B CD2   1 
ATOM   3462 N N     . ASP B 1 105 ? 29.860 -17.949 -46.035 1.00 30.06 ? 605 ASP B N     1 
ATOM   3463 C CA    . ASP B 1 105 ? 30.720 -17.615 -47.167 1.00 30.01 ? 605 ASP B CA    1 
ATOM   3464 C C     . ASP B 1 105 ? 30.087 -16.446 -47.924 1.00 29.08 ? 605 ASP B C     1 
ATOM   3465 O O     . ASP B 1 105 ? 29.213 -16.645 -48.770 1.00 28.82 ? 605 ASP B O     1 
ATOM   3466 C CB    . ASP B 1 105 ? 30.868 -18.826 -48.089 1.00 31.60 ? 605 ASP B CB    1 
ATOM   3467 C CG    . ASP B 1 105 ? 31.861 -18.587 -49.206 1.00 33.46 ? 605 ASP B CG    1 
ATOM   3468 O OD1   . ASP B 1 105 ? 32.666 -17.635 -49.104 1.00 34.26 ? 605 ASP B OD1   1 
ATOM   3469 O OD2   . ASP B 1 105 ? 31.833 -19.349 -50.197 1.00 35.05 ? 605 ASP B OD2   1 
ATOM   3470 N N     . HIS B 1 106 ? 30.535 -15.227 -47.604 1.00 27.12 ? 606 HIS B N     1 
ATOM   3471 C CA    . HIS B 1 106 ? 29.994 -14.023 -48.225 1.00 24.80 ? 606 HIS B CA    1 
ATOM   3472 C C     . HIS B 1 106 ? 31.076 -12.953 -48.248 1.00 24.29 ? 606 HIS B C     1 
ATOM   3473 O O     . HIS B 1 106 ? 31.893 -12.864 -47.322 1.00 23.77 ? 606 HIS B O     1 
ATOM   3474 C CB    . HIS B 1 106 ? 28.779 -13.540 -47.423 1.00 23.96 ? 606 HIS B CB    1 
ATOM   3475 C CG    . HIS B 1 106 ? 28.008 -12.442 -48.091 1.00 22.74 ? 606 HIS B CG    1 
ATOM   3476 N ND1   . HIS B 1 106 ? 28.367 -11.117 -47.991 1.00 22.27 ? 606 HIS B ND1   1 
ATOM   3477 C CD2   . HIS B 1 106 ? 26.878 -12.478 -48.835 1.00 22.63 ? 606 HIS B CD2   1 
ATOM   3478 C CE1   . HIS B 1 106 ? 27.483 -10.378 -48.649 1.00 23.21 ? 606 HIS B CE1   1 
ATOM   3479 N NE2   . HIS B 1 106 ? 26.572 -11.176 -49.168 1.00 22.32 ? 606 HIS B NE2   1 
ATOM   3480 N N     . CYS B 1 107 ? 31.076 -12.129 -49.290 1.00 23.45 ? 607 CYS B N     1 
ATOM   3481 C CA    . CYS B 1 107 ? 32.092 -11.092 -49.449 1.00 23.34 ? 607 CYS B CA    1 
ATOM   3482 C C     . CYS B 1 107 ? 32.031 -9.964  -48.420 1.00 22.52 ? 607 CYS B C     1 
ATOM   3483 O O     . CYS B 1 107 ? 32.975 -9.183  -48.298 1.00 22.02 ? 607 CYS B O     1 
ATOM   3484 C CB    . CYS B 1 107 ? 32.029 -10.509 -50.867 1.00 24.25 ? 607 CYS B CB    1 
ATOM   3485 S SG    . CYS B 1 107 ? 30.431 -9.775  -51.321 1.00 28.61 ? 607 CYS B SG    1 
ATOM   3486 N N     . ASN B 1 108 ? 30.922 -9.876  -47.689 1.00 21.64 ? 608 ASN B N     1 
ATOM   3487 C CA    . ASN B 1 108 ? 30.763 -8.843  -46.669 1.00 20.84 ? 608 ASN B CA    1 
ATOM   3488 C C     . ASN B 1 108 ? 30.749 -9.422  -45.254 1.00 20.97 ? 608 ASN B C     1 
ATOM   3489 O O     . ASN B 1 108 ? 30.200 -8.829  -44.323 1.00 20.99 ? 608 ASN B O     1 
ATOM   3490 C CB    . ASN B 1 108 ? 29.502 -8.020  -46.943 1.00 20.58 ? 608 ASN B CB    1 
ATOM   3491 C CG    . ASN B 1 108 ? 29.624 -7.204  -48.215 1.00 21.27 ? 608 ASN B CG    1 
ATOM   3492 O OD1   . ASN B 1 108 ? 30.606 -6.479  -48.404 1.00 21.80 ? 608 ASN B OD1   1 
ATOM   3493 N ND2   . ASN B 1 108 ? 28.650 -7.330  -49.100 1.00 19.13 ? 608 ASN B ND2   1 
ATOM   3494 N N     . ILE B 1 109 ? 31.362 -10.592 -45.103 1.00 20.47 ? 609 ILE B N     1 
ATOM   3495 C CA    . ILE B 1 109 ? 31.475 -11.249 -43.807 1.00 20.80 ? 609 ILE B CA    1 
ATOM   3496 C C     . ILE B 1 109 ? 32.916 -11.735 -43.737 1.00 21.86 ? 609 ILE B C     1 
ATOM   3497 O O     . ILE B 1 109 ? 33.415 -12.370 -44.675 1.00 21.15 ? 609 ILE B O     1 
ATOM   3498 C CB    . ILE B 1 109 ? 30.511 -12.451 -43.679 1.00 21.00 ? 609 ILE B CB    1 
ATOM   3499 C CG1   . ILE B 1 109 ? 29.062 -11.954 -43.715 1.00 20.52 ? 609 ILE B CG1   1 
ATOM   3500 C CG2   . ILE B 1 109 ? 30.802 -13.216 -42.383 1.00 20.81 ? 609 ILE B CG2   1 
ATOM   3501 C CD1   . ILE B 1 109 ? 28.025 -13.028 -43.499 1.00 21.55 ? 609 ILE B CD1   1 
ATOM   3502 N N     . VAL B 1 110 ? 33.596 -11.421 -42.642 1.00 22.12 ? 610 VAL B N     1 
ATOM   3503 C CA    . VAL B 1 110 ? 34.988 -11.807 -42.498 1.00 23.75 ? 610 VAL B CA    1 
ATOM   3504 C C     . VAL B 1 110 ? 35.138 -13.324 -42.627 1.00 24.56 ? 610 VAL B C     1 
ATOM   3505 O O     . VAL B 1 110 ? 34.362 -14.091 -42.060 1.00 24.14 ? 610 VAL B O     1 
ATOM   3506 C CB    . VAL B 1 110 ? 35.572 -11.284 -41.145 1.00 23.49 ? 610 VAL B CB    1 
ATOM   3507 C CG1   . VAL B 1 110 ? 35.050 -12.113 -39.976 1.00 23.84 ? 610 VAL B CG1   1 
ATOM   3508 C CG2   . VAL B 1 110 ? 37.098 -11.292 -41.203 1.00 24.19 ? 610 VAL B CG2   1 
ATOM   3509 N N     . ARG B 1 111 ? 36.139 -13.747 -43.390 1.00 25.97 ? 611 ARG B N     1 
ATOM   3510 C CA    . ARG B 1 111 ? 36.367 -15.167 -43.622 1.00 27.52 ? 611 ARG B CA    1 
ATOM   3511 C C     . ARG B 1 111 ? 37.175 -15.891 -42.554 1.00 26.99 ? 611 ARG B C     1 
ATOM   3512 O O     . ARG B 1 111 ? 38.171 -15.375 -42.049 1.00 26.61 ? 611 ARG B O     1 
ATOM   3513 C CB    . ARG B 1 111 ? 37.050 -15.375 -44.985 1.00 29.49 ? 611 ARG B CB    1 
ATOM   3514 C CG    . ARG B 1 111 ? 37.413 -16.838 -45.299 1.00 33.29 ? 611 ARG B CG    1 
ATOM   3515 C CD    . ARG B 1 111 ? 38.168 -16.976 -46.621 1.00 35.37 ? 611 ARG B CD    1 
ATOM   3516 N NE    . ARG B 1 111 ? 39.374 -16.151 -46.632 1.00 39.30 ? 611 ARG B NE    1 
ATOM   3517 C CZ    . ARG B 1 111 ? 40.299 -16.167 -47.591 1.00 41.74 ? 611 ARG B CZ    1 
ATOM   3518 N NH1   . ARG B 1 111 ? 40.167 -16.974 -48.640 1.00 43.02 ? 611 ARG B NH1   1 
ATOM   3519 N NH2   . ARG B 1 111 ? 41.362 -15.371 -47.505 1.00 42.29 ? 611 ARG B NH2   1 
ATOM   3520 N N     . LEU B 1 112 ? 36.723 -17.092 -42.208 1.00 27.33 ? 612 LEU B N     1 
ATOM   3521 C CA    . LEU B 1 112 ? 37.437 -17.926 -41.248 1.00 27.98 ? 612 LEU B CA    1 
ATOM   3522 C C     . LEU B 1 112 ? 38.363 -18.808 -42.100 1.00 29.18 ? 612 LEU B C     1 
ATOM   3523 O O     . LEU B 1 112 ? 37.896 -19.691 -42.822 1.00 29.02 ? 612 LEU B O     1 
ATOM   3524 C CB    . LEU B 1 112 ? 36.460 -18.805 -40.454 1.00 27.31 ? 612 LEU B CB    1 
ATOM   3525 C CG    . LEU B 1 112 ? 37.089 -19.906 -39.587 1.00 27.32 ? 612 LEU B CG    1 
ATOM   3526 C CD1   . LEU B 1 112 ? 37.771 -19.285 -38.383 1.00 26.97 ? 612 LEU B CD1   1 
ATOM   3527 C CD2   . LEU B 1 112 ? 36.024 -20.895 -39.141 1.00 27.25 ? 612 LEU B CD2   1 
ATOM   3528 N N     . ARG B 1 113 ? 39.663 -18.547 -42.042 1.00 30.21 ? 613 ARG B N     1 
ATOM   3529 C CA    . ARG B 1 113 ? 40.632 -19.329 -42.814 1.00 32.08 ? 613 ARG B CA    1 
ATOM   3530 C C     . ARG B 1 113 ? 40.730 -20.745 -42.251 1.00 32.68 ? 613 ARG B C     1 
ATOM   3531 O O     . ARG B 1 113 ? 40.582 -21.730 -42.975 1.00 32.53 ? 613 ARG B O     1 
ATOM   3532 C CB    . ARG B 1 113 ? 41.991 -18.652 -42.769 1.00 32.86 ? 613 ARG B CB    1 
ATOM   3533 C CG    . ARG B 1 113 ? 42.026 -17.323 -43.483 1.00 35.08 ? 613 ARG B CG    1 
ATOM   3534 C CD    . ARG B 1 113 ? 43.458 -16.923 -43.759 1.00 37.50 ? 613 ARG B CD    1 
ATOM   3535 N NE    . ARG B 1 113 ? 43.539 -15.748 -44.616 1.00 40.17 ? 613 ARG B NE    1 
ATOM   3536 C CZ    . ARG B 1 113 ? 44.665 -15.300 -45.161 1.00 41.01 ? 613 ARG B CZ    1 
ATOM   3537 N NH1   . ARG B 1 113 ? 44.646 -14.221 -45.928 1.00 41.80 ? 613 ARG B NH1   1 
ATOM   3538 N NH2   . ARG B 1 113 ? 45.811 -15.933 -44.943 1.00 42.61 ? 613 ARG B NH2   1 
ATOM   3539 N N     . TYR B 1 114 ? 40.999 -20.840 -40.953 1.00 33.42 ? 614 TYR B N     1 
ATOM   3540 C CA    . TYR B 1 114 ? 41.063 -22.128 -40.273 1.00 34.29 ? 614 TYR B CA    1 
ATOM   3541 C C     . TYR B 1 114 ? 40.992 -21.877 -38.787 1.00 34.02 ? 614 TYR B C     1 
ATOM   3542 O O     . TYR B 1 114 ? 40.945 -20.734 -38.346 1.00 34.10 ? 614 TYR B O     1 
ATOM   3543 C CB    . TYR B 1 114 ? 42.348 -22.906 -40.599 1.00 35.30 ? 614 TYR B CB    1 
ATOM   3544 C CG    . TYR B 1 114 ? 43.453 -22.099 -41.219 1.00 36.47 ? 614 TYR B CG    1 
ATOM   3545 C CD1   . TYR B 1 114 ? 43.813 -22.289 -42.551 1.00 36.95 ? 614 TYR B CD1   1 
ATOM   3546 C CD2   . TYR B 1 114 ? 44.133 -21.139 -40.482 1.00 37.70 ? 614 TYR B CD2   1 
ATOM   3547 C CE1   . TYR B 1 114 ? 44.822 -21.539 -43.139 1.00 38.19 ? 614 TYR B CE1   1 
ATOM   3548 C CE2   . TYR B 1 114 ? 45.146 -20.378 -41.060 1.00 38.62 ? 614 TYR B CE2   1 
ATOM   3549 C CZ    . TYR B 1 114 ? 45.483 -20.582 -42.386 1.00 38.79 ? 614 TYR B CZ    1 
ATOM   3550 O OH    . TYR B 1 114 ? 46.473 -19.818 -42.958 1.00 41.01 ? 614 TYR B OH    1 
ATOM   3551 N N     . PHE B 1 115 ? 40.970 -22.952 -38.017 1.00 33.70 ? 615 PHE B N     1 
ATOM   3552 C CA    . PHE B 1 115 ? 40.915 -22.835 -36.574 1.00 33.75 ? 615 PHE B CA    1 
ATOM   3553 C C     . PHE B 1 115 ? 41.758 -23.936 -35.965 1.00 34.56 ? 615 PHE B C     1 
ATOM   3554 O O     . PHE B 1 115 ? 41.998 -24.964 -36.594 1.00 34.31 ? 615 PHE B O     1 
ATOM   3555 C CB    . PHE B 1 115 ? 39.473 -22.950 -36.084 1.00 33.07 ? 615 PHE B CB    1 
ATOM   3556 C CG    . PHE B 1 115 ? 38.811 -24.257 -36.428 1.00 33.59 ? 615 PHE B CG    1 
ATOM   3557 C CD1   . PHE B 1 115 ? 38.252 -24.460 -37.689 1.00 33.67 ? 615 PHE B CD1   1 
ATOM   3558 C CD2   . PHE B 1 115 ? 38.702 -25.269 -35.474 1.00 33.35 ? 615 PHE B CD2   1 
ATOM   3559 C CE1   . PHE B 1 115 ? 37.586 -25.653 -37.996 1.00 33.41 ? 615 PHE B CE1   1 
ATOM   3560 C CE2   . PHE B 1 115 ? 38.039 -26.464 -35.769 1.00 33.34 ? 615 PHE B CE2   1 
ATOM   3561 C CZ    . PHE B 1 115 ? 37.479 -26.653 -37.033 1.00 33.31 ? 615 PHE B CZ    1 
ATOM   3562 N N     . PHE B 1 116 ? 42.223 -23.709 -34.744 1.00 35.02 ? 616 PHE B N     1 
ATOM   3563 C CA    . PHE B 1 116 ? 43.031 -24.694 -34.053 1.00 35.86 ? 616 PHE B CA    1 
ATOM   3564 C C     . PHE B 1 116 ? 42.918 -24.475 -32.560 1.00 37.34 ? 616 PHE B C     1 
ATOM   3565 O O     . PHE B 1 116 ? 42.560 -23.389 -32.105 1.00 36.51 ? 616 PHE B O     1 
ATOM   3566 C CB    . PHE B 1 116 ? 44.498 -24.598 -34.496 1.00 34.91 ? 616 PHE B CB    1 
ATOM   3567 C CG    . PHE B 1 116 ? 45.162 -23.294 -34.148 1.00 34.58 ? 616 PHE B CG    1 
ATOM   3568 C CD1   . PHE B 1 116 ? 45.188 -22.248 -35.060 1.00 34.01 ? 616 PHE B CD1   1 
ATOM   3569 C CD2   . PHE B 1 116 ? 45.782 -23.119 -32.914 1.00 34.45 ? 616 PHE B CD2   1 
ATOM   3570 C CE1   . PHE B 1 116 ? 45.823 -21.045 -34.752 1.00 34.30 ? 616 PHE B CE1   1 
ATOM   3571 C CE2   . PHE B 1 116 ? 46.420 -21.922 -32.595 1.00 34.53 ? 616 PHE B CE2   1 
ATOM   3572 C CZ    . PHE B 1 116 ? 46.440 -20.880 -33.518 1.00 34.26 ? 616 PHE B CZ    1 
ATOM   3573 N N     . TYR B 1 117 ? 43.215 -25.519 -31.799 1.00 39.35 ? 617 TYR B N     1 
ATOM   3574 C CA    . TYR B 1 117 ? 43.155 -25.425 -30.356 1.00 41.80 ? 617 TYR B CA    1 
ATOM   3575 C C     . TYR B 1 117 ? 44.565 -25.303 -29.796 1.00 44.26 ? 617 TYR B C     1 
ATOM   3576 O O     . TYR B 1 117 ? 45.526 -25.826 -30.367 1.00 44.11 ? 617 TYR B O     1 
ATOM   3577 C CB    . TYR B 1 117 ? 42.447 -26.651 -29.784 1.00 40.98 ? 617 TYR B CB    1 
ATOM   3578 C CG    . TYR B 1 117 ? 40.999 -26.734 -30.201 1.00 40.81 ? 617 TYR B CG    1 
ATOM   3579 C CD1   . TYR B 1 117 ? 39.997 -26.166 -29.417 1.00 40.53 ? 617 TYR B CD1   1 
ATOM   3580 C CD2   . TYR B 1 117 ? 40.631 -27.355 -31.395 1.00 40.68 ? 617 TYR B CD2   1 
ATOM   3581 C CE1   . TYR B 1 117 ? 38.662 -26.212 -29.810 1.00 40.66 ? 617 TYR B CE1   1 
ATOM   3582 C CE2   . TYR B 1 117 ? 39.298 -27.407 -31.799 1.00 40.48 ? 617 TYR B CE2   1 
ATOM   3583 C CZ    . TYR B 1 117 ? 38.320 -26.835 -31.002 1.00 40.67 ? 617 TYR B CZ    1 
ATOM   3584 O OH    . TYR B 1 117 ? 37.000 -26.890 -31.386 1.00 40.67 ? 617 TYR B OH    1 
ATOM   3585 N N     . SER B 1 118 ? 44.684 -24.582 -28.688 1.00 47.10 ? 618 SER B N     1 
ATOM   3586 C CA    . SER B 1 118 ? 45.967 -24.383 -28.042 1.00 50.24 ? 618 SER B CA    1 
ATOM   3587 C C     . SER B 1 118 ? 45.772 -24.523 -26.544 1.00 53.07 ? 618 SER B C     1 
ATOM   3588 O O     . SER B 1 118 ? 44.807 -24.003 -25.978 1.00 52.74 ? 618 SER B O     1 
ATOM   3589 C CB    . SER B 1 118 ? 46.525 -22.997 -28.375 1.00 49.55 ? 618 SER B CB    1 
ATOM   3590 O OG    . SER B 1 118 ? 45.671 -21.977 -27.894 1.00 48.94 ? 618 SER B OG    1 
ATOM   3591 N N     . SER B 1 119 ? 46.686 -25.246 -25.908 1.00 56.97 ? 619 SER B N     1 
ATOM   3592 C CA    . SER B 1 119 ? 46.611 -25.465 -24.473 1.00 60.55 ? 619 SER B CA    1 
ATOM   3593 C C     . SER B 1 119 ? 47.048 -24.213 -23.735 1.00 62.93 ? 619 SER B C     1 
ATOM   3594 O O     . SER B 1 119 ? 48.195 -23.774 -23.853 1.00 63.11 ? 619 SER B O     1 
ATOM   3595 C CB    . SER B 1 119 ? 47.497 -26.648 -24.063 1.00 60.69 ? 619 SER B CB    1 
ATOM   3596 O OG    . SER B 1 119 ? 48.348 -27.054 -25.127 1.00 61.60 ? 619 SER B OG    1 
ATOM   3597 N N     . GLY B 1 120 ? 46.116 -23.625 -22.991 1.00 65.86 ? 620 GLY B N     1 
ATOM   3598 C CA    . GLY B 1 120 ? 46.436 -22.438 -22.223 1.00 69.36 ? 620 GLY B CA    1 
ATOM   3599 C C     . GLY B 1 120 ? 47.377 -22.850 -21.107 1.00 71.69 ? 620 GLY B C     1 
ATOM   3600 O O     . GLY B 1 120 ? 46.966 -23.541 -20.171 1.00 72.19 ? 620 GLY B O     1 
ATOM   3601 N N     . GLU B 1 121 ? 48.638 -22.439 -21.213 1.00 73.65 ? 621 GLU B N     1 
ATOM   3602 C CA    . GLU B 1 121 ? 49.656 -22.776 -20.220 1.00 75.54 ? 621 GLU B CA    1 
ATOM   3603 C C     . GLU B 1 121 ? 49.261 -22.357 -18.806 1.00 76.21 ? 621 GLU B C     1 
ATOM   3604 O O     . GLU B 1 121 ? 50.084 -22.394 -17.890 1.00 76.51 ? 621 GLU B O     1 
ATOM   3605 C CB    . GLU B 1 121 ? 50.993 -22.119 -20.593 1.00 76.43 ? 621 GLU B CB    1 
ATOM   3606 C CG    . GLU B 1 121 ? 51.588 -22.606 -21.913 1.00 77.92 ? 621 GLU B CG    1 
ATOM   3607 C CD    . GLU B 1 121 ? 51.849 -24.106 -21.926 1.00 78.87 ? 621 GLU B CD    1 
ATOM   3608 O OE1   . GLU B 1 121 ? 52.238 -24.657 -20.871 1.00 79.56 ? 621 GLU B OE1   1 
ATOM   3609 O OE2   . GLU B 1 121 ? 51.665 -24.733 -22.994 1.00 79.18 ? 621 GLU B OE2   1 
ATOM   3610 N N     . LYS B 1 122 ? 48.001 -21.965 -18.633 1.00 76.84 ? 622 LYS B N     1 
ATOM   3611 C CA    . LYS B 1 122 ? 47.491 -21.532 -17.337 1.00 77.18 ? 622 LYS B CA    1 
ATOM   3612 C C     . LYS B 1 122 ? 46.875 -22.672 -16.530 1.00 77.18 ? 622 LYS B C     1 
ATOM   3613 O O     . LYS B 1 122 ? 46.840 -22.615 -15.301 1.00 77.55 ? 622 LYS B O     1 
ATOM   3614 C CB    . LYS B 1 122 ? 46.449 -20.426 -17.525 1.00 77.49 ? 622 LYS B CB    1 
ATOM   3615 C CG    . LYS B 1 122 ? 47.022 -19.098 -17.995 1.00 77.77 ? 622 LYS B CG    1 
ATOM   3616 C CD    . LYS B 1 122 ? 45.934 -18.201 -18.565 1.00 78.03 ? 622 LYS B CD    1 
ATOM   3617 C CE    . LYS B 1 122 ? 46.526 -17.087 -19.418 1.00 78.22 ? 622 LYS B CE    1 
ATOM   3618 N NZ    . LYS B 1 122 ? 45.645 -15.886 -19.458 1.00 78.05 ? 622 LYS B NZ    1 
ATOM   3619 N N     . LYS B 1 123 ? 46.387 -23.701 -17.214 1.00 76.96 ? 623 LYS B N     1 
ATOM   3620 C CA    . LYS B 1 123 ? 45.774 -24.839 -16.535 1.00 76.75 ? 623 LYS B CA    1 
ATOM   3621 C C     . LYS B 1 123 ? 45.301 -25.871 -17.549 1.00 76.08 ? 623 LYS B C     1 
ATOM   3622 O O     . LYS B 1 123 ? 45.852 -25.975 -18.645 1.00 76.32 ? 623 LYS B O     1 
ATOM   3623 C CB    . LYS B 1 123 ? 44.585 -24.370 -15.692 1.00 77.55 ? 623 LYS B CB    1 
ATOM   3624 C CG    . LYS B 1 123 ? 44.352 -25.190 -14.430 1.00 78.77 ? 623 LYS B CG    1 
ATOM   3625 C CD    . LYS B 1 123 ? 43.044 -24.806 -13.748 1.00 79.60 ? 623 LYS B CD    1 
ATOM   3626 C CE    . LYS B 1 123 ? 42.476 -25.969 -12.939 1.00 80.10 ? 623 LYS B CE    1 
ATOM   3627 N NZ    . LYS B 1 123 ? 41.234 -25.595 -12.203 1.00 80.28 ? 623 LYS B NZ    1 
ATOM   3628 N N     . ASP B 1 124 ? 44.281 -26.637 -17.170 1.00 74.86 ? 624 ASP B N     1 
ATOM   3629 C CA    . ASP B 1 124 ? 43.711 -27.649 -18.054 1.00 73.36 ? 624 ASP B CA    1 
ATOM   3630 C C     . ASP B 1 124 ? 42.691 -26.958 -18.959 1.00 71.54 ? 624 ASP B C     1 
ATOM   3631 O O     . ASP B 1 124 ? 41.723 -27.571 -19.422 1.00 71.61 ? 624 ASP B O     1 
ATOM   3632 C CB    . ASP B 1 124 ? 43.030 -28.753 -17.236 1.00 74.57 ? 624 ASP B CB    1 
ATOM   3633 C CG    . ASP B 1 124 ? 42.001 -28.209 -16.255 1.00 75.72 ? 624 ASP B CG    1 
ATOM   3634 O OD1   . ASP B 1 124 ? 41.229 -29.022 -15.694 1.00 76.44 ? 624 ASP B OD1   1 
ATOM   3635 O OD2   . ASP B 1 124 ? 41.961 -26.975 -16.043 1.00 75.99 ? 624 ASP B OD2   1 
ATOM   3636 N N     . GLU B 1 125 ? 42.922 -25.670 -19.197 1.00 68.90 ? 625 GLU B N     1 
ATOM   3637 C CA    . GLU B 1 125 ? 42.050 -24.860 -20.036 1.00 66.17 ? 625 GLU B CA    1 
ATOM   3638 C C     . GLU B 1 125 ? 42.480 -24.922 -21.506 1.00 63.41 ? 625 GLU B C     1 
ATOM   3639 O O     . GLU B 1 125 ? 43.657 -24.752 -21.832 1.00 63.04 ? 625 GLU B O     1 
ATOM   3640 C CB    . GLU B 1 125 ? 42.075 -23.409 -19.553 1.00 67.35 ? 625 GLU B CB    1 
ATOM   3641 C CG    . GLU B 1 125 ? 43.465 -22.782 -19.574 1.00 69.00 ? 625 GLU B CG    1 
ATOM   3642 C CD    . GLU B 1 125 ? 43.593 -21.602 -18.627 1.00 70.17 ? 625 GLU B CD    1 
ATOM   3643 O OE1   . GLU B 1 125 ? 43.253 -21.758 -17.434 1.00 71.07 ? 625 GLU B OE1   1 
ATOM   3644 O OE2   . GLU B 1 125 ? 44.033 -20.520 -19.074 1.00 70.69 ? 625 GLU B OE2   1 
ATOM   3645 N N     . VAL B 1 126 ? 41.515 -25.172 -22.385 1.00 59.82 ? 626 VAL B N     1 
ATOM   3646 C CA    . VAL B 1 126 ? 41.779 -25.246 -23.817 1.00 55.98 ? 626 VAL B CA    1 
ATOM   3647 C C     . VAL B 1 126 ? 41.243 -23.995 -24.500 1.00 52.85 ? 626 VAL B C     1 
ATOM   3648 O O     . VAL B 1 126 ? 40.171 -23.499 -24.155 1.00 52.17 ? 626 VAL B O     1 
ATOM   3649 C CB    . VAL B 1 126 ? 41.095 -26.475 -24.459 1.00 56.48 ? 626 VAL B CB    1 
ATOM   3650 C CG1   . VAL B 1 126 ? 41.790 -26.832 -25.765 1.00 56.34 ? 626 VAL B CG1   1 
ATOM   3651 C CG2   . VAL B 1 126 ? 41.123 -27.653 -23.498 1.00 56.78 ? 626 VAL B CG2   1 
ATOM   3652 N N     . TYR B 1 127 ? 41.989 -23.493 -25.473 1.00 49.39 ? 627 TYR B N     1 
ATOM   3653 C CA    . TYR B 1 127 ? 41.573 -22.304 -26.194 1.00 46.30 ? 627 TYR B CA    1 
ATOM   3654 C C     . TYR B 1 127 ? 41.304 -22.599 -27.658 1.00 43.94 ? 627 TYR B C     1 
ATOM   3655 O O     . TYR B 1 127 ? 42.062 -23.324 -28.302 1.00 43.79 ? 627 TYR B O     1 
ATOM   3656 C CB    . TYR B 1 127 ? 42.647 -21.227 -26.105 1.00 46.68 ? 627 TYR B CB    1 
ATOM   3657 C CG    . TYR B 1 127 ? 42.728 -20.561 -24.755 1.00 47.79 ? 627 TYR B CG    1 
ATOM   3658 C CD1   . TYR B 1 127 ? 43.504 -21.108 -23.730 1.00 48.33 ? 627 TYR B CD1   1 
ATOM   3659 C CD2   . TYR B 1 127 ? 42.038 -19.380 -24.502 1.00 47.82 ? 627 TYR B CD2   1 
ATOM   3660 C CE1   . TYR B 1 127 ? 43.590 -20.491 -22.483 1.00 48.54 ? 627 TYR B CE1   1 
ATOM   3661 C CE2   . TYR B 1 127 ? 42.116 -18.756 -23.262 1.00 48.50 ? 627 TYR B CE2   1 
ATOM   3662 C CZ    . TYR B 1 127 ? 42.893 -19.314 -22.256 1.00 48.80 ? 627 TYR B CZ    1 
ATOM   3663 O OH    . TYR B 1 127 ? 42.969 -18.689 -21.030 1.00 49.33 ? 627 TYR B OH    1 
ATOM   3664 N N     . LEU B 1 128 ? 40.213 -22.042 -28.174 1.00 40.64 ? 628 LEU B N     1 
ATOM   3665 C CA    . LEU B 1 128 ? 39.871 -22.200 -29.578 1.00 37.33 ? 628 LEU B CA    1 
ATOM   3666 C C     . LEU B 1 128 ? 40.415 -20.953 -30.269 1.00 35.60 ? 628 LEU B C     1 
ATOM   3667 O O     . LEU B 1 128 ? 40.178 -19.830 -29.814 1.00 34.83 ? 628 LEU B O     1 
ATOM   3668 C CB    . LEU B 1 128 ? 38.356 -22.288 -29.763 1.00 36.80 ? 628 LEU B CB    1 
ATOM   3669 C CG    . LEU B 1 128 ? 37.840 -22.048 -31.188 1.00 36.22 ? 628 LEU B CG    1 
ATOM   3670 C CD1   . LEU B 1 128 ? 38.250 -23.203 -32.097 1.00 35.58 ? 628 LEU B CD1   1 
ATOM   3671 C CD2   . LEU B 1 128 ? 36.323 -21.898 -31.158 1.00 36.06 ? 628 LEU B CD2   1 
ATOM   3672 N N     . ASN B 1 129 ? 41.167 -21.150 -31.347 1.00 33.26 ? 629 ASN B N     1 
ATOM   3673 C CA    . ASN B 1 129 ? 41.752 -20.042 -32.092 1.00 31.34 ? 629 ASN B CA    1 
ATOM   3674 C C     . ASN B 1 129 ? 41.179 -19.973 -33.491 1.00 30.63 ? 629 ASN B C     1 
ATOM   3675 O O     . ASN B 1 129 ? 41.374 -20.887 -34.282 1.00 29.78 ? 629 ASN B O     1 
ATOM   3676 C CB    . ASN B 1 129 ? 43.264 -20.207 -32.199 1.00 30.86 ? 629 ASN B CB    1 
ATOM   3677 C CG    . ASN B 1 129 ? 43.940 -20.271 -30.849 1.00 31.35 ? 629 ASN B CG    1 
ATOM   3678 O OD1   . ASN B 1 129 ? 44.534 -19.291 -30.393 1.00 30.50 ? 629 ASN B OD1   1 
ATOM   3679 N ND2   . ASN B 1 129 ? 43.855 -21.431 -30.197 1.00 30.79 ? 629 ASN B ND2   1 
ATOM   3680 N N     . LEU B 1 130 ? 40.471 -18.889 -33.791 1.00 29.74 ? 630 LEU B N     1 
ATOM   3681 C CA    . LEU B 1 130 ? 39.891 -18.700 -35.114 1.00 28.84 ? 630 LEU B CA    1 
ATOM   3682 C C     . LEU B 1 130 ? 40.809 -17.771 -35.900 1.00 28.70 ? 630 LEU B C     1 
ATOM   3683 O O     . LEU B 1 130 ? 41.035 -16.631 -35.494 1.00 28.46 ? 630 LEU B O     1 
ATOM   3684 C CB    . LEU B 1 130 ? 38.499 -18.072 -35.014 1.00 28.72 ? 630 LEU B CB    1 
ATOM   3685 C CG    . LEU B 1 130 ? 37.501 -18.704 -34.045 1.00 28.61 ? 630 LEU B CG    1 
ATOM   3686 C CD1   . LEU B 1 130 ? 36.277 -17.809 -33.920 1.00 28.26 ? 630 LEU B CD1   1 
ATOM   3687 C CD2   . LEU B 1 130 ? 37.096 -20.077 -34.540 1.00 29.07 ? 630 LEU B CD2   1 
ATOM   3688 N N     . VAL B 1 131 ? 41.351 -18.270 -37.009 1.00 28.04 ? 631 VAL B N     1 
ATOM   3689 C CA    . VAL B 1 131 ? 42.232 -17.474 -37.857 1.00 28.27 ? 631 VAL B CA    1 
ATOM   3690 C C     . VAL B 1 131 ? 41.383 -16.813 -38.947 1.00 28.82 ? 631 VAL B C     1 
ATOM   3691 O O     . VAL B 1 131 ? 40.826 -17.490 -39.815 1.00 29.25 ? 631 VAL B O     1 
ATOM   3692 C CB    . VAL B 1 131 ? 43.321 -18.352 -38.512 1.00 28.18 ? 631 VAL B CB    1 
ATOM   3693 C CG1   . VAL B 1 131 ? 44.285 -17.482 -39.302 1.00 26.65 ? 631 VAL B CG1   1 
ATOM   3694 C CG2   . VAL B 1 131 ? 44.059 -19.143 -37.441 1.00 27.11 ? 631 VAL B CG2   1 
ATOM   3695 N N     . LEU B 1 132 ? 41.291 -15.489 -38.895 1.00 28.64 ? 632 LEU B N     1 
ATOM   3696 C CA    . LEU B 1 132 ? 40.483 -14.739 -39.847 1.00 28.64 ? 632 LEU B CA    1 
ATOM   3697 C C     . LEU B 1 132 ? 41.288 -13.839 -40.761 1.00 29.17 ? 632 LEU B C     1 
ATOM   3698 O O     . LEU B 1 132 ? 42.458 -13.545 -40.499 1.00 28.71 ? 632 LEU B O     1 
ATOM   3699 C CB    . LEU B 1 132 ? 39.483 -13.860 -39.096 1.00 28.15 ? 632 LEU B CB    1 
ATOM   3700 C CG    . LEU B 1 132 ? 38.832 -14.453 -37.855 1.00 28.05 ? 632 LEU B CG    1 
ATOM   3701 C CD1   . LEU B 1 132 ? 38.215 -13.342 -37.010 1.00 28.19 ? 632 LEU B CD1   1 
ATOM   3702 C CD2   . LEU B 1 132 ? 37.779 -15.459 -38.285 1.00 27.64 ? 632 LEU B CD2   1 
ATOM   3703 N N     . ASP B 1 133 ? 40.646 -13.398 -41.840 1.00 29.84 ? 633 ASP B N     1 
ATOM   3704 C CA    . ASP B 1 133 ? 41.283 -12.470 -42.756 1.00 30.59 ? 633 ASP B CA    1 
ATOM   3705 C C     . ASP B 1 133 ? 41.431 -11.206 -41.910 1.00 30.72 ? 633 ASP B C     1 
ATOM   3706 O O     . ASP B 1 133 ? 40.547 -10.882 -41.110 1.00 30.47 ? 633 ASP B O     1 
ATOM   3707 C CB    . ASP B 1 133 ? 40.373 -12.167 -43.945 1.00 32.03 ? 633 ASP B CB    1 
ATOM   3708 C CG    . ASP B 1 133 ? 40.505 -13.185 -45.064 1.00 33.27 ? 633 ASP B CG    1 
ATOM   3709 O OD1   . ASP B 1 133 ? 39.668 -13.151 -45.987 1.00 33.68 ? 633 ASP B OD1   1 
ATOM   3710 O OD2   . ASP B 1 133 ? 41.438 -14.014 -45.022 1.00 34.91 ? 633 ASP B OD2   1 
ATOM   3711 N N     . TYR B 1 134 ? 42.541 -10.500 -42.073 1.00 30.80 ? 634 TYR B N     1 
ATOM   3712 C CA    . TYR B 1 134 ? 42.767 -9.276  -41.318 1.00 30.70 ? 634 TYR B CA    1 
ATOM   3713 C C     . TYR B 1 134 ? 42.203 -8.079  -42.086 1.00 30.09 ? 634 TYR B C     1 
ATOM   3714 O O     . TYR B 1 134 ? 42.429 -7.950  -43.283 1.00 30.17 ? 634 TYR B O     1 
ATOM   3715 C CB    . TYR B 1 134 ? 44.268 -9.078  -41.077 1.00 31.52 ? 634 TYR B CB    1 
ATOM   3716 C CG    . TYR B 1 134 ? 44.611 -7.726  -40.493 1.00 32.67 ? 634 TYR B CG    1 
ATOM   3717 C CD1   . TYR B 1 134 ? 45.031 -6.680  -41.312 1.00 32.80 ? 634 TYR B CD1   1 
ATOM   3718 C CD2   . TYR B 1 134 ? 44.467 -7.478  -39.127 1.00 32.89 ? 634 TYR B CD2   1 
ATOM   3719 C CE1   . TYR B 1 134 ? 45.295 -5.419  -40.787 1.00 33.38 ? 634 TYR B CE1   1 
ATOM   3720 C CE2   . TYR B 1 134 ? 44.727 -6.220  -38.592 1.00 33.41 ? 634 TYR B CE2   1 
ATOM   3721 C CZ    . TYR B 1 134 ? 45.138 -5.196  -39.430 1.00 33.52 ? 634 TYR B CZ    1 
ATOM   3722 O OH    . TYR B 1 134 ? 45.382 -3.943  -38.913 1.00 34.89 ? 634 TYR B OH    1 
ATOM   3723 N N     . VAL B 1 135 ? 41.440 -7.229  -41.401 1.00 28.90 ? 635 VAL B N     1 
ATOM   3724 C CA    . VAL B 1 135 ? 40.875 -6.020  -42.006 1.00 27.92 ? 635 VAL B CA    1 
ATOM   3725 C C     . VAL B 1 135 ? 41.408 -4.902  -41.105 1.00 27.76 ? 635 VAL B C     1 
ATOM   3726 O O     . VAL B 1 135 ? 41.261 -4.953  -39.888 1.00 27.13 ? 635 VAL B O     1 
ATOM   3727 C CB    . VAL B 1 135 ? 39.333 -6.052  -42.019 1.00 27.40 ? 635 VAL B CB    1 
ATOM   3728 C CG1   . VAL B 1 135 ? 38.797 -4.897  -42.846 1.00 26.60 ? 635 VAL B CG1   1 
ATOM   3729 C CG2   . VAL B 1 135 ? 38.854 -7.368  -42.614 1.00 27.29 ? 635 VAL B CG2   1 
ATOM   3730 N N     . PRO B 1 136 ? 42.008 -3.859  -41.701 1.00 27.92 ? 636 PRO B N     1 
ATOM   3731 C CA    . PRO B 1 136 ? 42.608 -2.718  -40.992 1.00 27.88 ? 636 PRO B CA    1 
ATOM   3732 C C     . PRO B 1 136 ? 41.790 -1.740  -40.154 1.00 27.70 ? 636 PRO B C     1 
ATOM   3733 O O     . PRO B 1 136 ? 42.299 -1.201  -39.163 1.00 27.99 ? 636 PRO B O     1 
ATOM   3734 C CB    . PRO B 1 136 ? 43.376 -1.989  -42.095 1.00 28.22 ? 636 PRO B CB    1 
ATOM   3735 C CG    . PRO B 1 136 ? 42.577 -2.269  -43.323 1.00 28.42 ? 636 PRO B CG    1 
ATOM   3736 C CD    . PRO B 1 136 ? 42.082 -3.684  -43.165 1.00 28.24 ? 636 PRO B CD    1 
ATOM   3737 N N     . GLU B 1 137 ? 40.545 -1.493  -40.536 1.00 27.10 ? 637 GLU B N     1 
ATOM   3738 C CA    . GLU B 1 137 ? 39.738 -0.533  -39.804 1.00 26.85 ? 637 GLU B CA    1 
ATOM   3739 C C     . GLU B 1 137 ? 38.385 -1.057  -39.375 1.00 25.43 ? 637 GLU B C     1 
ATOM   3740 O O     . GLU B 1 137 ? 38.014 -2.198  -39.657 1.00 24.25 ? 637 GLU B O     1 
ATOM   3741 C CB    . GLU B 1 137 ? 39.513 0.711   -40.664 1.00 29.28 ? 637 GLU B CB    1 
ATOM   3742 C CG    . GLU B 1 137 ? 40.701 1.627   -40.741 1.00 33.78 ? 637 GLU B CG    1 
ATOM   3743 C CD    . GLU B 1 137 ? 40.866 2.459   -39.493 1.00 36.30 ? 637 GLU B CD    1 
ATOM   3744 O OE1   . GLU B 1 137 ? 41.827 3.252   -39.440 1.00 39.33 ? 637 GLU B OE1   1 
ATOM   3745 O OE2   . GLU B 1 137 ? 40.037 2.329   -38.565 1.00 37.41 ? 637 GLU B OE2   1 
ATOM   3746 N N     . THR B 1 138 ? 37.657 -0.195  -38.677 1.00 24.14 ? 638 THR B N     1 
ATOM   3747 C CA    . THR B 1 138 ? 36.314 -0.497  -38.226 1.00 23.45 ? 638 THR B CA    1 
ATOM   3748 C C     . THR B 1 138 ? 35.496 0.771   -38.448 1.00 23.65 ? 638 THR B C     1 
ATOM   3749 O O     . THR B 1 138 ? 36.040 1.883   -38.444 1.00 23.22 ? 638 THR B O     1 
ATOM   3750 C CB    . THR B 1 138 ? 36.253 -0.859  -36.719 1.00 23.55 ? 638 THR B CB    1 
ATOM   3751 O OG1   . THR B 1 138 ? 36.649 0.273   -35.936 1.00 23.46 ? 638 THR B OG1   1 
ATOM   3752 C CG2   . THR B 1 138 ? 37.148 -2.042  -36.407 1.00 22.39 ? 638 THR B CG2   1 
ATOM   3753 N N     . VAL B 1 139 ? 34.197 0.605   -38.660 1.00 22.53 ? 639 VAL B N     1 
ATOM   3754 C CA    . VAL B 1 139 ? 33.327 1.749   -38.844 1.00 22.83 ? 639 VAL B CA    1 
ATOM   3755 C C     . VAL B 1 139 ? 33.454 2.634   -37.596 1.00 23.56 ? 639 VAL B C     1 
ATOM   3756 O O     . VAL B 1 139 ? 33.424 3.861   -37.688 1.00 23.64 ? 639 VAL B O     1 
ATOM   3757 C CB    . VAL B 1 139 ? 31.850 1.291   -39.035 1.00 22.69 ? 639 VAL B CB    1 
ATOM   3758 C CG1   . VAL B 1 139 ? 30.889 2.456   -38.818 1.00 22.81 ? 639 VAL B CG1   1 
ATOM   3759 C CG2   . VAL B 1 139 ? 31.671 0.723   -40.443 1.00 22.27 ? 639 VAL B CG2   1 
ATOM   3760 N N     . TYR B 1 140 ? 33.612 2.005   -36.436 1.00 23.72 ? 640 TYR B N     1 
ATOM   3761 C CA    . TYR B 1 140 ? 33.739 2.740   -35.184 1.00 25.46 ? 640 TYR B CA    1 
ATOM   3762 C C     . TYR B 1 140 ? 34.902 3.736   -35.198 1.00 26.28 ? 640 TYR B C     1 
ATOM   3763 O O     . TYR B 1 140 ? 34.729 4.915   -34.880 1.00 24.65 ? 640 TYR B O     1 
ATOM   3764 C CB    . TYR B 1 140 ? 33.930 1.770   -34.022 1.00 25.98 ? 640 TYR B CB    1 
ATOM   3765 C CG    . TYR B 1 140 ? 34.191 2.459   -32.704 1.00 28.08 ? 640 TYR B CG    1 
ATOM   3766 C CD1   . TYR B 1 140 ? 35.491 2.620   -32.226 1.00 29.48 ? 640 TYR B CD1   1 
ATOM   3767 C CD2   . TYR B 1 140 ? 33.138 2.953   -31.933 1.00 28.99 ? 640 TYR B CD2   1 
ATOM   3768 C CE1   . TYR B 1 140 ? 35.739 3.259   -31.007 1.00 30.66 ? 640 TYR B CE1   1 
ATOM   3769 C CE2   . TYR B 1 140 ? 33.370 3.591   -30.717 1.00 30.14 ? 640 TYR B CE2   1 
ATOM   3770 C CZ    . TYR B 1 140 ? 34.673 3.741   -30.260 1.00 31.07 ? 640 TYR B CZ    1 
ATOM   3771 O OH    . TYR B 1 140 ? 34.912 4.369   -29.057 1.00 32.57 ? 640 TYR B OH    1 
ATOM   3772 N N     . ARG B 1 141 ? 36.084 3.256   -35.569 1.00 27.12 ? 641 ARG B N     1 
ATOM   3773 C CA    . ARG B 1 141 ? 37.272 4.106   -35.603 1.00 29.00 ? 641 ARG B CA    1 
ATOM   3774 C C     . ARG B 1 141 ? 37.173 5.193   -36.656 1.00 28.46 ? 641 ARG B C     1 
ATOM   3775 O O     . ARG B 1 141 ? 37.546 6.334   -36.411 1.00 27.65 ? 641 ARG B O     1 
ATOM   3776 C CB    . ARG B 1 141 ? 38.522 3.260   -35.849 1.00 31.65 ? 641 ARG B CB    1 
ATOM   3777 C CG    . ARG B 1 141 ? 38.950 2.452   -34.632 1.00 36.26 ? 641 ARG B CG    1 
ATOM   3778 C CD    . ARG B 1 141 ? 40.182 1.604   -34.933 1.00 40.32 ? 641 ARG B CD    1 
ATOM   3779 N NE    . ARG B 1 141 ? 41.190 2.343   -35.698 1.00 43.78 ? 641 ARG B NE    1 
ATOM   3780 C CZ    . ARG B 1 141 ? 42.315 1.808   -36.170 1.00 45.41 ? 641 ARG B CZ    1 
ATOM   3781 N NH1   . ARG B 1 141 ? 42.582 0.525   -35.958 1.00 46.58 ? 641 ARG B NH1   1 
ATOM   3782 N NH2   . ARG B 1 141 ? 43.178 2.558   -36.848 1.00 46.21 ? 641 ARG B NH2   1 
ATOM   3783 N N     . VAL B 1 142 ? 36.661 4.840   -37.828 1.00 27.82 ? 642 VAL B N     1 
ATOM   3784 C CA    . VAL B 1 142 ? 36.520 5.804   -38.901 1.00 27.95 ? 642 VAL B CA    1 
ATOM   3785 C C     . VAL B 1 142 ? 35.550 6.901   -38.494 1.00 28.25 ? 642 VAL B C     1 
ATOM   3786 O O     . VAL B 1 142 ? 35.860 8.082   -38.623 1.00 28.01 ? 642 VAL B O     1 
ATOM   3787 C CB    . VAL B 1 142 ? 36.014 5.126   -40.187 1.00 28.04 ? 642 VAL B CB    1 
ATOM   3788 C CG1   . VAL B 1 142 ? 35.531 6.176   -41.192 1.00 28.11 ? 642 VAL B CG1   1 
ATOM   3789 C CG2   . VAL B 1 142 ? 37.130 4.269   -40.781 1.00 28.13 ? 642 VAL B CG2   1 
ATOM   3790 N N     . ALA B 1 143 ? 34.382 6.512   -37.991 1.00 28.18 ? 643 ALA B N     1 
ATOM   3791 C CA    . ALA B 1 143 ? 33.381 7.485   -37.579 1.00 29.65 ? 643 ALA B CA    1 
ATOM   3792 C C     . ALA B 1 143 ? 33.913 8.419   -36.490 1.00 30.71 ? 643 ALA B C     1 
ATOM   3793 O O     . ALA B 1 143 ? 33.579 9.602   -36.464 1.00 31.25 ? 643 ALA B O     1 
ATOM   3794 C CB    . ALA B 1 143 ? 32.119 6.770   -37.089 1.00 29.08 ? 643 ALA B CB    1 
ATOM   3795 N N     . ARG B 1 144 ? 34.735 7.881   -35.594 1.00 32.08 ? 644 ARG B N     1 
ATOM   3796 C CA    . ARG B 1 144 ? 35.313 8.661   -34.507 1.00 34.44 ? 644 ARG B CA    1 
ATOM   3797 C C     . ARG B 1 144 ? 36.320 9.685   -35.041 1.00 35.13 ? 644 ARG B C     1 
ATOM   3798 O O     . ARG B 1 144 ? 36.433 10.782  -34.509 1.00 35.00 ? 644 ARG B O     1 
ATOM   3799 C CB    . ARG B 1 144 ? 35.988 7.720   -33.503 1.00 36.24 ? 644 ARG B CB    1 
ATOM   3800 C CG    . ARG B 1 144 ? 36.404 8.372   -32.195 1.00 39.38 ? 644 ARG B CG    1 
ATOM   3801 C CD    . ARG B 1 144 ? 37.226 7.409   -31.334 1.00 42.64 ? 644 ARG B CD    1 
ATOM   3802 N NE    . ARG B 1 144 ? 38.225 6.680   -32.119 1.00 45.66 ? 644 ARG B NE    1 
ATOM   3803 C CZ    . ARG B 1 144 ? 39.028 5.734   -31.629 1.00 47.22 ? 644 ARG B CZ    1 
ATOM   3804 N NH1   . ARG B 1 144 ? 38.956 5.391   -30.346 1.00 48.12 ? 644 ARG B NH1   1 
ATOM   3805 N NH2   . ARG B 1 144 ? 39.909 5.134   -32.423 1.00 47.91 ? 644 ARG B NH2   1 
ATOM   3806 N N     . HIS B 1 145 ? 37.052 9.321   -36.089 1.00 36.48 ? 645 HIS B N     1 
ATOM   3807 C CA    . HIS B 1 145 ? 38.029 10.226  -36.693 1.00 37.77 ? 645 HIS B CA    1 
ATOM   3808 C C     . HIS B 1 145 ? 37.313 11.468  -37.216 1.00 37.83 ? 645 HIS B C     1 
ATOM   3809 O O     . HIS B 1 145 ? 37.766 12.591  -37.010 1.00 37.53 ? 645 HIS B O     1 
ATOM   3810 C CB    . HIS B 1 145 ? 38.757 9.539   -37.853 1.00 39.68 ? 645 HIS B CB    1 
ATOM   3811 C CG    . HIS B 1 145 ? 39.865 8.626   -37.423 1.00 42.92 ? 645 HIS B CG    1 
ATOM   3812 N ND1   . HIS B 1 145 ? 40.217 7.495   -38.132 1.00 44.44 ? 645 HIS B ND1   1 
ATOM   3813 C CD2   . HIS B 1 145 ? 40.704 8.678   -36.359 1.00 44.11 ? 645 HIS B CD2   1 
ATOM   3814 C CE1   . HIS B 1 145 ? 41.225 6.891   -37.526 1.00 44.75 ? 645 HIS B CE1   1 
ATOM   3815 N NE2   . HIS B 1 145 ? 41.539 7.589   -36.447 1.00 44.86 ? 645 HIS B NE2   1 
ATOM   3816 N N     . TYR B 1 146 ? 36.189 11.261  -37.894 1.00 37.51 ? 646 TYR B N     1 
ATOM   3817 C CA    . TYR B 1 146 ? 35.417 12.370  -38.438 1.00 37.79 ? 646 TYR B CA    1 
ATOM   3818 C C     . TYR B 1 146 ? 34.715 13.143  -37.336 1.00 39.21 ? 646 TYR B C     1 
ATOM   3819 O O     . TYR B 1 146 ? 34.633 14.366  -37.379 1.00 39.65 ? 646 TYR B O     1 
ATOM   3820 C CB    . TYR B 1 146 ? 34.373 11.862  -39.433 1.00 35.52 ? 646 TYR B CB    1 
ATOM   3821 C CG    . TYR B 1 146 ? 34.938 11.527  -40.791 1.00 33.22 ? 646 TYR B CG    1 
ATOM   3822 C CD1   . TYR B 1 146 ? 35.559 10.303  -41.022 1.00 32.24 ? 646 TYR B CD1   1 
ATOM   3823 C CD2   . TYR B 1 146 ? 34.860 12.437  -41.845 1.00 32.59 ? 646 TYR B CD2   1 
ATOM   3824 C CE1   . TYR B 1 146 ? 36.092 9.991   -42.265 1.00 31.14 ? 646 TYR B CE1   1 
ATOM   3825 C CE2   . TYR B 1 146 ? 35.388 12.137  -43.094 1.00 31.41 ? 646 TYR B CE2   1 
ATOM   3826 C CZ    . TYR B 1 146 ? 36.004 10.911  -43.294 1.00 31.30 ? 646 TYR B CZ    1 
ATOM   3827 O OH    . TYR B 1 146 ? 36.544 10.610  -44.517 1.00 30.89 ? 646 TYR B OH    1 
ATOM   3828 N N     . SER B 1 147 ? 34.200 12.428  -36.348 1.00 41.01 ? 647 SER B N     1 
ATOM   3829 C CA    . SER B 1 147 ? 33.501 13.075  -35.254 1.00 43.62 ? 647 SER B CA    1 
ATOM   3830 C C     . SER B 1 147 ? 34.438 14.018  -34.517 1.00 45.22 ? 647 SER B C     1 
ATOM   3831 O O     . SER B 1 147 ? 34.086 15.162  -34.225 1.00 45.33 ? 647 SER B O     1 
ATOM   3832 C CB    . SER B 1 147 ? 32.955 12.029  -34.286 1.00 44.35 ? 647 SER B CB    1 
ATOM   3833 O OG    . SER B 1 147 ? 31.654 12.391  -33.857 1.00 46.43 ? 647 SER B OG    1 
ATOM   3834 N N     . ARG B 1 148 ? 35.634 13.529  -34.216 1.00 46.94 ? 648 ARG B N     1 
ATOM   3835 C CA    . ARG B 1 148 ? 36.621 14.338  -33.522 1.00 48.89 ? 648 ARG B CA    1 
ATOM   3836 C C     . ARG B 1 148 ? 36.868 15.613  -34.317 1.00 49.37 ? 648 ARG B C     1 
ATOM   3837 O O     . ARG B 1 148 ? 36.768 16.714  -33.780 1.00 49.90 ? 648 ARG B O     1 
ATOM   3838 C CB    . ARG B 1 148 ? 37.922 13.555  -33.357 1.00 50.14 ? 648 ARG B CB    1 
ATOM   3839 C CG    . ARG B 1 148 ? 37.883 12.541  -32.224 1.00 52.59 ? 648 ARG B CG    1 
ATOM   3840 C CD    . ARG B 1 148 ? 39.242 11.888  -32.034 1.00 55.33 ? 648 ARG B CD    1 
ATOM   3841 N NE    . ARG B 1 148 ? 39.177 10.724  -31.154 1.00 58.17 ? 648 ARG B NE    1 
ATOM   3842 C CZ    . ARG B 1 148 ? 40.246 10.064  -30.708 1.00 59.91 ? 648 ARG B CZ    1 
ATOM   3843 N NH1   . ARG B 1 148 ? 41.466 10.456  -31.062 1.00 60.75 ? 648 ARG B NH1   1 
ATOM   3844 N NH2   . ARG B 1 148 ? 40.100 9.013   -29.905 1.00 60.21 ? 648 ARG B NH2   1 
ATOM   3845 N N     . ALA B 1 149 ? 37.175 15.461  -35.602 1.00 49.73 ? 649 ALA B N     1 
ATOM   3846 C CA    . ALA B 1 149 ? 37.427 16.605  -36.477 1.00 50.12 ? 649 ALA B CA    1 
ATOM   3847 C C     . ALA B 1 149 ? 36.147 17.397  -36.728 1.00 50.15 ? 649 ALA B C     1 
ATOM   3848 O O     . ALA B 1 149 ? 36.118 18.300  -37.561 1.00 50.16 ? 649 ALA B O     1 
ATOM   3849 C CB    . ALA B 1 149 ? 38.018 16.132  -37.807 1.00 49.72 ? 649 ALA B CB    1 
ATOM   3850 N N     . LYS B 1 150 ? 35.092 17.056  -35.999 1.00 50.81 ? 650 LYS B N     1 
ATOM   3851 C CA    . LYS B 1 150 ? 33.804 17.724  -36.141 1.00 51.61 ? 650 LYS B CA    1 
ATOM   3852 C C     . LYS B 1 150 ? 33.345 17.753  -37.597 1.00 51.33 ? 650 LYS B C     1 
ATOM   3853 O O     . LYS B 1 150 ? 32.718 18.715  -38.049 1.00 51.46 ? 650 LYS B O     1 
ATOM   3854 C CB    . LYS B 1 150 ? 33.873 19.149  -35.580 1.00 52.95 ? 650 LYS B CB    1 
ATOM   3855 C CG    . LYS B 1 150 ? 33.447 19.250  -34.116 1.00 54.54 ? 650 LYS B CG    1 
ATOM   3856 C CD    . LYS B 1 150 ? 33.178 20.692  -33.692 1.00 56.04 ? 650 LYS B CD    1 
ATOM   3857 C CE    . LYS B 1 150 ? 33.253 20.846  -32.170 1.00 57.43 ? 650 LYS B CE    1 
ATOM   3858 N NZ    . LYS B 1 150 ? 32.747 22.171  -31.683 1.00 57.71 ? 650 LYS B NZ    1 
ATOM   3859 N N     . GLN B 1 151 ? 33.676 16.690  -38.326 1.00 50.58 ? 651 GLN B N     1 
ATOM   3860 C CA    . GLN B 1 151 ? 33.281 16.545  -39.722 1.00 49.40 ? 651 GLN B CA    1 
ATOM   3861 C C     . GLN B 1 151 ? 32.358 15.339  -39.805 1.00 47.96 ? 651 GLN B C     1 
ATOM   3862 O O     . GLN B 1 151 ? 32.166 14.620  -38.824 1.00 47.93 ? 651 GLN B O     1 
ATOM   3863 C CB    . GLN B 1 151 ? 34.495 16.300  -40.617 1.00 50.22 ? 651 GLN B CB    1 
ATOM   3864 C CG    . GLN B 1 151 ? 35.711 17.127  -40.274 1.00 51.84 ? 651 GLN B CG    1 
ATOM   3865 C CD    . GLN B 1 151 ? 36.864 16.877  -41.228 1.00 53.24 ? 651 GLN B CD    1 
ATOM   3866 O OE1   . GLN B 1 151 ? 36.751 16.082  -42.164 1.00 53.83 ? 651 GLN B OE1   1 
ATOM   3867 N NE2   . GLN B 1 151 ? 37.983 17.559  -40.997 1.00 53.84 ? 651 GLN B NE2   1 
ATOM   3868 N N     . THR B 1 152 ? 31.788 15.119  -40.981 1.00 46.33 ? 652 THR B N     1 
ATOM   3869 C CA    . THR B 1 152 ? 30.892 13.990  -41.186 1.00 44.29 ? 652 THR B CA    1 
ATOM   3870 C C     . THR B 1 152 ? 31.392 13.171  -42.378 1.00 41.78 ? 652 THR B C     1 
ATOM   3871 O O     . THR B 1 152 ? 31.971 13.707  -43.320 1.00 41.15 ? 652 THR B O     1 
ATOM   3872 C CB    . THR B 1 152 ? 29.433 14.481  -41.413 1.00 45.01 ? 652 THR B CB    1 
ATOM   3873 O OG1   . THR B 1 152 ? 28.601 13.999  -40.350 1.00 46.24 ? 652 THR B OG1   1 
ATOM   3874 C CG2   . THR B 1 152 ? 28.888 13.997  -42.749 1.00 45.89 ? 652 THR B CG2   1 
