data_1J3R
# 
_entry.id   1J3R 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1J3R         
RCSB  RCSB005593   
WWPDB D_1000005593 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1J3P '1J3P contains the same protein complexed with 1 Fe ion' unspecified 
PDB 1J3Q '1J3Q contains the same protein complexed with 2 Fe ion' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1J3R 
_pdbx_database_status.recvd_initial_deposition_date   2003-02-11 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jeong, J.-J.'  1 
'Fushinobu, S.' 2 
'Ito, S.'       3 
'Hidaka, M.'    4 
'Shoun, H.'     5 
'Wakagi, T.'    6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of a novel cupin-type phosphoglucose isomerase' 'To be Published' ?   ?   ?   ?    ?      ?  ?         
0353 ? ?        ?                               
1       
'Characterization of the cupin-type phosphoglucose isomerase from the hyperthermophilic archaeon Thermococcus litoralis(1).' 
'FEBS Lett.'      535 200 204 2003 FEBLAL NE 0014-5793 0165 ? 12560104 '10.1016/S0014-5793(02)03900-5' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jeong, J.-J.'  1  
primary 'Fushinobu, S.' 2  
primary 'Ito, S.'       3  
primary 'Hidaka, M.'    4  
primary 'Shoun, H.'     5  
primary 'Wakagi, T.'    6  
1       'Jeong, J.-J.'  7  
1       'Fushinobu, S.' 8  
1       'Ito, S.'       9  
1       'Jeon, B.-S.'   10 
1       'Shoun, H.'     11 
1       'Wakagi, T.'    12 
# 
_cell.entry_id           1J3R 
_cell.length_a           40.670 
_cell.length_b           80.230 
_cell.length_c           130.040 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1J3R 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Phosphoglucose Isomerase' 21749.859 2   5.3.1.9 ? ? ? 
2 non-polymer man '6-PHOSPHOGLUCONIC ACID'   276.135   2   ?       ? ? ? 
3 non-polymer syn 'FE (III) ION'             55.845    1   ?       ? ? ? 
4 water       nat water                      18.015    273 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKYKEPFGVKLDFETGIIENAKKSVRRLSDMKGYFIDEEAWKKMVEEGDPVVYEVYAIEQEEKEGDLNFATTVLYPGKVG
NEFFMTKGHYHSKIDRAEVYFALKGKGGMLLQTPEGEARFIEMEPGTIVYVPPYWAHRTINTGDKPFIFLALYPADAGHD
YGTIAEKGFSKIVVEENGKVVVKDNPKWRM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKYKEPFGVKLDFETGIIENAKKSVRRLSDMKGYFIDEEAWKKMVEEGDPVVYEVYAIEQEEKEGDLNFATTVLYPGKVG
NEFFMTKGHYHSKIDRAEVYFALKGKGGMLLQTPEGEARFIEMEPGTIVYVPPYWAHRTINTGDKPFIFLALYPADAGHD
YGTIAEKGFSKIVVEENGKVVVKDNPKWRM
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   TYR n 
1 4   LYS n 
1 5   GLU n 
1 6   PRO n 
1 7   PHE n 
1 8   GLY n 
1 9   VAL n 
1 10  LYS n 
1 11  LEU n 
1 12  ASP n 
1 13  PHE n 
1 14  GLU n 
1 15  THR n 
1 16  GLY n 
1 17  ILE n 
1 18  ILE n 
1 19  GLU n 
1 20  ASN n 
1 21  ALA n 
1 22  LYS n 
1 23  LYS n 
1 24  SER n 
1 25  VAL n 
1 26  ARG n 
1 27  ARG n 
1 28  LEU n 
1 29  SER n 
1 30  ASP n 
1 31  MET n 
1 32  LYS n 
1 33  GLY n 
1 34  TYR n 
1 35  PHE n 
1 36  ILE n 
1 37  ASP n 
1 38  GLU n 
1 39  GLU n 
1 40  ALA n 
1 41  TRP n 
1 42  LYS n 
1 43  LYS n 
1 44  MET n 
1 45  VAL n 
1 46  GLU n 
1 47  GLU n 
1 48  GLY n 
1 49  ASP n 
1 50  PRO n 
1 51  VAL n 
1 52  VAL n 
1 53  TYR n 
1 54  GLU n 
1 55  VAL n 
1 56  TYR n 
1 57  ALA n 
1 58  ILE n 
1 59  GLU n 
1 60  GLN n 
1 61  GLU n 
1 62  GLU n 
1 63  LYS n 
1 64  GLU n 
1 65  GLY n 
1 66  ASP n 
1 67  LEU n 
1 68  ASN n 
1 69  PHE n 
1 70  ALA n 
1 71  THR n 
1 72  THR n 
1 73  VAL n 
1 74  LEU n 
1 75  TYR n 
1 76  PRO n 
1 77  GLY n 
1 78  LYS n 
1 79  VAL n 
1 80  GLY n 
1 81  ASN n 
1 82  GLU n 
1 83  PHE n 
1 84  PHE n 
1 85  MET n 
1 86  THR n 
1 87  LYS n 
1 88  GLY n 
1 89  HIS n 
1 90  TYR n 
1 91  HIS n 
1 92  SER n 
1 93  LYS n 
1 94  ILE n 
1 95  ASP n 
1 96  ARG n 
1 97  ALA n 
1 98  GLU n 
1 99  VAL n 
1 100 TYR n 
1 101 PHE n 
1 102 ALA n 
1 103 LEU n 
1 104 LYS n 
1 105 GLY n 
1 106 LYS n 
1 107 GLY n 
1 108 GLY n 
1 109 MET n 
1 110 LEU n 
1 111 LEU n 
1 112 GLN n 
1 113 THR n 
1 114 PRO n 
1 115 GLU n 
1 116 GLY n 
1 117 GLU n 
1 118 ALA n 
1 119 ARG n 
1 120 PHE n 
1 121 ILE n 
1 122 GLU n 
1 123 MET n 
1 124 GLU n 
1 125 PRO n 
1 126 GLY n 
1 127 THR n 
1 128 ILE n 
1 129 VAL n 
1 130 TYR n 
1 131 VAL n 
1 132 PRO n 
1 133 PRO n 
1 134 TYR n 
1 135 TRP n 
1 136 ALA n 
1 137 HIS n 
1 138 ARG n 
1 139 THR n 
1 140 ILE n 
1 141 ASN n 
1 142 THR n 
1 143 GLY n 
1 144 ASP n 
1 145 LYS n 
1 146 PRO n 
1 147 PHE n 
1 148 ILE n 
1 149 PHE n 
1 150 LEU n 
1 151 ALA n 
1 152 LEU n 
1 153 TYR n 
1 154 PRO n 
1 155 ALA n 
1 156 ASP n 
1 157 ALA n 
1 158 GLY n 
1 159 HIS n 
1 160 ASP n 
1 161 TYR n 
1 162 GLY n 
1 163 THR n 
1 164 ILE n 
1 165 ALA n 
1 166 GLU n 
1 167 LYS n 
1 168 GLY n 
1 169 PHE n 
1 170 SER n 
1 171 LYS n 
1 172 ILE n 
1 173 VAL n 
1 174 VAL n 
1 175 GLU n 
1 176 GLU n 
1 177 ASN n 
1 178 GLY n 
1 179 LYS n 
1 180 VAL n 
1 181 VAL n 
1 182 VAL n 
1 183 LYS n 
1 184 ASP n 
1 185 ASN n 
1 186 PRO n 
1 187 LYS n 
1 188 TRP n 
1 189 ARG n 
1 190 MET n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Thermococcus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Thermococcus litoralis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2265 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET21d 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    G6PI_THELI 
_struct_ref.pdbx_db_accession          P84140 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1J3R A 1 ? 190 ? P84140 1 ? 190 ? 1 190 
2 1 1J3R B 1 ? 190 ? P84140 1 ? 190 ? 1 190 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
6PG D-saccharide        . '6-PHOSPHOGLUCONIC ACID' ? 'C6 H13 O10 P'   276.135 
ALA 'L-peptide linking' y ALANINE                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ? 'C4 H7 N O4'     133.103 
FE  non-polymer         . 'FE (III) ION'           ? 'Fe 3'           55.845  
GLN 'L-peptide linking' y GLUTAMINE                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE               ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1J3R 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.31 
_exptl_crystal.density_percent_sol   46.2 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            278 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.0 
_exptl_crystal_grow.pdbx_details    
'PEG 8000, potassium phosphate, gluconate 6-phosphate, pH 4.0, VAPOR DIFFUSION, SITTING DROP, temperature 278K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2002-05-30 
_diffrn_detector.details                mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Yale mirrors' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU ULTRAX 18' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1J3R 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             40.12 
_reflns.d_resolution_high            2.18 
_reflns.number_obs                   22995 
_reflns.number_all                   22995 
_reflns.percent_possible_obs         97.2 
_reflns.pdbx_Rmerge_I_obs            0.089 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        6.8 
_reflns.B_iso_Wilson_estimate        20.6 
_reflns.pdbx_redundancy              7.12 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.18 
_reflns_shell.d_res_low              2.26 
_reflns_shell.percent_possible_all   97.2 
_reflns_shell.Rmerge_I_obs           0.207 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    3.1 
_reflns_shell.pdbx_redundancy        7.06 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1J3R 
_refine.ls_number_reflns_obs                     22345 
_refine.ls_number_reflns_all                     23012 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1458307.62 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.11 
_refine.ls_d_res_high                            2.18 
_refine.ls_percent_reflns_obs                    97.1 
_refine.ls_R_factor_obs                          0.218 
_refine.ls_R_factor_all                          0.22 
_refine.ls_R_factor_R_work                       0.218 
_refine.ls_R_factor_R_free                       0.263 
_refine.ls_R_factor_R_free_error                 0.008 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1117 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               28.5 
_refine.aniso_B[1][1]                            1.45 
_refine.aniso_B[2][2]                            -3.63 
_refine.aniso_B[3][3]                            2.18 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.449829 
_refine.solvent_model_param_bsol                 79.3442 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1J3P 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1J3R 
_refine_analyze.Luzzati_coordinate_error_obs    0.26 
_refine_analyze.Luzzati_sigma_a_obs             0.17 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.34 
_refine_analyze.Luzzati_sigma_a_free            0.25 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2985 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         35 
_refine_hist.number_atoms_solvent             273 
_refine_hist.number_atoms_total               3293 
_refine_hist.d_res_high                       2.18 
_refine_hist.d_res_low                        40.11 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      25.0  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      0.78  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.29  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.93  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.14  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.09  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.18 
_refine_ls_shell.d_res_low                        2.32 
_refine_ls_shell.number_reflns_R_work             3535 
_refine_ls_shell.R_factor_R_work                  0.236 
_refine_ls_shell.percent_reflns_obs               98.6 
_refine_ls_shell.R_factor_R_free                  0.293 
_refine_ls_shell.R_factor_R_free_error            0.022 
_refine_ls_shell.percent_reflns_R_free            4.7 
_refine_ls_shell.number_reflns_R_free             174 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
3 6PG.PARAM         6PG.TOP     'X-RAY DIFFRACTION' 
4 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1J3R 
_struct.title                     
'Crystal structure of Thermococcus litoralis phosphogrucose isomerase complexed with gluconate-6-phosphate' 
_struct.pdbx_descriptor           'phosphogrucose isomerase (E.C.5.3.1.9)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1J3R 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            'phosphoglucose isomerase, cupin superfamily, iron ion, archaea, gluconate 6-phosphate, ISOMERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 4 ? 
G N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological assembly is a dimer in the asymmetric unit.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 29  ? LYS A 32  ? SER A 29  LYS A 32  5 ? 4  
HELX_P HELX_P2 2 ASP A 37  ? GLY A 48  ? ASP A 37  GLY A 48  1 ? 12 
HELX_P HELX_P3 3 TYR A 161 ? GLY A 168 ? TYR A 161 GLY A 168 1 ? 8  
HELX_P HELX_P4 4 SER B 29  ? MET B 31  ? SER B 29  MET B 31  5 ? 3  
HELX_P HELX_P5 5 ASP B 37  ? GLY B 48  ? ASP B 37  GLY B 48  1 ? 12 
HELX_P HELX_P6 6 TYR B 161 ? LYS B 167 ? TYR B 161 LYS B 167 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            metalc1 
_struct_conn.conn_type_id                  metalc 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           D 
_struct_conn.ptnr1_label_comp_id           FE 
_struct_conn.ptnr1_label_seq_id            . 
_struct_conn.ptnr1_label_atom_id           FE 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           F 
_struct_conn.ptnr2_label_comp_id           HOH 
_struct_conn.ptnr2_label_seq_id            . 
_struct_conn.ptnr2_label_atom_id           O 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            FE 
_struct_conn.ptnr1_auth_seq_id             201 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            HOH 
_struct_conn.ptnr2_auth_seq_id             624 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.667 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
C ? 2 ? 
D ? 3 ? 
E ? 2 ? 
F ? 2 ? 
G ? 3 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 7   ? LYS A 10  ? PHE A 7   LYS A 10  
A 2 THR B 127 ? VAL B 131 ? THR B 127 VAL B 131 
A 3 GLU B 98  ? LYS B 104 ? GLU B 98  LYS B 104 
A 4 PHE B 147 ? PRO B 154 ? PHE B 147 PRO B 154 
A 5 LEU B 67  ? LEU B 74  ? LEU B 67  LEU B 74  
A 6 VAL B 51  ? ILE B 58  ? VAL B 51  ILE B 58  
A 7 LYS B 22  ? ARG B 27  ? LYS B 22  ARG B 27  
B 1 LYS A 22  ? ARG A 27  ? LYS A 22  ARG A 27  
B 2 VAL A 51  ? ILE A 58  ? VAL A 51  ILE A 58  
B 3 LEU A 67  ? LEU A 74  ? LEU A 67  LEU A 74  
B 4 PHE A 147 ? PRO A 154 ? PHE A 147 PRO A 154 
B 5 GLU A 98  ? LYS A 104 ? GLU A 98  LYS A 104 
B 6 THR A 127 ? VAL A 131 ? THR A 127 VAL A 131 
B 7 PHE B 7   ? LYS B 10  ? PHE B 7   LYS B 10  
C 1 LYS A 78  ? VAL A 79  ? LYS A 78  VAL A 79  
C 2 GLU A 82  ? PHE A 83  ? GLU A 82  PHE A 83  
D 1 ALA A 118 ? MET A 123 ? ALA A 118 MET A 123 
D 2 GLY A 107 ? GLN A 112 ? GLY A 107 GLN A 112 
D 3 ALA A 136 ? ASN A 141 ? ALA A 136 ASN A 141 
E 1 LYS A 171 ? GLU A 175 ? LYS A 171 GLU A 175 
E 2 LYS A 179 ? LYS A 183 ? LYS A 179 LYS A 183 
F 1 LYS B 78  ? VAL B 79  ? LYS B 78  VAL B 79  
F 2 GLU B 82  ? PHE B 83  ? GLU B 82  PHE B 83  
G 1 ALA B 118 ? MET B 123 ? ALA B 118 MET B 123 
G 2 GLY B 107 ? GLN B 112 ? GLY B 107 GLN B 112 
G 3 ALA B 136 ? ASN B 141 ? ALA B 136 ASN B 141 
H 1 LYS B 171 ? GLU B 175 ? LYS B 171 GLU B 175 
H 2 LYS B 179 ? LYS B 183 ? LYS B 179 LYS B 183 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 7   ? N PHE A 7   O TYR B 130 ? O TYR B 130 
A 2 3 O VAL B 131 ? O VAL B 131 N GLU B 98  ? N GLU B 98  
A 3 4 N PHE B 101 ? N PHE B 101 O LEU B 150 ? O LEU B 150 
A 4 5 O ALA B 151 ? O ALA B 151 N ALA B 70  ? N ALA B 70  
A 5 6 O VAL B 73  ? O VAL B 73  N GLU B 54  ? N GLU B 54  
A 6 7 O ALA B 57  ? O ALA B 57  N LYS B 22  ? N LYS B 22  
B 1 2 N LYS A 22  ? N LYS A 22  O ALA A 57  ? O ALA A 57  
B 2 3 N GLU A 54  ? N GLU A 54  O VAL A 73  ? O VAL A 73  
B 3 4 N ASN A 68  ? N ASN A 68  O TYR A 153 ? O TYR A 153 
B 4 5 O LEU A 150 ? O LEU A 150 N PHE A 101 ? N PHE A 101 
B 5 6 N GLU A 98  ? N GLU A 98  O VAL A 131 ? O VAL A 131 
B 6 7 N ILE A 128 ? N ILE A 128 O VAL B 9   ? O VAL B 9   
C 1 2 N VAL A 79  ? N VAL A 79  O GLU A 82  ? O GLU A 82  
D 1 2 O MET A 123 ? O MET A 123 N GLY A 107 ? N GLY A 107 
D 2 3 N LEU A 110 ? N LEU A 110 O ARG A 138 ? O ARG A 138 
E 1 2 N VAL A 174 ? N VAL A 174 O VAL A 180 ? O VAL A 180 
F 1 2 N VAL B 79  ? N VAL B 79  O GLU B 82  ? O GLU B 82  
G 1 2 O ARG B 119 ? O ARG B 119 N LEU B 111 ? N LEU B 111 
G 2 3 N GLN B 112 ? N GLN B 112 O ALA B 136 ? O ALA B 136 
H 1 2 N VAL B 174 ? N VAL B 174 O VAL B 180 ? O VAL B 180 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE 6PG A 600' 
AC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE 6PG B 601' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE A 201'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 21 TYR A 53  ? TYR A 53  . ? 1_555 ? 
2  AC1 21 VAL A 55  ? VAL A 55  . ? 1_555 ? 
3  AC1 21 ALA A 70  ? ALA A 70  . ? 1_555 ? 
4  AC1 21 THR A 72  ? THR A 72  . ? 1_555 ? 
5  AC1 21 THR A 86  ? THR A 86  . ? 1_555 ? 
6  AC1 21 LYS A 87  ? LYS A 87  . ? 1_555 ? 
7  AC1 21 GLY A 88  ? GLY A 88  . ? 1_555 ? 
8  AC1 21 HIS A 89  ? HIS A 89  . ? 1_555 ? 
9  AC1 21 GLU A 98  ? GLU A 98  . ? 1_555 ? 
10 AC1 21 TYR A 100 ? TYR A 100 . ? 1_555 ? 
11 AC1 21 PHE A 149 ? PHE A 149 . ? 1_555 ? 
12 AC1 21 TYR A 153 ? TYR A 153 . ? 1_555 ? 
13 AC1 21 HIS A 159 ? HIS A 159 . ? 1_555 ? 
14 AC1 21 TYR A 161 ? TYR A 161 . ? 1_555 ? 
15 AC1 21 FE  D .   ? FE  A 201 . ? 1_555 ? 
16 AC1 21 HOH F .   ? HOH A 603 . ? 1_555 ? 
17 AC1 21 HOH F .   ? HOH A 606 . ? 1_555 ? 
18 AC1 21 HOH F .   ? HOH A 620 . ? 1_555 ? 
19 AC1 21 HOH F .   ? HOH A 655 . ? 1_555 ? 
20 AC1 21 HOH F .   ? HOH A 684 . ? 1_555 ? 
21 AC1 21 HOH F .   ? HOH A 691 . ? 1_555 ? 
22 AC2 16 TYR B 53  ? TYR B 53  . ? 1_555 ? 
23 AC2 16 THR B 72  ? THR B 72  . ? 1_555 ? 
24 AC2 16 THR B 86  ? THR B 86  . ? 1_555 ? 
25 AC2 16 LYS B 87  ? LYS B 87  . ? 1_555 ? 
26 AC2 16 GLY B 88  ? GLY B 88  . ? 1_555 ? 
27 AC2 16 HIS B 89  ? HIS B 89  . ? 1_555 ? 
28 AC2 16 GLU B 98  ? GLU B 98  . ? 1_555 ? 
29 AC2 16 TYR B 100 ? TYR B 100 . ? 1_555 ? 
30 AC2 16 TYR B 153 ? TYR B 153 . ? 1_555 ? 
31 AC2 16 HIS B 159 ? HIS B 159 . ? 1_555 ? 
32 AC2 16 TYR B 161 ? TYR B 161 . ? 1_555 ? 
33 AC2 16 HOH G .   ? HOH B 602 . ? 1_555 ? 
34 AC2 16 HOH G .   ? HOH B 617 . ? 1_555 ? 
35 AC2 16 HOH G .   ? HOH B 631 . ? 1_555 ? 
36 AC2 16 HOH G .   ? HOH B 633 . ? 1_555 ? 
37 AC2 16 HOH G .   ? HOH B 676 . ? 1_555 ? 
38 AC3 5  HIS A 89  ? HIS A 89  . ? 1_555 ? 
39 AC3 5  HIS A 91  ? HIS A 91  . ? 1_555 ? 
40 AC3 5  GLU A 98  ? GLU A 98  . ? 1_555 ? 
41 AC3 5  6PG C .   ? 6PG A 600 . ? 1_555 ? 
42 AC3 5  HOH F .   ? HOH A 624 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1J3R 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1J3R 
_atom_sites.fract_transf_matrix[1][1]   0.024588 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012464 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007690 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? 45.675 38.345 40.078  1.00 21.86 ? 1   MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? 45.374 38.236 38.623  1.00 23.19 ? 1   MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? 43.874 38.329 38.357  1.00 22.69 ? 1   MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? 43.061 38.195 39.267  1.00 22.67 ? 1   MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? 45.903 36.909 38.068  1.00 25.35 ? 1   MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? 45.235 35.672 38.653  1.00 29.40 ? 1   MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? 45.826 34.120 37.895  1.00 37.38 ? 1   MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? 45.012 34.212 36.280  1.00 33.44 ? 1   MET A CE  1 
ATOM   9    N  N   . LYS A 1 2   ? 43.521 38.577 37.103  1.00 22.55 ? 2   LYS A N   1 
ATOM   10   C  CA  . LYS A 1 2   ? 42.125 38.671 36.700  1.00 25.56 ? 2   LYS A CA  1 
ATOM   11   C  C   . LYS A 1 2   ? 41.782 37.328 36.057  1.00 25.38 ? 2   LYS A C   1 
ATOM   12   O  O   . LYS A 1 2   ? 42.342 36.967 35.025  1.00 26.74 ? 2   LYS A O   1 
ATOM   13   C  CB  . LYS A 1 2   ? 41.944 39.825 35.706  1.00 22.61 ? 2   LYS A CB  1 
ATOM   14   C  CG  . LYS A 1 2   ? 40.529 39.996 35.183  1.00 25.43 ? 2   LYS A CG  1 
ATOM   15   C  CD  . LYS A 1 2   ? 40.426 41.241 34.296  1.00 27.49 ? 2   LYS A CD  1 
ATOM   16   C  CE  . LYS A 1 2   ? 39.201 41.190 33.384  1.00 29.74 ? 2   LYS A CE  1 
ATOM   17   N  NZ  . LYS A 1 2   ? 37.928 40.926 34.120  1.00 31.41 ? 2   LYS A NZ  1 
ATOM   18   N  N   . TYR A 1 3   ? 40.869 36.593 36.685  1.00 26.08 ? 3   TYR A N   1 
ATOM   19   C  CA  . TYR A 1 3   ? 40.463 35.267 36.218  1.00 24.99 ? 3   TYR A CA  1 
ATOM   20   C  C   . TYR A 1 3   ? 39.450 35.267 35.082  1.00 25.84 ? 3   TYR A C   1 
ATOM   21   O  O   . TYR A 1 3   ? 38.743 36.253 34.861  1.00 25.76 ? 3   TYR A O   1 
ATOM   22   C  CB  . TYR A 1 3   ? 39.874 34.479 37.388  1.00 23.74 ? 3   TYR A CB  1 
ATOM   23   C  CG  . TYR A 1 3   ? 40.773 34.437 38.604  1.00 24.39 ? 3   TYR A CG  1 
ATOM   24   C  CD1 . TYR A 1 3   ? 41.905 33.624 38.632  1.00 22.89 ? 3   TYR A CD1 1 
ATOM   25   C  CD2 . TYR A 1 3   ? 40.510 35.240 39.712  1.00 24.39 ? 3   TYR A CD2 1 
ATOM   26   C  CE1 . TYR A 1 3   ? 42.754 33.611 39.738  1.00 24.07 ? 3   TYR A CE1 1 
ATOM   27   C  CE2 . TYR A 1 3   ? 41.353 35.238 40.822  1.00 25.05 ? 3   TYR A CE2 1 
ATOM   28   C  CZ  . TYR A 1 3   ? 42.472 34.423 40.829  1.00 24.58 ? 3   TYR A CZ  1 
ATOM   29   O  OH  . TYR A 1 3   ? 43.311 34.431 41.921  1.00 23.32 ? 3   TYR A OH  1 
ATOM   30   N  N   . LYS A 1 4   ? 39.379 34.146 34.366  1.00 25.01 ? 4   LYS A N   1 
ATOM   31   C  CA  . LYS A 1 4   ? 38.413 34.004 33.287  1.00 25.72 ? 4   LYS A CA  1 
ATOM   32   C  C   . LYS A 1 4   ? 37.115 33.553 33.937  1.00 23.69 ? 4   LYS A C   1 
ATOM   33   O  O   . LYS A 1 4   ? 37.125 32.847 34.944  1.00 25.62 ? 4   LYS A O   1 
ATOM   34   C  CB  . LYS A 1 4   ? 38.866 32.963 32.252  1.00 24.38 ? 4   LYS A CB  1 
ATOM   35   C  CG  . LYS A 1 4   ? 39.972 33.433 31.322  1.00 25.35 ? 4   LYS A CG  1 
ATOM   36   C  CD  . LYS A 1 4   ? 40.094 32.548 30.079  1.00 23.88 ? 4   LYS A CD  1 
ATOM   37   C  CE  . LYS A 1 4   ? 40.485 31.116 30.428  1.00 22.78 ? 4   LYS A CE  1 
ATOM   38   N  NZ  . LYS A 1 4   ? 40.667 30.290 29.195  1.00 21.63 ? 4   LYS A NZ  1 
ATOM   39   N  N   . GLU A 1 5   ? 35.996 33.964 33.363  1.00 23.59 ? 5   GLU A N   1 
ATOM   40   C  CA  . GLU A 1 5   ? 34.702 33.602 33.908  1.00 23.15 ? 5   GLU A CA  1 
ATOM   41   C  C   . GLU A 1 5   ? 34.219 32.229 33.454  1.00 22.34 ? 5   GLU A C   1 
ATOM   42   O  O   . GLU A 1 5   ? 34.380 31.851 32.294  1.00 22.51 ? 5   GLU A O   1 
ATOM   43   C  CB  . GLU A 1 5   ? 33.661 34.652 33.509  1.00 26.37 ? 5   GLU A CB  1 
ATOM   44   C  CG  . GLU A 1 5   ? 33.774 35.967 34.254  1.00 27.84 ? 5   GLU A CG  1 
ATOM   45   C  CD  . GLU A 1 5   ? 33.530 35.807 35.743  1.00 31.26 ? 5   GLU A CD  1 
ATOM   46   O  OE1 . GLU A 1 5   ? 32.462 35.282 36.122  1.00 29.89 ? 5   GLU A OE1 1 
ATOM   47   O  OE2 . GLU A 1 5   ? 34.406 36.210 36.536  1.00 33.46 ? 5   GLU A OE2 1 
ATOM   48   N  N   . PRO A 1 6   ? 33.648 31.449 34.377  1.00 20.55 ? 6   PRO A N   1 
ATOM   49   C  CA  . PRO A 1 6   ? 33.155 30.135 33.971  1.00 21.99 ? 6   PRO A CA  1 
ATOM   50   C  C   . PRO A 1 6   ? 31.866 30.365 33.185  1.00 24.11 ? 6   PRO A C   1 
ATOM   51   O  O   . PRO A 1 6   ? 31.325 31.473 33.184  1.00 23.60 ? 6   PRO A O   1 
ATOM   52   C  CB  . PRO A 1 6   ? 32.907 29.427 35.304  1.00 21.52 ? 6   PRO A CB  1 
ATOM   53   C  CG  . PRO A 1 6   ? 32.653 30.541 36.257  1.00 19.97 ? 6   PRO A CG  1 
ATOM   54   C  CD  . PRO A 1 6   ? 33.665 31.576 35.845  1.00 20.23 ? 6   PRO A CD  1 
ATOM   55   N  N   . PHE A 1 7   ? 31.377 29.340 32.500  1.00 24.10 ? 7   PHE A N   1 
ATOM   56   C  CA  . PHE A 1 7   ? 30.143 29.500 31.747  1.00 23.63 ? 7   PHE A CA  1 
ATOM   57   C  C   . PHE A 1 7   ? 29.505 28.170 31.384  1.00 24.03 ? 7   PHE A C   1 
ATOM   58   O  O   . PHE A 1 7   ? 30.160 27.125 31.393  1.00 24.24 ? 7   PHE A O   1 
ATOM   59   C  CB  . PHE A 1 7   ? 30.397 30.328 30.474  1.00 23.22 ? 7   PHE A CB  1 
ATOM   60   C  CG  . PHE A 1 7   ? 31.322 29.669 29.482  1.00 24.61 ? 7   PHE A CG  1 
ATOM   61   C  CD1 . PHE A 1 7   ? 30.841 28.713 28.585  1.00 24.58 ? 7   PHE A CD1 1 
ATOM   62   C  CD2 . PHE A 1 7   ? 32.675 29.999 29.447  1.00 22.41 ? 7   PHE A CD2 1 
ATOM   63   C  CE1 . PHE A 1 7   ? 31.695 28.099 27.669  1.00 25.10 ? 7   PHE A CE1 1 
ATOM   64   C  CE2 . PHE A 1 7   ? 33.537 29.390 28.535  1.00 24.97 ? 7   PHE A CE2 1 
ATOM   65   C  CZ  . PHE A 1 7   ? 33.044 28.436 27.643  1.00 25.06 ? 7   PHE A CZ  1 
ATOM   66   N  N   . GLY A 1 8   ? 28.211 28.223 31.095  1.00 22.59 ? 8   GLY A N   1 
ATOM   67   C  CA  . GLY A 1 8   ? 27.489 27.039 30.690  1.00 22.54 ? 8   GLY A CA  1 
ATOM   68   C  C   . GLY A 1 8   ? 26.954 27.295 29.293  1.00 23.58 ? 8   GLY A C   1 
ATOM   69   O  O   . GLY A 1 8   ? 26.491 28.393 29.003  1.00 23.27 ? 8   GLY A O   1 
ATOM   70   N  N   . VAL A 1 9   ? 27.056 26.305 28.413  1.00 23.32 ? 9   VAL A N   1 
ATOM   71   C  CA  . VAL A 1 9   ? 26.539 26.435 27.058  1.00 23.25 ? 9   VAL A CA  1 
ATOM   72   C  C   . VAL A 1 9   ? 25.750 25.170 26.756  1.00 25.13 ? 9   VAL A C   1 
ATOM   73   O  O   . VAL A 1 9   ? 26.112 24.078 27.206  1.00 25.92 ? 9   VAL A O   1 
ATOM   74   C  CB  . VAL A 1 9   ? 27.661 26.615 26.000  1.00 22.48 ? 9   VAL A CB  1 
ATOM   75   C  CG1 . VAL A 1 9   ? 28.289 27.992 26.138  1.00 24.98 ? 9   VAL A CG1 1 
ATOM   76   C  CG2 . VAL A 1 9   ? 28.716 25.534 26.156  1.00 22.33 ? 9   VAL A CG2 1 
ATOM   77   N  N   . LYS A 1 10  ? 24.671 25.313 25.997  1.00 25.42 ? 10  LYS A N   1 
ATOM   78   C  CA  . LYS A 1 10  ? 23.824 24.171 25.684  1.00 26.94 ? 10  LYS A CA  1 
ATOM   79   C  C   . LYS A 1 10  ? 24.215 23.394 24.440  1.00 26.22 ? 10  LYS A C   1 
ATOM   80   O  O   . LYS A 1 10  ? 24.504 23.973 23.388  1.00 26.55 ? 10  LYS A O   1 
ATOM   81   C  CB  . LYS A 1 10  ? 22.366 24.623 25.555  1.00 27.92 ? 10  LYS A CB  1 
ATOM   82   C  CG  . LYS A 1 10  ? 21.387 23.490 25.300  1.00 32.01 ? 10  LYS A CG  1 
ATOM   83   C  CD  . LYS A 1 10  ? 21.436 22.427 26.408  1.00 35.31 ? 10  LYS A CD  1 
ATOM   84   C  CE  . LYS A 1 10  ? 21.114 23.014 27.778  1.00 35.30 ? 10  LYS A CE  1 
ATOM   85   N  NZ  . LYS A 1 10  ? 21.068 21.964 28.838  1.00 36.66 ? 10  LYS A NZ  1 
ATOM   86   N  N   . LEU A 1 11  ? 24.238 22.072 24.580  1.00 25.17 ? 11  LEU A N   1 
ATOM   87   C  CA  . LEU A 1 11  ? 24.545 21.185 23.472  1.00 24.97 ? 11  LEU A CA  1 
ATOM   88   C  C   . LEU A 1 11  ? 23.243 20.466 23.155  1.00 23.94 ? 11  LEU A C   1 
ATOM   89   O  O   . LEU A 1 11  ? 22.632 19.857 24.029  1.00 24.28 ? 11  LEU A O   1 
ATOM   90   C  CB  . LEU A 1 11  ? 25.626 20.166 23.852  1.00 24.34 ? 11  LEU A CB  1 
ATOM   91   C  CG  . LEU A 1 11  ? 25.925 19.080 22.804  1.00 25.81 ? 11  LEU A CG  1 
ATOM   92   C  CD1 . LEU A 1 11  ? 27.332 18.528 23.010  1.00 25.12 ? 11  LEU A CD1 1 
ATOM   93   C  CD2 . LEU A 1 11  ? 24.887 17.961 22.895  1.00 24.77 ? 11  LEU A CD2 1 
ATOM   94   N  N   . ASP A 1 12  ? 22.817 20.554 21.904  1.00 23.20 ? 12  ASP A N   1 
ATOM   95   C  CA  . ASP A 1 12  ? 21.585 19.910 21.469  1.00 21.74 ? 12  ASP A CA  1 
ATOM   96   C  C   . ASP A 1 12  ? 21.894 18.470 21.068  1.00 20.93 ? 12  ASP A C   1 
ATOM   97   O  O   . ASP A 1 12  ? 22.505 18.234 20.026  1.00 20.28 ? 12  ASP A O   1 
ATOM   98   C  CB  . ASP A 1 12  ? 21.011 20.664 20.268  1.00 21.87 ? 12  ASP A CB  1 
ATOM   99   C  CG  . ASP A 1 12  ? 19.609 20.208 19.907  1.00 23.46 ? 12  ASP A CG  1 
ATOM   100  O  OD1 . ASP A 1 12  ? 19.355 18.990 19.898  1.00 21.26 ? 12  ASP A OD1 1 
ATOM   101  O  OD2 . ASP A 1 12  ? 18.763 21.077 19.623  1.00 29.29 ? 12  ASP A OD2 1 
ATOM   102  N  N   . PHE A 1 13  ? 21.470 17.515 21.892  1.00 21.59 ? 13  PHE A N   1 
ATOM   103  C  CA  . PHE A 1 13  ? 21.705 16.091 21.624  1.00 22.81 ? 13  PHE A CA  1 
ATOM   104  C  C   . PHE A 1 13  ? 21.240 15.625 20.246  1.00 23.13 ? 13  PHE A C   1 
ATOM   105  O  O   . PHE A 1 13  ? 21.809 14.697 19.680  1.00 25.69 ? 13  PHE A O   1 
ATOM   106  C  CB  . PHE A 1 13  ? 21.011 15.222 22.683  1.00 22.79 ? 13  PHE A CB  1 
ATOM   107  C  CG  . PHE A 1 13  ? 21.681 15.239 24.026  1.00 24.10 ? 13  PHE A CG  1 
ATOM   108  C  CD1 . PHE A 1 13  ? 22.924 14.638 24.207  1.00 24.37 ? 13  PHE A CD1 1 
ATOM   109  C  CD2 . PHE A 1 13  ? 21.068 15.853 25.116  1.00 24.17 ? 13  PHE A CD2 1 
ATOM   110  C  CE1 . PHE A 1 13  ? 23.548 14.647 25.454  1.00 24.08 ? 13  PHE A CE1 1 
ATOM   111  C  CE2 . PHE A 1 13  ? 21.684 15.871 26.368  1.00 23.36 ? 13  PHE A CE2 1 
ATOM   112  C  CZ  . PHE A 1 13  ? 22.926 15.267 26.538  1.00 24.00 ? 13  PHE A CZ  1 
ATOM   113  N  N   . GLU A 1 14  ? 20.207 16.259 19.705  1.00 23.30 ? 14  GLU A N   1 
ATOM   114  C  CA  . GLU A 1 14  ? 19.679 15.851 18.406  1.00 21.86 ? 14  GLU A CA  1 
ATOM   115  C  C   . GLU A 1 14  ? 20.400 16.444 17.209  1.00 21.72 ? 14  GLU A C   1 
ATOM   116  O  O   . GLU A 1 14  ? 20.582 15.769 16.196  1.00 21.37 ? 14  GLU A O   1 
ATOM   117  C  CB  . GLU A 1 14  ? 18.191 16.193 18.313  1.00 22.29 ? 14  GLU A CB  1 
ATOM   118  C  CG  . GLU A 1 14  ? 17.309 15.431 19.290  1.00 24.51 ? 14  GLU A CG  1 
ATOM   119  C  CD  . GLU A 1 14  ? 17.375 13.927 19.091  1.00 25.47 ? 14  GLU A CD  1 
ATOM   120  O  OE1 . GLU A 1 14  ? 17.303 13.468 17.928  1.00 23.27 ? 14  GLU A OE1 1 
ATOM   121  O  OE2 . GLU A 1 14  ? 17.492 13.203 20.101  1.00 27.67 ? 14  GLU A OE2 1 
ATOM   122  N  N   . THR A 1 15  ? 20.804 17.705 17.317  1.00 22.04 ? 15  THR A N   1 
ATOM   123  C  CA  . THR A 1 15  ? 21.488 18.372 16.218  1.00 22.70 ? 15  THR A CA  1 
ATOM   124  C  C   . THR A 1 15  ? 23.009 18.376 16.347  1.00 21.86 ? 15  THR A C   1 
ATOM   125  O  O   . THR A 1 15  ? 23.715 18.540 15.357  1.00 20.35 ? 15  THR A O   1 
ATOM   126  C  CB  . THR A 1 15  ? 21.044 19.831 16.102  1.00 24.70 ? 15  THR A CB  1 
ATOM   127  O  OG1 . THR A 1 15  ? 21.481 20.549 17.263  1.00 24.14 ? 15  THR A OG1 1 
ATOM   128  C  CG2 . THR A 1 15  ? 19.519 19.922 15.986  1.00 23.49 ? 15  THR A CG2 1 
ATOM   129  N  N   . GLY A 1 16  ? 23.507 18.212 17.568  1.00 21.16 ? 16  GLY A N   1 
ATOM   130  C  CA  . GLY A 1 16  ? 24.942 18.235 17.784  1.00 19.73 ? 16  GLY A CA  1 
ATOM   131  C  C   . GLY A 1 16  ? 25.451 19.665 17.849  1.00 21.48 ? 16  GLY A C   1 
ATOM   132  O  O   . GLY A 1 16  ? 26.654 19.904 17.943  1.00 22.08 ? 16  GLY A O   1 
ATOM   133  N  N   . ILE A 1 17  ? 24.534 20.626 17.812  1.00 20.14 ? 17  ILE A N   1 
ATOM   134  C  CA  . ILE A 1 17  ? 24.910 22.034 17.850  1.00 23.07 ? 17  ILE A CA  1 
ATOM   135  C  C   . ILE A 1 17  ? 25.152 22.582 19.256  1.00 23.21 ? 17  ILE A C   1 
ATOM   136  O  O   . ILE A 1 17  ? 24.381 22.323 20.178  1.00 21.39 ? 17  ILE A O   1 
ATOM   137  C  CB  . ILE A 1 17  ? 23.841 22.907 17.158  1.00 23.63 ? 17  ILE A CB  1 
ATOM   138  C  CG1 . ILE A 1 17  ? 23.742 22.531 15.678  1.00 24.32 ? 17  ILE A CG1 1 
ATOM   139  C  CG2 . ILE A 1 17  ? 24.200 24.376 17.296  1.00 25.36 ? 17  ILE A CG2 1 
ATOM   140  C  CD1 . ILE A 1 17  ? 22.576 23.177 14.961  1.00 27.51 ? 17  ILE A CD1 1 
ATOM   141  N  N   . ILE A 1 18  ? 26.239 23.335 19.409  1.00 24.80 ? 18  ILE A N   1 
ATOM   142  C  CA  . ILE A 1 18  ? 26.584 23.951 20.693  1.00 23.93 ? 18  ILE A CA  1 
ATOM   143  C  C   . ILE A 1 18  ? 26.370 25.450 20.554  1.00 24.71 ? 18  ILE A C   1 
ATOM   144  O  O   . ILE A 1 18  ? 26.989 26.091 19.708  1.00 23.32 ? 18  ILE A O   1 
ATOM   145  C  CB  . ILE A 1 18  ? 28.061 23.722 21.072  1.00 22.61 ? 18  ILE A CB  1 
ATOM   146  C  CG1 . ILE A 1 18  ? 28.328 22.235 21.290  1.00 20.88 ? 18  ILE A CG1 1 
ATOM   147  C  CG2 . ILE A 1 18  ? 28.401 24.530 22.336  1.00 20.97 ? 18  ILE A CG2 1 
ATOM   148  C  CD1 . ILE A 1 18  ? 29.811 21.910 21.515  1.00 23.35 ? 18  ILE A CD1 1 
ATOM   149  N  N   . GLU A 1 19  ? 25.495 26.003 21.385  1.00 27.71 ? 19  GLU A N   1 
ATOM   150  C  CA  . GLU A 1 19  ? 25.192 27.429 21.335  1.00 30.58 ? 19  GLU A CA  1 
ATOM   151  C  C   . GLU A 1 19  ? 26.422 28.299 21.559  1.00 30.49 ? 19  GLU A C   1 
ATOM   152  O  O   . GLU A 1 19  ? 27.244 28.019 22.439  1.00 31.89 ? 19  GLU A O   1 
ATOM   153  C  CB  . GLU A 1 19  ? 24.132 27.782 22.381  1.00 32.97 ? 19  GLU A CB  1 
ATOM   154  C  CG  . GLU A 1 19  ? 24.592 27.590 23.814  1.00 37.90 ? 19  GLU A CG  1 
ATOM   155  C  CD  . GLU A 1 19  ? 23.553 28.034 24.826  1.00 40.38 ? 19  GLU A CD  1 
ATOM   156  O  OE1 . GLU A 1 19  ? 23.839 27.969 26.038  1.00 37.90 ? 19  GLU A OE1 1 
ATOM   157  O  OE2 . GLU A 1 19  ? 22.449 28.447 24.405  1.00 45.34 ? 19  GLU A OE2 1 
ATOM   158  N  N   . ASN A 1 20  ? 26.542 29.349 20.752  1.00 30.10 ? 20  ASN A N   1 
ATOM   159  C  CA  . ASN A 1 20  ? 27.656 30.290 20.858  1.00 30.70 ? 20  ASN A CA  1 
ATOM   160  C  C   . ASN A 1 20  ? 29.014 29.733 20.442  1.00 28.10 ? 20  ASN A C   1 
ATOM   161  O  O   . ASN A 1 20  ? 30.041 30.350 20.705  1.00 28.28 ? 20  ASN A O   1 
ATOM   162  C  CB  . ASN A 1 20  ? 27.748 30.819 22.291  1.00 33.72 ? 20  ASN A CB  1 
ATOM   163  C  CG  . ASN A 1 20  ? 26.732 31.905 22.577  1.00 38.57 ? 20  ASN A CG  1 
ATOM   164  O  OD1 . ASN A 1 20  ? 25.655 31.941 21.979  1.00 38.40 ? 20  ASN A OD1 1 
ATOM   165  N  ND2 . ASN A 1 20  ? 27.068 32.795 23.509  1.00 41.24 ? 20  ASN A ND2 1 
ATOM   166  N  N   . ALA A 1 21  ? 29.024 28.578 19.787  1.00 26.66 ? 21  ALA A N   1 
ATOM   167  C  CA  . ALA A 1 21  ? 30.281 27.974 19.360  1.00 26.79 ? 21  ALA A CA  1 
ATOM   168  C  C   . ALA A 1 21  ? 30.696 28.462 17.978  1.00 26.21 ? 21  ALA A C   1 
ATOM   169  O  O   . ALA A 1 21  ? 29.883 29.009 17.238  1.00 27.48 ? 21  ALA A O   1 
ATOM   170  C  CB  . ALA A 1 21  ? 30.154 26.452 19.362  1.00 24.93 ? 21  ALA A CB  1 
ATOM   171  N  N   . LYS A 1 22  ? 31.967 28.267 17.643  1.00 26.31 ? 22  LYS A N   1 
ATOM   172  C  CA  . LYS A 1 22  ? 32.503 28.653 16.339  1.00 26.72 ? 22  LYS A CA  1 
ATOM   173  C  C   . LYS A 1 22  ? 32.228 27.514 15.357  1.00 26.36 ? 22  LYS A C   1 
ATOM   174  O  O   . LYS A 1 22  ? 32.654 26.379 15.572  1.00 27.92 ? 22  LYS A O   1 
ATOM   175  C  CB  . LYS A 1 22  ? 34.012 28.901 16.434  1.00 27.41 ? 22  LYS A CB  1 
ATOM   176  C  CG  . LYS A 1 22  ? 34.667 29.230 15.101  1.00 32.56 ? 22  LYS A CG  1 
ATOM   177  C  CD  . LYS A 1 22  ? 36.162 29.481 15.256  1.00 36.43 ? 22  LYS A CD  1 
ATOM   178  C  CE  . LYS A 1 22  ? 36.886 28.252 15.799  1.00 39.31 ? 22  LYS A CE  1 
ATOM   179  N  NZ  . LYS A 1 22  ? 36.710 27.068 14.906  1.00 38.52 ? 22  LYS A NZ  1 
ATOM   180  N  N   . LYS A 1 23  ? 31.519 27.819 14.277  1.00 26.77 ? 23  LYS A N   1 
ATOM   181  C  CA  . LYS A 1 23  ? 31.163 26.804 13.290  1.00 27.42 ? 23  LYS A CA  1 
ATOM   182  C  C   . LYS A 1 23  ? 32.127 26.723 12.119  1.00 27.01 ? 23  LYS A C   1 
ATOM   183  O  O   . LYS A 1 23  ? 32.564 27.746 11.594  1.00 28.47 ? 23  LYS A O   1 
ATOM   184  C  CB  . LYS A 1 23  ? 29.749 27.070 12.765  1.00 27.16 ? 23  LYS A CB  1 
ATOM   185  C  CG  . LYS A 1 23  ? 29.258 26.084 11.708  1.00 26.60 ? 23  LYS A CG  1 
ATOM   186  C  CD  . LYS A 1 23  ? 27.882 26.501 11.206  1.00 24.60 ? 23  LYS A CD  1 
ATOM   187  C  CE  . LYS A 1 23  ? 27.295 25.505 10.227  1.00 26.10 ? 23  LYS A CE  1 
ATOM   188  N  NZ  . LYS A 1 23  ? 26.000 25.997 9.663   1.00 26.24 ? 23  LYS A NZ  1 
ATOM   189  N  N   . SER A 1 24  ? 32.457 25.494 11.729  1.00 26.60 ? 24  SER A N   1 
ATOM   190  C  CA  . SER A 1 24  ? 33.341 25.227 10.600  1.00 27.38 ? 24  SER A CA  1 
ATOM   191  C  C   . SER A 1 24  ? 32.671 24.185 9.719   1.00 26.93 ? 24  SER A C   1 
ATOM   192  O  O   . SER A 1 24  ? 32.003 23.279 10.217  1.00 26.12 ? 24  SER A O   1 
ATOM   193  C  CB  . SER A 1 24  ? 34.693 24.688 11.071  1.00 28.34 ? 24  SER A CB  1 
ATOM   194  O  OG  . SER A 1 24  ? 35.464 25.711 11.664  1.00 33.62 ? 24  SER A OG  1 
ATOM   195  N  N   . VAL A 1 25  ? 32.855 24.316 8.412   1.00 26.06 ? 25  VAL A N   1 
ATOM   196  C  CA  . VAL A 1 25  ? 32.261 23.384 7.469   1.00 25.56 ? 25  VAL A CA  1 
ATOM   197  C  C   . VAL A 1 25  ? 33.315 22.811 6.535   1.00 24.81 ? 25  VAL A C   1 
ATOM   198  O  O   . VAL A 1 25  ? 34.199 23.524 6.061   1.00 23.09 ? 25  VAL A O   1 
ATOM   199  C  CB  . VAL A 1 25  ? 31.172 24.070 6.619   1.00 26.30 ? 25  VAL A CB  1 
ATOM   200  C  CG1 . VAL A 1 25  ? 30.596 23.082 5.608   1.00 26.73 ? 25  VAL A CG1 1 
ATOM   201  C  CG2 . VAL A 1 25  ? 30.075 24.613 7.523   1.00 25.20 ? 25  VAL A CG2 1 
ATOM   202  N  N   . ARG A 1 26  ? 33.224 21.511 6.294   1.00 25.03 ? 26  ARG A N   1 
ATOM   203  C  CA  . ARG A 1 26  ? 34.146 20.834 5.400   1.00 25.50 ? 26  ARG A CA  1 
ATOM   204  C  C   . ARG A 1 26  ? 33.361 20.081 4.342   1.00 25.66 ? 26  ARG A C   1 
ATOM   205  O  O   . ARG A 1 26  ? 32.647 19.125 4.654   1.00 26.09 ? 26  ARG A O   1 
ATOM   206  C  CB  . ARG A 1 26  ? 35.034 19.848 6.163   1.00 27.15 ? 26  ARG A CB  1 
ATOM   207  C  CG  . ARG A 1 26  ? 36.329 20.440 6.691   1.00 30.74 ? 26  ARG A CG  1 
ATOM   208  C  CD  . ARG A 1 26  ? 36.127 21.227 7.973   1.00 34.12 ? 26  ARG A CD  1 
ATOM   209  N  NE  . ARG A 1 26  ? 37.344 21.941 8.346   1.00 38.08 ? 26  ARG A NE  1 
ATOM   210  C  CZ  . ARG A 1 26  ? 37.790 23.024 7.717   1.00 40.75 ? 26  ARG A CZ  1 
ATOM   211  N  NH1 . ARG A 1 26  ? 38.910 23.614 8.115   1.00 39.60 ? 26  ARG A NH1 1 
ATOM   212  N  NH2 . ARG A 1 26  ? 37.104 23.529 6.697   1.00 41.21 ? 26  ARG A NH2 1 
ATOM   213  N  N   . ARG A 1 27  ? 33.480 20.530 3.097   1.00 24.80 ? 27  ARG A N   1 
ATOM   214  C  CA  . ARG A 1 27  ? 32.807 19.887 1.975   1.00 24.22 ? 27  ARG A CA  1 
ATOM   215  C  C   . ARG A 1 27  ? 33.796 18.928 1.331   1.00 24.42 ? 27  ARG A C   1 
ATOM   216  O  O   . ARG A 1 27  ? 34.984 18.928 1.663   1.00 22.71 ? 27  ARG A O   1 
ATOM   217  C  CB  . ARG A 1 27  ? 32.362 20.924 0.940   1.00 23.84 ? 27  ARG A CB  1 
ATOM   218  C  CG  . ARG A 1 27  ? 31.247 21.834 1.413   1.00 24.22 ? 27  ARG A CG  1 
ATOM   219  C  CD  . ARG A 1 27  ? 30.926 22.916 0.386   1.00 25.85 ? 27  ARG A CD  1 
ATOM   220  N  NE  . ARG A 1 27  ? 29.780 23.721 0.803   1.00 26.30 ? 27  ARG A NE  1 
ATOM   221  C  CZ  . ARG A 1 27  ? 28.512 23.355 0.650   1.00 25.53 ? 27  ARG A CZ  1 
ATOM   222  N  NH1 . ARG A 1 27  ? 28.214 22.199 0.077   1.00 26.57 ? 27  ARG A NH1 1 
ATOM   223  N  NH2 . ARG A 1 27  ? 27.539 24.137 1.095   1.00 29.48 ? 27  ARG A NH2 1 
ATOM   224  N  N   . LEU A 1 28  ? 33.304 18.114 0.405   1.00 25.80 ? 28  LEU A N   1 
ATOM   225  C  CA  . LEU A 1 28  ? 34.150 17.154 -0.287  1.00 26.86 ? 28  LEU A CA  1 
ATOM   226  C  C   . LEU A 1 28  ? 35.294 17.883 -0.990  1.00 26.62 ? 28  LEU A C   1 
ATOM   227  O  O   . LEU A 1 28  ? 36.420 17.386 -1.041  1.00 26.76 ? 28  LEU A O   1 
ATOM   228  C  CB  . LEU A 1 28  ? 33.313 16.371 -1.295  1.00 28.99 ? 28  LEU A CB  1 
ATOM   229  C  CG  . LEU A 1 28  ? 33.693 14.912 -1.548  1.00 32.38 ? 28  LEU A CG  1 
ATOM   230  C  CD1 . LEU A 1 28  ? 33.788 14.158 -0.228  1.00 31.25 ? 28  LEU A CD1 1 
ATOM   231  C  CD2 . LEU A 1 28  ? 32.650 14.273 -2.453  1.00 30.21 ? 28  LEU A CD2 1 
ATOM   232  N  N   . SER A 1 29  ? 35.010 19.076 -1.511  1.00 26.15 ? 29  SER A N   1 
ATOM   233  C  CA  . SER A 1 29  ? 36.026 19.864 -2.200  1.00 25.77 ? 29  SER A CA  1 
ATOM   234  C  C   . SER A 1 29  ? 37.133 20.318 -1.252  1.00 26.15 ? 29  SER A C   1 
ATOM   235  O  O   . SER A 1 29  ? 38.201 20.755 -1.686  1.00 25.39 ? 29  SER A O   1 
ATOM   236  C  CB  . SER A 1 29  ? 35.391 21.085 -2.874  1.00 27.17 ? 29  SER A CB  1 
ATOM   237  O  OG  . SER A 1 29  ? 34.724 21.913 -1.937  1.00 28.37 ? 29  SER A OG  1 
ATOM   238  N  N   . ASP A 1 30  ? 36.876 20.211 0.046   1.00 25.87 ? 30  ASP A N   1 
ATOM   239  C  CA  . ASP A 1 30  ? 37.858 20.599 1.049   1.00 25.80 ? 30  ASP A CA  1 
ATOM   240  C  C   . ASP A 1 30  ? 38.747 19.425 1.422   1.00 27.28 ? 30  ASP A C   1 
ATOM   241  O  O   . ASP A 1 30  ? 39.700 19.583 2.182   1.00 28.02 ? 30  ASP A O   1 
ATOM   242  C  CB  . ASP A 1 30  ? 37.154 21.116 2.299   1.00 25.28 ? 30  ASP A CB  1 
ATOM   243  C  CG  . ASP A 1 30  ? 36.392 22.388 2.042   1.00 26.52 ? 30  ASP A CG  1 
ATOM   244  O  OD1 . ASP A 1 30  ? 37.029 23.365 1.599   1.00 25.95 ? 30  ASP A OD1 1 
ATOM   245  O  OD2 . ASP A 1 30  ? 35.165 22.413 2.276   1.00 26.58 ? 30  ASP A OD2 1 
ATOM   246  N  N   . MET A 1 31  ? 38.434 18.252 0.876   1.00 26.60 ? 31  MET A N   1 
ATOM   247  C  CA  . MET A 1 31  ? 39.193 17.042 1.162   1.00 28.19 ? 31  MET A CA  1 
ATOM   248  C  C   . MET A 1 31  ? 39.804 16.408 -0.088  1.00 29.46 ? 31  MET A C   1 
ATOM   249  O  O   . MET A 1 31  ? 39.796 15.187 -0.249  1.00 26.76 ? 31  MET A O   1 
ATOM   250  C  CB  . MET A 1 31  ? 38.287 16.029 1.866   1.00 26.65 ? 31  MET A CB  1 
ATOM   251  C  CG  . MET A 1 31  ? 37.723 16.546 3.181   1.00 25.94 ? 31  MET A CG  1 
ATOM   252  S  SD  . MET A 1 31  ? 36.624 15.382 3.978   1.00 24.47 ? 31  MET A SD  1 
ATOM   253  C  CE  . MET A 1 31  ? 37.788 14.120 4.496   1.00 21.96 ? 31  MET A CE  1 
ATOM   254  N  N   . LYS A 1 32  ? 40.337 17.244 -0.971  1.00 30.46 ? 32  LYS A N   1 
ATOM   255  C  CA  . LYS A 1 32  ? 40.957 16.750 -2.191  1.00 31.03 ? 32  LYS A CA  1 
ATOM   256  C  C   . LYS A 1 32  ? 42.190 15.925 -1.823  1.00 30.62 ? 32  LYS A C   1 
ATOM   257  O  O   . LYS A 1 32  ? 43.038 16.367 -1.038  1.00 28.54 ? 32  LYS A O   1 
ATOM   258  C  CB  . LYS A 1 32  ? 41.355 17.927 -3.085  1.00 33.49 ? 32  LYS A CB  1 
ATOM   259  C  CG  . LYS A 1 32  ? 41.823 17.535 -4.486  1.00 37.63 ? 32  LYS A CG  1 
ATOM   260  C  CD  . LYS A 1 32  ? 41.892 18.761 -5.391  1.00 40.29 ? 32  LYS A CD  1 
ATOM   261  C  CE  . LYS A 1 32  ? 42.285 18.401 -6.818  1.00 41.87 ? 32  LYS A CE  1 
ATOM   262  N  NZ  . LYS A 1 32  ? 43.696 17.930 -6.920  1.00 42.48 ? 32  LYS A NZ  1 
ATOM   263  N  N   . GLY A 1 33  ? 42.277 14.719 -2.376  1.00 29.44 ? 33  GLY A N   1 
ATOM   264  C  CA  . GLY A 1 33  ? 43.419 13.866 -2.093  1.00 29.68 ? 33  GLY A CA  1 
ATOM   265  C  C   . GLY A 1 33  ? 43.315 13.088 -0.791  1.00 28.86 ? 33  GLY A C   1 
ATOM   266  O  O   . GLY A 1 33  ? 44.318 12.604 -0.267  1.00 29.52 ? 33  GLY A O   1 
ATOM   267  N  N   . TYR A 1 34  ? 42.105 12.962 -0.263  1.00 26.25 ? 34  TYR A N   1 
ATOM   268  C  CA  . TYR A 1 34  ? 41.909 12.220 0.970   1.00 24.39 ? 34  TYR A CA  1 
ATOM   269  C  C   . TYR A 1 34  ? 41.308 10.850 0.718   1.00 23.87 ? 34  TYR A C   1 
ATOM   270  O  O   . TYR A 1 34  ? 41.619 9.892  1.423   1.00 22.47 ? 34  TYR A O   1 
ATOM   271  C  CB  . TYR A 1 34  ? 41.007 12.998 1.926   1.00 24.19 ? 34  TYR A CB  1 