ATOM   3875 N N     . LEU B 1 153 ? 31.183 11.866  -42.321 1.00 38.90 ? 653 LEU B N     1 
ATOM   3876 C CA    . LEU B 1 153 ? 31.619 10.987  -43.394 1.00 35.93 ? 653 LEU B CA    1 
ATOM   3877 C C     . LEU B 1 153 ? 30.841 11.294  -44.675 1.00 34.24 ? 653 LEU B C     1 
ATOM   3878 O O     . LEU B 1 153 ? 29.624 11.451  -44.638 1.00 33.96 ? 653 LEU B O     1 
ATOM   3879 C CB    . LEU B 1 153 ? 31.385 9.539   -42.966 1.00 35.23 ? 653 LEU B CB    1 
ATOM   3880 C CG    . LEU B 1 153 ? 31.903 8.390   -43.819 1.00 34.09 ? 653 LEU B CG    1 
ATOM   3881 C CD1   . LEU B 1 153 ? 33.414 8.309   -43.752 1.00 33.69 ? 653 LEU B CD1   1 
ATOM   3882 C CD2   . LEU B 1 153 ? 31.274 7.109   -43.305 1.00 34.01 ? 653 LEU B CD2   1 
ATOM   3883 N N     . PRO B 1 154 ? 31.539 11.423  -45.818 1.00 32.56 ? 654 PRO B N     1 
ATOM   3884 C CA    . PRO B 1 154 ? 30.826 11.706  -47.073 1.00 31.67 ? 654 PRO B CA    1 
ATOM   3885 C C     . PRO B 1 154 ? 29.732 10.656  -47.278 1.00 30.98 ? 654 PRO B C     1 
ATOM   3886 O O     . PRO B 1 154 ? 29.948 9.463   -47.052 1.00 30.41 ? 654 PRO B O     1 
ATOM   3887 C CB    . PRO B 1 154 ? 31.911 11.616  -48.149 1.00 31.10 ? 654 PRO B CB    1 
ATOM   3888 C CG    . PRO B 1 154 ? 33.197 11.843  -47.419 1.00 31.73 ? 654 PRO B CG    1 
ATOM   3889 C CD    . PRO B 1 154 ? 32.997 11.339  -46.009 1.00 32.34 ? 654 PRO B CD    1 
ATOM   3890 N N     . VAL B 1 155 ? 28.566 11.103  -47.718 1.00 29.67 ? 655 VAL B N     1 
ATOM   3891 C CA    . VAL B 1 155 ? 27.438 10.211  -47.911 1.00 28.86 ? 655 VAL B CA    1 
ATOM   3892 C C     . VAL B 1 155 ? 27.715 9.006   -48.808 1.00 27.97 ? 655 VAL B C     1 
ATOM   3893 O O     . VAL B 1 155 ? 27.140 7.943   -48.598 1.00 28.02 ? 655 VAL B O     1 
ATOM   3894 C CB    . VAL B 1 155 ? 26.217 11.003  -48.425 1.00 29.43 ? 655 VAL B CB    1 
ATOM   3895 C CG1   . VAL B 1 155 ? 24.982 10.108  -48.457 1.00 30.52 ? 655 VAL B CG1   1 
ATOM   3896 C CG2   . VAL B 1 155 ? 25.967 12.191  -47.499 1.00 29.93 ? 655 VAL B CG2   1 
ATOM   3897 N N     . ILE B 1 156 ? 28.596 9.146   -49.795 1.00 26.62 ? 656 ILE B N     1 
ATOM   3898 C CA    . ILE B 1 156 ? 28.882 8.008   -50.664 1.00 24.93 ? 656 ILE B CA    1 
ATOM   3899 C C     . ILE B 1 156 ? 29.410 6.825   -49.846 1.00 23.93 ? 656 ILE B C     1 
ATOM   3900 O O     . ILE B 1 156 ? 29.096 5.674   -50.139 1.00 23.06 ? 656 ILE B O     1 
ATOM   3901 C CB    . ILE B 1 156 ? 29.905 8.367   -51.771 1.00 25.01 ? 656 ILE B CB    1 
ATOM   3902 C CG1   . ILE B 1 156 ? 30.095 7.169   -52.706 1.00 24.40 ? 656 ILE B CG1   1 
ATOM   3903 C CG2   . ILE B 1 156 ? 31.233 8.776   -51.154 1.00 25.16 ? 656 ILE B CG2   1 
ATOM   3904 C CD1   . ILE B 1 156 ? 28.823 6.732   -53.418 1.00 24.74 ? 656 ILE B CD1   1 
ATOM   3905 N N     . TYR B 1 157 ? 30.204 7.108   -48.819 1.00 23.11 ? 657 TYR B N     1 
ATOM   3906 C CA    . TYR B 1 157 ? 30.741 6.045   -47.967 1.00 22.95 ? 657 TYR B CA    1 
ATOM   3907 C C     . TYR B 1 157 ? 29.631 5.481   -47.083 1.00 22.14 ? 657 TYR B C     1 
ATOM   3908 O O     . TYR B 1 157 ? 29.571 4.276   -46.842 1.00 21.17 ? 657 TYR B O     1 
ATOM   3909 C CB    . TYR B 1 157 ? 31.886 6.582   -47.109 1.00 24.32 ? 657 TYR B CB    1 
ATOM   3910 C CG    . TYR B 1 157 ? 33.139 6.814   -47.917 1.00 27.37 ? 657 TYR B CG    1 
ATOM   3911 C CD1   . TYR B 1 157 ? 33.670 8.097   -48.068 1.00 28.12 ? 657 TYR B CD1   1 
ATOM   3912 C CD2   . TYR B 1 157 ? 33.780 5.751   -48.563 1.00 27.72 ? 657 TYR B CD2   1 
ATOM   3913 C CE1   . TYR B 1 157 ? 34.815 8.316   -48.846 1.00 29.77 ? 657 TYR B CE1   1 
ATOM   3914 C CE2   . TYR B 1 157 ? 34.921 5.958   -49.341 1.00 29.17 ? 657 TYR B CE2   1 
ATOM   3915 C CZ    . TYR B 1 157 ? 35.431 7.241   -49.475 1.00 30.12 ? 657 TYR B CZ    1 
ATOM   3916 O OH    . TYR B 1 157 ? 36.572 7.444   -50.223 1.00 33.01 ? 657 TYR B OH    1 
ATOM   3917 N N     . VAL B 1 158 ? 28.756 6.361   -46.602 1.00 21.25 ? 658 VAL B N     1 
ATOM   3918 C CA    . VAL B 1 158 ? 27.636 5.940   -45.774 1.00 21.00 ? 658 VAL B CA    1 
ATOM   3919 C C     . VAL B 1 158 ? 26.794 4.956   -46.584 1.00 20.90 ? 658 VAL B C     1 
ATOM   3920 O O     . VAL B 1 158 ? 26.372 3.913   -46.080 1.00 20.00 ? 658 VAL B O     1 
ATOM   3921 C CB    . VAL B 1 158 ? 26.748 7.140   -45.373 1.00 21.04 ? 658 VAL B CB    1 
ATOM   3922 C CG1   . VAL B 1 158 ? 25.506 6.646   -44.623 1.00 21.32 ? 658 VAL B CG1   1 
ATOM   3923 C CG2   . VAL B 1 158 ? 27.548 8.121   -44.503 1.00 20.36 ? 658 VAL B CG2   1 
ATOM   3924 N N     . LYS B 1 159 ? 26.547 5.299   -47.845 1.00 20.31 ? 659 LYS B N     1 
ATOM   3925 C CA    . LYS B 1 159 ? 25.763 4.445   -48.731 1.00 20.13 ? 659 LYS B CA    1 
ATOM   3926 C C     . LYS B 1 159 ? 26.466 3.104   -48.935 1.00 20.03 ? 659 LYS B C     1 
ATOM   3927 O O     . LYS B 1 159 ? 25.866 2.042   -48.779 1.00 19.79 ? 659 LYS B O     1 
ATOM   3928 C CB    . LYS B 1 159 ? 25.570 5.127   -50.088 1.00 20.85 ? 659 LYS B CB    1 
ATOM   3929 C CG    . LYS B 1 159 ? 24.415 6.101   -50.138 1.00 21.64 ? 659 LYS B CG    1 
ATOM   3930 C CD    . LYS B 1 159 ? 24.333 6.765   -51.495 1.00 23.05 ? 659 LYS B CD    1 
ATOM   3931 C CE    . LYS B 1 159 ? 23.695 8.133   -51.376 1.00 23.69 ? 659 LYS B CE    1 
ATOM   3932 N NZ    . LYS B 1 159 ? 23.365 8.685   -52.718 1.00 25.59 ? 659 LYS B NZ    1 
ATOM   3933 N N     . LEU B 1 160 ? 27.748 3.153   -49.274 1.00 19.91 ? 660 LEU B N     1 
ATOM   3934 C CA    . LEU B 1 160 ? 28.510 1.929   -49.502 1.00 19.79 ? 660 LEU B CA    1 
ATOM   3935 C C     . LEU B 1 160 ? 28.599 1.007   -48.282 1.00 19.08 ? 660 LEU B C     1 
ATOM   3936 O O     . LEU B 1 160 ? 28.420 -0.200  -48.401 1.00 17.82 ? 660 LEU B O     1 
ATOM   3937 C CB    . LEU B 1 160 ? 29.927 2.267   -49.970 1.00 20.50 ? 660 LEU B CB    1 
ATOM   3938 C CG    . LEU B 1 160 ? 30.123 2.525   -51.466 1.00 21.52 ? 660 LEU B CG    1 
ATOM   3939 C CD1   . LEU B 1 160 ? 31.504 3.180   -51.672 1.00 22.17 ? 660 LEU B CD1   1 
ATOM   3940 C CD2   . LEU B 1 160 ? 30.018 1.220   -52.253 1.00 20.67 ? 660 LEU B CD2   1 
ATOM   3941 N N     . TYR B 1 161 ? 28.901 1.570   -47.116 1.00 18.79 ? 661 TYR B N     1 
ATOM   3942 C CA    . TYR B 1 161 ? 29.024 0.765   -45.903 1.00 18.63 ? 661 TYR B CA    1 
ATOM   3943 C C     . TYR B 1 161 ? 27.696 0.152   -45.485 1.00 18.11 ? 661 TYR B C     1 
ATOM   3944 O O     . TYR B 1 161 ? 27.624 -1.043  -45.193 1.00 17.63 ? 661 TYR B O     1 
ATOM   3945 C CB    . TYR B 1 161 ? 29.566 1.610   -44.741 1.00 19.89 ? 661 TYR B CB    1 
ATOM   3946 C CG    . TYR B 1 161 ? 30.953 2.164   -44.968 1.00 21.90 ? 661 TYR B CG    1 
ATOM   3947 C CD1   . TYR B 1 161 ? 31.782 1.637   -45.955 1.00 23.78 ? 661 TYR B CD1   1 
ATOM   3948 C CD2   . TYR B 1 161 ? 31.429 3.234   -44.206 1.00 24.25 ? 661 TYR B CD2   1 
ATOM   3949 C CE1   . TYR B 1 161 ? 33.055 2.157   -46.186 1.00 26.21 ? 661 TYR B CE1   1 
ATOM   3950 C CE2   . TYR B 1 161 ? 32.703 3.765   -44.428 1.00 25.48 ? 661 TYR B CE2   1 
ATOM   3951 C CZ    . TYR B 1 161 ? 33.507 3.219   -45.420 1.00 26.66 ? 661 TYR B CZ    1 
ATOM   3952 O OH    . TYR B 1 161 ? 34.769 3.724   -45.655 1.00 29.89 ? 661 TYR B OH    1 
ATOM   3953 N N     . MET B 1 162 ? 26.650 0.969   -45.449 1.00 16.98 ? 662 MET B N     1 
ATOM   3954 C CA    . MET B 1 162 ? 25.338 0.481   -45.036 1.00 17.60 ? 662 MET B CA    1 
ATOM   3955 C C     . MET B 1 162 ? 24.793 -0.563  -46.012 1.00 16.99 ? 662 MET B C     1 
ATOM   3956 O O     . MET B 1 162 ? 24.179 -1.551  -45.595 1.00 15.83 ? 662 MET B O     1 
ATOM   3957 C CB    . MET B 1 162 ? 24.351 1.649   -44.901 1.00 18.21 ? 662 MET B CB    1 
ATOM   3958 C CG    . MET B 1 162 ? 24.616 2.563   -43.701 1.00 21.38 ? 662 MET B CG    1 
ATOM   3959 S SD    . MET B 1 162 ? 24.750 1.681   -42.123 1.00 22.64 ? 662 MET B SD    1 
ATOM   3960 C CE    . MET B 1 162 ? 23.107 0.906   -42.053 1.00 23.06 ? 662 MET B CE    1 
ATOM   3961 N N     . TYR B 1 163 ? 25.019 -0.350  -47.305 1.00 16.47 ? 663 TYR B N     1 
ATOM   3962 C CA    . TYR B 1 163 ? 24.543 -1.302  -48.312 1.00 16.52 ? 663 TYR B CA    1 
ATOM   3963 C C     . TYR B 1 163 ? 25.178 -2.670  -48.073 1.00 16.81 ? 663 TYR B C     1 
ATOM   3964 O O     . TYR B 1 163 ? 24.497 -3.704  -48.082 1.00 16.34 ? 663 TYR B O     1 
ATOM   3965 C CB    . TYR B 1 163 ? 24.914 -0.824  -49.721 1.00 17.61 ? 663 TYR B CB    1 
ATOM   3966 C CG    . TYR B 1 163 ? 24.522 -1.792  -50.820 1.00 17.77 ? 663 TYR B CG    1 
ATOM   3967 C CD1   . TYR B 1 163 ? 25.430 -2.746  -51.297 1.00 18.64 ? 663 TYR B CD1   1 
ATOM   3968 C CD2   . TYR B 1 163 ? 23.249 -1.746  -51.391 1.00 18.50 ? 663 TYR B CD2   1 
ATOM   3969 C CE1   . TYR B 1 163 ? 25.076 -3.632  -52.325 1.00 17.84 ? 663 TYR B CE1   1 
ATOM   3970 C CE2   . TYR B 1 163 ? 22.883 -2.628  -52.421 1.00 19.06 ? 663 TYR B CE2   1 
ATOM   3971 C CZ    . TYR B 1 163 ? 23.806 -3.564  -52.879 1.00 18.70 ? 663 TYR B CZ    1 
ATOM   3972 O OH    . TYR B 1 163 ? 23.452 -4.418  -53.903 1.00 20.30 ? 663 TYR B OH    1 
ATOM   3973 N N     . GLN B 1 164 ? 26.488 -2.669  -47.866 1.00 16.69 ? 664 GLN B N     1 
ATOM   3974 C CA    . GLN B 1 164 ? 27.220 -3.903  -47.634 1.00 17.22 ? 664 GLN B CA    1 
ATOM   3975 C C     . GLN B 1 164 ? 26.775 -4.562  -46.322 1.00 17.46 ? 664 GLN B C     1 
ATOM   3976 O O     . GLN B 1 164 ? 26.718 -5.792  -46.227 1.00 17.02 ? 664 GLN B O     1 
ATOM   3977 C CB    . GLN B 1 164 ? 28.730 -3.623  -47.631 1.00 17.72 ? 664 GLN B CB    1 
ATOM   3978 C CG    . GLN B 1 164 ? 29.294 -3.331  -49.028 1.00 17.53 ? 664 GLN B CG    1 
ATOM   3979 C CD    . GLN B 1 164 ? 30.728 -2.818  -49.004 1.00 18.48 ? 664 GLN B CD    1 
ATOM   3980 O OE1   . GLN B 1 164 ? 30.981 -1.622  -48.821 1.00 20.16 ? 664 GLN B OE1   1 
ATOM   3981 N NE2   . GLN B 1 164 ? 31.668 -3.718  -49.190 1.00 16.09 ? 664 GLN B NE2   1 
ATOM   3982 N N     . LEU B 1 165 ? 26.460 -3.756  -45.310 1.00 16.26 ? 665 LEU B N     1 
ATOM   3983 C CA    . LEU B 1 165 ? 25.996 -4.321  -44.041 1.00 16.57 ? 665 LEU B CA    1 
ATOM   3984 C C     . LEU B 1 165 ? 24.652 -5.041  -44.265 1.00 16.91 ? 665 LEU B C     1 
ATOM   3985 O O     . LEU B 1 165 ? 24.447 -6.170  -43.798 1.00 17.36 ? 665 LEU B O     1 
ATOM   3986 C CB    . LEU B 1 165 ? 25.833 -3.219  -42.983 1.00 16.40 ? 665 LEU B CB    1 
ATOM   3987 C CG    . LEU B 1 165 ? 25.008 -3.584  -41.737 1.00 16.23 ? 665 LEU B CG    1 
ATOM   3988 C CD1   . LEU B 1 165 ? 25.580 -4.817  -41.060 1.00 16.37 ? 665 LEU B CD1   1 
ATOM   3989 C CD2   . LEU B 1 165 ? 25.006 -2.395  -40.769 1.00 17.50 ? 665 LEU B CD2   1 
ATOM   3990 N N     . PHE B 1 166 ? 23.740 -4.400  -44.988 1.00 16.20 ? 666 PHE B N     1 
ATOM   3991 C CA    . PHE B 1 166 ? 22.449 -5.022  -45.244 1.00 17.89 ? 666 PHE B CA    1 
ATOM   3992 C C     . PHE B 1 166 ? 22.599 -6.314  -46.062 1.00 18.01 ? 666 PHE B C     1 
ATOM   3993 O O     . PHE B 1 166 ? 21.857 -7.274  -45.852 1.00 18.77 ? 666 PHE B O     1 
ATOM   3994 C CB    . PHE B 1 166 ? 21.519 -4.021  -45.926 1.00 18.41 ? 666 PHE B CB    1 
ATOM   3995 C CG    . PHE B 1 166 ? 20.920 -3.014  -44.969 1.00 19.55 ? 666 PHE B CG    1 
ATOM   3996 C CD1   . PHE B 1 166 ? 21.027 -1.647  -45.212 1.00 19.61 ? 666 PHE B CD1   1 
ATOM   3997 C CD2   . PHE B 1 166 ? 20.261 -3.441  -43.813 1.00 19.66 ? 666 PHE B CD2   1 
ATOM   3998 C CE1   . PHE B 1 166 ? 20.491 -0.720  -44.321 1.00 19.41 ? 666 PHE B CE1   1 
ATOM   3999 C CE2   . PHE B 1 166 ? 19.721 -2.519  -42.914 1.00 19.79 ? 666 PHE B CE2   1 
ATOM   4000 C CZ    . PHE B 1 166 ? 19.839 -1.157  -43.174 1.00 19.39 ? 666 PHE B CZ    1 
ATOM   4001 N N     . ARG B 1 167 ? 23.568 -6.355  -46.973 1.00 18.04 ? 667 ARG B N     1 
ATOM   4002 C CA    . ARG B 1 167 ? 23.795 -7.567  -47.760 1.00 18.19 ? 667 ARG B CA    1 
ATOM   4003 C C     . ARG B 1 167 ? 24.208 -8.701  -46.827 1.00 17.99 ? 667 ARG B C     1 
ATOM   4004 O O     . ARG B 1 167 ? 23.677 -9.815  -46.907 1.00 18.42 ? 667 ARG B O     1 
ATOM   4005 C CB    . ARG B 1 167 ? 24.901 -7.344  -48.797 1.00 18.53 ? 667 ARG B CB    1 
ATOM   4006 C CG    . ARG B 1 167 ? 24.401 -6.797  -50.116 1.00 19.91 ? 667 ARG B CG    1 
ATOM   4007 C CD    . ARG B 1 167 ? 25.416 -7.042  -51.225 1.00 20.69 ? 667 ARG B CD    1 
ATOM   4008 N NE    . ARG B 1 167 ? 25.439 -8.436  -51.667 1.00 21.50 ? 667 ARG B NE    1 
ATOM   4009 C CZ    . ARG B 1 167 ? 26.346 -8.939  -52.501 1.00 22.10 ? 667 ARG B CZ    1 
ATOM   4010 N NH1   . ARG B 1 167 ? 27.311 -8.168  -52.986 1.00 22.19 ? 667 ARG B NH1   1 
ATOM   4011 N NH2   . ARG B 1 167 ? 26.274 -10.207 -52.872 1.00 22.96 ? 667 ARG B NH2   1 
ATOM   4012 N N     . SER B 1 168 ? 25.158 -8.423  -45.939 1.00 17.08 ? 668 SER B N     1 
ATOM   4013 C CA    . SER B 1 168 ? 25.626 -9.435  -45.004 1.00 17.73 ? 668 SER B CA    1 
ATOM   4014 C C     . SER B 1 168 ? 24.472 -9.932  -44.106 1.00 17.38 ? 668 SER B C     1 
ATOM   4015 O O     . SER B 1 168 ? 24.407 -11.116 -43.776 1.00 18.47 ? 668 SER B O     1 
ATOM   4016 C CB    . SER B 1 168 ? 26.799 -8.883  -44.167 1.00 17.00 ? 668 SER B CB    1 
ATOM   4017 O OG    . SER B 1 168 ? 26.361 -8.003  -43.149 1.00 17.72 ? 668 SER B OG    1 
ATOM   4018 N N     . LEU B 1 169 ? 23.556 -9.044  -43.731 1.00 17.44 ? 669 LEU B N     1 
ATOM   4019 C CA    . LEU B 1 169 ? 22.409 -9.430  -42.898 1.00 17.91 ? 669 LEU B CA    1 
ATOM   4020 C C     . LEU B 1 169 ? 21.388 -10.254 -43.700 1.00 18.68 ? 669 LEU B C     1 
ATOM   4021 O O     . LEU B 1 169 ? 20.780 -11.188 -43.174 1.00 18.78 ? 669 LEU B O     1 
ATOM   4022 C CB    . LEU B 1 169 ? 21.715 -8.193  -42.321 1.00 16.80 ? 669 LEU B CB    1 
ATOM   4023 C CG    . LEU B 1 169 ? 22.521 -7.373  -41.293 1.00 17.62 ? 669 LEU B CG    1 
ATOM   4024 C CD1   . LEU B 1 169 ? 21.649 -6.234  -40.737 1.00 16.59 ? 669 LEU B CD1   1 
ATOM   4025 C CD2   . LEU B 1 169 ? 23.019 -8.292  -40.166 1.00 16.01 ? 669 LEU B CD2   1 
ATOM   4026 N N     . ALA B 1 170 ? 21.178 -9.897  -44.961 1.00 18.94 ? 670 ALA B N     1 
ATOM   4027 C CA    . ALA B 1 170 ? 20.244 -10.654 -45.785 1.00 19.37 ? 670 ALA B CA    1 
ATOM   4028 C C     . ALA B 1 170 ? 20.780 -12.085 -45.860 1.00 19.64 ? 670 ALA B C     1 
ATOM   4029 O O     . ALA B 1 170 ? 20.018 -13.051 -45.791 1.00 20.24 ? 670 ALA B O     1 
ATOM   4030 C CB    . ALA B 1 170 ? 20.161 -10.046 -47.182 1.00 19.07 ? 670 ALA B CB    1 
ATOM   4031 N N     . TYR B 1 171 ? 22.098 -12.213 -45.974 1.00 19.95 ? 671 TYR B N     1 
ATOM   4032 C CA    . TYR B 1 171 ? 22.733 -13.522 -46.070 1.00 21.01 ? 671 TYR B CA    1 
ATOM   4033 C C     . TYR B 1 171 ? 22.610 -14.387 -44.813 1.00 21.50 ? 671 TYR B C     1 
ATOM   4034 O O     . TYR B 1 171 ? 22.142 -15.524 -44.891 1.00 22.49 ? 671 TYR B O     1 
ATOM   4035 C CB    . TYR B 1 171 ? 24.211 -13.368 -46.457 1.00 21.35 ? 671 TYR B CB    1 
ATOM   4036 C CG    . TYR B 1 171 ? 24.964 -14.680 -46.554 1.00 22.82 ? 671 TYR B CG    1 
ATOM   4037 C CD1   . TYR B 1 171 ? 25.853 -15.064 -45.555 1.00 22.66 ? 671 TYR B CD1   1 
ATOM   4038 C CD2   . TYR B 1 171 ? 24.781 -15.543 -47.646 1.00 23.59 ? 671 TYR B CD2   1 
ATOM   4039 C CE1   . TYR B 1 171 ? 26.546 -16.270 -45.629 1.00 24.11 ? 671 TYR B CE1   1 
ATOM   4040 C CE2   . TYR B 1 171 ? 25.472 -16.760 -47.729 1.00 23.71 ? 671 TYR B CE2   1 
ATOM   4041 C CZ    . TYR B 1 171 ? 26.352 -17.112 -46.716 1.00 24.29 ? 671 TYR B CZ    1 
ATOM   4042 O OH    . TYR B 1 171 ? 27.045 -18.299 -46.768 1.00 25.56 ? 671 TYR B OH    1 
ATOM   4043 N N     . ILE B 1 172 ? 23.027 -13.880 -43.655 1.00 20.85 ? 672 ILE B N     1 
ATOM   4044 C CA    . ILE B 1 172 ? 22.921 -14.693 -42.448 1.00 19.71 ? 672 ILE B CA    1 
ATOM   4045 C C     . ILE B 1 172 ? 21.460 -14.948 -42.058 1.00 20.26 ? 672 ILE B C     1 
ATOM   4046 O O     . ILE B 1 172 ? 21.126 -16.029 -41.571 1.00 20.44 ? 672 ILE B O     1 
ATOM   4047 C CB    . ILE B 1 172 ? 23.689 -14.063 -41.240 1.00 19.56 ? 672 ILE B CB    1 
ATOM   4048 C CG1   . ILE B 1 172 ? 23.144 -12.672 -40.920 1.00 19.18 ? 672 ILE B CG1   1 
ATOM   4049 C CG2   . ILE B 1 172 ? 25.174 -14.001 -41.545 1.00 19.26 ? 672 ILE B CG2   1 
ATOM   4050 C CD1   . ILE B 1 172 ? 23.620 -12.134 -39.563 1.00 19.71 ? 672 ILE B CD1   1 
ATOM   4051 N N     . HIS B 1 173 ? 20.585 -13.973 -42.287 1.00 20.24 ? 673 HIS B N     1 
ATOM   4052 C CA    . HIS B 1 173 ? 19.179 -14.134 -41.943 1.00 21.43 ? 673 HIS B CA    1 
ATOM   4053 C C     . HIS B 1 173 ? 18.518 -15.218 -42.795 1.00 23.76 ? 673 HIS B C     1 
ATOM   4054 O O     . HIS B 1 173 ? 17.570 -15.878 -42.349 1.00 23.86 ? 673 HIS B O     1 
ATOM   4055 C CB    . HIS B 1 173 ? 18.425 -12.819 -42.127 1.00 21.17 ? 673 HIS B CB    1 
ATOM   4056 C CG    . HIS B 1 173 ? 18.712 -11.800 -41.062 1.00 20.71 ? 673 HIS B CG    1 
ATOM   4057 N ND1   . HIS B 1 173 ? 18.070 -10.581 -41.007 1.00 20.05 ? 673 HIS B ND1   1 
ATOM   4058 C CD2   . HIS B 1 173 ? 19.584 -11.812 -40.023 1.00 19.53 ? 673 HIS B CD2   1 
ATOM   4059 C CE1   . HIS B 1 173 ? 18.532 -9.887  -39.979 1.00 18.61 ? 673 HIS B CE1   1 
ATOM   4060 N NE2   . HIS B 1 173 ? 19.452 -10.611 -39.367 1.00 17.86 ? 673 HIS B NE2   1 
ATOM   4061 N N     . SER B 1 174 ? 19.018 -15.397 -44.018 1.00 24.99 ? 674 SER B N     1 
ATOM   4062 C CA    . SER B 1 174 ? 18.468 -16.401 -44.931 1.00 26.09 ? 674 SER B CA    1 
ATOM   4063 C C     . SER B 1 174 ? 18.683 -17.803 -44.364 1.00 27.17 ? 674 SER B C     1 
ATOM   4064 O O     . SER B 1 174 ? 18.065 -18.766 -44.819 1.00 27.85 ? 674 SER B O     1 
ATOM   4065 C CB    . SER B 1 174 ? 19.125 -16.280 -46.311 1.00 25.24 ? 674 SER B CB    1 
ATOM   4066 O OG    . SER B 1 174 ? 20.372 -16.945 -46.330 1.00 25.27 ? 674 SER B OG    1 
ATOM   4067 N N     . PHE B 1 175 ? 19.569 -17.906 -43.378 1.00 27.62 ? 675 PHE B N     1 
ATOM   4068 C CA    . PHE B 1 175 ? 19.861 -19.171 -42.706 1.00 28.12 ? 675 PHE B CA    1 
ATOM   4069 C C     . PHE B 1 175 ? 19.156 -19.192 -41.351 1.00 27.71 ? 675 PHE B C     1 
ATOM   4070 O O     . PHE B 1 175 ? 19.271 -20.158 -40.601 1.00 28.36 ? 675 PHE B O     1 
ATOM   4071 C CB    . PHE B 1 175 ? 21.363 -19.323 -42.456 1.00 29.88 ? 675 PHE B CB    1 
ATOM   4072 C CG    . PHE B 1 175 ? 22.163 -19.578 -43.692 1.00 32.59 ? 675 PHE B CG    1 
ATOM   4073 C CD1   . PHE B 1 175 ? 22.173 -20.839 -44.283 1.00 33.41 ? 675 PHE B CD1   1 
ATOM   4074 C CD2   . PHE B 1 175 ? 22.904 -18.557 -44.272 1.00 33.05 ? 675 PHE B CD2   1 
ATOM   4075 C CE1   . PHE B 1 175 ? 22.913 -21.077 -45.441 1.00 34.57 ? 675 PHE B CE1   1 
ATOM   4076 C CE2   . PHE B 1 175 ? 23.649 -18.781 -45.431 1.00 34.49 ? 675 PHE B CE2   1 
ATOM   4077 C CZ    . PHE B 1 175 ? 23.654 -20.042 -46.017 1.00 34.60 ? 675 PHE B CZ    1 
ATOM   4078 N N     . GLY B 1 176 ? 18.440 -18.116 -41.035 1.00 27.55 ? 676 GLY B N     1 
ATOM   4079 C CA    . GLY B 1 176 ? 17.756 -18.034 -39.754 1.00 26.78 ? 676 GLY B CA    1 
ATOM   4080 C C     . GLY B 1 176 ? 18.690 -17.574 -38.639 1.00 26.60 ? 676 GLY B C     1 
ATOM   4081 O O     . GLY B 1 176 ? 18.311 -17.559 -37.461 1.00 26.46 ? 676 GLY B O     1 
ATOM   4082 N N     . ILE B 1 177 ? 19.912 -17.193 -39.007 1.00 25.07 ? 677 ILE B N     1 
ATOM   4083 C CA    . ILE B 1 177 ? 20.899 -16.738 -38.030 1.00 24.08 ? 677 ILE B CA    1 
ATOM   4084 C C     . ILE B 1 177 ? 20.806 -15.227 -37.773 1.00 23.58 ? 677 ILE B C     1 
ATOM   4085 O O     . ILE B 1 177 ? 20.861 -14.423 -38.705 1.00 22.78 ? 677 ILE B O     1 
ATOM   4086 C CB    . ILE B 1 177 ? 22.339 -17.076 -38.497 1.00 24.56 ? 677 ILE B CB    1 
ATOM   4087 C CG1   . ILE B 1 177 ? 22.517 -18.592 -38.569 1.00 24.51 ? 677 ILE B CG1   1 
ATOM   4088 C CG2   . ILE B 1 177 ? 23.370 -16.484 -37.533 1.00 23.01 ? 677 ILE B CG2   1 
ATOM   4089 C CD1   . ILE B 1 177 ? 23.675 -19.014 -39.425 1.00 25.94 ? 677 ILE B CD1   1 
ATOM   4090 N N     . CYS B 1 178 ? 20.650 -14.856 -36.502 1.00 22.17 ? 678 CYS B N     1 
ATOM   4091 C CA    . CYS B 1 178 ? 20.565 -13.451 -36.099 1.00 21.09 ? 678 CYS B CA    1 
ATOM   4092 C C     . CYS B 1 178 ? 21.906 -13.108 -35.444 1.00 20.07 ? 678 CYS B C     1 
ATOM   4093 O O     . CYS B 1 178 ? 22.394 -13.862 -34.595 1.00 20.70 ? 678 CYS B O     1 
ATOM   4094 C CB    . CYS B 1 178 ? 19.423 -13.255 -35.098 1.00 20.41 ? 678 CYS B CB    1 
ATOM   4095 S SG    . CYS B 1 178 ? 19.165 -11.538 -34.577 1.00 20.89 ? 678 CYS B SG    1 
ATOM   4096 N N     . HIS B 1 179 ? 22.509 -11.988 -35.845 1.00 18.74 ? 679 HIS B N     1 
ATOM   4097 C CA    . HIS B 1 179 ? 23.809 -11.595 -35.296 1.00 18.14 ? 679 HIS B CA    1 
ATOM   4098 C C     . HIS B 1 179 ? 23.710 -11.219 -33.813 1.00 17.52 ? 679 HIS B C     1 
ATOM   4099 O O     . HIS B 1 179 ? 24.535 -11.648 -33.010 1.00 17.33 ? 679 HIS B O     1 
ATOM   4100 C CB    . HIS B 1 179 ? 24.395 -10.427 -36.100 1.00 16.87 ? 679 HIS B CB    1 
ATOM   4101 C CG    . HIS B 1 179 ? 25.764 -10.010 -35.648 1.00 18.24 ? 679 HIS B CG    1 
ATOM   4102 N ND1   . HIS B 1 179 ? 26.914 -10.371 -36.315 1.00 19.04 ? 679 HIS B ND1   1 
ATOM   4103 C CD2   . HIS B 1 179 ? 26.161 -9.242  -34.605 1.00 17.04 ? 679 HIS B CD2   1 
ATOM   4104 C CE1   . HIS B 1 179 ? 27.961 -9.843  -35.704 1.00 17.40 ? 679 HIS B CE1   1 
ATOM   4105 N NE2   . HIS B 1 179 ? 27.530 -9.153  -34.664 1.00 18.30 ? 679 HIS B NE2   1 
ATOM   4106 N N     . ARG B 1 180 ? 22.701 -10.418 -33.472 1.00 17.44 ? 680 ARG B N     1 
ATOM   4107 C CA    . ARG B 1 180 ? 22.446 -9.980  -32.092 1.00 18.80 ? 680 ARG B CA    1 
ATOM   4108 C C     . ARG B 1 180 ? 23.460 -9.014  -31.471 1.00 19.40 ? 680 ARG B C     1 
ATOM   4109 O O     . ARG B 1 180 ? 23.372 -8.701  -30.281 1.00 20.91 ? 680 ARG B O     1 
ATOM   4110 C CB    . ARG B 1 180 ? 22.263 -11.195 -31.170 1.00 18.19 ? 680 ARG B CB    1 
ATOM   4111 C CG    . ARG B 1 180 ? 21.215 -12.187 -31.698 1.00 18.28 ? 680 ARG B CG    1 
ATOM   4112 C CD    . ARG B 1 180 ? 20.587 -13.010 -30.585 1.00 17.88 ? 680 ARG B CD    1 
ATOM   4113 N NE    . ARG B 1 180 ? 21.579 -13.843 -29.915 1.00 19.38 ? 680 ARG B NE    1 
ATOM   4114 C CZ    . ARG B 1 180 ? 21.307 -14.660 -28.903 1.00 19.55 ? 680 ARG B CZ    1 
ATOM   4115 N NH1   . ARG B 1 180 ? 20.069 -14.758 -28.435 1.00 20.96 ? 680 ARG B NH1   1 
ATOM   4116 N NH2   . ARG B 1 180 ? 22.277 -15.377 -28.362 1.00 20.40 ? 680 ARG B NH2   1 
ATOM   4117 N N     . ASP B 1 181 ? 24.419 -8.539  -32.256 1.00 19.76 ? 681 ASP B N     1 
ATOM   4118 C CA    . ASP B 1 181 ? 25.381 -7.577  -31.733 1.00 19.48 ? 681 ASP B CA    1 
ATOM   4119 C C     . ASP B 1 181 ? 25.877 -6.636  -32.822 1.00 18.80 ? 681 ASP B C     1 
ATOM   4120 O O     . ASP B 1 181 ? 27.071 -6.365  -32.916 1.00 18.76 ? 681 ASP B O     1 
ATOM   4121 C CB    . ASP B 1 181 ? 26.573 -8.279  -31.078 1.00 20.66 ? 681 ASP B CB    1 
ATOM   4122 C CG    . ASP B 1 181 ? 27.368 -7.345  -30.155 1.00 22.63 ? 681 ASP B CG    1 
ATOM   4123 O OD1   . ASP B 1 181 ? 26.790 -6.336  -29.685 1.00 22.51 ? 681 ASP B OD1   1 
ATOM   4124 O OD2   . ASP B 1 181 ? 28.565 -7.619  -29.904 1.00 23.13 ? 681 ASP B OD2   1 
ATOM   4125 N N     . ILE B 1 182 ? 24.959 -6.147  -33.649 1.00 18.00 ? 682 ILE B N     1 
ATOM   4126 C CA    . ILE B 1 182 ? 25.333 -5.222  -34.712 1.00 18.44 ? 682 ILE B CA    1 
ATOM   4127 C C     . ILE B 1 182 ? 25.678 -3.866  -34.083 1.00 18.97 ? 682 ILE B C     1 
ATOM   4128 O O     . ILE B 1 182 ? 24.861 -3.270  -33.390 1.00 19.76 ? 682 ILE B O     1 
ATOM   4129 C CB    . ILE B 1 182 ? 24.180 -5.031  -35.725 1.00 17.89 ? 682 ILE B CB    1 
ATOM   4130 C CG1   . ILE B 1 182 ? 23.883 -6.356  -36.436 1.00 17.58 ? 682 ILE B CG1   1 
ATOM   4131 C CG2   . ILE B 1 182 ? 24.538 -3.943  -36.729 1.00 17.46 ? 682 ILE B CG2   1 
ATOM   4132 C CD1   . ILE B 1 182 ? 25.077 -6.946  -37.173 1.00 17.77 ? 682 ILE B CD1   1 
ATOM   4133 N N     . LYS B 1 183 ? 26.894 -3.397  -34.330 1.00 18.79 ? 683 LYS B N     1 
ATOM   4134 C CA    . LYS B 1 183 ? 27.382 -2.127  -33.797 1.00 19.53 ? 683 LYS B CA    1 
ATOM   4135 C C     . LYS B 1 183 ? 28.627 -1.737  -34.598 1.00 19.64 ? 683 LYS B C     1 
ATOM   4136 O O     . LYS B 1 183 ? 29.257 -2.590  -35.212 1.00 19.33 ? 683 LYS B O     1 
ATOM   4137 C CB    . LYS B 1 183 ? 27.729 -2.271  -32.308 1.00 18.91 ? 683 LYS B CB    1 
ATOM   4138 C CG    . LYS B 1 183 ? 28.916 -3.181  -32.034 1.00 19.87 ? 683 LYS B CG    1 
ATOM   4139 C CD    . LYS B 1 183 ? 29.167 -3.384  -30.549 1.00 21.25 ? 683 LYS B CD    1 
ATOM   4140 C CE    . LYS B 1 183 ? 30.325 -4.336  -30.332 1.00 21.75 ? 683 LYS B CE    1 
ATOM   4141 N NZ    . LYS B 1 183 ? 30.268 -5.022  -29.010 1.00 25.25 ? 683 LYS B NZ    1 
ATOM   4142 N N     . PRO B 1 184 ? 28.995 -0.444  -34.601 1.00 20.45 ? 684 PRO B N     1 
ATOM   4143 C CA    . PRO B 1 184 ? 30.172 0.029   -35.345 1.00 20.88 ? 684 PRO B CA    1 
ATOM   4144 C C     . PRO B 1 184 ? 31.474 -0.749  -35.130 1.00 21.17 ? 684 PRO B C     1 
ATOM   4145 O O     . PRO B 1 184 ? 32.244 -0.949  -36.070 1.00 20.45 ? 684 PRO B O     1 
ATOM   4146 C CB    . PRO B 1 184 ? 30.295 1.494   -34.922 1.00 21.36 ? 684 PRO B CB    1 
ATOM   4147 C CG    . PRO B 1 184 ? 28.902 1.879   -34.557 1.00 21.32 ? 684 PRO B CG    1 
ATOM   4148 C CD    . PRO B 1 184 ? 28.304 0.661   -33.915 1.00 20.57 ? 684 PRO B CD    1 
ATOM   4149 N N     . GLN B 1 185 ? 31.721 -1.196  -33.905 1.00 21.52 ? 685 GLN B N     1 
ATOM   4150 C CA    . GLN B 1 185 ? 32.948 -1.934  -33.617 1.00 22.47 ? 685 GLN B CA    1 
ATOM   4151 C C     . GLN B 1 185 ? 32.995 -3.331  -34.240 1.00 21.25 ? 685 GLN B C     1 
ATOM   4152 O O     . GLN B 1 185 ? 34.058 -3.946  -34.316 1.00 21.85 ? 685 GLN B O     1 
ATOM   4153 C CB    . GLN B 1 185 ? 33.157 -2.029  -32.101 1.00 25.81 ? 685 GLN B CB    1 
ATOM   4154 C CG    . GLN B 1 185 ? 33.699 -0.736  -31.492 1.00 30.66 ? 685 GLN B CG    1 
ATOM   4155 C CD    . GLN B 1 185 ? 33.248 -0.512  -30.058 1.00 34.53 ? 685 GLN B CD    1 
ATOM   4156 O OE1   . GLN B 1 185 ? 32.063 -0.637  -29.734 1.00 37.75 ? 685 GLN B OE1   1 
ATOM   4157 N NE2   . GLN B 1 185 ? 34.196 -0.175  -29.187 1.00 35.76 ? 685 GLN B NE2   1 
ATOM   4158 N N     . ASN B 1 186 ? 31.844 -3.826  -34.685 1.00 20.00 ? 686 ASN B N     1 
ATOM   4159 C CA    . ASN B 1 186 ? 31.769 -5.147  -35.304 1.00 19.14 ? 686 ASN B CA    1 
ATOM   4160 C C     . ASN B 1 186 ? 31.675 -5.060  -36.829 1.00 18.81 ? 686 ASN B C     1 
ATOM   4161 O O     . ASN B 1 186 ? 31.368 -6.045  -37.501 1.00 18.23 ? 686 ASN B O     1 
ATOM   4162 C CB    . ASN B 1 186 ? 30.575 -5.922  -34.738 1.00 18.85 ? 686 ASN B CB    1 
ATOM   4163 C CG    . ASN B 1 186 ? 30.861 -6.488  -33.366 1.00 19.28 ? 686 ASN B CG    1 
ATOM   4164 O OD1   . ASN B 1 186 ? 32.019 -6.597  -32.971 1.00 20.56 ? 686 ASN B OD1   1 
ATOM   4165 N ND2   . ASN B 1 186 ? 29.813 -6.840  -32.626 1.00 18.85 ? 686 ASN B ND2   1 
ATOM   4166 N N     . LEU B 1 187 ? 31.946 -3.875  -37.366 1.00 17.59 ? 687 LEU B N     1 
ATOM   4167 C CA    . LEU B 1 187 ? 31.914 -3.661  -38.802 1.00 17.92 ? 687 LEU B CA    1 
ATOM   4168 C C     . LEU B 1 187 ? 33.329 -3.292  -39.252 1.00 19.35 ? 687 LEU B C     1 
ATOM   4169 O O     . LEU B 1 187 ? 33.785 -2.165  -39.050 1.00 18.95 ? 687 LEU B O     1 
ATOM   4170 C CB    . LEU B 1 187 ? 30.927 -2.540  -39.154 1.00 17.74 ? 687 LEU B CB    1 
ATOM   4171 C CG    . LEU B 1 187 ? 29.527 -2.694  -38.548 1.00 17.16 ? 687 LEU B CG    1 
ATOM   4172 C CD1   . LEU B 1 187 ? 28.665 -1.462  -38.875 1.00 17.80 ? 687 LEU B CD1   1 
ATOM   4173 C CD2   . LEU B 1 187 ? 28.871 -3.958  -39.094 1.00 17.99 ? 687 LEU B CD2   1 
ATOM   4174 N N     . LEU B 1 188 ? 34.030 -4.261  -39.834 1.00 19.88 ? 688 LEU B N     1 
ATOM   4175 C CA    . LEU B 1 188 ? 35.389 -4.041  -40.306 1.00 20.99 ? 688 LEU B CA    1 
ATOM   4176 C C     . LEU B 1 188 ? 35.383 -3.336  -41.659 1.00 21.59 ? 688 LEU B C     1 
ATOM   4177 O O     . LEU B 1 188 ? 34.483 -3.541  -42.472 1.00 21.40 ? 688 LEU B O     1 
ATOM   4178 C CB    . LEU B 1 188 ? 36.126 -5.376  -40.411 1.00 21.00 ? 688 LEU B CB    1 
ATOM   4179 C CG    . LEU B 1 188 ? 36.066 -6.261  -39.164 1.00 21.27 ? 688 LEU B CG    1 
ATOM   4180 C CD1   . LEU B 1 188 ? 36.773 -7.583  -39.447 1.00 21.77 ? 688 LEU B CD1   1 
ATOM   4181 C CD2   . LEU B 1 188 ? 36.703 -5.543  -37.980 1.00 21.18 ? 688 LEU B CD2   1 
ATOM   4182 N N     . LEU B 1 189 ? 36.401 -2.514  -41.898 1.00 23.06 ? 689 LEU B N     1 
ATOM   4183 C CA    . LEU B 1 189 ? 36.500 -1.753  -43.140 1.00 25.27 ? 689 LEU B CA    1 
ATOM   4184 C C     . LEU B 1 189 ? 37.895 -1.719  -43.726 1.00 26.27 ? 689 LEU B C     1 
ATOM   4185 O O     . LEU B 1 189 ? 38.884 -1.670  -43.003 1.00 25.10 ? 689 LEU B O     1 
ATOM   4186 C CB    . LEU B 1 189 ? 36.108 -0.286  -42.912 1.00 26.18 ? 689 LEU B CB    1 
ATOM   4187 C CG    . LEU B 1 189 ? 34.684 0.145   -42.590 1.00 27.55 ? 689 LEU B CG    1 
ATOM   4188 C CD1   . LEU B 1 189 ? 34.689 1.622   -42.182 1.00 27.76 ? 689 LEU B CD1   1 
ATOM   4189 C CD2   . LEU B 1 189 ? 33.804 -0.085  -43.808 1.00 28.14 ? 689 LEU B CD2   1 
ATOM   4190 N N     . ASP B 1 190 ? 37.957 -1.734  -45.050 1.00 28.89 ? 690 ASP B N     1 
ATOM   4191 C CA    . ASP B 1 190 ? 39.220 -1.587  -45.752 1.00 32.28 ? 690 ASP B CA    1 
ATOM   4192 C C     . ASP B 1 190 ? 39.014 -0.232  -46.427 1.00 33.38 ? 690 ASP B C     1 
ATOM   4193 O O     . ASP B 1 190 ? 38.316 -0.129  -47.428 1.00 33.15 ? 690 ASP B O     1 
ATOM   4194 C CB    . ASP B 1 190 ? 39.424 -2.679  -46.793 1.00 34.33 ? 690 ASP B CB    1 
ATOM   4195 C CG    . ASP B 1 190 ? 40.835 -2.684  -47.341 1.00 36.86 ? 690 ASP B CG    1 
ATOM   4196 O OD1   . ASP B 1 190 ? 41.230 -1.679  -47.964 1.00 37.95 ? 690 ASP B OD1   1 
ATOM   4197 O OD2   . ASP B 1 190 ? 41.553 -3.684  -47.141 1.00 39.30 ? 690 ASP B OD2   1 
ATOM   4198 N N     . PRO B 1 191 ? 39.613 0.828   -45.867 1.00 35.60 ? 691 PRO B N     1 
ATOM   4199 C CA    . PRO B 1 191 ? 39.526 2.212   -46.354 1.00 36.62 ? 691 PRO B CA    1 
ATOM   4200 C C     . PRO B 1 191 ? 39.732 2.432   -47.848 1.00 37.21 ? 691 PRO B C     1 
ATOM   4201 O O     . PRO B 1 191 ? 38.991 3.188   -48.480 1.00 37.78 ? 691 PRO B O     1 
ATOM   4202 C CB    . PRO B 1 191 ? 40.582 2.945   -45.532 1.00 37.33 ? 691 PRO B CB    1 
ATOM   4203 C CG    . PRO B 1 191 ? 40.670 2.153   -44.266 1.00 37.40 ? 691 PRO B CG    1 
ATOM   4204 C CD    . PRO B 1 191 ? 40.495 0.724   -44.689 1.00 36.57 ? 691 PRO B CD    1 
ATOM   4205 N N     . ASP B 1 192 ? 40.734 1.766   -48.406 1.00 37.58 ? 692 ASP B N     1 
ATOM   4206 C CA    . ASP B 1 192 ? 41.063 1.910   -49.818 1.00 38.01 ? 692 ASP B CA    1 
ATOM   4207 C C     . ASP B 1 192 ? 40.031 1.338   -50.773 1.00 36.92 ? 692 ASP B C     1 
ATOM   4208 O O     . ASP B 1 192 ? 39.660 1.982   -51.757 1.00 37.73 ? 692 ASP B O     1 
ATOM   4209 C CB    . ASP B 1 192 ? 42.420 1.262   -50.096 1.00 39.86 ? 692 ASP B CB    1 
ATOM   4210 C CG    . ASP B 1 192 ? 43.560 1.975   -49.386 1.00 42.30 ? 692 ASP B CG    1 
ATOM   4211 O OD1   . ASP B 1 192 ? 44.611 1.331   -49.162 1.00 43.71 ? 692 ASP B OD1   1 
ATOM   4212 O OD2   . ASP B 1 192 ? 43.406 3.175   -49.051 1.00 43.16 ? 692 ASP B OD2   1 
ATOM   4213 N N     . THR B 1 193 ? 39.569 0.130   -50.484 1.00 34.97 ? 693 THR B N     1 
ATOM   4214 C CA    . THR B 1 193 ? 38.599 -0.530  -51.338 1.00 32.67 ? 693 THR B CA    1 
ATOM   4215 C C     . THR B 1 193 ? 37.164 -0.224  -50.940 1.00 31.20 ? 693 THR B C     1 
ATOM   4216 O O     . THR B 1 193 ? 36.243 -0.488  -51.706 1.00 31.06 ? 693 THR B O     1 
ATOM   4217 C CB    . THR B 1 193 ? 38.794 -2.058  -51.310 1.00 32.91 ? 693 THR B CB    1 
ATOM   4218 O OG1   . THR B 1 193 ? 38.652 -2.538  -49.965 1.00 32.46 ? 693 THR B OG1   1 
ATOM   4219 C CG2   . THR B 1 193 ? 40.181 -2.423  -51.818 1.00 32.83 ? 693 THR B CG2   1 
ATOM   4220 N N     . ALA B 1 194 ? 36.985 0.335   -49.747 1.00 29.22 ? 694 ALA B N     1 
ATOM   4221 C CA    . ALA B 1 194 ? 35.660 0.663   -49.226 1.00 27.89 ? 694 ALA B CA    1 
ATOM   4222 C C     . ALA B 1 194 ? 34.840 -0.600  -48.950 1.00 26.75 ? 694 ALA B C     1 
ATOM   4223 O O     . ALA B 1 194 ? 33.616 -0.553  -48.889 1.00 27.16 ? 694 ALA B O     1 
ATOM   4224 C CB    . ALA B 1 194 ? 34.909 1.571   -50.202 1.00 27.76 ? 694 ALA B CB    1 
ATOM   4225 N N     . VAL B 1 195 ? 35.522 -1.726  -48.784 1.00 25.73 ? 695 VAL B N     1 
ATOM   4226 C CA    . VAL B 1 195 ? 34.848 -2.987  -48.502 1.00 24.05 ? 695 VAL B CA    1 
ATOM   4227 C C     . VAL B 1 195 ? 34.556 -3.093  -47.010 1.00 23.09 ? 695 VAL B C     1 
ATOM   4228 O O     . VAL B 1 195 ? 35.401 -2.761  -46.170 1.00 22.78 ? 695 VAL B O     1 
ATOM   4229 C CB    . VAL B 1 195 ? 35.716 -4.196  -48.922 1.00 24.27 ? 695 VAL B CB    1 
ATOM   4230 C CG1   . VAL B 1 195 ? 35.164 -5.478  -48.310 1.00 24.71 ? 695 VAL B CG1   1 
ATOM   4231 C CG2   . VAL B 1 195 ? 35.736 -4.318  -50.442 1.00 24.40 ? 695 VAL B CG2   1 
ATOM   4232 N N     . LEU B 1 196 ? 33.348 -3.537  -46.683 1.00 21.74 ? 696 LEU B N     1 
ATOM   4233 C CA    . LEU B 1 196 ? 32.961 -3.709  -45.286 1.00 20.80 ? 696 LEU B CA    1 
ATOM   4234 C C     . LEU B 1 196 ? 32.726 -5.198  -45.042 1.00 21.04 ? 696 LEU B C     1 
ATOM   4235 O O     . LEU B 1 196 ? 32.153 -5.887  -45.888 1.00 20.70 ? 696 LEU B O     1 
ATOM   4236 C CB    . LEU B 1 196 ? 31.674 -2.929  -44.981 1.00 19.95 ? 696 LEU B CB    1 
ATOM   4237 C CG    . LEU B 1 196 ? 31.088 -3.116  -43.575 1.00 19.80 ? 696 LEU B CG    1 
ATOM   4238 C CD1   . LEU B 1 196 ? 30.326 -1.863  -43.176 1.00 19.12 ? 696 LEU B CD1   1 
ATOM   4239 C CD2   . LEU B 1 196 ? 30.150 -4.327  -43.544 1.00 19.15 ? 696 LEU B CD2   1 
ATOM   4240 N N     . LYS B 1 197 ? 33.185 -5.695  -43.899 1.00 20.89 ? 697 LYS B N     1 
ATOM   4241 C CA    . LYS B 1 197 ? 32.990 -7.095  -43.552 1.00 20.67 ? 697 LYS B CA    1 
ATOM   4242 C C     . LYS B 1 197 ? 32.473 -7.186  -42.128 1.00 20.39 ? 697 LYS B C     1 
ATOM   4243 O O     . LYS B 1 197 ? 33.066 -6.650  -41.194 1.00 19.91 ? 697 LYS B O     1 
ATOM   4244 C CB    . LYS B 1 197 ? 34.299 -7.878  -43.677 1.00 22.63 ? 697 LYS B CB    1 
ATOM   4245 C CG    . LYS B 1 197 ? 34.694 -8.177  -45.123 1.00 24.54 ? 697 LYS B CG    1 
ATOM   4246 C CD    . LYS B 1 197 ? 36.150 -8.584  -45.202 1.00 27.28 ? 697 LYS B CD    1 
ATOM   4247 C CE    . LYS B 1 197 ? 36.611 -8.720  -46.647 1.00 28.49 ? 697 LYS B CE    1 
ATOM   4248 N NZ    . LYS B 1 197 ? 35.547 -9.317  -47.519 1.00 31.50 ? 697 LYS B NZ    1 
ATOM   4249 N N     . LEU B 1 198 ? 31.351 -7.867  -41.972 1.00 20.29 ? 698 LEU B N     1 
ATOM   4250 C CA    . LEU B 1 198 ? 30.742 -8.056  -40.666 1.00 19.61 ? 698 LEU B CA    1 
ATOM   4251 C C     . LEU B 1 198 ? 31.582 -9.069  -39.890 1.00 19.71 ? 698 LEU B C     1 
ATOM   4252 O O     . LEU B 1 198 ? 32.064 -10.048 -40.461 1.00 20.14 ? 698 LEU B O     1 
ATOM   4253 C CB    . LEU B 1 198 ? 29.307 -8.566  -40.851 1.00 18.50 ? 698 LEU B CB    1 
ATOM   4254 C CG    . LEU B 1 198 ? 28.471 -8.940  -39.627 1.00 18.76 ? 698 LEU B CG    1 
ATOM   4255 C CD1   . LEU B 1 198 ? 28.226 -7.712  -38.750 1.00 17.60 ? 698 LEU B CD1   1 
ATOM   4256 C CD2   . LEU B 1 198 ? 27.145 -9.529  -40.100 1.00 18.66 ? 698 LEU B CD2   1 
ATOM   4257 N N     . CYS B 1 199 ? 31.785 -8.825  -38.598 1.00 19.33 ? 699 CYS B N     1 
ATOM   4258 C CA    . CYS B 1 199 ? 32.556 -9.756  -37.781 1.00 20.06 ? 699 CYS B CA    1 
ATOM   4259 C C     . CYS B 1 199 ? 31.898 -9.996  -36.430 1.00 20.17 ? 699 CYS B C     1 
ATOM   4260 O O     . CYS B 1 199 ? 30.810 -9.490  -36.161 1.00 19.38 ? 699 CYS B O     1 
ATOM   4261 C CB    . CYS B 1 199 ? 33.996 -9.255  -37.578 1.00 20.41 ? 699 CYS B CB    1 
ATOM   4262 S SG    . CYS B 1 199 ? 34.224 -7.903  -36.370 1.00 23.61 ? 699 CYS B SG    1 
ATOM   4263 N N     . ASP B 1 200 ? 32.572 -10.787 -35.600 1.00 20.45 ? 700 ASP B N     1 
ATOM   4264 C CA    . ASP B 1 200 ? 32.124 -11.126 -34.248 1.00 21.21 ? 700 ASP B CA    1 
ATOM   4265 C C     . ASP B 1 200 ? 30.799 -11.869 -34.158 1.00 21.26 ? 700 ASP B C     1 
ATOM   4266 O O     . ASP B 1 200 ? 29.756 -11.273 -33.881 1.00 21.72 ? 700 ASP B O     1 
ATOM   4267 C CB    . ASP B 1 200 ? 32.044 -9.872  -33.380 1.00 21.72 ? 700 ASP B CB    1 
ATOM   4268 C CG    . ASP B 1 200 ? 31.734 -10.196 -31.927 1.00 23.25 ? 700 ASP B CG    1 
ATOM   4269 O OD1   . ASP B 1 200 ? 31.702 -11.392 -31.577 1.00 22.45 ? 700 ASP B OD1   1 
ATOM   4270 O OD2   . ASP B 1 200 ? 31.519 -9.263  -31.133 1.00 24.97 ? 700 ASP B OD2   1 
ATOM   4271 N N     . PHE B 1 201 ? 30.845 -13.181 -34.359 1.00 21.03 ? 701 PHE B N     1 
ATOM   4272 C CA    . PHE B 1 201 ? 29.637 -13.980 -34.282 1.00 20.80 ? 701 PHE B CA    1 
ATOM   4273 C C     . PHE B 1 201 ? 29.508 -14.648 -32.922 1.00 21.45 ? 701 PHE B C     1 
ATOM   4274 O O     . PHE B 1 201 ? 28.864 -15.691 -32.780 1.00 21.73 ? 701 PHE B O     1 
ATOM   4275 C CB    . PHE B 1 201 ? 29.623 -14.997 -35.421 1.00 20.26 ? 701 PHE B CB    1 
ATOM   4276 C CG    . PHE B 1 201 ? 29.383 -14.362 -36.755 1.00 21.02 ? 701 PHE B CG    1 
ATOM   4277 C CD1   . PHE B 1 201 ? 30.430 -13.772 -37.452 1.00 20.35 ? 701 PHE B CD1   1 
ATOM   4278 C CD2   . PHE B 1 201 ? 28.093 -14.265 -37.272 1.00 20.29 ? 701 PHE B CD2   1 
ATOM   4279 C CE1   . PHE B 1 201 ? 30.198 -13.086 -38.642 1.00 21.25 ? 701 PHE B CE1   1 
ATOM   4280 C CE2   . PHE B 1 201 ? 27.855 -13.578 -38.463 1.00 20.75 ? 701 PHE B CE2   1 
ATOM   4281 C CZ    . PHE B 1 201 ? 28.912 -12.987 -39.145 1.00 20.04 ? 701 PHE B CZ    1 
ATOM   4282 N N     . GLY B 1 202 ? 30.103 -14.011 -31.918 1.00 21.54 ? 702 GLY B N     1 
ATOM   4283 C CA    . GLY B 1 202 ? 30.061 -14.536 -30.565 1.00 21.81 ? 702 GLY B CA    1 
ATOM   4284 C C     . GLY B 1 202 ? 28.714 -14.448 -29.872 1.00 22.27 ? 702 GLY B C     1 
ATOM   4285 O O     . GLY B 1 202 ? 28.535 -15.069 -28.829 1.00 23.26 ? 702 GLY B O     1 
ATOM   4286 N N     . SER B 1 203 ? 27.774 -13.678 -30.426 1.00 22.39 ? 703 SER B N     1 
ATOM   4287 C CA    . SER B 1 203 ? 26.429 -13.537 -29.846 1.00 22.56 ? 703 SER B CA    1 