ATOM   272  C  CG  . TYR A 1 34  ? 41.759 14.009 2.751   1.00 24.87 ? 34  TYR A CG  1 
ATOM   273  C  CD1 . TYR A 1 34  ? 42.167 15.228 2.202   1.00 22.47 ? 34  TYR A CD1 1 
ATOM   274  C  CD2 . TYR A 1 34  ? 42.105 13.728 4.075   1.00 24.09 ? 34  TYR A CD2 1 
ATOM   275  C  CE1 . TYR A 1 34  ? 42.902 16.138 2.956   1.00 24.33 ? 34  TYR A CE1 1 
ATOM   276  C  CE2 . TYR A 1 34  ? 42.840 14.628 4.834   1.00 21.74 ? 34  TYR A CE2 1 
ATOM   277  C  CZ  . TYR A 1 34  ? 43.236 15.828 4.273   1.00 21.88 ? 34  TYR A CZ  1 
ATOM   278  O  OH  . TYR A 1 34  ? 43.976 16.706 5.025   1.00 23.49 ? 34  TYR A OH  1 
ATOM   279  N  N   . PHE A 1 35  ? 40.452 10.763 -0.295  1.00 23.12 ? 35  PHE A N   1 
ATOM   280  C  CA  . PHE A 1 35  ? 39.783 9.514  -0.632  1.00 23.93 ? 35  PHE A CA  1 
ATOM   281  C  C   . PHE A 1 35  ? 40.512 8.759  -1.728  1.00 24.22 ? 35  PHE A C   1 
ATOM   282  O  O   . PHE A 1 35  ? 41.115 9.355  -2.611  1.00 26.62 ? 35  PHE A O   1 
ATOM   283  C  CB  . PHE A 1 35  ? 38.337 9.806  -1.040  1.00 20.95 ? 35  PHE A CB  1 
ATOM   284  C  CG  . PHE A 1 35  ? 37.496 10.345 0.082   1.00 19.58 ? 35  PHE A CG  1 
ATOM   285  C  CD1 . PHE A 1 35  ? 36.913 9.482  1.006   1.00 19.34 ? 35  PHE A CD1 1 
ATOM   286  C  CD2 . PHE A 1 35  ? 37.330 11.715 0.247   1.00 19.18 ? 35  PHE A CD2 1 
ATOM   287  C  CE1 . PHE A 1 35  ? 36.167 9.970  2.069   1.00 19.10 ? 35  PHE A CE1 1 
ATOM   288  C  CE2 . PHE A 1 35  ? 36.584 12.221 1.309   1.00 19.70 ? 35  PHE A CE2 1 
ATOM   289  C  CZ  . PHE A 1 35  ? 36.005 11.347 2.226   1.00 20.73 ? 35  PHE A CZ  1 
ATOM   290  N  N   . ILE A 1 36  ? 40.450 7.436  -1.665  1.00 26.15 ? 36  ILE A N   1 
ATOM   291  C  CA  . ILE A 1 36  ? 41.135 6.611  -2.644  1.00 26.77 ? 36  ILE A CA  1 
ATOM   292  C  C   . ILE A 1 36  ? 40.538 6.693  -4.056  1.00 26.41 ? 36  ILE A C   1 
ATOM   293  O  O   . ILE A 1 36  ? 41.275 6.765  -5.038  1.00 25.83 ? 36  ILE A O   1 
ATOM   294  C  CB  . ILE A 1 36  ? 41.189 5.135  -2.164  1.00 26.51 ? 36  ILE A CB  1 
ATOM   295  C  CG1 . ILE A 1 36  ? 42.120 4.331  -3.070  1.00 30.09 ? 36  ILE A CG1 1 
ATOM   296  C  CG2 . ILE A 1 36  ? 39.799 4.524  -2.157  1.00 27.70 ? 36  ILE A CG2 1 
ATOM   297  C  CD1 . ILE A 1 36  ? 43.529 4.888  -3.135  1.00 31.46 ? 36  ILE A CD1 1 
ATOM   298  N  N   . ASP A 1 37  ? 39.214 6.693  -4.170  1.00 26.44 ? 37  ASP A N   1 
ATOM   299  C  CA  . ASP A 1 37  ? 38.586 6.764  -5.491  1.00 27.44 ? 37  ASP A CA  1 
ATOM   300  C  C   . ASP A 1 37  ? 38.484 8.223  -5.930  1.00 28.33 ? 37  ASP A C   1 
ATOM   301  O  O   . ASP A 1 37  ? 37.428 8.843  -5.790  1.00 27.27 ? 37  ASP A O   1 
ATOM   302  C  CB  . ASP A 1 37  ? 37.185 6.154  -5.451  1.00 28.06 ? 37  ASP A CB  1 
ATOM   303  C  CG  . ASP A 1 37  ? 36.649 5.842  -6.836  1.00 29.39 ? 37  ASP A CG  1 
ATOM   304  O  OD1 . ASP A 1 37  ? 37.039 6.538  -7.798  1.00 30.12 ? 37  ASP A OD1 1 
ATOM   305  O  OD2 . ASP A 1 37  ? 35.832 4.906  -6.960  1.00 30.64 ? 37  ASP A OD2 1 
ATOM   306  N  N   . GLU A 1 38  ? 39.573 8.765  -6.472  1.00 28.87 ? 38  GLU A N   1 
ATOM   307  C  CA  . GLU A 1 38  ? 39.588 10.160 -6.888  1.00 32.23 ? 38  GLU A CA  1 
ATOM   308  C  C   . GLU A 1 38  ? 38.596 10.473 -8.005  1.00 32.07 ? 38  GLU A C   1 
ATOM   309  O  O   . GLU A 1 38  ? 38.144 11.607 -8.126  1.00 32.55 ? 38  GLU A O   1 
ATOM   310  C  CB  . GLU A 1 38  ? 41.007 10.590 -7.296  1.00 34.82 ? 38  GLU A CB  1 
ATOM   311  C  CG  . GLU A 1 38  ? 41.349 10.411 -8.770  1.00 41.63 ? 38  GLU A CG  1 
ATOM   312  C  CD  . GLU A 1 38  ? 42.745 10.924 -9.116  1.00 44.15 ? 38  GLU A CD  1 
ATOM   313  O  OE1 . GLU A 1 38  ? 43.115 10.883 -10.309 1.00 44.59 ? 38  GLU A OE1 1 
ATOM   314  O  OE2 . GLU A 1 38  ? 43.471 11.364 -8.195  1.00 46.29 ? 38  GLU A OE2 1 
ATOM   315  N  N   . GLU A 1 39  ? 38.255 9.476  -8.817  1.00 32.09 ? 39  GLU A N   1 
ATOM   316  C  CA  . GLU A 1 39  ? 37.293 9.688  -9.895  1.00 32.28 ? 39  GLU A CA  1 
ATOM   317  C  C   . GLU A 1 39  ? 35.898 9.842  -9.289  1.00 29.71 ? 39  GLU A C   1 
ATOM   318  O  O   . GLU A 1 39  ? 35.111 10.681 -9.722  1.00 28.02 ? 39  GLU A O   1 
ATOM   319  C  CB  . GLU A 1 39  ? 37.300 8.507  -10.871 1.00 34.92 ? 39  GLU A CB  1 
ATOM   320  C  CG  . GLU A 1 39  ? 38.631 8.274  -11.553 1.00 41.92 ? 39  GLU A CG  1 
ATOM   321  C  CD  . GLU A 1 39  ? 39.077 9.462  -12.383 1.00 47.59 ? 39  GLU A CD  1 
ATOM   322  O  OE1 . GLU A 1 39  ? 38.340 9.845  -13.319 1.00 49.79 ? 39  GLU A OE1 1 
ATOM   323  O  OE2 . GLU A 1 39  ? 40.165 10.012 -12.098 1.00 50.66 ? 39  GLU A OE2 1 
ATOM   324  N  N   . ALA A 1 40  ? 35.594 9.020  -8.289  1.00 28.12 ? 40  ALA A N   1 
ATOM   325  C  CA  . ALA A 1 40  ? 34.300 9.089  -7.620  1.00 26.43 ? 40  ALA A CA  1 
ATOM   326  C  C   . ALA A 1 40  ? 34.231 10.399 -6.843  1.00 26.17 ? 40  ALA A C   1 
ATOM   327  O  O   . ALA A 1 40  ? 33.156 10.977 -6.665  1.00 25.28 ? 40  ALA A O   1 
ATOM   328  C  CB  . ALA A 1 40  ? 34.132 7.913  -6.678  1.00 26.75 ? 40  ALA A CB  1 
ATOM   329  N  N   . TRP A 1 41  ? 35.391 10.861 -6.385  1.00 25.45 ? 41  TRP A N   1 
ATOM   330  C  CA  . TRP A 1 41  ? 35.483 12.112 -5.642  1.00 26.44 ? 41  TRP A CA  1 
ATOM   331  C  C   . TRP A 1 41  ? 35.116 13.272 -6.564  1.00 26.70 ? 41  TRP A C   1 
ATOM   332  O  O   . TRP A 1 41  ? 34.282 14.111 -6.223  1.00 26.83 ? 41  TRP A O   1 
ATOM   333  C  CB  . TRP A 1 41  ? 36.906 12.318 -5.119  1.00 25.68 ? 41  TRP A CB  1 
ATOM   334  C  CG  . TRP A 1 41  ? 37.080 13.580 -4.341  1.00 27.67 ? 41  TRP A CG  1 
ATOM   335  C  CD1 . TRP A 1 41  ? 36.783 13.781 -3.019  1.00 29.24 ? 41  TRP A CD1 1 
ATOM   336  C  CD2 . TRP A 1 41  ? 37.570 14.831 -4.835  1.00 28.87 ? 41  TRP A CD2 1 
ATOM   337  N  NE1 . TRP A 1 41  ? 37.062 15.080 -2.661  1.00 29.61 ? 41  TRP A NE1 1 
ATOM   338  C  CE2 . TRP A 1 41  ? 37.549 15.746 -3.757  1.00 29.55 ? 41  TRP A CE2 1 
ATOM   339  C  CE3 . TRP A 1 41  ? 38.031 15.268 -6.085  1.00 30.25 ? 41  TRP A CE3 1 
ATOM   340  C  CZ2 . TRP A 1 41  ? 37.964 17.073 -3.890  1.00 31.69 ? 41  TRP A CZ2 1 
ATOM   341  C  CZ3 . TRP A 1 41  ? 38.446 16.592 -6.220  1.00 31.02 ? 41  TRP A CZ3 1 
ATOM   342  C  CH2 . TRP A 1 41  ? 38.410 17.477 -5.126  1.00 32.12 ? 41  TRP A CH2 1 
ATOM   343  N  N   . LYS A 1 42  ? 35.749 13.305 -7.734  1.00 26.70 ? 42  LYS A N   1 
ATOM   344  C  CA  . LYS A 1 42  ? 35.509 14.352 -8.722  1.00 28.01 ? 42  LYS A CA  1 
ATOM   345  C  C   . LYS A 1 42  ? 34.042 14.439 -9.137  1.00 26.89 ? 42  LYS A C   1 
ATOM   346  O  O   . LYS A 1 42  ? 33.462 15.521 -9.206  1.00 27.44 ? 42  LYS A O   1 
ATOM   347  C  CB  . LYS A 1 42  ? 36.367 14.096 -9.959  1.00 29.57 ? 42  LYS A CB  1 
ATOM   348  C  CG  . LYS A 1 42  ? 36.186 15.115 -11.069 1.00 33.70 ? 42  LYS A CG  1 
ATOM   349  C  CD  . LYS A 1 42  ? 36.888 14.686 -12.359 1.00 38.58 ? 42  LYS A CD  1 
ATOM   350  C  CE  . LYS A 1 42  ? 38.398 14.540 -12.180 1.00 39.80 ? 42  LYS A CE  1 
ATOM   351  N  NZ  . LYS A 1 42  ? 38.772 13.470 -11.212 1.00 41.48 ? 42  LYS A NZ  1 
ATOM   352  N  N   . LYS A 1 43  ? 33.452 13.288 -9.419  1.00 27.54 ? 43  LYS A N   1 
ATOM   353  C  CA  . LYS A 1 43  ? 32.060 13.216 -9.841  1.00 27.98 ? 43  LYS A CA  1 
ATOM   354  C  C   . LYS A 1 43  ? 31.111 13.760 -8.776  1.00 28.45 ? 43  LYS A C   1 
ATOM   355  O  O   . LYS A 1 43  ? 30.159 14.475 -9.091  1.00 26.03 ? 43  LYS A O   1 
ATOM   356  C  CB  . LYS A 1 43  ? 31.707 11.762 -10.164 1.00 30.48 ? 43  LYS A CB  1 
ATOM   357  C  CG  . LYS A 1 43  ? 30.287 11.531 -10.650 1.00 33.71 ? 43  LYS A CG  1 
ATOM   358  C  CD  . LYS A 1 43  ? 30.076 10.057 -10.987 1.00 37.28 ? 43  LYS A CD  1 
ATOM   359  C  CE  . LYS A 1 43  ? 28.675 9.784  -11.532 1.00 39.07 ? 43  LYS A CE  1 
ATOM   360  N  NZ  . LYS A 1 43  ? 28.479 8.348  -11.879 1.00 39.94 ? 43  LYS A NZ  1 
ATOM   361  N  N   . MET A 1 44  ? 31.372 13.421 -7.515  1.00 26.39 ? 44  MET A N   1 
ATOM   362  C  CA  . MET A 1 44  ? 30.522 13.876 -6.426  1.00 25.70 ? 44  MET A CA  1 
ATOM   363  C  C   . MET A 1 44  ? 30.658 15.366 -6.168  1.00 24.18 ? 44  MET A C   1 
ATOM   364  O  O   . MET A 1 44  ? 29.708 16.007 -5.717  1.00 23.99 ? 44  MET A O   1 
ATOM   365  C  CB  . MET A 1 44  ? 30.822 13.088 -5.147  1.00 26.78 ? 44  MET A CB  1 
ATOM   366  C  CG  . MET A 1 44  ? 30.452 11.615 -5.248  1.00 26.45 ? 44  MET A CG  1 
ATOM   367  S  SD  . MET A 1 44  ? 30.610 10.720 -3.697  1.00 29.24 ? 44  MET A SD  1 
ATOM   368  C  CE  . MET A 1 44  ? 29.206 11.376 -2.780  1.00 19.23 ? 44  MET A CE  1 
ATOM   369  N  N   . VAL A 1 45  ? 31.832 15.921 -6.449  1.00 22.82 ? 45  VAL A N   1 
ATOM   370  C  CA  . VAL A 1 45  ? 32.038 17.350 -6.245  1.00 24.71 ? 45  VAL A CA  1 
ATOM   371  C  C   . VAL A 1 45  ? 31.207 18.135 -7.261  1.00 26.80 ? 45  VAL A C   1 
ATOM   372  O  O   . VAL A 1 45  ? 30.496 19.083 -6.896  1.00 25.80 ? 45  VAL A O   1 
ATOM   373  C  CB  . VAL A 1 45  ? 33.524 17.733 -6.384  1.00 24.85 ? 45  VAL A CB  1 
ATOM   374  C  CG1 . VAL A 1 45  ? 33.666 19.245 -6.439  1.00 24.88 ? 45  VAL A CG1 1 
ATOM   375  C  CG2 . VAL A 1 45  ? 34.313 17.183 -5.202  1.00 26.25 ? 45  VAL A CG2 1 
ATOM   376  N  N   . GLU A 1 46  ? 31.291 17.734 -8.530  1.00 27.33 ? 46  GLU A N   1 
ATOM   377  C  CA  . GLU A 1 46  ? 30.530 18.393 -9.589  1.00 29.00 ? 46  GLU A CA  1 
ATOM   378  C  C   . GLU A 1 46  ? 29.027 18.181 -9.422  1.00 27.52 ? 46  GLU A C   1 
ATOM   379  O  O   . GLU A 1 46  ? 28.230 19.034 -9.803  1.00 27.86 ? 46  GLU A O   1 
ATOM   380  C  CB  . GLU A 1 46  ? 30.960 17.879 -10.966 1.00 33.07 ? 46  GLU A CB  1 
ATOM   381  C  CG  . GLU A 1 46  ? 32.341 18.343 -11.397 1.00 38.22 ? 46  GLU A CG  1 
ATOM   382  C  CD  . GLU A 1 46  ? 32.654 17.990 -12.839 1.00 42.15 ? 46  GLU A CD  1 
ATOM   383  O  OE1 . GLU A 1 46  ? 31.996 18.541 -13.750 1.00 42.52 ? 46  GLU A OE1 1 
ATOM   384  O  OE2 . GLU A 1 46  ? 33.559 17.157 -13.057 1.00 44.64 ? 46  GLU A OE2 1 
ATOM   385  N  N   . GLU A 1 47  ? 28.644 17.046 -8.849  1.00 25.83 ? 47  GLU A N   1 
ATOM   386  C  CA  . GLU A 1 47  ? 27.235 16.739 -8.640  1.00 26.31 ? 47  GLU A CA  1 
ATOM   387  C  C   . GLU A 1 47  ? 26.590 17.535 -7.505  1.00 25.13 ? 47  GLU A C   1 
ATOM   388  O  O   . GLU A 1 47  ? 25.365 17.549 -7.375  1.00 24.38 ? 47  GLU A O   1 
ATOM   389  C  CB  . GLU A 1 47  ? 27.059 15.246 -8.359  1.00 29.61 ? 47  GLU A CB  1 
ATOM   390  C  CG  . GLU A 1 47  ? 27.280 14.336 -9.555  1.00 31.02 ? 47  GLU A CG  1 
ATOM   391  C  CD  . GLU A 1 47  ? 27.342 12.867 -9.154  1.00 34.21 ? 47  GLU A CD  1 
ATOM   392  O  OE1 . GLU A 1 47  ? 27.370 12.005 -10.055 1.00 37.09 ? 47  GLU A OE1 1 
ATOM   393  O  OE2 . GLU A 1 47  ? 27.373 12.574 -7.939  1.00 33.96 ? 47  GLU A OE2 1 
ATOM   394  N  N   . GLY A 1 48  ? 27.402 18.190 -6.679  1.00 23.99 ? 48  GLY A N   1 
ATOM   395  C  CA  . GLY A 1 48  ? 26.841 18.952 -5.577  1.00 23.09 ? 48  GLY A CA  1 
ATOM   396  C  C   . GLY A 1 48  ? 27.829 19.313 -4.484  1.00 25.21 ? 48  GLY A C   1 
ATOM   397  O  O   . GLY A 1 48  ? 27.535 20.163 -3.645  1.00 27.78 ? 48  GLY A O   1 
ATOM   398  N  N   . ASP A 1 49  ? 28.997 18.676 -4.486  1.00 24.70 ? 49  ASP A N   1 
ATOM   399  C  CA  . ASP A 1 49  ? 30.022 18.949 -3.484  1.00 25.56 ? 49  ASP A CA  1 
ATOM   400  C  C   . ASP A 1 49  ? 29.390 18.991 -2.093  1.00 24.29 ? 49  ASP A C   1 
ATOM   401  O  O   . ASP A 1 49  ? 29.390 20.020 -1.422  1.00 25.57 ? 49  ASP A O   1 
ATOM   402  C  CB  . ASP A 1 49  ? 30.714 20.279 -3.794  1.00 24.21 ? 49  ASP A CB  1 
ATOM   403  C  CG  . ASP A 1 49  ? 31.906 20.543 -2.894  1.00 24.56 ? 49  ASP A CG  1 
ATOM   404  O  OD1 . ASP A 1 49  ? 32.492 19.571 -2.368  1.00 23.69 ? 49  ASP A OD1 1 
ATOM   405  O  OD2 . ASP A 1 49  ? 32.271 21.726 -2.730  1.00 21.17 ? 49  ASP A OD2 1 
ATOM   406  N  N   . PRO A 1 50  ? 28.845 17.855 -1.644  1.00 23.37 ? 50  PRO A N   1 
ATOM   407  C  CA  . PRO A 1 50  ? 28.200 17.753 -0.334  1.00 23.07 ? 50  PRO A CA  1 
ATOM   408  C  C   . PRO A 1 50  ? 29.105 18.033 0.854   1.00 22.70 ? 50  PRO A C   1 
ATOM   409  O  O   . PRO A 1 50  ? 30.335 17.926 0.776   1.00 21.94 ? 50  PRO A O   1 
ATOM   410  C  CB  . PRO A 1 50  ? 27.675 16.321 -0.321  1.00 24.10 ? 50  PRO A CB  1 
ATOM   411  C  CG  . PRO A 1 50  ? 28.703 15.589 -1.146  1.00 24.12 ? 50  PRO A CG  1 
ATOM   412  C  CD  . PRO A 1 50  ? 28.900 16.538 -2.306  1.00 22.50 ? 50  PRO A CD  1 
ATOM   413  N  N   . VAL A 1 51  ? 28.468 18.406 1.954   1.00 21.33 ? 51  VAL A N   1 
ATOM   414  C  CA  . VAL A 1 51  ? 29.166 18.675 3.197   1.00 20.48 ? 51  VAL A CA  1 
ATOM   415  C  C   . VAL A 1 51  ? 29.475 17.316 3.818   1.00 19.24 ? 51  VAL A C   1 
ATOM   416  O  O   . VAL A 1 51  ? 28.603 16.455 3.926   1.00 18.66 ? 51  VAL A O   1 
ATOM   417  C  CB  . VAL A 1 51  ? 28.276 19.481 4.153   1.00 20.74 ? 51  VAL A CB  1 
ATOM   418  C  CG1 . VAL A 1 51  ? 28.929 19.577 5.535   1.00 21.37 ? 51  VAL A CG1 1 
ATOM   419  C  CG2 . VAL A 1 51  ? 28.024 20.869 3.558   1.00 19.98 ? 51  VAL A CG2 1 
ATOM   420  N  N   . VAL A 1 52  ? 30.727 17.118 4.197   1.00 19.44 ? 52  VAL A N   1 
ATOM   421  C  CA  . VAL A 1 52  ? 31.144 15.868 4.812   1.00 18.46 ? 52  VAL A CA  1 
ATOM   422  C  C   . VAL A 1 52  ? 30.912 15.996 6.322   1.00 18.53 ? 52  VAL A C   1 
ATOM   423  O  O   . VAL A 1 52  ? 30.375 15.091 6.956   1.00 18.41 ? 52  VAL A O   1 
ATOM   424  C  CB  . VAL A 1 52  ? 32.635 15.586 4.486   1.00 18.11 ? 52  VAL A CB  1 
ATOM   425  C  CG1 . VAL A 1 52  ? 33.085 14.278 5.118   1.00 19.66 ? 52  VAL A CG1 1 
ATOM   426  C  CG2 . VAL A 1 52  ? 32.815 15.518 2.969   1.00 17.34 ? 52  VAL A CG2 1 
ATOM   427  N  N   . TYR A 1 53  ? 31.303 17.132 6.892   1.00 18.91 ? 53  TYR A N   1 
ATOM   428  C  CA  . TYR A 1 53  ? 31.094 17.358 8.316   1.00 19.36 ? 53  TYR A CA  1 
ATOM   429  C  C   . TYR A 1 53  ? 31.140 18.819 8.713   1.00 19.23 ? 53  TYR A C   1 
ATOM   430  O  O   . TYR A 1 53  ? 31.648 19.671 7.973   1.00 16.45 ? 53  TYR A O   1 
ATOM   431  C  CB  . TYR A 1 53  ? 32.102 16.560 9.161   1.00 18.91 ? 53  TYR A CB  1 
ATOM   432  C  CG  . TYR A 1 53  ? 33.560 16.881 8.938   1.00 20.10 ? 53  TYR A CG  1 
ATOM   433  C  CD1 . TYR A 1 53  ? 34.227 17.817 9.731   1.00 18.70 ? 53  TYR A CD1 1 
ATOM   434  C  CD2 . TYR A 1 53  ? 34.291 16.205 7.960   1.00 22.46 ? 53  TYR A CD2 1 
ATOM   435  C  CE1 . TYR A 1 53  ? 35.589 18.062 9.560   1.00 17.81 ? 53  TYR A CE1 1 
ATOM   436  C  CE2 . TYR A 1 53  ? 35.643 16.444 7.778   1.00 20.43 ? 53  TYR A CE2 1 
ATOM   437  C  CZ  . TYR A 1 53  ? 36.288 17.369 8.578   1.00 20.85 ? 53  TYR A CZ  1 
ATOM   438  O  OH  . TYR A 1 53  ? 37.631 17.588 8.378   1.00 20.02 ? 53  TYR A OH  1 
ATOM   439  N  N   . GLU A 1 54  ? 30.580 19.089 9.888   1.00 18.11 ? 54  GLU A N   1 
ATOM   440  C  CA  . GLU A 1 54  ? 30.529 20.425 10.451  1.00 20.82 ? 54  GLU A CA  1 
ATOM   441  C  C   . GLU A 1 54  ? 31.011 20.330 11.895  1.00 20.59 ? 54  GLU A C   1 
ATOM   442  O  O   . GLU A 1 54  ? 30.719 19.353 12.596  1.00 17.86 ? 54  GLU A O   1 
ATOM   443  C  CB  . GLU A 1 54  ? 29.095 20.958 10.407  1.00 22.63 ? 54  GLU A CB  1 
ATOM   444  C  CG  . GLU A 1 54  ? 28.452 20.810 9.037   1.00 25.23 ? 54  GLU A CG  1 
ATOM   445  C  CD  . GLU A 1 54  ? 27.007 21.262 9.007   1.00 26.84 ? 54  GLU A CD  1 
ATOM   446  O  OE1 . GLU A 1 54  ? 26.252 20.898 9.927   1.00 26.09 ? 54  GLU A OE1 1 
ATOM   447  O  OE2 . GLU A 1 54  ? 26.622 21.969 8.053   1.00 31.60 ? 54  GLU A OE2 1 
ATOM   448  N  N   . VAL A 1 55  ? 31.761 21.340 12.321  1.00 18.37 ? 55  VAL A N   1 
ATOM   449  C  CA  . VAL A 1 55  ? 32.304 21.387 13.669  1.00 19.14 ? 55  VAL A CA  1 
ATOM   450  C  C   . VAL A 1 55  ? 31.849 22.646 14.409  1.00 20.39 ? 55  VAL A C   1 
ATOM   451  O  O   . VAL A 1 55  ? 31.840 23.746 13.845  1.00 21.76 ? 55  VAL A O   1 
ATOM   452  C  CB  . VAL A 1 55  ? 33.853 21.379 13.637  1.00 17.90 ? 55  VAL A CB  1 
ATOM   453  C  CG1 . VAL A 1 55  ? 34.419 21.213 15.059  1.00 13.14 ? 55  VAL A CG1 1 
ATOM   454  C  CG2 . VAL A 1 55  ? 34.342 20.272 12.716  1.00 16.66 ? 55  VAL A CG2 1 
ATOM   455  N  N   . TYR A 1 56  ? 31.468 22.467 15.670  1.00 17.99 ? 56  TYR A N   1 
ATOM   456  C  CA  . TYR A 1 56  ? 31.042 23.560 16.535  1.00 17.27 ? 56  TYR A CA  1 
ATOM   457  C  C   . TYR A 1 56  ? 32.038 23.549 17.699  1.00 18.05 ? 56  TYR A C   1 
ATOM   458  O  O   . TYR A 1 56  ? 31.945 22.708 18.599  1.00 17.80 ? 56  TYR A O   1 
ATOM   459  C  CB  . TYR A 1 56  ? 29.616 23.303 17.022  1.00 18.43 ? 56  TYR A CB  1 
ATOM   460  C  CG  . TYR A 1 56  ? 28.596 23.320 15.902  1.00 21.64 ? 56  TYR A CG  1 
ATOM   461  C  CD1 . TYR A 1 56  ? 27.956 24.505 15.527  1.00 23.15 ? 56  TYR A CD1 1 
ATOM   462  C  CD2 . TYR A 1 56  ? 28.301 22.161 15.188  1.00 21.74 ? 56  TYR A CD2 1 
ATOM   463  C  CE1 . TYR A 1 56  ? 27.041 24.528 14.460  1.00 25.08 ? 56  TYR A CE1 1 
ATOM   464  C  CE2 . TYR A 1 56  ? 27.395 22.174 14.125  1.00 23.30 ? 56  TYR A CE2 1 
ATOM   465  C  CZ  . TYR A 1 56  ? 26.770 23.357 13.769  1.00 24.21 ? 56  TYR A CZ  1 
ATOM   466  O  OH  . TYR A 1 56  ? 25.870 23.357 12.728  1.00 25.47 ? 56  TYR A OH  1 
ATOM   467  N  N   . ALA A 1 57  ? 32.994 24.478 17.667  1.00 17.41 ? 57  ALA A N   1 
ATOM   468  C  CA  . ALA A 1 57  ? 34.043 24.541 18.680  1.00 19.58 ? 57  ALA A CA  1 
ATOM   469  C  C   . ALA A 1 57  ? 34.083 25.773 19.585  1.00 20.50 ? 57  ALA A C   1 
ATOM   470  O  O   . ALA A 1 57  ? 33.704 26.876 19.199  1.00 21.83 ? 57  ALA A O   1 
ATOM   471  C  CB  . ALA A 1 57  ? 35.411 24.366 17.999  1.00 18.07 ? 57  ALA A CB  1 
ATOM   472  N  N   . ILE A 1 58  ? 34.553 25.556 20.807  1.00 21.59 ? 58  ILE A N   1 
ATOM   473  C  CA  . ILE A 1 58  ? 34.706 26.615 21.796  1.00 21.76 ? 58  ILE A CA  1 
ATOM   474  C  C   . ILE A 1 58  ? 36.106 26.395 22.327  1.00 22.38 ? 58  ILE A C   1 
ATOM   475  O  O   . ILE A 1 58  ? 36.369 25.438 23.060  1.00 21.13 ? 58  ILE A O   1 
ATOM   476  C  CB  . ILE A 1 58  ? 33.668 26.505 22.935  1.00 20.85 ? 58  ILE A CB  1 
ATOM   477  C  CG1 . ILE A 1 58  ? 32.295 26.949 22.417  1.00 22.36 ? 58  ILE A CG1 1 
ATOM   478  C  CG2 . ILE A 1 58  ? 34.090 27.370 24.119  1.00 21.40 ? 58  ILE A CG2 1 
ATOM   479  C  CD1 . ILE A 1 58  ? 31.203 26.969 23.475  1.00 22.47 ? 58  ILE A CD1 1 
ATOM   480  N  N   . GLU A 1 59  ? 37.007 27.280 21.928  1.00 23.16 ? 59  GLU A N   1 
ATOM   481  C  CA  . GLU A 1 59  ? 38.401 27.167 22.307  1.00 25.09 ? 59  GLU A CA  1 
ATOM   482  C  C   . GLU A 1 59  ? 38.926 28.356 23.097  1.00 25.27 ? 59  GLU A C   1 
ATOM   483  O  O   . GLU A 1 59  ? 38.458 29.481 22.933  1.00 24.94 ? 59  GLU A O   1 
ATOM   484  C  CB  . GLU A 1 59  ? 39.233 26.970 21.039  1.00 26.56 ? 59  GLU A CB  1 
ATOM   485  C  CG  . GLU A 1 59  ? 38.737 25.800 20.194  1.00 30.84 ? 59  GLU A CG  1 
ATOM   486  C  CD  . GLU A 1 59  ? 39.413 25.705 18.840  1.00 33.08 ? 59  GLU A CD  1 
ATOM   487  O  OE1 . GLU A 1 59  ? 39.308 26.669 18.051  1.00 34.20 ? 59  GLU A OE1 1 
ATOM   488  O  OE2 . GLU A 1 59  ? 40.040 24.661 18.562  1.00 34.99 ? 59  GLU A OE2 1 
ATOM   489  N  N   . GLN A 1 60  ? 39.895 28.082 23.965  1.00 24.70 ? 60  GLN A N   1 
ATOM   490  C  CA  . GLN A 1 60  ? 40.532 29.105 24.790  1.00 25.42 ? 60  GLN A CA  1 
ATOM   491  C  C   . GLN A 1 60  ? 41.884 29.413 24.150  1.00 25.52 ? 60  GLN A C   1 
ATOM   492  O  O   . GLN A 1 60  ? 42.243 28.817 23.138  1.00 24.64 ? 60  GLN A O   1 
ATOM   493  C  CB  . GLN A 1 60  ? 40.754 28.571 26.206  1.00 24.56 ? 60  GLN A CB  1 
ATOM   494  C  CG  . GLN A 1 60  ? 39.519 27.933 26.812  1.00 24.72 ? 60  GLN A CG  1 
ATOM   495  C  CD  . GLN A 1 60  ? 38.366 28.909 26.920  1.00 25.67 ? 60  GLN A CD  1 
ATOM   496  O  OE1 . GLN A 1 60  ? 37.199 28.531 26.773  1.00 27.82 ? 60  GLN A OE1 1 
ATOM   497  N  NE2 . GLN A 1 60  ? 38.684 30.171 27.185  1.00 21.23 ? 60  GLN A NE2 1 
ATOM   498  N  N   . GLU A 1 61  ? 42.634 30.341 24.726  1.00 28.22 ? 61  GLU A N   1 
ATOM   499  C  CA  . GLU A 1 61  ? 43.949 30.650 24.179  1.00 31.67 ? 61  GLU A CA  1 
ATOM   500  C  C   . GLU A 1 61  ? 44.817 29.410 24.380  1.00 32.27 ? 61  GLU A C   1 
ATOM   501  O  O   . GLU A 1 61  ? 44.684 28.711 25.389  1.00 31.58 ? 61  GLU A O   1 
ATOM   502  C  CB  . GLU A 1 61  ? 44.563 31.854 24.896  1.00 33.61 ? 61  GLU A CB  1 
ATOM   503  C  CG  . GLU A 1 61  ? 43.811 33.154 24.651  1.00 40.06 ? 61  GLU A CG  1 
ATOM   504  C  CD  . GLU A 1 61  ? 44.477 34.350 25.307  1.00 43.37 ? 61  GLU A CD  1 
ATOM   505  O  OE1 . GLU A 1 61  ? 44.558 34.383 26.555  1.00 45.27 ? 61  GLU A OE1 1 
ATOM   506  O  OE2 . GLU A 1 61  ? 44.921 35.256 24.569  1.00 44.58 ? 61  GLU A OE2 1 
ATOM   507  N  N   . GLU A 1 62  ? 45.690 29.127 23.417  1.00 33.80 ? 62  GLU A N   1 
ATOM   508  C  CA  . GLU A 1 62  ? 46.555 27.956 23.502  1.00 36.17 ? 62  GLU A CA  1 
ATOM   509  C  C   . GLU A 1 62  ? 47.511 28.090 24.677  1.00 36.42 ? 62  GLU A C   1 
ATOM   510  O  O   . GLU A 1 62  ? 48.643 28.561 24.536  1.00 38.51 ? 62  GLU A O   1 
ATOM   511  C  CB  . GLU A 1 62  ? 47.326 27.767 22.189  1.00 37.01 ? 62  GLU A CB  1 
ATOM   512  C  CG  . GLU A 1 62  ? 46.410 27.474 21.003  1.00 41.41 ? 62  GLU A CG  1 
ATOM   513  C  CD  . GLU A 1 62  ? 47.151 27.357 19.681  1.00 44.78 ? 62  GLU A CD  1 
ATOM   514  O  OE1 . GLU A 1 62  ? 47.852 28.318 19.298  1.00 45.13 ? 62  GLU A OE1 1 
ATOM   515  O  OE2 . GLU A 1 62  ? 47.026 26.304 19.017  1.00 46.72 ? 62  GLU A OE2 1 
ATOM   516  N  N   . LYS A 1 63  ? 47.035 27.670 25.841  1.00 34.44 ? 63  LYS A N   1 
ATOM   517  C  CA  . LYS A 1 63  ? 47.813 27.738 27.062  1.00 35.06 ? 63  LYS A CA  1 
ATOM   518  C  C   . LYS A 1 63  ? 47.808 26.385 27.762  1.00 33.12 ? 63  LYS A C   1 
ATOM   519  O  O   . LYS A 1 63  ? 46.840 25.630 27.676  1.00 31.76 ? 63  LYS A O   1 
ATOM   520  C  CB  . LYS A 1 63  ? 47.234 28.810 27.990  1.00 37.21 ? 63  LYS A CB  1 
ATOM   521  C  CG  . LYS A 1 63  ? 48.115 29.174 29.181  1.00 41.94 ? 63  LYS A CG  1 
ATOM   522  C  CD  . LYS A 1 63  ? 49.353 29.996 28.775  1.00 45.30 ? 63  LYS A CD  1 
ATOM   523  C  CE  . LYS A 1 63  ? 50.413 29.168 28.038  1.00 46.71 ? 63  LYS A CE  1 
ATOM   524  N  NZ  . LYS A 1 63  ? 50.982 28.065 28.876  1.00 46.19 ? 63  LYS A NZ  1 
ATOM   525  N  N   . GLU A 1 64  ? 48.898 26.097 28.462  1.00 31.28 ? 64  GLU A N   1 
ATOM   526  C  CA  . GLU A 1 64  ? 49.064 24.843 29.179  1.00 30.38 ? 64  GLU A CA  1 
ATOM   527  C  C   . GLU A 1 64  ? 47.999 24.640 30.255  1.00 28.26 ? 64  GLU A C   1 
ATOM   528  O  O   . GLU A 1 64  ? 47.672 25.559 31.004  1.00 28.45 ? 64  GLU A O   1 
ATOM   529  C  CB  . GLU A 1 64  ? 50.450 24.810 29.827  1.00 33.24 ? 64  GLU A CB  1 
ATOM   530  C  CG  . GLU A 1 64  ? 51.046 23.425 29.976  1.00 38.36 ? 64  GLU A CG  1 
ATOM   531  C  CD  . GLU A 1 64  ? 52.373 23.451 30.704  1.00 42.90 ? 64  GLU A CD  1 
ATOM   532  O  OE1 . GLU A 1 64  ? 52.376 23.491 31.959  1.00 42.29 ? 64  GLU A OE1 1 
ATOM   533  O  OE2 . GLU A 1 64  ? 53.417 23.447 30.013  1.00 46.52 ? 64  GLU A OE2 1 
ATOM   534  N  N   . GLY A 1 65  ? 47.460 23.430 30.323  1.00 25.68 ? 65  GLY A N   1 
ATOM   535  C  CA  . GLY A 1 65  ? 46.465 23.120 31.332  1.00 25.68 ? 65  GLY A CA  1 
ATOM   536  C  C   . GLY A 1 65  ? 45.021 23.501 31.052  1.00 23.00 ? 65  GLY A C   1 
ATOM   537  O  O   . GLY A 1 65  ? 44.134 23.107 31.806  1.00 23.11 ? 65  GLY A O   1 
ATOM   538  N  N   . ASP A 1 66  ? 44.773 24.262 29.991  1.00 23.57 ? 66  ASP A N   1 
ATOM   539  C  CA  . ASP A 1 66  ? 43.404 24.667 29.675  1.00 22.36 ? 66  ASP A CA  1 
ATOM   540  C  C   . ASP A 1 66  ? 42.762 23.640 28.741  1.00 21.85 ? 66  ASP A C   1 
ATOM   541  O  O   . ASP A 1 66  ? 43.441 22.735 28.239  1.00 22.31 ? 66  ASP A O   1 
ATOM   542  C  CB  . ASP A 1 66  ? 43.393 26.068 29.054  1.00 21.38 ? 66  ASP A CB  1 
ATOM   543  C  CG  . ASP A 1 66  ? 42.078 26.796 29.280  1.00 21.39 ? 66  ASP A CG  1 
ATOM   544  O  OD1 . ASP A 1 66  ? 42.067 28.040 29.188  1.00 21.39 ? 66  ASP A OD1 1 
ATOM   545  O  OD2 . ASP A 1 66  ? 41.053 26.131 29.546  1.00 22.40 ? 66  ASP A OD2 1 
ATOM   546  N  N   . LEU A 1 67  ? 41.462 23.776 28.503  1.00 19.12 ? 67  LEU A N   1 
ATOM   547  C  CA  . LEU A 1 67  ? 40.754 22.809 27.668  1.00 17.69 ? 67  LEU A CA  1 
ATOM   548  C  C   . LEU A 1 67  ? 39.804 23.374 26.618  1.00 16.90 ? 67  LEU A C   1 
ATOM   549  O  O   . LEU A 1 67  ? 39.117 24.366 26.853  1.00 16.29 ? 67  LEU A O   1 
ATOM   550  C  CB  . LEU A 1 67  ? 39.964 21.861 28.568  1.00 16.21 ? 67  LEU A CB  1 
ATOM   551  C  CG  . LEU A 1 67  ? 40.729 21.001 29.575  1.00 18.95 ? 67  LEU A CG  1 
ATOM   552  C  CD1 . LEU A 1 67  ? 39.757 20.471 30.627  1.00 16.53 ? 67  LEU A CD1 1 
ATOM   553  C  CD2 . LEU A 1 67  ? 41.449 19.857 28.844  1.00 18.14 ? 67  LEU A CD2 1 
ATOM   554  N  N   . ASN A 1 68  ? 39.777 22.726 25.458  1.00 16.48 ? 68  ASN A N   1 
ATOM   555  C  CA  . ASN A 1 68  ? 38.887 23.105 24.368  1.00 16.35 ? 68  ASN A CA  1 
ATOM   556  C  C   . ASN A 1 68  ? 37.929 21.937 24.187  1.00 15.47 ? 68  ASN A C   1 
ATOM   557  O  O   . ASN A 1 68  ? 38.233 20.816 24.577  1.00 16.69 ? 68  ASN A O   1 
ATOM   558  C  CB  . ASN A 1 68  ? 39.646 23.299 23.049  1.00 16.82 ? 68  ASN A CB  1 
ATOM   559  C  CG  . ASN A 1 68  ? 40.593 24.486 23.075  1.00 19.14 ? 68  ASN A CG  1 
ATOM   560  O  OD1 . ASN A 1 68  ? 40.539 25.329 23.973  1.00 18.55 ? 68  ASN A OD1 1 
ATOM   561  N  ND2 . ASN A 1 68  ? 41.460 24.563 22.071  1.00 17.23 ? 68  ASN A ND2 1 
ATOM   562  N  N   . PHE A 1 69  ? 36.776 22.198 23.592  1.00 16.20 ? 69  PHE A N   1 
ATOM   563  C  CA  . PHE A 1 69  ? 35.811 21.139 23.337  1.00 16.77 ? 69  PHE A CA  1 
ATOM   564  C  C   . PHE A 1 69  ? 35.013 21.491 22.094  1.00 16.48 ? 69  PHE A C   1 
ATOM   565  O  O   . PHE A 1 69  ? 34.845 22.666 21.766  1.00 17.04 ? 69  PHE A O   1 
ATOM   566  C  CB  . PHE A 1 69  ? 34.895 20.920 24.551  1.00 14.45 ? 69  PHE A CB  1 
ATOM   567  C  CG  . PHE A 1 69  ? 34.068 22.108 24.927  1.00 17.93 ? 69  PHE A CG  1 
ATOM   568  C  CD1 . PHE A 1 69  ? 32.802 22.299 24.373  1.00 18.61 ? 69  PHE A CD1 1 
ATOM   569  C  CD2 . PHE A 1 69  ? 34.533 23.022 25.868  1.00 20.05 ? 69  PHE A CD2 1 
ATOM   570  C  CE1 . PHE A 1 69  ? 32.007 23.385 24.760  1.00 18.36 ? 69  PHE A CE1 1 
ATOM   571  C  CE2 . PHE A 1 69  ? 33.748 24.111 26.261  1.00 19.39 ? 69  PHE A CE2 1 
ATOM   572  C  CZ  . PHE A 1 69  ? 32.480 24.289 25.703  1.00 20.53 ? 69  PHE A CZ  1 
ATOM   573  N  N   . ALA A 1 70  ? 34.546 20.469 21.388  1.00 16.37 ? 70  ALA A N   1 
ATOM   574  C  CA  . ALA A 1 70  ? 33.785 20.695 20.172  1.00 16.36 ? 70  ALA A CA  1 
ATOM   575  C  C   . ALA A 1 70  ? 32.996 19.470 19.757  1.00 17.13 ? 70  ALA A C   1 
ATOM   576  O  O   . ALA A 1 70  ? 33.373 18.334 20.053  1.00 18.14 ? 70  ALA A O   1 
ATOM   577  C  CB  . ALA A 1 70  ? 34.726 21.102 19.041  1.00 16.91 ? 70  ALA A CB  1 
ATOM   578  N  N   . THR A 1 71  ? 31.882 19.715 19.082  1.00 16.63 ? 71  THR A N   1 
ATOM   579  C  CA  . THR A 1 71  ? 31.057 18.640 18.571  1.00 15.45 ? 71  THR A CA  1 
ATOM   580  C  C   . THR A 1 71  ? 31.304 18.570 17.076  1.00 16.04 ? 71  THR A C   1 
ATOM   581  O  O   . THR A 1 71  ? 31.719 19.546 16.455  1.00 16.10 ? 71  THR A O   1 
ATOM   582  C  CB  . THR A 1 71  ? 29.555 18.900 18.780  1.00 15.91 ? 71  THR A CB  1 
ATOM   583  O  OG1 . THR A 1 71  ? 29.259 20.269 18.466  1.00 15.86 ? 71  THR A OG1 1 
ATOM   584  C  CG2 . THR A 1 71  ? 29.146 18.580 20.212  1.00 13.25 ? 71  THR A CG2 1 
ATOM   585  N  N   . THR A 1 72  ? 31.080 17.398 16.505  1.00 17.81 ? 72  THR A N   1 
ATOM   586  C  CA  . THR A 1 72  ? 31.220 17.225 15.073  1.00 16.52 ? 72  THR A CA  1 
ATOM   587  C  C   . THR A 1 72  ? 29.979 16.496 14.595  1.00 17.87 ? 72  THR A C   1 
ATOM   588  O  O   . THR A 1 72  ? 29.481 15.581 15.258  1.00 19.17 ? 72  THR A O   1 
ATOM   589  C  CB  . THR A 1 72  ? 32.452 16.373 14.672  1.00 14.80 ? 72  THR A CB  1 
ATOM   590  O  OG1 . THR A 1 72  ? 33.659 17.036 15.070  1.00 13.91 ? 72  THR A OG1 1 
ATOM   591  C  CG2 . THR A 1 72  ? 32.482 16.183 13.152  1.00 14.52 ? 72  THR A CG2 1 
ATOM   592  N  N   . VAL A 1 73  ? 29.463 16.937 13.458  1.00 18.14 ? 73  VAL A N   1 
ATOM   593  C  CA  . VAL A 1 73  ? 28.318 16.299 12.846  1.00 16.94 ? 73  VAL A CA  1 
ATOM   594  C  C   . VAL A 1 73  ? 28.905 15.789 11.544  1.00 18.02 ? 73  VAL A C   1 
ATOM   595  O  O   . VAL A 1 73  ? 29.157 16.558 10.610  1.00 17.66 ? 73  VAL A O   1 
ATOM   596  C  CB  . VAL A 1 73  ? 27.168 17.298 12.596  1.00 17.99 ? 73  VAL A CB  1 
ATOM   597  C  CG1 . VAL A 1 73  ? 26.051 16.638 11.776  1.00 17.51 ? 73  VAL A CG1 1 
ATOM   598  C  CG2 . VAL A 1 73  ? 26.602 17.750 13.925  1.00 16.00 ? 73  VAL A CG2 1 
ATOM   599  N  N   . LEU A 1 74  ? 29.176 14.488 11.522  1.00 17.74 ? 74  LEU A N   1 
ATOM   600  C  CA  . LEU A 1 74  ? 29.759 13.829 10.366  1.00 19.55 ? 74  LEU A CA  1 
ATOM   601  C  C   . LEU A 1 74  ? 28.621 13.188 9.593   1.00 21.02 ? 74  LEU A C   1 
ATOM   602  O  O   . LEU A 1 74  ? 27.997 12.237 10.065  1.00 19.81 ? 74  LEU A O   1 
ATOM   603  C  CB  . LEU A 1 74  ? 30.776 12.781 10.834  1.00 18.58 ? 74  LEU A CB  1 
ATOM   604  C  CG  . LEU A 1 74  ? 31.448 11.823 9.847   1.00 21.13 ? 74  LEU A CG  1 
ATOM   605  C  CD1 . LEU A 1 74  ? 31.842 12.539 8.554   1.00 19.85 ? 74  LEU A CD1 1 
ATOM   606  C  CD2 . LEU A 1 74  ? 32.676 11.225 10.533  1.00 17.09 ? 74  LEU A CD2 1 
ATOM   607  N  N   . TYR A 1 75  ? 28.352 13.730 8.406   1.00 20.76 ? 75  TYR A N   1 
ATOM   608  C  CA  . TYR A 1 75  ? 27.267 13.252 7.560   1.00 19.97 ? 75  TYR A CA  1 
ATOM   609  C  C   . TYR A 1 75  ? 27.516 11.895 6.925   1.00 20.52 ? 75  TYR A C   1 
ATOM   610  O  O   . TYR A 1 75  ? 28.657 11.528 6.640   1.00 20.41 ? 75  TYR A O   1 
ATOM   611  C  CB  . TYR A 1 75  ? 26.960 14.305 6.492   1.00 21.59 ? 75  TYR A CB  1 
ATOM   612  C  CG  . TYR A 1 75  ? 26.346 15.535 7.101   1.00 21.54 ? 75  TYR A CG  1 
ATOM   613  C  CD1 . TYR A 1 75  ? 24.977 15.595 7.357   1.00 21.96 ? 75  TYR A CD1 1 
ATOM   614  C  CD2 . TYR A 1 75  ? 27.147 16.595 7.533   1.00 21.18 ? 75  TYR A CD2 1 
ATOM   615  C  CE1 . TYR A 1 75  ? 24.415 16.674 8.038   1.00 24.01 ? 75  TYR A CE1 1 
ATOM   616  C  CE2 . TYR A 1 75  ? 26.595 17.680 8.218   1.00 21.07 ? 75  TYR A CE2 1 
ATOM   617  C  CZ  . TYR A 1 75  ? 25.230 17.712 8.469   1.00 22.36 ? 75  TYR A CZ  1 
ATOM   618  O  OH  . TYR A 1 75  ? 24.679 18.762 9.173   1.00 21.56 ? 75  TYR A OH  1 
ATOM   619  N  N   . PRO A 1 76  ? 26.435 11.128 6.696   1.00 19.99 ? 76  PRO A N   1 
ATOM   620  C  CA  . PRO A 1 76  ? 26.500 9.794  6.095   1.00 20.92 ? 76  PRO A CA  1 
ATOM   621  C  C   . PRO A 1 76  ? 26.774 9.868  4.599   1.00 21.28 ? 76  PRO A C   1 
ATOM   622  O  O   . PRO A 1 76  ? 26.367 10.819 3.929   1.00 20.79 ? 76  PRO A O   1 
ATOM   623  C  CB  . PRO A 1 76  ? 25.123 9.215  6.412   1.00 20.99 ? 76  PRO A CB  1 
ATOM   624  C  CG  . PRO A 1 76  ? 24.233 10.427 6.265   1.00 19.73 ? 76  PRO A CG  1 
ATOM   625  C  CD  . PRO A 1 76  ? 25.037 11.512 6.978   1.00 19.19 ? 76  PRO A CD  1 
ATOM   626  N  N   . GLY A 1 77  ? 27.473 8.863  4.082   1.00 23.06 ? 77  GLY A N   1 
ATOM   627  C  CA  . GLY A 1 77  ? 27.790 8.837  2.667   1.00 23.47 ? 77  GLY A CA  1 
ATOM   628  C  C   . GLY A 1 77  ? 29.062 8.072  2.380   1.00 25.16 ? 77  GLY A C   1 
ATOM   629  O  O   . GLY A 1 77  ? 29.724 7.589  3.302   1.00 25.47 ? 77  GLY A O   1 
ATOM   630  N  N   . LYS A 1 78  ? 29.402 7.960  1.100   1.00 24.58 ? 78  LYS A N   1 
ATOM   631  C  CA  . LYS A 1 78  ? 30.611 7.259  0.676   1.00 27.55 ? 78  LYS A CA  1 
ATOM   632  C  C   . LYS A 1 78  ? 31.157 7.805  -0.635  1.00 26.44 ? 78  LYS A C   1 
ATOM   633  O  O   . LYS A 1 78  ? 30.403 8.273  -1.489  1.00 26.91 ? 78  LYS A O   1 
ATOM   634  C  CB  . LYS A 1 78  ? 30.345 5.759  0.476   1.00 28.32 ? 78  LYS A CB  1 
ATOM   635  C  CG  . LYS A 1 78  ? 29.974 4.985  1.727   1.00 32.18 ? 78  LYS A CG  1 
ATOM   636  C  CD  . LYS A 1 78  ? 29.998 3.479  1.466   1.00 33.66 ? 78  LYS A CD  1 
ATOM   637  C  CE  . LYS A 1 78  ? 28.977 3.065  0.419   1.00 36.25 ? 78  LYS A CE  1 
ATOM   638  N  NZ  . LYS A 1 78  ? 27.573 3.300  0.871   1.00 37.66 ? 78  LYS A NZ  1 
ATOM   639  N  N   . VAL A 1 79  ? 32.477 7.747  -0.776  1.00 24.76 ? 79  VAL A N   1 
ATOM   640  C  CA  . VAL A 1 79  ? 33.146 8.164  -1.999  1.00 24.66 ? 79  VAL A CA  1 
ATOM   641  C  C   . VAL A 1 79  ? 33.612 6.820  -2.549  1.00 26.18 ? 79  VAL A C   1 
ATOM   642  O  O   . VAL A 1 79  ? 34.580 6.242  -2.050  1.00 24.27 ? 79  VAL A O   1 
ATOM   643  C  CB  . VAL A 1 79  ? 34.356 9.055  -1.708  1.00 23.17 ? 79  VAL A CB  1 
ATOM   644  C  CG1 . VAL A 1 79  ? 35.012 9.477  -3.018  1.00 22.59 ? 79  VAL A CG1 1 
ATOM   645  C  CG2 . VAL A 1 79  ? 33.917 10.267 -0.902  1.00 20.12 ? 79  VAL A CG2 1 
ATOM   646  N  N   . GLY A 1 80  ? 32.924 6.325  -3.574  1.00 25.44 ? 80  GLY A N   1 
ATOM   647  C  CA  . GLY A 1 80  ? 33.255 5.012  -4.096  1.00 26.76 ? 80  GLY A CA  1 
ATOM   648  C  C   . GLY A 1 80  ? 32.629 4.101  -3.051  1.00 26.78 ? 80  GLY A C   1 
ATOM   649  O  O   . GLY A 1 80  ? 31.406 4.055  -2.926  1.00 27.17 ? 80  GLY A O   1 
ATOM   650  N  N   . ASN A 1 81  ? 33.448 3.391  -2.286  1.00 27.83 ? 81  ASN A N   1 
ATOM   651  C  CA  . ASN A 1 81  ? 32.919 2.545  -1.219  1.00 29.87 ? 81  ASN A CA  1 
ATOM   652  C  C   . ASN A 1 81  ? 33.595 2.916  0.105   1.00 28.24 ? 81  ASN A C   1 
ATOM   653  O  O   . ASN A 1 81  ? 33.531 2.174  1.088   1.00 28.96 ? 81  ASN A O   1 
ATOM   654  C  CB  . ASN A 1 81  ? 33.131 1.061  -1.538  1.00 33.24 ? 81  ASN A CB  1 
ATOM   655  C  CG  . ASN A 1 81  ? 34.570 0.733  -1.858  1.00 36.61 ? 81  ASN A CG  1 
ATOM   656  O  OD1 . ASN A 1 81  ? 35.461 0.908  -1.028  1.00 38.21 ? 81  ASN A OD1 1 
ATOM   657  N  ND2 . ASN A 1 81  ? 34.806 0.249  -3.074  1.00 40.73 ? 81  ASN A ND2 1 
ATOM   658  N  N   . GLU A 1 82  ? 34.231 4.085  0.118   1.00 25.66 ? 82  GLU A N   1 
ATOM   659  C  CA  . GLU A 1 82  ? 34.926 4.577  1.299   1.00 24.43 ? 82  GLU A CA  1 
ATOM   660  C  C   . GLU A 1 82  ? 34.016 5.544  2.068   1.00 24.38 ? 82  GLU A C   1 
ATOM   661  O  O   . GLU A 1 82  ? 33.622 6.583  1.544   1.00 23.90 ? 82  GLU A O   1 
ATOM   662  C  CB  . GLU A 1 82  ? 36.222 5.264  0.859   1.00 23.78 ? 82  GLU A CB  1 
ATOM   663  C  CG  . GLU A 1 82  ? 37.125 5.739  1.984   1.00 21.59 ? 82  GLU A CG  1 
ATOM   664  C  CD  . GLU A 1 82  ? 38.505 6.120  1.482   1.00 22.78 ? 82  GLU A CD  1 
ATOM   665  O  OE1 . GLU A 1 82  ? 38.641 6.435  0.281   1.00 26.26 ? 82  GLU A OE1 1 
ATOM   666  O  OE2 . GLU A 1 82  ? 39.457 6.113  2.284   1.00 23.97 ? 82  GLU A OE2 1 
ATOM   667  N  N   . PHE A 1 83  ? 33.681 5.185  3.307   1.00 23.02 ? 83  PHE A N   1 
ATOM   668  C  CA  . PHE A 1 83  ? 32.806 5.999  4.159   1.00 22.58 ? 83  PHE A CA  1 
ATOM   669  C  C   . PHE A 1 83  ? 33.292 7.433  4.383   1.00 22.83 ? 83  PHE A C   1 
ATOM   670  O  O   . PHE A 1 83  ? 34.500 7.686  4.457   1.00 21.15 ? 83  PHE A O   1 
ATOM   671  C  CB  . PHE A 1 83  ? 32.638 5.338  5.536   1.00 24.01 ? 83  PHE A CB  1 
ATOM   672  C  CG  . PHE A 1 83  ? 31.880 4.034  5.515   1.00 23.08 ? 83  PHE A CG  1 
ATOM   673  C  CD1 . PHE A 1 83  ? 30.514 4.012  5.255   1.00 23.27 ? 83  PHE A CD1 1 
ATOM   674  C  CD2 . PHE A 1 83  ? 32.530 2.835  5.789   1.00 23.26 ? 83  PHE A CD2 1 
ATOM   675  C  CE1 . PHE A 1 83  ? 29.799 2.814  5.273   1.00 20.91 ? 83  PHE A CE1 1 
ATOM   676  C  CE2 . PHE A 1 83  ? 31.828 1.631  5.808   1.00 21.65 ? 83  PHE A CE2 1 
ATOM   677  C  CZ  . PHE A 1 83  ? 30.456 1.624  5.549   1.00 23.81 ? 83  PHE A CZ  1 
ATOM   678  N  N   . PHE A 1 84  ? 32.337 8.360  4.495   1.00 21.92 ? 84  PHE A N   1 
ATOM   679  C  CA  . PHE A 1 84  ? 32.635 9.766  4.760   1.00 20.93 ? 84  PHE A CA  1 
ATOM   680  C  C   . PHE A 1 84  ? 33.441 9.764  6.056   1.00 20.97 ? 84  PHE A C   1 
ATOM   681  O  O   . PHE A 1 84  ? 33.177 8.960  6.958   1.00 19.37 ? 84  PHE A O   1 
ATOM   682  C  CB  . PHE A 1 84  ? 31.334 10.566 4.928   1.00 20.12 ? 84  PHE A CB  1 
ATOM   683  C  CG  . PHE A 1 84  ? 30.771 11.106 3.635   1.00 21.21 ? 84  PHE A CG  1 
ATOM   684  C  CD1 . PHE A 1 84  ? 31.034 10.478 2.417   1.00 22.72 ? 84  PHE A CD1 1 
ATOM   685  C  CD2 . PHE A 1 84  ? 29.963 12.242 3.638   1.00 22.80 ? 84  PHE A CD2 1 
ATOM   686  C  CE1 . PHE A 1 84  ? 30.506 10.973 1.221   1.00 24.04 ? 84  PHE A CE1 1 
ATOM   687  C  CE2 . PHE A 1 84  ? 29.429 12.750 2.446   1.00 24.83 ? 84  PHE A CE2 1 
ATOM   688  C  CZ  . PHE A 1 84  ? 29.699 12.113 1.235   1.00 24.54 ? 84  PHE A CZ  1 
ATOM   689  N  N   . MET A 1 85  ? 34.411 10.666 6.146   1.00 19.58 ? 85  MET A N   1 
ATOM   690  C  CA  . MET A 1 85  ? 35.312 10.716 7.291   1.00 19.00 ? 85  MET A CA  1 
ATOM   691  C  C   . MET A 1 85  ? 35.883 12.113 7.460   1.00 18.64 ? 85  MET A C   1 
ATOM   692  O  O   . MET A 1 85  ? 35.776 12.940 6.565   1.00 19.49 ? 85  MET A O   1 
ATOM   693  C  CB  . MET A 1 85  ? 36.468 9.750  7.027   1.00 20.10 ? 85  MET A CB  1 
ATOM   694  C  CG  . MET A 1 85  ? 37.196 10.098 5.711   1.00 19.50 ? 85  MET A CG  1 
ATOM   695  S  SD  . MET A 1 85  ? 38.311 8.851  5.043   1.00 20.84 ? 85  MET A SD  1 
ATOM   696  C  CE  . MET A 1 85  ? 39.270 9.837  3.856   1.00 18.62 ? 85  MET A CE  1 
ATOM   697  N  N   . THR A 1 86  ? 36.492 12.367 8.613   1.00 18.91 ? 86  THR A N   1 
ATOM   698  C  CA  . THR A 1 86  ? 37.129 13.654 8.866   1.00 17.97 ? 86  THR A CA  1 
ATOM   699  C  C   . THR A 1 86  ? 38.535 13.564 8.265   1.00 18.28 ? 86  THR A C   1 
ATOM   700  O  O   . THR A 1 86  ? 39.014 12.469 7.958   1.00 15.40 ? 86  THR A O   1 
ATOM   701  C  CB  . THR A 1 86  ? 37.235 13.947 10.377  1.00 17.49 ? 86  THR A CB  1 
ATOM   702  O  OG1 . THR A 1 86  ? 38.011 12.925 11.019  1.00 18.70 ? 86  THR A OG1 1 
ATOM   703  C  CG2 . THR A 1 86  ? 35.854 13.996 10.996  1.00 16.12 ? 86  THR A CG2 1 
ATOM   704  N  N   . LYS A 1 87  ? 39.187 14.708 8.083   1.00 18.01 ? 87  LYS A N   1 
ATOM   705  C  CA  . LYS A 1 87  ? 40.528 14.727 7.512   1.00 19.11 ? 87  LYS A CA  1 
ATOM   706  C  C   . LYS A 1 87  ? 41.499 13.905 8.346   1.00 18.08 ? 87  LYS A C   1 
ATOM   707  O  O   . LYS A 1 87  ? 42.311 13.157 7.801   1.00 18.83 ? 87  LYS A O   1 
ATOM   708  C  CB  . LYS A 1 87  ? 41.030 16.169 7.387   1.00 19.48 ? 87  LYS A CB  1 
ATOM   709  C  CG  . LYS A 1 87  ? 40.243 16.999 6.369   1.00 23.47 ? 87  LYS A CG  1 
ATOM   710  C  CD  . LYS A 1 87  ? 40.797 18.409 6.224   1.00 26.76 ? 87  LYS A CD  1 
ATOM   711  C  CE  . LYS A 1 87  ? 40.610 19.218 7.493   1.00 30.38 ? 87  LYS A CE  1 
ATOM   712  N  NZ  . LYS A 1 87  ? 41.120 20.613 7.340   1.00 32.82 ? 87  LYS A NZ  1 
ATOM   713  N  N   . GLY A 1 88  ? 41.400 14.032 9.667   1.00 16.52 ? 88  GLY A N   1 
ATOM   714  C  CA  . GLY A 1 88  ? 42.286 13.292 10.550  1.00 16.69 ? 88  GLY A CA  1 
ATOM   715  C  C   . GLY A 1 88  ? 43.557 14.080 10.807  1.00 17.68 ? 88  GLY A C   1 
ATOM   716  O  O   . GLY A 1 88  ? 44.055 14.772 9.915   1.00 17.07 ? 88  GLY A O   1 
ATOM   717  N  N   . HIS A 1 89  ? 44.094 13.976 12.018  1.00 15.30 ? 89  HIS A N   1 
ATOM   718  C  CA  . HIS A 1 89  ? 45.300 14.715 12.358  1.00 16.78 ? 89  HIS A CA  1 
ATOM   719  C  C   . HIS A 1 89  ? 45.996 14.244 13.628  1.00 16.88 ? 89  HIS A C   1 
ATOM   720  O  O   . HIS A 1 89  ? 45.455 13.462 14.423  1.00 16.40 ? 89  HIS A O   1 
ATOM   721  C  CB  . HIS A 1 89  ? 44.971 16.212 12.529  1.00 16.05 ? 89  HIS A CB  1 
ATOM   722  C  CG  . HIS A 1 89  ? 44.021 16.503 13.655  1.00 17.36 ? 89  HIS A CG  1 
ATOM   723  N  ND1 . HIS A 1 89  ? 42.656 16.338 13.543  1.00 18.39 ? 89  HIS A ND1 1 
ATOM   724  C  CD2 . HIS A 1 89  ? 44.242 16.912 14.928  1.00 18.58 ? 89  HIS A CD2 1 
ATOM   725  C  CE1 . HIS A 1 89  ? 42.079 16.631 14.695  1.00 17.86 ? 89  HIS A CE1 1 
ATOM   726  N  NE2 . HIS A 1 89  ? 43.019 16.982 15.555  1.00 17.46 ? 89  HIS A NE2 1 
ATOM   727  N  N   . TYR A 1 90  ? 47.213 14.738 13.796  1.00 16.83 ? 90  TYR A N   1 
ATOM   728  C  CA  . TYR A 1 90  ? 48.016 14.489 14.983  1.00 17.38 ? 90  TYR A CA  1 
ATOM   729  C  C   . TYR A 1 90  ? 47.876 15.821 15.707  1.00 17.92 ? 90  TYR A C   1 
ATOM   730  O  O   . TYR A 1 90  ? 47.438 16.802 15.108  1.00 17.66 ? 90  TYR A O   1 
ATOM   731  C  CB  . TYR A 1 90  ? 49.491 14.300 14.616  1.00 19.53 ? 90  TYR A CB  1 
ATOM   732  C  CG  . TYR A 1 90  ? 49.841 12.965 14.013  1.00 19.31 ? 90  TYR A CG  1 
ATOM   733  C  CD1 . TYR A 1 90  ? 50.077 11.858 14.825  1.00 18.98 ? 90  TYR A CD1 1 
ATOM   734  C  CD2 . TYR A 1 90  ? 49.976 12.815 12.628  1.00 16.73 ? 90  TYR A CD2 1 
ATOM   735  C  CE1 . TYR A 1 90  ? 50.446 10.628 14.282  1.00 19.51 ? 90  TYR A CE1 1 
ATOM   736  C  CE2 . TYR A 1 90  ? 50.342 11.593 12.073  1.00 18.23 ? 90  TYR A CE2 1 
ATOM   737  C  CZ  . TYR A 1 90  ? 50.575 10.503 12.909  1.00 21.54 ? 90  TYR A CZ  1 
ATOM   738  O  OH  . TYR A 1 90  ? 50.928 9.285  12.377  1.00 25.14 ? 90  TYR A OH  1 
ATOM   739  N  N   . HIS A 1 91  ? 48.218 15.876 16.984  1.00 18.96 ? 91  HIS A N   1 
ATOM   740  C  CA  . HIS A 1 91  ? 48.154 17.152 17.675  1.00 19.61 ? 91  HIS A CA  1 
ATOM   741  C  C   . HIS A 1 91  ? 49.478 17.844 17.348  1.00 21.79 ? 91  HIS A C   1 