ATOM   4288 C C     . SER B 1 203 ? 25.389 -14.101 -30.807 1.00 22.75 ? 703 SER B C     1 
ATOM   4289 O O     . SER B 1 203 ? 24.208 -14.194 -30.474 1.00 22.71 ? 703 SER B O     1 
ATOM   4290 C CB    . SER B 1 203 ? 26.080 -12.063 -29.608 1.00 22.92 ? 703 SER B CB    1 
ATOM   4291 O OG    . SER B 1 203 ? 26.894 -11.468 -28.615 1.00 23.81 ? 703 SER B OG    1 
ATOM   4292 N N     . ALA B 1 204 ? 25.839 -14.463 -32.005 1.00 22.89 ? 704 ALA B N     1 
ATOM   4293 C CA    . ALA B 1 204 ? 24.962 -14.981 -33.045 1.00 24.03 ? 704 ALA B CA    1 
ATOM   4294 C C     . ALA B 1 204 ? 24.261 -16.284 -32.667 1.00 24.93 ? 704 ALA B C     1 
ATOM   4295 O O     . ALA B 1 204 ? 24.815 -17.127 -31.960 1.00 24.91 ? 704 ALA B O     1 
ATOM   4296 C CB    . ALA B 1 204 ? 25.756 -15.160 -34.344 1.00 22.38 ? 704 ALA B CB    1 
ATOM   4297 N N     . LYS B 1 205 ? 23.037 -16.442 -33.149 1.00 26.47 ? 705 LYS B N     1 
ATOM   4298 C CA    . LYS B 1 205 ? 22.266 -17.639 -32.856 1.00 28.24 ? 705 LYS B CA    1 
ATOM   4299 C C     . LYS B 1 205 ? 21.124 -17.814 -33.840 1.00 29.04 ? 705 LYS B C     1 
ATOM   4300 O O     . LYS B 1 205 ? 20.533 -16.842 -34.307 1.00 27.91 ? 705 LYS B O     1 
ATOM   4301 C CB    . LYS B 1 205 ? 21.705 -17.552 -31.438 1.00 28.98 ? 705 LYS B CB    1 
ATOM   4302 C CG    . LYS B 1 205 ? 20.962 -18.787 -30.971 1.00 30.40 ? 705 LYS B CG    1 
ATOM   4303 C CD    . LYS B 1 205 ? 20.533 -18.614 -29.522 1.00 32.14 ? 705 LYS B CD    1 
ATOM   4304 C CE    . LYS B 1 205 ? 19.940 -19.891 -28.953 1.00 32.77 ? 705 LYS B CE    1 
ATOM   4305 N NZ    . LYS B 1 205 ? 18.539 -20.043 -29.400 1.00 33.75 ? 705 LYS B NZ    1 
ATOM   4306 N N     . GLN B 1 206 ? 20.820 -19.065 -34.161 1.00 30.46 ? 706 GLN B N     1 
ATOM   4307 C CA    . GLN B 1 206 ? 19.722 -19.352 -35.066 1.00 32.45 ? 706 GLN B CA    1 
ATOM   4308 C C     . GLN B 1 206 ? 18.424 -19.201 -34.278 1.00 32.40 ? 706 GLN B C     1 
ATOM   4309 O O     . GLN B 1 206 ? 18.200 -19.905 -33.295 1.00 32.78 ? 706 GLN B O     1 
ATOM   4310 C CB    . GLN B 1 206 ? 19.838 -20.771 -35.609 1.00 34.05 ? 706 GLN B CB    1 
ATOM   4311 C CG    . GLN B 1 206 ? 18.516 -21.322 -36.090 1.00 37.83 ? 706 GLN B CG    1 
ATOM   4312 C CD    . GLN B 1 206 ? 18.686 -22.364 -37.164 1.00 39.60 ? 706 GLN B CD    1 
ATOM   4313 O OE1   . GLN B 1 206 ? 19.531 -23.253 -37.049 1.00 40.34 ? 706 GLN B OE1   1 
ATOM   4314 N NE2   . GLN B 1 206 ? 17.883 -22.263 -38.223 1.00 40.86 ? 706 GLN B NE2   1 
ATOM   4315 N N     . LEU B 1 207 ? 17.573 -18.280 -34.704 1.00 32.48 ? 707 LEU B N     1 
ATOM   4316 C CA    . LEU B 1 207 ? 16.323 -18.051 -34.009 1.00 33.44 ? 707 LEU B CA    1 
ATOM   4317 C C     . LEU B 1 207 ? 15.226 -18.942 -34.565 1.00 35.29 ? 707 LEU B C     1 
ATOM   4318 O O     . LEU B 1 207 ? 14.895 -18.868 -35.751 1.00 35.71 ? 707 LEU B O     1 
ATOM   4319 C CB    . LEU B 1 207 ? 15.910 -16.585 -34.134 1.00 32.86 ? 707 LEU B CB    1 
ATOM   4320 C CG    . LEU B 1 207 ? 16.901 -15.527 -33.628 1.00 32.16 ? 707 LEU B CG    1 
ATOM   4321 C CD1   . LEU B 1 207 ? 16.223 -14.167 -33.657 1.00 32.08 ? 707 LEU B CD1   1 
ATOM   4322 C CD2   . LEU B 1 207 ? 17.377 -15.860 -32.220 1.00 31.23 ? 707 LEU B CD2   1 
ATOM   4323 N N     . VAL B 1 208 ? 14.673 -19.787 -33.698 1.00 36.53 ? 708 VAL B N     1 
ATOM   4324 C CA    . VAL B 1 208 ? 13.601 -20.700 -34.073 1.00 37.71 ? 708 VAL B CA    1 
ATOM   4325 C C     . VAL B 1 208 ? 12.302 -20.259 -33.419 1.00 38.61 ? 708 VAL B C     1 
ATOM   4326 O O     . VAL B 1 208 ? 12.214 -20.174 -32.196 1.00 38.52 ? 708 VAL B O     1 
ATOM   4327 C CB    . VAL B 1 208 ? 13.910 -22.138 -33.622 1.00 37.88 ? 708 VAL B CB    1 
ATOM   4328 C CG1   . VAL B 1 208 ? 12.866 -23.091 -34.184 1.00 37.97 ? 708 VAL B CG1   1 
ATOM   4329 C CG2   . VAL B 1 208 ? 15.303 -22.540 -34.080 1.00 37.24 ? 708 VAL B CG2   1 
ATOM   4330 N N     . ARG B 1 209 ? 11.301 -19.969 -34.240 1.00 40.16 ? 709 ARG B N     1 
ATOM   4331 C CA    . ARG B 1 209 ? 10.000 -19.539 -33.743 1.00 41.77 ? 709 ARG B CA    1 
ATOM   4332 C C     . ARG B 1 209 ? 9.546  -20.481 -32.632 1.00 41.90 ? 709 ARG B C     1 
ATOM   4333 O O     . ARG B 1 209 ? 9.742  -21.695 -32.715 1.00 42.11 ? 709 ARG B O     1 
ATOM   4334 C CB    . ARG B 1 209 ? 8.984  -19.542 -34.888 1.00 43.89 ? 709 ARG B CB    1 
ATOM   4335 C CG    . ARG B 1 209 ? 7.635  -18.937 -34.544 1.00 46.86 ? 709 ARG B CG    1 
ATOM   4336 C CD    . ARG B 1 209 ? 6.724  -18.917 -35.767 1.00 50.55 ? 709 ARG B CD    1 
ATOM   4337 N NE    . ARG B 1 209 ? 6.519  -20.255 -36.329 1.00 54.11 ? 709 ARG B NE    1 
ATOM   4338 C CZ    . ARG B 1 209 ? 5.685  -20.535 -37.332 1.00 55.40 ? 709 ARG B CZ    1 
ATOM   4339 N NH1   . ARG B 1 209 ? 4.968  -19.569 -37.898 1.00 55.86 ? 709 ARG B NH1   1 
ATOM   4340 N NH2   . ARG B 1 209 ? 5.566  -21.784 -37.771 1.00 55.94 ? 709 ARG B NH2   1 
ATOM   4341 N N     . GLY B 1 210 ? 8.956  -19.918 -31.584 1.00 41.69 ? 710 GLY B N     1 
ATOM   4342 C CA    . GLY B 1 210 ? 8.496  -20.734 -30.478 1.00 41.58 ? 710 GLY B CA    1 
ATOM   4343 C C     . GLY B 1 210 ? 9.568  -20.982 -29.432 1.00 41.59 ? 710 GLY B C     1 
ATOM   4344 O O     . GLY B 1 210 ? 9.273  -21.409 -28.313 1.00 42.23 ? 710 GLY B O     1 
ATOM   4345 N N     . GLU B 1 211 ? 10.821 -20.726 -29.789 1.00 40.84 ? 711 GLU B N     1 
ATOM   4346 C CA    . GLU B 1 211 ? 11.919 -20.919 -28.850 1.00 39.84 ? 711 GLU B CA    1 
ATOM   4347 C C     . GLU B 1 211 ? 12.278 -19.580 -28.208 1.00 38.12 ? 711 GLU B C     1 
ATOM   4348 O O     . GLU B 1 211 ? 12.437 -18.572 -28.899 1.00 37.68 ? 711 GLU B O     1 
ATOM   4349 C CB    . GLU B 1 211 ? 13.144 -21.467 -29.574 1.00 41.60 ? 711 GLU B CB    1 
ATOM   4350 C CG    . GLU B 1 211 ? 13.132 -22.954 -29.823 1.00 43.94 ? 711 GLU B CG    1 
ATOM   4351 C CD    . GLU B 1 211 ? 14.380 -23.400 -30.566 1.00 45.50 ? 711 GLU B CD    1 
ATOM   4352 O OE1   . GLU B 1 211 ? 15.402 -22.676 -30.491 1.00 45.79 ? 711 GLU B OE1   1 
ATOM   4353 O OE2   . GLU B 1 211 ? 14.337 -24.465 -31.223 1.00 46.76 ? 711 GLU B OE2   1 
ATOM   4354 N N     . PRO B 1 212 ? 12.408 -19.551 -26.874 1.00 36.45 ? 712 PRO B N     1 
ATOM   4355 C CA    . PRO B 1 212 ? 12.753 -18.294 -26.197 1.00 34.87 ? 712 PRO B CA    1 
ATOM   4356 C C     . PRO B 1 212 ? 14.243 -17.966 -26.310 1.00 33.11 ? 712 PRO B C     1 
ATOM   4357 O O     . PRO B 1 212 ? 15.078 -18.862 -26.388 1.00 32.72 ? 712 PRO B O     1 
ATOM   4358 C CB    . PRO B 1 212 ? 12.334 -18.545 -24.752 1.00 34.59 ? 712 PRO B CB    1 
ATOM   4359 C CG    . PRO B 1 212 ? 12.499 -20.028 -24.579 1.00 35.52 ? 712 PRO B CG    1 
ATOM   4360 C CD    . PRO B 1 212 ? 12.229 -20.664 -25.923 1.00 35.70 ? 712 PRO B CD    1 
ATOM   4361 N N     . ASN B 1 213 ? 14.575 -16.680 -26.331 1.00 31.38 ? 713 ASN B N     1 
ATOM   4362 C CA    . ASN B 1 213 ? 15.975 -16.278 -26.407 1.00 30.31 ? 713 ASN B CA    1 
ATOM   4363 C C     . ASN B 1 213 ? 16.220 -15.130 -25.434 1.00 28.83 ? 713 ASN B C     1 
ATOM   4364 O O     . ASN B 1 213 ? 15.323 -14.329 -25.184 1.00 28.44 ? 713 ASN B O     1 
ATOM   4365 C CB    . ASN B 1 213 ? 16.328 -15.873 -27.836 1.00 30.48 ? 713 ASN B CB    1 
ATOM   4366 C CG    . ASN B 1 213 ? 16.367 -17.064 -28.777 1.00 30.43 ? 713 ASN B CG    1 
ATOM   4367 O OD1   . ASN B 1 213 ? 17.254 -17.914 -28.687 1.00 30.62 ? 713 ASN B OD1   1 
ATOM   4368 N ND2   . ASN B 1 213 ? 15.398 -17.134 -29.678 1.00 30.58 ? 713 ASN B ND2   1 
ATOM   4369 N N     . VAL B 1 214 ? 17.428 -15.061 -24.883 1.00 28.03 ? 714 VAL B N     1 
ATOM   4370 C CA    . VAL B 1 214 ? 17.759 -14.021 -23.906 1.00 27.76 ? 714 VAL B CA    1 
ATOM   4371 C C     . VAL B 1 214 ? 17.656 -12.610 -24.451 1.00 27.88 ? 714 VAL B C     1 
ATOM   4372 O O     . VAL B 1 214 ? 17.982 -12.350 -25.608 1.00 27.50 ? 714 VAL B O     1 
ATOM   4373 C CB    . VAL B 1 214 ? 19.161 -14.228 -23.315 1.00 27.22 ? 714 VAL B CB    1 
ATOM   4374 C CG1   . VAL B 1 214 ? 19.208 -15.561 -22.621 1.00 26.65 ? 714 VAL B CG1   1 
ATOM   4375 C CG2   . VAL B 1 214 ? 20.224 -14.138 -24.397 1.00 27.23 ? 714 VAL B CG2   1 
ATOM   4376 N N     . SER B 1 215 ? 17.191 -11.691 -23.613 1.00 27.49 ? 715 SER B N     1 
ATOM   4377 C CA    . SER B 1 215 ? 17.048 -10.319 -24.056 1.00 26.86 ? 715 SER B CA    1 
ATOM   4378 C C     . SER B 1 215 ? 18.181 -9.424  -23.585 1.00 25.78 ? 715 SER B C     1 
ATOM   4379 O O     . SER B 1 215 ? 18.103 -8.212  -23.738 1.00 27.06 ? 715 SER B O     1 
ATOM   4380 C CB    . SER B 1 215 ? 15.710 -9.750  -23.585 1.00 27.82 ? 715 SER B CB    1 
ATOM   4381 O OG    . SER B 1 215 ? 15.663 -9.699  -22.176 1.00 29.73 ? 715 SER B OG    1 
ATOM   4382 N N     . TYR B 1 216 ? 19.236 -9.998  -23.019 1.00 24.63 ? 716 TYR B N     1 
ATOM   4383 C CA    . TYR B 1 216 ? 20.341 -9.160  -22.560 1.00 24.63 ? 716 TYR B CA    1 
ATOM   4384 C C     . TYR B 1 216 ? 21.523 -9.107  -23.526 1.00 23.82 ? 716 TYR B C     1 
ATOM   4385 O O     . TYR B 1 216 ? 22.641 -8.752  -23.141 1.00 23.92 ? 716 TYR B O     1 
ATOM   4386 C CB    . TYR B 1 216 ? 20.824 -9.584  -21.162 1.00 25.42 ? 716 TYR B CB    1 
ATOM   4387 C CG    . TYR B 1 216 ? 21.143 -11.051 -21.005 1.00 27.13 ? 716 TYR B CG    1 
ATOM   4388 C CD1   . TYR B 1 216 ? 22.373 -11.571 -21.407 1.00 28.36 ? 716 TYR B CD1   1 
ATOM   4389 C CD2   . TYR B 1 216 ? 20.230 -11.912 -20.417 1.00 28.31 ? 716 TYR B CD2   1 
ATOM   4390 C CE1   . TYR B 1 216 ? 22.683 -12.921 -21.216 1.00 28.68 ? 716 TYR B CE1   1 
ATOM   4391 C CE2   . TYR B 1 216 ? 20.526 -13.253 -20.223 1.00 29.33 ? 716 TYR B CE2   1 
ATOM   4392 C CZ    . TYR B 1 216 ? 21.750 -13.749 -20.620 1.00 30.03 ? 716 TYR B CZ    1 
ATOM   4393 O OH    . TYR B 1 216 ? 22.032 -15.078 -20.398 1.00 32.28 ? 716 TYR B OH    1 
ATOM   4394 N N     . ILE B 1 217 ? 21.279 -9.467  -24.783 1.00 23.12 ? 717 ILE B N     1 
ATOM   4395 C CA    . ILE B 1 217 ? 22.329 -9.402  -25.790 1.00 22.59 ? 717 ILE B CA    1 
ATOM   4396 C C     . ILE B 1 217 ? 22.254 -8.017  -26.438 1.00 22.41 ? 717 ILE B C     1 
ATOM   4397 O O     . ILE B 1 217 ? 21.337 -7.233  -26.150 1.00 21.17 ? 717 ILE B O     1 
ATOM   4398 C CB    . ILE B 1 217 ? 22.159 -10.497 -26.903 1.00 22.28 ? 717 ILE B CB    1 
ATOM   4399 C CG1   . ILE B 1 217 ? 20.677 -10.801 -27.157 1.00 21.83 ? 717 ILE B CG1   1 
ATOM   4400 C CG2   . ILE B 1 217 ? 22.903 -11.763 -26.497 1.00 22.07 ? 717 ILE B CG2   1 
ATOM   4401 C CD1   . ILE B 1 217 ? 19.941 -9.746  -27.935 1.00 20.34 ? 717 ILE B CD1   1 
ATOM   4402 N N     . CYS B 1 218 ? 23.220 -7.728  -27.306 1.00 22.28 ? 718 CYS B N     1 
ATOM   4403 C CA    . CYS B 1 218 ? 23.296 -6.464  -28.030 1.00 23.80 ? 718 CYS B CA    1 
ATOM   4404 C C     . CYS B 1 218 ? 23.790 -5.298  -27.189 1.00 24.71 ? 718 CYS B C     1 
ATOM   4405 O O     . CYS B 1 218 ? 23.394 -5.138  -26.044 1.00 24.83 ? 718 CYS B O     1 
ATOM   4406 C CB    . CYS B 1 218 ? 21.943 -6.107  -28.641 1.00 23.47 ? 718 CYS B CB    1 
ATOM   4407 S SG    . CYS B 1 218 ? 22.106 -5.029  -30.073 1.00 26.20 ? 718 CYS B SG    1 
ATOM   4408 N N     . SER B 1 219 ? 24.653 -4.476  -27.777 1.00 25.92 ? 719 SER B N     1 
ATOM   4409 C CA    . SER B 1 219 ? 25.220 -3.335  -27.079 1.00 26.86 ? 719 SER B CA    1 
ATOM   4410 C C     . SER B 1 219 ? 24.278 -2.155  -26.928 1.00 26.85 ? 719 SER B C     1 
ATOM   4411 O O     . SER B 1 219 ? 23.507 -1.838  -27.834 1.00 25.69 ? 719 SER B O     1 
ATOM   4412 C CB    . SER B 1 219 ? 26.487 -2.889  -27.791 1.00 27.71 ? 719 SER B CB    1 
ATOM   4413 O OG    . SER B 1 219 ? 27.398 -3.968  -27.813 1.00 33.06 ? 719 SER B OG    1 
ATOM   4414 N N     . ARG B 1 220 ? 24.347 -1.510  -25.768 1.00 28.23 ? 720 ARG B N     1 
ATOM   4415 C CA    . ARG B 1 220 ? 23.517 -0.346  -25.489 1.00 30.84 ? 720 ARG B CA    1 
ATOM   4416 C C     . ARG B 1 220 ? 23.728 0.691   -26.591 1.00 29.98 ? 720 ARG B C     1 
ATOM   4417 O O     . ARG B 1 220 ? 24.837 0.858   -27.103 1.00 32.15 ? 720 ARG B O     1 
ATOM   4418 C CB    . ARG B 1 220 ? 23.879 0.257   -24.122 1.00 34.41 ? 720 ARG B CB    1 
ATOM   4419 C CG    . ARG B 1 220 ? 25.267 0.883   -24.056 1.00 39.03 ? 720 ARG B CG    1 
ATOM   4420 C CD    . ARG B 1 220 ? 25.419 1.806   -22.840 1.00 44.03 ? 720 ARG B CD    1 
ATOM   4421 N NE    . ARG B 1 220 ? 26.488 2.785   -23.048 1.00 47.69 ? 720 ARG B NE    1 
ATOM   4422 C CZ    . ARG B 1 220 ? 26.722 3.826   -22.253 1.00 49.51 ? 720 ARG B CZ    1 
ATOM   4423 N NH1   . ARG B 1 220 ? 27.721 4.661   -22.529 1.00 50.09 ? 720 ARG B NH1   1 
ATOM   4424 N NH2   . ARG B 1 220 ? 25.963 4.032   -21.180 1.00 50.66 ? 720 ARG B NH2   1 
ATOM   4425 N N     . TYR B 1 221 ? 22.652 1.385   -26.929 1.00 28.63 ? 721 TYR B N     1 
ATOM   4426 C CA    . TYR B 1 221 ? 22.594 2.395   -27.985 1.00 26.95 ? 721 TYR B CA    1 
ATOM   4427 C C     . TYR B 1 221 ? 22.023 1.727   -29.232 1.00 24.18 ? 721 TYR B C     1 
ATOM   4428 O O     . TYR B 1 221 ? 21.260 2.342   -29.959 1.00 23.62 ? 721 TYR B O     1 
ATOM   4429 C CB    . TYR B 1 221 ? 23.970 2.980   -28.355 1.00 28.78 ? 721 TYR B CB    1 
ATOM   4430 C CG    . TYR B 1 221 ? 24.634 3.870   -27.322 1.00 30.95 ? 721 TYR B CG    1 
ATOM   4431 C CD1   . TYR B 1 221 ? 24.231 3.859   -25.983 1.00 31.80 ? 721 TYR B CD1   1 
ATOM   4432 C CD2   . TYR B 1 221 ? 25.725 4.668   -27.677 1.00 32.13 ? 721 TYR B CD2   1 
ATOM   4433 C CE1   . TYR B 1 221 ? 24.908 4.617   -25.022 1.00 33.34 ? 721 TYR B CE1   1 
ATOM   4434 C CE2   . TYR B 1 221 ? 26.407 5.426   -26.729 1.00 32.34 ? 721 TYR B CE2   1 
ATOM   4435 C CZ    . TYR B 1 221 ? 25.997 5.396   -25.408 1.00 33.67 ? 721 TYR B CZ    1 
ATOM   4436 O OH    . TYR B 1 221 ? 26.693 6.129   -24.468 1.00 35.72 ? 721 TYR B OH    1 
ATOM   4437 N N     . TYR B 1 222 ? 22.396 0.466   -29.465 1.00 22.34 ? 722 TYR B N     1 
ATOM   4438 C CA    . TYR B 1 222 ? 21.952 -0.270  -30.657 1.00 21.08 ? 722 TYR B CA    1 
ATOM   4439 C C     . TYR B 1 222 ? 20.859 -1.315  -30.418 1.00 20.85 ? 722 TYR B C     1 
ATOM   4440 O O     . TYR B 1 222 ? 20.448 -1.999  -31.348 1.00 19.93 ? 722 TYR B O     1 
ATOM   4441 C CB    . TYR B 1 222 ? 23.172 -0.923  -31.335 1.00 19.95 ? 722 TYR B CB    1 
ATOM   4442 C CG    . TYR B 1 222 ? 24.294 0.064   -31.525 1.00 19.96 ? 722 TYR B CG    1 
ATOM   4443 C CD1   . TYR B 1 222 ? 24.247 1.003   -32.556 1.00 18.95 ? 722 TYR B CD1   1 
ATOM   4444 C CD2   . TYR B 1 222 ? 25.346 0.143   -30.605 1.00 19.85 ? 722 TYR B CD2   1 
ATOM   4445 C CE1   . TYR B 1 222 ? 25.203 2.006   -32.667 1.00 19.44 ? 722 TYR B CE1   1 
ATOM   4446 C CE2   . TYR B 1 222 ? 26.317 1.151   -30.705 1.00 20.49 ? 722 TYR B CE2   1 
ATOM   4447 C CZ    . TYR B 1 222 ? 26.234 2.081   -31.734 1.00 20.02 ? 722 TYR B CZ    1 
ATOM   4448 O OH    . TYR B 1 222 ? 27.156 3.109   -31.812 1.00 21.14 ? 722 TYR B OH    1 
ATOM   4449 N N     . ARG B 1 223 ? 20.380 -1.413  -29.182 1.00 21.01 ? 723 ARG B N     1 
ATOM   4450 C CA    . ARG B 1 223 ? 19.334 -2.372  -28.805 1.00 21.97 ? 723 ARG B CA    1 
ATOM   4451 C C     . ARG B 1 223 ? 17.934 -1.996  -29.289 1.00 21.40 ? 723 ARG B C     1 
ATOM   4452 O O     . ARG B 1 223 ? 17.489 -0.866  -29.086 1.00 20.56 ? 723 ARG B O     1 
ATOM   4453 C CB    . ARG B 1 223 ? 19.270 -2.497  -27.282 1.00 24.17 ? 723 ARG B CB    1 
ATOM   4454 C CG    . ARG B 1 223 ? 20.377 -3.289  -26.666 1.00 27.96 ? 723 ARG B CG    1 
ATOM   4455 C CD    . ARG B 1 223 ? 20.501 -2.965  -25.187 1.00 31.18 ? 723 ARG B CD    1 
ATOM   4456 N NE    . ARG B 1 223 ? 19.383 -3.457  -24.381 1.00 34.23 ? 723 ARG B NE    1 
ATOM   4457 C CZ    . ARG B 1 223 ? 19.088 -4.745  -24.193 1.00 35.36 ? 723 ARG B CZ    1 
ATOM   4458 N NH1   . ARG B 1 223 ? 19.822 -5.695  -24.757 1.00 35.41 ? 723 ARG B NH1   1 
ATOM   4459 N NH2   . ARG B 1 223 ? 18.074 -5.085  -23.404 1.00 36.11 ? 723 ARG B NH2   1 
ATOM   4460 N N     . ALA B 1 224 ? 17.233 -2.951  -29.903 1.00 20.99 ? 724 ALA B N     1 
ATOM   4461 C CA    . ALA B 1 224 ? 15.867 -2.718  -30.371 1.00 20.81 ? 724 ALA B CA    1 
ATOM   4462 C C     . ALA B 1 224 ? 14.993 -2.515  -29.130 1.00 20.61 ? 724 ALA B C     1 
ATOM   4463 O O     . ALA B 1 224 ? 15.278 -3.068  -28.072 1.00 20.59 ? 724 ALA B O     1 
ATOM   4464 C CB    . ALA B 1 224 ? 15.366 -3.925  -31.180 1.00 20.41 ? 724 ALA B CB    1 
ATOM   4465 N N     . PRO B 1 225 ? 13.914 -1.725  -29.248 1.00 21.23 ? 725 PRO B N     1 
ATOM   4466 C CA    . PRO B 1 225 ? 13.023 -1.466  -28.108 1.00 21.60 ? 725 PRO B CA    1 
ATOM   4467 C C     . PRO B 1 225 ? 12.432 -2.715  -27.464 1.00 22.35 ? 725 PRO B C     1 
ATOM   4468 O O     . PRO B 1 225 ? 12.187 -2.725  -26.258 1.00 22.48 ? 725 PRO B O     1 
ATOM   4469 C CB    . PRO B 1 225 ? 11.945 -0.541  -28.675 1.00 21.62 ? 725 PRO B CB    1 
ATOM   4470 C CG    . PRO B 1 225 ? 12.066 -0.639  -30.163 1.00 22.27 ? 725 PRO B CG    1 
ATOM   4471 C CD    . PRO B 1 225 ? 13.474 -1.031  -30.474 1.00 21.42 ? 725 PRO B CD    1 
ATOM   4472 N N     . GLU B 1 226 ? 12.200 -3.767  -28.250 1.00 22.57 ? 726 GLU B N     1 
ATOM   4473 C CA    . GLU B 1 226 ? 11.648 -5.005  -27.689 1.00 22.43 ? 726 GLU B CA    1 
ATOM   4474 C C     . GLU B 1 226 ? 12.670 -5.688  -26.772 1.00 22.33 ? 726 GLU B C     1 
ATOM   4475 O O     . GLU B 1 226 ? 12.300 -6.414  -25.840 1.00 22.09 ? 726 GLU B O     1 
ATOM   4476 C CB    . GLU B 1 226 ? 11.181 -5.966  -28.803 1.00 22.13 ? 726 GLU B CB    1 
ATOM   4477 C CG    . GLU B 1 226 ? 12.260 -6.432  -29.777 1.00 22.87 ? 726 GLU B CG    1 
ATOM   4478 C CD    . GLU B 1 226 ? 12.291 -5.610  -31.055 1.00 23.28 ? 726 GLU B CD    1 
ATOM   4479 O OE1   . GLU B 1 226 ? 12.016 -4.390  -30.981 1.00 22.93 ? 726 GLU B OE1   1 
ATOM   4480 O OE2   . GLU B 1 226 ? 12.592 -6.181  -32.130 1.00 23.54 ? 726 GLU B OE2   1 
ATOM   4481 N N     . LEU B 1 227 ? 13.956 -5.455  -27.022 1.00 21.69 ? 727 LEU B N     1 
ATOM   4482 C CA    . LEU B 1 227 ? 14.989 -6.027  -26.163 1.00 21.57 ? 727 LEU B CA    1 
ATOM   4483 C C     . LEU B 1 227 ? 14.999 -5.239  -24.853 1.00 21.93 ? 727 LEU B C     1 
ATOM   4484 O O     . LEU B 1 227 ? 15.120 -5.811  -23.766 1.00 22.22 ? 727 LEU B O     1 
ATOM   4485 C CB    . LEU B 1 227 ? 16.367 -5.929  -26.824 1.00 21.34 ? 727 LEU B CB    1 
ATOM   4486 C CG    . LEU B 1 227 ? 16.594 -6.816  -28.052 1.00 21.09 ? 727 LEU B CG    1 
ATOM   4487 C CD1   . LEU B 1 227 ? 18.065 -6.731  -28.460 1.00 21.34 ? 727 LEU B CD1   1 
ATOM   4488 C CD2   . LEU B 1 227 ? 16.212 -8.258  -27.738 1.00 21.25 ? 727 LEU B CD2   1 
ATOM   4489 N N     . ILE B 1 228 ? 14.881 -3.920  -24.970 1.00 22.01 ? 728 ILE B N     1 
ATOM   4490 C CA    . ILE B 1 228 ? 14.865 -3.048  -23.801 1.00 22.11 ? 728 ILE B CA    1 
ATOM   4491 C C     . ILE B 1 228 ? 13.681 -3.447  -22.932 1.00 23.18 ? 728 ILE B C     1 
ATOM   4492 O O     . ILE B 1 228 ? 13.785 -3.472  -21.709 1.00 23.52 ? 728 ILE B O     1 
ATOM   4493 C CB    . ILE B 1 228 ? 14.747 -1.559  -24.212 1.00 21.32 ? 728 ILE B CB    1 
ATOM   4494 C CG1   . ILE B 1 228 ? 15.955 -1.163  -25.067 1.00 21.31 ? 728 ILE B CG1   1 
ATOM   4495 C CG2   . ILE B 1 228 ? 14.683 -0.657  -22.962 1.00 21.52 ? 728 ILE B CG2   1 
ATOM   4496 C CD1   . ILE B 1 228 ? 15.851 0.247   -25.640 1.00 21.71 ? 728 ILE B CD1   1 
ATOM   4497 N N     . PHE B 1 229 ? 12.564 -3.780  -23.575 1.00 24.61 ? 729 PHE B N     1 
ATOM   4498 C CA    . PHE B 1 229 ? 11.352 -4.199  -22.867 1.00 26.37 ? 729 PHE B CA    1 
ATOM   4499 C C     . PHE B 1 229 ? 11.415 -5.646  -22.372 1.00 27.16 ? 729 PHE B C     1 
ATOM   4500 O O     . PHE B 1 229 ? 10.425 -6.173  -21.871 1.00 28.60 ? 729 PHE B O     1 
ATOM   4501 C CB    . PHE B 1 229 ? 10.129 -4.037  -23.769 1.00 27.17 ? 729 PHE B CB    1 
ATOM   4502 C CG    . PHE B 1 229 ? 9.641  -2.620  -23.887 1.00 28.55 ? 729 PHE B CG    1 
ATOM   4503 C CD1   . PHE B 1 229 ? 9.434  -2.046  -25.135 1.00 29.36 ? 729 PHE B CD1   1 
ATOM   4504 C CD2   . PHE B 1 229 ? 9.352  -1.869  -22.753 1.00 29.87 ? 729 PHE B CD2   1 
ATOM   4505 C CE1   . PHE B 1 229 ? 8.942  -0.741  -25.258 1.00 28.91 ? 729 PHE B CE1   1 
ATOM   4506 C CE2   . PHE B 1 229 ? 8.857  -0.565  -22.866 1.00 30.04 ? 729 PHE B CE2   1 
ATOM   4507 C CZ    . PHE B 1 229 ? 8.653  -0.005  -24.123 1.00 29.79 ? 729 PHE B CZ    1 
ATOM   4508 N N     . GLY B 1 230 ? 12.561 -6.296  -22.536 1.00 27.87 ? 730 GLY B N     1 
ATOM   4509 C CA    . GLY B 1 230 ? 12.718 -7.664  -22.064 1.00 27.99 ? 730 GLY B CA    1 
ATOM   4510 C C     . GLY B 1 230 ? 12.059 -8.795  -22.840 1.00 28.76 ? 730 GLY B C     1 
ATOM   4511 O O     . GLY B 1 230 ? 11.788 -9.854  -22.270 1.00 28.86 ? 730 GLY B O     1 
ATOM   4512 N N     . ALA B 1 231 ? 11.797 -8.604  -24.130 1.00 28.86 ? 731 ALA B N     1 
ATOM   4513 C CA    . ALA B 1 231 ? 11.171 -9.667  -24.919 1.00 28.65 ? 731 ALA B CA    1 
ATOM   4514 C C     . ALA B 1 231 ? 12.135 -10.827 -25.154 1.00 28.53 ? 731 ALA B C     1 
ATOM   4515 O O     . ALA B 1 231 ? 13.341 -10.622 -25.298 1.00 28.58 ? 731 ALA B O     1 
ATOM   4516 C CB    . ALA B 1 231 ? 10.686 -9.115  -26.260 1.00 28.78 ? 731 ALA B CB    1 
ATOM   4517 N N     . THR B 1 232 ? 11.600 -12.047 -25.181 1.00 28.38 ? 732 THR B N     1 
ATOM   4518 C CA    . THR B 1 232 ? 12.411 -13.240 -25.424 1.00 28.55 ? 732 THR B CA    1 
ATOM   4519 C C     . THR B 1 232 ? 11.920 -13.966 -26.682 1.00 28.33 ? 732 THR B C     1 
ATOM   4520 O O     . THR B 1 232 ? 12.435 -15.024 -27.044 1.00 28.13 ? 732 THR B O     1 
ATOM   4521 C CB    . THR B 1 232 ? 12.360 -14.226 -24.235 1.00 29.27 ? 732 THR B CB    1 
ATOM   4522 O OG1   . THR B 1 232 ? 11.018 -14.698 -24.060 1.00 29.63 ? 732 THR B OG1   1 
ATOM   4523 C CG2   . THR B 1 232 ? 12.834 -13.543 -22.958 1.00 29.43 ? 732 THR B CG2   1 
ATOM   4524 N N     . ASP B 1 233 ? 10.923 -13.377 -27.335 1.00 28.26 ? 733 ASP B N     1 
ATOM   4525 C CA    . ASP B 1 233 ? 10.336 -13.929 -28.552 1.00 29.06 ? 733 ASP B CA    1 
ATOM   4526 C C     . ASP B 1 233 ? 10.665 -13.037 -29.751 1.00 28.24 ? 733 ASP B C     1 
ATOM   4527 O O     . ASP B 1 233 ? 9.917  -12.994 -30.736 1.00 28.03 ? 733 ASP B O     1 
ATOM   4528 C CB    . ASP B 1 233 ? 8.815  -14.033 -28.402 1.00 30.46 ? 733 ASP B CB    1 
ATOM   4529 C CG    . ASP B 1 233 ? 8.141  -12.673 -28.354 1.00 32.97 ? 733 ASP B CG    1 
ATOM   4530 O OD1   . ASP B 1 233 ? 8.780  -11.698 -27.894 1.00 34.48 ? 733 ASP B OD1   1 
ATOM   4531 O OD2   . ASP B 1 233 ? 6.971  -12.570 -28.778 1.00 34.69 ? 733 ASP B OD2   1 
ATOM   4532 N N     . TYR B 1 234 ? 11.783 -12.326 -29.666 1.00 26.75 ? 734 TYR B N     1 
ATOM   4533 C CA    . TYR B 1 234 ? 12.180 -11.437 -30.750 1.00 25.75 ? 734 TYR B CA    1 
ATOM   4534 C C     . TYR B 1 234 ? 12.676 -12.219 -31.966 1.00 25.41 ? 734 TYR B C     1 
ATOM   4535 O O     . TYR B 1 234 ? 12.976 -13.412 -31.879 1.00 24.25 ? 734 TYR B O     1 
ATOM   4536 C CB    . TYR B 1 234 ? 13.258 -10.455 -30.268 1.00 24.22 ? 734 TYR B CB    1 
ATOM   4537 C CG    . TYR B 1 234 ? 14.489 -11.120 -29.688 1.00 23.17 ? 734 TYR B CG    1 
ATOM   4538 C CD1   . TYR B 1 234 ? 15.527 -11.549 -30.513 1.00 22.93 ? 734 TYR B CD1   1 
ATOM   4539 C CD2   . TYR B 1 234 ? 14.615 -11.316 -28.307 1.00 22.81 ? 734 TYR B CD2   1 
ATOM   4540 C CE1   . TYR B 1 234 ? 16.667 -12.159 -29.979 1.00 22.30 ? 734 TYR B CE1   1 
ATOM   4541 C CE2   . TYR B 1 234 ? 15.745 -11.922 -27.763 1.00 22.14 ? 734 TYR B CE2   1 
ATOM   4542 C CZ    . TYR B 1 234 ? 16.767 -12.340 -28.601 1.00 21.70 ? 734 TYR B CZ    1 
ATOM   4543 O OH    . TYR B 1 234 ? 17.892 -12.928 -28.068 1.00 22.34 ? 734 TYR B OH    1 
ATOM   4544 N N     . THR B 1 235 ? 12.764 -11.519 -33.095 1.00 25.52 ? 735 THR B N     1 
ATOM   4545 C CA    . THR B 1 235 ? 13.198 -12.098 -34.359 1.00 24.86 ? 735 THR B CA    1 
ATOM   4546 C C     . THR B 1 235 ? 14.472 -11.423 -34.879 1.00 24.66 ? 735 THR B C     1 
ATOM   4547 O O     . THR B 1 235 ? 15.090 -10.610 -34.192 1.00 24.20 ? 735 THR B O     1 
ATOM   4548 C CB    . THR B 1 235 ? 12.104 -11.939 -35.419 1.00 25.34 ? 735 THR B CB    1 
ATOM   4549 O OG1   . THR B 1 235 ? 11.963 -10.551 -35.749 1.00 25.89 ? 735 THR B OG1   1 
ATOM   4550 C CG2   . THR B 1 235 ? 10.771 -12.440 -34.880 1.00 25.34 ? 735 THR B CG2   1 
ATOM   4551 N N     . SER B 1 236 ? 14.847 -11.761 -36.106 1.00 23.43 ? 736 SER B N     1 
ATOM   4552 C CA    . SER B 1 236 ? 16.044 -11.208 -36.721 1.00 23.19 ? 736 SER B CA    1 
ATOM   4553 C C     . SER B 1 236 ? 15.915 -9.721  -36.997 1.00 22.02 ? 736 SER B C     1 
ATOM   4554 O O     . SER B 1 236 ? 16.909 -9.045  -37.268 1.00 21.74 ? 736 SER B O     1 
ATOM   4555 C CB    . SER B 1 236 ? 16.344 -11.957 -38.021 1.00 24.10 ? 736 SER B CB    1 
ATOM   4556 O OG    . SER B 1 236 ? 16.840 -13.254 -37.732 1.00 26.24 ? 736 SER B OG    1 
ATOM   4557 N N     . SER B 1 237 ? 14.695 -9.200  -36.924 1.00 21.26 ? 737 SER B N     1 
ATOM   4558 C CA    . SER B 1 237 ? 14.500 -7.788  -37.180 1.00 20.80 ? 737 SER B CA    1 
ATOM   4559 C C     . SER B 1 237 ? 15.179 -6.923  -36.115 1.00 20.71 ? 737 SER B C     1 
ATOM   4560 O O     . SER B 1 237 ? 15.194 -5.704  -36.246 1.00 20.93 ? 737 SER B O     1 
ATOM   4561 C CB    . SER B 1 237 ? 13.014 -7.449  -37.279 1.00 21.71 ? 737 SER B CB    1 
ATOM   4562 O OG    . SER B 1 237 ? 12.366 -7.601  -36.031 1.00 23.86 ? 737 SER B OG    1 
ATOM   4563 N N     . ILE B 1 238 ? 15.726 -7.527  -35.057 1.00 19.35 ? 738 ILE B N     1 
ATOM   4564 C CA    . ILE B 1 238 ? 16.423 -6.703  -34.067 1.00 18.60 ? 738 ILE B CA    1 
ATOM   4565 C C     . ILE B 1 238 ? 17.733 -6.238  -34.712 1.00 18.36 ? 738 ILE B C     1 
ATOM   4566 O O     . ILE B 1 238 ? 18.258 -5.183  -34.368 1.00 18.26 ? 738 ILE B O     1 
ATOM   4567 C CB    . ILE B 1 238 ? 16.744 -7.451  -32.739 1.00 17.88 ? 738 ILE B CB    1 
ATOM   4568 C CG1   . ILE B 1 238 ? 17.654 -8.653  -32.988 1.00 18.07 ? 738 ILE B CG1   1 
ATOM   4569 C CG2   . ILE B 1 238 ? 15.439 -7.837  -32.039 1.00 18.18 ? 738 ILE B CG2   1 
ATOM   4570 C CD1   . ILE B 1 238 ? 18.388 -9.147  -31.719 1.00 18.38 ? 738 ILE B CD1   1 
ATOM   4571 N N     . ASP B 1 239 ? 18.252 -7.021  -35.658 1.00 17.89 ? 739 ASP B N     1 
ATOM   4572 C CA    . ASP B 1 239 ? 19.491 -6.646  -36.353 1.00 17.91 ? 739 ASP B CA    1 
ATOM   4573 C C     . ASP B 1 239 ? 19.219 -5.451  -37.264 1.00 17.93 ? 739 ASP B C     1 
ATOM   4574 O O     . ASP B 1 239 ? 20.105 -4.621  -37.504 1.00 17.70 ? 739 ASP B O     1 
ATOM   4575 C CB    . ASP B 1 239 ? 20.013 -7.790  -37.223 1.00 17.97 ? 739 ASP B CB    1 
ATOM   4576 C CG    . ASP B 1 239 ? 20.757 -8.853  -36.435 1.00 17.94 ? 739 ASP B CG    1 
ATOM   4577 O OD1   . ASP B 1 239 ? 20.938 -9.949  -37.002 1.00 18.30 ? 739 ASP B OD1   1 
ATOM   4578 O OD2   . ASP B 1 239 ? 21.159 -8.617  -35.274 1.00 16.10 ? 739 ASP B OD2   1 
ATOM   4579 N N     . VAL B 1 240 ? 17.998 -5.368  -37.788 1.00 17.91 ? 740 VAL B N     1 
ATOM   4580 C CA    . VAL B 1 240 ? 17.646 -4.266  -38.672 1.00 17.70 ? 740 VAL B CA    1 
ATOM   4581 C C     . VAL B 1 240 ? 17.557 -2.976  -37.875 1.00 17.52 ? 740 VAL B C     1 
ATOM   4582 O O     . VAL B 1 240 ? 17.996 -1.929  -38.349 1.00 16.84 ? 740 VAL B O     1 
ATOM   4583 C CB    . VAL B 1 240 ? 16.324 -4.537  -39.411 1.00 18.01 ? 740 VAL B CB    1 
ATOM   4584 C CG1   . VAL B 1 240 ? 15.895 -3.303  -40.213 1.00 18.03 ? 740 VAL B CG1   1 
ATOM   4585 C CG2   . VAL B 1 240 ? 16.508 -5.726  -40.339 1.00 18.51 ? 740 VAL B CG2   1 
ATOM   4586 N N     . TRP B 1 241 ? 16.995 -3.042  -36.666 1.00 17.13 ? 741 TRP B N     1 
ATOM   4587 C CA    . TRP B 1 241 ? 16.915 -1.839  -35.822 1.00 17.16 ? 741 TRP B CA    1 
ATOM   4588 C C     . TRP B 1 241 ? 18.346 -1.339  -35.574 1.00 16.88 ? 741 TRP B C     1 
ATOM   4589 O O     . TRP B 1 241 ? 18.635 -0.153  -35.751 1.00 17.24 ? 741 TRP B O     1 
ATOM   4590 C CB    . TRP B 1 241 ? 16.237 -2.144  -34.468 1.00 17.63 ? 741 TRP B CB    1 
ATOM   4591 C CG    . TRP B 1 241 ? 16.281 -0.987  -33.478 1.00 17.49 ? 741 TRP B CG    1 
ATOM   4592 C CD1   . TRP B 1 241 ? 17.310 -0.674  -32.632 1.00 17.03 ? 741 TRP B CD1   1 
ATOM   4593 C CD2   . TRP B 1 241 ? 15.274 0.021   -33.270 1.00 17.85 ? 741 TRP B CD2   1 
ATOM   4594 N NE1   . TRP B 1 241 ? 17.011 0.464   -31.915 1.00 17.73 ? 741 TRP B NE1   1 
ATOM   4595 C CE2   . TRP B 1 241 ? 15.771 0.912   -32.285 1.00 18.06 ? 741 TRP B CE2   1 
ATOM   4596 C CE3   . TRP B 1 241 ? 14.005 0.260   -33.818 1.00 18.33 ? 741 TRP B CE3   1 
ATOM   4597 C CZ2   . TRP B 1 241 ? 15.042 2.027   -31.835 1.00 17.64 ? 741 TRP B CZ2   1 
ATOM   4598 C CZ3   . TRP B 1 241 ? 13.278 1.374   -33.370 1.00 20.03 ? 741 TRP B CZ3   1 
ATOM   4599 C CH2   . TRP B 1 241 ? 13.806 2.241   -32.387 1.00 19.15 ? 741 TRP B CH2   1 
ATOM   4600 N N     . SER B 1 242 ? 19.236 -2.250  -35.183 1.00 16.58 ? 742 SER B N     1 
ATOM   4601 C CA    . SER B 1 242 ? 20.633 -1.899  -34.915 1.00 16.79 ? 742 SER B CA    1 
ATOM   4602 C C     . SER B 1 242 ? 21.312 -1.260  -36.124 1.00 16.84 ? 742 SER B C     1 
ATOM   4603 O O     . SER B 1 242 ? 22.031 -0.268  -35.983 1.00 16.45 ? 742 SER B O     1 
ATOM   4604 C CB    . SER B 1 242 ? 21.427 -3.136  -34.500 1.00 16.84 ? 742 SER B CB    1 
ATOM   4605 O OG    . SER B 1 242 ? 20.805 -3.804  -33.409 1.00 20.06 ? 742 SER B OG    1 
ATOM   4606 N N     . ALA B 1 243 ? 21.098 -1.830  -37.310 1.00 16.76 ? 743 ALA B N     1 
ATOM   4607 C CA    . ALA B 1 243 ? 21.700 -1.287  -38.524 1.00 16.89 ? 743 ALA B CA    1 
ATOM   4608 C C     . ALA B 1 243 ? 21.154 0.126   -38.726 1.00 16.89 ? 743 ALA B C     1 
ATOM   4609 O O     . ALA B 1 243 ? 21.865 1.020   -39.182 1.00 17.86 ? 743 ALA B O     1 
ATOM   4610 C CB    . ALA B 1 243 ? 21.360 -2.181  -39.737 1.00 17.75 ? 743 ALA B CB    1 
ATOM   4611 N N     . GLY B 1 244 ? 19.887 0.323   -38.385 1.00 16.78 ? 744 GLY B N     1 
ATOM   4612 C CA    . GLY B 1 244 ? 19.286 1.642   -38.513 1.00 16.95 ? 744 GLY B CA    1 
ATOM   4613 C C     . GLY B 1 244 ? 19.953 2.634   -37.563 1.00 17.42 ? 744 GLY B C     1 
ATOM   4614 O O     . GLY B 1 244 ? 20.114 3.815   -37.882 1.00 17.99 ? 744 GLY B O     1 
ATOM   4615 N N     . CYS B 1 245 ? 20.340 2.157   -36.383 1.00 17.86 ? 745 CYS B N     1 
ATOM   4616 C CA    . CYS B 1 245 ? 21.015 3.015   -35.409 1.00 17.68 ? 745 CYS B CA    1 
ATOM   4617 C C     . CYS B 1 245 ? 22.406 3.384   -35.937 1.00 17.93 ? 745 CYS B C     1 
ATOM   4618 O O     . CYS B 1 245 ? 22.906 4.481   -35.692 1.00 18.14 ? 745 CYS B O     1 
ATOM   4619 C CB    . CYS B 1 245 ? 21.142 2.290   -34.067 1.00 17.95 ? 745 CYS B CB    1 
ATOM   4620 S SG    . CYS B 1 245 ? 19.565 2.140   -33.179 1.00 18.88 ? 745 CYS B SG    1 
ATOM   4621 N N     . VAL B 1 246 ? 23.036 2.460   -36.655 1.00 17.45 ? 746 VAL B N     1 
ATOM   4622 C CA    . VAL B 1 246 ? 24.352 2.734   -37.215 1.00 17.86 ? 746 VAL B CA    1 
ATOM   4623 C C     . VAL B 1 246 ? 24.228 3.781   -38.323 1.00 18.38 ? 746 VAL B C     1 
ATOM   4624 O O     . VAL B 1 246 ? 25.034 4.712   -38.401 1.00 18.74 ? 746 VAL B O     1 
ATOM   4625 C CB    . VAL B 1 246 ? 25.005 1.445   -37.779 1.00 17.16 ? 746 VAL B CB    1 
ATOM   4626 C CG1   . VAL B 1 246 ? 26.284 1.788   -38.548 1.00 16.61 ? 746 VAL B CG1   1 
ATOM   4627 C CG2   . VAL B 1 246 ? 25.331 0.486   -36.618 1.00 17.18 ? 746 VAL B CG2   1 
ATOM   4628 N N     . LEU B 1 247 ? 23.221 3.637   -39.181 1.00 18.09 ? 747 LEU B N     1 
ATOM   4629 C CA    . LEU B 1 247 ? 23.033 4.592   -40.266 1.00 19.05 ? 747 LEU B CA    1 
ATOM   4630 C C     . LEU B 1 247 ? 22.774 5.988   -39.696 1.00 19.24 ? 747 LEU B C     1 
ATOM   4631 O O     . LEU B 1 247 ? 23.403 6.961   -40.101 1.00 19.60 ? 747 LEU B O     1 
ATOM   4632 C CB    . LEU B 1 247 ? 21.853 4.179   -41.153 1.00 19.31 ? 747 LEU B CB    1 
ATOM   4633 C CG    . LEU B 1 247 ? 21.295 5.271   -42.084 1.00 19.98 ? 747 LEU B CG    1 
ATOM   4634 C CD1   . LEU B 1 247 ? 22.379 5.733   -43.053 1.00 20.56 ? 747 LEU B CD1   1 
ATOM   4635 C CD2   . LEU B 1 247 ? 20.094 4.728   -42.855 1.00 21.29 ? 747 LEU B CD2   1 
ATOM   4636 N N     . ALA B 1 248 ? 21.842 6.080   -38.757 1.00 19.32 ? 748 ALA B N     1 
ATOM   4637 C CA    . ALA B 1 248 ? 21.510 7.360   -38.152 1.00 20.30 ? 748 ALA B CA    1 
ATOM   4638 C C     . ALA B 1 248 ? 22.748 7.983   -37.523 1.00 20.97 ? 748 ALA B C     1 
ATOM   4639 O O     . ALA B 1 248 ? 22.966 9.190   -37.634 1.00 22.20 ? 748 ALA B O     1 
ATOM   4640 C CB    . ALA B 1 248 ? 20.424 7.174   -37.108 1.00 19.63 ? 748 ALA B CB    1 
ATOM   4641 N N     . GLU B 1 249 ? 23.566 7.153   -36.883 1.00 21.75 ? 749 GLU B N     1 
ATOM   4642 C CA    . GLU B 1 249 ? 24.783 7.622   -36.226 1.00 21.86 ? 749 GLU B CA    1 
ATOM   4643 C C     . GLU B 1 249 ? 25.788 8.170   -37.234 1.00 22.08 ? 749 GLU B C     1 
ATOM   4644 O O     . GLU B 1 249 ? 26.426 9.193   -36.989 1.00 20.72 ? 749 GLU B O     1 
ATOM   4645 C CB    . GLU B 1 249 ? 25.416 6.486   -35.416 1.00 21.91 ? 749 GLU B CB    1 
ATOM   4646 C CG    . GLU B 1 249 ? 26.692 6.883   -34.700 1.00 23.61 ? 749 GLU B CG    1 
ATOM   4647 C CD    . GLU B 1 249 ? 27.111 5.897   -33.617 1.00 24.67 ? 749 GLU B CD    1 
ATOM   4648 O OE1   . GLU B 1 249 ? 26.321 4.991   -33.260 1.00 24.74 ? 749 GLU B OE1   1 
ATOM   4649 O OE2   . GLU B 1 249 ? 28.246 6.038   -33.115 1.00 24.61 ? 749 GLU B OE2   1 
ATOM   4650 N N     . LEU B 1 250 ? 25.937 7.494   -38.368 1.00 22.02 ? 750 LEU B N     1 
ATOM   4651 C CA    . LEU B 1 250 ? 26.873 7.964   -39.386 1.00 22.81 ? 750 LEU B CA    1 
ATOM   4652 C C     . LEU B 1 250 ? 26.415 9.298   -39.975 1.00 23.90 ? 750 LEU B C     1 
ATOM   4653 O O     . LEU B 1 250 ? 27.237 10.126  -40.374 1.00 24.38 ? 750 LEU B O     1 
ATOM   4654 C CB    . LEU B 1 250 ? 27.017 6.933   -40.501 1.00 22.82 ? 750 LEU B CB    1 
ATOM   4655 C CG    . LEU B 1 250 ? 27.713 5.634   -40.098 1.00 23.05 ? 750 LEU B CG    1 
ATOM   4656 C CD1   . LEU B 1 250 ? 27.736 4.683   -41.294 1.00 23.41 ? 750 LEU B CD1   1 
ATOM   4657 C CD2   . LEU B 1 250 ? 29.126 5.936   -39.604 1.00 23.49 ? 750 LEU B CD2   1 
ATOM   4658 N N     . LEU B 1 251 ? 25.104 9.512   -40.022 1.00 24.39 ? 751 LEU B N     1 
ATOM   4659 C CA    . LEU B 1 251 ? 24.563 10.760  -40.550 1.00 25.26 ? 751 LEU B CA    1 
ATOM   4660 C C     . LEU B 1 251 ? 24.625 11.880  -39.507 1.00 26.23 ? 751 LEU B C     1 
ATOM   4661 O O     . LEU B 1 251 ? 24.869 13.037  -39.845 1.00 26.73 ? 751 LEU B O     1 
ATOM   4662 C CB    . LEU B 1 251 ? 23.113 10.569  -40.995 1.00 24.33 ? 751 LEU B CB    1 
ATOM   4663 C CG    . LEU B 1 251 ? 22.850 9.655   -42.194 1.00 24.48 ? 751 LEU B CG    1 
ATOM   4664 C CD1   . LEU B 1 251 ? 21.352 9.459   -42.337 1.00 24.26 ? 751 LEU B CD1   1 
ATOM   4665 C CD2   . LEU B 1 251 ? 23.442 10.255  -43.469 1.00 23.77 ? 751 LEU B CD2   1 
ATOM   4666 N N     . LEU B 1 252 ? 24.413 11.529  -38.245 1.00 26.41 ? 752 LEU B N     1 
ATOM   4667 C CA    . LEU B 1 252 ? 24.419 12.504  -37.156 1.00 27.83 ? 752 LEU B CA    1 
ATOM   4668 C C     . LEU B 1 252 ? 25.787 12.890  -36.600 1.00 27.83 ? 752 LEU B C     1 
ATOM   4669 O O     . LEU B 1 252 ? 25.982 14.018  -36.164 1.00 28.71 ? 752 LEU B O     1 
ATOM   4670 C CB    . LEU B 1 252 ? 23.581 11.988  -35.993 1.00 28.36 ? 752 LEU B CB    1 
ATOM   4671 C CG    . LEU B 1 252 ? 22.072 12.016  -36.176 1.00 30.20 ? 752 LEU B CG    1 
ATOM   4672 C CD1   . LEU B 1 252 ? 21.422 11.175  -35.082 1.00 30.12 ? 752 LEU B CD1   1 
ATOM   4673 C CD2   . LEU B 1 252 ? 21.577 13.465  -36.126 1.00 30.40 ? 752 LEU B CD2   1 
ATOM   4674 N N     . GLY B 1 253 ? 26.722 11.950  -36.589 1.00 27.84 ? 753 GLY B N     1 
ATOM   4675 C CA    . GLY B 1 253 ? 28.031 12.230  -36.031 1.00 27.59 ? 753 GLY B CA    1 
ATOM   4676 C C     . GLY B 1 253 ? 28.083 11.764  -34.582 1.00 28.17 ? 753 GLY B C     1 
ATOM   4677 O O     . GLY B 1 253 ? 29.120 11.866  -33.928 1.00 28.16 ? 753 GLY B O     1 
ATOM   4678 N N     . GLN B 1 254 ? 26.956 11.260  -34.077 1.00 27.87 ? 754 GLN B N     1 
ATOM   4679 C CA    . GLN B 1 254 ? 26.865 10.754  -32.708 1.00 28.38 ? 754 GLN B CA    1 
ATOM   4680 C C     . GLN B 1 254 ? 25.713 9.756   -32.634 1.00 26.96 ? 754 GLN B C     1 
ATOM   4681 O O     . GLN B 1 254 ? 24.820 9.777   -33.478 1.00 26.48 ? 754 GLN B O     1 
ATOM   4682 C CB    . GLN B 1 254 ? 26.615 11.901  -31.716 1.00 29.90 ? 754 GLN B CB    1 
ATOM   4683 C CG    . GLN B 1 254 ? 25.364 12.721  -32.014 1.00 34.79 ? 754 GLN B CG    1 
ATOM   4684 C CD    . GLN B 1 254 ? 25.015 13.728  -30.914 1.00 37.88 ? 754 GLN B CD    1 
ATOM   4685 O OE1   . GLN B 1 254 ? 25.817 14.003  -30.019 1.00 40.28 ? 754 GLN B OE1   1 
ATOM   4686 N NE2   . GLN B 1 254 ? 23.808 14.282  -30.984 1.00 39.26 ? 754 GLN B NE2   1 
ATOM   4687 N N     . PRO B 1 255 ? 25.730 8.854   -31.636 1.00 26.66 ? 755 PRO B N     1 
ATOM   4688 C CA    . PRO B 1 255 ? 24.647 7.866   -31.501 1.00 26.32 ? 755 PRO B CA    1 
ATOM   4689 C C     . PRO B 1 255 ? 23.289 8.552   -31.418 1.00 25.95 ? 755 PRO B C     1 
ATOM   4690 O O     . PRO B 1 255 ? 23.147 9.589   -30.772 1.00 25.83 ? 755 PRO B O     1 
ATOM   4691 C CB    . PRO B 1 255 ? 24.981 7.122   -30.209 1.00 26.32 ? 755 PRO B CB    1 
ATOM   4692 C CG    . PRO B 1 255 ? 26.432 7.343   -30.001 1.00 27.20 ? 755 PRO B CG    1 
ATOM   4693 C CD    . PRO B 1 255 ? 26.764 8.685   -30.602 1.00 26.20 ? 755 PRO B CD    1 
ATOM   4694 N N     . ILE B 1 256 ? 22.281 7.978   -32.066 1.00 25.45 ? 756 ILE B N     1 
ATOM   4695 C CA    . ILE B 1 256 ? 20.960 8.592   -32.041 1.00 24.65 ? 756 ILE B CA    1 
ATOM   4696 C C     . ILE B 1 256 ? 20.164 8.330   -30.754 1.00 24.18 ? 756 ILE B C     1 
ATOM   4697 O O     . ILE B 1 256 ? 19.429 9.207   -30.302 1.00 23.72 ? 756 ILE B O     1 
ATOM   4698 C CB    . ILE B 1 256 ? 20.125 8.164   -33.280 1.00 25.07 ? 756 ILE B CB    1 
ATOM   4699 C CG1   . ILE B 1 256 ? 18.766 8.878   -33.258 1.00 26.11 ? 756 ILE B CG1   1 
ATOM   4700 C CG2   . ILE B 1 256 ? 19.983 6.650   -33.326 1.00 24.39 ? 756 ILE B CG2   1 
ATOM   4701 C CD1   . ILE B 1 256 ? 17.968 8.771   -34.561 1.00 27.35 ? 756 ILE B CD1   1 
ATOM   4702 N N     . PHE B 1 257 ? 20.322 7.150   -30.153 1.00 23.69 ? 757 PHE B N     1 
ATOM   4703 C CA    . PHE B 1 257 ? 19.586 6.817   -28.933 1.00 24.15 ? 757 PHE B CA    1 
ATOM   4704 C C     . PHE B 1 257 ? 20.489 6.499   -27.741 1.00 25.07 ? 757 PHE B C     1 
ATOM   4705 O O     . PHE B 1 257 ? 20.493 5.380   -27.228 1.00 25.40 ? 757 PHE B O     1 
ATOM   4706 C CB    . PHE B 1 257 ? 18.648 5.630   -29.196 1.00 22.51 ? 757 PHE B CB    1 
ATOM   4707 C CG    . PHE B 1 257 ? 17.661 5.871   -30.310 1.00 22.11 ? 757 PHE B CG    1 
ATOM   4708 C CD1   . PHE B 1 257 ? 17.518 4.950   -31.342 1.00 22.01 ? 757 PHE B CD1   1 
ATOM   4709 C CD2   . PHE B 1 257 ? 16.875 7.024   -30.325 1.00 22.11 ? 757 PHE B CD2   1 
ATOM   4710 C CE1   . PHE B 1 257 ? 16.608 5.167   -32.379 1.00 22.38 ? 757 PHE B CE1   1 
ATOM   4711 C CE2   . PHE B 1 257 ? 15.960 7.260   -31.353 1.00 22.97 ? 757 PHE B CE2   1 
ATOM   4712 C CZ    . PHE B 1 257 ? 15.825 6.322   -32.390 1.00 22.97 ? 757 PHE B CZ    1 
ATOM   4713 N N     . PRO B 1 258 ? 21.268 7.487   -27.274 1.00 26.19 ? 758 PRO B N     1 
ATOM   4714 C CA    . PRO B 1 258 ? 22.143 7.204   -26.130 1.00 27.01 ? 758 PRO B CA    1 
ATOM   4715 C C     . PRO B 1 258 ? 21.374 7.123   -24.814 1.00 27.88 ? 758 PRO B C     1 
ATOM   4716 O O     . PRO B 1 258 ? 20.206 7.500   -24.746 1.00 27.32 ? 758 PRO B O     1 
ATOM   4717 C CB    . PRO B 1 258 ? 23.132 8.366   -26.144 1.00 26.84 ? 758 PRO B CB    1 
ATOM   4718 C CG    . PRO B 1 258 ? 22.356 9.501   -26.742 1.00 26.65 ? 758 PRO B CG    1 
ATOM   4719 C CD    . PRO B 1 258 ? 21.400 8.878   -27.748 1.00 26.46 ? 758 PRO B CD    1 
ATOM   4720 N N     . GLY B 1 259 ? 22.037 6.626   -23.775 1.00 29.37 ? 759 GLY B N     1 
ATOM   4721 C CA    . GLY B 1 259 ? 21.407 6.512   -22.472 1.00 30.44 ? 759 GLY B CA    1 
ATOM   4722 C C     . GLY B 1 259 ? 22.153 5.534   -21.584 1.00 31.77 ? 759 GLY B C     1 
ATOM   4723 O O     . GLY B 1 259 ? 22.596 4.474   -22.041 1.00 31.89 ? 759 GLY B O     1 
ATOM   4724 N N     . ASP B 1 260 ? 22.295 5.877   -20.311 1.00 32.25 ? 760 ASP B N     1 
ATOM   4725 C CA    . ASP B 1 260 ? 22.998 5.001   -19.381 1.00 33.17 ? 760 ASP B CA    1 
ATOM   4726 C C     . ASP B 1 260 ? 22.072 3.925   -18.825 1.00 31.99 ? 760 ASP B C     1 
ATOM   4727 O O     . ASP B 1 260 ? 22.528 2.911   -18.298 1.00 32.01 ? 760 ASP B O     1 
ATOM   4728 C CB    . ASP B 1 260 ? 23.606 5.820   -18.243 1.00 35.47 ? 760 ASP B CB    1 
ATOM   4729 C CG    . ASP B 1 260 ? 24.893 6.513   -18.657 1.00 38.12 ? 760 ASP B CG    1 
ATOM   4730 O OD1   . ASP B 1 260 ? 25.348 6.301   -19.810 1.00 39.07 ? 760 ASP B OD1   1 
ATOM   4731 O OD2   . ASP B 1 260 ? 25.449 7.271   -17.831 1.00 40.20 ? 760 ASP B OD2   1 
ATOM   4732 N N     . SER B 1 261 ? 20.768 4.150   -18.947 1.00 31.05 ? 761 SER B N     1 
ATOM   4733 C CA    . SER B 1 261 ? 19.778 3.188   -18.484 1.00 29.93 ? 761 SER B CA    1 
ATOM   4734 C C     . SER B 1 261 ? 18.766 2.946   -19.605 1.00 29.37 ? 761 SER B C     1 
ATOM   4735 O O     . SER B 1 261 ? 18.689 3.724   -20.557 1.00 28.85 ? 761 SER B O     1 
ATOM   4736 C CB    . SER B 1 261 ? 19.060 3.715   -17.240 1.00 29.72 ? 761 SER B CB    1 
ATOM   4737 O OG    . SER B 1 261 ? 18.044 4.633   -17.595 1.00 29.88 ? 761 SER B OG    1 
ATOM   4738 N N     . GLY B 1 262 ? 18.003 1.862   -19.492 1.00 29.20 ? 762 GLY B N     1 
ATOM   4739 C CA    . GLY B 1 262 ? 17.000 1.557   -20.498 1.00 28.19 ? 762 GLY B CA    1 
ATOM   4740 C C     . GLY B 1 262 ? 15.947 2.648   -20.599 1.00 28.43 ? 762 GLY B C     1 
ATOM   4741 O O     . GLY B 1 262 ? 15.487 2.965   -21.692 1.00 27.50 ? 762 GLY B O     1 
ATOM   4742 N N     . VAL B 1 263 ? 15.556 3.232   -19.465 1.00 28.56 ? 763 VAL B N     1 
ATOM   4743 C CA    . VAL B 1 263 ? 14.548 4.290   -19.486 1.00 28.52 ? 763 VAL B CA    1 
ATOM   4744 C C     . VAL B 1 263 ? 15.047 5.509   -20.257 1.00 28.12 ? 763 VAL B C     1 
ATOM   4745 O O     . VAL B 1 263 ? 14.292 6.128   -21.004 1.00 28.01 ? 763 VAL B O     1 
ATOM   4746 C CB    . VAL B 1 263 ? 14.115 4.718   -18.044 1.00 29.63 ? 763 VAL B CB    1 
ATOM   4747 C CG1   . VAL B 1 263 ? 13.672 3.505   -17.256 1.00 30.30 ? 763 VAL B CG1   1 
ATOM   4748 C CG2   . VAL B 1 263 ? 15.252 5.407   -17.326 1.00 29.18 ? 763 VAL B CG2   1 
ATOM   4749 N N     . ASP B 1 264 ? 16.319 5.849   -20.086 1.00 27.97 ? 764 ASP B N     1 
ATOM   4750 C CA    . ASP B 1 264 ? 16.896 6.998   -20.780 1.00 27.90 ? 764 ASP B CA    1 
ATOM   4751 C C     . ASP B 1 264 ? 16.910 6.736   -22.282 1.00 27.66 ? 764 ASP B C     1 
ATOM   4752 O O     . ASP B 1 264 ? 16.673 7.642   -23.081 1.00 27.23 ? 764 ASP B O     1 
ATOM   4753 C CB    . ASP B 1 264 ? 18.325 7.251   -20.296 1.00 29.57 ? 764 ASP B CB    1 
ATOM   4754 C CG    . ASP B 1 264 ? 18.373 7.886   -18.909 1.00 31.79 ? 764 ASP B CG    1 
ATOM   4755 O OD1   . ASP B 1 264 ? 19.470 7.918   -18.316 1.00 33.74 ? 764 ASP B OD1   1 
ATOM   4756 O OD2   . ASP B 1 264 ? 17.323 8.346   -18.407 1.00 32.31 ? 764 ASP B OD2   1 
ATOM   4757 N N     . GLN B 1 265 ? 17.202 5.494   -22.658 1.00 26.66 ? 765 GLN B N     1 
ATOM   4758 C CA    . GLN B 1 265 ? 17.234 5.119   -24.065 1.00 26.28 ? 765 GLN B CA    1 
ATOM   4759 C C     . GLN B 1 265 ? 15.823 5.183   -24.634 1.00 25.74 ? 765 GLN B C     1 
ATOM   4760 O O     . GLN B 1 265 ? 15.605 5.705   -25.731 1.00 25.15 ? 765 GLN B O     1 
ATOM   4761 C CB    . GLN B 1 265 ? 17.815 3.710   -24.227 1.00 27.52 ? 765 GLN B CB    1 
ATOM   4762 C CG    . GLN B 1 265 ? 19.328 3.650   -24.053 1.00 29.79 ? 765 GLN B CG    1 
ATOM   4763 C CD    . GLN B 1 265 ? 19.855 2.236   -23.803 1.00 32.26 ? 765 GLN B CD    1 
ATOM   4764 O OE1   . GLN B 1 265 ? 20.883 2.051   -23.142 1.00 34.90 ? 765 GLN B OE1   1 
ATOM   4765 N NE2   . GLN B 1 265 ? 19.160 1.239   -24.330 1.00 32.31 ? 765 GLN B NE2   1 
ATOM   4766 N N     . LEU B 1 266 ? 14.855 4.668   -23.887 1.00 25.04 ? 766 LEU B N     1 
ATOM   4767 C CA    . LEU B 1 266 ? 13.472 4.700   -24.350 1.00 25.76 ? 766 LEU B CA    1 
ATOM   4768 C C     . LEU B 1 266 ? 13.009 6.138   -24.531 1.00 25.89 ? 766 LEU B C     1 
ATOM   4769 O O     . LEU B 1 266 ? 12.254 6.441   -25.451 1.00 25.08 ? 766 LEU B O     1 
ATOM   4770 C CB    . LEU B 1 266 ? 12.554 3.989   -23.365 1.00 26.32 ? 766 LEU B CB    1 
ATOM   4771 C CG    . LEU B 1 266 ? 12.557 2.467   -23.469 1.00 27.44 ? 766 LEU B CG    1 
ATOM   4772 C CD1   . LEU B 1 266 ? 11.652 1.890   -22.385 1.00 27.98 ? 766 LEU B CD1   1 
ATOM   4773 C CD2   . LEU B 1 266 ? 12.095 2.040   -24.857 1.00 26.82 ? 766 LEU B CD2   1 
ATOM   4774 N N     . VAL B 1 267 ? 13.466 7.024   -23.651 1.00 26.56 ? 767 VAL B N     1 
ATOM   4775 C CA    . VAL B 1 267 ? 13.098 8.433   -23.739 1.00 27.35 ? 767 VAL B CA    1 
ATOM   4776 C C     . VAL B 1 267 ? 13.634 9.082   -25.020 1.00 27.23 ? 767 VAL B C     1 
ATOM   4777 O O     . VAL B 1 267 ? 12.934 9.870   -25.662 1.00 27.41 ? 767 VAL B O     1 
ATOM   4778 C CB    . VAL B 1 267 ? 13.627 9.227   -22.519 1.00 28.18 ? 767 VAL B CB    1 
ATOM   4779 C CG1   . VAL B 1 267 ? 13.629 10.719  -22.828 1.00 28.02 ? 767 VAL B CG1   1 
ATOM   4780 C CG2   . VAL B 1 267 ? 12.772 8.932   -21.301 1.00 28.19 ? 767 VAL B CG2   1 
ATOM   4781 N N     . GLU B 1 268 ? 14.877 8.769   -25.380 1.00 26.59 ? 768 GLU B N     1 
ATOM   4782 C CA    . GLU B 1 268 ? 15.474 9.317   -26.596 1.00 26.25 ? 768 GLU B CA    1 
ATOM   4783 C C     . GLU B 1 268 ? 14.728 8.779   -27.815 1.00 25.53 ? 768 GLU B C     1 
ATOM   4784 O O     . GLU B 1 268 ? 14.538 9.491   -28.796 1.00 26.15 ? 768 GLU B O     1 
ATOM   4785 C CB    . GLU B 1 268 ? 16.955 8.932   -26.694 1.00 26.92 ? 768 GLU B CB    1 
ATOM   4786 C CG    . GLU B 1 268 ? 17.841 9.529   -25.612 1.00 29.59 ? 768 GLU B CG    1 
ATOM   4787 C CD    . GLU B 1 268 ? 17.844 11.049  -25.623 1.00 31.83 ? 768 GLU B CD    1 
ATOM   4788 O OE1   . GLU B 1 268 ? 17.819 11.644  -26.719 1.00 32.94 ? 768 GLU B OE1   1 
ATOM   4789 O OE2   . GLU B 1 268 ? 17.867 11.658  -24.530 1.00 34.62 ? 768 GLU B OE2   1 
ATOM   4790 N N     . ILE B 1 269 ? 14.313 7.516   -27.751 1.00 24.71 ? 769 ILE B N     1 
ATOM   4791 C CA    . ILE B 1 269 ? 13.578 6.887   -28.843 1.00 24.73 ? 769 ILE B CA    1 
ATOM   4792 C C     . ILE B 1 269 ? 12.206 7.549   -29.000 1.00 25.87 ? 769 ILE B C     1 
ATOM   4793 O O     . ILE B 1 269 ? 11.788 7.897   -30.110 1.00 25.43 ? 769 ILE B O     1 
ATOM   4794 C CB    . ILE B 1 269 ? 13.370 5.373   -28.584 1.00 23.62 ? 769 ILE B CB    1 
ATOM   4795 C CG1   . ILE B 1 269 ? 14.715 4.643   -28.652 1.00 23.83 ? 769 ILE B CG1   1 
ATOM   4796 C CG2   . ILE B 1 269 ? 12.407 4.789   -29.607 1.00 23.07 ? 769 ILE B CG2   1 
ATOM   4797 C CD1   . ILE B 1 269 ? 14.657 3.193   -28.214 1.00 21.92 ? 769 ILE B CD1   1 
ATOM   4798 N N     . ILE B 1 270 ? 11.517 7.722   -27.875 1.00 26.56 ? 770 ILE B N     1 
ATOM   4799 C CA    . ILE B 1 270 ? 10.194 8.334   -27.867 1.00 28.03 ? 770 ILE B CA    1 
ATOM   4800 C C     . ILE B 1 270 ? 10.262 9.770   -28.377 1.00 29.09 ? 770 ILE B C     1 
ATOM   4801 O O     . ILE B 1 270 ? 9.352  10.232  -29.061 1.00 29.73 ? 770 ILE B O     1 
ATOM   4802 C CB    . ILE B 1 270 ? 9.576  8.298   -26.446 1.00 28.22 ? 770 ILE B CB    1 
ATOM   4803 C CG1   . ILE B 1 270 ? 9.232  6.851   -26.083 1.00 27.96 ? 770 ILE B CG1   1 
ATOM   4804 C CG2   . ILE B 1 270 ? 8.319  9.163   -26.387 1.00 27.72 ? 770 ILE B CG2   1 
ATOM   4805 C CD1   . ILE B 1 270 ? 8.751  6.658   -24.670 1.00 28.92 ? 770 ILE B CD1   1 
ATOM   4806 N N     . LYS B 1 271 ? 11.344 10.473  -28.061 1.00 29.99 ? 771 LYS B N     1 
ATOM   4807 C CA    . LYS B 1 271 ? 11.499 11.847  -28.519 1.00 31.50 ? 771 LYS B CA    1 
ATOM   4808 C C     . LYS B 1 271 ? 11.430 11.923  -30.044 1.00 31.90 ? 771 LYS B C     1 
ATOM   4809 O O     . LYS B 1 271 ? 10.862 12.860  -30.607 1.00 32.47 ? 771 LYS B O     1 
ATOM   4810 C CB    . LYS B 1 271 ? 12.837 12.407  -28.053 1.00 32.54 ? 771 LYS B CB    1 
ATOM   4811 C CG    . LYS B 1 271 ? 12.815 13.027  -26.667 1.00 34.63 ? 771 LYS B CG    1 
ATOM   4812 C CD    . LYS B 1 271 ? 14.026 13.931  -26.476 1.00 36.36 ? 771 LYS B CD    1 
ATOM   4813 C CE    . LYS B 1 271 ? 14.473 13.953  -25.029 1.00 37.34 ? 771 LYS B CE    1 
ATOM   4814 N NZ    . LYS B 1 271 ? 15.921 14.261  -24.913 1.00 38.61 ? 771 LYS B NZ    1 
ATOM   4815 N N     . VAL B 1 272 ? 12.006 10.924  -30.706 1.00 32.18 ? 772 VAL B N     1 
ATOM   4816 C CA    . VAL B 1 272 ? 12.037 10.870  -32.163 1.00 31.85 ? 772 VAL B CA    1 
ATOM   4817 C C     . VAL B 1 272 ? 10.833 10.161  -32.775 1.00 32.49 ? 772 VAL B C     1 
ATOM   4818 O O     . VAL B 1 272 ? 10.179 10.698  -33.673 1.00 33.03 ? 772 VAL B O     1 
ATOM   4819 C CB    . VAL B 1 272 ? 13.321 10.165  -32.664 1.00 31.13 ? 772 VAL B CB    1 
ATOM   4820 C CG1   . VAL B 1 272 ? 13.341 10.137  -34.180 1.00 30.07 ? 772 VAL B CG1   1 
ATOM   4821 C CG2   . VAL B 1 272 ? 14.550 10.886  -32.136 1.00 30.47 ? 772 VAL B CG2   1 
ATOM   4822 N N     . LEU B 1 273 ? 10.536 8.961   -32.289 1.00 32.25 ? 773 LEU B N     1 
ATOM   4823 C CA    . LEU B 1 273 ? 9.425  8.181   -32.823 1.00 32.71 ? 773 LEU B CA    1 
ATOM   4824 C C     . LEU B 1 273 ? 8.075  8.551   -32.229 1.00 33.89 ? 773 LEU B C     1 
ATOM   4825 O O     . LEU B 1 273 ? 7.032  8.223   -32.792 1.00 34.06 ? 773 LEU B O     1 
ATOM   4826 C CB    . LEU B 1 273 ? 9.667  6.683   -32.592 1.00 31.82 ? 773 LEU B CB    1 
ATOM   4827 C CG    . LEU B 1 273 ? 10.935 6.003   -33.130 1.00 31.50 ? 773 LEU B CG    1 
ATOM   4828 C CD1   . LEU B 1 273 ? 10.660 4.515   -33.309 1.00 30.52 ? 773 LEU B CD1   1 
ATOM   4829 C CD2   . LEU B 1 273 ? 11.363 6.628   -34.444 1.00 32.48 ? 773 LEU B CD2   1 
ATOM   4830 N N     . GLY B 1 274 ? 8.092  9.231   -31.092 1.00 34.76 ? 774 GLY B N     1 
ATOM   4831 C CA    . GLY B 1 274 ? 6.844  9.581   -30.444 1.00 35.97 ? 774 GLY B CA    1 
ATOM   4832 C C     . GLY B 1 274 ? 6.455  8.428   -29.541 1.00 37.01 ? 774 GLY B C     1 
ATOM   4833 O O     . GLY B 1 274 ? 7.046  7.351   -29.614 1.00 36.47 ? 774 GLY B O     1 
ATOM   4834 N N     . THR B 1 275 ? 5.464  8.647   -28.685 1.00 38.35 ? 775 THR B N     1 
ATOM   4835 C CA    . THR B 1 275 ? 5.008  7.613   -27.765 1.00 39.38 ? 775 THR B CA    1 
ATOM   4836 C C     . THR B 1 275 ? 4.423  6.425   -28.522 1.00 39.63 ? 775 THR B C     1 
ATOM   4837 O O     . THR B 1 275 ? 3.608  6.597   -29.428 1.00 39.65 ? 775 THR B O     1 
ATOM   4838 C CB    . THR B 1 275 ? 3.940  8.170   -26.797 1.00 40.04 ? 775 THR B CB    1 
ATOM   4839 O OG1   . THR B 1 275 ? 4.553  9.119   -25.916 1.00 40.74 ? 775 THR B OG1   1 
ATOM   4840 C CG2   . THR B 1 275 ? 3.318  7.046   -25.967 1.00 40.57 ? 775 THR B CG2   1 
ATOM   4841 N N     . PRO B 1 276 ? 4.840  5.202   -28.164 1.00 39.85 ? 776 PRO B N     1 
ATOM   4842 C CA    . PRO B 1 276 ? 4.324  4.010   -28.841 1.00 40.94 ? 776 PRO B CA    1 
ATOM   4843 C C     . PRO B 1 276 ? 2.878  3.704   -28.465 1.00 42.51 ? 776 PRO B C     1 
ATOM   4844 O O     . PRO B 1 276 ? 2.523  3.705   -27.284 1.00 42.91 ? 776 PRO B O     1 
ATOM   4845 C CB    . PRO B 1 276 ? 5.270  2.903   -28.388 1.00 40.17 ? 776 PRO B CB    1 
ATOM   4846 C CG    . PRO B 1 276 ? 5.744  3.352   -27.049 1.00 39.69 ? 776 PRO B CG    1 
ATOM   4847 C CD    . PRO B 1 276 ? 5.821  4.859   -27.118 1.00 39.61 ? 776 PRO B CD    1 
ATOM   4848 N N     . THR B 1 277 ? 2.047  3.443   -29.468 1.00 43.85 ? 777 THR B N     1 
ATOM   4849 C CA    . THR B 1 277 ? 0.649  3.112   -29.220 1.00 45.25 ? 777 THR B CA    1 
ATOM   4850 C C     . THR B 1 277 ? 0.599  1.836   -28.393 1.00 46.62 ? 777 THR B C     1 
ATOM   4851 O O     . THR B 1 277 ? 1.573  1.079   -28.334 1.00 46.58 ? 777 THR B O     1 
ATOM   4852 C CB    . THR B 1 277 ? -0.123 2.844   -30.525 1.00 45.06 ? 777 THR B CB    1 
ATOM   4853 O OG1   . THR B 1 277 ? 0.302  1.591   -31.081 1.00 44.88 ? 777 THR B OG1   1 
ATOM   4854 C CG2   . THR B 1 277 ? 0.110  3.958   -31.528 1.00 44.91 ? 777 THR B CG2   1 
ATOM   4855 N N     . ARG B 1 278 ? -0.542 1.598   -27.759 1.00 48.24 ? 778 ARG B N     1 
ATOM   4856 C CA    . ARG B 1 278 ? -0.733 0.412   -26.938 1.00 49.79 ? 778 ARG B CA    1 
ATOM   4857 C C     . ARG B 1 278 ? -0.526 -0.840  -27.789 1.00 49.59 ? 778 ARG B C     1 
ATOM   4858 O O     . ARG B 1 278 ? -0.042 -1.868  -27.304 1.00 49.01 ? 778 ARG B O     1 
ATOM   4859 C CB    . ARG B 1 278 ? -2.146 0.422   -26.350 1.00 52.33 ? 778 ARG B CB    1 
ATOM   4860 C CG    . ARG B 1 278 ? -2.513 -0.819  -25.560 1.00 56.05 ? 778 ARG B CG    1 
ATOM   4861 C CD    . ARG B 1 278 ? -3.857 -0.636  -24.870 1.00 59.16 ? 778 ARG B CD    1 
ATOM   4862 N NE    . ARG B 1 278 ? -4.252 -1.823  -24.116 1.00 62.01 ? 778 ARG B NE    1 
ATOM   4863 C CZ    . ARG B 1 278 ? -5.383 -1.926  -23.421 1.00 63.56 ? 778 ARG B CZ    1 
ATOM   4864 N NH1   . ARG B 1 278 ? -6.239 -0.908  -23.383 1.00 64.34 ? 778 ARG B NH1   1 
ATOM   4865 N NH2   . ARG B 1 278 ? -5.660 -3.048  -22.762 1.00 64.38 ? 778 ARG B NH2   1 
ATOM   4866 N N     . GLU B 1 279 ? -0.894 -0.739  -29.063 1.00 49.34 ? 779 GLU B N     1 
ATOM   4867 C CA    . GLU B 1 279 ? -0.758 -1.852  -29.989 1.00 49.79 ? 779 GLU B CA    1 
ATOM   4868 C C     . GLU B 1 279 ? 0.708  -2.111  -30.328 1.00 48.85 ? 779 GLU B C     1 
ATOM   4869 O O     . GLU B 1 279 ? 1.149  -3.261  -30.372 1.00 48.46 ? 779 GLU B O     1 
ATOM   4870 C CB    . GLU B 1 279 ? -1.540 -1.570  -31.272 1.00 51.61 ? 779 GLU B CB    1 
ATOM   4871 C CG    . GLU B 1 279 ? -1.635 -2.772  -32.199 1.00 55.00 ? 779 GLU B CG    1 
ATOM   4872 C CD    . GLU B 1 279 ? -2.049 -2.391  -33.609 1.00 57.42 ? 779 GLU B CD    1 
ATOM   4873 O OE1   . GLU B 1 279 ? -2.691 -1.325  -33.778 1.00 58.99 ? 779 GLU B OE1   1 
ATOM   4874 O OE2   . GLU B 1 279 ? -1.734 -3.157  -34.552 1.00 58.34 ? 779 GLU B OE2   1 
ATOM   4875 N N     . GLN B 1 280 ? 1.455  -1.039  -30.574 1.00 47.55 ? 780 GLN B N     1 
ATOM   4876 C CA    . GLN B 1 280 ? 2.871  -1.158  -30.898 1.00 46.24 ? 780 GLN B CA    1 
ATOM   4877 C C     . GLN B 1 280 ? 3.601  -1.796  -29.719 1.00 46.66 ? 780 GLN B C     1 
ATOM   4878 O O     . GLN B 1 280 ? 4.504  -2.615  -29.902 1.00 46.10 ? 780 GLN B O     1 
ATOM   4879 C CB    . GLN B 1 280 ? 3.462  0.220   -31.193 1.00 44.61 ? 780 GLN B CB    1 
ATOM   4880 C CG    . GLN B 1 280 ? 3.407  0.612   -32.656 1.00 42.36 ? 780 GLN B CG    1 
ATOM   4881 C CD    . GLN B 1 280 ? 3.597  2.096   -32.861 1.00 41.43 ? 780 GLN B CD    1 
ATOM   4882 O OE1   . GLN B 1 280 ? 3.368  2.891   -31.952 1.00 41.36 ? 780 GLN B OE1   1 
ATOM   4883 N NE2   . GLN B 1 280 ? 4.021  2.481   -34.058 1.00 40.91 ? 780 GLN B NE2   1 
ATOM   4884 N N     . ILE B 1 281 ? 3.202  -1.418  -28.509 1.00 47.19 ? 781 ILE B N     1 
ATOM   4885 C CA    . ILE B 1 281 ? 3.812  -1.959  -27.304 1.00 48.32 ? 781 ILE B CA    1 
ATOM   4886 C C     . ILE B 1 281 ? 3.584  -3.465  -27.267 1.00 49.47 ? 781 ILE B C     1 
ATOM   4887 O O     . ILE B 1 281 ? 4.482  -4.243  -26.940 1.00 49.15 ? 781 ILE B O     1 
ATOM   4888 C CB    . ILE B 1 281 ? 3.200  -1.315  -26.041 1.00 47.97 ? 781 ILE B CB    1 
ATOM   4889 C CG1   . ILE B 1 281 ? 3.635  0.149   -25.949 1.00 47.98 ? 781 ILE B CG1   1 
ATOM   4890 C CG2   . ILE B 1 281 ? 3.638  -2.074  -24.802 1.00 47.78 ? 781 ILE B CG2   1 
ATOM   4891 C CD1   . ILE B 1 281 ? 3.102  0.883   -24.739 1.00 47.51 ? 781 ILE B CD1   1 
ATOM   4892 N N     . ARG B 1 282 ? 2.371  -3.864  -27.621 1.00 51.35 ? 782 ARG B N     1 
ATOM   4893 C CA    . ARG B 1 282 ? 1.980  -5.265  -27.645 1.00 53.23 ? 782 ARG B CA    1 
ATOM   4894 C C     . ARG B 1 282 ? 2.817  -6.062  -28.646 1.00 53.57 ? 782 ARG B C     1 
ATOM   4895 O O     . ARG B 1 282 ? 3.072  -7.248  -28.444 1.00 52.97 ? 782 ARG B O     1 
ATOM   4896 C CB    . ARG B 1 282 ? 0.496  -5.354  -28.003 1.00 55.13 ? 782 ARG B CB    1 
ATOM   4897 C CG    . ARG B 1 282 ? -0.073 -6.751  -28.060 1.00 58.09 ? 782 ARG B CG    1 
ATOM   4898 C CD    . ARG B 1 282 ? -1.475 -6.719  -28.652 1.00 60.64 ? 782 ARG B CD    1 
ATOM   4899 N NE    . ARG B 1 282 ? -2.075 -8.050  -28.701 1.00 63.87 ? 782 ARG B NE    1 
ATOM   4900 C CZ    . ARG B 1 282 ? -3.287 -8.310  -29.188 1.00 65.01 ? 782 ARG B CZ    1 
ATOM   4901 N NH1   . ARG B 1 282 ? -4.034 -7.322  -29.672 1.00 65.70 ? 782 ARG B NH1   1 
ATOM   4902 N NH2   . ARG B 1 282 ? -3.755 -9.557  -29.190 1.00 65.35 ? 782 ARG B NH2   1 
ATOM   4903 N N     . GLU B 1 283 ? 3.242  -5.398  -29.720 1.00 54.52 ? 783 GLU B N     1 
ATOM   4904 C CA    . GLU B 1 283 ? 4.052  -6.015  -30.773 1.00 55.65 ? 783 GLU B CA    1 
ATOM   4905 C C     . GLU B 1 283 ? 5.475  -6.347  -30.315 1.00 56.24 ? 783 GLU B C     1 
ATOM   4906 O O     . GLU B 1 283 ? 6.026  -7.393  -30.670 1.00 55.85 ? 783 GLU B O     1 
ATOM   4907 C CB    . GLU B 1 283 ? 4.134  -5.085  -31.984 1.00 56.26 ? 783 GLU B CB    1 
ATOM   4908 C CG    . GLU B 1 283 ? 2.791  -4.612  -32.497 1.00 57.55 ? 783 GLU B CG    1 
ATOM   4909 C CD    . GLU B 1 283 ? 2.280  -5.468  -33.635 1.00 58.49 ? 783 GLU B CD    1 
ATOM   4910 O OE1   . GLU B 1 283 ? 1.288  -5.061  -34.281 1.00 59.27 ? 783 GLU B OE1   1 
ATOM   4911 O OE2   . GLU B 1 283 ? 2.873  -6.543  -33.885 1.00 58.84 ? 783 GLU B OE2   1 
ATOM   4912 N N     . MET B 1 284 ? 6.068  -5.448  -29.537 1.00 57.18 ? 784 MET B N     1 
ATOM   4913 C CA    . MET B 1 284 ? 7.424  -5.644  -29.041 1.00 58.63 ? 784 MET B CA    1 
ATOM   4914 C C     . MET B 1 284 ? 7.457  -6.680  -27.943 1.00 60.58 ? 784 MET B C     1 
ATOM   4915 O O     . MET B 1 284 ? 8.167  -7.678  -28.038 1.00 60.36 ? 784 MET B O     1 
ATOM   4916 C CB    . MET B 1 284 ? 7.979  -4.328  -28.519 1.00 56.74 ? 784 MET B CB    1 
ATOM   4917 C CG    . MET B 1 284 ? 8.033  -3.277  -29.586 1.00 54.96 ? 784 MET B CG    1 
ATOM   4918 S SD    . MET B 1 284 ? 8.249  -1.643  -28.933 1.00 52.33 ? 784 MET B SD    1 
ATOM   4919 C CE    . MET B 1 284 ? 9.062  -0.957  -30.196 1.00 53.91 ? 784 MET B CE    1 
ATOM   4920 N N     . ASN B 1 285 ? 6.692  -6.434  -26.888 1.00 63.67 ? 785 ASN B N     1 
ATOM   4921 C CA    . ASN B 1 285 ? 6.635  -7.374  -25.785 1.00 67.21 ? 785 ASN B CA    1 
ATOM   4922 C C     . ASN B 1 285 ? 5.302  -7.310  -25.057 1.00 69.84 ? 785 ASN B C     1 
ATOM   4923 O O     . ASN B 1 285 ? 4.979  -6.308  -24.416 1.00 69.78 ? 785 ASN B O     1 
ATOM   4924 C CB    . ASN B 1 285 ? 7.758  -7.113  -24.787 1.00 67.07 ? 785 ASN B CB    1 
ATOM   4925 C CG    . ASN B 1 285 ? 7.724  -8.080  -23.629 1.00 67.18 ? 785 ASN B CG    1 
ATOM   4926 O OD1   . ASN B 1 285 ? 7.786  -7.683  -22.465 1.00 67.03 ? 785 ASN B OD1   1 
ATOM   4927 N ND2   . ASN B 1 285 ? 7.610  -9.365  -23.942 1.00 67.61 ? 785 ASN B ND2   1 
ATOM   4928 N N     . PRO B 1 286 ? 4.500  -8.383  -25.163 1.00 72.72 ? 786 PRO B N     1 
ATOM   4929 C CA    . PRO B 1 286 ? 3.196  -8.434  -24.500 1.00 75.26 ? 786 PRO B CA    1 
ATOM   4930 C C     . PRO B 1 286 ? 3.322  -8.993  -23.081 1.00 77.77 ? 786 PRO B C     1 
ATOM   4931 O O     . PRO B 1 286 ? 2.718  -10.013 -22.759 1.00 78.40 ? 786 PRO B O     1 
ATOM   4932 C CB    . PRO B 1 286 ? 2.378  -9.344  -25.405 1.00 74.73 ? 786 PRO B CB    1 
ATOM   4933 C CG    . PRO B 1 286 ? 3.397  -10.248 -26.068 1.00 73.89 ? 786 PRO B CG    1 
ATOM   4934 C CD    . PRO B 1 286 ? 4.768  -9.616  -25.926 1.00 73.15 ? 786 PRO B CD    1 
ATOM   4935 N N     . ASN B 1 287 ? 4.115  -8.323  -22.247 1.00 80.29 ? 787 ASN B N     1 
ATOM   4936 C CA    . ASN B 1 287 ? 4.307  -8.777  -20.880 1.00 82.81 ? 787 ASN B CA    1 
ATOM   4937 C C     . ASN B 1 287 ? 4.730  -7.683  -19.909 1.00 84.70 ? 787 ASN B C     1 
ATOM   4938 O O     . ASN B 1 287 ? 4.331  -7.707  -18.740 1.00 85.35 ? 787 ASN B O     1 
ATOM   4939 C CB    . ASN B 1 287 ? 5.351  -9.896  -20.821 1.00 82.72 ? 787 ASN B CB    1 
ATOM   4940 C CG    . ASN B 1 287 ? 4.953  -11.117 -21.620 1.00 82.81 ? 787 ASN B CG    1 
ATOM   4941 O OD1   . ASN B 1 287 ? 3.941  -11.762 -21.343 1.00 82.86 ? 787 ASN B OD1   1 
ATOM   4942 N ND2   . ASN B 1 287 ? 5.757  -11.444 -22.623 1.00 83.08 ? 787 ASN B ND2   1 
ATOM   4943 N N     . TYR B 1 288 ? 5.536  -6.727  -20.365 1.00 86.65 ? 788 TYR B N     1 
ATOM   4944 C CA    . TYR B 1 288 ? 6.004  -5.680  -19.455 1.00 88.49 ? 788 TYR B CA    1 
ATOM   4945 C C     . TYR B 1 288 ? 4.950  -4.706  -18.947 1.00 89.56 ? 788 TYR B C     1 
ATOM   4946 O O     . TYR B 1 288 ? 4.022  -4.329  -19.671 1.00 89.92 ? 788 TYR B O     1 
ATOM   4947 C CB    . TYR B 1 288 ? 7.201  -4.944  -20.066 1.00 88.39 ? 788 TYR B CB    1 
ATOM   4948 C CG    . TYR B 1 288 ? 8.474  -5.661  -19.691 1.00 88.60 ? 788 TYR B CG    1 
ATOM   4949 C CD1   . TYR B 1 288 ? 8.589  -7.040  -19.898 1.00 88.58 ? 788 TYR B CD1   1 
ATOM   4950 C CD2   . TYR B 1 288 ? 9.531  -4.994  -19.066 1.00 88.40 ? 788 TYR B CD2   1 
ATOM   4951 C CE1   . TYR B 1 288 ? 9.714  -7.740  -19.492 1.00 88.47 ? 788 TYR B CE1   1 
ATOM   4952 C CE2   . TYR B 1 288 ? 10.670 -5.693  -18.653 1.00 88.44 ? 788 TYR B CE2   1 
ATOM   4953 C CZ    . TYR B 1 288 ? 10.749 -7.068  -18.872 1.00 88.47 ? 788 TYR B CZ    1 
ATOM   4954 O OH    . TYR B 1 288 ? 11.852 -7.786  -18.464 1.00 88.34 ? 788 TYR B OH    1 
ATOM   4955 N N     . THR B 1 289 ? 5.114  -4.319  -17.685 1.00 90.54 ? 789 THR B N     1 
ATOM   4956 C CA    . THR B 1 289 ? 4.177  -3.453  -16.987 1.00 91.49 ? 789 THR B CA    1 
ATOM   4957 C C     . THR B 1 289 ? 4.156  -1.957  -17.295 1.00 92.01 ? 789 THR B C     1 
ATOM   4958 O O     . THR B 1 289 ? 3.186  -1.455  -17.871 1.00 92.05 ? 789 THR B O     1 
ATOM   4959 C CB    . THR B 1 289 ? 4.348  -3.624  -15.461 1.00 91.55 ? 789 THR B CB    1 
ATOM   4960 O OG1   . THR B 1 289 ? 5.286  -4.674  -15.191 1.00 91.33 ? 789 THR B OG1   1 
ATOM   4961 C CG2   . THR B 1 289 ? 3.011  -3.965  -14.792 1.00 91.62 ? 789 THR B CG2   1 
ATOM   4962 N N     . GLU B 1 290 ? 5.217  -1.247  -16.919 1.00 92.62 ? 790 GLU B N     1 
ATOM   4963 C CA    . GLU B 1 290 ? 5.262  0.197   -17.134 1.00 93.13 ? 790 GLU B CA    1 
ATOM   4964 C C     . GLU B 1 290 ? 4.671  0.659   -18.456 1.00 93.14 ? 790 GLU B C     1 
ATOM   4965 O O     . GLU B 1 290 ? 5.159  0.315   -19.531 1.00 93.47 ? 790 GLU B O     1 
ATOM   4966 C CB    . GLU B 1 290 ? 6.692  0.739   -17.015 1.00 93.62 ? 790 GLU B CB    1 
ATOM   4967 C CG    . GLU B 1 290 ? 6.767  2.225   -16.677 1.00 94.29 ? 790 GLU B CG    1 
ATOM   4968 C CD    . GLU B 1 290 ? 7.950  2.921   -17.329 1.00 94.66 ? 790 GLU B CD    1 
ATOM   4969 O OE1   . GLU B 1 290 ? 8.962  2.248   -17.607 1.00 95.06 ? 790 GLU B OE1   1 
ATOM   4970 O OE2   . GLU B 1 290 ? 7.868  4.145   -17.561 1.00 94.74 ? 790 GLU B OE2   1 
ATOM   4971 N N     . PHE B 1 291 ? 3.599  1.437   -18.353 1.00 92.80 ? 791 PHE B N     1 
ATOM   4972 C CA    . PHE B 1 291 ? 2.922  2.004   -19.509 1.00 92.19 ? 791 PHE B CA    1 
ATOM   4973 C C     . PHE B 1 291 ? 2.955  3.514   -19.294 1.00 91.65 ? 791 PHE B C     1 
ATOM   4974 O O     . PHE B 1 291 ? 2.539  4.301   -20.148 1.00 91.60 ? 791 PHE B O     1 
ATOM   4975 C CB    . PHE B 1 291 ? 1.476  1.504   -19.573 1.00 92.29 ? 791 PHE B CB    1 
ATOM   4976 C CG    . PHE B 1 291 ? 1.316  0.199   -20.309 1.00 92.30 ? 791 PHE B CG    1 
ATOM   4977 C CD1   . PHE B 1 291 ? 0.047  -0.303  -20.579 1.00 92.12 ? 791 PHE B CD1   1 
ATOM   4978 C CD2   . PHE B 1 291 ? 2.428  -0.528  -20.734 1.00 92.28 ? 791 PHE B CD2   1 
ATOM   4979 C CE1   . PHE B 1 291 ? -0.121 -1.509  -21.264 1.00 92.07 ? 791 PHE B CE1   1 
ATOM   4980 C CE2   . PHE B 1 291 ? 2.271  -1.738  -21.420 1.00 92.26 ? 791 PHE B CE2   1 
ATOM   4981 C CZ    . PHE B 1 291 ? 0.995  -2.228  -21.685 1.00 92.10 ? 791 PHE B CZ    1 
ATOM   4982 N N     . LYS B 1 292 ? 3.465  3.899   -18.126 1.00 90.88 ? 792 LYS B N     1 
ATOM   4983 C CA    . LYS B 1 292 ? 3.575  5.297   -17.744 1.00 90.08 ? 792 LYS B CA    1 
ATOM   4984 C C     . LYS B 1 292 ? 4.783  5.942   -18.422 1.00 89.34 ? 792 LYS B C     1 
ATOM   4985 O O     . LYS B 1 292 ? 5.911  5.835   -17.949 1.00 89.09 ? 792 LYS B O     1 
ATOM   4986 C CB    . LYS B 1 292 ? 3.710  5.411   -16.217 1.00 90.27 ? 792 LYS B CB    1 
ATOM   4987 C CG    . LYS B 1 292 ? 4.379  6.694   -15.724 1.00 90.47 ? 792 LYS B CG    1 
ATOM   4988 C CD    . LYS B 1 292 ? 4.925  6.529   -14.313 1.00 90.30 ? 792 LYS B CD    1 
ATOM   4989 C CE    . LYS B 1 292 ? 4.804  7.818   -13.515 1.00 89.90 ? 792 LYS B CE    1 
ATOM   4990 N NZ    . LYS B 1 292 ? 3.559  7.859   -12.696 1.00 89.39 ? 792 LYS B NZ    1 
ATOM   4991 N N     . PHE B 1 293 ? 4.536  6.603   -19.551 1.00 88.63 ? 793 PHE B N     1 
ATOM   4992 C CA    . PHE B 1 293 ? 5.588  7.284   -20.284 1.00 87.72 ? 793 PHE B CA    1 
ATOM   4993 C C     . PHE B 1 293 ? 5.035  8.506   -21.006 1.00 87.06 ? 793 PHE B C     1 
ATOM   4994 O O     . PHE B 1 293 ? 4.084  8.402   -21.784 1.00 86.97 ? 793 PHE B O     1 
ATOM   4995 C CB    . PHE B 1 293 ? 6.242  6.335   -21.288 1.00 87.76 ? 793 PHE B CB    1 
ATOM   4996 C CG    . PHE B 1 293 ? 7.691  6.083   -21.010 1.00 87.81 ? 793 PHE B CG    1 
ATOM   4997 C CD1   . PHE B 1 293 ? 8.152  4.794   -20.773 1.00 87.80 ? 793 PHE B CD1   1 
ATOM   4998 C CD2   . PHE B 1 293 ? 8.593  7.140   -20.969 1.00 87.83 ? 793 PHE B CD2   1 
ATOM   4999 C CE1   . PHE B 1 293 ? 9.497  4.561   -20.499 1.00 87.80 ? 793 PHE B CE1   1 
ATOM   5000 C CE2   . PHE B 1 293 ? 9.939  6.918   -20.698 1.00 87.72 ? 793 PHE B CE2   1 
ATOM   5001 C CZ    . PHE B 1 293 ? 10.393 5.625   -20.463 1.00 87.65 ? 793 PHE B CZ    1 
ATOM   5002 N N     . PRO B 1 294 ? 5.613  9.688   -20.735 1.00 86.29 ? 794 PRO B N     1 
ATOM   5003 C CA    . PRO B 1 294 ? 5.198  10.956  -21.338 1.00 85.62 ? 794 PRO B CA    1 
ATOM   5004 C C     . PRO B 1 294 ? 4.698  10.783  -22.770 1.00 84.91 ? 794 PRO B C     1 
ATOM   5005 O O     . PRO B 1 294 ? 5.350  10.134  -23.583 1.00 84.75 ? 794 PRO B O     1 
ATOM   5006 C CB    . PRO B 1 294 ? 6.456  11.816  -21.269 1.00 85.76 ? 794 PRO B CB    1 
ATOM   5007 C CG    . PRO B 1 294 ? 7.276  11.227  -20.154 1.00 85.99 ? 794 PRO B CG    1 
ATOM   5008 C CD    . PRO B 1 294 ? 6.733  9.875   -19.789 1.00 86.03 ? 794 PRO B CD    1 
ATOM   5009 N N     . GLN B 1 295 ? 3.538  11.367  -23.061 1.00 84.10 ? 795 GLN B N     1 
ATOM   5010 C CA    . GLN B 1 295 ? 2.949  11.271  -24.392 1.00 83.24 ? 795 GLN B CA    1 
ATOM   5011 C C     . GLN B 1 295 ? 3.497  12.355  -25.309 1.00 82.30 ? 795 GLN B C     1 
ATOM   5012 O O     . GLN B 1 295 ? 2.909  13.428  -25.442 1.00 82.12 ? 795 GLN B O     1 
ATOM   5013 C CB    . GLN B 1 295 ? 1.422  11.390  -24.323 1.00 83.71 ? 795 GLN B CB    1 
ATOM   5014 C CG    . GLN B 1 295 ? 0.837  11.250  -22.927 1.00 84.44 ? 795 GLN B CG    1 
ATOM   5015 C CD    . GLN B 1 295 ? 0.696  9.805   -22.489 1.00 84.85 ? 795 GLN B CD    1 
ATOM   5016 O OE1   . GLN B 1 295 ? 0.504  9.521   -21.306 1.00 85.28 ? 795 GLN B OE1   1 
ATOM   5017 N NE2   . GLN B 1 295 ? 0.793  8.883   -23.442 1.00 84.85 ? 795 GLN B NE2   1 
ATOM   5018 N N     . ILE B 1 296 ? 4.631  12.064  -25.935 1.00 81.19 ? 796 ILE B N     1 
ATOM   5019 C CA    . ILE B 1 296 ? 5.278  12.997  -26.846 1.00 79.88 ? 796 ILE B CA    1 
ATOM   5020 C C     . ILE B 1 296 ? 4.815  12.709  -28.272 1.00 79.15 ? 796 ILE B C     1 
ATOM   5021 O O     . ILE B 1 296 ? 4.534  11.564  -28.623 1.00 78.72 ? 796 ILE B O     1 
ATOM   5022 C CB    . ILE B 1 296 ? 6.824  12.868  -26.753 1.00 79.60 ? 796 ILE B CB    1 
ATOM   5023 C CG1   . ILE B 1 296 ? 7.362  13.884  -25.742 1.00 79.39 ? 796 ILE B CG1   1 
ATOM   5024 C CG2   . ILE B 1 296 ? 7.466  13.086  -28.114 1.00 79.50 ? 796 ILE B CG2   1 
ATOM   5025 C CD1   . ILE B 1 296 ? 7.506  13.333  -24.341 1.00 79.00 ? 796 ILE B CD1   1 
ATOM   5026 N N     . LYS B 1 297 ? 4.723  13.755  -29.085 1.00 78.58 ? 797 LYS B N     1 
ATOM   5027 C CA    . LYS B 1 297 ? 4.301  13.608  -30.472 1.00 78.16 ? 797 LYS B CA    1 
ATOM   5028 C C     . LYS B 1 297 ? 5.494  13.218  -31.345 1.00 77.59 ? 797 LYS B C     1 
ATOM   5029 O O     . LYS B 1 297 ? 6.645  13.482  -30.992 1.00 77.46 ? 797 LYS B O     1 
ATOM   5030 C CB    . LYS B 1 297 ? 3.678  14.915  -30.980 1.00 78.23 ? 797 LYS B CB    1 
ATOM   5031 C CG    . LYS B 1 297 ? 4.587  16.131  -30.866 1.00 78.53 ? 797 LYS B CG    1 
ATOM   5032 C CD    . LYS B 1 297 ? 4.559  16.728  -29.466 1.00 78.53 ? 797 LYS B CD    1 
ATOM   5033 C CE    . LYS B 1 297 ? 5.929  17.259  -29.072 1.00 78.60 ? 797 LYS B CE    1 
ATOM   5034 N NZ    . LYS B 1 297 ? 6.192  17.104  -27.614 1.00 78.41 ? 797 LYS B NZ    1 
ATOM   5035 N N     . ALA B 1 298 ? 5.216  12.584  -32.481 1.00 76.91 ? 798 ALA B N     1 
ATOM   5036 C CA    . ALA B 1 298 ? 6.265  12.151  -33.401 1.00 76.17 ? 798 ALA B CA    1 
ATOM   5037 C C     . ALA B 1 298 ? 7.175  13.310  -33.804 1.00 75.46 ? 798 ALA B C     1 
ATOM   5038 O O     . ALA B 1 298 ? 6.702  14.368  -34.226 1.00 75.52 ? 798 ALA B O     1 
ATOM   5039 C CB    . ALA B 1 298 ? 5.639  11.517  -34.645 1.00 76.40 ? 798 ALA B CB    1 
ATOM   5040 N N     . HIS B 1 299 ? 8.483  13.100  -33.673 1.00 74.38 ? 799 HIS B N     1 
ATOM   5041 C CA    . HIS B 1 299 ? 9.470  14.116  -34.026 1.00 73.15 ? 799 HIS B CA    1 
ATOM   5042 C C     . HIS B 1 299 ? 9.819  14.056  -35.510 1.00 71.73 ? 799 HIS B C     1 
ATOM   5043 O O     . HIS B 1 299 ? 10.349 13.051  -35.994 1.00 71.72 ? 799 HIS B O     1 
ATOM   5044 C CB    . HIS B 1 299 ? 10.745 13.920  -33.207 1.00 74.08 ? 799 HIS B CB    1 
ATOM   5045 C CG    . HIS B 1 299 ? 11.732 15.036  -33.349 1.00 74.78 ? 799 HIS B CG    1 
ATOM   5046 N ND1   . HIS B 1 299 ? 11.410 16.243  -33.932 1.00 75.27 ? 799 HIS B ND1   1 
ATOM   5047 C CD2   . HIS B 1 299 ? 13.026 15.135  -32.965 1.00 75.33 ? 799 HIS B CD2   1 
ATOM   5048 C CE1   . HIS B 1 299 ? 12.465 17.038  -33.901 1.00 75.42 ? 799 HIS B CE1   1 
ATOM   5049 N NE2   . HIS B 1 299 ? 13.459 16.391  -33.320 1.00 75.61 ? 799 HIS B NE2   1 
ATOM   5050 N N     . PRO B 1 300 ? 9.536  15.142  -36.253 1.00 70.15 ? 800 PRO B N     1 
ATOM   5051 C CA    . PRO B 1 300 ? 9.832  15.184  -37.689 1.00 68.32 ? 800 PRO B CA    1 
ATOM   5052 C C     . PRO B 1 300 ? 11.268 14.753  -37.949 1.00 66.16 ? 800 PRO B C     1 
ATOM   5053 O O     . PRO B 1 300 ? 12.211 15.466  -37.611 1.00 66.34 ? 800 PRO B O     1 
ATOM   5054 C CB    . PRO B 1 300 ? 9.588  16.647  -38.076 1.00 68.89 ? 800 PRO B CB    1 
ATOM   5055 C CG    . PRO B 1 300 ? 9.486  17.398  -36.765 1.00 69.65 ? 800 PRO B CG    1 
ATOM   5056 C CD    . PRO B 1 300 ? 8.949  16.407  -35.781 1.00 70.00 ? 800 PRO B CD    1 
ATOM   5057 N N     . TRP B 1 301 ? 11.421 13.574  -38.538 1.00 63.42 ? 801 TRP B N     1 
ATOM   5058 C CA    . TRP B 1 301 ? 12.735 13.032  -38.834 1.00 60.64 ? 801 TRP B CA    1 
ATOM   5059 C C     . TRP B 1 301 ? 13.646 14.051  -39.516 1.00 60.00 ? 801 TRP B C     1 
ATOM   5060 O O     . TRP B 1 301 ? 14.855 14.068  -39.276 1.00 59.88 ? 801 TRP B O     1 
ATOM   5061 C CB    . TRP B 1 301 ? 12.590 11.795  -39.713 1.00 58.27 ? 801 TRP B CB    1 
ATOM   5062 C CG    . TRP B 1 301 ? 12.373 10.532  -38.946 1.00 55.71 ? 801 TRP B CG    1 
ATOM   5063 C CD1   . TRP B 1 301 ? 11.207 9.829   -38.834 1.00 55.02 ? 801 TRP B CD1   1 
ATOM   5064 C CD2   . TRP B 1 301 ? 13.363 9.781   -38.234 1.00 54.28 ? 801 TRP B CD2   1 
ATOM   5065 N NE1   . TRP B 1 301 ? 11.411 8.684   -38.102 1.00 53.96 ? 801 TRP B NE1   1 
ATOM   5066 C CE2   . TRP B 1 301 ? 12.725 8.629   -37.722 1.00 53.66 ? 801 TRP B CE2   1 
ATOM   5067 C CE3   . TRP B 1 301 ? 14.728 9.967   -37.982 1.00 53.37 ? 801 TRP B CE3   1 
ATOM   5068 C CZ2   . TRP B 1 301 ? 13.405 7.668   -36.972 1.00 52.98 ? 801 TRP B CZ2   1 
ATOM   5069 C CZ3   . TRP B 1 301 ? 15.405 9.011   -37.236 1.00 52.99 ? 801 TRP B CZ3   1 
ATOM   5070 C CH2   . TRP B 1 301 ? 14.741 7.875   -36.741 1.00 52.93 ? 801 TRP B CH2   1 
ATOM   5071 N N     . THR B 1 302 ? 13.069 14.903  -40.361 1.00 59.14 ? 802 THR B N     1 
ATOM   5072 C CA    . THR B 1 302 ? 13.853 15.915  -41.066 1.00 58.29 ? 802 THR B CA    1 
ATOM   5073 C C     . THR B 1 302 ? 14.486 16.903  -40.089 1.00 57.36 ? 802 THR B C     1 
ATOM   5074 O O     . THR B 1 302 ? 15.550 17.465  -40.361 1.00 57.68 ? 802 THR B O     1 
ATOM   5075 C CB    . THR B 1 302 ? 12.988 16.682  -42.093 1.00 58.71 ? 802 THR B CB    1 
ATOM   5076 O OG1   . THR B 1 302 ? 12.565 15.777  -43.123 1.00 58.80 ? 802 THR B OG1   1 
ATOM   5077 C CG2   . THR B 1 302 ? 13.784 17.824  -42.729 1.00 58.55 ? 802 THR B CG2   1 
ATOM   5078 N N     . LYS B 1 303 ? 13.835 17.105  -38.947 1.00 55.89 ? 803 LYS B N     1 
ATOM   5079 C CA    . LYS B 1 303 ? 14.355 18.007  -37.926 1.00 54.37 ? 803 LYS B CA    1 
ATOM   5080 C C     . LYS B 1 303 ? 15.435 17.300  -37.102 1.00 52.30 ? 803 LYS B C     1 
ATOM   5081 O O     . LYS B 1 303 ? 16.177 17.933  -36.351 1.00 51.94 ? 803 LYS B O     1 
ATOM   5082 C CB    . LYS B 1 303 ? 13.223 18.478  -37.002 1.00 55.89 ? 803 LYS B CB    1 
ATOM   5083 C CG    . LYS B 1 303 ? 13.697 19.405  -35.880 1.00 57.93 ? 803 LYS B CG    1 
ATOM   5084 C CD    . LYS B 1 303 ? 12.545 20.091  -35.148 1.00 59.30 ? 803 LYS B CD    1 
ATOM   5085 C CE    . LYS B 1 303 ? 12.962 20.494  -33.736 1.00 60.09 ? 803 LYS B CE    1 
ATOM   5086 N NZ    . LYS B 1 303 ? 11.806 20.937  -32.899 1.00 61.20 ? 803 LYS B NZ    1 
ATOM   5087 N N     . VAL B 1 304 ? 15.525 15.984  -37.253 1.00 50.02 ? 804 VAL B N     1 
ATOM   5088 C CA    . VAL B 1 304 ? 16.505 15.194  -36.515 1.00 47.40 ? 804 VAL B CA    1 
ATOM   5089 C C     . VAL B 1 304 ? 17.915 15.316  -37.089 1.00 45.82 ? 804 VAL B C     1 
ATOM   5090 O O     . VAL B 1 304 ? 18.891 15.360  -36.339 1.00 45.06 ? 804 VAL B O     1 
ATOM   5091 C CB    . VAL B 1 304 ? 16.110 13.696  -36.495 1.00 47.54 ? 804 VAL B CB    1 
ATOM   5092 C CG1   . VAL B 1 304 ? 17.230 12.864  -35.888 1.00 46.99 ? 804 VAL B CG1   1 
ATOM   5093 C CG2   . VAL B 1 304 ? 14.821 13.510  -35.713 1.00 47.27 ? 804 VAL B CG2   1 
ATOM   5094 N N     . PHE B 1 305 ? 18.021 15.379  -38.415 1.00 43.87 ? 805 PHE B N     1 
ATOM   5095 C CA    . PHE B 1 305 ? 19.324 15.469  -39.063 1.00 42.56 ? 805 PHE B CA    1 
ATOM   5096 C C     . PHE B 1 305 ? 19.711 16.874  -39.516 1.00 42.95 ? 805 PHE B C     1 
ATOM   5097 O O     . PHE B 1 305 ? 18.862 17.757  -39.656 1.00 42.39 ? 805 PHE B O     1 
ATOM   5098 C CB    . PHE B 1 305 ? 19.369 14.502  -40.247 1.00 40.91 ? 805 PHE B CB    1 
ATOM   5099 C CG    . PHE B 1 305 ? 19.099 13.076  -39.864 1.00 39.06 ? 805 PHE B CG    1 
ATOM   5100 C CD1   . PHE B 1 305 ? 17.860 12.497  -40.114 1.00 37.77 ? 805 PHE B CD1   1 
ATOM   5101 C CD2   . PHE B 1 305 ? 20.080 12.317  -39.227 1.00 38.23 ? 805 PHE B CD2   1 
ATOM   5102 C CE1   . PHE B 1 305 ? 17.595 11.181  -39.733 1.00 37.36 ? 805 PHE B CE1   1 
ATOM   5103 C CE2   . PHE B 1 305 ? 19.827 10.998  -38.841 1.00 37.51 ? 805 PHE B CE2   1 
ATOM   5104 C CZ    . PHE B 1 305 ? 18.581 10.432  -39.096 1.00 36.83 ? 805 PHE B CZ    1 
ATOM   5105 N N     . ARG B 1 306 ? 21.009 17.067  -39.738 1.00 43.38 ? 806 ARG B N     1 
ATOM   5106 C CA    . ARG B 1 306 ? 21.534 18.351  -40.172 1.00 44.00 ? 806 ARG B CA    1 
ATOM   5107 C C     . ARG B 1 306 ? 20.916 18.755  -41.501 1.00 43.51 ? 806 ARG B C     1 
ATOM   5108 O O     . ARG B 1 306 ? 20.491 17.905  -42.282 1.00 42.96 ? 806 ARG B O     1 
ATOM   5109 C CB    . ARG B 1 306 ? 23.061 18.278  -40.296 1.00 45.67 ? 806 ARG B CB    1 
ATOM   5110 C CG    . ARG B 1 306 ? 23.562 17.520  -41.514 1.00 48.58 ? 806 ARG B CG    1 
ATOM   5111 C CD    . ARG B 1 306 ? 25.046 17.741  -41.749 1.00 51.52 ? 806 ARG B CD    1 
ATOM   5112 N NE    . ARG B 1 306 ? 25.520 17.122  -42.990 1.00 54.67 ? 806 ARG B NE    1 
ATOM   5113 C CZ    . ARG B 1 306 ? 25.393 15.825  -43.283 1.00 56.58 ? 806 ARG B CZ    1 
ATOM   5114 N NH1   . ARG B 1 306 ? 24.802 14.989  -42.427 1.00 57.59 ? 806 ARG B NH1   1 