ATOM   742  O  O   . HIS A 1 91  ? 50.454 17.173 17.009  1.00 19.14 ? 91  HIS A O   1 
ATOM   743  C  CB  . HIS A 1 91  ? 48.031 16.947 19.185  1.00 20.81 ? 91  HIS A CB  1 
ATOM   744  C  CG  . HIS A 1 91  ? 46.691 16.441 19.620  1.00 21.06 ? 91  HIS A CG  1 
ATOM   745  N  ND1 . HIS A 1 91  ? 46.539 15.349 20.442  1.00 21.77 ? 91  HIS A ND1 1 
ATOM   746  C  CD2 . HIS A 1 91  ? 45.440 16.893 19.357  1.00 21.88 ? 91  HIS A CD2 1 
ATOM   747  C  CE1 . HIS A 1 91  ? 45.252 15.144 20.670  1.00 23.57 ? 91  HIS A CE1 1 
ATOM   748  N  NE2 . HIS A 1 91  ? 44.567 16.069 20.023  1.00 23.62 ? 91  HIS A NE2 1 
ATOM   749  N  N   . SER A 1 92  ? 49.501 19.173 17.430  1.00 22.98 ? 92  SER A N   1 
ATOM   750  C  CA  . SER A 1 92  ? 50.711 19.949 17.162  1.00 24.61 ? 92  SER A CA  1 
ATOM   751  C  C   . SER A 1 92  ? 51.735 19.536 18.226  1.00 24.28 ? 92  SER A C   1 
ATOM   752  O  O   . SER A 1 92  ? 52.863 19.170 17.906  1.00 24.11 ? 92  SER A O   1 
ATOM   753  C  CB  . SER A 1 92  ? 50.397 21.444 17.246  1.00 26.18 ? 92  SER A CB  1 
ATOM   754  O  OG  . SER A 1 92  ? 51.442 22.209 16.680  1.00 29.00 ? 92  SER A OG  1 
ATOM   755  N  N   . LYS A 1 93  ? 51.344 19.626 19.494  1.00 23.72 ? 93  LYS A N   1 
ATOM   756  C  CA  . LYS A 1 93  ? 52.197 19.150 20.580  1.00 24.45 ? 93  LYS A CA  1 
ATOM   757  C  C   . LYS A 1 93  ? 51.708 17.703 20.598  1.00 23.86 ? 93  LYS A C   1 
ATOM   758  O  O   . LYS A 1 93  ? 50.737 17.360 21.277  1.00 22.64 ? 93  LYS A O   1 
ATOM   759  C  CB  . LYS A 1 93  ? 51.869 19.851 21.900  1.00 25.77 ? 93  LYS A CB  1 
ATOM   760  C  CG  . LYS A 1 93  ? 52.341 21.300 21.963  1.00 30.34 ? 93  LYS A CG  1 
ATOM   761  C  CD  . LYS A 1 93  ? 52.001 21.926 23.306  1.00 31.10 ? 93  LYS A CD  1 
ATOM   762  C  CE  . LYS A 1 93  ? 52.559 23.334 23.420  1.00 34.77 ? 93  LYS A CE  1 
ATOM   763  N  NZ  . LYS A 1 93  ? 54.049 23.339 23.362  1.00 38.01 ? 93  LYS A NZ  1 
ATOM   764  N  N   . ILE A 1 94  ? 52.383 16.872 19.814  1.00 23.87 ? 94  ILE A N   1 
ATOM   765  C  CA  . ILE A 1 94  ? 52.004 15.480 19.622  1.00 21.61 ? 94  ILE A CA  1 
ATOM   766  C  C   . ILE A 1 94  ? 51.714 14.574 20.814  1.00 22.08 ? 94  ILE A C   1 
ATOM   767  O  O   . ILE A 1 94  ? 50.999 13.582 20.657  1.00 22.82 ? 94  ILE A O   1 
ATOM   768  C  CB  . ILE A 1 94  ? 53.018 14.791 18.684  1.00 22.13 ? 94  ILE A CB  1 
ATOM   769  C  CG1 . ILE A 1 94  ? 52.353 13.598 17.996  1.00 19.75 ? 94  ILE A CG1 1 
ATOM   770  C  CG2 . ILE A 1 94  ? 54.260 14.386 19.457  1.00 22.50 ? 94  ILE A CG2 1 
ATOM   771  C  CD1 . ILE A 1 94  ? 53.106 13.101 16.784  1.00 21.61 ? 94  ILE A CD1 1 
ATOM   772  N  N   . ASP A 1 95  ? 52.233 14.893 21.997  1.00 19.69 ? 95  ASP A N   1 
ATOM   773  C  CA  . ASP A 1 95  ? 51.973 14.039 23.154  1.00 21.52 ? 95  ASP A CA  1 
ATOM   774  C  C   . ASP A 1 95  ? 50.692 14.405 23.912  1.00 20.24 ? 95  ASP A C   1 
ATOM   775  O  O   . ASP A 1 95  ? 50.465 13.959 25.032  1.00 21.03 ? 95  ASP A O   1 
ATOM   776  C  CB  . ASP A 1 95  ? 53.179 14.034 24.108  1.00 20.89 ? 95  ASP A CB  1 
ATOM   777  C  CG  . ASP A 1 95  ? 53.358 15.343 24.841  1.00 23.64 ? 95  ASP A CG  1 
ATOM   778  O  OD1 . ASP A 1 95  ? 52.649 16.316 24.518  1.00 25.92 ? 95  ASP A OD1 1 
ATOM   779  O  OD2 . ASP A 1 95  ? 54.220 15.400 25.746  1.00 25.34 ? 95  ASP A OD2 1 
ATOM   780  N  N   . ARG A 1 96  ? 49.847 15.207 23.283  1.00 20.16 ? 96  ARG A N   1 
ATOM   781  C  CA  . ARG A 1 96  ? 48.585 15.620 23.888  1.00 20.04 ? 96  ARG A CA  1 
ATOM   782  C  C   . ARG A 1 96  ? 47.526 14.562 23.595  1.00 18.93 ? 96  ARG A C   1 
ATOM   783  O  O   . ARG A 1 96  ? 47.432 14.071 22.475  1.00 21.00 ? 96  ARG A O   1 
ATOM   784  C  CB  . ARG A 1 96  ? 48.139 16.963 23.299  1.00 18.08 ? 96  ARG A CB  1 
ATOM   785  C  CG  . ARG A 1 96  ? 48.492 18.173 24.139  1.00 21.58 ? 96  ARG A CG  1 
ATOM   786  C  CD  . ARG A 1 96  ? 49.939 18.169 24.597  1.00 20.11 ? 96  ARG A CD  1 
ATOM   787  N  NE  . ARG A 1 96  ? 50.233 19.374 25.367  1.00 21.10 ? 96  ARG A NE  1 
ATOM   788  C  CZ  . ARG A 1 96  ? 51.284 19.520 26.162  1.00 19.11 ? 96  ARG A CZ  1 
ATOM   789  N  NH1 . ARG A 1 96  ? 52.162 18.531 26.300  1.00 17.51 ? 96  ARG A NH1 1 
ATOM   790  N  NH2 . ARG A 1 96  ? 51.449 20.653 26.831  1.00 19.90 ? 96  ARG A NH2 1 
ATOM   791  N  N   . ALA A 1 97  ? 46.728 14.213 24.594  1.00 17.76 ? 97  ALA A N   1 
ATOM   792  C  CA  . ALA A 1 97  ? 45.685 13.211 24.395  1.00 18.46 ? 97  ALA A CA  1 
ATOM   793  C  C   . ALA A 1 97  ? 44.371 13.891 24.019  1.00 17.82 ? 97  ALA A C   1 
ATOM   794  O  O   . ALA A 1 97  ? 44.305 15.115 23.912  1.00 17.95 ? 97  ALA A O   1 
ATOM   795  C  CB  . ALA A 1 97  ? 45.507 12.398 25.657  1.00 15.33 ? 97  ALA A CB  1 
ATOM   796  N  N   . GLU A 1 98  ? 43.332 13.092 23.804  1.00 18.47 ? 98  GLU A N   1 
ATOM   797  C  CA  . GLU A 1 98  ? 42.014 13.629 23.469  1.00 19.06 ? 98  GLU A CA  1 
ATOM   798  C  C   . GLU A 1 98  ? 40.956 12.611 23.866  1.00 17.89 ? 98  GLU A C   1 
ATOM   799  O  O   . GLU A 1 98  ? 41.233 11.413 23.937  1.00 17.14 ? 98  GLU A O   1 
ATOM   800  C  CB  . GLU A 1 98  ? 41.917 13.947 21.964  1.00 20.28 ? 98  GLU A CB  1 
ATOM   801  C  CG  . GLU A 1 98  ? 40.532 14.442 21.510  1.00 21.13 ? 98  GLU A CG  1 
ATOM   802  C  CD  . GLU A 1 98  ? 40.569 15.280 20.236  1.00 22.36 ? 98  GLU A CD  1 
ATOM   803  O  OE1 . GLU A 1 98  ? 41.613 15.309 19.555  1.00 20.34 ? 98  GLU A OE1 1 
ATOM   804  O  OE2 . GLU A 1 98  ? 39.541 15.913 19.908  1.00 24.38 ? 98  GLU A OE2 1 
ATOM   805  N  N   . VAL A 1 99  ? 39.750 13.087 24.154  1.00 16.66 ? 99  VAL A N   1 
ATOM   806  C  CA  . VAL A 1 99  ? 38.665 12.189 24.535  1.00 14.78 ? 99  VAL A CA  1 
ATOM   807  C  C   . VAL A 1 99  ? 37.410 12.472 23.716  1.00 16.79 ? 99  VAL A C   1 
ATOM   808  O  O   . VAL A 1 99  ? 36.963 13.625 23.604  1.00 14.22 ? 99  VAL A O   1 
ATOM   809  C  CB  . VAL A 1 99  ? 38.327 12.323 26.036  1.00 16.70 ? 99  VAL A CB  1 
ATOM   810  C  CG1 . VAL A 1 99  ? 37.078 11.490 26.385  1.00 14.81 ? 99  VAL A CG1 1 
ATOM   811  C  CG2 . VAL A 1 99  ? 39.506 11.859 26.865  1.00 15.91 ? 99  VAL A CG2 1 
ATOM   812  N  N   . TYR A 1 100 ? 36.856 11.413 23.135  1.00 16.57 ? 100 TYR A N   1 
ATOM   813  C  CA  . TYR A 1 100 ? 35.639 11.520 22.339  1.00 17.75 ? 100 TYR A CA  1 
ATOM   814  C  C   . TYR A 1 100 ? 34.458 10.872 23.068  1.00 18.22 ? 100 TYR A C   1 
ATOM   815  O  O   . TYR A 1 100 ? 34.618 9.888  23.793  1.00 18.49 ? 100 TYR A O   1 
ATOM   816  C  CB  . TYR A 1 100 ? 35.822 10.844 20.978  1.00 16.16 ? 100 TYR A CB  1 
ATOM   817  C  CG  . TYR A 1 100 ? 36.561 11.666 19.944  1.00 18.95 ? 100 TYR A CG  1 
ATOM   818  C  CD1 . TYR A 1 100 ? 35.996 11.907 18.693  1.00 18.66 ? 100 TYR A CD1 1 
ATOM   819  C  CD2 . TYR A 1 100 ? 37.842 12.164 20.192  1.00 22.22 ? 100 TYR A CD2 1 
ATOM   820  C  CE1 . TYR A 1 100 ? 36.688 12.619 17.709  1.00 20.76 ? 100 TYR A CE1 1 
ATOM   821  C  CE2 . TYR A 1 100 ? 38.545 12.884 19.212  1.00 22.16 ? 100 TYR A CE2 1 
ATOM   822  C  CZ  . TYR A 1 100 ? 37.957 13.104 17.972  1.00 23.98 ? 100 TYR A CZ  1 
ATOM   823  O  OH  . TYR A 1 100 ? 38.636 13.801 16.993  1.00 22.39 ? 100 TYR A OH  1 
ATOM   824  N  N   . PHE A 1 101 ? 33.274 11.439 22.875  1.00 16.38 ? 101 PHE A N   1 
ATOM   825  C  CA  . PHE A 1 101 ? 32.062 10.921 23.489  1.00 15.86 ? 101 PHE A CA  1 
ATOM   826  C  C   . PHE A 1 101 ? 31.000 10.950 22.388  1.00 14.77 ? 101 PHE A C   1 
ATOM   827  O  O   . PHE A 1 101 ? 30.526 12.021 22.000  1.00 12.05 ? 101 PHE A O   1 
ATOM   828  C  CB  . PHE A 1 101 ? 31.660 11.807 24.682  1.00 17.12 ? 101 PHE A CB  1 
ATOM   829  C  CG  . PHE A 1 101 ? 30.464 11.306 25.454  1.00 18.07 ? 101 PHE A CG  1 
ATOM   830  C  CD1 . PHE A 1 101 ? 30.214 9.943  25.583  1.00 18.48 ? 101 PHE A CD1 1 
ATOM   831  C  CD2 . PHE A 1 101 ? 29.614 12.204 26.097  1.00 17.02 ? 101 PHE A CD2 1 
ATOM   832  C  CE1 . PHE A 1 101 ? 29.127 9.480  26.340  1.00 19.68 ? 101 PHE A CE1 1 
ATOM   833  C  CE2 . PHE A 1 101 ? 28.531 11.755 26.853  1.00 17.60 ? 101 PHE A CE2 1 
ATOM   834  C  CZ  . PHE A 1 101 ? 28.290 10.389 26.976  1.00 18.61 ? 101 PHE A CZ  1 
ATOM   835  N  N   . ALA A 1 102 ? 30.665 9.770  21.869  1.00 13.20 ? 102 ALA A N   1 
ATOM   836  C  CA  . ALA A 1 102 ? 29.673 9.641  20.801  1.00 15.56 ? 102 ALA A CA  1 
ATOM   837  C  C   . ALA A 1 102 ? 28.273 9.900  21.351  1.00 17.01 ? 102 ALA A C   1 
ATOM   838  O  O   . ALA A 1 102 ? 27.916 9.396  22.417  1.00 15.86 ? 102 ALA A O   1 
ATOM   839  C  CB  . ALA A 1 102 ? 29.752 8.253  20.178  1.00 15.09 ? 102 ALA A CB  1 
ATOM   840  N  N   . LEU A 1 103 ? 27.485 10.679 20.611  1.00 17.76 ? 103 LEU A N   1 
ATOM   841  C  CA  . LEU A 1 103 ? 26.135 11.044 21.040  1.00 20.04 ? 103 LEU A CA  1 
ATOM   842  C  C   . LEU A 1 103 ? 24.989 10.590 20.139  1.00 21.08 ? 103 LEU A C   1 
ATOM   843  O  O   . LEU A 1 103 ? 23.867 10.423 20.603  1.00 22.61 ? 103 LEU A O   1 
ATOM   844  C  CB  . LEU A 1 103 ? 26.045 12.556 21.198  1.00 17.42 ? 103 LEU A CB  1 
ATOM   845  C  CG  . LEU A 1 103 ? 27.019 13.180 22.191  1.00 21.10 ? 103 LEU A CG  1 
ATOM   846  C  CD1 . LEU A 1 103 ? 26.902 14.691 22.109  1.00 19.79 ? 103 LEU A CD1 1 
ATOM   847  C  CD2 . LEU A 1 103 ? 26.711 12.668 23.608  1.00 18.67 ? 103 LEU A CD2 1 
ATOM   848  N  N   . LYS A 1 104 ? 25.256 10.403 18.856  1.00 20.59 ? 104 LYS A N   1 
ATOM   849  C  CA  . LYS A 1 104 ? 24.199 9.991  17.953  1.00 23.08 ? 104 LYS A CA  1 
ATOM   850  C  C   . LYS A 1 104 ? 24.765 9.318  16.715  1.00 20.91 ? 104 LYS A C   1 
ATOM   851  O  O   . LYS A 1 104 ? 25.850 9.664  16.247  1.00 19.85 ? 104 LYS A O   1 
ATOM   852  C  CB  . LYS A 1 104 ? 23.363 11.210 17.547  1.00 23.38 ? 104 LYS A CB  1 
ATOM   853  C  CG  . LYS A 1 104 ? 22.030 10.867 16.914  1.00 27.65 ? 104 LYS A CG  1 
ATOM   854  C  CD  . LYS A 1 104 ? 21.288 12.117 16.459  1.00 28.47 ? 104 LYS A CD  1 
ATOM   855  C  CE  . LYS A 1 104 ? 19.862 11.781 16.065  1.00 29.99 ? 104 LYS A CE  1 
ATOM   856  N  NZ  . LYS A 1 104 ? 19.143 11.153 17.214  1.00 27.89 ? 104 LYS A NZ  1 
ATOM   857  N  N   . GLY A 1 105 ? 24.029 8.344  16.195  1.00 19.93 ? 105 GLY A N   1 
ATOM   858  C  CA  . GLY A 1 105 ? 24.482 7.649  15.007  1.00 19.30 ? 105 GLY A CA  1 
ATOM   859  C  C   . GLY A 1 105 ? 25.465 6.536  15.311  1.00 20.40 ? 105 GLY A C   1 
ATOM   860  O  O   . GLY A 1 105 ? 25.650 6.134  16.466  1.00 18.99 ? 105 GLY A O   1 
ATOM   861  N  N   . LYS A 1 106 ? 26.106 6.050  14.258  1.00 20.02 ? 106 LYS A N   1 
ATOM   862  C  CA  . LYS A 1 106 ? 27.069 4.968  14.391  1.00 17.82 ? 106 LYS A CA  1 
ATOM   863  C  C   . LYS A 1 106 ? 28.300 5.236  13.550  1.00 16.99 ? 106 LYS A C   1 
ATOM   864  O  O   . LYS A 1 106 ? 28.207 5.744  12.445  1.00 15.45 ? 106 LYS A O   1 
ATOM   865  C  CB  . LYS A 1 106 ? 26.468 3.627  13.953  1.00 22.08 ? 106 LYS A CB  1 
ATOM   866  C  CG  . LYS A 1 106 ? 27.341 2.440  14.397  1.00 26.15 ? 106 LYS A CG  1 
ATOM   867  C  CD  . LYS A 1 106 ? 27.130 1.167  13.583  1.00 28.77 ? 106 LYS A CD  1 
ATOM   868  C  CE  . LYS A 1 106 ? 28.477 0.596  13.210  1.00 30.20 ? 106 LYS A CE  1 
ATOM   869  N  NZ  . LYS A 1 106 ? 29.357 0.821  14.414  1.00 34.43 ? 106 LYS A NZ  1 
ATOM   870  N  N   . GLY A 1 107 ? 29.452 4.869  14.081  1.00 20.29 ? 107 GLY A N   1 
ATOM   871  C  CA  . GLY A 1 107 ? 30.678 5.088  13.343  1.00 18.67 ? 107 GLY A CA  1 
ATOM   872  C  C   . GLY A 1 107 ? 31.837 4.415  14.041  1.00 18.80 ? 107 GLY A C   1 
ATOM   873  O  O   . GLY A 1 107 ? 31.672 3.404  14.721  1.00 17.43 ? 107 GLY A O   1 
ATOM   874  N  N   . GLY A 1 108 ? 33.017 4.991  13.875  1.00 19.33 ? 108 GLY A N   1 
ATOM   875  C  CA  . GLY A 1 108 ? 34.197 4.439  14.498  1.00 20.18 ? 108 GLY A CA  1 
ATOM   876  C  C   . GLY A 1 108 ? 35.341 5.415  14.367  1.00 21.26 ? 108 GLY A C   1 
ATOM   877  O  O   . GLY A 1 108 ? 35.246 6.412  13.647  1.00 20.96 ? 108 GLY A O   1 
ATOM   878  N  N   . MET A 1 109 ? 36.422 5.138  15.080  1.00 20.17 ? 109 MET A N   1 
ATOM   879  C  CA  . MET A 1 109 ? 37.584 5.996  15.025  1.00 22.05 ? 109 MET A CA  1 
ATOM   880  C  C   . MET A 1 109 ? 38.779 5.201  14.558  1.00 20.74 ? 109 MET A C   1 
ATOM   881  O  O   . MET A 1 109 ? 39.011 4.082  15.017  1.00 20.39 ? 109 MET A O   1 
ATOM   882  C  CB  . MET A 1 109 ? 37.897 6.589  16.399  1.00 22.53 ? 109 MET A CB  1 
ATOM   883  C  CG  . MET A 1 109 ? 38.990 7.642  16.337  1.00 23.86 ? 109 MET A CG  1 
ATOM   884  S  SD  . MET A 1 109 ? 39.507 8.223  17.940  1.00 26.27 ? 109 MET A SD  1 
ATOM   885  C  CE  . MET A 1 109 ? 37.987 9.061  18.483  1.00 26.16 ? 109 MET A CE  1 
ATOM   886  N  N   . LEU A 1 110 ? 39.528 5.783  13.631  1.00 21.37 ? 110 LEU A N   1 
ATOM   887  C  CA  . LEU A 1 110 ? 40.736 5.157  13.121  1.00 18.09 ? 110 LEU A CA  1 
ATOM   888  C  C   . LEU A 1 110 ? 41.904 5.912  13.741  1.00 19.71 ? 110 LEU A C   1 
ATOM   889  O  O   . LEU A 1 110 ? 41.953 7.146  13.688  1.00 19.38 ? 110 LEU A O   1 
ATOM   890  C  CB  . LEU A 1 110 ? 40.798 5.273  11.599  1.00 18.86 ? 110 LEU A CB  1 
ATOM   891  C  CG  . LEU A 1 110 ? 42.040 4.679  10.934  1.00 18.50 ? 110 LEU A CG  1 
ATOM   892  C  CD1 . LEU A 1 110 ? 42.116 3.180  11.228  1.00 19.13 ? 110 LEU A CD1 1 
ATOM   893  C  CD2 . LEU A 1 110 ? 41.980 4.934  9.431   1.00 19.24 ? 110 LEU A CD2 1 
ATOM   894  N  N   . LEU A 1 111 ? 42.828 5.181  14.353  1.00 17.86 ? 111 LEU A N   1 
ATOM   895  C  CA  . LEU A 1 111 ? 43.994 5.804  14.965  1.00 18.68 ? 111 LEU A CA  1 
ATOM   896  C  C   . LEU A 1 111 ? 45.262 5.131  14.463  1.00 18.76 ? 111 LEU A C   1 
ATOM   897  O  O   . LEU A 1 111 ? 45.242 3.964  14.064  1.00 20.22 ? 111 LEU A O   1 
ATOM   898  C  CB  . LEU A 1 111 ? 43.946 5.694  16.496  1.00 17.43 ? 111 LEU A CB  1 
ATOM   899  C  CG  . LEU A 1 111 ? 42.701 6.191  17.241  1.00 19.69 ? 111 LEU A CG  1 
ATOM   900  C  CD1 . LEU A 1 111 ? 41.680 5.069  17.337  1.00 18.90 ? 111 LEU A CD1 1 
ATOM   901  C  CD2 . LEU A 1 111 ? 43.087 6.637  18.645  1.00 19.62 ? 111 LEU A CD2 1 
ATOM   902  N  N   . GLN A 1 112 ? 46.364 5.870  14.462  1.00 19.33 ? 112 GLN A N   1 
ATOM   903  C  CA  . GLN A 1 112 ? 47.634 5.295  14.047  1.00 21.26 ? 112 GLN A CA  1 
ATOM   904  C  C   . GLN A 1 112 ? 48.807 6.031  14.669  1.00 21.96 ? 112 GLN A C   1 
ATOM   905  O  O   . GLN A 1 112 ? 48.706 7.204  15.027  1.00 20.29 ? 112 GLN A O   1 
ATOM   906  C  CB  . GLN A 1 112 ? 47.774 5.281  12.518  1.00 21.39 ? 112 GLN A CB  1 
ATOM   907  C  CG  . GLN A 1 112 ? 48.013 6.623  11.874  1.00 24.57 ? 112 GLN A CG  1 
ATOM   908  C  CD  . GLN A 1 112 ? 48.435 6.491  10.418  1.00 28.04 ? 112 GLN A CD  1 
ATOM   909  O  OE1 . GLN A 1 112 ? 47.839 5.729  9.646   1.00 26.00 ? 112 GLN A OE1 1 
ATOM   910  N  NE2 . GLN A 1 112 ? 49.464 7.237  10.033  1.00 27.16 ? 112 GLN A NE2 1 
ATOM   911  N  N   . THR A 1 113 ? 49.918 5.322  14.809  1.00 23.15 ? 113 THR A N   1 
ATOM   912  C  CA  . THR A 1 113 ? 51.118 5.900  15.384  1.00 25.21 ? 113 THR A CA  1 
ATOM   913  C  C   . THR A 1 113 ? 51.900 6.544  14.258  1.00 27.72 ? 113 THR A C   1 
ATOM   914  O  O   . THR A 1 113 ? 51.626 6.296  13.085  1.00 28.83 ? 113 THR A O   1 
ATOM   915  C  CB  . THR A 1 113 ? 52.006 4.826  16.004  1.00 24.83 ? 113 THR A CB  1 
ATOM   916  O  OG1 . THR A 1 113 ? 52.443 3.928  14.974  1.00 24.66 ? 113 THR A OG1 1 
ATOM   917  C  CG2 . THR A 1 113 ? 51.241 4.051  17.069  1.00 24.14 ? 113 THR A CG2 1 
ATOM   918  N  N   . PRO A 1 114 ? 52.885 7.385  14.597  1.00 29.53 ? 114 PRO A N   1 
ATOM   919  C  CA  . PRO A 1 114 ? 53.683 8.033  13.556  1.00 31.74 ? 114 PRO A CA  1 
ATOM   920  C  C   . PRO A 1 114 ? 54.263 6.986  12.604  1.00 34.52 ? 114 PRO A C   1 
ATOM   921  O  O   . PRO A 1 114 ? 54.492 7.259  11.428  1.00 36.43 ? 114 PRO A O   1 
ATOM   922  C  CB  . PRO A 1 114 ? 54.763 8.753  14.357  1.00 30.24 ? 114 PRO A CB  1 
ATOM   923  C  CG  . PRO A 1 114 ? 54.038 9.133  15.612  1.00 29.81 ? 114 PRO A CG  1 
ATOM   924  C  CD  . PRO A 1 114 ? 53.260 7.876  15.935  1.00 28.90 ? 114 PRO A CD  1 
ATOM   925  N  N   . GLU A 1 115 ? 54.488 5.781  13.119  1.00 35.71 ? 115 GLU A N   1 
ATOM   926  C  CA  . GLU A 1 115 ? 55.045 4.703  12.310  1.00 36.80 ? 115 GLU A CA  1 
ATOM   927  C  C   . GLU A 1 115 ? 54.010 3.975  11.460  1.00 36.96 ? 115 GLU A C   1 
ATOM   928  O  O   . GLU A 1 115 ? 54.363 3.138  10.626  1.00 38.11 ? 115 GLU A O   1 
ATOM   929  C  CB  . GLU A 1 115 ? 55.774 3.697  13.201  1.00 39.20 ? 115 GLU A CB  1 
ATOM   930  C  CG  . GLU A 1 115 ? 57.057 4.238  13.823  1.00 41.02 ? 115 GLU A CG  1 
ATOM   931  C  CD  . GLU A 1 115 ? 56.801 5.316  14.860  1.00 43.96 ? 115 GLU A CD  1 
ATOM   932  O  OE1 . GLU A 1 115 ? 56.097 5.028  15.851  1.00 43.72 ? 115 GLU A OE1 1 
ATOM   933  O  OE2 . GLU A 1 115 ? 57.307 6.449  14.689  1.00 45.84 ? 115 GLU A OE2 1 
ATOM   934  N  N   . GLY A 1 116 ? 52.734 4.279  11.674  1.00 35.98 ? 116 GLY A N   1 
ATOM   935  C  CA  . GLY A 1 116 ? 51.696 3.642  10.882  1.00 32.71 ? 116 GLY A CA  1 
ATOM   936  C  C   . GLY A 1 116 ? 50.913 2.504  11.514  1.00 31.12 ? 116 GLY A C   1 
ATOM   937  O  O   . GLY A 1 116 ? 50.044 1.936  10.854  1.00 30.09 ? 116 GLY A O   1 
ATOM   938  N  N   . GLU A 1 117 ? 51.206 2.154  12.767  1.00 29.61 ? 117 GLU A N   1 
ATOM   939  C  CA  . GLU A 1 117 ? 50.463 1.080  13.423  1.00 29.13 ? 117 GLU A CA  1 
ATOM   940  C  C   . GLU A 1 117 ? 49.060 1.632  13.681  1.00 26.11 ? 117 GLU A C   1 
ATOM   941  O  O   . GLU A 1 117 ? 48.908 2.682  14.307  1.00 23.47 ? 117 GLU A O   1 
ATOM   942  C  CB  . GLU A 1 117 ? 51.132 0.671  14.743  1.00 33.15 ? 117 GLU A CB  1 
ATOM   943  C  CG  . GLU A 1 117 ? 50.688 -0.705 15.243  1.00 38.97 ? 117 GLU A CG  1 
ATOM   944  C  CD  . GLU A 1 117 ? 51.380 -1.143 16.533  1.00 42.64 ? 117 GLU A CD  1 
ATOM   945  O  OE1 . GLU A 1 117 ? 52.621 -1.006 16.629  1.00 45.84 ? 117 GLU A OE1 1 
ATOM   946  O  OE2 . GLU A 1 117 ? 50.682 -1.643 17.444  1.00 41.11 ? 117 GLU A OE2 1 
ATOM   947  N  N   . ALA A 1 118 ? 48.044 0.923  13.199  1.00 22.77 ? 118 ALA A N   1 
ATOM   948  C  CA  . ALA A 1 118 ? 46.663 1.373  13.326  1.00 22.83 ? 118 ALA A CA  1 
ATOM   949  C  C   . ALA A 1 118 ? 45.739 0.599  14.262  1.00 22.37 ? 118 ALA A C   1 
ATOM   950  O  O   . ALA A 1 118 ? 45.967 -0.567 14.584  1.00 21.15 ? 118 ALA A O   1 
ATOM   951  C  CB  . ALA A 1 118 ? 46.024 1.430  11.938  1.00 21.32 ? 118 ALA A CB  1 
ATOM   952  N  N   . ARG A 1 119 ? 44.673 1.279  14.672  1.00 20.88 ? 119 ARG A N   1 
ATOM   953  C  CA  . ARG A 1 119 ? 43.653 0.708  15.541  1.00 20.69 ? 119 ARG A CA  1 
ATOM   954  C  C   . ARG A 1 119 ? 42.310 1.270  15.086  1.00 20.37 ? 119 ARG A C   1 
ATOM   955  O  O   . ARG A 1 119 ? 42.221 2.428  14.660  1.00 21.09 ? 119 ARG A O   1 
ATOM   956  C  CB  . ARG A 1 119 ? 43.869 1.120  17.003  1.00 20.06 ? 119 ARG A CB  1 
ATOM   957  C  CG  . ARG A 1 119 ? 45.153 0.641  17.650  1.00 21.77 ? 119 ARG A CG  1 
ATOM   958  C  CD  . ARG A 1 119 ? 45.087 -0.824 18.060  1.00 20.59 ? 119 ARG A CD  1 
ATOM   959  N  NE  . ARG A 1 119 ? 46.293 -1.187 18.796  1.00 23.07 ? 119 ARG A NE  1 
ATOM   960  C  CZ  . ARG A 1 119 ? 47.477 -1.414 18.236  1.00 21.61 ? 119 ARG A CZ  1 
ATOM   961  N  NH1 . ARG A 1 119 ? 47.625 -1.334 16.919  1.00 21.00 ? 119 ARG A NH1 1 
ATOM   962  N  NH2 . ARG A 1 119 ? 48.525 -1.689 19.000  1.00 21.01 ? 119 ARG A NH2 1 
ATOM   963  N  N   . PHE A 1 120 ? 41.270 0.455  15.169  1.00 17.88 ? 120 PHE A N   1 
ATOM   964  C  CA  . PHE A 1 120 ? 39.936 0.921  14.820  1.00 20.24 ? 120 PHE A CA  1 
ATOM   965  C  C   . PHE A 1 120 ? 38.987 0.585  15.974  1.00 20.06 ? 120 PHE A C   1 
ATOM   966  O  O   . PHE A 1 120 ? 38.833 -0.585 16.347  1.00 22.40 ? 120 PHE A O   1 
ATOM   967  C  CB  . PHE A 1 120 ? 39.441 0.270  13.527  1.00 19.40 ? 120 PHE A CB  1 
ATOM   968  C  CG  . PHE A 1 120 ? 38.088 0.754  13.097  1.00 22.43 ? 120 PHE A CG  1 
ATOM   969  C  CD1 . PHE A 1 120 ? 37.939 1.999  12.489  1.00 22.29 ? 120 PHE A CD1 1 
ATOM   970  C  CD2 . PHE A 1 120 ? 36.951 -0.012 13.345  1.00 24.27 ? 120 PHE A CD2 1 
ATOM   971  C  CE1 . PHE A 1 120 ? 36.675 2.478  12.135  1.00 23.45 ? 120 PHE A CE1 1 
ATOM   972  C  CE2 . PHE A 1 120 ? 35.677 0.455  12.996  1.00 23.21 ? 120 PHE A CE2 1 
ATOM   973  C  CZ  . PHE A 1 120 ? 35.539 1.703  12.390  1.00 24.78 ? 120 PHE A CZ  1 
ATOM   974  N  N   . ILE A 1 121 ? 38.371 1.613  16.550  1.00 20.49 ? 121 ILE A N   1 
ATOM   975  C  CA  . ILE A 1 121 ? 37.433 1.424  17.661  1.00 20.41 ? 121 ILE A CA  1 
ATOM   976  C  C   . ILE A 1 121 ? 36.030 1.858  17.240  1.00 21.10 ? 121 ILE A C   1 
ATOM   977  O  O   . ILE A 1 121 ? 35.815 3.014  16.861  1.00 17.21 ? 121 ILE A O   1 
ATOM   978  C  CB  . ILE A 1 121 ? 37.838 2.255  18.924  1.00 22.08 ? 121 ILE A CB  1 
ATOM   979  C  CG1 . ILE A 1 121 ? 39.117 1.698  19.563  1.00 23.74 ? 121 ILE A CG1 1 
ATOM   980  C  CG2 . ILE A 1 121 ? 36.710 2.221  19.955  1.00 18.95 ? 121 ILE A CG2 1 
ATOM   981  C  CD1 . ILE A 1 121 ? 40.346 1.839  18.717  1.00 31.57 ? 121 ILE A CD1 1 
ATOM   982  N  N   . GLU A 1 122 ? 35.082 0.926  17.312  1.00 21.03 ? 122 GLU A N   1 
ATOM   983  C  CA  . GLU A 1 122 ? 33.697 1.212  16.959  1.00 23.15 ? 122 GLU A CA  1 
ATOM   984  C  C   . GLU A 1 122 ? 33.072 2.180  17.951  1.00 21.22 ? 122 GLU A C   1 
ATOM   985  O  O   . GLU A 1 122 ? 33.399 2.174  19.143  1.00 20.41 ? 122 GLU A O   1 
ATOM   986  C  CB  . GLU A 1 122 ? 32.870 -0.075 16.922  1.00 25.76 ? 122 GLU A CB  1 
ATOM   987  C  CG  . GLU A 1 122 ? 33.220 -0.989 15.763  1.00 36.11 ? 122 GLU A CG  1 
ATOM   988  C  CD  . GLU A 1 122 ? 32.225 -2.119 15.594  1.00 40.52 ? 122 GLU A CD  1 
ATOM   989  O  OE1 . GLU A 1 122 ? 32.060 -2.919 16.542  1.00 41.48 ? 122 GLU A OE1 1 
ATOM   990  O  OE2 . GLU A 1 122 ? 31.608 -2.203 14.508  1.00 45.16 ? 122 GLU A OE2 1 
ATOM   991  N  N   . MET A 1 123 ? 32.155 3.000  17.456  1.00 19.23 ? 123 MET A N   1 
ATOM   992  C  CA  . MET A 1 123 ? 31.496 3.982  18.297  1.00 18.21 ? 123 MET A CA  1 
ATOM   993  C  C   . MET A 1 123 ? 29.992 4.016  18.066  1.00 18.63 ? 123 MET A C   1 
ATOM   994  O  O   . MET A 1 123 ? 29.534 3.954  16.936  1.00 18.23 ? 123 MET A O   1 
ATOM   995  C  CB  . MET A 1 123 ? 32.082 5.370  18.017  1.00 17.90 ? 123 MET A CB  1 
ATOM   996  C  CG  . MET A 1 123 ? 33.568 5.488  18.322  1.00 19.51 ? 123 MET A CG  1 
ATOM   997  S  SD  . MET A 1 123 ? 34.313 7.025  17.723  1.00 15.82 ? 123 MET A SD  1 
ATOM   998  C  CE  . MET A 1 123 ? 33.458 8.251  18.763  1.00 19.53 ? 123 MET A CE  1 
ATOM   999  N  N   . GLU A 1 124 ? 29.231 4.087  19.151  1.00 20.46 ? 124 GLU A N   1 
ATOM   1000 C  CA  . GLU A 1 124 ? 27.780 4.191  19.067  1.00 21.82 ? 124 GLU A CA  1 
ATOM   1001 C  C   . GLU A 1 124 ? 27.410 5.149  20.184  1.00 21.35 ? 124 GLU A C   1 
ATOM   1002 O  O   . GLU A 1 124 ? 28.279 5.550  20.959  1.00 20.15 ? 124 GLU A O   1 
ATOM   1003 C  CB  . GLU A 1 124 ? 27.102 2.828  19.269  1.00 26.09 ? 124 GLU A CB  1 
ATOM   1004 C  CG  . GLU A 1 124 ? 27.381 2.147  20.597  1.00 33.31 ? 124 GLU A CG  1 
ATOM   1005 C  CD  . GLU A 1 124 ? 26.508 0.912  20.807  1.00 37.07 ? 124 GLU A CD  1 
ATOM   1006 O  OE1 . GLU A 1 124 ? 26.374 0.107  19.861  1.00 40.30 ? 124 GLU A OE1 1 
ATOM   1007 O  OE2 . GLU A 1 124 ? 25.959 0.741  21.917  1.00 36.99 ? 124 GLU A OE2 1 
ATOM   1008 N  N   . PRO A 1 125 ? 26.131 5.549  20.277  1.00 19.85 ? 125 PRO A N   1 
ATOM   1009 C  CA  . PRO A 1 125 ? 25.773 6.473  21.355  1.00 19.66 ? 125 PRO A CA  1 
ATOM   1010 C  C   . PRO A 1 125 ? 26.223 5.941  22.715  1.00 18.36 ? 125 PRO A C   1 
ATOM   1011 O  O   . PRO A 1 125 ? 25.931 4.806  23.071  1.00 18.40 ? 125 PRO A O   1 
ATOM   1012 C  CB  . PRO A 1 125 ? 24.255 6.570  21.231  1.00 20.18 ? 125 PRO A CB  1 
ATOM   1013 C  CG  . PRO A 1 125 ? 24.045 6.448  19.740  1.00 19.35 ? 125 PRO A CG  1 
ATOM   1014 C  CD  . PRO A 1 125 ? 24.987 5.313  19.375  1.00 20.54 ? 125 PRO A CD  1 
ATOM   1015 N  N   . GLY A 1 126 ? 26.947 6.762  23.468  1.00 18.08 ? 126 GLY A N   1 
ATOM   1016 C  CA  . GLY A 1 126 ? 27.405 6.328  24.776  1.00 18.76 ? 126 GLY A CA  1 
ATOM   1017 C  C   . GLY A 1 126 ? 28.865 5.908  24.811  1.00 18.60 ? 126 GLY A C   1 
ATOM   1018 O  O   . GLY A 1 126 ? 29.456 5.815  25.889  1.00 18.30 ? 126 GLY A O   1 
ATOM   1019 N  N   . THR A 1 127 ? 29.452 5.653  23.644  1.00 16.14 ? 127 THR A N   1 
ATOM   1020 C  CA  . THR A 1 127 ? 30.858 5.252  23.588  1.00 19.23 ? 127 THR A CA  1 
ATOM   1021 C  C   . THR A 1 127 ? 31.816 6.413  23.888  1.00 19.12 ? 127 THR A C   1 
ATOM   1022 O  O   . THR A 1 127 ? 31.675 7.506  23.347  1.00 20.16 ? 127 THR A O   1 
ATOM   1023 C  CB  . THR A 1 127 ? 31.236 4.682  22.196  1.00 18.92 ? 127 THR A CB  1 
ATOM   1024 O  OG1 . THR A 1 127 ? 30.498 3.480  21.947  1.00 20.60 ? 127 THR A OG1 1 
ATOM   1025 C  CG2 . THR A 1 127 ? 32.732 4.372  22.130  1.00 20.45 ? 127 THR A CG2 1 
ATOM   1026 N  N   . ILE A 1 128 ? 32.779 6.168  24.767  1.00 18.23 ? 128 ILE A N   1 
ATOM   1027 C  CA  . ILE A 1 128 ? 33.788 7.164  25.095  1.00 19.43 ? 128 ILE A CA  1 
ATOM   1028 C  C   . ILE A 1 128 ? 35.096 6.588  24.551  1.00 19.47 ? 128 ILE A C   1 
ATOM   1029 O  O   . ILE A 1 128 ? 35.428 5.437  24.823  1.00 19.89 ? 128 ILE A O   1 
ATOM   1030 C  CB  . ILE A 1 128 ? 33.948 7.368  26.627  1.00 21.43 ? 128 ILE A CB  1 
ATOM   1031 C  CG1 . ILE A 1 128 ? 32.660 7.929  27.233  1.00 19.75 ? 128 ILE A CG1 1 
ATOM   1032 C  CG2 . ILE A 1 128 ? 35.110 8.338  26.905  1.00 19.93 ? 128 ILE A CG2 1 
ATOM   1033 C  CD1 . ILE A 1 128 ? 32.716 8.049  28.760  1.00 20.65 ? 128 ILE A CD1 1 
ATOM   1034 N  N   . VAL A 1 129 ? 35.827 7.369  23.765  1.00 19.62 ? 129 VAL A N   1 
ATOM   1035 C  CA  . VAL A 1 129 ? 37.095 6.892  23.217  1.00 17.34 ? 129 VAL A CA  1 
ATOM   1036 C  C   . VAL A 1 129 ? 38.264 7.716  23.729  1.00 18.36 ? 129 VAL A C   1 
ATOM   1037 O  O   . VAL A 1 129 ? 38.245 8.952  23.676  1.00 17.15 ? 129 VAL A O   1 
ATOM   1038 C  CB  . VAL A 1 129 ? 37.122 6.945  21.675  1.00 18.01 ? 129 VAL A CB  1 
ATOM   1039 C  CG1 . VAL A 1 129 ? 38.486 6.455  21.159  1.00 14.52 ? 129 VAL A CG1 1 
ATOM   1040 C  CG2 . VAL A 1 129 ? 36.004 6.085  21.107  1.00 16.50 ? 129 VAL A CG2 1 
ATOM   1041 N  N   . TYR A 1 130 ? 39.281 7.022  24.227  1.00 17.04 ? 130 TYR A N   1 
ATOM   1042 C  CA  . TYR A 1 130 ? 40.480 7.680  24.728  1.00 17.33 ? 130 TYR A CA  1 
ATOM   1043 C  C   . TYR A 1 130 ? 41.550 7.663  23.635  1.00 17.04 ? 130 TYR A C   1 
ATOM   1044 O  O   . TYR A 1 130 ? 42.000 6.598  23.217  1.00 17.44 ? 130 TYR A O   1 
ATOM   1045 C  CB  . TYR A 1 130 ? 41.005 6.951  25.971  1.00 17.17 ? 130 TYR A CB  1 
ATOM   1046 C  CG  . TYR A 1 130 ? 42.366 7.424  26.438  1.00 19.36 ? 130 TYR A CG  1 
ATOM   1047 C  CD1 . TYR A 1 130 ? 42.530 8.680  27.026  1.00 18.33 ? 130 TYR A CD1 1 
ATOM   1048 C  CD2 . TYR A 1 130 ? 43.497 6.620  26.273  1.00 20.39 ? 130 TYR A CD2 1 
ATOM   1049 C  CE1 . TYR A 1 130 ? 43.793 9.128  27.438  1.00 20.68 ? 130 TYR A CE1 1 
ATOM   1050 C  CE2 . TYR A 1 130 ? 44.758 7.051  26.681  1.00 19.84 ? 130 TYR A CE2 1 
ATOM   1051 C  CZ  . TYR A 1 130 ? 44.901 8.305  27.260  1.00 21.69 ? 130 TYR A CZ  1 
ATOM   1052 O  OH  . TYR A 1 130 ? 46.153 8.738  27.638  1.00 22.90 ? 130 TYR A OH  1 
ATOM   1053 N  N   . VAL A 1 131 ? 41.940 8.844  23.168  1.00 16.74 ? 131 VAL A N   1 
ATOM   1054 C  CA  . VAL A 1 131 ? 42.969 8.971  22.137  1.00 17.13 ? 131 VAL A CA  1 
ATOM   1055 C  C   . VAL A 1 131 ? 44.251 9.287  22.896  1.00 16.54 ? 131 VAL A C   1 
ATOM   1056 O  O   . VAL A 1 131 ? 44.444 10.408 23.361  1.00 15.98 ? 131 VAL A O   1 
ATOM   1057 C  CB  . VAL A 1 131 ? 42.655 10.123 21.158  1.00 17.85 ? 131 VAL A CB  1 
ATOM   1058 C  CG1 . VAL A 1 131 ? 43.736 10.211 20.079  1.00 15.84 ? 131 VAL A CG1 1 
ATOM   1059 C  CG2 . VAL A 1 131 ? 41.291 9.899  20.526  1.00 16.81 ? 131 VAL A CG2 1 
ATOM   1060 N  N   . PRO A 1 132 ? 45.150 8.301  23.016  1.00 16.12 ? 132 PRO A N   1 
ATOM   1061 C  CA  . PRO A 1 132 ? 46.411 8.483  23.737  1.00 17.05 ? 132 PRO A CA  1 
ATOM   1062 C  C   . PRO A 1 132 ? 47.381 9.433  23.071  1.00 16.34 ? 132 PRO A C   1 
ATOM   1063 O  O   . PRO A 1 132 ? 47.246 9.766  21.890  1.00 14.58 ? 132 PRO A O   1 
ATOM   1064 C  CB  . PRO A 1 132 ? 46.999 7.068  23.794  1.00 19.16 ? 132 PRO A CB  1 
ATOM   1065 C  CG  . PRO A 1 132 ? 45.854 6.146  23.325  1.00 18.08 ? 132 PRO A CG  1 
ATOM   1066 C  CD  . PRO A 1 132 ? 45.140 7.002  22.330  1.00 16.85 ? 132 PRO A CD  1 
ATOM   1067 N  N   . PRO A 1 133 ? 48.376 9.894  23.834  1.00 17.92 ? 133 PRO A N   1 
ATOM   1068 C  CA  . PRO A 1 133 ? 49.374 10.804 23.276  1.00 18.87 ? 133 PRO A CA  1 
ATOM   1069 C  C   . PRO A 1 133 ? 50.014 10.101 22.082  1.00 17.81 ? 133 PRO A C   1 
ATOM   1070 O  O   . PRO A 1 133 ? 50.035 8.873  22.030  1.00 16.74 ? 133 PRO A O   1 
ATOM   1071 C  CB  . PRO A 1 133 ? 50.355 10.977 24.435  1.00 20.07 ? 133 PRO A CB  1 
ATOM   1072 C  CG  . PRO A 1 133 ? 49.443 10.909 25.639  1.00 19.19 ? 133 PRO A CG  1 
ATOM   1073 C  CD  . PRO A 1 133 ? 48.541 9.750  25.294  1.00 16.88 ? 133 PRO A CD  1 
ATOM   1074 N  N   . TYR A 1 134 ? 50.495 10.884 21.120  1.00 19.28 ? 134 TYR A N   1 
ATOM   1075 C  CA  . TYR A 1 134 ? 51.172 10.370 19.930  1.00 19.92 ? 134 TYR A CA  1 
ATOM   1076 C  C   . TYR A 1 134 ? 50.344 9.751  18.817  1.00 21.06 ? 134 TYR A C   1 
ATOM   1077 O  O   . TYR A 1 134 ? 50.874 9.500  17.732  1.00 21.63 ? 134 TYR A O   1 
ATOM   1078 C  CB  . TYR A 1 134 ? 52.249 9.371  20.347  1.00 21.26 ? 134 TYR A CB  1 
ATOM   1079 C  CG  . TYR A 1 134 ? 53.331 10.010 21.164  1.00 23.02 ? 134 TYR A CG  1 
ATOM   1080 C  CD1 . TYR A 1 134 ? 54.283 10.839 20.566  1.00 23.41 ? 134 TYR A CD1 1 
ATOM   1081 C  CD2 . TYR A 1 134 ? 53.378 9.836  22.543  1.00 21.42 ? 134 TYR A CD2 1 
ATOM   1082 C  CE1 . TYR A 1 134 ? 55.253 11.482 21.326  1.00 21.61 ? 134 TYR A CE1 1 
ATOM   1083 C  CE2 . TYR A 1 134 ? 54.345 10.474 23.313  1.00 20.72 ? 134 TYR A CE2 1 
ATOM   1084 C  CZ  . TYR A 1 134 ? 55.275 11.297 22.698  1.00 22.20 ? 134 TYR A CZ  1 
ATOM   1085 O  OH  . TYR A 1 134 ? 56.212 11.952 23.460  1.00 20.01 ? 134 TYR A OH  1 
ATOM   1086 N  N   . TRP A 1 135 ? 49.060 9.508  19.056  1.00 19.39 ? 135 TRP A N   1 
ATOM   1087 C  CA  . TRP A 1 135 ? 48.235 8.888  18.021  1.00 19.18 ? 135 TRP A CA  1 
ATOM   1088 C  C   . TRP A 1 135 ? 47.441 9.862  17.162  1.00 18.51 ? 135 TRP A C   1 
ATOM   1089 O  O   . TRP A 1 135 ? 46.814 10.793 17.668  1.00 18.91 ? 135 TRP A O   1 
ATOM   1090 C  CB  . TRP A 1 135 ? 47.233 7.895  18.629  1.00 18.93 ? 135 TRP A CB  1 
ATOM   1091 C  CG  . TRP A 1 135 ? 47.813 6.686  19.316  1.00 19.36 ? 135 TRP A CG  1 
ATOM   1092 C  CD1 . TRP A 1 135 ? 48.368 6.636  20.568  1.00 17.99 ? 135 TRP A CD1 1 
ATOM   1093 C  CD2 . TRP A 1 135 ? 47.828 5.345  18.819  1.00 17.12 ? 135 TRP A CD2 1 
ATOM   1094 N  NE1 . TRP A 1 135 ? 48.716 5.344  20.882  1.00 18.28 ? 135 TRP A NE1 1 
ATOM   1095 C  CE2 . TRP A 1 135 ? 48.393 4.526  19.825  1.00 15.73 ? 135 TRP A CE2 1 
ATOM   1096 C  CE3 . TRP A 1 135 ? 47.413 4.748  17.619  1.00 14.15 ? 135 TRP A CE3 1 
ATOM   1097 C  CZ2 . TRP A 1 135 ? 48.557 3.148  19.677  1.00 15.86 ? 135 TRP A CZ2 1 
ATOM   1098 C  CZ3 . TRP A 1 135 ? 47.577 3.366  17.464  1.00 15.89 ? 135 TRP A CZ3 1 
ATOM   1099 C  CH2 . TRP A 1 135 ? 48.142 2.585  18.492  1.00 16.20 ? 135 TRP A CH2 1 
ATOM   1100 N  N   . ALA A 1 136 ? 47.466 9.634  15.856  1.00 16.98 ? 136 ALA A N   1 
ATOM   1101 C  CA  . ALA A 1 136 ? 46.692 10.451 14.942  1.00 17.32 ? 136 ALA A CA  1 
ATOM   1102 C  C   . ALA A 1 136 ? 45.308 9.819  14.991  1.00 18.05 ? 136 ALA A C   1 
ATOM   1103 O  O   . ALA A 1 136 ? 45.173 8.637  15.311  1.00 18.63 ? 136 ALA A O   1 
ATOM   1104 C  CB  . ALA A 1 136 ? 47.256 10.363 13.535  1.00 16.91 ? 136 ALA A CB  1 
ATOM   1105 N  N   . HIS A 1 137 ? 44.276 10.589 14.682  1.00 18.39 ? 137 HIS A N   1 
ATOM   1106 C  CA  . HIS A 1 137 ? 42.938 10.030 14.712  1.00 19.38 ? 137 HIS A CA  1 
ATOM   1107 C  C   . HIS A 1 137 ? 42.020 10.638 13.677  1.00 19.88 ? 137 HIS A C   1 
ATOM   1108 O  O   . HIS A 1 137 ? 42.096 11.831 13.371  1.00 20.31 ? 137 HIS A O   1 
ATOM   1109 C  CB  . HIS A 1 137 ? 42.334 10.193 16.108  1.00 20.72 ? 137 HIS A CB  1 
ATOM   1110 C  CG  . HIS A 1 137 ? 42.330 11.603 16.598  1.00 23.17 ? 137 HIS A CG  1 
ATOM   1111 N  ND1 . HIS A 1 137 ? 41.226 12.427 16.496  1.00 26.91 ? 137 HIS A ND1 1 
ATOM   1112 C  CD2 . HIS A 1 137 ? 43.305 12.351 17.167  1.00 24.50 ? 137 HIS A CD2 1 
ATOM   1113 C  CE1 . HIS A 1 137 ? 41.522 13.616 16.982  1.00 26.04 ? 137 HIS A CE1 1 
ATOM   1114 N  NE2 . HIS A 1 137 ? 42.778 13.599 17.397  1.00 27.36 ? 137 HIS A NE2 1 
ATOM   1115 N  N   . ARG A 1 138 ? 41.149 9.789  13.149  1.00 17.62 ? 138 ARG A N   1 
ATOM   1116 C  CA  . ARG A 1 138 ? 40.172 10.164 12.153  1.00 17.16 ? 138 ARG A CA  1 
ATOM   1117 C  C   . ARG A 1 138 ? 38.863 9.477  12.527  1.00 18.09 ? 138 ARG A C   1 
ATOM   1118 O  O   . ARG A 1 138 ? 38.859 8.322  12.943  1.00 19.48 ? 138 ARG A O   1 
ATOM   1119 C  CB  . ARG A 1 138 ? 40.633 9.697  10.764  1.00 17.02 ? 138 ARG A CB  1 
ATOM   1120 C  CG  . ARG A 1 138 ? 39.516 9.537  9.739   1.00 14.19 ? 138 ARG A CG  1 
ATOM   1121 C  CD  . ARG A 1 138 ? 40.062 9.017  8.406   1.00 15.90 ? 138 ARG A CD  1 
ATOM   1122 N  NE  . ARG A 1 138 ? 40.836 10.037 7.701   1.00 18.40 ? 138 ARG A NE  1 
ATOM   1123 C  CZ  . ARG A 1 138 ? 41.620 9.804  6.651   1.00 19.53 ? 138 ARG A CZ  1 
ATOM   1124 N  NH1 . ARG A 1 138 ? 41.751 8.570  6.166   1.00 17.20 ? 138 ARG A NH1 1 
ATOM   1125 N  NH2 . ARG A 1 138 ? 42.280 10.810 6.086   1.00 17.60 ? 138 ARG A NH2 1 
ATOM   1126 N  N   . THR A 1 139 ? 37.757 10.195 12.395  1.00 18.05 ? 139 THR A N   1 
ATOM   1127 C  CA  . THR A 1 139 ? 36.453 9.632  12.703  1.00 20.52 ? 139 THR A CA  1 
ATOM   1128 C  C   . THR A 1 139 ? 35.754 9.248  11.396  1.00 20.42 ? 139 THR A C   1 
ATOM   1129 O  O   . THR A 1 139 ? 35.879 9.941  10.388  1.00 17.90 ? 139 THR A O   1 
ATOM   1130 C  CB  . THR A 1 139 ? 35.582 10.636 13.474  1.00 23.08 ? 139 THR A CB  1 
ATOM   1131 O  OG1 . THR A 1 139 ? 36.013 10.697 14.843  1.00 27.12 ? 139 THR A OG1 1 
ATOM   1132 C  CG2 . THR A 1 139 ? 34.131 10.206 13.429  1.00 29.72 ? 139 THR A CG2 1 
ATOM   1133 N  N   . ILE A 1 140 ? 35.023 8.139  11.419  1.00 20.96 ? 140 ILE A N   1 
ATOM   1134 C  CA  . ILE A 1 140 ? 34.330 7.665  10.229  1.00 20.81 ? 140 ILE A CA  1 
ATOM   1135 C  C   . ILE A 1 140 ? 32.860 7.390  10.523  1.00 19.26 ? 140 ILE A C   1 
ATOM   1136 O  O   . ILE A 1 140 ? 32.519 6.909  11.600  1.00 17.98 ? 140 ILE A O   1 
ATOM   1137 C  CB  . ILE A 1 140 ? 34.970 6.362  9.696   1.00 23.50 ? 140 ILE A CB  1 
ATOM   1138 C  CG1 . ILE A 1 140 ? 36.442 6.597  9.333   1.00 26.20 ? 140 ILE A CG1 1 
ATOM   1139 C  CG2 . ILE A 1 140 ? 34.204 5.863  8.485   1.00 25.64 ? 140 ILE A CG2 1 
ATOM   1140 C  CD1 . ILE A 1 140 ? 37.370 6.589  10.517  1.00 29.87 ? 140 ILE A CD1 1 
ATOM   1141 N  N   . ASN A 1 141 ? 31.996 7.709  9.564   1.00 17.87 ? 141 ASN A N   1 
ATOM   1142 C  CA  . ASN A 1 141 ? 30.562 7.472  9.711   1.00 18.26 ? 141 ASN A CA  1 
ATOM   1143 C  C   . ASN A 1 141 ? 30.265 6.232  8.881   1.00 19.17 ? 141 ASN A C   1 
ATOM   1144 O  O   . ASN A 1 141 ? 30.387 6.247  7.656   1.00 18.94 ? 141 ASN A O   1 
ATOM   1145 C  CB  . ASN A 1 141 ? 29.752 8.665  9.181   1.00 15.47 ? 141 ASN A CB  1 
ATOM   1146 C  CG  . ASN A 1 141 ? 28.249 8.463  9.321   1.00 16.31 ? 141 ASN A CG  1 
ATOM   1147 O  OD1 . ASN A 1 141 ? 27.770 7.336  9.491   1.00 15.95 ? 141 ASN A OD1 1 
ATOM   1148 N  ND2 . ASN A 1 141 ? 27.495 9.556  9.236   1.00 13.48 ? 141 ASN A ND2 1 
ATOM   1149 N  N   . THR A 1 142 ? 29.893 5.155  9.558   1.00 21.27 ? 142 THR A N   1 
ATOM   1150 C  CA  . THR A 1 142 ? 29.598 3.898  8.891   1.00 23.78 ? 142 THR A CA  1 
ATOM   1151 C  C   . THR A 1 142 ? 28.097 3.645  8.816   1.00 24.93 ? 142 THR A C   1 
ATOM   1152 O  O   . THR A 1 142 ? 27.667 2.541  8.488   1.00 25.14 ? 142 THR A O   1 
ATOM   1153 C  CB  . THR A 1 142 ? 30.254 2.715  9.634   1.00 22.33 ? 142 THR A CB  1 
ATOM   1154 O  OG1 . THR A 1 142 ? 29.756 2.658  10.977  1.00 24.38 ? 142 THR A OG1 1 
ATOM   1155 C  CG2 . THR A 1 142 ? 31.760 2.874  9.666   1.00 21.72 ? 142 THR A CG2 1 
ATOM   1156 N  N   . GLY A 1 143 ? 27.306 4.671  9.118   1.00 26.10 ? 143 GLY A N   1 
ATOM   1157 C  CA  . GLY A 1 143 ? 25.859 4.518  9.092   1.00 26.35 ? 143 GLY A CA  1 
ATOM   1158 C  C   . GLY A 1 143 ? 25.142 5.288  8.000   1.00 26.09 ? 143 GLY A C   1 
ATOM   1159 O  O   . GLY A 1 143 ? 25.771 5.839  7.092   1.00 26.57 ? 143 GLY A O   1 
ATOM   1160 N  N   . ASP A 1 144 ? 23.817 5.330  8.095   1.00 26.57 ? 144 ASP A N   1 
ATOM   1161 C  CA  . ASP A 1 144 ? 22.999 6.029  7.109   1.00 28.01 ? 144 ASP A CA  1 
ATOM   1162 C  C   . ASP A 1 144 ? 22.459 7.345  7.671   1.00 26.07 ? 144 ASP A C   1 
ATOM   1163 O  O   . ASP A 1 144 ? 21.797 8.110  6.969   1.00 24.62 ? 144 ASP A O   1 
ATOM   1164 C  CB  . ASP A 1 144 ? 21.844 5.122  6.648   1.00 32.28 ? 144 ASP A CB  1 
ATOM   1165 C  CG  . ASP A 1 144 ? 20.841 4.830  7.756   1.00 36.35 ? 144 ASP A CG  1 
ATOM   1166 O  OD1 . ASP A 1 144 ? 21.258 4.670  8.922   1.00 39.07 ? 144 ASP A OD1 1 
ATOM   1167 O  OD2 . ASP A 1 144 ? 19.629 4.742  7.459   1.00 39.74 ? 144 ASP A OD2 1 
ATOM   1168 N  N   . LYS A 1 145 ? 22.753 7.601  8.942   1.00 24.74 ? 145 LYS A N   1 
ATOM   1169 C  CA  . LYS A 1 145 ? 22.314 8.826  9.608   1.00 24.15 ? 145 LYS A CA  1 
ATOM   1170 C  C   . LYS A 1 145 ? 23.544 9.594  10.091  1.00 22.52 ? 145 LYS A C   1 
ATOM   1171 O  O   . LYS A 1 145 ? 24.642 9.037  10.163  1.00 21.75 ? 145 LYS A O   1 
ATOM   1172 C  CB  . LYS A 1 145 ? 21.433 8.486  10.811  1.00 26.15 ? 145 LYS A CB  1 
ATOM   1173 C  CG  . LYS A 1 145 ? 20.124 7.781  10.475  1.00 30.53 ? 145 LYS A CG  1 
ATOM   1174 C  CD  . LYS A 1 145 ? 19.089 8.742  9.919   1.00 32.86 ? 145 LYS A CD  1 
ATOM   1175 C  CE  . LYS A 1 145 ? 17.735 8.559  10.607  1.00 35.63 ? 145 LYS A CE  1 
ATOM   1176 N  NZ  . LYS A 1 145 ? 17.197 7.173  10.474  1.00 35.11 ? 145 LYS A NZ  1 
ATOM   1177 N  N   . PRO A 1 146 ? 23.375 10.885 10.427  1.00 20.51 ? 146 PRO A N   1 
ATOM   1178 C  CA  . PRO A 1 146 ? 24.506 11.681 10.905  1.00 19.79 ? 146 PRO A CA  1 
ATOM   1179 C  C   . PRO A 1 146 ? 25.150 11.040 12.135  1.00 18.92 ? 146 PRO A C   1 
ATOM   1180 O  O   . PRO A 1 146 ? 24.465 10.511 13.014  1.00 18.16 ? 146 PRO A O   1 
ATOM   1181 C  CB  . PRO A 1 146 ? 23.868 13.035 11.233  1.00 19.20 ? 146 PRO A CB  1 
ATOM   1182 C  CG  . PRO A 1 146 ? 22.721 13.112 10.273  1.00 20.55 ? 146 PRO A CG  1 
ATOM   1183 C  CD  . PRO A 1 146 ? 22.157 11.710 10.327  1.00 20.84 ? 146 PRO A CD  1 
ATOM   1184 N  N   . PHE A 1 147 ? 26.473 11.079 12.179  1.00 18.62 ? 147 PHE A N   1 
ATOM   1185 C  CA  . PHE A 1 147 ? 27.223 10.527 13.299  1.00 18.84 ? 147 PHE A CA  1 
ATOM   1186 C  C   . PHE A 1 147 ? 27.661 11.751 14.100  1.00 18.40 ? 147 PHE A C   1 
ATOM   1187 O  O   . PHE A 1 147 ? 28.449 12.561 13.622  1.00 18.07 ? 147 PHE A O   1 
ATOM   1188 C  CB  . PHE A 1 147 ? 28.423 9.727  12.776  1.00 17.37 ? 147 PHE A CB  1 
ATOM   1189 C  CG  . PHE A 1 147 ? 29.316 9.181  13.858  1.00 19.95 ? 147 PHE A CG  1 
ATOM   1190 C  CD1 . PHE A 1 147 ? 28.779 8.664  15.033  1.00 19.56 ? 147 PHE A CD1 1 
ATOM   1191 C  CD2 . PHE A 1 147 ? 30.697 9.160  13.688  1.00 19.41 ? 147 PHE A CD2 1 
ATOM   1192 C  CE1 . PHE A 1 147 ? 29.602 8.129  16.029  1.00 19.32 ? 147 PHE A CE1 1 
ATOM   1193 C  CE2 . PHE A 1 147 ? 31.529 8.626  14.677  1.00 20.49 ? 147 PHE A CE2 1 
ATOM   1194 C  CZ  . PHE A 1 147 ? 30.979 8.111  15.851  1.00 18.90 ? 147 PHE A CZ  1 
ATOM   1195 N  N   . ILE A 1 148 ? 27.129 11.885 15.311  1.00 16.60 ? 148 ILE A N   1 
ATOM   1196 C  CA  . ILE A 1 148 ? 27.423 13.035 16.155  1.00 18.20 ? 148 ILE A CA  1 
ATOM   1197 C  C   . ILE A 1 148 ? 28.226 12.679 17.404  1.00 18.46 ? 148 ILE A C   1 
ATOM   1198 O  O   . ILE A 1 148 ? 27.927 11.692 18.085  1.00 14.89 ? 148 ILE A O   1 
ATOM   1199 C  CB  . ILE A 1 148 ? 26.101 13.729 16.583  1.00 19.25 ? 148 ILE A CB  1 
ATOM   1200 C  CG1 . ILE A 1 148 ? 25.274 14.067 15.337  1.00 20.35 ? 148 ILE A CG1 1 
ATOM   1201 C  CG2 . ILE A 1 148 ? 26.396 15.001 17.385  1.00 18.95 ? 148 ILE A CG2 1 
ATOM   1202 C  CD1 . ILE A 1 148 ? 23.897 14.628 15.643  1.00 19.14 ? 148 ILE A CD1 1 
ATOM   1203 N  N   . PHE A 1 149 ? 29.246 13.488 17.697  1.00 17.51 ? 149 PHE A N   1 
ATOM   1204 C  CA  . PHE A 1 149 ? 30.084 13.257 18.871  1.00 16.08 ? 149 PHE A CA  1 
ATOM   1205 C  C   . PHE A 1 149 ? 30.699 14.515 19.458  1.00 16.25 ? 149 PHE A C   1 
ATOM   1206 O  O   . PHE A 1 149 ? 30.813 15.547 18.798  1.00 14.58 ? 149 PHE A O   1 
ATOM   1207 C  CB  . PHE A 1 149 ? 31.193 12.248 18.542  1.00 16.07 ? 149 PHE A CB  1 
ATOM   1208 C  CG  . PHE A 1 149 ? 32.083 12.662 17.396  1.00 17.39 ? 149 PHE A CG  1 
ATOM   1209 C  CD1 . PHE A 1 149 ? 33.141 13.547 17.596  1.00 16.34 ? 149 PHE A CD1 1 
ATOM   1210 C  CD2 . PHE A 1 149 ? 31.876 12.146 16.118  1.00 15.37 ? 149 PHE A CD2 1 
ATOM   1211 C  CE1 . PHE A 1 149 ? 33.986 13.909 16.533  1.00 18.47 ? 149 PHE A CE1 1 
ATOM   1212 C  CE2 . PHE A 1 149 ? 32.711 12.502 15.050  1.00 18.17 ? 149 PHE A CE2 1 
ATOM   1213 C  CZ  . PHE A 1 149 ? 33.770 13.383 15.259  1.00 15.73 ? 149 PHE A CZ  1 
ATOM   1214 N  N   . LEU A 1 150 ? 31.085 14.417 20.724  1.00 17.41 ? 150 LEU A N   1 
ATOM   1215 C  CA  . LEU A 1 150 ? 31.722 15.518 21.423  1.00 16.50 ? 150 LEU A CA  1 
ATOM   1216 C  C   . LEU A 1 150 ? 33.192 15.148 21.634  1.00 16.22 ? 150 LEU A C   1 
ATOM   1217 O  O   . LEU A 1 150 ? 33.504 14.007 21.959  1.00 15.90 ? 150 LEU A O   1 
ATOM   1218 C  CB  . LEU A 1 150 ? 31.047 15.735 22.775  1.00 16.04 ? 150 LEU A CB  1 
ATOM   1219 C  CG  . LEU A 1 150 ? 31.699 16.774 23.688  1.00 17.33 ? 150 LEU A CG  1 
ATOM   1220 C  CD1 . LEU A 1 150 ? 31.592 18.154 23.051  1.00 14.48 ? 150 LEU A CD1 1 
ATOM   1221 C  CD2 . LEU A 1 150 ? 31.015 16.750 25.054  1.00 16.57 ? 150 LEU A CD2 1 
ATOM   1222 N  N   . ALA A 1 151 ? 34.088 16.108 21.437  1.00 16.61 ? 151 ALA A N   1 
ATOM   1223 C  CA  . ALA A 1 151 ? 35.515 15.866 21.629  1.00 17.93 ? 151 ALA A CA  1 
ATOM   1224 C  C   . ALA A 1 151 ? 36.074 16.901 22.594  1.00 18.59 ? 151 ALA A C   1 
ATOM   1225 O  O   . ALA A 1 151 ? 35.693 18.073 22.549  1.00 20.37 ? 151 ALA A O   1 
ATOM   1226 C  CB  . ALA A 1 151 ? 36.258 15.934 20.286  1.00 16.12 ? 151 ALA A CB  1 
ATOM   1227 N  N   . LEU A 1 152 ? 36.964 16.458 23.473  1.00 20.92 ? 152 LEU A N   1 
ATOM   1228 C  CA  . LEU A 1 152 ? 37.593 17.338 24.451  1.00 18.63 ? 152 LEU A CA  1 
ATOM   1229 C  C   . LEU A 1 152 ? 39.100 17.199 24.336  1.00 17.23 ? 152 LEU A C   1 
ATOM   1230 O  O   . LEU A 1 152 ? 39.631 16.093 24.376  1.00 15.63 ? 152 LEU A O   1 
ATOM   1231 C  CB  . LEU A 1 152 ? 37.144 16.975 25.862  1.00 22.77 ? 152 LEU A CB  1 
ATOM   1232 C  CG  . LEU A 1 152 ? 35.667 17.248 26.159  1.00 27.84 ? 152 LEU A CG  1 
ATOM   1233 C  CD1 . LEU A 1 152 ? 34.822 16.048 25.758  1.00 28.49 ? 152 LEU A CD1 1 
ATOM   1234 C  CD2 . LEU A 1 152 ? 35.503 17.536 27.641  1.00 30.04 ? 152 LEU A CD2 1 
ATOM   1235 N  N   . TYR A 1 153 ? 39.795 18.320 24.211  1.00 15.81 ? 153 TYR A N   1 
ATOM   1236 C  CA  . TYR A 1 153 ? 41.240 18.274 24.049  1.00 16.29 ? 153 TYR A CA  1 
ATOM   1237 C  C   . TYR A 1 153 ? 41.950 19.467 24.677  1.00 16.35 ? 153 TYR A C   1 
ATOM   1238 O  O   . TYR A 1 153 ? 41.358 20.538 24.852  1.00 15.36 ? 153 TYR A O   1 
ATOM   1239 C  CB  . TYR A 1 153 ? 41.570 18.186 22.548  1.00 19.59 ? 153 TYR A CB  1 
ATOM   1240 C  CG  . TYR A 1 153 ? 40.785 19.174 21.699  1.00 20.44 ? 153 TYR A CG  1 
ATOM   1241 C  CD1 . TYR A 1 153 ? 41.398 20.303 21.153  1.00 22.10 ? 153 TYR A CD1 1 
ATOM   1242 C  CD2 . TYR A 1 153 ? 39.411 19.013 21.508  1.00 22.03 ? 153 TYR A CD2 1 
ATOM   1243 C  CE1 . TYR A 1 153 ? 40.652 21.261 20.433  1.00 23.24 ? 153 TYR A CE1 1 
ATOM   1244 C  CE2 . TYR A 1 153 ? 38.657 19.955 20.804  1.00 22.80 ? 153 TYR A CE2 1 
ATOM   1245 C  CZ  . TYR A 1 153 ? 39.281 21.072 20.270  1.00 24.68 ? 153 TYR A CZ  1 
ATOM   1246 O  OH  . TYR A 1 153 ? 38.523 21.990 19.572  1.00 27.36 ? 153 TYR A OH  1 
ATOM   1247 N  N   . PRO A 1 154 ? 43.230 19.291 25.046  1.00 16.86 ? 154 PRO A N   1 
ATOM   1248 C  CA  . PRO A 1 154 ? 44.001 20.379 25.653  1.00 18.29 ? 154 PRO A CA  1 
ATOM   1249 C  C   . PRO A 1 154 ? 44.025 21.592 24.730  1.00 17.70 ? 154 PRO A C   1 
ATOM   1250 O  O   . PRO A 1 154 ? 44.166 21.452 23.513  1.00 16.61 ? 154 PRO A O   1 
ATOM   1251 C  CB  . PRO A 1 154 ? 45.386 19.758 25.837  1.00 18.13 ? 154 PRO A CB  1 
ATOM   1252 C  CG  . PRO A 1 154 ? 45.061 18.321 26.100  1.00 17.47 ? 154 PRO A CG  1 
ATOM   1253 C  CD  . PRO A 1 154 ? 44.011 18.040 25.048  1.00 18.07 ? 154 PRO A CD  1 
ATOM   1254 N  N   . ALA A 1 155 ? 43.892 22.777 25.317  1.00 17.64 ? 155 ALA A N   1 
ATOM   1255 C  CA  . ALA A 1 155 ? 43.885 24.019 24.547  1.00 18.69 ? 155 ALA A CA  1 
ATOM   1256 C  C   . ALA A 1 155 ? 45.205 24.305 23.834  1.00 19.63 ? 155 ALA A C   1 
ATOM   1257 O  O   . ALA A 1 155 ? 45.256 25.153 22.943  1.00 19.54 ? 155 ALA A O   1 
ATOM   1258 C  CB  . ALA A 1 155 ? 43.523 25.189 25.458  1.00 17.60 ? 155 ALA A CB  1 
ATOM   1259 N  N   . ASP A 1 156 ? 46.268 23.603 24.217  1.00 20.06 ? 156 ASP A N   1 
ATOM   1260 C  CA  . ASP A 1 156 ? 47.566 23.822 23.591  1.00 21.93 ? 156 ASP A CA  1 
ATOM   1261 C  C   . ASP A 1 156 ? 48.002 22.641 22.721  1.00 21.27 ? 156 ASP A C   1 
ATOM   1262 O  O   . ASP A 1 156 ? 49.150 22.569 22.291  1.00 20.75 ? 156 ASP A O   1 
ATOM   1263 C  CB  . ASP A 1 156 ? 48.633 24.126 24.663  1.00 20.13 ? 156 ASP A CB  1 
ATOM   1264 C  CG  . ASP A 1 156 ? 49.021 22.906 25.483  1.00 22.83 ? 156 ASP A CG  1 
ATOM   1265 O  OD1 . ASP A 1 156 ? 48.466 21.811 25.252  1.00 21.60 ? 156 ASP A OD1 1 
ATOM   1266 O  OD2 . ASP A 1 156 ? 49.897 23.045 26.368  1.00 20.75 ? 156 ASP A OD2 1 
ATOM   1267 N  N   . ALA A 1 157 ? 47.072 21.725 22.459  1.00 20.82 ? 157 ALA A N   1 
ATOM   1268 C  CA  . ALA A 1 157 ? 47.354 20.543 21.644  1.00 20.67 ? 157 ALA A CA  1 
ATOM   1269 C  C   . ALA A 1 157 ? 47.654 20.917 20.194  1.00 20.53 ? 157 ALA A C   1 
ATOM   1270 O  O   . ALA A 1 157 ? 48.537 20.333 19.561  1.00 20.26 ? 157 ALA A O   1 
ATOM   1271 C  CB  . ALA A 1 157 ? 46.171 19.577 21.695  1.00 17.49 ? 157 ALA A CB  1 
ATOM   1272 N  N   . GLY A 1 158 ? 46.918 21.895 19.674  1.00 19.04 ? 158 GLY A N   1 
ATOM   1273 C  CA  . GLY A 1 158 ? 47.119 22.314 18.298  1.00 20.98 ? 158 GLY A CA  1 
ATOM   1274 C  C   . GLY A 1 158 ? 46.713 21.244 17.295  1.00 22.42 ? 158 GLY A C   1 
ATOM   1275 O  O   . GLY A 1 158 ? 46.207 20.182 17.672  1.00 23.20 ? 158 GLY A O   1 
ATOM   1276 N  N   . HIS A 1 159 ? 46.936 21.520 16.013  1.00 22.60 ? 159 HIS A N   1 
ATOM   1277 C  CA  . HIS A 1 159 ? 46.581 20.571 14.966  1.00 21.98 ? 159 HIS A CA  1 
ATOM   1278 C  C   . HIS A 1 159 ? 47.679 20.384 13.925  1.00 22.87 ? 159 HIS A C   1 
ATOM   1279 O  O   . HIS A 1 159 ? 48.286 21.354 13.462  1.00 22.66 ? 159 HIS A O   1 
ATOM   1280 C  CB  . HIS A 1 159 ? 45.312 21.018 14.240  1.00 21.32 ? 159 HIS A CB  1 
ATOM   1281 C  CG  . HIS A 1 159 ? 44.137 21.243 15.140  1.00 21.46 ? 159 HIS A CG  1 
ATOM   1282 N  ND1 . HIS A 1 159 ? 43.996 22.377 15.911  1.00 21.47 ? 159 HIS A ND1 1 
ATOM   1283 C  CD2 . HIS A 1 159 ? 43.047 20.481 15.389  1.00 19.57 ? 159 HIS A CD2 1 
ATOM   1284 C  CE1 . HIS A 1 159 ? 42.869 22.304 16.594  1.00 20.32 ? 159 HIS A CE1 1 
ATOM   1285 N  NE2 . HIS A 1 159 ? 42.274 21.164 16.296  1.00 21.71 ? 159 HIS A NE2 1 
ATOM   1286 N  N   . ASP A 1 160 ? 47.926 19.129 13.563  1.00 22.78 ? 160 ASP A N   1 
ATOM   1287 C  CA  . ASP A 1 160 ? 48.909 18.803 12.538  1.00 23.94 ? 160 ASP A CA  1 
ATOM   1288 C  C   . ASP A 1 160 ? 48.234 17.957 11.450  1.00 23.58 ? 160 ASP A C   1 
ATOM   1289 O  O   . ASP A 1 160 ? 48.157 16.732 11.561  1.00 24.01 ? 160 ASP A O   1 
ATOM   1290 C  CB  . ASP A 1 160 ? 50.097 18.051 13.141  1.00 27.28 ? 160 ASP A CB  1 
ATOM   1291 C  CG  . ASP A 1 160 ? 51.136 17.694 12.100  1.00 30.50 ? 160 ASP A CG  1 
ATOM   1292 O  OD1 . ASP A 1 160 ? 51.205 18.409 11.081  1.00 32.54 ? 160 ASP A OD1 1 
ATOM   1293 O  OD2 . ASP A 1 160 ? 51.888 16.714 12.296  1.00 34.71 ? 160 ASP A OD2 1 
ATOM   1294 N  N   . TYR A 1 161 ? 47.741 18.631 10.409  1.00 22.37 ? 161 TYR A N   1 
ATOM   1295 C  CA  . TYR A 1 161 ? 47.045 18.002 9.282   1.00 23.01 ? 161 TYR A CA  1 
ATOM   1296 C  C   . TYR A 1 161 ? 47.968 17.607 8.125   1.00 23.95 ? 161 TYR A C   1 
ATOM   1297 O  O   . TYR A 1 161 ? 47.648 16.707 7.348   1.00 24.55 ? 161 TYR A O   1 
ATOM   1298 C  CB  . TYR A 1 161 ? 45.974 18.960 8.731   1.00 22.15 ? 161 TYR A CB  1 
ATOM   1299 C  CG  . TYR A 1 161 ? 44.812 19.233 9.662   1.00 22.45 ? 161 TYR A CG  1 
ATOM   1300 C  CD1 . TYR A 1 161 ? 43.791 18.299 9.826   1.00 22.25 ? 161 TYR A CD1 1 
ATOM   1301 C  CD2 . TYR A 1 161 ? 44.734 20.426 10.383  1.00 22.61 ? 161 TYR A CD2 1 
ATOM   1302 C  CE1 . TYR A 1 161 ? 42.723 18.544 10.682  1.00 19.92 ? 161 TYR A CE1 1 
ATOM   1303 C  CE2 . TYR A 1 161 ? 43.675 20.680 11.245  1.00 20.39 ? 161 TYR A CE2 1 
ATOM   1304 C  CZ  . TYR A 1 161 ? 42.672 19.732 11.390  1.00 22.23 ? 161 TYR A CZ  1 
ATOM   1305 O  OH  . TYR A 1 161 ? 41.624 19.971 12.248  1.00 21.09 ? 161 TYR A OH  1 
ATOM   1306 N  N   . GLY A 1 162 ? 49.106 18.291 8.029   1.00 25.42 ? 162 GLY A N   1 
ATOM   1307 C  CA  . GLY A 1 162 ? 50.073 18.069 6.963   1.00 25.42 ? 162 GLY A CA  1 
ATOM   1308 C  C   . GLY A 1 162 ? 50.450 16.659 6.565   1.00 25.80 ? 162 GLY A C   1 
ATOM   1309 O  O   . GLY A 1 162 ? 50.253 16.263 5.411   1.00 24.68 ? 162 GLY A O   1 
ATOM   1310 N  N   . THR A 1 163 ? 51.017 15.913 7.510   1.00 26.12 ? 163 THR A N   1 
ATOM   1311 C  CA  . THR A 1 163 ? 51.438 14.537 7.276   1.00 29.18 ? 163 THR A CA  1 
ATOM   1312 C  C   . THR A 1 163 ? 50.317 13.706 6.652   1.00 28.85 ? 163 THR A C   1 
ATOM   1313 O  O   . THR A 1 163 ? 50.537 12.968 5.694   1.00 28.38 ? 163 THR A O   1 
ATOM   1314 C  CB  . THR A 1 163 ? 51.849 13.859 8.592   1.00 31.71 ? 163 THR A CB  1 
ATOM   1315 O  OG1 . THR A 1 163 ? 52.622 14.772 9.377   1.00 37.62 ? 163 THR A OG1 1 
ATOM   1316 C  CG2 . THR A 1 163 ? 52.677 12.614 8.312   1.00 33.03 ? 163 THR A CG2 1 
ATOM   1317 N  N   . ILE A 1 164 ? 49.113 13.832 7.203   1.00 28.33 ? 164 ILE A N   1 
ATOM   1318 C  CA  . ILE A 1 164 ? 47.963 13.082 6.708   1.00 27.89 ? 164 ILE A CA  1 
ATOM   1319 C  C   . ILE A 1 164 ? 47.445 13.533 5.339   1.00 28.11 ? 164 ILE A C   1 
ATOM   1320 O  O   . ILE A 1 164 ? 47.075 12.699 4.506   1.00 27.10 ? 164 ILE A O   1 
ATOM   1321 C  CB  . ILE A 1 164 ? 46.822 13.117 7.743   1.00 26.37 ? 164 ILE A CB  1 
ATOM   1322 C  CG1 . ILE A 1 164 ? 47.258 12.324 8.978   1.00 28.98 ? 164 ILE A CG1 1 
ATOM   1323 C  CG2 . ILE A 1 164 ? 45.548 12.537 7.151   1.00 24.26 ? 164 ILE A CG2 1 
ATOM   1324 C  CD1 . ILE A 1 164 ? 46.294 12.386 10.127  1.00 31.56 ? 164 ILE A CD1 1 
ATOM   1325 N  N   . ALA A 1 165 ? 47.412 14.839 5.099   1.00 28.47 ? 165 ALA A N   1 
ATOM   1326 C  CA  . ALA A 1 165 ? 46.945 15.349 3.808   1.00 29.73 ? 165 ALA A CA  1 
ATOM   1327 C  C   . ALA A 1 165 ? 47.887 14.829 2.726   1.00 30.34 ? 165 ALA A C   1 
ATOM   1328 O  O   . ALA A 1 165 ? 47.505 14.630 1.573   1.00 31.56 ? 165 ALA A O   1 
ATOM   1329 C  CB  . ALA A 1 165 ? 46.952 16.876 3.814   1.00 29.79 ? 165 ALA A CB  1 
ATOM   1330 N  N   . GLU A 1 166 ? 49.128 14.611 3.136   1.00 32.21 ? 166 GLU A N   1 
ATOM   1331 C  CA  . GLU A 1 166 ? 50.196 14.125 2.281   1.00 33.42 ? 166 GLU A CA  1 
ATOM   1332 C  C   . GLU A 1 166 ? 50.100 12.620 2.012   1.00 34.60 ? 166 GLU A C   1 
ATOM   1333 O  O   . GLU A 1 166 ? 49.794 12.186 0.894   1.00 32.50 ? 166 GLU A O   1 
ATOM   1334 C  CB  . GLU A 1 166 ? 51.530 14.450 2.960   1.00 36.09 ? 166 GLU A CB  1 
ATOM   1335 C  CG  . GLU A 1 166 ? 52.729 13.679 2.467   1.00 40.35 ? 166 GLU A CG  1 
ATOM   1336 C  CD  . GLU A 1 166 ? 53.417 14.353 1.312   1.00 41.61 ? 166 GLU A CD  1 
ATOM   1337 O  OE1 . GLU A 1 166 ? 52.774 14.542 0.259   1.00 45.06 ? 166 GLU A OE1 1 
ATOM   1338 O  OE2 . GLU A 1 166 ? 54.605 14.696 1.458   1.00 42.83 ? 166 GLU A OE2 1 
ATOM   1339 N  N   . LYS A 1 167 ? 50.343 11.833 3.056   1.00 33.68 ? 167 LYS A N   1 
ATOM   1340 C  CA  . LYS A 1 167 ? 50.348 10.379 2.947   1.00 33.38 ? 167 LYS A CA  1 
ATOM   1341 C  C   . LYS A 1 167 ? 49.074 9.631  3.329   1.00 32.25 ? 167 LYS A C   1 
ATOM   1342 O  O   . LYS A 1 167 ? 48.983 8.424  3.108   1.00 31.38 ? 167 LYS A O   1 
ATOM   1343 C  CB  . LYS A 1 167 ? 51.523 9.845  3.765   1.00 35.48 ? 167 LYS A CB  1 
ATOM   1344 C  CG  . LYS A 1 167 ? 52.842 10.466 3.335   1.00 38.66 ? 167 LYS A CG  1 
ATOM   1345 C  CD  . LYS A 1 167 ? 53.975 10.202 4.301   1.00 39.91 ? 167 LYS A CD  1 
ATOM   1346 C  CE  . LYS A 1 167 ? 55.237 10.910 3.817   1.00 41.11 ? 167 LYS A CE  1 
ATOM   1347 N  NZ  . LYS A 1 167 ? 56.406 10.678 4.708   1.00 44.17 ? 167 LYS A NZ  1 
ATOM   1348 N  N   . GLY A 1 168 ? 48.095 10.336 3.887   1.00 29.96 ? 168 GLY A N   1 
ATOM   1349 C  CA  . GLY A 1 168 ? 46.858 9.689  4.290   1.00 27.13 ? 168 GLY A CA  1 
ATOM   1350 C  C   . GLY A 1 168 ? 47.112 8.740  5.448   1.00 26.84 ? 168 GLY A C   1 
ATOM   1351 O  O   . GLY A 1 168 ? 48.167 8.803  6.074   1.00 25.60 ? 168 GLY A O   1 
ATOM   1352 N  N   . PHE A 1 169 ? 46.151 7.870  5.745   1.00 25.42 ? 169 PHE A N   1 
ATOM   1353 C  CA  . PHE A 1 169 ? 46.307 6.896  6.826   1.00 25.85 ? 169 PHE A CA  1 
ATOM   1354 C  C   . PHE A 1 169 ? 46.769 5.578  6.211   1.00 25.78 ? 169 PHE A C   1 
ATOM   1355 O  O   . PHE A 1 169 ? 46.592 5.352  5.013   1.00 25.17 ? 169 PHE A O   1 
ATOM   1356 C  CB  . PHE A 1 169 ? 44.977 6.688  7.572   1.00 25.01 ? 169 PHE A CB  1 
ATOM   1357 C  CG  . PHE A 1 169 ? 44.717 7.696  8.669   1.00 26.12 ? 169 PHE A CG  1 
ATOM   1358 C  CD1 . PHE A 1 169 ? 44.828 7.329  10.011  1.00 25.77 ? 169 PHE A CD1 1 
ATOM   1359 C  CD2 . PHE A 1 169 ? 44.344 9.001  8.364   1.00 25.14 ? 169 PHE A CD2 1 
ATOM   1360 C  CE1 . PHE A 1 169 ? 44.567 8.249  11.034  1.00 26.77 ? 169 PHE A CE1 1 
ATOM   1361 C  CE2 . PHE A 1 169 ? 44.079 9.928  9.376   1.00 25.37 ? 169 PHE A CE2 1 
ATOM   1362 C  CZ  . PHE A 1 169 ? 44.190 9.552  10.715  1.00 24.86 ? 169 PHE A CZ  1 
ATOM   1363 N  N   . SER A 1 170 ? 47.363 4.711  7.025   1.00 25.35 ? 170 SER A N   1 
ATOM   1364 C  CA  . SER A 1 170 ? 47.843 3.427  6.527   1.00 26.89 ? 170 SER A CA  1 
ATOM   1365 C  C   . SER A 1 170 ? 46.689 2.487  6.221   1.00 27.32 ? 170 SER A C   1 
ATOM   1366 O  O   . SER A 1 170 ? 46.882 1.440  5.605   1.00 29.23 ? 170 SER A O   1 
ATOM   1367 C  CB  . SER A 1 170 ? 48.771 2.770  7.549   1.00 25.80 ? 170 SER A CB  1 
ATOM   1368 O  OG  . SER A 1 170 ? 48.043 2.322  8.678   1.00 24.80 ? 170 SER A OG  1 
ATOM   1369 N  N   . LYS A 1 171 ? 45.486 2.871  6.641   1.00 26.88 ? 171 LYS A N   1 
ATOM   1370 C  CA  . LYS A 1 171 ? 44.295 2.052  6.429   1.00 25.54 ? 171 LYS A CA  1 
ATOM   1371 C  C   . LYS A 1 171 ? 43.115 2.874  5.918   1.00 24.61 ? 171 LYS A C   1 
ATOM   1372 O  O   . LYS A 1 171 ? 43.076 4.091  6.083   1.00 23.84 ? 171 LYS A O   1 
ATOM   1373 C  CB  . LYS A 1 171 ? 43.874 1.390  7.748   1.00 27.26 ? 171 LYS A CB  1 
ATOM   1374 C  CG  . LYS A 1 171 ? 44.922 0.502  8.406   1.00 28.92 ? 171 LYS A CG  1 
ATOM   1375 C  CD  . LYS A 1 171 ? 45.128 -0.796 7.631   1.00 29.41 ? 171 LYS A CD  1 
ATOM   1376 C  CE  . LYS A 1 171 ? 46.162 -1.689 8.302   1.00 28.93 ? 171 LYS A CE  1 
ATOM   1377 N  NZ  . LYS A 1 171 ? 46.369 -2.948 7.528   1.00 30.74 ? 171 LYS A NZ  1 
ATOM   1378 N  N   . ILE A 1 172 ? 42.154 2.202  5.294   1.00 24.66 ? 172 ILE A N   1 
ATOM   1379 C  CA  . ILE A 1 172 ? 40.944 2.866  4.818   1.00 24.39 ? 172 ILE A CA  1 
ATOM   1380 C  C   . ILE A 1 172 ? 39.777 2.052  5.355   1.00 23.43 ? 172 ILE A C   1 
ATOM   1381 O  O   . ILE A 1 172 ? 39.921 0.853  5.608   1.00 24.62 ? 172 ILE A O   1 
ATOM   1382 C  CB  . ILE A 1 172 ? 40.856 2.932  3.274   1.00 24.36 ? 172 ILE A CB  1 
ATOM   1383 C  CG1 . ILE A 1 172 ? 40.694 1.523  2.691   1.00 25.79 ? 172 ILE A CG1 1 
ATOM   1384 C  CG2 . ILE A 1 172 ? 42.083 3.641  2.723   1.00 23.71 ? 172 ILE A CG2 1 
ATOM   1385 C  CD1 . ILE A 1 172 ? 40.407 1.504  1.196   1.00 27.77 ? 172 ILE A CD1 1 
ATOM   1386 N  N   . VAL A 1 173 ? 38.637 2.707  5.540   1.00 22.30 ? 173 VAL A N   1 
ATOM   1387 C  CA  . VAL A 1 173 ? 37.437 2.068  6.073   1.00 24.53 ? 173 VAL A CA  1 
ATOM   1388 C  C   . VAL A 1 173 ? 36.366 2.055  4.989   1.00 25.74 ? 173 VAL A C   1 
ATOM   1389 O  O   . VAL A 1 173 ? 35.782 3.089  4.672   1.00 26.93 ? 173 VAL A O   1 
ATOM   1390 C  CB  . VAL A 1 173 ? 36.909 2.844  7.309   1.00 23.12 ? 173 VAL A CB  1 
ATOM   1391 C  CG1 . VAL A 1 173 ? 35.710 2.135  7.904   1.00 24.02 ? 173 VAL A CG1 1 
ATOM   1392 C  CG2 . VAL A 1 173 ? 38.019 2.989  8.345   1.00 20.76 ? 173 VAL A CG2 1 
ATOM   1393 N  N   . VAL A 1 174 ? 36.100 0.876  4.439   1.00 27.13 ? 174 VAL A N   1 
ATOM   1394 C  CA  . VAL A 1 174 ? 35.134 0.739  3.359   1.00 27.83 ? 174 VAL A CA  1 
ATOM   1395 C  C   . VAL A 1 174 ? 33.997 -0.234 3.638   1.00 29.46 ? 174 VAL A C   1 
ATOM   1396 O  O   . VAL A 1 174 ? 34.003 -0.954 4.641   1.00 29.55 ? 174 VAL A O   1 
ATOM   1397 C  CB  . VAL A 1 174 ? 35.850 0.290  2.070   1.00 26.24 ? 174 VAL A CB  1 
ATOM   1398 C  CG1 . VAL A 1 174 ? 37.022 1.217  1.784   1.00 22.27 ? 174 VAL A CG1 1 
ATOM   1399 C  CG2 . VAL A 1 174 ? 36.340 -1.138 2.226   1.00 27.01 ? 174 VAL A CG2 1 
ATOM   1400 N  N   . GLU A 1 175 ? 33.018 -0.244 2.738   1.00 31.40 ? 175 GLU A N   1 
ATOM   1401 C  CA  . GLU A 1 175 ? 31.876 -1.135 2.867   1.00 34.87 ? 175 GLU A CA  1 
ATOM   1402 C  C   . GLU A 1 175 ? 31.898 -2.201 1.777   1.00 36.43 ? 175 GLU A C   1 
ATOM   1403 O  O   . GLU A 1 175 ? 31.940 -1.893 0.585   1.00 35.06 ? 175 GLU A O   1 
ATOM   1404 C  CB  . GLU A 1 175 ? 30.561 -0.352 2.787   1.00 35.19 ? 175 GLU A CB  1 
ATOM   1405 C  CG  . GLU A 1 175 ? 29.328 -1.211 3.062   1.00 38.20 ? 175 GLU A CG  1 
ATOM   1406 C  CD  . GLU A 1 175 ? 28.031 -0.425 2.995   1.00 40.89 ? 175 GLU A CD  1 
ATOM   1407 O  OE1 . GLU A 1 175 ? 26.961 -1.022 3.238   1.00 42.88 ? 175 GLU A OE1 1 
ATOM   1408 O  OE2 . GLU A 1 175 ? 28.077 0.788  2.700   1.00 43.75 ? 175 GLU A OE2 1 
ATOM   1409 N  N   . GLU A 1 176 ? 31.884 -3.458 2.209   1.00 39.23 ? 176 GLU A N   1 
ATOM   1410 C  CA  . GLU A 1 176 ? 31.879 -4.614 1.316   1.00 41.67 ? 176 GLU A CA  1 
ATOM   1411 C  C   . GLU A 1 176 ? 30.963 -5.597 2.021   1.00 43.20 ? 176 GLU A C   1 
ATOM   1412 O  O   . GLU A 1 176 ? 31.425 -6.415 2.816   1.00 43.74 ? 176 GLU A O   1 
ATOM   1413 C  CB  . GLU A 1 176 ? 33.279 -5.222 1.205   1.00 41.20 ? 176 GLU A CB  1 
ATOM   1414 C  CG  . GLU A 1 176 ? 34.387 -4.215 0.968   1.00 43.71 ? 176 GLU A CG  1 
ATOM   1415 C  CD  . GLU A 1 176 ? 35.756 -4.859 0.933   1.00 43.90 ? 176 GLU A CD  1 
ATOM   1416 O  OE1 . GLU A 1 176 ? 35.981 -5.812 1.707   1.00 44.94 ? 176 GLU A OE1 1 
ATOM   1417 O  OE2 . GLU A 1 176 ? 36.611 -4.404 0.144   1.00 45.49 ? 176 GLU A OE2 1 
ATOM   1418 N  N   . ASN A 1 177 ? 29.666 -5.509 1.751   1.00 45.60 ? 177 ASN A N   1 
ATOM   1419 C  CA  . ASN A 1 177 ? 28.705 -6.382 2.411   1.00 47.90 ? 177 ASN A CA  1 
ATOM   1420 C  C   . ASN A 1 177 ? 28.774 -6.114 3.920   1.00 48.50 ? 177 ASN A C   1 
ATOM   1421 O  O   . ASN A 1 177 ? 28.039 -6.721 4.700   1.00 50.68 ? 177 ASN A O   1 
ATOM   1422 C  CB  . ASN A 1 177 ? 29.041 -7.853 2.143   1.00 50.58 ? 177 ASN A CB  1 
ATOM   1423 C  CG  . ASN A 1 177 ? 28.992 -8.207 0.670   1.00 53.12 ? 177 ASN A CG  1 
ATOM   1424 O  OD1 . ASN A 1 177 ? 27.947 -8.109 0.030   1.00 55.51 ? 177 ASN A OD1 1 
ATOM   1425 N  ND2 . ASN A 1 177 ? 30.128 -8.629 0.125   1.00 55.01 ? 177 ASN A ND2 1 
ATOM   1426 N  N   . GLY A 1 178 ? 29.666 -5.204 4.316   1.00 46.03 ? 178 GLY A N   1 
ATOM   1427 C  CA  . GLY A 1 178 ? 29.848 -4.853 5.716   1.00 40.92 ? 178 GLY A CA  1 
ATOM   1428 C  C   . GLY A 1 178 ? 31.009 -3.884 5.895   1.00 38.68 ? 178 GLY A C   1 
ATOM   1429 O  O   . GLY A 1 178 ? 31.666 -3.509 4.924   1.00 37.34 ? 178 GLY A O   1 
ATOM   1430 N  N   . LYS A 1 179 ? 31.273 -3.482 7.133   1.00 36.09 ? 179 LYS A N   1 
ATOM   1431 C  CA  . LYS A 1 179 ? 32.356 -2.545 7.421   1.00 34.71 ? 179 LYS A CA  1 
ATOM   1432 C  C   . LYS A 1 179 ? 33.720 -3.231 7.474   1.00 33.00 ? 179 LYS A C   1 
ATOM   1433 O  O   . LYS A 1 179 ? 33.968 -4.067 8.338   1.00 31.62 ? 179 LYS A O   1 
ATOM   1434 C  CB  . LYS A 1 179 ? 32.095 -1.845 8.755   1.00 35.82 ? 179 LYS A CB  1 
ATOM   1435 C  CG  . LYS A 1 179 ? 30.794 -1.067 8.799   1.00 38.18 ? 179 LYS A CG  1 
ATOM   1436 C  CD  . LYS A 1 179 ? 30.326 -0.865 10.235  1.00 42.10 ? 179 LYS A CD  1 
ATOM   1437 C  CE  . LYS A 1 179 ? 29.938 -2.195 10.880  1.00 42.98 ? 179 LYS A CE  1 
ATOM   1438 N  NZ  . LYS A 1 179 ? 29.498 -2.040 12.286  1.00 43.63 ? 179 LYS A NZ  1 
ATOM   1439 N  N   . VAL A 1 180 ? 34.609 -2.863 6.557   1.00 32.32 ? 180 VAL A N   1 
ATOM   1440 C  CA  . VAL A 1 180 ? 35.941 -3.455 6.525   1.00 31.25 ? 180 VAL A CA  1 
ATOM   1441 C  C   . VAL A 1 180 ? 37.055 -2.412 6.574   1.00 31.23 ? 180 VAL A C   1 
ATOM   1442 O  O   . VAL A 1 180 ? 36.980 -1.373 5.920   1.00 31.33 ? 180 VAL A O   1 
ATOM   1443 C  CB  . VAL A 1 180 ? 36.142 -4.316 5.259   1.00 30.59 ? 180 VAL A CB  1 
ATOM   1444 C  CG1 . VAL A 1 180 ? 37.517 -4.955 5.284   1.00 30.95 ? 180 VAL A CG1 1 
ATOM   1445 C  CG2 . VAL A 1 180 ? 35.071 -5.393 5.180   1.00 29.74 ? 180 VAL A CG2 1 
ATOM   1446 N  N   . VAL A 1 181 ? 38.084 -2.710 7.359   1.00 30.50 ? 181 VAL A N   1 
ATOM   1447 C  CA  . VAL A 1 181 ? 39.249 -1.848 7.513   1.00 30.54 ? 181 VAL A CA  1 
ATOM   1448 C  C   . VAL A 1 181 ? 40.399 -2.524 6.769   1.00 32.02 ? 181 VAL A C   1 
ATOM   1449 O  O   . VAL A 1 181 ? 40.943 -3.525 7.235   1.00 33.95 ? 181 VAL A O   1 
ATOM   1450 C  CB  . VAL A 1 181 ? 39.638 -1.702 8.996   1.00 28.78 ? 181 VAL A CB  1 
ATOM   1451 C  CG1 . VAL A 1 181 ? 40.877 -0.840 9.129   1.00 29.78 ? 181 VAL A CG1 1 
ATOM   1452 C  CG2 . VAL A 1 181 ? 38.489 -1.099 9.773   1.00 27.03 ? 181 VAL A CG2 1 
ATOM   1453 N  N   . VAL A 1 182 ? 40.760 -1.983 5.611   1.00 32.65 ? 182 VAL A N   1 
ATOM   1454 C  CA  . VAL A 1 182 ? 41.826 -2.558 4.801   1.00 32.45 ? 182 VAL A CA  1 
ATOM   1455 C  C   . VAL A 1 182 ? 43.004 -1.602 4.634   1.00 32.15 ? 182 VAL A C   1 
ATOM   1456 O  O   . VAL A 1 182 ? 42.890 -0.410 4.895   1.00 30.83 ? 182 VAL A O   1 
ATOM   1457 C  CB  . VAL A 1 182 ? 41.298 -2.947 3.401   1.00 33.35 ? 182 VAL A CB  1 
ATOM   1458 C  CG1 . VAL A 1 182 ? 40.058 -3.810 3.532   1.00 33.81 ? 182 VAL A CG1 1 
ATOM   1459 C  CG2 . VAL A 1 182 ? 40.978 -1.704 2.598   1.00 34.34 ? 182 VAL A CG2 1 
ATOM   1460 N  N   . LYS A 1 183 ? 44.139 -2.137 4.196   1.00 33.49 ? 183 LYS A N   1 
ATOM   1461 C  CA  . LYS A 1 183 ? 45.332 -1.327 3.988   1.00 33.07 ? 183 LYS A CA  1 
ATOM   1462 C  C   . LYS A 1 183 ? 45.094 -0.235 2.942   1.00 33.05 ? 183 LYS A C   1 
ATOM   1463 O  O   . LYS A 1 183 ? 44.304 -0.413 2.011   1.00 30.21 ? 183 LYS A O   1 
ATOM   1464 C  CB  . LYS A 1 183 ? 46.495 -2.212 3.538   1.00 36.05 ? 183 LYS A CB  1 
ATOM   1465 C  CG  . LYS A 1 183 ? 46.866 -3.291 4.533   1.00 37.31 ? 183 LYS A CG  1 
ATOM   1466 C  CD  . LYS A 1 183 ? 48.186 -3.934 4.171   1.00 40.80 ? 183 LYS A CD  1 
ATOM   1467 C  CE  . LYS A 1 183 ? 48.620 -4.926 5.242   1.00 44.26 ? 183 LYS A CE  1 
ATOM   1468 N  NZ  . LYS A 1 183 ? 50.029 -5.366 5.047   1.00 45.15 ? 183 LYS A NZ  1 
ATOM   1469 N  N   . ASP A 1 184 ? 45.776 0.895  3.110   1.00 32.19 ? 184 ASP A N   1 
ATOM   1470 C  CA  . ASP A 1 184 ? 45.652 2.008  2.177   1.00 32.79 ? 184 ASP A CA  1 
ATOM   1471 C  C   . ASP A 1 184 ? 46.707 1.843  1.089   1.00 34.10 ? 184 ASP A C   1 
ATOM   1472 O  O   . ASP A 1 184 ? 47.902 1.984  1.345   1.00 33.98 ? 184 ASP A O   1 
ATOM   1473 C  CB  . ASP A 1 184 ? 45.851 3.338  2.909   1.00 30.89 ? 184 ASP A CB  1 
ATOM   1474 C  CG  . ASP A 1 184 ? 45.669 4.542  2.002   1.00 29.74 ? 184 ASP A CG  1 
ATOM   1475 O  OD1 . ASP A 1 184 ? 45.144 4.379  0.886   1.00 30.56 ? 184 ASP A OD1 1 
ATOM   1476 O  OD2 . ASP A 1 184 ? 46.037 5.661  2.412   1.00 30.01 ? 184 ASP A OD2 1 
ATOM   1477 N  N   . ASN A 1 185 ? 46.250 1.545  -0.122  1.00 36.19 ? 185 ASN A N   1 
ATOM   1478 C  CA  . ASN A 1 185 ? 47.124 1.335  -1.272  1.00 39.87 ? 185 ASN A CA  1 
ATOM   1479 C  C   . ASN A 1 185 ? 48.114 2.473  -1.531  1.00 40.10 ? 185 ASN A C   1 
ATOM   1480 O  O   . ASN A 1 185 ? 49.288 2.226  -1.814  1.00 38.61 ? 185 ASN A O   1 
ATOM   1481 C  CB  . ASN A 1 185 ? 46.269 1.105  -2.514  1.00 43.12 ? 185 ASN A CB  1 
ATOM   1482 C  CG  . ASN A 1 185 ? 45.055 0.259  -2.219  1.00 46.31 ? 185 ASN A CG  1 
ATOM   1483 O  OD1 . ASN A 1 185 ? 44.275 0.576  -1.319  1.00 48.66 ? 185 ASN A OD1 1 
ATOM   1484 N  ND2 . ASN A 1 185 ? 44.885 -0.822 -2.970  1.00 48.87 ? 185 ASN A ND2 1 
ATOM   1485 N  N   . PRO A 1 186 ? 47.651 3.733  -1.459  1.00 40.20 ? 186 PRO A N   1 
ATOM   1486 C  CA  . PRO A 1 186 ? 48.536 4.877  -1.690  1.00 40.15 ? 186 PRO A CA  1 
ATOM   1487 C  C   . PRO A 1 186 ? 49.304 5.312  -0.449  1.00 39.86 ? 186 PRO A C   1 
ATOM   1488 O  O   . PRO A 1 186 ? 49.961 6.351  -0.455  1.00 40.94 ? 186 PRO A O   1 
ATOM   1489 C  CB  . PRO A 1 186 ? 47.578 5.955  -2.186  1.00 40.63 ? 186 PRO A CB  1 
ATOM   1490 C  CG  . PRO A 1 186 ? 46.355 5.675  -1.401  1.00 42.78 ? 186 PRO A CG  1 
ATOM   1491 C  CD  . PRO A 1 186 ? 46.242 4.160  -1.509  1.00 42.69 ? 186 PRO A CD  1 
ATOM   1492 N  N   . LYS A 1 187 ? 49.219 4.518  0.614   1.00 39.55 ? 187 LYS A N   1 
ATOM   1493 C  CA  . LYS A 1 187 ? 49.926 4.836  1.851   1.00 38.11 ? 187 LYS A CA  1 
ATOM   1494 C  C   . LYS A 1 187 ? 51.399 4.451  1.737   1.00 37.76 ? 187 LYS A C   1 
ATOM   1495 O  O   . LYS A 1 187 ? 52.277 5.220  2.133   1.00 38.44 ? 187 LYS A O   1 
ATOM   1496 C  CB  . LYS A 1 187 ? 49.288 4.100  3.035   1.00 37.06 ? 187 LYS A CB  1 
ATOM   1497 C  CG  . LYS A 1 187 ? 50.068 4.196  4.346   1.00 33.14 ? 187 LYS A CG  1 
ATOM   1498 C  CD  . LYS A 1 187 ? 50.267 5.632  4.792   1.00 31.32 ? 187 LYS A CD  1 
ATOM   1499 C  CE  . LYS A 1 187 ? 50.761 5.693  6.227   1.00 31.22 ? 187 LYS A CE  1 
ATOM   1500 N  NZ  . LYS A 1 187 ? 51.923 4.789  6.460   1.00 31.90 ? 187 LYS A NZ  1 
ATOM   1501 N  N   . TYR B 1 3   ? 54.078 3.543  23.176  1.00 25.36 ? 3   TYR B N   1 
ATOM   1502 C  CA  . TYR B 1 3   ? 52.717 4.124  22.942  1.00 25.55 ? 3   TYR B CA  1 
ATOM   1503 C  C   . TYR B 1 3   ? 51.651 3.412  23.761  1.00 24.79 ? 3   TYR B C   1 
ATOM   1504 O  O   . TYR B 1 3   ? 51.570 2.181  23.746  1.00 24.31 ? 3   TYR B O   1 
ATOM   1505 C  CB  . TYR B 1 3   ? 52.321 4.007  21.465  1.00 26.59 ? 3   TYR B CB  1 
ATOM   1506 C  CG  . TYR B 1 3   ? 53.248 4.699  20.500  1.00 29.65 ? 3   TYR B CG  1 
ATOM   1507 C  CD1 . TYR B 1 3   ? 53.511 6.061  20.614  1.00 31.25 ? 3   TYR B CD1 1 
ATOM   1508 C  CD2 . TYR B 1 3   ? 53.846 3.995  19.454  1.00 29.04 ? 3   TYR B CD2 1 
ATOM   1509 C  CE1 . TYR B 1 3   ? 54.348 6.710  19.708  1.00 33.22 ? 3   TYR B CE1 1 
ATOM   1510 C  CE2 . TYR B 1 3   ? 54.683 4.631  18.545  1.00 31.20 ? 3   TYR B CE2 1 
ATOM   1511 C  CZ  . TYR B 1 3   ? 54.929 5.992  18.678  1.00 32.21 ? 3   TYR B CZ  1 
ATOM   1512 O  OH  . TYR B 1 3   ? 55.753 6.636  17.783  1.00 33.78 ? 3   TYR B OH  1 
ATOM   1513 N  N   . LYS B 1 4   ? 50.830 4.178  24.471  1.00 24.29 ? 4   LYS B N   1 
ATOM   1514 C  CA  . LYS B 1 4   ? 49.750 3.579  25.247  1.00 23.81 ? 4   LYS B CA  1 
ATOM   1515 C  C   . LYS B 1 4   ? 48.663 3.172  24.251  1.00 21.43 ? 4   LYS B C   1 
ATOM   1516 O  O   . LYS B 1 4   ? 48.590 3.724  23.155  1.00 21.90 ? 4   LYS B O   1 
ATOM   1517 C  CB  . LYS B 1 4   ? 49.196 4.579  26.267  1.00 23.35 ? 4   LYS B CB  1 
ATOM   1518 C  CG  . LYS B 1 4   ? 50.187 4.942  27.362  1.00 24.62 ? 4   LYS B CG  1 
ATOM   1519 C  CD  . LYS B 1 4   ? 49.509 5.542  28.597  1.00 25.34 ? 4   LYS B CD  1 
ATOM   1520 C  CE  . LYS B 1 4   ? 49.014 6.965  28.368  1.00 23.84 ? 4   LYS B CE  1 
ATOM   1521 N  NZ  . LYS B 1 4   ? 48.403 7.511  29.615  1.00 19.20 ? 4   LYS B NZ  1 
ATOM   1522 N  N   . GLU B 1 5   ? 47.835 2.204  24.627  1.00 22.29 ? 5   GLU B N   1 
ATOM   1523 C  CA  . GLU B 1 5   ? 46.763 1.723  23.756  1.00 21.60 ? 5   GLU B CA  1 
ATOM   1524 C  C   . GLU B 1 5   ? 45.478 2.534  23.818  1.00 18.68 ? 5   GLU B C   1 
ATOM   1525 O  O   . GLU B 1 5   ? 44.993 2.881  24.894  1.00 18.50 ? 5   GLU B O   1 
ATOM   1526 C  CB  . GLU B 1 5   ? 46.398 0.269  24.084  1.00 22.02 ? 5   GLU B CB  1 
ATOM   1527 C  CG  . GLU B 1 5   ? 47.290 -0.793 23.483  1.00 27.47 ? 5   GLU B CG  1 
ATOM   1528 C  CD  . GLU B 1 5   ? 47.203 -0.885 21.973  1.00 28.16 ? 5   GLU B CD  1 
ATOM   1529 O  OE1 . GLU B 1 5   ? 46.091 -1.046 21.419  1.00 28.73 ? 5   GLU B OE1 1 
ATOM   1530 O  OE2 . GLU B 1 5   ? 48.269 -0.810 21.335  1.00 32.80 ? 5   GLU B OE2 1 
ATOM   1531 N  N   . PRO B 1 6   ? 44.918 2.870  22.653  1.00 18.89 ? 6   PRO B N   1 
ATOM   1532 C  CA  . PRO B 1 6   ? 43.672 3.630  22.713  1.00 18.62 ? 6   PRO B CA  1 
ATOM   1533 C  C   . PRO B 1 6   ? 42.611 2.623  23.145  1.00 17.27 ? 6   PRO B C   1 
ATOM   1534 O  O   . PRO B 1 6   ? 42.847 1.420  23.090  1.00 17.79 ? 6   PRO B O   1 
ATOM   1535 C  CB  . PRO B 1 6   ? 43.485 4.108  21.269  1.00 18.67 ? 6   PRO B CB  1 
ATOM   1536 C  CG  . PRO B 1 6   ? 44.199 3.081  20.463  1.00 21.18 ? 6   PRO B CG  1 
ATOM   1537 C  CD  . PRO B 1 6   ? 45.439 2.807  21.276  1.00 18.74 ? 6   PRO B CD  1 
ATOM   1538 N  N   . PHE B 1 7   ? 41.464 3.101  23.603  1.00 16.55 ? 7   PHE B N   1 
ATOM   1539 C  CA  . PHE B 1 7   ? 40.398 2.195  24.016  1.00 18.43 ? 7   PHE B CA  1 
ATOM   1540 C  C   . PHE B 1 7   ? 39.057 2.894  24.019  1.00 17.83 ? 7   PHE B C   1 
ATOM   1541 O  O   . PHE B 1 7   ? 38.983 4.122  24.026  1.00 18.60 ? 7   PHE B O   1 
ATOM   1542 C  CB  . PHE B 1 7   ? 40.677 1.611  25.419  1.00 17.38 ? 7   PHE B CB  1 
ATOM   1543 C  CG  . PHE B 1 7   ? 40.696 2.637  26.526  1.00 17.78 ? 7   PHE B CG  1 
ATOM   1544 C  CD1 . PHE B 1 7   ? 39.510 3.159  27.036  1.00 18.55 ? 7   PHE B CD1 1 
ATOM   1545 C  CD2 . PHE B 1 7   ? 41.904 3.097  27.041  1.00 16.16 ? 7   PHE B CD2 1 
ATOM   1546 C  CE1 . PHE B 1 7   ? 39.524 4.126  28.038  1.00 18.90 ? 7   PHE B CE1 1 
ATOM   1547 C  CE2 . PHE B 1 7   ? 41.936 4.065  28.043  1.00 19.89 ? 7   PHE B CE2 1 
ATOM   1548 C  CZ  . PHE B 1 7   ? 40.743 4.583  28.546  1.00 19.40 ? 7   PHE B CZ  1 
ATOM   1549 N  N   . GLY B 1 8   ? 38.002 2.092  24.004  1.00 18.37 ? 8   GLY B N   1 
ATOM   1550 C  CA  . GLY B 1 8   ? 36.662 2.624  24.053  1.00 17.64 ? 8   GLY B CA  1 
ATOM   1551 C  C   . GLY B 1 8   ? 35.961 1.996  25.242  1.00 19.34 ? 8   GLY B C   1 
ATOM   1552 O  O   . GLY B 1 8   ? 36.260 0.863  25.608  1.00 17.70 ? 8   GLY B O   1 
ATOM   1553 N  N   . VAL B 1 9   ? 35.055 2.742  25.864  1.00 18.98 ? 9   VAL B N   1 
ATOM   1554 C  CA  . VAL B 1 9   ? 34.279 2.248  26.993  1.00 19.46 ? 9   VAL B CA  1 
ATOM   1555 C  C   . VAL B 1 9   ? 32.852 2.778  26.855  1.00 21.57 ? 9   VAL B C   1 
ATOM   1556 O  O   . VAL B 1 9   ? 32.637 3.901  26.379  1.00 20.50 ? 9   VAL B O   1 
ATOM   1557 C  CB  . VAL B 1 9   ? 34.860 2.714  28.344  1.00 18.73 ? 9   VAL B CB  1 
ATOM   1558 C  CG1 . VAL B 1 9   ? 36.152 1.960  28.642  1.00 21.62 ? 9   VAL B CG1 1 
ATOM   1559 C  CG2 . VAL B 1 9   ? 35.123 4.200  28.309  1.00 18.66 ? 9   VAL B CG2 1 
ATOM   1560 N  N   . LYS B 1 10  ? 31.877 1.971  27.259  1.00 20.49 ? 10  LYS B N   1 
ATOM   1561 C  CA  . LYS B 1 10  ? 30.482 2.383  27.160  1.00 22.51 ? 10  LYS B CA  1 
ATOM   1562 C  C   . LYS B 1 10  ? 29.981 3.124  28.393  1.00 21.10 ? 10  LYS B C   1 
ATOM   1563 O  O   . LYS B 1 10  ? 30.214 2.691  29.526  1.00 21.30 ? 10  LYS B O   1 
ATOM   1564 C  CB  . LYS B 1 10  ? 29.588 1.162  26.918  1.00 24.25 ? 10  LYS B CB  1 
ATOM   1565 C  CG  . LYS B 1 10  ? 29.843 0.458  25.598  1.00 30.90 ? 10  LYS B CG  1 
ATOM   1566 C  CD  . LYS B 1 10  ? 28.955 -0.777 25.457  1.00 35.34 ? 10  LYS B CD  1 
ATOM   1567 C  CE  . LYS B 1 10  ? 29.202 -1.504 24.142  1.00 37.81 ? 10  LYS B CE  1 
ATOM   1568 N  NZ  . LYS B 1 10  ? 28.895 -0.648 22.964  1.00 40.24 ? 10  LYS B NZ  1 
ATOM   1569 N  N   . LEU B 1 11  ? 29.308 4.250  28.163  1.00 20.17 ? 11  LEU B N   1 
ATOM   1570 C  CA  . LEU B 1 11  ? 28.715 5.037  29.239  1.00 18.21 ? 11  LEU B CA  1 
ATOM   1571 C  C   . LEU B 1 11  ? 27.214 4.799  29.112  1.00 20.52 ? 11  LEU B C   1 
ATOM   1572 O  O   . LEU B 1 11  ? 26.651 4.947  28.026  1.00 21.16 ? 11  LEU B O   1 
ATOM   1573 C  CB  . LEU B 1 11  ? 29.015 6.535  29.071  1.00 17.39 ? 11  LEU B CB  1 
ATOM   1574 C  CG  . LEU B 1 11  ? 28.492 7.490  30.163  1.00 17.91 ? 11  LEU B CG  1 
ATOM   1575 C  CD1 . LEU B 1 11  ? 29.335 8.757  30.198  1.00 19.11 ? 11  LEU B CD1 1 
ATOM   1576 C  CD2 . LEU B 1 11  ? 27.030 7.831  29.913  1.00 19.17 ? 11  LEU B CD2 1 
ATOM   1577 N  N   . ASP B 1 12  ? 26.579 4.401  30.209  1.00 22.43 ? 12  ASP B N   1 
ATOM   1578 C  CA  . ASP B 1 12  ? 25.138 4.149  30.220  1.00 22.42 ? 12  ASP B CA  1 
ATOM   1579 C  C   . ASP B 1 12  ? 24.449 5.465  30.584  1.00 21.17 ? 12  ASP B C   1 
ATOM   1580 O  O   . ASP B 1 12  ? 24.531 5.914  31.727  1.00 20.11 ? 12  ASP B O   1 
ATOM   1581 C  CB  . ASP B 1 12  ? 24.806 3.086  31.270  1.00 24.51 ? 12  ASP B CB  1 
ATOM   1582 C  CG  . ASP B 1 12  ? 23.331 2.698  31.271  1.00 28.01 ? 12  ASP B CG  1 
ATOM   1583 O  OD1 . ASP B 1 12  ? 22.468 3.598  31.268  1.00 28.97 ? 12  ASP B OD1 1 
ATOM   1584 O  OD2 . ASP B 1 12  ? 23.037 1.486  31.286  1.00 28.76 ? 12  ASP B OD2 1 
ATOM   1585 N  N   . PHE B 1 13  ? 23.787 6.083  29.611  1.00 21.49 ? 13  PHE B N   1 
ATOM   1586 C  CA  . PHE B 1 13  ? 23.099 7.360  29.817  1.00 22.46 ? 13  PHE B CA  1 
ATOM   1587 C  C   . PHE B 1 13  ? 22.038 7.338  30.914  1.00 24.40 ? 13  PHE B C   1 
ATOM   1588 O  O   . PHE B 1 13  ? 21.681 8.389  31.450  1.00 24.88 ? 13  PHE B O   1 
ATOM   1589 C  CB  . PHE B 1 13  ? 22.427 7.819  28.520  1.00 22.55 ? 13  PHE B CB  1 
ATOM   1590 C  CG  . PHE B 1 13  ? 23.384 8.279  27.461  1.00 23.07 ? 13  PHE B CG  1 
ATOM   1591 C  CD1 . PHE B 1 13  ? 24.061 9.488  27.592  1.00 23.03 ? 13  PHE B CD1 1 
ATOM   1592 C  CD2 . PHE B 1 13  ? 23.598 7.509  26.323  1.00 22.59 ? 13  PHE B CD2 1 
ATOM   1593 C  CE1 . PHE B 1 13  ? 24.942 9.927  26.602  1.00 24.10 ? 13  PHE B CE1 1 
ATOM   1594 C  CE2 . PHE B 1 13  ? 24.475 7.934  25.328  1.00 24.84 ? 13  PHE B CE2 1 
ATOM   1595 C  CZ  . PHE B 1 13  ? 25.148 9.147  25.466  1.00 24.76 ? 13  PHE B CZ  1 
ATOM   1596 N  N   . GLU B 1 14  ? 21.525 6.154  31.238  1.00 24.49 ? 14  GLU B N   1 
ATOM   1597 C  CA  . GLU B 1 14  ? 20.490 6.027  32.258  1.00 26.24 ? 14  GLU B CA  1 
ATOM   1598 C  C   . GLU B 1 14  ? 21.027 5.872  33.677  1.00 26.17 ? 14  GLU B C   1 
ATOM   1599 O  O   . GLU B 1 14  ? 20.493 6.463  34.615  1.00 24.70 ? 14  GLU B O   1 
ATOM   1600 C  CB  . GLU B 1 14  ? 19.581 4.835  31.942  1.00 29.46 ? 14  GLU B CB  1 
ATOM   1601 C  CG  . GLU B 1 14  ? 18.946 4.876  30.559  1.00 34.75 ? 14  GLU B CG  1 
ATOM   1602 C  CD  . GLU B 1 14  ? 18.270 6.202  30.266  1.00 38.70 ? 14  GLU B CD  1 
ATOM   1603 O  OE1 . GLU B 1 14  ? 17.462 6.658  31.108  1.00 40.76 ? 14  GLU B OE1 1 
ATOM   1604 O  OE2 . GLU B 1 14  ? 18.543 6.788  29.193  1.00 40.73 ? 14  GLU B OE2 1 
ATOM   1605 N  N   . THR B 1 15  ? 22.075 5.068  33.833  1.00 25.10 ? 15  THR B N   1 
ATOM   1606 C  CA  . THR B 1 15  ? 22.666 4.825  35.145  1.00 24.98 ? 15  THR B CA  1 
ATOM   1607 C  C   . THR B 1 15  ? 23.867 5.715  35.449  1.00 24.30 ? 15  THR B C   1 
ATOM   1608 O  O   . THR B 1 15  ? 24.224 5.910  36.613  1.00 24.39 ? 15  THR B O   1 
ATOM   1609 C  CB  . THR B 1 15  ? 23.140 3.379  35.272  1.00 25.14 ? 15  THR B CB  1 
ATOM   1610 O  OG1 . THR B 1 15  ? 24.128 3.128  34.267  1.00 27.78 ? 15  THR B OG1 1 
ATOM   1611 C  CG2 . THR B 1 15  ? 21.974 2.403  35.099  1.00 26.12 ? 15  THR B CG2 1 
ATOM   1612 N  N   . GLY B 1 16  ? 24.491 6.241  34.402  1.00 22.89 ? 16  GLY B N   1 
ATOM   1613 C  CA  . GLY B 1 16  ? 25.657 7.086  34.578  1.00 22.21 ? 16  GLY B CA  1 
ATOM   1614 C  C   . GLY B 1 16  ? 26.916 6.259  34.770  1.00 22.18 ? 16  GLY B C   1 
ATOM   1615 O  O   . GLY B 1 16  ? 28.001 6.801  34.947  1.00 23.61 ? 16  GLY B O   1 
ATOM   1616 N  N   . ILE B 1 17  ? 26.775 4.940  34.726  1.00 21.81 ? 17  ILE B N   1 
ATOM   1617 C  CA  . ILE B 1 17  ? 27.907 4.042  34.925  1.00 21.97 ? 17  ILE B CA  1 
ATOM   1618 C  C   . ILE B 1 17  ? 28.815 3.866  33.712  1.00 21.44 ? 17  ILE B C   1 
ATOM   1619 O  O   . ILE B 1 17  ? 28.344 3.574  32.605  1.00 20.27 ? 17  ILE B O   1 
ATOM   1620 C  CB  . ILE B 1 17  ? 27.418 2.653  35.359  1.00 24.89 ? 17  ILE B CB  1 
ATOM   1621 C  CG1 . ILE B 1 17  ? 26.701 2.765  36.708  1.00 24.63 ? 17  ILE B CG1 1 
ATOM   1622 C  CG2 . ILE B 1 17  ? 28.594 1.680  35.449  1.00 25.81 ? 17  ILE B CG2 1 
ATOM   1623 C  CD1 . ILE B 1 17  ? 26.019 1.487  37.148  1.00 26.77 ? 17  ILE B CD1 1 
ATOM   1624 N  N   . ILE B 1 18  ? 30.116 4.057  33.926  1.00 20.43 ? 18  ILE B N   1 
ATOM   1625 C  CA  . ILE B 1 18  ? 31.091 3.874  32.859  1.00 19.97 ? 18  ILE B CA  1 
ATOM   1626 C  C   . ILE B 1 18  ? 31.708 2.483  32.991  1.00 22.14 ? 18  ILE B C   1 
ATOM   1627 O  O   . ILE B 1 18  ? 32.214 2.102  34.046  1.00 20.50 ? 18  ILE B O   1 
ATOM   1628 C  CB  . ILE B 1 18  ? 32.257 4.887  32.909  1.00 20.49 ? 18  ILE B CB  1 
ATOM   1629 C  CG1 . ILE B 1 18  ? 31.753 6.315  32.688  1.00 20.14 ? 18  ILE B CG1 1 
ATOM   1630 C  CG2 . ILE B 1 18  ? 33.284 4.535  31.813  1.00 20.93 ? 18  ILE B CG2 1 
ATOM   1631 C  CD1 . ILE B 1 18  ? 32.878 7.352  32.710  1.00 19.08 ? 18  ILE B CD1 1 
ATOM   1632 N  N   . GLU B 1 19  ? 31.652 1.739  31.899  1.00 23.35 ? 19  GLU B N   1 
ATOM   1633 C  CA  . GLU B 1 19  ? 32.189 0.394  31.819  1.00 26.16 ? 19  GLU B CA  1 
ATOM   1634 C  C   . GLU B 1 19  ? 33.688 0.383  32.149  1.00 26.89 ? 19  GLU B C   1 
ATOM   1635 O  O   . GLU B 1 19  ? 34.437 1.255  31.702  1.00 25.28 ? 19  GLU B O   1 
ATOM   1636 C  CB  . GLU B 1 19  ? 31.931 -0.119 30.400  1.00 29.03 ? 19  GLU B CB  1 
ATOM   1637 C  CG  . GLU B 1 19  ? 32.555 -1.432 30.016  1.00 32.52 ? 19  GLU B CG  1 
ATOM   1638 C  CD  . GLU B 1 19  ? 32.311 -1.737 28.547  1.00 34.69 ? 19  GLU B CD  1 
ATOM   1639 O  OE1 . GLU B 1 19  ? 32.598 -0.858 27.707  1.00 32.81 ? 19  GLU B OE1 1 
ATOM   1640 O  OE2 . GLU B 1 19  ? 31.833 -2.845 28.231  1.00 36.99 ? 19  GLU B OE2 1 
ATOM   1641 N  N   . ASN B 1 20  ? 34.107 -0.591 32.955  1.00 25.35 ? 20  ASN B N   1 
ATOM   1642 C  CA  . ASN B 1 20  ? 35.512 -0.745 33.336  1.00 26.55 ? 20  ASN B CA  1 
ATOM   1643 C  C   . ASN B 1 20  ? 36.083 0.411  34.166  1.00 26.31 ? 20  ASN B C   1 
ATOM   1644 O  O   . ASN B 1 20  ? 37.293 0.512  34.330  1.00 25.92 ? 20  ASN B O   1 
ATOM   1645 C  CB  . ASN B 1 20  ? 36.379 -0.924 32.081  1.00 24.29 ? 20  ASN B CB  1 
ATOM   1646 C  CG  . ASN B 1 20  ? 35.884 -2.040 31.178  1.00 26.41 ? 20  ASN B CG  1 
ATOM   1647 O  OD1 . ASN B 1 20  ? 35.570 -1.815 30.002  1.00 25.07 ? 20  ASN B OD1 1 
ATOM   1648 N  ND2 . ASN B 1 20  ? 35.814 -3.253 31.719  1.00 24.19 ? 20  ASN B ND2 1 
ATOM   1649 N  N   . ALA B 1 21  ? 35.227 1.283  34.686  1.00 26.06 ? 21  ALA B N   1 
ATOM   1650 C  CA  . ALA B 1 21  ? 35.710 2.407  35.478  1.00 25.46 ? 21  ALA B CA  1 
ATOM   1651 C  C   . ALA B 1 21  ? 35.958 2.026  36.941  1.00 26.73 ? 21  ALA B C   1 
ATOM   1652 O  O   . ALA B 1 21  ? 35.493 0.990  37.414  1.00 26.01 ? 21  ALA B O   1 
ATOM   1653 C  CB  . ALA B 1 21  ? 34.717 3.568  35.400  1.00 24.10 ? 21  ALA B CB  1 
ATOM   1654 N  N   . LYS B 1 22  ? 36.710 2.875  37.636  1.00 28.40 ? 22  LYS B N   1 
ATOM   1655 C  CA  . LYS B 1 22  ? 37.032 2.690  39.050  1.00 29.97 ? 22  LYS B CA  1 
ATOM   1656 C  C   . LYS B 1 22  ? 35.933 3.394  39.846  1.00 28.63 ? 22  LYS B C   1 
ATOM   1657 O  O   . LYS B 1 22  ? 35.799 4.617  39.782  1.00 28.14 ? 22  LYS B O   1 
ATOM   1658 C  CB  . LYS B 1 22  ? 38.390 3.333  39.359  1.00 32.03 ? 22  LYS B CB  1 
ATOM   1659 C  CG  . LYS B 1 22  ? 38.899 3.117  40.771  1.00 36.38 ? 22  LYS B CG  1 
ATOM   1660 C  CD  . LYS B 1 22  ? 39.298 1.665  41.005  1.00 40.26 ? 22  LYS B CD  1 
ATOM   1661 C  CE  . LYS B 1 22  ? 39.982 1.487  42.357  1.00 41.61 ? 22  LYS B CE  1 
ATOM   1662 N  NZ  . LYS B 1 22  ? 40.391 0.069  42.586  1.00 43.49 ? 22  LYS B NZ  1 
ATOM   1663 N  N   . LYS B 1 23  ? 35.150 2.622  40.592  1.00 27.89 ? 23  LYS B N   1 
ATOM   1664 C  CA  . LYS B 1 23  ? 34.054 3.179  41.369  1.00 27.50 ? 23  LYS B CA  1 
ATOM   1665 C  C   . LYS B 1 23  ? 34.430 3.639  42.771  1.00 28.36 ? 23  LYS B C   1 
ATOM   1666 O  O   . LYS B 1 23  ? 35.082 2.919  43.522  1.00 27.43 ? 23  LYS B O   1 
ATOM   1667 C  CB  . LYS B 1 23  ? 32.919 2.159  41.475  1.00 28.76 ? 23  LYS B CB  1 
ATOM   1668 C  CG  . LYS B 1 23  ? 31.766 2.611  42.355  1.00 28.44 ? 23  LYS B CG  1 
ATOM   1669 C  CD  . LYS B 1 23  ? 30.689 1.550  42.426  1.00 28.44 ? 23  LYS B CD  1 
ATOM   1670 C  CE  . LYS B 1 23  ? 29.536 1.991  43.306  1.00 31.67 ? 23  LYS B CE  1 
ATOM   1671 N  NZ  . LYS B 1 23  ? 28.474 0.946  43.385  1.00 32.11 ? 23  LYS B NZ  1 
ATOM   1672 N  N   . SER B 1 24  ? 34.006 4.848  43.117  1.00 26.69 ? 24  SER B N   1 
ATOM   1673 C  CA  . SER B 1 24  ? 34.258 5.393  44.436  1.00 28.54 ? 24  SER B CA  1 
ATOM   1674 C  C   . SER B 1 24  ? 32.909 5.813  45.020  1.00 29.13 ? 24  SER B C   1 
ATOM   1675 O  O   . SER B 1 24  ? 31.998 6.229  44.287  1.00 25.61 ? 24  SER B O   1 
ATOM   1676 C  CB  . SER B 1 24  ? 35.227 6.581  44.360  1.00 29.38 ? 24  SER B CB  1 
ATOM   1677 O  OG  . SER B 1 24  ? 34.779 7.556  43.440  1.00 36.07 ? 24  SER B OG  1 
ATOM   1678 N  N   . VAL B 1 25  ? 32.776 5.682  46.335  1.00 28.90 ? 25  VAL B N   1 
ATOM   1679 C  CA  . VAL B 1 25  ? 31.531 6.019  47.015  1.00 31.28 ? 25  VAL B CA  1 