ATOM   5115 N NH2   . ARG B 1 306 ? 25.863 15.352  -44.435 1.00 57.49 ? 806 ARG B NH2   1 
ATOM   5116 N N     . PRO B 1 307 ? 20.848 20.068  -41.776 1.00 43.35 ? 807 PRO B N     1 
ATOM   5117 C CA    . PRO B 1 307 ? 20.262 20.503  -43.046 1.00 42.56 ? 807 PRO B CA    1 
ATOM   5118 C C     . PRO B 1 307 ? 21.070 19.968  -44.220 1.00 41.66 ? 807 PRO B C     1 
ATOM   5119 O O     . PRO B 1 307 ? 22.295 19.852  -44.142 1.00 41.45 ? 807 PRO B O     1 
ATOM   5120 C CB    . PRO B 1 307 ? 20.296 22.030  -42.966 1.00 42.91 ? 807 PRO B CB    1 
ATOM   5121 C CG    . PRO B 1 307 ? 21.340 22.339  -41.943 1.00 43.45 ? 807 PRO B CG    1 
ATOM   5122 C CD    . PRO B 1 307 ? 21.298 21.206  -40.954 1.00 43.62 ? 807 PRO B CD    1 
ATOM   5123 N N     . ARG B 1 308 ? 20.366 19.635  -45.295 1.00 40.97 ? 808 ARG B N     1 
ATOM   5124 C CA    . ARG B 1 308 ? 20.972 19.106  -46.511 1.00 40.62 ? 808 ARG B CA    1 
ATOM   5125 C C     . ARG B 1 308 ? 21.202 17.593  -46.453 1.00 39.18 ? 808 ARG B C     1 
ATOM   5126 O O     . ARG B 1 308 ? 21.814 17.016  -47.355 1.00 38.68 ? 808 ARG B O     1 
ATOM   5127 C CB    . ARG B 1 308 ? 22.286 19.839  -46.823 1.00 41.66 ? 808 ARG B CB    1 
ATOM   5128 C CG    . ARG B 1 308 ? 22.095 21.187  -47.513 1.00 43.77 ? 808 ARG B CG    1 
ATOM   5129 C CD    . ARG B 1 308 ? 23.428 21.792  -47.950 1.00 45.77 ? 808 ARG B CD    1 
ATOM   5130 N NE    . ARG B 1 308 ? 24.289 22.080  -46.806 1.00 47.88 ? 808 ARG B NE    1 
ATOM   5131 C CZ    . ARG B 1 308 ? 24.067 23.056  -45.928 1.00 49.42 ? 808 ARG B CZ    1 
ATOM   5132 N NH1   . ARG B 1 308 ? 23.008 23.849  -46.055 1.00 49.89 ? 808 ARG B NH1   1 
ATOM   5133 N NH2   . ARG B 1 308 ? 24.900 23.232  -44.910 1.00 50.54 ? 808 ARG B NH2   1 
ATOM   5134 N N     . THR B 1 309 ? 20.718 16.952  -45.391 1.00 37.71 ? 809 THR B N     1 
ATOM   5135 C CA    . THR B 1 309 ? 20.847 15.506  -45.271 1.00 36.14 ? 809 THR B CA    1 
ATOM   5136 C C     . THR B 1 309 ? 19.942 14.936  -46.354 1.00 35.55 ? 809 THR B C     1 
ATOM   5137 O O     . THR B 1 309 ? 18.781 15.331  -46.460 1.00 35.53 ? 809 THR B O     1 
ATOM   5138 C CB    . THR B 1 309 ? 20.359 15.010  -43.903 1.00 35.82 ? 809 THR B CB    1 
ATOM   5139 O OG1   . THR B 1 309 ? 21.272 15.443  -42.894 1.00 34.80 ? 809 THR B OG1   1 
ATOM   5140 C CG2   . THR B 1 309 ? 20.272 13.483  -43.883 1.00 35.63 ? 809 THR B CG2   1 
ATOM   5141 N N     . PRO B 1 310 ? 20.452 13.998  -47.171 1.00 34.94 ? 810 PRO B N     1 
ATOM   5142 C CA    . PRO B 1 310 ? 19.600 13.440  -48.229 1.00 34.43 ? 810 PRO B CA    1 
ATOM   5143 C C     . PRO B 1 310 ? 18.265 12.918  -47.707 1.00 34.12 ? 810 PRO B C     1 
ATOM   5144 O O     . PRO B 1 310 ? 18.224 12.131  -46.765 1.00 33.99 ? 810 PRO B O     1 
ATOM   5145 C CB    . PRO B 1 310 ? 20.457 12.335  -48.849 1.00 34.10 ? 810 PRO B CB    1 
ATOM   5146 C CG    . PRO B 1 310 ? 21.865 12.694  -48.491 1.00 34.61 ? 810 PRO B CG    1 
ATOM   5147 C CD    . PRO B 1 310 ? 21.796 13.392  -47.161 1.00 34.62 ? 810 PRO B CD    1 
ATOM   5148 N N     . PRO B 1 311 ? 17.153 13.373  -48.308 1.00 33.67 ? 811 PRO B N     1 
ATOM   5149 C CA    . PRO B 1 311 ? 15.798 12.960  -47.916 1.00 32.91 ? 811 PRO B CA    1 
ATOM   5150 C C     . PRO B 1 311 ? 15.618 11.444  -47.925 1.00 32.21 ? 811 PRO B C     1 
ATOM   5151 O O     . PRO B 1 311 ? 14.883 10.891  -47.102 1.00 31.80 ? 811 PRO B O     1 
ATOM   5152 C CB    . PRO B 1 311 ? 14.900 13.643  -48.947 1.00 33.11 ? 811 PRO B CB    1 
ATOM   5153 C CG    . PRO B 1 311 ? 15.711 14.808  -49.439 1.00 33.82 ? 811 PRO B CG    1 
ATOM   5154 C CD    . PRO B 1 311 ? 17.136 14.347  -49.415 1.00 33.65 ? 811 PRO B CD    1 
ATOM   5155 N N     . GLU B 1 312 ? 16.287 10.782  -48.867 1.00 31.11 ? 812 GLU B N     1 
ATOM   5156 C CA    . GLU B 1 312 ? 16.210 9.331   -48.998 1.00 30.59 ? 812 GLU B CA    1 
ATOM   5157 C C     . GLU B 1 312 ? 16.840 8.650   -47.785 1.00 28.89 ? 812 GLU B C     1 
ATOM   5158 O O     . GLU B 1 312 ? 16.392 7.587   -47.355 1.00 27.91 ? 812 GLU B O     1 
ATOM   5159 C CB    . GLU B 1 312 ? 16.922 8.872   -50.276 1.00 31.68 ? 812 GLU B CB    1 
ATOM   5160 C CG    . GLU B 1 312 ? 16.302 9.416   -51.557 1.00 34.72 ? 812 GLU B CG    1 
ATOM   5161 C CD    . GLU B 1 312 ? 16.640 10.888  -51.809 1.00 36.77 ? 812 GLU B CD    1 
ATOM   5162 O OE1   . GLU B 1 312 ? 15.976 11.502  -52.679 1.00 38.67 ? 812 GLU B OE1   1 
ATOM   5163 O OE2   . GLU B 1 312 ? 17.562 11.432  -51.148 1.00 36.34 ? 812 GLU B OE2   1 
ATOM   5164 N N     . ALA B 1 313 ? 17.884 9.265   -47.240 1.00 28.06 ? 813 ALA B N     1 
ATOM   5165 C CA    . ALA B 1 313 ? 18.563 8.715   -46.071 1.00 27.29 ? 813 ALA B CA    1 
ATOM   5166 C C     . ALA B 1 313 ? 17.614 8.774   -44.882 1.00 27.06 ? 813 ALA B C     1 
ATOM   5167 O O     . ALA B 1 313 ? 17.519 7.830   -44.100 1.00 26.00 ? 813 ALA B O     1 
ATOM   5168 C CB    . ALA B 1 313 ? 19.831 9.509   -45.775 1.00 26.76 ? 813 ALA B CB    1 
ATOM   5169 N N     . ILE B 1 314 ? 16.914 9.897   -44.755 1.00 27.46 ? 814 ILE B N     1 
ATOM   5170 C CA    . ILE B 1 314 ? 15.953 10.100  -43.677 1.00 28.09 ? 814 ILE B CA    1 
ATOM   5171 C C     . ILE B 1 314 ? 14.784 9.123   -43.819 1.00 27.20 ? 814 ILE B C     1 
ATOM   5172 O O     . ILE B 1 314 ? 14.292 8.584   -42.826 1.00 27.36 ? 814 ILE B O     1 
ATOM   5173 C CB    . ILE B 1 314 ? 15.396 11.538  -43.697 1.00 29.27 ? 814 ILE B CB    1 
ATOM   5174 C CG1   . ILE B 1 314 ? 16.538 12.544  -43.546 1.00 30.04 ? 814 ILE B CG1   1 
ATOM   5175 C CG2   . ILE B 1 314 ? 14.382 11.722  -42.579 1.00 29.62 ? 814 ILE B CG2   1 
ATOM   5176 C CD1   . ILE B 1 314 ? 16.115 13.987  -43.781 1.00 31.39 ? 814 ILE B CD1   1 
ATOM   5177 N N     . ALA B 1 315 ? 14.340 8.903   -45.055 1.00 26.36 ? 815 ALA B N     1 
ATOM   5178 C CA    . ALA B 1 315 ? 13.233 7.984   -45.320 1.00 25.39 ? 815 ALA B CA    1 
ATOM   5179 C C     . ALA B 1 315 ? 13.615 6.557   -44.928 1.00 25.00 ? 815 ALA B C     1 
ATOM   5180 O O     . ALA B 1 315 ? 12.849 5.864   -44.256 1.00 24.39 ? 815 ALA B O     1 
ATOM   5181 C CB    . ALA B 1 315 ? 12.846 8.037   -46.794 1.00 25.28 ? 815 ALA B CB    1 
ATOM   5182 N N     . LEU B 1 316 ? 14.796 6.120   -45.358 1.00 24.50 ? 816 LEU B N     1 
ATOM   5183 C CA    . LEU B 1 316 ? 15.285 4.782   -45.028 1.00 23.79 ? 816 LEU B CA    1 
ATOM   5184 C C     . LEU B 1 316 ? 15.341 4.646   -43.509 1.00 24.19 ? 816 LEU B C     1 
ATOM   5185 O O     . LEU B 1 316 ? 14.878 3.658   -42.949 1.00 24.09 ? 816 LEU B O     1 
ATOM   5186 C CB    . LEU B 1 316 ? 16.686 4.551   -45.624 1.00 22.65 ? 816 LEU B CB    1 
ATOM   5187 C CG    . LEU B 1 316 ? 17.450 3.262   -45.258 1.00 22.80 ? 816 LEU B CG    1 
ATOM   5188 C CD1   . LEU B 1 316 ? 16.567 2.030   -45.482 1.00 21.38 ? 816 LEU B CD1   1 
ATOM   5189 C CD2   . LEU B 1 316 ? 18.729 3.146   -46.100 1.00 20.57 ? 816 LEU B CD2   1 
ATOM   5190 N N     . CYS B 1 317 ? 15.905 5.642   -42.836 1.00 24.54 ? 817 CYS B N     1 
ATOM   5191 C CA    . CYS B 1 317 ? 15.995 5.592   -41.383 1.00 26.39 ? 817 CYS B CA    1 
ATOM   5192 C C     . CYS B 1 317 ? 14.636 5.348   -40.743 1.00 25.57 ? 817 CYS B C     1 
ATOM   5193 O O     . CYS B 1 317 ? 14.504 4.503   -39.863 1.00 24.97 ? 817 CYS B O     1 
ATOM   5194 C CB    . CYS B 1 317 ? 16.547 6.901   -40.832 1.00 28.67 ? 817 CYS B CB    1 
ATOM   5195 S SG    . CYS B 1 317 ? 18.321 6.915   -40.667 1.00 33.51 ? 817 CYS B SG    1 
ATOM   5196 N N     . SER B 1 318 ? 13.628 6.091   -41.183 1.00 25.49 ? 818 SER B N     1 
ATOM   5197 C CA    . SER B 1 318 ? 12.291 5.947   -40.617 1.00 26.32 ? 818 SER B CA    1 
ATOM   5198 C C     . SER B 1 318 ? 11.662 4.573   -40.854 1.00 26.57 ? 818 SER B C     1 
ATOM   5199 O O     . SER B 1 318 ? 10.774 4.154   -40.103 1.00 27.22 ? 818 SER B O     1 
ATOM   5200 C CB    . SER B 1 318 ? 11.362 7.039   -41.156 1.00 26.48 ? 818 SER B CB    1 
ATOM   5201 O OG    . SER B 1 318 ? 10.975 6.775   -42.488 1.00 28.90 ? 818 SER B OG    1 
ATOM   5202 N N     . ARG B 1 319 ? 12.120 3.868   -41.886 1.00 26.01 ? 819 ARG B N     1 
ATOM   5203 C CA    . ARG B 1 319 ? 11.583 2.540   -42.193 1.00 25.66 ? 819 ARG B CA    1 
ATOM   5204 C C     . ARG B 1 319 ? 12.372 1.425   -41.524 1.00 24.58 ? 819 ARG B C     1 
ATOM   5205 O O     . ARG B 1 319 ? 11.982 0.256   -41.580 1.00 23.32 ? 819 ARG B O     1 
ATOM   5206 C CB    . ARG B 1 319 ? 11.550 2.310   -43.708 1.00 27.24 ? 819 ARG B CB    1 
ATOM   5207 C CG    . ARG B 1 319 ? 10.662 3.304   -44.457 1.00 30.47 ? 819 ARG B CG    1 
ATOM   5208 C CD    . ARG B 1 319 ? 9.185  3.059   -44.188 1.00 32.55 ? 819 ARG B CD    1 
ATOM   5209 N NE    . ARG B 1 319 ? 8.710  1.858   -44.874 1.00 35.21 ? 819 ARG B NE    1 
ATOM   5210 C CZ    . ARG B 1 319 ? 8.391  0.721   -44.261 1.00 36.41 ? 819 ARG B CZ    1 
ATOM   5211 N NH1   . ARG B 1 319 ? 8.492  0.624   -42.936 1.00 36.79 ? 819 ARG B NH1   1 
ATOM   5212 N NH2   . ARG B 1 319 ? 7.985  -0.326  -44.972 1.00 37.09 ? 819 ARG B NH2   1 
ATOM   5213 N N     . LEU B 1 320 ? 13.483 1.783   -40.887 1.00 23.27 ? 820 LEU B N     1 
ATOM   5214 C CA    . LEU B 1 320 ? 14.311 0.801   -40.194 1.00 22.93 ? 820 LEU B CA    1 
ATOM   5215 C C     . LEU B 1 320 ? 14.031 0.878   -38.698 1.00 23.24 ? 820 LEU B C     1 
ATOM   5216 O O     . LEU B 1 320 ? 13.919 -0.140  -38.005 1.00 23.24 ? 820 LEU B O     1 
ATOM   5217 C CB    . LEU B 1 320 ? 15.793 1.092   -40.439 1.00 21.51 ? 820 LEU B CB    1 
ATOM   5218 C CG    . LEU B 1 320 ? 16.286 0.960   -41.877 1.00 21.26 ? 820 LEU B CG    1 
ATOM   5219 C CD1   . LEU B 1 320 ? 17.743 1.399   -41.945 1.00 19.94 ? 820 LEU B CD1   1 
ATOM   5220 C CD2   . LEU B 1 320 ? 16.129 -0.485  -42.345 1.00 20.60 ? 820 LEU B CD2   1 
ATOM   5221 N N     . LEU B 1 321 ? 13.925 2.109   -38.215 1.00 23.69 ? 821 LEU B N     1 
ATOM   5222 C CA    . LEU B 1 321 ? 13.680 2.371   -36.808 1.00 23.99 ? 821 LEU B CA    1 
ATOM   5223 C C     . LEU B 1 321 ? 12.186 2.485   -36.538 1.00 24.81 ? 821 LEU B C     1 
ATOM   5224 O O     . LEU B 1 321 ? 11.662 3.576   -36.338 1.00 25.44 ? 821 LEU B O     1 
ATOM   5225 C CB    . LEU B 1 321 ? 14.417 3.650   -36.392 1.00 23.40 ? 821 LEU B CB    1 
ATOM   5226 C CG    . LEU B 1 321 ? 15.935 3.581   -36.634 1.00 23.43 ? 821 LEU B CG    1 
ATOM   5227 C CD1   . LEU B 1 321 ? 16.601 4.888   -36.248 1.00 23.21 ? 821 LEU B CD1   1 
ATOM   5228 C CD2   . LEU B 1 321 ? 16.527 2.429   -35.824 1.00 23.14 ? 821 LEU B CD2   1 
ATOM   5229 N N     . GLU B 1 322 ? 11.507 1.341   -36.556 1.00 25.24 ? 822 GLU B N     1 
ATOM   5230 C CA    . GLU B 1 322 ? 10.070 1.275   -36.305 1.00 27.06 ? 822 GLU B CA    1 
ATOM   5231 C C     . GLU B 1 322 ? 9.835  0.489   -35.022 1.00 26.48 ? 822 GLU B C     1 
ATOM   5232 O O     . GLU B 1 322 ? 10.564 -0.459  -34.733 1.00 26.24 ? 822 GLU B O     1 
ATOM   5233 C CB    . GLU B 1 322 ? 9.345  0.559   -37.455 1.00 28.32 ? 822 GLU B CB    1 
ATOM   5234 C CG    . GLU B 1 322 ? 9.520  1.202   -38.820 1.00 32.30 ? 822 GLU B CG    1 
ATOM   5235 C CD    . GLU B 1 322 ? 8.331  2.063   -39.219 1.00 34.70 ? 822 GLU B CD    1 
ATOM   5236 O OE1   . GLU B 1 322 ? 7.530  2.420   -38.326 1.00 36.08 ? 822 GLU B OE1   1 
ATOM   5237 O OE2   . GLU B 1 322 ? 8.198  2.384   -40.426 1.00 36.36 ? 822 GLU B OE2   1 
ATOM   5238 N N     . TYR B 1 323 ? 8.817  0.879   -34.257 1.00 26.40 ? 823 TYR B N     1 
ATOM   5239 C CA    . TYR B 1 323 ? 8.481  0.178   -33.021 1.00 25.60 ? 823 TYR B CA    1 
ATOM   5240 C C     . TYR B 1 323 ? 8.031  -1.251  -33.344 1.00 25.53 ? 823 TYR B C     1 
ATOM   5241 O O     . TYR B 1 323 ? 8.553  -2.217  -32.792 1.00 25.56 ? 823 TYR B O     1 
ATOM   5242 C CB    . TYR B 1 323 ? 7.344  0.895   -32.283 1.00 25.88 ? 823 TYR B CB    1 
ATOM   5243 C CG    . TYR B 1 323 ? 7.747  2.113   -31.480 1.00 26.19 ? 823 TYR B CG    1 
ATOM   5244 C CD1   . TYR B 1 323 ? 8.734  2.035   -30.495 1.00 26.07 ? 823 TYR B CD1   1 
ATOM   5245 C CD2   . TYR B 1 323 ? 7.110  3.337   -31.675 1.00 26.10 ? 823 TYR B CD2   1 
ATOM   5246 C CE1   . TYR B 1 323 ? 9.075  3.143   -29.725 1.00 26.35 ? 823 TYR B CE1   1 
ATOM   5247 C CE2   . TYR B 1 323 ? 7.443  4.450   -30.912 1.00 26.76 ? 823 TYR B CE2   1 
ATOM   5248 C CZ    . TYR B 1 323 ? 8.425  4.345   -29.939 1.00 26.68 ? 823 TYR B CZ    1 
ATOM   5249 O OH    . TYR B 1 323 ? 8.759  5.444   -29.185 1.00 28.08 ? 823 TYR B OH    1 
ATOM   5250 N N     . THR B 1 324 ? 7.059  -1.386  -34.241 1.00 25.29 ? 824 THR B N     1 
ATOM   5251 C CA    . THR B 1 324 ? 6.560  -2.710  -34.612 1.00 25.94 ? 824 THR B CA    1 
ATOM   5252 C C     . THR B 1 324 ? 7.632  -3.464  -35.390 1.00 25.88 ? 824 THR B C     1 
ATOM   5253 O O     . THR B 1 324 ? 7.954  -3.106  -36.518 1.00 26.36 ? 824 THR B O     1 
ATOM   5254 C CB    . THR B 1 324 ? 5.274  -2.595  -35.466 1.00 26.13 ? 824 THR B CB    1 
ATOM   5255 O OG1   . THR B 1 324 ? 4.264  -1.910  -34.712 1.00 26.10 ? 824 THR B OG1   1 
ATOM   5256 C CG2   . THR B 1 324 ? 4.768  -3.977  -35.859 1.00 25.73 ? 824 THR B CG2   1 
ATOM   5257 N N     . PRO B 1 325 ? 8.191  -4.532  -34.796 1.00 26.37 ? 825 PRO B N     1 
ATOM   5258 C CA    . PRO B 1 325 ? 9.241  -5.328  -35.446 1.00 26.57 ? 825 PRO B CA    1 
ATOM   5259 C C     . PRO B 1 325 ? 8.951  -5.770  -36.883 1.00 26.85 ? 825 PRO B C     1 
ATOM   5260 O O     . PRO B 1 325 ? 9.800  -5.630  -37.766 1.00 26.24 ? 825 PRO B O     1 
ATOM   5261 C CB    . PRO B 1 325 ? 9.439  -6.510  -34.493 1.00 25.91 ? 825 PRO B CB    1 
ATOM   5262 C CG    . PRO B 1 325 ? 9.000  -5.988  -33.157 1.00 26.29 ? 825 PRO B CG    1 
ATOM   5263 C CD    . PRO B 1 325 ? 7.854  -5.060  -33.458 1.00 26.22 ? 825 PRO B CD    1 
ATOM   5264 N N     . THR B 1 326 ? 7.757  -6.303  -37.120 1.00 27.01 ? 826 THR B N     1 
ATOM   5265 C CA    . THR B 1 326 ? 7.391  -6.753  -38.457 1.00 26.55 ? 826 THR B CA    1 
ATOM   5266 C C     . THR B 1 326 ? 7.240  -5.602  -39.451 1.00 26.15 ? 826 THR B C     1 
ATOM   5267 O O     . THR B 1 326 ? 7.217  -5.827  -40.662 1.00 26.81 ? 826 THR B O     1 
ATOM   5268 C CB    . THR B 1 326 ? 6.077  -7.574  -38.436 1.00 26.76 ? 826 THR B CB    1 
ATOM   5269 O OG1   . THR B 1 326 ? 5.039  -6.814  -37.809 1.00 27.62 ? 826 THR B OG1   1 
ATOM   5270 C CG2   . THR B 1 326 ? 6.271  -8.855  -37.662 1.00 27.02 ? 826 THR B CG2   1 
ATOM   5271 N N     . ALA B 1 327 ? 7.139  -4.373  -38.952 1.00 25.66 ? 827 ALA B N     1 
ATOM   5272 C CA    . ALA B 1 327 ? 6.993  -3.208  -39.824 1.00 25.36 ? 827 ALA B CA    1 
ATOM   5273 C C     . ALA B 1 327 ? 8.330  -2.748  -40.437 1.00 25.13 ? 827 ALA B C     1 
ATOM   5274 O O     . ALA B 1 327 ? 8.348  -2.077  -41.469 1.00 26.05 ? 827 ALA B O     1 
ATOM   5275 C CB    . ALA B 1 327 ? 6.358  -2.064  -39.055 1.00 25.44 ? 827 ALA B CB    1 
ATOM   5276 N N     . ARG B 1 328 ? 9.444  -3.107  -39.807 1.00 23.63 ? 828 ARG B N     1 
ATOM   5277 C CA    . ARG B 1 328 ? 10.756 -2.720  -40.316 1.00 22.16 ? 828 ARG B CA    1 
ATOM   5278 C C     . ARG B 1 328 ? 11.072 -3.408  -41.647 1.00 22.11 ? 828 ARG B C     1 
ATOM   5279 O O     . ARG B 1 328 ? 10.651 -4.543  -41.890 1.00 21.41 ? 828 ARG B O     1 
ATOM   5280 C CB    . ARG B 1 328 ? 11.852 -3.086  -39.299 1.00 20.49 ? 828 ARG B CB    1 
ATOM   5281 C CG    . ARG B 1 328 ? 11.599 -2.542  -37.916 1.00 19.36 ? 828 ARG B CG    1 
ATOM   5282 C CD    . ARG B 1 328 ? 12.610 -3.003  -36.878 1.00 19.38 ? 828 ARG B CD    1 
ATOM   5283 N NE    . ARG B 1 328 ? 12.094 -2.627  -35.569 1.00 19.69 ? 828 ARG B NE    1 
ATOM   5284 C CZ    . ARG B 1 328 ? 12.279 -3.301  -34.441 1.00 20.38 ? 828 ARG B CZ    1 
ATOM   5285 N NH1   . ARG B 1 328 ? 12.992 -4.414  -34.433 1.00 19.68 ? 828 ARG B NH1   1 
ATOM   5286 N NH2   . ARG B 1 328 ? 11.694 -2.877  -33.320 1.00 19.35 ? 828 ARG B NH2   1 
ATOM   5287 N N     . LEU B 1 329 ? 11.829 -2.724  -42.501 1.00 21.52 ? 829 LEU B N     1 
ATOM   5288 C CA    . LEU B 1 329 ? 12.242 -3.308  -43.773 1.00 21.41 ? 829 LEU B CA    1 
ATOM   5289 C C     . LEU B 1 329 ? 13.131 -4.517  -43.478 1.00 22.35 ? 829 LEU B C     1 
ATOM   5290 O O     . LEU B 1 329 ? 13.774 -4.588  -42.418 1.00 21.58 ? 829 LEU B O     1 
ATOM   5291 C CB    . LEU B 1 329 ? 13.080 -2.310  -44.582 1.00 22.35 ? 829 LEU B CB    1 
ATOM   5292 C CG    . LEU B 1 329 ? 12.431 -1.028  -45.095 1.00 22.42 ? 829 LEU B CG    1 
ATOM   5293 C CD1   . LEU B 1 329 ? 13.508 -0.064  -45.590 1.00 22.53 ? 829 LEU B CD1   1 
ATOM   5294 C CD2   . LEU B 1 329 ? 11.474 -1.369  -46.217 1.00 23.24 ? 829 LEU B CD2   1 
ATOM   5295 N N     . THR B 1 330 ? 13.163 -5.468  -44.405 1.00 21.63 ? 830 THR B N     1 
ATOM   5296 C CA    . THR B 1 330 ? 14.036 -6.625  -44.267 1.00 22.10 ? 830 THR B CA    1 
ATOM   5297 C C     . THR B 1 330 ? 15.350 -6.130  -44.872 1.00 21.95 ? 830 THR B C     1 
ATOM   5298 O O     . THR B 1 330 ? 15.370 -5.107  -45.564 1.00 21.91 ? 830 THR B O     1 
ATOM   5299 C CB    . THR B 1 330 ? 13.549 -7.828  -45.108 1.00 22.51 ? 830 THR B CB    1 
ATOM   5300 O OG1   . THR B 1 330 ? 13.526 -7.460  -46.493 1.00 23.24 ? 830 THR B OG1   1 
ATOM   5301 C CG2   . THR B 1 330 ? 12.148 -8.244  -44.683 1.00 23.55 ? 830 THR B CG2   1 
ATOM   5302 N N     . PRO B 1 331 ? 16.468 -6.814  -44.587 1.00 21.68 ? 831 PRO B N     1 
ATOM   5303 C CA    . PRO B 1 331 ? 17.762 -6.403  -45.143 1.00 21.14 ? 831 PRO B CA    1 
ATOM   5304 C C     . PRO B 1 331 ? 17.749 -6.307  -46.668 1.00 21.29 ? 831 PRO B C     1 
ATOM   5305 O O     . PRO B 1 331 ? 18.275 -5.353  -47.238 1.00 20.93 ? 831 PRO B O     1 
ATOM   5306 C CB    . PRO B 1 331 ? 18.723 -7.480  -44.648 1.00 21.16 ? 831 PRO B CB    1 
ATOM   5307 C CG    . PRO B 1 331 ? 18.073 -8.006  -43.396 1.00 21.42 ? 831 PRO B CG    1 
ATOM   5308 C CD    . PRO B 1 331 ? 16.602 -7.967  -43.677 1.00 21.62 ? 831 PRO B CD    1 
ATOM   5309 N N     . LEU B 1 332 ? 17.149 -7.292  -47.333 1.00 21.47 ? 832 LEU B N     1 
ATOM   5310 C CA    . LEU B 1 332 ? 17.102 -7.281  -48.792 1.00 21.64 ? 832 LEU B CA    1 
ATOM   5311 C C     . LEU B 1 332 ? 16.307 -6.077  -49.290 1.00 21.38 ? 832 LEU B C     1 
ATOM   5312 O O     . LEU B 1 332 ? 16.690 -5.438  -50.268 1.00 21.93 ? 832 LEU B O     1 
ATOM   5313 C CB    . LEU B 1 332 ? 16.488 -8.589  -49.306 1.00 22.33 ? 832 LEU B CB    1 
ATOM   5314 C CG    . LEU B 1 332 ? 16.864 -9.041  -50.720 1.00 23.78 ? 832 LEU B CG    1 
ATOM   5315 C CD1   . LEU B 1 332 ? 18.376 -9.250  -50.833 1.00 22.96 ? 832 LEU B CD1   1 
ATOM   5316 C CD2   . LEU B 1 332 ? 16.100 -10.327 -51.043 1.00 23.46 ? 832 LEU B CD2   1 
ATOM   5317 N N     . GLU B 1 333 ? 15.204 -5.763  -48.614 1.00 21.92 ? 833 GLU B N     1 
ATOM   5318 C CA    . GLU B 1 333 ? 14.380 -4.616  -48.988 1.00 22.23 ? 833 GLU B CA    1 
ATOM   5319 C C     . GLU B 1 333 ? 15.161 -3.323  -48.773 1.00 22.16 ? 833 GLU B C     1 
ATOM   5320 O O     . GLU B 1 333 ? 15.036 -2.368  -49.550 1.00 21.81 ? 833 GLU B O     1 
ATOM   5321 C CB    . GLU B 1 333 ? 13.094 -4.572  -48.155 1.00 23.30 ? 833 GLU B CB    1 
ATOM   5322 C CG    . GLU B 1 333 ? 12.036 -5.574  -48.611 1.00 24.62 ? 833 GLU B CG    1 
ATOM   5323 C CD    . GLU B 1 333 ? 10.910 -5.754  -47.608 1.00 26.01 ? 833 GLU B CD    1 
ATOM   5324 O OE1   . GLU B 1 333 ? 10.968 -5.150  -46.517 1.00 25.24 ? 833 GLU B OE1   1 
ATOM   5325 O OE2   . GLU B 1 333 ? 9.958  -6.510  -47.912 1.00 26.83 ? 833 GLU B OE2   1 
ATOM   5326 N N     . ALA B 1 334 ? 15.957 -3.291  -47.708 1.00 21.02 ? 834 ALA B N     1 
ATOM   5327 C CA    . ALA B 1 334 ? 16.765 -2.114  -47.408 1.00 20.22 ? 834 ALA B CA    1 
ATOM   5328 C C     . ALA B 1 334 ? 17.763 -1.892  -48.555 1.00 19.62 ? 834 ALA B C     1 
ATOM   5329 O O     . ALA B 1 334 ? 17.943 -0.767  -49.015 1.00 18.67 ? 834 ALA B O     1 
ATOM   5330 C CB    . ALA B 1 334 ? 17.506 -2.301  -46.065 1.00 19.05 ? 834 ALA B CB    1 
ATOM   5331 N N     . CYS B 1 335 ? 18.389 -2.972  -49.023 1.00 19.47 ? 835 CYS B N     1 
ATOM   5332 C CA    . CYS B 1 335 ? 19.350 -2.880  -50.119 1.00 20.39 ? 835 CYS B CA    1 
ATOM   5333 C C     . CYS B 1 335 ? 18.733 -2.252  -51.366 1.00 21.53 ? 835 CYS B C     1 
ATOM   5334 O O     . CYS B 1 335 ? 19.416 -1.552  -52.132 1.00 21.63 ? 835 CYS B O     1 
ATOM   5335 C CB    . CYS B 1 335 ? 19.869 -4.268  -50.483 1.00 20.89 ? 835 CYS B CB    1 
ATOM   5336 S SG    . CYS B 1 335 ? 21.095 -4.945  -49.354 1.00 22.54 ? 835 CYS B SG    1 
ATOM   5337 N N     . ALA B 1 336 ? 17.443 -2.510  -51.567 1.00 22.28 ? 836 ALA B N     1 
ATOM   5338 C CA    . ALA B 1 336 ? 16.717 -2.009  -52.734 1.00 22.34 ? 836 ALA B CA    1 
ATOM   5339 C C     . ALA B 1 336 ? 16.154 -0.609  -52.539 1.00 22.98 ? 836 ALA B C     1 
ATOM   5340 O O     . ALA B 1 336 ? 15.535 -0.052  -53.451 1.00 23.48 ? 836 ALA B O     1 
ATOM   5341 C CB    . ALA B 1 336 ? 15.592 -2.976  -53.087 1.00 21.77 ? 836 ALA B CB    1 
ATOM   5342 N N     . HIS B 1 337 ? 16.357 -0.037  -51.357 1.00 22.62 ? 837 HIS B N     1 
ATOM   5343 C CA    . HIS B 1 337 ? 15.853 1.299   -51.084 1.00 23.18 ? 837 HIS B CA    1 
ATOM   5344 C C     . HIS B 1 337 ? 16.502 2.315   -52.031 1.00 23.81 ? 837 HIS B C     1 
ATOM   5345 O O     . HIS B 1 337 ? 17.616 2.107   -52.514 1.00 23.32 ? 837 HIS B O     1 
ATOM   5346 C CB    . HIS B 1 337 ? 16.122 1.686   -49.626 1.00 23.29 ? 837 HIS B CB    1 
ATOM   5347 C CG    . HIS B 1 337 ? 15.370 2.903   -49.181 1.00 23.82 ? 837 HIS B CG    1 
ATOM   5348 N ND1   . HIS B 1 337 ? 15.806 4.185   -49.443 1.00 23.83 ? 837 HIS B ND1   1 
ATOM   5349 C CD2   . HIS B 1 337 ? 14.206 3.035   -48.501 1.00 24.04 ? 837 HIS B CD2   1 
ATOM   5350 C CE1   . HIS B 1 337 ? 14.944 5.053   -48.942 1.00 24.07 ? 837 HIS B CE1   1 
ATOM   5351 N NE2   . HIS B 1 337 ? 13.964 4.381   -48.365 1.00 24.40 ? 837 HIS B NE2   1 
ATOM   5352 N N     . SER B 1 338 ? 15.800 3.416   -52.284 1.00 24.57 ? 838 SER B N     1 
ATOM   5353 C CA    . SER B 1 338 ? 16.291 4.456   -53.183 1.00 25.45 ? 838 SER B CA    1 
ATOM   5354 C C     . SER B 1 338 ? 17.524 5.204   -52.661 1.00 25.30 ? 838 SER B C     1 
ATOM   5355 O O     . SER B 1 338 ? 18.210 5.885   -53.431 1.00 25.38 ? 838 SER B O     1 
ATOM   5356 C CB    . SER B 1 338 ? 15.168 5.453   -53.473 1.00 26.91 ? 838 SER B CB    1 
ATOM   5357 O OG    . SER B 1 338 ? 14.735 6.064   -52.265 1.00 30.45 ? 838 SER B OG    1 
ATOM   5358 N N     . PHE B 1 339 ? 17.806 5.095   -51.364 1.00 24.10 ? 839 PHE B N     1 
ATOM   5359 C CA    . PHE B 1 339 ? 18.986 5.756   -50.804 1.00 23.41 ? 839 PHE B CA    1 
ATOM   5360 C C     . PHE B 1 339 ? 20.219 5.145   -51.464 1.00 22.55 ? 839 PHE B C     1 
ATOM   5361 O O     . PHE B 1 339 ? 21.254 5.799   -51.598 1.00 22.76 ? 839 PHE B O     1 
ATOM   5362 C CB    . PHE B 1 339 ? 19.044 5.550   -49.279 1.00 23.44 ? 839 PHE B CB    1 
ATOM   5363 C CG    . PHE B 1 339 ? 20.304 6.088   -48.623 1.00 22.87 ? 839 PHE B CG    1 
ATOM   5364 C CD1   . PHE B 1 339 ? 20.663 7.428   -48.754 1.00 22.23 ? 839 PHE B CD1   1 
ATOM   5365 C CD2   . PHE B 1 339 ? 21.116 5.251   -47.848 1.00 22.21 ? 839 PHE B CD2   1 
ATOM   5366 C CE1   . PHE B 1 339 ? 21.811 7.927   -48.123 1.00 22.96 ? 839 PHE B CE1   1 
ATOM   5367 C CE2   . PHE B 1 339 ? 22.266 5.741   -47.214 1.00 22.39 ? 839 PHE B CE2   1 
ATOM   5368 C CZ    . PHE B 1 339 ? 22.613 7.077   -47.350 1.00 22.00 ? 839 PHE B CZ    1 
ATOM   5369 N N     . PHE B 1 340 ? 20.105 3.893   -51.901 1.00 22.13 ? 840 PHE B N     1 
ATOM   5370 C CA    . PHE B 1 340 ? 21.236 3.223   -52.533 1.00 21.90 ? 840 PHE B CA    1 
ATOM   5371 C C     . PHE B 1 340 ? 21.241 3.296   -54.064 1.00 22.90 ? 840 PHE B C     1 
ATOM   5372 O O     . PHE B 1 340 ? 22.069 2.662   -54.720 1.00 22.36 ? 840 PHE B O     1 
ATOM   5373 C CB    . PHE B 1 340 ? 21.298 1.759   -52.085 1.00 21.08 ? 840 PHE B CB    1 
ATOM   5374 C CG    . PHE B 1 340 ? 21.436 1.587   -50.595 1.00 20.08 ? 840 PHE B CG    1 
ATOM   5375 C CD1   . PHE B 1 340 ? 22.575 2.034   -49.927 1.00 19.68 ? 840 PHE B CD1   1 
ATOM   5376 C CD2   . PHE B 1 340 ? 20.422 0.989   -49.857 1.00 19.64 ? 840 PHE B CD2   1 
ATOM   5377 C CE1   . PHE B 1 340 ? 22.701 1.886   -48.535 1.00 18.79 ? 840 PHE B CE1   1 
ATOM   5378 C CE2   . PHE B 1 340 ? 20.541 0.839   -48.465 1.00 20.03 ? 840 PHE B CE2   1 
ATOM   5379 C CZ    . PHE B 1 340 ? 21.685 1.289   -47.806 1.00 19.12 ? 840 PHE B CZ    1 
ATOM   5380 N N     . ASP B 1 341 ? 20.334 4.077   -54.638 1.00 23.97 ? 841 ASP B N     1 
ATOM   5381 C CA    . ASP B 1 341 ? 20.279 4.183   -56.095 1.00 25.59 ? 841 ASP B CA    1 
ATOM   5382 C C     . ASP B 1 341 ? 21.600 4.595   -56.741 1.00 25.93 ? 841 ASP B C     1 
ATOM   5383 O O     . ASP B 1 341 ? 21.948 4.100   -57.813 1.00 26.86 ? 841 ASP B O     1 
ATOM   5384 C CB    . ASP B 1 341 ? 19.181 5.160   -56.511 1.00 26.83 ? 841 ASP B CB    1 
ATOM   5385 C CG    . ASP B 1 341 ? 17.798 4.535   -56.470 1.00 28.80 ? 841 ASP B CG    1 
ATOM   5386 O OD1   . ASP B 1 341 ? 17.702 3.299   -56.289 1.00 29.87 ? 841 ASP B OD1   1 
ATOM   5387 O OD2   . ASP B 1 341 ? 16.805 5.285   -56.612 1.00 29.35 ? 841 ASP B OD2   1 
ATOM   5388 N N     . GLU B 1 342 ? 22.340 5.488   -56.090 1.00 25.58 ? 842 GLU B N     1 
ATOM   5389 C CA    . GLU B 1 342 ? 23.613 5.953   -56.630 1.00 25.15 ? 842 GLU B CA    1 
ATOM   5390 C C     . GLU B 1 342 ? 24.610 4.812   -56.825 1.00 24.16 ? 842 GLU B C     1 
ATOM   5391 O O     . GLU B 1 342 ? 25.431 4.841   -57.747 1.00 23.68 ? 842 GLU B O     1 
ATOM   5392 C CB    . GLU B 1 342 ? 24.233 7.011   -55.712 1.00 26.51 ? 842 GLU B CB    1 
ATOM   5393 C CG    . GLU B 1 342 ? 25.610 7.460   -56.176 1.00 29.03 ? 842 GLU B CG    1 
ATOM   5394 C CD    . GLU B 1 342 ? 26.163 8.627   -55.383 1.00 30.05 ? 842 GLU B CD    1 
ATOM   5395 O OE1   . GLU B 1 342 ? 25.576 8.979   -54.336 1.00 31.06 ? 842 GLU B OE1   1 
ATOM   5396 O OE2   . GLU B 1 342 ? 27.194 9.187   -55.811 1.00 31.60 ? 842 GLU B OE2   1 
ATOM   5397 N N     . LEU B 1 343 ? 24.541 3.813   -55.951 1.00 22.59 ? 843 LEU B N     1 
ATOM   5398 C CA    . LEU B 1 343 ? 25.436 2.665   -56.033 1.00 21.72 ? 843 LEU B CA    1 
ATOM   5399 C C     . LEU B 1 343 ? 25.165 1.832   -57.289 1.00 21.72 ? 843 LEU B C     1 
ATOM   5400 O O     . LEU B 1 343 ? 26.046 1.130   -57.776 1.00 21.41 ? 843 LEU B O     1 
ATOM   5401 C CB    . LEU B 1 343 ? 25.270 1.784   -54.790 1.00 21.43 ? 843 LEU B CB    1 
ATOM   5402 C CG    . LEU B 1 343 ? 25.540 2.444   -53.431 1.00 20.46 ? 843 LEU B CG    1 
ATOM   5403 C CD1   . LEU B 1 343 ? 25.558 1.377   -52.330 1.00 18.89 ? 843 LEU B CD1   1 
ATOM   5404 C CD2   . LEU B 1 343 ? 26.882 3.190   -53.476 1.00 19.51 ? 843 LEU B CD2   1 
ATOM   5405 N N     . ARG B 1 344 ? 23.944 1.918   -57.804 1.00 22.63 ? 844 ARG B N     1 
ATOM   5406 C CA    . ARG B 1 344 ? 23.548 1.162   -58.989 1.00 23.59 ? 844 ARG B CA    1 
ATOM   5407 C C     . ARG B 1 344 ? 23.810 1.930   -60.290 1.00 25.51 ? 844 ARG B C     1 
ATOM   5408 O O     . ARG B 1 344 ? 23.520 1.435   -61.380 1.00 25.86 ? 844 ARG B O     1 
ATOM   5409 C CB    . ARG B 1 344 ? 22.067 0.774   -58.886 1.00 22.43 ? 844 ARG B CB    1 
ATOM   5410 C CG    . ARG B 1 344 ? 21.785 -0.352  -57.879 1.00 21.99 ? 844 ARG B CG    1 
ATOM   5411 C CD    . ARG B 1 344 ? 20.292 -0.682  -57.781 1.00 21.49 ? 844 ARG B CD    1 
ATOM   5412 N NE    . ARG B 1 344 ? 19.541 0.258   -56.943 1.00 22.18 ? 844 ARG B NE    1 
ATOM   5413 C CZ    . ARG B 1 344 ? 19.403 0.149   -55.621 1.00 22.06 ? 844 ARG B CZ    1 
ATOM   5414 N NH1   . ARG B 1 344 ? 19.965 -0.861  -54.972 1.00 21.19 ? 844 ARG B NH1   1 
ATOM   5415 N NH2   . ARG B 1 344 ? 18.705 1.050   -54.949 1.00 22.08 ? 844 ARG B NH2   1 
ATOM   5416 N N     . ASP B 1 345 ? 24.352 3.139   -60.169 1.00 27.20 ? 845 ASP B N     1 
ATOM   5417 C CA    . ASP B 1 345 ? 24.679 3.951   -61.336 1.00 29.07 ? 845 ASP B CA    1 
ATOM   5418 C C     . ASP B 1 345 ? 25.907 3.331   -62.004 1.00 29.60 ? 845 ASP B C     1 
ATOM   5419 O O     . ASP B 1 345 ? 26.909 3.039   -61.349 1.00 29.51 ? 845 ASP B O     1 
ATOM   5420 C CB    . ASP B 1 345 ? 24.981 5.392   -60.916 1.00 30.21 ? 845 ASP B CB    1 
ATOM   5421 C CG    . ASP B 1 345 ? 25.162 6.319   -62.105 1.00 32.05 ? 845 ASP B CG    1 
ATOM   5422 O OD1   . ASP B 1 345 ? 25.981 6.006   -62.992 1.00 32.18 ? 845 ASP B OD1   1 
ATOM   5423 O OD2   . ASP B 1 345 ? 24.482 7.365   -62.153 1.00 34.44 ? 845 ASP B OD2   1 
ATOM   5424 N N     . PRO B 1 346 ? 25.857 3.144   -63.328 1.00 30.60 ? 846 PRO B N     1 
ATOM   5425 C CA    . PRO B 1 346 ? 26.997 2.542   -64.026 1.00 31.51 ? 846 PRO B CA    1 
ATOM   5426 C C     . PRO B 1 346 ? 28.310 3.319   -63.919 1.00 32.58 ? 846 PRO B C     1 
ATOM   5427 O O     . PRO B 1 346 ? 29.392 2.738   -64.032 1.00 33.17 ? 846 PRO B O     1 
ATOM   5428 C CB    . PRO B 1 346 ? 26.514 2.429   -65.475 1.00 31.14 ? 846 PRO B CB    1 
ATOM   5429 C CG    . PRO B 1 346 ? 25.445 3.485   -65.594 1.00 31.78 ? 846 PRO B CG    1 
ATOM   5430 C CD    . PRO B 1 346 ? 24.769 3.513   -64.252 1.00 30.82 ? 846 PRO B CD    1 
ATOM   5431 N N     . ASN B 1 347 ? 28.225 4.622   -63.689 1.00 33.17 ? 847 ASN B N     1 
ATOM   5432 C CA    . ASN B 1 347 ? 29.436 5.432   -63.613 1.00 35.10 ? 847 ASN B CA    1 
ATOM   5433 C C     . ASN B 1 347 ? 29.915 5.764   -62.215 1.00 35.03 ? 847 ASN B C     1 
ATOM   5434 O O     . ASN B 1 347 ? 30.873 6.515   -62.058 1.00 35.62 ? 847 ASN B O     1 
ATOM   5435 C CB    . ASN B 1 347 ? 29.244 6.732   -64.393 1.00 36.61 ? 847 ASN B CB    1 
ATOM   5436 C CG    . ASN B 1 347 ? 28.906 6.488   -65.845 1.00 38.05 ? 847 ASN B CG    1 
ATOM   5437 O OD1   . ASN B 1 347 ? 28.040 7.160   -66.410 1.00 40.59 ? 847 ASN B OD1   1 
ATOM   5438 N ND2   . ASN B 1 347 ? 29.583 5.519   -66.460 1.00 37.90 ? 847 ASN B ND2   1 
ATOM   5439 N N     . VAL B 1 348 ? 29.258 5.214   -61.201 1.00 35.21 ? 848 VAL B N     1 
ATOM   5440 C CA    . VAL B 1 348 ? 29.664 5.482   -59.826 1.00 35.19 ? 848 VAL B CA    1 
ATOM   5441 C C     . VAL B 1 348 ? 31.094 4.992   -59.568 1.00 35.75 ? 848 VAL B C     1 
ATOM   5442 O O     . VAL B 1 348 ? 31.498 3.933   -60.048 1.00 35.88 ? 848 VAL B O     1 
ATOM   5443 C CB    . VAL B 1 348 ? 28.685 4.817   -58.816 1.00 34.88 ? 848 VAL B CB    1 
ATOM   5444 C CG1   . VAL B 1 348 ? 28.926 3.314   -58.750 1.00 33.58 ? 848 VAL B CG1   1 
ATOM   5445 C CG2   . VAL B 1 348 ? 28.845 5.459   -57.440 1.00 34.35 ? 848 VAL B CG2   1 
ATOM   5446 N N     . LYS B 1 349 ? 31.866 5.777   -58.824 1.00 36.45 ? 849 LYS B N     1 
ATOM   5447 C CA    . LYS B 1 349 ? 33.241 5.410   -58.494 1.00 37.28 ? 849 LYS B CA    1 
ATOM   5448 C C     . LYS B 1 349 ? 33.561 5.908   -57.090 1.00 37.40 ? 849 LYS B C     1 
ATOM   5449 O O     . LYS B 1 349 ? 32.860 6.769   -56.562 1.00 36.95 ? 849 LYS B O     1 
ATOM   5450 C CB    . LYS B 1 349 ? 34.223 6.041   -59.490 1.00 37.90 ? 849 LYS B CB    1 
ATOM   5451 C CG    . LYS B 1 349 ? 34.087 5.534   -60.918 1.00 39.36 ? 849 LYS B CG    1 
ATOM   5452 C CD    . LYS B 1 349 ? 34.780 4.194   -61.099 1.00 40.88 ? 849 LYS B CD    1 
ATOM   5453 C CE    . LYS B 1 349 ? 34.458 3.586   -62.461 1.00 42.54 ? 849 LYS B CE    1 
ATOM   5454 N NZ    . LYS B 1 349 ? 32.986 3.499   -62.709 1.00 43.68 ? 849 LYS B NZ    1 
ATOM   5455 N N     . LEU B 1 350 ? 34.608 5.358   -56.482 1.00 37.36 ? 850 LEU B N     1 
ATOM   5456 C CA    . LEU B 1 350 ? 35.011 5.799   -55.153 1.00 38.49 ? 850 LEU B CA    1 
ATOM   5457 C C     . LEU B 1 350 ? 35.631 7.182   -55.325 1.00 39.95 ? 850 LEU B C     1 
ATOM   5458 O O     . LEU B 1 350 ? 36.140 7.507   -56.400 1.00 40.12 ? 850 LEU B O     1 
ATOM   5459 C CB    . LEU B 1 350 ? 36.061 4.856   -54.564 1.00 37.01 ? 850 LEU B CB    1 
ATOM   5460 C CG    . LEU B 1 350 ? 35.651 3.431   -54.199 1.00 36.88 ? 850 LEU B CG    1 
ATOM   5461 C CD1   . LEU B 1 350 ? 36.759 2.801   -53.362 1.00 36.78 ? 850 LEU B CD1   1 
ATOM   5462 C CD2   . LEU B 1 350 ? 34.337 3.440   -53.435 1.00 35.65 ? 850 LEU B CD2   1 
ATOM   5463 N N     . PRO B 1 351 ? 35.580 8.025   -54.281 1.00 41.40 ? 851 PRO B N     1 
ATOM   5464 C CA    . PRO B 1 351 ? 36.177 9.361   -54.416 1.00 42.75 ? 851 PRO B CA    1 
ATOM   5465 C C     . PRO B 1 351 ? 37.645 9.293   -54.862 1.00 44.06 ? 851 PRO B C     1 
ATOM   5466 O O     . PRO B 1 351 ? 38.122 10.164  -55.589 1.00 44.08 ? 851 PRO B O     1 
ATOM   5467 C CB    . PRO B 1 351 ? 36.017 9.968   -53.022 1.00 42.72 ? 851 PRO B CB    1 
ATOM   5468 C CG    . PRO B 1 351 ? 34.851 9.235   -52.432 1.00 41.73 ? 851 PRO B CG    1 
ATOM   5469 C CD    . PRO B 1 351 ? 34.953 7.833   -52.962 1.00 41.22 ? 851 PRO B CD    1 
ATOM   5470 N N     . ASN B 1 352 ? 38.357 8.253   -54.434 1.00 45.49 ? 852 ASN B N     1 
ATOM   5471 C CA    . ASN B 1 352 ? 39.759 8.095   -54.810 1.00 46.54 ? 852 ASN B CA    1 
ATOM   5472 C C     . ASN B 1 352 ? 39.901 7.607   -56.251 1.00 46.69 ? 852 ASN B C     1 
ATOM   5473 O O     . ASN B 1 352 ? 40.930 7.047   -56.621 1.00 47.34 ? 852 ASN B O     1 
ATOM   5474 C CB    . ASN B 1 352 ? 40.468 7.126   -53.852 1.00 47.61 ? 852 ASN B CB    1 
ATOM   5475 C CG    . ASN B 1 352 ? 39.886 5.721   -53.889 1.00 49.09 ? 852 ASN B CG    1 
ATOM   5476 O OD1   . ASN B 1 352 ? 40.210 4.879   -53.042 1.00 49.90 ? 852 ASN B OD1   1 
ATOM   5477 N ND2   . ASN B 1 352 ? 39.024 5.459   -54.868 1.00 49.34 ? 852 ASN B ND2   1 
ATOM   5478 N N     . GLY B 1 353 ? 38.858 7.823   -57.053 1.00 46.42 ? 853 GLY B N     1 
ATOM   5479 C CA    . GLY B 1 353 ? 38.877 7.418   -58.449 1.00 45.72 ? 853 GLY B CA    1 
ATOM   5480 C C     . GLY B 1 353 ? 38.765 5.922   -58.701 1.00 45.38 ? 853 GLY B C     1 
ATOM   5481 O O     . GLY B 1 353 ? 38.482 5.493   -59.822 1.00 45.34 ? 853 GLY B O     1 
ATOM   5482 N N     . ARG B 1 354 ? 38.986 5.127   -57.659 1.00 45.00 ? 854 ARG B N     1 
ATOM   5483 C CA    . ARG B 1 354 ? 38.922 3.671   -57.765 1.00 44.49 ? 854 ARG B CA    1 
ATOM   5484 C C     . ARG B 1 354 ? 37.502 3.119   -57.963 1.00 42.90 ? 854 ARG B C     1 
ATOM   5485 O O     . ARG B 1 354 ? 36.507 3.801   -57.711 1.00 42.20 ? 854 ARG B O     1 
ATOM   5486 C CB    . ARG B 1 354 ? 39.555 3.050   -56.517 1.00 45.94 ? 854 ARG B CB    1 
ATOM   5487 C CG    . ARG B 1 354 ? 39.733 1.550   -56.578 1.00 48.31 ? 854 ARG B CG    1 
ATOM   5488 C CD    . ARG B 1 354 ? 40.437 1.040   -55.333 1.00 50.13 ? 854 ARG B CD    1 
ATOM   5489 N NE    . ARG B 1 354 ? 41.620 1.838   -55.013 1.00 52.32 ? 854 ARG B NE    1 
ATOM   5490 C CZ    . ARG B 1 354 ? 42.512 1.511   -54.081 1.00 53.21 ? 854 ARG B CZ    1 
ATOM   5491 N NH1   . ARG B 1 354 ? 42.355 0.398   -53.373 1.00 54.04 ? 854 ARG B NH1   1 
ATOM   5492 N NH2   . ARG B 1 354 ? 43.561 2.293   -53.856 1.00 53.60 ? 854 ARG B NH2   1 
ATOM   5493 N N     . ASP B 1 355 ? 37.419 1.878   -58.426 1.00 41.76 ? 855 ASP B N     1 
ATOM   5494 C CA    . ASP B 1 355 ? 36.135 1.216   -58.655 1.00 40.59 ? 855 ASP B CA    1 
ATOM   5495 C C     . ASP B 1 355 ? 35.489 0.845   -57.327 1.00 39.01 ? 855 ASP B C     1 
ATOM   5496 O O     . ASP B 1 355 ? 36.186 0.611   -56.336 1.00 38.42 ? 855 ASP B O     1 
ATOM   5497 C CB    . ASP B 1 355 ? 36.344 -0.066  -59.452 1.00 42.11 ? 855 ASP B CB    1 
ATOM   5498 C CG    . ASP B 1 355 ? 35.893 0.054   -60.882 1.00 43.63 ? 855 ASP B CG    1 
ATOM   5499 O OD1   . ASP B 1 355 ? 36.084 -0.926  -61.634 1.00 45.01 ? 855 ASP B OD1   1 
ATOM   5500 O OD2   . ASP B 1 355 ? 35.352 1.117   -61.260 1.00 44.45 ? 855 ASP B OD2   1 
ATOM   5501 N N     . THR B 1 356 ? 34.162 0.789   -57.306 1.00 37.12 ? 856 THR B N     1 
ATOM   5502 C CA    . THR B 1 356 ? 33.459 0.402   -56.086 1.00 35.95 ? 856 THR B CA    1 
ATOM   5503 C C     . THR B 1 356 ? 33.667 -1.103  -55.922 1.00 34.34 ? 856 THR B C     1 
ATOM   5504 O O     . THR B 1 356 ? 34.053 -1.787  -56.870 1.00 34.11 ? 856 THR B O     1 
ATOM   5505 C CB    . THR B 1 356 ? 31.926 0.666   -56.173 1.00 36.35 ? 856 THR B CB    1 
ATOM   5506 O OG1   . THR B 1 356 ? 31.405 0.085   -57.374 1.00 38.16 ? 856 THR B OG1   1 
ATOM   5507 C CG2   . THR B 1 356 ? 31.625 2.154   -56.164 1.00 36.23 ? 856 THR B CG2   1 
ATOM   5508 N N     . PRO B 1 357 ? 33.451 -1.632  -54.711 1.00 33.20 ? 857 PRO B N     1 
ATOM   5509 C CA    . PRO B 1 357 ? 33.627 -3.076  -54.512 1.00 32.14 ? 857 PRO B CA    1 
ATOM   5510 C C     . PRO B 1 357 ? 32.469 -3.853  -55.140 1.00 31.07 ? 857 PRO B C     1 
ATOM   5511 O O     . PRO B 1 357 ? 31.552 -3.264  -55.716 1.00 29.95 ? 857 PRO B O     1 
ATOM   5512 C CB    . PRO B 1 357 ? 33.648 -3.245  -52.991 1.00 32.52 ? 857 PRO B CB    1 
ATOM   5513 C CG    . PRO B 1 357 ? 33.543 -1.857  -52.410 1.00 33.01 ? 857 PRO B CG    1 
ATOM   5514 C CD    . PRO B 1 357 ? 33.067 -0.936  -53.474 1.00 32.56 ? 857 PRO B CD    1 
ATOM   5515 N N     . ALA B 1 358 ? 32.519 -5.176  -55.024 1.00 30.53 ? 858 ALA B N     1 
ATOM   5516 C CA    . ALA B 1 358 ? 31.467 -6.039  -55.559 1.00 29.74 ? 858 ALA B CA    1 
ATOM   5517 C C     . ALA B 1 358 ? 30.162 -5.702  -54.837 1.00 29.07 ? 858 ALA B C     1 
ATOM   5518 O O     . ALA B 1 358 ? 30.104 -5.728  -53.605 1.00 29.10 ? 858 ALA B O     1 
ATOM   5519 C CB    . ALA B 1 358 ? 31.829 -7.495  -55.325 1.00 30.23 ? 858 ALA B CB    1 
ATOM   5520 N N     . LEU B 1 359 ? 29.121 -5.386  -55.599 1.00 27.50 ? 859 LEU B N     1 
ATOM   5521 C CA    . LEU B 1 359 ? 27.843 -5.023  -55.006 1.00 26.76 ? 859 LEU B CA    1 
ATOM   5522 C C     . LEU B 1 359 ? 26.651 -5.800  -55.547 1.00 26.30 ? 859 LEU B C     1 
ATOM   5523 O O     . LEU B 1 359 ? 25.584 -5.808  -54.932 1.00 25.31 ? 859 LEU B O     1 
ATOM   5524 C CB    . LEU B 1 359 ? 27.581 -3.533  -55.226 1.00 26.25 ? 859 LEU B CB    1 
ATOM   5525 C CG    . LEU B 1 359 ? 28.619 -2.534  -54.715 1.00 26.22 ? 859 LEU B CG    1 
ATOM   5526 C CD1   . LEU B 1 359 ? 28.331 -1.158  -55.305 1.00 26.59 ? 859 LEU B CD1   1 
ATOM   5527 C CD2   . LEU B 1 359 ? 28.583 -2.484  -53.190 1.00 25.78 ? 859 LEU B CD2   1 