ATOM   1680 C  C   . VAL B 1 25  ? 31.739 6.979  48.176  1.00 32.50 ? 25  VAL B C   1 
ATOM   1681 O  O   . VAL B 1 25  ? 32.654 6.809  48.978  1.00 32.55 ? 25  VAL B O   1 
ATOM   1682 C  CB  . VAL B 1 25  ? 30.838 4.746  47.554  1.00 31.06 ? 25  VAL B CB  1 
ATOM   1683 C  CG1 . VAL B 1 25  ? 29.593 5.118  48.355  1.00 32.27 ? 25  VAL B CG1 1 
ATOM   1684 C  CG2 . VAL B 1 25  ? 30.465 3.837  46.398  1.00 33.02 ? 25  VAL B CG2 1 
ATOM   1685 N  N   . ARG B 1 26  ? 30.879 7.987  48.261  1.00 33.44 ? 26  ARG B N   1 
ATOM   1686 C  CA  . ARG B 1 26  ? 30.957 8.963  49.337  1.00 34.63 ? 26  ARG B CA  1 
ATOM   1687 C  C   . ARG B 1 26  ? 29.609 9.112  50.038  1.00 34.08 ? 26  ARG B C   1 
ATOM   1688 O  O   . ARG B 1 26  ? 28.611 9.491  49.422  1.00 32.56 ? 26  ARG B O   1 
ATOM   1689 C  CB  . ARG B 1 26  ? 31.421 10.312 48.792  1.00 36.25 ? 26  ARG B CB  1 
ATOM   1690 C  CG  . ARG B 1 26  ? 32.866 10.309 48.326  1.00 42.78 ? 26  ARG B CG  1 
ATOM   1691 C  CD  . ARG B 1 26  ? 33.800 9.960  49.478  1.00 46.27 ? 26  ARG B CD  1 
ATOM   1692 N  NE  . ARG B 1 26  ? 35.174 9.743  49.036  1.00 50.46 ? 26  ARG B NE  1 
ATOM   1693 C  CZ  . ARG B 1 26  ? 35.905 10.646 48.392  1.00 52.52 ? 26  ARG B CZ  1 
ATOM   1694 N  NH1 . ARG B 1 26  ? 35.394 11.838 48.110  1.00 54.02 ? 26  ARG B NH1 1 
ATOM   1695 N  NH2 . ARG B 1 26  ? 37.147 10.356 48.028  1.00 54.48 ? 26  ARG B NH2 1 
ATOM   1696 N  N   . ARG B 1 27  ? 29.590 8.788  51.327  1.00 33.89 ? 27  ARG B N   1 
ATOM   1697 C  CA  . ARG B 1 27  ? 28.381 8.886  52.145  1.00 32.77 ? 27  ARG B CA  1 
ATOM   1698 C  C   . ARG B 1 27  ? 28.481 10.141 53.006  1.00 31.83 ? 27  ARG B C   1 
ATOM   1699 O  O   . ARG B 1 27  ? 29.495 10.844 52.977  1.00 28.73 ? 27  ARG B O   1 
ATOM   1700 C  CB  . ARG B 1 27  ? 28.257 7.661  53.052  1.00 35.09 ? 27  ARG B CB  1 
ATOM   1701 C  CG  . ARG B 1 27  ? 28.093 6.345  52.319  1.00 35.60 ? 27  ARG B CG  1 
ATOM   1702 C  CD  . ARG B 1 27  ? 28.411 5.174  53.235  1.00 37.87 ? 27  ARG B CD  1 
ATOM   1703 N  NE  . ARG B 1 27  ? 28.102 3.895  52.606  1.00 40.57 ? 27  ARG B NE  1 
ATOM   1704 C  CZ  . ARG B 1 27  ? 26.869 3.442  52.404  1.00 42.81 ? 27  ARG B CZ  1 
ATOM   1705 N  NH1 . ARG B 1 27  ? 25.823 4.165  52.788  1.00 43.18 ? 27  ARG B NH1 1 
ATOM   1706 N  NH2 . ARG B 1 27  ? 26.680 2.270  51.811  1.00 44.16 ? 27  ARG B NH2 1 
ATOM   1707 N  N   . LEU B 1 28  ? 27.431 10.420 53.772  1.00 32.89 ? 28  LEU B N   1 
ATOM   1708 C  CA  . LEU B 1 28  ? 27.423 11.590 54.646  1.00 32.93 ? 28  LEU B CA  1 
ATOM   1709 C  C   . LEU B 1 28  ? 28.563 11.551 55.658  1.00 34.22 ? 28  LEU B C   1 
ATOM   1710 O  O   . LEU B 1 28  ? 29.181 12.577 55.951  1.00 34.87 ? 28  LEU B O   1 
ATOM   1711 C  CB  . LEU B 1 28  ? 26.090 11.690 55.387  1.00 32.22 ? 28  LEU B CB  1 
ATOM   1712 C  CG  . LEU B 1 28  ? 24.949 12.330 54.600  1.00 30.79 ? 28  LEU B CG  1 
ATOM   1713 C  CD1 . LEU B 1 28  ? 23.676 12.320 55.427  1.00 32.24 ? 28  LEU B CD1 1 
ATOM   1714 C  CD2 . LEU B 1 28  ? 25.338 13.756 54.238  1.00 30.40 ? 28  LEU B CD2 1 
ATOM   1715 N  N   . SER B 1 29  ? 28.840 10.361 56.184  1.00 35.89 ? 29  SER B N   1 
ATOM   1716 C  CA  . SER B 1 29  ? 29.908 10.189 57.164  1.00 36.86 ? 29  SER B CA  1 
ATOM   1717 C  C   . SER B 1 29  ? 31.259 10.607 56.598  1.00 36.67 ? 29  SER B C   1 
ATOM   1718 O  O   . SER B 1 29  ? 32.216 10.802 57.344  1.00 37.15 ? 29  SER B O   1 
ATOM   1719 C  CB  . SER B 1 29  ? 29.971 8.732  57.626  1.00 37.05 ? 29  SER B CB  1 
ATOM   1720 O  OG  . SER B 1 29  ? 30.201 7.854  56.538  1.00 39.77 ? 29  SER B OG  1 
ATOM   1721 N  N   . ASP B 1 30  ? 31.332 10.754 55.278  1.00 36.74 ? 30  ASP B N   1 
ATOM   1722 C  CA  . ASP B 1 30  ? 32.575 11.152 54.626  1.00 35.83 ? 30  ASP B CA  1 
ATOM   1723 C  C   . ASP B 1 30  ? 32.616 12.649 54.364  1.00 34.85 ? 30  ASP B C   1 
ATOM   1724 O  O   . ASP B 1 30  ? 33.575 13.151 53.779  1.00 33.46 ? 30  ASP B O   1 
ATOM   1725 C  CB  . ASP B 1 30  ? 32.754 10.420 53.293  1.00 36.88 ? 30  ASP B CB  1 
ATOM   1726 C  CG  . ASP B 1 30  ? 32.657 8.923  53.432  1.00 37.44 ? 30  ASP B CG  1 
ATOM   1727 O  OD1 . ASP B 1 30  ? 33.350 8.356  54.304  1.00 39.35 ? 30  ASP B OD1 1 
ATOM   1728 O  OD2 . ASP B 1 30  ? 31.891 8.312  52.659  1.00 38.90 ? 30  ASP B OD2 1 
ATOM   1729 N  N   . MET B 1 31  ? 31.583 13.363 54.796  1.00 34.74 ? 31  MET B N   1 
ATOM   1730 C  CA  . MET B 1 31  ? 31.531 14.804 54.575  1.00 36.11 ? 31  MET B CA  1 
ATOM   1731 C  C   . MET B 1 31  ? 31.334 15.638 55.843  1.00 37.20 ? 31  MET B C   1 
ATOM   1732 O  O   . MET B 1 31  ? 30.599 16.626 55.829  1.00 36.61 ? 31  MET B O   1 
ATOM   1733 C  CB  . MET B 1 31  ? 30.417 15.135 53.577  1.00 33.40 ? 31  MET B CB  1 
ATOM   1734 C  CG  . MET B 1 31  ? 30.593 14.494 52.208  1.00 32.08 ? 31  MET B CG  1 
ATOM   1735 S  SD  . MET B 1 31  ? 29.228 14.898 51.090  1.00 26.15 ? 31  MET B SD  1 
ATOM   1736 C  CE  . MET B 1 31  ? 29.677 16.581 50.642  1.00 24.77 ? 31  MET B CE  1 
ATOM   1737 N  N   . LYS B 1 32  ? 31.984 15.256 56.936  1.00 38.00 ? 32  LYS B N   1 
ATOM   1738 C  CA  . LYS B 1 32  ? 31.840 16.022 58.167  1.00 39.31 ? 32  LYS B CA  1 
ATOM   1739 C  C   . LYS B 1 32  ? 32.507 17.391 58.016  1.00 39.96 ? 32  LYS B C   1 
ATOM   1740 O  O   . LYS B 1 32  ? 33.605 17.505 57.462  1.00 38.02 ? 32  LYS B O   1 
ATOM   1741 C  CB  . LYS B 1 32  ? 32.461 15.270 59.346  1.00 41.45 ? 32  LYS B CB  1 
ATOM   1742 C  CG  . LYS B 1 32  ? 32.292 15.989 60.676  1.00 44.16 ? 32  LYS B CG  1 
ATOM   1743 C  CD  . LYS B 1 32  ? 32.967 15.238 61.812  1.00 46.76 ? 32  LYS B CD  1 
ATOM   1744 C  CE  . LYS B 1 32  ? 32.833 16.000 63.123  1.00 47.79 ? 32  LYS B CE  1 
ATOM   1745 N  NZ  . LYS B 1 32  ? 33.568 15.328 64.230  1.00 48.69 ? 32  LYS B NZ  1 
ATOM   1746 N  N   . GLY B 1 33  ? 31.834 18.428 58.505  1.00 40.26 ? 33  GLY B N   1 
ATOM   1747 C  CA  . GLY B 1 33  ? 32.382 19.770 58.417  1.00 40.82 ? 33  GLY B CA  1 
ATOM   1748 C  C   . GLY B 1 33  ? 32.135 20.450 57.082  1.00 41.38 ? 33  GLY B C   1 
ATOM   1749 O  O   . GLY B 1 33  ? 32.774 21.456 56.770  1.00 43.19 ? 33  GLY B O   1 
ATOM   1750 N  N   . TYR B 1 34  ? 31.219 19.904 56.288  1.00 39.87 ? 34  TYR B N   1 
ATOM   1751 C  CA  . TYR B 1 34  ? 30.902 20.489 54.989  1.00 38.09 ? 34  TYR B CA  1 
ATOM   1752 C  C   . TYR B 1 34  ? 29.559 21.200 54.992  1.00 37.89 ? 34  TYR B C   1 
ATOM   1753 O  O   . TYR B 1 34  ? 29.446 22.324 54.510  1.00 38.89 ? 34  TYR B O   1 
ATOM   1754 C  CB  . TYR B 1 34  ? 30.902 19.421 53.889  1.00 36.72 ? 34  TYR B CB  1 
ATOM   1755 C  CG  . TYR B 1 34  ? 32.279 19.076 53.368  1.00 34.46 ? 34  TYR B CG  1 
ATOM   1756 C  CD1 . TYR B 1 34  ? 33.098 18.171 54.040  1.00 33.81 ? 34  TYR B CD1 1 
ATOM   1757 C  CD2 . TYR B 1 34  ? 32.775 19.685 52.217  1.00 33.47 ? 34  TYR B CD2 1 
ATOM   1758 C  CE1 . TYR B 1 34  ? 34.379 17.880 53.578  1.00 34.36 ? 34  TYR B CE1 1 
ATOM   1759 C  CE2 . TYR B 1 34  ? 34.052 19.405 51.746  1.00 33.64 ? 34  TYR B CE2 1 
ATOM   1760 C  CZ  . TYR B 1 34  ? 34.849 18.501 52.431  1.00 34.75 ? 34  TYR B CZ  1 
ATOM   1761 O  OH  . TYR B 1 34  ? 36.111 18.226 51.965  1.00 33.52 ? 34  TYR B OH  1 
ATOM   1762 N  N   . PHE B 1 35  ? 28.543 20.539 55.535  1.00 38.82 ? 35  PHE B N   1 
ATOM   1763 C  CA  . PHE B 1 35  ? 27.202 21.106 55.593  1.00 39.65 ? 35  PHE B CA  1 
ATOM   1764 C  C   . PHE B 1 35  ? 27.020 22.049 56.784  1.00 41.40 ? 35  PHE B C   1 
ATOM   1765 O  O   . PHE B 1 35  ? 27.551 21.812 57.871  1.00 40.65 ? 35  PHE B O   1 
ATOM   1766 C  CB  . PHE B 1 35  ? 26.172 19.977 55.644  1.00 39.05 ? 35  PHE B CB  1 
ATOM   1767 C  CG  . PHE B 1 35  ? 26.155 19.123 54.407  1.00 38.31 ? 35  PHE B CG  1 
ATOM   1768 C  CD1 . PHE B 1 35  ? 25.556 19.582 53.236  1.00 37.86 ? 35  PHE B CD1 1 
ATOM   1769 C  CD2 . PHE B 1 35  ? 26.757 17.866 54.403  1.00 38.27 ? 35  PHE B CD2 1 
ATOM   1770 C  CE1 . PHE B 1 35  ? 25.556 18.805 52.075  1.00 35.62 ? 35  PHE B CE1 1 
ATOM   1771 C  CE2 . PHE B 1 35  ? 26.764 17.080 53.246  1.00 37.60 ? 35  PHE B CE2 1 
ATOM   1772 C  CZ  . PHE B 1 35  ? 26.160 17.551 52.082  1.00 36.00 ? 35  PHE B CZ  1 
ATOM   1773 N  N   . ILE B 1 36  ? 26.266 23.122 56.566  1.00 42.69 ? 36  ILE B N   1 
ATOM   1774 C  CA  . ILE B 1 36  ? 26.013 24.117 57.601  1.00 44.72 ? 36  ILE B CA  1 
ATOM   1775 C  C   . ILE B 1 36  ? 25.312 23.521 58.825  1.00 45.47 ? 36  ILE B C   1 
ATOM   1776 O  O   . ILE B 1 36  ? 25.780 23.678 59.952  1.00 46.58 ? 36  ILE B O   1 
ATOM   1777 C  CB  . ILE B 1 36  ? 25.164 25.296 57.037  1.00 44.42 ? 36  ILE B CB  1 
ATOM   1778 C  CG1 . ILE B 1 36  ? 24.998 26.388 58.097  1.00 45.12 ? 36  ILE B CG1 1 
ATOM   1779 C  CG2 . ILE B 1 36  ? 23.803 24.798 56.579  1.00 44.52 ? 36  ILE B CG2 1 
ATOM   1780 C  CD1 . ILE B 1 36  ? 26.221 27.261 58.289  1.00 44.95 ? 36  ILE B CD1 1 
ATOM   1781 N  N   . ASP B 1 37  ? 24.198 22.830 58.598  1.00 46.48 ? 37  ASP B N   1 
ATOM   1782 C  CA  . ASP B 1 37  ? 23.430 22.228 59.682  1.00 46.66 ? 37  ASP B CA  1 
ATOM   1783 C  C   . ASP B 1 37  ? 24.133 20.989 60.225  1.00 47.14 ? 37  ASP B C   1 
ATOM   1784 O  O   . ASP B 1 37  ? 23.863 19.870 59.794  1.00 46.51 ? 37  ASP B O   1 
ATOM   1785 C  CB  . ASP B 1 37  ? 22.032 21.847 59.186  1.00 46.62 ? 37  ASP B CB  1 
ATOM   1786 C  CG  . ASP B 1 37  ? 21.047 21.636 60.321  1.00 46.51 ? 37  ASP B CG  1 
ATOM   1787 O  OD1 . ASP B 1 37  ? 21.450 21.074 61.362  1.00 46.54 ? 37  ASP B OD1 1 
ATOM   1788 O  OD2 . ASP B 1 37  ? 19.868 22.023 60.168  1.00 45.47 ? 37  ASP B OD2 1 
ATOM   1789 N  N   . GLU B 1 38  ? 25.028 21.197 61.183  1.00 48.64 ? 38  GLU B N   1 
ATOM   1790 C  CA  . GLU B 1 38  ? 25.779 20.102 61.783  1.00 49.91 ? 38  GLU B CA  1 
ATOM   1791 C  C   . GLU B 1 38  ? 24.863 19.126 62.522  1.00 49.92 ? 38  GLU B C   1 
ATOM   1792 O  O   . GLU B 1 38  ? 25.162 17.935 62.620  1.00 49.09 ? 38  GLU B O   1 
ATOM   1793 C  CB  . GLU B 1 38  ? 26.829 20.667 62.738  1.00 51.75 ? 38  GLU B CB  1 
ATOM   1794 C  CG  . GLU B 1 38  ? 27.940 19.702 63.084  1.00 55.72 ? 38  GLU B CG  1 
ATOM   1795 C  CD  . GLU B 1 38  ? 29.027 20.358 63.909  1.00 57.97 ? 38  GLU B CD  1 
ATOM   1796 O  OE1 . GLU B 1 38  ? 28.732 20.791 65.045  1.00 58.72 ? 38  GLU B OE1 1 
ATOM   1797 O  OE2 . GLU B 1 38  ? 30.173 20.446 63.418  1.00 60.14 ? 38  GLU B OE2 1 
ATOM   1798 N  N   . GLU B 1 39  ? 23.748 19.634 63.038  1.00 50.02 ? 39  GLU B N   1 
ATOM   1799 C  CA  . GLU B 1 39  ? 22.793 18.800 63.760  1.00 49.89 ? 39  GLU B CA  1 
ATOM   1800 C  C   . GLU B 1 39  ? 22.100 17.830 62.822  1.00 48.66 ? 39  GLU B C   1 
ATOM   1801 O  O   . GLU B 1 39  ? 22.230 16.615 62.971  1.00 48.76 ? 39  GLU B O   1 
ATOM   1802 C  CB  . GLU B 1 39  ? 21.742 19.664 64.463  1.00 51.59 ? 39  GLU B CB  1 
ATOM   1803 C  CG  . GLU B 1 39  ? 22.251 20.348 65.714  1.00 54.84 ? 39  GLU B CG  1 
ATOM   1804 C  CD  . GLU B 1 39  ? 22.846 19.364 66.700  1.00 56.65 ? 39  GLU B CD  1 
ATOM   1805 O  OE1 . GLU B 1 39  ? 22.128 18.421 67.102  1.00 56.52 ? 39  GLU B OE1 1 
ATOM   1806 O  OE2 . GLU B 1 39  ? 24.030 19.533 67.068  1.00 57.72 ? 39  GLU B OE2 1 
ATOM   1807 N  N   . ALA B 1 40  ? 21.357 18.372 61.860  1.00 47.10 ? 40  ALA B N   1 
ATOM   1808 C  CA  . ALA B 1 40  ? 20.646 17.549 60.891  1.00 45.71 ? 40  ALA B CA  1 
ATOM   1809 C  C   . ALA B 1 40  ? 21.615 16.534 60.294  1.00 44.43 ? 40  ALA B C   1 
ATOM   1810 O  O   . ALA B 1 40  ? 21.240 15.395 60.013  1.00 43.70 ? 40  ALA B O   1 
ATOM   1811 C  CB  . ALA B 1 40  ? 20.055 18.423 59.792  1.00 44.83 ? 40  ALA B CB  1 
ATOM   1812 N  N   . TRP B 1 41  ? 22.862 16.959 60.110  1.00 43.78 ? 41  TRP B N   1 
ATOM   1813 C  CA  . TRP B 1 41  ? 23.900 16.092 59.560  1.00 45.36 ? 41  TRP B CA  1 
ATOM   1814 C  C   . TRP B 1 41  ? 24.098 14.878 60.457  1.00 45.80 ? 41  TRP B C   1 
ATOM   1815 O  O   . TRP B 1 41  ? 23.919 13.737 60.028  1.00 46.12 ? 41  TRP B O   1 
ATOM   1816 C  CB  . TRP B 1 41  ? 25.226 16.842 59.452  1.00 45.14 ? 41  TRP B CB  1 
ATOM   1817 C  CG  . TRP B 1 41  ? 26.344 15.975 58.961  1.00 48.06 ? 41  TRP B CG  1 
ATOM   1818 C  CD1 . TRP B 1 41  ? 26.566 15.569 57.673  1.00 47.52 ? 41  TRP B CD1 1 
ATOM   1819 C  CD2 . TRP B 1 41  ? 27.375 15.373 59.754  1.00 48.36 ? 41  TRP B CD2 1 
ATOM   1820 N  NE1 . TRP B 1 41  ? 27.669 14.751 57.618  1.00 48.58 ? 41  TRP B NE1 1 
ATOM   1821 C  CE2 . TRP B 1 41  ? 28.184 14.613 58.881  1.00 48.84 ? 41  TRP B CE2 1 
ATOM   1822 C  CE3 . TRP B 1 41  ? 27.691 15.400 61.119  1.00 48.72 ? 41  TRP B CE3 1 
ATOM   1823 C  CZ2 . TRP B 1 41  ? 29.295 13.887 59.328  1.00 49.71 ? 41  TRP B CZ2 1 
ATOM   1824 C  CZ3 . TRP B 1 41  ? 28.796 14.680 61.565  1.00 49.45 ? 41  TRP B CZ3 1 
ATOM   1825 C  CH2 . TRP B 1 41  ? 29.584 13.932 60.670  1.00 50.63 ? 41  TRP B CH2 1 
ATOM   1826 N  N   . LYS B 1 42  ? 24.479 15.143 61.704  1.00 46.53 ? 42  LYS B N   1 
ATOM   1827 C  CA  . LYS B 1 42  ? 24.711 14.096 62.692  1.00 46.61 ? 42  LYS B CA  1 
ATOM   1828 C  C   . LYS B 1 42  ? 23.531 13.137 62.762  1.00 46.33 ? 42  LYS B C   1 
ATOM   1829 O  O   . LYS B 1 42  ? 23.709 11.930 62.909  1.00 47.24 ? 42  LYS B O   1 
ATOM   1830 C  CB  . LYS B 1 42  ? 24.946 14.725 64.069  1.00 47.85 ? 42  LYS B CB  1 
ATOM   1831 C  CG  . LYS B 1 42  ? 26.206 15.579 64.156  1.00 49.30 ? 42  LYS B CG  1 
ATOM   1832 C  CD  . LYS B 1 42  ? 26.257 16.432 65.425  1.00 50.98 ? 42  LYS B CD  1 
ATOM   1833 C  CE  . LYS B 1 42  ? 26.311 15.593 66.695  1.00 51.00 ? 42  LYS B CE  1 
ATOM   1834 N  NZ  . LYS B 1 42  ? 25.057 14.819 66.934  1.00 52.43 ? 42  LYS B NZ  1 
ATOM   1835 N  N   . LYS B 1 43  ? 22.324 13.679 62.650  1.00 46.35 ? 43  LYS B N   1 
ATOM   1836 C  CA  . LYS B 1 43  ? 21.118 12.860 62.706  1.00 47.57 ? 43  LYS B CA  1 
ATOM   1837 C  C   . LYS B 1 43  ? 21.070 11.869 61.547  1.00 47.68 ? 43  LYS B C   1 
ATOM   1838 O  O   . LYS B 1 43  ? 21.071 10.656 61.758  1.00 47.36 ? 43  LYS B O   1 
ATOM   1839 C  CB  . LYS B 1 43  ? 19.873 13.751 62.675  1.00 48.08 ? 43  LYS B CB  1 
ATOM   1840 C  CG  . LYS B 1 43  ? 18.572 12.993 62.838  1.00 48.68 ? 43  LYS B CG  1 
ATOM   1841 C  CD  . LYS B 1 43  ? 17.386 13.942 62.870  1.00 49.85 ? 43  LYS B CD  1 
ATOM   1842 C  CE  . LYS B 1 43  ? 16.091 13.190 63.137  1.00 50.68 ? 43  LYS B CE  1 
ATOM   1843 N  NZ  . LYS B 1 43  ? 16.147 12.449 64.430  1.00 51.31 ? 43  LYS B NZ  1 
ATOM   1844 N  N   . MET B 1 44  ? 21.036 12.398 60.326  1.00 47.49 ? 44  MET B N   1 
ATOM   1845 C  CA  . MET B 1 44  ? 20.986 11.578 59.121  1.00 47.37 ? 44  MET B CA  1 
ATOM   1846 C  C   . MET B 1 44  ? 22.039 10.475 59.119  1.00 46.42 ? 44  MET B C   1 
ATOM   1847 O  O   . MET B 1 44  ? 21.780 9.364  58.659  1.00 45.80 ? 44  MET B O   1 
ATOM   1848 C  CB  . MET B 1 44  ? 21.154 12.462 57.882  1.00 47.68 ? 44  MET B CB  1 
ATOM   1849 C  CG  . MET B 1 44  ? 20.025 13.460 57.695  1.00 48.51 ? 44  MET B CG  1 
ATOM   1850 S  SD  . MET B 1 44  ? 20.244 14.526 56.259  1.00 48.66 ? 44  MET B SD  1 
ATOM   1851 C  CE  . MET B 1 44  ? 19.725 13.423 54.945  1.00 47.12 ? 44  MET B CE  1 
ATOM   1852 N  N   . VAL B 1 45  ? 23.225 10.782 59.632  1.00 46.42 ? 45  VAL B N   1 
ATOM   1853 C  CA  . VAL B 1 45  ? 24.296 9.794  59.694  1.00 47.17 ? 45  VAL B CA  1 
ATOM   1854 C  C   . VAL B 1 45  ? 23.849 8.592  60.521  1.00 48.43 ? 45  VAL B C   1 
ATOM   1855 O  O   . VAL B 1 45  ? 23.891 7.454  60.053  1.00 48.43 ? 45  VAL B O   1 
ATOM   1856 C  CB  . VAL B 1 45  ? 25.570 10.390 60.326  1.00 47.02 ? 45  VAL B CB  1 
ATOM   1857 C  CG1 . VAL B 1 45  ? 26.629 9.307  60.485  1.00 46.06 ? 45  VAL B CG1 1 
ATOM   1858 C  CG2 . VAL B 1 45  ? 26.095 11.522 59.458  1.00 46.36 ? 45  VAL B CG2 1 
ATOM   1859 N  N   . GLU B 1 46  ? 23.420 8.849  61.753  1.00 49.78 ? 46  GLU B N   1 
ATOM   1860 C  CA  . GLU B 1 46  ? 22.960 7.776  62.625  1.00 50.41 ? 46  GLU B CA  1 
ATOM   1861 C  C   . GLU B 1 46  ? 21.680 7.178  62.068  1.00 49.92 ? 46  GLU B C   1 
ATOM   1862 O  O   . GLU B 1 46  ? 21.357 6.022  62.334  1.00 49.23 ? 46  GLU B O   1 
ATOM   1863 C  CB  . GLU B 1 46  ? 22.690 8.306  64.027  1.00 53.07 ? 46  GLU B CB  1 
ATOM   1864 C  CG  . GLU B 1 46  ? 23.884 8.933  64.690  1.00 56.93 ? 46  GLU B CG  1 
ATOM   1865 C  CD  . GLU B 1 46  ? 23.555 9.426  66.076  1.00 59.61 ? 46  GLU B CD  1 
ATOM   1866 O  OE1 . GLU B 1 46  ? 23.179 8.586  66.923  1.00 61.90 ? 46  GLU B OE1 1 
ATOM   1867 O  OE2 . GLU B 1 46  ? 23.664 10.648 66.317  1.00 61.25 ? 46  GLU B OE2 1 
ATOM   1868 N  N   . GLU B 1 47  ? 20.949 7.979  61.298  1.00 49.73 ? 47  GLU B N   1 
ATOM   1869 C  CA  . GLU B 1 47  ? 19.698 7.530  60.702  1.00 50.48 ? 47  GLU B CA  1 
ATOM   1870 C  C   . GLU B 1 47  ? 19.940 6.496  59.603  1.00 48.95 ? 47  GLU B C   1 
ATOM   1871 O  O   . GLU B 1 47  ? 19.055 5.699  59.292  1.00 49.84 ? 47  GLU B O   1 
ATOM   1872 C  CB  . GLU B 1 47  ? 18.922 8.722  60.130  1.00 52.50 ? 47  GLU B CB  1 
ATOM   1873 C  CG  . GLU B 1 47  ? 18.473 9.738  61.173  1.00 56.96 ? 47  GLU B CG  1 
ATOM   1874 C  CD  . GLU B 1 47  ? 17.507 9.156  62.190  1.00 58.64 ? 47  GLU B CD  1 
ATOM   1875 O  OE1 . GLU B 1 47  ? 16.360 8.829  61.811  1.00 59.44 ? 47  GLU B OE1 1 
ATOM   1876 O  OE2 . GLU B 1 47  ? 17.897 9.024  63.370  1.00 60.85 ? 47  GLU B OE2 1 
ATOM   1877 N  N   . GLY B 1 48  ? 21.134 6.510  59.018  1.00 47.16 ? 48  GLY B N   1 
ATOM   1878 C  CA  . GLY B 1 48  ? 21.439 5.553  57.966  1.00 45.36 ? 48  GLY B CA  1 
ATOM   1879 C  C   . GLY B 1 48  ? 22.688 5.862  57.161  1.00 43.55 ? 48  GLY B C   1 
ATOM   1880 O  O   . GLY B 1 48  ? 23.148 5.022  56.390  1.00 42.82 ? 48  GLY B O   1 
ATOM   1881 N  N   . ASP B 1 49  ? 23.241 7.059  57.344  1.00 42.18 ? 49  ASP B N   1 
ATOM   1882 C  CA  . ASP B 1 49  ? 24.441 7.474  56.621  1.00 41.72 ? 49  ASP B CA  1 
ATOM   1883 C  C   . ASP B 1 49  ? 24.252 7.169  55.139  1.00 39.70 ? 49  ASP B C   1 
ATOM   1884 O  O   . ASP B 1 49  ? 24.961 6.339  54.569  1.00 38.35 ? 49  ASP B O   1 
ATOM   1885 C  CB  . ASP B 1 49  ? 25.669 6.721  57.134  1.00 42.54 ? 49  ASP B CB  1 
ATOM   1886 C  CG  . ASP B 1 49  ? 26.964 7.269  56.564  1.00 45.51 ? 49  ASP B CG  1 
ATOM   1887 O  OD1 . ASP B 1 49  ? 27.986 6.547  56.602  1.00 45.57 ? 49  ASP B OD1 1 
ATOM   1888 O  OD2 . ASP B 1 49  ? 26.962 8.427  56.086  1.00 45.96 ? 49  ASP B OD2 1 
ATOM   1889 N  N   . PRO B 1 50  ? 23.289 7.844  54.497  1.00 38.32 ? 50  PRO B N   1 
ATOM   1890 C  CA  . PRO B 1 50  ? 22.993 7.645  53.076  1.00 37.51 ? 50  PRO B CA  1 
ATOM   1891 C  C   . PRO B 1 50  ? 24.111 8.068  52.128  1.00 35.39 ? 50  PRO B C   1 
ATOM   1892 O  O   . PRO B 1 50  ? 24.908 8.956  52.433  1.00 36.32 ? 50  PRO B O   1 
ATOM   1893 C  CB  . PRO B 1 50  ? 21.722 8.466  52.879  1.00 37.60 ? 50  PRO B CB  1 
ATOM   1894 C  CG  . PRO B 1 50  ? 21.949 9.621  53.804  1.00 39.00 ? 50  PRO B CG  1 
ATOM   1895 C  CD  . PRO B 1 50  ? 22.469 8.937  55.053  1.00 38.84 ? 50  PRO B CD  1 
ATOM   1896 N  N   . VAL B 1 51  ? 24.157 7.416  50.974  1.00 34.25 ? 51  VAL B N   1 
ATOM   1897 C  CA  . VAL B 1 51  ? 25.152 7.721  49.957  1.00 32.10 ? 51  VAL B CA  1 
ATOM   1898 C  C   . VAL B 1 51  ? 24.819 9.074  49.331  1.00 30.48 ? 51  VAL B C   1 
ATOM   1899 O  O   . VAL B 1 51  ? 23.681 9.319  48.935  1.00 29.21 ? 51  VAL B O   1 
ATOM   1900 C  CB  . VAL B 1 51  ? 25.153 6.645  48.853  1.00 33.57 ? 51  VAL B CB  1 
ATOM   1901 C  CG1 . VAL B 1 51  ? 26.197 6.980  47.793  1.00 34.72 ? 51  VAL B CG1 1 
ATOM   1902 C  CG2 . VAL B 1 51  ? 25.432 5.277  49.468  1.00 33.06 ? 51  VAL B CG2 1 
ATOM   1903 N  N   . VAL B 1 52  ? 25.808 9.957  49.259  1.00 28.08 ? 52  VAL B N   1 
ATOM   1904 C  CA  . VAL B 1 52  ? 25.589 11.270 48.670  1.00 27.17 ? 52  VAL B CA  1 
ATOM   1905 C  C   . VAL B 1 52  ? 25.867 11.192 47.169  1.00 26.97 ? 52  VAL B C   1 
ATOM   1906 O  O   . VAL B 1 52  ? 25.040 11.601 46.355  1.00 24.72 ? 52  VAL B O   1 
ATOM   1907 C  CB  . VAL B 1 52  ? 26.500 12.326 49.311  1.00 26.97 ? 52  VAL B CB  1 
ATOM   1908 C  CG1 . VAL B 1 52  ? 26.154 13.703 48.770  1.00 27.96 ? 52  VAL B CG1 1 
ATOM   1909 C  CG2 . VAL B 1 52  ? 26.341 12.288 50.830  1.00 27.87 ? 52  VAL B CG2 1 
ATOM   1910 N  N   . TYR B 1 53  ? 27.035 10.665 46.809  1.00 25.78 ? 53  TYR B N   1 
ATOM   1911 C  CA  . TYR B 1 53  ? 27.384 10.513 45.405  1.00 26.59 ? 53  TYR B CA  1 
ATOM   1912 C  C   . TYR B 1 53  ? 28.367 9.385  45.157  1.00 27.74 ? 53  TYR B C   1 
ATOM   1913 O  O   . TYR B 1 53  ? 29.041 8.902  46.078  1.00 27.30 ? 53  TYR B O   1 
ATOM   1914 C  CB  . TYR B 1 53  ? 27.940 11.822 44.833  1.00 24.31 ? 53  TYR B CB  1 
ATOM   1915 C  CG  . TYR B 1 53  ? 29.194 12.326 45.496  1.00 24.14 ? 53  TYR B CG  1 
ATOM   1916 C  CD1 . TYR B 1 53  ? 30.448 12.124 44.915  1.00 22.27 ? 53  TYR B CD1 1 
ATOM   1917 C  CD2 . TYR B 1 53  ? 29.127 13.039 46.691  1.00 21.88 ? 53  TYR B CD2 1 
ATOM   1918 C  CE1 . TYR B 1 53  ? 31.602 12.629 45.505  1.00 20.14 ? 53  TYR B CE1 1 
ATOM   1919 C  CE2 . TYR B 1 53  ? 30.268 13.544 47.289  1.00 24.14 ? 53  TYR B CE2 1 
ATOM   1920 C  CZ  . TYR B 1 53  ? 31.505 13.343 46.690  1.00 24.85 ? 53  TYR B CZ  1 
ATOM   1921 O  OH  . TYR B 1 53  ? 32.628 13.904 47.262  1.00 25.19 ? 53  TYR B OH  1 
ATOM   1922 N  N   . GLU B 1 54  ? 28.424 8.960  43.899  1.00 26.64 ? 54  GLU B N   1 
ATOM   1923 C  CA  . GLU B 1 54  ? 29.314 7.896  43.477  1.00 26.20 ? 54  GLU B CA  1 
ATOM   1924 C  C   . GLU B 1 54  ? 30.013 8.351  42.202  1.00 25.56 ? 54  GLU B C   1 
ATOM   1925 O  O   . GLU B 1 54  ? 29.415 9.017  41.353  1.00 23.67 ? 54  GLU B O   1 
ATOM   1926 C  CB  . GLU B 1 54  ? 28.517 6.613  43.229  1.00 26.75 ? 54  GLU B CB  1 
ATOM   1927 C  CG  . GLU B 1 54  ? 27.592 6.252  44.385  1.00 31.02 ? 54  GLU B CG  1 
ATOM   1928 C  CD  . GLU B 1 54  ? 26.861 4.934  44.183  1.00 32.27 ? 54  GLU B CD  1 
ATOM   1929 O  OE1 . GLU B 1 54  ? 26.273 4.728  43.100  1.00 32.10 ? 54  GLU B OE1 1 
ATOM   1930 O  OE2 . GLU B 1 54  ? 26.866 4.107  45.118  1.00 36.32 ? 54  GLU B OE2 1 
ATOM   1931 N  N   . VAL B 1 55  ? 31.284 7.990  42.081  1.00 24.75 ? 55  VAL B N   1 
ATOM   1932 C  CA  . VAL B 1 55  ? 32.088 8.365  40.933  1.00 24.81 ? 55  VAL B CA  1 
ATOM   1933 C  C   . VAL B 1 55  ? 32.611 7.133  40.192  1.00 24.56 ? 55  VAL B C   1 
ATOM   1934 O  O   . VAL B 1 55  ? 32.968 6.131  40.805  1.00 23.75 ? 55  VAL B O   1 
ATOM   1935 C  CB  . VAL B 1 55  ? 33.286 9.237  41.381  1.00 25.48 ? 55  VAL B CB  1 
ATOM   1936 C  CG1 . VAL B 1 55  ? 34.147 9.619  40.177  1.00 25.33 ? 55  VAL B CG1 1 
ATOM   1937 C  CG2 . VAL B 1 55  ? 32.777 10.487 42.099  1.00 24.86 ? 55  VAL B CG2 1 
ATOM   1938 N  N   . TYR B 1 56  ? 32.625 7.217  38.866  1.00 24.37 ? 56  TYR B N   1 
ATOM   1939 C  CA  . TYR B 1 56  ? 33.127 6.145  38.009  1.00 23.55 ? 56  TYR B CA  1 
ATOM   1940 C  C   . TYR B 1 56  ? 34.229 6.822  37.208  1.00 25.16 ? 56  TYR B C   1 
ATOM   1941 O  O   . TYR B 1 56  ? 33.957 7.587  36.278  1.00 25.94 ? 56  TYR B O   1 
ATOM   1942 C  CB  . TYR B 1 56  ? 32.015 5.636  37.098  1.00 23.33 ? 56  TYR B CB  1 
ATOM   1943 C  CG  . TYR B 1 56  ? 30.878 5.008  37.871  1.00 24.44 ? 56  TYR B CG  1 
ATOM   1944 C  CD1 . TYR B 1 56  ? 30.896 3.650  38.204  1.00 25.25 ? 56  TYR B CD1 1 
ATOM   1945 C  CD2 . TYR B 1 56  ? 29.816 5.787  38.333  1.00 23.61 ? 56  TYR B CD2 1 
ATOM   1946 C  CE1 . TYR B 1 56  ? 29.882 3.085  38.980  1.00 25.77 ? 56  TYR B CE1 1 
ATOM   1947 C  CE2 . TYR B 1 56  ? 28.805 5.238  39.108  1.00 25.35 ? 56  TYR B CE2 1 
ATOM   1948 C  CZ  . TYR B 1 56  ? 28.841 3.888  39.428  1.00 27.17 ? 56  TYR B CZ  1 
ATOM   1949 O  OH  . TYR B 1 56  ? 27.829 3.352  40.190  1.00 29.84 ? 56  TYR B OH  1 
ATOM   1950 N  N   . ALA B 1 57  ? 35.475 6.547  37.585  1.00 23.38 ? 57  ALA B N   1 
ATOM   1951 C  CA  . ALA B 1 57  ? 36.615 7.185  36.944  1.00 22.19 ? 57  ALA B CA  1 
ATOM   1952 C  C   . ALA B 1 57  ? 37.607 6.287  36.218  1.00 21.21 ? 57  ALA B C   1 
ATOM   1953 O  O   . ALA B 1 57  ? 37.837 5.138  36.592  1.00 20.54 ? 57  ALA B O   1 
ATOM   1954 C  CB  . ALA B 1 57  ? 37.361 8.030  37.980  1.00 19.32 ? 57  ALA B CB  1 
ATOM   1955 N  N   . ILE B 1 58  ? 38.180 6.854  35.163  1.00 21.14 ? 58  ILE B N   1 
ATOM   1956 C  CA  . ILE B 1 58  ? 39.199 6.217  34.345  1.00 21.08 ? 58  ILE B CA  1 
ATOM   1957 C  C   . ILE B 1 58  ? 40.253 7.308  34.250  1.00 20.94 ? 58  ILE B C   1 
ATOM   1958 O  O   . ILE B 1 58  ? 40.071 8.309  33.558  1.00 21.88 ? 58  ILE B O   1 
ATOM   1959 C  CB  . ILE B 1 58  ? 38.659 5.833  32.949  1.00 22.12 ? 58  ILE B CB  1 
ATOM   1960 C  CG1 . ILE B 1 58  ? 37.668 4.666  33.098  1.00 24.03 ? 58  ILE B CG1 1 
ATOM   1961 C  CG2 . ILE B 1 58  ? 39.812 5.421  32.027  1.00 22.18 ? 58  ILE B CG2 1 
ATOM   1962 C  CD1 . ILE B 1 58  ? 37.119 4.108  31.793  1.00 21.17 ? 58  ILE B CD1 1 
ATOM   1963 N  N   . GLU B 1 59  ? 41.343 7.120  34.983  1.00 22.09 ? 59  GLU B N   1 
ATOM   1964 C  CA  . GLU B 1 59  ? 42.411 8.108  35.035  1.00 24.49 ? 59  GLU B CA  1 
ATOM   1965 C  C   . GLU B 1 59  ? 43.734 7.582  34.507  1.00 24.45 ? 59  GLU B C   1 
ATOM   1966 O  O   . GLU B 1 59  ? 44.013 6.388  34.575  1.00 24.99 ? 59  GLU B O   1 
ATOM   1967 C  CB  . GLU B 1 59  ? 42.592 8.583  36.481  1.00 25.97 ? 59  GLU B CB  1 
ATOM   1968 C  CG  . GLU B 1 59  ? 41.320 9.141  37.118  1.00 30.12 ? 59  GLU B CG  1 
ATOM   1969 C  CD  . GLU B 1 59  ? 41.477 9.420  38.604  1.00 32.30 ? 59  GLU B CD  1 
ATOM   1970 O  OE1 . GLU B 1 59  ? 41.820 8.477  39.346  1.00 34.45 ? 59  GLU B OE1 1 
ATOM   1971 O  OE2 . GLU B 1 59  ? 41.256 10.575 39.031  1.00 33.11 ? 59  GLU B OE2 1 
ATOM   1972 N  N   . GLN B 1 60  ? 44.545 8.487  33.975  1.00 21.56 ? 60  GLN B N   1 
ATOM   1973 C  CA  . GLN B 1 60  ? 45.851 8.121  33.454  1.00 24.42 ? 60  GLN B CA  1 
ATOM   1974 C  C   . GLN B 1 60  ? 46.866 8.525  34.509  1.00 24.97 ? 60  GLN B C   1 
ATOM   1975 O  O   . GLN B 1 60  ? 46.508 9.093  35.544  1.00 22.26 ? 60  GLN B O   1 
ATOM   1976 C  CB  . GLN B 1 60  ? 46.152 8.878  32.151  1.00 23.47 ? 60  GLN B CB  1 
ATOM   1977 C  CG  . GLN B 1 60  ? 45.096 8.721  31.047  1.00 21.62 ? 60  GLN B CG  1 
ATOM   1978 C  CD  . GLN B 1 60  ? 44.876 7.276  30.634  1.00 22.87 ? 60  GLN B CD  1 
ATOM   1979 O  OE1 . GLN B 1 60  ? 45.824 6.554  30.313  1.00 22.42 ? 60  GLN B OE1 1 
ATOM   1980 N  NE2 . GLN B 1 60  ? 43.618 6.848  30.634  1.00 21.58 ? 60  GLN B NE2 1 
ATOM   1981 N  N   . GLU B 1 61  ? 48.132 8.221  34.260  1.00 25.87 ? 61  GLU B N   1 
ATOM   1982 C  CA  . GLU B 1 61  ? 49.160 8.611  35.197  1.00 26.68 ? 61  GLU B CA  1 
ATOM   1983 C  C   . GLU B 1 61  ? 49.302 10.120 35.073  1.00 25.97 ? 61  GLU B C   1 
ATOM   1984 O  O   . GLU B 1 61  ? 49.067 10.689 34.006  1.00 22.85 ? 61  GLU B O   1 
ATOM   1985 C  CB  . GLU B 1 61  ? 50.487 7.922  34.874  1.00 31.93 ? 61  GLU B CB  1 
ATOM   1986 C  CG  . GLU B 1 61  ? 50.532 6.469  35.312  1.00 39.12 ? 61  GLU B CG  1 
ATOM   1987 C  CD  . GLU B 1 61  ? 51.942 5.918  35.340  1.00 43.69 ? 61  GLU B CD  1 
ATOM   1988 O  OE1 . GLU B 1 61  ? 52.119 4.750  35.749  1.00 46.39 ? 61  GLU B OE1 1 
ATOM   1989 O  OE2 . GLU B 1 61  ? 52.873 6.656  34.953  1.00 46.70 ? 61  GLU B OE2 1 
ATOM   1990 N  N   . GLU B 1 62  ? 49.666 10.758 36.177  1.00 24.42 ? 62  GLU B N   1 
ATOM   1991 C  CA  . GLU B 1 62  ? 49.843 12.200 36.219  1.00 27.70 ? 62  GLU B CA  1 
ATOM   1992 C  C   . GLU B 1 62  ? 50.842 12.648 35.163  1.00 28.53 ? 62  GLU B C   1 
ATOM   1993 O  O   . GLU B 1 62  ? 52.051 12.510 35.347  1.00 31.33 ? 62  GLU B O   1 
ATOM   1994 C  CB  . GLU B 1 62  ? 50.345 12.604 37.598  1.00 29.29 ? 62  GLU B CB  1 
ATOM   1995 C  CG  . GLU B 1 62  ? 50.528 14.086 37.792  1.00 34.55 ? 62  GLU B CG  1 
ATOM   1996 C  CD  . GLU B 1 62  ? 51.316 14.390 39.046  1.00 35.40 ? 62  GLU B CD  1 
ATOM   1997 O  OE1 . GLU B 1 62  ? 51.060 13.720 40.072  1.00 33.65 ? 62  GLU B OE1 1 
ATOM   1998 O  OE2 . GLU B 1 62  ? 52.180 15.296 39.001  1.00 36.55 ? 62  GLU B OE2 1 
ATOM   1999 N  N   . LYS B 1 63  ? 50.337 13.188 34.058  1.00 28.89 ? 63  LYS B N   1 
ATOM   2000 C  CA  . LYS B 1 63  ? 51.204 13.654 32.987  1.00 28.03 ? 63  LYS B CA  1 
ATOM   2001 C  C   . LYS B 1 63  ? 50.619 14.861 32.258  1.00 27.67 ? 63  LYS B C   1 
ATOM   2002 O  O   . LYS B 1 63  ? 49.407 14.950 32.033  1.00 25.61 ? 63  LYS B O   1 
ATOM   2003 C  CB  . LYS B 1 63  ? 51.460 12.527 31.983  1.00 32.22 ? 63  LYS B CB  1 
ATOM   2004 C  CG  . LYS B 1 63  ? 52.706 12.742 31.134  1.00 35.41 ? 63  LYS B CG  1 
ATOM   2005 C  CD  . LYS B 1 63  ? 52.918 11.604 30.145  1.00 40.94 ? 63  LYS B CD  1 
ATOM   2006 C  CE  . LYS B 1 63  ? 54.298 11.682 29.495  1.00 42.05 ? 63  LYS B CE  1 
ATOM   2007 N  NZ  . LYS B 1 63  ? 54.560 13.011 28.873  1.00 44.14 ? 63  LYS B NZ  1 
ATOM   2008 N  N   . GLU B 1 64  ? 51.502 15.784 31.896  1.00 24.96 ? 64  GLU B N   1 
ATOM   2009 C  CA  . GLU B 1 64  ? 51.140 17.000 31.190  1.00 24.57 ? 64  GLU B CA  1 
ATOM   2010 C  C   . GLU B 1 64  ? 50.631 16.671 29.788  1.00 23.44 ? 64  GLU B C   1 
ATOM   2011 O  O   . GLU B 1 64  ? 51.265 15.918 29.051  1.00 20.52 ? 64  GLU B O   1 
ATOM   2012 C  CB  . GLU B 1 64  ? 52.363 17.915 31.106  1.00 26.83 ? 64  GLU B CB  1 
ATOM   2013 C  CG  . GLU B 1 64  ? 52.179 19.161 30.258  1.00 32.71 ? 64  GLU B CG  1 
ATOM   2014 C  CD  . GLU B 1 64  ? 53.484 19.911 30.057  1.00 35.75 ? 64  GLU B CD  1 
ATOM   2015 O  OE1 . GLU B 1 64  ? 54.097 20.310 31.072  1.00 37.83 ? 64  GLU B OE1 1 
ATOM   2016 O  OE2 . GLU B 1 64  ? 53.899 20.097 28.890  1.00 36.36 ? 64  GLU B OE2 1 
ATOM   2017 N  N   . GLY B 1 65  ? 49.481 17.233 29.429  1.00 22.26 ? 65  GLY B N   1 
ATOM   2018 C  CA  . GLY B 1 65  ? 48.919 16.974 28.116  1.00 20.06 ? 65  GLY B CA  1 
ATOM   2019 C  C   . GLY B 1 65  ? 47.994 15.767 28.046  1.00 20.85 ? 65  GLY B C   1 
ATOM   2020 O  O   . GLY B 1 65  ? 47.329 15.567 27.025  1.00 19.74 ? 65  GLY B O   1 
ATOM   2021 N  N   . ASP B 1 66  ? 47.936 14.964 29.111  1.00 18.43 ? 66  ASP B N   1 
ATOM   2022 C  CA  . ASP B 1 66  ? 47.069 13.783 29.111  1.00 18.75 ? 66  ASP B CA  1 
ATOM   2023 C  C   . ASP B 1 66  ? 45.722 14.119 29.772  1.00 18.96 ? 66  ASP B C   1 
ATOM   2024 O  O   . ASP B 1 66  ? 45.566 15.199 30.351  1.00 19.27 ? 66  ASP B O   1 
ATOM   2025 C  CB  . ASP B 1 66  ? 47.747 12.611 29.834  1.00 17.88 ? 66  ASP B CB  1 
ATOM   2026 C  CG  . ASP B 1 66  ? 47.368 11.256 29.241  1.00 21.27 ? 66  ASP B CG  1 
ATOM   2027 O  OD1 . ASP B 1 66  ? 46.265 11.140 28.659  1.00 17.60 ? 66  ASP B OD1 1 
ATOM   2028 O  OD2 . ASP B 1 66  ? 48.170 10.300 29.365  1.00 22.55 ? 66  ASP B OD2 1 
ATOM   2029 N  N   . LEU B 1 67  ? 44.756 13.202 29.697  1.00 17.10 ? 67  LEU B N   1 
ATOM   2030 C  CA  . LEU B 1 67  ? 43.421 13.467 30.249  1.00 18.40 ? 67  LEU B CA  1 
ATOM   2031 C  C   . LEU B 1 67  ? 42.743 12.339 31.024  1.00 16.70 ? 67  LEU B C   1 
ATOM   2032 O  O   . LEU B 1 67  ? 42.922 11.158 30.723  1.00 17.03 ? 67  LEU B O   1 
ATOM   2033 C  CB  . LEU B 1 67  ? 42.475 13.880 29.116  1.00 17.70 ? 67  LEU B CB  1 
ATOM   2034 C  CG  . LEU B 1 67  ? 42.866 15.062 28.226  1.00 19.28 ? 67  LEU B CG  1 
ATOM   2035 C  CD1 . LEU B 1 67  ? 42.127 14.963 26.895  1.00 18.37 ? 67  LEU B CD1 1 
ATOM   2036 C  CD2 . LEU B 1 67  ? 42.551 16.377 28.947  1.00 18.02 ? 67  LEU B CD2 1 
ATOM   2037 N  N   . ASN B 1 68  ? 41.946 12.732 32.014  1.00 17.48 ? 68  ASN B N   1 
ATOM   2038 C  CA  . ASN B 1 68  ? 41.168 11.802 32.832  1.00 15.18 ? 68  ASN B CA  1 
ATOM   2039 C  C   . ASN B 1 68  ? 39.702 12.181 32.654  1.00 14.68 ? 68  ASN B C   1 
ATOM   2040 O  O   . ASN B 1 68  ? 39.388 13.315 32.297  1.00 14.52 ? 68  ASN B O   1 
ATOM   2041 C  CB  . ASN B 1 68  ? 41.504 11.937 34.323  1.00 15.59 ? 68  ASN B CB  1 
ATOM   2042 C  CG  . ASN B 1 68  ? 42.946 11.594 34.637  1.00 19.40 ? 68  ASN B CG  1 
ATOM   2043 O  OD1 . ASN B 1 68  ? 43.608 10.894 33.878  1.00 20.74 ? 68  ASN B OD1 1 
ATOM   2044 N  ND2 . ASN B 1 68  ? 43.433 12.075 35.775  1.00 18.54 ? 68  ASN B ND2 1 
ATOM   2045 N  N   . PHE B 1 69  ? 38.806 11.236 32.899  1.00 15.85 ? 69  PHE B N   1 
ATOM   2046 C  CA  . PHE B 1 69  ? 37.382 11.517 32.804  1.00 17.90 ? 69  PHE B CA  1 
ATOM   2047 C  C   . PHE B 1 69  ? 36.632 10.646 33.797  1.00 19.39 ? 69  PHE B C   1 
ATOM   2048 O  O   . PHE B 1 69  ? 37.142 9.608  34.239  1.00 19.96 ? 69  PHE B O   1 
ATOM   2049 C  CB  . PHE B 1 69  ? 36.860 11.320 31.367  1.00 15.14 ? 69  PHE B CB  1 
ATOM   2050 C  CG  . PHE B 1 69  ? 36.976 9.918  30.839  1.00 16.24 ? 69  PHE B CG  1 
ATOM   2051 C  CD1 . PHE B 1 69  ? 35.942 9.000  31.025  1.00 13.40 ? 69  PHE B CD1 1 
ATOM   2052 C  CD2 . PHE B 1 69  ? 38.103 9.524  30.116  1.00 16.27 ? 69  PHE B CD2 1 
ATOM   2053 C  CE1 . PHE B 1 69  ? 36.020 7.709  30.498  1.00 13.18 ? 69  PHE B CE1 1 
ATOM   2054 C  CE2 . PHE B 1 69  ? 38.198 8.233  29.582  1.00 16.73 ? 69  PHE B CE2 1 
ATOM   2055 C  CZ  . PHE B 1 69  ? 37.150 7.321  29.772  1.00 16.68 ? 69  PHE B CZ  1 
ATOM   2056 N  N   . ALA B 1 70  ? 35.429 11.074 34.159  1.00 17.26 ? 70  ALA B N   1 
ATOM   2057 C  CA  . ALA B 1 70  ? 34.639 10.327 35.116  1.00 18.39 ? 70  ALA B CA  1 
ATOM   2058 C  C   . ALA B 1 70  ? 33.213 10.834 35.192  1.00 19.66 ? 70  ALA B C   1 
ATOM   2059 O  O   . ALA B 1 70  ? 32.940 12.023 34.973  1.00 20.74 ? 70  ALA B O   1 
ATOM   2060 C  CB  . ALA B 1 70  ? 35.293 10.417 36.505  1.00 19.40 ? 70  ALA B CB  1 
ATOM   2061 N  N   . THR B 1 71  ? 32.293 9.923  35.486  1.00 19.25 ? 71  THR B N   1 
ATOM   2062 C  CA  . THR B 1 71  ? 30.903 10.313 35.641  1.00 19.93 ? 71  THR B CA  1 
ATOM   2063 C  C   . THR B 1 71  ? 30.654 10.368 37.128  1.00 20.38 ? 71  THR B C   1 
ATOM   2064 O  O   . THR B 1 71  ? 31.307 9.668  37.907  1.00 21.08 ? 71  THR B O   1 
ATOM   2065 C  CB  . THR B 1 71  ? 29.912 9.290  35.029  1.00 19.18 ? 71  THR B CB  1 
ATOM   2066 O  OG1 . THR B 1 71  ? 30.222 7.976  35.508  1.00 18.56 ? 71  THR B OG1 1 
ATOM   2067 C  CG2 . THR B 1 71  ? 29.974 9.322  33.507  1.00 16.55 ? 71  THR B CG2 1 
ATOM   2068 N  N   . THR B 1 72  ? 29.727 11.227 37.523  1.00 20.47 ? 72  THR B N   1 
ATOM   2069 C  CA  . THR B 1 72  ? 29.351 11.344 38.913  1.00 19.61 ? 72  THR B CA  1 
ATOM   2070 C  C   . THR B 1 72  ? 27.844 11.200 38.971  1.00 22.19 ? 72  THR B C   1 
ATOM   2071 O  O   . THR B 1 72  ? 27.115 11.739 38.129  1.00 22.52 ? 72  THR B O   1 
ATOM   2072 C  CB  . THR B 1 72  ? 29.712 12.710 39.518  1.00 20.12 ? 72  THR B CB  1 
ATOM   2073 O  OG1 . THR B 1 72  ? 31.131 12.875 39.535  1.00 18.68 ? 72  THR B OG1 1 
ATOM   2074 C  CG2 . THR B 1 72  ? 29.189 12.803 40.944  1.00 21.27 ? 72  THR B CG2 1 
ATOM   2075 N  N   . VAL B 1 73  ? 27.386 10.439 39.952  1.00 22.10 ? 73  VAL B N   1 
ATOM   2076 C  CA  . VAL B 1 73  ? 25.967 10.236 40.171  1.00 22.47 ? 73  VAL B CA  1 
ATOM   2077 C  C   . VAL B 1 73  ? 25.718 10.843 41.546  1.00 22.72 ? 73  VAL B C   1 
ATOM   2078 O  O   . VAL B 1 73  ? 26.000 10.219 42.568  1.00 22.24 ? 73  VAL B O   1 
ATOM   2079 C  CB  . VAL B 1 73  ? 25.604 8.736  40.186  1.00 22.16 ? 73  VAL B CB  1 
ATOM   2080 C  CG1 . VAL B 1 73  ? 24.140 8.558  40.590  1.00 21.58 ? 73  VAL B CG1 1 
ATOM   2081 C  CG2 . VAL B 1 73  ? 25.859 8.133  38.809  1.00 17.07 ? 73  VAL B CG2 1 
ATOM   2082 N  N   . LEU B 1 74  ? 25.228 12.077 41.551  1.00 22.01 ? 74  LEU B N   1 
ATOM   2083 C  CA  . LEU B 1 74  ? 24.945 12.804 42.783  1.00 24.96 ? 74  LEU B CA  1 
ATOM   2084 C  C   . LEU B 1 74  ? 23.481 12.596 43.139  1.00 25.69 ? 74  LEU B C   1 
ATOM   2085 O  O   . LEU B 1 74  ? 22.584 13.115 42.467  1.00 25.70 ? 74  LEU B O   1 
ATOM   2086 C  CB  . LEU B 1 74  ? 25.236 14.294 42.588  1.00 24.46 ? 74  LEU B CB  1 
ATOM   2087 C  CG  . LEU B 1 74  ? 24.935 15.240 43.755  1.00 27.17 ? 74  LEU B CG  1 
ATOM   2088 C  CD1 . LEU B 1 74  ? 25.719 14.828 44.993  1.00 26.35 ? 74  LEU B CD1 1 
ATOM   2089 C  CD2 . LEU B 1 74  ? 25.299 16.660 43.338  1.00 26.40 ? 74  LEU B CD2 1 
ATOM   2090 N  N   . TYR B 1 75  ? 23.256 11.836 44.204  1.00 24.32 ? 75  TYR B N   1 
ATOM   2091 C  CA  . TYR B 1 75  ? 21.916 11.507 44.662  1.00 25.28 ? 75  TYR B CA  1 
ATOM   2092 C  C   . TYR B 1 75  ? 21.128 12.665 45.257  1.00 23.12 ? 75  TYR B C   1 
ATOM   2093 O  O   . TYR B 1 75  ? 21.694 13.575 45.857  1.00 23.01 ? 75  TYR B O   1 
ATOM   2094 C  CB  . TYR B 1 75  ? 22.000 10.343 45.651  1.00 25.82 ? 75  TYR B CB  1 
ATOM   2095 C  CG  . TYR B 1 75  ? 22.380 9.053  44.961  1.00 29.12 ? 75  TYR B CG  1 
ATOM   2096 C  CD1 . TYR B 1 75  ? 21.458 8.373  44.167  1.00 30.21 ? 75  TYR B CD1 1 
ATOM   2097 C  CD2 . TYR B 1 75  ? 23.681 8.547  45.040  1.00 30.20 ? 75  TYR B CD2 1 
ATOM   2098 C  CE1 . TYR B 1 75  ? 21.819 7.223  43.467  1.00 32.94 ? 75  TYR B CE1 1 
ATOM   2099 C  CE2 . TYR B 1 75  ? 24.053 7.398  44.343  1.00 29.83 ? 75  TYR B CE2 1 
ATOM   2100 C  CZ  . TYR B 1 75  ? 23.117 6.742  43.559  1.00 31.57 ? 75  TYR B CZ  1 
ATOM   2101 O  OH  . TYR B 1 75  ? 23.465 5.600  42.876  1.00 33.99 ? 75  TYR B OH  1 
ATOM   2102 N  N   . PRO B 1 76  ? 19.795 12.639 45.085  1.00 23.17 ? 76  PRO B N   1 
ATOM   2103 C  CA  . PRO B 1 76  ? 18.892 13.677 45.593  1.00 23.81 ? 76  PRO B CA  1 
ATOM   2104 C  C   . PRO B 1 76  ? 18.800 13.658 47.114  1.00 24.23 ? 76  PRO B C   1 
ATOM   2105 O  O   . PRO B 1 76  ? 18.844 12.597 47.727  1.00 24.77 ? 76  PRO B O   1 
ATOM   2106 C  CB  . PRO B 1 76  ? 17.566 13.333 44.919  1.00 22.13 ? 76  PRO B CB  1 
ATOM   2107 C  CG  . PRO B 1 76  ? 17.611 11.842 44.866  1.00 25.42 ? 76  PRO B CG  1 
ATOM   2108 C  CD  . PRO B 1 76  ? 19.035 11.562 44.421  1.00 21.99 ? 76  PRO B CD  1 
ATOM   2109 N  N   . GLY B 1 77  ? 18.685 14.838 47.715  1.00 25.05 ? 77  GLY B N   1 
ATOM   2110 C  CA  . GLY B 1 77  ? 18.587 14.925 49.161  1.00 26.53 ? 77  GLY B CA  1 
ATOM   2111 C  C   . GLY B 1 77  ? 18.994 16.280 49.711  1.00 28.17 ? 77  GLY B C   1 
ATOM   2112 O  O   . GLY B 1 77  ? 19.444 17.155 48.966  1.00 28.94 ? 77  GLY B O   1 
ATOM   2113 N  N   . LYS B 1 78  ? 18.830 16.459 51.018  1.00 28.89 ? 78  LYS B N   1 
ATOM   2114 C  CA  . LYS B 1 78  ? 19.195 17.710 51.675  1.00 31.00 ? 78  LYS B CA  1 
ATOM   2115 C  C   . LYS B 1 78  ? 19.617 17.491 53.127  1.00 30.59 ? 78  LYS B C   1 
ATOM   2116 O  O   . LYS B 1 78  ? 19.068 16.638 53.817  1.00 29.09 ? 78  LYS B O   1 
ATOM   2117 C  CB  . LYS B 1 78  ? 18.019 18.696 51.654  1.00 33.54 ? 78  LYS B CB  1 
ATOM   2118 C  CG  . LYS B 1 78  ? 17.572 19.153 50.271  1.00 34.85 ? 78  LYS B CG  1 
ATOM   2119 C  CD  . LYS B 1 78  ? 16.450 20.189 50.353  1.00 36.55 ? 78  LYS B CD  1 
ATOM   2120 C  CE  . LYS B 1 78  ? 15.191 19.608 50.989  1.00 38.13 ? 78  LYS B CE  1 
ATOM   2121 N  NZ  . LYS B 1 78  ? 14.058 20.572 50.938  1.00 41.43 ? 78  LYS B NZ  1 
ATOM   2122 N  N   . VAL B 1 79  ? 20.610 18.255 53.575  1.00 31.32 ? 79  VAL B N   1 
ATOM   2123 C  CA  . VAL B 1 79  ? 21.071 18.190 54.962  1.00 31.68 ? 79  VAL B CA  1 
ATOM   2124 C  C   . VAL B 1 79  ? 20.429 19.438 55.543  1.00 32.15 ? 79  VAL B C   1 
ATOM   2125 O  O   . VAL B 1 79  ? 20.919 20.547 55.336  1.00 33.57 ? 79  VAL B O   1 
ATOM   2126 C  CB  . VAL B 1 79  ? 22.603 18.321 55.074  1.00 32.69 ? 79  VAL B CB  1 
ATOM   2127 C  CG1 . VAL B 1 79  ? 23.022 18.283 56.550  1.00 31.21 ? 79  VAL B CG1 1 
ATOM   2128 C  CG2 . VAL B 1 79  ? 23.284 17.201 54.290  1.00 31.72 ? 79  VAL B CG2 1 
ATOM   2129 N  N   . GLY B 1 80  ? 19.328 19.261 56.263  1.00 33.06 ? 80  GLY B N   1 
ATOM   2130 C  CA  . GLY B 1 80  ? 18.621 20.416 56.785  1.00 33.57 ? 80  GLY B CA  1 
ATOM   2131 C  C   . GLY B 1 80  ? 17.844 20.900 55.575  1.00 32.78 ? 80  GLY B C   1 
ATOM   2132 O  O   . GLY B 1 80  ? 16.879 20.262 55.156  1.00 32.18 ? 80  GLY B O   1 
ATOM   2133 N  N   . ASN B 1 81  ? 18.265 22.016 54.998  1.00 34.37 ? 81  ASN B N   1 
ATOM   2134 C  CA  . ASN B 1 81  ? 17.617 22.532 53.801  1.00 36.66 ? 81  ASN B CA  1 
ATOM   2135 C  C   . ASN B 1 81  ? 18.690 22.788 52.744  1.00 35.34 ? 81  ASN B C   1 
ATOM   2136 O  O   . ASN B 1 81  ? 18.464 23.483 51.751  1.00 35.39 ? 81  ASN B O   1 
ATOM   2137 C  CB  . ASN B 1 81  ? 16.826 23.810 54.112  1.00 40.30 ? 81  ASN B CB  1 
ATOM   2138 C  CG  . ASN B 1 81  ? 17.616 24.804 54.926  1.00 43.46 ? 81  ASN B CG  1 
ATOM   2139 O  OD1 . ASN B 1 81  ? 18.630 25.329 54.471  1.00 46.74 ? 81  ASN B OD1 1 
ATOM   2140 N  ND2 . ASN B 1 81  ? 17.154 25.070 56.144  1.00 46.45 ? 81  ASN B ND2 1 
ATOM   2141 N  N   . GLU B 1 82  ? 19.860 22.197 52.972  1.00 33.47 ? 82  GLU B N   1 
ATOM   2142 C  CA  . GLU B 1 82  ? 20.996 22.321 52.068  1.00 31.34 ? 82  GLU B CA  1 
ATOM   2143 C  C   . GLU B 1 82  ? 21.072 21.083 51.167  1.00 29.60 ? 82  GLU B C   1 
ATOM   2144 O  O   . GLU B 1 82  ? 21.167 19.958 51.651  1.00 29.99 ? 82  GLU B O   1 
ATOM   2145 C  CB  . GLU B 1 82  ? 22.281 22.480 52.887  1.00 32.18 ? 82  GLU B CB  1 
ATOM   2146 C  CG  . GLU B 1 82  ? 23.545 22.729 52.075  1.00 33.56 ? 82  GLU B CG  1 
ATOM   2147 C  CD  . GLU B 1 82  ? 24.735 23.058 52.961  1.00 34.88 ? 82  GLU B CD  1 
ATOM   2148 O  OE1 . GLU B 1 82  ? 24.822 22.480 54.062  1.00 36.73 ? 82  GLU B OE1 1 
ATOM   2149 O  OE2 . GLU B 1 82  ? 25.584 23.881 52.560  1.00 35.37 ? 82  GLU B OE2 1 
ATOM   2150 N  N   . PHE B 1 83  ? 21.023 21.305 49.856  1.00 27.56 ? 83  PHE B N   1 
ATOM   2151 C  CA  . PHE B 1 83  ? 21.064 20.226 48.869  1.00 25.87 ? 83  PHE B CA  1 
ATOM   2152 C  C   . PHE B 1 83  ? 22.316 19.359 48.912  1.00 25.56 ? 83  PHE B C   1 
ATOM   2153 O  O   . PHE B 1 83  ? 23.416 19.843 49.195  1.00 24.89 ? 83  PHE B O   1 
ATOM   2154 C  CB  . PHE B 1 83  ? 20.953 20.796 47.448  1.00 24.46 ? 83  PHE B CB  1 
ATOM   2155 C  CG  . PHE B 1 83  ? 19.643 21.465 47.149  1.00 22.94 ? 83  PHE B CG  1 
ATOM   2156 C  CD1 . PHE B 1 83  ? 18.479 20.715 47.009  1.00 23.51 ? 83  PHE B CD1 1 
ATOM   2157 C  CD2 . PHE B 1 83  ? 19.577 22.845 46.993  1.00 21.86 ? 83  PHE B CD2 1 
ATOM   2158 C  CE1 . PHE B 1 83  ? 17.265 21.331 46.717  1.00 24.90 ? 83  PHE B CE1 1 
ATOM   2159 C  CE2 . PHE B 1 83  ? 18.371 23.475 46.702  1.00 23.54 ? 83  PHE B CE2 1 
ATOM   2160 C  CZ  . PHE B 1 83  ? 17.210 22.715 46.562  1.00 24.89 ? 83  PHE B CZ  1 
ATOM   2161 N  N   . PHE B 1 84  ? 22.139 18.079 48.600  1.00 25.64 ? 84  PHE B N   1 
ATOM   2162 C  CA  . PHE B 1 84  ? 23.257 17.143 48.537  1.00 26.47 ? 84  PHE B CA  1 
ATOM   2163 C  C   . PHE B 1 84  ? 24.259 17.738 47.541  1.00 26.37 ? 84  PHE B C   1 
ATOM   2164 O  O   . PHE B 1 84  ? 23.866 18.353 46.544  1.00 23.04 ? 84  PHE B O   1 
ATOM   2165 C  CB  . PHE B 1 84  ? 22.770 15.774 48.056  1.00 27.45 ? 84  PHE B CB  1 
ATOM   2166 C  CG  . PHE B 1 84  ? 22.329 14.857 49.166  1.00 28.18 ? 84  PHE B CG  1 
ATOM   2167 C  CD1 . PHE B 1 84  ? 21.933 15.363 50.402  1.00 29.58 ? 84  PHE B CD1 1 
ATOM   2168 C  CD2 . PHE B 1 84  ? 22.294 13.482 48.968  1.00 28.63 ? 84  PHE B CD2 1 
ATOM   2169 C  CE1 . PHE B 1 84  ? 21.523 14.508 51.429  1.00 28.75 ? 84  PHE B CE1 1 
ATOM   2170 C  CE2 . PHE B 1 84  ? 21.886 12.619 49.988  1.00 30.09 ? 84  PHE B CE2 1 
ATOM   2171 C  CZ  . PHE B 1 84  ? 21.494 13.137 51.218  1.00 30.63 ? 84  PHE B CZ  1 
ATOM   2172 N  N   . MET B 1 85  ? 25.544 17.542 47.807  1.00 24.10 ? 85  MET B N   1 
ATOM   2173 C  CA  . MET B 1 85  ? 26.584 18.122 46.978  1.00 24.31 ? 85  MET B CA  1 
ATOM   2174 C  C   . MET B 1 85  ? 27.891 17.341 47.088  1.00 25.02 ? 85  MET B C   1 
ATOM   2175 O  O   . MET B 1 85  ? 28.038 16.486 47.961  1.00 25.56 ? 85  MET B O   1 
ATOM   2176 C  CB  . MET B 1 85  ? 26.830 19.547 47.463  1.00 24.46 ? 85  MET B CB  1 
ATOM   2177 C  CG  . MET B 1 85  ? 27.151 19.581 48.962  1.00 26.21 ? 85  MET B CG  1 
ATOM   2178 S  SD  . MET B 1 85  ? 27.196 21.203 49.745  1.00 24.86 ? 85  MET B SD  1 
ATOM   2179 C  CE  . MET B 1 85  ? 28.275 20.850 51.187  1.00 26.33 ? 85  MET B CE  1 
ATOM   2180 N  N   . THR B 1 86  ? 28.837 17.651 46.203  1.00 22.67 ? 86  THR B N   1 
ATOM   2181 C  CA  . THR B 1 86  ? 30.145 17.010 46.239  1.00 23.05 ? 86  THR B CA  1 
ATOM   2182 C  C   . THR B 1 86  ? 31.013 17.860 47.163  1.00 23.07 ? 86  THR B C   1 
ATOM   2183 O  O   . THR B 1 86  ? 30.669 19.000 47.456  1.00 22.96 ? 86  THR B O   1 
ATOM   2184 C  CB  . THR B 1 86  ? 30.803 16.927 44.825  1.00 22.16 ? 86  THR B CB  1 
ATOM   2185 O  OG1 . THR B 1 86  ? 30.894 18.233 44.244  1.00 19.00 ? 86  THR B OG1 1 
ATOM   2186 C  CG2 . THR B 1 86  ? 29.992 16.023 43.912  1.00 20.76 ? 86  THR B CG2 1 
ATOM   2187 N  N   . LYS B 1 87  ? 32.130 17.319 47.631  1.00 25.88 ? 87  LYS B N   1 
ATOM   2188 C  CA  . LYS B 1 87  ? 32.996 18.074 48.528  1.00 26.54 ? 87  LYS B CA  1 
ATOM   2189 C  C   . LYS B 1 87  ? 33.525 19.373 47.920  1.00 26.48 ? 87  LYS B C   1 
ATOM   2190 O  O   . LYS B 1 87  ? 33.593 20.401 48.600  1.00 23.83 ? 87  LYS B O   1 
ATOM   2191 C  CB  . LYS B 1 87  ? 34.156 17.192 49.000  1.00 29.82 ? 87  LYS B CB  1 
ATOM   2192 C  CG  . LYS B 1 87  ? 33.700 16.050 49.909  1.00 33.98 ? 87  LYS B CG  1 
ATOM   2193 C  CD  . LYS B 1 87  ? 34.868 15.317 50.566  1.00 38.32 ? 87  LYS B CD  1 
ATOM   2194 C  CE  . LYS B 1 87  ? 35.694 14.533 49.556  1.00 41.85 ? 87  LYS B CE  1 
ATOM   2195 N  NZ  . LYS B 1 87  ? 36.753 13.710 50.218  1.00 43.45 ? 87  LYS B NZ  1 
ATOM   2196 N  N   . GLY B 1 88  ? 33.891 19.330 46.642  1.00 27.33 ? 88  GLY B N   1 
ATOM   2197 C  CA  . GLY B 1 88  ? 34.412 20.516 45.981  1.00 27.16 ? 88  GLY B CA  1 
ATOM   2198 C  C   . GLY B 1 88  ? 35.918 20.593 46.152  1.00 28.65 ? 88  GLY B C   1 
ATOM   2199 O  O   . GLY B 1 88  ? 36.440 20.200 47.195  1.00 28.71 ? 88  GLY B O   1 
ATOM   2200 N  N   . HIS B 1 89  ? 36.624 21.111 45.149  1.00 28.28 ? 89  HIS B N   1 
ATOM   2201 C  CA  . HIS B 1 89  ? 38.077 21.183 45.241  1.00 29.89 ? 89  HIS B CA  1 
ATOM   2202 C  C   . HIS B 1 89  ? 38.740 22.045 44.183  1.00 31.40 ? 89  HIS B C   1 
ATOM   2203 O  O   . HIS B 1 89  ? 38.144 22.364 43.151  1.00 32.65 ? 89  HIS B O   1 
ATOM   2204 C  CB  . HIS B 1 89  ? 38.659 19.771 45.133  1.00 29.74 ? 89  HIS B CB  1 
ATOM   2205 C  CG  . HIS B 1 89  ? 38.388 19.107 43.816  1.00 29.09 ? 89  HIS B CG  1 
ATOM   2206 N  ND1 . HIS B 1 89  ? 39.250 19.191 42.741  1.00 31.07 ? 89  HIS B ND1 1 
ATOM   2207 C  CD2 . HIS B 1 89  ? 37.338 18.366 43.391  1.00 28.95 ? 89  HIS B CD2 1 
ATOM   2208 C  CE1 . HIS B 1 89  ? 38.741 18.531 41.715  1.00 28.34 ? 89  HIS B CE1 1 
ATOM   2209 N  NE2 . HIS B 1 89  ? 37.580 18.020 42.083  1.00 29.26 ? 89  HIS B NE2 1 
ATOM   2210 N  N   . TYR B 1 90  ? 39.982 22.426 44.466  1.00 31.22 ? 90  TYR B N   1 
ATOM   2211 C  CA  . TYR B 1 90  ? 40.801 23.182 43.530  1.00 32.39 ? 90  TYR B CA  1 
ATOM   2212 C  C   . TYR B 1 90  ? 41.706 22.102 42.947  1.00 33.41 ? 90  TYR B C   1 
ATOM   2213 O  O   . TYR B 1 90  ? 41.693 20.963 43.417  1.00 32.17 ? 90  TYR B O   1 
ATOM   2214 C  CB  . TYR B 1 90  ? 41.694 24.203 44.243  1.00 32.93 ? 90  TYR B CB  1 
ATOM   2215 C  CG  . TYR B 1 90  ? 41.054 25.529 44.574  1.00 31.91 ? 90  TYR B CG  1 
ATOM   2216 C  CD1 . TYR B 1 90  ? 40.465 25.756 45.821  1.00 32.31 ? 90  TYR B CD1 1 
ATOM   2217 C  CD2 . TYR B 1 90  ? 41.073 26.575 43.653  1.00 31.64 ? 90  TYR B CD2 1 
ATOM   2218 C  CE1 . TYR B 1 90  ? 39.918 26.998 46.143  1.00 31.67 ? 90  TYR B CE1 1 
ATOM   2219 C  CE2 . TYR B 1 90  ? 40.528 27.816 43.961  1.00 31.55 ? 90  TYR B CE2 1 
ATOM   2220 C  CZ  . TYR B 1 90  ? 39.954 28.022 45.207  1.00 32.17 ? 90  TYR B CZ  1 
ATOM   2221 O  OH  . TYR B 1 90  ? 39.424 29.256 45.510  1.00 32.68 ? 90  TYR B OH  1 
ATOM   2222 N  N   . HIS B 1 91  ? 42.484 22.448 41.928  1.00 34.51 ? 91  HIS B N   1 
ATOM   2223 C  CA  . HIS B 1 91  ? 43.416 21.490 41.343  1.00 35.23 ? 91  HIS B CA  1 
ATOM   2224 C  C   . HIS B 1 91  ? 44.768 21.743 42.006  1.00 35.49 ? 91  HIS B C   1 
ATOM   2225 O  O   . HIS B 1 91  ? 45.105 22.895 42.295  1.00 34.95 ? 91  HIS B O   1 
ATOM   2226 C  CB  . HIS B 1 91  ? 43.559 21.701 39.828  1.00 33.51 ? 91  HIS B CB  1 
ATOM   2227 C  CG  . HIS B 1 91  ? 42.340 21.342 39.038  1.00 34.75 ? 91  HIS B CG  1 
ATOM   2228 N  ND1 . HIS B 1 91  ? 41.663 20.151 39.207  1.00 35.54 ? 91  HIS B ND1 1 
ATOM   2229 C  CD2 . HIS B 1 91  ? 41.702 21.996 38.039  1.00 33.25 ? 91  HIS B CD2 1 
ATOM   2230 C  CE1 . HIS B 1 91  ? 40.665 20.088 38.345  1.00 35.66 ? 91  HIS B CE1 1 
ATOM   2231 N  NE2 . HIS B 1 91  ? 40.667 21.196 37.623  1.00 35.14 ? 91  HIS B NE2 1 
ATOM   2232 N  N   . SER B 1 92  ? 45.531 20.680 42.256  1.00 35.19 ? 92  SER B N   1 
ATOM   2233 C  CA  . SER B 1 92  ? 46.855 20.821 42.860  1.00 35.52 ? 92  SER B CA  1 
ATOM   2234 C  C   . SER B 1 92  ? 47.590 21.829 41.992  1.00 34.18 ? 92  SER B C   1 
ATOM   2235 O  O   . SER B 1 92  ? 48.229 22.753 42.493  1.00 33.03 ? 92  SER B O   1 
ATOM   2236 C  CB  . SER B 1 92  ? 47.585 19.479 42.858  1.00 36.65 ? 92  SER B CB  1 
ATOM   2237 O  OG  . SER B 1 92  ? 46.847 18.524 43.598  1.00 41.09 ? 92  SER B OG  1 
ATOM   2238 N  N   . LYS B 1 93  ? 47.498 21.622 40.681  1.00 34.99 ? 93  LYS B N   1 
ATOM   2239 C  CA  . LYS B 1 93  ? 48.070 22.543 39.712  1.00 35.75 ? 93  LYS B CA  1 
ATOM   2240 C  C   . LYS B 1 93  ? 46.854 23.411 39.399  1.00 35.71 ? 93  LYS B C   1 
ATOM   2241 O  O   . LYS B 1 93  ? 46.226 23.278 38.344  1.00 34.37 ? 93  LYS B O   1 
ATOM   2242 C  CB  . LYS B 1 93  ? 48.544 21.812 38.450  1.00 36.58 ? 93  LYS B CB  1 
ATOM   2243 C  CG  . LYS B 1 93  ? 49.792 20.966 38.644  1.00 38.77 ? 93  LYS B CG  1 
ATOM   2244 C  CD  . LYS B 1 93  ? 50.305 20.442 37.309  1.00 40.45 ? 93  LYS B CD  1 
ATOM   2245 C  CE  . LYS B 1 93  ? 51.568 19.611 37.483  1.00 42.46 ? 93  LYS B CE  1 
ATOM   2246 N  NZ  . LYS B 1 93  ? 51.329 18.418 38.347  1.00 44.57 ? 93  LYS B NZ  1 
ATOM   2247 N  N   . ILE B 1 94  ? 46.518 24.267 40.364  1.00 36.07 ? 94  ILE B N   1 
ATOM   2248 C  CA  . ILE B 1 94  ? 45.375 25.176 40.307  1.00 35.01 ? 94  ILE B CA  1 
ATOM   2249 C  C   . ILE B 1 94  ? 45.160 25.787 38.930  1.00 33.63 ? 94  ILE B C   1 
ATOM   2250 O  O   . ILE B 1 94  ? 44.063 26.225 38.593  1.00 33.91 ? 94  ILE B O   1 
ATOM   2251 C  CB  . ILE B 1 94  ? 45.542 26.302 41.353  1.00 35.06 ? 94  ILE B CB  1 
ATOM   2252 C  CG1 . ILE B 1 94  ? 44.232 27.077 41.503  1.00 37.16 ? 94  ILE B CG1 1 
ATOM   2253 C  CG2 . ILE B 1 94  ? 46.683 27.221 40.947  1.00 34.75 ? 94  ILE B CG2 1 
ATOM   2254 C  CD1 . ILE B 1 94  ? 44.268 28.150 42.574  1.00 37.97 ? 94  ILE B CD1 1 
ATOM   2255 N  N   . ASP B 1 95  ? 46.225 25.794 38.142  1.00 32.53 ? 95  ASP B N   1 
ATOM   2256 C  CA  . ASP B 1 95  ? 46.239 26.327 36.790  1.00 32.03 ? 95  ASP B CA  1 
ATOM   2257 C  C   . ASP B 1 95  ? 45.362 25.539 35.800  1.00 30.55 ? 95  ASP B C   1 
ATOM   2258 O  O   . ASP B 1 95  ? 45.006 26.040 34.728  1.00 31.51 ? 95  ASP B O   1 
ATOM   2259 C  CB  . ASP B 1 95  ? 47.682 26.304 36.294  1.00 36.94 ? 95  ASP B CB  1 
ATOM   2260 C  CG  . ASP B 1 95  ? 47.929 27.281 35.191  1.00 37.65 ? 95  ASP B CG  1 
ATOM   2261 O  OD1 . ASP B 1 95  ? 49.066 27.300 34.677  1.00 40.25 ? 95  ASP B OD1 1 
ATOM   2262 O  OD2 . ASP B 1 95  ? 46.991 28.032 34.849  1.00 40.41 ? 95  ASP B OD2 1 
ATOM   2263 N  N   . ARG B 1 96  ? 45.031 24.306 36.158  1.00 24.95 ? 96  ARG B N   1 
ATOM   2264 C  CA  . ARG B 1 96  ? 44.239 23.428 35.301  1.00 23.68 ? 96  ARG B CA  1 
ATOM   2265 C  C   . ARG B 1 96  ? 42.739 23.703 35.223  1.00 22.29 ? 96  ARG B C   1 
ATOM   2266 O  O   . ARG B 1 96  ? 42.091 23.971 36.232  1.00 22.68 ? 96  ARG B O   1 
ATOM   2267 C  CB  . ARG B 1 96  ? 44.467 21.974 35.720  1.00 20.47 ? 96  ARG B CB  1 
ATOM   2268 C  CG  . ARG B 1 96  ? 45.656 21.297 35.033  1.00 21.66 ? 96  ARG B CG  1 
ATOM   2269 C  CD  . ARG B 1 96  ? 46.940 22.108 35.122  1.00 21.77 ? 96  ARG B CD  1 
ATOM   2270 N  NE  . ARG B 1 96  ? 48.033 21.453 34.401  1.00 20.56 ? 96  ARG B NE  1 
ATOM   2271 C  CZ  . ARG B 1 96  ? 49.136 22.070 33.993  1.00 21.05 ? 96  ARG B CZ  1 
ATOM   2272 N  NH1 . ARG B 1 96  ? 49.304 23.364 34.236  1.00 21.08 ? 96  ARG B NH1 1 
ATOM   2273 N  NH2 . ARG B 1 96  ? 50.065 21.398 33.324  1.00 20.87 ? 96  ARG B NH2 1 
ATOM   2274 N  N   . ALA B 1 97  ? 42.199 23.624 34.009  1.00 21.52 ? 97  ALA B N   1 
ATOM   2275 C  CA  . ALA B 1 97  ? 40.772 23.843 33.774  1.00 19.86 ? 97  ALA B CA  1 
ATOM   2276 C  C   . ALA B 1 97  ? 40.049 22.496 33.776  1.00 20.26 ? 97  ALA B C   1 
ATOM   2277 O  O   . ALA B 1 97  ? 40.679 21.444 33.914  1.00 17.61 ? 97  ALA B O   1 
ATOM   2278 C  CB  . ALA B 1 97  ? 40.568 24.540 32.435  1.00 19.46 ? 97  ALA B CB  1 
ATOM   2279 N  N   . GLU B 1 98  ? 38.729 22.531 33.623  1.00 19.39 ? 98  GLU B N   1 
ATOM   2280 C  CA  . GLU B 1 98  ? 37.937 21.307 33.594  1.00 18.61 ? 98  GLU B CA  1 
ATOM   2281 C  C   . GLU B 1 98  ? 36.624 21.527 32.835  1.00 19.05 ? 98  GLU B C   1 
ATOM   2282 O  O   . GLU B 1 98  ? 36.120 22.647 32.755  1.00 17.97 ? 98  GLU B O   1 
ATOM   2283 C  CB  . GLU B 1 98  ? 37.656 20.829 35.028  1.00 20.28 ? 98  GLU B CB  1 
ATOM   2284 C  CG  . GLU B 1 98  ? 36.938 19.485 35.106  1.00 25.82 ? 98  GLU B CG  1 
ATOM   2285 C  CD  . GLU B 1 98  ? 37.013 18.846 36.484  1.00 28.22 ? 98  GLU B CD  1 
ATOM   2286 O  OE1 . GLU B 1 98  ? 36.394 17.780 36.681  1.00 31.63 ? 98  GLU B OE1 1 
ATOM   2287 O  OE2 . GLU B 1 98  ? 37.692 19.400 37.369  1.00 27.90 ? 98  GLU B OE2 1 
ATOM   2288 N  N   . VAL B 1 99  ? 36.079 20.461 32.262  1.00 17.29 ? 99  VAL B N   1 
ATOM   2289 C  CA  . VAL B 1 99  ? 34.829 20.573 31.533  1.00 18.20 ? 99  VAL B CA  1 
ATOM   2290 C  C   . VAL B 1 99  ? 33.845 19.511 31.998  1.00 19.08 ? 99  VAL B C   1 
ATOM   2291 O  O   . VAL B 1 99  ? 34.197 18.330 32.128  1.00 20.02 ? 99  VAL B O   1 
ATOM   2292 C  CB  . VAL B 1 99  ? 35.063 20.449 30.010  1.00 19.61 ? 99  VAL B CB  1 
ATOM   2293 C  CG1 . VAL B 1 99  ? 33.732 20.499 29.260  1.00 16.49 ? 99  VAL B CG1 1 
ATOM   2294 C  CG2 . VAL B 1 99  ? 35.973 21.571 29.541  1.00 18.67 ? 99  VAL B CG2 1 
ATOM   2295 N  N   . TYR B 1 100 ? 32.616 19.947 32.273  1.00 19.73 ? 100 TYR B N   1 
ATOM   2296 C  CA  . TYR B 1 100 ? 31.546 19.060 32.729  1.00 19.13 ? 100 TYR B CA  1 
ATOM   2297 C  C   . TYR B 1 100 ? 30.441 19.023 31.686  1.00 19.15 ? 100 TYR B C   1 
ATOM   2298 O  O   . TYR B 1 100 ? 30.174 20.017 31.015  1.00 19.11 ? 100 TYR B O   1 
ATOM   2299 C  CB  . TYR B 1 100 ? 30.940 19.551 34.050  1.00 21.95 ? 100 TYR B CB  1 
ATOM   2300 C  CG  . TYR B 1 100 ? 31.745 19.244 35.288  1.00 22.53 ? 100 TYR B CG  1 
ATOM   2301 C  CD1 . TYR B 1 100 ? 31.156 18.597 36.374  1.00 24.81 ? 100 TYR B CD1 1 
ATOM   2302 C  CD2 . TYR B 1 100 ? 33.079 19.629 35.397  1.00 23.64 ? 100 TYR B CD2 1 
ATOM   2303 C  CE1 . TYR B 1 100 ? 31.875 18.343 37.542  1.00 23.95 ? 100 TYR B CE1 1 
ATOM   2304 C  CE2 . TYR B 1 100 ? 33.810 19.378 36.560  1.00 24.67 ? 100 TYR B CE2 1 
ATOM   2305 C  CZ  . TYR B 1 100 ? 33.198 18.733 37.628  1.00 25.66 ? 100 TYR B CZ  1 
ATOM   2306 O  OH  . TYR B 1 100 ? 33.907 18.473 38.783  1.00 27.66 ? 100 TYR B OH  1 
ATOM   2307 N  N   . PHE B 1 101 ? 29.793 17.872 31.566  1.00 18.82 ? 101 PHE B N   1 
ATOM   2308 C  CA  . PHE B 1 101 ? 28.715 17.693 30.606  1.00 18.48 ? 101 PHE B CA  1 
ATOM   2309 C  C   . PHE B 1 101 ? 27.581 16.979 31.343  1.00 16.80 ? 101 PHE B C   1 
ATOM   2310 O  O   . PHE B 1 101 ? 27.687 15.798 31.674  1.00 16.05 ? 101 PHE B O   1 
ATOM   2311 C  CB  . PHE B 1 101 ? 29.226 16.870 29.411  1.00 15.86 ? 101 PHE B CB  1 
ATOM   2312 C  CG  . PHE B 1 101 ? 28.227 16.715 28.294  1.00 20.42 ? 101 PHE B CG  1 
ATOM   2313 C  CD1 . PHE B 1 101 ? 27.327 17.734 27.990  1.00 19.91 ? 101 PHE B CD1 1 
ATOM   2314 C  CD2 . PHE B 1 101 ? 28.209 15.556 27.520  1.00 22.09 ? 101 PHE B CD2 1 
ATOM   2315 C  CE1 . PHE B 1 101 ? 26.425 17.598 26.937  1.00 20.92 ? 101 PHE B CE1 1 
ATOM   2316 C  CE2 . PHE B 1 101 ? 27.310 15.411 26.465  1.00 21.71 ? 101 PHE B CE2 1 
ATOM   2317 C  CZ  . PHE B 1 101 ? 26.418 16.436 26.172  1.00 20.59 ? 101 PHE B CZ  1 
ATOM   2318 N  N   . ALA B 1 102 ? 26.517 17.725 31.628  1.00 17.84 ? 102 ALA B N   1 
ATOM   2319 C  CA  . ALA B 1 102 ? 25.362 17.194 32.342  1.00 17.80 ? 102 ALA B CA  1 
ATOM   2320 C  C   . ALA B 1 102 ? 24.649 16.179 31.469  1.00 18.16 ? 102 ALA B C   1 
ATOM   2321 O  O   . ALA B 1 102 ? 24.371 16.448 30.302  1.00 18.92 ? 102 ALA B O   1 
ATOM   2322 C  CB  . ALA B 1 102 ? 24.416 18.326 32.714  1.00 17.62 ? 102 ALA B CB  1 
ATOM   2323 N  N   . LEU B 1 103 ? 24.341 15.021 32.046  1.00 18.52 ? 103 LEU B N   1 
ATOM   2324 C  CA  . LEU B 1 103 ? 23.683 13.945 31.314  1.00 19.22 ? 103 LEU B CA  1 
ATOM   2325 C  C   . LEU B 1 103 ? 22.266 13.604 31.766  1.00 19.68 ? 103 LEU B C   1 
ATOM   2326 O  O   . LEU B 1 103 ? 21.421 13.248 30.947  1.00 18.83 ? 103 LEU B O   1 
ATOM   2327 C  CB  . LEU B 1 103 ? 24.543 12.682 31.376  1.00 18.88 ? 103 LEU B CB  1 
ATOM   2328 C  CG  . LEU B 1 103 ? 25.925 12.855 30.740  1.00 20.83 ? 103 LEU B CG  1 
ATOM   2329 C  CD1 . LEU B 1 103 ? 26.700 11.555 30.841  1.00 18.74 ? 103 LEU B CD1 1 
ATOM   2330 C  CD2 . LEU B 1 103 ? 25.761 13.275 29.280  1.00 18.74 ? 103 LEU B CD2 1 
ATOM   2331 N  N   . LYS B 1 104 ? 21.997 13.712 33.061  1.00 21.10 ? 104 LYS B N   1 
ATOM   2332 C  CA  . LYS B 1 104 ? 20.670 13.377 33.554  1.00 21.63 ? 104 LYS B CA  1 
ATOM   2333 C  C   . LYS B 1 104 ? 20.338 14.151 34.825  1.00 22.55 ? 104 LYS B C   1 
ATOM   2334 O  O   . LYS B 1 104 ? 21.234 14.522 35.588  1.00 21.31 ? 104 LYS B O   1 
ATOM   2335 C  CB  . LYS B 1 104 ? 20.598 11.867 33.813  1.00 22.01 ? 104 LYS B CB  1 
ATOM   2336 C  CG  . LYS B 1 104 ? 19.198 11.295 33.800  1.00 22.92 ? 104 LYS B CG  1 
ATOM   2337 C  CD  . LYS B 1 104 ? 19.210 9.810  34.138  1.00 22.34 ? 104 LYS B CD  1 
ATOM   2338 C  CE  . LYS B 1 104 ? 17.824 9.199  34.006  1.00 26.50 ? 104 LYS B CE  1 
ATOM   2339 N  NZ  . LYS B 1 104 ? 17.807 7.738  34.356  1.00 29.55 ? 104 LYS B NZ  1 
ATOM   2340 N  N   . GLY B 1 105 ? 19.048 14.396 35.043  1.00 23.18 ? 105 GLY B N   1 
ATOM   2341 C  CA  . GLY B 1 105 ? 18.620 15.126 36.226  1.00 24.83 ? 105 GLY B CA  1 
ATOM   2342 C  C   . GLY B 1 105 ? 18.918 16.611 36.148  1.00 26.57 ? 105 GLY B C   1 
ATOM   2343 O  O   . GLY B 1 105 ? 19.153 17.153 35.064  1.00 26.06 ? 105 GLY B O   1 
ATOM   2344 N  N   . LYS B 1 106 ? 18.921 17.280 37.297  1.00 26.78 ? 106 LYS B N   1 
ATOM   2345 C  CA  . LYS B 1 106 ? 19.188 18.711 37.318  1.00 26.94 ? 106 LYS B CA  1 
ATOM   2346 C  C   . LYS B 1 106 ? 19.912 19.191 38.570  1.00 25.77 ? 106 LYS B C   1 
ATOM   2347 O  O   . LYS B 1 106 ? 19.686 18.703 39.678  1.00 21.84 ? 106 LYS B O   1 
ATOM   2348 C  CB  . LYS B 1 106 ? 17.881 19.492 37.151  1.00 29.66 ? 106 LYS B CB  1 
ATOM   2349 C  CG  . LYS B 1 106 ? 16.890 19.303 38.276  1.00 34.23 ? 106 LYS B CG  1 
ATOM   2350 C  CD  . LYS B 1 106 ? 15.586 20.049 37.990  1.00 40.28 ? 106 LYS B CD  1 
ATOM   2351 C  CE  . LYS B 1 106 ? 15.795 21.559 37.916  1.00 41.16 ? 106 LYS B CE  1 
ATOM   2352 N  NZ  . LYS B 1 106 ? 16.270 22.111 39.219  1.00 44.11 ? 106 LYS B NZ  1 
ATOM   2353 N  N   . GLY B 1 107 ? 20.787 20.167 38.374  1.00 25.17 ? 107 GLY B N   1 
ATOM   2354 C  CA  . GLY B 1 107 ? 21.537 20.711 39.480  1.00 25.42 ? 107 GLY B CA  1 
ATOM   2355 C  C   . GLY B 1 107 ? 22.248 21.971 39.052  1.00 26.19 ? 107 GLY B C   1 
ATOM   2356 O  O   . GLY B 1 107 ? 21.752 22.736 38.220  1.00 26.69 ? 107 GLY B O   1 
ATOM   2357 N  N   . GLY B 1 108 ? 23.424 22.187 39.618  1.00 23.61 ? 108 GLY B N   1 
ATOM   2358 C  CA  . GLY B 1 108 ? 24.184 23.367 39.272  1.00 22.63 ? 108 GLY B CA  1 
ATOM   2359 C  C   . GLY B 1 108 ? 25.573 23.237 39.834  1.00 21.66 ? 108 GLY B C   1 
ATOM   2360 O  O   . GLY B 1 108 ? 25.827 22.376 40.674  1.00 23.17 ? 108 GLY B O   1 
ATOM   2361 N  N   . MET B 1 109 ? 26.486 24.062 39.349  1.00 21.31 ? 109 MET B N   1 
ATOM   2362 C  CA  . MET B 1 109 ? 27.843 24.027 39.845  1.00 19.13 ? 109 MET B CA  1 
ATOM   2363 C  C   . MET B 1 109 ? 28.156 25.352 40.495  1.00 20.07 ? 109 MET B C   1 
ATOM   2364 O  O   . MET B 1 109 ? 27.813 26.406 39.961  1.00 18.26 ? 109 MET B O   1 
ATOM   2365 C  CB  . MET B 1 109 ? 28.840 23.783 38.714  1.00 21.24 ? 109 MET B CB  1 
ATOM   2366 C  CG  . MET B 1 109 ? 30.276 23.700 39.215  1.00 21.32 ? 109 MET B CG  1 
ATOM   2367 S  SD  . MET B 1 109 ? 31.457 23.427 37.900  1.00 26.23 ? 109 MET B SD  1 
ATOM   2368 C  CE  . MET B 1 109 ? 30.891 21.830 37.283  1.00 19.36 ? 109 MET B CE  1 
ATOM   2369 N  N   . LEU B 1 110 ? 28.793 25.287 41.661  1.00 20.80 ? 110 LEU B N   1 
ATOM   2370 C  CA  . LEU B 1 110 ? 29.193 26.472 42.394  1.00 21.15 ? 110 LEU B CA  1 
ATOM   2371 C  C   . LEU B 1 110 ? 30.704 26.593 42.219  1.00 22.97 ? 110 LEU B C   1 
ATOM   2372 O  O   . LEU B 1 110 ? 31.441 25.657 42.532  1.00 21.97 ? 110 LEU B O   1 
ATOM   2373 C  CB  . LEU B 1 110 ? 28.857 26.315 43.880  1.00 22.36 ? 110 LEU B CB  1 
ATOM   2374 C  CG  . LEU B 1 110 ? 29.294 27.477 44.771  1.00 22.75 ? 110 LEU B CG  1 
ATOM   2375 C  CD1 . LEU B 1 110 ? 28.475 28.706 44.406  1.00 21.37 ? 110 LEU B CD1 1 
ATOM   2376 C  CD2 . LEU B 1 110 ? 29.109 27.117 46.252  1.00 21.16 ? 110 LEU B CD2 1 
ATOM   2377 N  N   . LEU B 1 111 ? 31.163 27.731 41.708  1.00 23.16 ? 111 LEU B N   1 
ATOM   2378 C  CA  . LEU B 1 111 ? 32.592 27.940 41.501  1.00 23.91 ? 111 LEU B CA  1 
ATOM   2379 C  C   . LEU B 1 111 ? 33.087 29.129 42.307  1.00 26.21 ? 111 LEU B C   1 
ATOM   2380 O  O   . LEU B 1 111 ? 32.330 30.064 42.588  1.00 27.61 ? 111 LEU B O   1 
ATOM   2381 C  CB  . LEU B 1 111 ? 32.896 28.164 40.019  1.00 20.70 ? 111 LEU B CB  1 
ATOM   2382 C  CG  . LEU B 1 111 ? 32.373 27.102 39.052  1.00 20.44 ? 111 LEU B CG  1 
ATOM   2383 C  CD1 . LEU B 1 111 ? 31.023 27.543 38.502  1.00 15.02 ? 111 LEU B CD1 1 
ATOM   2384 C  CD2 . LEU B 1 111 ? 33.367 26.906 37.915  1.00 20.58 ? 111 LEU B CD2 1 
ATOM   2385 N  N   . GLN B 1 112 ? 34.366 29.094 42.666  1.00 27.07 ? 112 GLN B N   1 
ATOM   2386 C  CA  . GLN B 1 112 ? 34.962 30.159 43.457  1.00 26.68 ? 112 GLN B CA  1 
ATOM   2387 C  C   . GLN B 1 112 ? 36.442 30.333 43.137  1.00 26.29 ? 112 GLN B C   1 
ATOM   2388 O  O   . GLN B 1 112 ? 37.143 29.356 42.884  1.00 26.13 ? 112 GLN B O   1 
ATOM   2389 C  CB  . GLN B 1 112 ? 34.790 29.839 44.938  1.00 27.16 ? 112 GLN B CB  1 
ATOM   2390 C  CG  . GLN B 1 112 ? 35.119 30.990 45.863  1.00 30.98 ? 112 GLN B CG  1 
ATOM   2391 C  CD  . GLN B 1 112 ? 34.856 30.647 47.309  1.00 32.14 ? 112 GLN B CD  1 
ATOM   2392 O  OE1 . GLN B 1 112 ? 33.787 30.141 47.651  1.00 31.40 ? 112 GLN B OE1 1 
ATOM   2393 N  NE2 . GLN B 1 112 ? 35.828 30.926 48.173  1.00 32.57 ? 112 GLN B NE2 1 
ATOM   2394 N  N   . THR B 1 113 ? 36.910 31.578 43.136  1.00 26.18 ? 113 THR B N   1 
ATOM   2395 C  CA  . THR B 1 113 ? 38.316 31.863 42.855  1.00 27.62 ? 113 THR B CA  1 
ATOM   2396 C  C   . THR B 1 113 ? 39.049 32.121 44.163  1.00 26.35 ? 113 THR B C   1 
ATOM   2397 O  O   . THR B 1 113 ? 38.427 32.242 45.215  1.00 25.98 ? 113 THR B O   1 
ATOM   2398 C  CB  . THR B 1 113 ? 38.503 33.138 41.999  1.00 28.61 ? 113 THR B CB  1 
ATOM   2399 O  OG1 . THR B 1 113 ? 38.110 34.286 42.764  1.00 32.09 ? 113 THR B OG1 1 
ATOM   2400 C  CG2 . THR B 1 113 ? 37.686 33.068 40.743  1.00 29.81 ? 113 THR B CG2 1 
ATOM   2401 N  N   . PRO B 1 114 ? 40.388 32.200 44.110  1.00 26.14 ? 114 PRO B N   1 
ATOM   2402 C  CA  . PRO B 1 114 ? 41.181 32.457 45.314  1.00 28.13 ? 114 PRO B CA  1 
ATOM   2403 C  C   . PRO B 1 114 ? 40.969 33.908 45.748  1.00 29.15 ? 114 PRO B C   1 
ATOM   2404 O  O   . PRO B 1 114 ? 41.147 34.254 46.915  1.00 29.74 ? 114 PRO B O   1 
ATOM   2405 C  CB  . PRO B 1 114 ? 42.614 32.196 44.847  1.00 27.16 ? 114 PRO B CB  1 
ATOM   2406 C  CG  . PRO B 1 114 ? 42.438 31.172 43.766  1.00 26.05 ? 114 PRO B CG  1 
ATOM   2407 C  CD  . PRO B 1 114 ? 41.254 31.739 43.012  1.00 26.72 ? 114 PRO B CD  1 
ATOM   2408 N  N   . GLU B 1 115 ? 40.579 34.745 44.787  1.00 31.03 ? 115 GLU B N   1 
ATOM   2409 C  CA  . GLU B 1 115 ? 40.318 36.161 45.030  1.00 31.55 ? 115 GLU B CA  1 
ATOM   2410 C  C   . GLU B 1 115 ? 39.067 36.247 45.917  1.00 31.60 ? 115 GLU B C   1 
ATOM   2411 O  O   . GLU B 1 115 ? 38.964 37.124 46.775  1.00 31.23 ? 115 GLU B O   1 
ATOM   2412 C  CB  . GLU B 1 115 ? 40.097 36.880 43.681  1.00 33.94 ? 115 GLU B CB  1 
ATOM   2413 C  CG  . GLU B 1 115 ? 40.470 38.375 43.631  1.00 32.46 ? 115 GLU B CG  1 
ATOM   2414 C  CD  . GLU B 1 115 ? 40.721 38.897 42.195  1.00 37.34 ? 115 GLU B CD  1 
ATOM   2415 O  OE1 . GLU B 1 115 ? 39.770 38.908 41.362  1.00 30.79 ? 115 GLU B OE1 1 
ATOM   2416 O  OE2 . GLU B 1 115 ? 41.884 39.298 41.903  1.00 33.92 ? 115 GLU B OE2 1 
ATOM   2417 N  N   . GLY B 1 116 ? 38.133 35.316 45.716  1.00 31.00 ? 116 GLY B N   1 
ATOM   2418 C  CA  . GLY B 1 116 ? 36.906 35.298 46.501  1.00 29.42 ? 116 GLY B CA  1 
ATOM   2419 C  C   . GLY B 1 116 ? 35.616 35.325 45.685  1.00 28.76 ? 116 GLY B C   1 
ATOM   2420 O  O   . GLY B 1 116 ? 34.520 35.198 46.236  1.00 28.68 ? 116 GLY B O   1 
ATOM   2421 N  N   . GLU B 1 117 ? 35.742 35.485 44.370  1.00 28.19 ? 117 GLU B N   1 
ATOM   2422 C  CA  . GLU B 1 117 ? 34.582 35.534 43.478  1.00 26.61 ? 117 GLU B CA  1 
ATOM   2423 C  C   . GLU B 1 117 ? 33.817 34.206 43.499  1.00 26.15 ? 117 GLU B C   1 
ATOM   2424 O  O   . GLU B 1 117 ? 34.417 33.131 43.525  1.00 24.41 ? 117 GLU B O   1 
ATOM   2425 C  CB  . GLU B 1 117 ? 35.039 35.853 42.047  1.00 26.78 ? 117 GLU B CB  1 
ATOM   2426 C  CG  . GLU B 1 117 ? 33.902 36.166 41.083  1.00 27.75 ? 117 GLU B CG  1 
ATOM   2427 C  CD  . GLU B 1 117 ? 34.381 36.448 39.669  1.00 28.82 ? 117 GLU B CD  1 
ATOM   2428 O  OE1 . GLU B 1 117 ? 35.594 36.686 39.469  1.00 31.79 ? 117 GLU B OE1 1 
ATOM   2429 O  OE2 . GLU B 1 117 ? 33.540 36.438 38.750  1.00 29.89 ? 117 GLU B OE2 1 
ATOM   2430 N  N   . ALA B 1 118 ? 32.490 34.287 43.497  1.00 26.10 ? 118 ALA B N   1 
ATOM   2431 C  CA  . ALA B 1 118 ? 31.650 33.096 43.515  1.00 26.61 ? 118 ALA B CA  1 
ATOM   2432 C  C   . ALA B 1 118 ? 30.614 33.139 42.391  1.00 27.01 ? 118 ALA B C   1 
ATOM   2433 O  O   . ALA B 1 118 ? 29.969 34.163 42.166  1.00 27.53 ? 118 ALA B O   1 
ATOM   2434 C  CB  . ALA B 1 118 ? 30.957 32.968 44.863  1.00 25.27 ? 118 ALA B CB  1 
ATOM   2435 N  N   . ARG B 1 119 ? 30.460 32.016 41.698  1.00 27.25 ? 119 ARG B N   1 
ATOM   2436 C  CA  . ARG B 1 119 ? 29.521 31.902 40.583  1.00 27.07 ? 119 ARG B CA  1 
ATOM   2437 C  C   . ARG B 1 119 ? 28.730 30.599 40.675  1.00 27.03 ? 119 ARG B C   1 
ATOM   2438 O  O   . ARG B 1 119 ? 29.266 29.570 41.092  1.00 27.04 ? 119 ARG B O   1 
ATOM   2439 C  CB  . ARG B 1 119 ? 30.278 31.912 39.248  1.00 27.53 ? 119 ARG B CB  1 
ATOM   2440 C  CG  . ARG B 1 119 ? 30.976 33.216 38.883  1.00 28.06 ? 119 ARG B CG  1 
ATOM   2441 C  CD  . ARG B 1 119 ? 29.976 34.312 38.559  1.00 31.34 ? 119 ARG B CD  1 
ATOM   2442 N  NE  . ARG B 1 119 ? 28.939 33.845 37.635  1.00 37.94 ? 119 ARG B NE  1 
ATOM   2443 C  CZ  . ARG B 1 119 ? 29.137 33.527 36.355  1.00 40.29 ? 119 ARG B CZ  1 
ATOM   2444 N  NH1 . ARG B 1 119 ? 30.344 33.622 35.807  1.00 40.56 ? 119 ARG B NH1 1 
ATOM   2445 N  NH2 . ARG B 1 119 ? 28.121 33.102 35.618  1.00 41.13 ? 119 ARG B NH2 1 
ATOM   2446 N  N   . PHE B 1 120 ? 27.455 30.643 40.297  1.00 25.62 ? 120 PHE B N   1 
ATOM   2447 C  CA  . PHE B 1 120 ? 26.624 29.442 40.299  1.00 26.13 ? 120 PHE B CA  1 
ATOM   2448 C  C   . PHE B 1 120 ? 26.031 29.266 38.902  1.00 26.57 ? 120 PHE B C   1 
ATOM   2449 O  O   . PHE B 1 120 ? 25.334 30.145 38.391  1.00 24.98 ? 120 PHE B O   1 
ATOM   2450 C  CB  . PHE B 1 120 ? 25.493 29.536 41.324  1.00 26.33 ? 120 PHE B CB  1 
ATOM   2451 C  CG  . PHE B 1 120 ? 24.636 28.300 41.392  1.00 26.97 ? 120 PHE B CG  1 
ATOM   2452 C  CD1 . PHE B 1 120 ? 25.129 27.123 41.959  1.00 27.72 ? 120 PHE B CD1 1 
ATOM   2453 C  CD2 . PHE B 1 120 ? 23.342 28.305 40.877  1.00 28.65 ? 120 PHE B CD2 1 
ATOM   2454 C  CE1 . PHE B 1 120 ? 24.344 25.971 42.017  1.00 28.26 ? 120 PHE B CE1 1 
ATOM   2455 C  CE2 . PHE B 1 120 ? 22.544 27.153 40.927  1.00 30.55 ? 120 PHE B CE2 1 
ATOM   2456 C  CZ  . PHE B 1 120 ? 23.047 25.985 41.497  1.00 29.23 ? 120 PHE B CZ  1 
ATOM   2457 N  N   . ILE B 1 121 ? 26.318 28.124 38.289  1.00 27.30 ? 121 ILE B N   1 
ATOM   2458 C  CA  . ILE B 1 121 ? 25.837 27.840 36.946  1.00 27.47 ? 121 ILE B CA  1 
ATOM   2459 C  C   . ILE B 1 121 ? 24.865 26.671 36.974  1.00 27.76 ? 121 ILE B C   1 
ATOM   2460 O  O   . ILE B 1 121 ? 25.215 25.578 37.419  1.00 26.56 ? 121 ILE B O   1 
ATOM   2461 C  CB  . ILE B 1 121 ? 27.026 27.524 36.010  1.00 27.76 ? 121 ILE B CB  1 
ATOM   2462 C  CG1 . ILE B 1 121 ? 27.920 28.766 35.898  1.00 26.29 ? 121 ILE B CG1 1 
ATOM   2463 C  CG2 . ILE B 1 121 ? 26.522 27.081 34.636  1.00 26.82 ? 121 ILE B CG2 1 
ATOM   2464 C  CD1 . ILE B 1 121 ? 29.173 28.557 35.078  1.00 26.80 ? 121 ILE B CD1 1 
ATOM   2465 N  N   . GLU B 1 122 ? 23.639 26.913 36.510  1.00 27.02 ? 122 GLU B N   1 
ATOM   2466 C  CA  . GLU B 1 122 ? 22.616 25.872 36.488  1.00 28.06 ? 122 GLU B CA  1 
ATOM   2467 C  C   . GLU B 1 122 ? 22.929 24.848 35.414  1.00 25.73 ? 122 GLU B C   1 
ATOM   2468 O  O   . GLU B 1 122 ? 23.457 25.185 34.353  1.00 24.13 ? 122 GLU B O   1 
ATOM   2469 C  CB  . GLU B 1 122 ? 21.232 26.481 36.247  1.00 31.71 ? 122 GLU B CB  1 
ATOM   2470 C  CG  . GLU B 1 122 ? 20.899 27.618 37.201  1.00 36.22 ? 122 GLU B CG  1 
ATOM   2471 C  CD  . GLU B 1 122 ? 19.417 27.936 37.236  1.00 40.48 ? 122 GLU B CD  1 
ATOM   2472 O  OE1 . GLU B 1 122 ? 18.799 28.021 36.150  1.00 40.37 ? 122 GLU B OE1 1 
ATOM   2473 O  OE2 . GLU B 1 122 ? 18.876 28.107 38.353  1.00 42.04 ? 122 GLU B OE2 1 
ATOM   2474 N  N   . MET B 1 123 ? 22.607 23.592 35.700  1.00 25.10 ? 123 MET B N   1 
ATOM   2475 C  CA  . MET B 1 123 ? 22.881 22.514 34.763  1.00 24.04 ? 123 MET B CA  1 
ATOM   2476 C  C   . MET B 1 123 ? 21.687 21.592 34.566  1.00 24.07 ? 123 MET B C   1 
ATOM   2477 O  O   . MET B 1 123 ? 21.015 21.191 35.522  1.00 22.02 ? 123 MET B O   1 
ATOM   2478 C  CB  . MET B 1 123 ? 24.070 21.674 35.252  1.00 24.00 ? 123 MET B CB  1 
ATOM   2479 C  CG  . MET B 1 123 ? 25.306 22.475 35.645  1.00 26.43 ? 123 MET B CG  1 
ATOM   2480 S  SD  . MET B 1 123 ? 26.677 21.421 36.179  1.00 25.33 ? 123 MET B SD  1 
ATOM   2481 C  CE  . MET B 1 123 ? 26.316 21.196 37.849  1.00 30.52 ? 123 MET B CE  1 
ATOM   2482 N  N   . GLU B 1 124 ? 21.439 21.268 33.306  1.00 23.65 ? 124 GLU B N   1 
ATOM   2483 C  CA  . GLU B 1 124 ? 20.371 20.369 32.919  1.00 23.64 ? 124 GLU B CA  1 
ATOM   2484 C  C   . GLU B 1 124 ? 20.986 19.525 31.816  1.00 20.75 ? 124 GLU B C   1 
ATOM   2485 O  O   . GLU B 1 124 ? 22.028 19.883 31.267  1.00 20.68 ? 124 GLU B O   1 
ATOM   2486 C  CB  . GLU B 1 124 ? 19.172 21.157 32.404  1.00 27.41 ? 124 GLU B CB  1 
ATOM   2487 C  CG  . GLU B 1 124 ? 19.552 22.283 31.482  1.00 34.54 ? 124 GLU B CG  1 
ATOM   2488 C  CD  . GLU B 1 124 ? 18.350 23.016 30.938  1.00 39.72 ? 124 GLU B CD  1 
ATOM   2489 O  OE1 . GLU B 1 124 ? 17.573 22.409 30.165  1.00 43.29 ? 124 GLU B OE1 1 
ATOM   2490 O  OE2 . GLU B 1 124 ? 18.183 24.202 31.284  1.00 41.86 ? 124 GLU B OE2 1 
ATOM   2491 N  N   . PRO B 1 125 ? 20.365 18.387 31.483  1.00 19.96 ? 125 PRO B N   1 
ATOM   2492 C  CA  . PRO B 1 125 ? 20.939 17.552 30.430  1.00 19.36 ? 125 PRO B CA  1 
ATOM   2493 C  C   . PRO B 1 125 ? 21.275 18.368 29.185  1.00 19.57 ? 125 PRO B C   1 
ATOM   2494 O  O   . PRO B 1 125 ? 20.462 19.164 28.713  1.00 16.35 ? 125 PRO B O   1 
ATOM   2495 C  CB  . PRO B 1 125 ? 19.846 16.513 30.193  1.00 20.13 ? 125 PRO B CB  1 
ATOM   2496 C  CG  . PRO B 1 125 ? 19.246 16.362 31.578  1.00 16.68 ? 125 PRO B CG  1 
ATOM   2497 C  CD  . PRO B 1 125 ? 19.121 17.796 32.009  1.00 17.47 ? 125 PRO B CD  1 
ATOM   2498 N  N   . GLY B 1 126 ? 22.485 18.173 28.670  1.00 18.15 ? 126 GLY B N   1 
ATOM   2499 C  CA  . GLY B 1 126 ? 22.914 18.903 27.493  1.00 19.05 ? 126 GLY B CA  1 
ATOM   2500 C  C   . GLY B 1 126 ? 23.803 20.079 27.849  1.00 20.69 ? 126 GLY B C   1 
ATOM   2501 O  O   . GLY B 1 126 ? 24.535 20.591 26.999  1.00 19.72 ? 126 GLY B O   1 
ATOM   2502 N  N   . THR B 1 127 ? 23.748 20.504 29.110  1.00 19.56 ? 127 THR B N   1 
ATOM   2503 C  CA  . THR B 1 127 ? 24.557 21.626 29.574  1.00 21.29 ? 127 THR B CA  1 
ATOM   2504 C  C   . THR B 1 127 ? 26.043 21.293 29.698  1.00 20.04 ? 127 THR B C   1 
ATOM   2505 O  O   . THR B 1 127 ? 26.416 20.330 30.370  1.00 20.60 ? 127 THR B O   1 
ATOM   2506 C  CB  . THR B 1 127 ? 24.080 22.135 30.955  1.00 22.58 ? 127 THR B CB  1 
ATOM   2507 O  OG1 . THR B 1 127 ? 22.726 22.585 30.856  1.00 24.54 ? 127 THR B OG1 1 
ATOM   2508 C  CG2 . THR B 1 127 ? 24.959 23.296 31.432  1.00 22.02 ? 127 THR B CG2 1 
ATOM   2509 N  N   . ILE B 1 128 ? 26.880 22.091 29.039  1.00 18.94 ? 128 ILE B N   1 
ATOM   2510 C  CA  . ILE B 1 128 ? 28.328 21.926 29.105  1.00 16.86 ? 128 ILE B CA  1 
ATOM   2511 C  C   . ILE B 1 128 ? 28.842 23.086 29.953  1.00 18.24 ? 128 ILE B C   1 
ATOM   2512 O  O   . ILE B 1 128 ? 28.573 24.252 29.644  1.00 16.68 ? 128 ILE B O   1 
ATOM   2513 C  CB  . ILE B 1 128 ? 28.996 22.015 27.707  1.00 18.20 ? 128 ILE B CB  1 
ATOM   2514 C  CG1 . ILE B 1 128 ? 28.613 20.803 26.853  1.00 17.90 ? 128 ILE B CG1 1 
ATOM   2515 C  CG2 . ILE B 1 128 ? 30.518 22.088 27.856  1.00 17.40 ? 128 ILE B CG2 1 
ATOM   2516 C  CD1 . ILE B 1 128 ? 29.254 20.814 25.467  1.00 21.79 ? 128 ILE B CD1 1 
ATOM   2517 N  N   . VAL B 1 129 ? 29.558 22.772 31.030  1.00 17.28 ? 129 VAL B N   1 
ATOM   2518 C  CA  . VAL B 1 129 ? 30.096 23.813 31.899  1.00 17.72 ? 129 VAL B CA  1 
ATOM   2519 C  C   . VAL B 1 129 ? 31.607 23.896 31.786  1.00 17.64 ? 129 VAL B C   1 
ATOM   2520 O  O   . VAL B 1 129 ? 32.317 22.896 31.954  1.00 16.20 ? 129 VAL B O   1 
ATOM   2521 C  CB  . VAL B 1 129 ? 29.758 23.577 33.383  1.00 17.02 ? 129 VAL B CB  1 
ATOM   2522 C  CG1 . VAL B 1 129 ? 30.408 24.674 34.241  1.00 18.90 ? 129 VAL B CG1 1 
ATOM   2523 C  CG2 . VAL B 1 129 ? 28.252 23.570 33.588  1.00 18.94 ? 129 VAL B CG2 1 
ATOM   2524 N  N   . TYR B 1 130 ? 32.095 25.094 31.492  1.00 17.83 ? 130 TYR B N   1 
ATOM   2525 C  CA  . TYR B 1 130 ? 33.525 25.316 31.372  1.00 19.15 ? 130 TYR B CA  1 
ATOM   2526 C  C   . TYR B 1 130 ? 34.056 25.854 32.694  1.00 18.98 ? 130 TYR B C   1 
ATOM   2527 O  O   . TYR B 1 130 ? 33.694 26.953 33.107  1.00 18.96 ? 130 TYR B O   1 
ATOM   2528 C  CB  . TYR B 1 130 ? 33.826 26.316 30.252  1.00 17.76 ? 130 TYR B CB  1 
ATOM   2529 C  CG  . TYR B 1 130 ? 35.271 26.770 30.234  1.00 20.65 ? 130 TYR B CG  1 
ATOM   2530 C  CD1 . TYR B 1 130 ? 36.297 25.901 29.853  1.00 20.87 ? 130 TYR B CD1 1 
ATOM   2531 C  CD2 . TYR B 1 130 ? 35.617 28.054 30.650  1.00 20.22 ? 130 TYR B CD2 1 
ATOM   2532 C  CE1 . TYR B 1 130 ? 37.634 26.306 29.892  1.00 20.91 ? 130 TYR B CE1 1 
ATOM   2533 C  CE2 . TYR B 1 130 ? 36.935 28.469 30.697  1.00 21.02 ? 130 TYR B CE2 1 
ATOM   2534 C  CZ  . TYR B 1 130 ? 37.944 27.597 30.319  1.00 23.00 ? 130 TYR B CZ  1 
ATOM   2535 O  OH  . TYR B 1 130 ? 39.253 28.026 30.378  1.00 18.10 ? 130 TYR B OH  1 
ATOM   2536 N  N   . VAL B 1 131 ? 34.901 25.066 33.357  1.00 19.21 ? 131 VAL B N   1 
ATOM   2537 C  CA  . VAL B 1 131 ? 35.507 25.464 34.629  1.00 19.57 ? 131 VAL B CA  1 
ATOM   2538 C  C   . VAL B 1 131 ? 36.896 26.000 34.301  1.00 19.53 ? 131 VAL B C   1 
ATOM   2539 O  O   . VAL B 1 131 ? 37.810 25.232 33.999  1.00 20.13 ? 131 VAL B O   1 
ATOM   2540 C  CB  . VAL B 1 131 ? 35.638 24.264 35.596  1.00 19.59 ? 131 VAL B CB  1 
ATOM   2541 C  CG1 . VAL B 1 131 ? 36.429 24.674 36.835  1.00 19.79 ? 131 VAL B CG1 1 
ATOM   2542 C  CG2 . VAL B 1 131 ? 34.258 23.765 35.996  1.00 19.98 ? 131 VAL B CG2 1 
ATOM   2543 N  N   . PRO B 1 132 ? 37.075 27.329 34.358  1.00 18.82 ? 132 PRO B N   1 
ATOM   2544 C  CA  . PRO B 1 132 ? 38.371 27.945 34.050  1.00 18.84 ? 132 PRO B CA  1 
ATOM   2545 C  C   . PRO B 1 132 ? 39.490 27.659 35.051  1.00 18.30 ? 132 PRO B C   1 
ATOM   2546 O  O   . PRO B 1 132 ? 39.253 27.184 36.164  1.00 16.21 ? 132 PRO B O   1 
ATOM   2547 C  CB  . PRO B 1 132 ? 38.054 29.446 33.999  1.00 20.03 ? 132 PRO B CB  1 
ATOM   2548 C  CG  . PRO B 1 132 ? 36.523 29.538 34.060  1.00 20.95 ? 132 PRO B CG  1 
ATOM   2549 C  CD  . PRO B 1 132 ? 36.126 28.336 34.851  1.00 19.60 ? 132 PRO B CD  1 
ATOM   2550 N  N   . PRO B 1 133 ? 40.735 27.950 34.654  1.00 19.95 ? 133 PRO B N   1 
ATOM   2551 C  CA  . PRO B 1 133 ? 41.907 27.745 35.510  1.00 22.11 ? 133 PRO B CA  1 
ATOM   2552 C  C   . PRO B 1 133 ? 41.739 28.565 36.791  1.00 22.88 ? 133 PRO B C   1 
ATOM   2553 O  O   . PRO B 1 133 ? 41.211 29.680 36.744  1.00 24.27 ? 133 PRO B O   1 
ATOM   2554 C  CB  . PRO B 1 133 ? 43.054 28.289 34.661  1.00 19.84 ? 133 PRO B CB  1 
ATOM   2555 C  CG  . PRO B 1 133 ? 42.593 28.028 33.257  1.00 21.92 ? 133 PRO B CG  1 
ATOM   2556 C  CD  . PRO B 1 133 ? 41.133 28.403 33.309  1.00 19.83 ? 133 PRO B CD  1 
ATOM   2557 N  N   . TYR B 1 134 ? 42.182 28.009 37.918  1.00 24.56 ? 134 TYR B N   1 
ATOM   2558 C  CA  . TYR B 1 134 ? 42.137 28.683 39.223  1.00 25.18 ? 134 TYR B CA  1 
ATOM   2559 C  C   . TYR B 1 134 ? 40.815 28.641 39.968  1.00 25.52 ? 134 TYR B C   1 
ATOM   2560 O  O   . TYR B 1 134 ? 40.755 29.021 41.141  1.00 27.17 ? 134 TYR B O   1 
ATOM   2561 C  CB  . TYR B 1 134 ? 42.559 30.151 39.083  1.00 26.16 ? 134 TYR B CB  1 
ATOM   2562 C  CG  . TYR B 1 134 ? 43.953 30.336 38.549  1.00 28.05 ? 134 TYR B CG  1 
ATOM   2563 C  CD1 . TYR B 1 134 ? 45.066 30.040 39.335  1.00 29.63 ? 134 TYR B CD1 1 
ATOM   2564 C  CD2 . TYR B 1 134 ? 44.164 30.773 37.241  1.00 29.80 ? 134 TYR B CD2 1 
ATOM   2565 C  CE1 . TYR B 1 134 ? 46.353 30.172 38.834  1.00 29.17 ? 134 TYR B CE1 1 
ATOM   2566 C  CE2 . TYR B 1 134 ? 45.451 30.904 36.728  1.00 29.36 ? 134 TYR B CE2 1 
ATOM   2567 C  CZ  . TYR B 1 134 ? 46.538 30.598 37.534  1.00 29.89 ? 134 TYR B CZ  1 
ATOM   2568 O  OH  . TYR B 1 134 ? 47.809 30.694 37.028  1.00 31.60 ? 134 TYR B OH  1 
ATOM   2569 N  N   . TRP B 1 135 ? 39.751 28.198 39.309  1.00 24.00 ? 135 TRP B N   1 
ATOM   2570 C  CA  . TRP B 1 135 ? 38.456 28.155 39.979  1.00 22.14 ? 135 TRP B CA  1 
ATOM   2571 C  C   . TRP B 1 135 ? 38.172 26.844 40.687  1.00 22.84 ? 135 TRP B C   1 
ATOM   2572 O  O   . TRP B 1 135 ? 38.280 25.767 40.098  1.00 21.69 ? 135 TRP B O   1 
ATOM   2573 C  CB  . TRP B 1 135 ? 37.312 28.415 38.992  1.00 21.39 ? 135 TRP B CB  1 
ATOM   2574 C  CG  . TRP B 1 135 ? 37.226 29.815 38.453  1.00 20.14 ? 135 TRP B CG  1 
ATOM   2575 C  CD1 . TRP B 1 135 ? 38.030 30.383 37.509  1.00 21.27 ? 135 TRP B CD1 1 
ATOM   2576 C  CD2 . TRP B 1 135 ? 36.249 30.805 38.797  1.00 20.95 ? 135 TRP B CD2 1 
ATOM   2577 N  NE1 . TRP B 1 135 ? 37.615 31.666 37.240  1.00 20.65 ? 135 TRP B NE1 1 
ATOM   2578 C  CE2 . TRP B 1 135 ? 36.523 31.953 38.023  1.00 21.50 ? 135 TRP B CE2 1 
ATOM   2579 C  CE3 . TRP B 1 135 ? 35.170 30.837 39.694  1.00 19.04 ? 135 TRP B CE3 1 
ATOM   2580 C  CZ2 . TRP B 1 135 ? 35.750 33.119 38.104  1.00 21.91 ? 135 TRP B CZ2 1 
ATOM   2581 C  CZ3 . TRP B 1 135 ? 34.401 31.995 39.776  1.00 20.87 ? 135 TRP B CZ3 1 
ATOM   2582 C  CH2 . TRP B 1 135 ? 34.700 33.123 38.987  1.00 19.90 ? 135 TRP B CH2 1 
ATOM   2583 N  N   . ALA B 1 136 ? 37.808 26.940 41.961  1.00 23.53 ? 136 ALA B N   1 
ATOM   2584 C  CA  . ALA B 1 136 ? 37.438 25.761 42.722  1.00 21.72 ? 136 ALA B CA  1 
ATOM   2585 C  C   . ALA B 1 136 ? 36.023 25.500 42.228  1.00 23.54 ? 136 ALA B C   1 
ATOM   2586 O  O   . ALA B 1 136 ? 35.367 26.414 41.723  1.00 22.84 ? 136 ALA B O   1 
ATOM   2587 C  CB  . ALA B 1 136 ? 37.431 26.067 44.212  1.00 23.51 ? 136 ALA B CB  1 
ATOM   2588 N  N   . HIS B 1 137 ? 35.543 24.270 42.356  1.00 24.62 ? 137 HIS B N   1 
ATOM   2589 C  CA  . HIS B 1 137 ? 34.200 23.972 41.890  1.00 24.54 ? 137 HIS B CA  1 
ATOM   2590 C  C   . HIS B 1 137 ? 33.574 22.819 42.649  1.00 25.71 ? 137 HIS B C   1 
ATOM   2591 O  O   . HIS B 1 137 ? 34.248 21.845 43.003  1.00 25.70 ? 137 HIS B O   1 
ATOM   2592 C  CB  . HIS B 1 137 ? 34.209 23.637 40.390  1.00 24.56 ? 137 HIS B CB  1 
ATOM   2593 C  CG  . HIS B 1 137 ? 34.938 22.370 40.061  1.00 23.90 ? 137 HIS B CG  1 
ATOM   2594 N  ND1 . HIS B 1 137 ? 36.307 22.316 39.898  1.00 22.08 ? 137 HIS B ND1 1 
ATOM   2595 C  CD2 . HIS B 1 137 ? 34.495 21.100 39.933  1.00 22.70 ? 137 HIS B CD2 1 
ATOM   2596 C  CE1 . HIS B 1 137 ? 36.673 21.066 39.690  1.00 22.32 ? 137 HIS B CE1 1 
ATOM   2597 N  NE2 . HIS B 1 137 ? 35.593 20.306 39.708  1.00 22.82 ? 137 HIS B NE2 1 
ATOM   2598 N  N   . ARG B 1 138 ? 32.270 22.939 42.876  1.00 24.69 ? 138 ARG B N   1 
ATOM   2599 C  CA  . ARG B 1 138 ? 31.490 21.929 43.578  1.00 24.85 ? 138 ARG B CA  1 
ATOM   2600 C  C   . ARG B 1 138 ? 30.170 21.728 42.840  1.00 22.98 ? 138 ARG B C   1 
ATOM   2601 O  O   . ARG B 1 138 ? 29.616 22.683 42.300  1.00 20.93 ? 138 ARG B O   1 
ATOM   2602 C  CB  . ARG B 1 138 ? 31.212 22.390 45.011  1.00 27.49 ? 138 ARG B CB  1 
ATOM   2603 C  CG  . ARG B 1 138 ? 30.010 21.714 45.649  1.00 32.76 ? 138 ARG B CG  1 
ATOM   2604 C  CD  . ARG B 1 138 ? 30.198 21.555 47.145  1.00 37.73 ? 138 ARG B CD  1 
ATOM   2605 N  NE  . ARG B 1 138 ? 30.127 22.806 47.884  1.00 39.52 ? 138 ARG B NE  1 
ATOM   2606 C  CZ  . ARG B 1 138 ? 30.484 22.932 49.158  1.00 40.94 ? 138 ARG B CZ  1 
ATOM   2607 N  NH1 . ARG B 1 138 ? 30.382 24.107 49.761  1.00 41.89 ? 138 ARG B NH1 1 
ATOM   2608 N  NH2 . ARG B 1 138 ? 30.958 21.885 49.824  1.00 40.89 ? 138 ARG B NH2 1 
ATOM   2609 N  N   . THR B 1 139 ? 29.664 20.497 42.823  1.00 22.02 ? 139 THR B N   1 
ATOM   2610 C  CA  . THR B 1 139 ? 28.400 20.211 42.145  1.00 24.94 ? 139 THR B CA  1 
ATOM   2611 C  C   . THR B 1 139 ? 27.261 19.975 43.133  1.00 23.03 ? 139 THR B C   1 
ATOM   2612 O  O   . THR B 1 139 ? 27.446 19.313 44.148  1.00 23.05 ? 139 THR B O   1 
ATOM   2613 C  CB  . THR B 1 139 ? 28.525 18.986 41.213  1.00 25.72 ? 139 THR B CB  1 
ATOM   2614 O  OG1 . THR B 1 139 ? 29.462 19.273 40.167  1.00 29.17 ? 139 THR B OG1 1 
ATOM   2615 C  CG2 . THR B 1 139 ? 27.179 18.671 40.588  1.00 29.71 ? 139 THR B CG2 1 
ATOM   2616 N  N   . ILE B 1 140 ? 26.083 20.507 42.810  1.00 24.97 ? 140 ILE B N   1 
ATOM   2617 C  CA  . ILE B 1 140 ? 24.897 20.411 43.666  1.00 24.94 ? 140 ILE B CA  1 
ATOM   2618 C  C   . ILE B 1 140 ? 23.691 19.800 42.950  1.00 24.64 ? 140 ILE B C   1 