ATOM   5528 N N     . PHE B 1 360 ? 26.820 -6.455  -56.689 1.00 26.07 ? 860 PHE B N     1 
ATOM   5529 C CA    . PHE B 1 360 ? 25.686 -7.157  -57.277 1.00 26.69 ? 860 PHE B CA    1 
ATOM   5530 C C     . PHE B 1 360 ? 25.829 -8.653  -57.529 1.00 26.99 ? 860 PHE B C     1 
ATOM   5531 O O     . PHE B 1 360 ? 25.009 -9.239  -58.228 1.00 27.32 ? 860 PHE B O     1 
ATOM   5532 C CB    . PHE B 1 360 ? 25.273 -6.448  -58.576 1.00 26.92 ? 860 PHE B CB    1 
ATOM   5533 C CG    . PHE B 1 360 ? 25.414 -4.950  -58.521 1.00 26.78 ? 860 PHE B CG    1 
ATOM   5534 C CD1   . PHE B 1 360 ? 26.425 -4.304  -59.232 1.00 26.90 ? 860 PHE B CD1   1 
ATOM   5535 C CD2   . PHE B 1 360 ? 24.554 -4.184  -57.745 1.00 26.54 ? 860 PHE B CD2   1 
ATOM   5536 C CE1   . PHE B 1 360 ? 26.575 -2.927  -59.168 1.00 25.76 ? 860 PHE B CE1   1 
ATOM   5537 C CE2   . PHE B 1 360 ? 24.697 -2.799  -57.676 1.00 26.79 ? 860 PHE B CE2   1 
ATOM   5538 C CZ    . PHE B 1 360 ? 25.710 -2.173  -58.390 1.00 26.29 ? 860 PHE B CZ    1 
ATOM   5539 N N     . ASN B 1 361 ? 26.849 -9.278  -56.962 1.00 27.20 ? 861 ASN B N     1 
ATOM   5540 C CA    . ASN B 1 361 ? 27.016 -10.708 -57.149 1.00 28.55 ? 861 ASN B CA    1 
ATOM   5541 C C     . ASN B 1 361 ? 26.146 -11.494 -56.162 1.00 28.44 ? 861 ASN B C     1 
ATOM   5542 O O     . ASN B 1 361 ? 26.638 -12.324 -55.396 1.00 28.78 ? 861 ASN B O     1 
ATOM   5543 C CB    . ASN B 1 361 ? 28.491 -11.099 -57.009 1.00 29.57 ? 861 ASN B CB    1 
ATOM   5544 C CG    . ASN B 1 361 ? 29.141 -10.536 -55.759 1.00 31.93 ? 861 ASN B CG    1 
ATOM   5545 O OD1   . ASN B 1 361 ? 30.252 -10.939 -55.399 1.00 33.34 ? 861 ASN B OD1   1 
ATOM   5546 N ND2   . ASN B 1 361 ? 28.465 -9.604  -55.094 1.00 31.69 ? 861 ASN B ND2   1 
ATOM   5547 N N     . PHE B 1 362 ? 24.845 -11.219 -56.197 1.00 28.88 ? 862 PHE B N     1 
ATOM   5548 C CA    . PHE B 1 362 ? 23.857 -11.870 -55.329 1.00 29.90 ? 862 PHE B CA    1 
ATOM   5549 C C     . PHE B 1 362 ? 23.670 -13.349 -55.685 1.00 31.21 ? 862 PHE B C     1 
ATOM   5550 O O     . PHE B 1 362 ? 23.593 -13.694 -56.864 1.00 31.86 ? 862 PHE B O     1 
ATOM   5551 C CB    . PHE B 1 362 ? 22.497 -11.177 -55.473 1.00 28.90 ? 862 PHE B CB    1 
ATOM   5552 C CG    . PHE B 1 362 ? 22.401 -9.851  -54.773 1.00 29.02 ? 862 PHE B CG    1 
ATOM   5553 C CD1   . PHE B 1 362 ? 22.067 -9.783  -53.420 1.00 28.46 ? 862 PHE B CD1   1 
ATOM   5554 C CD2   . PHE B 1 362 ? 22.628 -8.663  -55.467 1.00 28.87 ? 862 PHE B CD2   1 
ATOM   5555 C CE1   . PHE B 1 362 ? 21.960 -8.551  -52.764 1.00 27.72 ? 862 PHE B CE1   1 
ATOM   5556 C CE2   . PHE B 1 362 ? 22.525 -7.426  -54.822 1.00 28.88 ? 862 PHE B CE2   1 
ATOM   5557 C CZ    . PHE B 1 362 ? 22.190 -7.371  -53.467 1.00 27.99 ? 862 PHE B CZ    1 
ATOM   5558 N N     . THR B 1 363 ? 23.588 -14.216 -54.676 1.00 31.61 ? 863 THR B N     1 
ATOM   5559 C CA    . THR B 1 363 ? 23.370 -15.639 -54.926 1.00 32.28 ? 863 THR B CA    1 
ATOM   5560 C C     . THR B 1 363 ? 21.904 -15.950 -54.654 1.00 32.65 ? 863 THR B C     1 
ATOM   5561 O O     . THR B 1 363 ? 21.177 -15.117 -54.100 1.00 32.82 ? 863 THR B O     1 
ATOM   5562 C CB    . THR B 1 363 ? 24.222 -16.540 -54.007 1.00 32.24 ? 863 THR B CB    1 
ATOM   5563 O OG1   . THR B 1 363 ? 23.811 -16.358 -52.647 1.00 32.80 ? 863 THR B OG1   1 
ATOM   5564 C CG2   . THR B 1 363 ? 25.709 -16.217 -54.157 1.00 31.83 ? 863 THR B CG2   1 
ATOM   5565 N N     . THR B 1 364 ? 21.468 -17.145 -55.050 1.00 32.33 ? 864 THR B N     1 
ATOM   5566 C CA    . THR B 1 364 ? 20.085 -17.563 -54.839 1.00 31.55 ? 864 THR B CA    1 
ATOM   5567 C C     . THR B 1 364 ? 19.762 -17.537 -53.341 1.00 31.27 ? 864 THR B C     1 
ATOM   5568 O O     . THR B 1 364 ? 18.699 -17.066 -52.928 1.00 30.55 ? 864 THR B O     1 
ATOM   5569 C CB    . THR B 1 364 ? 19.853 -18.991 -55.401 1.00 32.49 ? 864 THR B CB    1 
ATOM   5570 O OG1   . THR B 1 364 ? 20.030 -18.978 -56.827 1.00 32.12 ? 864 THR B OG1   1 
ATOM   5571 C CG2   . THR B 1 364 ? 18.448 -19.476 -55.071 1.00 31.94 ? 864 THR B CG2   1 
ATOM   5572 N N     . GLN B 1 365 ? 20.693 -18.044 -52.540 1.00 31.29 ? 865 GLN B N     1 
ATOM   5573 C CA    . GLN B 1 365 ? 20.547 -18.077 -51.085 1.00 31.89 ? 865 GLN B CA    1 
ATOM   5574 C C     . GLN B 1 365 ? 20.242 -16.665 -50.576 1.00 31.24 ? 865 GLN B C     1 
ATOM   5575 O O     . GLN B 1 365 ? 19.228 -16.421 -49.917 1.00 30.77 ? 865 GLN B O     1 
ATOM   5576 C CB    . GLN B 1 365 ? 21.848 -18.584 -50.450 1.00 33.50 ? 865 GLN B CB    1 
ATOM   5577 C CG    . GLN B 1 365 ? 21.829 -18.659 -48.924 1.00 36.10 ? 865 GLN B CG    1 
ATOM   5578 C CD    . GLN B 1 365 ? 20.809 -19.659 -48.411 1.00 38.22 ? 865 GLN B CD    1 
ATOM   5579 O OE1   . GLN B 1 365 ? 20.446 -20.610 -49.115 1.00 39.26 ? 865 GLN B OE1   1 
ATOM   5580 N NE2   . GLN B 1 365 ? 20.335 -19.452 -47.182 1.00 38.37 ? 865 GLN B NE2   1 
ATOM   5581 N N     . GLU B 1 366 ? 21.135 -15.741 -50.910 1.00 30.33 ? 866 GLU B N     1 
ATOM   5582 C CA    . GLU B 1 366 ? 21.014 -14.348 -50.511 1.00 29.83 ? 866 GLU B CA    1 
ATOM   5583 C C     . GLU B 1 366 ? 19.680 -13.719 -50.909 1.00 29.01 ? 866 GLU B C     1 
ATOM   5584 O O     . GLU B 1 366 ? 19.127 -12.899 -50.176 1.00 28.05 ? 866 GLU B O     1 
ATOM   5585 C CB    . GLU B 1 366 ? 22.166 -13.554 -51.130 1.00 30.18 ? 866 GLU B CB    1 
ATOM   5586 C CG    . GLU B 1 366 ? 22.532 -12.286 -50.393 1.00 31.47 ? 866 GLU B CG    1 
ATOM   5587 C CD    . GLU B 1 366 ? 23.792 -11.649 -50.954 1.00 31.97 ? 866 GLU B CD    1 
ATOM   5588 O OE1   . GLU B 1 366 ? 24.120 -10.521 -50.532 1.00 32.68 ? 866 GLU B OE1   1 
ATOM   5589 O OE2   . GLU B 1 366 ? 24.454 -12.277 -51.813 1.00 31.99 ? 866 GLU B OE2   1 
ATOM   5590 N N     . LEU B 1 367 ? 19.156 -14.108 -52.067 1.00 28.45 ? 867 LEU B N     1 
ATOM   5591 C CA    . LEU B 1 367 ? 17.893 -13.554 -52.548 1.00 27.86 ? 867 LEU B CA    1 
ATOM   5592 C C     . LEU B 1 367 ? 16.658 -14.347 -52.114 1.00 28.21 ? 867 LEU B C     1 
ATOM   5593 O O     . LEU B 1 367 ? 15.532 -13.890 -52.300 1.00 26.85 ? 867 LEU B O     1 
ATOM   5594 C CB    . LEU B 1 367 ? 17.911 -13.477 -54.079 1.00 27.68 ? 867 LEU B CB    1 
ATOM   5595 C CG    . LEU B 1 367 ? 19.027 -12.648 -54.717 1.00 27.46 ? 867 LEU B CG    1 
ATOM   5596 C CD1   . LEU B 1 367 ? 19.263 -13.100 -56.158 1.00 27.82 ? 867 LEU B CD1   1 
ATOM   5597 C CD2   . LEU B 1 367 ? 18.632 -11.184 -54.685 1.00 26.89 ? 867 LEU B CD2   1 
ATOM   5598 N N     . SER B 1 368 ? 16.870 -15.520 -51.526 1.00 28.94 ? 868 SER B N     1 
ATOM   5599 C CA    . SER B 1 368 ? 15.758 -16.382 -51.131 1.00 30.06 ? 868 SER B CA    1 
ATOM   5600 C C     . SER B 1 368 ? 14.550 -15.710 -50.474 1.00 30.35 ? 868 SER B C     1 
ATOM   5601 O O     . SER B 1 368 ? 13.417 -16.064 -50.773 1.00 30.75 ? 868 SER B O     1 
ATOM   5602 C CB    . SER B 1 368 ? 16.266 -17.528 -50.248 1.00 30.25 ? 868 SER B CB    1 
ATOM   5603 O OG    . SER B 1 368 ? 16.942 -17.046 -49.104 1.00 32.37 ? 868 SER B OG    1 
ATOM   5604 N N     . SER B 1 369 ? 14.773 -14.733 -49.601 1.00 30.46 ? 869 SER B N     1 
ATOM   5605 C CA    . SER B 1 369 ? 13.657 -14.069 -48.928 1.00 30.36 ? 869 SER B CA    1 
ATOM   5606 C C     . SER B 1 369 ? 12.671 -13.348 -49.854 1.00 30.65 ? 869 SER B C     1 
ATOM   5607 O O     . SER B 1 369 ? 11.523 -13.127 -49.479 1.00 30.56 ? 869 SER B O     1 
ATOM   5608 C CB    . SER B 1 369 ? 14.182 -13.077 -47.874 1.00 30.90 ? 869 SER B CB    1 
ATOM   5609 O OG    . SER B 1 369 ? 14.341 -11.763 -48.404 1.00 29.52 ? 869 SER B OG    1 
ATOM   5610 N N     . ASN B 1 370 ? 13.107 -12.977 -51.056 1.00 30.35 ? 870 ASN B N     1 
ATOM   5611 C CA    . ASN B 1 370 ? 12.238 -12.259 -51.992 1.00 30.09 ? 870 ASN B CA    1 
ATOM   5612 C C     . ASN B 1 370 ? 12.938 -12.161 -53.355 1.00 30.11 ? 870 ASN B C     1 
ATOM   5613 O O     . ASN B 1 370 ? 13.411 -11.095 -53.754 1.00 29.81 ? 870 ASN B O     1 
ATOM   5614 C CB    . ASN B 1 370 ? 11.932 -10.859 -51.437 1.00 30.43 ? 870 ASN B CB    1 
ATOM   5615 C CG    . ASN B 1 370 ? 10.763 -10.185 -52.134 1.00 31.40 ? 870 ASN B CG    1 
ATOM   5616 O OD1   . ASN B 1 370 ? 10.411 -10.534 -53.261 1.00 32.22 ? 870 ASN B OD1   1 
ATOM   5617 N ND2   . ASN B 1 370 ? 10.156 -9.208  -51.467 1.00 31.43 ? 870 ASN B ND2   1 
ATOM   5618 N N     . PRO B 1 371 ? 13.009 -13.285 -54.090 1.00 30.32 ? 871 PRO B N     1 
ATOM   5619 C CA    . PRO B 1 371 ? 13.663 -13.309 -55.402 1.00 29.73 ? 871 PRO B CA    1 
ATOM   5620 C C     . PRO B 1 371 ? 13.350 -12.167 -56.371 1.00 29.39 ? 871 PRO B C     1 
ATOM   5621 O O     . PRO B 1 371 ? 14.251 -11.662 -57.032 1.00 28.92 ? 871 PRO B O     1 
ATOM   5622 C CB    . PRO B 1 371 ? 13.277 -14.677 -55.959 1.00 30.16 ? 871 PRO B CB    1 
ATOM   5623 C CG    . PRO B 1 371 ? 13.142 -15.520 -54.732 1.00 30.15 ? 871 PRO B CG    1 
ATOM   5624 C CD    . PRO B 1 371 ? 12.483 -14.615 -53.729 1.00 29.70 ? 871 PRO B CD    1 
ATOM   5625 N N     . PRO B 1 372 ? 12.077 -11.740 -56.467 1.00 29.27 ? 872 PRO B N     1 
ATOM   5626 C CA    . PRO B 1 372 ? 11.749 -10.647 -57.390 1.00 29.47 ? 872 PRO B CA    1 
ATOM   5627 C C     . PRO B 1 372 ? 12.484 -9.325  -57.141 1.00 29.32 ? 872 PRO B C     1 
ATOM   5628 O O     . PRO B 1 372 ? 12.540 -8.465  -58.027 1.00 28.49 ? 872 PRO B O     1 
ATOM   5629 C CB    . PRO B 1 372 ? 10.231 -10.492 -57.250 1.00 29.50 ? 872 PRO B CB    1 
ATOM   5630 C CG    . PRO B 1 372 ? 9.763  -11.773 -56.657 1.00 29.50 ? 872 PRO B CG    1 
ATOM   5631 C CD    . PRO B 1 372 ? 10.880 -12.232 -55.768 1.00 29.94 ? 872 PRO B CD    1 
ATOM   5632 N N     . LEU B 1 373 ? 13.043 -9.154  -55.945 1.00 28.23 ? 873 LEU B N     1 
ATOM   5633 C CA    . LEU B 1 373 ? 13.763 -7.920  -55.644 1.00 27.84 ? 873 LEU B CA    1 
ATOM   5634 C C     . LEU B 1 373 ? 15.000 -7.801  -56.522 1.00 27.49 ? 873 LEU B C     1 
ATOM   5635 O O     . LEU B 1 373 ? 15.544 -6.711  -56.698 1.00 27.24 ? 873 LEU B O     1 
ATOM   5636 C CB    . LEU B 1 373 ? 14.166 -7.874  -54.166 1.00 27.41 ? 873 LEU B CB    1 
ATOM   5637 C CG    . LEU B 1 373 ? 13.028 -7.436  -53.245 1.00 27.23 ? 873 LEU B CG    1 
ATOM   5638 C CD1   . LEU B 1 373 ? 13.527 -7.306  -51.810 1.00 27.29 ? 873 LEU B CD1   1 
ATOM   5639 C CD2   . LEU B 1 373 ? 12.469 -6.116  -53.738 1.00 27.65 ? 873 LEU B CD2   1 
ATOM   5640 N N     . ALA B 1 374 ? 15.441 -8.929  -57.068 1.00 27.49 ? 874 ALA B N     1 
ATOM   5641 C CA    . ALA B 1 374 ? 16.610 -8.945  -57.938 1.00 28.02 ? 874 ALA B CA    1 
ATOM   5642 C C     . ALA B 1 374 ? 16.426 -8.014  -59.138 1.00 28.30 ? 874 ALA B C     1 
ATOM   5643 O O     . ALA B 1 374 ? 17.407 -7.529  -59.704 1.00 28.13 ? 874 ALA B O     1 
ATOM   5644 C CB    . ALA B 1 374 ? 16.887 -10.357 -58.415 1.00 27.52 ? 874 ALA B CB    1 
ATOM   5645 N N     . THR B 1 375 ? 15.177 -7.755  -59.522 1.00 28.68 ? 875 THR B N     1 
ATOM   5646 C CA    . THR B 1 375 ? 14.915 -6.880  -60.666 1.00 29.20 ? 875 THR B CA    1 
ATOM   5647 C C     . THR B 1 375 ? 15.346 -5.445  -60.387 1.00 29.38 ? 875 THR B C     1 
ATOM   5648 O O     . THR B 1 375 ? 15.479 -4.636  -61.305 1.00 29.25 ? 875 THR B O     1 
ATOM   5649 C CB    . THR B 1 375 ? 13.427 -6.893  -61.061 1.00 29.30 ? 875 THR B CB    1 
ATOM   5650 O OG1   . THR B 1 375 ? 12.643 -6.339  -59.999 1.00 29.77 ? 875 THR B OG1   1 
ATOM   5651 C CG2   . THR B 1 375 ? 12.971 -8.323  -61.346 1.00 28.81 ? 875 THR B CG2   1 
ATOM   5652 N N     . ILE B 1 376 ? 15.556 -5.134  -59.111 1.00 29.49 ? 876 ILE B N     1 
ATOM   5653 C CA    . ILE B 1 376 ? 16.004 -3.807  -58.696 1.00 29.34 ? 876 ILE B CA    1 
ATOM   5654 C C     . ILE B 1 376 ? 17.462 -3.915  -58.262 1.00 28.89 ? 876 ILE B C     1 
ATOM   5655 O O     . ILE B 1 376 ? 18.306 -3.113  -58.658 1.00 28.69 ? 876 ILE B O     1 
ATOM   5656 C CB    . ILE B 1 376 ? 15.198 -3.272  -57.484 1.00 30.12 ? 876 ILE B CB    1 
ATOM   5657 C CG1   . ILE B 1 376 ? 13.773 -2.941  -57.904 1.00 30.33 ? 876 ILE B CG1   1 
ATOM   5658 C CG2   . ILE B 1 376 ? 15.879 -2.027  -56.904 1.00 30.71 ? 876 ILE B CG2   1 
ATOM   5659 C CD1   . ILE B 1 376 ? 12.874 -2.622  -56.741 1.00 30.79 ? 876 ILE B CD1   1 
ATOM   5660 N N     . LEU B 1 377 ? 17.745 -4.933  -57.456 1.00 27.61 ? 877 LEU B N     1 
ATOM   5661 C CA    . LEU B 1 377 ? 19.080 -5.153  -56.925 1.00 26.42 ? 877 LEU B CA    1 
ATOM   5662 C C     . LEU B 1 377 ? 20.184 -5.317  -57.966 1.00 26.48 ? 877 LEU B C     1 
ATOM   5663 O O     . LEU B 1 377 ? 21.298 -4.825  -57.778 1.00 25.48 ? 877 LEU B O     1 
ATOM   5664 C CB    . LEU B 1 377 ? 19.058 -6.360  -55.986 1.00 25.52 ? 877 LEU B CB    1 
ATOM   5665 C CG    . LEU B 1 377 ? 18.226 -6.140  -54.718 1.00 25.56 ? 877 LEU B CG    1 
ATOM   5666 C CD1   . LEU B 1 377 ? 18.138 -7.436  -53.927 1.00 24.59 ? 877 LEU B CD1   1 
ATOM   5667 C CD2   . LEU B 1 377 ? 18.859 -5.030  -53.875 1.00 24.74 ? 877 LEU B CD2   1 
ATOM   5668 N N     . ILE B 1 378 ? 19.893 -6.025  -59.051 1.00 26.26 ? 878 ILE B N     1 
ATOM   5669 C CA    . ILE B 1 378 ? 20.889 -6.211  -60.097 1.00 26.81 ? 878 ILE B CA    1 
ATOM   5670 C C     . ILE B 1 378 ? 20.568 -5.223  -61.218 1.00 26.97 ? 878 ILE B C     1 
ATOM   5671 O O     . ILE B 1 378 ? 19.597 -5.401  -61.955 1.00 27.04 ? 878 ILE B O     1 
ATOM   5672 C CB    . ILE B 1 378 ? 20.870 -7.654  -60.628 1.00 26.67 ? 878 ILE B CB    1 
ATOM   5673 C CG1   . ILE B 1 378 ? 20.960 -8.634  -59.450 1.00 26.46 ? 878 ILE B CG1   1 
ATOM   5674 C CG2   . ILE B 1 378 ? 22.034 -7.871  -61.576 1.00 26.13 ? 878 ILE B CG2   1 
ATOM   5675 C CD1   . ILE B 1 378 ? 20.786 -10.080 -59.841 1.00 26.90 ? 878 ILE B CD1   1 
ATOM   5676 N N     . PRO B 1 379 ? 21.370 -4.149  -61.338 1.00 26.94 ? 879 PRO B N     1 
ATOM   5677 C CA    . PRO B 1 379 ? 21.156 -3.133  -62.370 1.00 26.94 ? 879 PRO B CA    1 
ATOM   5678 C C     . PRO B 1 379 ? 21.453 -3.644  -63.783 1.00 27.05 ? 879 PRO B C     1 
ATOM   5679 O O     . PRO B 1 379 ? 22.274 -4.544  -63.972 1.00 26.61 ? 879 PRO B O     1 
ATOM   5680 C CB    . PRO B 1 379 ? 22.085 -1.995  -61.944 1.00 26.84 ? 879 PRO B CB    1 
ATOM   5681 C CG    . PRO B 1 379 ? 23.190 -2.680  -61.228 1.00 26.72 ? 879 PRO B CG    1 
ATOM   5682 C CD    . PRO B 1 379 ? 22.547 -3.835  -60.503 1.00 27.10 ? 879 PRO B CD    1 
ATOM   5683 N N     . PRO B 1 380 ? 20.788 -3.060  -64.794 1.00 28.07 ? 880 PRO B N     1 
ATOM   5684 C CA    . PRO B 1 380 ? 20.974 -3.457  -66.196 1.00 28.65 ? 880 PRO B CA    1 
ATOM   5685 C C     . PRO B 1 380 ? 22.426 -3.633  -66.606 1.00 29.56 ? 880 PRO B C     1 
ATOM   5686 O O     . PRO B 1 380 ? 22.787 -4.658  -67.184 1.00 30.56 ? 880 PRO B O     1 
ATOM   5687 C CB    . PRO B 1 380 ? 20.295 -2.339  -66.981 1.00 28.98 ? 880 PRO B CB    1 
ATOM   5688 C CG    . PRO B 1 380 ? 19.254 -1.820  -66.053 1.00 29.00 ? 880 PRO B CG    1 
ATOM   5689 C CD    . PRO B 1 380 ? 19.816 -1.960  -64.658 1.00 27.76 ? 880 PRO B CD    1 
ATOM   5690 N N     . HIS B 1 381 ? 23.268 -2.645  -66.305 1.00 29.77 ? 881 HIS B N     1 
ATOM   5691 C CA    . HIS B 1 381 ? 24.671 -2.738  -66.687 1.00 29.91 ? 881 HIS B CA    1 
ATOM   5692 C C     . HIS B 1 381 ? 25.362 -3.946  -66.088 1.00 30.36 ? 881 HIS B C     1 
ATOM   5693 O O     . HIS B 1 381 ? 26.352 -4.423  -66.626 1.00 30.14 ? 881 HIS B O     1 
ATOM   5694 C CB    . HIS B 1 381 ? 25.429 -1.446  -66.327 1.00 30.02 ? 881 HIS B CB    1 
ATOM   5695 C CG    . HIS B 1 381 ? 25.709 -1.271  -64.865 1.00 29.91 ? 881 HIS B CG    1 
ATOM   5696 N ND1   . HIS B 1 381 ? 26.889 -1.675  -64.280 1.00 30.48 ? 881 HIS B ND1   1 
ATOM   5697 C CD2   . HIS B 1 381 ? 24.981 -0.689  -63.881 1.00 29.83 ? 881 HIS B CD2   1 
ATOM   5698 C CE1   . HIS B 1 381 ? 26.879 -1.348  -62.998 1.00 30.04 ? 881 HIS B CE1   1 
ATOM   5699 N NE2   . HIS B 1 381 ? 25.733 -0.749  -62.731 1.00 30.16 ? 881 HIS B NE2   1 
ATOM   5700 N N     . ALA B 1 382 ? 24.831 -4.456  -64.981 1.00 31.45 ? 882 ALA B N     1 
ATOM   5701 C CA    . ALA B 1 382 ? 25.424 -5.621  -64.335 1.00 32.43 ? 882 ALA B CA    1 
ATOM   5702 C C     . ALA B 1 382 ? 24.948 -6.911  -65.001 1.00 33.47 ? 882 ALA B C     1 
ATOM   5703 O O     . ALA B 1 382 ? 25.415 -8.001  -64.672 1.00 33.22 ? 882 ALA B O     1 
ATOM   5704 C CB    . ALA B 1 382 ? 25.075 -5.632  -62.841 1.00 32.51 ? 882 ALA B CB    1 
ATOM   5705 N N     . ARG B 1 383 ? 24.024 -6.784  -65.945 1.00 34.91 ? 883 ARG B N     1 
ATOM   5706 C CA    . ARG B 1 383 ? 23.495 -7.945  -66.653 1.00 36.58 ? 883 ARG B CA    1 
ATOM   5707 C C     . ARG B 1 383 ? 24.024 -8.036  -68.081 1.00 38.17 ? 883 ARG B C     1 
ATOM   5708 O O     . ARG B 1 383 ? 23.602 -8.901  -68.853 1.00 38.14 ? 883 ARG B O     1 
ATOM   5709 C CB    . ARG B 1 383 ? 21.973 -7.884  -66.699 1.00 35.55 ? 883 ARG B CB    1 
ATOM   5710 C CG    . ARG B 1 383 ? 21.333 -7.650  -65.358 1.00 34.75 ? 883 ARG B CG    1 
ATOM   5711 C CD    . ARG B 1 383 ? 19.843 -7.572  -65.520 1.00 34.53 ? 883 ARG B CD    1 
ATOM   5712 N NE    . ARG B 1 383 ? 19.205 -6.932  -64.380 1.00 33.71 ? 883 ARG B NE    1 
ATOM   5713 C CZ    . ARG B 1 383 ? 17.917 -6.620  -64.339 1.00 33.93 ? 883 ARG B CZ    1 
ATOM   5714 N NH1   . ARG B 1 383 ? 17.140 -6.895  -65.381 1.00 34.49 ? 883 ARG B NH1   1 
ATOM   5715 N NH2   . ARG B 1 383 ? 17.407 -6.044  -63.260 1.00 33.35 ? 883 ARG B NH2   1 
ATOM   5716 N N     . ILE B 1 384 ? 24.934 -7.136  -68.436 1.00 40.10 ? 884 ILE B N     1 
ATOM   5717 C CA    . ILE B 1 384 ? 25.500 -7.130  -69.777 1.00 42.34 ? 884 ILE B CA    1 
ATOM   5718 C C     . ILE B 1 384 ? 26.381 -8.353  -70.009 1.00 45.06 ? 884 ILE B C     1 
ATOM   5719 O O     . ILE B 1 384 ? 27.266 -8.655  -69.205 1.00 45.16 ? 884 ILE B O     1 
ATOM   5720 C CB    . ILE B 1 384 ? 26.326 -5.858  -70.024 1.00 41.01 ? 884 ILE B CB    1 
ATOM   5721 C CG1   . ILE B 1 384 ? 25.390 -4.656  -70.146 1.00 40.21 ? 884 ILE B CG1   1 
ATOM   5722 C CG2   . ILE B 1 384 ? 27.157 -6.011  -71.283 1.00 40.80 ? 884 ILE B CG2   1 
ATOM   5723 C CD1   . ILE B 1 384 ? 26.099 -3.314  -70.091 1.00 39.60 ? 884 ILE B CD1   1 
ATOM   5724 N N     . GLN B 1 385 ? 26.125 -9.048  -71.118 1.00 47.98 ? 885 GLN B N     1 
ATOM   5725 C CA    . GLN B 1 385 ? 26.875 -10.246 -71.489 1.00 50.86 ? 885 GLN B CA    1 
ATOM   5726 C C     . GLN B 1 385 ? 28.360 -9.940  -71.661 1.00 52.46 ? 885 GLN B C     1 
ATOM   5727 O O     . GLN B 1 385 ? 29.201 -10.511 -70.961 1.00 53.13 ? 885 GLN B O     1 
ATOM   5728 C CB    . GLN B 1 385 ? 26.317 -10.830 -72.790 1.00 51.79 ? 885 GLN B CB    1 
ATOM   5729 C CG    . GLN B 1 385 ? 25.760 -12.238 -72.660 1.00 53.64 ? 885 GLN B CG    1 
ATOM   5730 C CD    . GLN B 1 385 ? 25.706 -12.967 -73.987 1.00 54.91 ? 885 GLN B CD    1 
ATOM   5731 O OE1   . GLN B 1 385 ? 25.251 -12.422 -74.993 1.00 55.98 ? 885 GLN B OE1   1 
ATOM   5732 N NE2   . GLN B 1 385 ? 26.173 -14.208 -73.997 1.00 56.22 ? 885 GLN B NE2   1 
ATOM   5733 N N     . ALA B 1 386 ? 28.670 -9.043  -72.597 1.00 53.94 ? 886 ALA B N     1 
ATOM   5734 C CA    . ALA B 1 386 ? 30.046 -8.632  -72.880 1.00 55.43 ? 886 ALA B CA    1 
ATOM   5735 C C     . ALA B 1 386 ? 30.936 -9.775  -73.391 1.00 56.53 ? 886 ALA B C     1 
ATOM   5736 O O     . ALA B 1 386 ? 31.719 -9.523  -74.336 1.00 56.90 ? 886 ALA B O     1 
ATOM   5737 C CB    . ALA B 1 386 ? 30.670 -7.999  -71.624 1.00 55.96 ? 886 ALA B CB    1 
HETATM 5738 P PG    . ANP C 2 .   ? 19.199 11.353  -13.922 1.00 50.73 ? 430 ANP A PG    1 
HETATM 5739 O O1G   . ANP C 2 .   ? 19.918 12.168  -14.993 1.00 49.59 ? 430 ANP A O1G   1 
HETATM 5740 O O2G   . ANP C 2 .   ? 18.801 9.999   -14.503 1.00 49.93 ? 430 ANP A O2G   1 
HETATM 5741 O O3G   . ANP C 2 .   ? 20.216 11.158  -12.645 1.00 49.39 ? 430 ANP A O3G   1 
HETATM 5742 P PB    . ANP C 2 .   ? 17.384 13.588  -14.014 1.00 45.91 ? 430 ANP A PB    1 
HETATM 5743 O O1B   . ANP C 2 .   ? 18.329 14.042  -15.138 1.00 47.12 ? 430 ANP A O1B   1 
HETATM 5744 O O2B   . ANP C 2 .   ? 15.972 13.567  -14.612 1.00 46.55 ? 430 ANP A O2B   1 
HETATM 5745 N N3B   . ANP C 2 .   ? 17.820 12.107  -13.384 1.00 47.83 ? 430 ANP A N3B   1 
HETATM 5746 P PA    . ANP C 2 .   ? 18.538 14.588  -11.555 1.00 36.62 ? 430 ANP A PA    1 
HETATM 5747 O O1A   . ANP C 2 .   ? 17.691 14.731  -10.311 1.00 36.01 ? 430 ANP A O1A   1 
HETATM 5748 O O2A   . ANP C 2 .   ? 19.352 13.314  -11.537 1.00 37.46 ? 430 ANP A O2A   1 
HETATM 5749 O O3A   . ANP C 2 .   ? 17.595 14.660  -12.850 1.00 41.65 ? 430 ANP A O3A   1 
HETATM 5750 O "O5'" . ANP C 2 .   ? 19.527 15.805  -11.704 1.00 36.49 ? 430 ANP A "O5'" 1 
HETATM 5751 C "C5'" . ANP C 2 .   ? 20.591 15.704  -12.721 1.00 34.77 ? 430 ANP A "C5'" 1 
HETATM 5752 C "C4'" . ANP C 2 .   ? 21.898 16.224  -12.189 1.00 33.16 ? 430 ANP A "C4'" 1 
HETATM 5753 O "O4'" . ANP C 2 .   ? 21.611 17.573  -11.733 1.00 32.46 ? 430 ANP A "O4'" 1 
HETATM 5754 C "C3'" . ANP C 2 .   ? 22.435 15.467  -10.955 1.00 33.09 ? 430 ANP A "C3'" 1 
HETATM 5755 O "O3'" . ANP C 2 .   ? 23.076 14.216  -11.186 1.00 33.82 ? 430 ANP A "O3'" 1 
HETATM 5756 C "C2'" . ANP C 2 .   ? 23.247 16.581  -10.304 1.00 32.71 ? 430 ANP A "C2'" 1 
HETATM 5757 O "O2'" . ANP C 2 .   ? 24.607 16.668  -10.748 1.00 34.43 ? 430 ANP A "O2'" 1 
HETATM 5758 C "C1'" . ANP C 2 .   ? 22.394 17.865  -10.573 1.00 31.48 ? 430 ANP A "C1'" 1 
HETATM 5759 N N9    . ANP C 2 .   ? 21.545 18.057  -9.375  1.00 28.84 ? 430 ANP A N9    1 
HETATM 5760 C C8    . ANP C 2 .   ? 20.304 17.503  -8.979  1.00 28.65 ? 430 ANP A C8    1 
HETATM 5761 N N7    . ANP C 2 .   ? 19.705 17.823  -7.803  1.00 27.50 ? 430 ANP A N7    1 
HETATM 5762 C C5    . ANP C 2 .   ? 20.670 18.694  -7.376  1.00 25.98 ? 430 ANP A C5    1 
HETATM 5763 C C6    . ANP C 2 .   ? 20.774 19.475  -6.160  1.00 25.34 ? 430 ANP A C6    1 
HETATM 5764 N N6    . ANP C 2 .   ? 19.817 19.408  -5.230  1.00 24.60 ? 430 ANP A N6    1 
HETATM 5765 N N1    . ANP C 2 .   ? 21.855 20.297  -5.944  1.00 23.80 ? 430 ANP A N1    1 
HETATM 5766 C C2    . ANP C 2 .   ? 22.856 20.403  -6.854  1.00 24.98 ? 430 ANP A C2    1 
HETATM 5767 N N3    . ANP C 2 .   ? 22.931 19.766  -8.012  1.00 24.64 ? 430 ANP A N3    1 
HETATM 5768 C C4    . ANP C 2 .   ? 21.801 18.848  -8.332  1.00 27.01 ? 430 ANP A C4    1 
HETATM 5769 P PG    . ANP D 2 .   ? 32.855 -8.133  -28.616 1.00 49.21 ? 930 ANP B PG    1 
HETATM 5770 O O1G   . ANP D 2 .   ? 33.839 -7.393  -27.735 1.00 48.63 ? 930 ANP B O1G   1 
HETATM 5771 O O2G   . ANP D 2 .   ? 31.605 -8.459  -27.818 1.00 48.84 ? 930 ANP B O2G   1 
HETATM 5772 O O3G   . ANP D 2 .   ? 32.488 -7.178  -29.900 1.00 47.81 ? 930 ANP B O3G   1 
HETATM 5773 P PB    . ANP D 2 .   ? 35.047 -9.966  -28.800 1.00 44.86 ? 930 ANP B PB    1 
HETATM 5774 O O1B   . ANP D 2 .   ? 35.761 -8.851  -28.032 1.00 45.94 ? 930 ANP B O1B   1 
HETATM 5775 O O2B   . ANP D 2 .   ? 35.111 -11.211 -27.902 1.00 44.88 ? 930 ANP B O2B   1 
HETATM 5776 N N3B   . ANP D 2 .   ? 33.489 -9.550  -29.205 1.00 46.38 ? 930 ANP B N3B   1 
HETATM 5777 P PA    . ANP D 2 .   ? 35.583 -9.379  -31.577 1.00 36.35 ? 930 ANP B PA    1 
HETATM 5778 O O1A   . ANP D 2 .   ? 35.380 -10.425 -32.658 1.00 36.74 ? 930 ANP B O1A   1 
HETATM 5779 O O2A   . ANP D 2 .   ? 34.412 -8.420  -31.487 1.00 38.01 ? 930 ANP B O2A   1 
HETATM 5780 O O3A   . ANP D 2 .   ? 35.846 -10.101 -30.172 1.00 40.59 ? 930 ANP B O3A   1 
HETATM 5781 O "O5'" . ANP D 2 .   ? 36.893 -8.542  -31.855 1.00 35.33 ? 930 ANP B "O5'" 1 
HETATM 5782 C "C5'" . ANP D 2 .   ? 37.149 -7.363  -31.024 1.00 31.95 ? 930 ANP B "C5'" 1 
HETATM 5783 C "C4'" . ANP D 2 .   ? 37.773 -6.267  -31.842 1.00 30.05 ? 930 ANP B "C4'" 1 
HETATM 5784 O "O4'" . ANP D 2 .   ? 38.942 -6.869  -32.447 1.00 29.72 ? 930 ANP B "O4'" 1 
HETATM 5785 C "C3'" . ANP D 2 .   ? 36.908 -5.767  -33.017 1.00 30.00 ? 930 ANP B "C3'" 1 
HETATM 5786 O "O3'" . ANP D 2 .   ? 35.859 -4.849  -32.705 1.00 30.33 ? 930 ANP B "O3'" 1 
HETATM 5787 C "C2'" . ANP D 2 .   ? 38.003 -5.301  -33.968 1.00 29.85 ? 930 ANP B "C2'" 1 
HETATM 5788 O "O2'" . ANP D 2 .   ? 38.399 -3.938  -33.777 1.00 31.20 ? 930 ANP B "O2'" 1 
HETATM 5789 C "C1'" . ANP D 2 .   ? 39.149 -6.336  -33.755 1.00 29.01 ? 930 ANP B "C1'" 1 
HETATM 5790 N N9    . ANP D 2 .   ? 39.005 -7.382  -34.806 1.00 27.83 ? 930 ANP B N9    1 
HETATM 5791 C C8    . ANP D 2 .   ? 38.199 -8.544  -34.898 1.00 26.53 ? 930 ANP B C8    1 
HETATM 5792 N N7    . ANP D 2 .   ? 38.225 -9.370  -35.980 1.00 26.58 ? 930 ANP B N7    1 
HETATM 5793 C C5    . ANP D 2 .   ? 39.166 -8.664  -36.691 1.00 26.20 ? 930 ANP B C5    1 
HETATM 5794 C C6    . ANP D 2 .   ? 39.765 -8.900  -38.016 1.00 25.72 ? 930 ANP B C6    1 
HETATM 5795 N N6    . ANP D 2 .   ? 39.410 -9.952  -38.749 1.00 24.53 ? 930 ANP B N6    1 
HETATM 5796 N N1    . ANP D 2 .   ? 40.707 -8.038  -38.521 1.00 25.61 ? 930 ANP B N1    1 
HETATM 5797 C C2    . ANP D 2 .   ? 41.111 -6.948  -37.818 1.00 25.16 ? 930 ANP B C2    1 
HETATM 5798 N N3    . ANP D 2 .   ? 40.681 -6.573  -36.616 1.00 25.70 ? 930 ANP B N3    1 
HETATM 5799 C C4    . ANP D 2 .   ? 39.653 -7.445  -35.977 1.00 26.25 ? 930 ANP B C4    1 
HETATM 5800 O O     . HOH E 3 .   ? 26.991 7.790   -12.088 1.00 19.36 ? 431 HOH A O     1 
HETATM 5801 O O     . HOH E 3 .   ? 26.122 -4.513  -11.861 1.00 20.10 ? 432 HOH A O     1 
HETATM 5802 O O     . HOH E 3 .   ? 14.869 7.142   -8.536  1.00 22.49 ? 433 HOH A O     1 
HETATM 5803 O O     . HOH E 3 .   ? 20.106 -2.703  -9.306  1.00 18.58 ? 434 HOH A O     1 
HETATM 5804 O O     . HOH E 3 .   ? 14.638 -0.463  6.277   1.00 21.53 ? 435 HOH A O     1 
HETATM 5805 O O     . HOH E 3 .   ? 7.758  -0.495  -12.675 1.00 20.62 ? 436 HOH A O     1 
HETATM 5806 O O     . HOH E 3 .   ? 19.389 0.977   -7.729  1.00 16.89 ? 437 HOH A O     1 
HETATM 5807 O O     . HOH E 3 .   ? 24.453 12.088  15.339  1.00 20.30 ? 438 HOH A O     1 
HETATM 5808 O O     . HOH E 3 .   ? 18.660 18.670  1.853   1.00 21.18 ? 439 HOH A O     1 
HETATM 5809 O O     . HOH E 3 .   ? 30.080 -1.777  -11.806 1.00 18.33 ? 440 HOH A O     1 
HETATM 5810 O O     . HOH E 3 .   ? 26.288 3.659   13.661  1.00 17.00 ? 441 HOH A O     1 
HETATM 5811 O O     . HOH E 3 .   ? 14.864 -0.417  8.830   1.00 25.94 ? 442 HOH A O     1 
HETATM 5812 O O     . HOH E 3 .   ? 24.965 13.230  7.761   1.00 20.11 ? 443 HOH A O     1 
HETATM 5813 O O     . HOH E 3 .   ? 23.990 9.874   8.531   1.00 17.13 ? 444 HOH A O     1 
HETATM 5814 O O     . HOH E 3 .   ? 38.198 7.047   -7.423  1.00 27.19 ? 445 HOH A O     1 
HETATM 5815 O O     . HOH E 3 .   ? 18.476 -9.148  0.832   1.00 27.18 ? 446 HOH A O     1 
HETATM 5816 O O     . HOH E 3 .   ? 14.826 14.837  3.245   1.00 17.69 ? 447 HOH A O     1 
HETATM 5817 O O     . HOH E 3 .   ? 18.183 16.915  3.827   1.00 24.18 ? 448 HOH A O     1 
HETATM 5818 O O     . HOH E 3 .   ? 37.543 14.916  -0.846  1.00 36.81 ? 449 HOH A O     1 
HETATM 5819 O O     . HOH E 3 .   ? 15.702 -3.388  2.325   1.00 24.34 ? 450 HOH A O     1 
HETATM 5820 O O     . HOH E 3 .   ? 17.162 -2.029  6.165   1.00 21.10 ? 451 HOH A O     1 
HETATM 5821 O O     . HOH E 3 .   ? 24.677 -2.563  -15.213 1.00 39.19 ? 452 HOH A O     1 
HETATM 5822 O O     . HOH E 3 .   ? 31.035 -0.014  -9.856  1.00 21.13 ? 453 HOH A O     1 
HETATM 5823 O O     . HOH E 3 .   ? 11.588 16.200  1.067   1.00 31.19 ? 454 HOH A O     1 
HETATM 5824 O O     . HOH E 3 .   ? 35.094 -8.867  -13.718 1.00 29.41 ? 455 HOH A O     1 
HETATM 5825 O O     . HOH E 3 .   ? 36.183 5.393   -8.061  1.00 27.73 ? 456 HOH A O     1 
HETATM 5826 O O     . HOH E 3 .   ? 25.757 -6.215  10.174  1.00 36.92 ? 457 HOH A O     1 
HETATM 5827 O O     . HOH E 3 .   ? 30.490 17.860  9.342   1.00 23.45 ? 458 HOH A O     1 
HETATM 5828 O O     . HOH E 3 .   ? 39.224 3.896   -1.575  1.00 22.57 ? 459 HOH A O     1 
HETATM 5829 O O     . HOH E 3 .   ? 19.056 -6.306  0.672   1.00 23.56 ? 460 HOH A O     1 
HETATM 5830 O O     . HOH E 3 .   ? 37.698 16.422  5.138   1.00 25.57 ? 461 HOH A O     1 
HETATM 5831 O O     . HOH E 3 .   ? 31.462 8.889   16.566  1.00 28.44 ? 462 HOH A O     1 
HETATM 5832 O O     . HOH E 3 .   ? 39.236 -3.970  8.008   1.00 32.52 ? 463 HOH A O     1 
HETATM 5833 O O     . HOH E 3 .   ? 18.865 -0.013  -17.576 1.00 25.20 ? 464 HOH A O     1 
HETATM 5834 O O     . HOH E 3 .   ? 15.765 -8.200  -5.994  1.00 21.78 ? 465 HOH A O     1 
HETATM 5835 O O     . HOH E 3 .   ? 29.392 6.279   -12.704 1.00 26.95 ? 466 HOH A O     1 
HETATM 5836 O O     . HOH E 3 .   ? 28.153 14.443  -11.308 1.00 35.15 ? 467 HOH A O     1 
HETATM 5837 O O     . HOH E 3 .   ? 16.479 8.222   -12.061 1.00 31.08 ? 468 HOH A O     1 
HETATM 5838 O O     . HOH E 3 .   ? 43.691 16.010  9.325   1.00 32.41 ? 469 HOH A O     1 
HETATM 5839 O O     . HOH E 3 .   ? 13.530 14.542  0.940   1.00 24.11 ? 470 HOH A O     1 
HETATM 5840 O O     . HOH E 3 .   ? 4.964  3.132   -13.641 1.00 47.44 ? 471 HOH A O     1 
HETATM 5841 O O     . HOH E 3 .   ? 7.724  10.989  -11.770 1.00 30.21 ? 472 HOH A O     1 
HETATM 5842 O O     . HOH E 3 .   ? 10.534 20.262  3.444   1.00 48.65 ? 473 HOH A O     1 
HETATM 5843 O O     . HOH E 3 .   ? 26.205 20.138  4.736   1.00 37.51 ? 474 HOH A O     1 
HETATM 5844 O O     . HOH E 3 .   ? 25.235 16.963  10.016  1.00 27.97 ? 475 HOH A O     1 
HETATM 5845 O O     . HOH E 3 .   ? 9.225  8.056   -9.123  1.00 24.20 ? 476 HOH A O     1 
HETATM 5846 O O     . HOH E 3 .   ? 9.750  7.279   13.506  1.00 29.00 ? 477 HOH A O     1 
HETATM 5847 O O     . HOH E 3 .   ? 21.832 3.187   -11.270 1.00 30.44 ? 478 HOH A O     1 
HETATM 5848 O O     . HOH E 3 .   ? 5.210  4.431   -6.097  1.00 26.64 ? 479 HOH A O     1 
HETATM 5849 O O     . HOH E 3 .   ? 27.318 -4.528  -14.454 1.00 32.93 ? 480 HOH A O     1 
HETATM 5850 O O     . HOH E 3 .   ? 17.591 -4.840  8.726   1.00 30.56 ? 481 HOH A O     1 
HETATM 5851 O O     . HOH E 3 .   ? 22.386 19.436  6.018   1.00 55.78 ? 482 HOH A O     1 
HETATM 5852 O O     . HOH E 3 .   ? 22.192 -4.447  -18.350 1.00 29.49 ? 483 HOH A O     1 
HETATM 5853 O O     . HOH E 3 .   ? 9.707  10.493  8.204   1.00 32.49 ? 484 HOH A O     1 
HETATM 5854 O O     . HOH E 3 .   ? 15.444 -9.629  -1.973  1.00 28.97 ? 485 HOH A O     1 
HETATM 5855 O O     . HOH E 3 .   ? 12.084 0.638   15.069  1.00 26.15 ? 486 HOH A O     1 
HETATM 5856 O O     . HOH E 3 .   ? 16.455 4.054   -13.813 1.00 24.15 ? 487 HOH A O     1 
HETATM 5857 O O     . HOH E 3 .   ? 12.654 34.551  -1.316  1.00 49.24 ? 488 HOH A O     1 
HETATM 5858 O O     . HOH E 3 .   ? 36.095 0.901   10.600  1.00 28.35 ? 489 HOH A O     1 
HETATM 5859 O O     . HOH E 3 .   ? 15.261 -3.610  5.066   1.00 36.11 ? 490 HOH A O     1 
HETATM 5860 O O     . HOH E 3 .   ? 28.481 26.336  -3.435  1.00 40.55 ? 491 HOH A O     1 
HETATM 5861 O O     . HOH E 3 .   ? 8.790  4.974   -10.935 1.00 44.61 ? 492 HOH A O     1 
HETATM 5862 O O     . HOH E 3 .   ? 14.058 -11.339 -8.711  1.00 32.32 ? 493 HOH A O     1 
HETATM 5863 O O     . HOH E 3 .   ? 6.292  -8.877  -8.366  1.00 44.13 ? 494 HOH A O     1 
HETATM 5864 O O     . HOH E 3 .   ? 39.771 0.575   7.848   1.00 33.50 ? 495 HOH A O     1 
HETATM 5865 O O     . HOH E 3 .   ? 9.338  24.518  3.092   1.00 33.74 ? 496 HOH A O     1 
HETATM 5866 O O     . HOH E 3 .   ? 17.442 12.241  9.533   1.00 25.09 ? 497 HOH A O     1 
HETATM 5867 O O     . HOH E 3 .   ? 26.808 -14.913 -4.694  1.00 34.31 ? 498 HOH A O     1 
HETATM 5868 O O     . HOH E 3 .   ? 41.267 7.268   5.574   1.00 29.88 ? 499 HOH A O     1 
HETATM 5869 O O     . HOH E 3 .   ? 33.494 14.022  15.238  1.00 29.30 ? 500 HOH A O     1 
HETATM 5870 O O     . HOH E 3 .   ? 23.318 15.478  7.549   1.00 37.25 ? 501 HOH A O     1 
HETATM 5871 O O     . HOH E 3 .   ? 7.018  -5.932  -6.429  1.00 36.78 ? 502 HOH A O     1 
HETATM 5872 O O     . HOH E 3 .   ? 33.903 1.648   17.332  1.00 39.96 ? 503 HOH A O     1 
HETATM 5873 O O     . HOH E 3 .   ? 16.297 14.860  -6.305  1.00 25.54 ? 504 HOH A O     1 
HETATM 5874 O O     . HOH E 3 .   ? 16.021 -1.448  20.126  1.00 29.34 ? 505 HOH A O     1 
HETATM 5875 O O     . HOH E 3 .   ? 2.862  28.159  3.949   1.00 41.80 ? 506 HOH A O     1 
HETATM 5876 O O     . HOH E 3 .   ? 29.680 -14.167 0.574   1.00 55.70 ? 507 HOH A O     1 
HETATM 5877 O O     . HOH E 3 .   ? 28.214 0.765   19.228  1.00 37.30 ? 508 HOH A O     1 
HETATM 5878 O O     . HOH E 3 .   ? 16.685 -5.337  1.055   1.00 35.69 ? 509 HOH A O     1 
HETATM 5879 O O     . HOH E 3 .   ? 37.846 -1.358  8.290   1.00 36.48 ? 510 HOH A O     1 
HETATM 5880 O O     . HOH E 3 .   ? 14.976 -9.675  0.481   1.00 39.76 ? 511 HOH A O     1 
HETATM 5881 O O     . HOH E 3 .   ? 8.624  8.390   -11.542 1.00 41.50 ? 512 HOH A O     1 
HETATM 5882 O O     . HOH E 3 .   ? 14.201 16.748  4.965   1.00 34.67 ? 513 HOH A O     1 
HETATM 5883 O O     . HOH E 3 .   ? 13.978 13.887  -6.978  1.00 33.28 ? 514 HOH A O     1 
HETATM 5884 O O     . HOH E 3 .   ? 5.043  -2.674  -6.946  1.00 28.27 ? 515 HOH A O     1 
HETATM 5885 O O     . HOH E 3 .   ? 14.390 -10.520 -6.182  1.00 30.30 ? 516 HOH A O     1 
HETATM 5886 O O     . HOH E 3 .   ? 31.153 0.085   16.730  1.00 29.32 ? 517 HOH A O     1 
HETATM 5887 O O     . HOH E 3 .   ? 35.315 5.320   -10.914 1.00 33.00 ? 518 HOH A O     1 
HETATM 5888 O O     . HOH E 3 .   ? 8.818  -6.747  -2.512  1.00 33.59 ? 519 HOH A O     1 
HETATM 5889 O O     . HOH E 3 .   ? 17.998 -1.236  21.581  1.00 40.18 ? 520 HOH A O     1 
HETATM 5890 O O     . HOH E 3 .   ? 11.348 -2.095  0.727   1.00 29.25 ? 521 HOH A O     1 
HETATM 5891 O O     . HOH E 3 .   ? -2.527 20.652  4.171   1.00 55.35 ? 522 HOH A O     1 
HETATM 5892 O O     . HOH E 3 .   ? 36.973 -1.615  10.986  1.00 42.49 ? 523 HOH A O     1 
HETATM 5893 O O     . HOH E 3 .   ? 23.988 -15.747 -3.462  1.00 38.78 ? 524 HOH A O     1 
HETATM 5894 O O     . HOH E 3 .   ? 8.808  -6.001  -8.581  1.00 28.16 ? 525 HOH A O     1 
HETATM 5895 O O     . HOH E 3 .   ? 12.968 -3.784  2.015   1.00 32.23 ? 526 HOH A O     1 
HETATM 5896 O O     . HOH E 3 .   ? 14.346 -5.857  5.771   1.00 39.77 ? 527 HOH A O     1 
HETATM 5897 O O     . HOH E 3 .   ? 25.951 19.446  -9.088  1.00 48.66 ? 528 HOH A O     1 
HETATM 5898 O O     . HOH E 3 .   ? 8.349  -2.311  3.974   1.00 52.43 ? 529 HOH A O     1 
HETATM 5899 O O     . HOH E 3 .   ? 15.061 8.436   10.187  1.00 46.06 ? 530 HOH A O     1 
HETATM 5900 O O     . HOH E 3 .   ? 12.852 -2.138  5.395   1.00 36.16 ? 531 HOH A O     1 
HETATM 5901 O O     . HOH E 3 .   ? 17.456 16.142  -8.081  1.00 28.00 ? 532 HOH A O     1 
HETATM 5902 O O     . HOH E 3 .   ? 25.793 14.215  -11.393 1.00 53.30 ? 533 HOH A O     1 
HETATM 5903 O O     . HOH E 3 .   ? 32.895 20.826  14.002  1.00 50.78 ? 534 HOH A O     1 
HETATM 5904 O O     . HOH E 3 .   ? 26.010 18.513  -6.852  1.00 49.69 ? 535 HOH A O     1 
HETATM 5905 O O     . HOH E 3 .   ? 29.894 -3.569  14.227  1.00 35.91 ? 536 HOH A O     1 
HETATM 5906 O O     . HOH E 3 .   ? 25.950 1.426   21.652  1.00 38.16 ? 537 HOH A O     1 
HETATM 5907 O O     . HOH E 3 .   ? 30.416 -6.977  10.563  1.00 31.47 ? 538 HOH A O     1 
HETATM 5908 O O     . HOH E 3 .   ? 9.360  13.217  -12.515 1.00 29.34 ? 539 HOH A O     1 
HETATM 5909 O O     . HOH E 3 .   ? 37.061 20.772  3.378   1.00 48.19 ? 540 HOH A O     1 
HETATM 5910 O O     . HOH E 3 .   ? 20.951 25.816  2.484   1.00 55.57 ? 541 HOH A O     1 
HETATM 5911 O O     . HOH E 3 .   ? 11.617 3.348   18.918  1.00 37.80 ? 542 HOH A O     1 
HETATM 5912 O O     . HOH E 3 .   ? 35.932 15.111  -11.286 1.00 42.73 ? 543 HOH A O     1 
HETATM 5913 O O     . HOH E 3 .   ? 2.788  12.290  -1.157  1.00 35.79 ? 544 HOH A O     1 
HETATM 5914 O O     . HOH E 3 .   ? 47.867 -1.500  -2.127  1.00 48.95 ? 545 HOH A O     1 
HETATM 5915 O O     . HOH E 3 .   ? 38.431 18.402  3.304   1.00 34.89 ? 546 HOH A O     1 
HETATM 5916 O O     . HOH E 3 .   ? 14.260 -11.781 -3.473  1.00 42.09 ? 547 HOH A O     1 
HETATM 5917 O O     . HOH E 3 .   ? 41.783 7.597   8.063   1.00 49.94 ? 548 HOH A O     1 
HETATM 5918 O O     . HOH E 3 .   ? 41.437 16.065  11.433  1.00 35.73 ? 549 HOH A O     1 
HETATM 5919 O O     . HOH E 3 .   ? 5.134  10.513  -12.571 1.00 31.80 ? 550 HOH A O     1 
HETATM 5920 O O     . HOH E 3 .   ? 24.091 33.208  -5.838  1.00 49.29 ? 551 HOH A O     1 
HETATM 5921 O O     . HOH E 3 .   ? 17.440 -7.437  9.567   1.00 38.41 ? 552 HOH A O     1 
HETATM 5922 O O     . HOH E 3 .   ? 18.013 -7.316  -19.946 1.00 48.25 ? 553 HOH A O     1 
HETATM 5923 O O     . HOH E 3 .   ? 35.810 -6.756  -12.219 1.00 39.85 ? 554 HOH A O     1 
HETATM 5924 O O     . HOH E 3 .   ? 16.594 17.440  6.065   1.00 36.55 ? 555 HOH A O     1 
HETATM 5925 O O     . HOH E 3 .   ? 39.946 7.833   13.394  1.00 39.91 ? 556 HOH A O     1 
HETATM 5926 O O     . HOH E 3 .   ? 41.570 -1.590  -4.810  1.00 43.13 ? 557 HOH A O     1 
HETATM 5927 O O     . HOH E 3 .   ? 9.122  -8.933  -1.142  1.00 58.25 ? 558 HOH A O     1 
HETATM 5928 O O     . HOH E 3 .   ? 4.163  6.304   -4.429  1.00 48.18 ? 559 HOH A O     1 
HETATM 5929 O O     . HOH E 3 .   ? 44.907 9.064   -1.038  1.00 34.85 ? 560 HOH A O     1 
HETATM 5930 O O     . HOH E 3 .   ? 12.028 25.774  2.936   1.00 61.76 ? 561 HOH A O     1 
HETATM 5931 O O     . HOH E 3 .   ? 2.392  25.610  -5.875  1.00 35.15 ? 562 HOH A O     1 
HETATM 5932 O O     . HOH E 3 .   ? 16.657 10.163  10.881  1.00 44.33 ? 563 HOH A O     1 
HETATM 5933 O O     . HOH E 3 .   ? 33.322 -5.726  -19.738 1.00 36.73 ? 564 HOH A O     1 
HETATM 5934 O O     . HOH E 3 .   ? 9.664  -0.740  15.107  1.00 33.20 ? 565 HOH A O     1 
HETATM 5935 O O     . HOH E 3 .   ? 9.813  -3.061  13.857  1.00 32.82 ? 566 HOH A O     1 
HETATM 5936 O O     . HOH E 3 .   ? 29.757 -12.186 -2.841  1.00 37.79 ? 567 HOH A O     1 
HETATM 5937 O O     . HOH E 3 .   ? 28.226 -8.165  9.726   1.00 43.75 ? 568 HOH A O     1 
HETATM 5938 O O     . HOH E 3 .   ? 15.090 -4.057  20.191  1.00 40.66 ? 569 HOH A O     1 
HETATM 5939 O O     . HOH E 3 .   ? 36.360 19.661  15.272  1.00 44.98 ? 570 HOH A O     1 
HETATM 5940 O O     . HOH E 3 .   ? 3.300  30.262  -9.313  1.00 38.74 ? 571 HOH A O     1 