ATOM   2619 O  O   . ILE B 1 140 ? 23.439 20.109 41.789  1.00 24.86 ? 140 ILE B O   1 
ATOM   2620 C  CB  . ILE B 1 140 ? 24.448 21.819 44.151  1.00 26.53 ? 140 ILE B CB  1 
ATOM   2621 C  CG1 . ILE B 1 140 ? 25.655 22.653 44.595  1.00 29.28 ? 140 ILE B CG1 1 
ATOM   2622 C  CG2 . ILE B 1 140 ? 23.444 21.682 45.281  1.00 25.52 ? 140 ILE B CG2 1 
ATOM   2623 C  CD1 . ILE B 1 140 ? 26.257 22.237 45.913  1.00 31.19 ? 140 ILE B CD1 1 
ATOM   2624 N  N   . ASN B 1 141 ? 22.942 18.946 43.646  1.00 24.60 ? 141 ASN B N   1 
ATOM   2625 C  CA  . ASN B 1 141 ? 21.740 18.332 43.073  1.00 25.23 ? 141 ASN B CA  1 
ATOM   2626 C  C   . ASN B 1 141 ? 20.529 19.105 43.602  1.00 24.02 ? 141 ASN B C   1 
ATOM   2627 O  O   . ASN B 1 141 ? 20.202 19.024 44.781  1.00 25.28 ? 141 ASN B O   1 
ATOM   2628 C  CB  . ASN B 1 141 ? 21.617 16.858 43.490  1.00 23.47 ? 141 ASN B CB  1 
ATOM   2629 C  CG  . ASN B 1 141 ? 20.417 16.161 42.842  1.00 25.05 ? 141 ASN B CG  1 
ATOM   2630 O  OD1 . ASN B 1 141 ? 19.406 16.798 42.526  1.00 22.41 ? 141 ASN B OD1 1 
ATOM   2631 N  ND2 . ASN B 1 141 ? 20.522 14.846 42.657  1.00 21.34 ? 141 ASN B ND2 1 
ATOM   2632 N  N   . THR B 1 142 ? 19.867 19.858 42.737  1.00 25.19 ? 142 THR B N   1 
ATOM   2633 C  CA  . THR B 1 142 ? 18.708 20.637 43.166  1.00 26.03 ? 142 THR B CA  1 
ATOM   2634 C  C   . THR B 1 142 ? 17.384 19.945 42.876  1.00 25.91 ? 142 THR B C   1 
ATOM   2635 O  O   . THR B 1 142 ? 16.321 20.523 43.101  1.00 28.22 ? 142 THR B O   1 
ATOM   2636 C  CB  . THR B 1 142 ? 18.684 22.033 42.490  1.00 24.72 ? 142 THR B CB  1 
ATOM   2637 O  OG1 . THR B 1 142 ? 18.728 21.881 41.065  1.00 24.96 ? 142 THR B OG1 1 
ATOM   2638 C  CG2 . THR B 1 142 ? 19.867 22.872 42.949  1.00 25.08 ? 142 THR B CG2 1 
ATOM   2639 N  N   . GLY B 1 143 ? 17.445 18.710 42.390  1.00 26.65 ? 143 GLY B N   1 
ATOM   2640 C  CA  . GLY B 1 143 ? 16.228 17.982 42.063  1.00 26.96 ? 143 GLY B CA  1 
ATOM   2641 C  C   . GLY B 1 143 ? 15.909 16.820 42.982  1.00 27.73 ? 143 GLY B C   1 
ATOM   2642 O  O   . GLY B 1 143 ? 16.605 16.592 43.972  1.00 29.72 ? 143 GLY B O   1 
ATOM   2643 N  N   . ASP B 1 144 ? 14.858 16.075 42.656  1.00 26.19 ? 144 ASP B N   1 
ATOM   2644 C  CA  . ASP B 1 144 ? 14.462 14.936 43.477  1.00 27.99 ? 144 ASP B CA  1 
ATOM   2645 C  C   . ASP B 1 144 ? 14.887 13.611 42.844  1.00 26.71 ? 144 ASP B C   1 
ATOM   2646 O  O   . ASP B 1 144 ? 14.554 12.533 43.342  1.00 26.91 ? 144 ASP B O   1 
ATOM   2647 C  CB  . ASP B 1 144 ? 12.946 14.957 43.710  1.00 28.23 ? 144 ASP B CB  1 
ATOM   2648 C  CG  . ASP B 1 144 ? 12.154 14.621 42.460  1.00 32.50 ? 144 ASP B CG  1 
ATOM   2649 O  OD1 . ASP B 1 144 ? 12.662 14.862 41.344  1.00 32.14 ? 144 ASP B OD1 1 
ATOM   2650 O  OD2 . ASP B 1 144 ? 11.012 14.128 42.595  1.00 33.21 ? 144 ASP B OD2 1 
ATOM   2651 N  N   . LYS B 1 145 ? 15.637 13.705 41.750  1.00 25.87 ? 145 LYS B N   1 
ATOM   2652 C  CA  . LYS B 1 145 ? 16.131 12.524 41.040  1.00 26.39 ? 145 LYS B CA  1 
ATOM   2653 C  C   . LYS B 1 145 ? 17.649 12.643 40.953  1.00 25.17 ? 145 LYS B C   1 
ATOM   2654 O  O   . LYS B 1 145 ? 18.204 13.729 41.107  1.00 23.64 ? 145 LYS B O   1 
ATOM   2655 C  CB  . LYS B 1 145 ? 15.552 12.477 39.625  1.00 27.30 ? 145 LYS B CB  1 
ATOM   2656 C  CG  . LYS B 1 145 ? 14.102 12.912 39.533  1.00 31.34 ? 145 LYS B CG  1 
ATOM   2657 C  CD  . LYS B 1 145 ? 13.167 11.745 39.315  1.00 35.44 ? 145 LYS B CD  1 
ATOM   2658 C  CE  . LYS B 1 145 ? 13.178 10.781 40.479  1.00 36.99 ? 145 LYS B CE  1 
ATOM   2659 N  NZ  . LYS B 1 145 ? 12.116 9.748  40.296  1.00 38.87 ? 145 LYS B NZ  1 
ATOM   2660 N  N   . PRO B 1 146 ? 18.342 11.532 40.689  1.00 24.92 ? 146 PRO B N   1 
ATOM   2661 C  CA  . PRO B 1 146 ? 19.802 11.586 40.594  1.00 25.03 ? 146 PRO B CA  1 
ATOM   2662 C  C   . PRO B 1 146 ? 20.282 12.600 39.554  1.00 24.13 ? 146 PRO B C   1 
ATOM   2663 O  O   . PRO B 1 146 ? 19.677 12.752 38.495  1.00 25.05 ? 146 PRO B O   1 
ATOM   2664 C  CB  . PRO B 1 146 ? 20.176 10.151 40.214  1.00 25.95 ? 146 PRO B CB  1 
ATOM   2665 C  CG  . PRO B 1 146 ? 19.073 9.337  40.840  1.00 26.29 ? 146 PRO B CG  1 
ATOM   2666 C  CD  . PRO B 1 146 ? 17.853 10.160 40.474  1.00 26.19 ? 146 PRO B CD  1 
ATOM   2667 N  N   . PHE B 1 147 ? 21.364 13.300 39.873  1.00 24.46 ? 147 PHE B N   1 
ATOM   2668 C  CA  . PHE B 1 147 ? 21.946 14.282 38.963  1.00 23.69 ? 147 PHE B CA  1 
ATOM   2669 C  C   . PHE B 1 147 ? 23.215 13.634 38.411  1.00 24.38 ? 147 PHE B C   1 
ATOM   2670 O  O   . PHE B 1 147 ? 24.177 13.405 39.152  1.00 22.64 ? 147 PHE B O   1 
ATOM   2671 C  CB  . PHE B 1 147 ? 22.264 15.571 39.725  1.00 22.70 ? 147 PHE B CB  1 
ATOM   2672 C  CG  . PHE B 1 147 ? 22.914 16.636 38.891  1.00 22.15 ? 147 PHE B CG  1 
ATOM   2673 C  CD1 . PHE B 1 147 ? 22.479 16.894 37.595  1.00 24.82 ? 147 PHE B CD1 1 
ATOM   2674 C  CD2 . PHE B 1 147 ? 23.933 17.413 39.415  1.00 23.33 ? 147 PHE B CD2 1 
ATOM   2675 C  CE1 . PHE B 1 147 ? 23.048 17.915 36.837  1.00 23.90 ? 147 PHE B CE1 1 
ATOM   2676 C  CE2 . PHE B 1 147 ? 24.508 18.439 38.664  1.00 25.27 ? 147 PHE B CE2 1 
ATOM   2677 C  CZ  . PHE B 1 147 ? 24.063 18.687 37.372  1.00 23.76 ? 147 PHE B CZ  1 
ATOM   2678 N  N   . ILE B 1 148 ? 23.203 13.325 37.114  1.00 23.67 ? 148 ILE B N   1 
ATOM   2679 C  CA  . ILE B 1 148 ? 24.331 12.660 36.468  1.00 22.12 ? 148 ILE B CA  1 
ATOM   2680 C  C   . ILE B 1 148 ? 25.077 13.537 35.478  1.00 21.73 ? 148 ILE B C   1 
ATOM   2681 O  O   . ILE B 1 148 ? 24.466 14.190 34.628  1.00 20.37 ? 148 ILE B O   1 
ATOM   2682 C  CB  . ILE B 1 148 ? 23.873 11.394 35.703  1.00 23.40 ? 148 ILE B CB  1 
ATOM   2683 C  CG1 . ILE B 1 148 ? 22.907 10.577 36.566  1.00 23.49 ? 148 ILE B CG1 1 
ATOM   2684 C  CG2 . ILE B 1 148 ? 25.087 10.565 35.289  1.00 22.10 ? 148 ILE B CG2 1 
ATOM   2685 C  CD1 . ILE B 1 148 ? 23.345 10.415 37.999  1.00 29.41 ? 148 ILE B CD1 1 
ATOM   2686 N  N   . PHE B 1 149 ? 26.405 13.524 35.584  1.00 19.93 ? 149 PHE B N   1 
ATOM   2687 C  CA  . PHE B 1 149 ? 27.252 14.312 34.708  1.00 18.92 ? 149 PHE B CA  1 
ATOM   2688 C  C   . PHE B 1 149 ? 28.618 13.672 34.489  1.00 18.59 ? 149 PHE B C   1 
ATOM   2689 O  O   . PHE B 1 149 ? 29.108 12.915 35.325  1.00 18.44 ? 149 PHE B O   1 
ATOM   2690 C  CB  . PHE B 1 149 ? 27.419 15.727 35.274  1.00 18.59 ? 149 PHE B CB  1 
ATOM   2691 C  CG  . PHE B 1 149 ? 28.002 15.770 36.665  1.00 20.86 ? 149 PHE B CG  1 
ATOM   2692 C  CD1 . PHE B 1 149 ? 29.377 15.710 36.864  1.00 19.72 ? 149 PHE B CD1 1 
ATOM   2693 C  CD2 . PHE B 1 149 ? 27.171 15.897 37.774  1.00 19.65 ? 149 PHE B CD2 1 
ATOM   2694 C  CE1 . PHE B 1 149 ? 29.919 15.781 38.150  1.00 23.81 ? 149 PHE B CE1 1 
ATOM   2695 C  CE2 . PHE B 1 149 ? 27.705 15.968 39.062  1.00 22.43 ? 149 PHE B CE2 1 
ATOM   2696 C  CZ  . PHE B 1 149 ? 29.081 15.913 39.250  1.00 19.61 ? 149 PHE B CZ  1 
ATOM   2697 N  N   . LEU B 1 150 ? 29.204 13.972 33.338  1.00 18.16 ? 150 LEU B N   1 
ATOM   2698 C  CA  . LEU B 1 150 ? 30.521 13.484 32.956  1.00 16.16 ? 150 LEU B CA  1 
ATOM   2699 C  C   . LEU B 1 150 ? 31.482 14.649 33.137  1.00 16.26 ? 150 LEU B C   1 
ATOM   2700 O  O   . LEU B 1 150 ? 31.154 15.788 32.795  1.00 16.80 ? 150 LEU B O   1 
ATOM   2701 C  CB  . LEU B 1 150 ? 30.523 13.056 31.482  1.00 16.60 ? 150 LEU B CB  1 
ATOM   2702 C  CG  . LEU B 1 150 ? 31.893 12.828 30.822  1.00 19.34 ? 150 LEU B CG  1 
ATOM   2703 C  CD1 . LEU B 1 150 ? 32.614 11.662 31.503  1.00 16.82 ? 150 LEU B CD1 1 
ATOM   2704 C  CD2 . LEU B 1 150 ? 31.701 12.537 29.321  1.00 19.08 ? 150 LEU B CD2 1 
ATOM   2705 N  N   . ALA B 1 151 ? 32.659 14.370 33.682  1.00 16.59 ? 151 ALA B N   1 
ATOM   2706 C  CA  . ALA B 1 151 ? 33.665 15.403 33.885  1.00 15.66 ? 151 ALA B CA  1 
ATOM   2707 C  C   . ALA B 1 151 ? 34.960 14.967 33.219  1.00 16.97 ? 151 ALA B C   1 
ATOM   2708 O  O   . ALA B 1 151 ? 35.345 13.795 33.299  1.00 14.95 ? 151 ALA B O   1 
ATOM   2709 C  CB  . ALA B 1 151 ? 33.895 15.629 35.363  1.00 15.17 ? 151 ALA B CB  1 
ATOM   2710 N  N   . LEU B 1 152 ? 35.620 15.909 32.550  1.00 16.44 ? 152 LEU B N   1 
ATOM   2711 C  CA  . LEU B 1 152 ? 36.881 15.636 31.875  1.00 16.62 ? 152 LEU B CA  1 
ATOM   2712 C  C   . LEU B 1 152 ? 37.899 16.658 32.375  1.00 17.55 ? 152 LEU B C   1 
ATOM   2713 O  O   . LEU B 1 152 ? 37.603 17.856 32.442  1.00 15.64 ? 152 LEU B O   1 
ATOM   2714 C  CB  . LEU B 1 152 ? 36.695 15.714 30.350  1.00 17.88 ? 152 LEU B CB  1 
ATOM   2715 C  CG  . LEU B 1 152 ? 35.644 14.709 29.853  1.00 23.18 ? 152 LEU B CG  1 
ATOM   2716 C  CD1 . LEU B 1 152 ? 34.253 15.314 30.009  1.00 24.76 ? 152 LEU B CD1 1 
ATOM   2717 C  CD2 . LEU B 1 152 ? 35.889 14.344 28.399  1.00 26.34 ? 152 LEU B CD2 1 
ATOM   2718 N  N   . TYR B 1 153 ? 39.097 16.185 32.726  1.00 16.54 ? 153 TYR B N   1 
ATOM   2719 C  CA  . TYR B 1 153 ? 40.128 17.062 33.282  1.00 18.13 ? 153 TYR B CA  1 
ATOM   2720 C  C   . TYR B 1 153 ? 41.564 16.616 33.021  1.00 17.58 ? 153 TYR B C   1 
ATOM   2721 O  O   . TYR B 1 153 ? 41.831 15.436 32.809  1.00 17.52 ? 153 TYR B O   1 
ATOM   2722 C  CB  . TYR B 1 153 ? 39.908 17.199 34.796  1.00 20.56 ? 153 TYR B CB  1 
ATOM   2723 C  CG  . TYR B 1 153 ? 39.674 15.869 35.485  1.00 24.27 ? 153 TYR B CG  1 
ATOM   2724 C  CD1 . TYR B 1 153 ? 40.675 15.257 36.245  1.00 24.46 ? 153 TYR B CD1 1 
ATOM   2725 C  CD2 . TYR B 1 153 ? 38.467 15.183 35.313  1.00 27.06 ? 153 TYR B CD2 1 
ATOM   2726 C  CE1 . TYR B 1 153 ? 40.477 13.983 36.815  1.00 25.60 ? 153 TYR B CE1 1 
ATOM   2727 C  CE2 . TYR B 1 153 ? 38.263 13.921 35.863  1.00 26.52 ? 153 TYR B CE2 1 
ATOM   2728 C  CZ  . TYR B 1 153 ? 39.265 13.328 36.610  1.00 26.53 ? 153 TYR B CZ  1 
ATOM   2729 O  OH  . TYR B 1 153 ? 39.036 12.082 37.148  1.00 28.79 ? 153 TYR B OH  1 
ATOM   2730 N  N   . PRO B 1 154 ? 42.512 17.570 33.026  1.00 19.54 ? 154 PRO B N   1 
ATOM   2731 C  CA  . PRO B 1 154 ? 43.922 17.242 32.790  1.00 20.63 ? 154 PRO B CA  1 
ATOM   2732 C  C   . PRO B 1 154 ? 44.403 16.189 33.780  1.00 20.20 ? 154 PRO B C   1 
ATOM   2733 O  O   . PRO B 1 154 ? 44.129 16.284 34.975  1.00 19.57 ? 154 PRO B O   1 
ATOM   2734 C  CB  . PRO B 1 154 ? 44.622 18.585 32.980  1.00 19.76 ? 154 PRO B CB  1 
ATOM   2735 C  CG  . PRO B 1 154 ? 43.586 19.563 32.490  1.00 18.34 ? 154 PRO B CG  1 
ATOM   2736 C  CD  . PRO B 1 154 ? 42.324 19.030 33.127  1.00 18.02 ? 154 PRO B CD  1 
ATOM   2737 N  N   . ALA B 1 155 ? 45.114 15.186 33.269  1.00 21.85 ? 155 ALA B N   1 
ATOM   2738 C  CA  . ALA B 1 155 ? 45.638 14.092 34.086  1.00 21.99 ? 155 ALA B CA  1 
ATOM   2739 C  C   . ALA B 1 155 ? 46.628 14.546 35.158  1.00 24.16 ? 155 ALA B C   1 
ATOM   2740 O  O   . ALA B 1 155 ? 46.877 13.823 36.130  1.00 24.80 ? 155 ALA B O   1 
ATOM   2741 C  CB  . ALA B 1 155 ? 46.298 13.067 33.193  1.00 20.21 ? 155 ALA B CB  1 
ATOM   2742 N  N   . ASP B 1 156 ? 47.191 15.736 34.978  1.00 24.81 ? 156 ASP B N   1 
ATOM   2743 C  CA  . ASP B 1 156 ? 48.162 16.273 35.923  1.00 26.29 ? 156 ASP B CA  1 
ATOM   2744 C  C   . ASP B 1 156 ? 47.573 17.414 36.753  1.00 27.33 ? 156 ASP B C   1 
ATOM   2745 O  O   . ASP B 1 156 ? 48.308 18.132 37.432  1.00 26.82 ? 156 ASP B O   1 
ATOM   2746 C  CB  . ASP B 1 156 ? 49.397 16.776 35.167  1.00 24.75 ? 156 ASP B CB  1 
ATOM   2747 C  CG  . ASP B 1 156 ? 49.126 18.053 34.390  1.00 26.86 ? 156 ASP B CG  1 
ATOM   2748 O  OD1 . ASP B 1 156 ? 47.937 18.378 34.168  1.00 25.70 ? 156 ASP B OD1 1 
ATOM   2749 O  OD2 . ASP B 1 156 ? 50.101 18.727 33.988  1.00 24.62 ? 156 ASP B OD2 1 
ATOM   2750 N  N   . ALA B 1 157 ? 46.253 17.579 36.695  1.00 25.71 ? 157 ALA B N   1 
ATOM   2751 C  CA  . ALA B 1 157 ? 45.586 18.644 37.440  1.00 27.34 ? 157 ALA B CA  1 
ATOM   2752 C  C   . ALA B 1 157 ? 45.687 18.436 38.951  1.00 28.71 ? 157 ALA B C   1 
ATOM   2753 O  O   . ALA B 1 157 ? 45.879 19.394 39.704  1.00 28.97 ? 157 ALA B O   1 
ATOM   2754 C  CB  . ALA B 1 157 ? 44.115 18.742 37.020  1.00 27.08 ? 157 ALA B CB  1 
ATOM   2755 N  N   . GLY B 1 158 ? 45.561 17.187 39.389  1.00 29.67 ? 158 GLY B N   1 
ATOM   2756 C  CA  . GLY B 1 158 ? 45.642 16.894 40.810  1.00 32.21 ? 158 GLY B CA  1 
ATOM   2757 C  C   . GLY B 1 158 ? 44.408 17.349 41.569  1.00 34.69 ? 158 GLY B C   1 
ATOM   2758 O  O   . GLY B 1 158 ? 43.517 17.987 41.003  1.00 35.03 ? 158 GLY B O   1 
ATOM   2759 N  N   . HIS B 1 159 ? 44.356 17.032 42.859  1.00 35.09 ? 159 HIS B N   1 
ATOM   2760 C  CA  . HIS B 1 159 ? 43.214 17.402 43.688  1.00 36.70 ? 159 HIS B CA  1 
ATOM   2761 C  C   . HIS B 1 159 ? 43.627 18.120 44.967  1.00 37.74 ? 159 HIS B C   1 
ATOM   2762 O  O   . HIS B 1 159 ? 44.515 17.665 45.687  1.00 36.77 ? 159 HIS B O   1 
ATOM   2763 C  CB  . HIS B 1 159 ? 42.415 16.152 44.047  1.00 37.24 ? 159 HIS B CB  1 
ATOM   2764 C  CG  . HIS B 1 159 ? 41.918 15.397 42.859  1.00 38.35 ? 159 HIS B CG  1 
ATOM   2765 N  ND1 . HIS B 1 159 ? 40.677 15.625 42.294  1.00 39.53 ? 159 HIS B ND1 1 
ATOM   2766 C  CD2 . HIS B 1 159 ? 42.499 14.436 42.105  1.00 37.23 ? 159 HIS B CD2 1 
ATOM   2767 C  CE1 . HIS B 1 159 ? 40.522 14.837 41.251  1.00 38.38 ? 159 HIS B CE1 1 
ATOM   2768 N  NE2 . HIS B 1 159 ? 41.615 14.103 41.111  1.00 37.02 ? 159 HIS B NE2 1 
ATOM   2769 N  N   . ASP B 1 160 ? 42.973 19.246 45.241  1.00 37.49 ? 160 ASP B N   1 
ATOM   2770 C  CA  . ASP B 1 160 ? 43.247 20.033 46.436  1.00 37.63 ? 160 ASP B CA  1 
ATOM   2771 C  C   . ASP B 1 160 ? 41.949 20.251 47.215  1.00 38.27 ? 160 ASP B C   1 
ATOM   2772 O  O   . ASP B 1 160 ? 41.215 21.208 46.954  1.00 36.97 ? 160 ASP B O   1 
ATOM   2773 C  CB  . ASP B 1 160 ? 43.848 21.387 46.051  1.00 37.59 ? 160 ASP B CB  1 
ATOM   2774 C  CG  . ASP B 1 160 ? 44.079 22.285 47.254  1.00 39.22 ? 160 ASP B CG  1 
ATOM   2775 O  OD1 . ASP B 1 160 ? 44.451 23.460 47.058  1.00 39.35 ? 160 ASP B OD1 1 
ATOM   2776 O  OD2 . ASP B 1 160 ? 43.891 21.815 48.398  1.00 39.77 ? 160 ASP B OD2 1 
ATOM   2777 N  N   . TYR B 1 161 ? 41.671 19.364 48.168  1.00 38.94 ? 161 TYR B N   1 
ATOM   2778 C  CA  . TYR B 1 161 ? 40.461 19.465 48.978  1.00 38.91 ? 161 TYR B CA  1 
ATOM   2779 C  C   . TYR B 1 161 ? 40.678 20.261 50.263  1.00 40.32 ? 161 TYR B C   1 
ATOM   2780 O  O   . TYR B 1 161 ? 39.776 20.963 50.723  1.00 40.03 ? 161 TYR B O   1 
ATOM   2781 C  CB  . TYR B 1 161 ? 39.935 18.074 49.353  1.00 38.51 ? 161 TYR B CB  1 
ATOM   2782 C  CG  . TYR B 1 161 ? 39.479 17.220 48.191  1.00 37.37 ? 161 TYR B CG  1 
ATOM   2783 C  CD1 . TYR B 1 161 ? 40.392 16.463 47.459  1.00 36.92 ? 161 TYR B CD1 1 
ATOM   2784 C  CD2 . TYR B 1 161 ? 38.130 17.153 47.834  1.00 37.64 ? 161 TYR B CD2 1 
ATOM   2785 C  CE1 . TYR B 1 161 ? 39.976 15.658 46.403  1.00 36.73 ? 161 TYR B CE1 1 
ATOM   2786 C  CE2 . TYR B 1 161 ? 37.700 16.350 46.775  1.00 36.17 ? 161 TYR B CE2 1 
ATOM   2787 C  CZ  . TYR B 1 161 ? 38.631 15.605 46.066  1.00 36.92 ? 161 TYR B CZ  1 
ATOM   2788 O  OH  . TYR B 1 161 ? 38.226 14.803 45.026  1.00 36.70 ? 161 TYR B OH  1 
ATOM   2789 N  N   . GLY B 1 162 ? 41.873 20.139 50.836  1.00 41.77 ? 162 GLY B N   1 
ATOM   2790 C  CA  . GLY B 1 162 ? 42.205 20.823 52.078  1.00 42.67 ? 162 GLY B CA  1 
ATOM   2791 C  C   . GLY B 1 162 ? 41.640 22.219 52.273  1.00 43.63 ? 162 GLY B C   1 
ATOM   2792 O  O   . GLY B 1 162 ? 40.867 22.464 53.201  1.00 42.18 ? 162 GLY B O   1 
ATOM   2793 N  N   . THR B 1 163 ? 42.037 23.137 51.399  1.00 45.54 ? 163 THR B N   1 
ATOM   2794 C  CA  . THR B 1 163 ? 41.584 24.524 51.457  1.00 46.56 ? 163 THR B CA  1 
ATOM   2795 C  C   . THR B 1 163 ? 40.072 24.641 51.639  1.00 46.79 ? 163 THR B C   1 
ATOM   2796 O  O   . THR B 1 163 ? 39.604 25.434 52.454  1.00 47.79 ? 163 THR B O   1 
ATOM   2797 C  CB  . THR B 1 163 ? 41.968 25.282 50.175  1.00 48.12 ? 163 THR B CB  1 
ATOM   2798 O  OG1 . THR B 1 163 ? 43.376 25.151 49.943  1.00 49.65 ? 163 THR B OG1 1 
ATOM   2799 C  CG2 . THR B 1 163 ? 41.611 26.759 50.304  1.00 48.33 ? 163 THR B CG2 1 
ATOM   2800 N  N   . ILE B 1 164 ? 39.316 23.856 50.872  1.00 45.81 ? 164 ILE B N   1 
ATOM   2801 C  CA  . ILE B 1 164 ? 37.854 23.874 50.940  1.00 44.70 ? 164 ILE B CA  1 
ATOM   2802 C  C   . ILE B 1 164 ? 37.337 23.305 52.262  1.00 45.42 ? 164 ILE B C   1 
ATOM   2803 O  O   . ILE B 1 164 ? 36.440 23.880 52.886  1.00 43.90 ? 164 ILE B O   1 
ATOM   2804 C  CB  . ILE B 1 164 ? 37.221 23.062 49.781  1.00 43.22 ? 164 ILE B CB  1 
ATOM   2805 C  CG1 . ILE B 1 164 ? 37.664 23.632 48.429  1.00 41.74 ? 164 ILE B CG1 1 
ATOM   2806 C  CG2 . ILE B 1 164 ? 35.709 23.085 49.899  1.00 41.34 ? 164 ILE B CG2 1 
ATOM   2807 C  CD1 . ILE B 1 164 ? 37.248 25.066 48.193  1.00 40.84 ? 164 ILE B CD1 1 
ATOM   2808 N  N   . ALA B 1 165 ? 37.896 22.171 52.676  1.00 45.89 ? 165 ALA B N   1 
ATOM   2809 C  CA  . ALA B 1 165 ? 37.500 21.532 53.928  1.00 48.03 ? 165 ALA B CA  1 
ATOM   2810 C  C   . ALA B 1 165 ? 37.761 22.494 55.081  1.00 49.52 ? 165 ALA B C   1 
ATOM   2811 O  O   . ALA B 1 165 ? 37.058 22.481 56.093  1.00 49.39 ? 165 ALA B O   1 
ATOM   2812 C  CB  . ALA B 1 165 ? 38.291 20.246 54.133  1.00 46.62 ? 165 ALA B CB  1 
ATOM   2813 N  N   . GLU B 1 166 ? 38.778 23.333 54.908  1.00 51.73 ? 166 GLU B N   1 
ATOM   2814 C  CA  . GLU B 1 166 ? 39.162 24.319 55.912  1.00 54.40 ? 166 GLU B CA  1 
ATOM   2815 C  C   . GLU B 1 166 ? 38.282 25.569 55.826  1.00 54.80 ? 166 GLU B C   1 
ATOM   2816 O  O   . GLU B 1 166 ? 37.406 25.783 56.666  1.00 55.85 ? 166 GLU B O   1 
ATOM   2817 C  CB  . GLU B 1 166 ? 40.633 24.705 55.714  1.00 55.81 ? 166 GLU B CB  1 
ATOM   2818 C  CG  . GLU B 1 166 ? 41.177 25.708 56.721  1.00 59.84 ? 166 GLU B CG  1 
ATOM   2819 C  CD  . GLU B 1 166 ? 41.199 25.163 58.136  1.00 62.76 ? 166 GLU B CD  1 
ATOM   2820 O  OE1 . GLU B 1 166 ? 41.769 24.070 58.343  1.00 64.53 ? 166 GLU B OE1 1 
ATOM   2821 O  OE2 . GLU B 1 166 ? 40.651 25.828 59.043  1.00 64.29 ? 166 GLU B OE2 1 
ATOM   2822 N  N   . LYS B 1 167 ? 38.517 26.382 54.798  1.00 54.12 ? 167 LYS B N   1 
ATOM   2823 C  CA  . LYS B 1 167 ? 37.775 27.624 54.584  1.00 54.03 ? 167 LYS B CA  1 
ATOM   2824 C  C   . LYS B 1 167 ? 36.313 27.407 54.181  1.00 52.70 ? 167 LYS B C   1 
ATOM   2825 O  O   . LYS B 1 167 ? 35.398 27.953 54.800  1.00 53.59 ? 167 LYS B O   1 
ATOM   2826 C  CB  . LYS B 1 167 ? 38.462 28.457 53.499  1.00 55.30 ? 167 LYS B CB  1 
ATOM   2827 C  CG  . LYS B 1 167 ? 39.943 28.726 53.726  1.00 56.94 ? 167 LYS B CG  1 
ATOM   2828 C  CD  . LYS B 1 167 ? 40.170 29.754 54.816  1.00 58.67 ? 167 LYS B CD  1 
ATOM   2829 C  CE  . LYS B 1 167 ? 41.641 30.123 54.909  1.00 59.00 ? 167 LYS B CE  1 
ATOM   2830 N  NZ  . LYS B 1 167 ? 41.883 31.198 55.908  1.00 60.00 ? 167 LYS B NZ  1 
ATOM   2831 N  N   . GLY B 1 168 ? 36.102 26.616 53.133  1.00 50.54 ? 168 GLY B N   1 
ATOM   2832 C  CA  . GLY B 1 168 ? 34.754 26.367 52.650  1.00 46.31 ? 168 GLY B CA  1 
ATOM   2833 C  C   . GLY B 1 168 ? 34.403 27.366 51.561  1.00 43.11 ? 168 GLY B C   1 
ATOM   2834 O  O   . GLY B 1 168 ? 35.137 28.332 51.336  1.00 43.04 ? 168 GLY B O   1 
ATOM   2835 N  N   . PHE B 1 169 ? 33.290 27.139 50.873  1.00 40.22 ? 169 PHE B N   1 
ATOM   2836 C  CA  . PHE B 1 169 ? 32.858 28.044 49.811  1.00 36.80 ? 169 PHE B CA  1 
ATOM   2837 C  C   . PHE B 1 169 ? 32.157 29.256 50.423  1.00 36.05 ? 169 PHE B C   1 
ATOM   2838 O  O   . PHE B 1 169 ? 31.533 29.152 51.476  1.00 34.92 ? 169 PHE B O   1 
ATOM   2839 C  CB  . PHE B 1 169 ? 31.910 27.315 48.849  1.00 35.22 ? 169 PHE B CB  1 
ATOM   2840 C  CG  . PHE B 1 169 ? 32.612 26.427 47.848  1.00 31.88 ? 169 PHE B CG  1 
ATOM   2841 C  CD1 . PHE B 1 169 ? 32.975 26.919 46.592  1.00 29.93 ? 169 PHE B CD1 1 
ATOM   2842 C  CD2 . PHE B 1 169 ? 32.889 25.098 48.151  1.00 30.15 ? 169 PHE B CD2 1 
ATOM   2843 C  CE1 . PHE B 1 169 ? 33.605 26.096 45.652  1.00 28.33 ? 169 PHE B CE1 1 
ATOM   2844 C  CE2 . PHE B 1 169 ? 33.519 24.266 47.220  1.00 29.48 ? 169 PHE B CE2 1 
ATOM   2845 C  CZ  . PHE B 1 169 ? 33.876 24.768 45.966  1.00 27.28 ? 169 PHE B CZ  1 
ATOM   2846 N  N   . SER B 1 170 ? 32.261 30.402 49.760  1.00 35.69 ? 170 SER B N   1 
ATOM   2847 C  CA  . SER B 1 170 ? 31.642 31.627 50.251  1.00 36.97 ? 170 SER B CA  1 
ATOM   2848 C  C   . SER B 1 170 ? 30.121 31.618 50.119  1.00 37.04 ? 170 SER B C   1 
ATOM   2849 O  O   . SER B 1 170 ? 29.462 32.594 50.477  1.00 38.13 ? 170 SER B O   1 
ATOM   2850 C  CB  . SER B 1 170 ? 32.207 32.837 49.502  1.00 35.36 ? 170 SER B CB  1 
ATOM   2851 O  OG  . SER B 1 170 ? 31.862 32.779 48.130  1.00 36.93 ? 170 SER B OG  1 
ATOM   2852 N  N   . LYS B 1 171 ? 29.567 30.525 49.599  1.00 36.53 ? 171 LYS B N   1 
ATOM   2853 C  CA  . LYS B 1 171 ? 28.121 30.414 49.424  1.00 35.03 ? 171 LYS B CA  1 
ATOM   2854 C  C   . LYS B 1 171 ? 27.611 29.017 49.757  1.00 34.45 ? 171 LYS B C   1 
ATOM   2855 O  O   . LYS B 1 171 ? 28.378 28.054 49.815  1.00 33.36 ? 171 LYS B O   1 
ATOM   2856 C  CB  . LYS B 1 171 ? 27.731 30.724 47.974  1.00 35.66 ? 171 LYS B CB  1 
ATOM   2857 C  CG  . LYS B 1 171 ? 28.259 32.036 47.411  1.00 35.15 ? 171 LYS B CG  1 
ATOM   2858 C  CD  . LYS B 1 171 ? 27.531 33.231 47.999  1.00 36.83 ? 171 LYS B CD  1 
ATOM   2859 C  CE  . LYS B 1 171 ? 28.008 34.526 47.367  1.00 35.13 ? 171 LYS B CE  1 
ATOM   2860 N  NZ  . LYS B 1 171 ? 27.280 35.696 47.919  1.00 37.21 ? 171 LYS B NZ  1 
ATOM   2861 N  N   . ILE B 1 172 ? 26.303 28.927 49.978  1.00 32.89 ? 172 ILE B N   1 
ATOM   2862 C  CA  . ILE B 1 172 ? 25.632 27.661 50.243  1.00 33.23 ? 172 ILE B CA  1 
ATOM   2863 C  C   . ILE B 1 172 ? 24.401 27.652 49.336  1.00 33.82 ? 172 ILE B C   1 
ATOM   2864 O  O   . ILE B 1 172 ? 23.844 28.712 49.026  1.00 33.94 ? 172 ILE B O   1 
ATOM   2865 C  CB  . ILE B 1 172 ? 25.195 27.517 51.726  1.00 33.54 ? 172 ILE B CB  1 
ATOM   2866 C  CG1 . ILE B 1 172 ? 24.326 28.703 52.146  1.00 32.74 ? 172 ILE B CG1 1 
ATOM   2867 C  CG2 . ILE B 1 172 ? 26.426 27.390 52.619  1.00 33.51 ? 172 ILE B CG2 1 
ATOM   2868 C  CD1 . ILE B 1 172 ? 23.834 28.621 53.585  1.00 32.35 ? 172 ILE B CD1 1 
ATOM   2869 N  N   . VAL B 1 173 ? 23.995 26.468 48.887  1.00 32.21 ? 173 VAL B N   1 
ATOM   2870 C  CA  . VAL B 1 173 ? 22.839 26.345 48.002  1.00 32.22 ? 173 VAL B CA  1 
ATOM   2871 C  C   . VAL B 1 173 ? 21.724 25.653 48.763  1.00 31.40 ? 173 VAL B C   1 
ATOM   2872 O  O   . VAL B 1 173 ? 21.800 24.452 49.031  1.00 30.77 ? 173 VAL B O   1 
ATOM   2873 C  CB  . VAL B 1 173 ? 23.174 25.517 46.738  1.00 31.71 ? 173 VAL B CB  1 
ATOM   2874 C  CG1 . VAL B 1 173 ? 21.998 25.547 45.773  1.00 31.60 ? 173 VAL B CG1 1 
ATOM   2875 C  CG2 . VAL B 1 173 ? 24.421 26.060 46.072  1.00 32.53 ? 173 VAL B CG2 1 
ATOM   2876 N  N   . VAL B 1 174 ? 20.682 26.411 49.091  1.00 31.58 ? 174 VAL B N   1 
ATOM   2877 C  CA  . VAL B 1 174 ? 19.577 25.874 49.869  1.00 31.52 ? 174 VAL B CA  1 
ATOM   2878 C  C   . VAL B 1 174 ? 18.197 26.007 49.257  1.00 33.44 ? 174 VAL B C   1 
ATOM   2879 O  O   . VAL B 1 174 ? 17.971 26.769 48.314  1.00 33.99 ? 174 VAL B O   1 
ATOM   2880 C  CB  . VAL B 1 174 ? 19.523 26.533 51.262  1.00 30.48 ? 174 VAL B CB  1 
ATOM   2881 C  CG1 . VAL B 1 174 ? 20.859 26.372 51.958  1.00 29.55 ? 174 VAL B CG1 1 
ATOM   2882 C  CG2 . VAL B 1 174 ? 19.167 28.004 51.125  1.00 26.02 ? 174 VAL B CG2 1 
ATOM   2883 N  N   . GLU B 1 175 ? 17.276 25.252 49.839  1.00 35.30 ? 175 GLU B N   1 
ATOM   2884 C  CA  . GLU B 1 175 ? 15.890 25.224 49.426  1.00 39.04 ? 175 GLU B CA  1 
ATOM   2885 C  C   . GLU B 1 175 ? 15.048 26.098 50.358  1.00 40.45 ? 175 GLU B C   1 
ATOM   2886 O  O   . GLU B 1 175 ? 15.038 25.909 51.576  1.00 39.62 ? 175 GLU B O   1 
ATOM   2887 C  CB  . GLU B 1 175 ? 15.388 23.780 49.463  1.00 41.19 ? 175 GLU B CB  1 
ATOM   2888 C  CG  . GLU B 1 175 ? 13.889 23.605 49.299  1.00 46.20 ? 175 GLU B CG  1 
ATOM   2889 C  CD  . GLU B 1 175 ? 13.407 23.911 47.903  1.00 48.30 ? 175 GLU B CD  1 
ATOM   2890 O  OE1 . GLU B 1 175 ? 12.241 23.585 47.595  1.00 51.28 ? 175 GLU B OE1 1 
ATOM   2891 O  OE2 . GLU B 1 175 ? 14.189 24.479 47.112  1.00 52.05 ? 175 GLU B OE2 1 
ATOM   2892 N  N   . GLU B 1 176 ? 14.369 27.067 49.758  1.00 41.32 ? 176 GLU B N   1 
ATOM   2893 C  CA  . GLU B 1 176 ? 13.476 27.998 50.442  1.00 43.30 ? 176 GLU B CA  1 
ATOM   2894 C  C   . GLU B 1 176 ? 12.369 28.164 49.412  1.00 43.68 ? 176 GLU B C   1 
ATOM   2895 O  O   . GLU B 1 176 ? 12.306 29.176 48.717  1.00 43.39 ? 176 GLU B O   1 
ATOM   2896 C  CB  . GLU B 1 176 ? 14.170 29.342 50.682  1.00 43.62 ? 176 GLU B CB  1 
ATOM   2897 C  CG  . GLU B 1 176 ? 15.190 29.331 51.802  1.00 45.46 ? 176 GLU B CG  1 
ATOM   2898 C  CD  . GLU B 1 176 ? 15.962 30.631 51.894  1.00 48.11 ? 176 GLU B CD  1 
ATOM   2899 O  OE1 . GLU B 1 176 ? 15.333 31.706 51.820  1.00 49.96 ? 176 GLU B OE1 1 
ATOM   2900 O  OE2 . GLU B 1 176 ? 17.200 30.584 52.050  1.00 50.27 ? 176 GLU B OE2 1 
ATOM   2901 N  N   . ASN B 1 177 ? 11.516 27.146 49.312  1.00 44.84 ? 177 ASN B N   1 
ATOM   2902 C  CA  . ASN B 1 177 ? 10.437 27.111 48.328  1.00 45.50 ? 177 ASN B CA  1 
ATOM   2903 C  C   . ASN B 1 177 ? 11.156 26.810 47.012  1.00 45.02 ? 177 ASN B C   1 
ATOM   2904 O  O   . ASN B 1 177 ? 10.879 25.812 46.343  1.00 44.16 ? 177 ASN B O   1 
ATOM   2905 C  CB  . ASN B 1 177 ? 9.729  28.465 48.238  1.00 46.75 ? 177 ASN B CB  1 
ATOM   2906 C  CG  . ASN B 1 177 ? 9.287  28.980 49.590  1.00 48.73 ? 177 ASN B CG  1 
ATOM   2907 O  OD1 . ASN B 1 177 ? 8.362  28.444 50.203  1.00 51.38 ? 177 ASN B OD1 1 
ATOM   2908 N  ND2 . ASN B 1 177 ? 9.953  30.024 50.069  1.00 47.75 ? 177 ASN B ND2 1 
ATOM   2909 N  N   . GLY B 1 178 ? 12.098 27.684 46.667  1.00 43.36 ? 178 GLY B N   1 
ATOM   2910 C  CA  . GLY B 1 178 ? 12.883 27.526 45.460  1.00 40.11 ? 178 GLY B CA  1 
ATOM   2911 C  C   . GLY B 1 178 ? 14.362 27.426 45.799  1.00 38.94 ? 178 GLY B C   1 
ATOM   2912 O  O   . GLY B 1 178 ? 14.750 27.453 46.968  1.00 35.51 ? 178 GLY B O   1 
ATOM   2913 N  N   . LYS B 1 179 ? 15.193 27.312 44.771  1.00 38.33 ? 179 LYS B N   1 
ATOM   2914 C  CA  . LYS B 1 179 ? 16.634 27.199 44.961  1.00 38.16 ? 179 LYS B CA  1 
ATOM   2915 C  C   . LYS B 1 179 ? 17.237 28.571 45.253  1.00 36.38 ? 179 LYS B C   1 
ATOM   2916 O  O   . LYS B 1 179 ? 17.135 29.486 44.441  1.00 35.66 ? 179 LYS B O   1 
ATOM   2917 C  CB  . LYS B 1 179 ? 17.260 26.568 43.710  1.00 39.77 ? 179 LYS B CB  1 
ATOM   2918 C  CG  . LYS B 1 179 ? 18.779 26.487 43.701  1.00 42.64 ? 179 LYS B CG  1 
ATOM   2919 C  CD  . LYS B 1 179 ? 19.411 27.708 43.036  1.00 46.24 ? 179 LYS B CD  1 
ATOM   2920 C  CE  . LYS B 1 179 ? 18.865 27.950 41.618  1.00 47.48 ? 179 LYS B CE  1 
ATOM   2921 N  NZ  . LYS B 1 179 ? 19.020 26.784 40.693  1.00 46.80 ? 179 LYS B NZ  1 
ATOM   2922 N  N   . VAL B 1 180 ? 17.866 28.707 46.418  1.00 35.54 ? 180 VAL B N   1 
ATOM   2923 C  CA  . VAL B 1 180 ? 18.468 29.972 46.826  1.00 34.19 ? 180 VAL B CA  1 
ATOM   2924 C  C   . VAL B 1 180 ? 19.975 29.891 47.086  1.00 34.63 ? 180 VAL B C   1 
ATOM   2925 O  O   . VAL B 1 180 ? 20.444 29.050 47.852  1.00 34.56 ? 180 VAL B O   1 
ATOM   2926 C  CB  . VAL B 1 180 ? 17.782 30.518 48.105  1.00 34.89 ? 180 VAL B CB  1 
ATOM   2927 C  CG1 . VAL B 1 180 ? 18.500 31.769 48.596  1.00 34.96 ? 180 VAL B CG1 1 
ATOM   2928 C  CG2 . VAL B 1 180 ? 16.319 30.833 47.816  1.00 34.35 ? 180 VAL B CG2 1 
ATOM   2929 N  N   . VAL B 1 181 ? 20.728 30.775 46.442  1.00 34.83 ? 181 VAL B N   1 
ATOM   2930 C  CA  . VAL B 1 181 ? 22.170 30.823 46.622  1.00 35.16 ? 181 VAL B CA  1 
ATOM   2931 C  C   . VAL B 1 181 ? 22.463 31.990 47.554  1.00 36.64 ? 181 VAL B C   1 
ATOM   2932 O  O   . VAL B 1 181 ? 22.339 33.149 47.161  1.00 37.52 ? 181 VAL B O   1 
ATOM   2933 C  CB  . VAL B 1 181 ? 22.904 31.047 45.281  1.00 34.73 ? 181 VAL B CB  1 
ATOM   2934 C  CG1 . VAL B 1 181 ? 24.378 31.315 45.536  1.00 32.44 ? 181 VAL B CG1 1 
ATOM   2935 C  CG2 . VAL B 1 181 ? 22.747 29.819 44.389  1.00 31.72 ? 181 VAL B CG2 1 
ATOM   2936 N  N   . VAL B 1 182 ? 22.842 31.684 48.791  1.00 37.62 ? 182 VAL B N   1 
ATOM   2937 C  CA  . VAL B 1 182 ? 23.129 32.724 49.769  1.00 39.70 ? 182 VAL B CA  1 
ATOM   2938 C  C   . VAL B 1 182 ? 24.513 32.553 50.391  1.00 40.69 ? 182 VAL B C   1 
ATOM   2939 O  O   . VAL B 1 182 ? 25.165 31.524 50.208  1.00 41.25 ? 182 VAL B O   1 
ATOM   2940 C  CB  . VAL B 1 182 ? 22.053 32.735 50.880  1.00 40.15 ? 182 VAL B CB  1 
ATOM   2941 C  CG1 . VAL B 1 182 ? 22.129 31.455 51.694  1.00 40.63 ? 182 VAL B CG1 1 
ATOM   2942 C  CG2 . VAL B 1 182 ? 22.220 33.965 51.763  1.00 43.29 ? 182 VAL B CG2 1 
ATOM   2943 N  N   . LYS B 1 183 ? 24.961 33.573 51.118  1.00 41.27 ? 183 LYS B N   1 
ATOM   2944 C  CA  . LYS B 1 183 ? 26.269 33.547 51.764  1.00 42.44 ? 183 LYS B CA  1 
ATOM   2945 C  C   . LYS B 1 183 ? 26.398 32.434 52.803  1.00 42.03 ? 183 LYS B C   1 
ATOM   2946 O  O   . LYS B 1 183 ? 25.418 32.029 53.425  1.00 40.09 ? 183 LYS B O   1 
ATOM   2947 C  CB  . LYS B 1 183 ? 26.553 34.904 52.417  1.00 43.66 ? 183 LYS B CB  1 
ATOM   2948 C  CG  . LYS B 1 183 ? 26.684 36.059 51.426  1.00 44.39 ? 183 LYS B CG  1 
ATOM   2949 C  CD  . LYS B 1 183 ? 26.852 37.386 52.149  1.00 45.18 ? 183 LYS B CD  1 
ATOM   2950 C  CE  . LYS B 1 183 ? 27.254 38.508 51.196  1.00 48.74 ? 183 LYS B CE  1 
ATOM   2951 N  NZ  . LYS B 1 183 ? 26.216 38.814 50.173  1.00 49.27 ? 183 LYS B NZ  1 
ATOM   2952 N  N   . ASP B 1 184 ? 27.621 31.942 52.976  1.00 43.64 ? 184 ASP B N   1 
ATOM   2953 C  CA  . ASP B 1 184 ? 27.914 30.881 53.934  1.00 45.65 ? 184 ASP B CA  1 
ATOM   2954 C  C   . ASP B 1 184 ? 28.508 31.475 55.208  1.00 46.95 ? 184 ASP B C   1 
ATOM   2955 O  O   . ASP B 1 184 ? 29.605 32.029 55.192  1.00 46.24 ? 184 ASP B O   1 
ATOM   2956 C  CB  . ASP B 1 184 ? 28.885 29.873 53.307  1.00 45.94 ? 184 ASP B CB  1 
ATOM   2957 C  CG  . ASP B 1 184 ? 29.546 28.970 54.335  1.00 46.89 ? 184 ASP B CG  1 
ATOM   2958 O  OD1 . ASP B 1 184 ? 28.836 28.388 55.184  1.00 46.72 ? 184 ASP B OD1 1 
ATOM   2959 O  OD2 . ASP B 1 184 ? 30.787 28.837 54.285  1.00 47.03 ? 184 ASP B OD2 1 
ATOM   2960 N  N   . ASN B 1 185 ? 27.774 31.345 56.309  1.00 49.52 ? 185 ASN B N   1 
ATOM   2961 C  CA  . ASN B 1 185 ? 28.191 31.882 57.603  1.00 52.50 ? 185 ASN B CA  1 
ATOM   2962 C  C   . ASN B 1 185 ? 29.630 31.584 58.047  1.00 51.79 ? 185 ASN B C   1 
ATOM   2963 O  O   . ASN B 1 185 ? 30.390 32.509 58.336  1.00 51.41 ? 185 ASN B O   1 
ATOM   2964 C  CB  . ASN B 1 185 ? 27.203 31.427 58.689  1.00 56.35 ? 185 ASN B CB  1 
ATOM   2965 C  CG  . ASN B 1 185 ? 27.608 31.884 60.088  1.00 60.35 ? 185 ASN B CG  1 
ATOM   2966 O  OD1 . ASN B 1 185 ? 28.604 31.416 60.646  1.00 62.54 ? 185 ASN B OD1 1 
ATOM   2967 N  ND2 . ASN B 1 185 ? 26.831 32.801 60.660  1.00 61.40 ? 185 ASN B ND2 1 
ATOM   2968 N  N   . PRO B 1 186 ? 30.022 30.297 58.111  1.00 51.75 ? 186 PRO B N   1 
ATOM   2969 C  CA  . PRO B 1 186 ? 31.384 29.950 58.534  1.00 51.13 ? 186 PRO B CA  1 
ATOM   2970 C  C   . PRO B 1 186 ? 32.487 30.038 57.473  1.00 49.63 ? 186 PRO B C   1 
ATOM   2971 O  O   . PRO B 1 186 ? 33.567 29.473 57.647  1.00 48.58 ? 186 PRO B O   1 
ATOM   2972 C  CB  . PRO B 1 186 ? 31.215 28.534 59.070  1.00 51.78 ? 186 PRO B CB  1 
ATOM   2973 C  CG  . PRO B 1 186 ? 30.201 27.969 58.137  1.00 53.43 ? 186 PRO B CG  1 
ATOM   2974 C  CD  . PRO B 1 186 ? 29.181 29.087 58.038  1.00 52.95 ? 186 PRO B CD  1 
ATOM   2975 N  N   . LYS B 1 187 ? 32.232 30.753 56.384  1.00 48.45 ? 187 LYS B N   1 
ATOM   2976 C  CA  . LYS B 1 187 ? 33.234 30.878 55.334  1.00 47.74 ? 187 LYS B CA  1 
ATOM   2977 C  C   . LYS B 1 187 ? 34.458 31.624 55.860  1.00 47.93 ? 187 LYS B C   1 
ATOM   2978 O  O   . LYS B 1 187 ? 35.566 31.042 55.841  1.00 46.87 ? 187 LYS B O   1 
ATOM   2979 C  CB  . LYS B 1 187 ? 32.654 31.631 54.138  1.00 47.01 ? 187 LYS B CB  1 
ATOM   2980 C  CG  . LYS B 1 187 ? 33.341 31.321 52.823  1.00 48.18 ? 187 LYS B CG  1 
ATOM   2981 C  CD  . LYS B 1 187 ? 34.823 31.640 52.832  1.00 47.07 ? 187 LYS B CD  1 
ATOM   2982 C  CE  . LYS B 1 187 ? 35.428 31.376 51.468  1.00 46.68 ? 187 LYS B CE  1 
ATOM   2983 N  NZ  . LYS B 1 187 ? 36.856 31.773 51.402  1.00 49.39 ? 187 LYS B NZ  1 
HETATM 2984 C  C1  . 6PG C 2 .   ? 39.130 19.557 17.389  1.00 23.06 ? 600 6PG A C1  1 
HETATM 2985 C  C2  . 6PG C 2 .   ? 38.550 18.127 17.640  1.00 20.80 ? 600 6PG A C2  1 
HETATM 2986 C  C3  . 6PG C 2 .   ? 37.396 17.743 16.632  1.00 20.98 ? 600 6PG A C3  1 
HETATM 2987 C  C4  . 6PG C 2 .   ? 37.848 17.594 15.118  1.00 21.23 ? 600 6PG A C4  1 
HETATM 2988 C  C5  . 6PG C 2 .   ? 36.701 17.223 14.126  1.00 19.11 ? 600 6PG A C5  1 
HETATM 2989 C  C6  . 6PG C 2 .   ? 37.089 17.209 12.644  1.00 17.01 ? 600 6PG A C6  1 
HETATM 2990 O  O1A . 6PG C 2 .   ? 40.330 19.718 17.317  1.00 22.79 ? 600 6PG A O1A 1 
HETATM 2991 O  O1  . 6PG C 2 .   ? 38.374 20.511 17.259  1.00 23.49 ? 600 6PG A O1  1 
HETATM 2992 O  O2  . 6PG C 2 .   ? 39.575 17.144 17.516  1.00 18.26 ? 600 6PG A O2  1 
HETATM 2993 O  O3  . 6PG C 2 .   ? 36.370 18.746 16.773  1.00 22.42 ? 600 6PG A O3  1 
HETATM 2994 O  O4  . 6PG C 2 .   ? 38.406 18.822 14.664  1.00 22.19 ? 600 6PG A O4  1 
HETATM 2995 O  O5  . 6PG C 2 .   ? 36.231 15.928 14.441  1.00 19.04 ? 600 6PG A O5  1 
HETATM 2996 O  O6  . 6PG C 2 .   ? 38.236 16.384 12.466  1.00 17.61 ? 600 6PG A O6  1 
HETATM 2997 P  P   . 6PG C 2 .   ? 39.502 17.025 11.836  1.00 21.10 ? 600 6PG A P   1 
HETATM 2998 O  O1P . 6PG C 2 .   ? 40.636 15.994 11.832  1.00 19.24 ? 600 6PG A O1P 1 
HETATM 2999 O  O2P . 6PG C 2 .   ? 39.195 17.516 10.386  1.00 20.09 ? 600 6PG A O2P 1 
HETATM 3000 O  O3P . 6PG C 2 .   ? 39.921 18.270 12.672  1.00 18.43 ? 600 6PG A O3P 1 
HETATM 3001 FE FE  . FE  D 3 .   ? 42.421 17.858 18.416  1.00 64.21 ? 201 FE  A FE  1 
HETATM 3002 C  C1  . 6PG E 2 .   ? 37.380 14.339 39.084  1.00 28.65 ? 601 6PG B C1  1 
HETATM 3003 C  C2  . 6PG E 2 .   ? 36.159 15.198 38.635  1.00 28.39 ? 601 6PG B C2  1 
HETATM 3004 C  C3  . 6PG E 2 .   ? 34.799 14.699 39.257  1.00 28.29 ? 601 6PG B C3  1 
HETATM 3005 C  C4  . 6PG E 2 .   ? 34.665 14.948 40.811  1.00 30.61 ? 601 6PG B C4  1 
HETATM 3006 C  C5  . 6PG E 2 .   ? 33.374 14.371 41.452  1.00 30.61 ? 601 6PG B C5  1 
HETATM 3007 C  C6  . 6PG E 2 .   ? 33.409 14.302 42.988  1.00 29.34 ? 601 6PG B C6  1 
HETATM 3008 O  O1A . 6PG E 2 .   ? 38.398 14.890 39.425  1.00 28.51 ? 601 6PG B O1A 1 
HETATM 3009 O  O1  . 6PG E 2 .   ? 37.302 13.119 39.093  1.00 28.12 ? 601 6PG B O1  1 
HETATM 3010 O  O2  . 6PG E 2 .   ? 36.345 16.564 39.022  1.00 27.67 ? 601 6PG B O2  1 
HETATM 3011 O  O3  . 6PG E 2 .   ? 34.679 13.298 38.945  1.00 27.57 ? 601 6PG B O3  1 
HETATM 3012 O  O4  . 6PG E 2 .   ? 35.759 14.349 41.484  1.00 30.30 ? 601 6PG B O4  1 
HETATM 3013 O  O5  . 6PG E 2 .   ? 32.278 15.202 41.093  1.00 30.55 ? 601 6PG B O5  1 
HETATM 3014 O  O6  . 6PG E 2 .   ? 33.380 15.630 43.508  1.00 32.65 ? 601 6PG B O6  1 
HETATM 3015 P  P   . 6PG E 2 .   ? 34.657 16.142 44.254  1.00 34.43 ? 601 6PG B P   1 
HETATM 3016 O  O1P . 6PG E 2 .   ? 34.523 15.997 45.786  1.00 37.50 ? 601 6PG B O1P 1 
HETATM 3017 O  O2P . 6PG E 2 .   ? 35.902 15.360 43.754  1.00 32.90 ? 601 6PG B O2P 1 
HETATM 3018 O  O3P . 6PG E 2 .   ? 34.854 17.640 43.884  1.00 37.96 ? 601 6PG B O3P 1 
HETATM 3019 O  O   . HOH F 4 .   ? 45.105 16.083 7.533   1.00 20.88 ? 601 HOH A O   1 
HETATM 3020 O  O   . HOH F 4 .   ? 25.739 6.980  11.647  1.00 24.26 ? 602 HOH A O   1 
HETATM 3021 O  O   . HOH F 4 .   ? 37.539 13.707 14.562  1.00 17.98 ? 603 HOH A O   1 
HETATM 3022 O  O   . HOH F 4 .   ? 21.829 10.602 13.688  1.00 22.84 ? 604 HOH A O   1 
HETATM 3023 O  O   . HOH F 4 .   ? 36.226 5.921  5.641   1.00 19.98 ? 605 HOH A O   1 
HETATM 3024 O  O   . HOH F 4 .   ? 34.212 17.231 17.584  1.00 12.94 ? 606 HOH A O   1 
HETATM 3025 O  O   . HOH F 4 .   ? 38.746 5.429  4.892   1.00 25.91 ? 607 HOH A O   1 
HETATM 3026 O  O   . HOH F 4 .   ? 34.654 25.044 14.157  1.00 17.86 ? 608 HOH A O   1 
HETATM 3027 O  O   . HOH F 4 .   ? 36.813 25.746 25.839  1.00 20.55 ? 609 HOH A O   1 
HETATM 3028 O  O   . HOH F 4 .   ? 55.296 17.994 18.984  1.00 22.12 ? 610 HOH A O   1 
HETATM 3029 O  O   . HOH F 4 .   ? 37.328 6.518  -2.078  1.00 22.39 ? 611 HOH A O   1 
HETATM 3030 O  O   . HOH F 4 .   ? 21.767 7.360  17.127  1.00 28.51 ? 612 HOH A O   1 
HETATM 3031 O  O   . HOH F 4 .   ? 47.412 23.745 12.113  1.00 23.77 ? 613 HOH A O   1 
HETATM 3032 O  O   . HOH F 4 .   ? 27.976 6.813  6.191   1.00 18.27 ? 614 HOH A O   1 
HETATM 3033 O  O   . HOH F 4 .   ? 41.102 13.640 -4.627  1.00 23.51 ? 615 HOH A O   1 
HETATM 3034 O  O   . HOH F 4 .   ? 35.468 30.845 25.869  1.00 22.10 ? 616 HOH A O   1 
HETATM 3035 O  O   . HOH F 4 .   ? 20.067 22.670 17.734  1.00 27.65 ? 617 HOH A O   1 
HETATM 3036 O  O   . HOH F 4 .   ? 48.621 38.343 39.863  1.00 27.87 ? 618 HOH A O   1 
HETATM 3037 O  O   . HOH F 4 .   ? 26.938 30.737 31.688  1.00 26.19 ? 619 HOH A O   1 
HETATM 3038 O  O   . HOH F 4 .   ? 39.509 13.681 13.040  1.00 22.01 ? 620 HOH A O   1 
HETATM 3039 O  O   . HOH F 4 .   ? 33.295 24.414 2.279   1.00 27.95 ? 621 HOH A O   1 
HETATM 3040 O  O   . HOH F 4 .   ? 43.102 26.565 21.824  1.00 26.66 ? 622 HOH A O   1 
HETATM 3041 O  O   . HOH F 4 .   ? 45.498 20.788 29.286  1.00 19.16 ? 623 HOH A O   1 
HETATM 3042 O  O   . HOH F 4 .   ? 43.629 20.176 18.947  1.00 20.87 ? 624 HOH A O   1 
HETATM 3043 O  O   . HOH F 4 .   ? 36.848 31.879 27.825  1.00 29.40 ? 625 HOH A O   1 
HETATM 3044 O  O   . HOH F 4 .   ? 24.881 21.213 12.053  1.00 26.85 ? 626 HOH A O   1 
HETATM 3045 O  O   . HOH F 4 .   ? 40.743 20.162 -0.579  1.00 26.09 ? 627 HOH A O   1 
HETATM 3046 O  O   . HOH F 4 .   ? 43.373 10.484 3.585   1.00 24.35 ? 628 HOH A O   1 
HETATM 3047 O  O   . HOH F 4 .   ? 47.851 9.987  -0.464  1.00 41.04 ? 629 HOH A O   1 
HETATM 3048 O  O   . HOH F 4 .   ? 40.761 6.177  6.797   1.00 26.24 ? 630 HOH A O   1 
HETATM 3049 O  O   . HOH F 4 .   ? 35.830 -1.761 17.928  1.00 37.96 ? 631 HOH A O   1 
HETATM 3050 O  O   . HOH F 4 .   ? 48.340 24.040 15.394  1.00 22.82 ? 632 HOH A O   1 
HETATM 3051 O  O   . HOH F 4 .   ? 34.138 26.624 7.287   1.00 29.97 ? 633 HOH A O   1 
HETATM 3052 O  O   . HOH F 4 .   ? 36.023 28.867 19.894  1.00 29.63 ? 634 HOH A O   1 
HETATM 3053 O  O   . HOH F 4 .   ? 39.629 13.004 -2.055  1.00 33.44 ? 635 HOH A O   1 
HETATM 3054 O  O   . HOH F 4 .   ? 35.151 32.778 29.821  1.00 24.03 ? 636 HOH A O   1 
HETATM 3055 O  O   . HOH F 4 .   ? 46.879 13.079 -0.763  1.00 29.35 ? 637 HOH A O   1 
HETATM 3056 O  O   . HOH F 4 .   ? 45.582 26.963 32.044  1.00 27.07 ? 638 HOH A O   1 
HETATM 3057 O  O   . HOH F 4 .   ? 43.952 7.358  4.142   1.00 25.81 ? 639 HOH A O   1 
HETATM 3058 O  O   . HOH F 4 .   ? 39.351 21.012 -4.332  1.00 31.65 ? 640 HOH A O   1 
HETATM 3059 O  O   . HOH F 4 .   ? 27.921 10.030 -7.623  1.00 29.87 ? 641 HOH A O   1 
HETATM 3060 O  O   . HOH F 4 .   ? 30.836 7.360  -4.943  1.00 37.25 ? 642 HOH A O   1 
HETATM 3061 O  O   . HOH F 4 .   ? 46.754 12.175 20.497  1.00 26.65 ? 643 HOH A O   1 
HETATM 3062 O  O   . HOH F 4 .   ? 27.120 8.795  -0.522  1.00 27.92 ? 644 HOH A O   1 
HETATM 3063 O  O   . HOH F 4 .   ? 25.626 18.926 1.554   1.00 27.16 ? 645 HOH A O   1 
HETATM 3064 O  O   . HOH F 4 .   ? 26.050 16.013 3.226   1.00 28.47 ? 646 HOH A O   1 
HETATM 3065 O  O   . HOH F 4 .   ? 29.816 -7.520 6.617   1.00 57.17 ? 647 HOH A O   1 
HETATM 3066 O  O   . HOH F 4 .   ? 52.893 16.889 15.402  1.00 22.63 ? 648 HOH A O   1 
HETATM 3067 O  O   . HOH F 4 .   ? 43.461 18.785 -0.261  1.00 36.92 ? 649 HOH A O   1 
HETATM 3068 O  O   . HOH F 4 .   ? 23.247 27.443 28.879  1.00 39.21 ? 650 HOH A O   1 
HETATM 3069 O  O   . HOH F 4 .   ? 44.006 29.634 27.771  1.00 32.37 ? 651 HOH A O   1 
HETATM 3070 O  O   . HOH F 4 .   ? 50.835 13.579 27.509  1.00 23.43 ? 652 HOH A O   1 
HETATM 3071 O  O   . HOH F 4 .   ? 40.961 31.862 34.920  1.00 25.70 ? 653 HOH A O   1 
HETATM 3072 O  O   . HOH F 4 .   ? 36.128 23.709 -0.858  1.00 29.29 ? 654 HOH A O   1 
HETATM 3073 O  O   . HOH F 4 .   ? 38.859 20.282 10.035  1.00 36.83 ? 655 HOH A O   1 
HETATM 3074 O  O   . HOH F 4 .   ? 41.949 7.241  1.960   1.00 29.60 ? 656 HOH A O   1 
HETATM 3075 O  O   . HOH F 4 .   ? 26.894 0.748  6.361   1.00 39.33 ? 657 HOH A O   1 
HETATM 3076 O  O   . HOH F 4 .   ? 45.815 24.571 15.814  1.00 33.08 ? 658 HOH A O   1 
HETATM 3077 O  O   . HOH F 4 .   ? 24.502 2.901  22.214  1.00 29.47 ? 659 HOH A O   1 
HETATM 3078 O  O   . HOH F 4 .   ? 48.923 -0.277 5.247   1.00 38.73 ? 660 HOH A O   1 
HETATM 3079 O  O   . HOH F 4 .   ? 53.865 6.244  3.898   1.00 47.62 ? 661 HOH A O   1 
HETATM 3080 O  O   . HOH F 4 .   ? 50.157 -3.506 15.502  1.00 32.59 ? 662 HOH A O   1 
HETATM 3081 O  O   . HOH F 4 .   ? 36.584 11.345 -12.596 1.00 47.76 ? 663 HOH A O   1 
HETATM 3082 O  O   . HOH F 4 .   ? 47.939 20.859 28.083  1.00 31.66 ? 664 HOH A O   1 
HETATM 3083 O  O   . HOH F 4 .   ? 22.133 12.149 21.281  1.00 42.82 ? 665 HOH A O   1 
HETATM 3084 O  O   . HOH F 4 .   ? 43.997 11.673 -5.651  1.00 56.56 ? 666 HOH A O   1 
HETATM 3085 O  O   . HOH F 4 .   ? 33.882 0.570  20.910  1.00 32.49 ? 667 HOH A O   1 
HETATM 3086 O  O   . HOH F 4 .   ? 36.224 30.882 23.422  1.00 29.83 ? 668 HOH A O   1 
HETATM 3087 O  O   . HOH F 4 .   ? 25.244 13.306 3.697   1.00 28.15 ? 669 HOH A O   1 