HETATM 5941 O O     . HOH E 3 .   ? 11.936 8.561   10.291  1.00 46.36 ? 572 HOH A O     1 
HETATM 5942 O O     . HOH E 3 .   ? 12.236 -6.138  0.134   1.00 48.29 ? 573 HOH A O     1 
HETATM 5943 O O     . HOH E 3 .   ? 28.330 17.648  13.526  1.00 65.55 ? 574 HOH A O     1 
HETATM 5944 O O     . HOH E 3 .   ? 42.645 5.044   -9.178  1.00 47.53 ? 575 HOH A O     1 
HETATM 5945 O O     . HOH E 3 .   ? 10.367 -12.239 -13.081 1.00 51.83 ? 576 HOH A O     1 
HETATM 5946 O O     . HOH E 3 .   ? 10.847 27.306  -13.915 1.00 45.10 ? 577 HOH A O     1 
HETATM 5947 O O     . HOH E 3 .   ? -0.800 22.995  -3.456  1.00 51.30 ? 578 HOH A O     1 
HETATM 5948 O O     . HOH E 3 .   ? 8.604  37.075  -12.613 1.00 59.07 ? 579 HOH A O     1 
HETATM 5949 O O     . HOH E 3 .   ? 10.570 12.494  -15.011 1.00 64.77 ? 580 HOH A O     1 
HETATM 5950 O O     . HOH E 3 .   ? 27.334 18.941  9.365   1.00 42.85 ? 581 HOH A O     1 
HETATM 5951 O O     . HOH E 3 .   ? 10.884 -4.958  -1.787  1.00 27.35 ? 582 HOH A O     1 
HETATM 5952 O O     . HOH E 3 .   ? 29.201 15.817  -13.489 1.00 42.39 ? 583 HOH A O     1 
HETATM 5953 O O     . HOH E 3 .   ? 13.983 10.756  9.571   1.00 35.32 ? 584 HOH A O     1 
HETATM 5954 O O     . HOH E 3 .   ? 8.106  26.855  -18.116 1.00 60.72 ? 585 HOH A O     1 
HETATM 5955 O O     . HOH E 3 .   ? 36.207 -0.608  -14.850 1.00 41.84 ? 586 HOH A O     1 
HETATM 5956 O O     . HOH E 3 .   ? 6.191  10.743  6.055   1.00 56.46 ? 587 HOH A O     1 
HETATM 5957 O O     . HOH E 3 .   ? 10.715 -1.751  7.763   1.00 39.71 ? 588 HOH A O     1 
HETATM 5958 O O     . HOH E 3 .   ? 18.081 15.259  14.648  1.00 54.08 ? 589 HOH A O     1 
HETATM 5959 O O     . HOH E 3 .   ? 22.152 20.974  2.057   1.00 59.78 ? 590 HOH A O     1 
HETATM 5960 O O     . HOH E 3 .   ? 14.612 -6.996  -0.061  1.00 49.00 ? 591 HOH A O     1 
HETATM 5961 O O     . HOH E 3 .   ? 11.893 -6.175  6.936   1.00 56.79 ? 592 HOH A O     1 
HETATM 5962 O O     . HOH E 3 .   ? 4.948  -5.792  -0.180  1.00 49.85 ? 593 HOH A O     1 
HETATM 5963 O O     . HOH E 3 .   ? 31.576 26.642  -10.019 1.00 56.99 ? 594 HOH A O     1 
HETATM 5964 O O     . HOH E 3 .   ? 13.133 13.040  -13.006 1.00 44.58 ? 595 HOH A O     1 
HETATM 5965 O O     . HOH E 3 .   ? 27.747 -7.914  -26.487 1.00 40.44 ? 596 HOH A O     1 
HETATM 5966 O O     . HOH E 3 .   ? 16.179 15.842  8.535   1.00 59.24 ? 597 HOH A O     1 
HETATM 5967 O O     . HOH E 3 .   ? 7.633  -13.164 -12.527 1.00 45.72 ? 598 HOH A O     1 
HETATM 5968 O O     . HOH E 3 .   ? 8.691  -7.004  -5.137  1.00 37.80 ? 599 HOH A O     1 
HETATM 5969 O O     . HOH E 3 .   ? 23.083 28.215  0.322   1.00 51.50 ? 600 HOH A O     1 
HETATM 5970 O O     . HOH E 3 .   ? 14.947 -8.072  8.196   1.00 53.11 ? 601 HOH A O     1 
HETATM 5971 O O     . HOH E 3 .   ? 24.589 19.630  2.140   1.00 43.13 ? 602 HOH A O     1 
HETATM 5972 O O     . HOH E 3 .   ? 9.391  -3.074  -1.058  1.00 46.90 ? 603 HOH A O     1 
HETATM 5973 O O     . HOH E 3 .   ? 36.889 16.531  1.214   1.00 42.57 ? 604 HOH A O     1 
HETATM 5974 O O     . HOH E 3 .   ? 8.118  22.224  3.488   1.00 55.80 ? 605 HOH A O     1 
HETATM 5975 O O     . HOH E 3 .   ? 39.827 -5.915  -9.917  1.00 45.40 ? 606 HOH A O     1 
HETATM 5976 O O     . HOH E 3 .   ? 31.998 3.517   20.229  1.00 34.87 ? 607 HOH A O     1 
HETATM 5977 O O     . HOH E 3 .   ? 27.949 26.860  -9.386  1.00 57.74 ? 608 HOH A O     1 
HETATM 5978 O O     . HOH E 3 .   ? 31.052 -9.759  6.961   1.00 46.67 ? 609 HOH A O     1 
HETATM 5979 O O     . HOH E 3 .   ? 2.302  8.914   -6.583  1.00 48.95 ? 610 HOH A O     1 
HETATM 5980 O O     . HOH E 3 .   ? 15.254 10.502  -13.325 1.00 56.62 ? 611 HOH A O     1 
HETATM 5981 O O     . HOH E 3 .   ? 31.716 6.966   -11.103 1.00 37.17 ? 612 HOH A O     1 
HETATM 5982 O O     . HOH E 3 .   ? 33.527 8.677   -10.957 1.00 40.28 ? 613 HOH A O     1 
HETATM 5983 O O     . HOH E 3 .   ? 4.757  29.784  -11.421 1.00 56.44 ? 614 HOH A O     1 
HETATM 5984 O O     . HOH E 3 .   ? 21.375 -0.216  -19.401 1.00 45.82 ? 615 HOH A O     1 
HETATM 5985 O O     . HOH E 3 .   ? 10.236 16.631  -19.072 1.00 49.50 ? 616 HOH A O     1 
HETATM 5986 O O     . HOH E 3 .   ? 24.280 -16.323 -21.775 1.00 57.38 ? 617 HOH A O     1 
HETATM 5987 O O     . HOH E 3 .   ? 38.226 -9.562  4.105   1.00 45.95 ? 618 HOH A O     1 
HETATM 5988 O O     . HOH E 3 .   ? 7.947  2.403   12.728  1.00 44.28 ? 619 HOH A O     1 
HETATM 5989 O O     . HOH E 3 .   ? 43.373 -6.738  -1.151  1.00 39.50 ? 620 HOH A O     1 
HETATM 5990 O O     . HOH E 3 .   ? 16.132 12.402  -17.074 1.00 56.98 ? 621 HOH A O     1 
HETATM 5991 O O     . HOH E 3 .   ? 8.680  37.451  -2.174  1.00 61.68 ? 622 HOH A O     1 
HETATM 5992 O O     . HOH E 3 .   ? 37.063 19.125  1.215   1.00 51.64 ? 623 HOH A O     1 
HETATM 5993 O O     . HOH E 3 .   ? 4.692  5.651   -1.945  1.00 54.98 ? 624 HOH A O     1 
HETATM 5994 O O     . HOH E 3 .   ? 36.005 13.311  -0.066  1.00 50.98 ? 625 HOH A O     1 
HETATM 5995 O O     . HOH E 3 .   ? 19.608 25.413  0.222   1.00 52.33 ? 626 HOH A O     1 
HETATM 5996 O O     . HOH E 3 .   ? 1.373  16.650  -4.110  1.00 52.37 ? 627 HOH A O     1 
HETATM 5997 O O     . HOH E 3 .   ? 30.449 1.673   19.614  1.00 49.89 ? 628 HOH A O     1 
HETATM 5998 O O     . HOH E 3 .   ? 25.450 12.418  18.490  1.00 39.12 ? 629 HOH A O     1 
HETATM 5999 O O     . HOH E 3 .   ? 13.015 1.008   17.615  1.00 40.38 ? 630 HOH A O     1 
HETATM 6000 O O     . HOH E 3 .   ? 12.602 -11.651 6.601   1.00 51.34 ? 631 HOH A O     1 
HETATM 6001 O O     . HOH E 3 .   ? 15.371 -14.109 -4.463  1.00 46.50 ? 632 HOH A O     1 
HETATM 6002 O O     . HOH E 3 .   ? 8.480  -9.540  -5.323  1.00 62.77 ? 633 HOH A O     1 
HETATM 6003 O O     . HOH E 3 .   ? 6.522  -10.569 -11.971 1.00 47.00 ? 634 HOH A O     1 
HETATM 6004 O O     . HOH E 3 .   ? 9.645  6.029   -13.041 1.00 47.89 ? 635 HOH A O     1 
HETATM 6005 O O     . HOH E 3 .   ? 23.384 -18.320 -16.960 1.00 44.54 ? 636 HOH A O     1 
HETATM 6006 O O     . HOH E 3 .   ? 36.271 -3.045  13.063  1.00 55.33 ? 637 HOH A O     1 
HETATM 6007 O O     . HOH E 3 .   ? 17.353 16.632  -14.925 1.00 55.26 ? 638 HOH A O     1 
HETATM 6008 O O     . HOH E 3 .   ? 5.835  38.421  -2.696  1.00 61.58 ? 639 HOH A O     1 
HETATM 6009 O O     . HOH E 3 .   ? 26.452 3.827   -15.752 1.00 45.25 ? 640 HOH A O     1 
HETATM 6010 O O     . HOH E 3 .   ? 36.135 7.621   -11.372 1.00 64.15 ? 641 HOH A O     1 
HETATM 6011 O O     . HOH E 3 .   ? 13.262 -10.806 -20.398 1.00 36.53 ? 642 HOH A O     1 
HETATM 6012 O O     . HOH E 3 .   ? -1.222 20.518  -4.231  1.00 54.27 ? 643 HOH A O     1 
HETATM 6013 O O     . HOH E 3 .   ? 22.643 12.928  -13.720 1.00 51.22 ? 644 HOH A O     1 
HETATM 6014 O O     . HOH E 3 .   ? 28.996 25.891  -5.847  1.00 66.99 ? 645 HOH A O     1 
HETATM 6015 O O     . HOH E 3 .   ? 11.945 32.445  0.553   1.00 57.51 ? 646 HOH A O     1 
HETATM 6016 O O     . HOH E 3 .   ? 37.206 -2.943  -12.852 1.00 54.33 ? 647 HOH A O     1 
HETATM 6017 O O     . HOH E 3 .   ? 18.382 -16.273 1.114   1.00 52.95 ? 648 HOH A O     1 
HETATM 6018 O O     . HOH E 3 .   ? 7.294  2.271   -13.840 1.00 46.35 ? 649 HOH A O     1 
HETATM 6019 O O     . HOH E 3 .   ? 12.211 -10.629 -0.023  1.00 51.48 ? 650 HOH A O     1 
HETATM 6020 O O     . HOH E 3 .   ? 28.264 -9.634  7.343   1.00 53.85 ? 651 HOH A O     1 
HETATM 6021 O O     . HOH E 3 .   ? 43.362 -6.870  1.602   1.00 56.77 ? 652 HOH A O     1 
HETATM 6022 O O     . HOH E 3 .   ? 13.454 28.740  -13.914 1.00 57.46 ? 653 HOH A O     1 
HETATM 6023 O O     . HOH E 3 .   ? 12.930 22.563  4.710   1.00 56.84 ? 654 HOH A O     1 
HETATM 6024 O O     . HOH E 3 .   ? 12.192 -13.088 -18.809 1.00 57.08 ? 655 HOH A O     1 
HETATM 6025 O O     . HOH E 3 .   ? 40.037 5.194   7.990   1.00 52.02 ? 656 HOH A O     1 
HETATM 6026 O O     . HOH E 3 .   ? 40.603 8.669   10.091  1.00 51.96 ? 657 HOH A O     1 
HETATM 6027 O O     . HOH E 3 .   ? 39.945 10.739  13.182  1.00 53.68 ? 658 HOH A O     1 
HETATM 6028 O O     . HOH E 3 .   ? 35.551 13.261  17.820  1.00 56.21 ? 659 HOH A O     1 
HETATM 6029 O O     . HOH E 3 .   ? 33.206 10.611  24.541  1.00 54.18 ? 660 HOH A O     1 
HETATM 6030 O O     . HOH E 3 .   ? 28.161 12.227  14.518  1.00 50.33 ? 661 HOH A O     1 
HETATM 6031 O O     . HOH E 3 .   ? 31.317 5.492   22.425  1.00 43.36 ? 662 HOH A O     1 
HETATM 6032 O O     . HOH E 3 .   ? 5.936  1.984   7.447   1.00 54.97 ? 663 HOH A O     1 
HETATM 6033 O O     . HOH E 3 .   ? 35.070 16.556  4.788   1.00 48.42 ? 664 HOH A O     1 
HETATM 6034 O O     . HOH F 3 .   ? 21.978 4.791   -30.693 1.00 21.00 ? 7   HOH B O     1 
HETATM 6035 O O     . HOH F 3 .   ? 23.392 5.195   -33.074 1.00 20.26 ? 8   HOH B O     1 
HETATM 6036 O O     . HOH F 3 .   ? 21.946 -6.641  -33.426 1.00 17.46 ? 10  HOH B O     1 
HETATM 6037 O O     . HOH F 3 .   ? 17.736 -1.777  -19.949 1.00 23.28 ? 12  HOH B O     1 
HETATM 6038 O O     . HOH F 3 .   ? 20.986 -5.842  -20.955 1.00 25.45 ? 16  HOH B O     1 
HETATM 6039 O O     . HOH F 3 .   ? 17.133 -13.140 -48.592 1.00 29.05 ? 18  HOH B O     1 
HETATM 6040 O O     . HOH F 3 .   ? 13.323 -6.523  -40.460 1.00 21.32 ? 20  HOH B O     1 
HETATM 6041 O O     . HOH F 3 .   ? 19.393 -16.927 -26.494 1.00 17.24 ? 23  HOH B O     1 
HETATM 6042 O O     . HOH F 3 .   ? 13.814 -14.643 -36.934 1.00 23.89 ? 24  HOH B O     1 
HETATM 6043 O O     . HOH F 3 .   ? 17.521 -12.769 -45.997 1.00 25.08 ? 27  HOH B O     1 
HETATM 6044 O O     . HOH F 3 .   ? 7.428  3.310   -35.120 1.00 25.97 ? 32  HOH B O     1 
HETATM 6045 O O     . HOH F 3 .   ? 22.382 -5.439  -23.499 1.00 22.05 ? 33  HOH B O     1 
HETATM 6046 O O     . HOH F 3 .   ? 21.759 -3.173  -55.646 1.00 24.29 ? 34  HOH B O     1 
HETATM 6047 O O     . HOH F 3 .   ? 12.245 -8.772  -33.152 1.00 19.41 ? 35  HOH B O     1 
HETATM 6048 O O     . HOH F 3 .   ? 9.927  -9.097  -36.843 1.00 29.71 ? 37  HOH B O     1 
HETATM 6049 O O     . HOH F 3 .   ? 31.183 10.465  -37.488 1.00 27.40 ? 40  HOH B O     1 
HETATM 6050 O O     . HOH F 3 .   ? 29.741 2.658   -31.004 1.00 28.90 ? 42  HOH B O     1 
HETATM 6051 O O     . HOH F 3 .   ? 29.174 -10.257 -29.814 1.00 23.35 ? 43  HOH B O     1 
HETATM 6052 O O     . HOH F 3 .   ? 36.346 -11.274 -35.009 1.00 33.85 ? 44  HOH B O     1 
HETATM 6053 O O     . HOH F 3 .   ? 9.687  -9.461  -32.363 1.00 24.11 ? 45  HOH B O     1 
HETATM 6054 O O     . HOH F 3 .   ? 19.236 8.604   -53.948 1.00 41.97 ? 46  HOH B O     1 
HETATM 6055 O O     . HOH F 3 .   ? 37.276 -11.919 -45.242 1.00 29.35 ? 50  HOH B O     1 
HETATM 6056 O O     . HOH F 3 .   ? 32.730 -15.048 -45.445 1.00 28.69 ? 54  HOH B O     1 
HETATM 6057 O O     . HOH F 3 .   ? 29.189 -6.747  -58.524 1.00 26.99 ? 59  HOH B O     1 
HETATM 6058 O O     . HOH F 3 .   ? 31.844 -5.648  -51.267 1.00 23.19 ? 61  HOH B O     1 
HETATM 6059 O O     . HOH F 3 .   ? 34.639 -12.584 -36.260 1.00 29.68 ? 62  HOH B O     1 
HETATM 6060 O O     . HOH F 3 .   ? 15.439 -10.743 -41.876 1.00 26.75 ? 67  HOH B O     1 
HETATM 6061 O O     . HOH F 3 .   ? 27.322 -12.082 -32.709 1.00 22.50 ? 69  HOH B O     1 
HETATM 6062 O O     . HOH F 3 .   ? 18.943 -1.257  -22.639 1.00 29.80 ? 74  HOH B O     1 
HETATM 6063 O O     . HOH F 3 .   ? 27.339 -17.566 -31.459 1.00 26.75 ? 75  HOH B O     1 
HETATM 6064 O O     . HOH F 3 .   ? 18.859 -4.925  -31.481 1.00 20.61 ? 76  HOH B O     1 
HETATM 6065 O O     . HOH F 3 .   ? 35.233 -12.375 -46.871 1.00 27.03 ? 79  HOH B O     1 
HETATM 6066 O O     . HOH F 3 .   ? 22.352 -21.388 -33.124 1.00 27.99 ? 83  HOH B O     1 
HETATM 6067 O O     . HOH F 3 .   ? 37.057 -1.159  -54.343 1.00 31.24 ? 85  HOH B O     1 
HETATM 6068 O O     . HOH F 3 .   ? 21.400 7.180   -54.057 1.00 30.31 ? 89  HOH B O     1 
HETATM 6069 O O     . HOH F 3 .   ? 20.912 4.462   -60.369 1.00 38.65 ? 93  HOH B O     1 
HETATM 6070 O O     . HOH F 3 .   ? 12.020 -15.893 -33.152 1.00 39.65 ? 95  HOH B O     1 
HETATM 6071 O O     . HOH F 3 .   ? 24.873 7.680   -65.100 1.00 45.80 ? 96  HOH B O     1 
HETATM 6072 O O     . HOH F 3 .   ? 28.464 -5.972  -51.389 1.00 20.78 ? 97  HOH B O     1 
HETATM 6073 O O     . HOH F 3 .   ? 27.012 0.536   -60.294 1.00 27.81 ? 99  HOH B O     1 
HETATM 6074 O O     . HOH F 3 .   ? 18.533 1.561   -29.760 1.00 18.98 ? 104 HOH B O     1 
HETATM 6075 O O     . HOH F 3 .   ? 44.682 0.109   -38.932 1.00 51.91 ? 105 HOH B O     1 
HETATM 6076 O O     . HOH F 3 .   ? 32.948 -18.074 -28.933 1.00 33.54 ? 108 HOH B O     1 
HETATM 6077 O O     . HOH F 3 .   ? 39.636 6.755   -34.437 1.00 42.24 ? 110 HOH B O     1 
HETATM 6078 O O     . HOH F 3 .   ? 22.585 0.186   -65.199 1.00 27.74 ? 111 HOH B O     1 
HETATM 6079 O O     . HOH F 3 .   ? 19.207 15.246  -33.499 1.00 48.57 ? 112 HOH B O     1 
HETATM 6080 O O     . HOH F 3 .   ? 14.592 -11.638 -44.521 1.00 38.09 ? 113 HOH B O     1 
HETATM 6081 O O     . HOH F 3 .   ? 13.206 -9.501  -48.259 1.00 26.68 ? 116 HOH B O     1 
HETATM 6082 O O     . HOH F 3 .   ? 21.544 1.493   -63.123 1.00 33.50 ? 118 HOH B O     1 
HETATM 6083 O O     . HOH F 3 .   ? 34.135 -16.480 -47.240 1.00 32.96 ? 120 HOH B O     1 
HETATM 6084 O O     . HOH F 3 .   ? 51.594 -8.873  -37.331 1.00 44.39 ? 121 HOH B O     1 
HETATM 6085 O O     . HOH F 3 .   ? 16.249 11.487  -29.031 1.00 31.37 ? 122 HOH B O     1 
HETATM 6086 O O     . HOH F 3 .   ? 16.247 -9.911  -46.256 1.00 26.92 ? 123 HOH B O     1 
HETATM 6087 O O     . HOH F 3 .   ? 25.600 -9.278  -27.420 1.00 24.20 ? 124 HOH B O     1 
HETATM 6088 O O     . HOH F 3 .   ? 37.300 -0.174  -33.377 1.00 35.59 ? 130 HOH B O     1 
HETATM 6089 O O     . HOH F 3 .   ? 16.547 -16.741 -54.489 1.00 31.70 ? 132 HOH B O     1 
HETATM 6090 O O     . HOH F 3 .   ? 12.744 -18.336 -51.942 1.00 46.35 ? 134 HOH B O     1 
HETATM 6091 O O     . HOH F 3 .   ? 31.287 -11.455 -28.641 1.00 46.48 ? 135 HOH B O     1 
HETATM 6092 O O     . HOH F 3 .   ? 29.309 -12.961 -51.688 1.00 37.20 ? 136 HOH B O     1 
HETATM 6093 O O     . HOH F 3 .   ? 30.347 -19.266 -29.057 1.00 38.01 ? 137 HOH B O     1 
HETATM 6094 O O     . HOH F 3 .   ? 16.231 -14.932 -40.034 1.00 27.99 ? 138 HOH B O     1 
HETATM 6095 O O     . HOH F 3 .   ? 33.375 -14.568 -35.090 1.00 31.11 ? 140 HOH B O     1 
HETATM 6096 O O     . HOH F 3 .   ? 26.786 -20.115 -48.847 1.00 43.21 ? 141 HOH B O     1 
HETATM 6097 O O     . HOH F 3 .   ? 10.655 -6.801  -40.079 1.00 28.36 ? 144 HOH B O     1 
HETATM 6098 O O     . HOH F 3 .   ? 29.356 9.026   -36.151 1.00 34.26 ? 146 HOH B O     1 
HETATM 6099 O O     . HOH F 3 .   ? 32.706 -16.018 -42.967 1.00 29.33 ? 147 HOH B O     1 
HETATM 6100 O O     . HOH F 3 .   ? 29.477 8.500   -33.404 1.00 39.12 ? 149 HOH B O     1 
HETATM 6101 O O     . HOH F 3 .   ? 33.358 -13.980 -28.868 1.00 34.46 ? 150 HOH B O     1 
HETATM 6102 O O     . HOH F 3 .   ? 46.843 -21.327 -25.258 1.00 45.21 ? 151 HOH B O     1 
HETATM 6103 O O     . HOH F 3 .   ? 32.676 1.517   -59.763 1.00 37.27 ? 153 HOH B O     1 
HETATM 6104 O O     . HOH F 3 .   ? 5.746  0.998   -35.881 1.00 32.90 ? 161 HOH B O     1 
HETATM 6105 O O     . HOH F 3 .   ? 32.839 -27.007 -31.406 1.00 53.35 ? 162 HOH B O     1 
HETATM 6106 O O     . HOH F 3 .   ? 12.815 3.365   -51.832 1.00 36.31 ? 163 HOH B O     1 
HETATM 6107 O O     . HOH F 3 .   ? 44.096 -11.478 -44.500 1.00 41.27 ? 167 HOH B O     1 
HETATM 6108 O O     . HOH F 3 .   ? 33.656 -18.246 -42.913 1.00 40.35 ? 169 HOH B O     1 
HETATM 6109 O O     . HOH F 3 .   ? 39.682 -0.050  -59.148 1.00 49.29 ? 171 HOH B O     1 
HETATM 6110 O O     . HOH F 3 .   ? 28.691 -22.259 -47.034 1.00 60.74 ? 172 HOH B O     1 
HETATM 6111 O O     . HOH F 3 .   ? 32.666 6.256   -33.603 1.00 38.09 ? 173 HOH B O     1 
HETATM 6112 O O     . HOH F 3 .   ? 12.382 -13.321 -39.209 1.00 35.24 ? 176 HOH B O     1 
HETATM 6113 O O     . HOH F 3 .   ? 15.750 -20.022 -31.189 1.00 32.28 ? 177 HOH B O     1 
HETATM 6114 O O     . HOH F 3 .   ? -0.183 1.479   -33.666 1.00 43.17 ? 179 HOH B O     1 
HETATM 6115 O O     . HOH F 3 .   ? 33.877 -10.598 -25.546 1.00 38.71 ? 184 HOH B O     1 
HETATM 6116 O O     . HOH F 3 .   ? 25.417 -4.269  -30.406 1.00 37.11 ? 186 HOH B O     1 
HETATM 6117 O O     . HOH F 3 .   ? 9.051  -5.826  -44.118 1.00 50.62 ? 188 HOH B O     1 
HETATM 6118 O O     . HOH F 3 .   ? 40.786 -3.563  -35.980 1.00 48.26 ? 193 HOH B O     1 
HETATM 6119 O O     . HOH F 3 .   ? 19.141 0.870   -61.614 1.00 36.93 ? 198 HOH B O     1 
HETATM 6120 O O     . HOH F 3 .   ? 35.192 -14.369 -48.527 1.00 41.53 ? 201 HOH B O     1 
HETATM 6121 O O     . HOH F 3 .   ? 26.774 -13.452 -52.352 1.00 45.24 ? 203 HOH B O     1 
HETATM 6122 O O     . HOH F 3 .   ? 33.183 -22.521 -26.204 1.00 42.36 ? 205 HOH B O     1 
HETATM 6123 O O     . HOH F 3 .   ? 5.697  2.849   -22.426 1.00 55.84 ? 206 HOH B O     1 
HETATM 6124 O O     . HOH F 3 .   ? 31.092 8.710   -58.661 1.00 36.33 ? 207 HOH B O     1 
HETATM 6125 O O     . HOH F 3 .   ? 30.110 -3.253  -58.207 1.00 53.43 ? 208 HOH B O     1 
HETATM 6126 O O     . HOH F 3 .   ? 14.467 -13.450 -41.286 1.00 36.07 ? 210 HOH B O     1 
HETATM 6127 O O     . HOH F 3 .   ? 21.248 4.151   -63.862 1.00 48.79 ? 211 HOH B O     1 
HETATM 6128 O O     . HOH F 3 .   ? 12.019 -16.146 -35.673 1.00 36.45 ? 212 HOH B O     1 
HETATM 6129 O O     . HOH F 3 .   ? 10.677 -8.894  -48.834 1.00 42.11 ? 213 HOH B O     1 
HETATM 6130 O O     . HOH F 3 .   ? 12.076 -12.328 -44.391 1.00 46.88 ? 217 HOH B O     1 
HETATM 6131 O O     . HOH F 3 .   ? 39.911 -15.785 -24.161 1.00 52.94 ? 220 HOH B O     1 
HETATM 6132 O O     . HOH F 3 .   ? 18.187 -1.525  -60.883 1.00 33.88 ? 222 HOH B O     1 
HETATM 6133 O O     . HOH F 3 .   ? 10.274 5.365   -37.844 1.00 31.24 ? 223 HOH B O     1 
HETATM 6134 O O     . HOH F 3 .   ? 7.835  5.216   -41.372 1.00 43.39 ? 225 HOH B O     1 
HETATM 6135 O O     . HOH F 3 .   ? 40.947 -10.125 -47.729 1.00 57.74 ? 227 HOH B O     1 
HETATM 6136 O O     . HOH F 3 .   ? 18.163 11.610  -30.727 1.00 31.92 ? 229 HOH B O     1 
HETATM 6137 O O     . HOH F 3 .   ? 20.046 9.829   -23.035 1.00 40.03 ? 230 HOH B O     1 
HETATM 6138 O O     . HOH F 3 .   ? 30.251 15.434  -35.506 1.00 53.17 ? 233 HOH B O     1 
HETATM 6139 O O     . HOH F 3 .   ? 17.727 -21.635 -46.591 1.00 51.94 ? 235 HOH B O     1 
HETATM 6140 O O     . HOH F 3 .   ? 28.023 -18.058 -28.695 1.00 49.66 ? 237 HOH B O     1 
HETATM 6141 O O     . HOH F 3 .   ? 32.550 -2.711  -59.124 1.00 58.28 ? 240 HOH B O     1 
HETATM 6142 O O     . HOH F 3 .   ? 17.006 -16.226 -57.015 1.00 38.79 ? 242 HOH B O     1 
HETATM 6143 O O     . HOH F 3 .   ? 13.187 -17.638 -31.584 1.00 36.75 ? 243 HOH B O     1 
HETATM 6144 O O     . HOH F 3 .   ? 13.466 -15.382 -29.682 1.00 35.58 ? 246 HOH B O     1 
HETATM 6145 O O     . HOH F 3 .   ? 9.362  -9.447  -29.792 1.00 38.78 ? 249 HOH B O     1 
HETATM 6146 O O     . HOH F 3 .   ? 12.820 -1.018  -50.432 1.00 36.42 ? 251 HOH B O     1 
HETATM 6147 O O     . HOH F 3 .   ? 3.298  -0.092  -37.452 1.00 55.54 ? 252 HOH B O     1 
HETATM 6148 O O     . HOH F 3 .   ? 11.998 -25.635 -31.030 1.00 57.25 ? 253 HOH B O     1 
HETATM 6149 O O     . HOH F 3 .   ? 21.719 12.226  -30.616 1.00 53.27 ? 255 HOH B O     1 
HETATM 6150 O O     . HOH F 3 .   ? 34.231 -5.322  -30.265 1.00 41.85 ? 257 HOH B O     1 
HETATM 6151 O O     . HOH F 3 .   ? 15.496 -13.985 -44.691 1.00 39.74 ? 258 HOH B O     1 
HETATM 6152 O O     . HOH F 3 .   ? 64.740 -20.918 -40.941 1.00 59.87 ? 262 HOH B O     1 
HETATM 6153 O O     . HOH F 3 .   ? 26.959 15.236  -33.794 1.00 48.56 ? 264 HOH B O     1 
HETATM 6154 O O     . HOH F 3 .   ? 11.078 5.055   -47.740 1.00 42.09 ? 265 HOH B O     1 
HETATM 6155 O O     . HOH F 3 .   ? 34.925 -6.269  -54.132 1.00 35.26 ? 266 HOH B O     1 
HETATM 6156 O O     . HOH F 3 .   ? 29.265 11.917  -50.972 1.00 40.30 ? 267 HOH B O     1 
HETATM 6157 O O     . HOH F 3 .   ? 15.651 -16.576 -37.475 1.00 53.90 ? 269 HOH B O     1 
HETATM 6158 O O     . HOH F 3 .   ? 28.922 -25.620 -38.802 1.00 41.27 ? 272 HOH B O     1 
HETATM 6159 O O     . HOH F 3 .   ? 23.636 -22.667 -37.471 1.00 50.89 ? 273 HOH B O     1 
HETATM 6160 O O     . HOH F 3 .   ? 37.190 -4.491  -53.752 1.00 45.42 ? 276 HOH B O     1 
HETATM 6161 O O     . HOH F 3 .   ? 18.754 1.826   -58.988 1.00 36.65 ? 277 HOH B O     1 
HETATM 6162 O O     . HOH F 3 .   ? 40.522 -1.198  -35.454 1.00 57.92 ? 281 HOH B O     1 
HETATM 6163 O O     . HOH F 3 .   ? 19.979 9.872   -51.616 1.00 40.43 ? 283 HOH B O     1 
HETATM 6164 O O     . HOH F 3 .   ? 13.341 7.968   -50.977 1.00 47.95 ? 284 HOH B O     1 
HETATM 6165 O O     . HOH F 3 .   ? 37.871 4.390   -50.936 1.00 55.02 ? 286 HOH B O     1 
HETATM 6166 O O     . HOH F 3 .   ? 7.767  -9.529  -34.523 1.00 35.70 ? 287 HOH B O     1 
HETATM 6167 O O     . HOH F 3 .   ? 24.743 6.814   -15.286 1.00 44.32 ? 289 HOH B O     1 
HETATM 6168 O O     . HOH F 3 .   ? 29.768 -21.523 -27.608 1.00 43.30 ? 297 HOH B O     1 
HETATM 6169 O O     . HOH F 3 .   ? 29.674 -9.156  -26.262 1.00 40.25 ? 300 HOH B O     1 
HETATM 6170 O O     . HOH F 3 .   ? 27.408 11.342  -42.976 1.00 40.80 ? 303 HOH B O     1 
HETATM 6171 O O     . HOH F 3 .   ? 30.115 10.459  -39.823 1.00 38.19 ? 304 HOH B O     1 
HETATM 6172 O O     . HOH F 3 .   ? 17.810 5.945   -15.181 1.00 36.34 ? 306 HOH B O     1 
HETATM 6173 O O     . HOH F 3 .   ? 50.615 -27.849 -44.318 1.00 51.53 ? 308 HOH B O     1 
HETATM 6174 O O     . HOH F 3 .   ? 9.165  4.346   -15.231 1.00 48.35 ? 309 HOH B O     1 
HETATM 6175 O O     . HOH F 3 .   ? 39.116 -24.975 -21.363 1.00 45.37 ? 310 HOH B O     1 
HETATM 6176 O O     . HOH F 3 .   ? 10.491 -17.244 -29.110 1.00 44.23 ? 313 HOH B O     1 
HETATM 6177 O O     . HOH F 3 .   ? 5.934  -7.638  -34.790 1.00 46.26 ? 316 HOH B O     1 
HETATM 6178 O O     . HOH F 3 .   ? 51.854 -18.765 -45.934 1.00 54.35 ? 318 HOH B O     1 
HETATM 6179 O O     . HOH F 3 .   ? 11.124 -11.195 -42.298 1.00 58.08 ? 319 HOH B O     1 
HETATM 6180 O O     . HOH F 3 .   ? 19.190 -21.047 -51.660 1.00 42.34 ? 320 HOH B O     1 
HETATM 6181 O O     . HOH F 3 .   ? 43.948 -28.191 -33.297 1.00 43.50 ? 332 HOH B O     1 
HETATM 6182 O O     . HOH F 3 .   ? 36.505 -2.069  -32.165 1.00 43.52 ? 333 HOH B O     1 
HETATM 6183 O O     . HOH F 3 .   ? 30.678 4.480   -32.816 1.00 42.05 ? 334 HOH B O     1 
HETATM 6184 O O     . HOH F 3 .   ? 34.851 -25.906 -29.914 1.00 50.32 ? 335 HOH B O     1 
HETATM 6185 O O     . HOH F 3 .   ? 33.683 -7.477  -51.422 1.00 43.96 ? 336 HOH B O     1 
HETATM 6186 O O     . HOH F 3 .   ? 24.696 -17.160 -29.097 1.00 37.53 ? 337 HOH B O     1 
HETATM 6187 O O     . HOH F 3 .   ? 21.662 8.859   -19.831 1.00 47.42 ? 339 HOH B O     1 
HETATM 6188 O O     . HOH F 3 .   ? 35.039 -16.167 -20.402 1.00 53.14 ? 341 HOH B O     1 
HETATM 6189 O O     . HOH F 3 .   ? 27.337 -12.779 -26.495 1.00 42.98 ? 342 HOH B O     1 
HETATM 6190 O O     . HOH F 3 .   ? 20.827 0.186   -26.358 1.00 42.71 ? 345 HOH B O     1 
HETATM 6191 O O     . HOH F 3 .   ? 31.108 16.720  -43.136 1.00 53.39 ? 347 HOH B O     1 
HETATM 6192 O O     . HOH F 3 .   ? 12.045 -10.831 -39.092 1.00 44.90 ? 350 HOH B O     1 
HETATM 6193 O O     . HOH F 3 .   ? 13.907 -9.060  -40.606 1.00 40.51 ? 351 HOH B O     1 
HETATM 6194 O O     . HOH F 3 .   ? 3.909  -4.871  -39.395 1.00 48.48 ? 352 HOH B O     1 
HETATM 6195 O O     . HOH F 3 .   ? 40.382 6.607   -40.921 1.00 61.75 ? 354 HOH B O     1 
HETATM 6196 O O     . HOH F 3 .   ? 15.033 1.957   -55.725 1.00 43.13 ? 355 HOH B O     1 
HETATM 6197 O O     . HOH F 3 .   ? 34.801 -26.330 -42.107 1.00 69.53 ? 356 HOH B O     1 
HETATM 6198 O O     . HOH F 3 .   ? 28.983 6.764   -20.895 1.00 66.32 ? 361 HOH B O     1 
HETATM 6199 O O     . HOH F 3 .   ? 37.882 -10.888 -28.279 1.00 43.87 ? 363 HOH B O     1 
HETATM 6200 O O     . HOH F 3 .   ? 30.592 -0.022  -31.345 1.00 19.85 ? 366 HOH B O     1 
HETATM 6201 O O     . HOH F 3 .   ? 38.781 14.739  -42.833 1.00 50.94 ? 367 HOH B O     1 
HETATM 6202 O O     . HOH F 3 .   ? 15.249 -16.742 -46.531 1.00 44.37 ? 368 HOH B O     1 
HETATM 6203 O O     . HOH F 3 .   ? 17.366 17.350  -42.662 1.00 47.94 ? 369 HOH B O     1 
HETATM 6204 O O     . HOH F 3 .   ? 22.185 11.294  -51.670 1.00 41.62 ? 370 HOH B O     1 
HETATM 6205 O O     . HOH F 3 .   ? 12.831 0.434   -53.868 1.00 47.85 ? 371 HOH B O     1 
HETATM 6206 O O     . HOH F 3 .   ? 19.359 -22.056 -31.563 1.00 44.74 ? 376 HOH B O     1 
HETATM 6207 O O     . HOH F 3 .   ? 46.293 -19.772 -21.010 1.00 61.26 ? 379 HOH B O     1 
HETATM 6208 O O     . HOH F 3 .   ? 13.260 -22.652 -37.789 1.00 49.95 ? 380 HOH B O     1 
HETATM 6209 O O     . HOH F 3 .   ? 6.226  -10.512 -30.826 1.00 46.70 ? 381 HOH B O     1 
HETATM 6210 O O     . HOH F 3 .   ? 54.023 -23.966 -42.638 1.00 63.07 ? 393 HOH B O     1 
HETATM 6211 O O     . HOH F 3 .   ? 16.095 16.910  -45.525 1.00 57.20 ? 400 HOH B O     1 
HETATM 6212 O O     . HOH F 3 .   ? 16.076 -2.339  -62.385 1.00 43.30 ? 404 HOH B O     1 
HETATM 6213 O O     . HOH F 3 .   ? 40.479 7.204   -49.919 1.00 53.54 ? 413 HOH B O     1 
HETATM 6214 O O     . HOH F 3 .   ? 25.198 -10.153 -60.922 1.00 50.25 ? 414 HOH B O     1 
HETATM 6215 O O     . HOH F 3 .   ? 27.285 1.005   -26.835 1.00 48.18 ? 416 HOH B O     1 
HETATM 6216 O O     . HOH F 3 .   ? 26.211 13.162  -42.320 1.00 62.30 ? 417 HOH B O     1 
HETATM 6217 O O     . HOH F 3 .   ? 9.298  -16.254 -25.611 1.00 46.85 ? 418 HOH B O     1 
HETATM 6218 O O     . HOH F 3 .   ? 15.693 -13.548 -58.332 1.00 54.08 ? 419 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   ARG 4   4   ?   ?   ?   A . n 
A 1 5   PRO 5   5   ?   ?   ?   A . n 
A 1 6   ARG 6   6   ?   ?   ?   A . n 
A 1 7   THR 7   7   ?   ?   ?   A . n 
A 1 8   THR 8   8   ?   ?   ?   A . n 
A 1 9   SER 9   9   ?   ?   ?   A . n 
A 1 10  PHE 10  10  ?   ?   ?   A . n 
A 1 11  ALA 11  11  ?   ?   ?   A . n 
A 1 12  GLU 12  12  ?   ?   ?   A . n 
A 1 13  SER 13  13  ?   ?   ?   A . n 
A 1 14  CYS 14  14  ?   ?   ?   A . n 
A 1 15  LYS 15  15  ?   ?   ?   A . n 
A 1 16  PRO 16  16  ?   ?   ?   A . n 
A 1 17  VAL 17  17  ?   ?   ?   A . n 
A 1 18  GLN 18  18  ?   ?   ?   A . n 
A 1 19  GLN 19  19  ?   ?   ?   A . n 
A 1 20  PRO 20  20  ?   ?   ?   A . n 
A 1 21  SER 21  21  ?   ?   ?   A . n 
A 1 22  ALA 22  22  ?   ?   ?   A . n 
A 1 23  PHE 23  23  ?   ?   ?   A . n 
A 1 24  GLY 24  24  ?   ?   ?   A . n 
A 1 25  SER 25  25  ?   ?   ?   A . n 
A 1 26  MET 26  26  ?   ?   ?   A . n 
A 1 27  LYS 27  27  ?   ?   ?   A . n 
A 1 28  VAL 28  28  ?   ?   ?   A . n 
A 1 29  SER 29  29  ?   ?   ?   A . n 
A 1 30  ARG 30  30  ?   ?   ?   A . n 
A 1 31  ASP 31  31  ?   ?   ?   A . n 
A 1 32  LYS 32  32  ?   ?   ?   A . n 
A 1 33  ASP 33  33  ?   ?   ?   A . n 
A 1 34  GLY 34  34  ?   ?   ?   A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  VAL 37  37  37  VAL VAL A . n 
A 1 38  THR 38  38  38  THR THR A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  ALA 42  42  42  ALA ALA A . n 
A 1 43  THR 43  43  43  THR THR A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  GLN 46  46  46  GLN GLN A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  ARG 50  50  50  ARG ARG A . n 
A 1 51  PRO 51  51  51  PRO PRO A . n 
A 1 52  GLN 52  52  52  GLN GLN A . n 
A 1 53  GLU 53  53  53  GLU GLU A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  TYR 56  56  56  TYR TYR A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  ASP 58  58  58  ASP ASP A . n 
A 1 59  THR 59  59  59  THR THR A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  VAL 61  61  61  VAL VAL A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  VAL 70  70  70  VAL VAL A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  LYS 74  74  74  LYS LYS A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  CYS 76  76  76  CYS CYS A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  ILE 84  84  84  ILE ILE A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  ASP 90  90  90  ASP ASP A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  ASN 95  95  95  ASN ASN A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  GLU 97  97  97  GLU GLU A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 MET 101 101 101 MET MET A . n 
A 1 102 ARG 102 102 102 ARG ARG A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 HIS 106 106 106 HIS HIS A . n 
A 1 107 CYS 107 107 107 CYS CYS A . n 
A 1 108 ASN 108 108 108 ASN ASN A . n 
A 1 109 ILE 109 109 109 ILE ILE A . n 
A 1 110 VAL 110 110 110 VAL VAL A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 ARG 113 113 113 ARG ARG A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 PHE 115 115 115 PHE PHE A . n 
A 1 116 PHE 116 116 116 PHE PHE A . n 
A 1 117 TYR 117 117 117 TYR TYR A . n 
A 1 118 SER 118 118 118 SER SER A . n 
A 1 119 SER 119 119 119 SER SER A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 LYS 122 122 122 LYS LYS A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 ASP 124 124 124 ASP ASP A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 VAL 126 126 126 VAL VAL A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 LEU 130 130 130 LEU LEU A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 ASP 133 133 133 ASP ASP A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 PRO 136 136 136 PRO PRO A . n 
A 1 137 GLU 137 137 137 GLU GLU A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 TYR 140 140 140 TYR TYR A . n 
A 1 141 ARG 141 141 141 ARG ARG A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 HIS 145 145 145 HIS HIS A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 GLN 151 151 151 GLN GLN A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 PRO 154 154 154 PRO PRO A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 TYR 157 157 157 TYR TYR A . n 
A 1 158 VAL 158 158 158 VAL VAL A . n 
A 1 159 LYS 159 159 159 LYS LYS A . n 
A 1 160 LEU 160 160 160 LEU LEU A . n 
A 1 161 TYR 161 161 161 TYR TYR A . n 
A 1 162 MET 162 162 162 MET MET A . n 
A 1 163 TYR 163 163 163 TYR TYR A . n 
A 1 164 GLN 164 164 164 GLN GLN A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 PHE 166 166 166 PHE PHE A . n 
A 1 167 ARG 167 167 167 ARG ARG A . n 
A 1 168 SER 168 168 168 SER SER A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 ALA 170 170 170 ALA ALA A . n 
A 1 171 TYR 171 171 171 TYR TYR A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 HIS 173 173 173 HIS HIS A . n 
A 1 174 SER 174 174 174 SER SER A . n 
A 1 175 PHE 175 175 175 PHE PHE A . n 
A 1 176 GLY 176 176 176 GLY GLY A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 CYS 178 178 178 CYS CYS A . n 
A 1 179 HIS 179 179 179 HIS HIS A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 ILE 182 182 182 ILE ILE A . n 
A 1 183 LYS 183 183 183 LYS LYS A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 ASN 186 186 186 ASN ASN A . n 
A 1 187 LEU 187 187 187 LEU LEU A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 LEU 189 189 189 LEU LEU A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 ASP 192 192 192 ASP ASP A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 ALA 194 194 194 ALA ALA A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 LEU 196 196 196 LEU LEU A . n 
A 1 197 LYS 197 197 197 LYS LYS A . n 
A 1 198 LEU 198 198 198 LEU LEU A . n 
A 1 199 CYS 199 199 199 CYS CYS A . n 
A 1 200 ASP 200 200 200 ASP ASP A . n 
A 1 201 PHE 201 201 201 PHE PHE A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 SER 203 203 203 SER SER A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 LYS 205 205 205 LYS LYS A . n 
A 1 206 GLN 206 206 206 GLN GLN A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 VAL 208 208 208 VAL VAL A . n 
A 1 209 ARG 209 209 209 ARG ARG A . n 
A 1 210 GLY 210 210 210 GLY GLY A . n 
A 1 211 GLU 211 211 211 GLU GLU A . n 
A 1 212 PRO 212 212 212 PRO PRO A . n 
A 1 213 ASN 213 213 213 ASN ASN A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 TYR 216 216 216 TYR TYR A . n 
A 1 217 ILE 217 217 217 ILE ILE A . n 
A 1 218 CYS 218 218 218 CYS CYS A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 TYR 221 221 221 TYR TYR A . n 
A 1 222 TYR 222 222 222 TYR TYR A . n 
A 1 223 ARG 223 223 223 ARG ARG A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 PRO 225 225 225 PRO PRO A . n 
A 1 226 GLU 226 226 226 GLU GLU A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 ILE 228 228 228 ILE ILE A . n 
A 1 229 PHE 229 229 229 PHE PHE A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 THR 232 232 232 THR THR A . n 
A 1 233 ASP 233 233 233 ASP ASP A . n 
A 1 234 TYR 234 234 234 TYR TYR A . n 
A 1 235 THR 235 235 235 THR THR A . n 
A 1 236 SER 236 236 236 SER SER A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 ILE 238 238 238 ILE ILE A . n 
A 1 239 ASP 239 239 239 ASP ASP A . n 
A 1 240 VAL 240 240 240 VAL VAL A . n 
A 1 241 TRP 241 241 241 TRP TRP A . n 
A 1 242 SER 242 242 242 SER SER A . n 
A 1 243 ALA 243 243 243 ALA ALA A . n 
A 1 244 GLY 244 244 244 GLY GLY A . n 
A 1 245 CYS 245 245 245 CYS CYS A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 ALA 248 248 248 ALA ALA A . n 
A 1 249 GLU 249 249 249 GLU GLU A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 GLY 253 253 253 GLY GLY A . n 
A 1 254 GLN 254 254 254 GLN GLN A . n 
A 1 255 PRO 255 255 255 PRO PRO A . n 
A 1 256 ILE 256 256 256 ILE ILE A . n 
A 1 257 PHE 257 257 257 PHE PHE A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 GLY 259 259 259 GLY GLY A . n 
A 1 260 ASP 260 260 260 ASP ASP A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 GLY 262 262 262 GLY GLY A . n 
A 1 263 VAL 263 263 263 VAL VAL A . n 
A 1 264 ASP 264 264 264 ASP ASP A . n 
A 1 265 GLN 265 265 265 GLN GLN A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 VAL 267 267 267 VAL VAL A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 ILE 269 269 269 ILE ILE A . n 
A 1 270 ILE 270 270 270 ILE ILE A . n 
A 1 271 LYS 271 271 271 LYS LYS A . n 
A 1 272 VAL 272 272 272 VAL VAL A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 GLY 274 274 274 GLY GLY A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 PRO 276 276 276 PRO PRO A . n 
A 1 277 THR 277 277 277 THR THR A . n 
A 1 278 ARG 278 278 278 ARG ARG A . n 
A 1 279 GLU 279 279 279 GLU GLU A . n 
A 1 280 GLN 280 280 280 GLN GLN A . n 
A 1 281 ILE 281 281 281 ILE ILE A . n 
A 1 282 ARG 282 282 282 ARG ARG A . n 
A 1 283 GLU 283 283 283 GLU GLU A . n 
A 1 284 MET 284 284 284 MET MET A . n 
A 1 285 ASN 285 285 285 ASN ASN A . n 
A 1 286 PRO 286 286 286 PRO PRO A . n 
A 1 287 ASN 287 287 287 ASN ASN A . n 
A 1 288 TYR 288 288 288 TYR TYR A . n 
A 1 289 THR 289 289 289 THR THR A . n 
A 1 290 GLU 290 290 290 GLU GLU A . n 
A 1 291 PHE 291 291 291 PHE PHE A . n 
A 1 292 LYS 292 292 292 LYS LYS A . n 
A 1 293 PHE 293 293 293 PHE PHE A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 GLN 295 295 295 GLN GLN A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 LYS 297 297 297 LYS LYS A . n 
A 1 298 ALA 298 298 298 ALA ALA A . n 
A 1 299 HIS 299 299 299 HIS HIS A . n 
A 1 300 PRO 300 300 300 PRO PRO A . n 
A 1 301 TRP 301 301 301 TRP TRP A . n 
A 1 302 THR 302 302 302 THR THR A . n 
A 1 303 LYS 303 303 303 LYS LYS A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 PHE 305 305 305 PHE PHE A . n 
A 1 306 ARG 306 306 306 ARG ARG A . n 
A 1 307 PRO 307 307 307 PRO PRO A . n 
A 1 308 ARG 308 308 308 ARG ARG A . n 
A 1 309 THR 309 309 309 THR THR A . n 
A 1 310 PRO 310 310 310 PRO PRO A . n 
A 1 311 PRO 311 311 311 PRO PRO A . n 
A 1 312 GLU 312 312 312 GLU GLU A . n 
A 1 313 ALA 313 313 313 ALA ALA A . n 
A 1 314 ILE 314 314 314 ILE ILE A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 LEU 316 316 316 LEU LEU A . n 
A 1 317 CYS 317 317 317 CYS CYS A . n 
A 1 318 SER 318 318 318 SER SER A . n 
A 1 319 ARG 319 319 319 ARG ARG A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLU 322 322 322 GLU GLU A . n 
A 1 323 TYR 323 323 323 TYR TYR A . n 
A 1 324 THR 324 324 324 THR THR A . n 
A 1 325 PRO 325 325 325 PRO PRO A . n 
A 1 326 THR 326 326 326 THR THR A . n 
A 1 327 ALA 327 327 327 ALA ALA A . n 
A 1 328 ARG 328 328 328 ARG ARG A . n 
A 1 329 LEU 329 329 329 LEU LEU A . n 
A 1 330 THR 330 330 330 THR THR A . n 
A 1 331 PRO 331 331 331 PRO PRO A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 GLU 333 333 333 GLU GLU A . n 
A 1 334 ALA 334 334 334 ALA ALA A . n 
A 1 335 CYS 335 335 335 CYS CYS A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 HIS 337 337 337 HIS HIS A . n 
A 1 338 SER 338 338 338 SER SER A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 PHE 340 340 340 PHE PHE A . n 
A 1 341 ASP 341 341 341 ASP ASP A . n 
A 1 342 GLU 342 342 342 GLU GLU A . n 
A 1 343 LEU 343 343 343 LEU LEU A . n 
A 1 344 ARG 344 344 344 ARG ARG A . n 
A 1 345 ASP 345 345 345 ASP ASP A . n 
A 1 346 PRO 346 346 346 PRO PRO A . n 
A 1 347 ASN 347 347 347 ASN ASN A . n 
A 1 348 VAL 348 348 348 VAL VAL A . n 
A 1 349 LYS 349 349 349 LYS LYS A . n 
A 1 350 LEU 350 350 350 LEU LEU A . n 
A 1 351 PRO 351 351 351 PRO PRO A . n 
A 1 352 ASN 352 352 352 ASN ASN A . n 
A 1 353 GLY 353 353 353 GLY GLY A . n 
A 1 354 ARG 354 354 354 ARG ARG A . n 
A 1 355 ASP 355 355 355 ASP ASP A . n 
A 1 356 THR 356 356 356 THR THR A . n 
A 1 357 PRO 357 357 357 PRO PRO A . n 
A 1 358 ALA 358 358 358 ALA ALA A . n 
A 1 359 LEU 359 359 359 LEU LEU A . n 
A 1 360 PHE 360 360 360 PHE PHE A . n 
A 1 361 ASN 361 361 361 ASN ASN A . n 
A 1 362 PHE 362 362 362 PHE PHE A . n 
A 1 363 THR 363 363 363 THR THR A . n 
A 1 364 THR 364 364 364 THR THR A . n 
A 1 365 GLN 365 365 365 GLN GLN A . n 
A 1 366 GLU 366 366 366 GLU GLU A . n 
A 1 367 LEU 367 367 367 LEU LEU A . n 
A 1 368 SER 368 368 368 SER SER A . n 
A 1 369 SER 369 369 369 SER SER A . n 
A 1 370 ASN 370 370 370 ASN ASN A . n 
A 1 371 PRO 371 371 371 PRO PRO A . n 
A 1 372 PRO 372 372 372 PRO PRO A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 ALA 374 374 374 ALA ALA A . n 