HETATM 3088 O  O   . HOH F 4 .   ? 51.415 9.888  9.986   1.00 48.53 ? 670 HOH A O   1 
HETATM 3089 O  O   . HOH F 4 .   ? 45.192 11.994 2.468   1.00 24.93 ? 671 HOH A O   1 
HETATM 3090 O  O   . HOH F 4 .   ? 46.407 31.690 21.988  1.00 33.12 ? 672 HOH A O   1 
HETATM 3091 O  O   . HOH F 4 .   ? 23.652 16.287 -9.046  1.00 44.31 ? 673 HOH A O   1 
HETATM 3092 O  O   . HOH F 4 .   ? 48.892 13.696 18.606  1.00 31.87 ? 674 HOH A O   1 
HETATM 3093 O  O   . HOH F 4 .   ? 37.791 0.972  -2.103  1.00 42.28 ? 675 HOH A O   1 
HETATM 3094 O  O   . HOH F 4 .   ? 39.405 38.328 38.286  1.00 27.83 ? 676 HOH A O   1 
HETATM 3095 O  O   . HOH F 4 .   ? 54.455 20.754 15.948  1.00 28.42 ? 677 HOH A O   1 
HETATM 3096 O  O   . HOH F 4 .   ? 43.900 9.905  -3.229  1.00 40.70 ? 678 HOH A O   1 
HETATM 3097 O  O   . HOH F 4 .   ? 46.626 8.356  1.107   1.00 30.50 ? 679 HOH A O   1 
HETATM 3098 O  O   . HOH F 4 .   ? 44.186 19.329 4.511   1.00 26.02 ? 680 HOH A O   1 
HETATM 3099 O  O   . HOH F 4 .   ? 23.002 3.034  9.749   1.00 47.25 ? 681 HOH A O   1 
HETATM 3100 O  O   . HOH F 4 .   ? 56.615 19.385 15.820  1.00 26.39 ? 682 HOH A O   1 
HETATM 3101 O  O   . HOH F 4 .   ? 20.785 7.783  14.574  1.00 27.58 ? 683 HOH A O   1 
HETATM 3102 O  O   . HOH F 4 .   ? 38.050 21.329 13.535  1.00 37.61 ? 684 HOH A O   1 
HETATM 3103 O  O   . HOH F 4 .   ? 44.963 36.775 42.040  1.00 25.83 ? 685 HOH A O   1 
HETATM 3104 O  O   . HOH F 4 .   ? 33.012 0.672  23.535  1.00 32.45 ? 686 HOH A O   1 
HETATM 3105 O  O   . HOH F 4 .   ? 37.687 -5.196 9.117   1.00 31.73 ? 687 HOH A O   1 
HETATM 3106 O  O   . HOH F 4 .   ? 45.392 16.276 0.492   1.00 29.10 ? 688 HOH A O   1 
HETATM 3107 O  O   . HOH F 4 .   ? 41.522 31.745 26.683  1.00 40.12 ? 689 HOH A O   1 
HETATM 3108 O  O   . HOH F 4 .   ? 44.842 8.984  -0.537  1.00 38.54 ? 690 HOH A O   1 
HETATM 3109 O  O   . HOH F 4 .   ? 39.738 22.499 16.080  1.00 40.30 ? 691 HOH A O   1 
HETATM 3110 O  O   . HOH F 4 .   ? 23.411 5.624  11.397  1.00 27.04 ? 692 HOH A O   1 
HETATM 3111 O  O   . HOH F 4 .   ? 45.541 19.292 1.115   1.00 41.75 ? 693 HOH A O   1 
HETATM 3112 O  O   . HOH F 4 .   ? 27.177 5.227  3.874   1.00 36.73 ? 694 HOH A O   1 
HETATM 3113 O  O   . HOH F 4 .   ? 20.593 7.103  19.513  1.00 39.76 ? 695 HOH A O   1 
HETATM 3114 O  O   . HOH F 4 .   ? 34.296 30.675 20.986  1.00 44.35 ? 696 HOH A O   1 
HETATM 3115 O  O   . HOH F 4 .   ? 43.445 27.365 19.280  1.00 31.89 ? 697 HOH A O   1 
HETATM 3116 O  O   . HOH F 4 .   ? 37.249 20.476 -5.939  1.00 34.11 ? 698 HOH A O   1 
HETATM 3117 O  O   . HOH F 4 .   ? 44.394 22.754 20.495  1.00 27.86 ? 699 HOH A O   1 
HETATM 3118 O  O   . HOH F 4 .   ? 20.119 12.879 13.221  1.00 33.92 ? 700 HOH A O   1 
HETATM 3119 O  O   . HOH F 4 .   ? 36.824 3.620  -2.716  1.00 30.48 ? 701 HOH A O   1 
HETATM 3120 O  O   . HOH F 4 .   ? 24.804 18.048 4.435   1.00 37.22 ? 702 HOH A O   1 
HETATM 3121 O  O   . HOH F 4 .   ? 25.008 16.585 -3.611  1.00 36.57 ? 703 HOH A O   1 
HETATM 3122 O  O   . HOH F 4 .   ? 23.415 19.186 12.794  1.00 29.41 ? 704 HOH A O   1 
HETATM 3123 O  O   . HOH F 4 .   ? 28.997 31.523 25.690  1.00 55.05 ? 705 HOH A O   1 
HETATM 3124 O  O   . HOH F 4 .   ? 38.376 -2.503 18.602  1.00 31.08 ? 706 HOH A O   1 
HETATM 3125 O  O   . HOH F 4 .   ? 42.896 19.474 2.192   1.00 41.83 ? 707 HOH A O   1 
HETATM 3126 O  O   . HOH F 4 .   ? 49.303 15.021 9.818   1.00 28.93 ? 708 HOH A O   1 
HETATM 3127 O  O   . HOH F 4 .   ? 55.290 16.655 16.664  1.00 27.72 ? 709 HOH A O   1 
HETATM 3128 O  O   . HOH F 4 .   ? 24.233 25.758 12.522  1.00 37.24 ? 710 HOH A O   1 
HETATM 3129 O  O   . HOH F 4 .   ? 23.101 4.659  16.599  1.00 47.91 ? 711 HOH A O   1 
HETATM 3130 O  O   . HOH F 4 .   ? 41.093 37.077 32.195  1.00 34.15 ? 712 HOH A O   1 
HETATM 3131 O  O   . HOH F 4 .   ? 26.979 9.348  -5.277  1.00 41.14 ? 713 HOH A O   1 
HETATM 3132 O  O   . HOH F 4 .   ? 32.748 -8.102 4.186   1.00 32.24 ? 714 HOH A O   1 
HETATM 3133 O  O   . HOH F 4 .   ? 25.736 27.978 17.530  1.00 32.19 ? 715 HOH A O   1 
HETATM 3134 O  O   . HOH F 4 .   ? 31.755 31.162 25.235  1.00 37.11 ? 716 HOH A O   1 
HETATM 3135 O  O   . HOH F 4 .   ? 22.050 5.827  13.514  1.00 42.33 ? 717 HOH A O   1 
HETATM 3136 O  O   . HOH F 4 .   ? 39.539 24.027 1.419   1.00 34.76 ? 718 HOH A O   1 
HETATM 3137 O  O   . HOH F 4 .   ? 41.111 22.146 9.419   1.00 31.15 ? 719 HOH A O   1 
HETATM 3138 O  O   . HOH F 4 .   ? 25.850 3.021  4.666   1.00 44.88 ? 720 HOH A O   1 
HETATM 3139 O  O   . HOH F 4 .   ? 41.906 7.494  -8.299  1.00 44.13 ? 721 HOH A O   1 
HETATM 3140 O  O   . HOH F 4 .   ? 22.157 24.107 21.451  1.00 35.61 ? 722 HOH A O   1 
HETATM 3141 O  O   . HOH F 4 .   ? 24.883 9.855  1.353   1.00 41.35 ? 723 HOH A O   1 
HETATM 3142 O  O   . HOH F 4 .   ? 34.449 -3.946 11.212  1.00 45.49 ? 724 HOH A O   1 
HETATM 3143 O  O   . HOH F 4 .   ? 21.792 29.723 21.717  1.00 52.85 ? 725 HOH A O   1 
HETATM 3144 O  O   . HOH F 4 .   ? 36.790 -4.974 11.577  1.00 43.00 ? 726 HOH A O   1 
HETATM 3145 O  O   . HOH F 4 .   ? 45.572 32.933 41.647  1.00 39.16 ? 727 HOH A O   1 
HETATM 3146 O  O   . HOH F 4 .   ? 50.965 7.054  23.994  1.00 27.77 ? 728 HOH A O   1 
HETATM 3147 O  O   . HOH F 4 .   ? 48.285 -1.743 11.739  1.00 30.86 ? 729 HOH A O   1 
HETATM 3148 O  O   . HOH F 4 .   ? 37.464 19.458 -8.468  1.00 50.37 ? 730 HOH A O   1 
HETATM 3149 O  O   . HOH F 4 .   ? 43.655 6.515  -0.127  1.00 31.67 ? 731 HOH A O   1 
HETATM 3150 O  O   . HOH F 4 .   ? 39.674 6.658  -9.304  1.00 38.22 ? 732 HOH A O   1 
HETATM 3151 O  O   . HOH F 4 .   ? 32.766 33.656 28.227  1.00 39.42 ? 733 HOH A O   1 
HETATM 3152 O  O   . HOH F 4 .   ? 17.300 13.864 22.621  1.00 38.72 ? 734 HOH A O   1 
HETATM 3153 O  O   . HOH F 4 .   ? 20.338 10.899 6.888   1.00 38.15 ? 735 HOH A O   1 
HETATM 3154 O  O   . HOH F 4 .   ? 43.613 20.531 6.591   1.00 38.51 ? 736 HOH A O   1 
HETATM 3155 O  O   . HOH F 4 .   ? 50.135 24.469 13.467  1.00 46.54 ? 737 HOH A O   1 
HETATM 3156 O  O   . HOH F 4 .   ? 36.443 35.583 30.785  1.00 42.62 ? 738 HOH A O   1 
HETATM 3157 O  O   . HOH F 4 .   ? 52.271 8.322  25.944  1.00 45.39 ? 739 HOH A O   1 
HETATM 3158 O  O   . HOH F 4 .   ? 52.720 18.545 8.854   1.00 33.06 ? 740 HOH A O   1 
HETATM 3159 O  O   . HOH F 4 .   ? 27.227 -4.183 5.176   1.00 43.15 ? 741 HOH A O   1 
HETATM 3160 O  O   . HOH F 4 .   ? 53.797 15.507 28.317  1.00 32.76 ? 742 HOH A O   1 
HETATM 3161 O  O   . HOH F 4 .   ? 34.161 36.600 30.368  1.00 30.94 ? 743 HOH A O   1 
HETATM 3162 O  O   . HOH F 4 .   ? 16.904 16.304 23.274  1.00 40.43 ? 744 HOH A O   1 
HETATM 3163 O  O   . HOH F 4 .   ? 27.387 14.711 -4.813  1.00 38.96 ? 745 HOH A O   1 
HETATM 3164 O  O   . HOH F 4 .   ? 43.082 32.123 33.664  1.00 41.20 ? 746 HOH A O   1 
HETATM 3165 O  O   . HOH F 4 .   ? 54.860 12.748 -0.402  1.00 45.33 ? 747 HOH A O   1 
HETATM 3166 O  O   . HOH F 4 .   ? 35.490 2.786  -5.633  1.00 38.76 ? 748 HOH A O   1 
HETATM 3167 O  O   . HOH F 4 .   ? 45.362 19.719 -5.870  1.00 45.05 ? 749 HOH A O   1 
HETATM 3168 O  O   . HOH F 4 .   ? 56.843 14.673 15.860  1.00 37.01 ? 750 HOH A O   1 
HETATM 3169 O  O   . HOH F 4 .   ? 40.463 22.158 13.509  1.00 47.84 ? 751 HOH A O   1 
HETATM 3170 O  O   . HOH F 4 .   ? 29.839 -4.489 13.727  1.00 46.03 ? 752 HOH A O   1 
HETATM 3171 O  O   . HOH F 4 .   ? 29.390 26.243 2.037   1.00 49.18 ? 753 HOH A O   1 
HETATM 3172 O  O   . HOH G 4 .   ? 32.388 13.268 37.533  1.00 14.11 ? 602 HOH B O   1 
HETATM 3173 O  O   . HOH G 4 .   ? 18.156 15.951 39.782  1.00 18.37 ? 603 HOH B O   1 
HETATM 3174 O  O   . HOH G 4 .   ? 17.937 11.178 37.236  1.00 24.01 ? 604 HOH B O   1 
HETATM 3175 O  O   . HOH G 4 .   ? 24.084 22.509 48.634  1.00 20.82 ? 605 HOH B O   1 
HETATM 3176 O  O   . HOH G 4 .   ? 41.535 8.743  30.902  1.00 19.63 ? 606 HOH B O   1 
HETATM 3177 O  O   . HOH G 4 .   ? 48.121 19.180 31.378  1.00 22.10 ? 607 HOH B O   1 
HETATM 3178 O  O   . HOH G 4 .   ? 45.931 17.895 29.705  1.00 17.88 ? 608 HOH B O   1 
HETATM 3179 O  O   . HOH G 4 .   ? 45.408 2.309  27.494  1.00 26.93 ? 609 HOH B O   1 
HETATM 3180 O  O   . HOH G 4 .   ? 18.702 17.041 45.792  1.00 23.28 ? 610 HOH B O   1 
HETATM 3181 O  O   . HOH G 4 .   ? 50.536 9.176  38.585  1.00 30.37 ? 611 HOH B O   1 
HETATM 3182 O  O   . HOH G 4 .   ? 36.122 6.846  41.322  1.00 20.26 ? 612 HOH B O   1 
HETATM 3183 O  O   . HOH G 4 .   ? 20.648 10.484 30.277  1.00 31.53 ? 613 HOH B O   1 
HETATM 3184 O  O   . HOH G 4 .   ? 45.066 3.794  29.768  1.00 27.02 ? 614 HOH B O   1 
HETATM 3185 O  O   . HOH G 4 .   ? 27.809 25.242 48.723  1.00 24.49 ? 615 HOH B O   1 
HETATM 3186 O  O   . HOH G 4 .   ? 32.251 0.346  36.123  1.00 35.09 ? 616 HOH B O   1 
HETATM 3187 O  O   . HOH G 4 .   ? 39.403 17.353 39.004  1.00 25.92 ? 617 HOH B O   1 
HETATM 3188 O  O   . HOH G 4 .   ? 39.532 37.881 49.354  1.00 23.67 ? 618 HOH B O   1 
HETATM 3189 O  O   . HOH G 4 .   ? 38.586 32.411 47.829  1.00 26.47 ? 619 HOH B O   1 
HETATM 3190 O  O   . HOH G 4 .   ? 35.006 6.439  52.515  1.00 45.07 ? 620 HOH B O   1 
HETATM 3191 O  O   . HOH G 4 .   ? 17.958 16.859 56.983  1.00 37.60 ? 621 HOH B O   1 
HETATM 3192 O  O   . HOH G 4 .   ? 23.062 22.452 63.660  1.00 32.26 ? 622 HOH B O   1 
HETATM 3193 O  O   . HOH G 4 .   ? 8.283  31.778 47.766  1.00 48.91 ? 623 HOH B O   1 
HETATM 3194 O  O   . HOH G 4 .   ? 37.795 36.661 40.912  1.00 22.70 ? 624 HOH B O   1 
HETATM 3195 O  O   . HOH G 4 .   ? 29.653 35.273 51.068  1.00 31.13 ? 625 HOH B O   1 
HETATM 3196 O  O   . HOH G 4 .   ? 22.828 29.422 35.503  1.00 33.70 ? 626 HOH B O   1 
HETATM 3197 O  O   . HOH G 4 .   ? 25.531 24.426 49.784  1.00 24.21 ? 627 HOH B O   1 
HETATM 3198 O  O   . HOH G 4 .   ? 37.155 19.977 49.927  1.00 31.95 ? 628 HOH B O   1 
HETATM 3199 O  O   . HOH G 4 .   ? 46.025 11.235 36.856  1.00 26.58 ? 629 HOH B O   1 
HETATM 3200 O  O   . HOH G 4 .   ? 50.690 22.181 44.129  1.00 43.63 ? 630 HOH B O   1 
HETATM 3201 O  O   . HOH G 4 .   ? 31.875 17.847 40.936  1.00 26.60 ? 631 HOH B O   1 
HETATM 3202 O  O   . HOH G 4 .   ? 17.013 13.998 33.237  1.00 27.99 ? 632 HOH B O   1 
HETATM 3203 O  O   . HOH G 4 .   ? 33.246 19.057 42.756  1.00 27.47 ? 633 HOH B O   1 
HETATM 3204 O  O   . HOH G 4 .   ? 34.051 13.074 56.940  1.00 28.01 ? 634 HOH B O   1 
HETATM 3205 O  O   . HOH G 4 .   ? 35.611 12.744 45.534  1.00 52.42 ? 635 HOH B O   1 
HETATM 3206 O  O   . HOH G 4 .   ? 37.712 13.062 47.873  1.00 39.85 ? 636 HOH B O   1 
HETATM 3207 O  O   . HOH G 4 .   ? 39.774 24.877 37.583  1.00 33.38 ? 637 HOH B O   1 
HETATM 3208 O  O   . HOH G 4 .   ? 43.971 38.479 43.631  1.00 41.62 ? 638 HOH B O   1 
HETATM 3209 O  O   . HOH G 4 .   ? 28.156 25.965 55.985  1.00 43.16 ? 639 HOH B O   1 
HETATM 3210 O  O   . HOH G 4 .   ? 18.489 24.670 58.603  1.00 42.85 ? 640 HOH B O   1 
HETATM 3211 O  O   . HOH G 4 .   ? 30.601 -3.782 26.099  1.00 44.94 ? 641 HOH B O   1 
HETATM 3212 O  O   . HOH G 4 .   ? 57.323 8.933  17.875  1.00 38.51 ? 642 HOH B O   1 
HETATM 3213 O  O   . HOH G 4 .   ? 25.688 4.555  40.634  1.00 27.17 ? 643 HOH B O   1 
HETATM 3214 O  O   . HOH G 4 .   ? 12.774 31.656 48.081  1.00 40.82 ? 644 HOH B O   1 
HETATM 3215 O  O   . HOH G 4 .   ? 22.614 4.210  27.679  1.00 28.51 ? 645 HOH B O   1 
HETATM 3216 O  O   . HOH G 4 .   ? 20.437 6.735  37.522  1.00 40.28 ? 646 HOH B O   1 
HETATM 3217 O  O   . HOH G 4 .   ? 30.937 29.978 47.085  1.00 36.14 ? 647 HOH B O   1 
HETATM 3218 O  O   . HOH G 4 .   ? 24.477 0.690  33.885  1.00 46.27 ? 648 HOH B O   1 
HETATM 3219 O  O   . HOH G 4 .   ? 41.062 6.097  39.698  1.00 42.03 ? 649 HOH B O   1 
HETATM 3220 O  O   . HOH G 4 .   ? 34.860 23.130 57.645  1.00 38.92 ? 650 HOH B O   1 
HETATM 3221 O  O   . HOH G 4 .   ? 18.172 18.486 62.558  1.00 35.61 ? 651 HOH B O   1 
HETATM 3222 O  O   . HOH G 4 .   ? 43.743 -1.696 21.071  1.00 36.27 ? 652 HOH B O   1 
HETATM 3223 O  O   . HOH G 4 .   ? 31.914 23.260 52.677  1.00 33.43 ? 653 HOH B O   1 
HETATM 3224 O  O   . HOH G 4 .   ? 23.506 4.762  39.101  1.00 26.29 ? 654 HOH B O   1 
HETATM 3225 O  O   . HOH G 4 .   ? 43.956 0.231  28.225  1.00 30.82 ? 655 HOH B O   1 
HETATM 3226 O  O   . HOH G 4 .   ? 31.890 25.269 56.218  1.00 36.90 ? 656 HOH B O   1 
HETATM 3227 O  O   . HOH G 4 .   ? 15.541 16.166 32.280  1.00 30.07 ? 657 HOH B O   1 
HETATM 3228 O  O   . HOH G 4 .   ? 48.170 1.615  27.549  1.00 35.83 ? 658 HOH B O   1 
HETATM 3229 O  O   . HOH G 4 .   ? 32.445 -2.757 33.371  1.00 35.72 ? 659 HOH B O   1 
HETATM 3230 O  O   . HOH G 4 .   ? 19.042 10.032 47.650  1.00 32.44 ? 660 HOH B O   1 
HETATM 3231 O  O   . HOH G 4 .   ? 21.174 6.175  39.825  1.00 38.78 ? 661 HOH B O   1 
HETATM 3232 O  O   . HOH G 4 .   ? 11.065 24.671 50.465  1.00 49.98 ? 662 HOH B O   1 
HETATM 3233 O  O   . HOH G 4 .   ? 40.876 5.257  36.936  1.00 41.66 ? 663 HOH B O   1 
HETATM 3234 O  O   . HOH G 4 .   ? 15.821 12.384 35.729  1.00 25.23 ? 664 HOH B O   1 
HETATM 3235 O  O   . HOH G 4 .   ? 15.491 16.020 38.998  1.00 29.70 ? 665 HOH B O   1 
HETATM 3236 O  O   . HOH G 4 .   ? 35.630 -0.135 40.652  1.00 35.52 ? 666 HOH B O   1 
HETATM 3237 O  O   . HOH G 4 .   ? 24.668 35.560 47.809  1.00 41.53 ? 667 HOH B O   1 
HETATM 3238 O  O   . HOH G 4 .   ? 34.024 -1.337 36.569  1.00 38.80 ? 668 HOH B O   1 
HETATM 3239 O  O   . HOH G 4 .   ? 31.614 10.760 60.106  1.00 44.24 ? 669 HOH B O   1 
HETATM 3240 O  O   . HOH G 4 .   ? 16.291 17.187 47.592  1.00 41.81 ? 670 HOH B O   1 
HETATM 3241 O  O   . HOH G 4 .   ? 27.779 0.504  40.176  1.00 36.53 ? 671 HOH B O   1 
HETATM 3242 O  O   . HOH G 4 .   ? 51.483 25.845 34.004  1.00 40.64 ? 672 HOH B O   1 
HETATM 3243 O  O   . HOH G 4 .   ? 23.270 -1.181 35.453  1.00 36.49 ? 673 HOH B O   1 
HETATM 3244 O  O   . HOH G 4 .   ? 35.306 6.253  47.631  1.00 43.46 ? 674 HOH B O   1 
HETATM 3245 O  O   . HOH G 4 .   ? 42.058 24.895 39.936  1.00 31.05 ? 675 HOH B O   1 
HETATM 3246 O  O   . HOH G 4 .   ? 36.629 11.953 42.176  1.00 39.55 ? 676 HOH B O   1 
HETATM 3247 O  O   . HOH G 4 .   ? 45.856 10.626 39.349  1.00 37.97 ? 677 HOH B O   1 
HETATM 3248 O  O   . HOH G 4 .   ? 54.059 9.523  36.773  1.00 44.43 ? 678 HOH B O   1 
HETATM 3249 O  O   . HOH G 4 .   ? 20.540 25.233 32.298  1.00 48.34 ? 679 HOH B O   1 
HETATM 3250 O  O   . HOH G 4 .   ? 34.261 3.786  47.509  1.00 37.90 ? 680 HOH B O   1 
HETATM 3251 O  O   . HOH G 4 .   ? 39.224 12.462 43.519  1.00 47.50 ? 681 HOH B O   1 
HETATM 3252 O  O   . HOH G 4 .   ? 31.015 31.884 61.599  1.00 43.69 ? 682 HOH B O   1 
HETATM 3253 O  O   . HOH G 4 .   ? 20.590 0.618  31.754  1.00 43.47 ? 683 HOH B O   1 
HETATM 3254 O  O   . HOH G 4 .   ? 26.727 -0.624 33.168  1.00 37.80 ? 684 HOH B O   1 
HETATM 3255 O  O   . HOH G 4 .   ? 45.835 24.341 44.617  1.00 39.59 ? 685 HOH B O   1 
HETATM 3256 O  O   . HOH G 4 .   ? 38.711 23.067 40.028  1.00 38.06 ? 686 HOH B O   1 
HETATM 3257 O  O   . HOH G 4 .   ? 34.089 34.251 52.174  1.00 35.15 ? 687 HOH B O   1 
HETATM 3258 O  O   . HOH G 4 .   ? 34.097 22.890 53.976  1.00 41.00 ? 688 HOH B O   1 
HETATM 3259 O  O   . HOH G 4 .   ? 19.470 24.216 40.021  1.00 34.29 ? 689 HOH B O   1 
HETATM 3260 O  O   . HOH G 4 .   ? 15.572 16.543 29.844  1.00 30.02 ? 690 HOH B O   1 
HETATM 3261 O  O   . HOH G 4 .   ? 17.391 12.765 30.630  1.00 41.47 ? 691 HOH B O   1 
HETATM 3262 O  O   . HOH G 4 .   ? 14.983 14.723 36.604  1.00 30.70 ? 692 HOH B O   1 
HETATM 3263 O  O   . HOH G 4 .   ? 22.554 -0.548 37.884  1.00 46.81 ? 693 HOH B O   1 
HETATM 3264 O  O   . HOH G 4 .   ? 35.541 38.497 37.738  1.00 40.68 ? 694 HOH B O   1 
HETATM 3265 O  O   . HOH G 4 .   ? 42.006 36.926 50.067  1.00 43.01 ? 695 HOH B O   1 
HETATM 3266 O  O   . HOH G 4 .   ? 14.309 15.284 47.290  1.00 50.14 ? 696 HOH B O   1 
HETATM 3267 O  O   . HOH G 4 .   ? 20.875 11.199 65.986  1.00 39.10 ? 697 HOH B O   1 
HETATM 3268 O  O   . HOH G 4 .   ? 52.340 28.220 34.039  1.00 44.11 ? 698 HOH B O   1 
HETATM 3269 O  O   . HOH G 4 .   ? 21.075 8.470  48.903  1.00 38.32 ? 699 HOH B O   1 
HETATM 3270 O  O   . HOH G 4 .   ? 28.940 18.333 57.260  1.00 27.33 ? 700 HOH B O   1 
HETATM 3271 O  O   . HOH G 4 .   ? 35.978 19.997 56.391  1.00 44.35 ? 701 HOH B O   1 
HETATM 3272 O  O   . HOH G 4 .   ? 19.600 32.601 44.763  1.00 39.19 ? 702 HOH B O   1 
HETATM 3273 O  O   . HOH G 4 .   ? 23.622 27.204 31.995  1.00 40.25 ? 703 HOH B O   1 
HETATM 3274 O  O   . HOH G 4 .   ? 26.441 33.105 39.624  1.00 38.11 ? 704 HOH B O   1 
HETATM 3275 O  O   . HOH G 4 .   ? 39.665 34.075 49.876  1.00 35.54 ? 705 HOH B O   1 
HETATM 3276 O  O   . HOH G 4 .   ? 48.873 6.668  32.309  1.00 24.67 ? 706 HOH B O   1 
HETATM 3277 O  O   . HOH G 4 .   ? 16.158 28.940 37.701  1.00 49.48 ? 707 HOH B O   1 
HETATM 3278 O  O   . HOH G 4 .   ? 23.955 33.771 38.753  1.00 45.97 ? 708 HOH B O   1 
HETATM 3279 O  O   . HOH G 4 .   ? 23.108 21.852 55.894  1.00 36.68 ? 709 HOH B O   1 
HETATM 3280 O  O   . HOH G 4 .   ? 17.725 8.633  37.403  1.00 37.87 ? 710 HOH B O   1 
HETATM 3281 O  O   . HOH G 4 .   ? 17.622 8.661  45.569  1.00 50.23 ? 711 HOH B O   1 
HETATM 3282 O  O   . HOH G 4 .   ? 27.034 35.347 40.642  1.00 44.39 ? 712 HOH B O   1 
HETATM 3283 O  O   . HOH G 4 .   ? 16.923 14.635 28.821  1.00 46.62 ? 713 HOH B O   1 
HETATM 3284 O  O   . HOH G 4 .   ? 13.517 17.363 40.196  1.00 36.36 ? 714 HOH B O   1 
HETATM 3285 O  O   . HOH G 4 .   ? 28.418 25.272 61.009  1.00 43.31 ? 715 HOH B O   1 
HETATM 3286 O  O   . HOH G 4 .   ? 37.517 -1.342 38.882  1.00 49.09 ? 716 HOH B O   1 
HETATM 3287 O  O   . HOH G 4 .   ? 43.650 17.484 48.959  1.00 48.69 ? 717 HOH B O   1 
HETATM 3288 O  O   . HOH G 4 .   ? 12.367 16.880 48.221  1.00 48.69 ? 718 HOH B O   1 
HETATM 3289 O  O   . HOH G 4 .   ? 29.549 18.066 60.415  1.00 52.07 ? 719 HOH B O   1 
HETATM 3290 O  O   . HOH G 4 .   ? 14.287 12.583 46.530  1.00 40.52 ? 720 HOH B O   1 
HETATM 3291 O  O   . HOH G 4 .   ? 49.691 25.157 41.369  1.00 41.72 ? 721 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   LYS 2   2   2   LYS LYS A . n 
A 1 3   TYR 3   3   3   TYR TYR A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   PHE 7   7   7   PHE PHE A . n 
A 1 8   GLY 8   8   8   GLY GLY A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  LEU 11  11  11  LEU LEU A . n 
A 1 12  ASP 12  12  12  ASP ASP A . n 
A 1 13  PHE 13  13  13  PHE PHE A . n 
A 1 14  GLU 14  14  14  GLU GLU A . n 
A 1 15  THR 15  15  15  THR THR A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  ILE 17  17  17  ILE ILE A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  GLU 19  19  19  GLU GLU A . n 
A 1 20  ASN 20  20  20  ASN ASN A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  LYS 22  22  22  LYS LYS A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  ARG 26  26  26  ARG ARG A . n 
A 1 27  ARG 27  27  27  ARG ARG A . n 
A 1 28  LEU 28  28  28  LEU LEU A . n 
A 1 29  SER 29  29  29  SER SER A . n 
A 1 30  ASP 30  30  30  ASP ASP A . n 
A 1 31  MET 31  31  31  MET MET A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  TYR 34  34  34  TYR TYR A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ILE 36  36  36  ILE ILE A . n 
A 1 37  ASP 37  37  37  ASP ASP A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  TRP 41  41  41  TRP TRP A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  MET 44  44  44  MET MET A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  VAL 51  51  51  VAL VAL A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  TYR 53  53  53  TYR TYR A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  TYR 56  56  56  TYR TYR A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  GLN 60  60  60  GLN GLN A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  LYS 63  63  63  LYS LYS A . n 
A 1 64  GLU 64  64  64  GLU GLU A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  PHE 69  69  69  PHE PHE A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  THR 71  71  71  THR THR A . n 
A 1 72  THR 72  72  72  THR THR A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  LEU 74  74  74  LEU LEU A . n 
A 1 75  TYR 75  75  75  TYR TYR A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  MET 85  85  85  MET MET A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  LYS 87  87  87  LYS LYS A . n 
A 1 88  GLY 88  88  88  GLY GLY A . n 
A 1 89  HIS 89  89  89  HIS HIS A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  HIS 91  91  91  HIS HIS A . n 
A 1 92  SER 92  92  92  SER SER A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  ILE 94  94  94  ILE ILE A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 ALA 102 102 102 ALA ALA A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 LYS 106 106 106 LYS LYS A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 MET 109 109 109 MET MET A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 GLN 112 112 112 GLN GLN A . n 
A 1 113 THR 113 113 113 THR THR A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 ALA 118 118 118 ALA ALA A . n 
A 1 119 ARG 119 119 119 ARG ARG A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 GLU 122 122 122 GLU GLU A . n 
A 1 123 MET 123 123 123 MET MET A . n 
A 1 124 GLU 124 124 124 GLU GLU A . n 
A 1 125 PRO 125 125 125 PRO PRO A . n 
A 1 126 GLY 126 126 126 GLY GLY A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 VAL 131 131 131 VAL VAL A . n 
A 1 132 PRO 132 132 132 PRO PRO A . n 
A 1 133 PRO 133 133 133 PRO PRO A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 TRP 135 135 135 TRP TRP A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 HIS 137 137 137 HIS HIS A . n 
A 1 138 ARG 138 138 138 ARG ARG A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 ILE 140 140 140 ILE ILE A . n 
A 1 141 ASN 141 141 141 ASN ASN A . n 
A 1 142 THR 142 142 142 THR THR A . n 
A 1 143 GLY 143 143 143 GLY GLY A . n 
A 1 144 ASP 144 144 144 ASP ASP A . n 
A 1 145 LYS 145 145 145 LYS LYS A . n 
A 1 146 PRO 146 146 146 PRO PRO A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 ILE 148 148 148 ILE ILE A . n 
A 1 149 PHE 149 149 149 PHE PHE A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 ALA 151 151 151 ALA ALA A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 TYR 153 153 153 TYR TYR A . n 
A 1 154 PRO 154 154 154 PRO PRO A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 ASP 156 156 156 ASP ASP A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 GLY 158 158 158 GLY GLY A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 TYR 161 161 161 TYR TYR A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 THR 163 163 163 THR THR A . n 
A 1 164 ILE 164 164 164 ILE ILE A . n 
A 1 165 ALA 165 165 165 ALA ALA A . n 
A 1 166 GLU 166 166 166 GLU GLU A . n 
A 1 167 LYS 167 167 167 LYS LYS A . n 
A 1 168 GLY 168 168 168 GLY GLY A . n 
A 1 169 PHE 169 169 169 PHE PHE A . n 
A 1 170 SER 170 170 170 SER SER A . n 
A 1 171 LYS 171 171 171 LYS LYS A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 GLU 175 175 175 GLU GLU A . n 
A 1 176 GLU 176 176 176 GLU GLU A . n 
A 1 177 ASN 177 177 177 ASN ASN A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 LYS 179 179 179 LYS LYS A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 VAL 181 181 181 VAL VAL A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 LYS 183 183 183 LYS LYS A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 ASN 185 185 185 ASN ASN A . n 
A 1 186 PRO 186 186 186 PRO PRO A . n 
A 1 187 LYS 187 187 187 LYS LYS A . n 
A 1 188 TRP 188 188 ?   ?   ?   A . n 
A 1 189 ARG 189 189 ?   ?   ?   A . n 
A 1 190 MET 190 190 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   LYS 2   2   ?   ?   ?   B . n 
B 1 3   TYR 3   3   3   TYR TYR B . n 
B 1 4   LYS 4   4   4   LYS LYS B . n 
B 1 5   GLU 5   5   5   GLU GLU B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   PHE 7   7   7   PHE PHE B . n 
B 1 8   GLY 8   8   8   GLY GLY B . n 
B 1 9   VAL 9   9   9   VAL VAL B . n 
B 1 10  LYS 10  10  10  LYS LYS B . n 
B 1 11  LEU 11  11  11  LEU LEU B . n 
B 1 12  ASP 12  12  12  ASP ASP B . n 
B 1 13  PHE 13  13  13  PHE PHE B . n 
B 1 14  GLU 14  14  14  GLU GLU B . n 
B 1 15  THR 15  15  15  THR THR B . n 
B 1 16  GLY 16  16  16  GLY GLY B . n 
B 1 17  ILE 17  17  17  ILE ILE B . n 
B 1 18  ILE 18  18  18  ILE ILE B . n 
B 1 19  GLU 19  19  19  GLU GLU B . n 
B 1 20  ASN 20  20  20  ASN ASN B . n 
B 1 21  ALA 21  21  21  ALA ALA B . n 
B 1 22  LYS 22  22  22  LYS LYS B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  SER 24  24  24  SER SER B . n 
B 1 25  VAL 25  25  25  VAL VAL B . n 
B 1 26  ARG 26  26  26  ARG ARG B . n 
B 1 27  ARG 27  27  27  ARG ARG B . n 
B 1 28  LEU 28  28  28  LEU LEU B . n 
B 1 29  SER 29  29  29  SER SER B . n 
B 1 30  ASP 30  30  30  ASP ASP B . n 
B 1 31  MET 31  31  31  MET MET B . n 
B 1 32  LYS 32  32  32  LYS LYS B . n 
B 1 33  GLY 33  33  33  GLY GLY B . n 
B 1 34  TYR 34  34  34  TYR TYR B . n 
B 1 35  PHE 35  35  35  PHE PHE B . n 
B 1 36  ILE 36  36  36  ILE ILE B . n 
B 1 37  ASP 37  37  37  ASP ASP B . n 
B 1 38  GLU 38  38  38  GLU GLU B . n 
B 1 39  GLU 39  39  39  GLU GLU B . n 
B 1 40  ALA 40  40  40  ALA ALA B . n 
B 1 41  TRP 41  41  41  TRP TRP B . n 
B 1 42  LYS 42  42  42  LYS LYS B . n 
B 1 43  LYS 43  43  43  LYS LYS B . n 
B 1 44  MET 44  44  44  MET MET B . n 
B 1 45  VAL 45  45  45  VAL VAL B . n 
B 1 46  GLU 46  46  46  GLU GLU B . n 
B 1 47  GLU 47  47  47  GLU GLU B . n 
B 1 48  GLY 48  48  48  GLY GLY B . n 
B 1 49  ASP 49  49  49  ASP ASP B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  VAL 51  51  51  VAL VAL B . n 
B 1 52  VAL 52  52  52  VAL VAL B . n 
B 1 53  TYR 53  53  53  TYR TYR B . n 
B 1 54  GLU 54  54  54  GLU GLU B . n 
B 1 55  VAL 55  55  55  VAL VAL B . n 
B 1 56  TYR 56  56  56  TYR TYR B . n 
B 1 57  ALA 57  57  57  ALA ALA B . n 
B 1 58  ILE 58  58  58  ILE ILE B . n 
B 1 59  GLU 59  59  59  GLU GLU B . n 
B 1 60  GLN 60  60  60  GLN GLN B . n 
B 1 61  GLU 61  61  61  GLU GLU B . n 
B 1 62  GLU 62  62  62  GLU GLU B . n 
B 1 63  LYS 63  63  63  LYS LYS B . n 
B 1 64  GLU 64  64  64  GLU GLU B . n 
B 1 65  GLY 65  65  65  GLY GLY B . n 
B 1 66  ASP 66  66  66  ASP ASP B . n 
B 1 67  LEU 67  67  67  LEU LEU B . n 
B 1 68  ASN 68  68  68  ASN ASN B . n 
B 1 69  PHE 69  69  69  PHE PHE B . n 
B 1 70  ALA 70  70  70  ALA ALA B . n 
B 1 71  THR 71  71  71  THR THR B . n 
B 1 72  THR 72  72  72  THR THR B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  LEU 74  74  74  LEU LEU B . n 
B 1 75  TYR 75  75  75  TYR TYR B . n 
B 1 76  PRO 76  76  76  PRO PRO B . n 
B 1 77  GLY 77  77  77  GLY GLY B . n 
B 1 78  LYS 78  78  78  LYS LYS B . n 
B 1 79  VAL 79  79  79  VAL VAL B . n 
B 1 80  GLY 80  80  80  GLY GLY B . n 
B 1 81  ASN 81  81  81  ASN ASN B . n 
B 1 82  GLU 82  82  82  GLU GLU B . n 
B 1 83  PHE 83  83  83  PHE PHE B . n 
B 1 84  PHE 84  84  84  PHE PHE B . n 
B 1 85  MET 85  85  85  MET MET B . n 
B 1 86  THR 86  86  86  THR THR B . n 
B 1 87  LYS 87  87  87  LYS LYS B . n 
B 1 88  GLY 88  88  88  GLY GLY B . n 
B 1 89  HIS 89  89  89  HIS HIS B . n 
B 1 90  TYR 90  90  90  TYR TYR B . n 
B 1 91  HIS 91  91  91  HIS HIS B . n 
B 1 92  SER 92  92  92  SER SER B . n 
B 1 93  LYS 93  93  93  LYS LYS B . n 
B 1 94  ILE 94  94  94  ILE ILE B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  ARG 96  96  96  ARG ARG B . n 
B 1 97  ALA 97  97  97  ALA ALA B . n 
B 1 98  GLU 98  98  98  GLU GLU B . n 
B 1 99  VAL 99  99  99  VAL VAL B . n 
B 1 100 TYR 100 100 100 TYR TYR B . n 
B 1 101 PHE 101 101 101 PHE PHE B . n 
B 1 102 ALA 102 102 102 ALA ALA B . n 
B 1 103 LEU 103 103 103 LEU LEU B . n 
B 1 104 LYS 104 104 104 LYS LYS B . n 
B 1 105 GLY 105 105 105 GLY GLY B . n 
B 1 106 LYS 106 106 106 LYS LYS B . n 
B 1 107 GLY 107 107 107 GLY GLY B . n 
B 1 108 GLY 108 108 108 GLY GLY B . n 
B 1 109 MET 109 109 109 MET MET B . n 
B 1 110 LEU 110 110 110 LEU LEU B . n 
B 1 111 LEU 111 111 111 LEU LEU B . n 
B 1 112 GLN 112 112 112 GLN GLN B . n 
B 1 113 THR 113 113 113 THR THR B . n 
B 1 114 PRO 114 114 114 PRO PRO B . n 
B 1 115 GLU 115 115 115 GLU GLU B . n 
B 1 116 GLY 116 116 116 GLY GLY B . n 
B 1 117 GLU 117 117 117 GLU GLU B . n 
B 1 118 ALA 118 118 118 ALA ALA B . n 
B 1 119 ARG 119 119 119 ARG ARG B . n 
B 1 120 PHE 120 120 120 PHE PHE B . n 
B 1 121 ILE 121 121 121 ILE ILE B . n 
B 1 122 GLU 122 122 122 GLU GLU B . n 
B 1 123 MET 123 123 123 MET MET B . n 
B 1 124 GLU 124 124 124 GLU GLU B . n 
B 1 125 PRO 125 125 125 PRO PRO B . n 
B 1 126 GLY 126 126 126 GLY GLY B . n 
B 1 127 THR 127 127 127 THR THR B . n 
B 1 128 ILE 128 128 128 ILE ILE B . n 
B 1 129 VAL 129 129 129 VAL VAL B . n 
B 1 130 TYR 130 130 130 TYR TYR B . n 
B 1 131 VAL 131 131 131 VAL VAL B . n 
B 1 132 PRO 132 132 132 PRO PRO B . n 
B 1 133 PRO 133 133 133 PRO PRO B . n 
B 1 134 TYR 134 134 134 TYR TYR B . n 
B 1 135 TRP 135 135 135 TRP TRP B . n 
B 1 136 ALA 136 136 136 ALA ALA B . n 
B 1 137 HIS 137 137 137 HIS HIS B . n 
B 1 138 ARG 138 138 138 ARG ARG B . n 
B 1 139 THR 139 139 139 THR THR B . n 
B 1 140 ILE 140 140 140 ILE ILE B . n 
B 1 141 ASN 141 141 141 ASN ASN B . n 
B 1 142 THR 142 142 142 THR THR B . n 
B 1 143 GLY 143 143 143 GLY GLY B . n 
B 1 144 ASP 144 144 144 ASP ASP B . n 
B 1 145 LYS 145 145 145 LYS LYS B . n 
B 1 146 PRO 146 146 146 PRO PRO B . n 
B 1 147 PHE 147 147 147 PHE PHE B . n 
B 1 148 ILE 148 148 148 ILE ILE B . n 
B 1 149 PHE 149 149 149 PHE PHE B . n 
B 1 150 LEU 150 150 150 LEU LEU B . n 
B 1 151 ALA 151 151 151 ALA ALA B . n 
B 1 152 LEU 152 152 152 LEU LEU B . n 
B 1 153 TYR 153 153 153 TYR TYR B . n 
B 1 154 PRO 154 154 154 PRO PRO B . n 
B 1 155 ALA 155 155 155 ALA ALA B . n 
B 1 156 ASP 156 156 156 ASP ASP B . n 
B 1 157 ALA 157 157 157 ALA ALA B . n 
B 1 158 GLY 158 158 158 GLY GLY B . n 
B 1 159 HIS 159 159 159 HIS HIS B . n 
B 1 160 ASP 160 160 160 ASP ASP B . n 
B 1 161 TYR 161 161 161 TYR TYR B . n 
B 1 162 GLY 162 162 162 GLY GLY B . n 
B 1 163 THR 163 163 163 THR THR B . n 
B 1 164 ILE 164 164 164 ILE ILE B . n 
B 1 165 ALA 165 165 165 ALA ALA B . n 
B 1 166 GLU 166 166 166 GLU GLU B . n 
B 1 167 LYS 167 167 167 LYS LYS B . n 
B 1 168 GLY 168 168 168 GLY GLY B . n 
B 1 169 PHE 169 169 169 PHE PHE B . n 
B 1 170 SER 170 170 170 SER SER B . n 
B 1 171 LYS 171 171 171 LYS LYS B . n 
B 1 172 ILE 172 172 172 ILE ILE B . n 
B 1 173 VAL 173 173 173 VAL VAL B . n 
B 1 174 VAL 174 174 174 VAL VAL B . n 
B 1 175 GLU 175 175 175 GLU GLU B . n 
B 1 176 GLU 176 176 176 GLU GLU B . n 
B 1 177 ASN 177 177 177 ASN ASN B . n 
B 1 178 GLY 178 178 178 GLY GLY B . n 
B 1 179 LYS 179 179 179 LYS LYS B . n 
B 1 180 VAL 180 180 180 VAL VAL B . n 
B 1 181 VAL 181 181 181 VAL VAL B . n 
B 1 182 VAL 182 182 182 VAL VAL B . n 
B 1 183 LYS 183 183 183 LYS LYS B . n 
B 1 184 ASP 184 184 184 ASP ASP B . n 
B 1 185 ASN 185 185 185 ASN ASN B . n 
B 1 186 PRO 186 186 186 PRO PRO B . n 
B 1 187 LYS 187 187 187 LYS LYS B . n 
B 1 188 TRP 188 188 ?   ?   ?   B . n 
B 1 189 ARG 189 189 ?   ?   ?   B . n 
B 1 190 MET 190 190 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 6PG 1   600 600 6PG 6PG A . 
D 3 FE  1   201 201 FE  FE  A . 
E 2 6PG 1   601 601 6PG 6PG B . 
F 4 HOH 1   601 5   HOH TIP A . 
F 4 HOH 2   602 6   HOH TIP A . 
F 4 HOH 3   603 9   HOH TIP A . 
F 4 HOH 4   604 10  HOH TIP A . 
F 4 HOH 5   605 11  HOH TIP A . 
F 4 HOH 6   606 13  HOH TIP A . 
F 4 HOH 7   607 14  HOH TIP A . 
F 4 HOH 8   608 15  HOH TIP A . 
F 4 HOH 9   609 16  HOH TIP A . 
F 4 HOH 10  610 17  HOH TIP A . 
F 4 HOH 11  611 18  HOH TIP A . 
F 4 HOH 12  612 19  HOH TIP A . 
F 4 HOH 13  613 22  HOH TIP A . 
F 4 HOH 14  614 23  HOH TIP A . 
F 4 HOH 15  615 25  HOH TIP A . 
F 4 HOH 16  616 26  HOH TIP A . 
F 4 HOH 17  617 28  HOH TIP A . 
F 4 HOH 18  618 29  HOH TIP A . 
F 4 HOH 19  619 30  HOH TIP A . 
F 4 HOH 20  620 31  HOH TIP A . 
F 4 HOH 21  621 32  HOH TIP A . 
F 4 HOH 22  622 33  HOH TIP A . 
F 4 HOH 23  623 36  HOH TIP A . 
F 4 HOH 24  624 37  HOH TIP A . 
F 4 HOH 25  625 41  HOH TIP A . 
F 4 HOH 26  626 45  HOH TIP A . 
F 4 HOH 27  627 47  HOH TIP A . 
F 4 HOH 28  628 50  HOH TIP A . 
F 4 HOH 29  629 51  HOH TIP A . 
F 4 HOH 30  630 54  HOH TIP A . 
F 4 HOH 31  631 55  HOH TIP A . 
F 4 HOH 32  632 56  HOH TIP A . 
F 4 HOH 33  633 57  HOH TIP A . 
F 4 HOH 34  634 58  HOH TIP A . 
F 4 HOH 35  635 59  HOH TIP A . 
F 4 HOH 36  636 60  HOH TIP A . 
F 4 HOH 37  637 63  HOH TIP A . 
F 4 HOH 38  638 65  HOH TIP A . 
F 4 HOH 39  639 70  HOH TIP A . 
F 4 HOH 40  640 71  HOH TIP A . 
F 4 HOH 41  641 72  HOH TIP A . 
F 4 HOH 42  642 73  HOH TIP A . 
F 4 HOH 43  643 74  HOH TIP A . 
F 4 HOH 44  644 76  HOH TIP A . 
F 4 HOH 45  645 77  HOH TIP A . 
F 4 HOH 46  646 86  HOH TIP A . 
F 4 HOH 47  647 90  HOH TIP A . 
F 4 HOH 48  648 91  HOH TIP A . 
F 4 HOH 49  649 92  HOH TIP A . 
F 4 HOH 50  650 95  HOH TIP A . 
F 4 HOH 51  651 97  HOH TIP A . 
F 4 HOH 52  652 98  HOH TIP A . 
F 4 HOH 53  653 99  HOH TIP A . 
F 4 HOH 54  654 101 HOH TIP A . 
F 4 HOH 55  655 103 HOH TIP A . 
F 4 HOH 56  656 106 HOH TIP A . 
F 4 HOH 57  657 107 HOH TIP A . 
F 4 HOH 58  658 108 HOH TIP A . 
F 4 HOH 59  659 110 HOH TIP A . 
F 4 HOH 60  660 111 HOH TIP A . 
F 4 HOH 61  661 112 HOH TIP A . 
F 4 HOH 62  662 114 HOH TIP A . 
F 4 HOH 63  663 115 HOH TIP A . 
F 4 HOH 64  664 116 HOH TIP A . 
F 4 HOH 65  665 117 HOH TIP A . 
F 4 HOH 66  666 119 HOH TIP A . 
F 4 HOH 67  667 120 HOH TIP A . 
F 4 HOH 68  668 125 HOH TIP A . 
F 4 HOH 69  669 127 HOH TIP A . 
F 4 HOH 70  670 134 HOH TIP A . 
F 4 HOH 71  671 137 HOH TIP A . 
F 4 HOH 72  672 138 HOH TIP A . 
F 4 HOH 73  673 142 HOH TIP A . 
F 4 HOH 74  674 143 HOH TIP A . 
F 4 HOH 75  675 145 HOH TIP A . 
F 4 HOH 76  676 146 HOH TIP A . 
F 4 HOH 77  677 147 HOH TIP A . 
F 4 HOH 78  678 149 HOH TIP A . 
F 4 HOH 79  679 151 HOH TIP A . 
F 4 HOH 80  680 152 HOH TIP A . 
F 4 HOH 81  681 153 HOH TIP A . 
F 4 HOH 82  682 155 HOH TIP A . 
F 4 HOH 83  683 156 HOH TIP A . 
F 4 HOH 84  684 157 HOH TIP A . 
F 4 HOH 85  685 158 HOH TIP A . 
F 4 HOH 86  686 159 HOH TIP A . 
F 4 HOH 87  687 164 HOH TIP A . 
F 4 HOH 88  688 165 HOH TIP A . 
F 4 HOH 89  689 166 HOH TIP A . 
F 4 HOH 90  690 169 HOH TIP A . 
F 4 HOH 91  691 171 HOH TIP A . 
F 4 HOH 92  692 174 HOH TIP A . 
F 4 HOH 93  693 175 HOH TIP A . 
F 4 HOH 94  694 176 HOH TIP A . 
F 4 HOH 95  695 177 HOH TIP A . 
F 4 HOH 96  696 178 HOH TIP A . 
F 4 HOH 97  697 183 HOH TIP A . 
F 4 HOH 98  698 186 HOH TIP A . 
F 4 HOH 99  699 187 HOH TIP A . 
F 4 HOH 100 700 188 HOH TIP A . 
F 4 HOH 101 701 190 HOH TIP A . 
F 4 HOH 102 702 193 HOH TIP A . 
F 4 HOH 103 703 195 HOH TIP A . 
F 4 HOH 104 704 196 HOH TIP A . 
F 4 HOH 105 705 197 HOH TIP A . 
F 4 HOH 106 706 200 HOH TIP A . 
F 4 HOH 107 707 203 HOH TIP A . 
F 4 HOH 108 708 212 HOH TIP A . 
F 4 HOH 109 709 215 HOH TIP A . 
F 4 HOH 110 710 219 HOH TIP A . 
F 4 HOH 111 711 229 HOH TIP A . 
F 4 HOH 112 712 236 HOH TIP A . 
F 4 HOH 113 713 241 HOH TIP A . 
F 4 HOH 114 714 246 HOH TIP A . 
F 4 HOH 115 715 248 HOH TIP A . 
F 4 HOH 116 716 250 HOH TIP A . 
F 4 HOH 117 717 254 HOH TIP A . 
F 4 HOH 118 718 256 HOH TIP A . 
F 4 HOH 119 719 258 HOH TIP A . 
F 4 HOH 120 720 259 HOH TIP A . 
F 4 HOH 121 721 260 HOH TIP A . 
F 4 HOH 122 722 269 HOH TIP A . 
F 4 HOH 123 723 279 HOH TIP A . 
F 4 HOH 124 724 283 HOH TIP A . 
F 4 HOH 125 725 284 HOH TIP A . 
F 4 HOH 126 726 287 HOH TIP A . 
F 4 HOH 127 727 288 HOH TIP A . 
F 4 HOH 128 728 289 HOH TIP A . 
F 4 HOH 129 729 293 HOH TIP A . 
F 4 HOH 130 730 300 HOH TIP A . 
F 4 HOH 131 731 301 HOH TIP A . 
F 4 HOH 132 732 302 HOH TIP A . 
F 4 HOH 133 733 306 HOH TIP A . 
F 4 HOH 134 734 310 HOH TIP A . 
F 4 HOH 135 735 312 HOH TIP A . 
F 4 HOH 136 736 313 HOH TIP A . 
F 4 HOH 137 737 316 HOH TIP A . 
F 4 HOH 138 738 322 HOH TIP A . 
F 4 HOH 139 739 323 HOH TIP A . 
F 4 HOH 140 740 327 HOH TIP A . 
F 4 HOH 141 741 328 HOH TIP A . 
F 4 HOH 142 742 329 HOH TIP A . 
F 4 HOH 143 743 331 HOH TIP A . 
F 4 HOH 144 744 332 HOH TIP A . 
F 4 HOH 145 745 336 HOH TIP A . 
F 4 HOH 146 746 338 HOH TIP A . 
F 4 HOH 147 747 339 HOH TIP A . 
F 4 HOH 148 748 340 HOH TIP A . 
F 4 HOH 149 749 341 HOH TIP A . 
F 4 HOH 150 750 344 HOH TIP A . 
F 4 HOH 151 751 345 HOH TIP A . 
F 4 HOH 152 752 349 HOH TIP A . 
F 4 HOH 153 753 351 HOH TIP A . 
G 4 HOH 1   602 4   HOH TIP B . 
G 4 HOH 2   603 7   HOH TIP B . 
G 4 HOH 3   604 12  HOH TIP B . 
G 4 HOH 4   605 20  HOH TIP B . 
G 4 HOH 5   606 21  HOH TIP B . 
G 4 HOH 6   607 24  HOH TIP B . 
G 4 HOH 7   608 27  HOH TIP B . 
G 4 HOH 8   609 34  HOH TIP B . 
G 4 HOH 9   610 35  HOH TIP B . 
G 4 HOH 10  611 38  HOH TIP B . 
G 4 HOH 11  612 39  HOH TIP B . 
G 4 HOH 12  613 40  HOH TIP B . 
G 4 HOH 13  614 43  HOH TIP B . 
G 4 HOH 14  615 44  HOH TIP B . 
G 4 HOH 15  616 49  HOH TIP B . 
G 4 HOH 16  617 52  HOH TIP B . 
G 4 HOH 17  618 53  HOH TIP B . 
G 4 HOH 18  619 61  HOH TIP B . 
G 4 HOH 19  620 62  HOH TIP B . 
G 4 HOH 20  621 64  HOH TIP B . 
G 4 HOH 21  622 66  HOH TIP B . 
G 4 HOH 22  623 67  HOH TIP B . 
G 4 HOH 23  624 68  HOH TIP B . 
G 4 HOH 24  625 69  HOH TIP B . 
G 4 HOH 25  626 75  HOH TIP B . 
G 4 HOH 26  627 78  HOH TIP B . 
G 4 HOH 27  628 79  HOH TIP B . 
G 4 HOH 28  629 80  HOH TIP B . 
G 4 HOH 29  630 81  HOH TIP B . 
G 4 HOH 30  631 82  HOH TIP B . 
G 4 HOH 31  632 83  HOH TIP B . 
G 4 HOH 32  633 84  HOH TIP B . 
G 4 HOH 33  634 87  HOH TIP B . 
G 4 HOH 34  635 88  HOH TIP B . 
G 4 HOH 35  636 89  HOH TIP B . 
G 4 HOH 36  637 93  HOH TIP B . 
G 4 HOH 37  638 96  HOH TIP B . 
G 4 HOH 38  639 100 HOH TIP B . 
G 4 HOH 39  640 104 HOH TIP B . 
G 4 HOH 40  641 109 HOH TIP B . 
G 4 HOH 41  642 113 HOH TIP B . 
G 4 HOH 42  643 118 HOH TIP B . 
G 4 HOH 43  644 121 HOH TIP B . 
G 4 HOH 44  645 123 HOH TIP B . 
G 4 HOH 45  646 126 HOH TIP B . 
G 4 HOH 46  647 128 HOH TIP B . 
G 4 HOH 47  648 131 HOH TIP B . 
G 4 HOH 48  649 135 HOH TIP B . 
G 4 HOH 49  650 144 HOH TIP B . 
G 4 HOH 50  651 150 HOH TIP B . 
G 4 HOH 51  652 154 HOH TIP B . 
G 4 HOH 52  653 160 HOH TIP B . 
G 4 HOH 53  654 161 HOH TIP B . 
G 4 HOH 54  655 162 HOH TIP B . 
G 4 HOH 55  656 163 HOH TIP B . 
G 4 HOH 56  657 168 HOH TIP B . 
G 4 HOH 57  658 170 HOH TIP B . 
G 4 HOH 58  659 172 HOH TIP B . 
G 4 HOH 59  660 173 HOH TIP B . 
G 4 HOH 60  661 179 HOH TIP B . 
G 4 HOH 61  662 181 HOH TIP B . 
G 4 HOH 62  663 189 HOH TIP B . 
G 4 HOH 63  664 191 HOH TIP B . 
G 4 HOH 64  665 192 HOH TIP B . 
G 4 HOH 65  666 194 HOH TIP B . 
G 4 HOH 66  667 199 HOH TIP B . 
G 4 HOH 67  668 202 HOH TIP B . 
G 4 HOH 68  669 204 HOH TIP B . 
G 4 HOH 69  670 205 HOH TIP B . 
G 4 HOH 70  671 206 HOH TIP B . 
G 4 HOH 71  672 207 HOH TIP B . 
G 4 HOH 72  673 209 HOH TIP B . 
G 4 HOH 73  674 211 HOH TIP B . 
G 4 HOH 74  675 214 HOH TIP B . 
G 4 HOH 75  676 217 HOH TIP B . 
G 4 HOH 76  677 220 HOH TIP B . 
G 4 HOH 77  678 224 HOH TIP B . 
G 4 HOH 78  679 227 HOH TIP B . 
G 4 HOH 79  680 231 HOH TIP B . 
G 4 HOH 80  681 232 HOH TIP B . 
G 4 HOH 81  682 235 HOH TIP B . 
G 4 HOH 82  683 238 HOH TIP B . 
G 4 HOH 83  684 240 HOH TIP B . 
G 4 HOH 84  685 242 HOH TIP B . 
G 4 HOH 85  686 247 HOH TIP B . 
G 4 HOH 86  687 249 HOH TIP B . 
G 4 HOH 87  688 253 HOH TIP B . 
G 4 HOH 88  689 257 HOH TIP B . 
G 4 HOH 89  690 261 HOH TIP B . 
G 4 HOH 90  691 262 HOH TIP B . 
G 4 HOH 91  692 263 HOH TIP B . 
G 4 HOH 92  693 264 HOH TIP B . 
G 4 HOH 93  694 265 HOH TIP B . 
G 4 HOH 94  695 266 HOH TIP B . 
G 4 HOH 95  696 267 HOH TIP B . 
G 4 HOH 96  697 268 HOH TIP B . 
G 4 HOH 97  698 273 HOH TIP B . 
G 4 HOH 98  699 274 HOH TIP B . 
G 4 HOH 99  700 275 HOH TIP B . 
G 4 HOH 100 701 278 HOH TIP B . 
G 4 HOH 101 702 280 HOH TIP B . 
G 4 HOH 102 703 291 HOH TIP B . 
G 4 HOH 103 704 294 HOH TIP B . 
G 4 HOH 104 705 295 HOH TIP B . 
G 4 HOH 105 706 296 HOH TIP B . 
G 4 HOH 106 707 299 HOH TIP B . 
G 4 HOH 107 708 314 HOH TIP B . 
G 4 HOH 108 709 330 HOH TIP B . 
G 4 HOH 109 710 333 HOH TIP B . 
G 4 HOH 110 711 334 HOH TIP B . 
G 4 HOH 111 712 335 HOH TIP B . 
G 4 HOH 112 713 337 HOH TIP B . 
G 4 HOH 113 714 342 HOH TIP B . 
G 4 HOH 114 715 343 HOH TIP B . 
G 4 HOH 115 716 346 HOH TIP B . 
G 4 HOH 116 717 347 HOH TIP B . 
G 4 HOH 117 718 348 HOH TIP B . 
G 4 HOH 118 719 350 HOH TIP B . 
G 4 HOH 119 720 352 HOH TIP B . 
G 4 HOH 120 721 353 HOH TIP B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5370  ? 
1 MORE         -58   ? 
1 'SSA (A^2)'  15760 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2004-02-24 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS refinement 1.1 ? 1 
CNS phasing    .   ? 2 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 GLU A 62  ? ? -64.50 86.29  
2 1 TYR A 134 ? ? 76.17  -10.46 
3 1 ASN A 177 ? ? 61.29  -1.12  
4 1 GLU B 62  ? ? -55.82 102.08 
5 1 ILE B 94  ? ? -39.11 -21.84 
6 1 TYR B 134 ? ? 81.51  -10.61 
7 1 GLU B 166 ? ? -81.81 -73.94 
8 1 ASN B 177 ? ? 74.77  -58.03 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A TRP 188 ? A TRP 188 
2 1 Y 1 A ARG 189 ? A ARG 189 
3 1 Y 1 A MET 190 ? A MET 190 
4 1 Y 1 B MET 1   ? B MET 1   
5 1 Y 1 B LYS 2   ? B LYS 2   
6 1 Y 1 B TRP 188 ? B TRP 188 
7 1 Y 1 B ARG 189 ? B ARG 189 
8 1 Y 1 B MET 190 ? B MET 190 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '6-PHOSPHOGLUCONIC ACID' 6PG 
3 'FE (III) ION'           FE  
4 water                    HOH 
#