A 1 375 THR 375 375 375 THR THR A . n 
A 1 376 ILE 376 376 376 ILE ILE A . n 
A 1 377 LEU 377 377 377 LEU LEU A . n 
A 1 378 ILE 378 378 378 ILE ILE A . n 
A 1 379 PRO 379 379 379 PRO PRO A . n 
A 1 380 PRO 380 380 380 PRO PRO A . n 
A 1 381 HIS 381 381 381 HIS HIS A . n 
A 1 382 ALA 382 382 382 ALA ALA A . n 
A 1 383 ARG 383 383 383 ARG ARG A . n 
A 1 384 ILE 384 384 384 ILE ILE A . n 
A 1 385 GLN 385 385 385 GLN GLN A . n 
A 1 386 ALA 386 386 386 ALA ALA A . n 
A 1 387 ALA 387 387 387 ALA ALA A . n 
A 1 388 ALA 388 388 388 ALA ALA A . n 
A 1 389 SER 389 389 ?   ?   ?   A . n 
A 1 390 THR 390 390 ?   ?   ?   A . n 
A 1 391 PRO 391 391 ?   ?   ?   A . n 
A 1 392 THR 392 392 ?   ?   ?   A . n 
A 1 393 ASN 393 393 ?   ?   ?   A . n 
A 1 394 ALA 394 394 ?   ?   ?   A . n 
A 1 395 THR 395 395 ?   ?   ?   A . n 
A 1 396 ALA 396 396 ?   ?   ?   A . n 
A 1 397 ALA 397 397 ?   ?   ?   A . n 
A 1 398 SER 398 398 ?   ?   ?   A . n 
A 1 399 ASP 399 399 ?   ?   ?   A . n 
A 1 400 ALA 400 400 ?   ?   ?   A . n 
A 1 401 ASN 401 401 ?   ?   ?   A . n 
A 1 402 THR 402 402 ?   ?   ?   A . n 
A 1 403 GLY 403 403 ?   ?   ?   A . n 
A 1 404 ASP 404 404 ?   ?   ?   A . n 
A 1 405 ARG 405 405 ?   ?   ?   A . n 
A 1 406 GLY 406 406 ?   ?   ?   A . n 
A 1 407 GLN 407 407 ?   ?   ?   A . n 
A 1 408 THR 408 408 ?   ?   ?   A . n 
A 1 409 ASN 409 409 ?   ?   ?   A . n 
A 1 410 ASN 410 410 ?   ?   ?   A . n 
A 1 411 ALA 411 411 ?   ?   ?   A . n 
A 1 412 ALA 412 412 ?   ?   ?   A . n 
A 1 413 SER 413 413 ?   ?   ?   A . n 
A 1 414 ALA 414 414 ?   ?   ?   A . n 
A 1 415 SER 415 415 ?   ?   ?   A . n 
A 1 416 ALA 416 416 ?   ?   ?   A . n 
A 1 417 SER 417 417 ?   ?   ?   A . n 
A 1 418 ASN 418 418 ?   ?   ?   A . n 
A 1 419 SER 419 419 ?   ?   ?   A . n 
A 1 420 THR 420 420 ?   ?   ?   A . n 
B 1 1   MET 1   501 ?   ?   ?   B . n 
B 1 2   SER 2   502 ?   ?   ?   B . n 
B 1 3   GLY 3   503 ?   ?   ?   B . n 
B 1 4   ARG 4   504 ?   ?   ?   B . n 
B 1 5   PRO 5   505 ?   ?   ?   B . n 
B 1 6   ARG 6   506 ?   ?   ?   B . n 
B 1 7   THR 7   507 ?   ?   ?   B . n 
B 1 8   THR 8   508 ?   ?   ?   B . n 
B 1 9   SER 9   509 ?   ?   ?   B . n 
B 1 10  PHE 10  510 ?   ?   ?   B . n 
B 1 11  ALA 11  511 ?   ?   ?   B . n 
B 1 12  GLU 12  512 ?   ?   ?   B . n 
B 1 13  SER 13  513 ?   ?   ?   B . n 
B 1 14  CYS 14  514 ?   ?   ?   B . n 
B 1 15  LYS 15  515 ?   ?   ?   B . n 
B 1 16  PRO 16  516 ?   ?   ?   B . n 
B 1 17  VAL 17  517 ?   ?   ?   B . n 
B 1 18  GLN 18  518 ?   ?   ?   B . n 
B 1 19  GLN 19  519 ?   ?   ?   B . n 
B 1 20  PRO 20  520 ?   ?   ?   B . n 
B 1 21  SER 21  521 ?   ?   ?   B . n 
B 1 22  ALA 22  522 ?   ?   ?   B . n 
B 1 23  PHE 23  523 523 PHE PHE B . n 
B 1 24  GLY 24  524 524 GLY GLY B . n 
B 1 25  SER 25  525 525 SER SER B . n 
B 1 26  MET 26  526 526 MET MET B . n 
B 1 27  LYS 27  527 527 LYS LYS B . n 
B 1 28  VAL 28  528 528 VAL VAL B . n 
B 1 29  SER 29  529 529 SER SER B . n 
B 1 30  ARG 30  530 530 ARG ARG B . n 
B 1 31  ASP 31  531 531 ASP ASP B . n 
B 1 32  LYS 32  532 532 LYS LYS B . n 
B 1 33  ASP 33  533 533 ASP ASP B . n 
B 1 34  GLY 34  534 534 GLY GLY B . n 
B 1 35  SER 35  535 535 SER SER B . n 
B 1 36  LYS 36  536 536 LYS LYS B . n 
B 1 37  VAL 37  537 537 VAL VAL B . n 
B 1 38  THR 38  538 538 THR THR B . n 
B 1 39  THR 39  539 539 THR THR B . n 
B 1 40  VAL 40  540 540 VAL VAL B . n 
B 1 41  VAL 41  541 541 VAL VAL B . n 
B 1 42  ALA 42  542 542 ALA ALA B . n 
B 1 43  THR 43  543 543 THR THR B . n 
B 1 44  PRO 44  544 544 PRO PRO B . n 
B 1 45  GLY 45  545 545 GLY GLY B . n 
B 1 46  GLN 46  546 546 GLN GLN B . n 
B 1 47  GLY 47  547 547 GLY GLY B . n 
B 1 48  PRO 48  548 548 PRO PRO B . n 
B 1 49  ASP 49  549 549 ASP ASP B . n 
B 1 50  ARG 50  550 550 ARG ARG B . n 
B 1 51  PRO 51  551 551 PRO PRO B . n 
B 1 52  GLN 52  552 552 GLN GLN B . n 
B 1 53  GLU 53  553 553 GLU GLU B . n 
B 1 54  VAL 54  554 554 VAL VAL B . n 
B 1 55  SER 55  555 555 SER SER B . n 
B 1 56  TYR 56  556 556 TYR TYR B . n 
B 1 57  THR 57  557 557 THR THR B . n 
B 1 58  ASP 58  558 558 ASP ASP B . n 
B 1 59  THR 59  559 559 THR THR B . n 
B 1 60  LYS 60  560 560 LYS LYS B . n 
B 1 61  VAL 61  561 561 VAL VAL B . n 
B 1 62  ILE 62  562 562 ILE ILE B . n 
B 1 63  GLY 63  563 563 GLY GLY B . n 
B 1 64  ASN 64  564 564 ASN ASN B . n 
B 1 65  GLY 65  565 565 GLY GLY B . n 
B 1 66  SER 66  566 566 SER SER B . n 
B 1 67  PHE 67  567 567 PHE PHE B . n 
B 1 68  GLY 68  568 568 GLY GLY B . n 
B 1 69  VAL 69  569 569 VAL VAL B . n 
B 1 70  VAL 70  570 570 VAL VAL B . n 
B 1 71  TYR 71  571 571 TYR TYR B . n 
B 1 72  GLN 72  572 572 GLN GLN B . n 
B 1 73  ALA 73  573 573 ALA ALA B . n 
B 1 74  LYS 74  574 574 LYS LYS B . n 
B 1 75  LEU 75  575 575 LEU LEU B . n 
B 1 76  CYS 76  576 576 CYS CYS B . n 
B 1 77  ASP 77  577 577 ASP ASP B . n 
B 1 78  SER 78  578 578 SER SER B . n 
B 1 79  GLY 79  579 579 GLY GLY B . n 
B 1 80  GLU 80  580 580 GLU GLU B . n 
B 1 81  LEU 81  581 581 LEU LEU B . n 
B 1 82  VAL 82  582 582 VAL VAL B . n 
B 1 83  ALA 83  583 583 ALA ALA B . n 
B 1 84  ILE 84  584 584 ILE ILE B . n 
B 1 85  LYS 85  585 585 LYS LYS B . n 
B 1 86  LYS 86  586 586 LYS LYS B . n 
B 1 87  VAL 87  587 587 VAL VAL B . n 
B 1 88  LEU 88  588 588 LEU LEU B . n 
B 1 89  GLN 89  589 589 GLN GLN B . n 
B 1 90  ASP 90  590 590 ASP ASP B . n 
B 1 91  LYS 91  591 591 LYS LYS B . n 
B 1 92  ARG 92  592 592 ARG ARG B . n 
B 1 93  PHE 93  593 593 PHE PHE B . n 
B 1 94  LYS 94  594 594 LYS LYS B . n 
B 1 95  ASN 95  595 595 ASN ASN B . n 
B 1 96  ARG 96  596 596 ARG ARG B . n 
B 1 97  GLU 97  597 597 GLU GLU B . n 
B 1 98  LEU 98  598 598 LEU LEU B . n 
B 1 99  GLN 99  599 599 GLN GLN B . n 
B 1 100 ILE 100 600 600 ILE ILE B . n 
B 1 101 MET 101 601 601 MET MET B . n 
B 1 102 ARG 102 602 602 ARG ARG B . n 
B 1 103 LYS 103 603 603 LYS LYS B . n 
B 1 104 LEU 104 604 604 LEU LEU B . n 
B 1 105 ASP 105 605 605 ASP ASP B . n 
B 1 106 HIS 106 606 606 HIS HIS B . n 
B 1 107 CYS 107 607 607 CYS CYS B . n 
B 1 108 ASN 108 608 608 ASN ASN B . n 
B 1 109 ILE 109 609 609 ILE ILE B . n 
B 1 110 VAL 110 610 610 VAL VAL B . n 
B 1 111 ARG 111 611 611 ARG ARG B . n 
B 1 112 LEU 112 612 612 LEU LEU B . n 
B 1 113 ARG 113 613 613 ARG ARG B . n 
B 1 114 TYR 114 614 614 TYR TYR B . n 
B 1 115 PHE 115 615 615 PHE PHE B . n 
B 1 116 PHE 116 616 616 PHE PHE B . n 
B 1 117 TYR 117 617 617 TYR TYR B . n 
B 1 118 SER 118 618 618 SER SER B . n 
B 1 119 SER 119 619 619 SER SER B . n 
B 1 120 GLY 120 620 620 GLY GLY B . n 
B 1 121 GLU 121 621 621 GLU GLU B . n 
B 1 122 LYS 122 622 622 LYS LYS B . n 
B 1 123 LYS 123 623 623 LYS LYS B . n 
B 1 124 ASP 124 624 624 ASP ASP B . n 
B 1 125 GLU 125 625 625 GLU GLU B . n 
B 1 126 VAL 126 626 626 VAL VAL B . n 
B 1 127 TYR 127 627 627 TYR TYR B . n 
B 1 128 LEU 128 628 628 LEU LEU B . n 
B 1 129 ASN 129 629 629 ASN ASN B . n 
B 1 130 LEU 130 630 630 LEU LEU B . n 
B 1 131 VAL 131 631 631 VAL VAL B . n 
B 1 132 LEU 132 632 632 LEU LEU B . n 
B 1 133 ASP 133 633 633 ASP ASP B . n 
B 1 134 TYR 134 634 634 TYR TYR B . n 
B 1 135 VAL 135 635 635 VAL VAL B . n 
B 1 136 PRO 136 636 636 PRO PRO B . n 
B 1 137 GLU 137 637 637 GLU GLU B . n 
B 1 138 THR 138 638 638 THR THR B . n 
B 1 139 VAL 139 639 639 VAL VAL B . n 
B 1 140 TYR 140 640 640 TYR TYR B . n 
B 1 141 ARG 141 641 641 ARG ARG B . n 
B 1 142 VAL 142 642 642 VAL VAL B . n 
B 1 143 ALA 143 643 643 ALA ALA B . n 
B 1 144 ARG 144 644 644 ARG ARG B . n 
B 1 145 HIS 145 645 645 HIS HIS B . n 
B 1 146 TYR 146 646 646 TYR TYR B . n 
B 1 147 SER 147 647 647 SER SER B . n 
B 1 148 ARG 148 648 648 ARG ARG B . n 
B 1 149 ALA 149 649 649 ALA ALA B . n 
B 1 150 LYS 150 650 650 LYS LYS B . n 
B 1 151 GLN 151 651 651 GLN GLN B . n 
B 1 152 THR 152 652 652 THR THR B . n 
B 1 153 LEU 153 653 653 LEU LEU B . n 
B 1 154 PRO 154 654 654 PRO PRO B . n 
B 1 155 VAL 155 655 655 VAL VAL B . n 
B 1 156 ILE 156 656 656 ILE ILE B . n 
B 1 157 TYR 157 657 657 TYR TYR B . n 
B 1 158 VAL 158 658 658 VAL VAL B . n 
B 1 159 LYS 159 659 659 LYS LYS B . n 
B 1 160 LEU 160 660 660 LEU LEU B . n 
B 1 161 TYR 161 661 661 TYR TYR B . n 
B 1 162 MET 162 662 662 MET MET B . n 
B 1 163 TYR 163 663 663 TYR TYR B . n 
B 1 164 GLN 164 664 664 GLN GLN B . n 
B 1 165 LEU 165 665 665 LEU LEU B . n 
B 1 166 PHE 166 666 666 PHE PHE B . n 
B 1 167 ARG 167 667 667 ARG ARG B . n 
B 1 168 SER 168 668 668 SER SER B . n 
B 1 169 LEU 169 669 669 LEU LEU B . n 
B 1 170 ALA 170 670 670 ALA ALA B . n 
B 1 171 TYR 171 671 671 TYR TYR B . n 
B 1 172 ILE 172 672 672 ILE ILE B . n 
B 1 173 HIS 173 673 673 HIS HIS B . n 
B 1 174 SER 174 674 674 SER SER B . n 
B 1 175 PHE 175 675 675 PHE PHE B . n 
B 1 176 GLY 176 676 676 GLY GLY B . n 
B 1 177 ILE 177 677 677 ILE ILE B . n 
B 1 178 CYS 178 678 678 CYS CYS B . n 
B 1 179 HIS 179 679 679 HIS HIS B . n 
B 1 180 ARG 180 680 680 ARG ARG B . n 
B 1 181 ASP 181 681 681 ASP ASP B . n 
B 1 182 ILE 182 682 682 ILE ILE B . n 
B 1 183 LYS 183 683 683 LYS LYS B . n 
B 1 184 PRO 184 684 684 PRO PRO B . n 
B 1 185 GLN 185 685 685 GLN GLN B . n 
B 1 186 ASN 186 686 686 ASN ASN B . n 
B 1 187 LEU 187 687 687 LEU LEU B . n 
B 1 188 LEU 188 688 688 LEU LEU B . n 
B 1 189 LEU 189 689 689 LEU LEU B . n 
B 1 190 ASP 190 690 690 ASP ASP B . n 
B 1 191 PRO 191 691 691 PRO PRO B . n 
B 1 192 ASP 192 692 692 ASP ASP B . n 
B 1 193 THR 193 693 693 THR THR B . n 
B 1 194 ALA 194 694 694 ALA ALA B . n 
B 1 195 VAL 195 695 695 VAL VAL B . n 
B 1 196 LEU 196 696 696 LEU LEU B . n 
B 1 197 LYS 197 697 697 LYS LYS B . n 
B 1 198 LEU 198 698 698 LEU LEU B . n 
B 1 199 CYS 199 699 699 CYS CYS B . n 
B 1 200 ASP 200 700 700 ASP ASP B . n 
B 1 201 PHE 201 701 701 PHE PHE B . n 
B 1 202 GLY 202 702 702 GLY GLY B . n 
B 1 203 SER 203 703 703 SER SER B . n 
B 1 204 ALA 204 704 704 ALA ALA B . n 
B 1 205 LYS 205 705 705 LYS LYS B . n 
B 1 206 GLN 206 706 706 GLN GLN B . n 
B 1 207 LEU 207 707 707 LEU LEU B . n 
B 1 208 VAL 208 708 708 VAL VAL B . n 
B 1 209 ARG 209 709 709 ARG ARG B . n 
B 1 210 GLY 210 710 710 GLY GLY B . n 
B 1 211 GLU 211 711 711 GLU GLU B . n 
B 1 212 PRO 212 712 712 PRO PRO B . n 
B 1 213 ASN 213 713 713 ASN ASN B . n 
B 1 214 VAL 214 714 714 VAL VAL B . n 
B 1 215 SER 215 715 715 SER SER B . n 
B 1 216 TYR 216 716 716 TYR TYR B . n 
B 1 217 ILE 217 717 717 ILE ILE B . n 
B 1 218 CYS 218 718 718 CYS CYS B . n 
B 1 219 SER 219 719 719 SER SER B . n 
B 1 220 ARG 220 720 720 ARG ARG B . n 
B 1 221 TYR 221 721 721 TYR TYR B . n 
B 1 222 TYR 222 722 722 TYR TYR B . n 
B 1 223 ARG 223 723 723 ARG ARG B . n 
B 1 224 ALA 224 724 724 ALA ALA B . n 
B 1 225 PRO 225 725 725 PRO PRO B . n 
B 1 226 GLU 226 726 726 GLU GLU B . n 
B 1 227 LEU 227 727 727 LEU LEU B . n 
B 1 228 ILE 228 728 728 ILE ILE B . n 
B 1 229 PHE 229 729 729 PHE PHE B . n 
B 1 230 GLY 230 730 730 GLY GLY B . n 
B 1 231 ALA 231 731 731 ALA ALA B . n 
B 1 232 THR 232 732 732 THR THR B . n 
B 1 233 ASP 233 733 733 ASP ASP B . n 
B 1 234 TYR 234 734 734 TYR TYR B . n 
B 1 235 THR 235 735 735 THR THR B . n 
B 1 236 SER 236 736 736 SER SER B . n 
B 1 237 SER 237 737 737 SER SER B . n 
B 1 238 ILE 238 738 738 ILE ILE B . n 
B 1 239 ASP 239 739 739 ASP ASP B . n 
B 1 240 VAL 240 740 740 VAL VAL B . n 
B 1 241 TRP 241 741 741 TRP TRP B . n 
B 1 242 SER 242 742 742 SER SER B . n 
B 1 243 ALA 243 743 743 ALA ALA B . n 
B 1 244 GLY 244 744 744 GLY GLY B . n 
B 1 245 CYS 245 745 745 CYS CYS B . n 
B 1 246 VAL 246 746 746 VAL VAL B . n 
B 1 247 LEU 247 747 747 LEU LEU B . n 
B 1 248 ALA 248 748 748 ALA ALA B . n 
B 1 249 GLU 249 749 749 GLU GLU B . n 
B 1 250 LEU 250 750 750 LEU LEU B . n 
B 1 251 LEU 251 751 751 LEU LEU B . n 
B 1 252 LEU 252 752 752 LEU LEU B . n 
B 1 253 GLY 253 753 753 GLY GLY B . n 
B 1 254 GLN 254 754 754 GLN GLN B . n 
B 1 255 PRO 255 755 755 PRO PRO B . n 
B 1 256 ILE 256 756 756 ILE ILE B . n 
B 1 257 PHE 257 757 757 PHE PHE B . n 
B 1 258 PRO 258 758 758 PRO PRO B . n 
B 1 259 GLY 259 759 759 GLY GLY B . n 
B 1 260 ASP 260 760 760 ASP ASP B . n 
B 1 261 SER 261 761 761 SER SER B . n 
B 1 262 GLY 262 762 762 GLY GLY B . n 
B 1 263 VAL 263 763 763 VAL VAL B . n 
B 1 264 ASP 264 764 764 ASP ASP B . n 
B 1 265 GLN 265 765 765 GLN GLN B . n 
B 1 266 LEU 266 766 766 LEU LEU B . n 
B 1 267 VAL 267 767 767 VAL VAL B . n 
B 1 268 GLU 268 768 768 GLU GLU B . n 
B 1 269 ILE 269 769 769 ILE ILE B . n 
B 1 270 ILE 270 770 770 ILE ILE B . n 
B 1 271 LYS 271 771 771 LYS LYS B . n 
B 1 272 VAL 272 772 772 VAL VAL B . n 
B 1 273 LEU 273 773 773 LEU LEU B . n 
B 1 274 GLY 274 774 774 GLY GLY B . n 
B 1 275 THR 275 775 775 THR THR B . n 
B 1 276 PRO 276 776 776 PRO PRO B . n 
B 1 277 THR 277 777 777 THR THR B . n 
B 1 278 ARG 278 778 778 ARG ARG B . n 
B 1 279 GLU 279 779 779 GLU GLU B . n 
B 1 280 GLN 280 780 780 GLN GLN B . n 
B 1 281 ILE 281 781 781 ILE ILE B . n 
B 1 282 ARG 282 782 782 ARG ARG B . n 
B 1 283 GLU 283 783 783 GLU GLU B . n 
B 1 284 MET 284 784 784 MET MET B . n 
B 1 285 ASN 285 785 785 ASN ASN B . n 
B 1 286 PRO 286 786 786 PRO PRO B . n 
B 1 287 ASN 287 787 787 ASN ASN B . n 
B 1 288 TYR 288 788 788 TYR TYR B . n 
B 1 289 THR 289 789 789 THR THR B . n 
B 1 290 GLU 290 790 790 GLU GLU B . n 
B 1 291 PHE 291 791 791 PHE PHE B . n 
B 1 292 LYS 292 792 792 LYS LYS B . n 
B 1 293 PHE 293 793 793 PHE PHE B . n 
B 1 294 PRO 294 794 794 PRO PRO B . n 
B 1 295 GLN 295 795 795 GLN GLN B . n 
B 1 296 ILE 296 796 796 ILE ILE B . n 
B 1 297 LYS 297 797 797 LYS LYS B . n 
B 1 298 ALA 298 798 798 ALA ALA B . n 
B 1 299 HIS 299 799 799 HIS HIS B . n 
B 1 300 PRO 300 800 800 PRO PRO B . n 
B 1 301 TRP 301 801 801 TRP TRP B . n 
B 1 302 THR 302 802 802 THR THR B . n 
B 1 303 LYS 303 803 803 LYS LYS B . n 
B 1 304 VAL 304 804 804 VAL VAL B . n 
B 1 305 PHE 305 805 805 PHE PHE B . n 
B 1 306 ARG 306 806 806 ARG ARG B . n 
B 1 307 PRO 307 807 807 PRO PRO B . n 
B 1 308 ARG 308 808 808 ARG ARG B . n 
B 1 309 THR 309 809 809 THR THR B . n 
B 1 310 PRO 310 810 810 PRO PRO B . n 
B 1 311 PRO 311 811 811 PRO PRO B . n 
B 1 312 GLU 312 812 812 GLU GLU B . n 
B 1 313 ALA 313 813 813 ALA ALA B . n 
B 1 314 ILE 314 814 814 ILE ILE B . n 
B 1 315 ALA 315 815 815 ALA ALA B . n 
B 1 316 LEU 316 816 816 LEU LEU B . n 
B 1 317 CYS 317 817 817 CYS CYS B . n 
B 1 318 SER 318 818 818 SER SER B . n 
B 1 319 ARG 319 819 819 ARG ARG B . n 
B 1 320 LEU 320 820 820 LEU LEU B . n 
B 1 321 LEU 321 821 821 LEU LEU B . n 
B 1 322 GLU 322 822 822 GLU GLU B . n 
B 1 323 TYR 323 823 823 TYR TYR B . n 
B 1 324 THR 324 824 824 THR THR B . n 
B 1 325 PRO 325 825 825 PRO PRO B . n 
B 1 326 THR 326 826 826 THR THR B . n 
B 1 327 ALA 327 827 827 ALA ALA B . n 
B 1 328 ARG 328 828 828 ARG ARG B . n 
B 1 329 LEU 329 829 829 LEU LEU B . n 
B 1 330 THR 330 830 830 THR THR B . n 
B 1 331 PRO 331 831 831 PRO PRO B . n 
B 1 332 LEU 332 832 832 LEU LEU B . n 
B 1 333 GLU 333 833 833 GLU GLU B . n 
B 1 334 ALA 334 834 834 ALA ALA B . n 
B 1 335 CYS 335 835 835 CYS CYS B . n 
B 1 336 ALA 336 836 836 ALA ALA B . n 
B 1 337 HIS 337 837 837 HIS HIS B . n 
B 1 338 SER 338 838 838 SER SER B . n 
B 1 339 PHE 339 839 839 PHE PHE B . n 
B 1 340 PHE 340 840 840 PHE PHE B . n 
B 1 341 ASP 341 841 841 ASP ASP B . n 
B 1 342 GLU 342 842 842 GLU GLU B . n 
B 1 343 LEU 343 843 843 LEU LEU B . n 
B 1 344 ARG 344 844 844 ARG ARG B . n 
B 1 345 ASP 345 845 845 ASP ASP B . n 
B 1 346 PRO 346 846 846 PRO PRO B . n 
B 1 347 ASN 347 847 847 ASN ASN B . n 
B 1 348 VAL 348 848 848 VAL VAL B . n 
B 1 349 LYS 349 849 849 LYS LYS B . n 
B 1 350 LEU 350 850 850 LEU LEU B . n 
B 1 351 PRO 351 851 851 PRO PRO B . n 
B 1 352 ASN 352 852 852 ASN ASN B . n 
B 1 353 GLY 353 853 853 GLY GLY B . n 
B 1 354 ARG 354 854 854 ARG ARG B . n 
B 1 355 ASP 355 855 855 ASP ASP B . n 
B 1 356 THR 356 856 856 THR THR B . n 
B 1 357 PRO 357 857 857 PRO PRO B . n 
B 1 358 ALA 358 858 858 ALA ALA B . n 
B 1 359 LEU 359 859 859 LEU LEU B . n 
B 1 360 PHE 360 860 860 PHE PHE B . n 
B 1 361 ASN 361 861 861 ASN ASN B . n 
B 1 362 PHE 362 862 862 PHE PHE B . n 
B 1 363 THR 363 863 863 THR THR B . n 
B 1 364 THR 364 864 864 THR THR B . n 
B 1 365 GLN 365 865 865 GLN GLN B . n 
B 1 366 GLU 366 866 866 GLU GLU B . n 
B 1 367 LEU 367 867 867 LEU LEU B . n 
B 1 368 SER 368 868 868 SER SER B . n 
B 1 369 SER 369 869 869 SER SER B . n 
B 1 370 ASN 370 870 870 ASN ASN B . n 
B 1 371 PRO 371 871 871 PRO PRO B . n 
B 1 372 PRO 372 872 872 PRO PRO B . n 
B 1 373 LEU 373 873 873 LEU LEU B . n 
B 1 374 ALA 374 874 874 ALA ALA B . n 
B 1 375 THR 375 875 875 THR THR B . n 
B 1 376 ILE 376 876 876 ILE ILE B . n 
B 1 377 LEU 377 877 877 LEU LEU B . n 
B 1 378 ILE 378 878 878 ILE ILE B . n 
B 1 379 PRO 379 879 879 PRO PRO B . n 
B 1 380 PRO 380 880 880 PRO PRO B . n 
B 1 381 HIS 381 881 881 HIS HIS B . n 
B 1 382 ALA 382 882 882 ALA ALA B . n 
B 1 383 ARG 383 883 883 ARG ARG B . n 
B 1 384 ILE 384 884 884 ILE ILE B . n 
B 1 385 GLN 385 885 885 GLN GLN B . n 
B 1 386 ALA 386 886 886 ALA ALA B . n 
B 1 387 ALA 387 887 ?   ?   ?   B . n 
B 1 388 ALA 388 888 ?   ?   ?   B . n 
B 1 389 SER 389 889 ?   ?   ?   B . n 
B 1 390 THR 390 890 ?   ?   ?   B . n 
B 1 391 PRO 391 891 ?   ?   ?   B . n 
B 1 392 THR 392 892 ?   ?   ?   B . n 
B 1 393 ASN 393 893 ?   ?   ?   B . n 
B 1 394 ALA 394 894 ?   ?   ?   B . n 
B 1 395 THR 395 895 ?   ?   ?   B . n 
B 1 396 ALA 396 896 ?   ?   ?   B . n 
B 1 397 ALA 397 897 ?   ?   ?   B . n 
B 1 398 SER 398 898 ?   ?   ?   B . n 
B 1 399 ASP 399 899 ?   ?   ?   B . n 
B 1 400 ALA 400 900 ?   ?   ?   B . n 
B 1 401 ASN 401 901 ?   ?   ?   B . n 
B 1 402 THR 402 902 ?   ?   ?   B . n 
B 1 403 GLY 403 903 ?   ?   ?   B . n 
B 1 404 ASP 404 904 ?   ?   ?   B . n 
B 1 405 ARG 405 905 ?   ?   ?   B . n 
B 1 406 GLY 406 906 ?   ?   ?   B . n 
B 1 407 GLN 407 907 ?   ?   ?   B . n 
B 1 408 THR 408 908 ?   ?   ?   B . n 
B 1 409 ASN 409 909 ?   ?   ?   B . n 
B 1 410 ASN 410 910 ?   ?   ?   B . n 
B 1 411 ALA 411 911 ?   ?   ?   B . n 
B 1 412 ALA 412 912 ?   ?   ?   B . n 
B 1 413 SER 413 913 ?   ?   ?   B . n 
B 1 414 ALA 414 914 ?   ?   ?   B . n 
B 1 415 SER 415 915 ?   ?   ?   B . n 
B 1 416 ALA 416 916 ?   ?   ?   B . n 
B 1 417 SER 417 917 ?   ?   ?   B . n 
B 1 418 ASN 418 918 ?   ?   ?   B . n 
B 1 419 SER 419 919 ?   ?   ?   B . n 
B 1 420 THR 420 920 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4820  ? 
1 MORE         -18   ? 
1 'SSA (A^2)'  32970 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-12-03 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM    'data reduction' .    ? 1 
SCALEPACK 'data scaling'   .    ? 2 
X-PLOR    'model building' .    ? 3 
X-PLOR    refinement       98.1 ? 4 
X-PLOR    phasing          .    ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 123 ? ? -177.83 -153.51 
2  1 ASP A 124 ? ? -95.03  31.66   
3  1 ASP A 181 ? ? -147.11 47.57   
4  1 ASP A 200 ? ? 61.60   83.12   
5  1 CYS A 218 ? ? 75.44   133.64  
6  1 TYR A 221 ? ? 98.15   -33.72  
7  1 ASN A 285 ? ? -164.22 101.95  
8  1 ASN A 287 ? ? -147.74 -63.77  
9  1 TYR A 288 ? ? -36.66  123.37  
10 1 PRO A 294 ? ? -35.05  120.95  
11 1 ASN A 370 ? ? -176.26 71.69   
12 1 ASP B 549 ? ? -64.46  80.62   
13 1 GLU B 621 ? ? -55.59  10.75   
14 1 LYS B 623 ? ? 179.99  -152.92 
15 1 ALA B 649 ? ? -68.96  8.86    
16 1 ASP B 681 ? ? -149.83 43.82   
17 1 ASP B 700 ? ? 61.49   81.88   
18 1 CYS B 718 ? ? 76.18   138.08  
19 1 TYR B 721 ? ? 98.00   -37.59  
20 1 ASN B 787 ? ? -156.03 -35.22  
21 1 GLU B 790 ? ? -39.17  116.39  
22 1 PRO B 794 ? ? -33.26  131.43  
23 1 PRO B 800 ? ? -49.92  109.39  
24 1 ARG B 808 ? ? 84.42   6.17    
25 1 ASN B 852 ? ? -76.00  21.50   
26 1 ASN B 870 ? ? -171.37 73.32   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A SER 2   ? A SER 2   
3   1 Y 1 A GLY 3   ? A GLY 3   
4   1 Y 1 A ARG 4   ? A ARG 4   
5   1 Y 1 A PRO 5   ? A PRO 5   
6   1 Y 1 A ARG 6   ? A ARG 6   
7   1 Y 1 A THR 7   ? A THR 7   
8   1 Y 1 A THR 8   ? A THR 8   
9   1 Y 1 A SER 9   ? A SER 9   
10  1 Y 1 A PHE 10  ? A PHE 10  
11  1 Y 1 A ALA 11  ? A ALA 11  
12  1 Y 1 A GLU 12  ? A GLU 12  
13  1 Y 1 A SER 13  ? A SER 13  
14  1 Y 1 A CYS 14  ? A CYS 14  
15  1 Y 1 A LYS 15  ? A LYS 15  
16  1 Y 1 A PRO 16  ? A PRO 16  
17  1 Y 1 A VAL 17  ? A VAL 17  
18  1 Y 1 A GLN 18  ? A GLN 18  
19  1 Y 1 A GLN 19  ? A GLN 19  
20  1 Y 1 A PRO 20  ? A PRO 20  
21  1 Y 1 A SER 21  ? A SER 21  
22  1 Y 1 A ALA 22  ? A ALA 22  
23  1 Y 1 A PHE 23  ? A PHE 23  
24  1 Y 1 A GLY 24  ? A GLY 24  
25  1 Y 1 A SER 25  ? A SER 25  
26  1 Y 1 A MET 26  ? A MET 26  
27  1 Y 1 A LYS 27  ? A LYS 27  
28  1 Y 1 A VAL 28  ? A VAL 28  
29  1 Y 1 A SER 29  ? A SER 29  
30  1 Y 1 A ARG 30  ? A ARG 30  
31  1 Y 1 A ASP 31  ? A ASP 31  
32  1 Y 1 A LYS 32  ? A LYS 32  
33  1 Y 1 A ASP 33  ? A ASP 33  
34  1 Y 1 A GLY 34  ? A GLY 34  
35  1 Y 1 A SER 389 ? A SER 389 
36  1 Y 1 A THR 390 ? A THR 390 
37  1 Y 1 A PRO 391 ? A PRO 391 
38  1 Y 1 A THR 392 ? A THR 392 
39  1 Y 1 A ASN 393 ? A ASN 393 
40  1 Y 1 A ALA 394 ? A ALA 394 
41  1 Y 1 A THR 395 ? A THR 395 
42  1 Y 1 A ALA 396 ? A ALA 396 
43  1 Y 1 A ALA 397 ? A ALA 397 
44  1 Y 1 A SER 398 ? A SER 398 
45  1 Y 1 A ASP 399 ? A ASP 399 
46  1 Y 1 A ALA 400 ? A ALA 400 
47  1 Y 1 A ASN 401 ? A ASN 401 
48  1 Y 1 A THR 402 ? A THR 402 
49  1 Y 1 A GLY 403 ? A GLY 403 
50  1 Y 1 A ASP 404 ? A ASP 404 
51  1 Y 1 A ARG 405 ? A ARG 405 
52  1 Y 1 A GLY 406 ? A GLY 406 
53  1 Y 1 A GLN 407 ? A GLN 407 
54  1 Y 1 A THR 408 ? A THR 408 
55  1 Y 1 A ASN 409 ? A ASN 409 
56  1 Y 1 A ASN 410 ? A ASN 410 
57  1 Y 1 A ALA 411 ? A ALA 411 
58  1 Y 1 A ALA 412 ? A ALA 412 
59  1 Y 1 A SER 413 ? A SER 413 
60  1 Y 1 A ALA 414 ? A ALA 414 
61  1 Y 1 A SER 415 ? A SER 415 
62  1 Y 1 A ALA 416 ? A ALA 416 
63  1 Y 1 A SER 417 ? A SER 417 
64  1 Y 1 A ASN 418 ? A ASN 418 
65  1 Y 1 A SER 419 ? A SER 419 
66  1 Y 1 A THR 420 ? A THR 420 
67  1 Y 1 B MET 501 ? B MET 1   
68  1 Y 1 B SER 502 ? B SER 2   
69  1 Y 1 B GLY 503 ? B GLY 3   
70  1 Y 1 B ARG 504 ? B ARG 4   
71  1 Y 1 B PRO 505 ? B PRO 5   
72  1 Y 1 B ARG 506 ? B ARG 6   
73  1 Y 1 B THR 507 ? B THR 7   
74  1 Y 1 B THR 508 ? B THR 8   
75  1 Y 1 B SER 509 ? B SER 9   
76  1 Y 1 B PHE 510 ? B PHE 10  
77  1 Y 1 B ALA 511 ? B ALA 11  
78  1 Y 1 B GLU 512 ? B GLU 12  
79  1 Y 1 B SER 513 ? B SER 13  
80  1 Y 1 B CYS 514 ? B CYS 14  
81  1 Y 1 B LYS 515 ? B LYS 15  
82  1 Y 1 B PRO 516 ? B PRO 16  
83  1 Y 1 B VAL 517 ? B VAL 17  
84  1 Y 1 B GLN 518 ? B GLN 18  
85  1 Y 1 B GLN 519 ? B GLN 19  
86  1 Y 1 B PRO 520 ? B PRO 20  
87  1 Y 1 B SER 521 ? B SER 21  
88  1 Y 1 B ALA 522 ? B ALA 22  
89  1 Y 1 B ALA 887 ? B ALA 387 
90  1 Y 1 B ALA 888 ? B ALA 388 
91  1 Y 1 B SER 889 ? B SER 389 
92  1 Y 1 B THR 890 ? B THR 390 
93  1 Y 1 B PRO 891 ? B PRO 391 
94  1 Y 1 B THR 892 ? B THR 392 
95  1 Y 1 B ASN 893 ? B ASN 393 
96  1 Y 1 B ALA 894 ? B ALA 394 
97  1 Y 1 B THR 895 ? B THR 395 
98  1 Y 1 B ALA 896 ? B ALA 396 
99  1 Y 1 B ALA 897 ? B ALA 397 
100 1 Y 1 B SER 898 ? B SER 398 
101 1 Y 1 B ASP 899 ? B ASP 399 
102 1 Y 1 B ALA 900 ? B ALA 400 
103 1 Y 1 B ASN 901 ? B ASN 401 
104 1 Y 1 B THR 902 ? B THR 402 
105 1 Y 1 B GLY 903 ? B GLY 403 
106 1 Y 1 B ASP 904 ? B ASP 404 
107 1 Y 1 B ARG 905 ? B ARG 405 
108 1 Y 1 B GLY 906 ? B GLY 406 
109 1 Y 1 B GLN 907 ? B GLN 407 
110 1 Y 1 B THR 908 ? B THR 408 
111 1 Y 1 B ASN 909 ? B ASN 409 
112 1 Y 1 B ASN 910 ? B ASN 410 
113 1 Y 1 B ALA 911 ? B ALA 411 
114 1 Y 1 B ALA 912 ? B ALA 412 
115 1 Y 1 B SER 913 ? B SER 413 
116 1 Y 1 B ALA 914 ? B ALA 414 
117 1 Y 1 B SER 915 ? B SER 415 
118 1 Y 1 B ALA 916 ? B ALA 416 
119 1 Y 1 B SER 917 ? B SER 417 
120 1 Y 1 B ASN 918 ? B ASN 418 
121 1 Y 1 B SER 919 ? B SER 419 
122 1 Y 1 B THR 920 ? B THR 420 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ANP 
3 water                                         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ANP 1   430 430 ANP PNP A . 
D 2 ANP 1   930 930 ANP PNP B . 
E 3 HOH 1   431 1   HOH HOH A . 
E 3 HOH 2   432 2   HOH HOH A . 
E 3 HOH 3   433 3   HOH HOH A . 
E 3 HOH 4   434 4   HOH HOH A . 
E 3 HOH 5   435 5   HOH HOH A . 
E 3 HOH 6   436 6   HOH HOH A . 
E 3 HOH 7   437 9   HOH HOH A . 
E 3 HOH 8   438 11  HOH HOH A . 
E 3 HOH 9   439 13  HOH HOH A . 
E 3 HOH 10  440 14  HOH HOH A . 
E 3 HOH 11  441 15  HOH HOH A . 
E 3 HOH 12  442 17  HOH HOH A . 
E 3 HOH 13  443 19  HOH HOH A . 
E 3 HOH 14  444 21  HOH HOH A . 
E 3 HOH 15  445 22  HOH HOH A . 
E 3 HOH 16  446 25  HOH HOH A . 
E 3 HOH 17  447 26  HOH HOH A . 
E 3 HOH 18  448 28  HOH HOH A . 
E 3 HOH 19  449 29  HOH HOH A . 
E 3 HOH 20  450 30  HOH HOH A . 
E 3 HOH 21  451 31  HOH HOH A . 
E 3 HOH 22  452 36  HOH HOH A . 
E 3 HOH 23  453 38  HOH HOH A . 
E 3 HOH 24  454 39  HOH HOH A . 
E 3 HOH 25  455 41  HOH HOH A . 
E 3 HOH 26  456 47  HOH HOH A . 
E 3 HOH 27  457 48  HOH HOH A . 
E 3 HOH 28  458 49  HOH HOH A . 
E 3 HOH 29  459 51  HOH HOH A . 
E 3 HOH 30  460 52  HOH HOH A . 
E 3 HOH 31  461 53  HOH HOH A . 
E 3 HOH 32  462 55  HOH HOH A . 
E 3 HOH 33  463 56  HOH HOH A . 
E 3 HOH 34  464 57  HOH HOH A . 
E 3 HOH 35  465 58  HOH HOH A . 
E 3 HOH 36  466 60  HOH HOH A . 
E 3 HOH 37  467 63  HOH HOH A . 
E 3 HOH 38  468 64  HOH HOH A . 
E 3 HOH 39  469 65  HOH HOH A . 
E 3 HOH 40  470 66  HOH HOH A . 
E 3 HOH 41  471 68  HOH HOH A . 
E 3 HOH 42  472 70  HOH HOH A . 
E 3 HOH 43  473 71  HOH HOH A . 
E 3 HOH 44  474 72  HOH HOH A . 
E 3 HOH 45  475 73  HOH HOH A . 
E 3 HOH 46  476 77  HOH HOH A . 
E 3 HOH 47  477 78  HOH HOH A . 
E 3 HOH 48  478 80  HOH HOH A . 
E 3 HOH 49  479 81  HOH HOH A . 
E 3 HOH 50  480 82  HOH HOH A . 
E 3 HOH 51  481 84  HOH HOH A . 
E 3 HOH 52  482 86  HOH HOH A . 
E 3 HOH 53  483 87  HOH HOH A . 
E 3 HOH 54  484 88  HOH HOH A . 
E 3 HOH 55  485 90  HOH HOH A . 
E 3 HOH 56  486 91  HOH HOH A . 
E 3 HOH 57  487 92  HOH HOH A . 
E 3 HOH 58  488 94  HOH HOH A . 
E 3 HOH 59  489 98  HOH HOH A . 
E 3 HOH 60  490 100 HOH HOH A . 
E 3 HOH 61  491 101 HOH HOH A . 
E 3 HOH 62  492 102 HOH HOH A . 
E 3 HOH 63  493 103 HOH HOH A . 
E 3 HOH 64  494 106 HOH HOH A . 
E 3 HOH 65  495 107 HOH HOH A . 
E 3 HOH 66  496 109 HOH HOH A . 
E 3 HOH 67  497 114 HOH HOH A . 
E 3 HOH 68  498 115 HOH HOH A . 
E 3 HOH 69  499 117 HOH HOH A . 
E 3 HOH 70  500 119 HOH HOH A . 
E 3 HOH 71  501 125 HOH HOH A . 
E 3 HOH 72  502 126 HOH HOH A . 
E 3 HOH 73  503 127 HOH HOH A . 
E 3 HOH 74  504 128 HOH HOH A . 
E 3 HOH 75  505 129 HOH HOH A . 
E 3 HOH 76  506 131 HOH HOH A . 
E 3 HOH 77  507 133 HOH HOH A . 
E 3 HOH 78  508 139 HOH HOH A . 
E 3 HOH 79  509 142 HOH HOH A . 
E 3 HOH 80  510 143 HOH HOH A . 
E 3 HOH 81  511 145 HOH HOH A . 
E 3 HOH 82  512 148 HOH HOH A . 
E 3 HOH 83  513 152 HOH HOH A . 
E 3 HOH 84  514 154 HOH HOH A . 
E 3 HOH 85  515 155 HOH HOH A . 
E 3 HOH 86  516 156 HOH HOH A . 
E 3 HOH 87  517 157 HOH HOH A . 
E 3 HOH 88  518 158 HOH HOH A . 
E 3 HOH 89  519 159 HOH HOH A . 
E 3 HOH 90  520 160 HOH HOH A . 
E 3 HOH 91  521 164 HOH HOH A . 
E 3 HOH 92  522 165 HOH HOH A . 
E 3 HOH 93  523 166 HOH HOH A . 
E 3 HOH 94  524 168 HOH HOH A . 
E 3 HOH 95  525 170 HOH HOH A . 
E 3 HOH 96  526 174 HOH HOH A . 
E 3 HOH 97  527 175 HOH HOH A . 
E 3 HOH 98  528 178 HOH HOH A . 
E 3 HOH 99  529 180 HOH HOH A . 
E 3 HOH 100 530 181 HOH HOH A . 
E 3 HOH 101 531 182 HOH HOH A . 
E 3 HOH 102 532 183 HOH HOH A . 
E 3 HOH 103 533 185 HOH HOH A . 
E 3 HOH 104 534 187 HOH HOH A . 
E 3 HOH 105 535 189 HOH HOH A . 
E 3 HOH 106 536 190 HOH HOH A . 
E 3 HOH 107 537 191 HOH HOH A . 
E 3 HOH 108 538 192 HOH HOH A . 
E 3 HOH 109 539 194 HOH HOH A . 
E 3 HOH 110 540 195 HOH HOH A . 
E 3 HOH 111 541 196 HOH HOH A . 
E 3 HOH 112 542 197 HOH HOH A . 
E 3 HOH 113 543 199 HOH HOH A . 
E 3 HOH 114 544 200 HOH HOH A . 
E 3 HOH 115 545 202 HOH HOH A . 
E 3 HOH 116 546 204 HOH HOH A . 
E 3 HOH 117 547 209 HOH HOH A . 
E 3 HOH 118 548 214 HOH HOH A . 
E 3 HOH 119 549 215 HOH HOH A . 
E 3 HOH 120 550 216 HOH HOH A . 
E 3 HOH 121 551 218 HOH HOH A . 
E 3 HOH 122 552 219 HOH HOH A . 
E 3 HOH 123 553 221 HOH HOH A . 
E 3 HOH 124 554 224 HOH HOH A . 
E 3 HOH 125 555 226 HOH HOH A . 
E 3 HOH 126 556 228 HOH HOH A . 
E 3 HOH 127 557 231 HOH HOH A . 
E 3 HOH 128 558 232 HOH HOH A . 
E 3 HOH 129 559 234 HOH HOH A . 
E 3 HOH 130 560 236 HOH HOH A . 
E 3 HOH 131 561 238 HOH HOH A . 
E 3 HOH 132 562 239 HOH HOH A . 
E 3 HOH 133 563 241 HOH HOH A . 
E 3 HOH 134 564 244 HOH HOH A . 
E 3 HOH 135 565 245 HOH HOH A . 
E 3 HOH 136 566 247 HOH HOH A . 
E 3 HOH 137 567 248 HOH HOH A . 
E 3 HOH 138 568 250 HOH HOH A . 
E 3 HOH 139 569 254 HOH HOH A . 
E 3 HOH 140 570 256 HOH HOH A . 
E 3 HOH 141 571 259 HOH HOH A . 
E 3 HOH 142 572 260 HOH HOH A . 
E 3 HOH 143 573 261 HOH HOH A . 
E 3 HOH 144 574 263 HOH HOH A . 
E 3 HOH 145 575 268 HOH HOH A . 
E 3 HOH 146 576 270 HOH HOH A . 
E 3 HOH 147 577 271 HOH HOH A . 
E 3 HOH 148 578 274 HOH HOH A . 
E 3 HOH 149 579 275 HOH HOH A . 
E 3 HOH 150 580 278 HOH HOH A . 
E 3 HOH 151 581 279 HOH HOH A . 
E 3 HOH 152 582 280 HOH HOH A . 
E 3 HOH 153 583 282 HOH HOH A . 
E 3 HOH 154 584 285 HOH HOH A . 
E 3 HOH 155 585 288 HOH HOH A . 
E 3 HOH 156 586 290 HOH HOH A . 
E 3 HOH 157 587 291 HOH HOH A . 
E 3 HOH 158 588 292 HOH HOH A . 
E 3 HOH 159 589 293 HOH HOH A . 
E 3 HOH 160 590 294 HOH HOH A . 
E 3 HOH 161 591 295 HOH HOH A . 
E 3 HOH 162 592 296 HOH HOH A . 
E 3 HOH 163 593 298 HOH HOH A . 
E 3 HOH 164 594 299 HOH HOH A . 
E 3 HOH 165 595 301 HOH HOH A . 
E 3 HOH 166 596 302 HOH HOH A . 
E 3 HOH 167 597 305 HOH HOH A . 
E 3 HOH 168 598 307 HOH HOH A . 
E 3 HOH 169 599 311 HOH HOH A . 
E 3 HOH 170 600 312 HOH HOH A . 
E 3 HOH 171 601 314 HOH HOH A . 
E 3 HOH 172 602 315 HOH HOH A . 
E 3 HOH 173 603 317 HOH HOH A . 
E 3 HOH 174 604 321 HOH HOH A . 
E 3 HOH 175 605 322 HOH HOH A . 
E 3 HOH 176 606 323 HOH HOH A . 
E 3 HOH 177 607 324 HOH HOH A . 
E 3 HOH 178 608 325 HOH HOH A . 
E 3 HOH 179 609 326 HOH HOH A . 
E 3 HOH 180 610 327 HOH HOH A . 
E 3 HOH 181 611 328 HOH HOH A . 
E 3 HOH 182 612 329 HOH HOH A . 
E 3 HOH 183 613 330 HOH HOH A . 
E 3 HOH 184 614 331 HOH HOH A . 
E 3 HOH 185 615 338 HOH HOH A . 
E 3 HOH 186 616 340 HOH HOH A . 
E 3 HOH 187 617 343 HOH HOH A . 
E 3 HOH 188 618 344 HOH HOH A . 
E 3 HOH 189 619 346 HOH HOH A . 
E 3 HOH 190 620 348 HOH HOH A . 
E 3 HOH 191 621 349 HOH HOH A . 
E 3 HOH 192 622 353 HOH HOH A . 
E 3 HOH 193 623 357 HOH HOH A . 
E 3 HOH 194 624 358 HOH HOH A . 
E 3 HOH 195 625 359 HOH HOH A . 
E 3 HOH 196 626 360 HOH HOH A . 
E 3 HOH 197 627 362 HOH HOH A . 
E 3 HOH 198 628 364 HOH HOH A . 
E 3 HOH 199 629 365 HOH HOH A . 
E 3 HOH 200 630 372 HOH HOH A . 
E 3 HOH 201 631 373 HOH HOH A . 
E 3 HOH 202 632 374 HOH HOH A . 
E 3 HOH 203 633 375 HOH HOH A . 
E 3 HOH 204 634 377 HOH HOH A . 
E 3 HOH 205 635 378 HOH HOH A . 
E 3 HOH 206 636 382 HOH HOH A . 
E 3 HOH 207 637 383 HOH HOH A . 
E 3 HOH 208 638 384 HOH HOH A . 
E 3 HOH 209 639 385 HOH HOH A . 
E 3 HOH 210 640 386 HOH HOH A . 
E 3 HOH 211 641 387 HOH HOH A . 
E 3 HOH 212 642 388 HOH HOH A . 
E 3 HOH 213 643 389 HOH HOH A . 
E 3 HOH 214 644 390 HOH HOH A . 
E 3 HOH 215 645 391 HOH HOH A . 
E 3 HOH 216 646 392 HOH HOH A . 
E 3 HOH 217 647 394 HOH HOH A . 
E 3 HOH 218 648 395 HOH HOH A . 
E 3 HOH 219 649 396 HOH HOH A . 
E 3 HOH 220 650 397 HOH HOH A . 
E 3 HOH 221 651 398 HOH HOH A . 
E 3 HOH 222 652 399 HOH HOH A . 
E 3 HOH 223 653 401 HOH HOH A . 
E 3 HOH 224 654 402 HOH HOH A . 
E 3 HOH 225 655 403 HOH HOH A . 
E 3 HOH 226 656 405 HOH HOH A . 
E 3 HOH 227 657 406 HOH HOH A . 
E 3 HOH 228 658 407 HOH HOH A . 
E 3 HOH 229 659 408 HOH HOH A . 
E 3 HOH 230 660 409 HOH HOH A . 
E 3 HOH 231 661 410 HOH HOH A . 
E 3 HOH 232 662 411 HOH HOH A . 
E 3 HOH 233 663 412 HOH HOH A . 
E 3 HOH 234 664 415 HOH HOH A . 
F 3 HOH 1   7   7   HOH HOH B . 
F 3 HOH 2   8   8   HOH HOH B . 
F 3 HOH 3   10  10  HOH HOH B . 
F 3 HOH 4   12  12  HOH HOH B . 
F 3 HOH 5   16  16  HOH HOH B . 
F 3 HOH 6   18  18  HOH HOH B . 
F 3 HOH 7   20  20  HOH HOH B . 
F 3 HOH 8   23  23  HOH HOH B . 
F 3 HOH 9   24  24  HOH HOH B . 
F 3 HOH 10  27  27  HOH HOH B . 
F 3 HOH 11  32  32  HOH HOH B . 
F 3 HOH 12  33  33  HOH HOH B . 
F 3 HOH 13  34  34  HOH HOH B . 
F 3 HOH 14  35  35  HOH HOH B . 
F 3 HOH 15  37  37  HOH HOH B . 
F 3 HOH 16  40  40  HOH HOH B . 
F 3 HOH 17  42  42  HOH HOH B . 
F 3 HOH 18  43  43  HOH HOH B . 
F 3 HOH 19  44  44  HOH HOH B . 
F 3 HOH 20  45  45  HOH HOH B . 
F 3 HOH 21  46  46  HOH HOH B . 
F 3 HOH 22  50  50  HOH HOH B . 
F 3 HOH 23  54  54  HOH HOH B . 
F 3 HOH 24  59  59  HOH HOH B . 
F 3 HOH 25  61  61  HOH HOH B . 
F 3 HOH 26  62  62  HOH HOH B . 
F 3 HOH 27  67  67  HOH HOH B . 
F 3 HOH 28  69  69  HOH HOH B . 
F 3 HOH 29  74  74  HOH HOH B . 
F 3 HOH 30  75  75  HOH HOH B . 
F 3 HOH 31  76  76  HOH HOH B . 
F 3 HOH 32  79  79  HOH HOH B . 
F 3 HOH 33  83  83  HOH HOH B . 
F 3 HOH 34  85  85  HOH HOH B . 
F 3 HOH 35  89  89  HOH HOH B . 
F 3 HOH 36  93  93  HOH HOH B . 
F 3 HOH 37  95  95  HOH HOH B . 
F 3 HOH 38  96  96  HOH HOH B . 
F 3 HOH 39  97  97  HOH HOH B . 
F 3 HOH 40  99  99  HOH HOH B . 
F 3 HOH 41  104 104 HOH HOH B . 
F 3 HOH 42  105 105 HOH HOH B . 
F 3 HOH 43  108 108 HOH HOH B . 
F 3 HOH 44  110 110 HOH HOH B . 
F 3 HOH 45  111 111 HOH HOH B . 
F 3 HOH 46  112 112 HOH HOH B . 
F 3 HOH 47  113 113 HOH HOH B . 
F 3 HOH 48  116 116 HOH HOH B . 
F 3 HOH 49  118 118 HOH HOH B . 
F 3 HOH 50  120 120 HOH HOH B . 
F 3 HOH 51  121 121 HOH HOH B . 
F 3 HOH 52  122 122 HOH HOH B . 
F 3 HOH 53  123 123 HOH HOH B . 
F 3 HOH 54  124 124 HOH HOH B . 
F 3 HOH 55  130 130 HOH HOH B . 
F 3 HOH 56  132 132 HOH HOH B . 
F 3 HOH 57  134 134 HOH HOH B . 
F 3 HOH 58  135 135 HOH HOH B . 
F 3 HOH 59  136 136 HOH HOH B . 
F 3 HOH 60  137 137 HOH HOH B . 
F 3 HOH 61  138 138 HOH HOH B . 
F 3 HOH 62  140 140 HOH HOH B . 
F 3 HOH 63  141 141 HOH HOH B . 
F 3 HOH 64  144 144 HOH HOH B . 
F 3 HOH 65  146 146 HOH HOH B . 
F 3 HOH 66  147 147 HOH HOH B . 
F 3 HOH 67  149 149 HOH HOH B . 
F 3 HOH 68  150 150 HOH HOH B . 
F 3 HOH 69  151 151 HOH HOH B . 
F 3 HOH 70  153 153 HOH HOH B . 
F 3 HOH 71  161 161 HOH HOH B . 
F 3 HOH 72  162 162 HOH HOH B . 
F 3 HOH 73  163 163 HOH HOH B . 
F 3 HOH 74  167 167 HOH HOH B . 
F 3 HOH 75  169 169 HOH HOH B . 
F 3 HOH 76  171 171 HOH HOH B . 
F 3 HOH 77  172 172 HOH HOH B . 
F 3 HOH 78  173 173 HOH HOH B . 
F 3 HOH 79  176 176 HOH HOH B . 
F 3 HOH 80  177 177 HOH HOH B . 
F 3 HOH 81  179 179 HOH HOH B . 
F 3 HOH 82  184 184 HOH HOH B . 
F 3 HOH 83  186 186 HOH HOH B . 
F 3 HOH 84  188 188 HOH HOH B . 
F 3 HOH 85  193 193 HOH HOH B . 
F 3 HOH 86  198 198 HOH HOH B . 
F 3 HOH 87  201 201 HOH HOH B . 
F 3 HOH 88  203 203 HOH HOH B . 
F 3 HOH 89  205 205 HOH HOH B . 
F 3 HOH 90  206 206 HOH HOH B . 
F 3 HOH 91  207 207 HOH HOH B . 
F 3 HOH 92  208 208 HOH HOH B . 
F 3 HOH 93  210 210 HOH HOH B . 
F 3 HOH 94  211 211 HOH HOH B . 
F 3 HOH 95  212 212 HOH HOH B . 
F 3 HOH 96  213 213 HOH HOH B . 
F 3 HOH 97  217 217 HOH HOH B . 
F 3 HOH 98  220 220 HOH HOH B . 
F 3 HOH 99  222 222 HOH HOH B . 
F 3 HOH 100 223 223 HOH HOH B . 
F 3 HOH 101 225 225 HOH HOH B . 
F 3 HOH 102 227 227 HOH HOH B . 
F 3 HOH 103 229 229 HOH HOH B . 
F 3 HOH 104 230 230 HOH HOH B . 
F 3 HOH 105 233 233 HOH HOH B . 
F 3 HOH 106 235 235 HOH HOH B . 
F 3 HOH 107 237 237 HOH HOH B . 
F 3 HOH 108 240 240 HOH HOH B . 
F 3 HOH 109 242 242 HOH HOH B . 
F 3 HOH 110 243 243 HOH HOH B . 
F 3 HOH 111 246 246 HOH HOH B . 
F 3 HOH 112 249 249 HOH HOH B . 
F 3 HOH 113 251 251 HOH HOH B . 
F 3 HOH 114 252 252 HOH HOH B . 
F 3 HOH 115 253 253 HOH HOH B . 
F 3 HOH 116 255 255 HOH HOH B . 
F 3 HOH 117 257 257 HOH HOH B . 
F 3 HOH 118 258 258 HOH HOH B . 
F 3 HOH 119 262 262 HOH HOH B . 
F 3 HOH 120 264 264 HOH HOH B . 
F 3 HOH 121 265 265 HOH HOH B . 
F 3 HOH 122 266 266 HOH HOH B . 
F 3 HOH 123 267 267 HOH HOH B . 
F 3 HOH 124 269 269 HOH HOH B . 
F 3 HOH 125 272 272 HOH HOH B . 
F 3 HOH 126 273 273 HOH HOH B . 
F 3 HOH 127 276 276 HOH HOH B . 
F 3 HOH 128 277 277 HOH HOH B . 
F 3 HOH 129 281 281 HOH HOH B . 
F 3 HOH 130 283 283 HOH HOH B . 
F 3 HOH 131 284 284 HOH HOH B . 
F 3 HOH 132 286 286 HOH HOH B . 
F 3 HOH 133 287 287 HOH HOH B . 
F 3 HOH 134 289 289 HOH HOH B . 
F 3 HOH 135 297 297 HOH HOH B . 
F 3 HOH 136 300 300 HOH HOH B . 
F 3 HOH 137 303 303 HOH HOH B . 
F 3 HOH 138 304 304 HOH HOH B . 
F 3 HOH 139 306 306 HOH HOH B . 
F 3 HOH 140 308 308 HOH HOH B . 
F 3 HOH 141 309 309 HOH HOH B . 
F 3 HOH 142 310 310 HOH HOH B . 
F 3 HOH 143 313 313 HOH HOH B . 
F 3 HOH 144 316 316 HOH HOH B . 
F 3 HOH 145 318 318 HOH HOH B . 
F 3 HOH 146 319 319 HOH HOH B . 
F 3 HOH 147 320 320 HOH HOH B . 
F 3 HOH 148 332 332 HOH HOH B . 
F 3 HOH 149 333 333 HOH HOH B . 
F 3 HOH 150 334 334 HOH HOH B . 
F 3 HOH 151 335 335 HOH HOH B . 
F 3 HOH 152 336 336 HOH HOH B . 
F 3 HOH 153 337 337 HOH HOH B . 
F 3 HOH 154 339 339 HOH HOH B . 
F 3 HOH 155 341 341 HOH HOH B . 
F 3 HOH 156 342 342 HOH HOH B . 
F 3 HOH 157 345 345 HOH HOH B . 
F 3 HOH 158 347 347 HOH HOH B . 
F 3 HOH 159 350 350 HOH HOH B . 
F 3 HOH 160 351 351 HOH HOH B . 
F 3 HOH 161 352 352 HOH HOH B . 
F 3 HOH 162 354 354 HOH HOH B . 
F 3 HOH 163 355 355 HOH HOH B . 
F 3 HOH 164 356 356 HOH HOH B . 
F 3 HOH 165 361 361 HOH HOH B . 
F 3 HOH 166 363 363 HOH HOH B . 
F 3 HOH 167 366 366 HOH HOH B . 
F 3 HOH 168 367 367 HOH HOH B . 
F 3 HOH 169 368 368 HOH HOH B . 
F 3 HOH 170 369 369 HOH HOH B . 
F 3 HOH 171 370 370 HOH HOH B . 
F 3 HOH 172 371 371 HOH HOH B . 
F 3 HOH 173 376 376 HOH HOH B . 
F 3 HOH 174 379 379 HOH HOH B . 
F 3 HOH 175 380 380 HOH HOH B . 
F 3 HOH 176 381 381 HOH HOH B . 
F 3 HOH 177 393 393 HOH HOH B . 
F 3 HOH 178 400 400 HOH HOH B . 
F 3 HOH 179 404 404 HOH HOH B . 
F 3 HOH 180 413 413 HOH HOH B . 
F 3 HOH 181 414 414 HOH HOH B . 
F 3 HOH 182 416 416 HOH HOH B . 
F 3 HOH 183 417 417 HOH HOH B . 
F 3 HOH 184 418 418 HOH HOH B . 
F 3 HOH 185 419 419 HOH HOH B . 
#